data_5Z3U
# 
_entry.id   5Z3U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5Z3U         
WWPDB D_1300006368 
EMDB  EMD-6882     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Structure of Snf2-nucleosome complex at shl2 in ADP BeFx state' 
_pdbx_database_related.db_id          EMD-6882 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5Z3U 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, M.'   1 ? 
'Xia, X.'  2 ? 
'Liu, X.'  3 ? 
'Li, X.'   4 ? 
'Chen, Z.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            567 
_citation.language                  ? 
_citation.page_first                409 
_citation.page_last                 413 
_citation.title                     'Mechanism of DNA translocation underlying chromatin remodelling by Snf2.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-019-1029-2 
_citation.pdbx_database_id_PubMed   30867599 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, M.'   1 ? 
primary 'Xia, X.'  2 ? 
primary 'Tian, Y.' 3 ? 
primary 'Jia, Q.'  4 ? 
primary 'Liu, X.'  5 ? 
primary 'Lu, Y.'   6 ? 
primary 'Li, M.'   7 ? 
primary 'Li, X.'   8 ? 
primary 'Chen, Z.' 9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5Z3U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5Z3U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Transcription regulatory protein SNF2' 85802.805 1 3.6.4.- ? ? ? 
2  polymer     man 'Histone H3.2'                          15303.930 2 ?       ? ? ? 
3  polymer     man 'Histone H4'                            11263.231 2 ?       ? ? ? 
4  polymer     man 'Histone H2A'                           13978.241 2 ?       ? ? ? 
5  polymer     man 'Histone H2B 1.1'                       13524.752 2 ?       ? ? ? 
6  polymer     syn 'DNA (167-MER)'                         51381.758 1 ?       ? ? ? 
7  polymer     syn 'DNA (167-MER)'                         51723.949 1 ?       ? ? ? 
8  non-polymer syn 'MAGNESIUM ION'                         24.305    1 ?       ? ? ? 
9  non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"              427.201   1 ?       ? ? ? 
10 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION'             66.007    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;ATP-dependent helicase SNF2,Regulatory protein GAM1,Regulatory protein SWI2,SWI/SNF complex component SNF2,Transcription factor TYE3
;
5 H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;AYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYY
NVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPL
STLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSK
LSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHK
VLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSEL
LRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERA
YKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS
KKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQAR
KQRTKKEDKSEAIDG
;
;AYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYY
NVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPL
STLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSK
LSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHK
VLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSEL
LRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERA
YKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS
KKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQAR
KQRTKKEDKSEAIDG
;
O   ? 
2 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
5 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DT)(DG)(DA)(DA)(DG)(DC)(DT)(DT)(DG)(DT)(DC)(DG)(DA)(DG)(DA)(DA)
(DG)(DT)(DA)(DC)(DG)(DA)(DT)
;
;ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGAAGCTTGTCGAGAA
GTACGAT
;
I   ? 
7 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DT)(DA)(DC)(DT)(DT)(DC)(DT)(DC)(DG)(DA)(DC)(DA)(DA)(DG)(DC)(DT)
(DT)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCGTACTTCTCGACAAGCTTCAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAA
AACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGAT
TCTCGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   TYR n 
1 3   ILE n 
1 4   LYS n 
1 5   LEU n 
1 6   LEU n 
1 7   ASP n 
1 8   GLN n 
1 9   THR n 
1 10  LYS n 
1 11  ASP n 
1 12  THR n 
1 13  ARG n 
1 14  ILE n 
1 15  THR n 
1 16  HIS n 
1 17  LEU n 
1 18  LEU n 
1 19  ARG n 
1 20  GLN n 
1 21  THR n 
1 22  ASN n 
1 23  ALA n 
1 24  PHE n 
1 25  LEU n 
1 26  ASP n 
1 27  SER n 
1 28  LEU n 
1 29  THR n 
1 30  ARG n 
1 31  ALA n 
1 32  VAL n 
1 33  LYS n 
1 34  ASP n 
1 35  GLN n 
1 36  GLN n 
1 37  LYS n 
1 38  TYR n 
1 39  THR n 
1 40  LYS n 
1 41  GLU n 
1 42  MET n 
1 43  ILE n 
1 44  ASP n 
1 45  SER n 
1 46  HIS n 
1 47  ILE n 
1 48  LYS n 
1 49  GLU n 
1 50  ALA n 
1 51  SER n 
1 52  GLU n 
1 53  GLU n 
1 54  VAL n 
1 55  ASP n 
1 56  ASP n 
1 57  LEU n 
1 58  SER n 
1 59  MET n 
1 60  VAL n 
1 61  PRO n 
1 62  LYS n 
1 63  MET n 
1 64  LYS n 
1 65  ASP n 
1 66  GLU n 
1 67  GLU n 
1 68  TYR n 
1 69  ASP n 
1 70  ASP n 
1 71  ASP n 
1 72  ASP n 
1 73  ASP n 
1 74  ASN n 
1 75  SER n 
1 76  ASN n 
1 77  VAL n 
1 78  ASP n 
1 79  TYR n 
1 80  TYR n 
1 81  ASN n 
1 82  VAL n 
1 83  ALA n 
1 84  HIS n 
1 85  ARG n 
1 86  ILE n 
1 87  LYS n 
1 88  GLU n 
1 89  ASP n 
1 90  ILE n 
1 91  LYS n 
1 92  LYS n 
1 93  GLN n 
1 94  PRO n 
1 95  SER n 
1 96  ILE n 
1 97  LEU n 
1 98  VAL n 
1 99  GLY n 
1 100 GLY n 
1 101 THR n 
1 102 LEU n 
1 103 LYS n 
1 104 ASP n 
1 105 TYR n 
1 106 GLN n 
1 107 ILE n 
1 108 LYS n 
1 109 GLY n 
1 110 LEU n 
1 111 GLN n 
1 112 TRP n 
1 113 MET n 
1 114 VAL n 
1 115 SER n 
1 116 LEU n 
1 117 PHE n 
1 118 ASN n 
1 119 ASN n 
1 120 HIS n 
1 121 LEU n 
1 122 ASN n 
1 123 GLY n 
1 124 ILE n 
1 125 LEU n 
1 126 ALA n 
1 127 ASP n 
1 128 GLU n 
1 129 MET n 
1 130 GLY n 
1 131 LEU n 
1 132 GLY n 
1 133 LYS n 
1 134 THR n 
1 135 ILE n 
1 136 GLN n 
1 137 THR n 
1 138 ILE n 
1 139 SER n 
1 140 LEU n 
1 141 LEU n 
1 142 THR n 
1 143 TYR n 
1 144 LEU n 
1 145 TYR n 
1 146 GLU n 
1 147 MET n 
1 148 LYS n 
1 149 ASN n 
1 150 ILE n 
1 151 ARG n 
1 152 GLY n 
1 153 PRO n 
1 154 TYR n 
1 155 LEU n 
1 156 VAL n 
1 157 ILE n 
1 158 VAL n 
1 159 PRO n 
1 160 LEU n 
1 161 SER n 
1 162 THR n 
1 163 LEU n 
1 164 SER n 
1 165 ASN n 
1 166 TRP n 
1 167 SER n 
1 168 SER n 
1 169 GLU n 
1 170 PHE n 
1 171 ALA n 
1 172 LYS n 
1 173 TRP n 
1 174 ALA n 
1 175 PRO n 
1 176 THR n 
1 177 LEU n 
1 178 ARG n 
1 179 THR n 
1 180 ILE n 
1 181 SER n 
1 182 PHE n 
1 183 LYS n 
1 184 GLY n 
1 185 SER n 
1 186 PRO n 
1 187 ASN n 
1 188 GLU n 
1 189 ARG n 
1 190 LYS n 
1 191 ALA n 
1 192 LYS n 
1 193 GLN n 
1 194 ALA n 
1 195 LYS n 
1 196 ILE n 
1 197 ARG n 
1 198 ALA n 
1 199 GLY n 
1 200 GLU n 
1 201 PHE n 
1 202 ASP n 
1 203 VAL n 
1 204 VAL n 
1 205 LEU n 
1 206 THR n 
1 207 THR n 
1 208 PHE n 
1 209 GLU n 
1 210 TYR n 
1 211 ILE n 
1 212 ILE n 
1 213 LYS n 
1 214 GLU n 
1 215 ARG n 
1 216 ALA n 
1 217 LEU n 
1 218 LEU n 
1 219 SER n 
1 220 LYS n 
1 221 VAL n 
1 222 LYS n 
1 223 TRP n 
1 224 VAL n 
1 225 HIS n 
1 226 MET n 
1 227 ILE n 
1 228 ILE n 
1 229 ASP n 
1 230 GLU n 
1 231 GLY n 
1 232 HIS n 
1 233 ARG n 
1 234 MET n 
1 235 LYS n 
1 236 ASN n 
1 237 ALA n 
1 238 GLN n 
1 239 SER n 
1 240 LYS n 
1 241 LEU n 
1 242 SER n 
1 243 LEU n 
1 244 THR n 
1 245 LEU n 
1 246 ASN n 
1 247 THR n 
1 248 HIS n 
1 249 TYR n 
1 250 HIS n 
1 251 ALA n 
1 252 ASP n 
1 253 TYR n 
1 254 ARG n 
1 255 LEU n 
1 256 ILE n 
1 257 LEU n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 PRO n 
1 262 LEU n 
1 263 GLN n 
1 264 ASN n 
1 265 ASN n 
1 266 LEU n 
1 267 PRO n 
1 268 GLU n 
1 269 LEU n 
1 270 TRP n 
1 271 ALA n 
1 272 LEU n 
1 273 LEU n 
1 274 ASN n 
1 275 PHE n 
1 276 VAL n 
1 277 LEU n 
1 278 PRO n 
1 279 LYS n 
1 280 ILE n 
1 281 PHE n 
1 282 ASN n 
1 283 SER n 
1 284 VAL n 
1 285 LYS n 
1 286 SER n 
1 287 PHE n 
1 288 ASP n 
1 289 GLU n 
1 290 TRP n 
1 291 PHE n 
1 292 ASN n 
1 293 THR n 
1 294 PRO n 
1 295 PHE n 
1 296 ALA n 
1 297 ASN n 
1 298 THR n 
1 299 GLY n 
1 300 GLY n 
1 301 GLN n 
1 302 ASP n 
1 303 LYS n 
1 304 ILE n 
1 305 GLU n 
1 306 LEU n 
1 307 SER n 
1 308 GLU n 
1 309 GLU n 
1 310 GLU n 
1 311 THR n 
1 312 LEU n 
1 313 LEU n 
1 314 VAL n 
1 315 ILE n 
1 316 ARG n 
1 317 ARG n 
1 318 LEU n 
1 319 HIS n 
1 320 LYS n 
1 321 VAL n 
1 322 LEU n 
1 323 ARG n 
1 324 PRO n 
1 325 PHE n 
1 326 LEU n 
1 327 LEU n 
1 328 ARG n 
1 329 ARG n 
1 330 LEU n 
1 331 LYS n 
1 332 LYS n 
1 333 ASP n 
1 334 VAL n 
1 335 GLU n 
1 336 LYS n 
1 337 GLU n 
1 338 LEU n 
1 339 PRO n 
1 340 ASP n 
1 341 LYS n 
1 342 VAL n 
1 343 GLU n 
1 344 LYS n 
1 345 VAL n 
1 346 VAL n 
1 347 LYS n 
1 348 CYS n 
1 349 LYS n 
1 350 MET n 
1 351 SER n 
1 352 ALA n 
1 353 LEU n 
1 354 GLN n 
1 355 GLN n 
1 356 ILE n 
1 357 MET n 
1 358 TYR n 
1 359 GLN n 
1 360 GLN n 
1 361 MET n 
1 362 LEU n 
1 363 LYS n 
1 364 TYR n 
1 365 ARG n 
1 366 ARG n 
1 367 LEU n 
1 368 PHE n 
1 369 ILE n 
1 370 GLY n 
1 371 ASP n 
1 372 GLN n 
1 373 ASN n 
1 374 ASN n 
1 375 LYS n 
1 376 LYS n 
1 377 MET n 
1 378 VAL n 
1 379 GLY n 
1 380 LEU n 
1 381 ARG n 
1 382 GLY n 
1 383 PHE n 
1 384 ASN n 
1 385 ASN n 
1 386 GLN n 
1 387 ILE n 
1 388 MET n 
1 389 GLN n 
1 390 LEU n 
1 391 LYS n 
1 392 LYS n 
1 393 ILE n 
1 394 CYS n 
1 395 ASN n 
1 396 HIS n 
1 397 PRO n 
1 398 PHE n 
1 399 VAL n 
1 400 PHE n 
1 401 GLU n 
1 402 GLU n 
1 403 VAL n 
1 404 GLU n 
1 405 ASP n 
1 406 GLN n 
1 407 ILE n 
1 408 ASN n 
1 409 PRO n 
1 410 THR n 
1 411 ARG n 
1 412 GLU n 
1 413 THR n 
1 414 ASN n 
1 415 ASP n 
1 416 ASP n 
1 417 ILE n 
1 418 TRP n 
1 419 ARG n 
1 420 VAL n 
1 421 ALA n 
1 422 GLY n 
1 423 LYS n 
1 424 PHE n 
1 425 GLU n 
1 426 LEU n 
1 427 LEU n 
1 428 ASP n 
1 429 ARG n 
1 430 ILE n 
1 431 LEU n 
1 432 PRO n 
1 433 LYS n 
1 434 LEU n 
1 435 LYS n 
1 436 ALA n 
1 437 THR n 
1 438 GLY n 
1 439 HIS n 
1 440 ARG n 
1 441 VAL n 
1 442 LEU n 
1 443 ILE n 
1 444 PHE n 
1 445 PHE n 
1 446 GLN n 
1 447 MET n 
1 448 THR n 
1 449 GLN n 
1 450 ILE n 
1 451 MET n 
1 452 ASP n 
1 453 ILE n 
1 454 MET n 
1 455 GLU n 
1 456 ASP n 
1 457 PHE n 
1 458 LEU n 
1 459 ARG n 
1 460 TYR n 
1 461 ILE n 
1 462 ASN n 
1 463 ILE n 
1 464 LYS n 
1 465 TYR n 
1 466 LEU n 
1 467 ARG n 
1 468 LEU n 
1 469 ASP n 
1 470 GLY n 
1 471 HIS n 
1 472 THR n 
1 473 LYS n 
1 474 SER n 
1 475 ASP n 
1 476 GLU n 
1 477 ARG n 
1 478 SER n 
1 479 GLU n 
1 480 LEU n 
1 481 LEU n 
1 482 ARG n 
1 483 LEU n 
1 484 PHE n 
1 485 ASN n 
1 486 ALA n 
1 487 PRO n 
1 488 ASP n 
1 489 SER n 
1 490 GLU n 
1 491 TYR n 
1 492 LEU n 
1 493 CYS n 
1 494 PHE n 
1 495 ILE n 
1 496 LEU n 
1 497 SER n 
1 498 THR n 
1 499 ARG n 
1 500 ALA n 
1 501 GLY n 
1 502 GLY n 
1 503 LEU n 
1 504 GLY n 
1 505 LEU n 
1 506 ASN n 
1 507 LEU n 
1 508 GLN n 
1 509 THR n 
1 510 ALA n 
1 511 ASP n 
1 512 THR n 
1 513 VAL n 
1 514 ILE n 
1 515 ILE n 
1 516 PHE n 
1 517 ASP n 
1 518 THR n 
1 519 ASP n 
1 520 TRP n 
1 521 ASN n 
1 522 PRO n 
1 523 HIS n 
1 524 GLN n 
1 525 ASP n 
1 526 LEU n 
1 527 GLN n 
1 528 ALA n 
1 529 GLN n 
1 530 ASP n 
1 531 ARG n 
1 532 ALA n 
1 533 HIS n 
1 534 ARG n 
1 535 ILE n 
1 536 GLY n 
1 537 GLN n 
1 538 LYS n 
1 539 ASN n 
1 540 GLU n 
1 541 VAL n 
1 542 ARG n 
1 543 ILE n 
1 544 LEU n 
1 545 ARG n 
1 546 LEU n 
1 547 ILE n 
1 548 THR n 
1 549 THR n 
1 550 ASN n 
1 551 SER n 
1 552 VAL n 
1 553 GLU n 
1 554 GLU n 
1 555 VAL n 
1 556 ILE n 
1 557 LEU n 
1 558 GLU n 
1 559 ARG n 
1 560 ALA n 
1 561 TYR n 
1 562 LYS n 
1 563 LYS n 
1 564 LEU n 
1 565 ASP n 
1 566 ILE n 
1 567 ASP n 
1 568 GLY n 
1 569 LYS n 
1 570 VAL n 
1 571 ILE n 
1 572 GLN n 
1 573 ALA n 
1 574 GLY n 
1 575 LYS n 
1 576 PHE n 
1 577 ASP n 
1 578 ASN n 
1 579 LYS n 
1 580 SER n 
1 581 THR n 
1 582 SER n 
1 583 GLU n 
1 584 GLU n 
1 585 GLN n 
1 586 GLU n 
1 587 ALA n 
1 588 LEU n 
1 589 LEU n 
1 590 ARG n 
1 591 SER n 
1 592 LEU n 
1 593 LEU n 
1 594 ASP n 
1 595 ALA n 
1 596 GLU n 
1 597 GLU n 
1 598 GLU n 
1 599 ARG n 
1 600 ARG n 
1 601 LYS n 
1 602 LYS n 
1 603 ARG n 
1 604 GLU n 
1 605 SER n 
1 606 GLY n 
1 607 VAL n 
1 608 GLU n 
1 609 GLU n 
1 610 GLU n 
1 611 GLU n 
1 612 GLU n 
1 613 LEU n 
1 614 LYS n 
1 615 ASP n 
1 616 SER n 
1 617 GLU n 
1 618 ILE n 
1 619 ASN n 
1 620 GLU n 
1 621 ILE n 
1 622 LEU n 
1 623 ALA n 
1 624 ARG n 
1 625 ASN n 
1 626 ASP n 
1 627 GLU n 
1 628 GLU n 
1 629 MET n 
1 630 ALA n 
1 631 VAL n 
1 632 LEU n 
1 633 THR n 
1 634 ARG n 
1 635 MET n 
1 636 ASP n 
1 637 GLU n 
1 638 ASP n 
1 639 ARG n 
1 640 SER n 
1 641 LYS n 
1 642 LYS n 
1 643 GLU n 
1 644 GLU n 
1 645 GLU n 
1 646 LEU n 
1 647 GLY n 
1 648 VAL n 
1 649 LYS n 
1 650 SER n 
1 651 ARG n 
1 652 LEU n 
1 653 LEU n 
1 654 GLU n 
1 655 LYS n 
1 656 SER n 
1 657 GLU n 
1 658 LEU n 
1 659 PRO n 
1 660 ASP n 
1 661 ILE n 
1 662 TYR n 
1 663 SER n 
1 664 ARG n 
1 665 ASP n 
1 666 ILE n 
1 667 GLY n 
1 668 ALA n 
1 669 GLU n 
1 670 LEU n 
1 671 LYS n 
1 672 ARG n 
1 673 GLU n 
1 674 GLU n 
1 675 SER n 
1 676 GLU n 
1 677 SER n 
1 678 ALA n 
1 679 ALA n 
1 680 VAL n 
1 681 TYR n 
1 682 ASN n 
1 683 GLY n 
1 684 ARG n 
1 685 GLY n 
1 686 ALA n 
1 687 ARG n 
1 688 GLU n 
1 689 ARG n 
1 690 LYS n 
1 691 THR n 
1 692 ALA n 
1 693 THR n 
1 694 TYR n 
1 695 ASN n 
1 696 ASP n 
1 697 ASN n 
1 698 MET n 
1 699 SER n 
1 700 GLU n 
1 701 GLU n 
1 702 GLN n 
1 703 TRP n 
1 704 LEU n 
1 705 ARG n 
1 706 GLN n 
1 707 PHE n 
1 708 GLU n 
1 709 VAL n 
1 710 SER n 
1 711 ASP n 
1 712 ASP n 
1 713 GLU n 
1 714 LYS n 
1 715 ASN n 
1 716 ASP n 
1 717 LYS n 
1 718 GLN n 
1 719 ALA n 
1 720 ARG n 
1 721 LYS n 
1 722 GLN n 
1 723 ARG n 
1 724 THR n 
1 725 LYS n 
1 726 LYS n 
1 727 GLU n 
1 728 ASP n 
1 729 LYS n 
1 730 SER n 
1 731 GLU n 
1 732 ALA n 
1 733 ILE n 
1 734 ASP n 
1 735 GLY n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   LYS n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  SER n 
2 11  THR n 
2 12  GLY n 
2 13  GLY n 
2 14  LYS n 
2 15  ALA n 
2 16  PRO n 
2 17  ARG n 
2 18  LYS n 
2 19  GLN n 
2 20  LEU n 
2 21  ALA n 
2 22  THR n 
2 23  LYS n 
2 24  ALA n 
2 25  ALA n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  ALA n 
2 30  PRO n 
2 31  ALA n 
2 32  THR n 
2 33  GLY n 
2 34  GLY n 
2 35  VAL n 
2 36  LYS n 
2 37  LYS n 
2 38  PRO n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ARG n 
2 43  PRO n 
2 44  GLY n 
2 45  THR n 
2 46  VAL n 
2 47  ALA n 
2 48  LEU n 
2 49  ARG n 
2 50  GLU n 
2 51  ILE n 
2 52  ARG n 
2 53  ARG n 
2 54  TYR n 
2 55  GLN n 
2 56  LYS n 
2 57  SER n 
2 58  THR n 
2 59  GLU n 
2 60  LEU n 
2 61  LEU n 
2 62  ILE n 
2 63  ARG n 
2 64  LYS n 
2 65  LEU n 
2 66  PRO n 
2 67  PHE n 
2 68  GLN n 
2 69  ARG n 
2 70  LEU n 
2 71  VAL n 
2 72  ARG n 
2 73  GLU n 
2 74  ILE n 
2 75  ALA n 
2 76  GLN n 
2 77  ASP n 
2 78  PHE n 
2 79  LYS n 
2 80  THR n 
2 81  ASP n 
2 82  LEU n 
2 83  ARG n 
2 84  PHE n 
2 85  GLN n 
2 86  SER n 
2 87  SER n 
2 88  ALA n 
2 89  VAL n 
2 90  MET n 
2 91  ALA n 
2 92  LEU n 
2 93  GLN n 
2 94  GLU n 
2 95  ALA n 
2 96  SER n 
2 97  GLU n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 VAL n 
2 102 ALA n 
2 103 LEU n 
2 104 PHE n 
2 105 GLU n 
2 106 ASP n 
2 107 THR n 
2 108 ASN n 
2 109 LEU n 
2 110 CYS n 
2 111 ALA n 
2 112 ILE n 
2 113 HIS n 
2 114 ALA n 
2 115 LYS n 
2 116 ARG n 
2 117 VAL n 
2 118 THR n 
2 119 ILE n 
2 120 MET n 
2 121 PRO n 
2 122 LYS n 
2 123 ASP n 
2 124 ILE n 
2 125 GLN n 
2 126 LEU n 
2 127 ALA n 
2 128 ARG n 
2 129 ARG n 
2 130 ILE n 
2 131 ARG n 
2 132 GLY n 
2 133 GLU n 
2 134 ARG n 
2 135 ALA n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLY n 
3 7   GLY n 
3 8   LYS n 
3 9   GLY n 
3 10  LEU n 
3 11  GLY n 
3 12  LYS n 
3 13  GLY n 
3 14  GLY n 
3 15  ALA n 
3 16  LYS n 
3 17  ARG n 
3 18  HIS n 
3 19  ARG n 
3 20  LYS n 
3 21  VAL n 
3 22  LEU n 
3 23  ARG n 
3 24  ASP n 
3 25  ASN n 
3 26  ILE n 
3 27  GLN n 
3 28  GLY n 
3 29  ILE n 
3 30  THR n 
3 31  LYS n 
3 32  PRO n 
3 33  ALA n 
3 34  ILE n 
3 35  ARG n 
3 36  ARG n 
3 37  LEU n 
3 38  ALA n 
3 39  ARG n 
3 40  ARG n 
3 41  GLY n 
3 42  GLY n 
3 43  VAL n 
3 44  LYS n 
3 45  ARG n 
3 46  ILE n 
3 47  SER n 
3 48  GLY n 
3 49  LEU n 
3 50  ILE n 
3 51  TYR n 
3 52  GLU n 
3 53  GLU n 
3 54  THR n 
3 55  ARG n 
3 56  GLY n 
3 57  VAL n 
3 58  LEU n 
3 59  LYS n 
3 60  VAL n 
3 61  PHE n 
3 62  LEU n 
3 63  GLU n 
3 64  ASN n 
3 65  VAL n 
3 66  ILE n 
3 67  ARG n 
3 68  ASP n 
3 69  ALA n 
3 70  VAL n 
3 71  THR n 
3 72  TYR n 
3 73  THR n 
3 74  GLU n 
3 75  HIS n 
3 76  ALA n 
3 77  LYS n 
3 78  ARG n 
3 79  LYS n 
3 80  THR n 
3 81  VAL n 
3 82  THR n 
3 83  ALA n 
3 84  MET n 
3 85  ASP n 
3 86  VAL n 
3 87  VAL n 
3 88  TYR n 
3 89  ALA n 
3 90  LEU n 
3 91  LYS n 
3 92  ARG n 
3 93  GLN n 
3 94  GLY n 
3 95  ARG n 
3 96  THR n 
3 97  LEU n 
3 98  TYR n 
3 99  GLY n 
3 100 PHE n 
3 101 GLY n 
3 102 GLY n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLN n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  THR n 
4 11  ARG n 
4 12  ALA n 
4 13  LYS n 
4 14  ALA n 
4 15  LYS n 
4 16  THR n 
4 17  ARG n 
4 18  SER n 
4 19  SER n 
4 20  ARG n 
4 21  ALA n 
4 22  GLY n 
4 23  LEU n 
4 24  GLN n 
4 25  PHE n 
4 26  PRO n 
4 27  VAL n 
4 28  GLY n 
4 29  ARG n 
4 30  VAL n 
4 31  HIS n 
4 32  ARG n 
4 33  LEU n 
4 34  LEU n 
4 35  ARG n 
4 36  LYS n 
4 37  GLY n 
4 38  ASN n 
4 39  TYR n 
4 40  ALA n 
4 41  GLU n 
4 42  ARG n 
4 43  VAL n 
4 44  GLY n 
4 45  ALA n 
4 46  GLY n 
4 47  ALA n 
4 48  PRO n 
4 49  VAL n 
4 50  TYR n 
4 51  LEU n 
4 52  ALA n 
4 53  ALA n 
4 54  VAL n 
4 55  LEU n 
4 56  GLU n 
4 57  TYR n 
4 58  LEU n 
4 59  THR n 
4 60  ALA n 
4 61  GLU n 
4 62  ILE n 
4 63  LEU n 
4 64  GLU n 
4 65  LEU n 
4 66  ALA n 
4 67  GLY n 
4 68  ASN n 
4 69  ALA n 
4 70  ALA n 
4 71  ARG n 
4 72  ASP n 
4 73  ASN n 
4 74  LYS n 
4 75  LYS n 
4 76  THR n 
4 77  ARG n 
4 78  ILE n 
4 79  ILE n 
4 80  PRO n 
4 81  ARG n 
4 82  HIS n 
4 83  LEU n 
4 84  GLN n 
4 85  LEU n 
4 86  ALA n 
4 87  VAL n 
4 88  ARG n 
4 89  ASN n 
4 90  ASP n 
4 91  GLU n 
4 92  GLU n 
4 93  LEU n 
4 94  ASN n 
4 95  LYS n 
4 96  LEU n 
4 97  LEU n 
4 98  GLY n 
4 99  ARG n 
4 100 VAL n 
4 101 THR n 
4 102 ILE n 
4 103 ALA n 
4 104 GLN n 
4 105 GLY n 
4 106 GLY n 
4 107 VAL n 
4 108 LEU n 
4 109 PRO n 
4 110 ASN n 
4 111 ILE n 
4 112 GLN n 
4 113 SER n 
4 114 VAL n 
4 115 LEU n 
4 116 LEU n 
4 117 PRO n 
4 118 LYS n 
4 119 LYS n 
4 120 THR n 
4 121 GLU n 
4 122 SER n 
4 123 SER n 
4 124 LYS n 
4 125 SER n 
4 126 ALA n 
4 127 LYS n 
4 128 SER n 
4 129 LYS n 
5 1   ALA n 
5 2   LYS n 
5 3   SER n 
5 4   ALA n 
5 5   PRO n 
5 6   ALA n 
5 7   PRO n 
5 8   LYS n 
5 9   LYS n 
5 10  GLY n 
5 11  SER n 
5 12  LYS n 
5 13  LYS n 
5 14  ALA n 
5 15  VAL n 
5 16  THR n 
5 17  LYS n 
5 18  THR n 
5 19  GLN n 
5 20  LYS n 
5 21  LYS n 
5 22  ASP n 
5 23  GLY n 
5 24  LYS n 
5 25  LYS n 
5 26  ARG n 
5 27  ARG n 
5 28  LYS n 
5 29  THR n 
5 30  ARG n 
5 31  LYS n 
5 32  GLU n 
5 33  SER n 
5 34  TYR n 
5 35  ALA n 
5 36  ILE n 
5 37  TYR n 
5 38  VAL n 
5 39  TYR n 
5 40  LYS n 
5 41  VAL n 
5 42  LEU n 
5 43  LYS n 
5 44  GLN n 
5 45  VAL n 
5 46  HIS n 
5 47  PRO n 
5 48  ASP n 
5 49  THR n 
5 50  GLY n 
5 51  ILE n 
5 52  SER n 
5 53  SER n 
5 54  LYS n 
5 55  ALA n 
5 56  MET n 
5 57  SER n 
5 58  ILE n 
5 59  MET n 
5 60  ASN n 
5 61  SER n 
5 62  PHE n 
5 63  VAL n 
5 64  ASN n 
5 65  ASP n 
5 66  VAL n 
5 67  PHE n 
5 68  GLU n 
5 69  ARG n 
5 70  ILE n 
5 71  ALA n 
5 72  GLY n 
5 73  GLU n 
5 74  ALA n 
5 75  SER n 
5 76  ARG n 
5 77  LEU n 
5 78  ALA n 
5 79  HIS n 
5 80  TYR n 
5 81  ASN n 
5 82  LYS n 
5 83  ARG n 
5 84  SER n 
5 85  THR n 
5 86  ILE n 
5 87  THR n 
5 88  SER n 
5 89  ARG n 
5 90  GLU n 
5 91  ILE n 
5 92  GLN n 
5 93  THR n 
5 94  ALA n 
5 95  VAL n 
5 96  ARG n 
5 97  LEU n 
5 98  LEU n 
5 99  LEU n 
5 100 PRO n 
5 101 GLY n 
5 102 GLU n 
5 103 LEU n 
5 104 ALA n 
5 105 LYS n 
5 106 HIS n 
5 107 ALA n 
5 108 VAL n 
5 109 SER n 
5 110 GLU n 
5 111 GLY n 
5 112 THR n 
5 113 LYS n 
5 114 ALA n 
5 115 VAL n 
5 116 THR n 
5 117 LYS n 
5 118 TYR n 
5 119 THR n 
5 120 SER n 
5 121 ALA n 
5 122 LYS n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DA  n 
6 8   DA  n 
6 9   DT  n 
6 10  DC  n 
6 11  DC  n 
6 12  DC  n 
6 13  DG  n 
6 14  DG  n 
6 15  DT  n 
6 16  DG  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DA  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DC  n 
6 27  DT  n 
6 28  DC  n 
6 29  DA  n 
6 30  DA  n 
6 31  DT  n 
6 32  DT  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DT  n 
6 39  DA  n 
6 40  DG  n 
6 41  DA  n 
6 42  DC  n 
6 43  DA  n 
6 44  DG  n 
6 45  DC  n 
6 46  DT  n 
6 47  DC  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DC  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DG  n 
6 56  DC  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DA  n 
6 66  DC  n 
6 67  DG  n 
6 68  DT  n 
6 69  DA  n 
6 70  DC  n 
6 71  DG  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DT  n 
6 76  DG  n 
6 77  DT  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DC  n 
6 93  DC  n 
6 94  DG  n 
6 95  DC  n 
6 96  DC  n 
6 97  DA  n 
6 98  DA  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DG  n 
6 103 DA  n 
6 104 DT  n 
6 105 DT  n 
6 106 DA  n 
6 107 DC  n 
6 108 DT  n 
6 109 DC  n 
6 110 DC  n 
6 111 DC  n 
6 112 DT  n 
6 113 DA  n 
6 114 DG  n 
6 115 DT  n 
6 116 DC  n 
6 117 DT  n 
6 118 DC  n 
6 119 DC  n 
6 120 DA  n 
6 121 DG  n 
6 122 DG  n 
6 123 DC  n 
6 124 DA  n 
6 125 DC  n 
6 126 DG  n 
6 127 DT  n 
6 128 DG  n 
6 129 DT  n 
6 130 DC  n 
6 131 DA  n 
6 132 DG  n 
6 133 DA  n 
6 134 DT  n 
6 135 DA  n 
6 136 DT  n 
6 137 DA  n 
6 138 DT  n 
6 139 DA  n 
6 140 DC  n 
6 141 DA  n 
6 142 DT  n 
6 143 DC  n 
6 144 DC  n 
6 145 DT  n 
6 146 DG  n 
6 147 DA  n 
6 148 DA  n 
6 149 DG  n 
6 150 DC  n 
6 151 DT  n 
6 152 DT  n 
6 153 DG  n 
6 154 DT  n 
6 155 DC  n 
6 156 DG  n 
6 157 DA  n 
6 158 DG  n 
6 159 DA  n 
6 160 DA  n 
6 161 DG  n 
6 162 DT  n 
6 163 DA  n 
6 164 DC  n 
6 165 DG  n 
6 166 DA  n 
6 167 DT  n 
7 1   DA  n 
7 2   DT  n 
7 3   DC  n 
7 4   DG  n 
7 5   DT  n 
7 6   DA  n 
7 7   DC  n 
7 8   DT  n 
7 9   DT  n 
7 10  DC  n 
7 11  DT  n 
7 12  DC  n 
7 13  DG  n 
7 14  DA  n 
7 15  DC  n 
7 16  DA  n 
7 17  DA  n 
7 18  DG  n 
7 19  DC  n 
7 20  DT  n 
7 21  DT  n 
7 22  DC  n 
7 23  DA  n 
7 24  DG  n 
7 25  DG  n 
7 26  DA  n 
7 27  DT  n 
7 28  DG  n 
7 29  DT  n 
7 30  DA  n 
7 31  DT  n 
7 32  DA  n 
7 33  DT  n 
7 34  DA  n 
7 35  DT  n 
7 36  DC  n 
7 37  DT  n 
7 38  DG  n 
7 39  DA  n 
7 40  DC  n 
7 41  DA  n 
7 42  DC  n 
7 43  DG  n 
7 44  DT  n 
7 45  DG  n 
7 46  DC  n 
7 47  DC  n 
7 48  DT  n 
7 49  DG  n 
7 50  DG  n 
7 51  DA  n 
7 52  DG  n 
7 53  DA  n 
7 54  DC  n 
7 55  DT  n 
7 56  DA  n 
7 57  DG  n 
7 58  DG  n 
7 59  DG  n 
7 60  DA  n 
7 61  DG  n 
7 62  DT  n 
7 63  DA  n 
7 64  DA  n 
7 65  DT  n 
7 66  DC  n 
7 67  DC  n 
7 68  DC  n 
7 69  DC  n 
7 70  DT  n 
7 71  DT  n 
7 72  DG  n 
7 73  DG  n 
7 74  DC  n 
7 75  DG  n 
7 76  DG  n 
7 77  DT  n 
7 78  DT  n 
7 79  DA  n 
7 80  DA  n 
7 81  DA  n 
7 82  DA  n 
7 83  DC  n 
7 84  DG  n 
7 85  DC  n 
7 86  DG  n 
7 87  DG  n 
7 88  DG  n 
7 89  DG  n 
7 90  DG  n 
7 91  DA  n 
7 92  DC  n 
7 93  DA  n 
7 94  DG  n 
7 95  DC  n 
7 96  DG  n 
7 97  DC  n 
7 98  DG  n 
7 99  DT  n 
7 100 DA  n 
7 101 DC  n 
7 102 DG  n 
7 103 DT  n 
7 104 DG  n 
7 105 DC  n 
7 106 DG  n 
7 107 DT  n 
7 108 DT  n 
7 109 DT  n 
7 110 DA  n 
7 111 DA  n 
7 112 DG  n 
7 113 DC  n 
7 114 DG  n 
7 115 DG  n 
7 116 DT  n 
7 117 DG  n 
7 118 DC  n 
7 119 DT  n 
7 120 DA  n 
7 121 DG  n 
7 122 DA  n 
7 123 DG  n 
7 124 DC  n 
7 125 DT  n 
7 126 DG  n 
7 127 DT  n 
7 128 DC  n 
7 129 DT  n 
7 130 DA  n 
7 131 DC  n 
7 132 DG  n 
7 133 DA  n 
7 134 DC  n 
7 135 DC  n 
7 136 DA  n 
7 137 DA  n 
7 138 DT  n 
7 139 DT  n 
7 140 DG  n 
7 141 DA  n 
7 142 DG  n 
7 143 DC  n 
7 144 DG  n 
7 145 DG  n 
7 146 DC  n 
7 147 DC  n 
7 148 DT  n 
7 149 DC  n 
7 150 DG  n 
7 151 DG  n 
7 152 DC  n 
7 153 DA  n 
7 154 DC  n 
7 155 DC  n 
7 156 DG  n 
7 157 DG  n 
7 158 DG  n 
7 159 DA  n 
7 160 DT  n 
7 161 DT  n 
7 162 DC  n 
7 163 DT  n 
7 164 DC  n 
7 165 DG  n 
7 166 DA  n 
7 167 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 735 
;Baker's yeast
;
? 'SNF2, GAM1, RIC1, SWI2, TYE3, YOR290C' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae' 559292 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                                       ? ?                     ? ? 
? ? 'Xenopus laevis'           8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                                       ? ?                     ? ? 
? ? 'Xenopus laevis'           8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, LOC494591'                  ? ?                     ? ? 
? ? 'Xenopus laevis'           8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 122 'African clawed frog' ? ?                                       ? ?                     ? ? 
? ? 'Xenopus laevis'           8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 167 'synthetic construct' ? 32630 ? 
7 1 sample 1 167 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SNF2_YEAST   P22082 ? 1 
;AYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYY
NVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPL
STLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSK
LSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHK
VLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSEL
LRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERA
YKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS
KKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQAR
KQRTKKEDKSEAIDG
;
666 
2 UNP H32_XENLA    P84233 ? 2 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2   
3 UNP H4_XENLA     P62799 ? 3 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   
4 UNP Q6AZJ8_XENLA Q6AZJ8 ? 4 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2   
5 UNP H2B11_XENLA  P02281 ? 5 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5   
6 PDB 5Z3U         5Z3U   ? 6 ? 1   
7 PDB 5Z3U         5Z3U   ? 7 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5Z3U O 1 ? 735 ? P22082 666 ? 1400 ? 666 1400 
2  2 5Z3U A 1 ? 135 ? P84233 2   ? 136  ? 1   135  
3  3 5Z3U B 1 ? 102 ? P62799 2   ? 103  ? 1   102  
4  4 5Z3U C 1 ? 129 ? Q6AZJ8 2   ? 130  ? 1   129  
5  5 5Z3U D 1 ? 122 ? P02281 5   ? 126  ? 1   122  
6  2 5Z3U E 1 ? 135 ? P84233 2   ? 136  ? 1   135  
7  3 5Z3U F 1 ? 102 ? P62799 2   ? 103  ? 1   102  
8  4 5Z3U G 1 ? 129 ? Q6AZJ8 2   ? 130  ? 1   129  
9  5 5Z3U H 1 ? 122 ? P02281 5   ? 126  ? 1   122  
10 6 5Z3U I 1 ? 167 ? 5Z3U   1   ? 167  ? 1   167  
11 7 5Z3U J 1 ? 167 ? 5Z3U   -19 ? 147  ? -19 147  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 5Z3U ALA A 102 ? UNP P84233 GLY 103 conflict               102 1 
5 5Z3U THR D 29  ? UNP P02281 SER 33  'see sequence details' 29  2 
6 5Z3U ALA E 102 ? UNP P84233 GLY 103 conflict               102 3 
9 5Z3U THR H 29  ? UNP P02281 SER 33  'see sequence details' 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
BEF non-polymer         . 'BERYLLIUM TRIFLUORIDE ION'          ? 'Be F3 -1'          66.007  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5Z3U 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5Z3U 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.011  ? 17650 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.949  ? 25082 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 19.082 ? 12286 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.051  ? 2856  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.006  ? 2293  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5Z3U 
_struct.title                        'Structure of Snf2-nucleosome complex at shl2 in ADP BeFx state' 
_struct.pdbx_descriptor              
'Transcription regulatory protein SNF2, Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5Z3U 
_struct_keywords.text            
'complex, nucleosome, chromatin remodeling, gene regulation, STRUCTURAL PROTEIN-HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/HYDROLASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 9   ? ALA A 23  ? THR O 674  ALA O 688  1 ? 15 
HELX_P HELX_P2  AA2 TYR A 79  ? ALA A 83  ? TYR O 744  ALA O 748  1 ? 5  
HELX_P HELX_P3  AA3 ASP A 104 ? ASN A 119 ? ASP O 769  ASN O 784  1 ? 16 
HELX_P HELX_P4  AA4 GLY A 132 ? LYS A 148 ? GLY O 797  LYS O 813  1 ? 17 
HELX_P HELX_P5  AA5 LEU A 163 ? TRP A 173 ? LEU O 828  TRP O 838  1 ? 11 
HELX_P HELX_P6  AA6 ASN A 187 ? ILE A 196 ? ASN O 852  ILE O 861  1 ? 10 
HELX_P HELX_P7  AA7 ARG A 197 ? GLY A 199 ? ARG O 862  GLY O 864  5 ? 3  
HELX_P HELX_P8  AA8 GLU A 209 ? GLU A 214 ? GLU O 874  GLU O 879  1 ? 6  
HELX_P HELX_P9  AA9 GLU A 214 ? SER A 219 ? GLU O 879  SER O 884  1 ? 6  
HELX_P HELX_P10 AB1 GLU A 230 ? MET A 234 ? GLU O 895  MET O 899  5 ? 5  
HELX_P HELX_P11 AB2 SER A 239 ? TYR A 249 ? SER O 904  TYR O 914  1 ? 11 
HELX_P HELX_P12 AB3 GLU A 268 ? LEU A 277 ? GLU O 933  LEU O 942  1 ? 10 
HELX_P HELX_P13 AB4 SER A 283 ? SER A 286 ? SER O 948  SER O 951  5 ? 4  
HELX_P HELX_P14 AB5 PHE A 287 ? ASN A 292 ? PHE O 952  ASN O 957  1 ? 6  
HELX_P HELX_P15 AB6 LYS A 303 ? ARG A 323 ? LYS O 968  ARG O 988  1 ? 21 
HELX_P HELX_P16 AB7 LEU A 330 ? GLU A 335 ? LEU O 995  GLU O 1000 1 ? 6  
HELX_P HELX_P17 AB8 SER A 351 ? MET A 361 ? SER O 1016 MET O 1026 1 ? 11 
HELX_P HELX_P18 AB9 ASN A 385 ? HIS A 396 ? ASN O 1050 HIS O 1061 1 ? 12 
HELX_P HELX_P19 AC1 PHE A 400 ? ILE A 407 ? PHE O 1065 ILE O 1072 1 ? 8  
HELX_P HELX_P20 AC2 ALA A 421 ? GLY A 438 ? ALA O 1086 GLY O 1103 1 ? 18 
HELX_P HELX_P21 AC3 GLN A 449 ? ASN A 462 ? GLN O 1114 ASN O 1127 1 ? 14 
HELX_P HELX_P22 AC4 ASP A 475 ? ALA A 486 ? ASP O 1140 ALA O 1151 1 ? 12 
HELX_P HELX_P23 AC5 ASN A 521 ? ASP A 530 ? ASN O 1186 ASP O 1195 1 ? 10 
HELX_P HELX_P24 AC6 SER A 551 ? LYS A 569 ? SER O 1216 LYS O 1234 1 ? 19 
HELX_P HELX_P25 AC7 VAL A 570 ? LYS A 575 ? VAL O 1235 LYS O 1240 1 ? 6  
HELX_P HELX_P26 AC8 GLU A 583 ? GLU A 604 ? GLU O 1248 GLU O 1269 1 ? 22 
HELX_P HELX_P27 AC9 LYS A 614 ? ALA A 623 ? LYS O 1279 ALA O 1288 1 ? 10 
HELX_P HELX_P28 AD1 ASN A 625 ? LEU A 632 ? ASN O 1290 LEU O 1297 1 ? 8  
HELX_P HELX_P29 AD2 THR A 633 ? ASP A 636 ? THR O 1298 ASP O 1301 5 ? 4  
HELX_P HELX_P30 AD3 ARG A 672 ? ASN A 682 ? ARG O 1337 ASN O 1347 1 ? 11 
HELX_P HELX_P31 AD4 GLY B 44  ? SER B 57  ? GLY A 44   SER A 57   1 ? 14 
HELX_P HELX_P32 AD5 ARG B 63  ? ASP B 77  ? ARG A 63   ASP A 77   1 ? 15 
HELX_P HELX_P33 AD6 GLN B 85  ? ALA B 114 ? GLN A 85   ALA A 114  1 ? 30 
HELX_P HELX_P34 AD7 MET B 120 ? GLY B 132 ? MET A 120  GLY A 132  1 ? 13 
HELX_P HELX_P35 AD8 ASN C 25  ? ILE C 29  ? ASN B 25   ILE B 29   5 ? 5  
HELX_P HELX_P36 AD9 THR C 30  ? GLY C 42  ? THR B 30   GLY B 42   1 ? 13 
HELX_P HELX_P37 AE1 LEU C 49  ? ALA C 76  ? LEU B 49   ALA B 76   1 ? 28 
HELX_P HELX_P38 AE2 THR C 82  ? GLY C 94  ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P39 AE3 THR D 16  ? GLY D 22  ? THR C 16   GLY C 22   1 ? 7  
HELX_P HELX_P40 AE4 PRO D 26  ? GLY D 37  ? PRO C 26   GLY C 37   1 ? 12 
HELX_P HELX_P41 AE5 GLY D 46  ? ASN D 73  ? GLY C 46   ASN C 73   1 ? 28 
HELX_P HELX_P42 AE6 ILE D 79  ? ASP D 90  ? ILE C 79   ASP C 90   1 ? 12 
HELX_P HELX_P43 AE7 ASP D 90  ? GLY D 98  ? ASP C 90   GLY C 98   1 ? 9  
HELX_P HELX_P44 AE8 TYR E 34  ? GLN E 44  ? TYR D 34   GLN D 44   1 ? 11 
HELX_P HELX_P45 AE9 SER E 52  ? ASN E 81  ? SER D 52   ASN D 81   1 ? 30 
HELX_P HELX_P46 AF1 THR E 87  ? LEU E 99  ? THR D 87   LEU D 99   1 ? 13 
HELX_P HELX_P47 AF2 GLY E 101 ? ALA E 121 ? GLY D 101  ALA D 121  1 ? 21 
HELX_P HELX_P48 AF3 GLY F 44  ? SER F 57  ? GLY E 44   SER E 57   1 ? 14 
HELX_P HELX_P49 AF4 ARG F 63  ? ASP F 77  ? ARG E 63   ASP E 77   1 ? 15 
HELX_P HELX_P50 AF5 GLN F 85  ? ALA F 114 ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P51 AF6 MET F 120 ? GLY F 132 ? MET E 120  GLY E 132  1 ? 13 
HELX_P HELX_P52 AF7 ASP G 24  ? ILE G 29  ? ASP F 24   ILE F 29   5 ? 6  
HELX_P HELX_P53 AF8 THR G 30  ? GLY G 41  ? THR F 30   GLY F 41   1 ? 12 
HELX_P HELX_P54 AF9 LEU G 49  ? ALA G 76  ? LEU F 49   ALA F 76   1 ? 28 
HELX_P HELX_P55 AG1 THR G 82  ? GLY G 94  ? THR F 82   GLY F 94   1 ? 13 
HELX_P HELX_P56 AG2 THR H 16  ? GLY H 22  ? THR G 16   GLY G 22   1 ? 7  
HELX_P HELX_P57 AG3 PRO H 26  ? GLY H 37  ? PRO G 26   GLY G 37   1 ? 12 
HELX_P HELX_P58 AG4 GLY H 46  ? ASN H 73  ? GLY G 46   ASN G 73   1 ? 28 
HELX_P HELX_P59 AG5 ILE H 79  ? ASP H 90  ? ILE G 79   ASP G 90   1 ? 12 
HELX_P HELX_P60 AG6 ASP H 90  ? GLY H 98  ? ASP G 90   GLY G 98   1 ? 9  
HELX_P HELX_P61 AG7 TYR I 34  ? GLN I 44  ? TYR H 34   GLN H 44   1 ? 11 
HELX_P HELX_P62 AG8 SER I 52  ? ASN I 81  ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P63 AG9 THR I 87  ? LEU I 99  ? THR H 87   LEU H 99   1 ? 13 
HELX_P HELX_P64 AH1 GLY I 101 ? ALA I 121 ? GLY H 101  ALA H 121  1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A ASP 229 OD1 ? ? ? 1_555 L MG .   MG ? ? O ASP 894 O MG 1501 1_555 ? ? ? ? ? ? ?            2.515 ? 
metalc2   metalc ? ? A ASP 229 OD2 ? ? ? 1_555 L MG .   MG ? ? O ASP 894 O MG 1501 1_555 ? ? ? ? ? ? ?            2.030 ? 
hydrog1   hydrog ? ? J DT  2   N3  ? ? ? 1_555 K DA 166 N1 ? ? I DT  2   J DA 146  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? J DT  2   O4  ? ? ? 1_555 K DA 166 N6 ? ? I DT  2   J DA 146  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? J DC  3   N3  ? ? ? 1_555 K DG 165 N1 ? ? I DC  3   J DG 145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? J DC  3   N4  ? ? ? 1_555 K DG 165 O6 ? ? I DC  3   J DG 145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? J DC  3   O2  ? ? ? 1_555 K DG 165 N2 ? ? I DC  3   J DG 145  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? J DG  4   N1  ? ? ? 1_555 K DC 164 N3 ? ? I DG  4   J DC 144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? J DG  4   N2  ? ? ? 1_555 K DC 164 O2 ? ? I DG  4   J DC 144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? J DG  4   O6  ? ? ? 1_555 K DC 164 N4 ? ? I DG  4   J DC 144  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? J DA  5   N1  ? ? ? 1_555 K DT 163 N3 ? ? I DA  5   J DT 143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? J DA  5   N6  ? ? ? 1_555 K DT 163 O4 ? ? I DA  5   J DT 143  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? J DG  6   N1  ? ? ? 1_555 K DC 162 N3 ? ? I DG  6   J DC 142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? J DG  6   N2  ? ? ? 1_555 K DC 162 O2 ? ? I DG  6   J DC 142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? J DG  6   O6  ? ? ? 1_555 K DC 162 N4 ? ? I DG  6   J DC 142  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? J DA  7   N1  ? ? ? 1_555 K DT 161 N3 ? ? I DA  7   J DT 141  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? J DA  7   N6  ? ? ? 1_555 K DT 161 O4 ? ? I DA  7   J DT 141  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? J DA  8   N1  ? ? ? 1_555 K DT 160 N3 ? ? I DA  8   J DT 140  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? J DA  8   N6  ? ? ? 1_555 K DT 160 O4 ? ? I DA  8   J DT 140  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? J DT  9   N3  ? ? ? 1_555 K DA 159 N1 ? ? I DT  9   J DA 139  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? J DT  9   O4  ? ? ? 1_555 K DA 159 N6 ? ? I DT  9   J DA 139  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? J DC  10  N3  ? ? ? 1_555 K DG 158 N1 ? ? I DC  10  J DG 138  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? J DC  10  N4  ? ? ? 1_555 K DG 158 O6 ? ? I DC  10  J DG 138  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? J DC  10  O2  ? ? ? 1_555 K DG 158 N2 ? ? I DC  10  J DG 138  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? J DC  11  N3  ? ? ? 1_555 K DG 157 N1 ? ? I DC  11  J DG 137  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? J DC  11  N4  ? ? ? 1_555 K DG 157 O6 ? ? I DC  11  J DG 137  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? J DC  11  O2  ? ? ? 1_555 K DG 157 N2 ? ? I DC  11  J DG 137  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? J DC  12  N3  ? ? ? 1_555 K DG 156 N1 ? ? I DC  12  J DG 136  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? J DC  12  N4  ? ? ? 1_555 K DG 156 O6 ? ? I DC  12  J DG 136  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? J DC  12  O2  ? ? ? 1_555 K DG 156 N2 ? ? I DC  12  J DG 136  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? J DG  13  N1  ? ? ? 1_555 K DC 155 N3 ? ? I DG  13  J DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? J DG  13  N2  ? ? ? 1_555 K DC 155 O2 ? ? I DG  13  J DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? J DG  13  O6  ? ? ? 1_555 K DC 155 N4 ? ? I DG  13  J DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? J DG  14  N1  ? ? ? 1_555 K DC 154 N3 ? ? I DG  14  J DC 134  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? J DG  14  N2  ? ? ? 1_555 K DC 154 O2 ? ? I DG  14  J DC 134  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? J DG  14  O6  ? ? ? 1_555 K DC 154 N4 ? ? I DG  14  J DC 134  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? J DT  15  N3  ? ? ? 1_555 K DA 153 N1 ? ? I DT  15  J DA 133  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? J DT  15  O4  ? ? ? 1_555 K DA 153 N6 ? ? I DT  15  J DA 133  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? J DG  16  N1  ? ? ? 1_555 K DC 152 N3 ? ? I DG  16  J DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? J DG  16  N2  ? ? ? 1_555 K DC 152 O2 ? ? I DG  16  J DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? J DG  16  O6  ? ? ? 1_555 K DC 152 N4 ? ? I DG  16  J DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? J DC  17  N3  ? ? ? 1_555 K DG 151 N1 ? ? I DC  17  J DG 131  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? J DC  17  N4  ? ? ? 1_555 K DG 151 O6 ? ? I DC  17  J DG 131  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? J DC  17  O2  ? ? ? 1_555 K DG 151 N2 ? ? I DC  17  J DG 131  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? J DC  18  N3  ? ? ? 1_555 K DG 150 N1 ? ? I DC  18  J DG 130  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? J DC  18  N4  ? ? ? 1_555 K DG 150 O6 ? ? I DC  18  J DG 130  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? J DC  18  O2  ? ? ? 1_555 K DG 150 N2 ? ? I DC  18  J DG 130  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? J DG  19  N1  ? ? ? 1_555 K DC 149 N3 ? ? I DG  19  J DC 129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? J DG  19  N2  ? ? ? 1_555 K DC 149 O2 ? ? I DG  19  J DC 129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? J DG  19  O6  ? ? ? 1_555 K DC 149 N4 ? ? I DG  19  J DC 129  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? J DA  20  N1  ? ? ? 1_555 K DT 148 N3 ? ? I DA  20  J DT 128  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? J DA  20  N6  ? ? ? 1_555 K DT 148 O4 ? ? I DA  20  J DT 128  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? J DG  21  N1  ? ? ? 1_555 K DC 147 N3 ? ? I DG  21  J DC 127  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? J DG  21  N2  ? ? ? 1_555 K DC 147 O2 ? ? I DG  21  J DC 127  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? J DG  21  O6  ? ? ? 1_555 K DC 147 N4 ? ? I DG  21  J DC 127  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? J DG  22  N1  ? ? ? 1_555 K DC 146 N3 ? ? I DG  22  J DC 126  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? J DG  22  N2  ? ? ? 1_555 K DC 146 O2 ? ? I DG  22  J DC 126  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? J DG  22  O6  ? ? ? 1_555 K DC 146 N4 ? ? I DG  22  J DC 126  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? J DC  23  N3  ? ? ? 1_555 K DG 145 N1 ? ? I DC  23  J DG 125  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? J DC  23  N4  ? ? ? 1_555 K DG 145 O6 ? ? I DC  23  J DG 125  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? J DC  23  O2  ? ? ? 1_555 K DG 145 N2 ? ? I DC  23  J DG 125  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? J DC  24  N3  ? ? ? 1_555 K DG 144 N1 ? ? I DC  24  J DG 124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? J DC  24  N4  ? ? ? 1_555 K DG 144 O6 ? ? I DC  24  J DG 124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? J DC  24  O2  ? ? ? 1_555 K DG 144 N2 ? ? I DC  24  J DG 124  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? J DG  25  N1  ? ? ? 1_555 K DC 143 N3 ? ? I DG  25  J DC 123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? J DG  25  N2  ? ? ? 1_555 K DC 143 O2 ? ? I DG  25  J DC 123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? J DG  25  O6  ? ? ? 1_555 K DC 143 N4 ? ? I DG  25  J DC 123  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? J DC  26  N3  ? ? ? 1_555 K DG 142 N1 ? ? I DC  26  J DG 122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? J DC  26  N4  ? ? ? 1_555 K DG 142 O6 ? ? I DC  26  J DG 122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? J DC  26  O2  ? ? ? 1_555 K DG 142 N2 ? ? I DC  26  J DG 122  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? J DT  27  N3  ? ? ? 1_555 K DA 141 N1 ? ? I DT  27  J DA 121  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? J DT  27  O4  ? ? ? 1_555 K DA 141 N6 ? ? I DT  27  J DA 121  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? J DC  28  N3  ? ? ? 1_555 K DG 140 N1 ? ? I DC  28  J DG 120  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? J DC  28  N4  ? ? ? 1_555 K DG 140 O6 ? ? I DC  28  J DG 120  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? J DC  28  O2  ? ? ? 1_555 K DG 140 N2 ? ? I DC  28  J DG 120  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? J DA  29  N1  ? ? ? 1_555 K DT 139 N3 ? ? I DA  29  J DT 119  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? J DA  29  N6  ? ? ? 1_555 K DT 139 O4 ? ? I DA  29  J DT 119  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? J DA  30  N1  ? ? ? 1_555 K DT 138 N3 ? ? I DA  30  J DT 118  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? J DA  30  N6  ? ? ? 1_555 K DT 138 O4 ? ? I DA  30  J DT 118  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? J DT  31  N3  ? ? ? 1_555 K DA 137 N1 ? ? I DT  31  J DA 117  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? J DT  31  O4  ? ? ? 1_555 K DA 137 N6 ? ? I DT  31  J DA 117  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? J DT  32  N3  ? ? ? 1_555 K DA 136 N1 ? ? I DT  32  J DA 116  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? J DT  32  O4  ? ? ? 1_555 K DA 136 N6 ? ? I DT  32  J DA 116  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? J DG  33  N1  ? ? ? 1_555 K DC 135 N3 ? ? I DG  33  J DC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? J DG  33  N2  ? ? ? 1_555 K DC 135 O2 ? ? I DG  33  J DC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? J DG  33  O6  ? ? ? 1_555 K DC 135 N4 ? ? I DG  33  J DC 115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? J DG  34  N1  ? ? ? 1_555 K DC 134 N3 ? ? I DG  34  J DC 114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? J DG  34  N2  ? ? ? 1_555 K DC 134 O2 ? ? I DG  34  J DC 114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? J DG  34  O6  ? ? ? 1_555 K DC 134 N4 ? ? I DG  34  J DC 114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? J DT  35  N3  ? ? ? 1_555 K DA 133 N1 ? ? I DT  35  J DA 113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? J DT  35  O4  ? ? ? 1_555 K DA 133 N6 ? ? I DT  35  J DA 113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? J DC  36  N3  ? ? ? 1_555 K DG 132 N1 ? ? I DC  36  J DG 112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? J DC  36  N4  ? ? ? 1_555 K DG 132 O6 ? ? I DC  36  J DG 112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? J DC  36  O2  ? ? ? 1_555 K DG 132 N2 ? ? I DC  36  J DG 112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? J DG  37  N1  ? ? ? 1_555 K DC 131 N3 ? ? I DG  37  J DC 111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? J DG  37  N2  ? ? ? 1_555 K DC 131 O2 ? ? I DG  37  J DC 111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? J DG  37  O6  ? ? ? 1_555 K DC 131 N4 ? ? I DG  37  J DC 111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? J DT  38  N3  ? ? ? 1_555 K DA 130 N1 ? ? I DT  38  J DA 110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? J DT  38  O4  ? ? ? 1_555 K DA 130 N6 ? ? I DT  38  J DA 110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? J DA  39  N1  ? ? ? 1_555 K DT 129 N3 ? ? I DA  39  J DT 109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? J DA  39  N6  ? ? ? 1_555 K DT 129 O4 ? ? I DA  39  J DT 109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? J DG  40  N1  ? ? ? 1_555 K DC 128 N3 ? ? I DG  40  J DC 108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? J DG  40  N2  ? ? ? 1_555 K DC 128 O2 ? ? I DG  40  J DC 108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? J DG  40  O6  ? ? ? 1_555 K DC 128 N4 ? ? I DG  40  J DC 108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? J DA  41  N1  ? ? ? 1_555 K DT 127 N3 ? ? I DA  41  J DT 107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? J DA  41  N6  ? ? ? 1_555 K DT 127 O4 ? ? I DA  41  J DT 107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? J DC  42  N3  ? ? ? 1_555 K DG 126 N1 ? ? I DC  42  J DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? J DC  42  N4  ? ? ? 1_555 K DG 126 O6 ? ? I DC  42  J DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? J DC  42  O2  ? ? ? 1_555 K DG 126 N2 ? ? I DC  42  J DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? J DA  43  N1  ? ? ? 1_555 K DT 125 N3 ? ? I DA  43  J DT 105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? J DA  43  N6  ? ? ? 1_555 K DT 125 O4 ? ? I DA  43  J DT 105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? J DG  44  N1  ? ? ? 1_555 K DC 124 N3 ? ? I DG  44  J DC 104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? J DG  44  N2  ? ? ? 1_555 K DC 124 O2 ? ? I DG  44  J DC 104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? J DG  44  O6  ? ? ? 1_555 K DC 124 N4 ? ? I DG  44  J DC 104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? J DC  45  N3  ? ? ? 1_555 K DG 123 N1 ? ? I DC  45  J DG 103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? J DC  45  N4  ? ? ? 1_555 K DG 123 O6 ? ? I DC  45  J DG 103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? J DC  45  O2  ? ? ? 1_555 K DG 123 N2 ? ? I DC  45  J DG 103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? J DT  46  N3  ? ? ? 1_555 K DA 122 N1 ? ? I DT  46  J DA 102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? J DT  46  O4  ? ? ? 1_555 K DA 122 N6 ? ? I DT  46  J DA 102  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? J DC  47  N3  ? ? ? 1_555 K DG 121 N1 ? ? I DC  47  J DG 101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? J DC  47  N4  ? ? ? 1_555 K DG 121 O6 ? ? I DC  47  J DG 101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? J DC  47  O2  ? ? ? 1_555 K DG 121 N2 ? ? I DC  47  J DG 101  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? J DT  48  N3  ? ? ? 1_555 K DA 120 N1 ? ? I DT  48  J DA 100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? J DT  48  O4  ? ? ? 1_555 K DA 120 N6 ? ? I DT  48  J DA 100  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? J DA  49  N1  ? ? ? 1_555 K DT 119 N3 ? ? I DA  49  J DT 99   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? J DA  49  N6  ? ? ? 1_555 K DT 119 O4 ? ? I DA  49  J DT 99   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? J DG  50  N1  ? ? ? 1_555 K DC 118 N3 ? ? I DG  50  J DC 98   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? J DG  50  N2  ? ? ? 1_555 K DC 118 O2 ? ? I DG  50  J DC 98   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? J DG  50  O6  ? ? ? 1_555 K DC 118 N4 ? ? I DG  50  J DC 98   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? J DC  51  N3  ? ? ? 1_555 K DG 117 N1 ? ? I DC  51  J DG 97   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? J DC  51  N4  ? ? ? 1_555 K DG 117 O6 ? ? I DC  51  J DG 97   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? J DC  51  O2  ? ? ? 1_555 K DG 117 N2 ? ? I DC  51  J DG 97   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? J DA  52  N1  ? ? ? 1_555 K DT 116 N3 ? ? I DA  52  J DT 96   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? J DA  52  N6  ? ? ? 1_555 K DT 116 O4 ? ? I DA  52  J DT 96   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? J DC  53  N3  ? ? ? 1_555 K DG 115 N1 ? ? I DC  53  J DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? J DC  53  N4  ? ? ? 1_555 K DG 115 O6 ? ? I DC  53  J DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? J DC  53  O2  ? ? ? 1_555 K DG 115 N2 ? ? I DC  53  J DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? J DC  54  N3  ? ? ? 1_555 K DG 114 N1 ? ? I DC  54  J DG 94   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? J DC  54  N4  ? ? ? 1_555 K DG 114 O6 ? ? I DC  54  J DG 94   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? J DC  54  O2  ? ? ? 1_555 K DG 114 N2 ? ? I DC  54  J DG 94   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? J DG  55  N1  ? ? ? 1_555 K DC 113 N3 ? ? I DG  55  J DC 93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? J DG  55  N2  ? ? ? 1_555 K DC 113 O2 ? ? I DG  55  J DC 93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? J DG  55  O6  ? ? ? 1_555 K DC 113 N4 ? ? I DG  55  J DC 93   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? J DC  56  N3  ? ? ? 1_555 K DG 112 N1 ? ? I DC  56  J DG 92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? J DC  56  N4  ? ? ? 1_555 K DG 112 O6 ? ? I DC  56  J DG 92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? J DC  56  O2  ? ? ? 1_555 K DG 112 N2 ? ? I DC  56  J DG 92   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? J DT  57  N3  ? ? ? 1_555 K DA 111 N1 ? ? I DT  57  J DA 91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? J DT  57  O4  ? ? ? 1_555 K DA 111 N6 ? ? I DT  57  J DA 91   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? J DT  58  N3  ? ? ? 1_555 K DA 110 N1 ? ? I DT  58  J DA 90   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? J DT  58  O4  ? ? ? 1_555 K DA 110 N6 ? ? I DT  58  J DA 90   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? J DA  59  N1  ? ? ? 1_555 K DT 109 N3 ? ? I DA  59  J DT 89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? J DA  59  N6  ? ? ? 1_555 K DT 109 O4 ? ? I DA  59  J DT 89   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? J DA  60  N1  ? ? ? 1_555 K DT 108 N3 ? ? I DA  60  J DT 88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? J DA  60  N6  ? ? ? 1_555 K DT 108 O4 ? ? I DA  60  J DT 88   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? J DA  61  N1  ? ? ? 1_555 K DT 107 N3 ? ? I DA  61  J DT 87   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? J DA  61  N6  ? ? ? 1_555 K DT 107 O4 ? ? I DA  61  J DT 87   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? J DC  62  N3  ? ? ? 1_555 K DG 106 N1 ? ? I DC  62  J DG 86   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? J DC  62  N4  ? ? ? 1_555 K DG 106 O6 ? ? I DC  62  J DG 86   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? J DC  62  O2  ? ? ? 1_555 K DG 106 N2 ? ? I DC  62  J DG 86   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? J DG  63  N1  ? ? ? 1_555 K DC 105 N3 ? ? I DG  63  J DC 85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? J DG  63  N2  ? ? ? 1_555 K DC 105 O2 ? ? I DG  63  J DC 85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ? ? J DG  63  O6  ? ? ? 1_555 K DC 105 N4 ? ? I DG  63  J DC 85   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? J DC  64  N3  ? ? ? 1_555 K DG 104 N1 ? ? I DC  64  J DG 84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? J DC  64  N4  ? ? ? 1_555 K DG 104 O6 ? ? I DC  64  J DG 84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? J DC  64  O2  ? ? ? 1_555 K DG 104 N2 ? ? I DC  64  J DG 84   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? J DA  65  N1  ? ? ? 1_555 K DT 103 N3 ? ? I DA  65  J DT 83   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ? ? J DA  65  N6  ? ? ? 1_555 K DT 103 O4 ? ? I DA  65  J DT 83   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ? ? J DC  66  N3  ? ? ? 1_555 K DG 102 N1 ? ? I DC  66  J DG 82   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ? ? J DC  66  N4  ? ? ? 1_555 K DG 102 O6 ? ? I DC  66  J DG 82   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ? ? J DC  66  O2  ? ? ? 1_555 K DG 102 N2 ? ? I DC  66  J DG 82   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ? ? J DG  67  N1  ? ? ? 1_555 K DC 101 N3 ? ? I DG  67  J DC 81   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ? ? J DG  67  N2  ? ? ? 1_555 K DC 101 O2 ? ? I DG  67  J DC 81   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ? ? J DG  67  O6  ? ? ? 1_555 K DC 101 N4 ? ? I DG  67  J DC 81   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ? ? J DT  68  N3  ? ? ? 1_555 K DA 100 N1 ? ? I DT  68  J DA 80   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ? ? J DT  68  O4  ? ? ? 1_555 K DA 100 N6 ? ? I DT  68  J DA 80   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ? ? J DA  69  N1  ? ? ? 1_555 K DT 99  N3 ? ? I DA  69  J DT 79   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ? ? J DA  69  N6  ? ? ? 1_555 K DT 99  O4 ? ? I DA  69  J DT 79   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ? ? J DC  70  N3  ? ? ? 1_555 K DG 98  N1 ? ? I DC  70  J DG 78   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ? ? J DC  70  N4  ? ? ? 1_555 K DG 98  O6 ? ? I DC  70  J DG 78   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ? ? J DC  70  O2  ? ? ? 1_555 K DG 98  N2 ? ? I DC  70  J DG 78   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ? ? J DG  71  N1  ? ? ? 1_555 K DC 97  N3 ? ? I DG  71  J DC 77   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ? ? J DG  71  N2  ? ? ? 1_555 K DC 97  O2 ? ? I DG  71  J DC 77   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ? ? J DG  71  O6  ? ? ? 1_555 K DC 97  N4 ? ? I DG  71  J DC 77   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ? ? J DC  72  N3  ? ? ? 1_555 K DG 96  N1 ? ? I DC  72  J DG 76   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ? ? J DC  72  N4  ? ? ? 1_555 K DG 96  O6 ? ? I DC  72  J DG 76   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ? ? J DC  72  O2  ? ? ? 1_555 K DG 96  N2 ? ? I DC  72  J DG 76   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ? ? J DG  73  N1  ? ? ? 1_555 K DC 95  N3 ? ? I DG  73  J DC 75   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ? ? J DG  73  N2  ? ? ? 1_555 K DC 95  O2 ? ? I DG  73  J DC 75   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ? ? J DG  73  O6  ? ? ? 1_555 K DC 95  N4 ? ? I DG  73  J DC 75   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ? ? J DC  74  N3  ? ? ? 1_555 K DG 94  N1 ? ? I DC  74  J DG 74   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ? ? J DC  74  N4  ? ? ? 1_555 K DG 94  O6 ? ? I DC  74  J DG 74   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ? ? J DC  74  O2  ? ? ? 1_555 K DG 94  N2 ? ? I DC  74  J DG 74   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ? ? J DT  75  N3  ? ? ? 1_555 K DA 93  N1 ? ? I DT  75  J DA 73   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ? ? J DT  75  O4  ? ? ? 1_555 K DA 93  N6 ? ? I DT  75  J DA 73   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ? ? J DG  76  N1  ? ? ? 1_555 K DC 92  N3 ? ? I DG  76  J DC 72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ? ? J DG  76  N2  ? ? ? 1_555 K DC 92  O2 ? ? I DG  76  J DC 72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ? ? J DG  76  O6  ? ? ? 1_555 K DC 92  N4 ? ? I DG  76  J DC 72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ? ? J DT  77  N3  ? ? ? 1_555 K DA 91  N1 ? ? I DT  77  J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ? ? J DT  77  O4  ? ? ? 1_555 K DA 91  N6 ? ? I DT  77  J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ? ? J DC  78  N3  ? ? ? 1_555 K DG 90  N1 ? ? I DC  78  J DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ? ? J DC  78  N4  ? ? ? 1_555 K DG 90  O6 ? ? I DC  78  J DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ? ? J DC  78  O2  ? ? ? 1_555 K DG 90  N2 ? ? I DC  78  J DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ? ? J DC  79  N3  ? ? ? 1_555 K DG 89  N1 ? ? I DC  79  J DG 69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ? ? J DC  79  N4  ? ? ? 1_555 K DG 89  O6 ? ? I DC  79  J DG 69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ? ? J DC  79  O2  ? ? ? 1_555 K DG 89  N2 ? ? I DC  79  J DG 69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ? ? J DC  80  N3  ? ? ? 1_555 K DG 88  N1 ? ? I DC  80  J DG 68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog205 hydrog ? ? J DC  80  N4  ? ? ? 1_555 K DG 88  O6 ? ? I DC  80  J DG 68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog206 hydrog ? ? J DC  80  O2  ? ? ? 1_555 K DG 88  N2 ? ? I DC  80  J DG 68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog207 hydrog ? ? J DC  81  N3  ? ? ? 1_555 K DG 87  N1 ? ? I DC  81  J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog208 hydrog ? ? J DC  81  N4  ? ? ? 1_555 K DG 87  O6 ? ? I DC  81  J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog209 hydrog ? ? J DC  81  O2  ? ? ? 1_555 K DG 87  N2 ? ? I DC  81  J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog210 hydrog ? ? J DC  82  N3  ? ? ? 1_555 K DG 86  N1 ? ? I DC  82  J DG 66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog211 hydrog ? ? J DC  82  N4  ? ? ? 1_555 K DG 86  O6 ? ? I DC  82  J DG 66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog212 hydrog ? ? J DC  82  O2  ? ? ? 1_555 K DG 86  N2 ? ? I DC  82  J DG 66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog213 hydrog ? ? J DG  83  N1  ? ? ? 1_555 K DC 85  N3 ? ? I DG  83  J DC 65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog214 hydrog ? ? J DG  83  N2  ? ? ? 1_555 K DC 85  O2 ? ? I DG  83  J DC 65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog215 hydrog ? ? J DG  83  O6  ? ? ? 1_555 K DC 85  N4 ? ? I DG  83  J DC 65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog216 hydrog ? ? J DC  84  N3  ? ? ? 1_555 K DG 84  N1 ? ? I DC  84  J DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog217 hydrog ? ? J DC  84  N4  ? ? ? 1_555 K DG 84  O6 ? ? I DC  84  J DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog218 hydrog ? ? J DC  84  O2  ? ? ? 1_555 K DG 84  N2 ? ? I DC  84  J DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog219 hydrog ? ? J DG  85  N1  ? ? ? 1_555 K DC 83  N3 ? ? I DG  85  J DC 63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog220 hydrog ? ? J DG  85  N2  ? ? ? 1_555 K DC 83  O2 ? ? I DG  85  J DC 63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog221 hydrog ? ? J DG  85  O6  ? ? ? 1_555 K DC 83  N4 ? ? I DG  85  J DC 63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog222 hydrog ? ? J DT  86  N3  ? ? ? 1_555 K DA 82  N1 ? ? I DT  86  J DA 62   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog223 hydrog ? ? J DT  86  O4  ? ? ? 1_555 K DA 82  N6 ? ? I DT  86  J DA 62   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog224 hydrog ? ? J DT  87  N3  ? ? ? 1_555 K DA 81  N1 ? ? I DT  87  J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog225 hydrog ? ? J DT  87  O4  ? ? ? 1_555 K DA 81  N6 ? ? I DT  87  J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog226 hydrog ? ? J DT  88  N3  ? ? ? 1_555 K DA 80  N1 ? ? I DT  88  J DA 60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog227 hydrog ? ? J DT  88  O4  ? ? ? 1_555 K DA 80  N6 ? ? I DT  88  J DA 60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog228 hydrog ? ? J DT  89  N3  ? ? ? 1_555 K DA 79  N1 ? ? I DT  89  J DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog229 hydrog ? ? J DT  89  O4  ? ? ? 1_555 K DA 79  N6 ? ? I DT  89  J DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog230 hydrog ? ? J DA  90  N1  ? ? ? 1_555 K DT 78  N3 ? ? I DA  90  J DT 58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog231 hydrog ? ? J DA  90  N6  ? ? ? 1_555 K DT 78  O4 ? ? I DA  90  J DT 58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog232 hydrog ? ? J DA  91  N1  ? ? ? 1_555 K DT 77  N3 ? ? I DA  91  J DT 57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog233 hydrog ? ? J DA  91  N6  ? ? ? 1_555 K DT 77  O4 ? ? I DA  91  J DT 57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog234 hydrog ? ? J DC  92  N3  ? ? ? 1_555 K DG 76  N1 ? ? I DC  92  J DG 56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog235 hydrog ? ? J DC  92  N4  ? ? ? 1_555 K DG 76  O6 ? ? I DC  92  J DG 56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog236 hydrog ? ? J DC  92  O2  ? ? ? 1_555 K DG 76  N2 ? ? I DC  92  J DG 56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog237 hydrog ? ? J DC  93  N3  ? ? ? 1_555 K DG 75  N1 ? ? I DC  93  J DG 55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog238 hydrog ? ? J DC  93  N4  ? ? ? 1_555 K DG 75  O6 ? ? I DC  93  J DG 55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog239 hydrog ? ? J DC  93  O2  ? ? ? 1_555 K DG 75  N2 ? ? I DC  93  J DG 55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog240 hydrog ? ? J DG  94  N1  ? ? ? 1_555 K DC 74  N3 ? ? I DG  94  J DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog241 hydrog ? ? J DG  94  N2  ? ? ? 1_555 K DC 74  O2 ? ? I DG  94  J DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog242 hydrog ? ? J DG  94  O6  ? ? ? 1_555 K DC 74  N4 ? ? I DG  94  J DC 54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog243 hydrog ? ? J DC  95  N3  ? ? ? 1_555 K DG 73  N1 ? ? I DC  95  J DG 53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog244 hydrog ? ? J DC  95  N4  ? ? ? 1_555 K DG 73  O6 ? ? I DC  95  J DG 53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog245 hydrog ? ? J DC  95  O2  ? ? ? 1_555 K DG 73  N2 ? ? I DC  95  J DG 53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog246 hydrog ? ? J DC  96  N3  ? ? ? 1_555 K DG 72  N1 ? ? I DC  96  J DG 52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog247 hydrog ? ? J DC  96  N4  ? ? ? 1_555 K DG 72  O6 ? ? I DC  96  J DG 52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog248 hydrog ? ? J DC  96  O2  ? ? ? 1_555 K DG 72  N2 ? ? I DC  96  J DG 52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog249 hydrog ? ? J DA  97  N1  ? ? ? 1_555 K DT 71  N3 ? ? I DA  97  J DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog250 hydrog ? ? J DA  97  N6  ? ? ? 1_555 K DT 71  O4 ? ? I DA  97  J DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog251 hydrog ? ? J DA  98  N1  ? ? ? 1_555 K DT 70  N3 ? ? I DA  98  J DT 50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog252 hydrog ? ? J DA  98  N6  ? ? ? 1_555 K DT 70  O4 ? ? I DA  98  J DT 50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog253 hydrog ? ? J DG  99  N1  ? ? ? 1_555 K DC 69  N3 ? ? I DG  99  J DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog254 hydrog ? ? J DG  99  N2  ? ? ? 1_555 K DC 69  O2 ? ? I DG  99  J DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog255 hydrog ? ? J DG  99  O6  ? ? ? 1_555 K DC 69  N4 ? ? I DG  99  J DC 49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog256 hydrog ? ? J DG  100 N1  ? ? ? 1_555 K DC 68  N3 ? ? I DG  100 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog257 hydrog ? ? J DG  100 N2  ? ? ? 1_555 K DC 68  O2 ? ? I DG  100 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog258 hydrog ? ? J DG  100 O6  ? ? ? 1_555 K DC 68  N4 ? ? I DG  100 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog259 hydrog ? ? J DG  101 N1  ? ? ? 1_555 K DC 67  N3 ? ? I DG  101 J DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog260 hydrog ? ? J DG  101 N2  ? ? ? 1_555 K DC 67  O2 ? ? I DG  101 J DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog261 hydrog ? ? J DG  101 O6  ? ? ? 1_555 K DC 67  N4 ? ? I DG  101 J DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog262 hydrog ? ? J DG  102 N1  ? ? ? 1_555 K DC 66  N3 ? ? I DG  102 J DC 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog263 hydrog ? ? J DG  102 N2  ? ? ? 1_555 K DC 66  O2 ? ? I DG  102 J DC 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog264 hydrog ? ? J DG  102 O6  ? ? ? 1_555 K DC 66  N4 ? ? I DG  102 J DC 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog265 hydrog ? ? J DA  103 N1  ? ? ? 1_555 K DT 65  N3 ? ? I DA  103 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog266 hydrog ? ? J DA  103 N6  ? ? ? 1_555 K DT 65  O4 ? ? I DA  103 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog267 hydrog ? ? J DT  104 N3  ? ? ? 1_555 K DA 64  N1 ? ? I DT  104 J DA 44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog268 hydrog ? ? J DT  104 O4  ? ? ? 1_555 K DA 64  N6 ? ? I DT  104 J DA 44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog269 hydrog ? ? J DT  105 N3  ? ? ? 1_555 K DA 63  N1 ? ? I DT  105 J DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog270 hydrog ? ? J DT  105 O4  ? ? ? 1_555 K DA 63  N6 ? ? I DT  105 J DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog271 hydrog ? ? J DA  106 N1  ? ? ? 1_555 K DT 62  N3 ? ? I DA  106 J DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog272 hydrog ? ? J DA  106 N6  ? ? ? 1_555 K DT 62  O4 ? ? I DA  106 J DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog273 hydrog ? ? J DC  107 N3  ? ? ? 1_555 K DG 61  N1 ? ? I DC  107 J DG 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog274 hydrog ? ? J DC  107 N4  ? ? ? 1_555 K DG 61  O6 ? ? I DC  107 J DG 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog275 hydrog ? ? J DC  107 O2  ? ? ? 1_555 K DG 61  N2 ? ? I DC  107 J DG 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog276 hydrog ? ? J DT  108 N3  ? ? ? 1_555 K DA 60  N1 ? ? I DT  108 J DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog277 hydrog ? ? J DT  108 O4  ? ? ? 1_555 K DA 60  N6 ? ? I DT  108 J DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog278 hydrog ? ? J DC  109 N3  ? ? ? 1_555 K DG 59  N1 ? ? I DC  109 J DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog279 hydrog ? ? J DC  109 N4  ? ? ? 1_555 K DG 59  O6 ? ? I DC  109 J DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog280 hydrog ? ? J DC  109 O2  ? ? ? 1_555 K DG 59  N2 ? ? I DC  109 J DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog281 hydrog ? ? J DC  110 N3  ? ? ? 1_555 K DG 58  N1 ? ? I DC  110 J DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog282 hydrog ? ? J DC  110 N4  ? ? ? 1_555 K DG 58  O6 ? ? I DC  110 J DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog283 hydrog ? ? J DC  110 O2  ? ? ? 1_555 K DG 58  N2 ? ? I DC  110 J DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog284 hydrog ? ? J DC  111 N3  ? ? ? 1_555 K DG 57  N1 ? ? I DC  111 J DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog285 hydrog ? ? J DC  111 N4  ? ? ? 1_555 K DG 57  O6 ? ? I DC  111 J DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog286 hydrog ? ? J DC  111 O2  ? ? ? 1_555 K DG 57  N2 ? ? I DC  111 J DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog287 hydrog ? ? J DT  112 N3  ? ? ? 1_555 K DA 56  N1 ? ? I DT  112 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog288 hydrog ? ? J DT  112 O4  ? ? ? 1_555 K DA 56  N6 ? ? I DT  112 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog289 hydrog ? ? J DA  113 N1  ? ? ? 1_555 K DT 55  N3 ? ? I DA  113 J DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog290 hydrog ? ? J DA  113 N6  ? ? ? 1_555 K DT 55  O4 ? ? I DA  113 J DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog291 hydrog ? ? J DG  114 N1  ? ? ? 1_555 K DC 54  N3 ? ? I DG  114 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog292 hydrog ? ? J DG  114 N2  ? ? ? 1_555 K DC 54  O2 ? ? I DG  114 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog293 hydrog ? ? J DG  114 O6  ? ? ? 1_555 K DC 54  N4 ? ? I DG  114 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog294 hydrog ? ? J DT  115 N3  ? ? ? 1_555 K DA 53  N1 ? ? I DT  115 J DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog295 hydrog ? ? J DT  115 O4  ? ? ? 1_555 K DA 53  N6 ? ? I DT  115 J DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog296 hydrog ? ? J DC  116 N3  ? ? ? 1_555 K DG 52  N1 ? ? I DC  116 J DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog297 hydrog ? ? J DC  116 N4  ? ? ? 1_555 K DG 52  O6 ? ? I DC  116 J DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog298 hydrog ? ? J DC  116 O2  ? ? ? 1_555 K DG 52  N2 ? ? I DC  116 J DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog299 hydrog ? ? J DT  117 N3  ? ? ? 1_555 K DA 51  N1 ? ? I DT  117 J DA 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog300 hydrog ? ? J DT  117 O4  ? ? ? 1_555 K DA 51  N6 ? ? I DT  117 J DA 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog301 hydrog ? ? J DC  118 N3  ? ? ? 1_555 K DG 50  N1 ? ? I DC  118 J DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog302 hydrog ? ? J DC  118 N4  ? ? ? 1_555 K DG 50  O6 ? ? I DC  118 J DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog303 hydrog ? ? J DC  118 O2  ? ? ? 1_555 K DG 50  N2 ? ? I DC  118 J DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog304 hydrog ? ? J DC  119 N3  ? ? ? 1_555 K DG 49  N1 ? ? I DC  119 J DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog305 hydrog ? ? J DC  119 N4  ? ? ? 1_555 K DG 49  O6 ? ? I DC  119 J DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog306 hydrog ? ? J DC  119 O2  ? ? ? 1_555 K DG 49  N2 ? ? I DC  119 J DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog307 hydrog ? ? J DA  120 N1  ? ? ? 1_555 K DT 48  N3 ? ? I DA  120 J DT 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog308 hydrog ? ? J DA  120 N6  ? ? ? 1_555 K DT 48  O4 ? ? I DA  120 J DT 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog309 hydrog ? ? J DG  121 N1  ? ? ? 1_555 K DC 47  N3 ? ? I DG  121 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog310 hydrog ? ? J DG  121 N2  ? ? ? 1_555 K DC 47  O2 ? ? I DG  121 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog311 hydrog ? ? J DG  121 O6  ? ? ? 1_555 K DC 47  N4 ? ? I DG  121 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog312 hydrog ? ? J DG  122 N1  ? ? ? 1_555 K DC 46  N3 ? ? I DG  122 J DC 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog313 hydrog ? ? J DG  122 N2  ? ? ? 1_555 K DC 46  O2 ? ? I DG  122 J DC 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog314 hydrog ? ? J DG  122 O6  ? ? ? 1_555 K DC 46  N4 ? ? I DG  122 J DC 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog315 hydrog ? ? J DC  123 N3  ? ? ? 1_555 K DG 45  N1 ? ? I DC  123 J DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog316 hydrog ? ? J DC  123 N4  ? ? ? 1_555 K DG 45  O6 ? ? I DC  123 J DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog317 hydrog ? ? J DC  123 O2  ? ? ? 1_555 K DG 45  N2 ? ? I DC  123 J DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog318 hydrog ? ? J DA  124 N1  ? ? ? 1_555 K DT 44  N3 ? ? I DA  124 J DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog319 hydrog ? ? J DA  124 N6  ? ? ? 1_555 K DT 44  O4 ? ? I DA  124 J DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog320 hydrog ? ? J DC  125 N3  ? ? ? 1_555 K DG 43  N1 ? ? I DC  125 J DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog321 hydrog ? ? J DC  125 N4  ? ? ? 1_555 K DG 43  O6 ? ? I DC  125 J DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog322 hydrog ? ? J DC  125 O2  ? ? ? 1_555 K DG 43  N2 ? ? I DC  125 J DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog323 hydrog ? ? J DG  126 N1  ? ? ? 1_555 K DC 42  N3 ? ? I DG  126 J DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog324 hydrog ? ? J DG  126 N2  ? ? ? 1_555 K DC 42  O2 ? ? I DG  126 J DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog325 hydrog ? ? J DG  126 O6  ? ? ? 1_555 K DC 42  N4 ? ? I DG  126 J DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog326 hydrog ? ? J DT  127 N3  ? ? ? 1_555 K DA 41  N1 ? ? I DT  127 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog327 hydrog ? ? J DT  127 O4  ? ? ? 1_555 K DA 41  N6 ? ? I DT  127 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog328 hydrog ? ? J DG  128 N1  ? ? ? 1_555 K DC 40  N3 ? ? I DG  128 J DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog329 hydrog ? ? J DG  128 N2  ? ? ? 1_555 K DC 40  O2 ? ? I DG  128 J DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog330 hydrog ? ? J DG  128 O6  ? ? ? 1_555 K DC 40  N4 ? ? I DG  128 J DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog331 hydrog ? ? J DT  129 N3  ? ? ? 1_555 K DA 39  N1 ? ? I DT  129 J DA 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog332 hydrog ? ? J DT  129 O4  ? ? ? 1_555 K DA 39  N6 ? ? I DT  129 J DA 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog333 hydrog ? ? J DC  130 N3  ? ? ? 1_555 K DG 38  N1 ? ? I DC  130 J DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog334 hydrog ? ? J DC  130 N4  ? ? ? 1_555 K DG 38  O6 ? ? I DC  130 J DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog335 hydrog ? ? J DC  130 O2  ? ? ? 1_555 K DG 38  N2 ? ? I DC  130 J DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog336 hydrog ? ? J DA  131 N1  ? ? ? 1_555 K DT 37  N3 ? ? I DA  131 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog337 hydrog ? ? J DA  131 N6  ? ? ? 1_555 K DT 37  O4 ? ? I DA  131 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog338 hydrog ? ? J DG  132 N1  ? ? ? 1_555 K DC 36  N3 ? ? I DG  132 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog339 hydrog ? ? J DG  132 N2  ? ? ? 1_555 K DC 36  O2 ? ? I DG  132 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog340 hydrog ? ? J DG  132 O6  ? ? ? 1_555 K DC 36  N4 ? ? I DG  132 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog341 hydrog ? ? J DA  133 N1  ? ? ? 1_555 K DT 35  N3 ? ? I DA  133 J DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog342 hydrog ? ? J DA  133 N6  ? ? ? 1_555 K DT 35  O4 ? ? I DA  133 J DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog343 hydrog ? ? J DT  134 N3  ? ? ? 1_555 K DA 34  N1 ? ? I DT  134 J DA 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog344 hydrog ? ? J DT  134 O4  ? ? ? 1_555 K DA 34  N6 ? ? I DT  134 J DA 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog345 hydrog ? ? J DA  135 N1  ? ? ? 1_555 K DT 33  N3 ? ? I DA  135 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog346 hydrog ? ? J DA  135 N6  ? ? ? 1_555 K DT 33  O4 ? ? I DA  135 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog347 hydrog ? ? J DT  136 N3  ? ? ? 1_555 K DA 32  N1 ? ? I DT  136 J DA 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog348 hydrog ? ? J DT  136 O4  ? ? ? 1_555 K DA 32  N6 ? ? I DT  136 J DA 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog349 hydrog ? ? J DA  137 N1  ? ? ? 1_555 K DT 31  N3 ? ? I DA  137 J DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog350 hydrog ? ? J DA  137 N6  ? ? ? 1_555 K DT 31  O4 ? ? I DA  137 J DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog351 hydrog ? ? J DT  138 N3  ? ? ? 1_555 K DA 30  N1 ? ? I DT  138 J DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog352 hydrog ? ? J DT  138 O4  ? ? ? 1_555 K DA 30  N6 ? ? I DT  138 J DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog353 hydrog ? ? J DA  139 N1  ? ? ? 1_555 K DT 29  N3 ? ? I DA  139 J DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog354 hydrog ? ? J DA  139 N6  ? ? ? 1_555 K DT 29  O4 ? ? I DA  139 J DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog355 hydrog ? ? J DC  140 N3  ? ? ? 1_555 K DG 28  N1 ? ? I DC  140 J DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog356 hydrog ? ? J DC  140 N4  ? ? ? 1_555 K DG 28  O6 ? ? I DC  140 J DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog357 hydrog ? ? J DC  140 O2  ? ? ? 1_555 K DG 28  N2 ? ? I DC  140 J DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog358 hydrog ? ? J DA  141 N1  ? ? ? 1_555 K DT 27  N3 ? ? I DA  141 J DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog359 hydrog ? ? J DA  141 N6  ? ? ? 1_555 K DT 27  O4 ? ? I DA  141 J DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog360 hydrog ? ? J DT  142 N3  ? ? ? 1_555 K DA 26  N1 ? ? I DT  142 J DA 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog361 hydrog ? ? J DT  142 O4  ? ? ? 1_555 K DA 26  N6 ? ? I DT  142 J DA 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog362 hydrog ? ? J DC  143 N3  ? ? ? 1_555 K DG 25  N1 ? ? I DC  143 J DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog363 hydrog ? ? J DC  143 N4  ? ? ? 1_555 K DG 25  O6 ? ? I DC  143 J DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog364 hydrog ? ? J DC  143 O2  ? ? ? 1_555 K DG 25  N2 ? ? I DC  143 J DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog365 hydrog ? ? J DC  144 N3  ? ? ? 1_555 K DG 24  N1 ? ? I DC  144 J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog366 hydrog ? ? J DC  144 N4  ? ? ? 1_555 K DG 24  O6 ? ? I DC  144 J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog367 hydrog ? ? J DC  144 O2  ? ? ? 1_555 K DG 24  N2 ? ? I DC  144 J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog368 hydrog ? ? J DT  145 N3  ? ? ? 1_555 K DA 23  N1 ? ? I DT  145 J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog369 hydrog ? ? J DT  145 O4  ? ? ? 1_555 K DA 23  N6 ? ? I DT  145 J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog370 hydrog ? ? J DG  146 N1  ? ? ? 1_555 K DC 22  N3 ? ? I DG  146 J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog371 hydrog ? ? J DG  146 N2  ? ? ? 1_555 K DC 22  O2 ? ? I DG  146 J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog372 hydrog ? ? J DG  146 O6  ? ? ? 1_555 K DC 22  N4 ? ? I DG  146 J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog373 hydrog ? ? J DA  147 N1  ? ? ? 1_555 K DT 21  N3 ? ? I DA  147 J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog374 hydrog ? ? J DA  147 N6  ? ? ? 1_555 K DT 21  O4 ? ? I DA  147 J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           152 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            817 
_struct_mon_prot_cis.auth_asym_id           O 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    153 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     818 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    O 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -14.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA2 2 3 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA4 2 3 ? parallel 
AA4 3 4 ? parallel 
AA4 4 5 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
AB2 1 2 ? parallel 
AB3 1 2 ? parallel 
AB4 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 124 ? LEU A 125 ? ILE O 789  LEU O 790  
AA1 2 ILE A 256 ? LEU A 257 ? ILE O 921  LEU O 922  
AA2 1 VAL A 203 ? THR A 207 ? VAL O 868  THR O 872  
AA2 2 TYR A 154 ? VAL A 158 ? TYR O 819  VAL O 823  
AA2 3 ILE A 227 ? ILE A 228 ? ILE O 892  ILE O 893  
AA3 1 TRP A 223 ? HIS A 225 ? TRP O 888  HIS O 890  
AA3 2 ALA A 251 ? TYR A 253 ? ALA O 916  TYR O 918  
AA4 1 TYR A 465 ? ARG A 467 ? TYR O 1130 ARG O 1132 
AA4 2 CYS A 493 ? SER A 497 ? CYS O 1158 SER O 1162 
AA4 3 VAL A 441 ? PHE A 445 ? VAL O 1106 PHE O 1110 
AA4 4 THR A 512 ? ILE A 515 ? THR O 1177 ILE O 1180 
AA4 5 ILE A 543 ? ARG A 545 ? ILE O 1208 ARG O 1210 
AA5 1 ARG B 83  ? PHE B 84  ? ARG A 83   PHE A 84   
AA5 2 THR C 80  ? VAL C 81  ? THR B 80   VAL B 81   
AA6 1 THR B 118 ? ILE B 119 ? THR A 118  ILE A 119  
AA6 2 ARG C 45  ? ILE C 46  ? ARG B 45   ILE B 46   
AA7 1 ARG D 42  ? VAL D 43  ? ARG C 42   VAL C 43   
AA7 2 THR E 85  ? ILE E 86  ? THR D 85   ILE D 86   
AA8 1 ARG D 77  ? ILE D 78  ? ARG C 77   ILE C 78   
AA8 2 GLY E 50  ? ILE E 51  ? GLY D 50   ILE D 51   
AA9 1 VAL D 100 ? THR D 101 ? VAL C 100  THR C 101  
AA9 2 THR G 96  ? LEU G 97  ? THR F 96   LEU F 97   
AB1 1 ARG F 83  ? PHE F 84  ? ARG E 83   PHE E 84   
AB1 2 THR G 80  ? VAL G 81  ? THR F 80   VAL F 81   
AB2 1 THR F 118 ? ILE F 119 ? THR E 118  ILE E 119  
AB2 2 ARG G 45  ? ILE G 46  ? ARG F 45   ILE F 46   
AB3 1 ARG H 42  ? VAL H 43  ? ARG G 42   VAL G 43   
AB3 2 THR I 85  ? ILE I 86  ? THR H 85   ILE H 86   
AB4 1 ARG H 77  ? ILE H 78  ? ARG G 77   ILE G 78   
AB4 2 GLY I 50  ? ILE I 51  ? GLY H 50   ILE H 51   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 125 ? N LEU O 790  O ILE A 256 ? O ILE O 921  
AA2 1 2 O VAL A 204 ? O VAL O 869  N VAL A 156 ? N VAL O 821  
AA2 2 3 N LEU A 155 ? N LEU O 820  O ILE A 227 ? O ILE O 892  
AA3 1 2 N VAL A 224 ? N VAL O 889  O TYR A 253 ? O TYR O 918  
AA4 1 2 N LEU A 466 ? N LEU O 1131 O ILE A 495 ? O ILE O 1160 
AA4 2 3 O LEU A 496 ? O LEU O 1161 N ILE A 443 ? N ILE O 1108 
AA4 3 4 N LEU A 442 ? N LEU O 1107 O ILE A 514 ? O ILE O 1179 
AA4 4 5 N VAL A 513 ? N VAL O 1178 O LEU A 544 ? O LEU O 1209 
AA5 1 2 N ARG B 83  ? N ARG A 83   O VAL C 81  ? O VAL B 81   
AA6 1 2 O ILE B 119 ? O ILE A 119  N ARG C 45  ? N ARG B 45   
AA7 1 2 N ARG D 42  ? N ARG C 42   O ILE E 86  ? O ILE D 86   
AA8 1 2 N ILE D 78  ? N ILE C 78   O GLY E 50  ? O GLY D 50   
AA9 1 2 N THR D 101 ? N THR C 101  O THR G 96  ? O THR F 96   
AB1 1 2 N ARG F 83  ? N ARG E 83   O VAL G 81  ? O VAL F 81   
AB2 1 2 O ILE F 119 ? O ILE E 119  N ARG G 45  ? N ARG F 45   
AB3 1 2 N ARG H 42  ? N ARG G 42   O ILE I 86  ? O ILE H 86   
AB4 1 2 N ILE H 78  ? N ILE G 78   O GLY I 50  ? O GLY H 50   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software O MG  1501 ? 2  'binding site for residue MG O 1501'  
AC2 Software O ADP 1502 ? 12 'binding site for residue ADP O 1502' 
AC3 Software O BEF 1503 ? 5  'binding site for residue BEF O 1503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  ASP A 229 ? ASP O 894  . ? 1_555 ? 
2  AC1 2  LEU A 503 ? LEU O 1168 . ? 1_555 ? 
3  AC2 12 THR A 101 ? THR O 766  . ? 1_555 ? 
4  AC2 12 TYR A 105 ? TYR O 770  . ? 1_555 ? 
5  AC2 12 LEU A 131 ? LEU O 796  . ? 1_555 ? 
6  AC2 12 GLY A 132 ? GLY O 797  . ? 1_555 ? 
7  AC2 12 LYS A 133 ? LYS O 798  . ? 1_555 ? 
8  AC2 12 THR A 134 ? THR O 799  . ? 1_555 ? 
9  AC2 12 ILE A 135 ? ILE O 800  . ? 1_555 ? 
10 AC2 12 LEU A 503 ? LEU O 1168 . ? 1_555 ? 
11 AC2 12 ASN A 506 ? ASN O 1171 . ? 1_555 ? 
12 AC2 12 GLN A 508 ? GLN O 1173 . ? 1_555 ? 
13 AC2 12 ILE A 535 ? ILE O 1200 . ? 1_555 ? 
14 AC2 12 BEF N .   ? BEF O 1503 . ? 1_555 ? 
15 AC3 5  GLY A 130 ? GLY O 795  . ? 1_555 ? 
16 AC3 5  LEU A 503 ? LEU O 1168 . ? 1_555 ? 
17 AC3 5  ASN A 506 ? ASN O 1171 . ? 1_555 ? 
18 AC3 5  ARG A 534 ? ARG O 1199 . ? 1_555 ? 
19 AC3 5  ADP M .   ? ADP O 1502 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5Z3U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BE 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LEU A 1  5   ? 151.794 92.253  152.807 1.00 170.70 ? 670  LEU O N     1 
ATOM   2     C  CA    . LEU A 1  5   ? 150.513 92.135  152.121 1.00 170.70 ? 670  LEU O CA    1 
ATOM   3     C  C     . LEU A 1  5   ? 150.685 92.500  150.651 1.00 170.70 ? 670  LEU O C     1 
ATOM   4     O  O     . LEU A 1  5   ? 151.056 91.659  149.830 1.00 170.70 ? 670  LEU O O     1 
ATOM   5     C  CB    . LEU A 1  5   ? 149.456 93.029  152.778 1.00 162.63 ? 670  LEU O CB    1 
ATOM   6     C  CG    . LEU A 1  5   ? 148.702 92.503  154.005 1.00 162.63 ? 670  LEU O CG    1 
ATOM   7     C  CD1   . LEU A 1  5   ? 149.597 92.357  155.227 1.00 162.63 ? 670  LEU O CD1   1 
ATOM   8     C  CD2   . LEU A 1  5   ? 147.512 93.393  154.316 1.00 162.63 ? 670  LEU O CD2   1 
ATOM   9     N  N     . LEU A 1  6   ? 150.422 93.764  150.329 1.00 181.21 ? 671  LEU O N     1 
ATOM   10    C  CA    . LEU A 1  6   ? 150.726 94.325  149.021 1.00 181.21 ? 671  LEU O CA    1 
ATOM   11    C  C     . LEU A 1  6   ? 152.129 94.907  148.962 1.00 181.21 ? 671  LEU O C     1 
ATOM   12    O  O     . LEU A 1  6   ? 152.467 95.575  147.981 1.00 181.21 ? 671  LEU O O     1 
ATOM   13    C  CB    . LEU A 1  6   ? 149.699 95.389  148.629 1.00 151.88 ? 671  LEU O CB    1 
ATOM   14    C  CG    . LEU A 1  6   ? 148.279 94.877  148.411 1.00 151.88 ? 671  LEU O CG    1 
ATOM   15    C  CD1   . LEU A 1  6   ? 147.351 96.031  148.083 1.00 151.88 ? 671  LEU O CD1   1 
ATOM   16    C  CD2   . LEU A 1  6   ? 148.281 93.845  147.303 1.00 151.88 ? 671  LEU O CD2   1 
ATOM   17    N  N     . ASP A 1  7   ? 152.946 94.665  149.994 1.00 195.95 ? 672  ASP O N     1 
ATOM   18    C  CA    . ASP A 1  7   ? 154.250 95.306  150.141 1.00 195.95 ? 672  ASP O CA    1 
ATOM   19    C  C     . ASP A 1  7   ? 155.117 95.191  148.893 1.00 195.95 ? 672  ASP O C     1 
ATOM   20    O  O     . ASP A 1  7   ? 156.050 95.989  148.726 1.00 195.95 ? 672  ASP O O     1 
ATOM   21    C  CB    . ASP A 1  7   ? 154.984 94.714  151.348 1.00 186.25 ? 672  ASP O CB    1 
ATOM   22    C  CG    . ASP A 1  7   ? 154.351 95.118  152.668 1.00 186.25 ? 672  ASP O CG    1 
ATOM   23    O  OD1   . ASP A 1  7   ? 153.545 96.074  152.666 1.00 186.25 ? 672  ASP O OD1   1 
ATOM   24    O  OD2   . ASP A 1  7   ? 154.660 94.490  153.705 1.00 186.25 ? 672  ASP O OD2   1 
ATOM   25    N  N     . GLN A 1  8   ? 154.838 94.223  148.012 1.00 197.03 ? 673  GLN O N     1 
ATOM   26    C  CA    . GLN A 1  8   ? 155.436 94.260  146.683 1.00 197.03 ? 673  GLN O CA    1 
ATOM   27    C  C     . GLN A 1  8   ? 155.174 95.589  145.995 1.00 197.03 ? 673  GLN O C     1 
ATOM   28    O  O     . GLN A 1  8   ? 155.923 95.968  145.090 1.00 197.03 ? 673  GLN O O     1 
ATOM   29    C  CB    . GLN A 1  8   ? 154.911 93.116  145.811 1.00 173.94 ? 673  GLN O CB    1 
ATOM   30    C  CG    . GLN A 1  8   ? 155.366 91.738  146.254 1.00 173.94 ? 673  GLN O CG    1 
ATOM   31    C  CD    . GLN A 1  8   ? 154.838 90.627  145.365 1.00 173.94 ? 673  GLN O CD    1 
ATOM   32    O  OE1   . GLN A 1  8   ? 153.813 90.777  144.702 1.00 173.94 ? 673  GLN O OE1   1 
ATOM   33    N  NE2   . GLN A 1  8   ? 155.543 89.501  145.348 1.00 173.94 ? 673  GLN O NE2   1 
ATOM   34    N  N     . THR A 1  9   ? 154.124 96.305  146.402 1.00 197.57 ? 674  THR O N     1 
ATOM   35    C  CA    . THR A 1  9   ? 153.964 97.685  145.963 1.00 197.57 ? 674  THR O CA    1 
ATOM   36    C  C     . THR A 1  9   ? 155.066 98.569  146.537 1.00 197.57 ? 674  THR O C     1 
ATOM   37    O  O     . THR A 1  9   ? 155.633 99.407  145.826 1.00 197.57 ? 674  THR O O     1 
ATOM   38    C  CB    . THR A 1  9   ? 152.583 98.207  146.358 1.00 176.65 ? 674  THR O CB    1 
ATOM   39    O  OG1   . THR A 1  9   ? 151.574 97.385  145.756 1.00 176.65 ? 674  THR O OG1   1 
ATOM   40    C  CG2   . THR A 1  9   ? 152.400 99.639  145.891 1.00 176.65 ? 674  THR O CG2   1 
ATOM   41    N  N     . LYS A 1  10  ? 155.431 98.353  147.802 1.00 203.88 ? 675  LYS O N     1 
ATOM   42    C  CA    . LYS A 1  10  ? 156.450 99.193  148.421 1.00 203.88 ? 675  LYS O CA    1 
ATOM   43    C  C     . LYS A 1  10  ? 157.823 98.909  147.828 1.00 203.88 ? 675  LYS O C     1 
ATOM   44    O  O     . LYS A 1  10  ? 158.422 99.777  147.186 1.00 203.88 ? 675  LYS O O     1 
ATOM   45    C  CB    . LYS A 1  10  ? 156.475 98.988  149.936 1.00 185.66 ? 675  LYS O CB    1 
ATOM   46    C  CG    . LYS A 1  10  ? 157.571 99.797  150.625 1.00 185.66 ? 675  LYS O CG    1 
ATOM   47    C  CD    . LYS A 1  10  ? 157.545 99.633  152.135 1.00 185.66 ? 675  LYS O CD    1 
ATOM   48    C  CE    . LYS A 1  10  ? 158.142 98.305  152.566 1.00 185.66 ? 675  LYS O CE    1 
ATOM   49    N  NZ    . LYS A 1  10  ? 158.152 98.154  154.049 1.00 185.66 ? 675  LYS O NZ    1 
ATOM   50    N  N     . ASP A 1  11  ? 158.342 97.696  148.031 1.00 210.19 ? 676  ASP O N     1 
ATOM   51    C  CA    . ASP A 1  11  ? 159.667 97.370  147.505 1.00 210.19 ? 676  ASP O CA    1 
ATOM   52    C  C     . ASP A 1  11  ? 159.662 97.296  145.981 1.00 210.19 ? 676  ASP O C     1 
ATOM   53    O  O     . ASP A 1  11  ? 160.472 97.954  145.311 1.00 210.19 ? 676  ASP O O     1 
ATOM   54    C  CB    . ASP A 1  11  ? 160.165 96.058  148.108 1.00 203.65 ? 676  ASP O CB    1 
ATOM   55    C  CG    . ASP A 1  11  ? 160.585 96.209  149.553 1.00 203.65 ? 676  ASP O CG    1 
ATOM   56    O  OD1   . ASP A 1  11  ? 160.767 97.360  149.998 1.00 203.65 ? 676  ASP O OD1   1 
ATOM   57    O  OD2   . ASP A 1  11  ? 160.748 95.180  150.239 1.00 203.65 ? 676  ASP O OD2   1 
ATOM   58    N  N     . THR A 1  12  ? 158.746 96.505  145.416 1.00 215.01 ? 677  THR O N     1 
ATOM   59    C  CA    . THR A 1  12  ? 158.733 96.315  143.971 1.00 215.01 ? 677  THR O CA    1 
ATOM   60    C  C     . THR A 1  12  ? 158.453 97.627  143.250 1.00 215.01 ? 677  THR O C     1 
ATOM   61    O  O     . THR A 1  12  ? 158.987 97.868  142.161 1.00 215.01 ? 677  THR O O     1 
ATOM   62    C  CB    . THR A 1  12  ? 157.693 95.264  143.577 1.00 200.38 ? 677  THR O CB    1 
ATOM   63    O  OG1   . THR A 1  12  ? 157.897 94.075  144.346 1.00 200.38 ? 677  THR O OG1   1 
ATOM   64    C  CG2   . THR A 1  12  ? 157.846 94.905  142.107 1.00 200.38 ? 677  THR O CG2   1 
ATOM   65    N  N     . ARG A 1  13  ? 157.616 98.490  143.834 1.00 212.50 ? 678  ARG O N     1 
ATOM   66    C  CA    . ARG A 1  13  ? 157.288 99.734  143.157 1.00 212.50 ? 678  ARG O CA    1 
ATOM   67    C  C     . ARG A 1  13  ? 158.210 100.888 143.534 1.00 212.50 ? 678  ARG O C     1 
ATOM   68    O  O     . ARG A 1  13  ? 158.128 101.943 142.903 1.00 212.50 ? 678  ARG O O     1 
ATOM   69    C  CB    . ARG A 1  13  ? 155.826 100.121 143.407 1.00 188.21 ? 678  ARG O CB    1 
ATOM   70    C  CG    . ARG A 1  13  ? 154.819 99.070  142.940 1.00 188.21 ? 678  ARG O CG    1 
ATOM   71    C  CD    . ARG A 1  13  ? 154.714 98.916  141.437 1.00 188.21 ? 678  ARG O CD    1 
ATOM   72    N  NE    . ARG A 1  13  ? 153.720 97.896  141.110 1.00 188.21 ? 678  ARG O NE    1 
ATOM   73    C  CZ    . ARG A 1  13  ? 154.002 96.610  140.920 1.00 188.21 ? 678  ARG O CZ    1 
ATOM   74    N  NH1   . ARG A 1  13  ? 155.252 96.190  141.003 1.00 188.21 ? 678  ARG O NH1   1 
ATOM   75    N  NH2   . ARG A 1  13  ? 153.038 95.745  140.637 1.00 188.21 ? 678  ARG O NH2   1 
ATOM   76    N  N     . ILE A 1  14  ? 159.078 100.725 144.532 1.00 214.72 ? 679  ILE O N     1 
ATOM   77    C  CA    . ILE A 1  14  ? 160.195 101.654 144.681 1.00 214.72 ? 679  ILE O CA    1 
ATOM   78    C  C     . ILE A 1  14  ? 161.302 101.332 143.685 1.00 214.72 ? 679  ILE O C     1 
ATOM   79    O  O     . ILE A 1  14  ? 161.808 102.222 142.988 1.00 214.72 ? 679  ILE O O     1 
ATOM   80    C  CB    . ILE A 1  14  ? 160.720 101.666 146.129 1.00 188.67 ? 679  ILE O CB    1 
ATOM   81    C  CG1   . ILE A 1  14  ? 159.804 102.501 147.026 1.00 188.67 ? 679  ILE O CG1   1 
ATOM   82    C  CG2   . ILE A 1  14  ? 162.144 102.178 146.188 1.00 188.67 ? 679  ILE O CG2   1 
ATOM   83    C  CD1   . ILE A 1  14  ? 160.186 102.454 148.495 1.00 188.67 ? 679  ILE O CD1   1 
ATOM   84    N  N     . THR A 1  15  ? 161.702 100.058 143.594 1.00 215.94 ? 680  THR O N     1 
ATOM   85    C  CA    . THR A 1  15  ? 162.609 99.685  142.510 1.00 215.94 ? 680  THR O CA    1 
ATOM   86    C  C     . THR A 1  15  ? 161.982 100.007 141.163 1.00 215.94 ? 680  THR O C     1 
ATOM   87    O  O     . THR A 1  15  ? 162.689 100.317 140.196 1.00 215.94 ? 680  THR O O     1 
ATOM   88    C  CB    . THR A 1  15  ? 162.976 98.203  142.591 1.00 207.73 ? 680  THR O CB    1 
ATOM   89    O  OG1   . THR A 1  15  ? 161.779 97.417  142.598 1.00 207.73 ? 680  THR O OG1   1 
ATOM   90    C  CG2   . THR A 1  15  ? 163.792 97.913  143.844 1.00 207.73 ? 680  THR O CG2   1 
ATOM   91    N  N     . HIS A 1  16  ? 160.652 99.966  141.098 1.00 220.90 ? 681  HIS O N     1 
ATOM   92    C  CA    . HIS A 1  16  ? 159.936 100.414 139.919 1.00 220.90 ? 681  HIS O CA    1 
ATOM   93    C  C     . HIS A 1  16  ? 159.897 101.930 139.824 1.00 220.90 ? 681  HIS O C     1 
ATOM   94    O  O     . HIS A 1  16  ? 159.690 102.449 138.726 1.00 220.90 ? 681  HIS O O     1 
ATOM   95    C  CB    . HIS A 1  16  ? 158.518 99.840  139.911 1.00 202.63 ? 681  HIS O CB    1 
ATOM   96    C  CG    . HIS A 1  16  ? 157.783 100.035 138.622 1.00 202.63 ? 681  HIS O CG    1 
ATOM   97    N  ND1   . HIS A 1  16  ? 156.411 99.954  138.534 1.00 202.63 ? 681  HIS O ND1   1 
ATOM   98    C  CD2   . HIS A 1  16  ? 158.228 100.264 137.364 1.00 202.63 ? 681  HIS O CD2   1 
ATOM   99    C  CE1   . HIS A 1  16  ? 156.041 100.145 137.280 1.00 202.63 ? 681  HIS O CE1   1 
ATOM   100   N  NE2   . HIS A 1  16  ? 157.125 100.337 136.551 1.00 202.63 ? 681  HIS O NE2   1 
ATOM   101   N  N     . LEU A 1  17  ? 160.100 102.651 140.936 1.00 222.48 ? 682  LEU O N     1 
ATOM   102   C  CA    . LEU A 1  17  ? 160.386 104.082 140.846 1.00 222.48 ? 682  LEU O CA    1 
ATOM   103   C  C     . LEU A 1  17  ? 161.697 104.309 140.115 1.00 222.48 ? 682  LEU O C     1 
ATOM   104   O  O     . LEU A 1  17  ? 161.783 105.146 139.203 1.00 222.48 ? 682  LEU O O     1 
ATOM   105   C  CB    . LEU A 1  17  ? 160.428 104.717 142.240 1.00 205.67 ? 682  LEU O CB    1 
ATOM   106   C  CG    . LEU A 1  17  ? 159.130 104.830 143.039 1.00 205.67 ? 682  LEU O CG    1 
ATOM   107   C  CD1   . LEU A 1  17  ? 159.434 105.206 144.473 1.00 205.67 ? 682  LEU O CD1   1 
ATOM   108   C  CD2   . LEU A 1  17  ? 158.210 105.858 142.403 1.00 205.67 ? 682  LEU O CD2   1 
ATOM   109   N  N     . LEU A 1  18  ? 162.734 103.556 140.496 1.00 221.11 ? 683  LEU O N     1 
ATOM   110   C  CA    . LEU A 1  18  ? 163.942 103.532 139.682 1.00 221.11 ? 683  LEU O CA    1 
ATOM   111   C  C     . LEU A 1  18  ? 163.609 103.198 138.232 1.00 221.11 ? 683  LEU O C     1 
ATOM   112   O  O     . LEU A 1  18  ? 164.171 103.800 137.307 1.00 221.11 ? 683  LEU O O     1 
ATOM   113   C  CB    . LEU A 1  18  ? 164.951 102.523 140.239 1.00 212.29 ? 683  LEU O CB    1 
ATOM   114   C  CG    . LEU A 1  18  ? 165.561 102.717 141.630 1.00 212.29 ? 683  LEU O CG    1 
ATOM   115   C  CD1   . LEU A 1  18  ? 166.414 101.510 141.971 1.00 212.29 ? 683  LEU O CD1   1 
ATOM   116   C  CD2   . LEU A 1  18  ? 166.380 103.990 141.725 1.00 212.29 ? 683  LEU O CD2   1 
ATOM   117   N  N     . ARG A 1  19  ? 162.677 102.259 138.014 1.00 212.84 ? 684  ARG O N     1 
ATOM   118   C  CA    . ARG A 1  19  ? 162.339 101.853 136.649 1.00 212.84 ? 684  ARG O CA    1 
ATOM   119   C  C     . ARG A 1  19  ? 161.780 103.021 135.840 1.00 212.84 ? 684  ARG O C     1 
ATOM   120   O  O     . ARG A 1  19  ? 162.315 103.350 134.776 1.00 212.84 ? 684  ARG O O     1 
ATOM   121   C  CB    . ARG A 1  19  ? 161.357 100.679 136.645 1.00 196.06 ? 684  ARG O CB    1 
ATOM   122   C  CG    . ARG A 1  19  ? 161.883 99.378  137.247 1.00 196.06 ? 684  ARG O CG    1 
ATOM   123   C  CD    . ARG A 1  19  ? 163.032 98.752  136.459 1.00 196.06 ? 684  ARG O CD    1 
ATOM   124   N  NE    . ARG A 1  19  ? 163.420 97.475  137.058 1.00 196.06 ? 684  ARG O NE    1 
ATOM   125   C  CZ    . ARG A 1  19  ? 164.494 96.769  136.720 1.00 196.06 ? 684  ARG O CZ    1 
ATOM   126   N  NH1   . ARG A 1  19  ? 165.311 97.203  135.772 1.00 196.06 ? 684  ARG O NH1   1 
ATOM   127   N  NH2   . ARG A 1  19  ? 164.747 95.620  137.333 1.00 196.06 ? 684  ARG O NH2   1 
ATOM   128   N  N     . GLN A 1  20  ? 160.707 103.666 136.317 1.00 206.42 ? 685  GLN O N     1 
ATOM   129   C  CA    . GLN A 1  20  ? 160.166 104.798 135.565 1.00 206.42 ? 685  GLN O CA    1 
ATOM   130   C  C     . GLN A 1  20  ? 161.232 105.866 135.376 1.00 206.42 ? 685  GLN O C     1 
ATOM   131   O  O     . GLN A 1  20  ? 161.587 106.221 134.244 1.00 206.42 ? 685  GLN O O     1 
ATOM   132   C  CB    . GLN A 1  20  ? 158.939 105.427 136.247 1.00 215.60 ? 685  GLN O CB    1 
ATOM   133   C  CG    . GLN A 1  20  ? 157.711 104.565 136.450 1.00 215.60 ? 685  GLN O CG    1 
ATOM   134   C  CD    . GLN A 1  20  ? 157.525 104.171 137.893 1.00 215.60 ? 685  GLN O CD    1 
ATOM   135   O  OE1   . GLN A 1  20  ? 158.220 104.672 138.769 1.00 215.60 ? 685  GLN O OE1   1 
ATOM   136   N  NE2   . GLN A 1  20  ? 156.599 103.256 138.147 1.00 215.60 ? 685  GLN O NE2   1 
ATOM   137   N  N     . THR A 1  21  ? 161.783 106.358 136.489 1.00 206.30 ? 686  THR O N     1 
ATOM   138   C  CA    . THR A 1  21  ? 162.714 107.477 136.464 1.00 206.30 ? 686  THR O CA    1 
ATOM   139   C  C     . THR A 1  21  ? 163.861 107.245 135.489 1.00 206.30 ? 686  THR O C     1 
ATOM   140   O  O     . THR A 1  21  ? 163.971 107.958 134.486 1.00 206.30 ? 686  THR O O     1 
ATOM   141   C  CB    . THR A 1  21  ? 163.262 107.750 137.869 1.00 195.40 ? 686  THR O CB    1 
ATOM   142   O  OG1   . THR A 1  21  ? 163.826 106.549 138.413 1.00 195.40 ? 686  THR O OG1   1 
ATOM   143   C  CG2   . THR A 1  21  ? 162.166 108.261 138.785 1.00 195.40 ? 686  THR O CG2   1 
ATOM   144   N  N     . ASN A 1  22  ? 164.709 106.249 135.767 1.00 201.27 ? 687  ASN O N     1 
ATOM   145   C  CA    . ASN A 1  22  ? 165.913 106.038 134.965 1.00 201.27 ? 687  ASN O CA    1 
ATOM   146   C  C     . ASN A 1  22  ? 165.605 105.325 133.650 1.00 201.27 ? 687  ASN O C     1 
ATOM   147   O  O     . ASN A 1  22  ? 166.025 105.773 132.577 1.00 201.27 ? 687  ASN O O     1 
ATOM   148   C  CB    . ASN A 1  22  ? 166.939 105.242 135.778 1.00 177.71 ? 687  ASN O CB    1 
ATOM   149   C  CG    . ASN A 1  22  ? 167.502 106.035 136.940 1.00 177.71 ? 687  ASN O CG    1 
ATOM   150   O  OD1   . ASN A 1  22  ? 167.550 107.262 136.895 1.00 177.71 ? 687  ASN O OD1   1 
ATOM   151   N  ND2   . ASN A 1  22  ? 167.910 105.340 137.998 1.00 177.71 ? 687  ASN O ND2   1 
ATOM   152   N  N     . ALA A 1  23  ? 164.866 104.217 133.718 1.00 200.99 ? 688  ALA O N     1 
ATOM   153   C  CA    . ALA A 1  23  ? 164.660 103.368 132.549 1.00 200.99 ? 688  ALA O CA    1 
ATOM   154   C  C     . ALA A 1  23  ? 163.573 103.902 131.619 1.00 200.99 ? 688  ALA O C     1 
ATOM   155   O  O     . ALA A 1  23  ? 163.765 103.953 130.398 1.00 200.99 ? 688  ALA O O     1 
ATOM   156   C  CB    . ALA A 1  23  ? 164.324 101.945 132.999 1.00 179.28 ? 688  ALA O CB    1 
ATOM   157   N  N     . PHE A 1  24  ? 162.420 104.294 132.168 1.00 190.23 ? 689  PHE O N     1 
ATOM   158   C  CA    . PHE A 1  24  ? 161.250 104.554 131.328 1.00 190.23 ? 689  PHE O CA    1 
ATOM   159   C  C     . PHE A 1  24  ? 161.148 106.010 130.879 1.00 190.23 ? 689  PHE O C     1 
ATOM   160   O  O     . PHE A 1  24  ? 161.100 106.281 129.674 1.00 190.23 ? 689  PHE O O     1 
ATOM   161   C  CB    . PHE A 1  24  ? 159.964 104.108 132.038 1.00 201.41 ? 689  PHE O CB    1 
ATOM   162   C  CG    . PHE A 1  24  ? 159.814 102.614 132.120 1.00 201.41 ? 689  PHE O CG    1 
ATOM   163   C  CD1   . PHE A 1  24  ? 159.362 101.895 131.020 1.00 201.41 ? 689  PHE O CD1   1 
ATOM   164   C  CD2   . PHE A 1  24  ? 160.116 101.930 133.285 1.00 201.41 ? 689  PHE O CD2   1 
ATOM   165   C  CE1   . PHE A 1  24  ? 159.222 100.523 131.076 1.00 201.41 ? 689  PHE O CE1   1 
ATOM   166   C  CE2   . PHE A 1  24  ? 159.982 100.559 133.352 1.00 201.41 ? 689  PHE O CE2   1 
ATOM   167   C  CZ    . PHE A 1  24  ? 159.531 99.852  132.243 1.00 201.41 ? 689  PHE O CZ    1 
ATOM   168   N  N     . LEU A 1  25  ? 161.056 106.938 131.832 1.00 165.45 ? 690  LEU O N     1 
ATOM   169   C  CA    . LEU A 1  25  ? 160.845 108.367 131.574 1.00 165.45 ? 690  LEU O CA    1 
ATOM   170   C  C     . LEU A 1  25  ? 159.400 108.597 131.153 1.00 165.45 ? 690  LEU O C     1 
ATOM   171   O  O     . LEU A 1  25  ? 158.862 107.870 130.317 1.00 165.45 ? 690  LEU O O     1 
ATOM   172   C  CB    . LEU A 1  25  ? 161.795 108.915 130.498 1.00 139.25 ? 690  LEU O CB    1 
ATOM   173   C  CG    . LEU A 1  25  ? 163.306 108.866 130.721 1.00 139.25 ? 690  LEU O CG    1 
ATOM   174   C  CD1   . LEU A 1  25  ? 164.028 109.294 129.460 1.00 139.25 ? 690  LEU O CD1   1 
ATOM   175   C  CD2   . LEU A 1  25  ? 163.721 109.745 131.874 1.00 139.25 ? 690  LEU O CD2   1 
ATOM   176   N  N     . ASP A 1  78  ? 159.671 105.536 153.766 1.00 187.80 ? 743  ASP O N     1 
ATOM   177   C  CA    . ASP A 1  78  ? 160.103 106.916 153.575 1.00 188.70 ? 743  ASP O CA    1 
ATOM   178   C  C     . ASP A 1  78  ? 160.309 107.203 152.088 1.00 185.40 ? 743  ASP O C     1 
ATOM   179   O  O     . ASP A 1  78  ? 161.417 107.082 151.565 1.00 187.32 ? 743  ASP O O     1 
ATOM   180   C  CB    . ASP A 1  78  ? 161.386 107.189 154.366 1.00 177.95 ? 743  ASP O CB    1 
ATOM   181   C  CG    . ASP A 1  78  ? 161.786 108.653 154.350 1.00 181.46 ? 743  ASP O CG    1 
ATOM   182   O  OD1   . ASP A 1  78  ? 161.038 109.474 153.779 1.00 181.86 ? 743  ASP O OD1   1 
ATOM   183   O  OD2   . ASP A 1  78  ? 162.848 108.985 154.918 1.00 187.24 ? 743  ASP O OD2   1 
ATOM   184   N  N     . TYR A 1  79  ? 159.224 107.583 151.414 1.00 190.22 ? 744  TYR O N     1 
ATOM   185   C  CA    . TYR A 1  79  ? 159.261 107.867 149.986 1.00 179.08 ? 744  TYR O CA    1 
ATOM   186   C  C     . TYR A 1  79  ? 159.730 109.278 149.676 1.00 176.10 ? 744  TYR O C     1 
ATOM   187   O  O     . TYR A 1  79  ? 159.881 109.618 148.498 1.00 179.12 ? 744  TYR O O     1 
ATOM   188   C  CB    . TYR A 1  79  ? 157.878 107.654 149.376 1.00 187.26 ? 744  TYR O CB    1 
ATOM   189   C  CG    . TYR A 1  79  ? 157.377 106.238 149.484 1.00 191.66 ? 744  TYR O CG    1 
ATOM   190   C  CD1   . TYR A 1  79  ? 157.646 105.308 148.492 1.00 187.59 ? 744  TYR O CD1   1 
ATOM   191   C  CD2   . TYR A 1  79  ? 156.642 105.827 150.587 1.00 193.65 ? 744  TYR O CD2   1 
ATOM   192   C  CE1   . TYR A 1  79  ? 157.183 104.017 148.589 1.00 185.46 ? 744  TYR O CE1   1 
ATOM   193   C  CE2   . TYR A 1  79  ? 156.184 104.537 150.694 1.00 194.94 ? 744  TYR O CE2   1 
ATOM   194   C  CZ    . TYR A 1  79  ? 156.459 103.635 149.694 1.00 189.88 ? 744  TYR O CZ    1 
ATOM   195   O  OH    . TYR A 1  79  ? 155.997 102.347 149.797 1.00 185.97 ? 744  TYR O OH    1 
ATOM   196   N  N     . TYR A 1  80  ? 159.965 110.097 150.702 1.00 186.34 ? 745  TYR O N     1 
ATOM   197   C  CA    . TYR A 1  80  ? 160.430 111.466 150.516 1.00 191.14 ? 745  TYR O CA    1 
ATOM   198   C  C     . TYR A 1  80  ? 161.787 111.531 149.826 1.00 184.66 ? 745  TYR O C     1 
ATOM   199   O  O     . TYR A 1  80  ? 162.201 112.616 149.402 1.00 186.88 ? 745  TYR O O     1 
ATOM   200   C  CB    . TYR A 1  80  ? 160.468 112.166 151.882 1.00 180.94 ? 745  TYR O CB    1 
ATOM   201   C  CG    . TYR A 1  80  ? 161.039 113.564 151.877 1.00 184.77 ? 745  TYR O CG    1 
ATOM   202   C  CD1   . TYR A 1  80  ? 160.305 114.635 151.387 1.00 188.74 ? 745  TYR O CD1   1 
ATOM   203   C  CD2   . TYR A 1  80  ? 162.308 113.815 152.380 1.00 193.56 ? 745  TYR O CD2   1 
ATOM   204   C  CE1   . TYR A 1  80  ? 160.825 115.915 151.384 1.00 195.17 ? 745  TYR O CE1   1 
ATOM   205   C  CE2   . TYR A 1  80  ? 162.836 115.089 152.384 1.00 198.50 ? 745  TYR O CE2   1 
ATOM   206   C  CZ    . TYR A 1  80  ? 162.092 116.135 151.886 1.00 202.36 ? 745  TYR O CZ    1 
ATOM   207   O  OH    . TYR A 1  80  ? 162.618 117.405 151.890 1.00 208.68 ? 745  TYR O OH    1 
ATOM   208   N  N     . ASN A 1  81  ? 162.476 110.398 149.685 1.00 175.85 ? 746  ASN O N     1 
ATOM   209   C  CA    . ASN A 1  81  ? 163.797 110.353 149.067 1.00 180.86 ? 746  ASN O CA    1 
ATOM   210   C  C     . ASN A 1  81  ? 163.765 109.625 147.728 1.00 179.78 ? 746  ASN O C     1 
ATOM   211   O  O     . ASN A 1  81  ? 163.910 110.262 146.687 1.00 188.23 ? 746  ASN O O     1 
ATOM   212   C  CB    . ASN A 1  81  ? 164.803 109.705 150.024 1.00 176.20 ? 746  ASN O CB    1 
ATOM   213   C  CG    . ASN A 1  81  ? 165.140 110.591 151.209 1.00 176.20 ? 746  ASN O CG    1 
ATOM   214   O  OD1   . ASN A 1  81  ? 165.009 111.813 151.144 1.00 176.20 ? 746  ASN O OD1   1 
ATOM   215   N  ND2   . ASN A 1  81  ? 165.578 109.976 152.301 1.00 176.20 ? 746  ASN O ND2   1 
ATOM   216   N  N     . VAL A 1  82  ? 163.553 108.305 147.722 1.00 166.42 ? 747  VAL O N     1 
ATOM   217   C  CA    . VAL A 1  82  ? 163.862 107.491 146.545 1.00 171.86 ? 747  VAL O CA    1 
ATOM   218   C  C     . VAL A 1  82  ? 163.086 107.967 145.319 1.00 170.27 ? 747  VAL O C     1 
ATOM   219   O  O     . VAL A 1  82  ? 163.642 108.077 144.220 1.00 174.81 ? 747  VAL O O     1 
ATOM   220   C  CB    . VAL A 1  82  ? 163.612 106.001 146.838 1.00 158.02 ? 747  VAL O CB    1 
ATOM   221   C  CG1   . VAL A 1  82  ? 162.178 105.760 147.294 1.00 168.69 ? 747  VAL O CG1   1 
ATOM   222   C  CG2   . VAL A 1  82  ? 163.926 105.172 145.605 1.00 161.06 ? 747  VAL O CG2   1 
ATOM   223   N  N     . ALA A 1  83  ? 161.793 108.251 145.480 1.00 177.43 ? 748  ALA O N     1 
ATOM   224   C  CA    . ALA A 1  83  ? 161.029 108.775 144.353 1.00 164.97 ? 748  ALA O CA    1 
ATOM   225   C  C     . ALA A 1  83  ? 161.408 110.216 144.055 1.00 169.05 ? 748  ALA O C     1 
ATOM   226   O  O     . ALA A 1  83  ? 161.351 110.651 142.901 1.00 171.82 ? 748  ALA O O     1 
ATOM   227   C  CB    . ALA A 1  83  ? 159.532 108.676 144.635 1.00 149.60 ? 748  ALA O CB    1 
ATOM   228   N  N     . HIS A 1  84  ? 161.788 110.961 145.085 1.00 176.14 ? 749  HIS O N     1 
ATOM   229   C  CA    . HIS A 1  84  ? 162.156 112.367 145.007 1.00 178.36 ? 749  HIS O CA    1 
ATOM   230   C  C     . HIS A 1  84  ? 163.662 112.565 144.843 1.00 179.83 ? 749  HIS O C     1 
ATOM   231   O  O     . HIS A 1  84  ? 164.145 113.691 145.002 1.00 184.36 ? 749  HIS O O     1 
ATOM   232   C  CB    . HIS A 1  84  ? 161.636 113.105 146.245 1.00 176.14 ? 749  HIS O CB    1 
ATOM   233   C  CG    . HIS A 1  84  ? 160.158 112.951 146.456 1.00 177.67 ? 749  HIS O CG    1 
ATOM   234   N  ND1   . HIS A 1  84  ? 159.221 113.495 145.604 1.00 177.97 ? 749  HIS O ND1   1 
ATOM   235   C  CD2   . HIS A 1  84  ? 159.458 112.310 147.422 1.00 178.40 ? 749  HIS O CD2   1 
ATOM   236   C  CE1   . HIS A 1  84  ? 158.008 113.195 146.036 1.00 173.46 ? 749  HIS O CE1   1 
ATOM   237   N  NE2   . HIS A 1  84  ? 158.124 112.479 147.139 1.00 172.71 ? 749  HIS O NE2   1 
ATOM   238   N  N     . ARG A 1  85  ? 164.399 111.487 144.549 1.00 169.46 ? 750  ARG O N     1 
ATOM   239   C  CA    . ARG A 1  85  ? 165.846 111.409 144.748 1.00 174.52 ? 750  ARG O CA    1 
ATOM   240   C  C     . ARG A 1  85  ? 166.615 112.642 144.295 1.00 175.48 ? 750  ARG O C     1 
ATOM   241   O  O     . ARG A 1  85  ? 167.495 113.129 145.013 1.00 175.96 ? 750  ARG O O     1 
ATOM   242   C  CB    . ARG A 1  85  ? 166.373 110.158 144.038 1.00 149.84 ? 750  ARG O CB    1 
ATOM   243   C  CG    . ARG A 1  85  ? 166.101 110.113 142.541 1.00 172.09 ? 750  ARG O CG    1 
ATOM   244   C  CD    . ARG A 1  85  ? 166.625 108.831 141.928 1.00 193.92 ? 750  ARG O CD    1 
ATOM   245   N  NE    . ARG A 1  85  ? 168.074 108.724 142.060 1.00 207.43 ? 750  ARG O NE    1 
ATOM   246   C  CZ    . ARG A 1  85  ? 168.780 107.665 141.682 1.00 216.11 ? 750  ARG O CZ    1 
ATOM   247   N  NH1   . ARG A 1  85  ? 168.171 106.621 141.142 1.00 223.08 ? 750  ARG O NH1   1 
ATOM   248   N  NH2   . ARG A 1  85  ? 170.095 107.648 141.839 1.00 212.98 ? 750  ARG O NH2   1 
ATOM   249   N  N     . ILE A 1  86  ? 166.302 113.175 143.123 1.00 158.78 ? 751  ILE O N     1 
ATOM   250   C  CA    . ILE A 1  86  ? 166.973 114.387 142.674 1.00 162.82 ? 751  ILE O CA    1 
ATOM   251   C  C     . ILE A 1  86  ? 166.339 115.565 143.399 1.00 170.95 ? 751  ILE O C     1 
ATOM   252   O  O     . ILE A 1  86  ? 165.138 115.820 143.264 1.00 163.69 ? 751  ILE O O     1 
ATOM   253   C  CB    . ILE A 1  86  ? 166.883 114.543 141.152 1.00 134.99 ? 751  ILE O CB    1 
ATOM   254   C  CG1   . ILE A 1  86  ? 167.651 113.410 140.477 1.00 134.36 ? 751  ILE O CG1   1 
ATOM   255   C  CG2   . ILE A 1  86  ? 167.447 115.881 140.727 1.00 131.27 ? 751  ILE O CG2   1 
ATOM   256   C  CD1   . ILE A 1  86  ? 167.435 113.331 138.991 1.00 131.13 ? 751  ILE O CD1   1 
ATOM   257   N  N     . LYS A 1  87  ? 167.148 116.284 144.173 1.00 168.85 ? 752  LYS O N     1 
ATOM   258   C  CA    . LYS A 1  87  ? 166.676 117.290 145.110 1.00 171.35 ? 752  LYS O CA    1 
ATOM   259   C  C     . LYS A 1  87  ? 167.095 118.682 144.661 1.00 169.62 ? 752  LYS O C     1 
ATOM   260   O  O     . LYS A 1  87  ? 168.112 118.851 143.980 1.00 172.50 ? 752  LYS O O     1 
ATOM   261   C  CB    . LYS A 1  87  ? 167.228 117.035 146.516 1.00 154.85 ? 752  LYS O CB    1 
ATOM   262   C  CG    . LYS A 1  87  ? 166.882 115.690 147.126 1.00 163.19 ? 752  LYS O CG    1 
ATOM   263   C  CD    . LYS A 1  87  ? 165.407 115.590 147.453 1.00 165.03 ? 752  LYS O CD    1 
ATOM   264   C  CE    . LYS A 1  87  ? 165.112 114.323 148.235 1.00 173.51 ? 752  LYS O CE    1 
ATOM   265   N  NZ    . LYS A 1  87  ? 165.331 113.095 147.430 1.00 175.36 ? 752  LYS O NZ    1 
ATOM   266   N  N     . GLU A 1  88  ? 166.305 119.677 145.068 1.00 174.48 ? 753  GLU O N     1 
ATOM   267   C  CA    . GLU A 1  88  ? 166.642 121.089 144.916 1.00 178.97 ? 753  GLU O CA    1 
ATOM   268   C  C     . GLU A 1  88  ? 165.524 121.914 145.540 1.00 178.79 ? 753  GLU O C     1 
ATOM   269   O  O     . GLU A 1  88  ? 164.389 121.449 145.677 1.00 175.61 ? 753  GLU O O     1 
ATOM   270   C  CB    . GLU A 1  88  ? 166.825 121.469 143.436 1.00 174.55 ? 753  GLU O CB    1 
ATOM   271   C  CG    . GLU A 1  88  ? 167.309 122.885 143.170 1.00 175.56 ? 753  GLU O CG    1 
ATOM   272   C  CD    . GLU A 1  88  ? 167.518 123.150 141.695 1.00 184.66 ? 753  GLU O CD    1 
ATOM   273   O  OE1   . GLU A 1  88  ? 167.263 122.236 140.883 1.00 184.36 ? 753  GLU O OE1   1 
ATOM   274   O  OE2   . GLU A 1  88  ? 167.937 124.271 141.345 1.00 178.25 ? 753  GLU O OE2   1 
ATOM   275   N  N     . ASP A 1  89  ? 165.863 123.145 145.922 1.00 178.63 ? 754  ASP O N     1 
ATOM   276   C  CA    . ASP A 1  89  ? 164.883 124.153 146.298 1.00 181.16 ? 754  ASP O CA    1 
ATOM   277   C  C     . ASP A 1  89  ? 165.471 125.532 146.034 1.00 183.09 ? 754  ASP O C     1 
ATOM   278   O  O     . ASP A 1  89  ? 166.658 125.762 146.276 1.00 181.62 ? 754  ASP O O     1 
ATOM   279   C  CB    . ASP A 1  89  ? 164.461 124.019 147.767 1.00 184.74 ? 754  ASP O CB    1 
ATOM   280   C  CG    . ASP A 1  89  ? 165.639 124.033 148.719 1.00 184.74 ? 754  ASP O CG    1 
ATOM   281   O  OD1   . ASP A 1  89  ? 166.789 123.922 148.250 1.00 184.74 ? 754  ASP O OD1   1 
ATOM   282   O  OD2   . ASP A 1  89  ? 165.416 124.165 149.941 1.00 184.74 ? 754  ASP O OD2   1 
ATOM   283   N  N     . ILE A 1  90  ? 164.638 126.446 145.545 1.00 180.59 ? 755  ILE O N     1 
ATOM   284   C  CA    . ILE A 1  90  ? 165.049 127.821 145.288 1.00 179.16 ? 755  ILE O CA    1 
ATOM   285   C  C     . ILE A 1  90  ? 163.887 128.737 145.636 1.00 191.68 ? 755  ILE O C     1 
ATOM   286   O  O     . ILE A 1  90  ? 162.752 128.493 145.215 1.00 191.59 ? 755  ILE O O     1 
ATOM   287   C  CB    . ILE A 1  90  ? 165.480 128.037 143.823 1.00 165.14 ? 755  ILE O CB    1 
ATOM   288   C  CG1   . ILE A 1  90  ? 166.718 127.211 143.483 1.00 165.14 ? 755  ILE O CG1   1 
ATOM   289   C  CG2   . ILE A 1  90  ? 165.772 129.498 143.561 1.00 165.14 ? 755  ILE O CG2   1 
ATOM   290   C  CD1   . ILE A 1  90  ? 167.069 127.237 142.023 1.00 165.14 ? 755  ILE O CD1   1 
ATOM   291   N  N     . LYS A 1  91  ? 164.167 129.788 146.402 1.00 202.36 ? 756  LYS O N     1 
ATOM   292   C  CA    . LYS A 1  91  ? 163.180 130.820 146.690 1.00 203.87 ? 756  LYS O CA    1 
ATOM   293   C  C     . LYS A 1  91  ? 163.214 131.957 145.679 1.00 203.10 ? 756  LYS O C     1 
ATOM   294   O  O     . LYS A 1  91  ? 162.334 132.825 145.715 1.00 209.38 ? 756  LYS O O     1 
ATOM   295   C  CB    . LYS A 1  91  ? 163.404 131.389 148.095 1.00 209.85 ? 756  LYS O CB    1 
ATOM   296   C  CG    . LYS A 1  91  ? 163.211 130.384 149.215 1.00 209.85 ? 756  LYS O CG    1 
ATOM   297   C  CD    . LYS A 1  91  ? 163.615 130.988 150.548 1.00 209.85 ? 756  LYS O CD    1 
ATOM   298   C  CE    . LYS A 1  91  ? 163.457 129.996 151.687 1.00 209.85 ? 756  LYS O CE    1 
ATOM   299   N  NZ    . LYS A 1  91  ? 163.931 130.581 152.973 1.00 209.85 ? 756  LYS O NZ    1 
ATOM   300   N  N     . LYS A 1  92  ? 164.198 131.968 144.784 1.00 193.77 ? 757  LYS O N     1 
ATOM   301   C  CA    . LYS A 1  92  ? 164.376 133.047 143.822 1.00 194.41 ? 757  LYS O CA    1 
ATOM   302   C  C     . LYS A 1  92  ? 163.496 132.808 142.601 1.00 192.81 ? 757  LYS O C     1 
ATOM   303   O  O     . LYS A 1  92  ? 163.644 131.796 141.906 1.00 186.59 ? 757  LYS O O     1 
ATOM   304   C  CB    . LYS A 1  92  ? 165.842 133.167 143.413 1.00 165.27 ? 757  LYS O CB    1 
ATOM   305   C  CG    . LYS A 1  92  ? 166.746 133.651 144.525 1.00 165.27 ? 757  LYS O CG    1 
ATOM   306   C  CD    . LYS A 1  92  ? 168.155 133.880 144.012 1.00 165.27 ? 757  LYS O CD    1 
ATOM   307   C  CE    . LYS A 1  92  ? 169.038 134.513 145.075 1.00 165.27 ? 757  LYS O CE    1 
ATOM   308   N  NZ    . LYS A 1  92  ? 169.417 133.541 146.136 1.00 165.27 ? 757  LYS O NZ    1 
ATOM   309   N  N     . GLN A 1  93  ? 162.598 133.752 142.338 1.00 188.20 ? 758  GLN O N     1 
ATOM   310   C  CA    . GLN A 1  93  ? 161.645 133.623 141.255 1.00 183.71 ? 758  GLN O CA    1 
ATOM   311   C  C     . GLN A 1  93  ? 162.348 133.676 139.902 1.00 185.90 ? 758  GLN O C     1 
ATOM   312   O  O     . GLN A 1  93  ? 163.459 134.197 139.784 1.00 183.92 ? 758  GLN O O     1 
ATOM   313   C  CB    . GLN A 1  93  ? 160.596 134.728 141.358 1.00 172.23 ? 758  GLN O CB    1 
ATOM   314   C  CG    . GLN A 1  93  ? 161.155 136.132 141.265 1.00 172.28 ? 758  GLN O CG    1 
ATOM   315   C  CD    . GLN A 1  93  ? 160.089 137.187 141.462 1.00 179.94 ? 758  GLN O CD    1 
ATOM   316   O  OE1   . GLN A 1  93  ? 159.033 136.919 142.035 1.00 181.28 ? 758  GLN O OE1   1 
ATOM   317   N  NE2   . GLN A 1  93  ? 160.358 138.394 140.985 1.00 169.08 ? 758  GLN O NE2   1 
ATOM   318   N  N     . PRO A 1  94  ? 161.719 133.126 138.867 1.00 174.17 ? 759  PRO O N     1 
ATOM   319   C  CA    . PRO A 1  94  ? 162.282 133.226 137.518 1.00 165.61 ? 759  PRO O CA    1 
ATOM   320   C  C     . PRO A 1  94  ? 162.289 134.661 137.012 1.00 173.63 ? 759  PRO O C     1 
ATOM   321   O  O     . PRO A 1  94  ? 161.483 135.503 137.414 1.00 169.03 ? 759  PRO O O     1 
ATOM   322   C  CB    . PRO A 1  94  ? 161.345 132.347 136.684 1.00 158.98 ? 759  PRO O CB    1 
ATOM   323   C  CG    . PRO A 1  94  ? 160.062 132.351 137.443 1.00 158.98 ? 759  PRO O CG    1 
ATOM   324   C  CD    . PRO A 1  94  ? 160.476 132.337 138.882 1.00 158.98 ? 759  PRO O CD    1 
ATOM   325   N  N     . SER A 1  95  ? 163.223 134.927 136.098 1.00 165.93 ? 760  SER O N     1 
ATOM   326   C  CA    . SER A 1  95  ? 163.419 136.283 135.601 1.00 161.94 ? 760  SER O CA    1 
ATOM   327   C  C     . SER A 1  95  ? 162.290 136.747 134.694 1.00 160.85 ? 760  SER O C     1 
ATOM   328   O  O     . SER A 1  95  ? 162.135 137.956 134.491 1.00 162.60 ? 760  SER O O     1 
ATOM   329   C  CB    . SER A 1  95  ? 164.745 136.380 134.851 1.00 149.94 ? 760  SER O CB    1 
ATOM   330   O  OG    . SER A 1  95  ? 165.834 136.140 135.723 1.00 179.50 ? 760  SER O OG    1 
ATOM   331   N  N     . ILE A 1  96  ? 161.508 135.825 134.136 1.00 156.96 ? 761  ILE O N     1 
ATOM   332   C  CA    . ILE A 1  96  ? 160.445 136.242 133.232 1.00 154.40 ? 761  ILE O CA    1 
ATOM   333   C  C     . ILE A 1  96  ? 159.267 136.806 134.013 1.00 155.50 ? 761  ILE O C     1 
ATOM   334   O  O     . ILE A 1  96  ? 158.553 137.683 133.515 1.00 155.14 ? 761  ILE O O     1 
ATOM   335   C  CB    . ILE A 1  96  ? 160.011 135.074 132.331 1.00 149.97 ? 761  ILE O CB    1 
ATOM   336   C  CG1   . ILE A 1  96  ? 161.173 134.590 131.465 1.00 146.71 ? 761  ILE O CG1   1 
ATOM   337   C  CG2   . ILE A 1  96  ? 158.883 135.500 131.428 1.00 139.66 ? 761  ILE O CG2   1 
ATOM   338   C  CD1   . ILE A 1  96  ? 161.815 133.334 131.970 1.00 142.19 ? 761  ILE O CD1   1 
ATOM   339   N  N     . LEU A 1  97  ? 159.057 136.335 135.242 1.00 141.71 ? 762  LEU O N     1 
ATOM   340   C  CA    . LEU A 1  97  ? 157.922 136.776 136.043 1.00 148.85 ? 762  LEU O CA    1 
ATOM   341   C  C     . LEU A 1  97  ? 157.917 138.292 136.176 1.00 156.56 ? 762  LEU O C     1 
ATOM   342   O  O     . LEU A 1  97  ? 158.914 138.896 136.579 1.00 147.80 ? 762  LEU O O     1 
ATOM   343   C  CB    . LEU A 1  97  ? 157.974 136.120 137.425 1.00 141.57 ? 762  LEU O CB    1 
ATOM   344   C  CG    . LEU A 1  97  ? 156.913 136.529 138.449 1.00 150.64 ? 762  LEU O CG    1 
ATOM   345   C  CD1   . LEU A 1  97  ? 155.524 136.188 137.952 1.00 146.14 ? 762  LEU O CD1   1 
ATOM   346   C  CD2   . LEU A 1  97  ? 157.171 135.855 139.784 1.00 145.04 ? 762  LEU O CD2   1 
ATOM   347   N  N     . VAL A 1  98  ? 156.790 138.902 135.822 1.00 138.46 ? 763  VAL O N     1 
ATOM   348   C  CA    . VAL A 1  98  ? 156.646 140.352 135.790 1.00 139.30 ? 763  VAL O CA    1 
ATOM   349   C  C     . VAL A 1  98  ? 155.553 140.755 136.766 1.00 164.43 ? 763  VAL O C     1 
ATOM   350   O  O     . VAL A 1  98  ? 154.404 140.313 136.639 1.00 163.87 ? 763  VAL O O     1 
ATOM   351   C  CB    . VAL A 1  98  ? 156.323 140.866 134.378 1.00 146.97 ? 763  VAL O CB    1 
ATOM   352   C  CG1   . VAL A 1  98  ? 155.983 142.342 134.423 1.00 175.05 ? 763  VAL O CG1   1 
ATOM   353   C  CG2   . VAL A 1  98  ? 157.498 140.633 133.454 1.00 142.61 ? 763  VAL O CG2   1 
ATOM   354   N  N     . GLY A 1  99  ? 155.908 141.597 137.733 1.00 160.28 ? 764  GLY O N     1 
ATOM   355   C  CA    . GLY A 1  99  ? 154.920 142.184 138.610 1.00 170.05 ? 764  GLY O CA    1 
ATOM   356   C  C     . GLY A 1  99  ? 154.215 141.159 139.465 1.00 162.35 ? 764  GLY O C     1 
ATOM   357   O  O     . GLY A 1  99  ? 152.990 141.025 139.391 1.00 157.27 ? 764  GLY O O     1 
ATOM   358   N  N     . GLY A 1  100 ? 154.967 140.415 140.268 1.00 177.52 ? 765  GLY O N     1 
ATOM   359   C  CA    . GLY A 1  100 ? 154.365 139.353 141.048 1.00 162.92 ? 765  GLY O CA    1 
ATOM   360   C  C     . GLY A 1  100 ? 155.030 139.183 142.395 1.00 161.15 ? 765  GLY O C     1 
ATOM   361   O  O     . GLY A 1  100 ? 156.146 139.654 142.636 1.00 165.03 ? 765  GLY O O     1 
ATOM   362   N  N     . THR A 1  101 ? 154.315 138.492 143.272 1.00 168.76 ? 766  THR O N     1 
ATOM   363   C  CA    . THR A 1  101 ? 154.745 138.232 144.632 1.00 165.64 ? 766  THR O CA    1 
ATOM   364   C  C     . THR A 1  101 ? 154.888 136.728 144.808 1.00 162.77 ? 766  THR O C     1 
ATOM   365   O  O     . THR A 1  101 ? 154.212 135.944 144.137 1.00 171.81 ? 766  THR O O     1 
ATOM   366   C  CB    . THR A 1  101 ? 153.734 138.804 145.637 1.00 151.78 ? 766  THR O CB    1 
ATOM   367   O  OG1   . THR A 1  101 ? 153.564 140.205 145.390 1.00 163.76 ? 766  THR O OG1   1 
ATOM   368   C  CG2   . THR A 1  101 ? 154.209 138.614 147.070 1.00 149.84 ? 766  THR O CG2   1 
ATOM   369   N  N     . LEU A 1  102 ? 155.787 136.325 145.694 1.00 169.47 ? 767  LEU O N     1 
ATOM   370   C  CA    . LEU A 1  102 ? 155.998 134.917 145.994 1.00 167.65 ? 767  LEU O CA    1 
ATOM   371   C  C     . LEU A 1  102 ? 155.521 134.630 147.409 1.00 159.57 ? 767  LEU O C     1 
ATOM   372   O  O     . LEU A 1  102 ? 156.143 135.071 148.380 1.00 169.88 ? 767  LEU O O     1 
ATOM   373   C  CB    . LEU A 1  102 ? 157.466 134.531 145.846 1.00 177.35 ? 767  LEU O CB    1 
ATOM   374   C  CG    . LEU A 1  102 ? 158.111 134.571 144.466 1.00 174.49 ? 767  LEU O CG    1 
ATOM   375   C  CD1   . LEU A 1  102 ? 159.588 134.264 144.621 1.00 174.66 ? 767  LEU O CD1   1 
ATOM   376   C  CD2   . LEU A 1  102 ? 157.440 133.584 143.522 1.00 176.86 ? 767  LEU O CD2   1 
ATOM   377   N  N     . LYS A 1  103 ? 154.426 133.888 147.525 1.00 170.07 ? 768  LYS O N     1 
ATOM   378   C  CA    . LYS A 1  103 ? 154.179 133.183 148.767 1.00 174.01 ? 768  LYS O CA    1 
ATOM   379   C  C     . LYS A 1  103 ? 154.975 131.884 148.757 1.00 173.58 ? 768  LYS O C     1 
ATOM   380   O  O     . LYS A 1  103 ? 155.619 131.525 147.769 1.00 180.49 ? 768  LYS O O     1 
ATOM   381   C  CB    . LYS A 1  103 ? 152.690 132.919 148.959 1.00 157.64 ? 768  LYS O CB    1 
ATOM   382   C  CG    . LYS A 1  103 ? 151.860 134.167 149.150 1.00 167.64 ? 768  LYS O CG    1 
ATOM   383   C  CD    . LYS A 1  103 ? 150.423 133.824 149.482 1.00 177.08 ? 768  LYS O CD    1 
ATOM   384   C  CE    . LYS A 1  103 ? 149.624 135.076 149.766 1.00 176.93 ? 768  LYS O CE    1 
ATOM   385   N  NZ    . LYS A 1  103 ? 149.365 135.841 148.518 1.00 191.61 ? 768  LYS O NZ    1 
ATOM   386   N  N     . ASP A 1  104 ? 154.919 131.154 149.863 1.00 180.60 ? 769  ASP O N     1 
ATOM   387   C  CA    . ASP A 1  104 ? 155.722 129.949 149.982 1.00 176.80 ? 769  ASP O CA    1 
ATOM   388   C  C     . ASP A 1  104 ? 155.080 128.729 149.336 1.00 176.58 ? 769  ASP O C     1 
ATOM   389   O  O     . ASP A 1  104 ? 155.787 127.756 149.054 1.00 179.20 ? 769  ASP O O     1 
ATOM   390   C  CB    . ASP A 1  104 ? 156.000 129.669 151.457 1.00 171.85 ? 769  ASP O CB    1 
ATOM   391   C  CG    . ASP A 1  104 ? 154.735 129.645 152.284 1.00 171.85 ? 769  ASP O CG    1 
ATOM   392   O  OD1   . ASP A 1  104 ? 153.676 130.029 151.745 1.00 171.85 ? 769  ASP O OD1   1 
ATOM   393   O  OD2   . ASP A 1  104 ? 154.794 129.239 153.464 1.00 171.85 ? 769  ASP O OD2   1 
ATOM   394   N  N     . TYR A 1  105 ? 153.772 128.754 149.078 1.00 181.27 ? 770  TYR O N     1 
ATOM   395   C  CA    . TYR A 1  105 ? 153.107 127.538 148.620 1.00 177.02 ? 770  TYR O CA    1 
ATOM   396   C  C     . TYR A 1  105 ? 153.560 127.154 147.219 1.00 172.31 ? 770  TYR O C     1 
ATOM   397   O  O     . TYR A 1  105 ? 153.981 126.017 146.987 1.00 174.51 ? 770  TYR O O     1 
ATOM   398   C  CB    . TYR A 1  105 ? 151.588 127.698 148.689 1.00 160.43 ? 770  TYR O CB    1 
ATOM   399   C  CG    . TYR A 1  105 ? 151.006 128.804 147.839 1.00 168.94 ? 770  TYR O CG    1 
ATOM   400   C  CD1   . TYR A 1  105 ? 150.627 128.570 146.526 1.00 166.49 ? 770  TYR O CD1   1 
ATOM   401   C  CD2   . TYR A 1  105 ? 150.804 130.072 148.356 1.00 174.45 ? 770  TYR O CD2   1 
ATOM   402   C  CE1   . TYR A 1  105 ? 150.102 129.569 145.746 1.00 172.45 ? 770  TYR O CE1   1 
ATOM   403   C  CE2   . TYR A 1  105 ? 150.260 131.077 147.577 1.00 180.35 ? 770  TYR O CE2   1 
ATOM   404   C  CZ    . TYR A 1  105 ? 149.910 130.817 146.272 1.00 179.65 ? 770  TYR O CZ    1 
ATOM   405   O  OH    . TYR A 1  105 ? 149.371 131.809 145.484 1.00 194.32 ? 770  TYR O OH    1 
ATOM   406   N  N     . GLN A 1  106 ? 153.499 128.093 146.273 1.00 171.08 ? 771  GLN O N     1 
ATOM   407   C  CA    . GLN A 1  106 ? 153.922 127.783 144.916 1.00 160.69 ? 771  GLN O CA    1 
ATOM   408   C  C     . GLN A 1  106 ? 155.421 127.588 144.830 1.00 169.27 ? 771  GLN O C     1 
ATOM   409   O  O     . GLN A 1  106 ? 155.914 127.123 143.800 1.00 172.97 ? 771  GLN O O     1 
ATOM   410   C  CB    . GLN A 1  106 ? 153.498 128.880 143.941 1.00 171.28 ? 771  GLN O CB    1 
ATOM   411   C  CG    . GLN A 1  106 ? 154.330 130.143 144.008 1.00 177.91 ? 771  GLN O CG    1 
ATOM   412   C  CD    . GLN A 1  106 ? 154.021 130.992 145.217 1.00 185.43 ? 771  GLN O CD    1 
ATOM   413   O  OE1   . GLN A 1  106 ? 153.176 130.646 146.044 1.00 179.34 ? 771  GLN O OE1   1 
ATOM   414   N  NE2   . GLN A 1  106 ? 154.704 132.119 145.323 1.00 176.21 ? 771  GLN O NE2   1 
ATOM   415   N  N     . ILE A 1  107 ? 156.151 127.940 145.879 1.00 169.93 ? 772  ILE O N     1 
ATOM   416   C  CA    . ILE A 1  107 ? 157.559 127.592 145.951 1.00 166.43 ? 772  ILE O CA    1 
ATOM   417   C  C     . ILE A 1  107 ? 157.715 126.118 146.280 1.00 163.70 ? 772  ILE O C     1 
ATOM   418   O  O     . ILE A 1  107 ? 158.245 125.338 145.484 1.00 162.70 ? 772  ILE O O     1 
ATOM   419   C  CB    . ILE A 1  107 ? 158.272 128.479 146.982 1.00 161.99 ? 772  ILE O CB    1 
ATOM   420   C  CG1   . ILE A 1  107 ? 158.182 129.938 146.551 1.00 161.99 ? 772  ILE O CG1   1 
ATOM   421   C  CG2   . ILE A 1  107 ? 159.717 128.048 147.134 1.00 161.99 ? 772  ILE O CG2   1 
ATOM   422   C  CD1   . ILE A 1  107 ? 158.646 130.897 147.608 1.00 161.99 ? 772  ILE O CD1   1 
ATOM   423   N  N     . LYS A 1  108 ? 157.242 125.712 147.458 1.00 172.44 ? 773  LYS O N     1 
ATOM   424   C  CA    . LYS A 1  108 ? 157.358 124.318 147.872 1.00 179.23 ? 773  LYS O CA    1 
ATOM   425   C  C     . LYS A 1  108 ? 156.755 123.384 146.830 1.00 177.59 ? 773  LYS O C     1 
ATOM   426   O  O     . LYS A 1  108 ? 157.425 122.477 146.320 1.00 174.79 ? 773  LYS O O     1 
ATOM   427   C  CB    . LYS A 1  108 ? 156.690 124.136 149.236 1.00 147.32 ? 773  LYS O CB    1 
ATOM   428   C  CG    . LYS A 1  108 ? 157.419 124.865 150.360 1.00 163.56 ? 773  LYS O CG    1 
ATOM   429   C  CD    . LYS A 1  108 ? 156.728 124.688 151.700 1.00 185.84 ? 773  LYS O CD    1 
ATOM   430   C  CE    . LYS A 1  108 ? 157.495 125.395 152.797 1.00 197.55 ? 773  LYS O CE    1 
ATOM   431   N  NZ    . LYS A 1  108 ? 158.850 124.803 152.972 1.00 197.64 ? 773  LYS O NZ    1 
ATOM   432   N  N     . GLY A 1  109 ? 155.488 123.607 146.486 1.00 170.16 ? 774  GLY O N     1 
ATOM   433   C  CA    . GLY A 1  109 ? 154.898 122.862 145.393 1.00 170.86 ? 774  GLY O CA    1 
ATOM   434   C  C     . GLY A 1  109 ? 155.655 123.039 144.096 1.00 170.11 ? 774  GLY O C     1 
ATOM   435   O  O     . GLY A 1  109 ? 155.756 122.101 143.301 1.00 161.28 ? 774  GLY O O     1 
ATOM   436   N  N     . LEU A 1  110 ? 156.204 124.233 143.869 1.00 166.16 ? 775  LEU O N     1 
ATOM   437   C  CA    . LEU A 1  110 ? 156.976 124.503 142.664 1.00 153.92 ? 775  LEU O CA    1 
ATOM   438   C  C     . LEU A 1  110 ? 158.111 123.509 142.519 1.00 155.30 ? 775  LEU O C     1 
ATOM   439   O  O     . LEU A 1  110 ? 158.050 122.622 141.668 1.00 153.13 ? 775  LEU O O     1 
ATOM   440   C  CB    . LEU A 1  110 ? 157.535 125.922 142.674 1.00 149.94 ? 775  LEU O CB    1 
ATOM   441   C  CG    . LEU A 1  110 ? 158.515 126.256 141.558 1.00 151.74 ? 775  LEU O CG    1 
ATOM   442   C  CD1   . LEU A 1  110 ? 157.836 126.116 140.215 1.00 143.90 ? 775  LEU O CD1   1 
ATOM   443   C  CD2   . LEU A 1  110 ? 159.068 127.658 141.750 1.00 154.64 ? 775  LEU O CD2   1 
ATOM   444   N  N     . GLN A 1  111 ? 159.134 123.623 143.362 1.00 156.95 ? 776  GLN O N     1 
ATOM   445   C  CA    . GLN A 1  111 ? 160.252 122.702 143.244 1.00 159.48 ? 776  GLN O CA    1 
ATOM   446   C  C     . GLN A 1  111 ? 159.871 121.266 143.569 1.00 164.63 ? 776  GLN O C     1 
ATOM   447   O  O     . GLN A 1  111 ? 160.685 120.368 143.338 1.00 160.72 ? 776  GLN O O     1 
ATOM   448   C  CB    . GLN A 1  111 ? 161.429 123.147 144.122 1.00 154.82 ? 776  GLN O CB    1 
ATOM   449   C  CG    . GLN A 1  111 ? 162.164 124.395 143.618 1.00 159.64 ? 776  GLN O CG    1 
ATOM   450   C  CD    . GLN A 1  111 ? 161.637 125.688 144.204 1.00 171.32 ? 776  GLN O CD    1 
ATOM   451   O  OE1   . GLN A 1  111 ? 160.791 125.680 145.092 1.00 166.96 ? 776  GLN O OE1   1 
ATOM   452   N  NE2   . GLN A 1  111 ? 162.131 126.812 143.697 1.00 176.75 ? 776  GLN O NE2   1 
ATOM   453   N  N     . TRP A 1  112 ? 158.668 121.014 144.089 1.00 180.45 ? 777  TRP O N     1 
ATOM   454   C  CA    . TRP A 1  112 ? 158.245 119.624 144.216 1.00 173.00 ? 777  TRP O CA    1 
ATOM   455   C  C     . TRP A 1  112 ? 157.832 119.043 142.870 1.00 167.01 ? 777  TRP O C     1 
ATOM   456   O  O     . TRP A 1  112 ? 158.258 117.943 142.499 1.00 165.66 ? 777  TRP O O     1 
ATOM   457   C  CB    . TRP A 1  112 ? 157.108 119.492 145.224 1.00 183.78 ? 777  TRP O CB    1 
ATOM   458   C  CG    . TRP A 1  112 ? 156.657 118.075 145.369 1.00 193.80 ? 777  TRP O CG    1 
ATOM   459   C  CD1   . TRP A 1  112 ? 157.260 117.095 146.103 1.00 188.14 ? 777  TRP O CD1   1 
ATOM   460   C  CD2   . TRP A 1  112 ? 155.489 117.483 144.793 1.00 180.86 ? 777  TRP O CD2   1 
ATOM   461   N  NE1   . TRP A 1  112 ? 156.552 115.926 146.004 1.00 190.97 ? 777  TRP O NE1   1 
ATOM   462   C  CE2   . TRP A 1  112 ? 155.457 116.137 145.207 1.00 184.85 ? 777  TRP O CE2   1 
ATOM   463   C  CE3   . TRP A 1  112 ? 154.469 117.958 143.966 1.00 185.40 ? 777  TRP O CE3   1 
ATOM   464   C  CZ2   . TRP A 1  112 ? 154.447 115.262 144.821 1.00 181.59 ? 777  TRP O CZ2   1 
ATOM   465   C  CZ3   . TRP A 1  112 ? 153.463 117.088 143.589 1.00 184.15 ? 777  TRP O CZ3   1 
ATOM   466   C  CH2   . TRP A 1  112 ? 153.462 115.756 144.014 1.00 180.04 ? 777  TRP O CH2   1 
ATOM   467   N  N     . MET A 1  113 ? 157.000 119.763 142.123 1.00 164.68 ? 778  MET O N     1 
ATOM   468   C  CA    . MET A 1  113 ? 156.657 119.296 140.788 1.00 162.79 ? 778  MET O CA    1 
ATOM   469   C  C     . MET A 1  113 ? 157.867 119.354 139.870 1.00 165.73 ? 778  MET O C     1 
ATOM   470   O  O     . MET A 1  113 ? 158.139 118.409 139.124 1.00 167.44 ? 778  MET O O     1 
ATOM   471   C  CB    . MET A 1  113 ? 155.510 120.116 140.209 1.00 167.66 ? 778  MET O CB    1 
ATOM   472   C  CG    . MET A 1  113 ? 155.158 119.689 138.803 1.00 173.19 ? 778  MET O CG    1 
ATOM   473   S  SD    . MET A 1  113 ? 154.576 117.982 138.771 1.00 179.49 ? 778  MET O SD    1 
ATOM   474   C  CE    . MET A 1  113 ? 154.280 117.747 137.021 1.00 172.28 ? 778  MET O CE    1 
ATOM   475   N  N     . VAL A 1  114 ? 158.599 120.468 139.907 1.00 156.36 ? 779  VAL O N     1 
ATOM   476   C  CA    . VAL A 1  114 ? 159.843 120.575 139.153 1.00 156.02 ? 779  VAL O CA    1 
ATOM   477   C  C     . VAL A 1  114 ? 160.759 119.421 139.512 1.00 162.26 ? 779  VAL O C     1 
ATOM   478   O  O     . VAL A 1  114 ? 161.458 118.867 138.657 1.00 159.25 ? 779  VAL O O     1 
ATOM   479   C  CB    . VAL A 1  114 ? 160.515 121.934 139.419 1.00 149.65 ? 779  VAL O CB    1 
ATOM   480   C  CG1   . VAL A 1  114 ? 161.843 122.016 138.694 1.00 149.65 ? 779  VAL O CG1   1 
ATOM   481   C  CG2   . VAL A 1  114 ? 159.606 123.070 138.994 1.00 149.65 ? 779  VAL O CG2   1 
ATOM   482   N  N     . SER A 1  115 ? 160.758 119.031 140.785 1.00 163.19 ? 780  SER O N     1 
ATOM   483   C  CA    . SER A 1  115 ? 161.488 117.837 141.181 1.00 161.62 ? 780  SER O CA    1 
ATOM   484   C  C     . SER A 1  115 ? 160.932 116.608 140.480 1.00 169.80 ? 780  SER O C     1 
ATOM   485   O  O     . SER A 1  115 ? 161.687 115.704 140.104 1.00 166.01 ? 780  SER O O     1 
ATOM   486   C  CB    . SER A 1  115 ? 161.435 117.666 142.698 1.00 160.88 ? 780  SER O CB    1 
ATOM   487   O  OG    . SER A 1  115 ? 162.086 116.473 143.100 1.00 167.15 ? 780  SER O OG    1 
ATOM   488   N  N     . LEU A 1  116 ? 159.612 116.557 140.288 1.00 167.29 ? 781  LEU O N     1 
ATOM   489   C  CA    . LEU A 1  116 ? 159.030 115.417 139.592 1.00 163.11 ? 781  LEU O CA    1 
ATOM   490   C  C     . LEU A 1  116 ? 159.443 115.384 138.128 1.00 167.52 ? 781  LEU O C     1 
ATOM   491   O  O     . LEU A 1  116 ? 159.604 114.302 137.556 1.00 168.50 ? 781  LEU O O     1 
ATOM   492   C  CB    . LEU A 1  116 ? 157.509 115.438 139.722 1.00 162.46 ? 781  LEU O CB    1 
ATOM   493   C  CG    . LEU A 1  116 ? 156.970 115.265 141.141 1.00 164.34 ? 781  LEU O CG    1 
ATOM   494   C  CD1   . LEU A 1  116 ? 155.457 115.372 141.167 1.00 158.55 ? 781  LEU O CD1   1 
ATOM   495   C  CD2   . LEU A 1  116 ? 157.423 113.933 141.710 1.00 158.38 ? 781  LEU O CD2   1 
ATOM   496   N  N     . PHE A 1  117 ? 159.624 116.548 137.506 1.00 160.35 ? 782  PHE O N     1 
ATOM   497   C  CA    . PHE A 1  117 ? 160.156 116.557 136.151 1.00 163.99 ? 782  PHE O CA    1 
ATOM   498   C  C     . PHE A 1  117 ? 161.622 116.152 136.134 1.00 167.67 ? 782  PHE O C     1 
ATOM   499   O  O     . PHE A 1  117 ? 162.059 115.420 135.240 1.00 164.26 ? 782  PHE O O     1 
ATOM   500   C  CB    . PHE A 1  117 ? 159.991 117.928 135.511 1.00 161.97 ? 782  PHE O CB    1 
ATOM   501   C  CG    . PHE A 1  117 ? 160.643 118.029 134.172 1.00 161.97 ? 782  PHE O CG    1 
ATOM   502   C  CD1   . PHE A 1  117 ? 160.017 117.528 133.047 1.00 161.97 ? 782  PHE O CD1   1 
ATOM   503   C  CD2   . PHE A 1  117 ? 161.900 118.593 134.040 1.00 161.97 ? 782  PHE O CD2   1 
ATOM   504   C  CE1   . PHE A 1  117 ? 160.623 117.605 131.809 1.00 161.97 ? 782  PHE O CE1   1 
ATOM   505   C  CE2   . PHE A 1  117 ? 162.512 118.672 132.806 1.00 161.97 ? 782  PHE O CE2   1 
ATOM   506   C  CZ    . PHE A 1  117 ? 161.871 118.178 131.688 1.00 161.97 ? 782  PHE O CZ    1 
ATOM   507   N  N     . ASN A 1  118 ? 162.407 116.643 137.092 1.00 164.26 ? 783  ASN O N     1 
ATOM   508   C  CA    . ASN A 1  118 ? 163.778 116.169 137.212 1.00 163.75 ? 783  ASN O CA    1 
ATOM   509   C  C     . ASN A 1  118 ? 163.797 114.673 137.483 1.00 164.87 ? 783  ASN O C     1 
ATOM   510   O  O     . ASN A 1  118 ? 164.601 113.936 136.902 1.00 169.46 ? 783  ASN O O     1 
ATOM   511   C  CB    . ASN A 1  118 ? 164.506 116.936 138.312 1.00 160.83 ? 783  ASN O CB    1 
ATOM   512   C  CG    . ASN A 1  118 ? 164.715 118.393 137.958 1.00 163.60 ? 783  ASN O CG    1 
ATOM   513   O  OD1   . ASN A 1  118 ? 164.679 118.768 136.787 1.00 170.60 ? 783  ASN O OD1   1 
ATOM   514   N  ND2   . ASN A 1  118 ? 164.945 119.222 138.969 1.00 160.84 ? 783  ASN O ND2   1 
ATOM   515   N  N     . ASN A 1  119 ? 162.893 114.205 138.344 1.00 172.48 ? 784  ASN O N     1 
ATOM   516   C  CA    . ASN A 1  119 ? 162.632 112.779 138.464 1.00 171.36 ? 784  ASN O CA    1 
ATOM   517   C  C     . ASN A 1  119 ? 161.993 112.202 137.212 1.00 171.88 ? 784  ASN O C     1 
ATOM   518   O  O     . ASN A 1  119 ? 161.855 110.978 137.120 1.00 171.22 ? 784  ASN O O     1 
ATOM   519   C  CB    . ASN A 1  119 ? 161.720 112.504 139.658 1.00 163.12 ? 784  ASN O CB    1 
ATOM   520   C  CG    . ASN A 1  119 ? 162.404 112.748 140.979 1.00 168.93 ? 784  ASN O CG    1 
ATOM   521   O  OD1   . ASN A 1  119 ? 163.206 111.935 141.435 1.00 170.46 ? 784  ASN O OD1   1 
ATOM   522   N  ND2   . ASN A 1  119 ? 162.087 113.871 141.609 1.00 167.72 ? 784  ASN O ND2   1 
ATOM   523   N  N     . HIS A 1  120 ? 161.599 113.048 136.263 1.00 164.39 ? 785  HIS O N     1 
ATOM   524   C  CA    . HIS A 1  120 ? 160.846 112.635 135.087 1.00 164.41 ? 785  HIS O CA    1 
ATOM   525   C  C     . HIS A 1  120 ? 159.587 111.891 135.515 1.00 165.11 ? 785  HIS O C     1 
ATOM   526   O  O     . HIS A 1  120 ? 159.364 110.729 135.177 1.00 170.78 ? 785  HIS O O     1 
ATOM   527   C  CB    . HIS A 1  120 ? 161.709 111.775 134.167 1.00 155.90 ? 785  HIS O CB    1 
ATOM   528   C  CG    . HIS A 1  120 ? 162.989 112.430 133.763 1.00 155.90 ? 785  HIS O CG    1 
ATOM   529   N  ND1   . HIS A 1  120 ? 163.040 113.480 132.874 1.00 155.90 ? 785  HIS O ND1   1 
ATOM   530   C  CD2   . HIS A 1  120 ? 164.267 112.190 134.136 1.00 155.90 ? 785  HIS O CD2   1 
ATOM   531   C  CE1   . HIS A 1  120 ? 164.295 113.854 132.708 1.00 155.90 ? 785  HIS O CE1   1 
ATOM   532   N  NE2   . HIS A 1  120 ? 165.060 113.086 133.463 1.00 155.90 ? 785  HIS O NE2   1 
ATOM   533   N  N     . LEU A 1  121 ? 158.754 112.600 136.268 1.00 180.86 ? 786  LEU O N     1 
ATOM   534   C  CA    . LEU A 1  121 ? 157.557 112.015 136.845 1.00 176.42 ? 786  LEU O CA    1 
ATOM   535   C  C     . LEU A 1  121 ? 156.448 113.052 136.863 1.00 178.94 ? 786  LEU O C     1 
ATOM   536   O  O     . LEU A 1  121 ? 156.700 114.257 136.942 1.00 175.81 ? 786  LEU O O     1 
ATOM   537   C  CB    . LEU A 1  121 ? 157.806 111.494 138.262 1.00 183.37 ? 786  LEU O CB    1 
ATOM   538   C  CG    . LEU A 1  121 ? 158.765 110.311 138.371 1.00 184.32 ? 786  LEU O CG    1 
ATOM   539   C  CD1   . LEU A 1  121 ? 159.012 109.956 139.824 1.00 176.19 ? 786  LEU O CD1   1 
ATOM   540   C  CD2   . LEU A 1  121 ? 158.214 109.117 137.620 1.00 172.64 ? 786  LEU O CD2   1 
ATOM   541   N  N     . ASN A 1  122 ? 155.218 112.564 136.775 1.00 187.08 ? 787  ASN O N     1 
ATOM   542   C  CA    . ASN A 1  122 ? 154.020 113.381 136.723 1.00 190.92 ? 787  ASN O CA    1 
ATOM   543   C  C     . ASN A 1  122 ? 153.380 113.463 138.107 1.00 192.05 ? 787  ASN O C     1 
ATOM   544   O  O     . ASN A 1  122 ? 153.963 113.052 139.114 1.00 194.54 ? 787  ASN O O     1 
ATOM   545   C  CB    . ASN A 1  122 ? 153.076 112.803 135.677 1.00 175.31 ? 787  ASN O CB    1 
ATOM   546   C  CG    . ASN A 1  122 ? 153.658 112.876 134.290 1.00 175.82 ? 787  ASN O CG    1 
ATOM   547   O  OD1   . ASN A 1  122 ? 154.516 113.714 134.012 1.00 173.41 ? 787  ASN O OD1   1 
ATOM   548   N  ND2   . ASN A 1  122 ? 153.215 111.986 133.414 1.00 178.54 ? 787  ASN O ND2   1 
ATOM   549   N  N     . GLY A 1  123 ? 152.177 114.016 138.169 1.00 188.82 ? 788  GLY O N     1 
ATOM   550   C  CA    . GLY A 1  123 ? 151.466 114.066 139.430 1.00 185.91 ? 788  GLY O CA    1 
ATOM   551   C  C     . GLY A 1  123 ? 150.123 114.734 139.262 1.00 193.60 ? 788  GLY O C     1 
ATOM   552   O  O     . GLY A 1  123 ? 149.696 115.061 138.152 1.00 193.37 ? 788  GLY O O     1 
ATOM   553   N  N     . ILE A 1  124 ? 149.457 114.924 140.392 1.00 186.92 ? 789  ILE O N     1 
ATOM   554   C  CA    . ILE A 1  124 ? 148.194 115.640 140.463 1.00 185.70 ? 789  ILE O CA    1 
ATOM   555   C  C     . ILE A 1  124 ? 148.334 116.699 141.541 1.00 196.46 ? 789  ILE O C     1 
ATOM   556   O  O     . ILE A 1  124 ? 149.005 116.487 142.555 1.00 192.07 ? 789  ILE O O     1 
ATOM   557   C  CB    . ILE A 1  124 ? 147.006 114.704 140.781 1.00 184.32 ? 789  ILE O CB    1 
ATOM   558   C  CG1   . ILE A 1  124 ? 146.759 113.707 139.655 1.00 176.91 ? 789  ILE O CG1   1 
ATOM   559   C  CG2   . ILE A 1  124 ? 145.736 115.491 141.048 1.00 182.06 ? 789  ILE O CG2   1 
ATOM   560   C  CD1   . ILE A 1  124 ? 145.673 112.716 140.004 1.00 186.61 ? 789  ILE O CD1   1 
ATOM   561   N  N     . LEU A 1  125 ? 147.705 117.844 141.325 1.00 165.86 ? 790  LEU O N     1 
ATOM   562   C  CA    . LEU A 1  125 ? 147.658 118.891 142.333 1.00 166.98 ? 790  LEU O CA    1 
ATOM   563   C  C     . LEU A 1  125 ? 146.291 118.855 143.005 1.00 175.56 ? 790  LEU O C     1 
ATOM   564   O  O     . LEU A 1  125 ? 145.276 119.194 142.393 1.00 169.70 ? 790  LEU O O     1 
ATOM   565   C  CB    . LEU A 1  125 ? 147.944 120.255 141.725 1.00 145.23 ? 790  LEU O CB    1 
ATOM   566   C  CG    . LEU A 1  125 ? 147.868 121.343 142.783 1.00 155.80 ? 790  LEU O CG    1 
ATOM   567   C  CD1   . LEU A 1  125 ? 148.897 121.092 143.860 1.00 151.33 ? 790  LEU O CD1   1 
ATOM   568   C  CD2   . LEU A 1  125 ? 148.099 122.683 142.145 1.00 158.52 ? 790  LEU O CD2   1 
ATOM   569   N  N     . ALA A 1  126 ? 146.279 118.448 144.267 1.00 162.05 ? 791  ALA O N     1 
ATOM   570   C  CA    . ALA A 1  126 ? 145.075 118.244 145.058 1.00 169.21 ? 791  ALA O CA    1 
ATOM   571   C  C     . ALA A 1  126 ? 144.658 119.476 145.841 1.00 172.58 ? 791  ALA O C     1 
ATOM   572   O  O     . ALA A 1  126 ? 143.780 119.371 146.702 1.00 177.14 ? 791  ALA O O     1 
ATOM   573   C  CB    . ALA A 1  126 ? 145.266 117.077 146.023 1.00 156.44 ? 791  ALA O CB    1 
ATOM   574   N  N     . ASP A 1  127 ? 145.268 120.627 145.582 1.00 168.56 ? 792  ASP O N     1 
ATOM   575   C  CA    . ASP A 1  127 ? 145.217 121.734 146.520 1.00 165.21 ? 792  ASP O CA    1 
ATOM   576   C  C     . ASP A 1  127 ? 143.793 122.262 146.650 1.00 172.17 ? 792  ASP O C     1 
ATOM   577   O  O     . ASP A 1  127 ? 142.874 121.827 145.953 1.00 173.66 ? 792  ASP O O     1 
ATOM   578   C  CB    . ASP A 1  127 ? 146.134 122.841 146.042 1.00 162.75 ? 792  ASP O CB    1 
ATOM   579   C  CG    . ASP A 1  127 ? 145.794 123.270 144.651 1.00 165.82 ? 792  ASP O CG    1 
ATOM   580   O  OD1   . ASP A 1  127 ? 144.982 122.565 144.018 1.00 161.86 ? 792  ASP O OD1   1 
ATOM   581   O  OD2   . ASP A 1  127 ? 146.318 124.301 144.192 1.00 171.47 ? 792  ASP O OD2   1 
ATOM   582   N  N     . GLU A 1  128 ? 143.613 123.253 147.524 1.00 157.61 ? 793  GLU O N     1 
ATOM   583   C  CA    . GLU A 1  128 ? 142.260 123.575 147.954 1.00 159.47 ? 793  GLU O CA    1 
ATOM   584   C  C     . GLU A 1  128 ? 141.522 124.296 146.843 1.00 158.32 ? 793  GLU O C     1 
ATOM   585   O  O     . GLU A 1  128 ? 140.785 123.649 146.097 1.00 157.18 ? 793  GLU O O     1 
ATOM   586   C  CB    . GLU A 1  128 ? 142.284 124.436 149.218 1.00 141.19 ? 793  GLU O CB    1 
ATOM   587   C  CG    . GLU A 1  128 ? 140.909 124.800 149.771 1.00 154.57 ? 793  GLU O CG    1 
ATOM   588   C  CD    . GLU A 1  128 ? 140.990 125.628 151.046 1.00 163.93 ? 793  GLU O CD    1 
ATOM   589   O  OE1   . GLU A 1  128 ? 142.119 125.954 151.467 1.00 170.67 ? 793  GLU O OE1   1 
ATOM   590   O  OE2   . GLU A 1  128 ? 139.931 125.948 151.629 1.00 164.60 ? 793  GLU O OE2   1 
ATOM   591   N  N     . MET A 1  129 ? 141.816 125.585 146.660 1.00 141.94 ? 794  MET O N     1 
ATOM   592   C  CA    . MET A 1  129 ? 141.297 126.520 145.658 1.00 144.41 ? 794  MET O CA    1 
ATOM   593   C  C     . MET A 1  129 ? 141.957 127.868 145.901 1.00 138.19 ? 794  MET O C     1 
ATOM   594   O  O     . MET A 1  129 ? 142.464 128.139 146.991 1.00 136.12 ? 794  MET O O     1 
ATOM   595   C  CB    . MET A 1  129 ? 139.763 126.684 145.694 1.00 113.02 ? 794  MET O CB    1 
ATOM   596   C  CG    . MET A 1  129 ? 139.028 125.499 145.130 1.00 128.84 ? 794  MET O CG    1 
ATOM   597   S  SD    . MET A 1  129 ? 137.253 125.359 145.223 1.00 182.34 ? 794  MET O SD    1 
ATOM   598   C  CE    . MET A 1  129 ? 137.152 123.639 144.750 1.00 140.44 ? 794  MET O CE    1 
ATOM   599   N  N     . GLY A 1  130 ? 141.920 128.720 144.881 1.00 148.57 ? 795  GLY O N     1 
ATOM   600   C  CA    . GLY A 1  130 ? 142.547 130.018 144.986 1.00 136.28 ? 795  GLY O CA    1 
ATOM   601   C  C     . GLY A 1  130 ? 144.042 129.991 145.168 1.00 150.39 ? 795  GLY O C     1 
ATOM   602   O  O     . GLY A 1  130 ? 144.635 131.038 145.437 1.00 155.04 ? 795  GLY O O     1 
ATOM   603   N  N     . LEU A 1  131 ? 144.672 128.834 145.020 1.00 164.56 ? 796  LEU O N     1 
ATOM   604   C  CA    . LEU A 1  131 ? 146.111 128.726 145.191 1.00 167.64 ? 796  LEU O CA    1 
ATOM   605   C  C     . LEU A 1  131 ? 146.882 129.091 143.935 1.00 161.84 ? 796  LEU O C     1 
ATOM   606   O  O     . LEU A 1  131 ? 148.092 128.865 143.893 1.00 171.46 ? 796  LEU O O     1 
ATOM   607   C  CB    . LEU A 1  131 ? 146.508 127.322 145.654 1.00 151.18 ? 796  LEU O CB    1 
ATOM   608   C  CG    . LEU A 1  131 ? 146.585 127.071 147.164 1.00 155.63 ? 796  LEU O CG    1 
ATOM   609   C  CD1   . LEU A 1  131 ? 145.226 127.081 147.813 1.00 149.70 ? 796  LEU O CD1   1 
ATOM   610   C  CD2   . LEU A 1  131 ? 147.315 125.776 147.468 1.00 158.90 ? 796  LEU O CD2   1 
ATOM   611   N  N     . GLY A 1  132 ? 146.223 129.578 142.890 1.00 156.46 ? 797  GLY O N     1 
ATOM   612   C  CA    . GLY A 1  132 ? 146.964 130.129 141.775 1.00 157.18 ? 797  GLY O CA    1 
ATOM   613   C  C     . GLY A 1  132 ? 147.696 129.101 140.943 1.00 162.87 ? 797  GLY O C     1 
ATOM   614   O  O     . GLY A 1  132 ? 148.874 129.286 140.622 1.00 163.93 ? 797  GLY O O     1 
ATOM   615   N  N     . LYS A 1  133 ? 147.009 128.011 140.592 1.00 154.86 ? 798  LYS O N     1 
ATOM   616   C  CA    . LYS A 1  133 ? 147.591 127.021 139.692 1.00 149.80 ? 798  LYS O CA    1 
ATOM   617   C  C     . LYS A 1  133 ? 148.140 127.680 138.440 1.00 146.68 ? 798  LYS O C     1 
ATOM   618   O  O     . LYS A 1  133 ? 149.128 127.208 137.863 1.00 152.19 ? 798  LYS O O     1 
ATOM   619   C  CB    . LYS A 1  133 ? 146.539 125.986 139.312 1.00 119.70 ? 798  LYS O CB    1 
ATOM   620   C  CG    . LYS A 1  133 ? 146.061 125.146 140.462 1.00 123.35 ? 798  LYS O CG    1 
ATOM   621   C  CD    . LYS A 1  133 ? 144.972 124.211 140.007 1.00 126.16 ? 798  LYS O CD    1 
ATOM   622   C  CE    . LYS A 1  133 ? 144.575 123.280 141.112 1.00 128.12 ? 798  LYS O CE    1 
ATOM   623   N  NZ    . LYS A 1  133 ? 143.815 123.981 142.184 1.00 128.85 ? 798  LYS O NZ    1 
ATOM   624   N  N     . THR A 1  134 ? 147.504 128.767 138.008 1.00 151.07 ? 799  THR O N     1 
ATOM   625   C  CA    . THR A 1  134 ? 148.031 129.573 136.918 1.00 149.90 ? 799  THR O CA    1 
ATOM   626   C  C     . THR A 1  134 ? 149.492 129.917 137.152 1.00 154.24 ? 799  THR O C     1 
ATOM   627   O  O     . THR A 1  134 ? 150.352 129.663 136.303 1.00 148.60 ? 799  THR O O     1 
ATOM   628   C  CB    . THR A 1  134 ? 147.208 130.851 136.789 1.00 145.73 ? 799  THR O CB    1 
ATOM   629   O  OG1   . THR A 1  134 ? 145.835 130.515 136.561 1.00 161.37 ? 799  THR O OG1   1 
ATOM   630   C  CG2   . THR A 1  134 ? 147.725 131.702 135.645 1.00 142.89 ? 799  THR O CG2   1 
ATOM   631   N  N     . ILE A 1  135 ? 149.791 130.482 138.318 1.00 151.14 ? 800  ILE O N     1 
ATOM   632   C  CA    . ILE A 1  135 ? 151.138 130.963 138.582 1.00 145.98 ? 800  ILE O CA    1 
ATOM   633   C  C     . ILE A 1  135 ? 152.112 129.800 138.674 1.00 146.78 ? 800  ILE O C     1 
ATOM   634   O  O     . ILE A 1  135 ? 153.270 129.911 138.261 1.00 141.44 ? 800  ILE O O     1 
ATOM   635   C  CB    . ILE A 1  135 ? 151.137 131.819 139.855 1.00 116.06 ? 800  ILE O CB    1 
ATOM   636   C  CG1   . ILE A 1  135 ? 150.241 133.031 139.635 1.00 121.28 ? 800  ILE O CG1   1 
ATOM   637   C  CG2   . ILE A 1  135 ? 152.539 132.264 140.197 1.00 111.01 ? 800  ILE O CG2   1 
ATOM   638   C  CD1   . ILE A 1  135 ? 150.000 133.829 140.860 1.00 140.50 ? 800  ILE O CD1   1 
ATOM   639   N  N     . GLN A 1  136 ? 151.662 128.665 139.202 1.00 160.37 ? 801  GLN O N     1 
ATOM   640   C  CA    . GLN A 1  136 ? 152.532 127.498 139.261 1.00 159.72 ? 801  GLN O CA    1 
ATOM   641   C  C     . GLN A 1  136 ? 152.844 126.959 137.872 1.00 165.84 ? 801  GLN O C     1 
ATOM   642   O  O     . GLN A 1  136 ? 153.949 126.462 137.633 1.00 156.47 ? 801  GLN O O     1 
ATOM   643   C  CB    . GLN A 1  136 ? 151.892 126.420 140.132 1.00 171.29 ? 801  GLN O CB    1 
ATOM   644   C  CG    . GLN A 1  136 ? 151.834 126.795 141.606 1.00 172.16 ? 801  GLN O CG    1 
ATOM   645   C  CD    . GLN A 1  136 ? 151.109 125.770 142.452 1.00 171.95 ? 801  GLN O CD    1 
ATOM   646   O  OE1   . GLN A 1  136 ? 150.223 125.067 141.975 1.00 180.44 ? 801  GLN O OE1   1 
ATOM   647   N  NE2   . GLN A 1  136 ? 151.498 125.669 143.715 1.00 169.98 ? 801  GLN O NE2   1 
ATOM   648   N  N     . THR A 1  137 ? 151.891 127.049 136.949 1.00 163.55 ? 802  THR O N     1 
ATOM   649   C  CA    . THR A 1  137 ? 152.155 126.658 135.570 1.00 154.67 ? 802  THR O CA    1 
ATOM   650   C  C     . THR A 1  137 ? 153.055 127.664 134.868 1.00 163.73 ? 802  THR O C     1 
ATOM   651   O  O     . THR A 1  137 ? 153.880 127.290 134.021 1.00 166.86 ? 802  THR O O     1 
ATOM   652   C  CB    . THR A 1  137 ? 150.835 126.519 134.829 1.00 155.66 ? 802  THR O CB    1 
ATOM   653   O  OG1   . THR A 1  137 ? 150.110 127.750 134.941 1.00 159.24 ? 802  THR O OG1   1 
ATOM   654   C  CG2   . THR A 1  137 ? 150.012 125.402 135.437 1.00 149.89 ? 802  THR O CG2   1 
ATOM   655   N  N     . ILE A 1  138 ? 152.935 128.934 135.239 1.00 164.02 ? 803  ILE O N     1 
ATOM   656   C  CA    . ILE A 1  138 ? 153.742 129.975 134.622 1.00 168.81 ? 803  ILE O CA    1 
ATOM   657   C  C     . ILE A 1  138 ? 155.186 129.835 135.067 1.00 163.68 ? 803  ILE O C     1 
ATOM   658   O  O     . ILE A 1  138 ? 156.087 129.640 134.249 1.00 160.45 ? 803  ILE O O     1 
ATOM   659   C  CB    . ILE A 1  138 ? 153.178 131.363 134.960 1.00 152.88 ? 803  ILE O CB    1 
ATOM   660   C  CG1   . ILE A 1  138 ? 151.822 131.553 134.278 1.00 158.13 ? 803  ILE O CG1   1 
ATOM   661   C  CG2   . ILE A 1  138 ? 154.160 132.448 134.554 1.00 151.75 ? 803  ILE O CG2   1 
ATOM   662   C  CD1   . ILE A 1  138 ? 151.078 132.789 134.717 1.00 158.08 ? 803  ILE O CD1   1 
ATOM   663   N  N     . SER A 1  139 ? 155.426 129.948 136.372 1.00 168.60 ? 804  SER O N     1 
ATOM   664   C  CA    . SER A 1  139 ? 156.738 129.620 136.914 1.00 174.48 ? 804  SER O CA    1 
ATOM   665   C  C     . SER A 1  139 ? 157.224 128.263 136.425 1.00 173.57 ? 804  SER O C     1 
ATOM   666   O  O     . SER A 1  139 ? 158.431 128.063 136.245 1.00 176.82 ? 804  SER O O     1 
ATOM   667   C  CB    . SER A 1  139 ? 156.689 129.639 138.439 1.00 160.82 ? 804  SER O CB    1 
ATOM   668   O  OG    . SER A 1  139 ? 155.795 128.651 138.915 1.00 157.73 ? 804  SER O OG    1 
ATOM   669   N  N     . LEU A 1  140 ? 156.306 127.321 136.211 1.00 175.52 ? 805  LEU O N     1 
ATOM   670   C  CA    . LEU A 1  140 ? 156.654 125.998 135.709 1.00 174.87 ? 805  LEU O CA    1 
ATOM   671   C  C     . LEU A 1  140 ? 157.380 126.082 134.376 1.00 170.51 ? 805  LEU O C     1 
ATOM   672   O  O     . LEU A 1  140 ? 158.583 125.815 134.301 1.00 177.11 ? 805  LEU O O     1 
ATOM   673   C  CB    . LEU A 1  140 ? 155.399 125.139 135.569 1.00 157.17 ? 805  LEU O CB    1 
ATOM   674   C  CG    . LEU A 1  140 ? 155.567 123.660 135.229 1.00 161.93 ? 805  LEU O CG    1 
ATOM   675   C  CD1   . LEU A 1  140 ? 154.433 122.872 135.851 1.00 151.33 ? 805  LEU O CD1   1 
ATOM   676   C  CD2   . LEU A 1  140 ? 155.594 123.423 133.734 1.00 165.01 ? 805  LEU O CD2   1 
ATOM   677   N  N     . LEU A 1  141 ? 156.664 126.457 133.315 1.00 156.72 ? 806  LEU O N     1 
ATOM   678   C  CA    . LEU A 1  141 ? 157.295 126.458 131.999 1.00 158.18 ? 806  LEU O CA    1 
ATOM   679   C  C     . LEU A 1  141 ? 158.337 127.559 131.876 1.00 164.33 ? 806  LEU O C     1 
ATOM   680   O  O     . LEU A 1  141 ? 159.412 127.342 131.310 1.00 163.96 ? 806  LEU O O     1 
ATOM   681   C  CB    . LEU A 1  141 ? 156.242 126.590 130.904 1.00 151.13 ? 806  LEU O CB    1 
ATOM   682   C  CG    . LEU A 1  141 ? 155.394 125.343 130.678 1.00 151.13 ? 806  LEU O CG    1 
ATOM   683   C  CD1   . LEU A 1  141 ? 154.269 125.622 129.710 1.00 151.13 ? 806  LEU O CD1   1 
ATOM   684   C  CD2   . LEU A 1  141 ? 156.277 124.232 130.141 1.00 151.13 ? 806  LEU O CD2   1 
ATOM   685   N  N     . THR A 1  142 ? 158.034 128.746 132.392 1.00 161.90 ? 807  THR O N     1 
ATOM   686   C  CA    . THR A 1  142 ? 158.972 129.856 132.293 1.00 164.62 ? 807  THR O CA    1 
ATOM   687   C  C     . THR A 1  142 ? 160.273 129.562 133.021 1.00 167.56 ? 807  THR O C     1 
ATOM   688   O  O     . THR A 1  142 ? 161.325 130.085 132.641 1.00 168.32 ? 807  THR O O     1 
ATOM   689   C  CB    . THR A 1  142 ? 158.342 131.129 132.850 1.00 146.78 ? 807  THR O CB    1 
ATOM   690   O  OG1   . THR A 1  142 ? 157.956 130.912 134.212 1.00 145.47 ? 807  THR O OG1   1 
ATOM   691   C  CG2   . THR A 1  142 ? 157.123 131.522 132.033 1.00 139.32 ? 807  THR O CG2   1 
ATOM   692   N  N     . TYR A 1  143 ? 160.219 128.775 134.094 1.00 161.69 ? 808  TYR O N     1 
ATOM   693   C  CA    . TYR A 1  143 ? 161.443 128.406 134.795 1.00 167.52 ? 808  TYR O CA    1 
ATOM   694   C  C     . TYR A 1  143 ? 162.157 127.249 134.103 1.00 173.66 ? 808  TYR O C     1 
ATOM   695   O  O     . TYR A 1  143 ? 163.367 127.318 133.857 1.00 171.74 ? 808  TYR O O     1 
ATOM   696   C  CB    . TYR A 1  143 ? 161.124 128.064 136.249 1.00 163.83 ? 808  TYR O CB    1 
ATOM   697   C  CG    . TYR A 1  143 ? 162.324 127.635 137.055 1.00 169.61 ? 808  TYR O CG    1 
ATOM   698   C  CD1   . TYR A 1  143 ? 163.257 128.564 137.493 1.00 175.94 ? 808  TYR O CD1   1 
ATOM   699   C  CD2   . TYR A 1  143 ? 162.514 126.305 137.397 1.00 167.02 ? 808  TYR O CD2   1 
ATOM   700   C  CE1   . TYR A 1  143 ? 164.353 128.177 138.237 1.00 175.49 ? 808  TYR O CE1   1 
ATOM   701   C  CE2   . TYR A 1  143 ? 163.604 125.910 138.144 1.00 168.49 ? 808  TYR O CE2   1 
ATOM   702   C  CZ    . TYR A 1  143 ? 164.521 126.848 138.558 1.00 175.60 ? 808  TYR O CZ    1 
ATOM   703   O  OH    . TYR A 1  143 ? 165.610 126.457 139.300 1.00 175.49 ? 808  TYR O OH    1 
ATOM   704   N  N     . LEU A 1  144 ? 161.418 126.183 133.774 1.00 176.65 ? 809  LEU O N     1 
ATOM   705   C  CA    . LEU A 1  144 ? 162.022 125.031 133.107 1.00 173.02 ? 809  LEU O CA    1 
ATOM   706   C  C     . LEU A 1  144 ? 162.714 125.448 131.824 1.00 174.75 ? 809  LEU O C     1 
ATOM   707   O  O     . LEU A 1  144 ? 163.891 125.144 131.603 1.00 175.92 ? 809  LEU O O     1 
ATOM   708   C  CB    . LEU A 1  144 ? 160.962 123.973 132.799 1.00 170.83 ? 809  LEU O CB    1 
ATOM   709   C  CG    . LEU A 1  144 ? 160.334 123.179 133.941 1.00 174.86 ? 809  LEU O CG    1 
ATOM   710   C  CD1   . LEU A 1  144 ? 159.192 122.320 133.418 1.00 167.47 ? 809  LEU O CD1   1 
ATOM   711   C  CD2   . LEU A 1  144 ? 161.390 122.315 134.613 1.00 167.86 ? 809  LEU O CD2   1 
ATOM   712   N  N     . TYR A 1  145 ? 161.985 126.141 130.964 1.00 168.92 ? 810  TYR O N     1 
ATOM   713   C  CA    . TYR A 1  145 ? 162.475 126.586 129.675 1.00 176.19 ? 810  TYR O CA    1 
ATOM   714   C  C     . TYR A 1  145 ? 162.990 128.013 129.713 1.00 175.64 ? 810  TYR O C     1 
ATOM   715   O  O     . TYR A 1  145 ? 163.278 128.593 128.663 1.00 173.68 ? 810  TYR O O     1 
ATOM   716   C  CB    . TYR A 1  145 ? 161.381 126.372 128.649 1.00 167.18 ? 810  TYR O CB    1 
ATOM   717   C  CG    . TYR A 1  145 ? 161.152 124.892 128.551 1.00 167.18 ? 810  TYR O CG    1 
ATOM   718   C  CD1   . TYR A 1  145 ? 162.223 124.032 128.353 1.00 167.18 ? 810  TYR O CD1   1 
ATOM   719   C  CD2   . TYR A 1  145 ? 159.905 124.341 128.785 1.00 167.18 ? 810  TYR O CD2   1 
ATOM   720   C  CE1   . TYR A 1  145 ? 162.047 122.668 128.296 1.00 167.18 ? 810  TYR O CE1   1 
ATOM   721   C  CE2   . TYR A 1  145 ? 159.716 122.972 128.740 1.00 167.18 ? 810  TYR O CE2   1 
ATOM   722   C  CZ    . TYR A 1  145 ? 160.792 122.139 128.493 1.00 167.18 ? 810  TYR O CZ    1 
ATOM   723   O  OH    . TYR A 1  145 ? 160.612 120.776 128.445 1.00 167.18 ? 810  TYR O OH    1 
ATOM   724   N  N     . GLU A 1  146 ? 163.064 128.604 130.903 1.00 174.17 ? 811  GLU O N     1 
ATOM   725   C  CA    . GLU A 1  146 ? 164.092 129.606 131.140 1.00 164.87 ? 811  GLU O CA    1 
ATOM   726   C  C     . GLU A 1  146 ? 165.451 128.940 131.276 1.00 174.02 ? 811  GLU O C     1 
ATOM   727   O  O     . GLU A 1  146 ? 166.464 129.481 130.823 1.00 167.69 ? 811  GLU O O     1 
ATOM   728   C  CB    . GLU A 1  146 ? 163.778 130.419 132.391 1.00 142.60 ? 811  GLU O CB    1 
ATOM   729   C  CG    . GLU A 1  146 ? 164.806 131.502 132.680 1.00 149.76 ? 811  GLU O CG    1 
ATOM   730   C  CD    . GLU A 1  146 ? 164.468 132.307 133.913 1.00 160.42 ? 811  GLU O CD    1 
ATOM   731   O  OE1   . GLU A 1  146 ? 163.444 132.002 134.549 1.00 163.32 ? 811  GLU O OE1   1 
ATOM   732   O  OE2   . GLU A 1  146 ? 165.227 133.238 134.249 1.00 164.36 ? 811  GLU O OE2   1 
ATOM   733   N  N     . MET A 1  147 ? 165.489 127.760 131.898 1.00 172.54 ? 812  MET O N     1 
ATOM   734   C  CA    . MET A 1  147 ? 166.741 127.010 131.980 1.00 164.81 ? 812  MET O CA    1 
ATOM   735   C  C     . MET A 1  147 ? 167.048 126.336 130.648 1.00 175.11 ? 812  MET O C     1 
ATOM   736   O  O     . MET A 1  147 ? 167.978 126.728 129.938 1.00 171.65 ? 812  MET O O     1 
ATOM   737   C  CB    . MET A 1  147 ? 166.677 125.969 133.101 1.00 174.87 ? 812  MET O CB    1 
ATOM   738   C  CG    . MET A 1  147 ? 166.537 126.532 134.495 1.00 174.87 ? 812  MET O CG    1 
ATOM   739   S  SD    . MET A 1  147 ? 166.704 125.223 135.724 1.00 174.87 ? 812  MET O SD    1 
ATOM   740   C  CE    . MET A 1  147 ? 165.180 124.315 135.483 1.00 174.87 ? 812  MET O CE    1 
ATOM   741   N  N     . LYS A 1  148 ? 166.260 125.322 130.292 1.00 167.94 ? 813  LYS O N     1 
ATOM   742   C  CA    . LYS A 1  148 ? 166.553 124.558 129.087 1.00 163.98 ? 813  LYS O CA    1 
ATOM   743   C  C     . LYS A 1  148 ? 166.414 125.400 127.830 1.00 162.58 ? 813  LYS O C     1 
ATOM   744   O  O     . LYS A 1  148 ? 167.048 125.095 126.814 1.00 168.41 ? 813  LYS O O     1 
ATOM   745   C  CB    . LYS A 1  148 ? 165.638 123.341 128.993 1.00 138.19 ? 813  LYS O CB    1 
ATOM   746   C  CG    . LYS A 1  148 ? 166.159 122.086 129.672 1.00 139.94 ? 813  LYS O CG    1 
ATOM   747   C  CD    . LYS A 1  148 ? 166.139 122.193 131.183 1.00 142.23 ? 813  LYS O CD    1 
ATOM   748   C  CE    . LYS A 1  148 ? 166.594 120.888 131.808 1.00 146.17 ? 813  LYS O CE    1 
ATOM   749   N  NZ    . LYS A 1  148 ? 166.563 120.934 133.293 1.00 145.84 ? 813  LYS O NZ    1 
ATOM   750   N  N     . ASN A 1  149 ? 165.573 126.433 127.863 1.00 164.43 ? 814  ASN O N     1 
ATOM   751   C  CA    . ASN A 1  149 ? 165.286 127.330 126.746 1.00 168.65 ? 814  ASN O CA    1 
ATOM   752   C  C     . ASN A 1  149 ? 164.572 126.629 125.596 1.00 172.79 ? 814  ASN O C     1 
ATOM   753   O  O     . ASN A 1  149 ? 164.203 127.294 124.621 1.00 163.14 ? 814  ASN O O     1 
ATOM   754   C  CB    . ASN A 1  149 ? 166.547 128.023 126.211 1.00 167.22 ? 814  ASN O CB    1 
ATOM   755   C  CG    . ASN A 1  149 ? 167.105 129.035 127.187 1.00 167.22 ? 814  ASN O CG    1 
ATOM   756   O  OD1   . ASN A 1  149 ? 166.379 129.553 128.037 1.00 167.22 ? 814  ASN O OD1   1 
ATOM   757   N  ND2   . ASN A 1  149 ? 168.398 129.321 127.076 1.00 167.22 ? 814  ASN O ND2   1 
ATOM   758   N  N     . ILE A 1  150 ? 164.367 125.312 125.678 1.00 168.13 ? 815  ILE O N     1 
ATOM   759   C  CA    . ILE A 1  150 ? 163.746 124.565 124.589 1.00 165.81 ? 815  ILE O CA    1 
ATOM   760   C  C     . ILE A 1  150 ? 162.389 125.158 124.236 1.00 165.69 ? 815  ILE O C     1 
ATOM   761   O  O     . ILE A 1  150 ? 162.020 125.244 123.059 1.00 162.64 ? 815  ILE O O     1 
ATOM   762   C  CB    . ILE A 1  150 ? 163.635 123.082 124.981 1.00 146.13 ? 815  ILE O CB    1 
ATOM   763   C  CG1   . ILE A 1  150 ? 165.028 122.500 125.224 1.00 146.13 ? 815  ILE O CG1   1 
ATOM   764   C  CG2   . ILE A 1  150 ? 162.915 122.299 123.898 1.00 146.13 ? 815  ILE O CG2   1 
ATOM   765   C  CD1   . ILE A 1  150 ? 165.015 121.136 125.869 1.00 146.13 ? 815  ILE O CD1   1 
ATOM   766   N  N     . ARG A 1  151 ? 161.605 125.512 125.256 1.00 167.86 ? 816  ARG O N     1 
ATOM   767   C  CA    . ARG A 1  151 ? 160.424 126.375 125.194 1.00 175.56 ? 816  ARG O CA    1 
ATOM   768   C  C     . ARG A 1  151 ? 159.259 125.828 124.371 1.00 176.15 ? 816  ARG O C     1 
ATOM   769   O  O     . ARG A 1  151 ? 158.201 126.462 124.320 1.00 175.25 ? 816  ARG O O     1 
ATOM   770   C  CB    . ARG A 1  151 ? 160.796 127.791 124.719 1.00 159.81 ? 816  ARG O CB    1 
ATOM   771   C  CG    . ARG A 1  151 ? 161.147 128.015 123.255 1.00 159.81 ? 816  ARG O CG    1 
ATOM   772   C  CD    . ARG A 1  151 ? 161.276 129.500 123.031 1.00 159.81 ? 816  ARG O CD    1 
ATOM   773   N  NE    . ARG A 1  151 ? 162.279 130.049 123.933 1.00 159.81 ? 816  ARG O NE    1 
ATOM   774   C  CZ    . ARG A 1  151 ? 162.348 131.325 124.286 1.00 159.81 ? 816  ARG O CZ    1 
ATOM   775   N  NH1   . ARG A 1  151 ? 161.467 132.194 123.815 1.00 159.81 ? 816  ARG O NH1   1 
ATOM   776   N  NH2   . ARG A 1  151 ? 163.295 131.730 125.120 1.00 159.81 ? 816  ARG O NH2   1 
ATOM   777   N  N     . GLY A 1  152 ? 159.411 124.674 123.731 1.00 160.80 ? 817  GLY O N     1 
ATOM   778   C  CA    . GLY A 1  152 ? 158.272 124.082 123.047 1.00 159.62 ? 817  GLY O CA    1 
ATOM   779   C  C     . GLY A 1  152 ? 158.508 122.766 122.334 1.00 160.09 ? 817  GLY O C     1 
ATOM   780   O  O     . GLY A 1  152 ? 159.612 122.227 122.378 1.00 171.03 ? 817  GLY O O     1 
ATOM   781   N  N     . PRO A 1  153 ? 157.462 122.230 121.682 1.00 164.62 ? 818  PRO O N     1 
ATOM   782   C  CA    . PRO A 1  153 ? 156.051 122.603 121.804 1.00 152.96 ? 818  PRO O CA    1 
ATOM   783   C  C     . PRO A 1  153 ? 155.414 122.028 123.059 1.00 161.33 ? 818  PRO O C     1 
ATOM   784   O  O     . PRO A 1  153 ? 155.679 120.872 123.382 1.00 160.52 ? 818  PRO O O     1 
ATOM   785   C  CB    . PRO A 1  153 ? 155.412 121.974 120.563 1.00 162.56 ? 818  PRO O CB    1 
ATOM   786   C  CG    . PRO A 1  153 ? 156.543 121.717 119.634 1.00 163.63 ? 818  PRO O CG    1 
ATOM   787   C  CD    . PRO A 1  153 ? 157.664 121.324 120.541 1.00 161.67 ? 818  PRO O CD    1 
ATOM   788   N  N     . TYR A 1  154 ? 154.565 122.798 123.737 1.00 150.28 ? 819  TYR O N     1 
ATOM   789   C  CA    . TYR A 1  154 ? 153.834 122.285 124.886 1.00 144.09 ? 819  TYR O CA    1 
ATOM   790   C  C     . TYR A 1  154 ? 152.490 122.986 124.945 1.00 152.03 ? 819  TYR O C     1 
ATOM   791   O  O     . TYR A 1  154 ? 152.404 124.187 124.686 1.00 153.56 ? 819  TYR O O     1 
ATOM   792   C  CB    . TYR A 1  154 ? 154.599 122.500 126.196 1.00 162.00 ? 819  TYR O CB    1 
ATOM   793   C  CG    . TYR A 1  154 ? 155.971 121.880 126.183 1.00 164.85 ? 819  TYR O CG    1 
ATOM   794   C  CD1   . TYR A 1  154 ? 156.151 120.531 126.427 1.00 160.33 ? 819  TYR O CD1   1 
ATOM   795   C  CD2   . TYR A 1  154 ? 157.089 122.649 125.924 1.00 163.36 ? 819  TYR O CD2   1 
ATOM   796   C  CE1   . TYR A 1  154 ? 157.406 119.968 126.408 1.00 161.76 ? 819  TYR O CE1   1 
ATOM   797   C  CE2   . TYR A 1  154 ? 158.343 122.094 125.899 1.00 163.50 ? 819  TYR O CE2   1 
ATOM   798   C  CZ    . TYR A 1  154 ? 158.500 120.755 126.147 1.00 166.75 ? 819  TYR O CZ    1 
ATOM   799   O  OH    . TYR A 1  154 ? 159.766 120.217 126.124 1.00 174.36 ? 819  TYR O OH    1 
ATOM   800   N  N     . LEU A 1  155 ? 151.448 122.240 125.300 1.00 147.08 ? 820  LEU O N     1 
ATOM   801   C  CA    . LEU A 1  155 ? 150.087 122.742 125.237 1.00 147.52 ? 820  LEU O CA    1 
ATOM   802   C  C     . LEU A 1  155 ? 149.393 122.591 126.581 1.00 155.04 ? 820  LEU O C     1 
ATOM   803   O  O     . LEU A 1  155 ? 149.675 121.667 127.345 1.00 152.06 ? 820  LEU O O     1 
ATOM   804   C  CB    . LEU A 1  155 ? 149.285 122.011 124.153 1.00 132.79 ? 820  LEU O CB    1 
ATOM   805   C  CG    . LEU A 1  155 ? 149.035 120.511 124.309 1.00 142.34 ? 820  LEU O CG    1 
ATOM   806   C  CD1   . LEU A 1  155 ? 147.784 120.223 125.116 1.00 135.83 ? 820  LEU O CD1   1 
ATOM   807   C  CD2   . LEU A 1  155 ? 148.970 119.831 122.964 1.00 137.56 ? 820  LEU O CD2   1 
ATOM   808   N  N     . VAL A 1  156 ? 148.478 123.512 126.856 1.00 136.51 ? 821  VAL O N     1 
ATOM   809   C  CA    . VAL A 1  156 ? 147.566 123.397 127.982 1.00 139.09 ? 821  VAL O CA    1 
ATOM   810   C  C     . VAL A 1  156 ? 146.159 123.437 127.420 1.00 139.75 ? 821  VAL O C     1 
ATOM   811   O  O     . VAL A 1  156 ? 145.904 124.051 126.381 1.00 139.01 ? 821  VAL O O     1 
ATOM   812   C  CB    . VAL A 1  156 ? 147.755 124.509 129.033 1.00 148.62 ? 821  VAL O CB    1 
ATOM   813   C  CG1   . VAL A 1  156 ? 149.170 124.508 129.558 1.00 144.77 ? 821  VAL O CG1   1 
ATOM   814   C  CG2   . VAL A 1  156 ? 147.403 125.853 128.456 1.00 142.25 ? 821  VAL O CG2   1 
ATOM   815   N  N     . ILE A 1  157 ? 145.246 122.770 128.109 1.00 126.61 ? 822  ILE O N     1 
ATOM   816   C  CA    . ILE A 1  157 ? 143.860 122.651 127.686 1.00 123.66 ? 822  ILE O CA    1 
ATOM   817   C  C     . ILE A 1  157 ? 142.989 123.025 128.873 1.00 135.41 ? 822  ILE O C     1 
ATOM   818   O  O     . ILE A 1  157 ? 142.986 122.327 129.891 1.00 130.29 ? 822  ILE O O     1 
ATOM   819   C  CB    . ILE A 1  157 ? 143.543 121.243 127.173 1.00 121.47 ? 822  ILE O CB    1 
ATOM   820   C  CG1   . ILE A 1  157 ? 142.048 121.083 126.941 1.00 122.88 ? 822  ILE O CG1   1 
ATOM   821   C  CG2   . ILE A 1  157 ? 144.121 120.186 128.080 1.00 124.86 ? 822  ILE O CG2   1 
ATOM   822   C  CD1   . ILE A 1  157 ? 141.685 119.793 126.245 1.00 110.96 ? 822  ILE O CD1   1 
ATOM   823   N  N     . VAL A 1  158 ? 142.245 124.114 128.746 1.00 118.30 ? 823  VAL O N     1 
ATOM   824   C  CA    . VAL A 1  158 ? 141.663 124.762 129.915 1.00 123.11 ? 823  VAL O CA    1 
ATOM   825   C  C     . VAL A 1  158 ? 140.160 124.905 129.739 1.00 126.05 ? 823  VAL O C     1 
ATOM   826   O  O     . VAL A 1  158 ? 139.648 124.746 128.625 1.00 127.32 ? 823  VAL O O     1 
ATOM   827   C  CB    . VAL A 1  158 ? 142.295 126.136 130.151 1.00 144.48 ? 823  VAL O CB    1 
ATOM   828   C  CG1   . VAL A 1  158 ? 143.783 126.000 130.399 1.00 144.35 ? 823  VAL O CG1   1 
ATOM   829   C  CG2   . VAL A 1  158 ? 142.013 127.027 128.972 1.00 135.44 ? 823  VAL O CG2   1 
ATOM   830   N  N     . PRO A 1  159 ? 139.422 125.194 130.804 1.00 117.89 ? 824  PRO O N     1 
ATOM   831   C  CA    . PRO A 1  159 ? 137.976 125.374 130.671 1.00 122.02 ? 824  PRO O CA    1 
ATOM   832   C  C     . PRO A 1  159 ? 137.599 126.561 129.800 1.00 118.70 ? 824  PRO O C     1 
ATOM   833   O  O     . PRO A 1  159 ? 138.132 127.661 129.938 1.00 118.53 ? 824  PRO O O     1 
ATOM   834   C  CB    . PRO A 1  159 ? 137.522 125.579 132.117 1.00 130.04 ? 824  PRO O CB    1 
ATOM   835   C  CG    . PRO A 1  159 ? 138.505 124.814 132.895 1.00 133.86 ? 824  PRO O CG    1 
ATOM   836   C  CD    . PRO A 1  159 ? 139.815 125.037 132.210 1.00 127.70 ? 824  PRO O CD    1 
ATOM   837   N  N     . LEU A 1  160 ? 136.627 126.327 128.923 1.00 90.46  ? 825  LEU O N     1 
ATOM   838   C  CA    . LEU A 1  160 ? 136.072 127.384 128.094 1.00 93.21  ? 825  LEU O CA    1 
ATOM   839   C  C     . LEU A 1  160 ? 135.537 128.552 128.892 1.00 95.65  ? 825  LEU O C     1 
ATOM   840   O  O     . LEU A 1  160 ? 135.276 129.608 128.314 1.00 96.27  ? 825  LEU O O     1 
ATOM   841   C  CB    . LEU A 1  160 ? 134.964 126.815 127.239 1.00 119.47 ? 825  LEU O CB    1 
ATOM   842   C  CG    . LEU A 1  160 ? 135.568 126.050 126.092 1.00 111.01 ? 825  LEU O CG    1 
ATOM   843   C  CD1   . LEU A 1  160 ? 134.553 125.123 125.492 1.00 115.27 ? 825  LEU O CD1   1 
ATOM   844   C  CD2   . LEU A 1  160 ? 135.912 127.130 125.111 1.00 111.21 ? 825  LEU O CD2   1 
ATOM   845   N  N     . SER A 1  161 ? 135.305 128.381 130.185 1.00 107.50 ? 826  SER O N     1 
ATOM   846   C  CA    . SER A 1  161 ? 134.972 129.548 130.982 1.00 111.96 ? 826  SER O CA    1 
ATOM   847   C  C     . SER A 1  161 ? 136.194 130.420 131.201 1.00 113.19 ? 826  SER O C     1 
ATOM   848   O  O     . SER A 1  161 ? 136.092 131.650 131.177 1.00 113.70 ? 826  SER O O     1 
ATOM   849   C  CB    . SER A 1  161 ? 134.379 129.131 132.318 1.00 125.84 ? 826  SER O CB    1 
ATOM   850   O  OG    . SER A 1  161 ? 133.131 128.501 132.136 1.00 135.51 ? 826  SER O OG    1 
ATOM   851   N  N     . THR A 1  162 ? 137.354 129.806 131.407 1.00 122.19 ? 827  THR O N     1 
ATOM   852   C  CA    . THR A 1  162 ? 138.592 130.548 131.607 1.00 120.30 ? 827  THR O CA    1 
ATOM   853   C  C     . THR A 1  162 ? 139.431 130.390 130.353 1.00 112.97 ? 827  THR O C     1 
ATOM   854   O  O     . THR A 1  162 ? 140.094 129.370 130.161 1.00 123.37 ? 827  THR O O     1 
ATOM   855   C  CB    . THR A 1  162 ? 139.346 130.016 132.815 1.00 128.21 ? 827  THR O CB    1 
ATOM   856   O  OG1   . THR A 1  162 ? 139.684 128.645 132.576 1.00 130.47 ? 827  THR O OG1   1 
ATOM   857   C  CG2   . THR A 1  162 ? 138.479 130.095 134.039 1.00 131.11 ? 827  THR O CG2   1 
ATOM   858   N  N     . LEU A 1  163 ? 139.447 131.417 129.521 1.00 119.48 ? 828  LEU O N     1 
ATOM   859   C  CA    . LEU A 1  163 ? 140.345 131.374 128.384 1.00 125.90 ? 828  LEU O CA    1 
ATOM   860   C  C     . LEU A 1  163 ? 141.022 132.729 128.287 1.00 127.90 ? 828  LEU O C     1 
ATOM   861   O  O     . LEU A 1  163 ? 142.235 132.841 128.480 1.00 122.44 ? 828  LEU O O     1 
ATOM   862   C  CB    . LEU A 1  163 ? 139.581 130.989 127.119 1.00 122.67 ? 828  LEU O CB    1 
ATOM   863   C  CG    . LEU A 1  163 ? 140.347 130.629 125.842 1.00 135.01 ? 828  LEU O CG    1 
ATOM   864   C  CD1   . LEU A 1  163 ? 141.046 131.797 125.162 1.00 131.78 ? 828  LEU O CD1   1 
ATOM   865   C  CD2   . LEU A 1  163 ? 141.312 129.482 126.132 1.00 147.52 ? 828  LEU O CD2   1 
ATOM   866   N  N     . SER A 1  164 ? 140.232 133.767 127.998 1.00 146.47 ? 829  SER O N     1 
ATOM   867   C  CA    . SER A 1  164 ? 140.757 135.125 127.989 1.00 144.36 ? 829  SER O CA    1 
ATOM   868   C  C     . SER A 1  164 ? 141.360 135.507 129.328 1.00 144.51 ? 829  SER O C     1 
ATOM   869   O  O     . SER A 1  164 ? 142.172 136.434 129.386 1.00 149.84 ? 829  SER O O     1 
ATOM   870   C  CB    . SER A 1  164 ? 139.659 136.121 127.633 1.00 157.83 ? 829  SER O CB    1 
ATOM   871   O  OG    . SER A 1  164 ? 138.670 136.138 128.644 1.00 157.73 ? 829  SER O OG    1 
ATOM   872   N  N     . ASN A 1  165 ? 140.956 134.841 130.406 1.00 135.78 ? 830  ASN O N     1 
ATOM   873   C  CA    . ASN A 1  165 ? 141.683 134.957 131.658 1.00 146.66 ? 830  ASN O CA    1 
ATOM   874   C  C     . ASN A 1  165 ? 143.127 134.544 131.425 1.00 146.19 ? 830  ASN O C     1 
ATOM   875   O  O     . ASN A 1  165 ? 144.038 135.375 131.501 1.00 146.93 ? 830  ASN O O     1 
ATOM   876   C  CB    . ASN A 1  165 ? 141.052 134.088 132.740 1.00 125.96 ? 830  ASN O CB    1 
ATOM   877   C  CG    . ASN A 1  165 ? 141.607 134.388 134.104 1.00 135.33 ? 830  ASN O CG    1 
ATOM   878   O  OD1   . ASN A 1  165 ? 141.953 135.528 134.397 1.00 139.36 ? 830  ASN O OD1   1 
ATOM   879   N  ND2   . ASN A 1  165 ? 141.717 133.366 134.944 1.00 133.47 ? 830  ASN O ND2   1 
ATOM   880   N  N     . TRP A 1  166 ? 143.329 133.261 131.109 1.00 134.79 ? 831  TRP O N     1 
ATOM   881   C  CA    . TRP A 1  166 ? 144.668 132.741 130.850 1.00 140.47 ? 831  TRP O CA    1 
ATOM   882   C  C     . TRP A 1  166 ? 145.439 133.641 129.903 1.00 138.97 ? 831  TRP O C     1 
ATOM   883   O  O     . TRP A 1  166 ? 146.635 133.876 130.093 1.00 150.66 ? 831  TRP O O     1 
ATOM   884   C  CB    . TRP A 1  166 ? 144.577 131.341 130.260 1.00 144.61 ? 831  TRP O CB    1 
ATOM   885   C  CG    . TRP A 1  166 ? 144.098 130.312 131.208 1.00 150.88 ? 831  TRP O CG    1 
ATOM   886   C  CD1   . TRP A 1  166 ? 142.804 129.984 131.464 1.00 144.37 ? 831  TRP O CD1   1 
ATOM   887   C  CD2   . TRP A 1  166 ? 144.900 129.416 131.983 1.00 150.65 ? 831  TRP O CD2   1 
ATOM   888   N  NE1   . TRP A 1  166 ? 142.746 128.961 132.378 1.00 147.53 ? 831  TRP O NE1   1 
ATOM   889   C  CE2   . TRP A 1  166 ? 144.022 128.592 132.709 1.00 151.54 ? 831  TRP O CE2   1 
ATOM   890   C  CE3   . TRP A 1  166 ? 146.273 129.237 132.143 1.00 153.03 ? 831  TRP O CE3   1 
ATOM   891   C  CZ2   . TRP A 1  166 ? 144.471 127.608 133.580 1.00 155.72 ? 831  TRP O CZ2   1 
ATOM   892   C  CZ3   . TRP A 1  166 ? 146.716 128.260 133.008 1.00 151.55 ? 831  TRP O CZ3   1 
ATOM   893   C  CH2   . TRP A 1  166 ? 145.819 127.459 133.716 1.00 144.30 ? 831  TRP O CH2   1 
ATOM   894   N  N     . SER A 1  167 ? 144.768 134.156 128.876 1.00 136.85 ? 832  SER O N     1 
ATOM   895   C  CA    . SER A 1  167 ? 145.405 135.130 128.003 1.00 137.13 ? 832  SER O CA    1 
ATOM   896   C  C     . SER A 1  167 ? 145.780 136.394 128.762 1.00 140.30 ? 832  SER O C     1 
ATOM   897   O  O     . SER A 1  167 ? 146.779 137.042 128.433 1.00 137.34 ? 832  SER O O     1 
ATOM   898   C  CB    . SER A 1  167 ? 144.477 135.460 126.838 1.00 136.80 ? 832  SER O CB    1 
ATOM   899   O  OG    . SER A 1  167 ? 145.046 136.450 126.004 1.00 144.72 ? 832  SER O OG    1 
ATOM   900   N  N     . SER A 1  168 ? 144.997 136.760 129.778 1.00 157.82 ? 833  SER O N     1 
ATOM   901   C  CA    . SER A 1  168 ? 145.294 137.968 130.539 1.00 159.35 ? 833  SER O CA    1 
ATOM   902   C  C     . SER A 1  168 ? 146.535 137.780 131.395 1.00 155.29 ? 833  SER O C     1 
ATOM   903   O  O     . SER A 1  168 ? 147.475 138.582 131.330 1.00 158.92 ? 833  SER O O     1 
ATOM   904   C  CB    . SER A 1  168 ? 144.095 138.359 131.405 1.00 159.94 ? 833  SER O CB    1 
ATOM   905   O  OG    . SER A 1  168 ? 144.389 139.485 132.212 1.00 160.44 ? 833  SER O OG    1 
ATOM   906   N  N     . GLU A 1  169 ? 146.561 136.724 132.209 1.00 161.98 ? 834  GLU O N     1 
ATOM   907   C  CA    . GLU A 1  169 ? 147.760 136.478 132.998 1.00 169.74 ? 834  GLU O CA    1 
ATOM   908   C  C     . GLU A 1  169 ? 148.970 136.270 132.103 1.00 168.86 ? 834  GLU O C     1 
ATOM   909   O  O     . GLU A 1  169 ? 150.045 136.819 132.366 1.00 167.27 ? 834  GLU O O     1 
ATOM   910   C  CB    . GLU A 1  169 ? 147.565 135.294 133.940 1.00 143.89 ? 834  GLU O CB    1 
ATOM   911   C  CG    . GLU A 1  169 ? 146.682 135.628 135.124 1.00 157.96 ? 834  GLU O CG    1 
ATOM   912   C  CD    . GLU A 1  169 ? 145.226 135.318 134.891 1.00 181.88 ? 834  GLU O CD    1 
ATOM   913   O  OE1   . GLU A 1  169 ? 144.903 134.739 133.839 1.00 190.89 ? 834  GLU O OE1   1 
ATOM   914   O  OE2   . GLU A 1  169 ? 144.403 135.666 135.760 1.00 182.69 ? 834  GLU O OE2   1 
ATOM   915   N  N     . PHE A 1  170 ? 148.811 135.512 131.022 1.00 151.99 ? 835  PHE O N     1 
ATOM   916   C  CA    . PHE A 1  170 ? 149.893 135.414 130.055 1.00 151.83 ? 835  PHE O CA    1 
ATOM   917   C  C     . PHE A 1  170 ? 150.272 136.763 129.483 1.00 163.30 ? 835  PHE O C     1 
ATOM   918   O  O     . PHE A 1  170 ? 151.388 136.914 128.982 1.00 164.45 ? 835  PHE O O     1 
ATOM   919   C  CB    . PHE A 1  170 ? 149.513 134.478 128.921 1.00 137.49 ? 835  PHE O CB    1 
ATOM   920   C  CG    . PHE A 1  170 ? 149.396 133.065 129.342 1.00 140.10 ? 835  PHE O CG    1 
ATOM   921   C  CD1   . PHE A 1  170 ? 150.012 132.628 130.500 1.00 142.26 ? 835  PHE O CD1   1 
ATOM   922   C  CD2   . PHE A 1  170 ? 148.667 132.168 128.588 1.00 144.57 ? 835  PHE O CD2   1 
ATOM   923   C  CE1   . PHE A 1  170 ? 149.905 131.321 130.894 1.00 140.74 ? 835  PHE O CE1   1 
ATOM   924   C  CE2   . PHE A 1  170 ? 148.554 130.859 128.977 1.00 144.10 ? 835  PHE O CE2   1 
ATOM   925   C  CZ    . PHE A 1  170 ? 149.175 130.432 130.131 1.00 149.64 ? 835  PHE O CZ    1 
ATOM   926   N  N     . ALA A 1  171 ? 149.366 137.737 129.506 1.00 163.43 ? 836  ALA O N     1 
ATOM   927   C  CA    . ALA A 1  171 ? 149.752 139.074 129.079 1.00 160.65 ? 836  ALA O CA    1 
ATOM   928   C  C     . ALA A 1  171 ? 150.621 139.752 130.130 1.00 157.59 ? 836  ALA O C     1 
ATOM   929   O  O     . ALA A 1  171 ? 151.765 140.132 129.856 1.00 164.51 ? 836  ALA O O     1 
ATOM   930   C  CB    . ALA A 1  171 ? 148.510 139.913 128.773 1.00 131.09 ? 836  ALA O CB    1 
ATOM   931   N  N     . LYS A 1  172 ? 150.106 139.898 131.349 1.00 166.09 ? 837  LYS O N     1 
ATOM   932   C  CA    . LYS A 1  172 ? 150.822 140.716 132.317 1.00 166.58 ? 837  LYS O CA    1 
ATOM   933   C  C     . LYS A 1  172 ? 151.769 139.938 133.216 1.00 162.57 ? 837  LYS O C     1 
ATOM   934   O  O     . LYS A 1  172 ? 152.624 140.555 133.860 1.00 171.42 ? 837  LYS O O     1 
ATOM   935   C  CB    . LYS A 1  172 ? 149.829 141.488 133.191 1.00 139.83 ? 837  LYS O CB    1 
ATOM   936   C  CG    . LYS A 1  172 ? 148.931 140.612 134.040 1.00 164.99 ? 837  LYS O CG    1 
ATOM   937   C  CD    . LYS A 1  172 ? 147.937 141.450 134.826 1.00 170.73 ? 837  LYS O CD    1 
ATOM   938   C  CE    . LYS A 1  172 ? 147.002 140.576 135.639 1.00 185.48 ? 837  LYS O CE    1 
ATOM   939   N  NZ    . LYS A 1  172 ? 145.994 141.387 136.371 1.00 187.35 ? 837  LYS O NZ    1 
ATOM   940   N  N     . TRP A 1  173 ? 151.640 138.619 133.304 1.00 154.57 ? 838  TRP O N     1 
ATOM   941   C  CA    . TRP A 1  173 ? 152.517 137.844 134.173 1.00 165.34 ? 838  TRP O CA    1 
ATOM   942   C  C     . TRP A 1  173 ? 153.624 137.100 133.435 1.00 159.80 ? 838  TRP O C     1 
ATOM   943   O  O     . TRP A 1  173 ? 154.383 136.372 134.079 1.00 158.83 ? 838  TRP O O     1 
ATOM   944   C  CB    . TRP A 1  173 ? 151.692 136.905 135.053 1.00 180.28 ? 838  TRP O CB    1 
ATOM   945   C  CG    . TRP A 1  173 ? 150.908 137.706 136.050 1.00 180.36 ? 838  TRP O CG    1 
ATOM   946   C  CD1   . TRP A 1  173 ? 150.952 139.060 136.211 1.00 183.90 ? 838  TRP O CD1   1 
ATOM   947   C  CD2   . TRP A 1  173 ? 149.980 137.220 137.026 1.00 185.80 ? 838  TRP O CD2   1 
ATOM   948   N  NE1   . TRP A 1  173 ? 150.103 139.450 137.215 1.00 183.73 ? 838  TRP O NE1   1 
ATOM   949   C  CE2   . TRP A 1  173 ? 149.495 138.339 137.736 1.00 183.82 ? 838  TRP O CE2   1 
ATOM   950   C  CE3   . TRP A 1  173 ? 149.508 135.950 137.369 1.00 188.25 ? 838  TRP O CE3   1 
ATOM   951   C  CZ2   . TRP A 1  173 ? 148.564 138.227 138.767 1.00 179.51 ? 838  TRP O CZ2   1 
ATOM   952   C  CZ3   . TRP A 1  173 ? 148.578 135.841 138.395 1.00 186.10 ? 838  TRP O CZ3   1 
ATOM   953   C  CH2   . TRP A 1  173 ? 148.119 136.973 139.082 1.00 189.57 ? 838  TRP O CH2   1 
ATOM   954   N  N     . ALA A 1  174 ? 153.734 137.267 132.109 1.00 157.46 ? 839  ALA O N     1 
ATOM   955   C  CA    . ALA A 1  174 ? 154.967 136.974 131.382 1.00 155.21 ? 839  ALA O CA    1 
ATOM   956   C  C     . ALA A 1  174 ? 154.842 137.366 129.917 1.00 146.54 ? 839  ALA O C     1 
ATOM   957   O  O     . ALA A 1  174 ? 153.965 136.868 129.207 1.00 151.47 ? 839  ALA O O     1 
ATOM   958   C  CB    . ALA A 1  174 ? 155.306 135.484 131.459 1.00 131.76 ? 839  ALA O CB    1 
ATOM   959   N  N     . PRO A 1  175 ? 155.737 138.210 129.420 1.00 172.17 ? 840  PRO O N     1 
ATOM   960   C  CA    . PRO A 1  175 ? 155.725 138.560 127.996 1.00 168.00 ? 840  PRO O CA    1 
ATOM   961   C  C     . PRO A 1  175 ? 156.403 137.555 127.080 1.00 173.20 ? 840  PRO O C     1 
ATOM   962   O  O     . PRO A 1  175 ? 155.980 137.372 125.934 1.00 183.01 ? 840  PRO O O     1 
ATOM   963   C  CB    . PRO A 1  175 ? 156.460 139.904 127.971 1.00 158.15 ? 840  PRO O CB    1 
ATOM   964   C  CG    . PRO A 1  175 ? 157.401 139.824 129.121 1.00 168.79 ? 840  PRO O CG    1 
ATOM   965   C  CD    . PRO A 1  175 ? 156.719 139.001 130.180 1.00 164.54 ? 840  PRO O CD    1 
ATOM   966   N  N     . THR A 1  176 ? 157.452 136.894 127.570 1.00 163.51 ? 841  THR O N     1 
ATOM   967   C  CA    . THR A 1  176 ? 158.409 136.282 126.654 1.00 169.60 ? 841  THR O CA    1 
ATOM   968   C  C     . THR A 1  176 ? 157.837 135.052 125.974 1.00 174.95 ? 841  THR O C     1 
ATOM   969   O  O     . THR A 1  176 ? 158.224 134.730 124.845 1.00 177.52 ? 841  THR O O     1 
ATOM   970   C  CB    . THR A 1  176 ? 159.696 135.904 127.387 1.00 165.52 ? 841  THR O CB    1 
ATOM   971   O  OG1   . THR A 1  176 ? 159.406 134.918 128.383 1.00 165.52 ? 841  THR O OG1   1 
ATOM   972   C  CG2   . THR A 1  176 ? 160.315 137.124 128.051 1.00 165.52 ? 841  THR O CG2   1 
ATOM   973   N  N     . LEU A 1  177 ? 156.929 134.356 126.636 1.00 170.12 ? 842  LEU O N     1 
ATOM   974   C  CA    . LEU A 1  177 ? 156.377 133.114 126.118 1.00 169.63 ? 842  LEU O CA    1 
ATOM   975   C  C     . LEU A 1  177 ? 154.944 133.379 125.675 1.00 168.17 ? 842  LEU O C     1 
ATOM   976   O  O     . LEU A 1  177 ? 154.056 133.595 126.508 1.00 172.26 ? 842  LEU O O     1 
ATOM   977   C  CB    . LEU A 1  177 ? 156.464 132.015 127.171 1.00 165.11 ? 842  LEU O CB    1 
ATOM   978   C  CG    . LEU A 1  177 ? 157.922 131.791 127.590 1.00 165.11 ? 842  LEU O CG    1 
ATOM   979   C  CD1   . LEU A 1  177 ? 158.043 130.698 128.635 1.00 165.11 ? 842  LEU O CD1   1 
ATOM   980   C  CD2   . LEU A 1  177 ? 158.813 131.507 126.388 1.00 165.11 ? 842  LEU O CD2   1 
ATOM   981   N  N     . ARG A 1  178 ? 154.727 133.369 124.362 1.00 163.24 ? 843  ARG O N     1 
ATOM   982   C  CA    . ARG A 1  178 ? 153.424 133.628 123.779 1.00 159.03 ? 843  ARG O CA    1 
ATOM   983   C  C     . ARG A 1  178 ? 152.746 132.309 123.429 1.00 168.26 ? 843  ARG O C     1 
ATOM   984   O  O     . ARG A 1  178 ? 153.318 131.226 123.563 1.00 170.71 ? 843  ARG O O     1 
ATOM   985   C  CB    . ARG A 1  178 ? 153.562 134.523 122.548 1.00 157.54 ? 843  ARG O CB    1 
ATOM   986   C  CG    . ARG A 1  178 ? 154.010 135.933 122.853 1.00 157.54 ? 843  ARG O CG    1 
ATOM   987   C  CD    . ARG A 1  178 ? 154.216 136.711 121.572 1.00 157.54 ? 843  ARG O CD    1 
ATOM   988   N  NE    . ARG A 1  178 ? 154.605 138.093 121.829 1.00 157.54 ? 843  ARG O NE    1 
ATOM   989   C  CZ    . ARG A 1  178 ? 155.846 138.482 122.102 1.00 157.54 ? 843  ARG O CZ    1 
ATOM   990   N  NH1   . ARG A 1  178 ? 156.821 137.587 122.164 1.00 157.54 ? 843  ARG O NH1   1 
ATOM   991   N  NH2   . ARG A 1  178 ? 156.110 139.763 122.317 1.00 157.54 ? 843  ARG O NH2   1 
ATOM   992   N  N     . THR A 1  179 ? 151.509 132.403 122.959 1.00 162.08 ? 844  THR O N     1 
ATOM   993   C  CA    . THR A 1  179 ? 150.685 131.225 122.751 1.00 154.88 ? 844  THR O CA    1 
ATOM   994   C  C     . THR A 1  179 ? 149.785 131.460 121.546 1.00 161.08 ? 844  THR O C     1 
ATOM   995   O  O     . THR A 1  179 ? 149.935 132.440 120.810 1.00 168.08 ? 844  THR O O     1 
ATOM   996   C  CB    . THR A 1  179 ? 149.840 130.910 123.992 1.00 152.45 ? 844  THR O CB    1 
ATOM   997   O  OG1   . THR A 1  179 ? 149.035 132.050 124.316 1.00 152.45 ? 844  THR O OG1   1 
ATOM   998   C  CG2   . THR A 1  179 ? 150.705 130.536 125.188 1.00 152.45 ? 844  THR O CG2   1 
ATOM   999   N  N     . ILE A 1  180 ? 148.838 130.549 121.361 1.00 161.60 ? 845  ILE O N     1 
ATOM   1000  C  CA    . ILE A 1  180 ? 147.821 130.644 120.325 1.00 159.77 ? 845  ILE O CA    1 
ATOM   1001  C  C     . ILE A 1  180 ? 146.550 130.007 120.871 1.00 158.76 ? 845  ILE O C     1 
ATOM   1002  O  O     . ILE A 1  180 ? 146.607 129.024 121.613 1.00 155.08 ? 845  ILE O O     1 
ATOM   1003  C  CB    . ILE A 1  180 ? 148.302 129.978 119.019 1.00 151.29 ? 845  ILE O CB    1 
ATOM   1004  C  CG1   . ILE A 1  180 ? 147.249 130.125 117.925 1.00 151.29 ? 845  ILE O CG1   1 
ATOM   1005  C  CG2   . ILE A 1  180 ? 148.676 128.525 119.255 1.00 151.29 ? 845  ILE O CG2   1 
ATOM   1006  C  CD1   . ILE A 1  180 ? 147.726 129.700 116.564 1.00 151.29 ? 845  ILE O CD1   1 
ATOM   1007  N  N     . SER A 1  181 ? 145.405 130.576 120.517 1.00 140.83 ? 846  SER O N     1 
ATOM   1008  C  CA    . SER A 1  181 ? 144.122 130.153 121.054 1.00 144.26 ? 846  SER O CA    1 
ATOM   1009  C  C     . SER A 1  181 ? 143.265 129.526 119.961 1.00 141.13 ? 846  SER O C     1 
ATOM   1010  O  O     . SER A 1  181 ? 143.645 129.463 118.790 1.00 149.70 ? 846  SER O O     1 
ATOM   1011  C  CB    . SER A 1  181 ? 143.396 131.337 121.691 1.00 127.31 ? 846  SER O CB    1 
ATOM   1012  O  OG    . SER A 1  181 ? 142.106 130.957 122.132 1.00 122.34 ? 846  SER O OG    1 
ATOM   1013  N  N     . PHE A 1  182 ? 142.099 129.032 120.368 1.00 126.70 ? 847  PHE O N     1 
ATOM   1014  C  CA    . PHE A 1  182 ? 141.089 128.560 119.432 1.00 132.51 ? 847  PHE O CA    1 
ATOM   1015  C  C     . PHE A 1  182 ? 139.722 128.993 119.926 1.00 130.95 ? 847  PHE O C     1 
ATOM   1016  O  O     . PHE A 1  182 ? 139.272 128.527 120.974 1.00 134.86 ? 847  PHE O O     1 
ATOM   1017  C  CB    . PHE A 1  182 ? 141.156 127.048 119.299 1.00 134.74 ? 847  PHE O CB    1 
ATOM   1018  C  CG    . PHE A 1  182 ? 142.463 126.558 118.786 1.00 134.74 ? 847  PHE O CG    1 
ATOM   1019  C  CD1   . PHE A 1  182 ? 142.701 126.469 117.434 1.00 134.74 ? 847  PHE O CD1   1 
ATOM   1020  C  CD2   . PHE A 1  182 ? 143.465 126.214 119.659 1.00 134.74 ? 847  PHE O CD2   1 
ATOM   1021  C  CE1   . PHE A 1  182 ? 143.898 126.012 116.962 1.00 134.74 ? 847  PHE O CE1   1 
ATOM   1022  C  CE2   . PHE A 1  182 ? 144.673 125.773 119.194 1.00 134.74 ? 847  PHE O CE2   1 
ATOM   1023  C  CZ    . PHE A 1  182 ? 144.891 125.671 117.842 1.00 134.74 ? 847  PHE O CZ    1 
ATOM   1024  N  N     . LYS A 1  183 ? 139.050 129.844 119.159 1.00 137.22 ? 848  LYS O N     1 
ATOM   1025  C  CA    . LYS A 1  183 ? 137.725 130.334 119.516 1.00 134.42 ? 848  LYS O CA    1 
ATOM   1026  C  C     . LYS A 1  183 ? 136.998 130.753 118.251 1.00 146.08 ? 848  LYS O C     1 
ATOM   1027  O  O     . LYS A 1  183 ? 137.594 130.889 117.181 1.00 153.12 ? 848  LYS O O     1 
ATOM   1028  C  CB    . LYS A 1  183 ? 137.769 131.525 120.478 1.00 129.29 ? 848  LYS O CB    1 
ATOM   1029  C  CG    . LYS A 1  183 ? 138.197 131.240 121.893 1.00 144.59 ? 848  LYS O CG    1 
ATOM   1030  C  CD    . LYS A 1  183 ? 138.110 132.511 122.712 1.00 156.37 ? 848  LYS O CD    1 
ATOM   1031  C  CE    . LYS A 1  183 ? 138.992 133.581 122.101 1.00 158.13 ? 848  LYS O CE    1 
ATOM   1032  N  NZ    . LYS A 1  183 ? 140.416 133.149 122.040 1.00 152.26 ? 848  LYS O NZ    1 
ATOM   1033  N  N     . GLY A 1  184 ? 135.690 130.959 118.396 1.00 139.35 ? 849  GLY O N     1 
ATOM   1034  C  CA    . GLY A 1  184 ? 134.922 131.585 117.345 1.00 148.77 ? 849  GLY O CA    1 
ATOM   1035  C  C     . GLY A 1  184 ? 134.729 130.662 116.160 1.00 150.65 ? 849  GLY O C     1 
ATOM   1036  O  O     . GLY A 1  184 ? 134.636 129.442 116.290 1.00 140.64 ? 849  GLY O O     1 
ATOM   1037  N  N     . SER A 1  185 ? 134.686 131.261 114.979 1.00 145.56 ? 850  SER O N     1 
ATOM   1038  C  CA    . SER A 1  185 ? 134.330 130.508 113.794 1.00 144.37 ? 850  SER O CA    1 
ATOM   1039  C  C     . SER A 1  185 ? 135.456 129.566 113.375 1.00 139.46 ? 850  SER O C     1 
ATOM   1040  O  O     . SER A 1  185 ? 136.639 129.832 113.625 1.00 136.36 ? 850  SER O O     1 
ATOM   1041  C  CB    . SER A 1  185 ? 134.020 131.446 112.641 1.00 159.82 ? 850  SER O CB    1 
ATOM   1042  O  OG    . SER A 1  185 ? 135.190 132.134 112.241 1.00 162.07 ? 850  SER O OG    1 
ATOM   1043  N  N     . PRO A 1  186 ? 135.111 128.472 112.692 1.00 121.72 ? 851  PRO O N     1 
ATOM   1044  C  CA    . PRO A 1  186 ? 136.130 127.709 111.970 1.00 124.07 ? 851  PRO O CA    1 
ATOM   1045  C  C     . PRO A 1  186 ? 136.868 128.550 110.965 1.00 131.74 ? 851  PRO O C     1 
ATOM   1046  O  O     . PRO A 1  186 ? 137.886 128.093 110.453 1.00 136.54 ? 851  PRO O O     1 
ATOM   1047  C  CB    . PRO A 1  186 ? 135.322 126.608 111.270 1.00 97.88  ? 851  PRO O CB    1 
ATOM   1048  C  CG    . PRO A 1  186 ? 134.092 126.480 112.076 1.00 99.03  ? 851  PRO O CG    1 
ATOM   1049  C  CD    . PRO A 1  186 ? 133.776 127.869 112.550 1.00 99.57  ? 851  PRO O CD    1 
ATOM   1050  N  N     . ASN A 1  187 ? 136.360 129.739 110.630 1.00 137.10 ? 852  ASN O N     1 
ATOM   1051  C  CA    . ASN A 1  187 ? 137.093 130.655 109.761 1.00 142.61 ? 852  ASN O CA    1 
ATOM   1052  C  C     . ASN A 1  187 ? 138.285 131.262 110.482 1.00 137.07 ? 852  ASN O C     1 
ATOM   1053  O  O     . ASN A 1  187 ? 139.415 131.211 109.986 1.00 144.28 ? 852  ASN O O     1 
ATOM   1054  C  CB    . ASN A 1  187 ? 136.161 131.755 109.259 1.00 127.81 ? 852  ASN O CB    1 
ATOM   1055  C  CG    . ASN A 1  187 ? 135.182 131.257 108.224 1.00 135.34 ? 852  ASN O CG    1 
ATOM   1056  O  OD1   . ASN A 1  187 ? 135.467 130.314 107.487 1.00 138.79 ? 852  ASN O OD1   1 
ATOM   1057  N  ND2   . ASN A 1  187 ? 134.005 131.872 108.179 1.00 136.32 ? 852  ASN O ND2   1 
ATOM   1058  N  N     . GLU A 1  188 ? 138.052 131.870 111.646 1.00 138.17 ? 853  GLU O N     1 
ATOM   1059  C  CA    . GLU A 1  188 ? 139.176 132.390 112.413 1.00 133.30 ? 853  GLU O CA    1 
ATOM   1060  C  C     . GLU A 1  188 ? 140.142 131.270 112.753 1.00 137.12 ? 853  GLU O C     1 
ATOM   1061  O  O     . GLU A 1  188 ? 141.367 131.419 112.616 1.00 140.10 ? 853  GLU O O     1 
ATOM   1062  C  CB    . GLU A 1  188 ? 138.675 133.087 113.674 1.00 155.33 ? 853  GLU O CB    1 
ATOM   1063  C  CG    . GLU A 1  188 ? 137.873 134.334 113.372 1.00 155.33 ? 853  GLU O CG    1 
ATOM   1064  C  CD    . GLU A 1  188 ? 137.267 134.952 114.609 1.00 155.33 ? 853  GLU O CD    1 
ATOM   1065  O  OE1   . GLU A 1  188 ? 137.341 134.327 115.684 1.00 155.33 ? 853  GLU O OE1   1 
ATOM   1066  O  OE2   . GLU A 1  188 ? 136.700 136.058 114.507 1.00 155.33 ? 853  GLU O OE2   1 
ATOM   1067  N  N     . ARG A 1  189 ? 139.603 130.117 113.145 1.00 126.55 ? 854  ARG O N     1 
ATOM   1068  C  CA    . ARG A 1  189 ? 140.463 128.963 113.333 1.00 124.62 ? 854  ARG O CA    1 
ATOM   1069  C  C     . ARG A 1  189 ? 141.138 128.525 112.042 1.00 127.16 ? 854  ARG O C     1 
ATOM   1070  O  O     . ARG A 1  189 ? 142.171 127.859 112.111 1.00 130.04 ? 854  ARG O O     1 
ATOM   1071  C  CB    . ARG A 1  189 ? 139.668 127.815 113.942 1.00 120.08 ? 854  ARG O CB    1 
ATOM   1072  C  CG    . ARG A 1  189 ? 139.301 128.062 115.384 1.00 113.12 ? 854  ARG O CG    1 
ATOM   1073  C  CD    . ARG A 1  189 ? 138.674 126.839 116.019 1.00 109.56 ? 854  ARG O CD    1 
ATOM   1074  N  NE    . ARG A 1  189 ? 137.389 126.513 115.415 1.00 117.42 ? 854  ARG O NE    1 
ATOM   1075  C  CZ    . ARG A 1  189 ? 136.241 127.062 115.789 1.00 124.57 ? 854  ARG O CZ    1 
ATOM   1076  N  NH1   . ARG A 1  189 ? 136.224 127.964 116.758 1.00 127.05 ? 854  ARG O NH1   1 
ATOM   1077  N  NH2   . ARG A 1  189 ? 135.112 126.712 115.194 1.00 132.47 ? 854  ARG O NH2   1 
ATOM   1078  N  N     . LYS A 1  190 ? 140.590 128.872 110.870 1.00 112.01 ? 855  LYS O N     1 
ATOM   1079  C  CA    . LYS A 1  190 ? 141.342 128.678 109.630 1.00 118.66 ? 855  LYS O CA    1 
ATOM   1080  C  C     . LYS A 1  190 ? 142.538 129.608 109.590 1.00 124.44 ? 855  LYS O C     1 
ATOM   1081  O  O     . LYS A 1  190 ? 143.661 129.182 109.297 1.00 126.91 ? 855  LYS O O     1 
ATOM   1082  C  CB    . LYS A 1  190 ? 140.474 128.924 108.394 1.00 106.33 ? 855  LYS O CB    1 
ATOM   1083  C  CG    . LYS A 1  190 ? 139.447 127.881 108.044 1.00 111.48 ? 855  LYS O CG    1 
ATOM   1084  C  CD    . LYS A 1  190 ? 138.677 128.328 106.808 1.00 120.22 ? 855  LYS O CD    1 
ATOM   1085  C  CE    . LYS A 1  190 ? 137.629 127.317 106.389 1.00 120.29 ? 855  LYS O CE    1 
ATOM   1086  N  NZ    . LYS A 1  190 ? 136.461 127.357 107.311 1.00 120.32 ? 855  LYS O NZ    1 
ATOM   1087  N  N     . ALA A 1  191 ? 142.305 130.891 109.879 1.00 118.01 ? 856  ALA O N     1 
ATOM   1088  C  CA    . ALA A 1  191 ? 143.372 131.881 109.805 1.00 120.85 ? 856  ALA O CA    1 
ATOM   1089  C  C     . ALA A 1  191 ? 144.554 131.473 110.670 1.00 117.04 ? 856  ALA O C     1 
ATOM   1090  O  O     . ALA A 1  191 ? 145.695 131.416 110.195 1.00 118.45 ? 856  ALA O O     1 
ATOM   1091  C  CB    . ALA A 1  191 ? 142.841 133.253 110.218 1.00 99.93  ? 856  ALA O CB    1 
ATOM   1092  N  N     . LYS A 1  192 ? 144.301 131.148 111.935 1.00 120.89 ? 857  LYS O N     1 
ATOM   1093  C  CA    . LYS A 1  192 ? 145.426 130.758 112.773 1.00 110.41 ? 857  LYS O CA    1 
ATOM   1094  C  C     . LYS A 1  192 ? 145.866 129.313 112.552 1.00 103.94 ? 857  LYS O C     1 
ATOM   1095  O  O     . LYS A 1  192 ? 147.032 128.996 112.816 1.00 101.64 ? 857  LYS O O     1 
ATOM   1096  C  CB    . LYS A 1  192 ? 145.089 131.034 114.236 1.00 109.86 ? 857  LYS O CB    1 
ATOM   1097  C  CG    . LYS A 1  192 ? 145.076 132.534 114.506 1.00 109.86 ? 857  LYS O CG    1 
ATOM   1098  C  CD    . LYS A 1  192 ? 144.903 132.906 115.961 1.00 109.86 ? 857  LYS O CD    1 
ATOM   1099  C  CE    . LYS A 1  192 ? 143.512 132.583 116.448 1.00 109.86 ? 857  LYS O CE    1 
ATOM   1100  N  NZ    . LYS A 1  192 ? 143.311 133.110 117.820 1.00 109.86 ? 857  LYS O NZ    1 
ATOM   1101  N  N     . GLN A 1  193 ? 144.991 128.447 112.028 1.00 107.57 ? 858  GLN O N     1 
ATOM   1102  C  CA    . GLN A 1  193 ? 145.369 127.048 111.840 1.00 112.27 ? 858  GLN O CA    1 
ATOM   1103  C  C     . GLN A 1  193 ? 146.334 126.896 110.674 1.00 115.30 ? 858  GLN O C     1 
ATOM   1104  O  O     . GLN A 1  193 ? 147.296 126.128 110.754 1.00 110.87 ? 858  GLN O O     1 
ATOM   1105  C  CB    . GLN A 1  193 ? 144.134 126.167 111.610 1.00 127.93 ? 858  GLN O CB    1 
ATOM   1106  C  CG    . GLN A 1  193 ? 143.533 126.187 110.199 1.00 129.44 ? 858  GLN O CG    1 
ATOM   1107  C  CD    . GLN A 1  193 ? 142.271 125.358 110.092 1.00 140.77 ? 858  GLN O CD    1 
ATOM   1108  O  OE1   . GLN A 1  193 ? 141.579 125.136 111.082 1.00 145.58 ? 858  GLN O OE1   1 
ATOM   1109  N  NE2   . GLN A 1  193 ? 141.991 124.858 108.896 1.00 143.74 ? 858  GLN O NE2   1 
ATOM   1110  N  N     . ALA A 1  194 ? 146.070 127.597 109.573 1.00 119.12 ? 859  ALA O N     1 
ATOM   1111  C  CA    . ALA A 1  194 ? 146.967 127.573 108.430 1.00 122.86 ? 859  ALA O CA    1 
ATOM   1112  C  C     . ALA A 1  194 ? 148.136 128.521 108.643 1.00 115.58 ? 859  ALA O C     1 
ATOM   1113  O  O     . ALA A 1  194 ? 149.270 128.208 108.262 1.00 118.45 ? 859  ALA O O     1 
ATOM   1114  C  CB    . ALA A 1  194 ? 146.200 127.929 107.158 1.00 111.51 ? 859  ALA O CB    1 
ATOM   1115  N  N     . LYS A 1  195 ? 147.870 129.682 109.247 1.00 130.76 ? 860  LYS O N     1 
ATOM   1116  C  CA    . LYS A 1  195 ? 148.914 130.628 109.620 1.00 124.05 ? 860  LYS O CA    1 
ATOM   1117  C  C     . LYS A 1  195 ? 150.007 129.944 110.426 1.00 122.17 ? 860  LYS O C     1 
ATOM   1118  O  O     . LYS A 1  195 ? 151.130 129.773 109.949 1.00 126.13 ? 860  LYS O O     1 
ATOM   1119  C  CB    . LYS A 1  195 ? 148.326 131.790 110.429 1.00 116.00 ? 860  LYS O CB    1 
ATOM   1120  C  CG    . LYS A 1  195 ? 149.353 132.849 110.846 1.00 120.89 ? 860  LYS O CG    1 
ATOM   1121  C  CD    . LYS A 1  195 ? 148.767 133.933 111.761 1.00 133.48 ? 860  LYS O CD    1 
ATOM   1122  C  CE    . LYS A 1  195 ? 147.826 134.868 111.019 1.00 141.87 ? 860  LYS O CE    1 
ATOM   1123  N  NZ    . LYS A 1  195 ? 147.243 135.888 111.932 1.00 144.38 ? 860  LYS O NZ    1 
ATOM   1124  N  N     . ILE A 1  196 ? 149.684 129.547 111.647 1.00 119.21 ? 861  ILE O N     1 
ATOM   1125  C  CA    . ILE A 1  196 ? 150.698 129.034 112.553 1.00 118.91 ? 861  ILE O CA    1 
ATOM   1126  C  C     . ILE A 1  196 ? 150.687 127.513 112.473 1.00 130.88 ? 861  ILE O C     1 
ATOM   1127  O  O     . ILE A 1  196 ? 151.360 126.821 113.245 1.00 134.20 ? 861  ILE O O     1 
ATOM   1128  C  CB    . ILE A 1  196 ? 150.474 129.600 113.962 1.00 134.79 ? 861  ILE O CB    1 
ATOM   1129  C  CG1   . ILE A 1  196 ? 150.544 131.123 113.860 1.00 132.99 ? 861  ILE O CG1   1 
ATOM   1130  C  CG2   . ILE A 1  196 ? 151.568 129.185 114.899 1.00 129.58 ? 861  ILE O CG2   1 
ATOM   1131  C  CD1   . ILE A 1  196 ? 150.212 131.862 115.111 1.00 138.09 ? 861  ILE O CD1   1 
ATOM   1132  N  N     . ARG A 1  197 ? 149.919 126.990 111.513 1.00 135.75 ? 862  ARG O N     1 
ATOM   1133  C  CA    . ARG A 1  197 ? 149.975 125.568 111.187 1.00 140.83 ? 862  ARG O CA    1 
ATOM   1134  C  C     . ARG A 1  197 ? 151.406 125.059 111.092 1.00 139.88 ? 862  ARG O C     1 
ATOM   1135  O  O     . ARG A 1  197 ? 151.716 123.958 111.565 1.00 140.88 ? 862  ARG O O     1 
ATOM   1136  C  CB    . ARG A 1  197 ? 149.260 125.315 109.859 1.00 141.31 ? 862  ARG O CB    1 
ATOM   1137  C  CG    . ARG A 1  197 ? 149.466 123.925 109.327 1.00 150.35 ? 862  ARG O CG    1 
ATOM   1138  C  CD    . ARG A 1  197 ? 148.912 122.883 110.258 1.00 156.80 ? 862  ARG O CD    1 
ATOM   1139  N  NE    . ARG A 1  197 ? 149.137 121.555 109.710 1.00 162.37 ? 862  ARG O NE    1 
ATOM   1140  C  CZ    . ARG A 1  197 ? 150.251 120.853 109.846 1.00 162.76 ? 862  ARG O CZ    1 
ATOM   1141  N  NH1   . ARG A 1  197 ? 151.271 121.315 110.540 1.00 158.30 ? 862  ARG O NH1   1 
ATOM   1142  N  NH2   . ARG A 1  197 ? 150.326 119.656 109.303 1.00 166.06 ? 862  ARG O NH2   1 
ATOM   1143  N  N     . ALA A 1  198 ? 152.293 125.853 110.506 1.00 143.82 ? 863  ALA O N     1 
ATOM   1144  C  CA    . ALA A 1  198 ? 153.666 125.438 110.261 1.00 150.03 ? 863  ALA O CA    1 
ATOM   1145  C  C     . ALA A 1  198 ? 154.440 125.151 111.541 1.00 143.12 ? 863  ALA O C     1 
ATOM   1146  O  O     . ALA A 1  198 ? 155.551 124.613 111.472 1.00 142.21 ? 863  ALA O O     1 
ATOM   1147  C  CB    . ALA A 1  198 ? 154.381 126.496 109.423 1.00 119.27 ? 863  ALA O CB    1 
ATOM   1148  N  N     . GLY A 1  199 ? 153.873 125.468 112.696 1.00 155.26 ? 864  GLY O N     1 
ATOM   1149  C  CA    . GLY A 1  199 ? 154.515 125.176 113.960 1.00 140.11 ? 864  GLY O CA    1 
ATOM   1150  C  C     . GLY A 1  199 ? 155.565 126.166 114.413 1.00 140.76 ? 864  GLY O C     1 
ATOM   1151  O  O     . GLY A 1  199 ? 156.643 125.756 114.859 1.00 147.30 ? 864  GLY O O     1 
ATOM   1152  N  N     . GLU A 1  200 ? 155.287 127.463 114.308 1.00 142.30 ? 865  GLU O N     1 
ATOM   1153  C  CA    . GLU A 1  200 ? 156.139 128.497 114.885 1.00 145.89 ? 865  GLU O CA    1 
ATOM   1154  C  C     . GLU A 1  200 ? 155.388 129.102 116.058 1.00 145.11 ? 865  GLU O C     1 
ATOM   1155  O  O     . GLU A 1  200 ? 154.471 129.904 115.859 1.00 149.82 ? 865  GLU O O     1 
ATOM   1156  C  CB    . GLU A 1  200 ? 156.474 129.576 113.861 1.00 141.89 ? 865  GLU O CB    1 
ATOM   1157  C  CG    . GLU A 1  200 ? 157.247 129.087 112.661 1.00 141.89 ? 865  GLU O CG    1 
ATOM   1158  C  CD    . GLU A 1  200 ? 156.346 128.457 111.628 1.00 141.89 ? 865  GLU O CD    1 
ATOM   1159  O  OE1   . GLU A 1  200 ? 155.141 128.302 111.915 1.00 141.89 ? 865  GLU O OE1   1 
ATOM   1160  O  OE2   . GLU A 1  200 ? 156.837 128.133 110.528 1.00 141.89 ? 865  GLU O OE2   1 
ATOM   1161  N  N     . PHE A 1  201 ? 155.815 128.772 117.272 1.00 174.51 ? 866  PHE O N     1 
ATOM   1162  C  CA    . PHE A 1  201 ? 155.079 129.197 118.453 1.00 160.77 ? 866  PHE O CA    1 
ATOM   1163  C  C     . PHE A 1  201 ? 155.808 128.707 119.689 1.00 156.88 ? 866  PHE O C     1 
ATOM   1164  O  O     . PHE A 1  201 ? 156.624 127.782 119.627 1.00 162.83 ? 866  PHE O O     1 
ATOM   1165  C  CB    . PHE A 1  201 ? 153.654 128.644 118.465 1.00 159.96 ? 866  PHE O CB    1 
ATOM   1166  C  CG    . PHE A 1  201 ? 153.591 127.145 118.482 1.00 161.64 ? 866  PHE O CG    1 
ATOM   1167  C  CD1   . PHE A 1  201 ? 153.597 126.450 119.678 1.00 153.86 ? 866  PHE O CD1   1 
ATOM   1168  C  CD2   . PHE A 1  201 ? 153.533 126.430 117.302 1.00 156.15 ? 866  PHE O CD2   1 
ATOM   1169  C  CE1   . PHE A 1  201 ? 153.545 125.077 119.696 1.00 152.93 ? 866  PHE O CE1   1 
ATOM   1170  C  CE2   . PHE A 1  201 ? 153.475 125.053 117.317 1.00 160.08 ? 866  PHE O CE2   1 
ATOM   1171  C  CZ    . PHE A 1  201 ? 153.480 124.377 118.514 1.00 156.16 ? 866  PHE O CZ    1 
ATOM   1172  N  N     . ASP A 1  202 ? 155.492 129.334 120.818 1.00 165.25 ? 867  ASP O N     1 
ATOM   1173  C  CA    . ASP A 1  202 ? 155.954 128.817 122.096 1.00 160.33 ? 867  ASP O CA    1 
ATOM   1174  C  C     . ASP A 1  202 ? 155.054 127.689 122.598 1.00 165.65 ? 867  ASP O C     1 
ATOM   1175  O  O     . ASP A 1  202 ? 155.536 126.601 122.932 1.00 169.03 ? 867  ASP O O     1 
ATOM   1176  C  CB    . ASP A 1  202 ? 156.011 129.957 123.111 1.00 166.19 ? 867  ASP O CB    1 
ATOM   1177  C  CG    . ASP A 1  202 ? 156.933 131.066 122.674 1.00 166.19 ? 867  ASP O CG    1 
ATOM   1178  O  OD1   . ASP A 1  202 ? 157.744 130.829 121.756 1.00 166.19 ? 867  ASP O OD1   1 
ATOM   1179  O  OD2   . ASP A 1  202 ? 156.838 132.178 123.227 1.00 166.19 ? 867  ASP O OD2   1 
ATOM   1180  N  N     . VAL A 1  203 ? 153.742 127.919 122.620 1.00 157.56 ? 868  VAL O N     1 
ATOM   1181  C  CA    . VAL A 1  203 ? 152.814 127.084 123.380 1.00 151.36 ? 868  VAL O CA    1 
ATOM   1182  C  C     . VAL A 1  203 ? 151.458 127.078 122.691 1.00 153.50 ? 868  VAL O C     1 
ATOM   1183  O  O     . VAL A 1  203 ? 151.033 128.081 122.112 1.00 160.86 ? 868  VAL O O     1 
ATOM   1184  C  CB    . VAL A 1  203 ? 152.703 127.571 124.842 1.00 153.67 ? 868  VAL O CB    1 
ATOM   1185  C  CG1   . VAL A 1  203 ? 151.485 126.995 125.530 1.00 159.17 ? 868  VAL O CG1   1 
ATOM   1186  C  CG2   . VAL A 1  203 ? 153.943 127.168 125.623 1.00 152.90 ? 868  VAL O CG2   1 
ATOM   1187  N  N     . VAL A 1  204 ? 150.786 125.932 122.759 1.00 147.26 ? 869  VAL O N     1 
ATOM   1188  C  CA    . VAL A 1  204 ? 149.448 125.745 122.219 1.00 152.68 ? 869  VAL O CA    1 
ATOM   1189  C  C     . VAL A 1  204 ? 148.440 125.890 123.347 1.00 152.70 ? 869  VAL O C     1 
ATOM   1190  O  O     . VAL A 1  204 ? 148.562 125.237 124.387 1.00 145.94 ? 869  VAL O O     1 
ATOM   1191  C  CB    . VAL A 1  204 ? 149.320 124.371 121.544 1.00 153.87 ? 869  VAL O CB    1 
ATOM   1192  C  CG1   . VAL A 1  204 ? 147.878 124.073 121.217 1.00 153.87 ? 869  VAL O CG1   1 
ATOM   1193  C  CG2   . VAL A 1  204 ? 150.159 124.332 120.288 1.00 153.87 ? 869  VAL O CG2   1 
ATOM   1194  N  N     . LEU A 1  205 ? 147.447 126.744 123.149 1.00 130.45 ? 870  LEU O N     1 
ATOM   1195  C  CA    . LEU A 1  205 ? 146.332 126.857 124.074 1.00 126.27 ? 870  LEU O CA    1 
ATOM   1196  C  C     . LEU A 1  205 ? 145.057 126.486 123.344 1.00 138.39 ? 870  LEU O C     1 
ATOM   1197  O  O     . LEU A 1  205 ? 144.774 127.019 122.268 1.00 138.56 ? 870  LEU O O     1 
ATOM   1198  C  CB    . LEU A 1  205 ? 146.225 128.258 124.655 1.00 130.04 ? 870  LEU O CB    1 
ATOM   1199  C  CG    . LEU A 1  205 ? 144.982 128.498 125.501 1.00 138.99 ? 870  LEU O CG    1 
ATOM   1200  C  CD1   . LEU A 1  205 ? 144.915 127.506 126.623 1.00 140.28 ? 870  LEU O CD1   1 
ATOM   1201  C  CD2   . LEU A 1  205 ? 145.042 129.894 126.060 1.00 134.63 ? 870  LEU O CD2   1 
ATOM   1202  N  N     . THR A 1  206 ? 144.293 125.579 123.937 1.00 141.09 ? 871  THR O N     1 
ATOM   1203  C  CA    . THR A 1  206 ? 143.115 124.995 123.320 1.00 139.28 ? 871  THR O CA    1 
ATOM   1204  C  C     . THR A 1  206 ? 142.039 124.877 124.383 1.00 144.50 ? 871  THR O C     1 
ATOM   1205  O  O     . THR A 1  206 ? 142.162 125.423 125.482 1.00 144.15 ? 871  THR O O     1 
ATOM   1206  C  CB    . THR A 1  206 ? 143.437 123.630 122.708 1.00 150.23 ? 871  THR O CB    1 
ATOM   1207  O  OG1   . THR A 1  206 ? 142.269 123.110 122.070 1.00 156.04 ? 871  THR O OG1   1 
ATOM   1208  C  CG2   . THR A 1  206 ? 143.868 122.680 123.790 1.00 145.98 ? 871  THR O CG2   1 
ATOM   1209  N  N     . THR A 1  207 ? 140.957 124.184 124.048 1.00 131.98 ? 872  THR O N     1 
ATOM   1210  C  CA    . THR A 1  207 ? 139.910 123.893 125.007 1.00 131.91 ? 872  THR O CA    1 
ATOM   1211  C  C     . THR A 1  207 ? 139.518 122.437 124.844 1.00 139.73 ? 872  THR O C     1 
ATOM   1212  O  O     . THR A 1  207 ? 140.085 121.717 124.020 1.00 135.73 ? 872  THR O O     1 
ATOM   1213  C  CB    . THR A 1  207 ? 138.713 124.811 124.813 1.00 133.87 ? 872  THR O CB    1 
ATOM   1214  O  OG1   . THR A 1  207 ? 138.128 124.548 123.536 1.00 144.30 ? 872  THR O OG1   1 
ATOM   1215  C  CG2   . THR A 1  207 ? 139.175 126.254 124.865 1.00 134.03 ? 872  THR O CG2   1 
ATOM   1216  N  N     . PHE A 1  208 ? 138.527 122.007 125.626 1.00 123.58 ? 873  PHE O N     1 
ATOM   1217  C  CA    . PHE A 1  208 ? 138.237 120.584 125.743 1.00 121.36 ? 873  PHE O CA    1 
ATOM   1218  C  C     . PHE A 1  208 ? 137.994 119.944 124.383 1.00 129.94 ? 873  PHE O C     1 
ATOM   1219  O  O     . PHE A 1  208 ? 138.757 119.080 123.949 1.00 130.73 ? 873  PHE O O     1 
ATOM   1220  C  CB    . PHE A 1  208 ? 137.046 120.359 126.672 1.00 123.72 ? 873  PHE O CB    1 
ATOM   1221  C  CG    . PHE A 1  208 ? 137.313 120.723 128.110 1.00 123.72 ? 873  PHE O CG    1 
ATOM   1222  C  CD1   . PHE A 1  208 ? 138.026 119.868 128.930 1.00 123.72 ? 873  PHE O CD1   1 
ATOM   1223  C  CD2   . PHE A 1  208 ? 136.823 121.900 128.652 1.00 123.72 ? 873  PHE O CD2   1 
ATOM   1224  C  CE1   . PHE A 1  208 ? 138.267 120.190 130.257 1.00 123.72 ? 873  PHE O CE1   1 
ATOM   1225  C  CE2   . PHE A 1  208 ? 137.058 122.221 129.981 1.00 123.72 ? 873  PHE O CE2   1 
ATOM   1226  C  CZ    . PHE A 1  208 ? 137.784 121.367 130.780 1.00 123.72 ? 873  PHE O CZ    1 
ATOM   1227  N  N     . GLU A 1  209 ? 136.939 120.357 123.687 1.00 136.74 ? 874  GLU O N     1 
ATOM   1228  C  CA    . GLU A 1  209 ? 136.513 119.597 122.515 1.00 141.13 ? 874  GLU O CA    1 
ATOM   1229  C  C     . GLU A 1  209 ? 137.363 119.893 121.284 1.00 137.50 ? 874  GLU O C     1 
ATOM   1230  O  O     . GLU A 1  209 ? 137.601 118.999 120.457 1.00 132.99 ? 874  GLU O O     1 
ATOM   1231  C  CB    . GLU A 1  209 ? 135.042 119.878 122.230 1.00 114.54 ? 874  GLU O CB    1 
ATOM   1232  C  CG    . GLU A 1  209 ? 134.752 121.269 121.706 1.00 120.35 ? 874  GLU O CG    1 
ATOM   1233  C  CD    . GLU A 1  209 ? 134.854 122.337 122.773 1.00 139.72 ? 874  GLU O CD    1 
ATOM   1234  O  OE1   . GLU A 1  209 ? 135.277 122.025 123.905 1.00 151.21 ? 874  GLU O OE1   1 
ATOM   1235  O  OE2   . GLU A 1  209 ? 134.505 123.496 122.477 1.00 133.76 ? 874  GLU O OE2   1 
ATOM   1236  N  N     . TYR A 1  210 ? 137.833 121.132 121.137 1.00 151.34 ? 875  TYR O N     1 
ATOM   1237  C  CA    . TYR A 1  210 ? 138.574 121.468 119.931 1.00 147.42 ? 875  TYR O CA    1 
ATOM   1238  C  C     . TYR A 1  210 ? 139.769 120.567 119.733 1.00 149.94 ? 875  TYR O C     1 
ATOM   1239  O  O     . TYR A 1  210 ? 140.263 120.461 118.614 1.00 143.05 ? 875  TYR O O     1 
ATOM   1240  C  CB    . TYR A 1  210 ? 139.022 122.918 119.956 1.00 143.80 ? 875  TYR O CB    1 
ATOM   1241  C  CG    . TYR A 1  210 ? 137.861 123.851 119.877 1.00 150.45 ? 875  TYR O CG    1 
ATOM   1242  C  CD1   . TYR A 1  210 ? 136.788 123.563 119.061 1.00 155.39 ? 875  TYR O CD1   1 
ATOM   1243  C  CD2   . TYR A 1  210 ? 137.827 125.017 120.615 1.00 151.44 ? 875  TYR O CD2   1 
ATOM   1244  C  CE1   . TYR A 1  210 ? 135.711 124.408 118.983 1.00 161.99 ? 875  TYR O CE1   1 
ATOM   1245  C  CE2   . TYR A 1  210 ? 136.753 125.871 120.548 1.00 164.79 ? 875  TYR O CE2   1 
ATOM   1246  C  CZ    . TYR A 1  210 ? 135.696 125.563 119.729 1.00 165.58 ? 875  TYR O CZ    1 
ATOM   1247  O  OH    . TYR A 1  210 ? 134.618 126.415 119.657 1.00 167.82 ? 875  TYR O OH    1 
ATOM   1248  N  N     . ILE A 1  211 ? 140.242 119.900 120.781 1.00 150.31 ? 876  ILE O N     1 
ATOM   1249  C  CA    . ILE A 1  211 ? 141.255 118.894 120.528 1.00 143.03 ? 876  ILE O CA    1 
ATOM   1250  C  C     . ILE A 1  211 ? 140.626 117.701 119.827 1.00 144.95 ? 876  ILE O C     1 
ATOM   1251  O  O     . ILE A 1  211 ? 141.300 116.984 119.081 1.00 144.48 ? 876  ILE O O     1 
ATOM   1252  C  CB    . ILE A 1  211 ? 141.955 118.494 121.833 1.00 154.50 ? 876  ILE O CB    1 
ATOM   1253  C  CG1   . ILE A 1  211 ? 141.046 117.625 122.678 1.00 160.16 ? 876  ILE O CG1   1 
ATOM   1254  C  CG2   . ILE A 1  211 ? 142.270 119.738 122.623 1.00 145.25 ? 876  ILE O CG2   1 
ATOM   1255  C  CD1   . ILE A 1  211 ? 141.266 116.139 122.485 1.00 145.69 ? 876  ILE O CD1   1 
ATOM   1256  N  N     . ILE A 1  212 ? 139.340 117.449 120.063 1.00 131.11 ? 877  ILE O N     1 
ATOM   1257  C  CA    . ILE A 1  212 ? 138.695 116.337 119.381 1.00 133.74 ? 877  ILE O CA    1 
ATOM   1258  C  C     . ILE A 1  212 ? 138.464 116.691 117.926 1.00 136.38 ? 877  ILE O C     1 
ATOM   1259  O  O     . ILE A 1  212 ? 138.807 115.925 117.019 1.00 135.07 ? 877  ILE O O     1 
ATOM   1260  C  CB    . ILE A 1  212 ? 137.376 115.958 120.070 1.00 149.46 ? 877  ILE O CB    1 
ATOM   1261  C  CG1   . ILE A 1  212 ? 137.648 115.443 121.477 1.00 141.51 ? 877  ILE O CG1   1 
ATOM   1262  C  CG2   . ILE A 1  212 ? 136.634 114.917 119.247 1.00 147.72 ? 877  ILE O CG2   1 
ATOM   1263  C  CD1   . ILE A 1  212 ? 136.409 115.314 122.312 1.00 144.92 ? 877  ILE O CD1   1 
ATOM   1264  N  N     . LYS A 1  213 ? 137.870 117.857 117.683 1.00 123.83 ? 878  LYS O N     1 
ATOM   1265  C  CA    . LYS A 1  213 ? 137.598 118.248 116.308 1.00 135.91 ? 878  LYS O CA    1 
ATOM   1266  C  C     . LYS A 1  213 ? 138.893 118.502 115.536 1.00 127.58 ? 878  LYS O C     1 
ATOM   1267  O  O     . LYS A 1  213 ? 139.144 117.856 114.516 1.00 127.18 ? 878  LYS O O     1 
ATOM   1268  C  CB    . LYS A 1  213 ? 136.684 119.472 116.297 1.00 129.24 ? 878  LYS O CB    1 
ATOM   1269  C  CG    . LYS A 1  213 ? 135.287 119.214 116.858 1.00 131.22 ? 878  LYS O CG    1 
ATOM   1270  C  CD    . LYS A 1  213 ? 134.515 120.512 116.890 1.00 131.40 ? 878  LYS O CD    1 
ATOM   1271  C  CE    . LYS A 1  213 ? 134.211 121.018 115.498 1.00 128.40 ? 878  LYS O CE    1 
ATOM   1272  N  NZ    . LYS A 1  213 ? 133.215 120.177 114.802 1.00 118.06 ? 878  LYS O NZ    1 
ATOM   1273  N  N     . GLU A 1  214 ? 139.741 119.402 116.024 1.00 136.91 ? 879  GLU O N     1 
ATOM   1274  C  CA    . GLU A 1  214 ? 141.038 119.726 115.437 1.00 139.36 ? 879  GLU O CA    1 
ATOM   1275  C  C     . GLU A 1  214 ? 142.024 118.580 115.534 1.00 140.99 ? 879  GLU O C     1 
ATOM   1276  O  O     . GLU A 1  214 ? 143.169 118.714 115.073 1.00 136.67 ? 879  GLU O O     1 
ATOM   1277  C  CB    . GLU A 1  214 ? 141.646 120.940 116.134 1.00 155.64 ? 879  GLU O CB    1 
ATOM   1278  C  CG    . GLU A 1  214 ? 140.821 122.187 116.042 1.00 155.64 ? 879  GLU O CG    1 
ATOM   1279  C  CD    . GLU A 1  214 ? 141.443 123.345 116.781 1.00 155.64 ? 879  GLU O CD    1 
ATOM   1280  O  OE1   . GLU A 1  214 ? 142.462 123.153 117.479 1.00 155.64 ? 879  GLU O OE1   1 
ATOM   1281  O  OE2   . GLU A 1  214 ? 140.887 124.452 116.661 1.00 155.64 ? 879  GLU O OE2   1 
ATOM   1282  N  N     . ARG A 1  215 ? 141.631 117.496 116.198 1.00 140.80 ? 880  ARG O N     1 
ATOM   1283  C  CA    . ARG A 1  215 ? 142.571 116.424 116.472 1.00 138.56 ? 880  ARG O CA    1 
ATOM   1284  C  C     . ARG A 1  215 ? 143.324 116.004 115.223 1.00 141.47 ? 880  ARG O C     1 
ATOM   1285  O  O     . ARG A 1  215 ? 144.520 115.703 115.287 1.00 135.80 ? 880  ARG O O     1 
ATOM   1286  C  CB    . ARG A 1  215 ? 141.849 115.226 117.056 1.00 140.30 ? 880  ARG O CB    1 
ATOM   1287  C  CG    . ARG A 1  215 ? 142.807 114.126 117.349 1.00 147.18 ? 880  ARG O CG    1 
ATOM   1288  C  CD    . ARG A 1  215 ? 142.094 112.918 117.834 1.00 162.56 ? 880  ARG O CD    1 
ATOM   1289  N  NE    . ARG A 1  215 ? 141.157 112.422 116.834 1.00 177.34 ? 880  ARG O NE    1 
ATOM   1290  C  CZ    . ARG A 1  215 ? 141.511 111.718 115.765 1.00 173.57 ? 880  ARG O CZ    1 
ATOM   1291  N  NH1   . ARG A 1  215 ? 140.587 111.285 114.917 1.00 167.86 ? 880  ARG O NH1   1 
ATOM   1292  N  NH2   . ARG A 1  215 ? 142.791 111.463 115.535 1.00 167.27 ? 880  ARG O NH2   1 
ATOM   1293  N  N     . ALA A 1  216 ? 142.651 115.988 114.075 1.00 121.86 ? 881  ALA O N     1 
ATOM   1294  C  CA    . ALA A 1  216 ? 143.353 115.699 112.831 1.00 121.24 ? 881  ALA O CA    1 
ATOM   1295  C  C     . ALA A 1  216 ? 144.460 116.707 112.583 1.00 119.24 ? 881  ALA O C     1 
ATOM   1296  O  O     . ALA A 1  216 ? 145.507 116.379 112.011 1.00 130.94 ? 881  ALA O O     1 
ATOM   1297  C  CB    . ALA A 1  216 ? 142.381 115.711 111.654 1.00 119.51 ? 881  ALA O CB    1 
ATOM   1298  N  N     . LEU A 1  217 ? 144.210 117.962 112.936 1.00 123.53 ? 882  LEU O N     1 
ATOM   1299  C  CA    . LEU A 1  217 ? 145.154 119.005 112.581 1.00 123.48 ? 882  LEU O CA    1 
ATOM   1300  C  C     . LEU A 1  217 ? 146.363 118.939 113.478 1.00 126.30 ? 882  LEU O C     1 
ATOM   1301  O  O     . LEU A 1  217 ? 147.506 118.860 113.018 1.00 131.30 ? 882  LEU O O     1 
ATOM   1302  C  CB    . LEU A 1  217 ? 144.502 120.371 112.729 1.00 107.95 ? 882  LEU O CB    1 
ATOM   1303  C  CG    . LEU A 1  217 ? 145.396 121.512 112.295 1.00 114.70 ? 882  LEU O CG    1 
ATOM   1304  C  CD1   . LEU A 1  217 ? 145.478 121.538 110.718 1.00 112.63 ? 882  LEU O CD1   1 
ATOM   1305  C  CD2   . LEU A 1  217 ? 144.849 122.763 112.878 1.00 124.13 ? 882  LEU O CD2   1 
ATOM   1306  N  N     . LEU A 1  218 ? 146.109 118.989 114.772 1.00 135.79 ? 883  LEU O N     1 
ATOM   1307  C  CA    . LEU A 1  218 ? 147.180 119.250 115.701 1.00 126.17 ? 883  LEU O CA    1 
ATOM   1308  C  C     . LEU A 1  218 ? 147.655 117.962 116.346 1.00 127.75 ? 883  LEU O C     1 
ATOM   1309  O  O     . LEU A 1  218 ? 148.457 117.993 117.287 1.00 129.44 ? 883  LEU O O     1 
ATOM   1310  C  CB    . LEU A 1  218 ? 146.722 120.301 116.699 1.00 130.68 ? 883  LEU O CB    1 
ATOM   1311  C  CG    . LEU A 1  218 ? 145.589 119.985 117.653 1.00 129.32 ? 883  LEU O CG    1 
ATOM   1312  C  CD1   . LEU A 1  218 ? 146.183 119.296 118.849 1.00 120.69 ? 883  LEU O CD1   1 
ATOM   1313  C  CD2   . LEU A 1  218 ? 144.956 121.250 118.059 1.00 123.00 ? 883  LEU O CD2   1 
ATOM   1314  N  N     . SER A 1  219 ? 147.133 116.821 115.896 1.00 134.82 ? 884  SER O N     1 
ATOM   1315  C  CA    . SER A 1  219 ? 147.574 115.561 116.485 1.00 131.98 ? 884  SER O CA    1 
ATOM   1316  C  C     . SER A 1  219 ? 148.837 115.032 115.818 1.00 133.68 ? 884  SER O C     1 
ATOM   1317  O  O     . SER A 1  219 ? 149.505 114.146 116.360 1.00 139.23 ? 884  SER O O     1 
ATOM   1318  C  CB    . SER A 1  219 ? 146.469 114.518 116.382 1.00 137.69 ? 884  SER O CB    1 
ATOM   1319  O  OG    . SER A 1  219 ? 146.264 114.190 115.025 1.00 140.98 ? 884  SER O OG    1 
ATOM   1320  N  N     . LYS A 1  220 ? 149.149 115.515 114.618 1.00 128.23 ? 885  LYS O N     1 
ATOM   1321  C  CA    . LYS A 1  220 ? 150.263 114.972 113.852 1.00 125.46 ? 885  LYS O CA    1 
ATOM   1322  C  C     . LYS A 1  220 ? 151.616 115.428 114.386 1.00 134.11 ? 885  LYS O C     1 
ATOM   1323  O  O     . LYS A 1  220 ? 152.658 115.023 113.861 1.00 134.26 ? 885  LYS O O     1 
ATOM   1324  C  CB    . LYS A 1  220 ? 150.135 115.357 112.378 1.00 112.05 ? 885  LYS O CB    1 
ATOM   1325  C  CG    . LYS A 1  220 ? 148.989 114.695 111.673 1.00 125.02 ? 885  LYS O CG    1 
ATOM   1326  C  CD    . LYS A 1  220 ? 148.934 115.109 110.221 1.00 134.83 ? 885  LYS O CD    1 
ATOM   1327  C  CE    . LYS A 1  220 ? 147.821 114.369 109.512 1.00 149.77 ? 885  LYS O CE    1 
ATOM   1328  N  NZ    . LYS A 1  220 ? 147.776 114.693 108.061 1.00 158.78 ? 885  LYS O NZ    1 
ATOM   1329  N  N     . VAL A 1  221 ? 151.623 116.287 115.400 1.00 141.88 ? 886  VAL O N     1 
ATOM   1330  C  CA    . VAL A 1  221 ? 152.856 116.871 115.916 1.00 143.73 ? 886  VAL O CA    1 
ATOM   1331  C  C     . VAL A 1  221 ? 153.243 116.193 117.226 1.00 141.14 ? 886  VAL O C     1 
ATOM   1332  O  O     . VAL A 1  221 ? 152.386 115.759 118.004 1.00 134.00 ? 886  VAL O O     1 
ATOM   1333  C  CB    . VAL A 1  221 ? 152.693 118.391 116.090 1.00 140.41 ? 886  VAL O CB    1 
ATOM   1334  C  CG1   . VAL A 1  221 ? 152.485 119.038 114.730 1.00 138.65 ? 886  VAL O CG1   1 
ATOM   1335  C  CG2   . VAL A 1  221 ? 151.509 118.666 116.983 1.00 131.83 ? 886  VAL O CG2   1 
ATOM   1336  N  N     . LYS A 1  222 ? 154.548 116.073 117.459 1.00 144.09 ? 887  LYS O N     1 
ATOM   1337  C  CA    . LYS A 1  222 ? 155.028 115.393 118.652 1.00 151.15 ? 887  LYS O CA    1 
ATOM   1338  C  C     . LYS A 1  222 ? 154.859 116.293 119.872 1.00 156.86 ? 887  LYS O C     1 
ATOM   1339  O  O     . LYS A 1  222 ? 154.776 117.520 119.758 1.00 162.56 ? 887  LYS O O     1 
ATOM   1340  C  CB    . LYS A 1  222 ? 156.493 114.987 118.485 1.00 143.30 ? 887  LYS O CB    1 
ATOM   1341  C  CG    . LYS A 1  222 ? 157.022 114.063 119.570 1.00 148.54 ? 887  LYS O CG    1 
ATOM   1342  C  CD    . LYS A 1  222 ? 158.525 113.850 119.446 1.00 155.92 ? 887  LYS O CD    1 
ATOM   1343  C  CE    . LYS A 1  222 ? 158.885 113.097 118.176 1.00 164.83 ? 887  LYS O CE    1 
ATOM   1344  N  NZ    . LYS A 1  222 ? 160.353 112.888 118.035 1.00 177.16 ? 887  LYS O NZ    1 
ATOM   1345  N  N     . TRP A 1  223 ? 154.788 115.669 121.047 1.00 162.73 ? 888  TRP O N     1 
ATOM   1346  C  CA    . TRP A 1  223 ? 154.618 116.403 122.289 1.00 166.56 ? 888  TRP O CA    1 
ATOM   1347  C  C     . TRP A 1  223 ? 155.421 115.734 123.394 1.00 160.36 ? 888  TRP O C     1 
ATOM   1348  O  O     . TRP A 1  223 ? 155.801 114.566 123.297 1.00 157.94 ? 888  TRP O O     1 
ATOM   1349  C  CB    . TRP A 1  223 ? 153.147 116.490 122.691 1.00 146.91 ? 888  TRP O CB    1 
ATOM   1350  C  CG    . TRP A 1  223 ? 152.302 117.248 121.709 1.00 152.83 ? 888  TRP O CG    1 
ATOM   1351  C  CD1   . TRP A 1  223 ? 151.510 116.722 120.731 1.00 145.99 ? 888  TRP O CD1   1 
ATOM   1352  C  CD2   . TRP A 1  223 ? 152.185 118.668 121.596 1.00 154.25 ? 888  TRP O CD2   1 
ATOM   1353  N  NE1   . TRP A 1  223 ? 150.891 117.724 120.031 1.00 151.04 ? 888  TRP O NE1   1 
ATOM   1354  C  CE2   . TRP A 1  223 ? 151.292 118.930 120.539 1.00 151.78 ? 888  TRP O CE2   1 
ATOM   1355  C  CE3   . TRP A 1  223 ? 152.744 119.744 122.288 1.00 149.33 ? 888  TRP O CE3   1 
ATOM   1356  C  CZ2   . TRP A 1  223 ? 150.949 120.215 120.158 1.00 149.67 ? 888  TRP O CZ2   1 
ATOM   1357  C  CZ3   . TRP A 1  223 ? 152.398 121.017 121.913 1.00 148.58 ? 888  TRP O CZ3   1 
ATOM   1358  C  CH2   . TRP A 1  223 ? 151.509 121.244 120.857 1.00 158.42 ? 888  TRP O CH2   1 
ATOM   1359  N  N     . VAL A 1  224 ? 155.669 116.494 124.458 1.00 170.97 ? 889  VAL O N     1 
ATOM   1360  C  CA    . VAL A 1  224 ? 156.482 116.012 125.569 1.00 159.95 ? 889  VAL O CA    1 
ATOM   1361  C  C     . VAL A 1  224 ? 155.771 116.214 126.898 1.00 166.64 ? 889  VAL O C     1 
ATOM   1362  O  O     . VAL A 1  224 ? 155.529 115.257 127.640 1.00 171.62 ? 889  VAL O O     1 
ATOM   1363  C  CB    . VAL A 1  224 ? 157.854 116.702 125.590 1.00 147.60 ? 889  VAL O CB    1 
ATOM   1364  C  CG1   . VAL A 1  224 ? 158.578 116.371 126.890 1.00 148.02 ? 889  VAL O CG1   1 
ATOM   1365  N  N     . HIS A 1  225 ? 155.482 117.467 127.227 1.00 162.43 ? 890  HIS O N     1 
ATOM   1366  C  CA    . HIS A 1  225 ? 154.912 117.850 128.513 1.00 157.98 ? 890  HIS O CA    1 
ATOM   1367  C  C     . HIS A 1  225 ? 153.561 118.511 128.262 1.00 167.13 ? 890  HIS O C     1 
ATOM   1368  O  O     . HIS A 1  225 ? 153.500 119.607 127.694 1.00 160.51 ? 890  HIS O O     1 
ATOM   1369  C  CB    . HIS A 1  225 ? 155.883 118.780 129.239 1.00 158.54 ? 890  HIS O CB    1 
ATOM   1370  C  CG    . HIS A 1  225 ? 155.448 119.193 130.607 1.00 164.72 ? 890  HIS O CG    1 
ATOM   1371  N  ND1   . HIS A 1  225 ? 154.586 120.244 130.830 1.00 162.63 ? 890  HIS O ND1   1 
ATOM   1372  C  CD2   . HIS A 1  225 ? 155.794 118.723 131.828 1.00 165.12 ? 890  HIS O CD2   1 
ATOM   1373  C  CE1   . HIS A 1  225 ? 154.408 120.392 132.130 1.00 164.64 ? 890  HIS O CE1   1 
ATOM   1374  N  NE2   . HIS A 1  225 ? 155.122 119.476 132.757 1.00 162.29 ? 890  HIS O NE2   1 
ATOM   1375  N  N     . MET A 1  226 ? 152.481 117.853 128.681 1.00 159.35 ? 891  MET O N     1 
ATOM   1376  C  CA    . MET A 1  226 ? 151.140 118.393 128.513 1.00 160.61 ? 891  MET O CA    1 
ATOM   1377  C  C     . MET A 1  226 ? 150.543 118.740 129.869 1.00 162.11 ? 891  MET O C     1 
ATOM   1378  O  O     . MET A 1  226 ? 150.897 118.153 130.894 1.00 166.43 ? 891  MET O O     1 
ATOM   1379  C  CB    . MET A 1  226 ? 150.197 117.422 127.793 1.00 140.25 ? 891  MET O CB    1 
ATOM   1380  C  CG    . MET A 1  226 ? 149.644 116.298 128.659 1.00 143.19 ? 891  MET O CG    1 
ATOM   1381  S  SD    . MET A 1  226 ? 148.584 115.113 127.789 1.00 151.07 ? 891  MET O SD    1 
ATOM   1382  C  CE    . MET A 1  226 ? 149.728 113.841 127.271 1.00 155.83 ? 891  MET O CE    1 
ATOM   1383  N  N     . ILE A 1  227 ? 149.631 119.704 129.860 1.00 134.11 ? 892  ILE O N     1 
ATOM   1384  C  CA    . ILE A 1  227 ? 148.970 120.183 131.063 1.00 136.71 ? 892  ILE O CA    1 
ATOM   1385  C  C     . ILE A 1  227 ? 147.477 120.254 130.802 1.00 142.19 ? 892  ILE O C     1 
ATOM   1386  O  O     . ILE A 1  227 ? 147.041 120.660 129.721 1.00 140.57 ? 892  ILE O O     1 
ATOM   1387  C  CB    . ILE A 1  227 ? 149.511 121.560 131.492 1.00 141.23 ? 892  ILE O CB    1 
ATOM   1388  C  CG1   . ILE A 1  227 ? 150.995 121.459 131.806 1.00 145.10 ? 892  ILE O CG1   1 
ATOM   1389  C  CG2   . ILE A 1  227 ? 148.761 122.090 132.698 1.00 146.92 ? 892  ILE O CG2   1 
ATOM   1390  C  CD1   . ILE A 1  227 ? 151.273 120.508 132.920 1.00 142.94 ? 892  ILE O CD1   1 
ATOM   1391  N  N     . ILE A 1  228 ? 146.696 119.849 131.793 1.00 122.56 ? 893  ILE O N     1 
ATOM   1392  C  CA    . ILE A 1  228 ? 145.252 119.995 131.775 1.00 126.61 ? 893  ILE O CA    1 
ATOM   1393  C  C     . ILE A 1  228 ? 144.869 120.796 133.013 1.00 127.78 ? 893  ILE O C     1 
ATOM   1394  O  O     . ILE A 1  228 ? 145.651 120.937 133.954 1.00 128.41 ? 893  ILE O O     1 
ATOM   1395  C  CB    . ILE A 1  228 ? 144.546 118.621 131.736 1.00 129.52 ? 893  ILE O CB    1 
ATOM   1396  C  CG1   . ILE A 1  228 ? 143.038 118.758 131.594 1.00 129.52 ? 893  ILE O CG1   1 
ATOM   1397  C  CG2   . ILE A 1  228 ? 144.836 117.828 132.972 1.00 129.52 ? 893  ILE O CG2   1 
ATOM   1398  C  CD1   . ILE A 1  228 ? 142.356 117.438 131.398 1.00 129.52 ? 893  ILE O CD1   1 
ATOM   1399  N  N     . ASP A 1  229 ? 143.675 121.366 132.987 1.00 118.56 ? 894  ASP O N     1 
ATOM   1400  C  CA    . ASP A 1  229 ? 143.103 121.981 134.169 1.00 119.75 ? 894  ASP O CA    1 
ATOM   1401  C  C     . ASP A 1  229 ? 141.751 121.339 134.436 1.00 126.13 ? 894  ASP O C     1 
ATOM   1402  O  O     . ASP A 1  229 ? 141.182 120.672 133.572 1.00 129.59 ? 894  ASP O O     1 
ATOM   1403  C  CB    . ASP A 1  229 ? 142.983 123.499 134.003 1.00 133.09 ? 894  ASP O CB    1 
ATOM   1404  C  CG    . ASP A 1  229 ? 142.485 124.194 135.259 1.00 133.09 ? 894  ASP O CG    1 
ATOM   1405  O  OD1   . ASP A 1  229 ? 142.086 123.511 136.221 1.00 133.09 ? 894  ASP O OD1   1 
ATOM   1406  O  OD2   . ASP A 1  229 ? 142.527 125.437 135.301 1.00 133.09 ? 894  ASP O OD2   1 
ATOM   1407  N  N     . GLU A 1  230 ? 141.261 121.524 135.655 1.00 117.93 ? 895  GLU O N     1 
ATOM   1408  C  CA    . GLU A 1  230 ? 140.018 120.915 136.115 1.00 125.04 ? 895  GLU O CA    1 
ATOM   1409  C  C     . GLU A 1  230 ? 139.995 119.425 135.792 1.00 128.54 ? 895  GLU O C     1 
ATOM   1410  O  O     . GLU A 1  230 ? 139.159 118.931 135.037 1.00 134.09 ? 895  GLU O O     1 
ATOM   1411  C  CB    . GLU A 1  230 ? 138.813 121.631 135.513 1.00 126.85 ? 895  GLU O CB    1 
ATOM   1412  C  CG    . GLU A 1  230 ? 138.655 123.043 136.006 1.00 134.00 ? 895  GLU O CG    1 
ATOM   1413  C  CD    . GLU A 1  230 ? 138.464 123.111 137.501 1.00 132.96 ? 895  GLU O CD    1 
ATOM   1414  O  OE1   . GLU A 1  230 ? 137.734 122.261 138.052 1.00 138.18 ? 895  GLU O OE1   1 
ATOM   1415  O  OE2   . GLU A 1  230 ? 139.052 124.011 138.127 1.00 127.80 ? 895  GLU O OE2   1 
ATOM   1416  N  N     . GLY A 1  231 ? 140.938 118.709 136.399 1.00 125.46 ? 896  GLY O N     1 
ATOM   1417  C  CA    . GLY A 1  231 ? 141.105 117.304 136.083 1.00 128.32 ? 896  GLY O CA    1 
ATOM   1418  C  C     . GLY A 1  231 ? 139.871 116.474 136.352 1.00 133.39 ? 896  GLY O C     1 
ATOM   1419  O  O     . GLY A 1  231 ? 139.652 115.454 135.696 1.00 133.89 ? 896  GLY O O     1 
ATOM   1420  N  N     . HIS A 1  232 ? 139.034 116.904 137.294 1.00 124.32 ? 897  HIS O N     1 
ATOM   1421  C  CA    . HIS A 1  232 ? 137.838 116.132 137.585 1.00 131.60 ? 897  HIS O CA    1 
ATOM   1422  C  C     . HIS A 1  232 ? 136.887 116.083 136.404 1.00 137.47 ? 897  HIS O C     1 
ATOM   1423  O  O     . HIS A 1  232 ? 135.894 115.352 136.459 1.00 142.86 ? 897  HIS O O     1 
ATOM   1424  C  CB    . HIS A 1  232 ? 137.143 116.689 138.818 1.00 138.68 ? 897  HIS O CB    1 
ATOM   1425  C  CG    . HIS A 1  232 ? 136.770 118.126 138.698 1.00 142.70 ? 897  HIS O CG    1 
ATOM   1426  N  ND1   . HIS A 1  232 ? 135.678 118.551 137.978 1.00 138.31 ? 897  HIS O ND1   1 
ATOM   1427  C  CD2   . HIS A 1  232 ? 137.341 119.238 139.213 1.00 151.65 ? 897  HIS O CD2   1 
ATOM   1428  C  CE1   . HIS A 1  232 ? 135.591 119.867 138.055 1.00 144.23 ? 897  HIS O CE1   1 
ATOM   1429  N  NE2   . HIS A 1  232 ? 136.589 120.308 138.799 1.00 152.43 ? 897  HIS O NE2   1 
ATOM   1430  N  N     . ARG A 1  233 ? 137.161 116.845 135.348 1.00 129.59 ? 898  ARG O N     1 
ATOM   1431  C  CA    . ARG A 1  233 ? 136.483 116.621 134.080 1.00 134.79 ? 898  ARG O CA    1 
ATOM   1432  C  C     . ARG A 1  233 ? 136.846 115.265 133.492 1.00 136.75 ? 898  ARG O C     1 
ATOM   1433  O  O     . ARG A 1  233 ? 136.031 114.656 132.791 1.00 143.52 ? 898  ARG O O     1 
ATOM   1434  C  CB    . ARG A 1  233 ? 136.842 117.734 133.098 1.00 122.34 ? 898  ARG O CB    1 
ATOM   1435  C  CG    . ARG A 1  233 ? 136.142 117.662 131.754 1.00 121.06 ? 898  ARG O CG    1 
ATOM   1436  C  CD    . ARG A 1  233 ? 134.646 117.897 131.882 1.00 121.24 ? 898  ARG O CD    1 
ATOM   1437  N  NE    . ARG A 1  233 ? 134.357 119.222 132.427 1.00 120.80 ? 898  ARG O NE    1 
ATOM   1438  C  CZ    . ARG A 1  233 ? 133.135 119.694 132.653 1.00 127.90 ? 898  ARG O CZ    1 
ATOM   1439  N  NH1   . ARG A 1  233 ? 132.072 118.961 132.360 1.00 136.32 ? 898  ARG O NH1   1 
ATOM   1440  N  NH2   . ARG A 1  233 ? 132.976 120.910 133.157 1.00 127.34 ? 898  ARG O NH2   1 
ATOM   1441  N  N     . MET A 1  234 ? 138.063 114.787 133.745 1.00 134.53 ? 899  MET O N     1 
ATOM   1442  C  CA    . MET A 1  234 ? 138.510 113.513 133.199 1.00 136.23 ? 899  MET O CA    1 
ATOM   1443  C  C     . MET A 1  234 ? 137.635 112.347 133.628 1.00 139.57 ? 899  MET O C     1 
ATOM   1444  O  O     . MET A 1  234 ? 136.852 111.828 132.828 1.00 136.96 ? 899  MET O O     1 
ATOM   1445  C  CB    . MET A 1  234 ? 139.948 113.243 133.618 1.00 153.64 ? 899  MET O CB    1 
ATOM   1446  C  CG    . MET A 1  234 ? 140.928 114.198 133.014 1.00 153.64 ? 899  MET O CG    1 
ATOM   1447  S  SD    . MET A 1  234 ? 140.903 114.034 131.231 1.00 153.64 ? 899  MET O SD    1 
ATOM   1448  C  CE    . MET A 1  234 ? 141.538 112.372 131.071 1.00 153.64 ? 899  MET O CE    1 
ATOM   1449  N  N     . LYS A 1  235 ? 137.752 111.943 134.892 1.00 126.07 ? 900  LYS O N     1 
ATOM   1450  C  CA    . LYS A 1  235 ? 137.034 110.785 135.413 1.00 131.98 ? 900  LYS O CA    1 
ATOM   1451  C  C     . LYS A 1  235 ? 137.231 109.567 134.519 1.00 138.89 ? 900  LYS O C     1 
ATOM   1452  O  O     . LYS A 1  235 ? 138.357 109.081 134.387 1.00 142.33 ? 900  LYS O O     1 
ATOM   1453  C  CB    . LYS A 1  235 ? 135.557 111.116 135.607 1.00 135.17 ? 900  LYS O CB    1 
ATOM   1454  C  CG    . LYS A 1  235 ? 135.362 112.123 136.725 1.00 143.83 ? 900  LYS O CG    1 
ATOM   1455  C  CD    . LYS A 1  235 ? 133.924 112.549 136.878 1.00 148.27 ? 900  LYS O CD    1 
ATOM   1456  C  CE    . LYS A 1  235 ? 133.782 113.546 138.012 1.00 148.80 ? 900  LYS O CE    1 
ATOM   1457  N  NZ    . LYS A 1  235 ? 132.394 114.063 138.131 1.00 149.40 ? 900  LYS O NZ    1 
ATOM   1458  N  N     . ASN A 1  236 ? 136.158 109.070 133.905 1.00 144.60 ? 901  ASN O N     1 
ATOM   1459  C  CA    . ASN A 1  236 ? 136.243 107.836 133.133 1.00 144.60 ? 901  ASN O CA    1 
ATOM   1460  C  C     . ASN A 1  236 ? 137.352 107.911 132.096 1.00 144.60 ? 901  ASN O C     1 
ATOM   1461  O  O     . ASN A 1  236 ? 137.643 108.969 131.537 1.00 144.60 ? 901  ASN O O     1 
ATOM   1462  C  CB    . ASN A 1  236 ? 134.932 107.554 132.407 1.00 146.87 ? 901  ASN O CB    1 
ATOM   1463  C  CG    . ASN A 1  236 ? 133.830 107.172 133.337 1.00 146.87 ? 901  ASN O CG    1 
ATOM   1464  O  OD1   . ASN A 1  236 ? 134.075 106.709 134.446 1.00 146.87 ? 901  ASN O OD1   1 
ATOM   1465  N  ND2   . ASN A 1  236 ? 132.596 107.363 132.899 1.00 146.87 ? 901  ASN O ND2   1 
ATOM   1466  N  N     . ALA A 1  237 ? 137.991 106.772 131.857 1.00 133.40 ? 902  ALA O N     1 
ATOM   1467  C  CA    . ALA A 1  237 ? 138.835 106.648 130.680 1.00 133.40 ? 902  ALA O CA    1 
ATOM   1468  C  C     . ALA A 1  237 ? 138.021 106.336 129.439 1.00 133.40 ? 902  ALA O C     1 
ATOM   1469  O  O     . ALA A 1  237 ? 138.487 106.588 128.324 1.00 133.40 ? 902  ALA O O     1 
ATOM   1470  C  CB    . ALA A 1  237 ? 139.888 105.563 130.885 1.00 121.10 ? 902  ALA O CB    1 
ATOM   1471  N  N     . GLN A 1  238 ? 136.818 105.797 129.610 1.00 156.48 ? 903  GLN O N     1 
ATOM   1472  C  CA    . GLN A 1  238 ? 135.942 105.566 128.476 1.00 162.19 ? 903  GLN O CA    1 
ATOM   1473  C  C     . GLN A 1  238 ? 135.280 106.849 127.997 1.00 157.43 ? 903  GLN O C     1 
ATOM   1474  O  O     . GLN A 1  238 ? 134.787 106.891 126.865 1.00 157.61 ? 903  GLN O O     1 
ATOM   1475  C  CB    . GLN A 1  238 ? 134.894 104.517 128.840 1.00 161.15 ? 903  GLN O CB    1 
ATOM   1476  C  CG    . GLN A 1  238 ? 134.035 104.061 127.685 1.00 161.15 ? 903  GLN O CG    1 
ATOM   1477  C  CD    . GLN A 1  238 ? 133.215 102.849 128.038 1.00 161.15 ? 903  GLN O CD    1 
ATOM   1478  O  OE1   . GLN A 1  238 ? 133.370 102.276 129.115 1.00 161.15 ? 903  GLN O OE1   1 
ATOM   1479  N  NE2   . GLN A 1  238 ? 132.338 102.445 127.132 1.00 161.15 ? 903  GLN O NE2   1 
ATOM   1480  N  N     . SER A 1  239 ? 135.267 107.892 128.826 1.00 165.77 ? 904  SER O N     1 
ATOM   1481  C  CA    . SER A 1  239 ? 134.849 109.205 128.356 1.00 161.98 ? 904  SER O CA    1 
ATOM   1482  C  C     . SER A 1  239 ? 135.702 109.625 127.170 1.00 154.67 ? 904  SER O C     1 
ATOM   1483  O  O     . SER A 1  239 ? 136.921 109.440 127.167 1.00 147.04 ? 904  SER O O     1 
ATOM   1484  C  CB    . SER A 1  239 ? 134.963 110.236 129.470 1.00 154.05 ? 904  SER O CB    1 
ATOM   1485  O  OG    . SER A 1  239 ? 134.639 111.518 128.973 1.00 143.50 ? 904  SER O OG    1 
ATOM   1486  N  N     . LYS A 1  240 ? 135.049 110.205 126.164 1.00 153.85 ? 905  LYS O N     1 
ATOM   1487  C  CA    . LYS A 1  240 ? 135.669 110.340 124.853 1.00 149.58 ? 905  LYS O CA    1 
ATOM   1488  C  C     . LYS A 1  240 ? 136.961 111.139 124.925 1.00 138.00 ? 905  LYS O C     1 
ATOM   1489  O  O     . LYS A 1  240 ? 137.953 110.778 124.285 1.00 134.31 ? 905  LYS O O     1 
ATOM   1490  C  CB    . LYS A 1  240 ? 134.693 110.991 123.884 1.00 137.41 ? 905  LYS O CB    1 
ATOM   1491  C  CG    . LYS A 1  240 ? 135.121 110.926 122.441 1.00 137.41 ? 905  LYS O CG    1 
ATOM   1492  C  CD    . LYS A 1  240 ? 135.040 109.499 121.931 1.00 137.41 ? 905  LYS O CD    1 
ATOM   1493  C  CE    . LYS A 1  240 ? 135.380 109.427 120.457 1.00 137.41 ? 905  LYS O CE    1 
ATOM   1494  N  NZ    . LYS A 1  240 ? 134.382 110.173 119.645 1.00 137.41 ? 905  LYS O NZ    1 
ATOM   1495  N  N     . LEU A 1  241 ? 136.980 112.205 125.727 1.00 150.53 ? 906  LEU O N     1 
ATOM   1496  C  CA    . LEU A 1  241 ? 138.145 113.086 125.777 1.00 140.39 ? 906  LEU O CA    1 
ATOM   1497  C  C     . LEU A 1  241 ? 139.414 112.320 126.122 1.00 138.56 ? 906  LEU O C     1 
ATOM   1498  O  O     . LEU A 1  241 ? 140.448 112.476 125.462 1.00 135.73 ? 906  LEU O O     1 
ATOM   1499  C  CB    . LEU A 1  241 ? 137.911 114.202 126.788 1.00 148.65 ? 906  LEU O CB    1 
ATOM   1500  C  CG    . LEU A 1  241 ? 139.102 115.129 126.983 1.00 147.07 ? 906  LEU O CG    1 
ATOM   1501  C  CD1   . LEU A 1  241 ? 139.433 115.785 125.676 1.00 154.01 ? 906  LEU O CD1   1 
ATOM   1502  C  CD2   . LEU A 1  241 ? 138.774 116.177 128.020 1.00 137.89 ? 906  LEU O CD2   1 
ATOM   1503  N  N     . SER A 1  242 ? 139.351 111.480 127.152 1.00 151.23 ? 907  SER O N     1 
ATOM   1504  C  CA    . SER A 1  242 ? 140.529 110.749 127.599 1.00 151.30 ? 907  SER O CA    1 
ATOM   1505  C  C     . SER A 1  242 ? 141.086 109.865 126.491 1.00 154.22 ? 907  SER O C     1 
ATOM   1506  O  O     . SER A 1  242 ? 142.253 109.988 126.099 1.00 149.23 ? 907  SER O O     1 
ATOM   1507  C  CB    . SER A 1  242 ? 140.169 109.913 128.821 1.00 150.14 ? 907  SER O CB    1 
ATOM   1508  O  OG    . SER A 1  242 ? 139.186 108.954 128.478 1.00 150.14 ? 907  SER O OG    1 
ATOM   1509  N  N     . LEU A 1  243 ? 140.255 108.961 125.971 1.00 152.20 ? 908  LEU O N     1 
ATOM   1510  C  CA    . LEU A 1  243 ? 140.724 108.013 124.971 1.00 156.84 ? 908  LEU O CA    1 
ATOM   1511  C  C     . LEU A 1  243 ? 141.135 108.700 123.681 1.00 151.44 ? 908  LEU O C     1 
ATOM   1512  O  O     . LEU A 1  243 ? 142.013 108.191 122.969 1.00 151.99 ? 908  LEU O O     1 
ATOM   1513  C  CB    . LEU A 1  243 ? 139.650 106.957 124.728 1.00 151.35 ? 908  LEU O CB    1 
ATOM   1514  C  CG    . LEU A 1  243 ? 138.249 107.424 124.353 1.00 151.35 ? 908  LEU O CG    1 
ATOM   1515  C  CD1   . LEU A 1  243 ? 138.136 107.765 122.885 1.00 151.35 ? 908  LEU O CD1   1 
ATOM   1516  C  CD2   . LEU A 1  243 ? 137.259 106.340 124.727 1.00 151.35 ? 908  LEU O CD2   1 
ATOM   1517  N  N     . THR A 1  244 ? 140.535 109.849 123.369 1.00 164.59 ? 909  THR O N     1 
ATOM   1518  C  CA    . THR A 1  244 ? 141.083 110.669 122.299 1.00 159.98 ? 909  THR O CA    1 
ATOM   1519  C  C     . THR A 1  244 ? 142.504 111.089 122.625 1.00 150.22 ? 909  THR O C     1 
ATOM   1520  O  O     . THR A 1  244 ? 143.408 110.875 121.817 1.00 146.89 ? 909  THR O O     1 
ATOM   1521  C  CB    . THR A 1  244 ? 140.209 111.895 122.047 1.00 151.42 ? 909  THR O CB    1 
ATOM   1522  O  OG1   . THR A 1  244 ? 140.034 112.626 123.267 1.00 151.42 ? 909  THR O OG1   1 
ATOM   1523  C  CG2   . THR A 1  244 ? 138.863 111.482 121.493 1.00 151.42 ? 909  THR O CG2   1 
ATOM   1524  N  N     . LEU A 1  245 ? 142.724 111.647 123.821 1.00 166.19 ? 910  LEU O N     1 
ATOM   1525  C  CA    . LEU A 1  245 ? 144.074 112.023 124.235 1.00 157.91 ? 910  LEU O CA    1 
ATOM   1526  C  C     . LEU A 1  245 ? 145.056 110.879 124.059 1.00 157.67 ? 910  LEU O C     1 
ATOM   1527  O  O     . LEU A 1  245 ? 146.185 111.087 123.605 1.00 152.43 ? 910  LEU O O     1 
ATOM   1528  C  CB    . LEU A 1  245 ? 144.084 112.471 125.691 1.00 166.31 ? 910  LEU O CB    1 
ATOM   1529  C  CG    . LEU A 1  245 ? 143.411 113.774 126.078 1.00 163.72 ? 910  LEU O CG    1 
ATOM   1530  C  CD1   . LEU A 1  245 ? 143.414 113.882 127.582 1.00 158.11 ? 910  LEU O CD1   1 
ATOM   1531  C  CD2   . LEU A 1  245 ? 144.186 114.911 125.475 1.00 161.11 ? 910  LEU O CD2   1 
ATOM   1532  N  N     . ASN A 1  246 ? 144.649 109.664 124.424 1.00 154.64 ? 911  ASN O N     1 
ATOM   1533  C  CA    . ASN A 1  246 ? 145.539 108.517 124.273 1.00 156.36 ? 911  ASN O CA    1 
ATOM   1534  C  C     . ASN A 1  246 ? 145.831 108.234 122.802 1.00 159.59 ? 911  ASN O C     1 
ATOM   1535  O  O     . ASN A 1  246 ? 146.995 108.150 122.395 1.00 160.28 ? 911  ASN O O     1 
ATOM   1536  C  CB    . ASN A 1  246 ? 144.933 107.291 124.955 1.00 157.97 ? 911  ASN O CB    1 
ATOM   1537  C  CG    . ASN A 1  246 ? 144.843 107.439 126.471 1.00 154.41 ? 911  ASN O CG    1 
ATOM   1538  O  OD1   . ASN A 1  246 ? 143.795 107.194 127.070 1.00 148.06 ? 911  ASN O OD1   1 
ATOM   1539  N  ND2   . ASN A 1  246 ? 145.953 107.818 127.098 1.00 159.17 ? 911  ASN O ND2   1 
ATOM   1540  N  N     . THR A 1  247 ? 144.788 108.097 121.981 1.00 155.65 ? 912  THR O N     1 
ATOM   1541  C  CA    . THR A 1  247 ? 145.022 107.922 120.551 1.00 158.44 ? 912  THR O CA    1 
ATOM   1542  C  C     . THR A 1  247 ? 145.566 109.206 119.903 1.00 151.18 ? 912  THR O C     1 
ATOM   1543  O  O     . THR A 1  247 ? 146.278 109.127 118.895 1.00 152.59 ? 912  THR O O     1 
ATOM   1544  C  CB    . THR A 1  247 ? 143.734 107.470 119.862 1.00 159.85 ? 912  THR O CB    1 
ATOM   1545  O  OG1   . THR A 1  247 ? 143.290 106.238 120.447 1.00 159.85 ? 912  THR O OG1   1 
ATOM   1546  C  CG2   . THR A 1  247 ? 143.958 107.258 118.357 1.00 159.85 ? 912  THR O CG2   1 
ATOM   1547  N  N     . HIS A 1  248 ? 145.258 110.383 120.476 1.00 166.06 ? 913  HIS O N     1 
ATOM   1548  C  CA    . HIS A 1  248 ? 145.645 111.685 119.946 1.00 159.55 ? 913  HIS O CA    1 
ATOM   1549  C  C     . HIS A 1  248 ? 147.118 111.684 119.594 1.00 156.98 ? 913  HIS O C     1 
ATOM   1550  O  O     . HIS A 1  248 ? 147.496 111.641 118.418 1.00 158.15 ? 913  HIS O O     1 
ATOM   1551  C  CB    . HIS A 1  248 ? 145.400 112.800 120.975 1.00 173.25 ? 913  HIS O CB    1 
ATOM   1552  C  CG    . HIS A 1  248 ? 145.340 114.179 120.415 1.00 173.25 ? 913  HIS O CG    1 
ATOM   1553  N  ND1   . HIS A 1  248 ? 146.438 114.845 119.922 1.00 173.25 ? 913  HIS O ND1   1 
ATOM   1554  C  CD2   . HIS A 1  248 ? 144.311 115.053 120.363 1.00 173.25 ? 913  HIS O CD2   1 
ATOM   1555  C  CE1   . HIS A 1  248 ? 146.079 116.062 119.562 1.00 173.25 ? 913  HIS O CE1   1 
ATOM   1556  N  NE2   . HIS A 1  248 ? 144.792 116.210 119.812 1.00 173.25 ? 913  HIS O NE2   1 
ATOM   1557  N  N     . TYR A 1  249 ? 147.953 111.696 120.627 1.00 172.50 ? 914  TYR O N     1 
ATOM   1558  C  CA    . TYR A 1  249 ? 149.387 111.886 120.511 1.00 172.50 ? 914  TYR O CA    1 
ATOM   1559  C  C     . TYR A 1  249 ? 150.045 111.216 121.706 1.00 172.50 ? 914  TYR O C     1 
ATOM   1560  O  O     . TYR A 1  249 ? 149.427 110.416 122.416 1.00 172.50 ? 914  TYR O O     1 
ATOM   1561  C  CB    . TYR A 1  249 ? 149.748 113.374 120.457 1.00 165.77 ? 914  TYR O CB    1 
ATOM   1562  C  CG    . TYR A 1  249 ? 149.510 114.095 121.761 1.00 165.77 ? 914  TYR O CG    1 
ATOM   1563  C  CD1   . TYR A 1  249 ? 150.537 114.333 122.655 1.00 165.77 ? 914  TYR O CD1   1 
ATOM   1564  C  CD2   . TYR A 1  249 ? 148.241 114.503 122.114 1.00 165.77 ? 914  TYR O CD2   1 
ATOM   1565  C  CE1   . TYR A 1  249 ? 150.300 114.993 123.842 1.00 165.77 ? 914  TYR O CE1   1 
ATOM   1566  C  CE2   . TYR A 1  249 ? 147.992 115.159 123.290 1.00 165.77 ? 914  TYR O CE2   1 
ATOM   1567  C  CZ    . TYR A 1  249 ? 149.024 115.401 124.156 1.00 165.77 ? 914  TYR O CZ    1 
ATOM   1568  O  OH    . TYR A 1  249 ? 148.786 116.053 125.340 1.00 165.77 ? 914  TYR O OH    1 
ATOM   1569  N  N     . HIS A 1  250 ? 151.324 111.519 121.901 1.00 173.58 ? 915  HIS O N     1 
ATOM   1570  C  CA    . HIS A 1  250 ? 152.052 111.081 123.084 1.00 173.58 ? 915  HIS O CA    1 
ATOM   1571  C  C     . HIS A 1  250 ? 152.940 112.202 123.595 1.00 173.58 ? 915  HIS O C     1 
ATOM   1572  O  O     . HIS A 1  250 ? 153.816 112.683 122.870 1.00 173.58 ? 915  HIS O O     1 
ATOM   1573  C  CB    . HIS A 1  250 ? 152.874 109.841 122.770 1.00 176.25 ? 915  HIS O CB    1 
ATOM   1574  C  CG    . HIS A 1  250 ? 152.045 108.712 122.265 1.00 176.25 ? 915  HIS O CG    1 
ATOM   1575  N  ND1   . HIS A 1  250 ? 151.118 108.074 123.058 1.00 176.25 ? 915  HIS O ND1   1 
ATOM   1576  C  CD2   . HIS A 1  250 ? 151.967 108.130 121.046 1.00 176.25 ? 915  HIS O CD2   1 
ATOM   1577  C  CE1   . HIS A 1  250 ? 150.517 107.133 122.355 1.00 176.25 ? 915  HIS O CE1   1 
ATOM   1578  N  NE2   . HIS A 1  250 ? 151.014 107.145 121.131 1.00 176.25 ? 915  HIS O NE2   1 
ATOM   1579  N  N     . ALA A 1  251 ? 152.697 112.618 124.832 1.00 164.10 ? 916  ALA O N     1 
ATOM   1580  C  CA    . ALA A 1  251 ? 153.565 113.530 125.560 1.00 165.85 ? 916  ALA O CA    1 
ATOM   1581  C  C     . ALA A 1  251 ? 154.115 112.803 126.776 1.00 166.60 ? 916  ALA O C     1 
ATOM   1582  O  O     . ALA A 1  251 ? 153.346 112.291 127.598 1.00 166.28 ? 916  ALA O O     1 
ATOM   1583  C  CB    . ALA A 1  251 ? 152.818 114.787 125.999 1.00 147.75 ? 916  ALA O CB    1 
ATOM   1584  N  N     . ASP A 1  252 ? 155.444 112.784 126.901 1.00 179.31 ? 917  ASP O N     1 
ATOM   1585  C  CA    . ASP A 1  252 ? 156.076 112.050 127.990 1.00 180.30 ? 917  ASP O CA    1 
ATOM   1586  C  C     . ASP A 1  252 ? 155.671 112.573 129.360 1.00 186.15 ? 917  ASP O C     1 
ATOM   1587  O  O     . ASP A 1  252 ? 155.822 111.853 130.352 1.00 192.06 ? 917  ASP O O     1 
ATOM   1588  C  CB    . ASP A 1  252 ? 157.598 112.104 127.849 1.00 205.75 ? 917  ASP O CB    1 
ATOM   1589  C  CG    . ASP A 1  252 ? 158.102 111.315 126.657 1.00 205.75 ? 917  ASP O CG    1 
ATOM   1590  O  OD1   . ASP A 1  252 ? 157.321 110.516 126.103 1.00 205.75 ? 917  ASP O OD1   1 
ATOM   1591  O  OD2   . ASP A 1  252 ? 159.278 111.488 126.274 1.00 205.75 ? 917  ASP O OD2   1 
ATOM   1592  N  N     . TYR A 1  253 ? 155.162 113.797 129.446 1.00 176.34 ? 918  TYR O N     1 
ATOM   1593  C  CA    . TYR A 1  253 ? 154.798 114.390 130.720 1.00 182.48 ? 918  TYR O CA    1 
ATOM   1594  C  C     . TYR A 1  253 ? 153.349 114.849 130.695 1.00 179.96 ? 918  TYR O C     1 
ATOM   1595  O  O     . TYR A 1  253 ? 152.811 115.221 129.649 1.00 181.09 ? 918  TYR O O     1 
ATOM   1596  C  CB    . TYR A 1  253 ? 155.718 115.558 131.061 1.00 160.58 ? 918  TYR O CB    1 
ATOM   1597  C  CG    . TYR A 1  253 ? 157.150 115.134 131.266 1.00 160.58 ? 918  TYR O CG    1 
ATOM   1598  C  CD1   . TYR A 1  253 ? 157.602 114.736 132.515 1.00 160.58 ? 918  TYR O CD1   1 
ATOM   1599  C  CD2   . TYR A 1  253 ? 158.046 115.109 130.207 1.00 160.58 ? 918  TYR O CD2   1 
ATOM   1600  C  CE1   . TYR A 1  253 ? 158.908 114.337 132.707 1.00 160.58 ? 918  TYR O CE1   1 
ATOM   1601  C  CE2   . TYR A 1  253 ? 159.355 114.711 130.390 1.00 160.58 ? 918  TYR O CE2   1 
ATOM   1602  C  CZ    . TYR A 1  253 ? 159.778 114.326 131.641 1.00 160.58 ? 918  TYR O CZ    1 
ATOM   1603  O  OH    . TYR A 1  253 ? 161.079 113.929 131.824 1.00 160.58 ? 918  TYR O OH    1 
ATOM   1604  N  N     . ARG A 1  254 ? 152.727 114.807 131.868 1.00 189.39 ? 919  ARG O N     1 
ATOM   1605  C  CA    . ARG A 1  254 ? 151.326 115.146 132.054 1.00 181.03 ? 919  ARG O CA    1 
ATOM   1606  C  C     . ARG A 1  254 ? 151.213 115.911 133.364 1.00 190.14 ? 919  ARG O C     1 
ATOM   1607  O  O     . ARG A 1  254 ? 152.222 116.262 133.982 1.00 186.95 ? 919  ARG O O     1 
ATOM   1608  C  CB    . ARG A 1  254 ? 150.456 113.882 132.048 1.00 163.45 ? 919  ARG O CB    1 
ATOM   1609  C  CG    . ARG A 1  254 ? 150.413 113.177 130.710 1.00 166.85 ? 919  ARG O CG    1 
ATOM   1610  C  CD    . ARG A 1  254 ? 149.717 111.835 130.791 1.00 176.50 ? 919  ARG O CD    1 
ATOM   1611  N  NE    . ARG A 1  254 ? 150.457 110.897 131.627 1.00 185.90 ? 919  ARG O NE    1 
ATOM   1612  C  CZ    . ARG A 1  254 ? 150.094 109.636 131.838 1.00 186.88 ? 919  ARG O CZ    1 
ATOM   1613  N  NH1   . ARG A 1  254 ? 150.825 108.854 132.621 1.00 187.65 ? 919  ARG O NH1   1 
ATOM   1614  N  NH2   . ARG A 1  254 ? 148.993 109.157 131.275 1.00 180.93 ? 919  ARG O NH2   1 
ATOM   1615  N  N     . LEU A 1  255 ? 149.978 116.165 133.785 1.00 170.36 ? 920  LEU O N     1 
ATOM   1616  C  CA    . LEU A 1  255 ? 149.659 116.764 135.077 1.00 171.52 ? 920  LEU O CA    1 
ATOM   1617  C  C     . LEU A 1  255 ? 148.144 116.884 135.126 1.00 176.96 ? 920  LEU O C     1 
ATOM   1618  O  O     . LEU A 1  255 ? 147.461 116.728 134.113 1.00 179.78 ? 920  LEU O O     1 
ATOM   1619  C  CB    . LEU A 1  255 ? 150.329 118.128 135.288 1.00 165.88 ? 920  LEU O CB    1 
ATOM   1620  C  CG    . LEU A 1  255 ? 150.124 118.916 136.588 1.00 170.70 ? 920  LEU O CG    1 
ATOM   1621  C  CD1   . LEU A 1  255 ? 150.647 118.161 137.802 1.00 167.71 ? 920  LEU O CD1   1 
ATOM   1622  C  CD2   . LEU A 1  255 ? 150.783 120.275 136.491 1.00 169.44 ? 920  LEU O CD2   1 
ATOM   1623  N  N     . ILE A 1  256 ? 147.626 117.121 136.322 1.00 171.86 ? 921  ILE O N     1 
ATOM   1624  C  CA    . ILE A 1  256 ? 146.212 117.380 136.537 1.00 168.29 ? 921  ILE O CA    1 
ATOM   1625  C  C     . ILE A 1  256 ? 146.088 118.478 137.574 1.00 172.37 ? 921  ILE O C     1 
ATOM   1626  O  O     . ILE A 1  256 ? 146.659 118.375 138.663 1.00 171.34 ? 921  ILE O O     1 
ATOM   1627  C  CB    . ILE A 1  256 ? 145.461 116.120 136.997 1.00 176.03 ? 921  ILE O CB    1 
ATOM   1628  C  CG1   . ILE A 1  256 ? 145.316 115.134 135.834 1.00 182.35 ? 921  ILE O CG1   1 
ATOM   1629  C  CG2   . ILE A 1  256 ? 144.138 116.499 137.641 1.00 173.81 ? 921  ILE O CG2   1 
ATOM   1630  C  CD1   . ILE A 1  256 ? 144.801 113.769 136.233 1.00 187.51 ? 921  ILE O CD1   1 
ATOM   1631  N  N     . LEU A 1  257 ? 145.345 119.521 137.248 1.00 129.83 ? 922  LEU O N     1 
ATOM   1632  C  CA    . LEU A 1  257 ? 145.113 120.632 138.156 1.00 131.23 ? 922  LEU O CA    1 
ATOM   1633  C  C     . LEU A 1  257 ? 143.638 120.649 138.523 1.00 133.19 ? 922  LEU O C     1 
ATOM   1634  O  O     . LEU A 1  257 ? 142.780 120.688 137.638 1.00 135.66 ? 922  LEU O O     1 
ATOM   1635  C  CB    . LEU A 1  257 ? 145.537 121.941 137.504 1.00 129.63 ? 922  LEU O CB    1 
ATOM   1636  C  CG    . LEU A 1  257 ? 147.037 122.033 137.282 1.00 130.82 ? 922  LEU O CG    1 
ATOM   1637  C  CD1   . LEU A 1  257 ? 147.352 123.230 136.432 1.00 133.36 ? 922  LEU O CD1   1 
ATOM   1638  C  CD2   . LEU A 1  257 ? 147.712 122.165 138.618 1.00 128.82 ? 922  LEU O CD2   1 
ATOM   1639  N  N     . THR A 1  258 ? 143.344 120.607 139.816 1.00 111.94 ? 923  THR O N     1 
ATOM   1640  C  CA    . THR A 1  258 ? 141.963 120.454 140.238 1.00 111.36 ? 923  THR O CA    1 
ATOM   1641  C  C     . THR A 1  258 ? 141.780 120.972 141.649 1.00 122.00 ? 923  THR O C     1 
ATOM   1642  O  O     . THR A 1  258 ? 142.739 121.140 142.404 1.00 120.85 ? 923  THR O O     1 
ATOM   1643  C  CB    . THR A 1  258 ? 141.518 118.999 140.178 1.00 112.88 ? 923  THR O CB    1 
ATOM   1644  O  OG1   . THR A 1  258 ? 140.142 118.916 140.567 1.00 126.52 ? 923  THR O OG1   1 
ATOM   1645  C  CG2   . THR A 1  258 ? 142.358 118.157 141.114 1.00 110.81 ? 923  THR O CG2   1 
ATOM   1646  N  N     . GLY A 1  259 ? 140.520 121.198 141.998 1.00 124.11 ? 924  GLY O N     1 
ATOM   1647  C  CA    . GLY A 1  259 ? 140.137 121.612 143.327 1.00 119.14 ? 924  GLY O CA    1 
ATOM   1648  C  C     . GLY A 1  259 ? 139.641 120.503 144.223 1.00 124.32 ? 924  GLY O C     1 
ATOM   1649  O  O     . GLY A 1  259 ? 139.132 120.797 145.311 1.00 122.55 ? 924  GLY O O     1 
ATOM   1650  N  N     . THR A 1  260 ? 139.788 119.241 143.819 1.00 128.93 ? 925  THR O N     1 
ATOM   1651  C  CA    . THR A 1  260 ? 139.337 118.117 144.627 1.00 134.14 ? 925  THR O CA    1 
ATOM   1652  C  C     . THR A 1  260 ? 139.686 116.781 143.987 1.00 139.52 ? 925  THR O C     1 
ATOM   1653  O  O     . THR A 1  260 ? 139.830 116.681 142.764 1.00 142.07 ? 925  THR O O     1 
ATOM   1654  C  CB    . THR A 1  260 ? 137.828 118.175 144.851 1.00 151.52 ? 925  THR O CB    1 
ATOM   1655  O  OG1   . THR A 1  260 ? 137.445 117.147 145.769 1.00 160.52 ? 925  THR O OG1   1 
ATOM   1656  C  CG2   . THR A 1  260 ? 137.098 117.972 143.546 1.00 142.77 ? 925  THR O CG2   1 
ATOM   1657  N  N     . PRO A 1  261 ? 139.847 115.745 144.785 1.00 156.18 ? 926  PRO O N     1 
ATOM   1658  C  CA    . PRO A 1  261 ? 139.980 114.395 144.234 1.00 142.62 ? 926  PRO O CA    1 
ATOM   1659  C  C     . PRO A 1  261 ? 138.673 113.868 143.672 1.00 149.85 ? 926  PRO O C     1 
ATOM   1660  O  O     . PRO A 1  261 ? 137.703 114.612 143.504 1.00 150.38 ? 926  PRO O O     1 
ATOM   1661  C  CB    . PRO A 1  261 ? 140.438 113.571 145.440 1.00 149.26 ? 926  PRO O CB    1 
ATOM   1662  C  CG    . PRO A 1  261 ? 141.108 114.561 146.324 1.00 160.08 ? 926  PRO O CG    1 
ATOM   1663  C  CD    . PRO A 1  261 ? 140.293 115.807 146.184 1.00 159.03 ? 926  PRO O CD    1 
ATOM   1664  N  N     . LEU A 1  262 ? 138.650 112.571 143.388 1.00 156.76 ? 927  LEU O N     1 
ATOM   1665  C  CA    . LEU A 1  262 ? 137.582 111.955 142.618 1.00 153.66 ? 927  LEU O CA    1 
ATOM   1666  C  C     . LEU A 1  262 ? 136.297 111.867 143.449 1.00 157.59 ? 927  LEU O C     1 
ATOM   1667  O  O     . LEU A 1  262 ? 136.224 112.310 144.599 1.00 158.61 ? 927  LEU O O     1 
ATOM   1668  C  CB    . LEU A 1  262 ? 138.057 110.587 142.120 1.00 158.00 ? 927  LEU O CB    1 
ATOM   1669  C  CG    . LEU A 1  262 ? 137.362 109.807 141.000 1.00 163.46 ? 927  LEU O CG    1 
ATOM   1670  C  CD1   . LEU A 1  262 ? 138.415 109.158 140.163 1.00 163.66 ? 927  LEU O CD1   1 
ATOM   1671  C  CD2   . LEU A 1  262 ? 136.440 108.736 141.524 1.00 159.66 ? 927  LEU O CD2   1 
ATOM   1672  N  N     . GLN A 1  263 ? 135.270 111.284 142.836 1.00 155.31 ? 928  GLN O N     1 
ATOM   1673  C  CA    . GLN A 1  263 ? 133.949 111.133 143.428 1.00 164.28 ? 928  GLN O CA    1 
ATOM   1674  C  C     . GLN A 1  263 ? 134.001 110.266 144.684 1.00 154.00 ? 928  GLN O C     1 
ATOM   1675  O  O     . GLN A 1  263 ? 134.928 109.480 144.897 1.00 151.02 ? 928  GLN O O     1 
ATOM   1676  C  CB    . GLN A 1  263 ? 132.993 110.515 142.399 1.00 148.69 ? 928  GLN O CB    1 
ATOM   1677  C  CG    . GLN A 1  263 ? 131.548 110.320 142.852 1.00 151.58 ? 928  GLN O CG    1 
ATOM   1678  C  CD    . GLN A 1  263 ? 130.857 111.621 143.184 1.00 153.07 ? 928  GLN O CD    1 
ATOM   1679  O  OE1   . GLN A 1  263 ? 130.769 112.516 142.347 1.00 157.40 ? 928  GLN O OE1   1 
ATOM   1680  N  NE2   . GLN A 1  263 ? 130.353 111.731 144.406 1.00 157.96 ? 928  GLN O NE2   1 
ATOM   1681  N  N     . ASN A 1  264 ? 132.985 110.444 145.534 1.00 154.49 ? 929  ASN O N     1 
ATOM   1682  C  CA    . ASN A 1  264 ? 132.805 109.580 146.695 1.00 151.15 ? 929  ASN O CA    1 
ATOM   1683  C  C     . ASN A 1  264 ? 132.914 108.112 146.319 1.00 156.35 ? 929  ASN O C     1 
ATOM   1684  O  O     . ASN A 1  264 ? 133.553 107.328 147.030 1.00 161.32 ? 929  ASN O O     1 
ATOM   1685  C  CB    . ASN A 1  264 ? 131.441 109.837 147.340 1.00 138.13 ? 929  ASN O CB    1 
ATOM   1686  C  CG    . ASN A 1  264 ? 131.355 111.179 148.027 1.00 155.02 ? 929  ASN O CG    1 
ATOM   1687  O  OD1   . ASN A 1  264 ? 131.882 111.362 149.119 1.00 149.37 ? 929  ASN O OD1   1 
ATOM   1688  N  ND2   . ASN A 1  264 ? 130.675 112.123 147.396 1.00 165.12 ? 929  ASN O ND2   1 
ATOM   1689  N  N     . ASN A 1  265 ? 132.290 107.718 145.207 1.00 166.12 ? 930  ASN O N     1 
ATOM   1690  C  CA    . ASN A 1  265 ? 132.265 106.305 144.848 1.00 163.72 ? 930  ASN O CA    1 
ATOM   1691  C  C     . ASN A 1  265 ? 133.670 105.778 144.630 1.00 164.60 ? 930  ASN O C     1 
ATOM   1692  O  O     . ASN A 1  265 ? 133.971 104.625 144.959 1.00 170.67 ? 930  ASN O O     1 
ATOM   1693  C  CB    . ASN A 1  265 ? 131.417 106.089 143.599 1.00 135.30 ? 930  ASN O CB    1 
ATOM   1694  C  CG    . ASN A 1  265 ? 129.959 106.382 143.838 1.00 150.80 ? 930  ASN O CG    1 
ATOM   1695  O  OD1   . ASN A 1  265 ? 129.504 106.427 144.980 1.00 154.04 ? 930  ASN O OD1   1 
ATOM   1696  N  ND2   . ASN A 1  265 ? 129.208 106.563 142.761 1.00 164.50 ? 930  ASN O ND2   1 
ATOM   1697  N  N     . LEU A 1  266 ? 134.529 106.600 144.063 1.00 145.39 ? 931  LEU O N     1 
ATOM   1698  C  CA    . LEU A 1  266 ? 135.939 106.297 143.905 1.00 148.37 ? 931  LEU O CA    1 
ATOM   1699  C  C     . LEU A 1  266 ? 136.210 104.972 143.184 1.00 156.36 ? 931  LEU O C     1 
ATOM   1700  O  O     . LEU A 1  266 ? 137.113 104.237 143.592 1.00 157.16 ? 931  LEU O O     1 
ATOM   1701  C  CB    . LEU A 1  266 ? 136.544 106.277 145.312 1.00 148.83 ? 931  LEU O CB    1 
ATOM   1702  C  CG    . LEU A 1  266 ? 138.022 106.169 145.656 1.00 154.18 ? 931  LEU O CG    1 
ATOM   1703  C  CD1   . LEU A 1  266 ? 138.721 107.461 145.292 1.00 159.18 ? 931  LEU O CD1   1 
ATOM   1704  C  CD2   . LEU A 1  266 ? 138.186 105.833 147.125 1.00 166.41 ? 931  LEU O CD2   1 
ATOM   1705  N  N     . PRO A 1  267 ? 135.482 104.612 142.103 1.00 156.53 ? 932  PRO O N     1 
ATOM   1706  C  CA    . PRO A 1  267 ? 135.939 103.473 141.304 1.00 161.33 ? 932  PRO O CA    1 
ATOM   1707  C  C     . PRO A 1  267 ? 137.122 103.861 140.445 1.00 161.73 ? 932  PRO O C     1 
ATOM   1708  O  O     . PRO A 1  267 ? 138.070 103.091 140.256 1.00 174.97 ? 932  PRO O O     1 
ATOM   1709  C  CB    . PRO A 1  267 ? 134.718 103.130 140.440 1.00 158.88 ? 932  PRO O CB    1 
ATOM   1710  C  CG    . PRO A 1  267 ? 133.575 103.785 141.128 1.00 158.88 ? 932  PRO O CG    1 
ATOM   1711  C  CD    . PRO A 1  267 ? 134.176 105.064 141.600 1.00 158.88 ? 932  PRO O CD    1 
ATOM   1712  N  N     . GLU A 1  268 ? 137.061 105.080 139.925 1.00 155.02 ? 933  GLU O N     1 
ATOM   1713  C  CA    . GLU A 1  268 ? 137.932 105.509 138.844 1.00 160.84 ? 933  GLU O CA    1 
ATOM   1714  C  C     . GLU A 1  268 ? 139.242 106.085 139.342 1.00 161.27 ? 933  GLU O C     1 
ATOM   1715  O  O     . GLU A 1  268 ? 140.057 106.516 138.525 1.00 167.78 ? 933  GLU O O     1 
ATOM   1716  C  CB    . GLU A 1  268 ? 137.225 106.545 137.958 1.00 140.35 ? 933  GLU O CB    1 
ATOM   1717  C  CG    . GLU A 1  268 ? 135.928 106.063 137.309 1.00 154.33 ? 933  GLU O CG    1 
ATOM   1718  C  CD    . GLU A 1  268 ? 134.704 106.347 138.167 1.00 166.64 ? 933  GLU O CD    1 
ATOM   1719  O  OE1   . GLU A 1  268 ? 134.867 106.963 139.240 1.00 168.51 ? 933  GLU O OE1   1 
ATOM   1720  O  OE2   . GLU A 1  268 ? 133.585 105.943 137.780 1.00 175.99 ? 933  GLU O OE2   1 
ATOM   1721  N  N     . LEU A 1  269 ? 139.453 106.127 140.659 1.00 167.89 ? 934  LEU O N     1 
ATOM   1722  C  CA    . LEU A 1  269 ? 140.771 106.478 141.165 1.00 167.69 ? 934  LEU O CA    1 
ATOM   1723  C  C     . LEU A 1  269 ? 141.821 105.613 140.489 1.00 172.77 ? 934  LEU O C     1 
ATOM   1724  O  O     . LEU A 1  269 ? 142.947 106.064 140.243 1.00 167.37 ? 934  LEU O O     1 
ATOM   1725  C  CB    . LEU A 1  269 ? 140.804 106.312 142.681 1.00 160.67 ? 934  LEU O CB    1 
ATOM   1726  C  CG    . LEU A 1  269 ? 142.056 106.798 143.403 1.00 167.43 ? 934  LEU O CG    1 
ATOM   1727  C  CD1   . LEU A 1  269 ? 142.170 108.307 143.256 1.00 156.58 ? 934  LEU O CD1   1 
ATOM   1728  C  CD2   . LEU A 1  269 ? 142.027 106.394 144.869 1.00 172.32 ? 934  LEU O CD2   1 
ATOM   1729  N  N     . TRP A 1  270 ? 141.447 104.375 140.157 1.00 168.88 ? 935  TRP O N     1 
ATOM   1730  C  CA    . TRP A 1  270 ? 142.165 103.598 139.157 1.00 173.52 ? 935  TRP O CA    1 
ATOM   1731  C  C     . TRP A 1  270 ? 142.468 104.439 137.925 1.00 174.45 ? 935  TRP O C     1 
ATOM   1732  O  O     . TRP A 1  270 ? 143.628 104.619 137.562 1.00 180.91 ? 935  TRP O O     1 
ATOM   1733  C  CB    . TRP A 1  270 ? 141.357 102.354 138.776 1.00 192.33 ? 935  TRP O CB    1 
ATOM   1734  C  CG    . TRP A 1  270 ? 141.355 101.296 139.824 1.00 188.39 ? 935  TRP O CG    1 
ATOM   1735  C  CD1   . TRP A 1  270 ? 142.123 101.260 140.950 1.00 189.94 ? 935  TRP O CD1   1 
ATOM   1736  C  CD2   . TRP A 1  270 ? 140.532 100.125 139.860 1.00 187.36 ? 935  TRP O CD2   1 
ATOM   1737  N  NE1   . TRP A 1  270 ? 141.838 100.131 141.679 1.00 189.80 ? 935  TRP O NE1   1 
ATOM   1738  C  CE2   . TRP A 1  270 ? 140.862 99.419  141.032 1.00 184.98 ? 935  TRP O CE2   1 
ATOM   1739  C  CE3   . TRP A 1  270 ? 139.547 99.606  139.016 1.00 188.13 ? 935  TRP O CE3   1 
ATOM   1740  C  CZ2   . TRP A 1  270 ? 140.246 98.222  141.380 1.00 189.74 ? 935  TRP O CZ2   1 
ATOM   1741  C  CZ3   . TRP A 1  270 ? 138.938 98.412  139.363 1.00 184.76 ? 935  TRP O CZ3   1 
ATOM   1742  C  CH2   . TRP A 1  270 ? 139.288 97.736  140.535 1.00 189.05 ? 935  TRP O CH2   1 
ATOM   1743  N  N     . ALA A 1  271 ? 141.430 104.942 137.252 1.00 162.54 ? 936  ALA O N     1 
ATOM   1744  C  CA    . ALA A 1  271 ? 141.642 105.662 135.999 1.00 164.57 ? 936  ALA O CA    1 
ATOM   1745  C  C     . ALA A 1  271 ? 142.598 106.834 136.185 1.00 165.73 ? 936  ALA O C     1 
ATOM   1746  O  O     . ALA A 1  271 ? 143.523 107.030 135.382 1.00 167.33 ? 936  ALA O O     1 
ATOM   1747  C  CB    . ALA A 1  271 ? 140.305 106.140 135.434 1.00 159.69 ? 936  ALA O CB    1 
ATOM   1748  N  N     . LEU A 1  272 ? 142.382 107.631 137.232 1.00 171.85 ? 937  LEU O N     1 
ATOM   1749  C  CA    . LEU A 1  272 ? 143.306 108.707 137.555 1.00 170.91 ? 937  LEU O CA    1 
ATOM   1750  C  C     . LEU A 1  272 ? 144.716 108.156 137.557 1.00 169.09 ? 937  LEU O C     1 
ATOM   1751  O  O     . LEU A 1  272 ? 145.512 108.477 136.674 1.00 171.55 ? 937  LEU O O     1 
ATOM   1752  C  CB    . LEU A 1  272 ? 143.001 109.342 138.911 1.00 146.46 ? 937  LEU O CB    1 
ATOM   1753  C  CG    . LEU A 1  272 ? 141.715 110.140 139.090 1.00 146.46 ? 937  LEU O CG    1 
ATOM   1754  C  CD1   . LEU A 1  272 ? 141.620 110.649 140.518 1.00 146.46 ? 937  LEU O CD1   1 
ATOM   1755  C  CD2   . LEU A 1  272 ? 141.663 111.286 138.107 1.00 146.46 ? 937  LEU O CD2   1 
ATOM   1756  N  N     . LEU A 1  273 ? 145.003 107.267 138.506 1.00 177.88 ? 938  LEU O N     1 
ATOM   1757  C  CA    . LEU A 1  273 ? 146.362 106.767 138.673 1.00 177.97 ? 938  LEU O CA    1 
ATOM   1758  C  C     . LEU A 1  273 ? 146.850 105.976 137.461 1.00 183.34 ? 938  LEU O C     1 
ATOM   1759  O  O     . LEU A 1  273 ? 148.037 105.639 137.399 1.00 178.51 ? 938  LEU O O     1 
ATOM   1760  C  CB    . LEU A 1  273 ? 146.441 105.927 139.956 1.00 160.01 ? 938  LEU O CB    1 
ATOM   1761  C  CG    . LEU A 1  273 ? 146.611 106.663 141.298 1.00 168.59 ? 938  LEU O CG    1 
ATOM   1762  C  CD1   . LEU A 1  273 ? 145.421 107.554 141.619 1.00 180.26 ? 938  LEU O CD1   1 
ATOM   1763  C  CD2   . LEU A 1  273 ? 146.837 105.680 142.436 1.00 173.56 ? 938  LEU O CD2   1 
ATOM   1764  N  N     . ASN A 1  274 ? 145.971 105.668 136.505 1.00 182.26 ? 939  ASN O N     1 
ATOM   1765  C  CA    . ASN A 1  274 ? 146.428 105.241 135.189 1.00 183.83 ? 939  ASN O CA    1 
ATOM   1766  C  C     . ASN A 1  274 ? 147.022 106.424 134.449 1.00 185.76 ? 939  ASN O C     1 
ATOM   1767  O  O     . ASN A 1  274 ? 148.108 106.331 133.863 1.00 184.39 ? 939  ASN O O     1 
ATOM   1768  C  CB    . ASN A 1  274 ? 145.275 104.648 134.367 1.00 172.47 ? 939  ASN O CB    1 
ATOM   1769  C  CG    . ASN A 1  274 ? 144.645 103.429 135.010 1.00 177.48 ? 939  ASN O CG    1 
ATOM   1770  O  OD1   . ASN A 1  274 ? 143.423 103.274 135.017 1.00 179.77 ? 939  ASN O OD1   1 
ATOM   1771  N  ND2   . ASN A 1  274 ? 145.473 102.569 135.576 1.00 172.36 ? 939  ASN O ND2   1 
ATOM   1772  N  N     . PHE A 1  275 ? 146.317 107.553 134.479 1.00 178.81 ? 940  PHE O N     1 
ATOM   1773  C  CA    . PHE A 1  275 ? 146.751 108.746 133.774 1.00 183.57 ? 940  PHE O CA    1 
ATOM   1774  C  C     . PHE A 1  275 ? 147.844 109.499 134.523 1.00 185.95 ? 940  PHE O C     1 
ATOM   1775  O  O     . PHE A 1  275 ? 148.424 110.437 133.972 1.00 186.79 ? 940  PHE O O     1 
ATOM   1776  C  CB    . PHE A 1  275 ? 145.537 109.646 133.533 1.00 186.10 ? 940  PHE O CB    1 
ATOM   1777  C  CG    . PHE A 1  275 ? 145.824 110.850 132.689 1.00 186.63 ? 940  PHE O CG    1 
ATOM   1778  C  CD1   . PHE A 1  275 ? 145.918 110.734 131.313 1.00 189.55 ? 940  PHE O CD1   1 
ATOM   1779  C  CD2   . PHE A 1  275 ? 145.976 112.099 133.263 1.00 190.31 ? 940  PHE O CD2   1 
ATOM   1780  C  CE1   . PHE A 1  275 ? 146.175 111.834 130.529 1.00 194.44 ? 940  PHE O CE1   1 
ATOM   1781  C  CE2   . PHE A 1  275 ? 146.235 113.206 132.480 1.00 185.56 ? 940  PHE O CE2   1 
ATOM   1782  C  CZ    . PHE A 1  275 ? 146.334 113.071 131.110 1.00 185.39 ? 940  PHE O CZ    1 
ATOM   1783  N  N     . VAL A 1  276 ? 148.128 109.118 135.765 1.00 189.78 ? 941  VAL O N     1 
ATOM   1784  C  CA    . VAL A 1  276 ? 149.135 109.813 136.557 1.00 185.42 ? 941  VAL O CA    1 
ATOM   1785  C  C     . VAL A 1  276 ? 150.534 109.296 136.252 1.00 193.96 ? 941  VAL O C     1 
ATOM   1786  O  O     . VAL A 1  276 ? 151.479 110.082 136.123 1.00 196.21 ? 941  VAL O O     1 
ATOM   1787  C  CB    . VAL A 1  276 ? 148.796 109.684 138.051 1.00 186.34 ? 941  VAL O CB    1 
ATOM   1788  C  CG1   . VAL A 1  276 ? 149.866 110.341 138.896 1.00 194.12 ? 941  VAL O CG1   1 
ATOM   1789  C  CG2   . VAL A 1  276 ? 147.449 110.299 138.327 1.00 186.78 ? 941  VAL O CG2   1 
ATOM   1790  N  N     . LEU A 1  277 ? 150.678 107.989 136.070 1.00 198.36 ? 942  LEU O N     1 
ATOM   1791  C  CA    . LEU A 1  277 ? 151.958 107.297 136.159 1.00 198.36 ? 942  LEU O CA    1 
ATOM   1792  C  C     . LEU A 1  277 ? 151.757 105.849 135.708 1.00 198.36 ? 942  LEU O C     1 
ATOM   1793  O  O     . LEU A 1  277 ? 150.617 105.385 135.600 1.00 198.36 ? 942  LEU O O     1 
ATOM   1794  C  CB    . LEU A 1  277 ? 152.523 107.328 137.595 1.00 184.68 ? 942  LEU O CB    1 
ATOM   1795  C  CG    . LEU A 1  277 ? 153.065 108.590 138.276 1.00 184.68 ? 942  LEU O CG    1 
ATOM   1796  C  CD1   . LEU A 1  277 ? 153.457 108.302 139.712 1.00 184.68 ? 942  LEU O CD1   1 
ATOM   1797  C  CD2   . LEU A 1  277 ? 154.251 109.149 137.508 1.00 184.68 ? 942  LEU O CD2   1 
ATOM   1798  N  N     . PRO A 1  278 ? 152.851 105.132 135.417 1.00 198.85 ? 943  PRO O N     1 
ATOM   1799  C  CA    . PRO A 1  278 ? 152.732 103.733 134.974 1.00 198.85 ? 943  PRO O CA    1 
ATOM   1800  C  C     . PRO A 1  278 ? 152.164 102.781 136.010 1.00 198.85 ? 943  PRO O C     1 
ATOM   1801  O  O     . PRO A 1  278 ? 151.895 101.624 135.668 1.00 198.85 ? 943  PRO O O     1 
ATOM   1802  C  CB    . PRO A 1  278 ? 154.178 103.351 134.632 1.00 190.77 ? 943  PRO O CB    1 
ATOM   1803  C  CG    . PRO A 1  278 ? 154.820 104.629 134.277 1.00 190.77 ? 943  PRO O CG    1 
ATOM   1804  C  CD    . PRO A 1  278 ? 154.220 105.639 135.217 1.00 190.77 ? 943  PRO O CD    1 
ATOM   1805  N  N     . LYS A 1  279 ? 152.031 103.201 137.262 1.00 199.26 ? 944  LYS O N     1 
ATOM   1806  C  CA    . LYS A 1  279 ? 151.883 102.275 138.376 1.00 199.26 ? 944  LYS O CA    1 
ATOM   1807  C  C     . LYS A 1  279 ? 150.858 101.165 138.149 1.00 199.26 ? 944  LYS O C     1 
ATOM   1808  O  O     . LYS A 1  279 ? 151.243 100.010 137.945 1.00 199.26 ? 944  LYS O O     1 
ATOM   1809  C  CB    . LYS A 1  279 ? 151.543 103.070 139.638 1.00 193.32 ? 944  LYS O CB    1 
ATOM   1810  C  CG    . LYS A 1  279 ? 151.374 102.232 140.883 1.00 193.32 ? 944  LYS O CG    1 
ATOM   1811  C  CD    . LYS A 1  279 ? 151.225 103.112 142.113 1.00 193.32 ? 944  LYS O CD    1 
ATOM   1812  C  CE    . LYS A 1  279 ? 149.879 103.806 142.156 1.00 193.32 ? 944  LYS O CE    1 
ATOM   1813  N  NZ    . LYS A 1  279 ? 149.723 104.589 143.413 1.00 193.32 ? 944  LYS O NZ    1 
ATOM   1814  N  N     . ILE A 1  280 ? 149.563 101.489 138.150 1.00 188.69 ? 945  ILE O N     1 
ATOM   1815  C  CA    . ILE A 1  280 ? 148.533 100.465 138.309 1.00 188.69 ? 945  ILE O CA    1 
ATOM   1816  C  C     . ILE A 1  280 ? 147.893 100.016 137.003 1.00 188.69 ? 945  ILE O C     1 
ATOM   1817  O  O     . ILE A 1  280 ? 146.957 99.208  137.053 1.00 188.69 ? 945  ILE O O     1 
ATOM   1818  C  CB    . ILE A 1  280 ? 147.430 100.932 139.276 1.00 175.86 ? 945  ILE O CB    1 
ATOM   1819  C  CG1   . ILE A 1  280 ? 146.755 102.183 138.735 1.00 175.86 ? 945  ILE O CG1   1 
ATOM   1820  C  CG2   . ILE A 1  280 ? 148.000 101.199 140.645 1.00 175.86 ? 945  ILE O CG2   1 
ATOM   1821  C  CD1   . ILE A 1  280 ? 145.557 102.576 139.531 1.00 175.86 ? 945  ILE O CD1   1 
ATOM   1822  N  N     . PHE A 1  281 ? 148.338 100.507 135.842 1.00 190.44 ? 946  PHE O N     1 
ATOM   1823  C  CA    . PHE A 1  281 ? 147.512 100.277 134.656 1.00 190.44 ? 946  PHE O CA    1 
ATOM   1824  C  C     . PHE A 1  281 ? 147.451 98.812  134.237 1.00 190.44 ? 946  PHE O C     1 
ATOM   1825  O  O     . PHE A 1  281 ? 146.581 98.450  133.440 1.00 190.44 ? 946  PHE O O     1 
ATOM   1826  C  CB    . PHE A 1  281 ? 147.961 101.133 133.462 1.00 193.35 ? 946  PHE O CB    1 
ATOM   1827  C  CG    . PHE A 1  281 ? 149.354 100.855 132.966 1.00 193.35 ? 946  PHE O CG    1 
ATOM   1828  C  CD1   . PHE A 1  281 ? 149.609 99.773  132.141 1.00 193.35 ? 946  PHE O CD1   1 
ATOM   1829  C  CD2   . PHE A 1  281 ? 150.382 101.737 133.226 1.00 193.35 ? 946  PHE O CD2   1 
ATOM   1830  C  CE1   . PHE A 1  281 ? 150.880 99.534  131.656 1.00 193.35 ? 946  PHE O CE1   1 
ATOM   1831  C  CE2   . PHE A 1  281 ? 151.653 101.503 132.734 1.00 193.35 ? 946  PHE O CE2   1 
ATOM   1832  C  CZ    . PHE A 1  281 ? 151.902 100.398 131.956 1.00 193.35 ? 946  PHE O CZ    1 
ATOM   1833  N  N     . ASN A 1  282 ? 148.345 97.965  134.741 1.00 191.31 ? 947  ASN O N     1 
ATOM   1834  C  CA    . ASN A 1  282 ? 148.331 96.561  134.347 1.00 191.31 ? 947  ASN O CA    1 
ATOM   1835  C  C     . ASN A 1  282 ? 147.309 95.741  135.131 1.00 191.31 ? 947  ASN O C     1 
ATOM   1836  O  O     . ASN A 1  282 ? 146.585 94.927  134.547 1.00 191.31 ? 947  ASN O O     1 
ATOM   1837  C  CB    . ASN A 1  282 ? 149.730 95.980  134.516 1.00 201.58 ? 947  ASN O CB    1 
ATOM   1838  C  CG    . ASN A 1  282 ? 150.680 96.461  133.449 1.00 201.58 ? 947  ASN O CG    1 
ATOM   1839  O  OD1   . ASN A 1  282 ? 150.268 96.737  132.325 1.00 201.58 ? 947  ASN O OD1   1 
ATOM   1840  N  ND2   . ASN A 1  282 ? 151.952 96.592  133.798 1.00 201.58 ? 947  ASN O ND2   1 
ATOM   1841  N  N     . SER A 1  283 ? 147.242 95.939  136.446 1.00 176.54 ? 948  SER O N     1 
ATOM   1842  C  CA    . SER A 1  283 ? 146.469 95.098  137.357 1.00 176.54 ? 948  SER O CA    1 
ATOM   1843  C  C     . SER A 1  283 ? 145.075 95.649  137.669 1.00 176.54 ? 948  SER O C     1 
ATOM   1844  O  O     . SER A 1  283 ? 144.393 95.103  138.542 1.00 176.54 ? 948  SER O O     1 
ATOM   1845  C  CB    . SER A 1  283 ? 147.257 94.873  138.654 1.00 158.28 ? 948  SER O CB    1 
ATOM   1846  O  OG    . SER A 1  283 ? 147.515 96.092  139.328 1.00 158.28 ? 948  SER O OG    1 
ATOM   1847  N  N     . VAL A 1  284 ? 144.637 96.696  136.964 1.00 178.63 ? 949  VAL O N     1 
ATOM   1848  C  CA    . VAL A 1  284 ? 143.570 97.600  137.390 1.00 178.63 ? 949  VAL O CA    1 
ATOM   1849  C  C     . VAL A 1  284 ? 142.365 96.877  137.982 1.00 178.63 ? 949  VAL O C     1 
ATOM   1850  O  O     . VAL A 1  284 ? 141.836 97.291  139.017 1.00 178.63 ? 949  VAL O O     1 
ATOM   1851  C  CB    . VAL A 1  284 ? 143.107 98.468  136.204 1.00 154.11 ? 949  VAL O CB    1 
ATOM   1852  C  CG1   . VAL A 1  284 ? 142.021 99.442  136.635 1.00 154.11 ? 949  VAL O CG1   1 
ATOM   1853  C  CG2   . VAL A 1  284 ? 144.268 99.193  135.584 1.00 154.11 ? 949  VAL O CG2   1 
ATOM   1854  N  N     . LYS A 1  285 ? 141.943 95.781  137.346 1.00 176.81 ? 950  LYS O N     1 
ATOM   1855  C  CA    . LYS A 1  285 ? 140.635 95.190  137.630 1.00 176.81 ? 950  LYS O CA    1 
ATOM   1856  C  C     . LYS A 1  285 ? 140.470 94.751  139.083 1.00 176.81 ? 950  LYS O C     1 
ATOM   1857  O  O     . LYS A 1  285 ? 139.354 94.786  139.614 1.00 176.81 ? 950  LYS O O     1 
ATOM   1858  C  CB    . LYS A 1  285 ? 140.403 93.981  136.723 1.00 162.94 ? 950  LYS O CB    1 
ATOM   1859  C  CG    . LYS A 1  285 ? 140.202 94.272  135.251 1.00 162.94 ? 950  LYS O CG    1 
ATOM   1860  C  CD    . LYS A 1  285 ? 140.465 93.004  134.452 1.00 162.94 ? 950  LYS O CD    1 
ATOM   1861  C  CE    . LYS A 1  285 ? 139.569 91.861  134.921 1.00 162.94 ? 950  LYS O CE    1 
ATOM   1862  N  NZ    . LYS A 1  285 ? 139.833 90.578  134.205 1.00 162.94 ? 950  LYS O NZ    1 
ATOM   1863  N  N     . SER A 1  286 ? 141.549 94.321  139.741 1.00 183.87 ? 951  SER O N     1 
ATOM   1864  C  CA    . SER A 1  286 ? 141.386 93.415  140.876 1.00 183.87 ? 951  SER O CA    1 
ATOM   1865  C  C     . SER A 1  286 ? 140.974 94.104  142.176 1.00 183.87 ? 951  SER O C     1 
ATOM   1866  O  O     . SER A 1  286 ? 140.209 93.524  142.952 1.00 183.87 ? 951  SER O O     1 
ATOM   1867  C  CB    . SER A 1  286 ? 142.676 92.625  141.100 1.00 171.10 ? 951  SER O CB    1 
ATOM   1868  O  OG    . SER A 1  286 ? 143.742 93.480  141.467 1.00 171.10 ? 951  SER O OG    1 
ATOM   1869  N  N     . PHE A 1  287 ? 141.418 95.333  142.423 1.00 181.21 ? 952  PHE O N     1 
ATOM   1870  C  CA    . PHE A 1  287 ? 141.436 95.881  143.777 1.00 181.21 ? 952  PHE O CA    1 
ATOM   1871  C  C     . PHE A 1  287 ? 140.081 96.392  144.253 1.00 181.21 ? 952  PHE O C     1 
ATOM   1872  O  O     . PHE A 1  287 ? 140.003 96.928  145.367 1.00 181.21 ? 952  PHE O O     1 
ATOM   1873  C  CB    . PHE A 1  287 ? 142.464 97.009  143.864 1.00 163.49 ? 952  PHE O CB    1 
ATOM   1874  C  CG    . PHE A 1  287 ? 143.865 96.567  143.572 1.00 163.49 ? 952  PHE O CG    1 
ATOM   1875  C  CD1   . PHE A 1  287 ? 144.631 95.959  144.551 1.00 163.49 ? 952  PHE O CD1   1 
ATOM   1876  C  CD2   . PHE A 1  287 ? 144.418 96.757  142.318 1.00 163.49 ? 952  PHE O CD2   1 
ATOM   1877  C  CE1   . PHE A 1  287 ? 145.922 95.548  144.285 1.00 163.49 ? 952  PHE O CE1   1 
ATOM   1878  C  CE2   . PHE A 1  287 ? 145.708 96.347  142.047 1.00 163.49 ? 952  PHE O CE2   1 
ATOM   1879  C  CZ    . PHE A 1  287 ? 146.460 95.742  143.031 1.00 163.49 ? 952  PHE O CZ    1 
ATOM   1880  N  N     . ASP A 1  288 ? 139.028 96.231  143.445 1.00 194.40 ? 953  ASP O N     1 
ATOM   1881  C  CA    . ASP A 1  288 ? 137.754 96.913  143.678 1.00 194.40 ? 953  ASP O CA    1 
ATOM   1882  C  C     . ASP A 1  288 ? 137.176 96.625  145.063 1.00 194.40 ? 953  ASP O C     1 
ATOM   1883  O  O     . ASP A 1  288 ? 136.990 97.545  145.871 1.00 194.40 ? 953  ASP O O     1 
ATOM   1884  C  CB    . ASP A 1  288 ? 136.761 96.539  142.565 1.00 200.48 ? 953  ASP O CB    1 
ATOM   1885  C  CG    . ASP A 1  288 ? 136.715 95.040  142.291 1.00 200.48 ? 953  ASP O CG    1 
ATOM   1886  O  OD1   . ASP A 1  288 ? 137.544 94.322  142.864 1.00 200.48 ? 953  ASP O OD1   1 
ATOM   1887  O  OD2   . ASP A 1  288 ? 135.878 94.585  141.482 1.00 200.48 ? 953  ASP O OD2   1 
ATOM   1888  N  N     . GLU A 1  289 ? 136.902 95.354  145.373 1.00 202.05 ? 954  GLU O N     1 
ATOM   1889  C  CA    . GLU A 1  289 ? 136.209 95.084  146.628 1.00 202.05 ? 954  GLU O CA    1 
ATOM   1890  C  C     . GLU A 1  289 ? 137.097 95.335  147.836 1.00 202.05 ? 954  GLU O C     1 
ATOM   1891  O  O     . GLU A 1  289 ? 136.578 95.517  148.942 1.00 202.05 ? 954  GLU O O     1 
ATOM   1892  C  CB    . GLU A 1  289 ? 135.671 93.652  146.691 1.00 210.02 ? 954  GLU O CB    1 
ATOM   1893  C  CG    . GLU A 1  289 ? 136.696 92.567  146.955 1.00 210.02 ? 954  GLU O CG    1 
ATOM   1894  C  CD    . GLU A 1  289 ? 137.362 92.075  145.701 1.00 210.02 ? 954  GLU O CD    1 
ATOM   1895  O  OE1   . GLU A 1  289 ? 137.113 92.666  144.641 1.00 210.02 ? 954  GLU O OE1   1 
ATOM   1896  O  OE2   . GLU A 1  289 ? 138.094 91.069  145.771 1.00 210.02 ? 954  GLU O OE2   1 
ATOM   1897  N  N     . TRP A 1  290 ? 138.418 95.330  147.660 1.00 200.12 ? 955  TRP O N     1 
ATOM   1898  C  CA    . TRP A 1  290 ? 139.298 95.696  148.762 1.00 200.12 ? 955  TRP O CA    1 
ATOM   1899  C  C     . TRP A 1  290 ? 139.215 97.187  149.055 1.00 200.12 ? 955  TRP O C     1 
ATOM   1900  O  O     . TRP A 1  290 ? 138.926 97.597  150.185 1.00 200.12 ? 955  TRP O O     1 
ATOM   1901  C  CB    . TRP A 1  290 ? 140.741 95.297  148.453 1.00 223.22 ? 955  TRP O CB    1 
ATOM   1902  C  CG    . TRP A 1  290 ? 140.995 93.827  148.524 1.00 223.22 ? 955  TRP O CG    1 
ATOM   1903  C  CD1   . TRP A 1  290 ? 141.278 93.103  149.643 1.00 223.22 ? 955  TRP O CD1   1 
ATOM   1904  C  CD2   . TRP A 1  290 ? 141.013 92.900  147.431 1.00 223.22 ? 955  TRP O CD2   1 
ATOM   1905  N  NE1   . TRP A 1  290 ? 141.461 91.781  149.318 1.00 223.22 ? 955  TRP O NE1   1 
ATOM   1906  C  CE2   . TRP A 1  290 ? 141.306 91.629  147.966 1.00 223.22 ? 955  TRP O CE2   1 
ATOM   1907  C  CE3   . TRP A 1  290 ? 140.808 93.019  146.054 1.00 223.22 ? 955  TRP O CE3   1 
ATOM   1908  C  CZ2   . TRP A 1  290 ? 141.396 90.488  147.175 1.00 223.22 ? 955  TRP O CZ2   1 
ATOM   1909  C  CZ3   . TRP A 1  290 ? 140.905 91.887  145.274 1.00 223.22 ? 955  TRP O CZ3   1 
ATOM   1910  C  CH2   . TRP A 1  290 ? 141.190 90.638  145.835 1.00 223.22 ? 955  TRP O CH2   1 
ATOM   1911  N  N     . PHE A 1  291 ? 139.461 98.019  148.043 1.00 183.25 ? 956  PHE O N     1 
ATOM   1912  C  CA    . PHE A 1  291 ? 139.534 99.452  148.296 1.00 183.25 ? 956  PHE O CA    1 
ATOM   1913  C  C     . PHE A 1  291 ? 138.170 100.043 148.624 1.00 183.25 ? 956  PHE O C     1 
ATOM   1914  O  O     . PHE A 1  291 ? 138.084 100.995 149.408 1.00 183.25 ? 956  PHE O O     1 
ATOM   1915  C  CB    . PHE A 1  291 ? 140.158 100.168 147.099 1.00 168.83 ? 956  PHE O CB    1 
ATOM   1916  C  CG    . PHE A 1  291 ? 141.618 99.870  146.906 1.00 168.83 ? 956  PHE O CG    1 
ATOM   1917  C  CD1   . PHE A 1  291 ? 142.374 99.331  147.934 1.00 168.83 ? 956  PHE O CD1   1 
ATOM   1918  C  CD2   . PHE A 1  291 ? 142.241 100.153 145.702 1.00 168.83 ? 956  PHE O CD2   1 
ATOM   1919  C  CE1   . PHE A 1  291 ? 143.719 99.066  147.758 1.00 168.83 ? 956  PHE O CE1   1 
ATOM   1920  C  CE2   . PHE A 1  291 ? 143.585 99.893  145.521 1.00 168.83 ? 956  PHE O CE2   1 
ATOM   1921  C  CZ    . PHE A 1  291 ? 144.325 99.347  146.550 1.00 168.83 ? 956  PHE O CZ    1 
ATOM   1922  N  N     . ASN A 1  292 ? 137.099 99.495  148.054 1.00 179.38 ? 957  ASN O N     1 
ATOM   1923  C  CA    . ASN A 1  292 ? 135.765 100.022 148.322 1.00 179.38 ? 957  ASN O CA    1 
ATOM   1924  C  C     . ASN A 1  292 ? 135.265 99.694  149.723 1.00 179.38 ? 957  ASN O C     1 
ATOM   1925  O  O     . ASN A 1  292 ? 134.179 100.155 150.093 1.00 179.38 ? 957  ASN O O     1 
ATOM   1926  C  CB    . ASN A 1  292 ? 134.771 99.497  147.284 1.00 166.39 ? 957  ASN O CB    1 
ATOM   1927  N  N     . THR A 1  293 ? 136.024 98.916  150.501 1.00 169.40 ? 958  THR O N     1 
ATOM   1928  C  CA    . THR A 1  293 ? 135.542 98.441  151.794 1.00 169.40 ? 958  THR O CA    1 
ATOM   1929  C  C     . THR A 1  293 ? 135.219 99.587  152.749 1.00 169.40 ? 958  THR O C     1 
ATOM   1930  O  O     . THR A 1  293 ? 134.401 99.420  153.661 1.00 169.40 ? 958  THR O O     1 
ATOM   1931  C  CB    . THR A 1  293 ? 136.574 97.500  152.410 1.00 157.23 ? 958  THR O CB    1 
ATOM   1932  N  N     . PRO A 1  294 ? 135.844 100.753 152.562 1.00 166.68 ? 959  PRO O N     1 
ATOM   1933  C  CA    . PRO A 1  294 ? 135.488 101.934 153.341 1.00 166.68 ? 959  PRO O CA    1 
ATOM   1934  C  C     . PRO A 1  294 ? 134.114 102.480 152.981 1.00 166.68 ? 959  PRO O C     1 
ATOM   1935  O  O     . PRO A 1  294 ? 133.612 103.360 153.688 1.00 166.68 ? 959  PRO O O     1 
ATOM   1936  C  CB    . PRO A 1  294 ? 136.539 103.029 153.152 1.00 148.71 ? 959  PRO O CB    1 
ATOM   1937  N  N     . PHE A 1  295 ? 133.507 101.987 151.904 1.00 176.85 ? 960  PHE O N     1 
ATOM   1938  C  CA    . PHE A 1  295 ? 132.175 102.406 151.486 1.00 176.85 ? 960  PHE O CA    1 
ATOM   1939  C  C     . PHE A 1  295 ? 131.233 101.208 151.401 1.00 176.85 ? 960  PHE O C     1 
ATOM   1940  O  O     . PHE A 1  295 ? 130.611 100.965 150.368 1.00 176.85 ? 960  PHE O O     1 
ATOM   1941  C  CB    . PHE A 1  295 ? 132.241 103.119 150.150 1.00 132.89 ? 960  PHE O CB    1 
ATOM   1942  N  N     . ASP A 1  302 ? 129.283 98.612  164.542 1.00 206.64 ? 967  ASP O N     1 
ATOM   1943  C  CA    . ASP A 1  302 ? 130.701 98.334  164.739 1.00 206.64 ? 967  ASP O CA    1 
ATOM   1944  C  C     . ASP A 1  302 ? 131.566 99.333  163.979 1.00 206.64 ? 967  ASP O C     1 
ATOM   1945  O  O     . ASP A 1  302 ? 132.495 98.940  163.273 1.00 206.64 ? 967  ASP O O     1 
ATOM   1946  C  CB    . ASP A 1  302 ? 131.038 96.908  164.292 1.00 191.37 ? 967  ASP O CB    1 
ATOM   1947  C  CG    . ASP A 1  302 ? 130.434 95.851  165.197 1.00 191.37 ? 967  ASP O CG    1 
ATOM   1948  O  OD1   . ASP A 1  302 ? 130.030 96.189  166.328 1.00 191.37 ? 967  ASP O OD1   1 
ATOM   1949  O  OD2   . ASP A 1  302 ? 130.359 94.679  164.772 1.00 191.37 ? 967  ASP O OD2   1 
ATOM   1950  N  N     . LYS A 1  303 ? 131.250 100.626 164.124 1.00 211.07 ? 968  LYS O N     1 
ATOM   1951  C  CA    . LYS A 1  303 ? 132.031 101.666 163.458 1.00 211.07 ? 968  LYS O CA    1 
ATOM   1952  C  C     . LYS A 1  303 ? 133.512 101.538 163.778 1.00 211.07 ? 968  LYS O C     1 
ATOM   1953  O  O     . LYS A 1  303 ? 134.360 101.792 162.917 1.00 211.07 ? 968  LYS O O     1 
ATOM   1954  C  CB    . LYS A 1  303 ? 131.534 103.058 163.866 1.00 198.25 ? 968  LYS O CB    1 
ATOM   1955  C  CG    . LYS A 1  303 ? 130.057 103.322 163.607 1.00 198.25 ? 968  LYS O CG    1 
ATOM   1956  C  CD    . LYS A 1  303 ? 129.701 103.128 162.149 1.00 198.25 ? 968  LYS O CD    1 
ATOM   1957  C  CE    . LYS A 1  303 ? 130.247 104.255 161.292 1.00 198.25 ? 968  LYS O CE    1 
ATOM   1958  N  NZ    . LYS A 1  303 ? 129.796 104.124 159.875 1.00 198.25 ? 968  LYS O NZ    1 
ATOM   1959  N  N     . ILE A 1  304 ? 133.841 101.139 165.007 1.00 212.36 ? 969  ILE O N     1 
ATOM   1960  C  CA    . ILE A 1  304 ? 135.238 100.953 165.382 1.00 212.36 ? 969  ILE O CA    1 
ATOM   1961  C  C     . ILE A 1  304 ? 135.834 99.768  164.638 1.00 212.36 ? 969  ILE O C     1 
ATOM   1962  O  O     . ILE A 1  304 ? 136.963 99.833  164.145 1.00 212.36 ? 969  ILE O O     1 
ATOM   1963  C  CB    . ILE A 1  304 ? 135.359 100.778 166.905 1.00 201.09 ? 969  ILE O CB    1 
ATOM   1964  C  CG1   . ILE A 1  304 ? 134.841 102.019 167.626 1.00 201.09 ? 969  ILE O CG1   1 
ATOM   1965  C  CG2   . ILE A 1  304 ? 136.805 100.509 167.295 1.00 201.09 ? 969  ILE O CG2   1 
ATOM   1966  C  CD1   . ILE A 1  304 ? 134.650 101.811 169.108 1.00 201.09 ? 969  ILE O CD1   1 
ATOM   1967  N  N     . GLU A 1  305 ? 135.093 98.663  164.552 1.00 213.99 ? 970  GLU O N     1 
ATOM   1968  C  CA    . GLU A 1  305 ? 135.614 97.488  163.865 1.00 213.99 ? 970  GLU O CA    1 
ATOM   1969  C  C     . GLU A 1  305 ? 135.567 97.669  162.354 1.00 213.99 ? 970  GLU O C     1 
ATOM   1970  O  O     . GLU A 1  305 ? 136.547 97.384  161.657 1.00 213.99 ? 970  GLU O O     1 
ATOM   1971  C  CB    . GLU A 1  305 ? 134.842 96.237  164.287 1.00 193.64 ? 970  GLU O CB    1 
ATOM   1972  C  CG    . GLU A 1  305 ? 135.116 95.770  165.711 1.00 193.64 ? 970  GLU O CG    1 
ATOM   1973  C  CD    . GLU A 1  305 ? 134.302 96.508  166.755 1.00 193.64 ? 970  GLU O CD    1 
ATOM   1974  O  OE1   . GLU A 1  305 ? 133.561 97.448  166.393 1.00 193.64 ? 970  GLU O OE1   1 
ATOM   1975  O  OE2   . GLU A 1  305 ? 134.400 96.139  167.944 1.00 193.64 ? 970  GLU O OE2   1 
ATOM   1976  N  N     . LEU A 1  306 ? 134.429 98.130  161.827 1.00 228.56 ? 971  LEU O N     1 
ATOM   1977  C  CA    . LEU A 1  306 ? 134.321 98.357  160.389 1.00 228.56 ? 971  LEU O CA    1 
ATOM   1978  C  C     . LEU A 1  306 ? 135.371 99.354  159.924 1.00 228.56 ? 971  LEU O C     1 
ATOM   1979  O  O     . LEU A 1  306 ? 136.217 99.045  159.074 1.00 228.56 ? 971  LEU O O     1 
ATOM   1980  C  CB    . LEU A 1  306 ? 132.917 98.853  160.032 1.00 237.67 ? 971  LEU O CB    1 
ATOM   1981  C  CG    . LEU A 1  306 ? 131.743 97.899  160.247 1.00 237.67 ? 971  LEU O CG    1 
ATOM   1982  C  CD1   . LEU A 1  306 ? 130.434 98.610  159.966 1.00 237.67 ? 971  LEU O CD1   1 
ATOM   1983  C  CD2   . LEU A 1  306 ? 131.879 96.674  159.363 1.00 237.67 ? 971  LEU O CD2   1 
ATOM   1984  N  N     . SER A 1  307 ? 135.350 100.556 160.499 1.00 217.18 ? 972  SER O N     1 
ATOM   1985  C  CA    . SER A 1  307 ? 136.343 101.550 160.119 1.00 217.18 ? 972  SER O CA    1 
ATOM   1986  C  C     . SER A 1  307 ? 137.752 101.077 160.447 1.00 217.18 ? 972  SER O C     1 
ATOM   1987  O  O     . SER A 1  307 ? 138.707 101.448 159.756 1.00 217.18 ? 972  SER O O     1 
ATOM   1988  C  CB    . SER A 1  307 ? 136.056 102.886 160.805 1.00 204.30 ? 972  SER O CB    1 
ATOM   1989  O  OG    . SER A 1  307 ? 136.230 102.788 162.207 1.00 204.30 ? 972  SER O OG    1 
ATOM   1990  N  N     . GLU A 1  308 ? 137.897 100.223 161.457 1.00 218.09 ? 973  GLU O N     1 
ATOM   1991  C  CA    . GLU A 1  308 ? 139.220 99.816  161.903 1.00 218.09 ? 973  GLU O CA    1 
ATOM   1992  C  C     . GLU A 1  308 ? 139.838 98.882  160.875 1.00 218.09 ? 973  GLU O C     1 
ATOM   1993  O  O     . GLU A 1  308 ? 140.815 99.250  160.212 1.00 218.09 ? 973  GLU O O     1 
ATOM   1994  C  CB    . GLU A 1  308 ? 139.140 99.160  163.285 1.00 203.33 ? 973  GLU O CB    1 
ATOM   1995  C  CG    . GLU A 1  308 ? 140.477 98.789  163.899 1.00 203.33 ? 973  GLU O CG    1 
ATOM   1996  C  CD    . GLU A 1  308 ? 141.002 97.480  163.372 1.00 203.33 ? 973  GLU O CD    1 
ATOM   1997  O  OE1   . GLU A 1  308 ? 140.181 96.661  162.909 1.00 203.33 ? 973  GLU O OE1   1 
ATOM   1998  O  OE2   . GLU A 1  308 ? 142.230 97.271  163.413 1.00 203.33 ? 973  GLU O OE2   1 
ATOM   1999  N  N     . GLU A 1  309 ? 139.269 97.683  160.728 1.00 216.20 ? 974  GLU O N     1 
ATOM   2000  C  CA    . GLU A 1  309 ? 139.750 96.729  159.739 1.00 216.20 ? 974  GLU O CA    1 
ATOM   2001  C  C     . GLU A 1  309 ? 139.702 97.373  158.359 1.00 216.20 ? 974  GLU O C     1 
ATOM   2002  O  O     . GLU A 1  309 ? 140.748 97.708  157.790 1.00 216.20 ? 974  GLU O O     1 
ATOM   2003  C  CB    . GLU A 1  309 ? 138.921 95.441  159.771 1.00 202.76 ? 974  GLU O CB    1 
ATOM   2004  C  CG    . GLU A 1  309 ? 139.529 94.291  158.974 1.00 202.76 ? 974  GLU O CG    1 
ATOM   2005  C  CD    . GLU A 1  309 ? 139.357 94.444  157.476 1.00 202.76 ? 974  GLU O CD    1 
ATOM   2006  O  OE1   . GLU A 1  309 ? 138.376 95.089  157.056 1.00 202.76 ? 974  GLU O OE1   1 
ATOM   2007  O  OE2   . GLU A 1  309 ? 140.217 93.943  156.720 1.00 202.76 ? 974  GLU O OE2   1 
ATOM   2008  N  N     . GLU A 1  310 ? 138.492 97.587  157.835 1.00 208.32 ? 975  GLU O N     1 
ATOM   2009  C  CA    . GLU A 1  310 ? 138.339 98.151  156.499 1.00 208.32 ? 975  GLU O CA    1 
ATOM   2010  C  C     . GLU A 1  310 ? 139.108 99.460  156.344 1.00 208.32 ? 975  GLU O C     1 
ATOM   2011  O  O     . GLU A 1  310 ? 140.154 99.495  155.677 1.00 208.32 ? 975  GLU O O     1 
ATOM   2012  C  CB    . GLU A 1  310 ? 136.853 98.350  156.167 1.00 201.05 ? 975  GLU O CB    1 
ATOM   2013  C  CG    . GLU A 1  310 ? 136.058 97.063  155.841 1.00 201.05 ? 975  GLU O CG    1 
ATOM   2014  C  CD    . GLU A 1  310 ? 135.516 96.299  157.052 1.00 201.05 ? 975  GLU O CD    1 
ATOM   2015  O  OE1   . GLU A 1  310 ? 135.837 96.646  158.204 1.00 201.05 ? 975  GLU O OE1   1 
ATOM   2016  O  OE2   . GLU A 1  310 ? 134.739 95.345  156.841 1.00 201.05 ? 975  GLU O OE2   1 
ATOM   2017  N  N     . THR A 1  311 ? 138.640 100.527 156.997 1.00 209.40 ? 976  THR O N     1 
ATOM   2018  C  CA    . THR A 1  311 ? 139.158 101.844 156.645 1.00 209.40 ? 976  THR O CA    1 
ATOM   2019  C  C     . THR A 1  311 ? 140.538 102.083 157.242 1.00 209.40 ? 976  THR O C     1 
ATOM   2020  O  O     . THR A 1  311 ? 141.393 102.685 156.588 1.00 209.40 ? 976  THR O O     1 
ATOM   2021  C  CB    . THR A 1  311 ? 138.201 102.952 157.086 1.00 197.12 ? 976  THR O CB    1 
ATOM   2022  O  OG1   . THR A 1  311 ? 138.284 103.134 158.500 1.00 197.12 ? 976  THR O OG1   1 
ATOM   2023  C  CG2   . THR A 1  311 ? 136.778 102.590 156.712 1.00 197.12 ? 976  THR O CG2   1 
ATOM   2024  N  N     . LEU A 1  312 ? 140.791 101.628 158.470 1.00 202.11 ? 977  LEU O N     1 
ATOM   2025  C  CA    . LEU A 1  312 ? 142.117 101.862 159.025 1.00 202.11 ? 977  LEU O CA    1 
ATOM   2026  C  C     . LEU A 1  312 ? 143.161 101.008 158.319 1.00 202.11 ? 977  LEU O C     1 
ATOM   2027  O  O     . LEU A 1  312 ? 144.191 101.526 157.876 1.00 202.11 ? 977  LEU O O     1 
ATOM   2028  C  CB    . LEU A 1  312 ? 142.125 101.639 160.535 1.00 190.38 ? 977  LEU O CB    1 
ATOM   2029  C  CG    . LEU A 1  312 ? 141.416 102.767 161.287 1.00 190.38 ? 977  LEU O CG    1 
ATOM   2030  C  CD1   . LEU A 1  312 ? 141.371 102.499 162.777 1.00 190.38 ? 977  LEU O CD1   1 
ATOM   2031  C  CD2   . LEU A 1  312 ? 142.112 104.089 161.010 1.00 190.38 ? 977  LEU O CD2   1 
ATOM   2032  N  N     . LEU A 1  313 ? 142.905 99.707  158.166 1.00 197.84 ? 978  LEU O N     1 
ATOM   2033  C  CA    . LEU A 1  313 ? 143.883 98.873  157.478 1.00 197.84 ? 978  LEU O CA    1 
ATOM   2034  C  C     . LEU A 1  313 ? 144.136 99.385  156.066 1.00 197.84 ? 978  LEU O C     1 
ATOM   2035  O  O     . LEU A 1  313 ? 145.226 99.889  155.771 1.00 197.84 ? 978  LEU O O     1 
ATOM   2036  C  CB    . LEU A 1  313 ? 143.439 97.410  157.443 1.00 197.53 ? 978  LEU O CB    1 
ATOM   2037  C  CG    . LEU A 1  313 ? 143.435 96.637  158.764 1.00 197.53 ? 978  LEU O CG    1 
ATOM   2038  C  CD1   . LEU A 1  313 ? 142.876 95.245  158.539 1.00 197.53 ? 978  LEU O CD1   1 
ATOM   2039  C  CD2   . LEU A 1  313 ? 144.831 96.560  159.338 1.00 197.53 ? 978  LEU O CD2   1 
ATOM   2040  N  N     . VAL A 1  314 ? 143.118 99.307  155.204 1.00 191.02 ? 979  VAL O N     1 
ATOM   2041  C  CA    . VAL A 1  314 ? 143.352 99.571  153.789 1.00 191.02 ? 979  VAL O CA    1 
ATOM   2042  C  C     . VAL A 1  314 ? 143.629 101.050 153.539 1.00 191.02 ? 979  VAL O C     1 
ATOM   2043  O  O     . VAL A 1  314 ? 144.414 101.401 152.648 1.00 191.02 ? 979  VAL O O     1 
ATOM   2044  C  CB    . VAL A 1  314 ? 142.160 99.060  152.962 1.00 179.62 ? 979  VAL O CB    1 
ATOM   2045  C  CG1   . VAL A 1  314 ? 142.331 99.415  151.499 1.00 179.62 ? 979  VAL O CG1   1 
ATOM   2046  C  CG2   . VAL A 1  314 ? 142.021 97.562  153.128 1.00 179.62 ? 979  VAL O CG2   1 
ATOM   2047  N  N     . ILE A 1  315 ? 143.018 101.940 154.319 1.00 197.36 ? 980  ILE O N     1 
ATOM   2048  C  CA    . ILE A 1  315 ? 143.237 103.364 154.095 1.00 197.36 ? 980  ILE O CA    1 
ATOM   2049  C  C     . ILE A 1  315 ? 144.630 103.777 154.551 1.00 197.36 ? 980  ILE O C     1 
ATOM   2050  O  O     . ILE A 1  315 ? 145.297 104.570 153.878 1.00 197.36 ? 980  ILE O O     1 
ATOM   2051  C  CB    . ILE A 1  315 ? 142.128 104.198 154.759 1.00 190.20 ? 980  ILE O CB    1 
ATOM   2052  C  CG1   . ILE A 1  315 ? 140.833 104.063 153.951 1.00 190.20 ? 980  ILE O CG1   1 
ATOM   2053  C  CG2   . ILE A 1  315 ? 142.535 105.639 154.865 1.00 190.20 ? 980  ILE O CG2   1 
ATOM   2054  C  CD1   . ILE A 1  315 ? 139.641 104.772 154.550 1.00 190.20 ? 980  ILE O CD1   1 
ATOM   2055  N  N     . ARG A 1  316 ? 145.107 103.245 155.682 1.00 190.11 ? 981  ARG O N     1 
ATOM   2056  C  CA    . ARG A 1  316 ? 146.525 103.399 156.001 1.00 187.39 ? 981  ARG O CA    1 
ATOM   2057  C  C     . ARG A 1  316 ? 147.390 102.901 154.851 1.00 189.20 ? 981  ARG O C     1 
ATOM   2058  O  O     . ARG A 1  316 ? 148.344 103.575 154.435 1.00 185.00 ? 981  ARG O O     1 
ATOM   2059  C  CB    . ARG A 1  316 ? 146.895 102.652 157.283 1.00 152.41 ? 981  ARG O CB    1 
ATOM   2060  C  CG    . ARG A 1  316 ? 146.467 103.284 158.586 1.00 169.53 ? 981  ARG O CG    1 
ATOM   2061  C  CD    . ARG A 1  316 ? 147.260 102.646 159.720 1.00 185.44 ? 981  ARG O CD    1 
ATOM   2062  N  NE    . ARG A 1  316 ? 147.054 101.202 159.825 1.00 203.32 ? 981  ARG O NE    1 
ATOM   2063  C  CZ    . ARG A 1  316 ? 146.121 100.630 160.578 1.00 212.75 ? 981  ARG O CZ    1 
ATOM   2064  N  NH1   . ARG A 1  316 ? 145.305 101.374 161.310 1.00 201.38 ? 981  ARG O NH1   1 
ATOM   2065  N  NH2   . ARG A 1  316 ? 146.011 99.311  160.612 1.00 222.86 ? 981  ARG O NH2   1 
ATOM   2066  N  N     . ARG A 1  317 ? 147.067 101.712 154.327 1.00 183.67 ? 982  ARG O N     1 
ATOM   2067  C  CA    . ARG A 1  317 ? 147.797 101.182 153.179 1.00 176.50 ? 982  ARG O CA    1 
ATOM   2068  C  C     . ARG A 1  317 ? 147.912 102.234 152.089 1.00 182.53 ? 982  ARG O C     1 
ATOM   2069  O  O     . ARG A 1  317 ? 148.998 102.494 151.556 1.00 183.04 ? 982  ARG O O     1 
ATOM   2070  C  CB    . ARG A 1  317 ? 147.092 99.948  152.613 1.00 164.26 ? 982  ARG O CB    1 
ATOM   2071  C  CG    . ARG A 1  317 ? 146.845 98.801  153.568 1.00 166.24 ? 982  ARG O CG    1 
ATOM   2072  C  CD    . ARG A 1  317 ? 148.124 98.273  154.148 1.00 177.25 ? 982  ARG O CD    1 
ATOM   2073  N  NE    . ARG A 1  317 ? 149.093 97.987  153.094 1.00 170.54 ? 982  ARG O NE    1 
ATOM   2074  C  CZ    . ARG A 1  317 ? 149.069 96.916  152.308 1.00 178.71 ? 982  ARG O CZ    1 
ATOM   2075  N  NH1   . ARG A 1  317 ? 148.106 96.014  152.430 1.00 173.86 ? 982  ARG O NH1   1 
ATOM   2076  N  NH2   . ARG A 1  317 ? 150.005 96.758  151.384 1.00 172.62 ? 982  ARG O NH2   1 
ATOM   2077  N  N     . LEU A 1  318 ? 146.790 102.882 151.777 1.00 179.64 ? 983  LEU O N     1 
ATOM   2078  C  CA    . LEU A 1  318 ? 146.755 103.805 150.651 1.00 179.96 ? 983  LEU O CA    1 
ATOM   2079  C  C     . LEU A 1  318 ? 147.502 105.095 150.965 1.00 186.77 ? 983  LEU O C     1 
ATOM   2080  O  O     . LEU A 1  318 ? 148.173 105.651 150.090 1.00 186.09 ? 983  LEU O O     1 
ATOM   2081  C  CB    . LEU A 1  318 ? 145.304 104.073 150.269 1.00 172.70 ? 983  LEU O CB    1 
ATOM   2082  C  CG    . LEU A 1  318 ? 144.600 102.775 149.866 1.00 174.88 ? 983  LEU O CG    1 
ATOM   2083  C  CD1   . LEU A 1  318 ? 143.119 102.994 149.617 1.00 176.28 ? 983  LEU O CD1   1 
ATOM   2084  C  CD2   . LEU A 1  318 ? 145.272 102.147 148.656 1.00 171.16 ? 983  LEU O CD2   1 
ATOM   2085  N  N     . HIS A 1  319 ? 147.409 105.584 152.206 1.00 195.73 ? 984  HIS O N     1 
ATOM   2086  C  CA    . HIS A 1  319 ? 148.269 106.688 152.616 1.00 198.11 ? 984  HIS O CA    1 
ATOM   2087  C  C     . HIS A 1  319 ? 149.718 106.374 152.304 1.00 196.69 ? 984  HIS O C     1 
ATOM   2088  O  O     . HIS A 1  319 ? 150.399 107.143 151.619 1.00 193.97 ? 984  HIS O O     1 
ATOM   2089  C  CB    . HIS A 1  319 ? 148.129 106.981 154.108 1.00 177.09 ? 984  HIS O CB    1 
ATOM   2090  C  CG    . HIS A 1  319 ? 146.780 107.469 154.511 1.00 196.49 ? 984  HIS O CG    1 
ATOM   2091  N  ND1   . HIS A 1  319 ? 146.260 108.662 154.063 1.00 204.41 ? 984  HIS O ND1   1 
ATOM   2092  C  CD2   . HIS A 1  319 ? 145.867 106.956 155.367 1.00 201.37 ? 984  HIS O CD2   1 
ATOM   2093  C  CE1   . HIS A 1  319 ? 145.066 108.842 154.596 1.00 199.71 ? 984  HIS O CE1   1 
ATOM   2094  N  NE2   . HIS A 1  319 ? 144.807 107.826 155.396 1.00 200.73 ? 984  HIS O NE2   1 
ATOM   2095  N  N     . LYS A 1  320 ? 150.202 105.226 152.788 1.00 194.47 ? 985  LYS O N     1 
ATOM   2096  C  CA    . LYS A 1  320 ? 151.581 104.851 152.497 1.00 193.06 ? 985  LYS O CA    1 
ATOM   2097  C  C     . LYS A 1  320 ? 151.805 104.718 150.996 1.00 199.13 ? 985  LYS O C     1 
ATOM   2098  O  O     . LYS A 1  320 ? 152.935 104.874 150.519 1.00 196.11 ? 985  LYS O O     1 
ATOM   2099  C  CB    . LYS A 1  320 ? 151.944 103.555 153.228 1.00 164.15 ? 985  LYS O CB    1 
ATOM   2100  C  CG    . LYS A 1  320 ? 153.408 103.147 153.091 1.00 176.95 ? 985  LYS O CG    1 
ATOM   2101  C  CD    . LYS A 1  320 ? 153.718 101.872 153.861 1.00 185.21 ? 985  LYS O CD    1 
ATOM   2102  C  CE    . LYS A 1  320 ? 153.619 102.091 155.363 1.00 201.84 ? 985  LYS O CE    1 
ATOM   2103  N  NZ    . LYS A 1  320 ? 154.644 103.051 155.860 1.00 215.16 ? 985  LYS O NZ    1 
ATOM   2104  N  N     . VAL A 1  321 ? 150.745 104.446 150.235 1.00 182.46 ? 986  VAL O N     1 
ATOM   2105  C  CA    . VAL A 1  321 ? 150.860 104.491 148.782 1.00 180.74 ? 986  VAL O CA    1 
ATOM   2106  C  C     . VAL A 1  321 ? 150.751 105.923 148.269 1.00 189.63 ? 986  VAL O C     1 
ATOM   2107  O  O     . VAL A 1  321 ? 151.519 106.336 147.396 1.00 196.64 ? 986  VAL O O     1 
ATOM   2108  C  CB    . VAL A 1  321 ? 149.807 103.574 148.133 1.00 170.97 ? 986  VAL O CB    1 
ATOM   2109  C  CG1   . VAL A 1  321 ? 149.846 103.710 146.624 1.00 172.00 ? 986  VAL O CG1   1 
ATOM   2110  C  CG2   . VAL A 1  321 ? 150.045 102.130 148.533 1.00 171.78 ? 986  VAL O CG2   1 
ATOM   2111  N  N     . LEU A 1  322 ? 149.825 106.714 148.816 1.00 174.63 ? 987  LEU O N     1 
ATOM   2112  C  CA    . LEU A 1  322 ? 149.467 108.006 148.233 1.00 179.82 ? 987  LEU O CA    1 
ATOM   2113  C  C     . LEU A 1  322 ? 150.379 109.154 148.641 1.00 183.54 ? 987  LEU O C     1 
ATOM   2114  O  O     . LEU A 1  322 ? 150.118 110.291 148.233 1.00 178.58 ? 987  LEU O O     1 
ATOM   2115  C  CB    . LEU A 1  322 ? 148.027 108.377 148.596 1.00 158.08 ? 987  LEU O CB    1 
ATOM   2116  C  CG    . LEU A 1  322 ? 146.919 107.570 147.929 1.00 160.43 ? 987  LEU O CG    1 
ATOM   2117  C  CD1   . LEU A 1  322 ? 145.578 107.910 148.544 1.00 151.15 ? 987  LEU O CD1   1 
ATOM   2118  C  CD2   . LEU A 1  322 ? 146.910 107.867 146.444 1.00 157.74 ? 987  LEU O CD2   1 
ATOM   2119  N  N     . ARG A 1  323 ? 151.418 108.906 149.436 1.00 181.92 ? 988  ARG O N     1 
ATOM   2120  C  CA    . ARG A 1  323 ? 152.301 109.998 149.842 1.00 187.05 ? 988  ARG O CA    1 
ATOM   2121  C  C     . ARG A 1  323 ? 152.930 110.729 148.660 1.00 180.00 ? 988  ARG O C     1 
ATOM   2122  O  O     . ARG A 1  323 ? 152.869 111.970 148.633 1.00 175.72 ? 988  ARG O O     1 
ATOM   2123  C  CB    . ARG A 1  323 ? 153.352 109.469 150.826 1.00 159.54 ? 988  ARG O CB    1 
ATOM   2124  C  CG    . ARG A 1  323 ? 152.758 109.052 152.160 1.00 167.54 ? 988  ARG O CG    1 
ATOM   2125  C  CD    . ARG A 1  323 ? 153.787 108.535 153.143 1.00 178.01 ? 988  ARG O CD    1 
ATOM   2126  N  NE    . ARG A 1  323 ? 153.153 108.111 154.390 1.00 181.52 ? 988  ARG O NE    1 
ATOM   2127  C  CZ    . ARG A 1  323 ? 153.790 107.510 155.391 1.00 176.90 ? 988  ARG O CZ    1 
ATOM   2128  N  NH1   . ARG A 1  323 ? 155.087 107.253 155.296 1.00 163.49 ? 988  ARG O NH1   1 
ATOM   2129  N  NH2   . ARG A 1  323 ? 153.129 107.161 156.487 1.00 179.65 ? 988  ARG O NH2   1 
ATOM   2130  N  N     . PRO A 1  324 ? 153.544 110.059 147.662 1.00 182.52 ? 989  PRO O N     1 
ATOM   2131  C  CA    . PRO A 1  324 ? 154.181 110.781 146.556 1.00 186.49 ? 989  PRO O CA    1 
ATOM   2132  C  C     . PRO A 1  324 ? 153.252 111.074 145.378 1.00 184.64 ? 989  PRO O C     1 
ATOM   2133  O  O     . PRO A 1  324 ? 153.586 110.813 144.217 1.00 179.78 ? 989  PRO O O     1 
ATOM   2134  C  CB    . PRO A 1  324 ? 155.303 109.826 146.141 1.00 177.77 ? 989  PRO O CB    1 
ATOM   2135  C  CG    . PRO A 1  324 ? 154.736 108.487 146.400 1.00 176.32 ? 989  PRO O CG    1 
ATOM   2136  C  CD    . PRO A 1  324 ? 153.824 108.614 147.587 1.00 183.30 ? 989  PRO O CD    1 
ATOM   2137  N  N     . PHE A 1  325 ? 152.067 111.616 145.661 1.00 182.64 ? 990  PHE O N     1 
ATOM   2138  C  CA    . PHE A 1  325 ? 151.188 112.001 144.560 1.00 176.87 ? 990  PHE O CA    1 
ATOM   2139  C  C     . PHE A 1  325 ? 150.546 113.376 144.727 1.00 181.95 ? 990  PHE O C     1 
ATOM   2140  O  O     . PHE A 1  325 ? 150.890 114.328 144.021 1.00 191.27 ? 990  PHE O O     1 
ATOM   2141  C  CB    . PHE A 1  325 ? 150.093 110.952 144.384 1.00 177.46 ? 990  PHE O CB    1 
ATOM   2142  C  CG    . PHE A 1  325 ? 150.613 109.593 144.043 1.00 176.51 ? 990  PHE O CG    1 
ATOM   2143  C  CD1   . PHE A 1  325 ? 150.905 109.259 142.735 1.00 180.74 ? 990  PHE O CD1   1 
ATOM   2144  C  CD2   . PHE A 1  325 ? 150.820 108.648 145.034 1.00 173.42 ? 990  PHE O CD2   1 
ATOM   2145  C  CE1   . PHE A 1  325 ? 151.385 108.002 142.420 1.00 176.25 ? 990  PHE O CE1   1 
ATOM   2146  C  CE2   . PHE A 1  325 ? 151.301 107.395 144.720 1.00 173.96 ? 990  PHE O CE2   1 
ATOM   2147  C  CZ    . PHE A 1  325 ? 151.586 107.073 143.416 1.00 177.78 ? 990  PHE O CZ    1 
ATOM   2148  N  N     . LEU A 1  326 ? 149.592 113.469 145.647 1.00 185.17 ? 991  LEU O N     1 
ATOM   2149  C  CA    . LEU A 1  326 ? 148.726 114.630 145.787 1.00 183.16 ? 991  LEU O CA    1 
ATOM   2150  C  C     . LEU A 1  326 ? 149.344 115.681 146.697 1.00 186.57 ? 991  LEU O C     1 
ATOM   2151  O  O     . LEU A 1  326 ? 150.082 115.363 147.631 1.00 190.41 ? 991  LEU O O     1 
ATOM   2152  C  CB    . LEU A 1  326 ? 147.356 114.208 146.314 1.00 175.72 ? 991  LEU O CB    1 
ATOM   2153  C  CG    . LEU A 1  326 ? 146.360 113.723 145.254 1.00 190.76 ? 991  LEU O CG    1 
ATOM   2154  C  CD1   . LEU A 1  326 ? 146.827 112.455 144.566 1.00 180.17 ? 991  LEU O CD1   1 
ATOM   2155  C  CD2   . LEU A 1  326 ? 144.990 113.504 145.868 1.00 194.51 ? 991  LEU O CD2   1 
ATOM   2156  N  N     . LEU A 1  327 ? 149.023 116.943 146.418 1.00 171.99 ? 992  LEU O N     1 
ATOM   2157  C  CA    . LEU A 1  327 ? 149.630 118.081 147.097 1.00 178.03 ? 992  LEU O CA    1 
ATOM   2158  C  C     . LEU A 1  327 ? 148.565 119.110 147.445 1.00 171.06 ? 992  LEU O C     1 
ATOM   2159  O  O     . LEU A 1  327 ? 147.813 119.538 146.568 1.00 172.07 ? 992  LEU O O     1 
ATOM   2160  C  CB    . LEU A 1  327 ? 150.711 118.697 146.209 1.00 160.70 ? 992  LEU O CB    1 
ATOM   2161  C  CG    . LEU A 1  327 ? 151.383 119.977 146.664 1.00 162.87 ? 992  LEU O CG    1 
ATOM   2162  C  CD1   . LEU A 1  327 ? 152.004 119.774 148.017 1.00 154.80 ? 992  LEU O CD1   1 
ATOM   2163  C  CD2   . LEU A 1  327 ? 152.446 120.306 145.651 1.00 158.40 ? 992  LEU O CD2   1 
ATOM   2164  N  N     . ARG A 1  328 ? 148.495 119.501 148.716 1.00 169.69 ? 993  ARG O N     1 
ATOM   2165  C  CA    . ARG A 1  328 ? 147.437 120.398 149.164 1.00 169.29 ? 993  ARG O CA    1 
ATOM   2166  C  C     . ARG A 1  328 ? 147.849 121.079 150.462 1.00 172.08 ? 993  ARG O C     1 
ATOM   2167  O  O     . ARG A 1  328 ? 148.694 120.573 151.199 1.00 173.92 ? 993  ARG O O     1 
ATOM   2168  C  CB    . ARG A 1  328 ? 146.128 119.627 149.365 1.00 166.97 ? 993  ARG O CB    1 
ATOM   2169  C  CG    . ARG A 1  328 ? 144.962 120.460 149.871 1.00 173.58 ? 993  ARG O CG    1 
ATOM   2170  C  CD    . ARG A 1  328 ? 143.721 119.620 150.081 1.00 172.05 ? 993  ARG O CD    1 
ATOM   2171  N  NE    . ARG A 1  328 ? 142.616 120.403 150.624 1.00 172.38 ? 993  ARG O NE    1 
ATOM   2172  C  CZ    . ARG A 1  328 ? 142.419 120.616 151.921 1.00 173.62 ? 993  ARG O CZ    1 
ATOM   2173  N  NH1   . ARG A 1  328 ? 143.254 120.106 152.815 1.00 167.63 ? 993  ARG O NH1   1 
ATOM   2174  N  NH2   . ARG A 1  328 ? 141.382 121.335 152.326 1.00 173.39 ? 993  ARG O NH2   1 
ATOM   2175  N  N     . ARG A 1  329 ? 147.229 122.229 150.733 1.00 151.47 ? 994  ARG O N     1 
ATOM   2176  C  CA    . ARG A 1  329 ? 147.137 122.793 152.080 1.00 158.11 ? 994  ARG O CA    1 
ATOM   2177  C  C     . ARG A 1  329 ? 145.870 123.639 152.182 1.00 174.09 ? 994  ARG O C     1 
ATOM   2178  O  O     . ARG A 1  329 ? 145.014 123.622 151.294 1.00 168.06 ? 994  ARG O O     1 
ATOM   2179  C  CB    . ARG A 1  329 ? 148.365 123.627 152.463 1.00 169.17 ? 994  ARG O CB    1 
ATOM   2180  C  CG    . ARG A 1  329 ? 149.596 122.837 152.858 1.00 173.76 ? 994  ARG O CG    1 
ATOM   2181  C  CD    . ARG A 1  329 ? 150.559 123.697 153.654 1.00 170.78 ? 994  ARG O CD    1 
ATOM   2182  N  NE    . ARG A 1  329 ? 151.014 124.848 152.887 1.00 172.93 ? 994  ARG O NE    1 
ATOM   2183  C  CZ    . ARG A 1  329 ? 152.062 124.827 152.073 1.00 173.71 ? 994  ARG O CZ    1 
ATOM   2184  N  NH1   . ARG A 1  329 ? 152.768 123.711 151.928 1.00 174.94 ? 994  ARG O NH1   1 
ATOM   2185  N  NH2   . ARG A 1  329 ? 152.407 125.921 151.409 1.00 171.79 ? 994  ARG O NH2   1 
ATOM   2186  N  N     . LEU A 1  330 ? 145.754 124.377 153.283 1.00 171.86 ? 995  LEU O N     1 
ATOM   2187  C  CA    . LEU A 1  330 ? 144.653 125.292 153.523 1.00 170.36 ? 995  LEU O CA    1 
ATOM   2188  C  C     . LEU A 1  330 ? 145.110 126.726 153.297 1.00 171.51 ? 995  LEU O C     1 
ATOM   2189  O  O     . LEU A 1  330 ? 146.249 126.998 152.917 1.00 175.13 ? 995  LEU O O     1 
ATOM   2190  C  CB    . LEU A 1  330 ? 144.110 125.141 154.944 1.00 165.23 ? 995  LEU O CB    1 
ATOM   2191  C  CG    . LEU A 1  330 ? 143.489 123.810 155.348 1.00 163.34 ? 995  LEU O CG    1 
ATOM   2192  C  CD1   . LEU A 1  330 ? 143.077 123.851 156.807 1.00 173.52 ? 995  LEU O CD1   1 
ATOM   2193  C  CD2   . LEU A 1  330 ? 142.308 123.497 154.466 1.00 156.93 ? 995  LEU O CD2   1 
ATOM   2194  N  N     . LYS A 1  331 ? 144.197 127.662 153.557 1.00 167.80 ? 996  LYS O N     1 
ATOM   2195  C  CA    . LYS A 1  331 ? 144.516 129.081 153.451 1.00 169.80 ? 996  LYS O CA    1 
ATOM   2196  C  C     . LYS A 1  331 ? 145.273 129.575 154.678 1.00 167.25 ? 996  LYS O C     1 
ATOM   2197  O  O     . LYS A 1  331 ? 146.210 130.374 154.556 1.00 169.74 ? 996  LYS O O     1 
ATOM   2198  C  CB    . LYS A 1  331 ? 143.230 129.887 153.263 1.00 161.85 ? 996  LYS O CB    1 
ATOM   2199  C  CG    . LYS A 1  331 ? 143.452 131.358 152.940 1.00 164.53 ? 996  LYS O CG    1 
ATOM   2200  C  CD    . LYS A 1  331 ? 142.133 132.022 152.579 1.00 172.26 ? 996  LYS O CD    1 
ATOM   2201  C  CE    . LYS A 1  331 ? 142.309 133.457 152.159 1.00 195.12 ? 996  LYS O CE    1 
ATOM   2202  N  NZ    . LYS A 1  331 ? 142.744 134.354 153.232 1.00 201.05 ? 996  LYS O NZ    1 
ATOM   2203  N  N     . LYS A 1  332 ? 144.863 129.121 155.865 1.00 164.22 ? 997  LYS O N     1 
ATOM   2204  C  CA    . LYS A 1  332 ? 145.569 129.493 157.083 1.00 173.91 ? 997  LYS O CA    1 
ATOM   2205  C  C     . LYS A 1  332 ? 147.037 129.105 157.013 1.00 172.77 ? 997  LYS O C     1 
ATOM   2206  O  O     . LYS A 1  332 ? 147.885 129.783 157.605 1.00 179.61 ? 997  LYS O O     1 
ATOM   2207  C  CB    . LYS A 1  332 ? 144.906 128.846 158.299 1.00 156.47 ? 997  LYS O CB    1 
ATOM   2208  C  CG    . LYS A 1  332 ? 144.878 127.330 158.267 1.00 164.55 ? 997  LYS O CG    1 
ATOM   2209  C  CD    . LYS A 1  332 ? 144.242 126.781 159.526 1.00 166.41 ? 997  LYS O CD    1 
ATOM   2210  C  CE    . LYS A 1  332 ? 142.779 127.180 159.619 1.00 165.33 ? 997  LYS O CE    1 
ATOM   2211  N  NZ    . LYS A 1  332 ? 142.131 126.660 160.858 1.00 167.05 ? 997  LYS O NZ    1 
ATOM   2212  N  N     . ASP A 1  333 ? 147.356 128.029 156.293 1.00 174.78 ? 998  ASP O N     1 
ATOM   2213  C  CA    . ASP A 1  333 ? 148.749 127.641 156.123 1.00 178.38 ? 998  ASP O CA    1 
ATOM   2214  C  C     . ASP A 1  333 ? 149.527 128.733 155.405 1.00 178.10 ? 998  ASP O C     1 
ATOM   2215  O  O     . ASP A 1  333 ? 150.542 129.229 155.907 1.00 180.26 ? 998  ASP O O     1 
ATOM   2216  C  CB    . ASP A 1  333 ? 148.836 126.320 155.362 1.00 161.78 ? 998  ASP O CB    1 
ATOM   2217  C  CG    . ASP A 1  333 ? 148.328 125.155 156.175 1.00 172.08 ? 998  ASP O CG    1 
ATOM   2218  O  OD1   . ASP A 1  333 ? 148.139 125.326 157.396 1.00 182.58 ? 998  ASP O OD1   1 
ATOM   2219  O  OD2   . ASP A 1  333 ? 148.134 124.066 155.604 1.00 164.05 ? 998  ASP O OD2   1 
ATOM   2220  N  N     . VAL A 1  334 ? 149.046 129.143 154.233 1.00 161.12 ? 999  VAL O N     1 
ATOM   2221  C  CA    . VAL A 1  334 ? 149.787 130.117 153.444 1.00 158.41 ? 999  VAL O CA    1 
ATOM   2222  C  C     . VAL A 1  334 ? 149.600 131.542 153.941 1.00 165.78 ? 999  VAL O C     1 
ATOM   2223  O  O     . VAL A 1  334 ? 150.488 132.379 153.736 1.00 159.23 ? 999  VAL O O     1 
ATOM   2224  C  CB    . VAL A 1  334 ? 149.383 130.017 151.966 1.00 158.13 ? 999  VAL O CB    1 
ATOM   2225  C  CG1   . VAL A 1  334 ? 149.716 128.642 151.438 1.00 154.33 ? 999  VAL O CG1   1 
ATOM   2226  C  CG2   . VAL A 1  334 ? 147.905 130.305 151.799 1.00 161.72 ? 999  VAL O CG2   1 
ATOM   2227  N  N     . GLU A 1  335 ? 148.476 131.850 154.586 1.00 170.82 ? 1000 GLU O N     1 
ATOM   2228  C  CA    . GLU A 1  335 ? 148.170 133.237 154.912 1.00 168.04 ? 1000 GLU O CA    1 
ATOM   2229  C  C     . GLU A 1  335 ? 147.748 133.440 156.358 1.00 164.09 ? 1000 GLU O C     1 
ATOM   2230  O  O     . GLU A 1  335 ? 148.445 134.111 157.125 1.00 157.15 ? 1000 GLU O O     1 
ATOM   2231  C  CB    . GLU A 1  335 ? 147.064 133.758 154.001 1.00 144.63 ? 1000 GLU O CB    1 
ATOM   2232  C  CG    . GLU A 1  335 ? 147.445 133.845 152.547 1.00 163.45 ? 1000 GLU O CG    1 
ATOM   2233  C  CD    . GLU A 1  335 ? 146.294 134.326 151.705 1.00 174.73 ? 1000 GLU O CD    1 
ATOM   2234  O  OE1   . GLU A 1  335 ? 145.181 134.432 152.255 1.00 181.63 ? 1000 GLU O OE1   1 
ATOM   2235  O  OE2   . GLU A 1  335 ? 146.493 134.598 150.503 1.00 173.97 ? 1000 GLU O OE2   1 
ATOM   2236  N  N     . LYS A 1  336 ? 146.598 132.868 156.714 1.00 179.62 ? 1001 LYS O N     1 
ATOM   2237  C  CA    . LYS A 1  336 ? 145.758 133.142 157.882 1.00 182.05 ? 1001 LYS O CA    1 
ATOM   2238  C  C     . LYS A 1  336 ? 144.845 134.332 157.599 1.00 167.68 ? 1001 LYS O C     1 
ATOM   2239  O  O     . LYS A 1  336 ? 144.021 134.679 158.456 1.00 167.98 ? 1001 LYS O O     1 
ATOM   2240  C  CB    . LYS A 1  336 ? 146.533 133.392 159.188 1.00 157.74 ? 1001 LYS O CB    1 
ATOM   2241  C  CG    . LYS A 1  336 ? 147.239 132.164 159.753 1.00 168.67 ? 1001 LYS O CG    1 
ATOM   2242  C  CD    . LYS A 1  336 ? 147.850 132.464 161.115 1.00 172.86 ? 1001 LYS O CD    1 
ATOM   2243  C  CE    . LYS A 1  336 ? 148.950 133.502 161.019 1.00 171.46 ? 1001 LYS O CE    1 
ATOM   2244  N  NZ    . LYS A 1  336 ? 150.101 132.998 160.227 1.00 173.09 ? 1001 LYS O NZ    1 
ATOM   2245  N  N     . GLU A 1  337 ? 144.951 134.961 156.427 1.00 174.15 ? 1002 GLU O N     1 
ATOM   2246  C  CA    . GLU A 1  337 ? 144.085 136.083 156.084 1.00 174.15 ? 1002 GLU O CA    1 
ATOM   2247  C  C     . GLU A 1  337 ? 142.619 135.689 155.949 1.00 174.15 ? 1002 GLU O C     1 
ATOM   2248  O  O     . GLU A 1  337 ? 141.776 136.577 155.782 1.00 174.15 ? 1002 GLU O O     1 
ATOM   2249  C  CB    . GLU A 1  337 ? 144.551 136.739 154.784 1.00 147.67 ? 1002 GLU O CB    1 
ATOM   2250  C  CG    . GLU A 1  337 ? 145.907 137.412 154.861 1.00 147.67 ? 1002 GLU O CG    1 
ATOM   2251  C  CD    . GLU A 1  337 ? 146.293 138.070 153.553 1.00 147.67 ? 1002 GLU O CD    1 
ATOM   2252  O  OE1   . GLU A 1  337 ? 145.559 137.894 152.562 1.00 147.67 ? 1002 GLU O OE1   1 
ATOM   2253  O  OE2   . GLU A 1  337 ? 147.332 138.755 153.509 1.00 147.67 ? 1002 GLU O OE2   1 
ATOM   2254  N  N     . LEU A 1  338 ? 142.299 134.399 155.989 1.00 186.74 ? 1003 LEU O N     1 
ATOM   2255  C  CA    . LEU A 1  338 ? 140.919 133.945 155.886 1.00 186.74 ? 1003 LEU O CA    1 
ATOM   2256  C  C     . LEU A 1  338 ? 140.101 134.595 156.989 1.00 186.74 ? 1003 LEU O C     1 
ATOM   2257  O  O     . LEU A 1  338 ? 140.421 134.413 158.172 1.00 186.74 ? 1003 LEU O O     1 
ATOM   2258  C  CB    . LEU A 1  338 ? 140.847 132.425 155.988 1.00 160.33 ? 1003 LEU O CB    1 
ATOM   2259  C  CG    . LEU A 1  338 ? 139.460 131.785 156.039 1.00 160.33 ? 1003 LEU O CG    1 
ATOM   2260  C  CD1   . LEU A 1  338 ? 138.630 132.072 154.793 1.00 160.33 ? 1003 LEU O CD1   1 
ATOM   2261  C  CD2   . LEU A 1  338 ? 139.594 130.287 156.247 1.00 160.33 ? 1003 LEU O CD2   1 
ATOM   2262  N  N     . PRO A 1  339 ? 139.070 135.374 156.658 1.00 193.14 ? 1004 PRO O N     1 
ATOM   2263  C  CA    . PRO A 1  339 ? 138.399 136.171 157.700 1.00 193.14 ? 1004 PRO O CA    1 
ATOM   2264  C  C     . PRO A 1  339 ? 137.726 135.337 158.781 1.00 193.14 ? 1004 PRO O C     1 
ATOM   2265  O  O     . PRO A 1  339 ? 137.847 135.681 159.961 1.00 193.14 ? 1004 PRO O O     1 
ATOM   2266  C  CB    . PRO A 1  339 ? 137.400 137.010 156.895 1.00 181.77 ? 1004 PRO O CB    1 
ATOM   2267  C  CG    . PRO A 1  339 ? 137.157 136.214 155.657 1.00 181.77 ? 1004 PRO O CG    1 
ATOM   2268  C  CD    . PRO A 1  339 ? 138.471 135.580 155.331 1.00 181.77 ? 1004 PRO O CD    1 
ATOM   2269  N  N     . ASP A 1  340 ? 137.050 134.246 158.421 1.00 196.70 ? 1005 ASP O N     1 
ATOM   2270  C  CA    . ASP A 1  340 ? 136.469 133.307 159.378 1.00 191.46 ? 1005 ASP O CA    1 
ATOM   2271  C  C     . ASP A 1  340 ? 136.388 131.932 158.726 1.00 181.90 ? 1005 ASP O C     1 
ATOM   2272  O  O     . ASP A 1  340 ? 136.867 131.725 157.609 1.00 166.71 ? 1005 ASP O O     1 
ATOM   2273  C  CB    . ASP A 1  340 ? 135.085 133.764 159.847 1.00 182.11 ? 1005 ASP O CB    1 
ATOM   2274  C  CG    . ASP A 1  340 ? 135.148 134.794 160.952 1.00 191.38 ? 1005 ASP O CG    1 
ATOM   2275  O  OD1   . ASP A 1  340 ? 136.160 134.826 161.681 1.00 196.22 ? 1005 ASP O OD1   1 
ATOM   2276  O  OD2   . ASP A 1  340 ? 134.185 135.579 161.085 1.00 181.30 ? 1005 ASP O OD2   1 
ATOM   2277  N  N     . LYS A 1  341 ? 135.766 130.984 159.432 1.00 157.41 ? 1006 LYS O N     1 
ATOM   2278  C  CA    . LYS A 1  341 ? 135.407 129.730 158.781 1.00 165.57 ? 1006 LYS O CA    1 
ATOM   2279  C  C     . LYS A 1  341 ? 134.473 129.980 157.609 1.00 167.39 ? 1006 LYS O C     1 
ATOM   2280  O  O     . LYS A 1  341 ? 134.426 129.168 156.679 1.00 163.31 ? 1006 LYS O O     1 
ATOM   2281  C  CB    . LYS A 1  341 ? 134.760 128.771 159.784 1.00 136.24 ? 1006 LYS O CB    1 
ATOM   2282  C  CG    . LYS A 1  341 ? 134.385 127.405 159.215 1.00 140.84 ? 1006 LYS O CG    1 
ATOM   2283  C  CD    . LYS A 1  341 ? 135.606 126.694 158.654 1.00 144.24 ? 1006 LYS O CD    1 
ATOM   2284  C  CE    . LYS A 1  341 ? 135.347 125.212 158.468 1.00 148.12 ? 1006 LYS O CE    1 
ATOM   2285  N  NZ    . LYS A 1  341 ? 134.225 124.950 157.528 1.00 151.79 ? 1006 LYS O NZ    1 
ATOM   2286  N  N     . VAL A 1  342 ? 133.739 131.096 157.649 1.00 156.04 ? 1007 VAL O N     1 
ATOM   2287  C  CA    . VAL A 1  342 ? 132.951 131.661 156.558 1.00 150.93 ? 1007 VAL O CA    1 
ATOM   2288  C  C     . VAL A 1  342 ? 132.088 130.594 155.899 1.00 150.16 ? 1007 VAL O C     1 
ATOM   2289  O  O     . VAL A 1  342 ? 131.876 130.612 154.682 1.00 154.31 ? 1007 VAL O O     1 
ATOM   2290  C  CB    . VAL A 1  342 ? 133.853 132.387 155.535 1.00 144.87 ? 1007 VAL O CB    1 
ATOM   2291  C  CG1   . VAL A 1  342 ? 134.639 133.482 156.227 1.00 153.56 ? 1007 VAL O CG1   1 
ATOM   2292  C  CG2   . VAL A 1  342 ? 134.792 131.445 154.777 1.00 145.93 ? 1007 VAL O CG2   1 
ATOM   2293  N  N     . GLU A 1  343 ? 131.572 129.665 156.700 1.00 154.80 ? 1008 GLU O N     1 
ATOM   2294  C  CA    . GLU A 1  343 ? 130.613 128.669 156.234 1.00 158.74 ? 1008 GLU O CA    1 
ATOM   2295  C  C     . GLU A 1  343 ? 129.469 128.581 157.231 1.00 157.12 ? 1008 GLU O C     1 
ATOM   2296  O  O     . GLU A 1  343 ? 129.674 128.156 158.371 1.00 158.13 ? 1008 GLU O O     1 
ATOM   2297  C  CB    . GLU A 1  343 ? 131.275 127.307 156.055 1.00 144.24 ? 1008 GLU O CB    1 
ATOM   2298  C  CG    . GLU A 1  343 ? 130.328 126.236 155.575 1.00 164.87 ? 1008 GLU O CG    1 
ATOM   2299  C  CD    . GLU A 1  343 ? 131.030 124.923 155.331 1.00 174.96 ? 1008 GLU O CD    1 
ATOM   2300  O  OE1   . GLU A 1  343 ? 132.253 124.849 155.567 1.00 186.33 ? 1008 GLU O OE1   1 
ATOM   2301  O  OE2   . GLU A 1  343 ? 130.361 123.965 154.898 1.00 163.71 ? 1008 GLU O OE2   1 
ATOM   2302  N  N     . LYS A 1  344 ? 128.268 128.962 156.798 1.00 146.38 ? 1009 LYS O N     1 
ATOM   2303  C  CA    . LYS A 1  344 ? 127.051 128.822 157.587 1.00 141.29 ? 1009 LYS O CA    1 
ATOM   2304  C  C     . LYS A 1  344 ? 125.939 128.352 156.662 1.00 147.31 ? 1009 LYS O C     1 
ATOM   2305  O  O     . LYS A 1  344 ? 126.126 128.237 155.449 1.00 144.92 ? 1009 LYS O O     1 
ATOM   2306  C  CB    . LYS A 1  344 ? 126.662 130.141 158.266 1.00 133.13 ? 1009 LYS O CB    1 
ATOM   2307  C  CG    . LYS A 1  344 ? 127.699 130.696 159.225 1.00 143.31 ? 1009 LYS O CG    1 
ATOM   2308  C  CD    . LYS A 1  344 ? 127.919 129.751 160.395 1.00 161.36 ? 1009 LYS O CD    1 
ATOM   2309  C  CE    . LYS A 1  344 ? 128.941 130.301 161.375 1.00 173.13 ? 1009 LYS O CE    1 
ATOM   2310  N  NZ    . LYS A 1  344 ? 129.190 129.353 162.497 1.00 182.82 ? 1009 LYS O NZ    1 
ATOM   2311  N  N     . VAL A 1  345 ? 124.765 128.094 157.232 1.00 146.86 ? 1010 VAL O N     1 
ATOM   2312  C  CA    . VAL A 1  345 ? 123.571 127.749 156.472 1.00 145.68 ? 1010 VAL O CA    1 
ATOM   2313  C  C     . VAL A 1  345 ? 122.364 128.376 157.158 1.00 142.37 ? 1010 VAL O C     1 
ATOM   2314  O  O     . VAL A 1  345 ? 122.473 128.969 158.235 1.00 148.54 ? 1010 VAL O O     1 
ATOM   2315  C  CB    . VAL A 1  345 ? 123.370 126.224 156.344 1.00 140.65 ? 1010 VAL O CB    1 
ATOM   2316  C  CG1   . VAL A 1  345 ? 124.523 125.578 155.607 1.00 135.16 ? 1010 VAL O CG1   1 
ATOM   2317  C  CG2   . VAL A 1  345 ? 123.194 125.599 157.709 1.00 135.78 ? 1010 VAL O CG2   1 
ATOM   2318  N  N     . VAL A 1  346 ? 121.200 128.222 156.531 1.00 150.93 ? 1011 VAL O N     1 
ATOM   2319  C  CA    . VAL A 1  346 ? 119.909 128.549 157.121 1.00 154.23 ? 1011 VAL O CA    1 
ATOM   2320  C  C     . VAL A 1  346 ? 118.897 127.514 156.647 1.00 144.64 ? 1011 VAL O C     1 
ATOM   2321  O  O     . VAL A 1  346 ? 119.220 126.599 155.886 1.00 150.71 ? 1011 VAL O O     1 
ATOM   2322  C  CB    . VAL A 1  346 ? 119.423 129.971 156.763 1.00 147.74 ? 1011 VAL O CB    1 
ATOM   2323  C  CG1   . VAL A 1  346 ? 120.304 131.033 157.388 1.00 154.10 ? 1011 VAL O CG1   1 
ATOM   2324  C  CG2   . VAL A 1  346 ? 119.347 130.148 155.259 1.00 141.23 ? 1011 VAL O CG2   1 
ATOM   2325  N  N     . LYS A 1  347 ? 117.660 127.667 157.106 1.00 142.78 ? 1012 LYS O N     1 
ATOM   2326  C  CA    . LYS A 1  347 ? 116.556 126.825 156.683 1.00 149.93 ? 1012 LYS O CA    1 
ATOM   2327  C  C     . LYS A 1  347 ? 115.398 127.711 156.257 1.00 156.46 ? 1012 LYS O C     1 
ATOM   2328  O  O     . LYS A 1  347 ? 115.430 128.933 156.418 1.00 157.22 ? 1012 LYS O O     1 
ATOM   2329  C  CB    . LYS A 1  347 ? 116.114 125.880 157.807 1.00 135.20 ? 1012 LYS O CB    1 
ATOM   2330  C  CG    . LYS A 1  347 ? 117.214 124.972 158.324 1.00 140.46 ? 1012 LYS O CG    1 
ATOM   2331  C  CD    . LYS A 1  347 ? 117.751 124.064 157.238 1.00 152.84 ? 1012 LYS O CD    1 
ATOM   2332  C  CE    . LYS A 1  347 ? 116.769 122.948 156.944 1.00 141.81 ? 1012 LYS O CE    1 
ATOM   2333  N  NZ    . LYS A 1  347 ? 117.329 121.966 155.994 1.00 155.24 ? 1012 LYS O NZ    1 
ATOM   2334  N  N     . CYS A 1  348 ? 114.350 127.075 155.747 1.00 142.81 ? 1013 CYS O N     1 
ATOM   2335  C  CA    . CYS A 1  348 ? 113.164 127.776 155.273 1.00 146.27 ? 1013 CYS O CA    1 
ATOM   2336  C  C     . CYS A 1  348 ? 111.977 126.822 155.348 1.00 148.44 ? 1013 CYS O C     1 
ATOM   2337  O  O     . CYS A 1  348 ? 112.091 125.696 155.843 1.00 144.36 ? 1013 CYS O O     1 
ATOM   2338  C  CB    . CYS A 1  348 ? 113.359 128.302 153.846 1.00 154.28 ? 1013 CYS O CB    1 
ATOM   2339  S  SG    . CYS A 1  348 ? 114.604 129.591 153.627 1.00 160.75 ? 1013 CYS O SG    1 
ATOM   2340  N  N     . LYS A 1  349 ? 110.832 127.282 154.849 1.00 137.90 ? 1014 LYS O N     1 
ATOM   2341  C  CA    . LYS A 1  349 ? 109.631 126.469 154.737 1.00 139.06 ? 1014 LYS O CA    1 
ATOM   2342  C  C     . LYS A 1  349 ? 108.893 126.892 153.478 1.00 130.07 ? 1014 LYS O C     1 
ATOM   2343  O  O     . LYS A 1  349 ? 108.882 128.075 153.129 1.00 138.09 ? 1014 LYS O O     1 
ATOM   2344  C  CB    . LYS A 1  349 ? 108.720 126.625 155.962 1.00 134.40 ? 1014 LYS O CB    1 
ATOM   2345  C  CG    . LYS A 1  349 ? 109.273 126.042 157.260 1.00 139.17 ? 1014 LYS O CG    1 
ATOM   2346  C  CD    . LYS A 1  349 ? 108.311 126.260 158.422 1.00 139.61 ? 1014 LYS O CD    1 
ATOM   2347  C  CE    . LYS A 1  349 ? 108.842 125.655 159.711 1.00 161.11 ? 1014 LYS O CE    1 
ATOM   2348  N  NZ    . LYS A 1  349 ? 108.978 124.176 159.605 1.00 169.57 ? 1014 LYS O NZ    1 
ATOM   2349  N  N     . MET A 1  350 ? 108.274 125.926 152.807 1.00 123.75 ? 1015 MET O N     1 
ATOM   2350  C  CA    . MET A 1  350 ? 107.580 126.158 151.549 1.00 124.98 ? 1015 MET O CA    1 
ATOM   2351  C  C     . MET A 1  350 ? 106.078 126.257 151.769 1.00 137.90 ? 1015 MET O C     1 
ATOM   2352  O  O     . MET A 1  350 ? 105.520 125.590 152.643 1.00 131.75 ? 1015 MET O O     1 
ATOM   2353  C  CB    . MET A 1  350 ? 107.886 125.042 150.550 1.00 131.47 ? 1015 MET O CB    1 
ATOM   2354  C  CG    . MET A 1  350 ? 107.045 125.092 149.296 1.00 131.47 ? 1015 MET O CG    1 
ATOM   2355  S  SD    . MET A 1  350 ? 107.282 126.589 148.339 1.00 131.47 ? 1015 MET O SD    1 
ATOM   2356  C  CE    . MET A 1  350 ? 106.097 126.309 147.030 1.00 131.47 ? 1015 MET O CE    1 
ATOM   2357  N  N     . SER A 1  351 ? 105.432 127.115 150.972 1.00 140.18 ? 1016 SER O N     1 
ATOM   2358  C  CA    . SER A 1  351 ? 103.990 127.307 151.078 1.00 138.39 ? 1016 SER O CA    1 
ATOM   2359  C  C     . SER A 1  351 ? 103.274 125.973 150.948 1.00 135.38 ? 1016 SER O C     1 
ATOM   2360  O  O     . SER A 1  351 ? 103.557 125.188 150.040 1.00 140.21 ? 1016 SER O O     1 
ATOM   2361  C  CB    . SER A 1  351 ? 103.490 128.267 150.002 1.00 127.39 ? 1016 SER O CB    1 
ATOM   2362  O  OG    . SER A 1  351 ? 103.630 127.693 148.716 1.00 126.46 ? 1016 SER O OG    1 
ATOM   2363  N  N     . ALA A 1  352 ? 102.337 125.725 151.863 1.00 140.25 ? 1017 ALA O N     1 
ATOM   2364  C  CA    . ALA A 1  352 ? 101.667 124.433 151.912 1.00 147.11 ? 1017 ALA O CA    1 
ATOM   2365  C  C     . ALA A 1  352 ? 100.915 124.128 150.629 1.00 147.82 ? 1017 ALA O C     1 
ATOM   2366  O  O     . ALA A 1  352 ? 100.560 122.968 150.396 1.00 154.96 ? 1017 ALA O O     1 
ATOM   2367  C  CB    . ALA A 1  352 ? 100.717 124.378 153.107 1.00 115.65 ? 1017 ALA O CB    1 
ATOM   2368  N  N     . LEU A 1  353 ? 100.688 125.142 149.792 1.00 148.13 ? 1018 LEU O N     1 
ATOM   2369  C  CA    . LEU A 1  353 ? 99.964  124.954 148.540 1.00 154.28 ? 1018 LEU O CA    1 
ATOM   2370  C  C     . LEU A 1  353 ? 100.510 123.762 147.769 1.00 148.54 ? 1018 LEU O C     1 
ATOM   2371  O  O     . LEU A 1  353 ? 99.762  122.876 147.342 1.00 150.84 ? 1018 LEU O O     1 
ATOM   2372  C  CB    . LEU A 1  353 ? 100.071 126.226 147.700 1.00 137.35 ? 1018 LEU O CB    1 
ATOM   2373  C  CG    . LEU A 1  353 ? 99.163  127.405 148.044 1.00 149.17 ? 1018 LEU O CG    1 
ATOM   2374  C  CD1   . LEU A 1  353 ? 99.478  127.984 149.418 1.00 141.63 ? 1018 LEU O CD1   1 
ATOM   2375  C  CD2   . LEU A 1  353 ? 99.305  128.473 146.976 1.00 144.90 ? 1018 LEU O CD2   1 
ATOM   2376  N  N     . GLN A 1  354 ? 101.819 123.725 147.592 1.00 143.10 ? 1019 GLN O N     1 
ATOM   2377  C  CA    . GLN A 1  354 ? 102.482 122.617 146.935 1.00 139.96 ? 1019 GLN O CA    1 
ATOM   2378  C  C     . GLN A 1  354 ? 102.989 121.579 147.921 1.00 146.82 ? 1019 GLN O C     1 
ATOM   2379  O  O     . GLN A 1  354 ? 103.400 120.492 147.501 1.00 150.50 ? 1019 GLN O O     1 
ATOM   2380  C  CB    . GLN A 1  354 ? 103.620 123.164 146.077 1.00 138.06 ? 1019 GLN O CB    1 
ATOM   2381  C  CG    . GLN A 1  354 ? 103.097 124.107 145.005 1.00 129.03 ? 1019 GLN O CG    1 
ATOM   2382  C  CD    . GLN A 1  354 ? 102.792 125.493 145.547 1.00 140.52 ? 1019 GLN O CD    1 
ATOM   2383  O  OE1   . GLN A 1  354 ? 103.072 125.790 146.706 1.00 134.93 ? 1019 GLN O OE1   1 
ATOM   2384  N  NE2   . GLN A 1  354 ? 102.166 126.326 144.728 1.00 133.29 ? 1019 GLN O NE2   1 
ATOM   2385  N  N     . GLN A 1  355 ? 102.958 121.887 149.221 1.00 149.17 ? 1020 GLN O N     1 
ATOM   2386  C  CA    . GLN A 1  355 ? 103.248 120.875 150.226 1.00 152.17 ? 1020 GLN O CA    1 
ATOM   2387  C  C     . GLN A 1  355 ? 102.149 119.824 150.269 1.00 158.11 ? 1020 GLN O C     1 
ATOM   2388  O  O     . GLN A 1  355 ? 102.430 118.641 150.492 1.00 163.92 ? 1020 GLN O O     1 
ATOM   2389  C  CB    . GLN A 1  355 ? 103.404 121.513 151.610 1.00 148.97 ? 1020 GLN O CB    1 
ATOM   2390  C  CG    . GLN A 1  355 ? 104.551 122.507 151.789 1.00 148.97 ? 1020 GLN O CG    1 
ATOM   2391  C  CD    . GLN A 1  355 ? 105.923 121.869 151.752 1.00 148.97 ? 1020 GLN O CD    1 
ATOM   2392  O  OE1   . GLN A 1  355 ? 106.626 121.950 150.753 1.00 148.97 ? 1020 GLN O OE1   1 
ATOM   2393  N  NE2   . GLN A 1  355 ? 106.316 121.244 152.852 1.00 148.97 ? 1020 GLN O NE2   1 
ATOM   2394  N  N     . ILE A 1  356 ? 100.895 120.241 150.071 1.00 166.52 ? 1021 ILE O N     1 
ATOM   2395  C  CA    . ILE A 1  356 ? 99.792  119.288 150.017 1.00 166.60 ? 1021 ILE O CA    1 
ATOM   2396  C  C     . ILE A 1  356 ? 100.030 118.289 148.901 1.00 165.50 ? 1021 ILE O C     1 
ATOM   2397  O  O     . ILE A 1  356 ? 99.632  117.122 148.994 1.00 174.11 ? 1021 ILE O O     1 
ATOM   2398  C  CB    . ILE A 1  356 ? 98.454  120.030 149.828 1.00 178.09 ? 1021 ILE O CB    1 
ATOM   2399  C  CG1   . ILE A 1  356 ? 98.194  120.992 150.987 1.00 178.09 ? 1021 ILE O CG1   1 
ATOM   2400  C  CG2   . ILE A 1  356 ? 97.296  119.041 149.724 1.00 178.09 ? 1021 ILE O CG2   1 
ATOM   2401  C  CD1   . ILE A 1  356 ? 97.027  121.937 150.743 1.00 178.09 ? 1021 ILE O CD1   1 
ATOM   2402  N  N     . MET A 1  357 ? 100.696 118.725 147.837 1.00 150.76 ? 1022 MET O N     1 
ATOM   2403  C  CA    . MET A 1  357 ? 100.994 117.828 146.734 1.00 153.51 ? 1022 MET O CA    1 
ATOM   2404  C  C     . MET A 1  357 ? 102.058 116.807 147.116 1.00 156.15 ? 1022 MET O C     1 
ATOM   2405  O  O     . MET A 1  357 ? 102.023 115.668 146.639 1.00 146.29 ? 1022 MET O O     1 
ATOM   2406  C  CB    . MET A 1  357 ? 101.428 118.655 145.536 1.00 136.66 ? 1022 MET O CB    1 
ATOM   2407  C  CG    . MET A 1  357 ? 100.385 119.667 145.110 1.00 136.66 ? 1022 MET O CG    1 
ATOM   2408  S  SD    . MET A 1  357 ? 98.845  118.880 144.613 1.00 136.66 ? 1022 MET O SD    1 
ATOM   2409  C  CE    . MET A 1  357 ? 97.875  120.308 144.143 1.00 136.66 ? 1022 MET O CE    1 
ATOM   2410  N  N     . TYR A 1  358 ? 103.003 117.195 147.977 1.00 158.82 ? 1023 TYR O N     1 
ATOM   2411  C  CA    . TYR A 1  358 ? 103.971 116.237 148.501 1.00 152.07 ? 1023 TYR O CA    1 
ATOM   2412  C  C     . TYR A 1  358 ? 103.289 115.151 149.323 1.00 165.23 ? 1023 TYR O C     1 
ATOM   2413  O  O     . TYR A 1  358 ? 103.671 113.979 149.254 1.00 170.56 ? 1023 TYR O O     1 
ATOM   2414  C  CB    . TYR A 1  358 ? 105.007 116.950 149.364 1.00 150.69 ? 1023 TYR O CB    1 
ATOM   2415  C  CG    . TYR A 1  358 ? 105.860 117.944 148.636 1.00 150.69 ? 1023 TYR O CG    1 
ATOM   2416  C  CD1   . TYR A 1  358 ? 106.380 117.660 147.393 1.00 150.69 ? 1023 TYR O CD1   1 
ATOM   2417  C  CD2   . TYR A 1  358 ? 106.144 119.173 149.198 1.00 150.69 ? 1023 TYR O CD2   1 
ATOM   2418  C  CE1   . TYR A 1  358 ? 107.161 118.576 146.731 1.00 150.69 ? 1023 TYR O CE1   1 
ATOM   2419  C  CE2   . TYR A 1  358 ? 106.921 120.090 148.544 1.00 150.69 ? 1023 TYR O CE2   1 
ATOM   2420  C  CZ    . TYR A 1  358 ? 107.431 119.791 147.310 1.00 150.69 ? 1023 TYR O CZ    1 
ATOM   2421  O  OH    . TYR A 1  358 ? 108.211 120.717 146.653 1.00 150.69 ? 1023 TYR O OH    1 
ATOM   2422  N  N     . GLN A 1  359 ? 102.304 115.526 150.143 1.00 175.06 ? 1024 GLN O N     1 
ATOM   2423  C  CA    . GLN A 1  359 ? 101.634 114.532 150.976 1.00 175.19 ? 1024 GLN O CA    1 
ATOM   2424  C  C     . GLN A 1  359 ? 100.887 113.515 150.124 1.00 176.22 ? 1024 GLN O C     1 
ATOM   2425  O  O     . GLN A 1  359 ? 101.089 112.304 150.264 1.00 190.51 ? 1024 GLN O O     1 
ATOM   2426  C  CB    . GLN A 1  359 ? 100.670 115.205 151.957 1.00 180.29 ? 1024 GLN O CB    1 
ATOM   2427  C  CG    . GLN A 1  359 ? 101.315 115.992 153.090 1.00 180.29 ? 1024 GLN O CG    1 
ATOM   2428  C  CD    . GLN A 1  359 ? 100.278 116.610 154.025 1.00 180.29 ? 1024 GLN O CD    1 
ATOM   2429  O  OE1   . GLN A 1  359 ? 99.145  116.880 153.622 1.00 180.29 ? 1024 GLN O OE1   1 
ATOM   2430  N  NE2   . GLN A 1  359 ? 100.659 116.818 155.282 1.00 180.29 ? 1024 GLN O NE2   1 
ATOM   2431  N  N     . GLN A 1  360 ? 100.005 113.988 149.243 1.00 172.71 ? 1025 GLN O N     1 
ATOM   2432  C  CA    . GLN A 1  360 ? 99.192  113.072 148.451 1.00 175.28 ? 1025 GLN O CA    1 
ATOM   2433  C  C     . GLN A 1  360 ? 100.030 112.378 147.379 1.00 189.88 ? 1025 GLN O C     1 
ATOM   2434  O  O     . GLN A 1  360 ? 100.080 111.143 147.312 1.00 197.68 ? 1025 GLN O O     1 
ATOM   2435  C  CB    . GLN A 1  360 ? 98.017  113.830 147.826 1.00 167.40 ? 1025 GLN O CB    1 
ATOM   2436  C  CG    . GLN A 1  360 ? 96.989  112.938 147.157 1.00 178.04 ? 1025 GLN O CG    1 
ATOM   2437  C  CD    . GLN A 1  360 ? 95.788  113.700 146.639 1.00 182.89 ? 1025 GLN O CD    1 
ATOM   2438  O  OE1   . GLN A 1  360 ? 95.673  114.906 146.838 1.00 193.06 ? 1025 GLN O OE1   1 
ATOM   2439  N  NE2   . GLN A 1  360 ? 94.884  112.998 145.969 1.00 179.98 ? 1025 GLN O NE2   1 
ATOM   2440  N  N     . MET A 1  361 ? 100.701 113.164 146.533 1.00 172.61 ? 1026 MET O N     1 
ATOM   2441  C  CA    . MET A 1  361 ? 101.526 112.647 145.437 1.00 173.45 ? 1026 MET O CA    1 
ATOM   2442  C  C     . MET A 1  361 ? 100.773 111.635 144.580 1.00 175.69 ? 1026 MET O C     1 
ATOM   2443  O  O     . MET A 1  361 ? 101.377 110.744 143.983 1.00 172.47 ? 1026 MET O O     1 
ATOM   2444  C  CB    . MET A 1  361 ? 102.828 112.034 145.958 1.00 144.85 ? 1026 MET O CB    1 
ATOM   2445  C  CG    . MET A 1  361 ? 103.820 113.045 146.483 1.00 151.93 ? 1026 MET O CG    1 
ATOM   2446  S  SD    . MET A 1  361 ? 105.303 112.294 147.168 1.00 169.82 ? 1026 MET O SD    1 
ATOM   2447  C  CE    . MET A 1  361 ? 106.066 111.676 145.675 1.00 165.47 ? 1026 MET O CE    1 
ATOM   2448  N  N     . LEU A 1  362 ? 99.449  111.767 144.497 1.00 170.40 ? 1027 LEU O N     1 
ATOM   2449  C  CA    . LEU A 1  362 ? 98.688  110.880 143.629 1.00 175.36 ? 1027 LEU O CA    1 
ATOM   2450  C  C     . LEU A 1  362 ? 98.675  111.360 142.186 1.00 184.36 ? 1027 LEU O C     1 
ATOM   2451  O  O     . LEU A 1  362 ? 98.288  110.595 141.296 1.00 183.96 ? 1027 LEU O O     1 
ATOM   2452  C  CB    . LEU A 1  362 ? 97.258  110.708 144.146 1.00 164.56 ? 1027 LEU O CB    1 
ATOM   2453  C  CG    . LEU A 1  362 ? 97.125  109.923 145.457 1.00 164.56 ? 1027 LEU O CG    1 
ATOM   2454  C  CD1   . LEU A 1  362 ? 95.681  109.881 145.944 1.00 164.56 ? 1027 LEU O CD1   1 
ATOM   2455  C  CD2   . LEU A 1  362 ? 97.673  108.515 145.308 1.00 164.56 ? 1027 LEU O CD2   1 
ATOM   2456  N  N     . LYS A 1  363 ? 99.066  112.610 141.937 1.00 164.17 ? 1028 LYS O N     1 
ATOM   2457  C  CA    . LYS A 1  363 ? 99.441  113.022 140.590 1.00 164.14 ? 1028 LYS O CA    1 
ATOM   2458  C  C     . LYS A 1  363 ? 100.875 112.630 140.274 1.00 174.34 ? 1028 LYS O C     1 
ATOM   2459  O  O     . LYS A 1  363 ? 101.210 112.368 139.113 1.00 189.04 ? 1028 LYS O O     1 
ATOM   2460  C  CB    . LYS A 1  363 ? 99.303  114.533 140.440 1.00 179.29 ? 1028 LYS O CB    1 
ATOM   2461  C  CG    . LYS A 1  363 ? 97.911  115.060 140.622 1.00 179.29 ? 1028 LYS O CG    1 
ATOM   2462  C  CD    . LYS A 1  363 ? 97.941  116.559 140.511 1.00 179.29 ? 1028 LYS O CD    1 
ATOM   2463  C  CE    . LYS A 1  363 ? 98.883  117.127 141.550 1.00 179.29 ? 1028 LYS O CE    1 
ATOM   2464  N  NZ    . LYS A 1  363 ? 98.462  116.764 142.927 1.00 179.29 ? 1028 LYS O NZ    1 
ATOM   2465  N  N     . TYR A 1  364 ? 101.725 112.602 141.300 1.00 161.16 ? 1029 TYR O N     1 
ATOM   2466  C  CA    . TYR A 1  364 ? 103.159 112.443 141.116 1.00 161.70 ? 1029 TYR O CA    1 
ATOM   2467  C  C     . TYR A 1  364 ? 103.548 110.994 140.881 1.00 165.23 ? 1029 TYR O C     1 
ATOM   2468  O  O     . TYR A 1  364 ? 104.395 110.705 140.030 1.00 163.16 ? 1029 TYR O O     1 
ATOM   2469  C  CB    . TYR A 1  364 ? 103.890 112.986 142.341 1.00 154.30 ? 1029 TYR O CB    1 
ATOM   2470  C  CG    . TYR A 1  364 ? 103.659 114.452 142.548 1.00 154.30 ? 1029 TYR O CG    1 
ATOM   2471  C  CD1   . TYR A 1  364 ? 103.566 115.304 141.467 1.00 154.30 ? 1029 TYR O CD1   1 
ATOM   2472  C  CD2   . TYR A 1  364 ? 103.541 114.988 143.817 1.00 154.30 ? 1029 TYR O CD2   1 
ATOM   2473  C  CE1   . TYR A 1  364 ? 103.354 116.648 141.638 1.00 154.30 ? 1029 TYR O CE1   1 
ATOM   2474  C  CE2   . TYR A 1  364 ? 103.334 116.334 144.002 1.00 154.30 ? 1029 TYR O CE2   1 
ATOM   2475  C  CZ    . TYR A 1  364 ? 103.239 117.162 142.907 1.00 154.30 ? 1029 TYR O CZ    1 
ATOM   2476  O  OH    . TYR A 1  364 ? 103.036 118.514 143.060 1.00 154.30 ? 1029 TYR O OH    1 
ATOM   2477  N  N     . ARG A 1  365 ? 102.933 110.073 141.615 1.00 178.66 ? 1030 ARG O N     1 
ATOM   2478  C  CA    . ARG A 1  365 ? 103.459 108.717 141.672 1.00 173.42 ? 1030 ARG O CA    1 
ATOM   2479  C  C     . ARG A 1  365 ? 103.215 107.974 140.364 1.00 181.77 ? 1030 ARG O C     1 
ATOM   2480  O  O     . ARG A 1  365 ? 104.164 107.608 139.663 1.00 187.74 ? 1030 ARG O O     1 
ATOM   2481  C  CB    . ARG A 1  365 ? 102.864 107.980 142.878 1.00 181.78 ? 1030 ARG O CB    1 
ATOM   2482  C  CG    . ARG A 1  365 ? 101.346 107.882 142.930 1.00 181.78 ? 1030 ARG O CG    1 
ATOM   2483  C  CD    . ARG A 1  365 ? 100.906 107.242 144.222 1.00 181.78 ? 1030 ARG O CD    1 
ATOM   2484  N  NE    . ARG A 1  365 ? 101.404 105.878 144.355 1.00 181.78 ? 1030 ARG O NE    1 
ATOM   2485  C  CZ    . ARG A 1  365 ? 100.784 104.809 143.872 1.00 181.78 ? 1030 ARG O CZ    1 
ATOM   2486  N  NH1   . ARG A 1  365 ? 99.635  104.947 143.221 1.00 181.78 ? 1030 ARG O NH1   1 
ATOM   2487  N  NH2   . ARG A 1  365 ? 101.310 103.603 144.043 1.00 181.78 ? 1030 ARG O NH2   1 
ATOM   2488  N  N     . ARG A 1  366 ? 101.953 107.763 140.003 1.00 180.18 ? 1031 ARG O N     1 
ATOM   2489  C  CA    . ARG A 1  366 ? 101.610 106.896 138.886 1.00 186.69 ? 1031 ARG O CA    1 
ATOM   2490  C  C     . ARG A 1  366 ? 101.551 107.632 137.556 1.00 190.89 ? 1031 ARG O C     1 
ATOM   2491  O  O     . ARG A 1  366 ? 101.228 107.012 136.538 1.00 194.88 ? 1031 ARG O O     1 
ATOM   2492  C  CB    . ARG A 1  366 ? 100.267 106.199 139.150 1.00 190.35 ? 1031 ARG O CB    1 
ATOM   2493  C  CG    . ARG A 1  366 ? 99.070  107.138 139.292 1.00 190.35 ? 1031 ARG O CG    1 
ATOM   2494  C  CD    . ARG A 1  366 ? 97.763  106.351 139.442 1.00 190.35 ? 1031 ARG O CD    1 
ATOM   2495  N  NE    . ARG A 1  366 ? 96.580  107.212 139.448 1.00 190.35 ? 1031 ARG O NE    1 
ATOM   2496  C  CZ    . ARG A 1  366 ? 95.337  106.769 139.604 1.00 190.35 ? 1031 ARG O CZ    1 
ATOM   2497  N  NH1   . ARG A 1  366 ? 95.108  105.474 139.772 1.00 190.35 ? 1031 ARG O NH1   1 
ATOM   2498  N  NH2   . ARG A 1  366 ? 94.322  107.619 139.593 1.00 190.35 ? 1031 ARG O NH2   1 
ATOM   2499  N  N     . LEU A 1  367 ? 101.859 108.923 137.533 1.00 184.40 ? 1032 LEU O N     1 
ATOM   2500  C  CA    . LEU A 1  367 ? 101.719 109.698 136.309 1.00 188.42 ? 1032 LEU O CA    1 
ATOM   2501  C  C     . LEU A 1  367 ? 103.001 110.452 135.965 1.00 198.47 ? 1032 LEU O C     1 
ATOM   2502  O  O     . LEU A 1  367 ? 103.118 111.032 134.885 1.00 209.02 ? 1032 LEU O O     1 
ATOM   2503  C  CB    . LEU A 1  367 ? 100.551 110.672 136.444 1.00 185.99 ? 1032 LEU O CB    1 
ATOM   2504  C  CG    . LEU A 1  367 ? 99.203  109.997 136.704 1.00 185.99 ? 1032 LEU O CG    1 
ATOM   2505  C  CD1   . LEU A 1  367 ? 98.119  111.032 136.945 1.00 185.99 ? 1032 LEU O CD1   1 
ATOM   2506  C  CD2   . LEU A 1  367 ? 98.828  109.061 135.562 1.00 185.99 ? 1032 LEU O CD2   1 
ATOM   2507  N  N     . GLY A 1  382 ? 102.963 114.554 130.654 1.00 30.00  ? 1047 GLY O N     1 
ATOM   2508  C  CA    . GLY A 1  382 ? 103.246 113.420 131.511 1.00 30.00  ? 1047 GLY O CA    1 
ATOM   2509  C  C     . GLY A 1  382 ? 104.429 113.659 132.429 1.00 30.00  ? 1047 GLY O C     1 
ATOM   2510  O  O     . GLY A 1  382 ? 105.491 114.095 131.986 1.00 30.00  ? 1047 GLY O O     1 
ATOM   2511  N  N     . PHE A 1  383 ? 104.232 113.388 133.717 1.00 30.00  ? 1048 PHE O N     1 
ATOM   2512  C  CA    . PHE A 1  383 ? 105.272 113.545 134.723 1.00 30.00  ? 1048 PHE O CA    1 
ATOM   2513  C  C     . PHE A 1  383 ? 106.212 112.343 134.720 1.00 30.00  ? 1048 PHE O C     1 
ATOM   2514  O  O     . PHE A 1  383 ? 105.841 111.237 134.320 1.00 30.00  ? 1048 PHE O O     1 
ATOM   2515  C  CB    . PHE A 1  383 ? 104.650 113.711 136.107 1.00 30.00  ? 1048 PHE O CB    1 
ATOM   2516  C  CG    . PHE A 1  383 ? 103.704 114.871 136.210 1.00 30.00  ? 1048 PHE O CG    1 
ATOM   2517  C  CD1   . PHE A 1  383 ? 104.179 116.153 136.403 1.00 30.00  ? 1048 PHE O CD1   1 
ATOM   2518  C  CD2   . PHE A 1  383 ? 102.336 114.674 136.127 1.00 30.00  ? 1048 PHE O CD2   1 
ATOM   2519  C  CE1   . PHE A 1  383 ? 103.311 117.216 136.503 1.00 30.00  ? 1048 PHE O CE1   1 
ATOM   2520  C  CE2   . PHE A 1  383 ? 101.464 115.730 136.224 1.00 30.00  ? 1048 PHE O CE2   1 
ATOM   2521  C  CZ    . PHE A 1  383 ? 101.950 117.003 136.414 1.00 30.00  ? 1048 PHE O CZ    1 
ATOM   2522  N  N     . ASN A 1  384 ? 107.429 112.561 135.217 1.00 30.00  ? 1049 ASN O N     1 
ATOM   2523  C  CA    . ASN A 1  384 ? 108.422 111.494 135.289 1.00 30.00  ? 1049 ASN O CA    1 
ATOM   2524  C  C     . ASN A 1  384 ? 109.648 112.014 136.027 1.00 30.00  ? 1049 ASN O C     1 
ATOM   2525  O  O     . ASN A 1  384 ? 109.890 113.222 136.080 1.00 30.00  ? 1049 ASN O O     1 
ATOM   2526  C  CB    . ASN A 1  384 ? 108.809 110.993 133.892 1.00 30.00  ? 1049 ASN O CB    1 
ATOM   2527  C  CG    . ASN A 1  384 ? 109.607 109.712 133.934 1.00 30.00  ? 1049 ASN O CG    1 
ATOM   2528  O  OD1   . ASN A 1  384 ? 109.477 108.920 134.866 1.00 30.00  ? 1049 ASN O OD1   1 
ATOM   2529  N  ND2   . ASN A 1  384 ? 110.431 109.495 132.919 1.00 30.00  ? 1049 ASN O ND2   1 
ATOM   2530  N  N     . ASN A 1  385 ? 110.442 111.075 136.554 1.00 152.74 ? 1050 ASN O N     1 
ATOM   2531  C  CA    . ASN A 1  385 ? 111.433 111.378 137.583 1.00 153.29 ? 1050 ASN O CA    1 
ATOM   2532  C  C     . ASN A 1  385 ? 110.845 112.351 138.589 1.00 149.13 ? 1050 ASN O C     1 
ATOM   2533  O  O     . ASN A 1  385 ? 111.261 113.512 138.659 1.00 145.16 ? 1050 ASN O O     1 
ATOM   2534  C  CB    . ASN A 1  385 ? 112.725 111.937 136.989 1.00 151.43 ? 1050 ASN O CB    1 
ATOM   2535  C  CG    . ASN A 1  385 ? 113.601 110.858 136.386 1.00 151.43 ? 1050 ASN O CG    1 
ATOM   2536  O  OD1   . ASN A 1  385 ? 113.490 109.684 136.740 1.00 151.43 ? 1050 ASN O OD1   1 
ATOM   2537  N  ND2   . ASN A 1  385 ? 114.494 111.253 135.487 1.00 151.43 ? 1050 ASN O ND2   1 
ATOM   2538  N  N     . GLN A 1  386 ? 109.860 111.883 139.358 1.00 157.51 ? 1051 GLN O N     1 
ATOM   2539  C  CA    . GLN A 1  386 ? 109.140 112.768 140.262 1.00 152.43 ? 1051 GLN O CA    1 
ATOM   2540  C  C     . GLN A 1  386 ? 110.061 113.443 141.261 1.00 147.29 ? 1051 GLN O C     1 
ATOM   2541  O  O     . GLN A 1  386 ? 109.690 114.476 141.812 1.00 144.89 ? 1051 GLN O O     1 
ATOM   2542  C  CB    . GLN A 1  386 ? 108.051 112.003 141.010 1.00 154.79 ? 1051 GLN O CB    1 
ATOM   2543  C  CG    . GLN A 1  386 ? 108.570 110.940 141.957 1.00 154.79 ? 1051 GLN O CG    1 
ATOM   2544  C  CD    . GLN A 1  386 ? 107.451 110.225 142.681 1.00 154.79 ? 1051 GLN O CD    1 
ATOM   2545  O  OE1   . GLN A 1  386 ? 106.300 110.257 142.249 1.00 154.79 ? 1051 GLN O OE1   1 
ATOM   2546  N  NE2   . GLN A 1  386 ? 107.782 109.577 143.789 1.00 154.79 ? 1051 GLN O NE2   1 
ATOM   2547  N  N     . ILE A 1  387 ? 111.243 112.883 141.514 1.00 142.53 ? 1052 ILE O N     1 
ATOM   2548  C  CA    . ILE A 1  387 ? 112.234 113.582 142.325 1.00 142.53 ? 1052 ILE O CA    1 
ATOM   2549  C  C     . ILE A 1  387 ? 112.660 114.865 141.630 1.00 142.53 ? 1052 ILE O C     1 
ATOM   2550  O  O     . ILE A 1  387 ? 112.675 115.949 142.226 1.00 142.53 ? 1052 ILE O O     1 
ATOM   2551  C  CB    . ILE A 1  387 ? 113.440 112.669 142.591 1.00 149.74 ? 1052 ILE O CB    1 
ATOM   2552  C  CG1   . ILE A 1  387 ? 113.007 111.440 143.383 1.00 149.74 ? 1052 ILE O CG1   1 
ATOM   2553  C  CG2   . ILE A 1  387 ? 114.525 113.435 143.319 1.00 149.74 ? 1052 ILE O CG2   1 
ATOM   2554  C  CD1   . ILE A 1  387 ? 114.062 110.372 143.454 1.00 149.74 ? 1052 ILE O CD1   1 
ATOM   2555  N  N     . MET A 1  388 ? 113.024 114.752 140.352 1.00 144.27 ? 1053 MET O N     1 
ATOM   2556  C  CA    . MET A 1  388 ? 113.339 115.936 139.566 1.00 143.64 ? 1053 MET O CA    1 
ATOM   2557  C  C     . MET A 1  388 ? 112.150 116.877 139.511 1.00 139.19 ? 1053 MET O C     1 
ATOM   2558  O  O     . MET A 1  388 ? 112.312 118.099 139.573 1.00 134.01 ? 1053 MET O O     1 
ATOM   2559  C  CB    . MET A 1  388 ? 113.769 115.535 138.158 1.00 160.01 ? 1053 MET O CB    1 
ATOM   2560  C  CG    . MET A 1  388 ? 114.202 116.705 137.299 1.00 160.01 ? 1053 MET O CG    1 
ATOM   2561  S  SD    . MET A 1  388 ? 115.698 117.492 137.924 1.00 160.01 ? 1053 MET O SD    1 
ATOM   2562  C  CE    . MET A 1  388 ? 116.932 116.271 137.487 1.00 160.01 ? 1053 MET O CE    1 
ATOM   2563  N  N     . GLN A 1  389 ? 110.944 116.325 139.397 1.00 134.20 ? 1054 GLN O N     1 
ATOM   2564  C  CA    . GLN A 1  389 ? 109.757 117.157 139.519 1.00 138.88 ? 1054 GLN O CA    1 
ATOM   2565  C  C     . GLN A 1  389 ? 109.771 117.930 140.830 1.00 135.45 ? 1054 GLN O C     1 
ATOM   2566  O  O     . GLN A 1  389 ? 109.444 119.122 140.864 1.00 131.89 ? 1054 GLN O O     1 
ATOM   2567  C  CB    . GLN A 1  389 ? 108.500 116.298 139.427 1.00 154.49 ? 1054 GLN O CB    1 
ATOM   2568  C  CG    . GLN A 1  389 ? 108.255 115.652 138.078 1.00 157.15 ? 1054 GLN O CG    1 
ATOM   2569  C  CD    . GLN A 1  389 ? 108.111 116.666 136.962 1.00 155.73 ? 1054 GLN O CD    1 
ATOM   2570  O  OE1   . GLN A 1  389 ? 107.629 117.778 137.178 1.00 160.07 ? 1054 GLN O OE1   1 
ATOM   2571  N  NE2   . GLN A 1  389 ? 108.488 116.271 135.751 1.00 157.21 ? 1054 GLN O NE2   1 
ATOM   2572  N  N     . LEU A 1  390 ? 110.159 117.266 141.920 1.00 141.64 ? 1055 LEU O N     1 
ATOM   2573  C  CA    . LEU A 1  390 ? 110.196 117.922 143.220 1.00 138.69 ? 1055 LEU O CA    1 
ATOM   2574  C  C     . LEU A 1  390 ? 111.174 119.081 143.195 1.00 135.65 ? 1055 LEU O C     1 
ATOM   2575  O  O     . LEU A 1  390 ? 110.801 120.236 143.424 1.00 136.78 ? 1055 LEU O O     1 
ATOM   2576  C  CB    . LEU A 1  390 ? 110.593 116.922 144.305 1.00 145.00 ? 1055 LEU O CB    1 
ATOM   2577  C  CG    . LEU A 1  390 ? 109.717 115.693 144.515 1.00 154.88 ? 1055 LEU O CG    1 
ATOM   2578  C  CD1   . LEU A 1  390 ? 110.320 114.782 145.557 1.00 152.71 ? 1055 LEU O CD1   1 
ATOM   2579  C  CD2   . LEU A 1  390 ? 108.315 116.073 144.888 1.00 153.28 ? 1055 LEU O CD2   1 
ATOM   2580  N  N     . LYS A 1  391 ? 112.434 118.786 142.882 1.00 146.65 ? 1056 LYS O N     1 
ATOM   2581  C  CA    . LYS A 1  391 ? 113.445 119.828 142.833 1.00 149.98 ? 1056 LYS O CA    1 
ATOM   2582  C  C     . LYS A 1  391 ? 113.013 120.976 141.936 1.00 145.74 ? 1056 LYS O C     1 
ATOM   2583  O  O     . LYS A 1  391 ? 113.364 122.132 142.193 1.00 144.59 ? 1056 LYS O O     1 
ATOM   2584  C  CB    . LYS A 1  391 ? 114.764 119.226 142.363 1.00 147.94 ? 1056 LYS O CB    1 
ATOM   2585  C  CG    . LYS A 1  391 ? 115.915 120.192 142.354 1.00 147.94 ? 1056 LYS O CG    1 
ATOM   2586  C  CD    . LYS A 1  391 ? 117.189 119.488 141.956 1.00 147.94 ? 1056 LYS O CD    1 
ATOM   2587  C  CE    . LYS A 1  391 ? 118.336 120.470 141.845 1.00 147.94 ? 1056 LYS O CE    1 
ATOM   2588  N  NZ    . LYS A 1  391 ? 119.600 119.785 141.463 1.00 147.94 ? 1056 LYS O NZ    1 
ATOM   2589  N  N     . LYS A 1  392 ? 112.230 120.685 140.895 1.00 136.26 ? 1057 LYS O N     1 
ATOM   2590  C  CA    . LYS A 1  392 ? 111.632 121.755 140.108 1.00 137.51 ? 1057 LYS O CA    1 
ATOM   2591  C  C     . LYS A 1  392 ? 110.652 122.564 140.942 1.00 131.96 ? 1057 LYS O C     1 
ATOM   2592  O  O     . LYS A 1  392 ? 110.657 123.798 140.903 1.00 134.36 ? 1057 LYS O O     1 
ATOM   2593  C  CB    . LYS A 1  392 ? 110.922 121.192 138.883 1.00 103.22 ? 1057 LYS O CB    1 
ATOM   2594  C  CG    . LYS A 1  392 ? 111.816 120.641 137.806 1.00 113.04 ? 1057 LYS O CG    1 
ATOM   2595  C  CD    . LYS A 1  392 ? 110.961 120.095 136.683 1.00 117.82 ? 1057 LYS O CD    1 
ATOM   2596  C  CE    . LYS A 1  392 ? 111.799 119.575 135.551 1.00 131.75 ? 1057 LYS O CE    1 
ATOM   2597  N  NZ    . LYS A 1  392 ? 110.939 119.004 134.486 1.00 136.45 ? 1057 LYS O NZ    1 
ATOM   2598  N  N     . ILE A 1  393 ? 109.775 121.883 141.683 1.00 132.35 ? 1058 ILE O N     1 
ATOM   2599  C  CA    . ILE A 1  393 ? 108.800 122.592 142.507 1.00 134.74 ? 1058 ILE O CA    1 
ATOM   2600  C  C     . ILE A 1  393 ? 109.313 122.873 143.909 1.00 135.56 ? 1058 ILE O C     1 
ATOM   2601  O  O     . ILE A 1  393 ? 108.710 123.683 144.628 1.00 132.61 ? 1058 ILE O O     1 
ATOM   2602  C  CB    . ILE A 1  393 ? 107.480 121.803 142.562 1.00 142.85 ? 1058 ILE O CB    1 
ATOM   2603  C  CG1   . ILE A 1  393 ? 107.699 120.442 143.209 1.00 142.85 ? 1058 ILE O CG1   1 
ATOM   2604  C  CG2   . ILE A 1  393 ? 106.931 121.620 141.163 1.00 142.85 ? 1058 ILE O CG2   1 
ATOM   2605  C  CD1   . ILE A 1  393 ? 106.427 119.677 143.430 1.00 142.85 ? 1058 ILE O CD1   1 
ATOM   2606  N  N     . CYS A 1  394 ? 110.410 122.238 144.319 1.00 132.44 ? 1059 CYS O N     1 
ATOM   2607  C  CA    . CYS A 1  394 ? 111.106 122.680 145.519 1.00 130.88 ? 1059 CYS O CA    1 
ATOM   2608  C  C     . CYS A 1  394 ? 111.511 124.135 145.386 1.00 131.02 ? 1059 CYS O C     1 
ATOM   2609  O  O     . CYS A 1  394 ? 111.222 124.960 146.257 1.00 135.01 ? 1059 CYS O O     1 
ATOM   2610  C  CB    . CYS A 1  394 ? 112.342 121.818 145.764 1.00 145.44 ? 1059 CYS O CB    1 
ATOM   2611  S  SG    . CYS A 1  394 ? 112.017 120.115 146.213 1.00 149.06 ? 1059 CYS O SG    1 
ATOM   2612  N  N     . ASN A 1  395 ? 112.189 124.464 144.293 1.00 123.66 ? 1060 ASN O N     1 
ATOM   2613  C  CA    . ASN A 1  395 ? 112.657 125.826 144.100 1.00 132.43 ? 1060 ASN O CA    1 
ATOM   2614  C  C     . ASN A 1  395 ? 111.488 126.777 143.920 1.00 137.66 ? 1060 ASN O C     1 
ATOM   2615  O  O     . ASN A 1  395 ? 111.324 127.727 144.693 1.00 132.75 ? 1060 ASN O O     1 
ATOM   2616  C  CB    . ASN A 1  395 ? 113.582 125.885 142.891 1.00 117.99 ? 1060 ASN O CB    1 
ATOM   2617  C  CG    . ASN A 1  395 ? 114.827 125.070 143.087 1.00 132.24 ? 1060 ASN O CG    1 
ATOM   2618  O  OD1   . ASN A 1  395 ? 115.213 124.774 144.216 1.00 134.79 ? 1060 ASN O OD1   1 
ATOM   2619  N  ND2   . ASN A 1  395 ? 115.470 124.701 141.990 1.00 126.70 ? 1060 ASN O ND2   1 
ATOM   2620  N  N     . HIS A 1  396 ? 110.635 126.511 142.930 1.00 131.06 ? 1061 HIS O N     1 
ATOM   2621  C  CA    . HIS A 1  396 ? 109.671 127.525 142.533 1.00 130.34 ? 1061 HIS O CA    1 
ATOM   2622  C  C     . HIS A 1  396 ? 108.714 127.084 141.432 1.00 137.72 ? 1061 HIS O C     1 
ATOM   2623  O  O     . HIS A 1  396 ? 109.114 126.394 140.487 1.00 137.30 ? 1061 HIS O O     1 
ATOM   2624  C  CB    . HIS A 1  396 ? 110.416 128.775 142.077 1.00 138.19 ? 1061 HIS O CB    1 
ATOM   2625  C  CG    . HIS A 1  396 ? 109.519 129.881 141.640 1.00 138.19 ? 1061 HIS O CG    1 
ATOM   2626  N  ND1   . HIS A 1  396 ? 108.529 130.396 142.445 1.00 138.19 ? 1061 HIS O ND1   1 
ATOM   2627  C  CD2   . HIS A 1  396 ? 109.490 130.604 140.499 1.00 138.19 ? 1061 HIS O CD2   1 
ATOM   2628  C  CE1   . HIS A 1  396 ? 107.903 131.365 141.804 1.00 138.19 ? 1061 HIS O CE1   1 
ATOM   2629  N  NE2   . HIS A 1  396 ? 108.467 131.511 140.620 1.00 138.19 ? 1061 HIS O NE2   1 
ATOM   2630  N  N     . PRO A 1  397 ? 107.442 127.469 141.529 1.00 141.60 ? 1062 PRO O N     1 
ATOM   2631  C  CA    . PRO A 1  397 ? 106.514 127.315 140.402 1.00 141.60 ? 1062 PRO O CA    1 
ATOM   2632  C  C     . PRO A 1  397 ? 106.804 128.291 139.280 1.00 141.60 ? 1062 PRO O C     1 
ATOM   2633  O  O     . PRO A 1  397 ? 107.907 128.828 139.186 1.00 141.60 ? 1062 PRO O O     1 
ATOM   2634  C  CB    . PRO A 1  397 ? 105.145 127.580 141.035 1.00 143.24 ? 1062 PRO O CB    1 
ATOM   2635  C  CG    . PRO A 1  397 ? 105.444 128.447 142.181 1.00 143.24 ? 1062 PRO O CG    1 
ATOM   2636  C  CD    . PRO A 1  397 ? 106.738 127.924 142.737 1.00 143.24 ? 1062 PRO O CD    1 
ATOM   2637  N  N     . PHE A 1  398 ? 105.841 128.459 138.383 1.00 138.57 ? 1063 PHE O N     1 
ATOM   2638  C  CA    . PHE A 1  398 ? 106.001 129.221 137.150 1.00 146.37 ? 1063 PHE O CA    1 
ATOM   2639  C  C     . PHE A 1  398 ? 107.011 128.567 136.224 1.00 145.82 ? 1063 PHE O C     1 
ATOM   2640  O  O     . PHE A 1  398 ? 107.565 129.224 135.339 1.00 150.14 ? 1063 PHE O O     1 
ATOM   2641  C  CB    . PHE A 1  398 ? 106.417 130.674 137.411 1.00 148.42 ? 1063 PHE O CB    1 
ATOM   2642  C  CG    . PHE A 1  398 ? 105.416 131.474 138.192 1.00 144.59 ? 1063 PHE O CG    1 
ATOM   2643  C  CD1   . PHE A 1  398 ? 104.304 132.014 137.574 1.00 146.32 ? 1063 PHE O CD1   1 
ATOM   2644  C  CD2   . PHE A 1  398 ? 105.617 131.729 139.539 1.00 146.15 ? 1063 PHE O CD2   1 
ATOM   2645  C  CE1   . PHE A 1  398 ? 103.396 132.766 138.296 1.00 145.07 ? 1063 PHE O CE1   1 
ATOM   2646  C  CE2   . PHE A 1  398 ? 104.718 132.483 140.267 1.00 136.48 ? 1063 PHE O CE2   1 
ATOM   2647  C  CZ    . PHE A 1  398 ? 103.606 133.001 139.647 1.00 142.64 ? 1063 PHE O CZ    1 
ATOM   2648  N  N     . VAL A 1  399 ? 107.252 127.272 136.420 1.00 149.76 ? 1064 VAL O N     1 
ATOM   2649  C  CA    . VAL A 1  399 ? 108.040 126.509 135.464 1.00 155.18 ? 1064 VAL O CA    1 
ATOM   2650  C  C     . VAL A 1  399 ? 107.176 126.147 134.270 1.00 145.46 ? 1064 VAL O C     1 
ATOM   2651  O  O     . VAL A 1  399 ? 107.683 125.933 133.163 1.00 155.53 ? 1064 VAL O O     1 
ATOM   2652  C  CB    . VAL A 1  399 ? 108.635 125.261 136.141 1.00 131.65 ? 1064 VAL O CB    1 
ATOM   2653  C  CG1   . VAL A 1  399 ? 109.359 124.389 135.138 1.00 148.41 ? 1064 VAL O CG1   1 
ATOM   2654  C  CG2   . VAL A 1  399 ? 109.578 125.665 137.259 1.00 129.76 ? 1064 VAL O CG2   1 
ATOM   2655  N  N     . PHE A 1  400 ? 105.864 126.114 134.459 1.00 191.66 ? 1065 PHE O N     1 
ATOM   2656  C  CA    . PHE A 1  400 ? 104.943 125.682 133.425 1.00 196.12 ? 1065 PHE O CA    1 
ATOM   2657  C  C     . PHE A 1  400 ? 103.889 126.757 133.238 1.00 194.67 ? 1065 PHE O C     1 
ATOM   2658  O  O     . PHE A 1  400 ? 103.428 127.360 134.213 1.00 191.81 ? 1065 PHE O O     1 
ATOM   2659  C  CB    . PHE A 1  400 ? 104.323 124.359 133.809 1.00 191.11 ? 1065 PHE O CB    1 
ATOM   2660  C  CG    . PHE A 1  400 ? 105.339 123.322 134.151 1.00 191.94 ? 1065 PHE O CG    1 
ATOM   2661  C  CD1   . PHE A 1  400 ? 105.959 122.593 133.159 1.00 194.56 ? 1065 PHE O CD1   1 
ATOM   2662  C  CD2   . PHE A 1  400 ? 105.708 123.111 135.469 1.00 193.37 ? 1065 PHE O CD2   1 
ATOM   2663  C  CE1   . PHE A 1  400 ? 106.908 121.653 133.473 1.00 193.10 ? 1065 PHE O CE1   1 
ATOM   2664  C  CE2   . PHE A 1  400 ? 106.654 122.172 135.789 1.00 193.84 ? 1065 PHE O CE2   1 
ATOM   2665  C  CZ    . PHE A 1  400 ? 107.258 121.442 134.790 1.00 192.18 ? 1065 PHE O CZ    1 
ATOM   2666  N  N     . GLU A 1  401 ? 103.524 126.994 131.977 1.00 198.17 ? 1066 GLU O N     1 
ATOM   2667  C  CA    . GLU A 1  401 ? 102.691 128.141 131.629 1.00 202.41 ? 1066 GLU O CA    1 
ATOM   2668  C  C     . GLU A 1  401 ? 101.415 128.196 132.456 1.00 206.33 ? 1066 GLU O C     1 
ATOM   2669  O  O     . GLU A 1  401 ? 100.975 129.278 132.858 1.00 191.80 ? 1066 GLU O O     1 
ATOM   2670  C  CB    . GLU A 1  401 ? 102.360 128.094 130.139 1.00 195.29 ? 1066 GLU O CB    1 
ATOM   2671  C  CG    . GLU A 1  401 ? 103.551 128.349 129.237 1.00 195.29 ? 1066 GLU O CG    1 
ATOM   2672  C  CD    . GLU A 1  401 ? 104.500 127.172 129.156 1.00 195.29 ? 1066 GLU O CD    1 
ATOM   2673  O  OE1   . GLU A 1  401 ? 104.300 126.183 129.892 1.00 195.29 ? 1066 GLU O OE1   1 
ATOM   2674  O  OE2   . GLU A 1  401 ? 105.451 127.239 128.352 1.00 195.29 ? 1066 GLU O OE2   1 
ATOM   2675  N  N     . GLU A 1  402 ? 100.817 127.037 132.736 1.00 193.51 ? 1067 GLU O N     1 
ATOM   2676  C  CA    . GLU A 1  402 ? 99.526  127.037 133.412 1.00 188.35 ? 1067 GLU O CA    1 
ATOM   2677  C  C     . GLU A 1  402 ? 99.614  127.655 134.797 1.00 192.65 ? 1067 GLU O C     1 
ATOM   2678  O  O     . GLU A 1  402 ? 98.659  128.306 135.236 1.00 199.08 ? 1067 GLU O O     1 
ATOM   2679  C  CB    . GLU A 1  402 ? 98.955  125.622 133.475 1.00 148.17 ? 1067 GLU O CB    1 
ATOM   2680  C  CG    . GLU A 1  402 ? 99.738  124.642 134.315 1.00 173.85 ? 1067 GLU O CG    1 
ATOM   2681  C  CD    . GLU A 1  402 ? 100.950 124.106 133.587 1.00 195.45 ? 1067 GLU O CD    1 
ATOM   2682  O  OE1   . GLU A 1  402 ? 101.300 124.642 132.517 1.00 195.54 ? 1067 GLU O OE1   1 
ATOM   2683  O  OE2   . GLU A 1  402 ? 101.535 123.118 134.065 1.00 202.82 ? 1067 GLU O OE2   1 
ATOM   2684  N  N     . VAL A 1  403 ? 100.753 127.506 135.479 1.00 174.25 ? 1068 VAL O N     1 
ATOM   2685  C  CA    . VAL A 1  403 ? 100.931 128.158 136.775 1.00 175.19 ? 1068 VAL O CA    1 
ATOM   2686  C  C     . VAL A 1  403 ? 100.562 129.629 136.658 1.00 176.32 ? 1068 VAL O C     1 
ATOM   2687  O  O     . VAL A 1  403 ? 99.640  130.124 137.319 1.00 169.90 ? 1068 VAL O O     1 
ATOM   2688  C  CB    . VAL A 1  403 ? 102.379 127.997 137.268 1.00 170.28 ? 1068 VAL O CB    1 
ATOM   2689  C  CG1   . VAL A 1  403 ? 102.569 128.735 138.584 1.00 173.10 ? 1068 VAL O CG1   1 
ATOM   2690  C  CG2   . VAL A 1  403 ? 102.748 126.527 137.400 1.00 164.07 ? 1068 VAL O CG2   1 
ATOM   2691  N  N     . GLU A 1  404 ? 101.236 130.327 135.750 1.00 183.57 ? 1069 GLU O N     1 
ATOM   2692  C  CA    . GLU A 1  404 ? 100.890 131.710 135.464 1.00 188.67 ? 1069 GLU O CA    1 
ATOM   2693  C  C     . GLU A 1  404 ? 99.483  131.848 134.899 1.00 191.17 ? 1069 GLU O C     1 
ATOM   2694  O  O     . GLU A 1  404 ? 98.864  132.904 135.055 1.00 187.62 ? 1069 GLU O O     1 
ATOM   2695  C  CB    . GLU A 1  404 ? 101.925 132.291 134.501 1.00 159.74 ? 1069 GLU O CB    1 
ATOM   2696  C  CG    . GLU A 1  404 ? 101.681 133.719 134.061 1.00 181.18 ? 1069 GLU O CG    1 
ATOM   2697  C  CD    . GLU A 1  404 ? 100.736 133.829 132.869 1.00 199.75 ? 1069 GLU O CD    1 
ATOM   2698  O  OE1   . GLU A 1  404 ? 100.619 132.848 132.108 1.00 212.86 ? 1069 GLU O OE1   1 
ATOM   2699  O  OE2   . GLU A 1  404 ? 100.120 134.896 132.682 1.00 203.46 ? 1069 GLU O OE2   1 
ATOM   2700  N  N     . ASP A 1  405 ? 98.951  130.804 134.270 1.00 194.41 ? 1070 ASP O N     1 
ATOM   2701  C  CA    . ASP A 1  405 ? 97.676  130.942 133.582 1.00 203.80 ? 1070 ASP O CA    1 
ATOM   2702  C  C     . ASP A 1  405 ? 96.549  131.054 134.593 1.00 207.45 ? 1070 ASP O C     1 
ATOM   2703  O  O     . ASP A 1  405 ? 95.930  132.114 134.720 1.00 207.39 ? 1070 ASP O O     1 
ATOM   2704  C  CB    . ASP A 1  405 ? 97.436  129.760 132.647 1.00 212.15 ? 1070 ASP O CB    1 
ATOM   2705  C  CG    . ASP A 1  405 ? 98.420  129.720 131.502 1.00 212.15 ? 1070 ASP O CG    1 
ATOM   2706  O  OD1   . ASP A 1  405 ? 99.091  130.742 131.254 1.00 212.15 ? 1070 ASP O OD1   1 
ATOM   2707  O  OD2   . ASP A 1  405 ? 98.536  128.659 130.856 1.00 212.15 ? 1070 ASP O OD2   1 
ATOM   2708  N  N     . GLN A 1  406 ? 96.281  129.975 135.325 1.00 191.25 ? 1071 GLN O N     1 
ATOM   2709  C  CA    . GLN A 1  406 ? 95.235  130.031 136.331 1.00 194.00 ? 1071 GLN O CA    1 
ATOM   2710  C  C     . GLN A 1  406 ? 95.659  130.766 137.594 1.00 192.27 ? 1071 GLN O C     1 
ATOM   2711  O  O     . GLN A 1  406 ? 94.816  130.971 138.473 1.00 191.55 ? 1071 GLN O O     1 
ATOM   2712  C  CB    . GLN A 1  406 ? 94.744  128.629 136.710 1.00 173.94 ? 1071 GLN O CB    1 
ATOM   2713  C  CG    . GLN A 1  406 ? 95.765  127.716 137.383 1.00 179.41 ? 1071 GLN O CG    1 
ATOM   2714  C  CD    . GLN A 1  406 ? 96.536  126.868 136.394 1.00 201.49 ? 1071 GLN O CD    1 
ATOM   2715  O  OE1   . GLN A 1  406 ? 96.272  126.914 135.197 1.00 199.93 ? 1071 GLN O OE1   1 
ATOM   2716  N  NE2   . GLN A 1  406 ? 97.492  126.088 136.887 1.00 211.59 ? 1071 GLN O NE2   1 
ATOM   2717  N  N     . ILE A 1  407 ? 96.919  131.176 137.715 1.00 172.84 ? 1072 ILE O N     1 
ATOM   2718  C  CA    . ILE A 1  407 ? 97.400  131.864 138.909 1.00 164.45 ? 1072 ILE O CA    1 
ATOM   2719  C  C     . ILE A 1  407 ? 97.589  133.362 138.669 1.00 174.99 ? 1072 ILE O C     1 
ATOM   2720  O  O     . ILE A 1  407 ? 96.918  134.187 139.293 1.00 178.78 ? 1072 ILE O O     1 
ATOM   2721  C  CB    . ILE A 1  407 ? 98.684  131.207 139.453 1.00 165.21 ? 1072 ILE O CB    1 
ATOM   2722  C  CG1   . ILE A 1  407 ? 98.319  129.838 140.032 1.00 165.21 ? 1072 ILE O CG1   1 
ATOM   2723  C  CG2   . ILE A 1  407 ? 99.328  132.087 140.497 1.00 165.21 ? 1072 ILE O CG2   1 
ATOM   2724  C  CD1   . ILE A 1  407 ? 99.499  128.990 140.426 1.00 165.21 ? 1072 ILE O CD1   1 
ATOM   2725  N  N     . ASN A 1  408 ? 98.506  133.734 137.779 1.00 181.91 ? 1073 ASN O N     1 
ATOM   2726  C  CA    . ASN A 1  408 ? 98.796  135.138 137.481 1.00 187.81 ? 1073 ASN O CA    1 
ATOM   2727  C  C     . ASN A 1  408 ? 98.504  135.399 136.007 1.00 189.54 ? 1073 ASN O C     1 
ATOM   2728  O  O     . ASN A 1  408 ? 99.430  135.498 135.193 1.00 200.04 ? 1073 ASN O O     1 
ATOM   2729  C  CB    . ASN A 1  408 ? 100.240 135.491 137.820 1.00 187.94 ? 1073 ASN O CB    1 
ATOM   2730  C  CG    . ASN A 1  408 ? 100.533 136.971 137.663 1.00 188.70 ? 1073 ASN O CG    1 
ATOM   2731  O  OD1   . ASN A 1  408 ? 99.762  137.711 137.050 1.00 184.06 ? 1073 ASN O OD1   1 
ATOM   2732  N  ND2   . ASN A 1  408 ? 101.674 137.400 138.180 1.00 198.71 ? 1073 ASN O ND2   1 
ATOM   2733  N  N     . PRO A 1  409 ? 97.235  135.589 135.644 1.00 186.62 ? 1074 PRO O N     1 
ATOM   2734  C  CA    . PRO A 1  409 ? 96.856  135.627 134.220 1.00 192.98 ? 1074 PRO O CA    1 
ATOM   2735  C  C     . PRO A 1  409 ? 97.655  136.591 133.357 1.00 206.41 ? 1074 PRO O C     1 
ATOM   2736  O  O     . PRO A 1  409 ? 97.791  136.349 132.152 1.00 215.23 ? 1074 PRO O O     1 
ATOM   2737  C  CB    . PRO A 1  409 ? 95.379  136.040 134.276 1.00 190.87 ? 1074 PRO O CB    1 
ATOM   2738  C  CG    . PRO A 1  409 ? 94.908  135.589 135.613 1.00 196.89 ? 1074 PRO O CG    1 
ATOM   2739  C  CD    . PRO A 1  409 ? 96.077  135.770 136.535 1.00 194.18 ? 1074 PRO O CD    1 
ATOM   2740  N  N     . THR A 1  410 ? 98.164  137.686 133.913 1.00 204.89 ? 1075 THR O N     1 
ATOM   2741  C  CA    . THR A 1  410 ? 98.868  138.687 133.123 1.00 193.92 ? 1075 THR O CA    1 
ATOM   2742  C  C     . THR A 1  410 ? 100.386 138.560 133.174 1.00 195.65 ? 1075 THR O C     1 
ATOM   2743  O  O     . THR A 1  410 ? 101.073 139.369 132.545 1.00 197.22 ? 1075 THR O O     1 
ATOM   2744  C  CB    . THR A 1  410 ? 98.462  140.089 133.574 1.00 199.69 ? 1075 THR O CB    1 
ATOM   2745  O  OG1   . THR A 1  410 ? 98.699  140.224 134.980 1.00 199.69 ? 1075 THR O OG1   1 
ATOM   2746  C  CG2   . THR A 1  410 ? 96.998  140.335 133.281 1.00 199.69 ? 1075 THR O CG2   1 
ATOM   2747  N  N     . ARG A 1  411 ? 100.919 137.604 133.941 1.00 188.73 ? 1076 ARG O N     1 
ATOM   2748  C  CA    . ARG A 1  411 ? 102.363 137.336 134.065 1.00 188.94 ? 1076 ARG O CA    1 
ATOM   2749  C  C     . ARG A 1  411 ? 103.169 138.602 134.344 1.00 190.91 ? 1076 ARG O C     1 
ATOM   2750  O  O     . ARG A 1  411 ? 104.356 138.682 134.026 1.00 196.09 ? 1076 ARG O O     1 
ATOM   2751  C  CB    . ARG A 1  411 ? 102.927 136.601 132.838 1.00 168.85 ? 1076 ARG O CB    1 
ATOM   2752  C  CG    . ARG A 1  411 ? 102.903 137.329 131.505 1.00 168.85 ? 1076 ARG O CG    1 
ATOM   2753  C  CD    . ARG A 1  411 ? 103.465 136.456 130.394 1.00 168.85 ? 1076 ARG O CD    1 
ATOM   2754  N  NE    . ARG A 1  411 ? 104.900 136.210 130.525 1.00 168.85 ? 1076 ARG O NE    1 
ATOM   2755  C  CZ    . ARG A 1  411 ? 105.840 136.993 130.003 1.00 168.85 ? 1076 ARG O CZ    1 
ATOM   2756  N  NH1   . ARG A 1  411 ? 107.120 136.701 130.164 1.00 168.85 ? 1076 ARG O NH1   1 
ATOM   2757  N  NH2   . ARG A 1  411 ? 105.498 138.067 129.307 1.00 168.85 ? 1076 ARG O NH2   1 
ATOM   2758  N  N     . GLU A 1  412 ? 102.541 139.592 134.964 1.00 184.21 ? 1077 GLU O N     1 
ATOM   2759  C  CA    . GLU A 1  412 ? 103.234 140.810 135.345 1.00 188.88 ? 1077 GLU O CA    1 
ATOM   2760  C  C     . GLU A 1  412 ? 103.985 140.594 136.655 1.00 183.82 ? 1077 GLU O C     1 
ATOM   2761  O  O     . GLU A 1  412 ? 103.685 139.674 137.422 1.00 192.81 ? 1077 GLU O O     1 
ATOM   2762  C  CB    . GLU A 1  412 ? 102.245 141.968 135.468 1.00 193.48 ? 1077 GLU O CB    1 
ATOM   2763  C  CG    . GLU A 1  412 ? 101.207 141.785 136.564 1.00 193.48 ? 1077 GLU O CG    1 
ATOM   2764  C  CD    . GLU A 1  412 ? 100.120 142.847 136.527 1.00 193.48 ? 1077 GLU O CD    1 
ATOM   2765  O  OE1   . GLU A 1  412 ? 100.305 143.869 135.834 1.00 193.48 ? 1077 GLU O OE1   1 
ATOM   2766  O  OE2   . GLU A 1  412 ? 99.083  142.661 137.199 1.00 193.48 ? 1077 GLU O OE2   1 
ATOM   2767  N  N     . THR A 1  413 ? 105.002 141.425 136.888 1.00 177.37 ? 1078 THR O N     1 
ATOM   2768  C  CA    . THR A 1  413 ? 105.656 141.419 138.191 1.00 175.00 ? 1078 THR O CA    1 
ATOM   2769  C  C     . THR A 1  413 ? 104.604 141.653 139.257 1.00 179.90 ? 1078 THR O C     1 
ATOM   2770  O  O     . THR A 1  413 ? 103.887 142.656 139.228 1.00 191.88 ? 1078 THR O O     1 
ATOM   2771  C  CB    . THR A 1  413 ? 106.742 142.488 138.271 1.00 167.33 ? 1078 THR O CB    1 
ATOM   2772  O  OG1   . THR A 1  413 ? 106.171 143.773 137.993 1.00 167.33 ? 1078 THR O OG1   1 
ATOM   2773  C  CG2   . THR A 1  413 ? 107.865 142.191 137.287 1.00 167.33 ? 1078 THR O CG2   1 
ATOM   2774  N  N     . ASN A 1  414 ? 104.522 140.731 140.203 1.00 176.66 ? 1079 ASN O N     1 
ATOM   2775  C  CA    . ASN A 1  414 ? 103.300 140.577 140.965 1.00 178.34 ? 1079 ASN O CA    1 
ATOM   2776  C  C     . ASN A 1  414 ? 103.633 139.973 142.317 1.00 173.42 ? 1079 ASN O C     1 
ATOM   2777  O  O     . ASN A 1  414 ? 104.702 139.392 142.518 1.00 168.69 ? 1079 ASN O O     1 
ATOM   2778  C  CB    . ASN A 1  414 ? 102.308 139.700 140.191 1.00 189.68 ? 1079 ASN O CB    1 
ATOM   2779  C  CG    . ASN A 1  414 ? 100.940 139.640 140.829 1.00 195.23 ? 1079 ASN O CG    1 
ATOM   2780  O  OD1   . ASN A 1  414 ? 100.777 139.892 142.019 1.00 197.44 ? 1079 ASN O OD1   1 
ATOM   2781  N  ND2   . ASN A 1  414 ? 99.940  139.301 140.028 1.00 194.69 ? 1079 ASN O ND2   1 
ATOM   2782  N  N     . ASP A 1  415 ? 102.691 140.111 143.242 1.00 174.79 ? 1080 ASP O N     1 
ATOM   2783  C  CA    . ASP A 1  415 ? 102.850 139.465 144.526 1.00 175.41 ? 1080 ASP O CA    1 
ATOM   2784  C  C     . ASP A 1  415 ? 102.683 137.956 144.344 1.00 183.37 ? 1080 ASP O C     1 
ATOM   2785  O  O     . ASP A 1  415 ? 102.387 137.463 143.250 1.00 184.93 ? 1080 ASP O O     1 
ATOM   2786  C  CB    . ASP A 1  415 ? 101.837 140.037 145.523 1.00 165.56 ? 1080 ASP O CB    1 
ATOM   2787  C  CG    . ASP A 1  415 ? 102.061 139.545 146.936 1.00 169.70 ? 1080 ASP O CG    1 
ATOM   2788  O  OD1   . ASP A 1  415 ? 103.041 138.804 147.140 1.00 174.81 ? 1080 ASP O OD1   1 
ATOM   2789  O  OD2   . ASP A 1  415 ? 101.266 139.898 147.834 1.00 184.43 ? 1080 ASP O OD2   1 
ATOM   2790  N  N     . ASP A 1  416 ? 102.917 137.217 145.429 1.00 164.87 ? 1081 ASP O N     1 
ATOM   2791  C  CA    . ASP A 1  416 ? 102.909 135.757 145.436 1.00 169.23 ? 1081 ASP O CA    1 
ATOM   2792  C  C     . ASP A 1  416 ? 104.010 135.189 144.547 1.00 170.56 ? 1081 ASP O C     1 
ATOM   2793  O  O     . ASP A 1  416 ? 104.268 133.984 144.565 1.00 172.80 ? 1081 ASP O O     1 
ATOM   2794  C  CB    . ASP A 1  416 ? 101.537 135.212 145.036 1.00 160.45 ? 1081 ASP O CB    1 
ATOM   2795  C  CG    . ASP A 1  416 ? 100.508 135.396 146.130 1.00 160.45 ? 1081 ASP O CG    1 
ATOM   2796  O  OD1   . ASP A 1  416 ? 100.915 135.656 147.284 1.00 160.45 ? 1081 ASP O OD1   1 
ATOM   2797  O  OD2   . ASP A 1  416 ? 99.299  135.281 145.843 1.00 160.45 ? 1081 ASP O OD2   1 
ATOM   2798  N  N     . ILE A 1  417 ? 104.663 136.044 143.764 1.00 151.38 ? 1082 ILE O N     1 
ATOM   2799  C  CA    . ILE A 1  417 ? 105.954 135.677 143.203 1.00 142.66 ? 1082 ILE O CA    1 
ATOM   2800  C  C     . ILE A 1  417 ? 106.957 135.493 144.325 1.00 151.54 ? 1082 ILE O C     1 
ATOM   2801  O  O     . ILE A 1  417 ? 107.634 134.466 144.426 1.00 152.85 ? 1082 ILE O O     1 
ATOM   2802  C  CB    . ILE A 1  417 ? 106.422 136.742 142.199 1.00 138.76 ? 1082 ILE O CB    1 
ATOM   2803  C  CG1   . ILE A 1  417 ? 105.561 136.689 140.937 1.00 138.76 ? 1082 ILE O CG1   1 
ATOM   2804  C  CG2   . ILE A 1  417 ? 107.893 136.580 141.893 1.00 138.76 ? 1082 ILE O CG2   1 
ATOM   2805  C  CD1   . ILE A 1  417 ? 105.840 137.802 139.959 1.00 138.76 ? 1082 ILE O CD1   1 
ATOM   2806  N  N     . TRP A 1  418 ? 107.055 136.486 145.191 1.00 143.05 ? 1083 TRP O N     1 
ATOM   2807  C  CA    . TRP A 1  418 ? 107.904 136.400 146.362 1.00 147.10 ? 1083 TRP O CA    1 
ATOM   2808  C  C     . TRP A 1  418 ? 107.229 135.722 147.546 1.00 151.92 ? 1083 TRP O C     1 
ATOM   2809  O  O     . TRP A 1  418 ? 107.932 135.270 148.456 1.00 149.24 ? 1083 TRP O O     1 
ATOM   2810  C  CB    . TRP A 1  418 ? 108.364 137.803 146.752 1.00 141.91 ? 1083 TRP O CB    1 
ATOM   2811  C  CG    . TRP A 1  418 ? 107.227 138.721 146.976 1.00 153.59 ? 1083 TRP O CG    1 
ATOM   2812  C  CD1   . TRP A 1  418 ? 106.509 139.382 146.026 1.00 156.48 ? 1083 TRP O CD1   1 
ATOM   2813  C  CD2   . TRP A 1  418 ? 106.679 139.103 148.234 1.00 148.31 ? 1083 TRP O CD2   1 
ATOM   2814  N  NE1   . TRP A 1  418 ? 105.536 140.143 146.617 1.00 144.29 ? 1083 TRP O NE1   1 
ATOM   2815  C  CE2   . TRP A 1  418 ? 105.623 139.993 147.975 1.00 158.60 ? 1083 TRP O CE2   1 
ATOM   2816  C  CE3   . TRP A 1  418 ? 106.979 138.779 149.559 1.00 144.91 ? 1083 TRP O CE3   1 
ATOM   2817  C  CZ2   . TRP A 1  418 ? 104.864 140.559 148.990 1.00 153.92 ? 1083 TRP O CZ2   1 
ATOM   2818  C  CZ3   . TRP A 1  418 ? 106.225 139.343 150.565 1.00 142.74 ? 1083 TRP O CZ3   1 
ATOM   2819  C  CH2   . TRP A 1  418 ? 105.180 140.222 150.276 1.00 150.91 ? 1083 TRP O CH2   1 
ATOM   2820  N  N     . ARG A 1  419 ? 105.897 135.622 147.559 1.00 149.18 ? 1084 ARG O N     1 
ATOM   2821  C  CA    . ARG A 1  419 ? 105.199 134.959 148.657 1.00 150.18 ? 1084 ARG O CA    1 
ATOM   2822  C  C     . ARG A 1  419 ? 105.012 133.466 148.438 1.00 147.54 ? 1084 ARG O C     1 
ATOM   2823  O  O     . ARG A 1  419 ? 104.519 132.786 149.344 1.00 153.85 ? 1084 ARG O O     1 
ATOM   2824  C  CB    . ARG A 1  419 ? 103.814 135.576 148.908 1.00 132.86 ? 1084 ARG O CB    1 
ATOM   2825  C  CG    . ARG A 1  419 ? 103.790 136.955 149.532 1.00 134.86 ? 1084 ARG O CG    1 
ATOM   2826  C  CD    . ARG A 1  419 ? 102.343 137.423 149.696 1.00 131.43 ? 1084 ARG O CD    1 
ATOM   2827  N  NE    . ARG A 1  419 ? 101.604 136.691 150.722 1.00 139.42 ? 1084 ARG O NE    1 
ATOM   2828  C  CZ    . ARG A 1  419 ? 101.493 137.088 151.988 1.00 136.79 ? 1084 ARG O CZ    1 
ATOM   2829  N  NH1   . ARG A 1  419 ? 102.048 138.227 152.381 1.00 123.58 ? 1084 ARG O NH1   1 
ATOM   2830  N  NH2   . ARG A 1  419 ? 100.804 136.360 152.858 1.00 134.29 ? 1084 ARG O NH2   1 
ATOM   2831  N  N     . VAL A 1  420 ? 105.371 132.934 147.271 1.00 141.05 ? 1085 VAL O N     1 
ATOM   2832  C  CA    . VAL A 1  420 ? 105.105 131.523 147.021 1.00 141.19 ? 1085 VAL O CA    1 
ATOM   2833  C  C     . VAL A 1  420 ? 106.113 130.640 147.748 1.00 143.77 ? 1085 VAL O C     1 
ATOM   2834  O  O     . VAL A 1  420 ? 105.740 129.639 148.368 1.00 144.24 ? 1085 VAL O O     1 
ATOM   2835  C  CB    . VAL A 1  420 ? 105.065 131.234 145.510 1.00 127.73 ? 1085 VAL O CB    1 
ATOM   2836  C  CG1   . VAL A 1  420 ? 106.382 131.568 144.854 1.00 131.42 ? 1085 VAL O CG1   1 
ATOM   2837  C  CG2   . VAL A 1  420 ? 104.696 129.794 145.270 1.00 127.89 ? 1085 VAL O CG2   1 
ATOM   2838  N  N     . ALA A 1  421 ? 107.390 130.995 147.716 1.00 128.80 ? 1086 ALA O N     1 
ATOM   2839  C  CA    . ALA A 1  421 ? 108.415 130.163 148.323 1.00 134.26 ? 1086 ALA O CA    1 
ATOM   2840  C  C     . ALA A 1  421 ? 109.022 130.877 149.521 1.00 132.39 ? 1086 ALA O C     1 
ATOM   2841  O  O     . ALA A 1  421 ? 108.713 132.035 149.814 1.00 134.16 ? 1086 ALA O O     1 
ATOM   2842  C  CB    . ALA A 1  421 ? 109.490 129.802 147.298 1.00 118.55 ? 1086 ALA O CB    1 
ATOM   2843  N  N     . GLY A 1  422 ? 109.900 130.167 150.219 1.00 127.87 ? 1087 GLY O N     1 
ATOM   2844  C  CA    . GLY A 1  422 ? 110.623 130.748 151.330 1.00 123.67 ? 1087 GLY O CA    1 
ATOM   2845  C  C     . GLY A 1  422 ? 111.910 131.384 150.862 1.00 127.59 ? 1087 GLY O C     1 
ATOM   2846  O  O     . GLY A 1  422 ? 112.411 132.333 151.468 1.00 139.64 ? 1087 GLY O O     1 
ATOM   2847  N  N     . LYS A 1  423 ? 112.452 130.859 149.765 1.00 120.70 ? 1088 LYS O N     1 
ATOM   2848  C  CA    . LYS A 1  423 ? 113.647 131.455 149.189 1.00 125.61 ? 1088 LYS O CA    1 
ATOM   2849  C  C     . LYS A 1  423 ? 113.358 132.857 148.682 1.00 131.53 ? 1088 LYS O C     1 
ATOM   2850  O  O     . LYS A 1  423 ? 114.196 133.754 148.804 1.00 131.42 ? 1088 LYS O O     1 
ATOM   2851  C  CB    . LYS A 1  423 ? 114.173 130.575 148.063 1.00 103.05 ? 1088 LYS O CB    1 
ATOM   2852  C  CG    . LYS A 1  423 ? 114.652 129.223 148.527 1.00 103.18 ? 1088 LYS O CG    1 
ATOM   2853  C  CD    . LYS A 1  423 ? 114.987 128.341 147.341 1.00 103.20 ? 1088 LYS O CD    1 
ATOM   2854  C  CE    . LYS A 1  423 ? 115.434 126.961 147.783 1.00 101.84 ? 1088 LYS O CE    1 
ATOM   2855  N  NZ    . LYS A 1  423 ? 115.624 126.057 146.616 1.00 104.04 ? 1088 LYS O NZ    1 
ATOM   2856  N  N     . PHE A 1  424 ? 112.177 133.064 148.106 1.00 141.21 ? 1089 PHE O N     1 
ATOM   2857  C  CA    . PHE A 1  424 ? 111.819 134.390 147.624 1.00 147.41 ? 1089 PHE O CA    1 
ATOM   2858  C  C     . PHE A 1  424 ? 111.324 135.292 148.742 1.00 142.98 ? 1089 PHE O C     1 
ATOM   2859  O  O     . PHE A 1  424 ? 111.519 136.510 148.683 1.00 144.11 ? 1089 PHE O O     1 
ATOM   2860  C  CB    . PHE A 1  424 ? 110.763 134.282 146.529 1.00 139.82 ? 1089 PHE O CB    1 
ATOM   2861  C  CG    . PHE A 1  424 ? 111.252 133.610 145.290 1.00 135.53 ? 1089 PHE O CG    1 
ATOM   2862  C  CD1   . PHE A 1  424 ? 112.605 133.484 145.048 1.00 141.45 ? 1089 PHE O CD1   1 
ATOM   2863  C  CD2   . PHE A 1  424 ? 110.364 133.110 144.363 1.00 137.38 ? 1089 PHE O CD2   1 
ATOM   2864  C  CE1   . PHE A 1  424 ? 113.060 132.866 143.907 1.00 143.30 ? 1089 PHE O CE1   1 
ATOM   2865  C  CE2   . PHE A 1  424 ? 110.814 132.495 143.220 1.00 135.32 ? 1089 PHE O CE2   1 
ATOM   2866  C  CZ    . PHE A 1  424 ? 112.163 132.371 142.991 1.00 143.25 ? 1089 PHE O CZ    1 
ATOM   2867  N  N     . GLU A 1  425 ? 110.685 134.723 149.760 1.00 142.82 ? 1090 GLU O N     1 
ATOM   2868  C  CA    . GLU A 1  425 ? 110.190 135.546 150.854 1.00 146.97 ? 1090 GLU O CA    1 
ATOM   2869  C  C     . GLU A 1  425 ? 111.348 136.002 151.731 1.00 155.65 ? 1090 GLU O C     1 
ATOM   2870  O  O     . GLU A 1  425 ? 111.600 137.203 151.878 1.00 156.46 ? 1090 GLU O O     1 
ATOM   2871  C  CB    . GLU A 1  425 ? 109.142 134.773 151.660 1.00 140.56 ? 1090 GLU O CB    1 
ATOM   2872  C  CG    . GLU A 1  425 ? 108.424 135.603 152.723 1.00 144.95 ? 1090 GLU O CG    1 
ATOM   2873  C  CD    . GLU A 1  425 ? 109.220 135.738 154.002 1.00 157.90 ? 1090 GLU O CD    1 
ATOM   2874  O  OE1   . GLU A 1  425 ? 110.019 134.828 154.291 1.00 156.38 ? 1090 GLU O OE1   1 
ATOM   2875  O  OE2   . GLU A 1  425 ? 109.060 136.757 154.706 1.00 155.08 ? 1090 GLU O OE2   1 
ATOM   2876  N  N     . LEU A 1  426 ? 112.057 135.049 152.334 1.00 159.97 ? 1091 LEU O N     1 
ATOM   2877  C  CA    . LEU A 1  426 ? 113.268 135.384 153.069 1.00 162.56 ? 1091 LEU O CA    1 
ATOM   2878  C  C     . LEU A 1  426 ? 114.331 136.003 152.171 1.00 156.74 ? 1091 LEU O C     1 
ATOM   2879  O  O     . LEU A 1  426 ? 115.228 136.690 152.670 1.00 155.58 ? 1091 LEU O O     1 
ATOM   2880  C  CB    . LEU A 1  426 ? 113.807 134.140 153.773 1.00 157.61 ? 1091 LEU O CB    1 
ATOM   2881  C  CG    . LEU A 1  426 ? 112.862 133.614 154.860 1.00 163.44 ? 1091 LEU O CG    1 
ATOM   2882  C  CD1   . LEU A 1  426 ? 113.380 132.331 155.495 1.00 158.26 ? 1091 LEU O CD1   1 
ATOM   2883  C  CD2   . LEU A 1  426 ? 112.618 134.675 155.923 1.00 166.64 ? 1091 LEU O CD2   1 
ATOM   2884  N  N     . LEU A 1  427 ? 114.250 135.786 150.861 1.00 154.02 ? 1092 LEU O N     1 
ATOM   2885  C  CA    . LEU A 1  427 ? 115.133 136.504 149.952 1.00 152.00 ? 1092 LEU O CA    1 
ATOM   2886  C  C     . LEU A 1  427 ? 114.776 137.981 149.911 1.00 150.11 ? 1092 LEU O C     1 
ATOM   2887  O  O     . LEU A 1  427 ? 115.658 138.850 149.956 1.00 160.81 ? 1092 LEU O O     1 
ATOM   2888  C  CB    . LEU A 1  427 ? 115.057 135.888 148.564 1.00 136.59 ? 1092 LEU O CB    1 
ATOM   2889  C  CG    . LEU A 1  427 ? 115.829 136.585 147.458 1.00 138.16 ? 1092 LEU O CG    1 
ATOM   2890  C  CD1   . LEU A 1  427 ? 117.289 136.705 147.832 1.00 132.65 ? 1092 LEU O CD1   1 
ATOM   2891  C  CD2   . LEU A 1  427 ? 115.682 135.758 146.202 1.00 138.24 ? 1092 LEU O CD2   1 
ATOM   2892  N  N     . ASP A 1  428 ? 113.480 138.285 149.818 1.00 163.18 ? 1093 ASP O N     1 
ATOM   2893  C  CA    . ASP A 1  428 ? 113.037 139.654 150.036 1.00 161.59 ? 1093 ASP O CA    1 
ATOM   2894  C  C     . ASP A 1  428 ? 113.564 140.168 151.363 1.00 165.55 ? 1093 ASP O C     1 
ATOM   2895  O  O     . ASP A 1  428 ? 114.041 141.303 151.456 1.00 168.54 ? 1093 ASP O O     1 
ATOM   2896  C  CB    . ASP A 1  428 ? 111.510 139.734 150.012 1.00 165.82 ? 1093 ASP O CB    1 
ATOM   2897  C  CG    . ASP A 1  428 ? 111.001 141.160 150.103 1.00 172.58 ? 1093 ASP O CG    1 
ATOM   2898  O  OD1   . ASP A 1  428 ? 111.818 142.096 149.984 1.00 173.88 ? 1093 ASP O OD1   1 
ATOM   2899  O  OD2   . ASP A 1  428 ? 109.787 141.349 150.324 1.00 175.37 ? 1093 ASP O OD2   1 
ATOM   2900  N  N     . ARG A 1  429 ? 113.506 139.329 152.396 1.00 168.16 ? 1094 ARG O N     1 
ATOM   2901  C  CA    . ARG A 1  429 ? 113.966 139.743 153.713 1.00 176.35 ? 1094 ARG O CA    1 
ATOM   2902  C  C     . ARG A 1  429 ? 115.437 140.138 153.686 1.00 176.02 ? 1094 ARG O C     1 
ATOM   2903  O  O     . ARG A 1  429 ? 115.829 141.128 154.314 1.00 180.60 ? 1094 ARG O O     1 
ATOM   2904  C  CB    . ARG A 1  429 ? 113.723 138.624 154.723 1.00 160.48 ? 1094 ARG O CB    1 
ATOM   2905  C  CG    . ARG A 1  429 ? 112.257 138.263 154.932 1.00 164.04 ? 1094 ARG O CG    1 
ATOM   2906  C  CD    . ARG A 1  429 ? 111.517 139.297 155.766 1.00 164.16 ? 1094 ARG O CD    1 
ATOM   2907  N  NE    . ARG A 1  429 ? 112.047 139.374 157.124 1.00 160.79 ? 1094 ARG O NE    1 
ATOM   2908  C  CZ    . ARG A 1  429 ? 111.618 140.227 158.049 1.00 164.09 ? 1094 ARG O CZ    1 
ATOM   2909  N  NH1   . ARG A 1  429 ? 112.167 140.236 159.255 1.00 173.11 ? 1094 ARG O NH1   1 
ATOM   2910  N  NH2   . ARG A 1  429 ? 110.628 141.058 157.775 1.00 159.51 ? 1094 ARG O NH2   1 
ATOM   2911  N  N     . ILE A 1  430 ? 116.268 139.388 152.961 1.00 173.41 ? 1095 ILE O N     1 
ATOM   2912  C  CA    . ILE A 1  430 ? 117.694 139.699 152.978 1.00 174.37 ? 1095 ILE O CA    1 
ATOM   2913  C  C     . ILE A 1  430 ? 118.048 140.839 152.036 1.00 172.81 ? 1095 ILE O C     1 
ATOM   2914  O  O     . ILE A 1  430 ? 119.086 141.481 152.231 1.00 176.17 ? 1095 ILE O O     1 
ATOM   2915  C  CB    . ILE A 1  430 ? 118.558 138.472 152.647 1.00 169.06 ? 1095 ILE O CB    1 
ATOM   2916  C  CG1   . ILE A 1  430 ? 118.284 137.973 151.236 1.00 172.11 ? 1095 ILE O CG1   1 
ATOM   2917  C  CG2   . ILE A 1  430 ? 118.307 137.361 153.641 1.00 166.55 ? 1095 ILE O CG2   1 
ATOM   2918  C  CD1   . ILE A 1  430 ? 119.221 136.879 150.818 1.00 177.74 ? 1095 ILE O CD1   1 
ATOM   2919  N  N     . LEU A 1  431 ? 117.209 141.124 151.042 1.00 151.62 ? 1096 LEU O N     1 
ATOM   2920  C  CA    . LEU A 1  431 ? 117.467 142.230 150.119 1.00 151.26 ? 1096 LEU O CA    1 
ATOM   2921  C  C     . LEU A 1  431 ? 117.851 143.548 150.789 1.00 162.19 ? 1096 LEU O C     1 
ATOM   2922  O  O     . LEU A 1  431 ? 118.890 144.122 150.416 1.00 165.88 ? 1096 LEU O O     1 
ATOM   2923  C  CB    . LEU A 1  431 ? 116.237 142.424 149.227 1.00 154.06 ? 1096 LEU O CB    1 
ATOM   2924  C  CG    . LEU A 1  431 ? 116.352 143.663 148.348 1.00 155.25 ? 1096 LEU O CG    1 
ATOM   2925  C  CD1   . LEU A 1  431 ? 117.505 143.494 147.373 1.00 152.26 ? 1096 LEU O CD1   1 
ATOM   2926  C  CD2   . LEU A 1  431 ? 115.047 143.932 147.626 1.00 156.31 ? 1096 LEU O CD2   1 
ATOM   2927  N  N     . PRO A 1  432 ? 117.080 144.092 151.742 1.00 161.00 ? 1097 PRO O N     1 
ATOM   2928  C  CA    . PRO A 1  432 ? 117.440 145.407 152.292 1.00 166.91 ? 1097 PRO O CA    1 
ATOM   2929  C  C     . PRO A 1  432 ? 118.767 145.403 153.007 1.00 164.95 ? 1097 PRO O C     1 
ATOM   2930  O  O     . PRO A 1  432 ? 119.464 146.423 153.019 1.00 161.66 ? 1097 PRO O O     1 
ATOM   2931  C  CB    . PRO A 1  432 ? 116.287 145.702 153.260 1.00 159.12 ? 1097 PRO O CB    1 
ATOM   2932  C  CG    . PRO A 1  432 ? 115.176 144.913 152.751 1.00 159.04 ? 1097 PRO O CG    1 
ATOM   2933  C  CD    . PRO A 1  432 ? 115.812 143.630 152.328 1.00 156.65 ? 1097 PRO O CD    1 
ATOM   2934  N  N     . LYS A 1  433 ? 119.131 144.284 153.627 1.00 166.19 ? 1098 LYS O N     1 
ATOM   2935  C  CA    . LYS A 1  433 ? 120.466 144.167 154.191 1.00 168.85 ? 1098 LYS O CA    1 
ATOM   2936  C  C     . LYS A 1  433 ? 121.513 144.096 153.091 1.00 170.18 ? 1098 LYS O C     1 
ATOM   2937  O  O     . LYS A 1  433 ? 122.580 144.720 153.195 1.00 171.66 ? 1098 LYS O O     1 
ATOM   2938  C  CB    . LYS A 1  433 ? 120.523 142.945 155.103 1.00 164.69 ? 1098 LYS O CB    1 
ATOM   2939  C  CG    . LYS A 1  433 ? 119.750 143.146 156.397 1.00 163.90 ? 1098 LYS O CG    1 
ATOM   2940  C  CD    . LYS A 1  433 ? 119.783 141.924 157.282 1.00 162.27 ? 1098 LYS O CD    1 
ATOM   2941  C  CE    . LYS A 1  433 ? 118.911 140.827 156.721 1.00 162.20 ? 1098 LYS O CE    1 
ATOM   2942  N  NZ    . LYS A 1  433 ? 117.477 141.230 156.742 1.00 171.08 ? 1098 LYS O NZ    1 
ATOM   2943  N  N     . LEU A 1  434 ? 121.211 143.361 152.019 1.00 155.57 ? 1099 LEU O N     1 
ATOM   2944  C  CA    . LEU A 1  434 ? 122.085 143.262 150.860 1.00 154.88 ? 1099 LEU O CA    1 
ATOM   2945  C  C     . LEU A 1  434 ? 122.482 144.648 150.389 1.00 162.30 ? 1099 LEU O C     1 
ATOM   2946  O  O     . LEU A 1  434 ? 123.647 145.044 150.508 1.00 170.68 ? 1099 LEU O O     1 
ATOM   2947  C  CB    . LEU A 1  434 ? 121.401 142.518 149.712 1.00 152.66 ? 1099 LEU O CB    1 
ATOM   2948  C  CG    . LEU A 1  434 ? 120.967 141.072 149.914 1.00 152.66 ? 1099 LEU O CG    1 
ATOM   2949  C  CD1   . LEU A 1  434 ? 120.246 140.549 148.680 1.00 152.66 ? 1099 LEU O CD1   1 
ATOM   2950  C  CD2   . LEU A 1  434 ? 122.150 140.205 150.274 1.00 152.66 ? 1099 LEU O CD2   1 
ATOM   2951  N  N     . LYS A 1  435 ? 121.516 145.397 149.858 1.00 153.53 ? 1100 LYS O N     1 
ATOM   2952  C  CA    . LYS A 1  435 ? 121.844 146.730 149.375 1.00 153.78 ? 1100 LYS O CA    1 
ATOM   2953  C  C     . LYS A 1  435 ? 122.326 147.624 150.507 1.00 157.77 ? 1100 LYS O C     1 
ATOM   2954  O  O     . LYS A 1  435 ? 123.158 148.511 150.288 1.00 156.70 ? 1100 LYS O O     1 
ATOM   2955  C  CB    . LYS A 1  435 ? 120.639 147.352 148.675 1.00 130.67 ? 1100 LYS O CB    1 
ATOM   2956  C  CG    . LYS A 1  435 ? 120.895 148.764 148.175 1.00 141.76 ? 1100 LYS O CG    1 
ATOM   2957  C  CD    . LYS A 1  435 ? 122.095 148.799 147.241 1.00 155.73 ? 1100 LYS O CD    1 
ATOM   2958  C  CE    . LYS A 1  435 ? 122.153 150.101 146.466 1.00 161.10 ? 1100 LYS O CE    1 
ATOM   2959  N  NZ    . LYS A 1  435 ? 122.245 151.270 147.377 1.00 165.23 ? 1100 LYS O NZ    1 
ATOM   2960  N  N     . ALA A 1  436 ? 121.833 147.389 151.721 1.00 160.97 ? 1101 ALA O N     1 
ATOM   2961  C  CA    . ALA A 1  436 ? 122.167 148.205 152.878 1.00 159.63 ? 1101 ALA O CA    1 
ATOM   2962  C  C     . ALA A 1  436 ? 123.668 148.261 153.097 1.00 169.29 ? 1101 ALA O C     1 
ATOM   2963  O  O     . ALA A 1  436 ? 124.296 149.301 152.872 1.00 176.34 ? 1101 ALA O O     1 
ATOM   2964  C  CB    . ALA A 1  436 ? 121.488 147.658 154.132 1.00 159.59 ? 1101 ALA O CB    1 
ATOM   2965  N  N     . THR A 1  437 ? 124.252 147.143 153.523 1.00 166.92 ? 1102 THR O N     1 
ATOM   2966  C  CA    . THR A 1  437 ? 125.691 147.127 153.742 1.00 164.39 ? 1102 THR O CA    1 
ATOM   2967  C  C     . THR A 1  437 ? 126.472 147.132 152.440 1.00 165.57 ? 1102 THR O C     1 
ATOM   2968  O  O     . THR A 1  437 ? 127.689 147.345 152.467 1.00 168.05 ? 1102 THR O O     1 
ATOM   2969  C  CB    . THR A 1  437 ? 126.087 145.913 154.577 1.00 161.04 ? 1102 THR O CB    1 
ATOM   2970  O  OG1   . THR A 1  437 ? 125.692 144.718 153.893 1.00 161.14 ? 1102 THR O OG1   1 
ATOM   2971  C  CG2   . THR A 1  437 ? 125.411 145.966 155.937 1.00 163.28 ? 1102 THR O CG2   1 
ATOM   2972  N  N     . GLY A 1  438 ? 125.806 146.899 151.312 1.00 161.63 ? 1103 GLY O N     1 
ATOM   2973  C  CA    . GLY A 1  438 ? 126.443 146.949 150.018 1.00 156.22 ? 1103 GLY O CA    1 
ATOM   2974  C  C     . GLY A 1  438 ? 127.409 145.826 149.728 1.00 160.73 ? 1103 GLY O C     1 
ATOM   2975  O  O     . GLY A 1  438 ? 127.966 145.785 148.626 1.00 166.98 ? 1103 GLY O O     1 
ATOM   2976  N  N     . HIS A 1  439 ? 127.644 144.923 150.676 1.00 149.80 ? 1104 HIS O N     1 
ATOM   2977  C  CA    . HIS A 1  439 ? 128.508 143.783 150.408 1.00 151.03 ? 1104 HIS O CA    1 
ATOM   2978  C  C     . HIS A 1  439 ? 127.889 142.908 149.333 1.00 158.57 ? 1104 HIS O C     1 
ATOM   2979  O  O     . HIS A 1  439 ? 126.711 142.548 149.410 1.00 159.75 ? 1104 HIS O O     1 
ATOM   2980  C  CB    . HIS A 1  439 ? 128.729 142.979 151.680 1.00 156.02 ? 1104 HIS O CB    1 
ATOM   2981  C  CG    . HIS A 1  439 ? 129.356 143.768 152.780 1.00 163.77 ? 1104 HIS O CG    1 
ATOM   2982  N  ND1   . HIS A 1  439 ? 130.660 144.206 152.728 1.00 158.07 ? 1104 HIS O ND1   1 
ATOM   2983  C  CD2   . HIS A 1  439 ? 128.857 144.205 153.959 1.00 170.95 ? 1104 HIS O CD2   1 
ATOM   2984  C  CE1   . HIS A 1  439 ? 130.939 144.877 153.831 1.00 161.69 ? 1104 HIS O CE1   1 
ATOM   2985  N  NE2   . HIS A 1  439 ? 129.861 144.892 154.595 1.00 170.70 ? 1104 HIS O NE2   1 
ATOM   2986  N  N     . ARG A 1  440 ? 128.688 142.563 148.331 1.00 145.67 ? 1105 ARG O N     1 
ATOM   2987  C  CA    . ARG A 1  440 ? 128.122 141.954 147.144 1.00 153.27 ? 1105 ARG O CA    1 
ATOM   2988  C  C     . ARG A 1  440 ? 127.826 140.482 147.387 1.00 152.91 ? 1105 ARG O C     1 
ATOM   2989  O  O     . ARG A 1  440 ? 128.169 139.912 148.423 1.00 157.58 ? 1105 ARG O O     1 
ATOM   2990  C  CB    . ARG A 1  440 ? 129.066 142.140 145.970 1.00 142.71 ? 1105 ARG O CB    1 
ATOM   2991  C  CG    . ARG A 1  440 ? 129.292 143.593 145.686 1.00 142.48 ? 1105 ARG O CG    1 
ATOM   2992  C  CD    . ARG A 1  440 ? 130.224 143.789 144.528 1.00 144.45 ? 1105 ARG O CD    1 
ATOM   2993  N  NE    . ARG A 1  440 ? 129.639 143.265 143.297 1.00 149.53 ? 1105 ARG O NE    1 
ATOM   2994  C  CZ    . ARG A 1  440 ? 130.264 143.251 142.127 1.00 153.78 ? 1105 ARG O CZ    1 
ATOM   2995  N  NH1   . ARG A 1  440 ? 131.492 143.739 142.045 1.00 134.46 ? 1105 ARG O NH1   1 
ATOM   2996  N  NH2   . ARG A 1  440 ? 129.669 142.754 141.047 1.00 160.28 ? 1105 ARG O NH2   1 
ATOM   2997  N  N     . VAL A 1  441 ? 127.190 139.858 146.400 1.00 138.58 ? 1106 VAL O N     1 
ATOM   2998  C  CA    . VAL A 1  441 ? 126.602 138.535 146.578 1.00 131.78 ? 1106 VAL O CA    1 
ATOM   2999  C  C     . VAL A 1  441 ? 126.728 137.766 145.275 1.00 131.76 ? 1106 VAL O C     1 
ATOM   3000  O  O     . VAL A 1  441 ? 126.557 138.328 144.192 1.00 136.12 ? 1106 VAL O O     1 
ATOM   3001  C  CB    . VAL A 1  441 ? 125.119 138.628 147.006 1.00 142.60 ? 1106 VAL O CB    1 
ATOM   3002  C  CG1   . VAL A 1  441 ? 124.492 137.248 147.083 1.00 147.31 ? 1106 VAL O CG1   1 
ATOM   3003  C  CG2   . VAL A 1  441 ? 124.969 139.344 148.335 1.00 144.70 ? 1106 VAL O CG2   1 
ATOM   3004  N  N     . LEU A 1  442 ? 127.020 136.476 145.381 1.00 124.28 ? 1107 LEU O N     1 
ATOM   3005  C  CA    . LEU A 1  442 ? 126.890 135.559 144.261 1.00 126.16 ? 1107 LEU O CA    1 
ATOM   3006  C  C     . LEU A 1  442 ? 125.724 134.617 144.507 1.00 125.09 ? 1107 LEU O C     1 
ATOM   3007  O  O     . LEU A 1  442 ? 125.510 134.160 145.634 1.00 126.51 ? 1107 LEU O O     1 
ATOM   3008  C  CB    . LEU A 1  442 ? 128.160 134.746 144.045 1.00 115.11 ? 1107 LEU O CB    1 
ATOM   3009  C  CG    . LEU A 1  442 ? 129.337 135.595 143.611 1.00 135.31 ? 1107 LEU O CG    1 
ATOM   3010  C  CD1   . LEU A 1  442 ? 130.577 134.745 143.454 1.00 126.95 ? 1107 LEU O CD1   1 
ATOM   3011  C  CD2   . LEU A 1  442 ? 128.976 136.272 142.321 1.00 144.94 ? 1107 LEU O CD2   1 
ATOM   3012  N  N     . ILE A 1  443 ? 124.974 134.331 143.449 1.00 112.93 ? 1108 ILE O N     1 
ATOM   3013  C  CA    . ILE A 1  443 ? 123.900 133.352 143.495 1.00 116.11 ? 1108 ILE O CA    1 
ATOM   3014  C  C     . ILE A 1  443 ? 124.142 132.345 142.388 1.00 120.29 ? 1108 ILE O C     1 
ATOM   3015  O  O     . ILE A 1  443 ? 124.323 132.723 141.226 1.00 113.34 ? 1108 ILE O O     1 
ATOM   3016  C  CB    . ILE A 1  443 ? 122.516 134.002 143.344 1.00 109.02 ? 1108 ILE O CB    1 
ATOM   3017  C  CG1   . ILE A 1  443 ? 122.263 134.963 144.498 1.00 109.02 ? 1108 ILE O CG1   1 
ATOM   3018  C  CG2   . ILE A 1  443 ? 121.442 132.942 143.336 1.00 109.02 ? 1108 ILE O CG2   1 
ATOM   3019  C  CD1   . ILE A 1  443 ? 122.546 136.390 144.154 1.00 109.02 ? 1108 ILE O CD1   1 
ATOM   3020  N  N     . PHE A 1  444 ? 124.126 131.070 142.743 1.00 105.53 ? 1109 PHE O N     1 
ATOM   3021  C  CA    . PHE A 1  444 ? 124.402 129.984 141.822 1.00 109.40 ? 1109 PHE O CA    1 
ATOM   3022  C  C     . PHE A 1  444 ? 123.151 129.149 141.628 1.00 113.48 ? 1109 PHE O C     1 
ATOM   3023  O  O     . PHE A 1  444 ? 122.225 129.179 142.439 1.00 115.76 ? 1109 PHE O O     1 
ATOM   3024  C  CB    . PHE A 1  444 ? 125.535 129.101 142.340 1.00 110.78 ? 1109 PHE O CB    1 
ATOM   3025  C  CG    . PHE A 1  444 ? 126.857 129.783 142.377 1.00 117.26 ? 1109 PHE O CG    1 
ATOM   3026  C  CD1   . PHE A 1  444 ? 127.712 129.717 141.300 1.00 120.56 ? 1109 PHE O CD1   1 
ATOM   3027  C  CD2   . PHE A 1  444 ? 127.231 130.519 143.475 1.00 121.29 ? 1109 PHE O CD2   1 
ATOM   3028  C  CE1   . PHE A 1  444 ? 128.926 130.345 141.334 1.00 125.50 ? 1109 PHE O CE1   1 
ATOM   3029  C  CE2   . PHE A 1  444 ? 128.442 131.155 143.509 1.00 127.20 ? 1109 PHE O CE2   1 
ATOM   3030  C  CZ    . PHE A 1  444 ? 129.290 131.070 142.437 1.00 124.12 ? 1109 PHE O CZ    1 
ATOM   3031  N  N     . PHE A 1  445 ? 123.119 128.420 140.525 1.00 115.87 ? 1110 PHE O N     1 
ATOM   3032  C  CA    . PHE A 1  445 ? 121.977 127.583 140.216 1.00 113.70 ? 1110 PHE O CA    1 
ATOM   3033  C  C     . PHE A 1  445 ? 122.461 126.266 139.645 1.00 121.09 ? 1110 PHE O C     1 
ATOM   3034  O  O     . PHE A 1  445 ? 123.418 126.231 138.868 1.00 124.48 ? 1110 PHE O O     1 
ATOM   3035  C  CB    . PHE A 1  445 ? 121.038 128.279 139.234 1.00 115.68 ? 1110 PHE O CB    1 
ATOM   3036  C  CG    . PHE A 1  445 ? 120.353 129.477 139.807 1.00 113.36 ? 1110 PHE O CG    1 
ATOM   3037  C  CD1   . PHE A 1  445 ? 119.138 129.357 140.441 1.00 114.05 ? 1110 PHE O CD1   1 
ATOM   3038  C  CD2   . PHE A 1  445 ? 120.937 130.720 139.740 1.00 115.34 ? 1110 PHE O CD2   1 
ATOM   3039  C  CE1   . PHE A 1  445 ? 118.510 130.464 140.966 1.00 113.10 ? 1110 PHE O CE1   1 
ATOM   3040  C  CE2   . PHE A 1  445 ? 120.312 131.826 140.271 1.00 115.38 ? 1110 PHE O CE2   1 
ATOM   3041  C  CZ    . PHE A 1  445 ? 119.102 131.697 140.887 1.00 112.11 ? 1110 PHE O CZ    1 
ATOM   3042  N  N     . GLN A 1  446 ? 121.813 125.181 140.059 1.00 128.51 ? 1111 GLN O N     1 
ATOM   3043  C  CA    . GLN A 1  446 ? 122.092 123.892 139.447 1.00 121.84 ? 1111 GLN O CA    1 
ATOM   3044  C  C     . GLN A 1  446 ? 121.348 123.727 138.130 1.00 122.72 ? 1111 GLN O C     1 
ATOM   3045  O  O     . GLN A 1  446 ? 121.925 123.251 137.150 1.00 135.71 ? 1111 GLN O O     1 
ATOM   3046  C  CB    . GLN A 1  446 ? 121.739 122.761 140.408 1.00 102.03 ? 1111 GLN O CB    1 
ATOM   3047  C  CG    . GLN A 1  446 ? 122.056 121.404 139.842 1.00 116.03 ? 1111 GLN O CG    1 
ATOM   3048  C  CD    . GLN A 1  446 ? 123.517 121.270 139.501 1.00 129.43 ? 1111 GLN O CD    1 
ATOM   3049  O  OE1   . GLN A 1  446 ? 123.908 121.426 138.348 1.00 126.14 ? 1111 GLN O OE1   1 
ATOM   3050  N  NE2   . GLN A 1  446 ? 124.337 120.983 140.502 1.00 133.46 ? 1111 GLN O NE2   1 
ATOM   3051  N  N     . MET A 1  447 ? 120.081 124.120 138.076 1.00 126.05 ? 1112 MET O N     1 
ATOM   3052  C  CA    . MET A 1  447 ? 119.303 123.991 136.857 1.00 128.53 ? 1112 MET O CA    1 
ATOM   3053  C  C     . MET A 1  447 ? 119.018 125.359 136.262 1.00 130.45 ? 1112 MET O C     1 
ATOM   3054  O  O     . MET A 1  447 ? 118.920 126.361 136.972 1.00 136.58 ? 1112 MET O O     1 
ATOM   3055  C  CB    . MET A 1  447 ? 117.992 123.245 137.097 1.00 133.62 ? 1112 MET O CB    1 
ATOM   3056  C  CG    . MET A 1  447 ? 118.179 121.788 137.446 1.00 138.31 ? 1112 MET O CG    1 
ATOM   3057  S  SD    . MET A 1  447 ? 116.627 120.880 137.446 1.00 141.48 ? 1112 MET O SD    1 
ATOM   3058  C  CE    . MET A 1  447 ? 115.876 121.496 138.943 1.00 176.38 ? 1112 MET O CE    1 
ATOM   3059  N  N     . THR A 1  448 ? 118.886 125.381 134.938 1.00 122.73 ? 1113 THR O N     1 
ATOM   3060  C  CA    . THR A 1  448 ? 118.889 126.639 134.205 1.00 120.53 ? 1113 THR O CA    1 
ATOM   3061  C  C     . THR A 1  448 ? 117.648 127.472 134.488 1.00 122.29 ? 1113 THR O C     1 
ATOM   3062  O  O     . THR A 1  448 ? 117.750 128.599 134.981 1.00 129.13 ? 1113 THR O O     1 
ATOM   3063  C  CB    . THR A 1  448 ? 119.006 126.354 132.716 1.00 133.99 ? 1113 THR O CB    1 
ATOM   3064  O  OG1   . THR A 1  448 ? 117.931 125.493 132.323 1.00 149.69 ? 1113 THR O OG1   1 
ATOM   3065  C  CG2   . THR A 1  448 ? 120.325 125.672 132.426 1.00 134.71 ? 1113 THR O CG2   1 
ATOM   3066  N  N     . GLN A 1  449 ? 116.462 126.919 134.214 1.00 114.00 ? 1114 GLN O N     1 
ATOM   3067  C  CA    . GLN A 1  449 ? 115.268 127.751 134.075 1.00 111.62 ? 1114 GLN O CA    1 
ATOM   3068  C  C     . GLN A 1  449 ? 115.092 128.709 135.236 1.00 113.33 ? 1114 GLN O C     1 
ATOM   3069  O  O     . GLN A 1  449 ? 114.601 129.827 135.050 1.00 121.31 ? 1114 GLN O O     1 
ATOM   3070  C  CB    . GLN A 1  449 ? 114.010 126.892 133.954 1.00 127.81 ? 1114 GLN O CB    1 
ATOM   3071  C  CG    . GLN A 1  449 ? 113.925 126.052 132.708 1.00 127.81 ? 1114 GLN O CG    1 
ATOM   3072  C  CD    . GLN A 1  449 ? 114.621 124.725 132.863 1.00 127.81 ? 1114 GLN O CD    1 
ATOM   3073  O  OE1   . GLN A 1  449 ? 115.202 124.432 133.907 1.00 127.81 ? 1114 GLN O OE1   1 
ATOM   3074  N  NE2   . GLN A 1  449 ? 114.553 123.903 131.828 1.00 127.81 ? 1114 GLN O NE2   1 
ATOM   3075  N  N     . ILE A 1  450 ? 115.499 128.297 136.434 1.00 106.62 ? 1115 ILE O N     1 
ATOM   3076  C  CA    . ILE A 1  450 ? 115.219 129.089 137.624 1.00 112.05 ? 1115 ILE O CA    1 
ATOM   3077  C  C     . ILE A 1  450 ? 115.800 130.482 137.477 1.00 109.01 ? 1115 ILE O C     1 
ATOM   3078  O  O     . ILE A 1  450 ? 115.189 131.476 137.891 1.00 113.17 ? 1115 ILE O O     1 
ATOM   3079  C  CB    . ILE A 1  450 ? 115.769 128.382 138.869 1.00 109.38 ? 1115 ILE O CB    1 
ATOM   3080  C  CG1   . ILE A 1  450 ? 115.182 126.982 138.972 1.00 133.79 ? 1115 ILE O CG1   1 
ATOM   3081  C  CG2   . ILE A 1  450 ? 115.387 129.153 140.103 1.00 119.38 ? 1115 ILE O CG2   1 
ATOM   3082  C  CD1   . ILE A 1  450 ? 116.086 125.912 138.429 1.00 140.53 ? 1115 ILE O CD1   1 
ATOM   3083  N  N     . MET A 1  451 ? 116.977 130.581 136.864 1.00 119.16 ? 1116 MET O N     1 
ATOM   3084  C  CA    . MET A 1  451 ? 117.605 131.880 136.708 1.00 113.40 ? 1116 MET O CA    1 
ATOM   3085  C  C     . MET A 1  451 ? 116.719 132.837 135.942 1.00 111.32 ? 1116 MET O C     1 
ATOM   3086  O  O     . MET A 1  451 ? 116.848 134.045 136.115 1.00 118.12 ? 1116 MET O O     1 
ATOM   3087  C  CB    . MET A 1  451 ? 118.946 131.749 135.993 1.00 119.26 ? 1116 MET O CB    1 
ATOM   3088  C  CG    . MET A 1  451 ? 118.836 131.417 134.520 1.00 125.88 ? 1116 MET O CG    1 
ATOM   3089  S  SD    . MET A 1  451 ? 120.445 131.309 133.718 1.00 124.07 ? 1116 MET O SD    1 
ATOM   3090  C  CE    . MET A 1  451 ? 120.873 133.039 133.574 1.00 123.21 ? 1116 MET O CE    1 
ATOM   3091  N  N     . ASP A 1  452 ? 115.820 132.327 135.105 1.00 117.60 ? 1117 ASP O N     1 
ATOM   3092  C  CA    . ASP A 1  452 ? 114.949 133.205 134.333 1.00 127.12 ? 1117 ASP O CA    1 
ATOM   3093  C  C     . ASP A 1  452 ? 113.991 133.947 135.254 1.00 131.44 ? 1117 ASP O C     1 
ATOM   3094  O  O     . ASP A 1  452 ? 113.948 135.185 135.281 1.00 124.57 ? 1117 ASP O O     1 
ATOM   3095  C  CB    . ASP A 1  452 ? 114.169 132.376 133.314 1.00 127.29 ? 1117 ASP O CB    1 
ATOM   3096  C  CG    . ASP A 1  452 ? 115.072 131.599 132.389 1.00 146.48 ? 1117 ASP O CG    1 
ATOM   3097  O  OD1   . ASP A 1  452 ? 116.289 131.867 132.383 1.00 151.06 ? 1117 ASP O OD1   1 
ATOM   3098  O  OD2   . ASP A 1  452 ? 114.563 130.721 131.668 1.00 158.01 ? 1117 ASP O OD2   1 
ATOM   3099  N  N     . ILE A 1  453 ? 113.221 133.186 136.029 1.00 118.58 ? 1118 ILE O N     1 
ATOM   3100  C  CA    . ILE A 1  453 ? 112.300 133.775 136.984 1.00 120.29 ? 1118 ILE O CA    1 
ATOM   3101  C  C     . ILE A 1  453 ? 113.060 134.623 137.983 1.00 121.78 ? 1118 ILE O C     1 
ATOM   3102  O  O     . ILE A 1  453 ? 112.554 135.647 138.452 1.00 122.07 ? 1118 ILE O O     1 
ATOM   3103  C  CB    . ILE A 1  453 ? 111.493 132.664 137.675 1.00 141.08 ? 1118 ILE O CB    1 
ATOM   3104  C  CG1   . ILE A 1  453 ? 110.709 131.875 136.624 1.00 139.47 ? 1118 ILE O CG1   1 
ATOM   3105  C  CG2   . ILE A 1  453 ? 110.563 133.263 138.719 1.00 131.90 ? 1118 ILE O CG2   1 
ATOM   3106  C  CD1   . ILE A 1  453 ? 110.115 130.582 137.129 1.00 139.42 ? 1118 ILE O CD1   1 
ATOM   3107  N  N     . MET A 1  454 ? 114.289 134.225 138.316 1.00 124.46 ? 1119 MET O N     1 
ATOM   3108  C  CA    . MET A 1  454 ? 115.111 135.061 139.179 1.00 123.47 ? 1119 MET O CA    1 
ATOM   3109  C  C     . MET A 1  454 ? 115.417 136.392 138.518 1.00 122.63 ? 1119 MET O C     1 
ATOM   3110  O  O     . MET A 1  454 ? 115.412 137.439 139.174 1.00 128.31 ? 1119 MET O O     1 
ATOM   3111  C  CB    . MET A 1  454 ? 116.405 134.346 139.531 1.00 136.98 ? 1119 MET O CB    1 
ATOM   3112  C  CG    . MET A 1  454 ? 117.262 135.165 140.450 1.00 131.68 ? 1119 MET O CG    1 
ATOM   3113  S  SD    . MET A 1  454 ? 116.343 135.464 141.962 1.00 144.42 ? 1119 MET O SD    1 
ATOM   3114  C  CE    . MET A 1  454 ? 116.333 133.813 142.651 1.00 135.00 ? 1119 MET O CE    1 
ATOM   3115  N  N     . GLU A 1  455 ? 115.695 136.369 137.218 1.00 117.30 ? 1120 GLU O N     1 
ATOM   3116  C  CA    . GLU A 1  455 ? 115.954 137.606 136.502 1.00 129.41 ? 1120 GLU O CA    1 
ATOM   3117  C  C     . GLU A 1  455 ? 114.738 138.509 136.552 1.00 124.91 ? 1120 GLU O C     1 
ATOM   3118  O  O     . GLU A 1  455 ? 114.855 139.697 136.855 1.00 123.12 ? 1120 GLU O O     1 
ATOM   3119  C  CB    . GLU A 1  455 ? 116.350 137.313 135.059 1.00 115.87 ? 1120 GLU O CB    1 
ATOM   3120  C  CG    . GLU A 1  455 ? 117.695 136.649 134.933 1.00 122.56 ? 1120 GLU O CG    1 
ATOM   3121  C  CD    . GLU A 1  455 ? 118.006 136.237 133.520 1.00 130.43 ? 1120 GLU O CD    1 
ATOM   3122  O  OE1   . GLU A 1  455 ? 117.135 136.411 132.644 1.00 127.79 ? 1120 GLU O OE1   1 
ATOM   3123  O  OE2   . GLU A 1  455 ? 119.105 135.696 133.294 1.00 126.67 ? 1120 GLU O OE2   1 
ATOM   3124  N  N     . ASP A 1  456 ? 113.555 137.956 136.276 1.00 124.91 ? 1121 ASP O N     1 
ATOM   3125  C  CA    . ASP A 1  456 ? 112.344 138.762 136.393 1.00 129.36 ? 1121 ASP O CA    1 
ATOM   3126  C  C     . ASP A 1  456 ? 112.179 139.286 137.810 1.00 129.77 ? 1121 ASP O C     1 
ATOM   3127  O  O     . ASP A 1  456 ? 111.727 140.420 138.019 1.00 139.21 ? 1121 ASP O O     1 
ATOM   3128  C  CB    . ASP A 1  456 ? 111.121 137.941 135.982 1.00 118.53 ? 1121 ASP O CB    1 
ATOM   3129  C  CG    . ASP A 1  456 ? 111.160 137.533 134.525 1.00 128.77 ? 1121 ASP O CG    1 
ATOM   3130  O  OD1   . ASP A 1  456 ? 112.035 138.045 133.806 1.00 129.63 ? 1121 ASP O OD1   1 
ATOM   3131  O  OD2   . ASP A 1  456 ? 110.318 136.716 134.094 1.00 137.66 ? 1121 ASP O OD2   1 
ATOM   3132  N  N     . PHE A 1  457 ? 112.569 138.481 138.789 1.00 134.30 ? 1122 PHE O N     1 
ATOM   3133  C  CA    . PHE A 1  457 ? 112.435 138.877 140.178 1.00 129.92 ? 1122 PHE O CA    1 
ATOM   3134  C  C     . PHE A 1  457 ? 113.310 140.087 140.474 1.00 133.91 ? 1122 PHE O C     1 
ATOM   3135  O  O     . PHE A 1  457 ? 112.870 141.039 141.130 1.00 135.88 ? 1122 PHE O O     1 
ATOM   3136  C  CB    . PHE A 1  457 ? 112.774 137.674 141.053 1.00 141.80 ? 1122 PHE O CB    1 
ATOM   3137  C  CG    . PHE A 1  457 ? 112.653 137.925 142.509 1.00 143.74 ? 1122 PHE O CG    1 
ATOM   3138  C  CD1   . PHE A 1  457 ? 111.410 138.034 143.103 1.00 139.92 ? 1122 PHE O CD1   1 
ATOM   3139  C  CD2   . PHE A 1  457 ? 113.780 137.992 143.299 1.00 144.81 ? 1122 PHE O CD2   1 
ATOM   3140  C  CE1   . PHE A 1  457 ? 111.298 138.253 144.455 1.00 142.00 ? 1122 PHE O CE1   1 
ATOM   3141  C  CE2   . PHE A 1  457 ? 113.676 138.198 144.650 1.00 145.22 ? 1122 PHE O CE2   1 
ATOM   3142  C  CZ    . PHE A 1  457 ? 112.435 138.337 145.231 1.00 141.71 ? 1122 PHE O CZ    1 
ATOM   3143  N  N     . LEU A 1  458 ? 114.535 140.097 139.950 1.00 124.71 ? 1123 LEU O N     1 
ATOM   3144  C  CA    . LEU A 1  458 ? 115.353 141.298 140.048 1.00 126.30 ? 1123 LEU O CA    1 
ATOM   3145  C  C     . LEU A 1  458 ? 114.768 142.438 139.231 1.00 134.15 ? 1123 LEU O C     1 
ATOM   3146  O  O     . LEU A 1  458 ? 114.889 143.603 139.625 1.00 132.11 ? 1123 LEU O O     1 
ATOM   3147  C  CB    . LEU A 1  458 ? 116.777 140.992 139.606 1.00 120.55 ? 1123 LEU O CB    1 
ATOM   3148  C  CG    . LEU A 1  458 ? 117.444 140.052 140.601 1.00 128.62 ? 1123 LEU O CG    1 
ATOM   3149  C  CD1   . LEU A 1  458 ? 118.764 139.558 140.096 1.00 122.98 ? 1123 LEU O CD1   1 
ATOM   3150  C  CD2   . LEU A 1  458 ? 117.649 140.790 141.890 1.00 120.01 ? 1123 LEU O CD2   1 
ATOM   3151  N  N     . ARG A 1  459 ? 114.131 142.125 138.101 1.00 139.24 ? 1124 ARG O N     1 
ATOM   3152  C  CA    . ARG A 1  459 ? 113.443 143.149 137.324 1.00 143.80 ? 1124 ARG O CA    1 
ATOM   3153  C  C     . ARG A 1  459 ? 112.393 143.851 138.166 1.00 148.98 ? 1124 ARG O C     1 
ATOM   3154  O  O     . ARG A 1  459 ? 112.110 145.033 137.947 1.00 144.08 ? 1124 ARG O O     1 
ATOM   3155  C  CB    . ARG A 1  459 ? 112.798 142.538 136.077 1.00 131.61 ? 1124 ARG O CB    1 
ATOM   3156  C  CG    . ARG A 1  459 ? 113.769 141.901 135.097 1.00 140.45 ? 1124 ARG O CG    1 
ATOM   3157  C  CD    . ARG A 1  459 ? 114.540 142.932 134.307 1.00 153.09 ? 1124 ARG O CD    1 
ATOM   3158  N  NE    . ARG A 1  459 ? 113.690 143.636 133.355 1.00 169.03 ? 1124 ARG O NE    1 
ATOM   3159  C  CZ    . ARG A 1  459 ? 114.085 144.686 132.645 1.00 178.17 ? 1124 ARG O CZ    1 
ATOM   3160  N  NH1   . ARG A 1  459 ? 115.318 145.154 132.782 1.00 170.89 ? 1124 ARG O NH1   1 
ATOM   3161  N  NH2   . ARG A 1  459 ? 113.250 145.267 131.796 1.00 175.36 ? 1124 ARG O NH2   1 
ATOM   3162  N  N     . TYR A 1  460 ? 111.800 143.144 139.128 1.00 148.50 ? 1125 TYR O N     1 
ATOM   3163  C  CA    . TYR A 1  460 ? 110.995 143.841 140.120 1.00 143.00 ? 1125 TYR O CA    1 
ATOM   3164  C  C     . TYR A 1  460 ? 111.855 144.529 141.167 1.00 150.31 ? 1125 TYR O C     1 
ATOM   3165  O  O     . TYR A 1  460 ? 111.491 145.606 141.651 1.00 150.90 ? 1125 TYR O O     1 
ATOM   3166  C  CB    . TYR A 1  460 ? 110.032 142.886 140.818 1.00 165.81 ? 1125 TYR O CB    1 
ATOM   3167  C  CG    . TYR A 1  460 ? 109.332 143.552 141.980 1.00 165.81 ? 1125 TYR O CG    1 
ATOM   3168  C  CD1   . TYR A 1  460 ? 108.275 144.431 141.770 1.00 165.81 ? 1125 TYR O CD1   1 
ATOM   3169  C  CD2   . TYR A 1  460 ? 109.750 143.331 143.286 1.00 165.81 ? 1125 TYR O CD2   1 
ATOM   3170  C  CE1   . TYR A 1  460 ? 107.644 145.053 142.829 1.00 165.81 ? 1125 TYR O CE1   1 
ATOM   3171  C  CE2   . TYR A 1  460 ? 109.125 143.951 144.349 1.00 165.81 ? 1125 TYR O CE2   1 
ATOM   3172  C  CZ    . TYR A 1  460 ? 108.074 144.809 144.117 1.00 165.81 ? 1125 TYR O CZ    1 
ATOM   3173  O  OH    . TYR A 1  460 ? 107.454 145.421 145.181 1.00 165.81 ? 1125 TYR O OH    1 
ATOM   3174  N  N     . ILE A 1  461 ? 112.979 143.920 141.538 1.00 155.49 ? 1126 ILE O N     1 
ATOM   3175  C  CA    . ILE A 1  461 ? 113.826 144.497 142.575 1.00 149.29 ? 1126 ILE O CA    1 
ATOM   3176  C  C     . ILE A 1  461 ? 114.480 145.782 142.086 1.00 151.76 ? 1126 ILE O C     1 
ATOM   3177  O  O     . ILE A 1  461 ? 114.649 146.737 142.854 1.00 157.09 ? 1126 ILE O O     1 
ATOM   3178  C  CB    . ILE A 1  461 ? 114.861 143.459 143.039 1.00 123.71 ? 1126 ILE O CB    1 
ATOM   3179  C  CG1   . ILE A 1  461 ? 114.155 142.365 143.841 1.00 123.71 ? 1126 ILE O CG1   1 
ATOM   3180  C  CG2   . ILE A 1  461 ? 115.990 144.113 143.825 1.00 123.71 ? 1126 ILE O CG2   1 
ATOM   3181  C  CD1   . ILE A 1  461 ? 115.043 141.218 144.222 1.00 123.71 ? 1126 ILE O CD1   1 
ATOM   3182  N  N     . ASN A 1  462 ? 114.847 145.827 140.807 1.00 157.86 ? 1127 ASN O N     1 
ATOM   3183  C  CA    . ASN A 1  462 ? 115.389 146.975 140.084 1.00 161.17 ? 1127 ASN O CA    1 
ATOM   3184  C  C     . ASN A 1  462 ? 116.854 147.223 140.412 1.00 168.88 ? 1127 ASN O C     1 
ATOM   3185  O  O     . ASN A 1  462 ? 117.454 148.129 139.826 1.00 173.87 ? 1127 ASN O O     1 
ATOM   3186  C  CB    . ASN A 1  462 ? 114.595 148.268 140.330 1.00 151.58 ? 1127 ASN O CB    1 
ATOM   3187  C  CG    . ASN A 1  462 ? 113.200 148.207 139.747 1.00 151.58 ? 1127 ASN O CG    1 
ATOM   3188  O  OD1   . ASN A 1  462 ? 112.940 147.459 138.807 1.00 151.58 ? 1127 ASN O OD1   1 
ATOM   3189  N  ND2   . ASN A 1  462 ? 112.289 148.985 140.314 1.00 151.58 ? 1127 ASN O ND2   1 
ATOM   3190  N  N     . ILE A 1  463 ? 117.447 146.471 141.322 1.00 132.09 ? 1128 ILE O N     1 
ATOM   3191  C  CA    . ILE A 1  463 ? 118.876 146.562 141.584 1.00 135.62 ? 1128 ILE O CA    1 
ATOM   3192  C  C     . ILE A 1  463 ? 119.605 145.606 140.652 1.00 131.81 ? 1128 ILE O C     1 
ATOM   3193  O  O     . ILE A 1  463 ? 119.307 144.408 140.616 1.00 139.72 ? 1128 ILE O O     1 
ATOM   3194  C  CB    . ILE A 1  463 ? 119.180 146.271 143.059 1.00 111.62 ? 1128 ILE O CB    1 
ATOM   3195  C  CG1   . ILE A 1  463 ? 118.811 147.497 143.904 1.00 111.62 ? 1128 ILE O CG1   1 
ATOM   3196  C  CG2   . ILE A 1  463 ? 120.628 145.876 143.229 1.00 111.62 ? 1128 ILE O CG2   1 
ATOM   3197  C  CD1   . ILE A 1  463 ? 117.402 147.482 144.461 1.00 111.62 ? 1128 ILE O CD1   1 
ATOM   3198  N  N     . LYS A 1  464 ? 120.566 146.138 139.904 1.00 129.43 ? 1129 LYS O N     1 
ATOM   3199  C  CA    . LYS A 1  464 ? 120.987 145.506 138.666 1.00 134.02 ? 1129 LYS O CA    1 
ATOM   3200  C  C     . LYS A 1  464 ? 121.842 144.269 138.934 1.00 130.99 ? 1129 LYS O C     1 
ATOM   3201  O  O     . LYS A 1  464 ? 122.390 144.072 140.022 1.00 137.32 ? 1129 LYS O O     1 
ATOM   3202  C  CB    . LYS A 1  464 ? 121.740 146.507 137.788 1.00 156.21 ? 1129 LYS O CB    1 
ATOM   3203  C  CG    . LYS A 1  464 ? 121.884 146.072 136.333 1.00 156.21 ? 1129 LYS O CG    1 
ATOM   3204  C  CD    . LYS A 1  464 ? 122.626 147.086 135.478 1.00 156.21 ? 1129 LYS O CD    1 
ATOM   3205  C  CE    . LYS A 1  464 ? 124.100 147.117 135.767 1.00 156.21 ? 1129 LYS O CE    1 
ATOM   3206  N  NZ    . LYS A 1  464 ? 124.716 145.824 135.383 1.00 156.21 ? 1129 LYS O NZ    1 
ATOM   3207  N  N     . TYR A 1  465 ? 121.927 143.419 137.913 1.00 107.33 ? 1130 TYR O N     1 
ATOM   3208  C  CA    . TYR A 1  465 ? 122.588 142.130 137.995 1.00 108.78 ? 1130 TYR O CA    1 
ATOM   3209  C  C     . TYR A 1  465 ? 123.084 141.735 136.618 1.00 112.60 ? 1130 TYR O C     1 
ATOM   3210  O  O     . TYR A 1  465 ? 122.454 142.048 135.607 1.00 112.61 ? 1130 TYR O O     1 
ATOM   3211  C  CB    . TYR A 1  465 ? 121.629 141.057 138.476 1.00 118.12 ? 1130 TYR O CB    1 
ATOM   3212  C  CG    . TYR A 1  465 ? 120.533 140.815 137.473 1.00 125.37 ? 1130 TYR O CG    1 
ATOM   3213  C  CD1   . TYR A 1  465 ? 120.636 139.804 136.531 1.00 115.09 ? 1130 TYR O CD1   1 
ATOM   3214  C  CD2   . TYR A 1  465 ? 119.414 141.627 137.439 1.00 125.19 ? 1130 TYR O CD2   1 
ATOM   3215  C  CE1   . TYR A 1  465 ? 119.643 139.592 135.611 1.00 128.55 ? 1130 TYR O CE1   1 
ATOM   3216  C  CE2   . TYR A 1  465 ? 118.416 141.420 136.525 1.00 124.40 ? 1130 TYR O CE2   1 
ATOM   3217  C  CZ    . TYR A 1  465 ? 118.535 140.402 135.611 1.00 128.11 ? 1130 TYR O CZ    1 
ATOM   3218  O  OH    . TYR A 1  465 ? 117.541 140.194 134.687 1.00 123.93 ? 1130 TYR O OH    1 
ATOM   3219  N  N     . LEU A 1  466 ? 124.197 141.019 136.588 1.00 99.22  ? 1131 LEU O N     1 
ATOM   3220  C  CA    . LEU A 1  466 ? 124.617 140.332 135.380 1.00 94.11  ? 1131 LEU O CA    1 
ATOM   3221  C  C     . LEU A 1  466 ? 124.041 138.929 135.363 1.00 97.91  ? 1131 LEU O C     1 
ATOM   3222  O  O     . LEU A 1  466 ? 123.870 138.296 136.403 1.00 98.47  ? 1131 LEU O O     1 
ATOM   3223  C  CB    . LEU A 1  466 ? 126.134 140.261 135.271 1.00 115.41 ? 1131 LEU O CB    1 
ATOM   3224  C  CG    . LEU A 1  466 ? 126.810 141.611 135.119 1.00 120.37 ? 1131 LEU O CG    1 
ATOM   3225  C  CD1   . LEU A 1  466 ? 128.305 141.429 135.018 1.00 123.72 ? 1131 LEU O CD1   1 
ATOM   3226  C  CD2   . LEU A 1  466 ? 126.273 142.329 133.912 1.00 112.57 ? 1131 LEU O CD2   1 
ATOM   3227  N  N     . ARG A 1  467 ? 123.717 138.453 134.177 1.00 113.17 ? 1132 ARG O N     1 
ATOM   3228  C  CA    . ARG A 1  467 ? 123.271 137.080 134.013 1.00 109.78 ? 1132 ARG O CA    1 
ATOM   3229  C  C     . ARG A 1  467 ? 124.357 136.317 133.271 1.00 108.93 ? 1132 ARG O C     1 
ATOM   3230  O  O     . ARG A 1  467 ? 124.603 136.558 132.086 1.00 113.07 ? 1132 ARG O O     1 
ATOM   3231  C  CB    . ARG A 1  467 ? 121.928 137.023 133.288 1.00 131.89 ? 1132 ARG O CB    1 
ATOM   3232  C  CG    . ARG A 1  467 ? 121.903 137.620 131.898 1.00 132.18 ? 1132 ARG O CG    1 
ATOM   3233  C  CD    . ARG A 1  467 ? 120.525 137.501 131.300 1.00 127.90 ? 1132 ARG O CD    1 
ATOM   3234  N  NE    . ARG A 1  467 ? 120.107 136.105 131.204 1.00 130.79 ? 1132 ARG O NE    1 
ATOM   3235  C  CZ    . ARG A 1  467 ? 120.391 135.305 130.183 1.00 138.47 ? 1132 ARG O CZ    1 
ATOM   3236  N  NH1   . ARG A 1  467 ? 121.093 135.762 129.158 1.00 120.15 ? 1132 ARG O NH1   1 
ATOM   3237  N  NH2   . ARG A 1  467 ? 119.970 134.047 130.185 1.00 121.19 ? 1132 ARG O NH2   1 
ATOM   3238  N  N     . LEU A 1  468 ? 125.027 135.415 133.970 1.00 106.74 ? 1133 LEU O N     1 
ATOM   3239  C  CA    . LEU A 1  468 ? 125.970 134.516 133.334 1.00 111.50 ? 1133 LEU O CA    1 
ATOM   3240  C  C     . LEU A 1  468 ? 125.429 133.107 133.459 1.00 118.40 ? 1133 LEU O C     1 
ATOM   3241  O  O     . LEU A 1  468 ? 124.896 132.725 134.503 1.00 117.55 ? 1133 LEU O O     1 
ATOM   3242  C  CB    . LEU A 1  468 ? 127.359 134.601 133.956 1.00 79.54  ? 1133 LEU O CB    1 
ATOM   3243  C  CG    . LEU A 1  468 ? 128.507 133.984 133.152 1.00 87.48  ? 1133 LEU O CG    1 
ATOM   3244  C  CD1   . LEU A 1  468 ? 129.790 134.692 133.506 1.00 83.82  ? 1133 LEU O CD1   1 
ATOM   3245  C  CD2   . LEU A 1  468 ? 128.664 132.494 133.356 1.00 93.11  ? 1133 LEU O CD2   1 
ATOM   3246  N  N     . ASP A 1  469 ? 125.546 132.349 132.380 1.00 105.88 ? 1134 ASP O N     1 
ATOM   3247  C  CA    . ASP A 1  469 ? 125.097 130.970 132.367 1.00 107.63 ? 1134 ASP O CA    1 
ATOM   3248  C  C     . ASP A 1  469 ? 125.794 130.260 131.223 1.00 112.49 ? 1134 ASP O C     1 
ATOM   3249  O  O     . ASP A 1  469 ? 126.319 130.897 130.310 1.00 113.81 ? 1134 ASP O O     1 
ATOM   3250  C  CB    . ASP A 1  469 ? 123.576 130.892 132.247 1.00 120.47 ? 1134 ASP O CB    1 
ATOM   3251  C  CG    . ASP A 1  469 ? 123.045 131.750 131.127 1.00 128.77 ? 1134 ASP O CG    1 
ATOM   3252  O  OD1   . ASP A 1  469 ? 123.842 132.527 130.568 1.00 133.52 ? 1134 ASP O OD1   1 
ATOM   3253  O  OD2   . ASP A 1  469 ? 121.843 131.657 130.805 1.00 129.27 ? 1134 ASP O OD2   1 
ATOM   3254  N  N     . GLY A 1  470 ? 125.805 128.934 131.287 1.00 113.09 ? 1135 GLY O N     1 
ATOM   3255  C  CA    . GLY A 1  470 ? 126.450 128.171 130.241 1.00 111.18 ? 1135 GLY O CA    1 
ATOM   3256  C  C     . GLY A 1  470 ? 125.875 128.501 128.878 1.00 115.40 ? 1135 GLY O C     1 
ATOM   3257  O  O     . GLY A 1  470 ? 124.745 128.972 128.757 1.00 122.61 ? 1135 GLY O O     1 
ATOM   3258  N  N     . HIS A 1  471 ? 126.715 128.348 127.855 1.00 135.64 ? 1136 HIS O N     1 
ATOM   3259  C  CA    . HIS A 1  471 ? 126.334 128.354 126.442 1.00 135.57 ? 1136 HIS O CA    1 
ATOM   3260  C  C     . HIS A 1  471 ? 125.748 129.684 125.980 1.00 128.55 ? 1136 HIS O C     1 
ATOM   3261  O  O     . HIS A 1  471 ? 125.361 129.800 124.815 1.00 136.48 ? 1136 HIS O O     1 
ATOM   3262  C  CB    . HIS A 1  471 ? 125.355 127.224 126.095 1.00 116.57 ? 1136 HIS O CB    1 
ATOM   3263  C  CG    . HIS A 1  471 ? 123.974 127.421 126.623 1.00 116.57 ? 1136 HIS O CG    1 
ATOM   3264  N  ND1   . HIS A 1  471 ? 123.104 128.351 126.098 1.00 116.57 ? 1136 HIS O ND1   1 
ATOM   3265  C  CD2   . HIS A 1  471 ? 123.299 126.789 127.611 1.00 116.57 ? 1136 HIS O CD2   1 
ATOM   3266  C  CE1   . HIS A 1  471 ? 121.960 128.300 126.754 1.00 116.57 ? 1136 HIS O CE1   1 
ATOM   3267  N  NE2   . HIS A 1  471 ? 122.052 127.360 127.678 1.00 116.57 ? 1136 HIS O NE2   1 
ATOM   3268  N  N     . THR A 1  472 ? 125.617 130.663 126.877 1.00 130.47 ? 1137 THR O N     1 
ATOM   3269  C  CA    . THR A 1  472 ? 125.068 131.966 126.510 1.00 133.40 ? 1137 THR O CA    1 
ATOM   3270  C  C     . THR A 1  472 ? 125.695 132.501 125.226 1.00 124.65 ? 1137 THR O C     1 
ATOM   3271  O  O     . THR A 1  472 ? 125.012 132.606 124.204 1.00 133.07 ? 1137 THR O O     1 
ATOM   3272  C  CB    . THR A 1  472 ? 125.224 132.964 127.671 1.00 118.49 ? 1137 THR O CB    1 
ATOM   3273  O  OG1   . THR A 1  472 ? 124.702 134.243 127.291 1.00 119.68 ? 1137 THR O OG1   1 
ATOM   3274  C  CG2   . THR A 1  472 ? 126.671 133.102 128.151 1.00 106.31 ? 1137 THR O CG2   1 
ATOM   3275  N  N     . LYS A 1  473 ? 126.986 132.804 125.254 1.00 132.16 ? 1138 LYS O N     1 
ATOM   3276  C  CA    . LYS A 1  473 ? 127.750 133.224 124.088 1.00 140.99 ? 1138 LYS O CA    1 
ATOM   3277  C  C     . LYS A 1  473 ? 129.205 132.863 124.336 1.00 136.60 ? 1138 LYS O C     1 
ATOM   3278  O  O     . LYS A 1  473 ? 129.526 132.084 125.239 1.00 136.40 ? 1138 LYS O O     1 
ATOM   3279  C  CB    . LYS A 1  473 ? 127.588 134.718 123.784 1.00 119.27 ? 1138 LYS O CB    1 
ATOM   3280  C  CG    . LYS A 1  473 ? 126.297 135.103 123.083 1.00 127.31 ? 1138 LYS O CG    1 
ATOM   3281  C  CD    . LYS A 1  473 ? 126.230 136.596 122.825 1.00 142.11 ? 1138 LYS O CD    1 
ATOM   3282  C  CE    . LYS A 1  473 ? 124.981 136.956 122.046 1.00 153.66 ? 1138 LYS O CE    1 
ATOM   3283  N  NZ    . LYS A 1  473 ? 124.857 138.421 121.814 1.00 159.21 ? 1138 LYS O NZ    1 
ATOM   3284  N  N     . SER A 1  474 ? 130.085 133.410 123.509 1.00 129.20 ? 1139 SER O N     1 
ATOM   3285  C  CA    . SER A 1  474 ? 131.499 133.097 123.612 1.00 126.82 ? 1139 SER O CA    1 
ATOM   3286  C  C     . SER A 1  474 ? 132.247 134.152 124.422 1.00 128.11 ? 1139 SER O C     1 
ATOM   3287  O  O     . SER A 1  474 ? 132.643 133.904 125.565 1.00 135.09 ? 1139 SER O O     1 
ATOM   3288  C  CB    . SER A 1  474 ? 132.089 132.962 122.209 1.00 107.09 ? 1139 SER O CB    1 
ATOM   3289  O  OG    . SER A 1  474 ? 133.470 132.670 122.257 1.00 127.69 ? 1139 SER O OG    1 
ATOM   3290  N  N     . ASP A 1  475 ? 132.436 135.334 123.849 1.00 125.62 ? 1140 ASP O N     1 
ATOM   3291  C  CA    . ASP A 1  475 ? 133.341 136.309 124.436 1.00 130.51 ? 1140 ASP O CA    1 
ATOM   3292  C  C     . ASP A 1  475 ? 132.660 137.330 125.335 1.00 133.16 ? 1140 ASP O C     1 
ATOM   3293  O  O     . ASP A 1  475 ? 133.350 138.038 126.088 1.00 143.37 ? 1140 ASP O O     1 
ATOM   3294  C  CB    . ASP A 1  475 ? 134.087 137.016 123.314 1.00 131.91 ? 1140 ASP O CB    1 
ATOM   3295  C  CG    . ASP A 1  475 ? 135.000 136.080 122.564 1.00 131.91 ? 1140 ASP O CG    1 
ATOM   3296  O  OD1   . ASP A 1  475 ? 135.306 135.006 123.119 1.00 131.91 ? 1140 ASP O OD1   1 
ATOM   3297  O  OD2   . ASP A 1  475 ? 135.392 136.398 121.422 1.00 131.91 ? 1140 ASP O OD2   1 
ATOM   3298  N  N     . GLU A 1  476 ? 131.327 137.405 125.320 1.00 122.33 ? 1141 GLU O N     1 
ATOM   3299  C  CA    . GLU A 1  476 ? 130.672 138.285 126.279 1.00 125.10 ? 1141 GLU O CA    1 
ATOM   3300  C  C     . GLU A 1  476 ? 130.827 137.769 127.697 1.00 129.45 ? 1141 GLU O C     1 
ATOM   3301  O  O     . GLU A 1  476 ? 130.566 138.508 128.647 1.00 119.39 ? 1141 GLU O O     1 
ATOM   3302  C  CB    . GLU A 1  476 ? 129.197 138.471 125.939 1.00 124.69 ? 1141 GLU O CB    1 
ATOM   3303  C  CG    . GLU A 1  476 ? 128.977 139.257 124.669 1.00 124.69 ? 1141 GLU O CG    1 
ATOM   3304  C  CD    . GLU A 1  476 ? 127.513 139.474 124.364 1.00 124.69 ? 1141 GLU O CD    1 
ATOM   3305  O  OE1   . GLU A 1  476 ? 126.663 138.918 125.088 1.00 124.69 ? 1141 GLU O OE1   1 
ATOM   3306  O  OE2   . GLU A 1  476 ? 127.210 140.189 123.388 1.00 124.69 ? 1141 GLU O OE2   1 
ATOM   3307  N  N     . ARG A 1  477 ? 131.237 136.514 127.856 1.00 123.29 ? 1142 ARG O N     1 
ATOM   3308  C  CA    . ARG A 1  477 ? 131.750 136.065 129.140 1.00 123.13 ? 1142 ARG O CA    1 
ATOM   3309  C  C     . ARG A 1  477 ? 132.880 136.976 129.596 1.00 124.51 ? 1142 ARG O C     1 
ATOM   3310  O  O     . ARG A 1  477 ? 132.831 137.566 130.681 1.00 124.12 ? 1142 ARG O O     1 
ATOM   3311  C  CB    . ARG A 1  477 ? 132.228 134.620 129.015 1.00 112.86 ? 1142 ARG O CB    1 
ATOM   3312  C  CG    . ARG A 1  477 ? 131.116 133.608 128.758 1.00 126.10 ? 1142 ARG O CG    1 
ATOM   3313  C  CD    . ARG A 1  477 ? 131.678 132.196 128.665 1.00 134.77 ? 1142 ARG O CD    1 
ATOM   3314  N  NE    . ARG A 1  477 ? 130.654 131.178 128.456 1.00 149.76 ? 1142 ARG O NE    1 
ATOM   3315  C  CZ    . ARG A 1  477 ? 130.927 129.898 128.231 1.00 156.06 ? 1142 ARG O CZ    1 
ATOM   3316  N  NH1   . ARG A 1  477 ? 132.188 129.497 128.179 1.00 159.45 ? 1142 ARG O NH1   1 
ATOM   3317  N  NH2   . ARG A 1  477 ? 129.948 129.023 128.055 1.00 151.85 ? 1142 ARG O NH2   1 
ATOM   3318  N  N     . SER A 1  478 ? 133.898 137.125 128.747 1.00 125.02 ? 1143 SER O N     1 
ATOM   3319  C  CA    . SER A 1  478 ? 135.024 137.996 129.063 1.00 135.96 ? 1143 SER O CA    1 
ATOM   3320  C  C     . SER A 1  478 ? 134.561 139.423 129.294 1.00 128.24 ? 1143 SER O C     1 
ATOM   3321  O  O     . SER A 1  478 ? 134.973 140.077 130.261 1.00 127.02 ? 1143 SER O O     1 
ATOM   3322  C  CB    . SER A 1  478 ? 136.043 137.954 127.929 1.00 103.71 ? 1143 SER O CB    1 
ATOM   3323  O  OG    . SER A 1  478 ? 136.547 136.645 127.758 1.00 132.11 ? 1143 SER O OG    1 
ATOM   3324  N  N     . GLU A 1  479 ? 133.707 139.930 128.401 1.00 140.20 ? 1144 GLU O N     1 
ATOM   3325  C  CA    . GLU A 1  479 ? 133.218 141.297 128.556 1.00 138.26 ? 1144 GLU O CA    1 
ATOM   3326  C  C     . GLU A 1  479 ? 132.557 141.491 129.915 1.00 141.00 ? 1144 GLU O C     1 
ATOM   3327  O  O     . GLU A 1  479 ? 132.843 142.458 130.631 1.00 142.96 ? 1144 GLU O O     1 
ATOM   3328  C  CB    . GLU A 1  479 ? 132.246 141.637 127.427 1.00 152.70 ? 1144 GLU O CB    1 
ATOM   3329  C  CG    . GLU A 1  479 ? 131.721 143.063 127.475 1.00 153.05 ? 1144 GLU O CG    1 
ATOM   3330  C  CD    . GLU A 1  479 ? 130.840 143.399 126.288 1.00 166.90 ? 1144 GLU O CD    1 
ATOM   3331  O  OE1   . GLU A 1  479 ? 130.606 142.506 125.448 1.00 162.01 ? 1144 GLU O OE1   1 
ATOM   3332  O  OE2   . GLU A 1  479 ? 130.389 144.558 126.190 1.00 162.09 ? 1144 GLU O OE2   1 
ATOM   3333  N  N     . LEU A 1  480 ? 131.675 140.566 130.290 1.00 131.84 ? 1145 LEU O N     1 
ATOM   3334  C  CA    . LEU A 1  480 ? 131.051 140.641 131.603 1.00 134.72 ? 1145 LEU O CA    1 
ATOM   3335  C  C     . LEU A 1  480 ? 132.093 140.611 132.709 1.00 134.41 ? 1145 LEU O C     1 
ATOM   3336  O  O     . LEU A 1  480 ? 131.976 141.350 133.691 1.00 130.43 ? 1145 LEU O O     1 
ATOM   3337  C  CB    . LEU A 1  480 ? 130.033 139.512 131.769 1.00 115.11 ? 1145 LEU O CB    1 
ATOM   3338  C  CG    . LEU A 1  480 ? 128.578 139.836 131.399 1.00 116.25 ? 1145 LEU O CG    1 
ATOM   3339  C  CD1   . LEU A 1  480 ? 128.384 140.181 129.931 1.00 125.48 ? 1145 LEU O CD1   1 
ATOM   3340  C  CD2   . LEU A 1  480 ? 127.664 138.692 131.789 1.00 126.08 ? 1145 LEU O CD2   1 
ATOM   3341  N  N     . LEU A 1  481 ? 133.126 139.775 132.565 1.00 128.57 ? 1146 LEU O N     1 
ATOM   3342  C  CA    . LEU A 1  481 ? 134.213 139.770 133.541 1.00 128.70 ? 1146 LEU O CA    1 
ATOM   3343  C  C     . LEU A 1  481 ? 134.789 141.163 133.725 1.00 132.58 ? 1146 LEU O C     1 
ATOM   3344  O  O     . LEU A 1  481 ? 135.006 141.618 134.855 1.00 134.22 ? 1146 LEU O O     1 
ATOM   3345  C  CB    . LEU A 1  481 ? 135.318 138.805 133.116 1.00 122.83 ? 1146 LEU O CB    1 
ATOM   3346  C  CG    . LEU A 1  481 ? 135.051 137.310 133.198 1.00 132.37 ? 1146 LEU O CG    1 
ATOM   3347  C  CD1   . LEU A 1  481 ? 136.214 136.548 132.595 1.00 129.89 ? 1146 LEU O CD1   1 
ATOM   3348  C  CD2   . LEU A 1  481 ? 134.857 136.922 134.647 1.00 118.68 ? 1146 LEU O CD2   1 
ATOM   3349  N  N     . ARG A 1  482 ? 135.058 141.854 132.619 1.00 143.91 ? 1147 ARG O N     1 
ATOM   3350  C  CA    . ARG A 1  482 ? 135.551 143.221 132.720 1.00 149.30 ? 1147 ARG O CA    1 
ATOM   3351  C  C     . ARG A 1  482 ? 134.552 144.103 133.454 1.00 147.35 ? 1147 ARG O C     1 
ATOM   3352  O  O     . ARG A 1  482 ? 134.917 144.827 134.386 1.00 149.95 ? 1147 ARG O O     1 
ATOM   3353  C  CB    . ARG A 1  482 ? 135.844 143.778 131.330 1.00 140.55 ? 1147 ARG O CB    1 
ATOM   3354  C  CG    . ARG A 1  482 ? 136.397 145.187 131.324 1.00 140.48 ? 1147 ARG O CG    1 
ATOM   3355  C  CD    . ARG A 1  482 ? 136.593 145.646 129.899 1.00 141.22 ? 1147 ARG O CD    1 
ATOM   3356  N  NE    . ARG A 1  482 ? 135.317 145.710 129.195 1.00 151.36 ? 1147 ARG O NE    1 
ATOM   3357  C  CZ    . ARG A 1  482 ? 135.185 145.695 127.872 1.00 153.38 ? 1147 ARG O CZ    1 
ATOM   3358  N  NH1   . ARG A 1  482 ? 136.253 145.600 127.092 1.00 147.82 ? 1147 ARG O NH1   1 
ATOM   3359  N  NH2   . ARG A 1  482 ? 133.977 145.760 127.328 1.00 149.57 ? 1147 ARG O NH2   1 
ATOM   3360  N  N     . LEU A 1  483 ? 133.278 144.044 133.051 1.00 139.41 ? 1148 LEU O N     1 
ATOM   3361  C  CA    . LEU A 1  483 ? 132.253 144.845 133.713 1.00 142.15 ? 1148 LEU O CA    1 
ATOM   3362  C  C     . LEU A 1  483 ? 132.248 144.623 135.213 1.00 141.43 ? 1148 LEU O C     1 
ATOM   3363  O  O     . LEU A 1  483 ? 131.994 145.555 135.983 1.00 146.91 ? 1148 LEU O O     1 
ATOM   3364  C  CB    . LEU A 1  483 ? 130.873 144.523 133.144 1.00 141.20 ? 1148 LEU O CB    1 
ATOM   3365  C  CG    . LEU A 1  483 ? 130.686 144.945 131.692 1.00 141.20 ? 1148 LEU O CG    1 
ATOM   3366  C  CD1   . LEU A 1  483 ? 129.307 144.564 131.180 1.00 141.20 ? 1148 LEU O CD1   1 
ATOM   3367  C  CD2   . LEU A 1  483 ? 130.925 146.441 131.566 1.00 141.20 ? 1148 LEU O CD2   1 
ATOM   3368  N  N     . PHE A 1  484 ? 132.507 143.395 135.646 1.00 126.75 ? 1149 PHE O N     1 
ATOM   3369  C  CA    . PHE A 1  484 ? 132.578 143.111 137.070 1.00 136.40 ? 1149 PHE O CA    1 
ATOM   3370  C  C     . PHE A 1  484 ? 133.814 143.731 137.692 1.00 139.99 ? 1149 PHE O C     1 
ATOM   3371  O  O     . PHE A 1  484 ? 133.723 144.466 138.681 1.00 137.86 ? 1149 PHE O O     1 
ATOM   3372  C  CB    . PHE A 1  484 ? 132.581 141.608 137.289 1.00 134.47 ? 1149 PHE O CB    1 
ATOM   3373  C  CG    . PHE A 1  484 ? 132.901 141.209 138.684 1.00 136.51 ? 1149 PHE O CG    1 
ATOM   3374  C  CD1   . PHE A 1  484 ? 131.923 141.219 139.657 1.00 140.70 ? 1149 PHE O CD1   1 
ATOM   3375  C  CD2   . PHE A 1  484 ? 134.192 140.820 139.023 1.00 141.53 ? 1149 PHE O CD2   1 
ATOM   3376  C  CE1   . PHE A 1  484 ? 132.213 140.841 140.934 1.00 142.71 ? 1149 PHE O CE1   1 
ATOM   3377  C  CE2   . PHE A 1  484 ? 134.495 140.447 140.298 1.00 143.82 ? 1149 PHE O CE2   1 
ATOM   3378  C  CZ    . PHE A 1  484 ? 133.496 140.455 141.260 1.00 145.80 ? 1149 PHE O CZ    1 
ATOM   3379  N  N     . ASN A 1  485 ? 134.982 143.456 137.114 1.00 149.99 ? 1150 ASN O N     1 
ATOM   3380  C  CA    . ASN A 1  485 ? 136.247 143.817 137.740 1.00 148.69 ? 1150 ASN O CA    1 
ATOM   3381  C  C     . ASN A 1  485 ? 136.392 145.314 137.960 1.00 152.34 ? 1150 ASN O C     1 
ATOM   3382  O  O     . ASN A 1  485 ? 137.297 145.730 138.691 1.00 160.78 ? 1150 ASN O O     1 
ATOM   3383  C  CB    . ASN A 1  485 ? 137.408 143.305 136.888 1.00 134.73 ? 1150 ASN O CB    1 
ATOM   3384  C  CG    . ASN A 1  485 ? 137.470 141.791 136.840 1.00 152.02 ? 1150 ASN O CG    1 
ATOM   3385  O  OD1   . ASN A 1  485 ? 137.875 141.145 137.806 1.00 162.03 ? 1150 ASN O OD1   1 
ATOM   3386  N  ND2   . ASN A 1  485 ? 137.077 141.218 135.706 1.00 150.65 ? 1150 ASN O ND2   1 
ATOM   3387  N  N     . ALA A 1  486 ? 135.540 146.121 137.348 1.00 137.87 ? 1151 ALA O N     1 
ATOM   3388  C  CA    . ALA A 1  486 ? 135.541 147.553 137.590 1.00 142.80 ? 1151 ALA O CA    1 
ATOM   3389  C  C     . ALA A 1  486 ? 135.169 147.828 139.041 1.00 157.12 ? 1151 ALA O C     1 
ATOM   3390  O  O     . ALA A 1  486 ? 134.084 147.422 139.479 1.00 150.73 ? 1151 ALA O O     1 
ATOM   3391  C  CB    . ALA A 1  486 ? 134.567 148.245 136.647 1.00 131.12 ? 1151 ALA O CB    1 
ATOM   3392  N  N     . PRO A 1  487 ? 136.024 148.499 139.815 1.00 151.39 ? 1152 PRO O N     1 
ATOM   3393  C  CA    . PRO A 1  487 ? 135.722 148.715 141.238 1.00 158.70 ? 1152 PRO O CA    1 
ATOM   3394  C  C     . PRO A 1  487 ? 134.480 149.544 141.482 1.00 155.58 ? 1152 PRO O C     1 
ATOM   3395  O  O     . PRO A 1  487 ? 133.973 149.561 142.609 1.00 150.65 ? 1152 PRO O O     1 
ATOM   3396  C  CB    . PRO A 1  487 ? 136.975 149.436 141.750 1.00 149.73 ? 1152 PRO O CB    1 
ATOM   3397  C  CG    . PRO A 1  487 ? 138.049 149.026 140.808 1.00 143.42 ? 1152 PRO O CG    1 
ATOM   3398  C  CD    . PRO A 1  487 ? 137.381 148.949 139.471 1.00 140.55 ? 1152 PRO O CD    1 
ATOM   3399  N  N     . ASP A 1  488 ? 133.980 150.243 140.474 1.00 173.81 ? 1153 ASP O N     1 
ATOM   3400  C  CA    . ASP A 1  488 ? 132.818 151.096 140.652 1.00 169.94 ? 1153 ASP O CA    1 
ATOM   3401  C  C     . ASP A 1  488 ? 131.502 150.352 140.480 1.00 158.16 ? 1153 ASP O C     1 
ATOM   3402  O  O     . ASP A 1  488 ? 130.449 150.999 140.497 1.00 162.81 ? 1153 ASP O O     1 
ATOM   3403  C  CB    . ASP A 1  488 ? 132.877 152.267 139.670 1.00 168.78 ? 1153 ASP O CB    1 
ATOM   3404  C  CG    . ASP A 1  488 ? 132.845 151.818 138.226 1.00 177.89 ? 1153 ASP O CG    1 
ATOM   3405  O  OD1   . ASP A 1  488 ? 132.903 150.596 137.979 1.00 182.71 ? 1153 ASP O OD1   1 
ATOM   3406  O  OD2   . ASP A 1  488 ? 132.751 152.693 137.340 1.00 177.62 ? 1153 ASP O OD2   1 
ATOM   3407  N  N     . SER A 1  489 ? 131.533 149.033 140.294 1.00 177.91 ? 1154 SER O N     1 
ATOM   3408  C  CA    . SER A 1  489 ? 130.351 148.307 139.844 1.00 171.16 ? 1154 SER O CA    1 
ATOM   3409  C  C     . SER A 1  489 ? 129.158 148.589 140.742 1.00 167.35 ? 1154 SER O C     1 
ATOM   3410  O  O     . SER A 1  489 ? 129.217 148.406 141.961 1.00 171.26 ? 1154 SER O O     1 
ATOM   3411  C  CB    . SER A 1  489 ? 130.637 146.807 139.804 1.00 148.61 ? 1154 SER O CB    1 
ATOM   3412  O  OG    . SER A 1  489 ? 129.486 146.093 139.394 1.00 144.52 ? 1154 SER O OG    1 
ATOM   3413  N  N     . GLU A 1  490 ? 128.082 149.063 140.121 1.00 176.89 ? 1155 GLU O N     1 
ATOM   3414  C  CA    . GLU A 1  490 ? 126.875 149.411 140.853 1.00 177.59 ? 1155 GLU O CA    1 
ATOM   3415  C  C     . GLU A 1  490 ? 126.016 148.186 141.114 1.00 181.41 ? 1155 GLU O C     1 
ATOM   3416  O  O     . GLU A 1  490 ? 125.462 148.031 142.208 1.00 191.21 ? 1155 GLU O O     1 
ATOM   3417  C  CB    . GLU A 1  490 ? 126.094 150.469 140.079 1.00 173.48 ? 1155 GLU O CB    1 
ATOM   3418  C  CG    . GLU A 1  490 ? 126.858 151.773 139.922 1.00 173.48 ? 1155 GLU O CG    1 
ATOM   3419  C  CD    . GLU A 1  490 ? 127.845 151.733 138.774 1.00 173.48 ? 1155 GLU O CD    1 
ATOM   3420  O  OE1   . GLU A 1  490 ? 127.934 150.681 138.105 1.00 173.48 ? 1155 GLU O OE1   1 
ATOM   3421  O  OE2   . GLU A 1  490 ? 128.539 152.745 138.549 1.00 173.48 ? 1155 GLU O OE2   1 
ATOM   3422  N  N     . TYR A 1  491 ? 125.896 147.311 140.124 1.00 171.87 ? 1156 TYR O N     1 
ATOM   3423  C  CA    . TYR A 1  491 ? 125.139 146.084 140.307 1.00 164.22 ? 1156 TYR O CA    1 
ATOM   3424  C  C     . TYR A 1  491 ? 125.898 145.177 141.266 1.00 168.49 ? 1156 TYR O C     1 
ATOM   3425  O  O     . TYR A 1  491 ? 127.059 144.830 141.025 1.00 179.77 ? 1156 TYR O O     1 
ATOM   3426  C  CB    . TYR A 1  491 ? 124.905 145.421 138.954 1.00 159.02 ? 1156 TYR O CB    1 
ATOM   3427  C  CG    . TYR A 1  491 ? 126.159 145.071 138.200 1.00 156.27 ? 1156 TYR O CG    1 
ATOM   3428  C  CD1   . TYR A 1  491 ? 126.709 143.811 138.282 1.00 152.81 ? 1156 TYR O CD1   1 
ATOM   3429  C  CD2   . TYR A 1  491 ? 126.810 146.015 137.425 1.00 157.14 ? 1156 TYR O CD2   1 
ATOM   3430  C  CE1   . TYR A 1  491 ? 127.864 143.503 137.609 1.00 162.44 ? 1156 TYR O CE1   1 
ATOM   3431  C  CE2   . TYR A 1  491 ? 127.954 145.706 136.730 1.00 157.14 ? 1156 TYR O CE2   1 
ATOM   3432  C  CZ    . TYR A 1  491 ? 128.477 144.447 136.827 1.00 161.75 ? 1156 TYR O CZ    1 
ATOM   3433  O  OH    . TYR A 1  491 ? 129.626 144.120 136.155 1.00 172.79 ? 1156 TYR O OH    1 
ATOM   3434  N  N     . LEU A 1  492 ? 125.257 144.837 142.385 1.00 165.43 ? 1157 LEU O N     1 
ATOM   3435  C  CA    . LEU A 1  492 ? 125.957 144.112 143.436 1.00 158.84 ? 1157 LEU O CA    1 
ATOM   3436  C  C     . LEU A 1  492 ? 125.985 142.619 143.162 1.00 152.15 ? 1157 LEU O C     1 
ATOM   3437  O  O     . LEU A 1  492 ? 127.020 141.973 143.347 1.00 155.40 ? 1157 LEU O O     1 
ATOM   3438  C  CB    . LEU A 1  492 ? 125.315 144.396 144.793 1.00 158.04 ? 1157 LEU O CB    1 
ATOM   3439  C  CG    . LEU A 1  492 ? 125.420 145.844 145.270 1.00 158.04 ? 1157 LEU O CG    1 
ATOM   3440  C  CD1   . LEU A 1  492 ? 124.664 146.028 146.572 1.00 158.04 ? 1157 LEU O CD1   1 
ATOM   3441  C  CD2   . LEU A 1  492 ? 126.874 146.251 145.432 1.00 158.04 ? 1157 LEU O CD2   1 
ATOM   3442  N  N     . CYS A 1  493 ? 124.870 142.058 142.716 1.00 141.44 ? 1158 CYS O N     1 
ATOM   3443  C  CA    . CYS A 1  493 ? 124.777 140.621 142.542 1.00 140.36 ? 1158 CYS O CA    1 
ATOM   3444  C  C     . CYS A 1  493 ? 124.915 140.265 141.072 1.00 137.63 ? 1158 CYS O C     1 
ATOM   3445  O  O     . CYS A 1  493 ? 124.914 141.132 140.196 1.00 138.99 ? 1158 CYS O O     1 
ATOM   3446  C  CB    . CYS A 1  493 ? 123.438 140.115 143.079 1.00 157.54 ? 1158 CYS O CB    1 
ATOM   3447  S  SG    . CYS A 1  493 ? 123.133 140.514 144.810 1.00 171.67 ? 1158 CYS O SG    1 
ATOM   3448  N  N     . PHE A 1  494 ? 124.990 138.962 140.810 1.00 117.07 ? 1159 PHE O N     1 
ATOM   3449  C  CA    . PHE A 1  494 ? 124.899 138.391 139.471 1.00 125.51 ? 1159 PHE O CA    1 
ATOM   3450  C  C     . PHE A 1  494 ? 125.028 136.883 139.590 1.00 123.63 ? 1159 PHE O C     1 
ATOM   3451  O  O     . PHE A 1  494 ? 125.491 136.358 140.605 1.00 125.59 ? 1159 PHE O O     1 
ATOM   3452  C  CB    . PHE A 1  494 ? 125.951 138.932 138.505 1.00 119.72 ? 1159 PHE O CB    1 
ATOM   3453  C  CG    . PHE A 1  494 ? 127.348 138.591 138.864 1.00 122.57 ? 1159 PHE O CG    1 
ATOM   3454  C  CD1   . PHE A 1  494 ? 127.952 137.462 138.347 1.00 131.46 ? 1159 PHE O CD1   1 
ATOM   3455  C  CD2   . PHE A 1  494 ? 128.068 139.410 139.703 1.00 125.74 ? 1159 PHE O CD2   1 
ATOM   3456  C  CE1   . PHE A 1  494 ? 129.246 137.157 138.664 1.00 134.79 ? 1159 PHE O CE1   1 
ATOM   3457  C  CE2   . PHE A 1  494 ? 129.359 139.109 140.031 1.00 131.92 ? 1159 PHE O CE2   1 
ATOM   3458  C  CZ    . PHE A 1  494 ? 129.956 137.982 139.508 1.00 123.94 ? 1159 PHE O CZ    1 
ATOM   3459  N  N     . ILE A 1  495 ? 124.644 136.199 138.523 1.00 111.06 ? 1160 ILE O N     1 
ATOM   3460  C  CA    . ILE A 1  495 ? 124.325 134.783 138.565 1.00 113.32 ? 1160 ILE O CA    1 
ATOM   3461  C  C     . ILE A 1  495 ? 125.354 134.005 137.766 1.00 112.38 ? 1160 ILE O C     1 
ATOM   3462  O  O     . ILE A 1  495 ? 125.866 134.480 136.748 1.00 119.29 ? 1160 ILE O O     1 
ATOM   3463  C  CB    . ILE A 1  495 ? 122.914 134.562 137.999 1.00 112.02 ? 1160 ILE O CB    1 
ATOM   3464  C  CG1   . ILE A 1  495 ? 121.889 135.306 138.839 1.00 112.02 ? 1160 ILE O CG1   1 
ATOM   3465  C  CG2   . ILE A 1  495 ? 122.586 133.109 137.959 1.00 112.02 ? 1160 ILE O CG2   1 
ATOM   3466  C  CD1   . ILE A 1  495 ? 120.535 135.333 138.208 1.00 112.02 ? 1160 ILE O CD1   1 
ATOM   3467  N  N     . LEU A 1  496 ? 125.648 132.793 138.225 1.00 93.42  ? 1161 LEU O N     1 
ATOM   3468  C  CA    . LEU A 1  496 ? 126.513 131.878 137.501 1.00 105.73 ? 1161 LEU O CA    1 
ATOM   3469  C  C     . LEU A 1  496 ? 125.819 130.536 137.349 1.00 102.67 ? 1161 LEU O C     1 
ATOM   3470  O  O     . LEU A 1  496 ? 124.713 130.318 137.848 1.00 105.32 ? 1161 LEU O O     1 
ATOM   3471  C  CB    . LEU A 1  496 ? 127.848 131.692 138.215 1.00 121.91 ? 1161 LEU O CB    1 
ATOM   3472  C  CG    . LEU A 1  496 ? 128.614 132.994 138.317 1.00 128.76 ? 1161 LEU O CG    1 
ATOM   3473  C  CD1   . LEU A 1  496 ? 129.875 132.761 139.096 1.00 141.08 ? 1161 LEU O CD1   1 
ATOM   3474  C  CD2   . LEU A 1  496 ? 128.919 133.515 136.938 1.00 134.05 ? 1161 LEU O CD2   1 
ATOM   3475  N  N     . SER A 1  497 ? 126.490 129.625 136.660 1.00 94.99  ? 1162 SER O N     1 
ATOM   3476  C  CA    . SER A 1  497 ? 126.016 128.263 136.493 1.00 102.88 ? 1162 SER O CA    1 
ATOM   3477  C  C     . SER A 1  497 ? 127.019 127.348 137.167 1.00 108.58 ? 1162 SER O C     1 
ATOM   3478  O  O     . SER A 1  497 ? 128.215 127.409 136.870 1.00 117.03 ? 1162 SER O O     1 
ATOM   3479  C  CB    . SER A 1  497 ? 125.854 127.904 135.020 1.00 76.02  ? 1162 SER O CB    1 
ATOM   3480  O  OG    . SER A 1  497 ? 125.423 126.564 134.877 1.00 90.18  ? 1162 SER O OG    1 
ATOM   3481  N  N     . THR A 1  498 ? 126.529 126.520 138.085 1.00 91.36  ? 1163 THR O N     1 
ATOM   3482  C  CA    . THR A 1  498 ? 127.410 125.675 138.878 1.00 97.95  ? 1163 THR O CA    1 
ATOM   3483  C  C     . THR A 1  498 ? 128.267 124.786 137.991 1.00 102.71 ? 1163 THR O C     1 
ATOM   3484  O  O     . THR A 1  498 ? 129.475 124.652 138.207 1.00 109.27 ? 1163 THR O O     1 
ATOM   3485  C  CB    . THR A 1  498 ? 126.572 124.839 139.838 1.00 109.95 ? 1163 THR O CB    1 
ATOM   3486  O  OG1   . THR A 1  498 ? 125.610 124.090 139.087 1.00 117.80 ? 1163 THR O OG1   1 
ATOM   3487  C  CG2   . THR A 1  498 ? 125.842 125.738 140.822 1.00 104.74 ? 1163 THR O CG2   1 
ATOM   3488  N  N     . ARG A 1  499 ? 127.654 124.175 136.977 1.00 104.78 ? 1164 ARG O N     1 
ATOM   3489  C  CA    . ARG A 1  499 ? 128.400 123.313 136.067 1.00 104.78 ? 1164 ARG O CA    1 
ATOM   3490  C  C     . ARG A 1  499 ? 129.475 124.087 135.318 1.00 104.78 ? 1164 ARG O C     1 
ATOM   3491  O  O     . ARG A 1  499 ? 130.539 123.539 135.014 1.00 104.78 ? 1164 ARG O O     1 
ATOM   3492  C  CB    . ARG A 1  499 ? 127.438 122.660 135.082 1.00 106.39 ? 1164 ARG O CB    1 
ATOM   3493  C  CG    . ARG A 1  499 ? 128.080 121.697 134.117 1.00 106.39 ? 1164 ARG O CG    1 
ATOM   3494  C  CD    . ARG A 1  499 ? 128.589 120.463 134.823 1.00 106.39 ? 1164 ARG O CD    1 
ATOM   3495  N  NE    . ARG A 1  499 ? 127.505 119.731 135.471 1.00 106.39 ? 1164 ARG O NE    1 
ATOM   3496  C  CZ    . ARG A 1  499 ? 127.673 118.598 136.143 1.00 106.39 ? 1164 ARG O CZ    1 
ATOM   3497  N  NH1   . ARG A 1  499 ? 126.636 117.998 136.712 1.00 106.39 ? 1164 ARG O NH1   1 
ATOM   3498  N  NH2   . ARG A 1  499 ? 128.875 118.050 136.226 1.00 106.39 ? 1164 ARG O NH2   1 
ATOM   3499  N  N     . ALA A 1  500 ? 129.212 125.353 135.010 1.00 122.71 ? 1165 ALA O N     1 
ATOM   3500  C  CA    . ALA A 1  500 ? 130.173 126.251 134.388 1.00 122.71 ? 1165 ALA O CA    1 
ATOM   3501  C  C     . ALA A 1  500 ? 130.952 127.070 135.406 1.00 122.71 ? 1165 ALA O C     1 
ATOM   3502  O  O     . ALA A 1  500 ? 131.644 128.014 135.017 1.00 122.71 ? 1165 ALA O O     1 
ATOM   3503  C  CB    . ALA A 1  500 ? 129.471 127.187 133.406 1.00 123.31 ? 1165 ALA O CB    1 
ATOM   3504  N  N     . GLY A 1  501 ? 130.808 126.773 136.698 1.00 123.43 ? 1166 GLY O N     1 
ATOM   3505  C  CA    . GLY A 1  501 ? 131.562 127.481 137.715 1.00 123.43 ? 1166 GLY O CA    1 
ATOM   3506  C  C     . GLY A 1  501 ? 133.054 127.285 137.562 1.00 123.43 ? 1166 GLY O C     1 
ATOM   3507  O  O     . GLY A 1  501 ? 133.780 128.269 137.423 1.00 123.43 ? 1166 GLY O O     1 
ATOM   3508  N  N     . GLY A 1  502 ? 133.529 126.041 137.642 1.00 116.26 ? 1167 GLY O N     1 
ATOM   3509  C  CA    . GLY A 1  502 ? 134.735 125.606 136.956 1.00 116.26 ? 1167 GLY O CA    1 
ATOM   3510  C  C     . GLY A 1  502 ? 135.904 126.566 136.969 1.00 116.26 ? 1167 GLY O C     1 
ATOM   3511  O  O     . GLY A 1  502 ? 136.617 126.688 135.970 1.00 116.26 ? 1167 GLY O O     1 
ATOM   3512  N  N     . LEU A 1  503 ? 136.094 127.270 138.081 1.00 122.70 ? 1168 LEU O N     1 
ATOM   3513  C  CA    . LEU A 1  503 ? 137.019 128.398 138.192 1.00 122.70 ? 1168 LEU O CA    1 
ATOM   3514  C  C     . LEU A 1  503 ? 136.700 129.503 137.192 1.00 122.70 ? 1168 LEU O C     1 
ATOM   3515  O  O     . LEU A 1  503 ? 137.544 130.364 136.929 1.00 122.70 ? 1168 LEU O O     1 
ATOM   3516  C  CB    . LEU A 1  503 ? 138.482 127.963 138.026 1.00 128.23 ? 1168 LEU O CB    1 
ATOM   3517  C  CG    . LEU A 1  503 ? 139.150 127.038 139.045 1.00 128.23 ? 1168 LEU O CG    1 
ATOM   3518  C  CD1   . LEU A 1  503 ? 140.571 126.722 138.600 1.00 128.23 ? 1168 LEU O CD1   1 
ATOM   3519  C  CD2   . LEU A 1  503 ? 139.144 127.639 140.440 1.00 128.23 ? 1168 LEU O CD2   1 
ATOM   3520  N  N     . GLY A 1  504 ? 135.463 129.536 136.691 1.00 104.56 ? 1169 GLY O N     1 
ATOM   3521  C  CA    . GLY A 1  504 ? 135.116 130.374 135.555 1.00 104.56 ? 1169 GLY O CA    1 
ATOM   3522  C  C     . GLY A 1  504 ? 135.420 131.838 135.747 1.00 104.56 ? 1169 GLY O C     1 
ATOM   3523  O  O     . GLY A 1  504 ? 135.530 132.575 134.763 1.00 104.56 ? 1169 GLY O O     1 
ATOM   3524  N  N     . LEU A 1  505 ? 135.559 132.280 136.987 1.00 87.79  ? 1170 LEU O N     1 
ATOM   3525  C  CA    . LEU A 1  505 ? 135.963 133.642 137.256 1.00 89.73  ? 1170 LEU O CA    1 
ATOM   3526  C  C     . LEU A 1  505 ? 136.909 133.647 138.441 1.00 89.29  ? 1170 LEU O C     1 
ATOM   3527  O  O     . LEU A 1  505 ? 137.127 132.630 139.101 1.00 87.78  ? 1170 LEU O O     1 
ATOM   3528  C  CB    . LEU A 1  505 ? 134.758 134.563 137.511 1.00 92.03  ? 1170 LEU O CB    1 
ATOM   3529  C  CG    . LEU A 1  505 ? 133.794 134.395 138.692 1.00 96.75  ? 1170 LEU O CG    1 
ATOM   3530  C  CD1   . LEU A 1  505 ? 134.352 134.947 139.998 1.00 94.39  ? 1170 LEU O CD1   1 
ATOM   3531  C  CD2   . LEU A 1  505 ? 132.491 135.092 138.359 1.00 101.30 ? 1170 LEU O CD2   1 
ATOM   3532  N  N     . ASN A 1  506 ? 137.501 134.803 138.672 1.00 116.88 ? 1171 ASN O N     1 
ATOM   3533  C  CA    . ASN A 1  506 ? 138.115 135.125 139.941 1.00 120.84 ? 1171 ASN O CA    1 
ATOM   3534  C  C     . ASN A 1  506 ? 137.360 136.306 140.525 1.00 116.58 ? 1171 ASN O C     1 
ATOM   3535  O  O     . ASN A 1  506 ? 136.971 137.222 139.798 1.00 114.52 ? 1171 ASN O O     1 
ATOM   3536  C  CB    . ASN A 1  506 ? 139.589 135.449 139.764 1.00 136.36 ? 1171 ASN O CB    1 
ATOM   3537  C  CG    . ASN A 1  506 ? 140.310 135.615 141.082 1.00 136.13 ? 1171 ASN O CG    1 
ATOM   3538  O  OD1   . ASN A 1  506 ? 139.697 135.875 142.118 1.00 131.78 ? 1171 ASN O OD1   1 
ATOM   3539  N  ND2   . ASN A 1  506 ? 141.623 135.460 141.051 1.00 134.21 ? 1171 ASN O ND2   1 
ATOM   3540  N  N     . LEU A 1  507 ? 137.122 136.266 141.831 1.00 117.39 ? 1172 LEU O N     1 
ATOM   3541  C  CA    . LEU A 1  507 ? 136.409 137.331 142.527 1.00 119.30 ? 1172 LEU O CA    1 
ATOM   3542  C  C     . LEU A 1  507 ? 137.187 137.720 143.768 1.00 121.61 ? 1172 LEU O C     1 
ATOM   3543  O  O     . LEU A 1  507 ? 137.316 136.919 144.698 1.00 124.59 ? 1172 LEU O O     1 
ATOM   3544  C  CB    . LEU A 1  507 ? 134.998 136.890 142.906 1.00 113.40 ? 1172 LEU O CB    1 
ATOM   3545  C  CG    . LEU A 1  507 ? 134.142 137.919 143.644 1.00 114.95 ? 1172 LEU O CG    1 
ATOM   3546  C  CD1   . LEU A 1  507 ? 132.684 137.770 143.254 1.00 112.41 ? 1172 LEU O CD1   1 
ATOM   3547  C  CD2   . LEU A 1  507 ? 134.286 137.756 145.147 1.00 118.23 ? 1172 LEU O CD2   1 
ATOM   3548  N  N     . GLN A 1  508 ? 137.718 138.934 143.782 1.00 131.14 ? 1173 GLN O N     1 
ATOM   3549  C  CA    . GLN A 1  508 ? 138.207 139.510 145.021 1.00 137.49 ? 1173 GLN O CA    1 
ATOM   3550  C  C     . GLN A 1  508 ? 137.287 140.567 145.621 1.00 131.28 ? 1173 GLN O C     1 
ATOM   3551  O  O     . GLN A 1  508 ? 137.569 141.041 146.726 1.00 135.55 ? 1173 GLN O O     1 
ATOM   3552  C  CB    . GLN A 1  508 ? 139.602 140.103 144.805 1.00 136.31 ? 1173 GLN O CB    1 
ATOM   3553  C  CG    . GLN A 1  508 ? 140.650 139.053 144.485 1.00 148.64 ? 1173 GLN O CG    1 
ATOM   3554  C  CD    . GLN A 1  508 ? 142.023 139.645 144.267 1.00 157.60 ? 1173 GLN O CD    1 
ATOM   3555  O  OE1   . GLN A 1  508 ? 142.158 140.812 143.905 1.00 160.08 ? 1173 GLN O OE1   1 
ATOM   3556  N  NE2   . GLN A 1  508 ? 143.056 138.843 144.499 1.00 161.81 ? 1173 GLN O NE2   1 
ATOM   3557  N  N     . THR A 1  509 ? 136.207 140.957 144.941 1.00 125.39 ? 1174 THR O N     1 
ATOM   3558  C  CA    . THR A 1  509 ? 135.500 142.178 145.316 1.00 122.46 ? 1174 THR O CA    1 
ATOM   3559  C  C     . THR A 1  509 ? 134.244 141.949 146.148 1.00 118.08 ? 1174 THR O C     1 
ATOM   3560  O  O     . THR A 1  509 ? 133.596 142.925 146.538 1.00 128.26 ? 1174 THR O O     1 
ATOM   3561  C  CB    . THR A 1  509 ? 135.125 142.985 144.075 1.00 121.96 ? 1174 THR O CB    1 
ATOM   3562  O  OG1   . THR A 1  509 ? 134.080 142.312 143.375 1.00 116.42 ? 1174 THR O OG1   1 
ATOM   3563  C  CG2   . THR A 1  509 ? 136.322 143.099 143.155 1.00 122.97 ? 1174 THR O CG2   1 
ATOM   3564  N  N     . ALA A 1  510 ? 133.870 140.709 146.428 1.00 130.86 ? 1175 ALA O N     1 
ATOM   3565  C  CA    . ALA A 1  510 ? 132.645 140.451 147.167 1.00 134.11 ? 1175 ALA O CA    1 
ATOM   3566  C  C     . ALA A 1  510 ? 132.952 139.571 148.368 1.00 130.68 ? 1175 ALA O C     1 
ATOM   3567  O  O     . ALA A 1  510 ? 134.084 139.123 148.571 1.00 126.66 ? 1175 ALA O O     1 
ATOM   3568  C  CB    . ALA A 1  510 ? 131.584 139.794 146.279 1.00 113.57 ? 1175 ALA O CB    1 
ATOM   3569  N  N     . ASP A 1  511 ? 131.920 139.319 149.166 1.00 151.05 ? 1176 ASP O N     1 
ATOM   3570  C  CA    . ASP A 1  511 ? 132.049 138.459 150.332 1.00 149.84 ? 1176 ASP O CA    1 
ATOM   3571  C  C     . ASP A 1  511 ? 130.954 137.400 150.335 1.00 144.76 ? 1176 ASP O C     1 
ATOM   3572  O  O     . ASP A 1  511 ? 131.244 136.202 150.296 1.00 149.51 ? 1176 ASP O O     1 
ATOM   3573  C  CB    . ASP A 1  511 ? 132.046 139.293 151.618 1.00 148.84 ? 1176 ASP O CB    1 
ATOM   3574  C  CG    . ASP A 1  511 ? 130.819 140.173 151.749 1.00 164.12 ? 1176 ASP O CG    1 
ATOM   3575  O  OD1   . ASP A 1  511 ? 130.011 140.216 150.799 1.00 152.39 ? 1176 ASP O OD1   1 
ATOM   3576  O  OD2   . ASP A 1  511 ? 130.667 140.823 152.805 1.00 174.83 ? 1176 ASP O OD2   1 
ATOM   3577  N  N     . THR A 1  512 ? 129.699 137.826 150.388 1.00 145.50 ? 1177 THR O N     1 
ATOM   3578  C  CA    . THR A 1  512 ? 128.598 136.885 150.522 1.00 144.78 ? 1177 THR O CA    1 
ATOM   3579  C  C     . THR A 1  512 ? 128.471 136.010 149.283 1.00 138.88 ? 1177 THR O C     1 
ATOM   3580  O  O     . THR A 1  512 ? 128.599 136.484 148.152 1.00 150.54 ? 1177 THR O O     1 
ATOM   3581  C  CB    . THR A 1  512 ? 127.296 137.638 150.767 1.00 139.41 ? 1177 THR O CB    1 
ATOM   3582  O  OG1   . THR A 1  512 ? 127.442 138.462 151.928 1.00 140.08 ? 1177 THR O OG1   1 
ATOM   3583  C  CG2   . THR A 1  512 ? 126.152 136.661 150.993 1.00 138.88 ? 1177 THR O CG2   1 
ATOM   3584  N  N     . VAL A 1  513 ? 128.228 134.721 149.504 1.00 132.31 ? 1178 VAL O N     1 
ATOM   3585  C  CA    . VAL A 1  513 ? 127.954 133.762 148.440 1.00 133.64 ? 1178 VAL O CA    1 
ATOM   3586  C  C     . VAL A 1  513 ? 126.740 132.943 148.838 1.00 142.79 ? 1178 VAL O C     1 
ATOM   3587  O  O     . VAL A 1  513 ? 126.677 132.429 149.959 1.00 143.32 ? 1178 VAL O O     1 
ATOM   3588  C  CB    . VAL A 1  513 ? 129.155 132.837 148.175 1.00 145.22 ? 1178 VAL O CB    1 
ATOM   3589  C  CG1   . VAL A 1  513 ? 128.751 131.714 147.244 1.00 144.71 ? 1178 VAL O CG1   1 
ATOM   3590  C  CG2   . VAL A 1  513 ? 130.288 133.628 147.573 1.00 144.90 ? 1178 VAL O CG2   1 
ATOM   3591  N  N     . ILE A 1  514 ? 125.781 132.816 147.928 1.00 128.89 ? 1179 ILE O N     1 
ATOM   3592  C  CA    . ILE A 1  514 ? 124.551 132.087 148.193 1.00 124.57 ? 1179 ILE O CA    1 
ATOM   3593  C  C     . ILE A 1  514 ? 124.414 130.972 147.170 1.00 126.20 ? 1179 ILE O C     1 
ATOM   3594  O  O     . ILE A 1  514 ? 124.543 131.209 145.964 1.00 123.67 ? 1179 ILE O O     1 
ATOM   3595  C  CB    . ILE A 1  514 ? 123.321 133.006 148.157 1.00 122.42 ? 1179 ILE O CB    1 
ATOM   3596  C  CG1   . ILE A 1  514 ? 123.373 134.024 149.290 1.00 122.60 ? 1179 ILE O CG1   1 
ATOM   3597  C  CG2   . ILE A 1  514 ? 122.069 132.198 148.295 1.00 117.96 ? 1179 ILE O CG2   1 
ATOM   3598  C  CD1   . ILE A 1  514 ? 122.286 135.071 149.200 1.00 124.90 ? 1179 ILE O CD1   1 
ATOM   3599  N  N     . ILE A 1  515 ? 124.148 129.766 147.654 1.00 124.17 ? 1180 ILE O N     1 
ATOM   3600  C  CA    . ILE A 1  515 ? 123.900 128.603 146.816 1.00 125.05 ? 1180 ILE O CA    1 
ATOM   3601  C  C     . ILE A 1  515 ? 122.432 128.233 146.946 1.00 132.07 ? 1180 ILE O C     1 
ATOM   3602  O  O     . ILE A 1  515 ? 121.828 128.384 148.012 1.00 130.06 ? 1180 ILE O O     1 
ATOM   3603  C  CB    . ILE A 1  515 ? 124.806 127.419 147.217 1.00 133.58 ? 1180 ILE O CB    1 
ATOM   3604  C  CG1   . ILE A 1  515 ? 126.273 127.758 146.966 1.00 135.49 ? 1180 ILE O CG1   1 
ATOM   3605  C  CG2   . ILE A 1  515 ? 124.437 126.160 146.465 1.00 134.13 ? 1180 ILE O CG2   1 
ATOM   3606  C  CD1   . ILE A 1  515 ? 127.019 128.205 148.197 1.00 143.01 ? 1180 ILE O CD1   1 
ATOM   3607  N  N     . PHE A 1  516 ? 121.853 127.756 145.859 1.00 116.69 ? 1181 PHE O N     1 
ATOM   3608  C  CA    . PHE A 1  516 ? 120.516 127.196 145.886 1.00 118.82 ? 1181 PHE O CA    1 
ATOM   3609  C  C     . PHE A 1  516 ? 120.568 125.701 145.600 1.00 116.44 ? 1181 PHE O C     1 
ATOM   3610  O  O     . PHE A 1  516 ? 121.636 125.080 145.543 1.00 113.79 ? 1181 PHE O O     1 
ATOM   3611  C  CB    . PHE A 1  516 ? 119.590 127.860 144.868 1.00 109.43 ? 1181 PHE O CB    1 
ATOM   3612  C  CG    . PHE A 1  516 ? 119.292 129.295 145.137 1.00 109.43 ? 1181 PHE O CG    1 
ATOM   3613  C  CD1   . PHE A 1  516 ? 119.617 129.883 146.334 1.00 109.43 ? 1181 PHE O CD1   1 
ATOM   3614  C  CD2   . PHE A 1  516 ? 118.618 130.042 144.190 1.00 109.43 ? 1181 PHE O CD2   1 
ATOM   3615  C  CE1   . PHE A 1  516 ? 119.316 131.204 146.556 1.00 109.43 ? 1181 PHE O CE1   1 
ATOM   3616  C  CE2   . PHE A 1  516 ? 118.314 131.356 144.405 1.00 109.43 ? 1181 PHE O CE2   1 
ATOM   3617  C  CZ    . PHE A 1  516 ? 118.659 131.941 145.588 1.00 109.43 ? 1181 PHE O CZ    1 
ATOM   3618  N  N     . ASP A 1  517 ? 119.385 125.131 145.436 1.00 130.66 ? 1182 ASP O N     1 
ATOM   3619  C  CA    . ASP A 1  517 ? 119.155 123.846 144.775 1.00 143.30 ? 1182 ASP O CA    1 
ATOM   3620  C  C     . ASP A 1  517 ? 119.805 122.722 145.591 1.00 143.05 ? 1182 ASP O C     1 
ATOM   3621  O  O     . ASP A 1  517 ? 119.686 122.705 146.826 1.00 142.30 ? 1182 ASP O O     1 
ATOM   3622  C  CB    . ASP A 1  517 ? 119.654 123.982 143.344 1.00 120.95 ? 1182 ASP O CB    1 
ATOM   3623  C  CG    . ASP A 1  517 ? 118.919 125.064 142.570 1.00 132.73 ? 1182 ASP O CG    1 
ATOM   3624  O  OD1   . ASP A 1  517 ? 117.842 125.499 143.024 1.00 130.04 ? 1182 ASP O OD1   1 
ATOM   3625  O  OD2   . ASP A 1  517 ? 119.422 125.501 141.517 1.00 136.04 ? 1182 ASP O OD2   1 
ATOM   3626  N  N     . THR A 1  518 ? 120.494 121.790 144.933 1.00 144.84 ? 1183 THR O N     1 
ATOM   3627  C  CA    . THR A 1  518 ? 120.764 120.460 145.464 1.00 144.84 ? 1183 THR O CA    1 
ATOM   3628  C  C     . THR A 1  518 ? 122.222 120.069 145.318 1.00 144.84 ? 1183 THR O C     1 
ATOM   3629  O  O     . THR A 1  518 ? 122.860 119.702 146.301 1.00 144.84 ? 1183 THR O O     1 
ATOM   3630  C  CB    . THR A 1  518 ? 119.892 119.419 144.761 1.00 135.95 ? 1183 THR O CB    1 
ATOM   3631  O  OG1   . THR A 1  518 ? 118.510 119.674 145.033 1.00 135.95 ? 1183 THR O OG1   1 
ATOM   3632  C  CG2   . THR A 1  518 ? 120.246 118.029 145.209 1.00 135.95 ? 1183 THR O CG2   1 
ATOM   3633  N  N     . ASP A 1  519 ? 122.697 120.036 144.072 1.00 139.38 ? 1184 ASP O N     1 
ATOM   3634  C  CA    . ASP A 1  519 ? 124.054 119.698 143.641 1.00 139.38 ? 1184 ASP O CA    1 
ATOM   3635  C  C     . ASP A 1  519 ? 124.472 118.298 144.075 1.00 139.38 ? 1184 ASP O C     1 
ATOM   3636  O  O     . ASP A 1  519 ? 125.283 118.108 144.981 1.00 139.38 ? 1184 ASP O O     1 
ATOM   3637  C  CB    . ASP A 1  519 ? 125.062 120.811 144.016 1.00 146.64 ? 1184 ASP O CB    1 
ATOM   3638  C  CG    . ASP A 1  519 ? 125.281 121.017 145.511 1.00 146.64 ? 1184 ASP O CG    1 
ATOM   3639  O  OD1   . ASP A 1  519 ? 125.210 120.102 146.346 1.00 146.64 ? 1184 ASP O OD1   1 
ATOM   3640  O  OD2   . ASP A 1  519 ? 125.480 122.191 145.864 1.00 146.64 ? 1184 ASP O OD2   1 
ATOM   3641  N  N     . TRP A 1  520 ? 123.948 117.305 143.355 1.00 136.16 ? 1185 TRP O N     1 
ATOM   3642  C  CA    . TRP A 1  520 ? 124.152 115.897 143.677 1.00 136.16 ? 1185 TRP O CA    1 
ATOM   3643  C  C     . TRP A 1  520 ? 125.618 115.531 143.884 1.00 136.16 ? 1185 TRP O C     1 
ATOM   3644  O  O     . TRP A 1  520 ? 125.905 114.456 144.420 1.00 136.16 ? 1185 TRP O O     1 
ATOM   3645  C  CB    . TRP A 1  520 ? 123.572 115.029 142.560 1.00 120.88 ? 1185 TRP O CB    1 
ATOM   3646  C  CG    . TRP A 1  520 ? 122.085 115.066 142.464 1.00 120.88 ? 1185 TRP O CG    1 
ATOM   3647  C  CD1   . TRP A 1  520 ? 121.341 115.983 141.789 1.00 120.88 ? 1185 TRP O CD1   1 
ATOM   3648  C  CD2   . TRP A 1  520 ? 121.155 114.111 143.001 1.00 120.88 ? 1185 TRP O CD2   1 
ATOM   3649  N  NE1   . TRP A 1  520 ? 120.005 115.685 141.899 1.00 120.88 ? 1185 TRP O NE1   1 
ATOM   3650  C  CE2   . TRP A 1  520 ? 119.865 114.538 142.635 1.00 120.88 ? 1185 TRP O CE2   1 
ATOM   3651  C  CE3   . TRP A 1  520 ? 121.287 112.949 143.765 1.00 120.88 ? 1185 TRP O CE3   1 
ATOM   3652  C  CZ2   . TRP A 1  520 ? 118.715 113.847 143.009 1.00 120.88 ? 1185 TRP O CZ2   1 
ATOM   3653  C  CZ3   . TRP A 1  520 ? 120.142 112.265 144.134 1.00 120.88 ? 1185 TRP O CZ3   1 
ATOM   3654  C  CH2   . TRP A 1  520 ? 118.875 112.716 143.756 1.00 120.88 ? 1185 TRP O CH2   1 
ATOM   3655  N  N     . ASN A 1  521 ? 126.555 116.376 143.463 1.00 132.90 ? 1186 ASN O N     1 
ATOM   3656  C  CA    . ASN A 1  521 ? 127.905 116.125 143.916 1.00 132.90 ? 1186 ASN O CA    1 
ATOM   3657  C  C     . ASN A 1  521 ? 128.429 117.339 144.671 1.00 132.90 ? 1186 ASN O C     1 
ATOM   3658  O  O     . ASN A 1  521 ? 128.256 118.472 144.217 1.00 132.90 ? 1186 ASN O O     1 
ATOM   3659  C  CB    . ASN A 1  521 ? 128.814 115.827 142.720 1.00 128.22 ? 1186 ASN O CB    1 
ATOM   3660  C  CG    . ASN A 1  521 ? 130.173 115.313 143.129 1.00 128.22 ? 1186 ASN O CG    1 
ATOM   3661  O  OD1   . ASN A 1  521 ? 130.325 114.677 144.169 1.00 128.22 ? 1186 ASN O OD1   1 
ATOM   3662  N  ND2   . ASN A 1  521 ? 131.172 115.567 142.293 1.00 128.22 ? 1186 ASN O ND2   1 
ATOM   3663  N  N     . PRO A 1  522 ? 129.070 117.138 145.821 1.00 146.69 ? 1187 PRO O N     1 
ATOM   3664  C  CA    . PRO A 1  522 ? 129.564 118.291 146.581 1.00 146.69 ? 1187 PRO O CA    1 
ATOM   3665  C  C     . PRO A 1  522 ? 130.785 118.940 145.979 1.00 146.69 ? 1187 PRO O C     1 
ATOM   3666  O  O     . PRO A 1  522 ? 130.992 120.139 146.193 1.00 146.69 ? 1187 PRO O O     1 
ATOM   3667  C  CB    . PRO A 1  522 ? 129.872 117.694 147.956 1.00 153.81 ? 1187 PRO O CB    1 
ATOM   3668  C  CG    . PRO A 1  522 ? 128.969 116.528 148.044 1.00 153.81 ? 1187 PRO O CG    1 
ATOM   3669  C  CD    . PRO A 1  522 ? 128.961 115.946 146.668 1.00 153.81 ? 1187 PRO O CD    1 
ATOM   3670  N  N     . HIS A 1  523 ? 131.611 118.186 145.251 1.00 146.54 ? 1188 HIS O N     1 
ATOM   3671  C  CA    . HIS A 1  523 ? 132.850 118.744 144.719 1.00 146.54 ? 1188 HIS O CA    1 
ATOM   3672  C  C     . HIS A 1  523 ? 132.593 120.035 143.962 1.00 146.54 ? 1188 HIS O C     1 
ATOM   3673  O  O     . HIS A 1  523 ? 133.423 120.950 143.979 1.00 146.54 ? 1188 HIS O O     1 
ATOM   3674  C  CB    . HIS A 1  523 ? 133.537 117.724 143.812 1.00 156.84 ? 1188 HIS O CB    1 
ATOM   3675  C  CG    . HIS A 1  523 ? 133.863 116.430 144.493 1.00 156.84 ? 1188 HIS O CG    1 
ATOM   3676  N  ND1   . HIS A 1  523 ? 134.833 116.324 145.466 1.00 156.84 ? 1188 HIS O ND1   1 
ATOM   3677  C  CD2   . HIS A 1  523 ? 133.348 115.188 144.340 1.00 156.84 ? 1188 HIS O CD2   1 
ATOM   3678  C  CE1   . HIS A 1  523 ? 134.900 115.072 145.883 1.00 156.84 ? 1188 HIS O CE1   1 
ATOM   3679  N  NE2   . HIS A 1  523 ? 134.009 114.362 145.216 1.00 156.84 ? 1188 HIS O NE2   1 
ATOM   3680  N  N     . GLN A 1  524 ? 131.449 120.125 143.293 1.00 140.93 ? 1189 GLN O N     1 
ATOM   3681  C  CA    . GLN A 1  524 ? 131.051 121.368 142.652 1.00 140.93 ? 1189 GLN O CA    1 
ATOM   3682  C  C     . GLN A 1  524 ? 130.401 122.318 143.647 1.00 140.93 ? 1189 GLN O C     1 
ATOM   3683  O  O     . GLN A 1  524 ? 130.614 123.534 143.579 1.00 140.93 ? 1189 GLN O O     1 
ATOM   3684  C  CB    . GLN A 1  524 ? 130.137 121.047 141.477 1.00 101.18 ? 1189 GLN O CB    1 
ATOM   3685  C  CG    . GLN A 1  524 ? 130.889 120.261 140.420 1.00 101.18 ? 1189 GLN O CG    1 
ATOM   3686  C  CD    . GLN A 1  524 ? 130.014 119.741 139.313 1.00 101.18 ? 1189 GLN O CD    1 
ATOM   3687  O  OE1   . GLN A 1  524 ? 128.812 119.558 139.490 1.00 101.18 ? 1189 GLN O OE1   1 
ATOM   3688  N  NE2   . GLN A 1  524 ? 130.618 119.478 138.161 1.00 101.18 ? 1189 GLN O NE2   1 
ATOM   3689  N  N     . ASP A 1  525 ? 129.619 121.780 144.583 1.00 149.93 ? 1190 ASP O N     1 
ATOM   3690  C  CA    . ASP A 1  525 ? 129.110 122.589 145.683 1.00 149.93 ? 1190 ASP O CA    1 
ATOM   3691  C  C     . ASP A 1  525 ? 130.235 123.349 146.367 1.00 149.93 ? 1190 ASP O C     1 
ATOM   3692  O  O     . ASP A 1  525 ? 130.183 124.575 146.508 1.00 149.93 ? 1190 ASP O O     1 
ATOM   3693  C  CB    . ASP A 1  525 ? 128.382 121.690 146.682 1.00 141.88 ? 1190 ASP O CB    1 
ATOM   3694  C  CG    . ASP A 1  525 ? 127.946 122.429 147.934 1.00 141.88 ? 1190 ASP O CG    1 
ATOM   3695  O  OD1   . ASP A 1  525 ? 127.123 123.362 147.836 1.00 141.88 ? 1190 ASP O OD1   1 
ATOM   3696  O  OD2   . ASP A 1  525 ? 128.412 122.055 149.031 1.00 141.88 ? 1190 ASP O OD2   1 
ATOM   3697  N  N     . LEU A 1  526 ? 131.271 122.628 146.793 1.00 147.16 ? 1191 LEU O N     1 
ATOM   3698  C  CA    . LEU A 1  526 ? 132.427 123.278 147.395 1.00 147.16 ? 1191 LEU O CA    1 
ATOM   3699  C  C     . LEU A 1  526 ? 133.211 124.081 146.365 1.00 147.16 ? 1191 LEU O C     1 
ATOM   3700  O  O     . LEU A 1  526 ? 133.809 125.114 146.702 1.00 147.16 ? 1191 LEU O O     1 
ATOM   3701  C  CB    . LEU A 1  526 ? 133.296 122.228 148.088 1.00 147.47 ? 1191 LEU O CB    1 
ATOM   3702  C  CG    . LEU A 1  526 ? 133.818 121.041 147.270 1.00 147.47 ? 1191 LEU O CG    1 
ATOM   3703  C  CD1   . LEU A 1  526 ? 135.124 121.345 146.563 1.00 147.47 ? 1191 LEU O CD1   1 
ATOM   3704  C  CD2   . LEU A 1  526 ? 133.931 119.786 148.122 1.00 147.47 ? 1191 LEU O CD2   1 
ATOM   3705  N  N     . GLN A 1  527 ? 133.192 123.637 145.107 1.00 143.90 ? 1192 GLN O N     1 
ATOM   3706  C  CA    . GLN A 1  527 ? 133.907 124.341 144.051 1.00 143.90 ? 1192 GLN O CA    1 
ATOM   3707  C  C     . GLN A 1  527 ? 133.462 125.791 143.967 1.00 143.90 ? 1192 GLN O C     1 
ATOM   3708  O  O     . GLN A 1  527 ? 134.265 126.714 144.135 1.00 143.90 ? 1192 GLN O O     1 
ATOM   3709  C  CB    . GLN A 1  527 ? 133.683 123.635 142.718 1.00 145.38 ? 1192 GLN O CB    1 
ATOM   3710  C  CG    . GLN A 1  527 ? 134.456 124.229 141.576 1.00 145.38 ? 1192 GLN O CG    1 
ATOM   3711  C  CD    . GLN A 1  527 ? 135.940 124.017 141.720 1.00 145.38 ? 1192 GLN O CD    1 
ATOM   3712  O  OE1   . GLN A 1  527 ? 136.418 122.883 141.717 1.00 145.38 ? 1192 GLN O OE1   1 
ATOM   3713  N  NE2   . GLN A 1  527 ? 136.682 125.107 141.873 1.00 145.38 ? 1192 GLN O NE2   1 
ATOM   3714  N  N     . ALA A 1  528 ? 132.173 126.011 143.722 1.00 144.68 ? 1193 ALA O N     1 
ATOM   3715  C  CA    . ALA A 1  528 ? 131.672 127.377 143.742 1.00 144.68 ? 1193 ALA O CA    1 
ATOM   3716  C  C     . ALA A 1  528 ? 131.715 127.947 145.147 1.00 144.68 ? 1193 ALA O C     1 
ATOM   3717  O  O     . ALA A 1  528 ? 131.871 129.160 145.321 1.00 144.68 ? 1193 ALA O O     1 
ATOM   3718  C  CB    . ALA A 1  528 ? 130.252 127.431 143.185 1.00 141.84 ? 1193 ALA O CB    1 
ATOM   3719  N  N     . GLN A 1  529 ? 131.595 127.084 146.156 1.00 147.37 ? 1194 GLN O N     1 
ATOM   3720  C  CA    . GLN A 1  529 ? 131.623 127.535 147.541 1.00 147.37 ? 1194 GLN O CA    1 
ATOM   3721  C  C     . GLN A 1  529 ? 132.852 128.377 147.835 1.00 147.37 ? 1194 GLN O C     1 
ATOM   3722  O  O     . GLN A 1  529 ? 132.783 129.325 148.622 1.00 147.37 ? 1194 GLN O O     1 
ATOM   3723  C  CB    . GLN A 1  529 ? 131.586 126.326 148.477 1.00 137.82 ? 1194 GLN O CB    1 
ATOM   3724  C  CG    . GLN A 1  529 ? 131.577 126.656 149.942 1.00 137.82 ? 1194 GLN O CG    1 
ATOM   3725  C  CD    . GLN A 1  529 ? 130.288 127.300 150.358 1.00 137.82 ? 1194 GLN O CD    1 
ATOM   3726  O  OE1   . GLN A 1  529 ? 130.183 128.518 150.391 1.00 137.82 ? 1194 GLN O OE1   1 
ATOM   3727  N  NE2   . GLN A 1  529 ? 129.295 126.485 150.691 1.00 137.82 ? 1194 GLN O NE2   1 
ATOM   3728  N  N     . ASP A 1  530 ? 133.977 128.062 147.211 1.00 151.57 ? 1195 ASP O N     1 
ATOM   3729  C  CA    . ASP A 1  530 ? 135.229 128.685 147.610 1.00 151.57 ? 1195 ASP O CA    1 
ATOM   3730  C  C     . ASP A 1  530 ? 135.591 129.929 146.803 1.00 151.57 ? 1195 ASP O C     1 
ATOM   3731  O  O     . ASP A 1  530 ? 136.663 130.498 147.029 1.00 151.57 ? 1195 ASP O O     1 
ATOM   3732  C  CB    . ASP A 1  530 ? 136.358 127.659 147.524 1.00 159.11 ? 1195 ASP O CB    1 
ATOM   3733  C  CG    . ASP A 1  530 ? 136.187 126.530 148.524 1.00 159.11 ? 1195 ASP O CG    1 
ATOM   3734  O  OD1   . ASP A 1  530 ? 135.404 126.699 149.481 1.00 159.11 ? 1195 ASP O OD1   1 
ATOM   3735  O  OD2   . ASP A 1  530 ? 136.822 125.471 148.348 1.00 159.11 ? 1195 ASP O OD2   1 
ATOM   3736  N  N     . ARG A 1  531 ? 134.737 130.377 145.880 1.00 150.18 ? 1196 ARG O N     1 
ATOM   3737  C  CA    . ARG A 1  531 ? 135.079 131.555 145.088 1.00 150.18 ? 1196 ARG O CA    1 
ATOM   3738  C  C     . ARG A 1  531 ? 135.224 132.804 145.933 1.00 150.18 ? 1196 ARG O C     1 
ATOM   3739  O  O     . ARG A 1  531 ? 135.911 133.740 145.517 1.00 150.18 ? 1196 ARG O O     1 
ATOM   3740  C  CB    . ARG A 1  531 ? 134.023 131.818 144.022 1.00 154.66 ? 1196 ARG O CB    1 
ATOM   3741  C  CG    . ARG A 1  531 ? 133.879 130.707 143.037 1.00 154.66 ? 1196 ARG O CG    1 
ATOM   3742  C  CD    . ARG A 1  531 ? 135.068 130.644 142.118 1.00 154.66 ? 1196 ARG O CD    1 
ATOM   3743  N  NE    . ARG A 1  531 ? 134.903 129.520 141.219 1.00 154.66 ? 1196 ARG O NE    1 
ATOM   3744  C  CZ    . ARG A 1  531 ? 135.363 128.307 141.479 1.00 154.66 ? 1196 ARG O CZ    1 
ATOM   3745  N  NH1   . ARG A 1  531 ? 135.151 127.321 140.627 1.00 154.66 ? 1196 ARG O NH1   1 
ATOM   3746  N  NH2   . ARG A 1  531 ? 136.032 128.081 142.598 1.00 154.66 ? 1196 ARG O NH2   1 
ATOM   3747  N  N     . ALA A 1  532 ? 134.609 132.835 147.111 1.00 168.11 ? 1197 ALA O N     1 
ATOM   3748  C  CA    . ALA A 1  532 ? 134.494 134.072 147.871 1.00 168.11 ? 1197 ALA O CA    1 
ATOM   3749  C  C     . ALA A 1  532 ? 135.827 134.489 148.475 1.00 168.11 ? 1197 ALA O C     1 
ATOM   3750  O  O     . ALA A 1  532 ? 136.403 135.505 148.072 1.00 168.11 ? 1197 ALA O O     1 
ATOM   3751  C  CB    . ALA A 1  532 ? 133.451 133.922 148.976 1.00 159.79 ? 1197 ALA O CB    1 
ATOM   3752  N  N     . HIS A 1  533 ? 136.324 133.725 149.443 1.00 160.89 ? 1198 HIS O N     1 
ATOM   3753  C  CA    . HIS A 1  533 ? 137.609 134.065 150.030 1.00 160.89 ? 1198 HIS O CA    1 
ATOM   3754  C  C     . HIS A 1  533 ? 138.704 133.801 149.008 1.00 160.89 ? 1198 HIS O C     1 
ATOM   3755  O  O     . HIS A 1  533 ? 138.868 132.675 148.527 1.00 160.89 ? 1198 HIS O O     1 
ATOM   3756  C  CB    . HIS A 1  533 ? 137.841 133.291 151.327 1.00 163.62 ? 1198 HIS O CB    1 
ATOM   3757  C  CG    . HIS A 1  533 ? 137.760 131.806 151.183 1.00 163.62 ? 1198 HIS O CG    1 
ATOM   3758  N  ND1   . HIS A 1  533 ? 138.761 131.058 150.604 1.00 163.62 ? 1198 HIS O ND1   1 
ATOM   3759  C  CD2   . HIS A 1  533 ? 136.815 130.924 151.583 1.00 163.62 ? 1198 HIS O CD2   1 
ATOM   3760  C  CE1   . HIS A 1  533 ? 138.425 129.781 150.633 1.00 163.62 ? 1198 HIS O CE1   1 
ATOM   3761  N  NE2   . HIS A 1  533 ? 137.249 129.672 151.223 1.00 163.62 ? 1198 HIS O NE2   1 
ATOM   3762  N  N     . ARG A 1  534 ? 139.448 134.851 148.682 1.00 157.99 ? 1199 ARG O N     1 
ATOM   3763  C  CA    . ARG A 1  534 ? 140.387 134.861 147.576 1.00 157.99 ? 1199 ARG O CA    1 
ATOM   3764  C  C     . ARG A 1  534 ? 141.637 135.591 148.029 1.00 157.99 ? 1199 ARG O C     1 
ATOM   3765  O  O     . ARG A 1  534 ? 141.572 136.469 148.892 1.00 157.99 ? 1199 ARG O O     1 
ATOM   3766  C  CB    . ARG A 1  534 ? 139.781 135.556 146.352 1.00 124.88 ? 1199 ARG O CB    1 
ATOM   3767  C  CG    . ARG A 1  534 ? 140.639 135.534 145.108 1.00 124.88 ? 1199 ARG O CG    1 
ATOM   3768  C  CD    . ARG A 1  534 ? 140.769 134.131 144.556 1.00 124.88 ? 1199 ARG O CD    1 
ATOM   3769  N  NE    . ARG A 1  534 ? 139.468 133.589 144.175 1.00 124.88 ? 1199 ARG O NE    1 
ATOM   3770  C  CZ    . ARG A 1  534 ? 139.281 132.372 143.674 1.00 124.88 ? 1199 ARG O CZ    1 
ATOM   3771  N  NH1   . ARG A 1  534 ? 140.315 131.574 143.469 1.00 124.88 ? 1199 ARG O NH1   1 
ATOM   3772  N  NH2   . ARG A 1  534 ? 138.061 131.957 143.364 1.00 124.88 ? 1199 ARG O NH2   1 
ATOM   3773  N  N     . ILE A 1  535 ? 142.781 135.215 147.459 1.00 163.56 ? 1200 ILE O N     1 
ATOM   3774  C  CA    . ILE A 1  535 ? 144.014 135.898 147.815 1.00 163.56 ? 1200 ILE O CA    1 
ATOM   3775  C  C     . ILE A 1  535 ? 143.825 137.387 147.607 1.00 163.56 ? 1200 ILE O C     1 
ATOM   3776  O  O     . ILE A 1  535 ? 143.350 137.827 146.556 1.00 163.56 ? 1200 ILE O O     1 
ATOM   3777  C  CB    . ILE A 1  535 ? 145.192 135.349 146.997 1.00 160.03 ? 1200 ILE O CB    1 
ATOM   3778  C  CG1   . ILE A 1  535 ? 145.479 133.900 147.396 1.00 160.03 ? 1200 ILE O CG1   1 
ATOM   3779  C  CG2   . ILE A 1  535 ? 146.413 136.223 147.187 1.00 160.03 ? 1200 ILE O CG2   1 
ATOM   3780  C  CD1   . ILE A 1  535 ? 146.513 133.221 146.536 1.00 160.03 ? 1200 ILE O CD1   1 
ATOM   3781  N  N     . GLY A 1  536 ? 144.164 138.167 148.625 1.00 148.81 ? 1201 GLY O N     1 
ATOM   3782  C  CA    . GLY A 1  536 ? 143.869 139.586 148.601 1.00 148.81 ? 1201 GLY O CA    1 
ATOM   3783  C  C     . GLY A 1  536 ? 142.417 139.899 148.885 1.00 148.81 ? 1201 GLY O C     1 
ATOM   3784  O  O     . GLY A 1  536 ? 141.856 140.822 148.281 1.00 148.81 ? 1201 GLY O O     1 
ATOM   3785  N  N     . GLN A 1  537 ? 141.790 139.154 149.788 1.00 147.04 ? 1202 GLN O N     1 
ATOM   3786  C  CA    . GLN A 1  537 ? 140.408 139.414 150.169 1.00 147.04 ? 1202 GLN O CA    1 
ATOM   3787  C  C     . GLN A 1  537 ? 140.410 140.314 151.395 1.00 147.04 ? 1202 GLN O C     1 
ATOM   3788  O  O     . GLN A 1  537 ? 140.770 139.880 152.493 1.00 147.04 ? 1202 GLN O O     1 
ATOM   3789  C  CB    . GLN A 1  537 ? 139.662 138.118 150.462 1.00 144.10 ? 1202 GLN O CB    1 
ATOM   3790  C  CG    . GLN A 1  537 ? 138.202 138.334 150.751 1.00 144.10 ? 1202 GLN O CG    1 
ATOM   3791  C  CD    . GLN A 1  537 ? 137.473 138.879 149.548 1.00 144.10 ? 1202 GLN O CD    1 
ATOM   3792  O  OE1   . GLN A 1  537 ? 137.247 140.083 149.441 1.00 144.10 ? 1202 GLN O OE1   1 
ATOM   3793  N  NE2   . GLN A 1  537 ? 137.101 137.994 148.631 1.00 144.10 ? 1202 GLN O NE2   1 
ATOM   3794  N  N     . LYS A 1  538 ? 139.990 141.559 151.214 1.00 142.35 ? 1203 LYS O N     1 
ATOM   3795  C  CA    . LYS A 1  538 ? 139.899 142.489 152.325 1.00 142.35 ? 1203 LYS O CA    1 
ATOM   3796  C  C     . LYS A 1  538 ? 138.558 142.425 153.034 1.00 142.35 ? 1203 LYS O C     1 
ATOM   3797  O  O     . LYS A 1  538 ? 138.411 143.019 154.108 1.00 142.35 ? 1203 LYS O O     1 
ATOM   3798  C  CB    . LYS A 1  538 ? 140.161 143.917 151.843 1.00 123.49 ? 1203 LYS O CB    1 
ATOM   3799  C  CG    . LYS A 1  538 ? 141.596 144.150 151.424 1.00 123.49 ? 1203 LYS O CG    1 
ATOM   3800  C  CD    . LYS A 1  538 ? 141.843 145.597 151.055 1.00 123.49 ? 1203 LYS O CD    1 
ATOM   3801  C  CE    . LYS A 1  538 ? 143.320 145.845 150.807 1.00 123.49 ? 1203 LYS O CE    1 
ATOM   3802  N  NZ    . LYS A 1  538 ? 143.771 145.240 149.527 1.00 123.49 ? 1203 LYS O NZ    1 
ATOM   3803  N  N     . ASN A 1  539 ? 137.587 141.719 152.470 1.00 151.05 ? 1204 ASN O N     1 
ATOM   3804  C  CA    . ASN A 1  539 ? 136.289 141.614 153.101 1.00 151.05 ? 1204 ASN O CA    1 
ATOM   3805  C  C     . ASN A 1  539 ? 136.216 140.351 153.949 1.00 151.05 ? 1204 ASN O C     1 
ATOM   3806  O  O     . ASN A 1  539 ? 137.148 139.545 154.005 1.00 151.05 ? 1204 ASN O O     1 
ATOM   3807  C  CB    . ASN A 1  539 ? 135.180 141.646 152.054 1.00 134.45 ? 1204 ASN O CB    1 
ATOM   3808  C  CG    . ASN A 1  539 ? 134.984 143.022 151.465 1.00 134.45 ? 1204 ASN O CG    1 
ATOM   3809  O  OD1   . ASN A 1  539 ? 135.333 144.022 152.084 1.00 134.45 ? 1204 ASN O OD1   1 
ATOM   3810  N  ND2   . ASN A 1  539 ? 134.418 143.082 150.266 1.00 134.45 ? 1204 ASN O ND2   1 
ATOM   3811  N  N     . GLU A 1  540 ? 135.081 140.182 154.616 1.00 164.71 ? 1205 GLU O N     1 
ATOM   3812  C  CA    . GLU A 1  540 ? 134.846 139.087 155.543 1.00 164.71 ? 1205 GLU O CA    1 
ATOM   3813  C  C     . GLU A 1  540 ? 133.666 138.286 155.022 1.00 164.71 ? 1205 GLU O C     1 
ATOM   3814  O  O     . GLU A 1  540 ? 132.553 138.811 154.918 1.00 164.71 ? 1205 GLU O O     1 
ATOM   3815  C  CB    . GLU A 1  540 ? 134.583 139.621 156.950 1.00 175.76 ? 1205 GLU O CB    1 
ATOM   3816  C  CG    . GLU A 1  540 ? 134.433 138.571 158.029 1.00 175.76 ? 1205 GLU O CG    1 
ATOM   3817  C  CD    . GLU A 1  540 ? 134.208 139.195 159.397 1.00 175.76 ? 1205 GLU O CD    1 
ATOM   3818  O  OE1   . GLU A 1  540 ? 134.175 140.442 159.484 1.00 175.76 ? 1205 GLU O OE1   1 
ATOM   3819  O  OE2   . GLU A 1  540 ? 134.047 138.442 160.380 1.00 175.76 ? 1205 GLU O OE2   1 
ATOM   3820  N  N     . VAL A 1  541 ? 133.911 137.029 154.698 1.00 165.13 ? 1206 VAL O N     1 
ATOM   3821  C  CA    . VAL A 1  541 ? 132.976 136.232 153.916 1.00 156.23 ? 1206 VAL O CA    1 
ATOM   3822  C  C     . VAL A 1  541 ? 131.863 135.694 154.805 1.00 149.26 ? 1206 VAL O C     1 
ATOM   3823  O  O     . VAL A 1  541 ? 132.102 135.228 155.924 1.00 145.76 ? 1206 VAL O O     1 
ATOM   3824  C  CB    . VAL A 1  541 ? 133.730 135.091 153.214 1.00 141.66 ? 1206 VAL O CB    1 
ATOM   3825  C  CG1   . VAL A 1  541 ? 132.763 134.183 152.491 1.00 133.49 ? 1206 VAL O CG1   1 
ATOM   3826  C  CG2   . VAL A 1  541 ? 134.778 135.650 152.268 1.00 137.60 ? 1206 VAL O CG2   1 
ATOM   3827  N  N     . ARG A 1  542 ? 130.635 135.768 154.306 1.00 145.75 ? 1207 ARG O N     1 
ATOM   3828  C  CA    . ARG A 1  542 ? 129.495 135.093 154.903 1.00 144.00 ? 1207 ARG O CA    1 
ATOM   3829  C  C     . ARG A 1  542 ? 128.784 134.306 153.819 1.00 139.61 ? 1207 ARG O C     1 
ATOM   3830  O  O     . ARG A 1  542 ? 128.704 134.751 152.673 1.00 147.81 ? 1207 ARG O O     1 
ATOM   3831  C  CB    . ARG A 1  542 ? 128.538 136.082 155.574 1.00 151.49 ? 1207 ARG O CB    1 
ATOM   3832  C  CG    . ARG A 1  542 ? 129.138 136.718 156.797 1.00 158.11 ? 1207 ARG O CG    1 
ATOM   3833  C  CD    . ARG A 1  542 ? 129.320 135.645 157.855 1.00 170.20 ? 1207 ARG O CD    1 
ATOM   3834  N  NE    . ARG A 1  542 ? 130.020 136.127 159.040 1.00 172.26 ? 1207 ARG O NE    1 
ATOM   3835  C  CZ    . ARG A 1  542 ? 129.434 136.745 160.056 1.00 170.75 ? 1207 ARG O CZ    1 
ATOM   3836  N  NH1   . ARG A 1  542 ? 128.128 136.976 160.034 1.00 172.79 ? 1207 ARG O NH1   1 
ATOM   3837  N  NH2   . ARG A 1  542 ? 130.161 137.142 161.090 1.00 164.06 ? 1207 ARG O NH2   1 
ATOM   3838  N  N     . ILE A 1  543 ? 128.290 133.127 154.172 1.00 147.47 ? 1208 ILE O N     1 
ATOM   3839  C  CA    . ILE A 1  543 ? 127.720 132.208 153.198 1.00 141.36 ? 1208 ILE O CA    1 
ATOM   3840  C  C     . ILE A 1  543 ? 126.520 131.521 153.818 1.00 147.62 ? 1208 ILE O C     1 
ATOM   3841  O  O     . ILE A 1  543 ? 126.563 131.106 154.980 1.00 151.55 ? 1208 ILE O O     1 
ATOM   3842  C  CB    . ILE A 1  543 ? 128.762 131.176 152.735 1.00 130.73 ? 1208 ILE O CB    1 
ATOM   3843  C  CG1   . ILE A 1  543 ? 129.850 131.873 151.923 1.00 136.44 ? 1208 ILE O CG1   1 
ATOM   3844  C  CG2   . ILE A 1  543 ? 128.097 130.083 151.941 1.00 126.35 ? 1208 ILE O CG2   1 
ATOM   3845  C  CD1   . ILE A 1  543 ? 131.081 131.056 151.712 1.00 135.68 ? 1208 ILE O CD1   1 
ATOM   3846  N  N     . LEU A 1  544 ? 125.445 131.400 153.042 1.00 143.55 ? 1209 LEU O N     1 
ATOM   3847  C  CA    . LEU A 1  544 ? 124.242 130.724 153.498 1.00 145.23 ? 1209 LEU O CA    1 
ATOM   3848  C  C     . LEU A 1  544 ? 123.683 129.838 152.394 1.00 138.12 ? 1209 LEU O C     1 
ATOM   3849  O  O     . LEU A 1  544 ? 123.726 130.194 151.213 1.00 150.41 ? 1209 LEU O O     1 
ATOM   3850  C  CB    . LEU A 1  544 ? 123.177 131.729 153.951 1.00 150.49 ? 1209 LEU O CB    1 
ATOM   3851  C  CG    . LEU A 1  544 ? 123.529 132.556 155.188 1.00 163.83 ? 1209 LEU O CG    1 
ATOM   3852  C  CD1   . LEU A 1  544 ? 122.447 133.580 155.470 1.00 164.04 ? 1209 LEU O CD1   1 
ATOM   3853  C  CD2   . LEU A 1  544 ? 123.744 131.652 156.392 1.00 157.30 ? 1209 LEU O CD2   1 
ATOM   3854  N  N     . ARG A 1  545 ? 123.166 128.682 152.793 1.00 145.07 ? 1210 ARG O N     1 
ATOM   3855  C  CA    . ARG A 1  545 ? 122.451 127.779 151.906 1.00 148.60 ? 1210 ARG O CA    1 
ATOM   3856  C  C     . ARG A 1  545 ? 120.956 127.953 152.124 1.00 149.82 ? 1210 ARG O C     1 
ATOM   3857  O  O     . ARG A 1  545 ? 120.498 128.056 153.265 1.00 157.25 ? 1210 ARG O O     1 
ATOM   3858  C  CB    . ARG A 1  545 ? 122.835 126.327 152.180 1.00 129.82 ? 1210 ARG O CB    1 
ATOM   3859  C  CG    . ARG A 1  545 ? 124.288 125.983 151.948 1.00 147.47 ? 1210 ARG O CG    1 
ATOM   3860  C  CD    . ARG A 1  545 ? 124.499 124.508 152.242 1.00 150.61 ? 1210 ARG O CD    1 
ATOM   3861  N  NE    . ARG A 1  545 ? 125.887 124.085 152.104 1.00 146.98 ? 1210 ARG O NE    1 
ATOM   3862  C  CZ    . ARG A 1  545 ? 126.439 123.694 150.962 1.00 145.42 ? 1210 ARG O CZ    1 
ATOM   3863  N  NH1   . ARG A 1  545 ? 125.718 123.671 149.850 1.00 130.83 ? 1210 ARG O NH1   1 
ATOM   3864  N  NH2   . ARG A 1  545 ? 127.710 123.321 150.933 1.00 148.22 ? 1210 ARG O NH2   1 
ATOM   3865  N  N     . LEU A 1  546 ? 120.194 127.968 151.038 1.00 145.96 ? 1211 LEU O N     1 
ATOM   3866  C  CA    . LEU A 1  546 ? 118.747 128.124 151.118 1.00 148.27 ? 1211 LEU O CA    1 
ATOM   3867  C  C     . LEU A 1  546 ? 118.095 126.762 150.938 1.00 145.96 ? 1211 LEU O C     1 
ATOM   3868  O  O     . LEU A 1  546 ? 118.065 126.222 149.830 1.00 154.19 ? 1211 LEU O O     1 
ATOM   3869  C  CB    . LEU A 1  546 ? 118.236 129.114 150.075 1.00 128.84 ? 1211 LEU O CB    1 
ATOM   3870  C  CG    . LEU A 1  546 ? 118.213 130.583 150.503 1.00 136.40 ? 1211 LEU O CG    1 
ATOM   3871  C  CD1   . LEU A 1  546 ? 119.614 131.120 150.720 1.00 127.73 ? 1211 LEU O CD1   1 
ATOM   3872  C  CD2   . LEU A 1  546 ? 117.457 131.435 149.495 1.00 128.68 ? 1211 LEU O CD2   1 
ATOM   3873  N  N     . ILE A 1  547 ? 117.551 126.227 152.026 1.00 148.15 ? 1212 ILE O N     1 
ATOM   3874  C  CA    . ILE A 1  547 ? 116.846 124.954 152.034 1.00 148.91 ? 1212 ILE O CA    1 
ATOM   3875  C  C     . ILE A 1  547 ? 115.551 125.144 152.806 1.00 155.69 ? 1212 ILE O C     1 
ATOM   3876  O  O     . ILE A 1  547 ? 115.526 125.839 153.827 1.00 152.83 ? 1212 ILE O O     1 
ATOM   3877  C  CB    . ILE A 1  547 ? 117.692 123.836 152.674 1.00 145.97 ? 1212 ILE O CB    1 
ATOM   3878  C  CG1   . ILE A 1  547 ? 119.036 123.690 151.964 1.00 154.09 ? 1212 ILE O CG1   1 
ATOM   3879  C  CG2   . ILE A 1  547 ? 116.948 122.523 152.632 1.00 147.77 ? 1212 ILE O CG2   1 
ATOM   3880  C  CD1   . ILE A 1  547 ? 118.916 123.296 150.520 1.00 150.66 ? 1212 ILE O CD1   1 
ATOM   3881  N  N     . THR A 1  548 ? 114.476 124.540 152.321 1.00 155.38 ? 1213 THR O N     1 
ATOM   3882  C  CA    . THR A 1  548 ? 113.198 124.576 153.013 1.00 158.91 ? 1213 THR O CA    1 
ATOM   3883  C  C     . THR A 1  548 ? 113.005 123.276 153.777 1.00 158.18 ? 1213 THR O C     1 
ATOM   3884  O  O     . THR A 1  548 ? 113.186 122.192 153.217 1.00 165.15 ? 1213 THR O O     1 
ATOM   3885  C  CB    . THR A 1  548 ? 112.041 124.782 152.038 1.00 143.73 ? 1213 THR O CB    1 
ATOM   3886  O  OG1   . THR A 1  548 ? 112.017 123.703 151.096 1.00 143.73 ? 1213 THR O OG1   1 
ATOM   3887  C  CG2   . THR A 1  548 ? 112.206 126.088 151.295 1.00 143.73 ? 1213 THR O CG2   1 
ATOM   3888  N  N     . THR A 1  549 ? 112.625 123.390 155.045 1.00 172.59 ? 1214 THR O N     1 
ATOM   3889  C  CA    . THR A 1  549 ? 112.415 122.225 155.889 1.00 172.16 ? 1214 THR O CA    1 
ATOM   3890  C  C     . THR A 1  549 ? 111.215 121.419 155.406 1.00 168.50 ? 1214 THR O C     1 
ATOM   3891  O  O     . THR A 1  549 ? 110.387 121.893 154.623 1.00 170.74 ? 1214 THR O O     1 
ATOM   3892  C  CB    . THR A 1  549 ? 112.187 122.642 157.337 1.00 169.80 ? 1214 THR O CB    1 
ATOM   3893  O  OG1   . THR A 1  549 ? 111.021 123.469 157.412 1.00 169.80 ? 1214 THR O OG1   1 
ATOM   3894  C  CG2   . THR A 1  549 ? 113.378 123.418 157.856 1.00 169.80 ? 1214 THR O CG2   1 
ATOM   3895  N  N     . ASN A 1  550 ? 111.138 120.176 155.881 1.00 163.90 ? 1215 ASN O N     1 
ATOM   3896  C  CA    . ASN A 1  550 ? 109.998 119.303 155.608 1.00 169.71 ? 1215 ASN O CA    1 
ATOM   3897  C  C     . ASN A 1  550 ? 109.834 119.109 154.104 1.00 172.62 ? 1215 ASN O C     1 
ATOM   3898  O  O     . ASN A 1  550 ? 108.771 119.351 153.530 1.00 175.19 ? 1215 ASN O O     1 
ATOM   3899  C  CB    . ASN A 1  550 ? 108.717 119.862 156.234 1.00 174.25 ? 1215 ASN O CB    1 
ATOM   3900  C  CG    . ASN A 1  550 ? 108.784 119.929 157.752 1.00 174.25 ? 1215 ASN O CG    1 
ATOM   3901  O  OD1   . ASN A 1  550 ? 109.552 119.207 158.388 1.00 174.25 ? 1215 ASN O OD1   1 
ATOM   3902  N  ND2   . ASN A 1  550 ? 107.981 120.808 158.337 1.00 174.25 ? 1215 ASN O ND2   1 
ATOM   3903  N  N     . SER A 1  551 ? 110.920 118.697 153.461 1.00 170.05 ? 1216 SER O N     1 
ATOM   3904  C  CA    . SER A 1  551 ? 110.961 118.607 152.009 1.00 170.05 ? 1216 SER O CA    1 
ATOM   3905  C  C     . SER A 1  551 ? 112.040 117.612 151.607 1.00 170.05 ? 1216 SER O C     1 
ATOM   3906  O  O     . SER A 1  551 ? 112.868 117.196 152.418 1.00 170.05 ? 1216 SER O O     1 
ATOM   3907  C  CB    . SER A 1  551 ? 111.194 119.985 151.385 1.00 161.51 ? 1216 SER O CB    1 
ATOM   3908  O  OG    . SER A 1  551 ? 112.416 120.545 151.828 1.00 161.51 ? 1216 SER O OG    1 
ATOM   3909  N  N     . VAL A 1  552 ? 111.999 117.203 150.339 1.00 159.78 ? 1217 VAL O N     1 
ATOM   3910  C  CA    . VAL A 1  552 ? 113.019 116.290 149.843 1.00 152.82 ? 1217 VAL O CA    1 
ATOM   3911  C  C     . VAL A 1  552 ? 114.389 116.951 149.794 1.00 154.77 ? 1217 VAL O C     1 
ATOM   3912  O  O     . VAL A 1  552 ? 115.414 116.261 149.845 1.00 167.69 ? 1217 VAL O O     1 
ATOM   3913  C  CB    . VAL A 1  552 ? 112.615 115.757 148.456 1.00 143.27 ? 1217 VAL O CB    1 
ATOM   3914  C  CG1   . VAL A 1  552 ? 112.521 116.896 147.470 1.00 145.36 ? 1217 VAL O CG1   1 
ATOM   3915  C  CG2   . VAL A 1  552 ? 113.596 114.693 147.963 1.00 149.70 ? 1217 VAL O CG2   1 
ATOM   3916  N  N     . GLU A 1  553 ? 114.448 118.278 149.711 1.00 151.82 ? 1218 GLU O N     1 
ATOM   3917  C  CA    . GLU A 1  553 ? 115.735 118.907 149.448 1.00 145.38 ? 1218 GLU O CA    1 
ATOM   3918  C  C     . GLU A 1  553 ? 116.650 118.837 150.661 1.00 148.46 ? 1218 GLU O C     1 
ATOM   3919  O  O     . GLU A 1  553 ? 117.854 118.604 150.514 1.00 151.65 ? 1218 GLU O O     1 
ATOM   3920  C  CB    . GLU A 1  553 ? 115.542 120.345 148.986 1.00 141.06 ? 1218 GLU O CB    1 
ATOM   3921  C  CG    . GLU A 1  553 ? 114.886 121.238 149.987 1.00 150.08 ? 1218 GLU O CG    1 
ATOM   3922  C  CD    . GLU A 1  553 ? 114.673 122.617 149.434 1.00 155.57 ? 1218 GLU O CD    1 
ATOM   3923  O  OE1   . GLU A 1  553 ? 115.318 122.947 148.414 1.00 148.04 ? 1218 GLU O OE1   1 
ATOM   3924  O  OE2   . GLU A 1  553 ? 113.866 123.370 150.014 1.00 149.90 ? 1218 GLU O OE2   1 
ATOM   3925  N  N     . GLU A 1  554 ? 116.117 119.023 151.869 1.00 159.55 ? 1219 GLU O N     1 
ATOM   3926  C  CA    . GLU A 1  554 ? 116.987 118.820 153.016 1.00 166.72 ? 1219 GLU O CA    1 
ATOM   3927  C  C     . GLU A 1  554 ? 117.315 117.351 153.195 1.00 163.37 ? 1219 GLU O C     1 
ATOM   3928  O  O     . GLU A 1  554 ? 118.325 117.030 153.823 1.00 167.90 ? 1219 GLU O O     1 
ATOM   3929  C  CB    . GLU A 1  554 ? 116.388 119.385 154.307 1.00 168.09 ? 1219 GLU O CB    1 
ATOM   3930  C  CG    . GLU A 1  554 ? 115.247 118.614 154.941 1.00 172.28 ? 1219 GLU O CG    1 
ATOM   3931  C  CD    . GLU A 1  554 ? 113.909 118.949 154.340 1.00 175.08 ? 1219 GLU O CD    1 
ATOM   3932  O  OE1   . GLU A 1  554 ? 113.877 119.643 153.307 1.00 181.92 ? 1219 GLU O OE1   1 
ATOM   3933  O  OE2   . GLU A 1  554 ? 112.882 118.530 154.906 1.00 166.23 ? 1219 GLU O OE2   1 
ATOM   3934  N  N     . VAL A 1  555 ? 116.489 116.459 152.648 1.00 151.54 ? 1220 VAL O N     1 
ATOM   3935  C  CA    . VAL A 1  555 ? 116.873 115.055 152.564 1.00 154.26 ? 1220 VAL O CA    1 
ATOM   3936  C  C     . VAL A 1  555 ? 118.119 114.907 151.711 1.00 160.40 ? 1220 VAL O C     1 
ATOM   3937  O  O     . VAL A 1  555 ? 119.052 114.170 152.060 1.00 167.48 ? 1220 VAL O O     1 
ATOM   3938  C  CB    . VAL A 1  555 ? 115.714 114.215 152.005 1.00 166.71 ? 1220 VAL O CB    1 
ATOM   3939  C  CG1   . VAL A 1  555 ? 116.173 112.791 151.732 1.00 166.71 ? 1220 VAL O CG1   1 
ATOM   3940  C  CG2   . VAL A 1  555 ? 114.531 114.253 152.956 1.00 166.71 ? 1220 VAL O CG2   1 
ATOM   3941  N  N     . ILE A 1  556 ? 118.164 115.612 150.583 1.00 132.86 ? 1221 ILE O N     1 
ATOM   3942  C  CA    . ILE A 1  556 ? 119.333 115.464 149.735 1.00 135.00 ? 1221 ILE O CA    1 
ATOM   3943  C  C     . ILE A 1  556 ? 120.528 116.150 150.376 1.00 136.55 ? 1221 ILE O C     1 
ATOM   3944  O  O     . ILE A 1  556 ? 121.669 115.741 150.159 1.00 144.11 ? 1221 ILE O O     1 
ATOM   3945  C  CB    . ILE A 1  556 ? 119.072 116.012 148.328 1.00 107.17 ? 1221 ILE O CB    1 
ATOM   3946  C  CG1   . ILE A 1  556 ? 117.757 115.475 147.786 1.00 108.17 ? 1221 ILE O CG1   1 
ATOM   3947  C  CG2   . ILE A 1  556 ? 120.140 115.483 147.408 1.00 99.91  ? 1221 ILE O CG2   1 
ATOM   3948  C  CD1   . ILE A 1  556 ? 117.297 116.191 146.549 1.00 104.28 ? 1221 ILE O CD1   1 
ATOM   3949  N  N     . LEU A 1  557 ? 120.297 117.208 151.154 1.00 135.74 ? 1222 LEU O N     1 
ATOM   3950  C  CA    . LEU A 1  557 ? 121.371 117.769 151.964 1.00 148.34 ? 1222 LEU O CA    1 
ATOM   3951  C  C     . LEU A 1  557 ? 121.926 116.723 152.912 1.00 156.36 ? 1222 LEU O C     1 
ATOM   3952  O  O     . LEU A 1  557 ? 123.149 116.536 153.015 1.00 164.60 ? 1222 LEU O O     1 
ATOM   3953  C  CB    . LEU A 1  557 ? 120.865 118.977 152.745 1.00 146.69 ? 1222 LEU O CB    1 
ATOM   3954  C  CG    . LEU A 1  557 ? 121.820 119.477 153.827 1.00 145.78 ? 1222 LEU O CG    1 
ATOM   3955  C  CD1   . LEU A 1  557 ? 123.168 119.869 153.245 1.00 153.81 ? 1222 LEU O CD1   1 
ATOM   3956  C  CD2   . LEU A 1  557 ? 121.199 120.651 154.562 1.00 134.91 ? 1222 LEU O CD2   1 
ATOM   3957  N  N     . GLU A 1  558 ? 121.029 116.036 153.619 1.00 177.92 ? 1223 GLU O N     1 
ATOM   3958  C  CA    . GLU A 1  558 ? 121.424 114.904 154.439 1.00 178.53 ? 1223 GLU O CA    1 
ATOM   3959  C  C     . GLU A 1  558 ? 122.359 114.002 153.653 1.00 176.60 ? 1223 GLU O C     1 
ATOM   3960  O  O     . GLU A 1  558 ? 123.532 113.864 153.999 1.00 170.33 ? 1223 GLU O O     1 
ATOM   3961  C  CB    . GLU A 1  558 ? 120.192 114.134 154.920 1.00 165.11 ? 1223 GLU O CB    1 
ATOM   3962  C  CG    . GLU A 1  558 ? 119.249 114.937 155.800 1.00 178.57 ? 1223 GLU O CG    1 
ATOM   3963  C  CD    . GLU A 1  558 ? 119.932 115.513 157.020 1.00 204.02 ? 1223 GLU O CD    1 
ATOM   3964  O  OE1   . GLU A 1  558 ? 120.788 114.817 157.604 1.00 208.61 ? 1223 GLU O OE1   1 
ATOM   3965  O  OE2   . GLU A 1  558 ? 119.616 116.663 157.397 1.00 214.37 ? 1223 GLU O OE2   1 
ATOM   3966  N  N     . ARG A 1  559 ? 121.865 113.434 152.548 1.00 165.27 ? 1224 ARG O N     1 
ATOM   3967  C  CA    . ARG A 1  559 ? 122.698 112.572 151.713 1.00 165.27 ? 1224 ARG O CA    1 
ATOM   3968  C  C     . ARG A 1  559 ? 124.008 113.241 151.318 1.00 165.27 ? 1224 ARG O C     1 
ATOM   3969  O  O     . ARG A 1  559 ? 125.028 112.563 151.137 1.00 165.27 ? 1224 ARG O O     1 
ATOM   3970  C  CB    . ARG A 1  559 ? 121.926 112.167 150.461 1.00 170.80 ? 1224 ARG O CB    1 
ATOM   3971  C  CG    . ARG A 1  559 ? 120.758 111.252 150.735 1.00 170.80 ? 1224 ARG O CG    1 
ATOM   3972  C  CD    . ARG A 1  559 ? 119.977 110.991 149.465 1.00 170.80 ? 1224 ARG O CD    1 
ATOM   3973  N  NE    . ARG A 1  559 ? 120.798 110.335 148.457 1.00 170.80 ? 1224 ARG O NE    1 
ATOM   3974  C  CZ    . ARG A 1  559 ? 121.001 109.024 148.400 1.00 170.80 ? 1224 ARG O CZ    1 
ATOM   3975  N  NH1   . ARG A 1  559 ? 120.440 108.226 149.300 1.00 170.80 ? 1224 ARG O NH1   1 
ATOM   3976  N  NH2   . ARG A 1  559 ? 121.766 108.511 147.446 1.00 170.80 ? 1224 ARG O NH2   1 
ATOM   3977  N  N     . ALA A 1  560 ? 124.005 114.564 151.184 1.00 158.48 ? 1225 ALA O N     1 
ATOM   3978  C  CA    . ALA A 1  560 ? 125.197 115.260 150.725 1.00 158.48 ? 1225 ALA O CA    1 
ATOM   3979  C  C     . ALA A 1  560 ? 126.297 115.182 151.768 1.00 158.48 ? 1225 ALA O C     1 
ATOM   3980  O  O     . ALA A 1  560 ? 127.403 114.704 151.487 1.00 158.48 ? 1225 ALA O O     1 
ATOM   3981  C  CB    . ALA A 1  560 ? 124.863 116.712 150.392 1.00 147.79 ? 1225 ALA O CB    1 
ATOM   3982  N  N     . TYR A 1  561 ? 126.013 115.618 152.992 1.00 178.86 ? 1226 TYR O N     1 
ATOM   3983  C  CA    . TYR A 1  561 ? 127.090 115.488 153.960 1.00 178.86 ? 1226 TYR O CA    1 
ATOM   3984  C  C     . TYR A 1  561 ? 127.218 114.070 154.499 1.00 178.86 ? 1226 TYR O C     1 
ATOM   3985  O  O     . TYR A 1  561 ? 128.204 113.770 155.181 1.00 178.86 ? 1226 TYR O O     1 
ATOM   3986  C  CB    . TYR A 1  561 ? 126.949 116.516 155.085 1.00 192.32 ? 1226 TYR O CB    1 
ATOM   3987  C  CG    . TYR A 1  561 ? 125.733 116.426 155.959 1.00 192.32 ? 1226 TYR O CG    1 
ATOM   3988  C  CD1   . TYR A 1  561 ? 125.765 115.717 157.149 1.00 192.32 ? 1226 TYR O CD1   1 
ATOM   3989  C  CD2   . TYR A 1  561 ? 124.565 117.084 155.616 1.00 192.32 ? 1226 TYR O CD2   1 
ATOM   3990  C  CE1   . TYR A 1  561 ? 124.661 115.652 157.964 1.00 192.32 ? 1226 TYR O CE1   1 
ATOM   3991  C  CE2   . TYR A 1  561 ? 123.454 117.022 156.421 1.00 192.32 ? 1226 TYR O CE2   1 
ATOM   3992  C  CZ    . TYR A 1  561 ? 123.507 116.305 157.594 1.00 192.32 ? 1226 TYR O CZ    1 
ATOM   3993  O  OH    . TYR A 1  561 ? 122.400 116.242 158.403 1.00 192.32 ? 1226 TYR O OH    1 
ATOM   3994  N  N     . LYS A 1  562 ? 126.264 113.187 154.190 1.00 182.80 ? 1227 LYS O N     1 
ATOM   3995  C  CA    . LYS A 1  562 ? 126.551 111.759 154.233 1.00 182.80 ? 1227 LYS O CA    1 
ATOM   3996  C  C     . LYS A 1  562 ? 127.743 111.450 153.348 1.00 182.80 ? 1227 LYS O C     1 
ATOM   3997  O  O     . LYS A 1  562 ? 128.664 110.730 153.746 1.00 182.80 ? 1227 LYS O O     1 
ATOM   3998  C  CB    . LYS A 1  562 ? 125.348 110.931 153.772 1.00 177.86 ? 1227 LYS O CB    1 
ATOM   3999  C  CG    . LYS A 1  562 ? 124.071 111.014 154.593 1.00 177.86 ? 1227 LYS O CG    1 
ATOM   4000  C  CD    . LYS A 1  562 ? 124.182 110.374 155.957 1.00 177.86 ? 1227 LYS O CD    1 
ATOM   4001  C  CE    . LYS A 1  562 ? 122.804 110.306 156.600 1.00 177.86 ? 1227 LYS O CE    1 
ATOM   4002  N  NZ    . LYS A 1  562 ? 122.236 111.655 156.893 1.00 177.86 ? 1227 LYS O NZ    1 
ATOM   4003  N  N     . LYS A 1  563 ? 127.741 111.991 152.133 1.00 157.35 ? 1228 LYS O N     1 
ATOM   4004  C  CA    . LYS A 1  563 ? 128.917 111.852 151.294 1.00 157.35 ? 1228 LYS O CA    1 
ATOM   4005  C  C     . LYS A 1  563 ? 130.085 112.682 151.804 1.00 157.35 ? 1228 LYS O C     1 
ATOM   4006  O  O     . LYS A 1  563 ? 131.225 112.420 151.416 1.00 157.35 ? 1228 LYS O O     1 
ATOM   4007  C  CB    . LYS A 1  563 ? 128.568 112.211 149.858 1.00 135.23 ? 1228 LYS O CB    1 
ATOM   4008  C  CG    . LYS A 1  563 ? 127.703 111.163 149.198 1.00 135.23 ? 1228 LYS O CG    1 
ATOM   4009  C  CD    . LYS A 1  563 ? 127.299 111.589 147.813 1.00 135.23 ? 1228 LYS O CD    1 
ATOM   4010  C  CE    . LYS A 1  563 ? 126.398 112.807 147.891 1.00 135.23 ? 1228 LYS O CE    1 
ATOM   4011  N  NZ    . LYS A 1  563 ? 125.139 112.502 148.622 1.00 135.23 ? 1228 LYS O NZ    1 
ATOM   4012  N  N     . LEU A 1  564 ? 129.845 113.664 152.677 1.00 173.36 ? 1229 LEU O N     1 
ATOM   4013  C  CA    . LEU A 1  564 ? 130.978 114.256 153.381 1.00 173.36 ? 1229 LEU O CA    1 
ATOM   4014  C  C     . LEU A 1  564 ? 131.575 113.277 154.381 1.00 173.36 ? 1229 LEU O C     1 
ATOM   4015  O  O     . LEU A 1  564 ? 132.774 113.345 154.675 1.00 173.36 ? 1229 LEU O O     1 
ATOM   4016  C  CB    . LEU A 1  564 ? 130.584 115.556 154.077 1.00 157.38 ? 1229 LEU O CB    1 
ATOM   4017  C  CG    . LEU A 1  564 ? 130.274 116.724 153.143 1.00 157.38 ? 1229 LEU O CG    1 
ATOM   4018  C  CD1   . LEU A 1  564 ? 129.869 117.959 153.930 1.00 157.38 ? 1229 LEU O CD1   1 
ATOM   4019  C  CD2   . LEU A 1  564 ? 131.472 117.015 152.265 1.00 157.38 ? 1229 LEU O CD2   1 
ATOM   4020  N  N     . ASP A 1  565 ? 130.763 112.364 154.913 1.00 190.39 ? 1230 ASP O N     1 
ATOM   4021  C  CA    . ASP A 1  565 ? 131.321 111.270 155.698 1.00 190.39 ? 1230 ASP O CA    1 
ATOM   4022  C  C     . ASP A 1  565 ? 131.975 110.217 154.813 1.00 190.39 ? 1230 ASP O C     1 
ATOM   4023  O  O     . ASP A 1  565 ? 132.939 109.572 155.237 1.00 190.39 ? 1230 ASP O O     1 
ATOM   4024  C  CB    . ASP A 1  565 ? 130.239 110.625 156.566 1.00 203.06 ? 1230 ASP O CB    1 
ATOM   4025  C  CG    . ASP A 1  565 ? 129.852 111.485 157.747 1.00 203.06 ? 1230 ASP O CG    1 
ATOM   4026  O  OD1   . ASP A 1  565 ? 130.630 112.395 158.099 1.00 203.06 ? 1230 ASP O OD1   1 
ATOM   4027  O  OD2   . ASP A 1  565 ? 128.771 111.250 158.323 1.00 203.06 ? 1230 ASP O OD2   1 
ATOM   4028  N  N     . ILE A 1  566 ? 131.472 110.029 153.593 1.00 178.37 ? 1231 ILE O N     1 
ATOM   4029  C  CA    . ILE A 1  566 ? 132.052 109.032 152.701 1.00 178.37 ? 1231 ILE O CA    1 
ATOM   4030  C  C     . ILE A 1  566 ? 133.432 109.477 152.240 1.00 178.37 ? 1231 ILE O C     1 
ATOM   4031  O  O     . ILE A 1  566 ? 134.413 108.733 152.341 1.00 178.37 ? 1231 ILE O O     1 
ATOM   4032  C  CB    . ILE A 1  566 ? 131.119 108.775 151.506 1.00 159.50 ? 1231 ILE O CB    1 
ATOM   4033  C  CG1   . ILE A 1  566 ? 129.798 108.170 151.978 1.00 159.50 ? 1231 ILE O CG1   1 
ATOM   4034  C  CG2   . ILE A 1  566 ? 131.789 107.852 150.506 1.00 159.50 ? 1231 ILE O CG2   1 
ATOM   4035  C  CD1   . ILE A 1  566 ? 128.743 108.115 150.900 1.00 159.50 ? 1231 ILE O CD1   1 
ATOM   4036  N  N     . ASP A 1  567 ? 133.528 110.699 151.725 1.00 174.93 ? 1232 ASP O N     1 
ATOM   4037  C  CA    . ASP A 1  567 ? 134.821 111.225 151.325 1.00 174.93 ? 1232 ASP O CA    1 
ATOM   4038  C  C     . ASP A 1  567 ? 135.669 111.618 152.525 1.00 174.93 ? 1232 ASP O C     1 
ATOM   4039  O  O     . ASP A 1  567 ? 136.888 111.761 152.387 1.00 174.93 ? 1232 ASP O O     1 
ATOM   4040  C  CB    . ASP A 1  567 ? 134.615 112.406 150.373 1.00 161.01 ? 1232 ASP O CB    1 
ATOM   4041  C  CG    . ASP A 1  567 ? 133.874 113.572 151.017 1.00 161.01 ? 1232 ASP O CG    1 
ATOM   4042  O  OD1   . ASP A 1  567 ? 133.744 113.607 152.252 1.00 161.01 ? 1232 ASP O OD1   1 
ATOM   4043  O  OD2   . ASP A 1  567 ? 133.399 114.455 150.274 1.00 161.01 ? 1232 ASP O OD2   1 
ATOM   4044  N  N     . GLY A 1  568 ? 135.048 111.801 153.693 1.00 179.46 ? 1233 GLY O N     1 
ATOM   4045  C  CA    . GLY A 1  568 ? 135.818 112.056 154.897 1.00 179.46 ? 1233 GLY O CA    1 
ATOM   4046  C  C     . GLY A 1  568 ? 136.827 110.966 155.193 1.00 179.46 ? 1233 GLY O C     1 
ATOM   4047  O  O     . GLY A 1  568 ? 137.870 111.224 155.799 1.00 179.46 ? 1233 GLY O O     1 
ATOM   4048  N  N     . LYS A 1  569 ? 136.529 109.738 154.783 1.00 179.66 ? 1234 LYS O N     1 
ATOM   4049  C  CA    . LYS A 1  569 ? 137.490 108.647 154.804 1.00 179.66 ? 1234 LYS O CA    1 
ATOM   4050  C  C     . LYS A 1  569 ? 138.239 108.521 153.486 1.00 179.66 ? 1234 LYS O C     1 
ATOM   4051  O  O     . LYS A 1  569 ? 139.047 107.601 153.332 1.00 179.66 ? 1234 LYS O O     1 
ATOM   4052  C  CB    . LYS A 1  569 ? 136.782 107.327 155.122 1.00 161.36 ? 1234 LYS O CB    1 
ATOM   4053  C  CG    . LYS A 1  569 ? 136.195 107.255 156.518 1.00 161.36 ? 1234 LYS O CG    1 
ATOM   4054  C  CD    . LYS A 1  569 ? 135.549 105.904 156.756 1.00 161.36 ? 1234 LYS O CD    1 
ATOM   4055  C  CE    . LYS A 1  569 ? 134.336 105.690 155.869 1.00 161.36 ? 1234 LYS O CE    1 
ATOM   4056  N  NZ    . LYS A 1  569 ? 133.240 106.630 156.216 1.00 161.36 ? 1234 LYS O NZ    1 
ATOM   4057  N  N     . VAL A 1  570 ? 137.984 109.415 152.532 1.00 176.30 ? 1235 VAL O N     1 
ATOM   4058  C  CA    . VAL A 1  570 ? 138.616 109.341 151.221 1.00 176.30 ? 1235 VAL O CA    1 
ATOM   4059  C  C     . VAL A 1  570 ? 139.400 110.622 150.958 1.00 176.30 ? 1235 VAL O C     1 
ATOM   4060  O  O     . VAL A 1  570 ? 140.635 110.632 151.035 1.00 176.30 ? 1235 VAL O O     1 
ATOM   4061  C  CB    . VAL A 1  570 ? 137.570 109.100 150.117 1.00 168.72 ? 1235 VAL O CB    1 
ATOM   4062  C  CG1   . VAL A 1  570 ? 138.231 109.081 148.748 1.00 168.72 ? 1235 VAL O CG1   1 
ATOM   4063  C  CG2   . VAL A 1  570 ? 136.812 107.808 150.365 1.00 168.72 ? 1235 VAL O CG2   1 
ATOM   4064  N  N     . ILE A 1  571 ? 138.693 111.712 150.649 1.00 178.68 ? 1236 ILE O N     1 
ATOM   4065  C  CA    . ILE A 1  571 ? 139.387 112.944 150.282 1.00 178.68 ? 1236 ILE O CA    1 
ATOM   4066  C  C     . ILE A 1  571 ? 139.861 113.691 151.519 1.00 178.68 ? 1236 ILE O C     1 
ATOM   4067  O  O     . ILE A 1  571 ? 140.788 114.501 151.439 1.00 178.68 ? 1236 ILE O O     1 
ATOM   4068  C  CB    . ILE A 1  571 ? 138.502 113.844 149.407 1.00 168.36 ? 1236 ILE O CB    1 
ATOM   4069  C  CG1   . ILE A 1  571 ? 137.347 114.416 150.220 1.00 168.36 ? 1236 ILE O CG1   1 
ATOM   4070  C  CG2   . ILE A 1  571 ? 137.965 113.059 148.226 1.00 168.36 ? 1236 ILE O CG2   1 
ATOM   4071  C  CD1   . ILE A 1  571 ? 136.554 115.462 149.484 1.00 168.36 ? 1236 ILE O CD1   1 
ATOM   4072  N  N     . GLN A 1  572 ? 139.221 113.475 152.665 1.00 178.86 ? 1237 GLN O N     1 
ATOM   4073  C  CA    . GLN A 1  572 ? 139.825 113.925 153.906 1.00 178.86 ? 1237 GLN O CA    1 
ATOM   4074  C  C     . GLN A 1  572 ? 140.901 112.961 154.370 1.00 178.86 ? 1237 GLN O C     1 
ATOM   4075  O  O     . GLN A 1  572 ? 141.721 113.323 155.220 1.00 178.86 ? 1237 GLN O O     1 
ATOM   4076  C  CB    . GLN A 1  572 ? 138.767 114.097 154.996 1.00 164.62 ? 1237 GLN O CB    1 
ATOM   4077  C  CG    . GLN A 1  572 ? 137.736 115.178 154.707 1.00 164.62 ? 1237 GLN O CG    1 
ATOM   4078  C  CD    . GLN A 1  572 ? 136.741 115.347 155.835 1.00 164.62 ? 1237 GLN O CD    1 
ATOM   4079  O  OE1   . GLN A 1  572 ? 136.561 114.455 156.661 1.00 164.62 ? 1237 GLN O OE1   1 
ATOM   4080  N  NE2   . GLN A 1  572 ? 136.083 116.496 155.871 1.00 164.62 ? 1237 GLN O NE2   1 
ATOM   4081  N  N     . ALA A 1  573 ? 140.899 111.740 153.837 1.00 184.94 ? 1238 ALA O N     1 
ATOM   4082  C  CA    . ALA A 1  573 ? 142.055 110.867 153.972 1.00 184.94 ? 1238 ALA O CA    1 
ATOM   4083  C  C     . ALA A 1  573 ? 143.144 111.258 152.983 1.00 184.94 ? 1238 ALA O C     1 
ATOM   4084  O  O     . ALA A 1  573 ? 144.330 111.258 153.326 1.00 184.94 ? 1238 ALA O O     1 
ATOM   4085  C  CB    . ALA A 1  573 ? 141.640 109.411 153.772 1.00 171.13 ? 1238 ALA O CB    1 
ATOM   4086  N  N     . GLY A 1  574 ? 142.762 111.618 151.757 1.00 188.02 ? 1239 GLY O N     1 
ATOM   4087  C  CA    . GLY A 1  574 ? 143.754 111.977 150.764 1.00 188.02 ? 1239 GLY O CA    1 
ATOM   4088  C  C     . GLY A 1  574 ? 144.296 113.386 150.873 1.00 188.02 ? 1239 GLY O C     1 
ATOM   4089  O  O     . GLY A 1  574 ? 145.333 113.680 150.273 1.00 188.02 ? 1239 GLY O O     1 
ATOM   4090  N  N     . LYS A 1  575 ? 143.637 114.264 151.634 1.00 187.63 ? 1240 LYS O N     1 
ATOM   4091  C  CA    . LYS A 1  575 ? 143.969 115.684 151.540 1.00 187.63 ? 1240 LYS O CA    1 
ATOM   4092  C  C     . LYS A 1  575 ? 145.245 116.039 152.296 1.00 187.63 ? 1240 LYS O C     1 
ATOM   4093  O  O     . LYS A 1  575 ? 146.045 116.847 151.813 1.00 187.63 ? 1240 LYS O O     1 
ATOM   4094  C  CB    . LYS A 1  575 ? 142.817 116.558 152.048 1.00 171.87 ? 1240 LYS O CB    1 
ATOM   4095  C  CG    . LYS A 1  575 ? 142.440 116.358 153.506 1.00 171.87 ? 1240 LYS O CG    1 
ATOM   4096  C  CD    . LYS A 1  575 ? 141.507 117.461 153.993 1.00 171.87 ? 1240 LYS O CD    1 
ATOM   4097  C  CE    . LYS A 1  575 ? 140.193 117.471 153.244 1.00 171.87 ? 1240 LYS O CE    1 
ATOM   4098  N  NZ    . LYS A 1  575 ? 139.275 118.521 153.767 1.00 171.87 ? 1240 LYS O NZ    1 
ATOM   4099  N  N     . PHE A 1  576 ? 145.457 115.452 153.468 1.00 178.88 ? 1241 PHE O N     1 
ATOM   4100  C  CA    . PHE A 1  576 ? 146.464 115.949 154.395 1.00 178.88 ? 1241 PHE O CA    1 
ATOM   4101  C  C     . PHE A 1  576 ? 147.862 115.445 154.091 1.00 178.88 ? 1241 PHE O C     1 
ATOM   4102  O  O     . PHE A 1  576 ? 148.785 115.744 154.852 1.00 178.88 ? 1241 PHE O O     1 
ATOM   4103  C  CB    . PHE A 1  576 ? 146.096 115.562 155.824 1.00 182.16 ? 1241 PHE O CB    1 
ATOM   4104  C  CG    . PHE A 1  576 ? 145.911 114.093 156.013 1.00 182.16 ? 1241 PHE O CG    1 
ATOM   4105  C  CD1   . PHE A 1  576 ? 146.998 113.269 156.240 1.00 182.16 ? 1241 PHE O CD1   1 
ATOM   4106  C  CD2   . PHE A 1  576 ? 144.649 113.532 155.967 1.00 182.16 ? 1241 PHE O CD2   1 
ATOM   4107  C  CE1   . PHE A 1  576 ? 146.828 111.914 156.409 1.00 182.16 ? 1241 PHE O CE1   1 
ATOM   4108  C  CE2   . PHE A 1  576 ? 144.473 112.181 156.148 1.00 182.16 ? 1241 PHE O CE2   1 
ATOM   4109  C  CZ    . PHE A 1  576 ? 145.562 111.371 156.366 1.00 182.16 ? 1241 PHE O CZ    1 
ATOM   4110  N  N     . ASP A 1  577 ? 148.044 114.688 153.020 1.00 175.74 ? 1242 ASP O N     1 
ATOM   4111  C  CA    . ASP A 1  577 ? 149.313 114.025 152.754 1.00 175.74 ? 1242 ASP O CA    1 
ATOM   4112  C  C     . ASP A 1  577 ? 150.053 114.856 151.713 1.00 175.74 ? 1242 ASP O C     1 
ATOM   4113  O  O     . ASP A 1  577 ? 149.729 114.820 150.524 1.00 175.74 ? 1242 ASP O O     1 
ATOM   4114  C  CB    . ASP A 1  577 ? 149.047 112.601 152.283 1.00 156.98 ? 1242 ASP O CB    1 
ATOM   4115  C  CG    . ASP A 1  577 ? 150.288 111.757 152.236 1.00 156.98 ? 1242 ASP O CG    1 
ATOM   4116  O  OD1   . ASP A 1  577 ? 151.390 112.273 152.519 1.00 156.98 ? 1242 ASP O OD1   1 
ATOM   4117  O  OD2   . ASP A 1  577 ? 150.143 110.557 151.937 1.00 156.98 ? 1242 ASP O OD2   1 
ATOM   4118  N  N     . ASN A 1  578 ? 151.066 115.591 152.167 1.00 169.77 ? 1243 ASN O N     1 
ATOM   4119  C  CA    . ASN A 1  578 ? 151.831 116.487 151.310 1.00 169.77 ? 1243 ASN O CA    1 
ATOM   4120  C  C     . ASN A 1  578 ? 153.326 116.293 151.532 1.00 169.77 ? 1243 ASN O C     1 
ATOM   4121  O  O     . ASN A 1  578 ? 154.050 115.848 150.634 1.00 169.77 ? 1243 ASN O O     1 
ATOM   4122  C  CB    . ASN A 1  578 ? 151.433 117.941 151.572 1.00 140.02 ? 1243 ASN O CB    1 
ATOM   4123  N  N     . LYS A 1  579 ? 153.792 116.645 152.728 1.00 176.63 ? 1244 LYS O N     1 
ATOM   4124  C  CA    . LYS A 1  579 ? 155.163 116.410 153.154 1.00 176.63 ? 1244 LYS O CA    1 
ATOM   4125  C  C     . LYS A 1  579 ? 155.328 115.091 153.895 1.00 176.63 ? 1244 LYS O C     1 
ATOM   4126  O  O     . LYS A 1  579 ? 156.422 114.819 154.399 1.00 176.63 ? 1244 LYS O O     1 
ATOM   4127  C  CB    . LYS A 1  579 ? 155.641 117.555 154.048 1.00 158.63 ? 1244 LYS O CB    1 
ATOM   4128  C  CG    . LYS A 1  579 ? 155.594 118.913 153.393 1.00 158.63 ? 1244 LYS O CG    1 
ATOM   4129  C  CD    . LYS A 1  579 ? 156.609 119.010 152.275 1.00 158.63 ? 1244 LYS O CD    1 
ATOM   4130  C  CE    . LYS A 1  579 ? 156.650 120.412 151.694 1.00 158.63 ? 1244 LYS O CE    1 
ATOM   4131  N  NZ    . LYS A 1  579 ? 155.394 120.747 150.970 1.00 158.63 ? 1244 LYS O NZ    1 
ATOM   4132  N  N     . SER A 1  580 ? 154.271 114.279 153.981 1.00 202.86 ? 1245 SER O N     1 
ATOM   4133  C  CA    . SER A 1  580 ? 154.268 113.008 154.711 1.00 202.86 ? 1245 SER O CA    1 
ATOM   4134  C  C     . SER A 1  580 ? 154.599 113.229 156.193 1.00 202.86 ? 1245 SER O C     1 
ATOM   4135  O  O     . SER A 1  580 ? 155.672 112.887 156.694 1.00 202.86 ? 1245 SER O O     1 
ATOM   4136  C  CB    . SER A 1  580 ? 155.219 111.994 154.058 1.00 178.96 ? 1245 SER O CB    1 
ATOM   4137  O  OG    . SER A 1  580 ? 156.566 112.432 154.097 1.00 178.96 ? 1245 SER O OG    1 
ATOM   4138  N  N     . THR A 1  581 ? 153.619 113.810 156.884 1.00 206.08 ? 1246 THR O N     1 
ATOM   4139  C  CA    . THR A 1  581 ? 153.748 114.196 158.284 1.00 206.08 ? 1246 THR O CA    1 
ATOM   4140  C  C     . THR A 1  581 ? 153.640 112.966 159.187 1.00 206.08 ? 1246 THR O C     1 
ATOM   4141  O  O     . THR A 1  581 ? 153.670 111.820 158.730 1.00 206.08 ? 1246 THR O O     1 
ATOM   4142  C  CB    . THR A 1  581 ? 152.696 115.245 158.633 1.00 194.73 ? 1246 THR O CB    1 
ATOM   4143  O  OG1   . THR A 1  581 ? 151.388 114.704 158.410 1.00 194.73 ? 1246 THR O OG1   1 
ATOM   4144  C  CG2   . THR A 1  581 ? 152.874 116.478 157.761 1.00 194.73 ? 1246 THR O CG2   1 
ATOM   4145  N  N     . SER A 1  582 ? 153.536 113.195 160.499 1.00 204.34 ? 1247 SER O N     1 
ATOM   4146  C  CA    . SER A 1  582 ? 153.429 112.102 161.464 1.00 204.34 ? 1247 SER O CA    1 
ATOM   4147  C  C     . SER A 1  582 ? 152.120 112.172 162.239 1.00 204.34 ? 1247 SER O C     1 
ATOM   4148  O  O     . SER A 1  582 ? 151.231 111.350 162.004 1.00 204.34 ? 1247 SER O O     1 
ATOM   4149  C  CB    . SER A 1  582 ? 154.627 112.116 162.413 1.00 172.62 ? 1247 SER O CB    1 
ATOM   4150  O  OG    . SER A 1  582 ? 154.622 113.280 163.223 1.00 172.62 ? 1247 SER O OG    1 
ATOM   4151  N  N     . GLU A 1  583 ? 151.969 113.125 163.158 1.00 202.71 ? 1248 GLU O N     1 
ATOM   4152  C  CA    . GLU A 1  583 ? 150.839 113.145 164.077 1.00 202.71 ? 1248 GLU O CA    1 
ATOM   4153  C  C     . GLU A 1  583 ? 149.631 113.909 163.559 1.00 202.71 ? 1248 GLU O C     1 
ATOM   4154  O  O     . GLU A 1  583 ? 148.579 113.872 164.206 1.00 202.71 ? 1248 GLU O O     1 
ATOM   4155  C  CB    . GLU A 1  583 ? 151.261 113.739 165.424 1.00 194.58 ? 1248 GLU O CB    1 
ATOM   4156  C  CG    . GLU A 1  583 ? 152.223 112.862 166.182 1.00 194.58 ? 1248 GLU O CG    1 
ATOM   4157  C  CD    . GLU A 1  583 ? 151.644 111.490 166.446 1.00 194.58 ? 1248 GLU O CD    1 
ATOM   4158  O  OE1   . GLU A 1  583 ? 150.437 111.405 166.762 1.00 194.58 ? 1248 GLU O OE1   1 
ATOM   4159  O  OE2   . GLU A 1  583 ? 152.391 110.497 166.328 1.00 194.58 ? 1248 GLU O OE2   1 
ATOM   4160  N  N     . GLU A 1  584 ? 149.746 114.602 162.426 1.00 207.96 ? 1249 GLU O N     1 
ATOM   4161  C  CA    . GLU A 1  584 ? 148.603 115.350 161.915 1.00 207.96 ? 1249 GLU O CA    1 
ATOM   4162  C  C     . GLU A 1  584 ? 147.452 114.415 161.567 1.00 207.96 ? 1249 GLU O C     1 
ATOM   4163  O  O     . GLU A 1  584 ? 146.278 114.765 161.744 1.00 207.96 ? 1249 GLU O O     1 
ATOM   4164  C  CB    . GLU A 1  584 ? 149.019 116.174 160.696 1.00 199.25 ? 1249 GLU O CB    1 
ATOM   4165  C  CG    . GLU A 1  584 ? 150.062 117.242 160.989 1.00 199.25 ? 1249 GLU O CG    1 
ATOM   4166  C  CD    . GLU A 1  584 ? 150.467 118.013 159.747 1.00 199.25 ? 1249 GLU O CD    1 
ATOM   4167  O  OE1   . GLU A 1  584 ? 150.037 117.626 158.641 1.00 199.25 ? 1249 GLU O OE1   1 
ATOM   4168  O  OE2   . GLU A 1  584 ? 151.221 119.000 159.874 1.00 199.25 ? 1249 GLU O OE2   1 
ATOM   4169  N  N     . GLN A 1  585 ? 147.769 113.213 161.084 1.00 216.29 ? 1250 GLN O N     1 
ATOM   4170  C  CA    . GLN A 1  585 ? 146.719 112.275 160.711 1.00 216.29 ? 1250 GLN O CA    1 
ATOM   4171  C  C     . GLN A 1  585 ? 145.960 111.769 161.932 1.00 216.29 ? 1250 GLN O C     1 
ATOM   4172  O  O     . GLN A 1  585 ? 144.748 111.538 161.851 1.00 216.29 ? 1250 GLN O O     1 
ATOM   4173  C  CB    . GLN A 1  585 ? 147.318 111.120 159.908 1.00 202.06 ? 1250 GLN O CB    1 
ATOM   4174  C  CG    . GLN A 1  585 ? 148.334 110.280 160.652 1.00 202.06 ? 1250 GLN O CG    1 
ATOM   4175  C  CD    . GLN A 1  585 ? 148.952 109.208 159.778 1.00 202.06 ? 1250 GLN O CD    1 
ATOM   4176  O  OE1   . GLN A 1  585 ? 148.966 109.321 158.552 1.00 202.06 ? 1250 GLN O OE1   1 
ATOM   4177  N  NE2   . GLN A 1  585 ? 149.457 108.151 160.404 1.00 202.06 ? 1250 GLN O NE2   1 
ATOM   4178  N  N     . GLU A 1  586 ? 146.639 111.609 163.070 1.00 218.23 ? 1251 GLU O N     1 
ATOM   4179  C  CA    . GLU A 1  586 ? 145.930 111.275 164.300 1.00 218.23 ? 1251 GLU O CA    1 
ATOM   4180  C  C     . GLU A 1  586 ? 145.229 112.489 164.893 1.00 218.23 ? 1251 GLU O C     1 
ATOM   4181  O  O     . GLU A 1  586 ? 144.252 112.332 165.632 1.00 218.23 ? 1251 GLU O O     1 
ATOM   4182  C  CB    . GLU A 1  586 ? 146.886 110.666 165.327 1.00 212.47 ? 1251 GLU O CB    1 
ATOM   4183  C  CG    . GLU A 1  586 ? 147.458 109.325 164.920 1.00 212.47 ? 1251 GLU O CG    1 
ATOM   4184  C  CD    . GLU A 1  586 ? 148.677 109.466 164.041 1.00 212.47 ? 1251 GLU O CD    1 
ATOM   4185  O  OE1   . GLU A 1  586 ? 149.046 110.613 163.722 1.00 212.47 ? 1251 GLU O OE1   1 
ATOM   4186  O  OE2   . GLU A 1  586 ? 149.268 108.432 163.667 1.00 212.47 ? 1251 GLU O OE2   1 
ATOM   4187  N  N     . ALA A 1  587 ? 145.719 113.696 164.598 1.00 215.76 ? 1252 ALA O N     1 
ATOM   4188  C  CA    . ALA A 1  587 ? 144.959 114.893 164.933 1.00 215.76 ? 1252 ALA O CA    1 
ATOM   4189  C  C     . ALA A 1  587 ? 143.622 114.894 164.209 1.00 215.76 ? 1252 ALA O C     1 
ATOM   4190  O  O     . ALA A 1  587 ? 142.589 115.249 164.789 1.00 215.76 ? 1252 ALA O O     1 
ATOM   4191  C  CB    . ALA A 1  587 ? 145.762 116.147 164.590 1.00 173.33 ? 1252 ALA O CB    1 
ATOM   4192  N  N     . LEU A 1  588 ? 143.619 114.481 162.940 1.00 214.89 ? 1253 LEU O N     1 
ATOM   4193  C  CA    . LEU A 1  588 ? 142.356 114.324 162.233 1.00 214.89 ? 1253 LEU O CA    1 
ATOM   4194  C  C     . LEU A 1  588 ? 141.569 113.128 162.748 1.00 214.89 ? 1253 LEU O C     1 
ATOM   4195  O  O     . LEU A 1  588 ? 140.334 113.135 162.694 1.00 214.89 ? 1253 LEU O O     1 
ATOM   4196  C  CB    . LEU A 1  588 ? 142.599 114.201 160.733 1.00 188.61 ? 1253 LEU O CB    1 
ATOM   4197  C  CG    . LEU A 1  588 ? 143.124 115.481 160.086 1.00 188.61 ? 1253 LEU O CG    1 
ATOM   4198  C  CD1   . LEU A 1  588 ? 143.413 115.265 158.612 1.00 188.61 ? 1253 LEU O CD1   1 
ATOM   4199  C  CD2   . LEU A 1  588 ? 142.127 116.615 160.286 1.00 188.61 ? 1253 LEU O CD2   1 
ATOM   4200  N  N     . LEU A 1  589 ? 142.251 112.098 163.249 1.00 224.51 ? 1254 LEU O N     1 
ATOM   4201  C  CA    . LEU A 1  589 ? 141.534 110.990 163.870 1.00 224.51 ? 1254 LEU O CA    1 
ATOM   4202  C  C     . LEU A 1  589 ? 140.735 111.468 165.074 1.00 224.51 ? 1254 LEU O C     1 
ATOM   4203  O  O     . LEU A 1  589 ? 139.522 111.249 165.156 1.00 224.51 ? 1254 LEU O O     1 
ATOM   4204  C  CB    . LEU A 1  589 ? 142.508 109.883 164.275 1.00 212.49 ? 1254 LEU O CB    1 
ATOM   4205  C  CG    . LEU A 1  589 ? 143.170 109.100 163.141 1.00 212.49 ? 1254 LEU O CG    1 
ATOM   4206  C  CD1   . LEU A 1  589 ? 144.223 108.137 163.673 1.00 212.49 ? 1254 LEU O CD1   1 
ATOM   4207  C  CD2   . LEU A 1  589 ? 142.115 108.352 162.343 1.00 212.49 ? 1254 LEU O CD2   1 
ATOM   4208  N  N     . ARG A 1  590 ? 141.399 112.135 166.018 1.00 218.43 ? 1255 ARG O N     1 
ATOM   4209  C  CA    . ARG A 1  590 ? 140.729 112.522 167.255 1.00 218.43 ? 1255 ARG O CA    1 
ATOM   4210  C  C     . ARG A 1  590 ? 139.769 113.687 167.034 1.00 218.43 ? 1255 ARG O C     1 
ATOM   4211  O  O     . ARG A 1  590 ? 138.591 113.605 167.394 1.00 218.43 ? 1255 ARG O O     1 
ATOM   4212  C  CB    . ARG A 1  590 ? 141.771 112.843 168.334 1.00 210.16 ? 1255 ARG O CB    1 
ATOM   4213  C  CG    . ARG A 1  590 ? 142.758 113.949 167.986 1.00 210.16 ? 1255 ARG O CG    1 
ATOM   4214  C  CD    . ARG A 1  590 ? 143.773 114.140 169.092 1.00 210.16 ? 1255 ARG O CD    1 
ATOM   4215  N  NE    . ARG A 1  590 ? 144.616 112.960 169.242 1.00 210.16 ? 1255 ARG O NE    1 
ATOM   4216  C  CZ    . ARG A 1  590 ? 145.724 112.745 168.544 1.00 210.16 ? 1255 ARG O CZ    1 
ATOM   4217  N  NH1   . ARG A 1  590 ? 146.127 113.639 167.655 1.00 210.16 ? 1255 ARG O NH1   1 
ATOM   4218  N  NH2   . ARG A 1  590 ? 146.433 111.643 168.741 1.00 210.16 ? 1255 ARG O NH2   1 
ATOM   4219  N  N     . SER A 1  591 ? 140.244 114.771 166.420 1.00 219.47 ? 1256 SER O N     1 
ATOM   4220  C  CA    . SER A 1  591 ? 139.404 115.952 166.259 1.00 219.47 ? 1256 SER O CA    1 
ATOM   4221  C  C     . SER A 1  591 ? 138.393 115.764 165.135 1.00 219.47 ? 1256 SER O C     1 
ATOM   4222  O  O     . SER A 1  591 ? 137.199 116.042 165.308 1.00 219.47 ? 1256 SER O O     1 
ATOM   4223  C  CB    . SER A 1  591 ? 140.278 117.182 166.011 1.00 206.56 ? 1256 SER O CB    1 
ATOM   4224  O  OG    . SER A 1  591 ? 141.086 117.472 167.141 1.00 206.56 ? 1256 SER O OG    1 
ATOM   4225  N  N     . LEU A 1  592 ? 138.851 115.290 163.974 1.00 221.29 ? 1257 LEU O N     1 
ATOM   4226  C  CA    . LEU A 1  592 ? 137.912 114.992 162.900 1.00 221.29 ? 1257 LEU O CA    1 
ATOM   4227  C  C     . LEU A 1  592 ? 136.911 113.938 163.344 1.00 221.29 ? 1257 LEU O C     1 
ATOM   4228  O  O     . LEU A 1  592 ? 135.704 114.100 163.153 1.00 221.29 ? 1257 LEU O O     1 
ATOM   4229  C  CB    . LEU A 1  592 ? 138.649 114.539 161.642 1.00 197.33 ? 1257 LEU O CB    1 
ATOM   4230  C  CG    . LEU A 1  592 ? 137.733 114.136 160.484 1.00 197.33 ? 1257 LEU O CG    1 
ATOM   4231  C  CD1   . LEU A 1  592 ? 136.883 115.315 160.044 1.00 197.33 ? 1257 LEU O CD1   1 
ATOM   4232  C  CD2   . LEU A 1  592 ? 138.531 113.583 159.316 1.00 197.33 ? 1257 LEU O CD2   1 
ATOM   4233  N  N     . LEU A 1  593 ? 137.390 112.859 163.970 1.00 217.18 ? 1258 LEU O N     1 
ATOM   4234  C  CA    . LEU A 1  593 ? 136.455 111.862 164.480 1.00 217.18 ? 1258 LEU O CA    1 
ATOM   4235  C  C     . LEU A 1  593 ? 135.519 112.466 165.522 1.00 217.18 ? 1258 LEU O C     1 
ATOM   4236  O  O     . LEU A 1  593 ? 134.404 111.970 165.712 1.00 217.18 ? 1258 LEU O O     1 
ATOM   4237  C  CB    . LEU A 1  593 ? 137.209 110.664 165.058 1.00 202.10 ? 1258 LEU O CB    1 
ATOM   4238  C  CG    . LEU A 1  593 ? 136.363 109.505 165.595 1.00 202.10 ? 1258 LEU O CG    1 
ATOM   4239  C  CD1   . LEU A 1  593 ? 135.595 108.805 164.471 1.00 202.10 ? 1258 LEU O CD1   1 
ATOM   4240  C  CD2   . LEU A 1  593 ? 137.216 108.521 166.384 1.00 202.10 ? 1258 LEU O CD2   1 
ATOM   4241  N  N     . ASP A 1  594 ? 135.942 113.544 166.195 1.00 221.74 ? 1259 ASP O N     1 
ATOM   4242  C  CA    . ASP A 1  594 ? 135.001 114.313 167.006 1.00 221.74 ? 1259 ASP O CA    1 
ATOM   4243  C  C     . ASP A 1  594 ? 133.989 115.051 166.139 1.00 221.74 ? 1259 ASP O C     1 
ATOM   4244  O  O     . ASP A 1  594 ? 132.878 115.340 166.601 1.00 221.74 ? 1259 ASP O O     1 
ATOM   4245  C  CB    . ASP A 1  594 ? 135.737 115.314 167.898 1.00 219.83 ? 1259 ASP O CB    1 
ATOM   4246  C  CG    . ASP A 1  594 ? 136.486 114.649 169.028 1.00 219.83 ? 1259 ASP O CG    1 
ATOM   4247  O  OD1   . ASP A 1  594 ? 136.183 113.477 169.328 1.00 219.83 ? 1259 ASP O OD1   1 
ATOM   4248  O  OD2   . ASP A 1  594 ? 137.391 115.292 169.602 1.00 219.83 ? 1259 ASP O OD2   1 
ATOM   4249  N  N     . ALA A 1  595 ? 134.355 115.384 164.894 1.00 222.65 ? 1260 ALA O N     1 
ATOM   4250  C  CA    . ALA A 1  595 ? 133.396 116.019 163.990 1.00 222.65 ? 1260 ALA O CA    1 
ATOM   4251  C  C     . ALA A 1  595 ? 132.387 115.013 163.440 1.00 222.65 ? 1260 ALA O C     1 
ATOM   4252  O  O     . ALA A 1  595 ? 131.173 115.249 163.496 1.00 222.65 ? 1260 ALA O O     1 
ATOM   4253  C  CB    . ALA A 1  595 ? 134.125 116.729 162.846 1.00 194.53 ? 1260 ALA O CB    1 
ATOM   4254  N  N     . GLU A 1  596 ? 132.864 113.882 162.906 1.00 224.73 ? 1261 GLU O N     1 
ATOM   4255  C  CA    . GLU A 1  596 ? 131.933 112.856 162.455 1.00 224.73 ? 1261 GLU O CA    1 
ATOM   4256  C  C     . GLU A 1  596 ? 131.082 112.347 163.609 1.00 224.73 ? 1261 GLU O C     1 
ATOM   4257  O  O     . GLU A 1  596 ? 129.873 112.148 163.453 1.00 224.73 ? 1261 GLU O O     1 
ATOM   4258  C  CB    . GLU A 1  596 ? 132.660 111.696 161.765 1.00 216.93 ? 1261 GLU O CB    1 
ATOM   4259  C  CG    . GLU A 1  596 ? 133.163 111.992 160.349 1.00 216.93 ? 1261 GLU O CG    1 
ATOM   4260  C  CD    . GLU A 1  596 ? 134.635 112.327 160.283 1.00 216.93 ? 1261 GLU O CD    1 
ATOM   4261  O  OE1   . GLU A 1  596 ? 135.299 112.265 161.332 1.00 216.93 ? 1261 GLU O OE1   1 
ATOM   4262  O  OE2   . GLU A 1  596 ? 135.128 112.641 159.182 1.00 216.93 ? 1261 GLU O OE2   1 
ATOM   4263  N  N     . GLU A 1  597 ? 131.686 112.156 164.782 1.00 234.54 ? 1262 GLU O N     1 
ATOM   4264  C  CA    . GLU A 1  597 ? 130.894 111.805 165.957 1.00 234.54 ? 1262 GLU O CA    1 
ATOM   4265  C  C     . GLU A 1  597 ? 129.924 112.923 166.315 1.00 234.54 ? 1262 GLU O C     1 
ATOM   4266  O  O     . GLU A 1  597 ? 128.839 112.658 166.843 1.00 234.54 ? 1262 GLU O O     1 
ATOM   4267  C  CB    . GLU A 1  597 ? 131.817 111.482 167.137 1.00 228.01 ? 1262 GLU O CB    1 
ATOM   4268  C  CG    . GLU A 1  597 ? 131.120 110.953 168.389 1.00 228.01 ? 1262 GLU O CG    1 
ATOM   4269  C  CD    . GLU A 1  597 ? 130.504 112.046 169.235 1.00 228.01 ? 1262 GLU O CD    1 
ATOM   4270  O  OE1   . GLU A 1  597 ? 130.967 113.202 169.147 1.00 228.01 ? 1262 GLU O OE1   1 
ATOM   4271  O  OE2   . GLU A 1  597 ? 129.548 111.756 169.984 1.00 228.01 ? 1262 GLU O OE2   1 
ATOM   4272  N  N     . GLU A 1  598 ? 130.290 114.174 166.026 1.00 229.28 ? 1263 GLU O N     1 
ATOM   4273  C  CA    . GLU A 1  598 ? 129.400 115.294 166.311 1.00 229.28 ? 1263 GLU O CA    1 
ATOM   4274  C  C     . GLU A 1  598 ? 128.158 115.250 165.426 1.00 229.28 ? 1263 GLU O C     1 
ATOM   4275  O  O     . GLU A 1  598 ? 127.039 115.499 165.899 1.00 229.28 ? 1263 GLU O O     1 
ATOM   4276  C  CB    . GLU A 1  598 ? 130.159 116.610 166.139 1.00 217.14 ? 1263 GLU O CB    1 
ATOM   4277  C  CG    . GLU A 1  598 ? 129.363 117.851 166.479 1.00 217.14 ? 1263 GLU O CG    1 
ATOM   4278  C  CD    . GLU A 1  598 ? 130.191 119.115 166.366 1.00 217.14 ? 1263 GLU O CD    1 
ATOM   4279  O  OE1   . GLU A 1  598 ? 131.381 119.007 166.003 1.00 217.14 ? 1263 GLU O OE1   1 
ATOM   4280  O  OE2   . GLU A 1  598 ? 129.654 120.211 166.636 1.00 217.14 ? 1263 GLU O OE2   1 
ATOM   4281  N  N     . ARG A 1  599 ? 128.322 114.922 164.144 1.00 223.96 ? 1264 ARG O N     1 
ATOM   4282  C  CA    . ARG A 1  599 ? 127.130 114.740 163.328 1.00 223.96 ? 1264 ARG O CA    1 
ATOM   4283  C  C     . ARG A 1  599 ? 126.429 113.419 163.616 1.00 223.96 ? 1264 ARG O C     1 
ATOM   4284  O  O     . ARG A 1  599 ? 125.247 113.279 163.282 1.00 223.96 ? 1264 ARG O O     1 
ATOM   4285  C  CB    . ARG A 1  599 ? 127.453 114.863 161.838 1.00 203.93 ? 1264 ARG O CB    1 
ATOM   4286  C  CG    . ARG A 1  599 ? 128.448 113.872 161.296 1.00 203.93 ? 1264 ARG O CG    1 
ATOM   4287  C  CD    . ARG A 1  599 ? 128.617 114.088 159.804 1.00 203.93 ? 1264 ARG O CD    1 
ATOM   4288  N  NE    . ARG A 1  599 ? 129.156 115.407 159.491 1.00 203.93 ? 1264 ARG O NE    1 
ATOM   4289  C  CZ    . ARG A 1  599 ? 130.452 115.690 159.454 1.00 203.93 ? 1264 ARG O CZ    1 
ATOM   4290  N  NH1   . ARG A 1  599 ? 130.859 116.917 159.159 1.00 203.93 ? 1264 ARG O NH1   1 
ATOM   4291  N  NH2   . ARG A 1  599 ? 131.343 114.744 159.712 1.00 203.93 ? 1264 ARG O NH2   1 
ATOM   4292  N  N     . ARG A 1  600 ? 127.116 112.459 164.240 1.00 226.66 ? 1265 ARG O N     1 
ATOM   4293  C  CA    . ARG A 1  600 ? 126.411 111.308 164.793 1.00 226.66 ? 1265 ARG O CA    1 
ATOM   4294  C  C     . ARG A 1  600 ? 125.466 111.751 165.900 1.00 226.66 ? 1265 ARG O C     1 
ATOM   4295  O  O     . ARG A 1  600 ? 124.309 111.319 165.957 1.00 226.66 ? 1265 ARG O O     1 
ATOM   4296  C  CB    . ARG A 1  600 ? 127.404 110.265 165.311 1.00 217.26 ? 1265 ARG O CB    1 
ATOM   4297  C  CG    . ARG A 1  600 ? 128.303 109.685 164.239 1.00 217.26 ? 1265 ARG O CG    1 
ATOM   4298  C  CD    . ARG A 1  600 ? 127.503 108.944 163.189 1.00 217.26 ? 1265 ARG O CD    1 
ATOM   4299  N  NE    . ARG A 1  600 ? 128.356 108.430 162.126 1.00 217.26 ? 1265 ARG O NE    1 
ATOM   4300  C  CZ    . ARG A 1  600 ? 127.897 107.936 160.981 1.00 217.26 ? 1265 ARG O CZ    1 
ATOM   4301  N  NH1   . ARG A 1  600 ? 126.592 107.891 160.757 1.00 217.26 ? 1265 ARG O NH1   1 
ATOM   4302  N  NH2   . ARG A 1  600 ? 128.741 107.488 160.062 1.00 217.26 ? 1265 ARG O NH2   1 
ATOM   4303  N  N     . LYS A 1  601 ? 125.948 112.622 166.791 1.00 224.81 ? 1266 LYS O N     1 
ATOM   4304  C  CA    . LYS A 1  601 ? 125.059 113.294 167.732 1.00 224.81 ? 1266 LYS O CA    1 
ATOM   4305  C  C     . LYS A 1  601 ? 123.893 113.942 167.002 1.00 224.81 ? 1266 LYS O C     1 
ATOM   4306  O  O     . LYS A 1  601 ? 122.732 113.797 167.404 1.00 224.81 ? 1266 LYS O O     1 
ATOM   4307  C  CB    . LYS A 1  601 ? 125.818 114.360 168.528 1.00 206.46 ? 1266 LYS O CB    1 
ATOM   4308  C  CG    . LYS A 1  601 ? 126.856 113.871 169.519 1.00 206.46 ? 1266 LYS O CG    1 
ATOM   4309  C  CD    . LYS A 1  601 ? 127.369 115.070 170.314 1.00 206.46 ? 1266 LYS O CD    1 
ATOM   4310  C  CE    . LYS A 1  601 ? 128.281 114.666 171.458 1.00 206.46 ? 1266 LYS O CE    1 
ATOM   4311  N  NZ    . LYS A 1  601 ? 129.638 114.306 170.986 1.00 206.46 ? 1266 LYS O NZ    1 
ATOM   4312  N  N     . LYS A 1  602 ? 124.190 114.674 165.924 1.00 215.04 ? 1267 LYS O N     1 
ATOM   4313  C  CA    . LYS A 1  602 ? 123.142 115.379 165.196 1.00 215.04 ? 1267 LYS O CA    1 
ATOM   4314  C  C     . LYS A 1  602 ? 122.043 114.422 164.750 1.00 215.04 ? 1267 LYS O C     1 
ATOM   4315  O  O     . LYS A 1  602 ? 120.868 114.605 165.087 1.00 215.04 ? 1267 LYS O O     1 
ATOM   4316  C  CB    . LYS A 1  602 ? 123.746 116.122 164.006 1.00 206.15 ? 1267 LYS O CB    1 
ATOM   4317  C  CG    . LYS A 1  602 ? 124.758 117.165 164.420 1.00 206.15 ? 1267 LYS O CG    1 
ATOM   4318  C  CD    . LYS A 1  602 ? 124.089 118.290 165.184 1.00 206.15 ? 1267 LYS O CD    1 
ATOM   4319  C  CE    . LYS A 1  602 ? 125.091 119.358 165.555 1.00 206.15 ? 1267 LYS O CE    1 
ATOM   4320  N  NZ    . LYS A 1  602 ? 126.051 118.826 166.554 1.00 206.15 ? 1267 LYS O NZ    1 
ATOM   4321  N  N     . ARG A 1  603 ? 122.410 113.383 164.000 1.00 212.20 ? 1268 ARG O N     1 
ATOM   4322  C  CA    . ARG A 1  603 ? 121.418 112.397 163.585 1.00 212.20 ? 1268 ARG O CA    1 
ATOM   4323  C  C     . ARG A 1  603 ? 120.820 111.694 164.795 1.00 212.20 ? 1268 ARG O C     1 
ATOM   4324  O  O     . ARG A 1  603 ? 119.615 111.789 165.061 1.00 212.20 ? 1268 ARG O O     1 
ATOM   4325  C  CB    . ARG A 1  603 ? 122.059 111.366 162.655 1.00 206.80 ? 1268 ARG O CB    1 
ATOM   4326  C  CG    . ARG A 1  603 ? 122.631 111.909 161.362 1.00 206.80 ? 1268 ARG O CG    1 
ATOM   4327  C  CD    . ARG A 1  603 ? 123.324 110.798 160.601 1.00 206.80 ? 1268 ARG O CD    1 
ATOM   4328  N  NE    . ARG A 1  603 ? 123.943 111.286 159.382 1.00 206.80 ? 1268 ARG O NE    1 
ATOM   4329  C  CZ    . ARG A 1  603 ? 125.139 111.854 159.342 1.00 206.80 ? 1268 ARG O CZ    1 
ATOM   4330  N  NH1   . ARG A 1  603 ? 125.838 112.004 160.458 1.00 206.80 ? 1268 ARG O NH1   1 
ATOM   4331  N  NH2   . ARG A 1  603 ? 125.636 112.271 158.187 1.00 206.80 ? 1268 ARG O NH2   1 
ATOM   4332  N  N     . GLU A 1  604 ? 121.669 111.013 165.560 1.00 209.28 ? 1269 GLU O N     1 
ATOM   4333  C  CA    . GLU A 1  604 ? 121.238 110.152 166.652 1.00 209.28 ? 1269 GLU O CA    1 
ATOM   4334  C  C     . GLU A 1  604 ? 122.436 109.636 167.435 1.00 209.28 ? 1269 GLU O C     1 
ATOM   4335  O  O     . GLU A 1  604 ? 123.261 108.896 166.900 1.00 209.28 ? 1269 GLU O O     1 
ATOM   4336  C  CB    . GLU A 1  604 ? 120.421 108.974 166.123 1.00 211.75 ? 1269 GLU O CB    1 
ATOM   4337  C  CG    . GLU A 1  604 ? 119.924 108.036 167.199 1.00 211.75 ? 1269 GLU O CG    1 
ATOM   4338  C  CD    . GLU A 1  604 ? 119.058 106.935 166.643 1.00 211.75 ? 1269 GLU O CD    1 
ATOM   4339  O  OE1   . GLU A 1  604 ? 118.835 106.915 165.416 1.00 211.75 ? 1269 GLU O OE1   1 
ATOM   4340  O  OE2   . GLU A 1  604 ? 118.608 106.081 167.431 1.00 211.75 ? 1269 GLU O OE2   1 
ATOM   4341  N  N     . GLU A 1  611 ? 110.536 130.829 162.352 1.00 152.17 ? 1276 GLU O N     1 
ATOM   4342  C  CA    . GLU A 1  611 ? 111.864 130.778 161.756 1.00 152.17 ? 1276 GLU O CA    1 
ATOM   4343  C  C     . GLU A 1  611 ? 112.745 131.923 162.233 1.00 152.17 ? 1276 GLU O C     1 
ATOM   4344  O  O     . GLU A 1  611 ? 112.692 132.342 163.388 1.00 152.17 ? 1276 GLU O O     1 
ATOM   4345  C  CB    . GLU A 1  611 ? 111.781 130.832 160.230 1.00 136.09 ? 1276 GLU O CB    1 
ATOM   4346  C  CG    . GLU A 1  611 ? 111.109 129.655 159.557 1.00 136.09 ? 1276 GLU O CG    1 
ATOM   4347  C  CD    . GLU A 1  611 ? 111.061 129.823 158.052 1.00 136.09 ? 1276 GLU O CD    1 
ATOM   4348  O  OE1   . GLU A 1  611 ? 111.385 130.928 157.574 1.00 136.09 ? 1276 GLU O OE1   1 
ATOM   4349  O  OE2   . GLU A 1  611 ? 110.709 128.857 157.348 1.00 136.09 ? 1276 GLU O OE2   1 
ATOM   4350  N  N     . GLU A 1  612 ? 113.549 132.425 161.303 1.00 164.52 ? 1277 GLU O N     1 
ATOM   4351  C  CA    . GLU A 1  612 ? 114.420 133.571 161.505 1.00 164.52 ? 1277 GLU O CA    1 
ATOM   4352  C  C     . GLU A 1  612 ? 113.761 134.883 161.104 1.00 164.52 ? 1277 GLU O C     1 
ATOM   4353  O  O     . GLU A 1  612 ? 114.455 135.898 161.006 1.00 164.52 ? 1277 GLU O O     1 
ATOM   4354  C  CB    . GLU A 1  612 ? 115.723 133.390 160.725 1.00 158.90 ? 1277 GLU O CB    1 
ATOM   4355  C  CG    . GLU A 1  612 ? 116.593 132.242 161.198 1.00 158.90 ? 1277 GLU O CG    1 
ATOM   4356  C  CD    . GLU A 1  612 ? 117.863 132.108 160.377 1.00 158.90 ? 1277 GLU O CD    1 
ATOM   4357  O  OE1   . GLU A 1  612 ? 117.985 132.807 159.349 1.00 158.90 ? 1277 GLU O OE1   1 
ATOM   4358  O  OE2   . GLU A 1  612 ? 118.739 131.303 160.758 1.00 158.90 ? 1277 GLU O OE2   1 
ATOM   4359  N  N     . LEU A 1  613 ? 112.455 134.864 160.812 1.00 169.81 ? 1278 LEU O N     1 
ATOM   4360  C  CA    . LEU A 1  613 ? 111.765 136.041 160.286 1.00 185.03 ? 1278 LEU O CA    1 
ATOM   4361  C  C     . LEU A 1  613 ? 112.081 137.303 161.080 1.00 185.28 ? 1278 LEU O C     1 
ATOM   4362  O  O     . LEU A 1  613 ? 112.241 138.383 160.500 1.00 176.58 ? 1278 LEU O O     1 
ATOM   4363  C  CB    . LEU A 1  613 ? 110.254 135.801 160.265 1.00 172.24 ? 1278 LEU O CB    1 
ATOM   4364  C  CG    . LEU A 1  613 ? 109.631 135.085 159.061 1.00 172.24 ? 1278 LEU O CG    1 
ATOM   4365  C  CD1   . LEU A 1  613 ? 110.050 133.628 158.987 1.00 172.24 ? 1278 LEU O CD1   1 
ATOM   4366  C  CD2   . LEU A 1  613 ? 108.113 135.208 159.079 1.00 172.24 ? 1278 LEU O CD2   1 
ATOM   4367  N  N     . LYS A 1  614 ? 112.159 137.195 162.406 1.00 185.26 ? 1279 LYS O N     1 
ATOM   4368  C  CA    . LYS A 1  614 ? 112.573 138.331 163.222 1.00 186.63 ? 1279 LYS O CA    1 
ATOM   4369  C  C     . LYS A 1  614 ? 113.955 138.803 162.794 1.00 188.05 ? 1279 LYS O C     1 
ATOM   4370  O  O     . LYS A 1  614 ? 114.891 138.005 162.687 1.00 186.85 ? 1279 LYS O O     1 
ATOM   4371  C  CB    . LYS A 1  614 ? 112.582 137.953 164.704 1.00 172.27 ? 1279 LYS O CB    1 
ATOM   4372  C  CG    . LYS A 1  614 ? 111.208 137.731 165.308 1.00 172.27 ? 1279 LYS O CG    1 
ATOM   4373  C  CD    . LYS A 1  614 ? 111.307 137.376 166.783 1.00 172.27 ? 1279 LYS O CD    1 
ATOM   4374  C  CE    . LYS A 1  614 ? 112.013 136.043 166.982 1.00 172.27 ? 1279 LYS O CE    1 
ATOM   4375  N  NZ    . LYS A 1  614 ? 111.268 134.908 166.366 1.00 172.27 ? 1279 LYS O NZ    1 
ATOM   4376  N  N     . ASP A 1  615 ? 114.084 140.110 162.551 1.00 188.72 ? 1280 ASP O N     1 
ATOM   4377  C  CA    . ASP A 1  615 ? 115.350 140.646 162.065 1.00 189.66 ? 1280 ASP O CA    1 
ATOM   4378  C  C     . ASP A 1  615 ? 116.510 140.329 162.996 1.00 188.86 ? 1280 ASP O C     1 
ATOM   4379  O  O     . ASP A 1  615 ? 117.656 140.300 162.542 1.00 191.41 ? 1280 ASP O O     1 
ATOM   4380  C  CB    . ASP A 1  615 ? 115.256 142.162 161.869 1.00 193.80 ? 1280 ASP O CB    1 
ATOM   4381  C  CG    . ASP A 1  615 ? 114.376 142.547 160.694 1.00 200.70 ? 1280 ASP O CG    1 
ATOM   4382  O  OD1   . ASP A 1  615 ? 114.020 141.655 159.897 1.00 195.09 ? 1280 ASP O OD1   1 
ATOM   4383  O  OD2   . ASP A 1  615 ? 114.063 143.749 160.554 1.00 202.50 ? 1280 ASP O OD2   1 
ATOM   4384  N  N     . SER A 1  616 ? 116.237 140.065 164.275 1.00 182.62 ? 1281 SER O N     1 
ATOM   4385  C  CA    . SER A 1  616 ? 117.305 139.838 165.242 1.00 176.05 ? 1281 SER O CA    1 
ATOM   4386  C  C     . SER A 1  616 ? 118.252 138.742 164.771 1.00 175.03 ? 1281 SER O C     1 
ATOM   4387  O  O     . SER A 1  616 ? 119.454 138.972 164.593 1.00 184.78 ? 1281 SER O O     1 
ATOM   4388  C  CB    . SER A 1  616 ? 116.699 139.476 166.599 1.00 163.80 ? 1281 SER O CB    1 
ATOM   4389  O  OG    . SER A 1  616 ? 115.916 140.540 167.104 1.00 181.67 ? 1281 SER O OG    1 
ATOM   4390  N  N     . GLU A 1  617 ? 117.713 137.547 164.530 1.00 164.04 ? 1282 GLU O N     1 
ATOM   4391  C  CA    . GLU A 1  617 ? 118.517 136.399 164.133 1.00 172.99 ? 1282 GLU O CA    1 
ATOM   4392  C  C     . GLU A 1  617 ? 119.322 136.686 162.873 1.00 178.31 ? 1282 GLU O C     1 
ATOM   4393  O  O     . GLU A 1  617 ? 120.556 136.726 162.917 1.00 175.82 ? 1282 GLU O O     1 
ATOM   4394  C  CB    . GLU A 1  617 ? 117.627 135.174 163.924 1.00 149.42 ? 1282 GLU O CB    1 
ATOM   4395  C  CG    . GLU A 1  617 ? 116.972 134.648 165.192 1.00 163.31 ? 1282 GLU O CG    1 
ATOM   4396  C  CD    . GLU A 1  617 ? 115.710 135.401 165.564 1.00 172.04 ? 1282 GLU O CD    1 
ATOM   4397  O  OE1   . GLU A 1  617 ? 115.393 136.407 164.899 1.00 184.55 ? 1282 GLU O OE1   1 
ATOM   4398  O  OE2   . GLU A 1  617 ? 115.026 134.977 166.518 1.00 159.83 ? 1282 GLU O OE2   1 
ATOM   4399  N  N     . ILE A 1  618 ? 118.629 136.898 161.752 1.00 174.01 ? 1283 ILE O N     1 
ATOM   4400  C  CA    . ILE A 1  618 ? 119.314 137.047 160.471 1.00 160.74 ? 1283 ILE O CA    1 
ATOM   4401  C  C     . ILE A 1  618 ? 120.331 138.177 160.534 1.00 157.10 ? 1283 ILE O C     1 
ATOM   4402  O  O     . ILE A 1  618 ? 121.433 138.071 159.981 1.00 162.30 ? 1283 ILE O O     1 
ATOM   4403  C  CB    . ILE A 1  618 ? 118.291 137.266 159.345 1.00 142.76 ? 1283 ILE O CB    1 
ATOM   4404  C  CG1   . ILE A 1  618 ? 117.373 136.051 159.227 1.00 142.76 ? 1283 ILE O CG1   1 
ATOM   4405  C  CG2   . ILE A 1  618 ? 119.003 137.487 158.031 1.00 142.76 ? 1283 ILE O CG2   1 
ATOM   4406  C  CD1   . ILE A 1  618 ? 116.191 136.258 158.306 1.00 142.76 ? 1283 ILE O CD1   1 
ATOM   4407  N  N     . ASN A 1  619 ? 119.985 139.274 161.212 1.00 156.47 ? 1284 ASN O N     1 
ATOM   4408  C  CA    . ASN A 1  619 ? 120.957 140.339 161.440 1.00 162.41 ? 1284 ASN O CA    1 
ATOM   4409  C  C     . ASN A 1  619 ? 122.204 139.797 162.121 1.00 172.80 ? 1284 ASN O C     1 
ATOM   4410  O  O     . ASN A 1  619 ? 123.328 140.045 161.673 1.00 175.06 ? 1284 ASN O O     1 
ATOM   4411  C  CB    . ASN A 1  619 ? 120.339 141.459 162.280 1.00 154.65 ? 1284 ASN O CB    1 
ATOM   4412  C  CG    . ASN A 1  619 ? 119.322 142.275 161.513 1.00 162.92 ? 1284 ASN O CG    1 
ATOM   4413  O  OD1   . ASN A 1  619 ? 119.323 142.295 160.287 1.00 163.46 ? 1284 ASN O OD1   1 
ATOM   4414  N  ND2   . ASN A 1  619 ? 118.444 142.956 162.239 1.00 159.64 ? 1284 ASN O ND2   1 
ATOM   4415  N  N     . GLU A 1  620 ? 122.022 139.038 163.203 1.00 178.31 ? 1285 GLU O N     1 
ATOM   4416  C  CA    . GLU A 1  620 ? 123.168 138.502 163.929 1.00 177.46 ? 1285 GLU O CA    1 
ATOM   4417  C  C     . GLU A 1  620 ? 124.030 137.623 163.032 1.00 180.10 ? 1285 GLU O C     1 
ATOM   4418  O  O     . GLU A 1  620 ? 125.236 137.857 162.891 1.00 183.23 ? 1285 GLU O O     1 
ATOM   4419  C  CB    . GLU A 1  620 ? 122.696 137.722 165.154 1.00 183.87 ? 1285 GLU O CB    1 
ATOM   4420  C  CG    . GLU A 1  620 ? 122.049 138.584 166.216 1.00 183.87 ? 1285 GLU O CG    1 
ATOM   4421  C  CD    . GLU A 1  620 ? 121.534 137.773 167.381 1.00 183.87 ? 1285 GLU O CD    1 
ATOM   4422  O  OE1   . GLU A 1  620 ? 121.561 136.528 167.294 1.00 183.87 ? 1285 GLU O OE1   1 
ATOM   4423  O  OE2   . GLU A 1  620 ? 121.092 138.378 168.379 1.00 183.87 ? 1285 GLU O OE2   1 
ATOM   4424  N  N     . ILE A 1  621 ? 123.428 136.604 162.414 1.00 175.79 ? 1286 ILE O N     1 
ATOM   4425  C  CA    . ILE A 1  621 ? 124.204 135.698 161.572 1.00 178.55 ? 1286 ILE O CA    1 
ATOM   4426  C  C     . ILE A 1  621 ? 124.895 136.454 160.448 1.00 181.49 ? 1286 ILE O C     1 
ATOM   4427  O  O     . ILE A 1  621 ? 126.012 136.104 160.047 1.00 185.42 ? 1286 ILE O O     1 
ATOM   4428  C  CB    . ILE A 1  621 ? 123.305 134.568 161.036 1.00 161.64 ? 1286 ILE O CB    1 
ATOM   4429  C  CG1   . ILE A 1  621 ? 122.964 133.590 162.166 1.00 157.33 ? 1286 ILE O CG1   1 
ATOM   4430  C  CG2   . ILE A 1  621 ? 123.963 133.852 159.859 1.00 167.48 ? 1286 ILE O CG2   1 
ATOM   4431  C  CD1   . ILE A 1  621 ? 121.623 133.823 162.826 1.00 166.36 ? 1286 ILE O CD1   1 
ATOM   4432  N  N     . LEU A 1  622 ? 124.273 137.519 159.950 1.00 187.83 ? 1287 LEU O N     1 
ATOM   4433  C  CA    . LEU A 1  622 ? 124.835 138.262 158.828 1.00 183.54 ? 1287 LEU O CA    1 
ATOM   4434  C  C     . LEU A 1  622 ? 125.761 139.379 159.296 1.00 183.04 ? 1287 LEU O C     1 
ATOM   4435  O  O     . LEU A 1  622 ? 126.963 139.347 159.019 1.00 185.99 ? 1287 LEU O O     1 
ATOM   4436  C  CB    . LEU A 1  622 ? 123.710 138.820 157.951 1.00 172.48 ? 1287 LEU O CB    1 
ATOM   4437  C  CG    . LEU A 1  622 ? 123.179 137.886 156.861 1.00 172.48 ? 1287 LEU O CG    1 
ATOM   4438  C  CD1   . LEU A 1  622 ? 122.510 136.646 157.438 1.00 172.48 ? 1287 LEU O CD1   1 
ATOM   4439  C  CD2   . LEU A 1  622 ? 122.221 138.637 155.961 1.00 172.48 ? 1287 LEU O CD2   1 
ATOM   4440  N  N     . ALA A 1  623 ? 125.211 140.369 159.998 1.00 169.30 ? 1288 ALA O N     1 
ATOM   4441  C  CA    . ALA A 1  623 ? 125.997 141.521 160.421 1.00 177.56 ? 1288 ALA O CA    1 
ATOM   4442  C  C     . ALA A 1  623 ? 127.229 141.069 161.194 1.00 180.07 ? 1288 ALA O C     1 
ATOM   4443  O  O     . ALA A 1  623 ? 127.131 140.282 162.138 1.00 185.88 ? 1288 ALA O O     1 
ATOM   4444  C  CB    . ALA A 1  623 ? 125.140 142.459 161.274 1.00 157.10 ? 1288 ALA O CB    1 
ATOM   4445  N  N     . ARG A 1  624 ? 128.393 141.548 160.763 1.00 167.98 ? 1289 ARG O N     1 
ATOM   4446  C  CA    . ARG A 1  624 ? 129.675 141.071 161.259 1.00 178.24 ? 1289 ARG O CA    1 
ATOM   4447  C  C     . ARG A 1  624 ? 130.274 141.959 162.342 1.00 182.03 ? 1289 ARG O C     1 
ATOM   4448  O  O     . ARG A 1  624 ? 131.361 141.657 162.842 1.00 185.64 ? 1289 ARG O O     1 
ATOM   4449  C  CB    . ARG A 1  624 ? 130.639 140.918 160.084 1.00 170.41 ? 1289 ARG O CB    1 
ATOM   4450  C  CG    . ARG A 1  624 ? 130.124 139.878 159.098 1.00 164.58 ? 1289 ARG O CG    1 
ATOM   4451  C  CD    . ARG A 1  624 ? 131.123 139.510 158.021 1.00 168.00 ? 1289 ARG O CD    1 
ATOM   4452  N  NE    . ARG A 1  624 ? 131.427 140.625 157.129 1.00 172.93 ? 1289 ARG O NE    1 
ATOM   4453  C  CZ    . ARG A 1  624 ? 130.733 140.911 156.032 1.00 172.57 ? 1289 ARG O CZ    1 
ATOM   4454  N  NH1   . ARG A 1  624 ? 129.698 140.159 155.688 1.00 162.46 ? 1289 ARG O NH1   1 
ATOM   4455  N  NH2   . ARG A 1  624 ? 131.077 141.943 155.275 1.00 178.54 ? 1289 ARG O NH2   1 
ATOM   4456  N  N     . ASN A 1  625 ? 129.600 143.045 162.713 1.00 175.48 ? 1290 ASN O N     1 
ATOM   4457  C  CA    . ASN A 1  625 ? 129.954 143.787 163.914 1.00 166.11 ? 1290 ASN O CA    1 
ATOM   4458  C  C     . ASN A 1  625 ? 128.707 144.492 164.428 1.00 177.60 ? 1290 ASN O C     1 
ATOM   4459  O  O     . ASN A 1  625 ? 127.708 144.623 163.714 1.00 180.40 ? 1290 ASN O O     1 
ATOM   4460  C  CB    . ASN A 1  625 ? 131.116 144.771 163.673 1.00 153.47 ? 1290 ASN O CB    1 
ATOM   4461  C  CG    . ASN A 1  625 ? 130.782 145.874 162.679 1.00 161.13 ? 1290 ASN O CG    1 
ATOM   4462  O  OD1   . ASN A 1  625 ? 129.657 146.361 162.609 1.00 168.59 ? 1290 ASN O OD1   1 
ATOM   4463  N  ND2   . ASN A 1  625 ? 131.782 146.283 161.909 1.00 165.30 ? 1290 ASN O ND2   1 
ATOM   4464  N  N     . ASP A 1  626 ? 128.769 144.929 165.688 1.00 177.10 ? 1291 ASP O N     1 
ATOM   4465  C  CA    . ASP A 1  626 ? 127.611 145.573 166.300 1.00 174.69 ? 1291 ASP O CA    1 
ATOM   4466  C  C     . ASP A 1  626 ? 127.194 146.817 165.531 1.00 168.73 ? 1291 ASP O C     1 
ATOM   4467  O  O     . ASP A 1  626 ? 126.006 147.156 165.494 1.00 163.95 ? 1291 ASP O O     1 
ATOM   4468  C  CB    . ASP A 1  626 ? 127.910 145.929 167.755 1.00 166.35 ? 1291 ASP O CB    1 
ATOM   4469  C  CG    . ASP A 1  626 ? 126.705 146.513 168.474 1.00 166.35 ? 1291 ASP O CG    1 
ATOM   4470  O  OD1   . ASP A 1  626 ? 125.732 145.766 168.712 1.00 166.35 ? 1291 ASP O OD1   1 
ATOM   4471  O  OD2   . ASP A 1  626 ? 126.729 147.717 168.799 1.00 166.35 ? 1291 ASP O OD2   1 
ATOM   4472  N  N     . GLU A 1  627 ? 128.149 147.510 164.915 1.00 159.06 ? 1292 GLU O N     1 
ATOM   4473  C  CA    . GLU A 1  627 ? 127.793 148.646 164.076 1.00 165.85 ? 1292 GLU O CA    1 
ATOM   4474  C  C     . GLU A 1  627 ? 127.012 148.195 162.850 1.00 172.74 ? 1292 GLU O C     1 
ATOM   4475  O  O     . GLU A 1  627 ? 126.107 148.900 162.390 1.00 178.31 ? 1292 GLU O O     1 
ATOM   4476  C  CB    . GLU A 1  627 ? 129.051 149.409 163.669 1.00 141.99 ? 1292 GLU O CB    1 
ATOM   4477  C  CG    . GLU A 1  627 ? 128.792 150.650 162.845 1.00 154.64 ? 1292 GLU O CG    1 
ATOM   4478  C  CD    . GLU A 1  627 ? 130.069 151.385 162.511 1.00 168.01 ? 1292 GLU O CD    1 
ATOM   4479  O  OE1   . GLU A 1  627 ? 131.152 150.903 162.903 1.00 173.42 ? 1292 GLU O OE1   1 
ATOM   4480  O  OE2   . GLU A 1  627 ? 129.993 152.443 161.857 1.00 172.44 ? 1292 GLU O OE2   1 
ATOM   4481  N  N     . GLU A 1  628 ? 127.339 147.021 162.307 1.00 173.10 ? 1293 GLU O N     1 
ATOM   4482  C  CA    . GLU A 1  628 ? 126.518 146.482 161.232 1.00 161.94 ? 1293 GLU O CA    1 
ATOM   4483  C  C     . GLU A 1  628 ? 125.120 146.152 161.735 1.00 165.43 ? 1293 GLU O C     1 
ATOM   4484  O  O     . GLU A 1  628 ? 124.127 146.403 161.044 1.00 160.56 ? 1293 GLU O O     1 
ATOM   4485  C  CB    . GLU A 1  628 ? 127.171 145.247 160.615 1.00 157.16 ? 1293 GLU O CB    1 
ATOM   4486  C  CG    . GLU A 1  628 ? 128.459 145.529 159.871 1.00 166.00 ? 1293 GLU O CG    1 
ATOM   4487  C  CD    . GLU A 1  628 ? 129.009 144.302 159.179 1.00 165.09 ? 1293 GLU O CD    1 
ATOM   4488  O  OE1   . GLU A 1  628 ? 128.458 143.207 159.386 1.00 165.63 ? 1293 GLU O OE1   1 
ATOM   4489  O  OE2   . GLU A 1  628 ? 129.990 144.435 158.419 1.00 159.25 ? 1293 GLU O OE2   1 
ATOM   4490  N  N     . MET A 1  629 ? 125.023 145.584 162.938 1.00 158.37 ? 1294 MET O N     1 
ATOM   4491  C  CA    . MET A 1  629 ? 123.719 145.393 163.560 1.00 161.54 ? 1294 MET O CA    1 
ATOM   4492  C  C     . MET A 1  629 ? 122.951 146.705 163.628 1.00 163.46 ? 1294 MET O C     1 
ATOM   4493  O  O     . MET A 1  629 ? 121.740 146.740 163.383 1.00 169.99 ? 1294 MET O O     1 
ATOM   4494  C  CB    . MET A 1  629 ? 123.892 144.806 164.961 1.00 160.04 ? 1294 MET O CB    1 
ATOM   4495  C  CG    . MET A 1  629 ? 124.427 143.386 164.996 1.00 160.04 ? 1294 MET O CG    1 
ATOM   4496  S  SD    . MET A 1  629 ? 123.286 142.184 164.292 1.00 160.04 ? 1294 MET O SD    1 
ATOM   4497  C  CE    . MET A 1  629 ? 121.961 142.235 165.495 1.00 160.04 ? 1294 MET O CE    1 
ATOM   4498  N  N     . ALA A 1  630 ? 123.650 147.799 163.944 1.00 160.80 ? 1295 ALA O N     1 
ATOM   4499  C  CA    . ALA A 1  630 ? 122.987 149.088 164.103 1.00 165.72 ? 1295 ALA O CA    1 
ATOM   4500  C  C     . ALA A 1  630 ? 122.531 149.650 162.765 1.00 165.99 ? 1295 ALA O C     1 
ATOM   4501  O  O     . ALA A 1  630 ? 121.411 150.160 162.651 1.00 167.06 ? 1295 ALA O O     1 
ATOM   4502  C  CB    . ALA A 1  630 ? 123.916 150.075 164.808 1.00 148.92 ? 1295 ALA O CB    1 
ATOM   4503  N  N     . VAL A 1  631 ? 123.379 149.567 161.737 1.00 165.90 ? 1296 VAL O N     1 
ATOM   4504  C  CA    . VAL A 1  631 ? 122.996 150.079 160.427 1.00 162.82 ? 1296 VAL O CA    1 
ATOM   4505  C  C     . VAL A 1  631 ? 121.884 149.266 159.792 1.00 157.74 ? 1296 VAL O C     1 
ATOM   4506  O  O     . VAL A 1  631 ? 121.377 149.652 158.737 1.00 159.82 ? 1296 VAL O O     1 
ATOM   4507  C  CB    . VAL A 1  631 ? 124.196 150.135 159.459 1.00 135.77 ? 1296 VAL O CB    1 
ATOM   4508  C  CG1   . VAL A 1  631 ? 125.280 151.035 160.013 1.00 137.39 ? 1296 VAL O CG1   1 
ATOM   4509  C  CG2   . VAL A 1  631 ? 124.728 148.753 159.174 1.00 132.13 ? 1296 VAL O CG2   1 
ATOM   4510  N  N     . LEU A 1  632 ? 121.509 148.138 160.390 1.00 162.07 ? 1297 LEU O N     1 
ATOM   4511  C  CA    . LEU A 1  632 ? 120.349 147.388 159.935 1.00 159.52 ? 1297 LEU O CA    1 
ATOM   4512  C  C     . LEU A 1  632 ? 119.068 147.805 160.639 1.00 164.65 ? 1297 LEU O C     1 
ATOM   4513  O  O     . LEU A 1  632 ? 117.991 147.334 160.260 1.00 172.68 ? 1297 LEU O O     1 
ATOM   4514  C  CB    . LEU A 1  632 ? 120.576 145.886 160.125 1.00 144.71 ? 1297 LEU O CB    1 
ATOM   4515  C  CG    . LEU A 1  632 ? 121.743 145.371 159.282 1.00 144.71 ? 1297 LEU O CG    1 
ATOM   4516  C  CD1   . LEU A 1  632 ? 121.986 143.877 159.470 1.00 144.71 ? 1297 LEU O CD1   1 
ATOM   4517  C  CD2   . LEU A 1  632 ? 121.534 145.722 157.822 1.00 144.71 ? 1297 LEU O CD2   1 
ATOM   4518  N  N     . THR A 1  633 ? 119.158 148.670 161.650 1.00 164.87 ? 1298 THR O N     1 
ATOM   4519  C  CA    . THR A 1  633 ? 117.951 149.207 162.264 1.00 168.72 ? 1298 THR O CA    1 
ATOM   4520  C  C     . THR A 1  633 ? 117.173 150.079 161.289 1.00 172.77 ? 1298 THR O C     1 
ATOM   4521  O  O     . THR A 1  633 ? 115.944 150.170 161.385 1.00 175.54 ? 1298 THR O O     1 
ATOM   4522  C  CB    . THR A 1  633 ? 118.303 150.003 163.518 1.00 162.89 ? 1298 THR O CB    1 
ATOM   4523  O  OG1   . THR A 1  633 ? 119.211 151.056 163.177 1.00 162.89 ? 1298 THR O OG1   1 
ATOM   4524  C  CG2   . THR A 1  633 ? 118.947 149.099 164.554 1.00 162.89 ? 1298 THR O CG2   1 
ATOM   4525  N  N     . ARG A 1  634 ? 117.865 150.723 160.347 1.00 170.62 ? 1299 ARG O N     1 
ATOM   4526  C  CA    . ARG A 1  634 ? 117.190 151.494 159.310 1.00 173.46 ? 1299 ARG O CA    1 
ATOM   4527  C  C     . ARG A 1  634 ? 116.371 150.618 158.379 1.00 175.82 ? 1299 ARG O C     1 
ATOM   4528  O  O     . ARG A 1  634 ? 115.603 151.149 157.571 1.00 182.02 ? 1299 ARG O O     1 
ATOM   4529  C  CB    . ARG A 1  634 ? 118.202 152.284 158.481 1.00 172.94 ? 1299 ARG O CB    1 
ATOM   4530  C  CG    . ARG A 1  634 ? 119.200 151.415 157.725 1.00 172.94 ? 1299 ARG O CG    1 
ATOM   4531  C  CD    . ARG A 1  634 ? 120.127 152.249 156.850 1.00 172.94 ? 1299 ARG O CD    1 
ATOM   4532  N  NE    . ARG A 1  634 ? 121.093 151.430 156.125 1.00 172.94 ? 1299 ARG O NE    1 
ATOM   4533  C  CZ    . ARG A 1  634 ? 122.045 151.921 155.339 1.00 172.94 ? 1299 ARG O CZ    1 
ATOM   4534  N  NH1   . ARG A 1  634 ? 122.159 153.231 155.174 1.00 172.94 ? 1299 ARG O NH1   1 
ATOM   4535  N  NH2   . ARG A 1  634 ? 122.884 151.103 154.717 1.00 172.94 ? 1299 ARG O NH2   1 
ATOM   4536  N  N     . MET A 1  635 ? 116.539 149.303 158.453 1.00 173.85 ? 1300 MET O N     1 
ATOM   4537  C  CA    . MET A 1  635 ? 115.738 148.358 157.696 1.00 166.37 ? 1300 MET O CA    1 
ATOM   4538  C  C     . MET A 1  635 ? 114.590 147.780 158.508 1.00 168.69 ? 1300 MET O C     1 
ATOM   4539  O  O     . MET A 1  635 ? 113.884 146.893 158.019 1.00 167.43 ? 1300 MET O O     1 
ATOM   4540  C  CB    . MET A 1  635 ? 116.632 147.242 157.161 1.00 166.96 ? 1300 MET O CB    1 
ATOM   4541  C  CG    . MET A 1  635 ? 117.703 147.788 156.240 1.00 166.96 ? 1300 MET O CG    1 
ATOM   4542  S  SD    . MET A 1  635 ? 116.935 148.659 154.858 1.00 166.96 ? 1300 MET O SD    1 
ATOM   4543  C  CE    . MET A 1  635 ? 118.356 149.250 153.950 1.00 166.96 ? 1300 MET O CE    1 
ATOM   4544  N  N     . ASP A 1  636 ? 114.399 148.245 159.736 1.00 160.55 ? 1301 ASP O N     1 
ATOM   4545  C  CA    . ASP A 1  636 ? 113.332 147.763 160.597 1.00 162.05 ? 1301 ASP O CA    1 
ATOM   4546  C  C     . ASP A 1  636 ? 112.024 148.505 160.363 1.00 173.19 ? 1301 ASP O C     1 
ATOM   4547  O  O     . ASP A 1  636 ? 111.033 148.228 161.045 1.00 169.51 ? 1301 ASP O O     1 
ATOM   4548  C  CB    . ASP A 1  636 ? 113.755 147.899 162.061 1.00 151.18 ? 1301 ASP O CB    1 
ATOM   4549  C  CG    . ASP A 1  636 ? 114.987 147.075 162.393 1.00 159.73 ? 1301 ASP O CG    1 
ATOM   4550  O  OD1   . ASP A 1  636 ? 115.336 146.157 161.620 1.00 163.58 ? 1301 ASP O OD1   1 
ATOM   4551  O  OD2   . ASP A 1  636 ? 115.623 147.366 163.426 1.00 169.16 ? 1301 ASP O OD2   1 
ATOM   4552  N  N     . GLU A 1  637 ? 112.003 149.439 159.420 1.00 163.79 ? 1302 GLU O N     1 
ATOM   4553  C  CA    . GLU A 1  637 ? 110.880 150.337 159.207 1.00 168.74 ? 1302 GLU O CA    1 
ATOM   4554  C  C     . GLU A 1  637 ? 109.876 149.819 158.190 1.00 169.90 ? 1302 GLU O C     1 
ATOM   4555  O  O     . GLU A 1  637 ? 108.790 150.395 158.060 1.00 175.37 ? 1302 GLU O O     1 
ATOM   4556  C  CB    . GLU A 1  637 ? 111.412 151.702 158.768 1.00 148.88 ? 1302 GLU O CB    1 
ATOM   4557  C  CG    . GLU A 1  637 ? 112.153 152.450 159.863 1.00 167.17 ? 1302 GLU O CG    1 
ATOM   4558  C  CD    . GLU A 1  637 ? 113.533 151.877 160.146 1.00 181.79 ? 1302 GLU O CD    1 
ATOM   4559  O  OE1   . GLU A 1  637 ? 113.849 150.790 159.628 1.00 187.25 ? 1302 GLU O OE1   1 
ATOM   4560  O  OE2   . GLU A 1  637 ? 114.312 152.522 160.872 1.00 182.95 ? 1302 GLU O OE2   1 
ATOM   4561  N  N     . ASP A 1  638 ? 110.197 148.737 157.488 1.00 164.02 ? 1303 ASP O N     1 
ATOM   4562  C  CA    . ASP A 1  638 ? 109.367 148.295 156.377 1.00 164.04 ? 1303 ASP O CA    1 
ATOM   4563  C  C     . ASP A 1  638 ? 108.971 146.828 156.506 1.00 167.81 ? 1303 ASP O C     1 
ATOM   4564  O  O     . ASP A 1  638 ? 107.782 146.515 156.600 1.00 174.34 ? 1303 ASP O O     1 
ATOM   4565  C  CB    . ASP A 1  638 ? 110.083 148.571 155.054 1.00 170.69 ? 1303 ASP O CB    1 
ATOM   4566  C  CG    . ASP A 1  638 ? 111.487 148.027 155.034 1.00 170.69 ? 1303 ASP O CG    1 
ATOM   4567  O  OD1   . ASP A 1  638 ? 111.958 147.569 156.096 1.00 170.69 ? 1303 ASP O OD1   1 
ATOM   4568  O  OD2   . ASP A 1  638 ? 112.119 148.053 153.961 1.00 170.69 ? 1303 ASP O OD2   1 
ATOM   4569  N  N     . ARG A 1  639 ? 109.943 145.914 156.502 1.00 170.56 ? 1304 ARG O N     1 
ATOM   4570  C  CA    . ARG A 1  639 ? 109.607 144.499 156.616 1.00 161.46 ? 1304 ARG O CA    1 
ATOM   4571  C  C     . ARG A 1  639 ? 109.165 144.114 158.022 1.00 160.21 ? 1304 ARG O C     1 
ATOM   4572  O  O     . ARG A 1  639 ? 108.552 143.055 158.193 1.00 164.60 ? 1304 ARG O O     1 
ATOM   4573  C  CB    . ARG A 1  639 ? 110.792 143.644 156.177 1.00 158.45 ? 1304 ARG O CB    1 
ATOM   4574  C  CG    . ARG A 1  639 ? 111.041 143.673 154.688 1.00 163.52 ? 1304 ARG O CG    1 
ATOM   4575  C  CD    . ARG A 1  639 ? 112.232 142.827 154.301 1.00 157.57 ? 1304 ARG O CD    1 
ATOM   4576  N  NE    . ARG A 1  639 ? 113.493 143.365 154.799 1.00 170.28 ? 1304 ARG O NE    1 
ATOM   4577  C  CZ    . ARG A 1  639 ? 114.152 142.888 155.847 1.00 174.09 ? 1304 ARG O CZ    1 
ATOM   4578  N  NH1   . ARG A 1  639 ? 113.674 141.853 156.516 1.00 163.59 ? 1304 ARG O NH1   1 
ATOM   4579  N  NH2   . ARG A 1  639 ? 115.299 143.438 156.218 1.00 168.76 ? 1304 ARG O NH2   1 
ATOM   4580  N  N     . SER A 1  640 ? 109.456 144.942 159.024 1.00 150.43 ? 1305 SER O N     1 
ATOM   4581  C  CA    . SER A 1  640 ? 108.953 144.747 160.378 1.00 158.12 ? 1305 SER O CA    1 
ATOM   4582  C  C     . SER A 1  640 ? 107.916 145.800 160.747 1.00 169.57 ? 1305 SER O C     1 
ATOM   4583  O  O     . SER A 1  640 ? 106.747 145.470 160.968 1.00 168.16 ? 1305 SER O O     1 
ATOM   4584  C  CB    . SER A 1  640 ? 110.111 144.761 161.385 1.00 143.89 ? 1305 SER O CB    1 
ATOM   4585  O  OG    . SER A 1  640 ? 110.732 146.032 161.427 1.00 170.86 ? 1305 SER O OG    1 
ATOM   4586  N  N     . LYS A 1  641 ? 108.320 147.069 160.822 1.00 159.29 ? 1306 LYS O N     1 
ATOM   4587  C  CA    . LYS A 1  641 ? 107.412 148.156 161.171 1.00 159.60 ? 1306 LYS O CA    1 
ATOM   4588  C  C     . LYS A 1  641 ? 106.223 148.202 160.223 1.00 166.93 ? 1306 LYS O C     1 
ATOM   4589  O  O     . LYS A 1  641 ? 105.089 147.945 160.638 1.00 171.08 ? 1306 LYS O O     1 
ATOM   4590  C  CB    . LYS A 1  641 ? 108.151 149.490 161.156 1.00 153.57 ? 1306 LYS O CB    1 
ATOM   4591  C  CG    . LYS A 1  641 ? 107.291 150.703 161.457 1.00 153.57 ? 1306 LYS O CG    1 
ATOM   4592  C  CD    . LYS A 1  641 ? 106.665 150.629 162.834 1.00 153.57 ? 1306 LYS O CD    1 
ATOM   4593  C  CE    . LYS A 1  641 ? 106.157 151.993 163.249 1.00 153.57 ? 1306 LYS O CE    1 
ATOM   4594  N  NZ    . LYS A 1  641 ? 105.156 152.515 162.280 1.00 153.57 ? 1306 LYS O NZ    1 
ATOM   4595  N  N     . LYS A 1  642 ? 106.475 148.523 158.952 1.00 173.86 ? 1307 LYS O N     1 
ATOM   4596  C  CA    . LYS A 1  642 ? 105.455 148.512 157.903 1.00 170.61 ? 1307 LYS O CA    1 
ATOM   4597  C  C     . LYS A 1  642 ? 104.308 149.467 158.248 1.00 167.28 ? 1307 LYS O C     1 
ATOM   4598  O  O     . LYS A 1  642 ? 103.205 149.065 158.626 1.00 157.61 ? 1307 LYS O O     1 
ATOM   4599  C  CB    . LYS A 1  642 ? 104.940 147.086 157.662 1.00 155.96 ? 1307 LYS O CB    1 
ATOM   4600  C  CG    . LYS A 1  642 ? 103.974 146.951 156.494 1.00 155.96 ? 1307 LYS O CG    1 
ATOM   4601  C  CD    . LYS A 1  642 ? 103.481 145.522 156.360 1.00 155.96 ? 1307 LYS O CD    1 
ATOM   4602  C  CE    . LYS A 1  642 ? 102.600 145.125 157.536 1.00 155.96 ? 1307 LYS O CE    1 
ATOM   4603  N  NZ    . LYS A 1  642 ? 101.336 145.912 157.583 1.00 155.96 ? 1307 LYS O NZ    1 
ATOM   4604  N  N     . GLU A 1  643 ? 104.618 150.753 158.135 1.00 162.92 ? 1308 GLU O N     1 
ATOM   4605  C  CA    . GLU A 1  643 ? 103.660 151.814 158.438 1.00 155.92 ? 1308 GLU O CA    1 
ATOM   4606  C  C     . GLU A 1  643 ? 103.117 151.694 159.861 1.00 156.55 ? 1308 GLU O C     1 
ATOM   4607  O  O     . GLU A 1  643 ? 101.985 152.089 160.141 1.00 156.73 ? 1308 GLU O O     1 
ATOM   4608  C  CB    . GLU A 1  643 ? 102.500 151.808 157.436 1.00 143.83 ? 1308 GLU O CB    1 
ATOM   4609  C  CG    . GLU A 1  643 ? 102.884 152.181 156.019 1.00 143.83 ? 1308 GLU O CG    1 
ATOM   4610  C  CD    . GLU A 1  643 ? 101.696 152.147 155.077 1.00 143.83 ? 1308 GLU O CD    1 
ATOM   4611  O  OE1   . GLU A 1  643 ? 100.622 151.669 155.493 1.00 143.83 ? 1308 GLU O OE1   1 
ATOM   4612  O  OE2   . GLU A 1  643 ? 101.833 152.599 153.922 1.00 143.83 ? 1308 GLU O OE2   1 
ATOM   4613  N  N     . LYS A 1  671 ? 94.938  131.035 147.786 1.00 157.89 ? 1336 LYS O N     1 
ATOM   4614  C  CA    . LYS A 1  671 ? 95.703  129.894 148.276 1.00 157.89 ? 1336 LYS O CA    1 
ATOM   4615  C  C     . LYS A 1  671 ? 95.157  128.565 147.754 1.00 157.89 ? 1336 LYS O C     1 
ATOM   4616  O  O     . LYS A 1  671 ? 95.703  127.992 146.813 1.00 157.89 ? 1336 LYS O O     1 
ATOM   4617  C  CB    . LYS A 1  671 ? 95.728  129.890 149.809 1.00 121.32 ? 1336 LYS O CB    1 
ATOM   4618  C  CG    . LYS A 1  671 ? 96.602  130.974 150.423 1.00 121.32 ? 1336 LYS O CG    1 
ATOM   4619  C  CD    . LYS A 1  671 ? 96.585  130.905 151.942 1.00 121.32 ? 1336 LYS O CD    1 
ATOM   4620  C  CE    . LYS A 1  671 ? 95.211  131.246 152.495 1.00 121.32 ? 1336 LYS O CE    1 
ATOM   4621  N  NZ    . LYS A 1  671 ? 94.821  132.653 152.194 1.00 121.32 ? 1336 LYS O NZ    1 
ATOM   4622  N  N     . ARG A 1  672 ? 94.070  128.088 148.365 1.00 179.03 ? 1337 ARG O N     1 
ATOM   4623  C  CA    . ARG A 1  672 ? 93.577  126.744 148.076 1.00 179.03 ? 1337 ARG O CA    1 
ATOM   4624  C  C     . ARG A 1  672 ? 93.051  126.630 146.652 1.00 179.03 ? 1337 ARG O C     1 
ATOM   4625  O  O     . ARG A 1  672 ? 93.194  125.574 146.018 1.00 179.03 ? 1337 ARG O O     1 
ATOM   4626  C  CB    . ARG A 1  672 ? 92.490  126.361 149.077 1.00 175.52 ? 1337 ARG O CB    1 
ATOM   4627  C  CG    . ARG A 1  672 ? 92.009  124.936 148.950 1.00 175.52 ? 1337 ARG O CG    1 
ATOM   4628  C  CD    . ARG A 1  672 ? 93.158  123.956 149.069 1.00 175.52 ? 1337 ARG O CD    1 
ATOM   4629  N  NE    . ARG A 1  672 ? 93.890  123.992 150.338 1.00 175.52 ? 1337 ARG O NE    1 
ATOM   4630  C  CZ    . ARG A 1  672 ? 93.536  123.297 151.419 1.00 175.52 ? 1337 ARG O CZ    1 
ATOM   4631  N  NH1   . ARG A 1  672 ? 92.449  122.543 151.384 1.00 175.52 ? 1337 ARG O NH1   1 
ATOM   4632  N  NH2   . ARG A 1  672 ? 94.261  123.343 152.531 1.00 175.52 ? 1337 ARG O NH2   1 
ATOM   4633  N  N     . GLU A 1  673 ? 92.426  127.695 146.141 1.00 189.64 ? 1338 GLU O N     1 
ATOM   4634  C  CA    . GLU A 1  673 ? 91.906  127.671 144.778 1.00 189.64 ? 1338 GLU O CA    1 
ATOM   4635  C  C     . GLU A 1  673 ? 92.957  127.185 143.803 1.00 189.64 ? 1338 GLU O C     1 
ATOM   4636  O  O     . GLU A 1  673 ? 92.698  126.301 142.981 1.00 189.64 ? 1338 GLU O O     1 
ATOM   4637  C  CB    . GLU A 1  673 ? 91.427  129.061 144.358 1.00 186.39 ? 1338 GLU O CB    1 
ATOM   4638  C  CG    . GLU A 1  673 ? 90.892  129.130 142.910 1.00 186.39 ? 1338 GLU O CG    1 
ATOM   4639  C  CD    . GLU A 1  673 ? 91.979  129.274 141.844 1.00 186.39 ? 1338 GLU O CD    1 
ATOM   4640  O  OE1   . GLU A 1  673 ? 93.072  129.792 142.154 1.00 186.39 ? 1338 GLU O OE1   1 
ATOM   4641  O  OE2   . GLU A 1  673 ? 91.731  128.862 140.693 1.00 186.39 ? 1338 GLU O OE2   1 
ATOM   4642  N  N     . GLU A 1  674 ? 94.152  127.767 143.879 1.00 187.23 ? 1339 GLU O N     1 
ATOM   4643  C  CA    . GLU A 1  674 ? 95.204  127.437 142.929 1.00 187.23 ? 1339 GLU O CA    1 
ATOM   4644  C  C     . GLU A 1  674 ? 95.569  125.959 142.992 1.00 187.23 ? 1339 GLU O C     1 
ATOM   4645  O  O     . GLU A 1  674 ? 95.931  125.361 141.970 1.00 187.23 ? 1339 GLU O O     1 
ATOM   4646  C  CB    . GLU A 1  674 ? 96.422  128.315 143.205 1.00 168.64 ? 1339 GLU O CB    1 
ATOM   4647  C  CG    . GLU A 1  674 ? 96.156  129.807 143.028 1.00 168.64 ? 1339 GLU O CG    1 
ATOM   4648  C  CD    . GLU A 1  674 ? 97.359  130.645 143.389 1.00 168.64 ? 1339 GLU O CD    1 
ATOM   4649  O  OE1   . GLU A 1  674 ? 98.333  130.073 143.919 1.00 168.64 ? 1339 GLU O OE1   1 
ATOM   4650  O  OE2   . GLU A 1  674 ? 97.333  131.870 143.154 1.00 168.64 ? 1339 GLU O OE2   1 
ATOM   4651  N  N     . SER A 1  675 ? 95.454  125.349 144.173 1.00 194.73 ? 1340 SER O N     1 
ATOM   4652  C  CA    . SER A 1  675 ? 95.720  123.926 144.302 1.00 194.73 ? 1340 SER O CA    1 
ATOM   4653  C  C     . SER A 1  675 ? 94.569  123.083 143.779 1.00 194.73 ? 1340 SER O C     1 
ATOM   4654  O  O     . SER A 1  675 ? 94.802  121.959 143.330 1.00 194.73 ? 1340 SER O O     1 
ATOM   4655  C  CB    . SER A 1  675 ? 96.006  123.561 145.754 1.00 186.18 ? 1340 SER O CB    1 
ATOM   4656  O  OG    . SER A 1  675 ? 94.858  123.780 146.543 1.00 186.18 ? 1340 SER O OG    1 
ATOM   4657  N  N     . GLU A 1  676 ? 93.326  123.576 143.829 1.00 199.15 ? 1341 GLU O N     1 
ATOM   4658  C  CA    . GLU A 1  676 ? 92.294  122.859 143.084 1.00 199.15 ? 1341 GLU O CA    1 
ATOM   4659  C  C     . GLU A 1  676 ? 92.488  122.999 141.579 1.00 199.15 ? 1341 GLU O C     1 
ATOM   4660  O  O     . GLU A 1  676 ? 92.129  122.087 140.824 1.00 199.15 ? 1341 GLU O O     1 
ATOM   4661  C  CB    . GLU A 1  676 ? 90.880  123.298 143.469 1.00 193.04 ? 1341 GLU O CB    1 
ATOM   4662  C  CG    . GLU A 1  676 ? 90.383  122.724 144.777 1.00 193.04 ? 1341 GLU O CG    1 
ATOM   4663  C  CD    . GLU A 1  676 ? 90.384  123.714 145.910 1.00 193.04 ? 1341 GLU O CD    1 
ATOM   4664  O  OE1   . GLU A 1  676 ? 90.652  124.901 145.656 1.00 193.04 ? 1341 GLU O OE1   1 
ATOM   4665  O  OE2   . GLU A 1  676 ? 90.111  123.295 147.051 1.00 193.04 ? 1341 GLU O OE2   1 
ATOM   4666  N  N     . SER A 1  677 ? 93.075  124.109 141.127 1.00 197.65 ? 1342 SER O N     1 
ATOM   4667  C  CA    . SER A 1  677 ? 93.355  124.265 139.704 1.00 197.65 ? 1342 SER O CA    1 
ATOM   4668  C  C     . SER A 1  677 ? 94.464  123.323 139.256 1.00 197.65 ? 1342 SER O C     1 
ATOM   4669  O  O     . SER A 1  677 ? 94.379  122.721 138.180 1.00 197.65 ? 1342 SER O O     1 
ATOM   4670  C  CB    . SER A 1  677 ? 93.736  125.709 139.401 1.00 188.38 ? 1342 SER O CB    1 
ATOM   4671  O  OG    . SER A 1  677 ? 94.960  126.036 140.034 1.00 188.38 ? 1342 SER O OG    1 
ATOM   4672  N  N     . ALA A 1  678 ? 95.516  123.184 140.066 1.00 193.33 ? 1343 ALA O N     1 
ATOM   4673  C  CA    . ALA A 1  678 ? 96.578  122.238 139.749 1.00 193.33 ? 1343 ALA O CA    1 
ATOM   4674  C  C     . ALA A 1  678 ? 96.184  120.795 140.022 1.00 193.33 ? 1343 ALA O C     1 
ATOM   4675  O  O     . ALA A 1  678 ? 96.805  119.886 139.466 1.00 193.33 ? 1343 ALA O O     1 
ATOM   4676  C  CB    . ALA A 1  678 ? 97.849  122.568 140.535 1.00 173.09 ? 1343 ALA O CB    1 
ATOM   4677  N  N     . ALA A 1  679 ? 95.182  120.557 140.868 1.00 196.27 ? 1344 ALA O N     1 
ATOM   4678  C  CA    . ALA A 1  679 ? 94.708  119.193 141.075 1.00 196.27 ? 1344 ALA O CA    1 
ATOM   4679  C  C     . ALA A 1  679 ? 93.829  118.735 139.920 1.00 196.27 ? 1344 ALA O C     1 
ATOM   4680  O  O     . ALA A 1  679 ? 93.949  117.592 139.467 1.00 196.27 ? 1344 ALA O O     1 
ATOM   4681  C  CB    . ALA A 1  679 ? 93.948  119.077 142.397 1.00 177.15 ? 1344 ALA O CB    1 
ATOM   4682  N  N     . VAL A 1  680 ? 92.942  119.604 139.429 1.00 196.15 ? 1345 VAL O N     1 
ATOM   4683  C  CA    . VAL A 1  680 ? 92.131  119.238 138.271 1.00 196.15 ? 1345 VAL O CA    1 
ATOM   4684  C  C     . VAL A 1  680 ? 92.986  119.207 137.011 1.00 196.15 ? 1345 VAL O C     1 
ATOM   4685  O  O     . VAL A 1  680 ? 93.010  118.208 136.282 1.00 196.15 ? 1345 VAL O O     1 
ATOM   4686  C  CB    . VAL A 1  680 ? 90.934  120.195 138.115 1.00 187.02 ? 1345 VAL O CB    1 
ATOM   4687  C  CG1   . VAL A 1  680 ? 90.203  119.909 136.818 1.00 187.02 ? 1345 VAL O CG1   1 
ATOM   4688  C  CG2   . VAL A 1  680 ? 89.976  120.055 139.289 1.00 187.02 ? 1345 VAL O CG2   1 
ATOM   4689  N  N     . TYR A 1  681 ? 93.709  120.293 136.741 1.00 191.37 ? 1346 TYR O N     1 
ATOM   4690  C  CA    . TYR A 1  681 ? 94.427  120.419 135.479 1.00 191.37 ? 1346 TYR O CA    1 
ATOM   4691  C  C     . TYR A 1  681 ? 95.787  119.730 135.490 1.00 191.37 ? 1346 TYR O C     1 
ATOM   4692  O  O     . TYR A 1  681 ? 96.370  119.526 134.418 1.00 191.37 ? 1346 TYR O O     1 
ATOM   4693  C  CB    . TYR A 1  681 ? 94.554  121.899 135.120 1.00 189.50 ? 1346 TYR O CB    1 
ATOM   4694  C  CG    . TYR A 1  681 ? 93.208  122.527 134.839 1.00 189.50 ? 1346 TYR O CG    1 
ATOM   4695  C  CD1   . TYR A 1  681 ? 92.660  122.497 133.564 1.00 189.50 ? 1346 TYR O CD1   1 
ATOM   4696  C  CD2   . TYR A 1  681 ? 92.472  123.121 135.852 1.00 189.50 ? 1346 TYR O CD2   1 
ATOM   4697  C  CE1   . TYR A 1  681 ? 91.423  123.061 133.303 1.00 189.50 ? 1346 TYR O CE1   1 
ATOM   4698  C  CE2   . TYR A 1  681 ? 91.233  123.684 135.601 1.00 189.50 ? 1346 TYR O CE2   1 
ATOM   4699  C  CZ    . TYR A 1  681 ? 90.713  123.652 134.326 1.00 189.50 ? 1346 TYR O CZ    1 
ATOM   4700  O  OH    . TYR A 1  681 ? 89.481  124.214 134.077 1.00 189.50 ? 1346 TYR O OH    1 
ATOM   4701  N  N     . ASN A 1  682 ? 96.306  119.380 136.664 1.00 188.48 ? 1347 ASN O N     1 
ATOM   4702  C  CA    . ASN A 1  682 ? 97.351  118.377 136.804 1.00 188.48 ? 1347 ASN O CA    1 
ATOM   4703  C  C     . ASN A 1  682 ? 96.775  117.008 137.126 1.00 188.48 ? 1347 ASN O C     1 
ATOM   4704  O  O     . ASN A 1  682 ? 97.529  116.082 137.435 1.00 188.48 ? 1347 ASN O O     1 
ATOM   4705  C  CB    . ASN A 1  682 ? 98.364  118.794 137.872 1.00 184.04 ? 1347 ASN O CB    1 
ATOM   4706  C  CG    . ASN A 1  682 ? 99.283  119.903 137.402 1.00 184.04 ? 1347 ASN O CG    1 
ATOM   4707  O  OD1   . ASN A 1  682 ? 100.247 119.660 136.678 1.00 184.04 ? 1347 ASN O OD1   1 
ATOM   4708  N  ND2   . ASN A 1  682 ? 98.984  121.130 137.804 1.00 184.04 ? 1347 ASN O ND2   1 
ATOM   4709  N  N     . GLY A 1  683 ? 95.454  116.873 137.095 1.00 188.76 ? 1348 GLY O N     1 
ATOM   4710  C  CA    . GLY A 1  683 ? 94.773  115.629 137.360 1.00 188.76 ? 1348 GLY O CA    1 
ATOM   4711  C  C     . GLY A 1  683 ? 94.769  114.623 136.232 1.00 188.76 ? 1348 GLY O C     1 
ATOM   4712  O  O     . GLY A 1  683 ? 94.017  113.649 136.297 1.00 188.76 ? 1348 GLY O O     1 
ATOM   4713  N  N     . ARG A 1  684 ? 95.582  114.822 135.197 1.00 194.61 ? 1349 ARG O N     1 
ATOM   4714  C  CA    . ARG A 1  684 ? 95.673  113.871 134.087 1.00 194.61 ? 1349 ARG O CA    1 
ATOM   4715  C  C     . ARG A 1  684 ? 96.134  112.493 134.540 1.00 194.61 ? 1349 ARG O C     1 
ATOM   4716  O  O     . ARG A 1  684 ? 97.129  111.975 134.041 1.00 194.61 ? 1349 ARG O O     1 
ATOM   4717  C  CB    . ARG A 1  684 ? 96.622  114.397 133.008 1.00 177.16 ? 1349 ARG O CB    1 
ATOM   4718  C  CG    . ARG A 1  684 ? 96.175  115.706 132.372 1.00 177.16 ? 1349 ARG O CG    1 
ATOM   4719  C  CD    . ARG A 1  684 ? 94.956  115.497 131.486 1.00 177.16 ? 1349 ARG O CD    1 
ATOM   4720  N  NE    . ARG A 1  684 ? 94.539  116.725 130.821 1.00 177.16 ? 1349 ARG O NE    1 
ATOM   4721  C  CZ    . ARG A 1  684 ? 93.654  117.573 131.326 1.00 177.16 ? 1349 ARG O CZ    1 
ATOM   4722  N  NH1   . ARG A 1  684 ? 93.326  118.671 130.659 1.00 177.16 ? 1349 ARG O NH1   1 
ATOM   4723  N  NH2   . ARG A 1  684 ? 93.098  117.323 132.502 1.00 177.16 ? 1349 ARG O NH2   1 
ATOM   4724  N  N     . LYS B 2  37  ? 123.054 140.578 87.437  1.00 148.49 ? 37   LYS A N     1 
ATOM   4725  C  CA    . LYS B 2  37  ? 122.570 139.778 88.555  1.00 152.61 ? 37   LYS A CA    1 
ATOM   4726  C  C     . LYS B 2  37  ? 123.487 138.593 88.806  1.00 157.26 ? 37   LYS A C     1 
ATOM   4727  O  O     . LYS B 2  37  ? 124.187 138.144 87.903  1.00 156.12 ? 37   LYS A O     1 
ATOM   4728  C  CB    . LYS B 2  37  ? 121.145 139.290 88.289  1.00 123.68 ? 37   LYS A CB    1 
ATOM   4729  N  N     . PRO B 2  38  ? 123.490 138.087 90.034  1.00 160.82 ? 38   PRO A N     1 
ATOM   4730  C  CA    . PRO B 2  38  ? 124.270 136.883 90.323  1.00 158.06 ? 38   PRO A CA    1 
ATOM   4731  C  C     . PRO B 2  38  ? 123.797 135.712 89.478  1.00 158.60 ? 38   PRO A C     1 
ATOM   4732  O  O     . PRO B 2  38  ? 122.704 135.716 88.909  1.00 159.46 ? 38   PRO A O     1 
ATOM   4733  C  CB    . PRO B 2  38  ? 124.006 136.636 91.815  1.00 148.65 ? 38   PRO A CB    1 
ATOM   4734  C  CG    . PRO B 2  38  ? 123.666 137.980 92.355  1.00 150.99 ? 38   PRO A CG    1 
ATOM   4735  C  CD    . PRO B 2  38  ? 122.913 138.675 91.255  1.00 155.39 ? 38   PRO A CD    1 
ATOM   4736  N  N     . HIS B 2  39  ? 124.646 134.696 89.404  1.00 142.95 ? 39   HIS A N     1 
ATOM   4737  C  CA    . HIS B 2  39  ? 124.317 133.501 88.643  1.00 136.85 ? 39   HIS A CA    1 
ATOM   4738  C  C     . HIS B 2  39  ? 123.148 132.803 89.314  1.00 130.76 ? 39   HIS A C     1 
ATOM   4739  O  O     . HIS B 2  39  ? 123.231 132.424 90.485  1.00 130.33 ? 39   HIS A O     1 
ATOM   4740  C  CB    . HIS B 2  39  ? 125.545 132.598 88.573  1.00 143.41 ? 39   HIS A CB    1 
ATOM   4741  C  CG    . HIS B 2  39  ? 125.338 131.325 87.816  1.00 137.67 ? 39   HIS A CG    1 
ATOM   4742  N  ND1   . HIS B 2  39  ? 124.880 130.171 88.412  1.00 134.95 ? 39   HIS A ND1   1 
ATOM   4743  C  CD2   . HIS B 2  39  ? 125.546 131.018 86.515  1.00 133.46 ? 39   HIS A CD2   1 
ATOM   4744  C  CE1   . HIS B 2  39  ? 124.814 129.209 87.511  1.00 132.92 ? 39   HIS A CE1   1 
ATOM   4745  N  NE2   . HIS B 2  39  ? 125.209 129.698 86.351  1.00 133.26 ? 39   HIS A NE2   1 
ATOM   4746  N  N     . ARG B 2  40  ? 122.058 132.644 88.572  1.00 125.05 ? 40   ARG A N     1 
ATOM   4747  C  CA    . ARG B 2  40  ? 120.812 132.103 89.098  1.00 116.05 ? 40   ARG A CA    1 
ATOM   4748  C  C     . ARG B 2  40  ? 120.253 131.101 88.110  1.00 110.13 ? 40   ARG A C     1 
ATOM   4749  O  O     . ARG B 2  40  ? 120.025 131.434 86.946  1.00 104.42 ? 40   ARG A O     1 
ATOM   4750  C  CB    . ARG B 2  40  ? 119.790 133.210 89.355  1.00 122.60 ? 40   ARG A CB    1 
ATOM   4751  C  CG    . ARG B 2  40  ? 120.138 134.117 90.510  1.00 125.37 ? 40   ARG A CG    1 
ATOM   4752  C  CD    . ARG B 2  40  ? 119.166 135.276 90.603  1.00 125.82 ? 40   ARG A CD    1 
ATOM   4753  N  NE    . ARG B 2  40  ? 117.803 134.847 90.886  1.00 123.04 ? 40   ARG A NE    1 
ATOM   4754  C  CZ    . ARG B 2  40  ? 117.332 134.621 92.107  1.00 127.06 ? 40   ARG A CZ    1 
ATOM   4755  N  NH1   . ARG B 2  40  ? 118.120 134.777 93.160  1.00 129.69 ? 40   ARG A NH1   1 
ATOM   4756  N  NH2   . ARG B 2  40  ? 116.075 134.239 92.274  1.00 124.38 ? 40   ARG A NH2   1 
ATOM   4757  N  N     . TYR B 2  41  ? 120.037 129.878 88.572  1.00 120.93 ? 41   TYR A N     1 
ATOM   4758  C  CA    . TYR B 2  41  ? 119.408 128.880 87.733  1.00 100.09 ? 41   TYR A CA    1 
ATOM   4759  C  C     . TYR B 2  41  ? 117.962 129.260 87.459  1.00 104.35 ? 41   TYR A C     1 
ATOM   4760  O  O     . TYR B 2  41  ? 117.349 130.039 88.190  1.00 106.86 ? 41   TYR A O     1 
ATOM   4761  C  CB    . TYR B 2  41  ? 119.447 127.523 88.411  1.00 100.22 ? 41   TYR A CB    1 
ATOM   4762  C  CG    . TYR B 2  41  ? 120.827 126.994 88.661  1.00 109.79 ? 41   TYR A CG    1 
ATOM   4763  C  CD1   . TYR B 2  41  ? 121.477 126.234 87.707  1.00 114.50 ? 41   TYR A CD1   1 
ATOM   4764  C  CD2   . TYR B 2  41  ? 121.475 127.241 89.858  1.00 118.92 ? 41   TYR A CD2   1 
ATOM   4765  C  CE1   . TYR B 2  41  ? 122.731 125.735 87.933  1.00 120.25 ? 41   TYR A CE1   1 
ATOM   4766  C  CE2   . TYR B 2  41  ? 122.730 126.746 90.092  1.00 121.88 ? 41   TYR A CE2   1 
ATOM   4767  C  CZ    . TYR B 2  41  ? 123.354 125.994 89.125  1.00 123.14 ? 41   TYR A CZ    1 
ATOM   4768  O  OH    . TYR B 2  41  ? 124.612 125.495 89.348  1.00 126.14 ? 41   TYR A OH    1 
ATOM   4769  N  N     . ARG B 2  42  ? 117.416 128.706 86.384  1.00 89.53  ? 42   ARG A N     1 
ATOM   4770  C  CA    . ARG B 2  42  ? 115.981 128.782 86.207  1.00 97.56  ? 42   ARG A CA    1 
ATOM   4771  C  C     . ARG B 2  42  ? 115.296 127.937 87.272  1.00 93.96  ? 42   ARG A C     1 
ATOM   4772  O  O     . ARG B 2  42  ? 115.841 126.922 87.709  1.00 91.14  ? 42   ARG A O     1 
ATOM   4773  C  CB    . ARG B 2  42  ? 115.561 128.283 84.837  1.00 98.17  ? 42   ARG A CB    1 
ATOM   4774  C  CG    . ARG B 2  42  ? 115.943 129.160 83.686  1.00 107.65 ? 42   ARG A CG    1 
ATOM   4775  C  CD    . ARG B 2  42  ? 115.290 128.610 82.443  1.00 118.79 ? 42   ARG A CD    1 
ATOM   4776  N  NE    . ARG B 2  42  ? 115.595 129.385 81.251  1.00 128.40 ? 42   ARG A NE    1 
ATOM   4777  C  CZ    . ARG B 2  42  ? 115.163 129.064 80.039  1.00 137.53 ? 42   ARG A CZ    1 
ATOM   4778  N  NH1   . ARG B 2  42  ? 114.403 127.989 79.876  1.00 139.86 ? 42   ARG A NH1   1 
ATOM   4779  N  NH2   . ARG B 2  42  ? 115.481 129.815 78.994  1.00 140.30 ? 42   ARG A NH2   1 
ATOM   4780  N  N     . PRO B 2  43  ? 114.110 128.338 87.712  1.00 85.73  ? 43   PRO A N     1 
ATOM   4781  C  CA    . PRO B 2  43  ? 113.372 127.509 88.663  1.00 77.03  ? 43   PRO A CA    1 
ATOM   4782  C  C     . PRO B 2  43  ? 113.188 126.109 88.109  1.00 74.12  ? 43   PRO A C     1 
ATOM   4783  O  O     . PRO B 2  43  ? 112.939 125.921 86.918  1.00 76.08  ? 43   PRO A O     1 
ATOM   4784  C  CB    . PRO B 2  43  ? 112.038 128.243 88.804  1.00 68.42  ? 43   PRO A CB    1 
ATOM   4785  C  CG    . PRO B 2  43  ? 112.371 129.644 88.508  1.00 73.49  ? 43   PRO A CG    1 
ATOM   4786  C  CD    . PRO B 2  43  ? 113.404 129.592 87.425  1.00 79.23  ? 43   PRO A CD    1 
ATOM   4787  N  N     . GLY B 2  44  ? 113.349 125.125 88.979  1.00 73.27  ? 44   GLY A N     1 
ATOM   4788  C  CA    . GLY B 2  44  ? 113.197 123.743 88.617  1.00 67.08  ? 44   GLY A CA    1 
ATOM   4789  C  C     . GLY B 2  44  ? 114.493 122.983 88.431  1.00 80.24  ? 44   GLY A C     1 
ATOM   4790  O  O     . GLY B 2  44  ? 114.483 121.752 88.525  1.00 80.09  ? 44   GLY A O     1 
ATOM   4791  N  N     . THR B 2  45  ? 115.606 123.667 88.180  1.00 74.88  ? 45   THR A N     1 
ATOM   4792  C  CA    . THR B 2  45  ? 116.850 122.926 88.025  1.00 72.51  ? 45   THR A CA    1 
ATOM   4793  C  C     . THR B 2  45  ? 117.436 122.534 89.369  1.00 80.93  ? 45   THR A C     1 
ATOM   4794  O  O     . THR B 2  45  ? 117.925 121.409 89.534  1.00 74.20  ? 45   THR A O     1 
ATOM   4795  C  CB    . THR B 2  45  ? 117.861 123.738 87.244  1.00 102.76 ? 45   THR A CB    1 
ATOM   4796  O  OG1   . THR B 2  45  ? 117.316 124.038 85.958  1.00 113.09 ? 45   THR A OG1   1 
ATOM   4797  C  CG2   . THR B 2  45  ? 119.123 122.930 87.066  1.00 105.09 ? 45   THR A CG2   1 
ATOM   4798  N  N     . VAL B 2  46  ? 117.397 123.447 90.337  1.00 77.63  ? 46   VAL A N     1 
ATOM   4799  C  CA    . VAL B 2  46  ? 117.767 123.084 91.698  1.00 69.85  ? 46   VAL A CA    1 
ATOM   4800  C  C     . VAL B 2  46  ? 116.959 121.879 92.147  1.00 68.28  ? 46   VAL A C     1 
ATOM   4801  O  O     . VAL B 2  46  ? 117.469 120.973 92.818  1.00 68.62  ? 46   VAL A O     1 
ATOM   4802  C  CB    . VAL B 2  46  ? 117.553 124.277 92.637  1.00 70.68  ? 46   VAL A CB    1 
ATOM   4803  C  CG1   . VAL B 2  46  ? 117.982 123.917 94.039  1.00 59.02  ? 46   VAL A CG1   1 
ATOM   4804  C  CG2   . VAL B 2  46  ? 118.283 125.488 92.117  1.00 81.03  ? 46   VAL A CG2   1 
ATOM   4805  N  N     . ALA B 2  47  ? 115.686 121.845 91.765  1.00 60.25  ? 47   ALA A N     1 
ATOM   4806  C  CA    . ALA B 2  47  ? 114.840 120.719 92.118  1.00 54.82  ? 47   ALA A CA    1 
ATOM   4807  C  C     . ALA B 2  47  ? 115.439 119.419 91.618  1.00 54.81  ? 47   ALA A C     1 
ATOM   4808  O  O     . ALA B 2  47  ? 115.774 118.537 92.411  1.00 54.39  ? 47   ALA A O     1 
ATOM   4809  C  CB    . ALA B 2  47  ? 113.442 120.921 91.546  1.00 53.15  ? 47   ALA A CB    1 
ATOM   4810  N  N     . LEU B 2  48  ? 115.621 119.295 90.306  1.00 45.33  ? 48   LEU A N     1 
ATOM   4811  C  CA    . LEU B 2  48  ? 116.149 118.045 89.778  1.00 46.51  ? 48   LEU A CA    1 
ATOM   4812  C  C     . LEU B 2  48  ? 117.468 117.688 90.430  1.00 48.42  ? 48   LEU A C     1 
ATOM   4813  O  O     . LEU B 2  48  ? 117.695 116.529 90.799  1.00 61.75  ? 48   LEU A O     1 
ATOM   4814  C  CB    . LEU B 2  48  ? 116.333 118.115 88.272  1.00 45.08  ? 48   LEU A CB    1 
ATOM   4815  C  CG    . LEU B 2  48  ? 115.125 117.700 87.453  1.00 52.40  ? 48   LEU A CG    1 
ATOM   4816  C  CD1   . LEU B 2  48  ? 114.029 118.732 87.578  1.00 54.78  ? 48   LEU A CD1   1 
ATOM   4817  C  CD2   . LEU B 2  48  ? 115.530 117.487 86.015  1.00 64.10  ? 48   LEU A CD2   1 
ATOM   4818  N  N     . ARG B 2  49  ? 118.345 118.669 90.600  1.00 55.72  ? 49   ARG A N     1 
ATOM   4819  C  CA    . ARG B 2  49  ? 119.634 118.351 91.186  1.00 62.23  ? 49   ARG A CA    1 
ATOM   4820  C  C     . ARG B 2  49  ? 119.452 117.753 92.574  1.00 66.58  ? 49   ARG A C     1 
ATOM   4821  O  O     . ARG B 2  49  ? 120.121 116.773 92.932  1.00 65.36  ? 49   ARG A O     1 
ATOM   4822  C  CB    . ARG B 2  49  ? 120.506 119.598 91.204  1.00 80.02  ? 49   ARG A CB    1 
ATOM   4823  C  CG    . ARG B 2  49  ? 121.948 119.347 91.534  1.00 90.15  ? 49   ARG A CG    1 
ATOM   4824  C  CD    . ARG B 2  49  ? 122.759 120.613 91.354  1.00 93.13  ? 49   ARG A CD    1 
ATOM   4825  N  NE    . ARG B 2  49  ? 122.345 121.646 92.291  1.00 85.72  ? 49   ARG A NE    1 
ATOM   4826  C  CZ    . ARG B 2  49  ? 121.564 122.667 91.969  1.00 87.94  ? 49   ARG A CZ    1 
ATOM   4827  N  NH1   . ARG B 2  49  ? 121.107 122.784 90.731  1.00 79.39  ? 49   ARG A NH1   1 
ATOM   4828  N  NH2   . ARG B 2  49  ? 121.231 123.563 92.886  1.00 95.56  ? 49   ARG A NH2   1 
ATOM   4829  N  N     . GLU B 2  50  ? 118.492 118.270 93.342  1.00 49.22  ? 50   GLU A N     1 
ATOM   4830  C  CA    . GLU B 2  50  ? 118.139 117.589 94.580  1.00 42.20  ? 50   GLU A CA    1 
ATOM   4831  C  C     . GLU B 2  50  ? 117.684 116.166 94.300  1.00 42.26  ? 50   GLU A C     1 
ATOM   4832  O  O     . GLU B 2  50  ? 118.282 115.211 94.796  1.00 46.78  ? 50   GLU A O     1 
ATOM   4833  C  CB    . GLU B 2  50  ? 117.062 118.344 95.352  1.00 42.89  ? 50   GLU A CB    1 
ATOM   4834  C  CG    . GLU B 2  50  ? 117.543 119.603 96.015  1.00 57.77  ? 50   GLU A CG    1 
ATOM   4835  C  CD    . GLU B 2  50  ? 116.474 120.238 96.878  1.00 65.90  ? 50   GLU A CD    1 
ATOM   4836  O  OE1   . GLU B 2  50  ? 115.315 119.784 96.815  1.00 74.73  ? 50   GLU A OE1   1 
ATOM   4837  O  OE2   . GLU B 2  50  ? 116.790 121.184 97.630  1.00 58.67  ? 50   GLU A OE2   1 
ATOM   4838  N  N     . ILE B 2  51  ? 116.649 116.005 93.473  1.00 33.40  ? 51   ILE A N     1 
ATOM   4839  C  CA    . ILE B 2  51  ? 116.045 114.689 93.302  1.00 33.91  ? 51   ILE A CA    1 
ATOM   4840  C  C     . ILE B 2  51  ? 117.105 113.640 93.046  1.00 49.98  ? 51   ILE A C     1 
ATOM   4841  O  O     . ILE B 2  51  ? 117.088 112.561 93.650  1.00 59.60  ? 51   ILE A O     1 
ATOM   4842  C  CB    . ILE B 2  51  ? 115.001 114.705 92.180  1.00 31.64  ? 51   ILE A CB    1 
ATOM   4843  C  CG1   . ILE B 2  51  ? 113.782 115.492 92.612  1.00 26.83  ? 51   ILE A CG1   1 
ATOM   4844  C  CG2   . ILE B 2  51  ? 114.590 113.311 91.850  1.00 18.68  ? 51   ILE A CG2   1 
ATOM   4845  C  CD1   . ILE B 2  51  ? 112.775 115.631 91.521  1.00 23.70  ? 51   ILE A CD1   1 
ATOM   4846  N  N     . ARG B 2  52  ? 118.067 113.943 92.181  1.00 46.31  ? 52   ARG A N     1 
ATOM   4847  C  CA    . ARG B 2  52  ? 119.188 113.027 92.033  1.00 48.74  ? 52   ARG A CA    1 
ATOM   4848  C  C     . ARG B 2  52  ? 119.911 112.848 93.358  1.00 47.50  ? 52   ARG A C     1 
ATOM   4849  O  O     . ARG B 2  52  ? 120.169 111.717 93.794  1.00 45.17  ? 52   ARG A O     1 
ATOM   4850  C  CB    . ARG B 2  52  ? 120.145 113.530 90.965  1.00 73.91  ? 52   ARG A CB    1 
ATOM   4851  C  CG    . ARG B 2  52  ? 119.567 113.485 89.576  1.00 80.30  ? 52   ARG A CG    1 
ATOM   4852  C  CD    . ARG B 2  52  ? 120.532 114.075 88.563  1.00 77.29  ? 52   ARG A CD    1 
ATOM   4853  N  NE    . ARG B 2  52  ? 119.993 113.997 87.213  1.00 84.48  ? 52   ARG A NE    1 
ATOM   4854  C  CZ    . ARG B 2  52  ? 119.136 114.874 86.706  1.00 96.72  ? 52   ARG A CZ    1 
ATOM   4855  N  NH1   . ARG B 2  52  ? 118.720 115.896 87.440  1.00 99.54  ? 52   ARG A NH1   1 
ATOM   4856  N  NH2   . ARG B 2  52  ? 118.693 114.727 85.468  1.00 95.00  ? 52   ARG A NH2   1 
ATOM   4857  N  N     . ARG B 2  53  ? 120.214 113.958 94.032  1.00 38.40  ? 53   ARG A N     1 
ATOM   4858  C  CA    . ARG B 2  53  ? 120.976 113.866 95.272  1.00 38.42  ? 53   ARG A CA    1 
ATOM   4859  C  C     . ARG B 2  53  ? 120.326 112.913 96.264  1.00 47.80  ? 53   ARG A C     1 
ATOM   4860  O  O     . ARG B 2  53  ? 120.968 111.983 96.757  1.00 53.09  ? 53   ARG A O     1 
ATOM   4861  C  CB    . ARG B 2  53  ? 121.126 115.241 95.898  1.00 52.38  ? 53   ARG A CB    1 
ATOM   4862  C  CG    . ARG B 2  53  ? 121.855 115.207 97.197  1.00 54.33  ? 53   ARG A CG    1 
ATOM   4863  C  CD    . ARG B 2  53  ? 121.898 116.578 97.782  1.00 65.44  ? 53   ARG A CD    1 
ATOM   4864  N  NE    . ARG B 2  53  ? 122.603 116.587 99.048  1.00 76.75  ? 53   ARG A NE    1 
ATOM   4865  C  CZ    . ARG B 2  53  ? 122.877 117.691 99.723  1.00 87.79  ? 53   ARG A CZ    1 
ATOM   4866  N  NH1   . ARG B 2  53  ? 122.488 118.863 99.246  1.00 86.46  ? 53   ARG A NH1   1 
ATOM   4867  N  NH2   . ARG B 2  53  ? 123.530 117.626 100.873 1.00 99.46  ? 53   ARG A NH2   1 
ATOM   4868  N  N     . TYR B 2  54  ? 119.048 113.122 96.564  1.00 47.70  ? 54   TYR A N     1 
ATOM   4869  C  CA    . TYR B 2  54  ? 118.405 112.317 97.591  1.00 45.35  ? 54   TYR A CA    1 
ATOM   4870  C  C     . TYR B 2  54  ? 118.135 110.907 97.112  1.00 37.03  ? 54   TYR A C     1 
ATOM   4871  O  O     . TYR B 2  54  ? 118.387 109.948 97.845  1.00 37.16  ? 54   TYR A O     1 
ATOM   4872  C  CB    . TYR B 2  54  ? 117.121 112.976 98.059  1.00 57.55  ? 54   TYR A CB    1 
ATOM   4873  C  CG    . TYR B 2  54  ? 117.398 114.193 98.863  1.00 51.93  ? 54   TYR A CG    1 
ATOM   4874  C  CD1   . TYR B 2  54  ? 117.606 114.105 100.216 1.00 57.22  ? 54   TYR A CD1   1 
ATOM   4875  C  CD2   . TYR B 2  54  ? 117.486 115.425 98.268  1.00 49.99  ? 54   TYR A CD2   1 
ATOM   4876  C  CE1   . TYR B 2  54  ? 117.872 115.210 100.957 1.00 59.00  ? 54   TYR A CE1   1 
ATOM   4877  C  CE2   . TYR B 2  54  ? 117.754 116.537 99.000  1.00 46.60  ? 54   TYR A CE2   1 
ATOM   4878  C  CZ    . TYR B 2  54  ? 117.945 116.425 100.345 1.00 49.33  ? 54   TYR A CZ    1 
ATOM   4879  O  OH    . TYR B 2  54  ? 118.216 117.548 101.081 1.00 48.26  ? 54   TYR A OH    1 
ATOM   4880  N  N     . GLN B 2  55  ? 117.640 110.742 95.890  1.00 27.92  ? 55   GLN A N     1 
ATOM   4881  C  CA    . GLN B 2  55  ? 117.410 109.372 95.471  1.00 32.26  ? 55   GLN A CA    1 
ATOM   4882  C  C     . GLN B 2  55  ? 118.699 108.590 95.370  1.00 28.49  ? 55   GLN A C     1 
ATOM   4883  O  O     . GLN B 2  55  ? 118.650 107.375 95.176  1.00 41.11  ? 55   GLN A O     1 
ATOM   4884  C  CB    . GLN B 2  55  ? 116.674 109.311 94.147  1.00 20.51  ? 55   GLN A CB    1 
ATOM   4885  C  CG    . GLN B 2  55  ? 115.293 109.860 94.223  1.00 25.61  ? 55   GLN A CG    1 
ATOM   4886  C  CD    . GLN B 2  55  ? 114.555 109.685 92.942  1.00 31.06  ? 55   GLN A CD    1 
ATOM   4887  O  OE1   . GLN B 2  55  ? 115.156 109.495 91.899  1.00 27.85  ? 55   GLN A OE1   1 
ATOM   4888  N  NE2   . GLN B 2  55  ? 113.241 109.744 93.004  1.00 42.87  ? 55   GLN A NE2   1 
ATOM   4889  N  N     . LYS B 2  56  ? 119.848 109.246 95.494  1.00 36.95  ? 56   LYS A N     1 
ATOM   4890  C  CA    . LYS B 2  56  ? 121.091 108.492 95.543  1.00 32.92  ? 56   LYS A CA    1 
ATOM   4891  C  C     . LYS B 2  56  ? 121.320 107.839 96.906  1.00 45.41  ? 56   LYS A C     1 
ATOM   4892  O  O     . LYS B 2  56  ? 121.679 106.661 96.973  1.00 47.42  ? 56   LYS A O     1 
ATOM   4893  C  CB    . LYS B 2  56  ? 122.261 109.398 95.179  1.00 37.47  ? 56   LYS A CB    1 
ATOM   4894  C  CG    . LYS B 2  56  ? 123.589 108.694 95.184  1.00 61.87  ? 56   LYS A CG    1 
ATOM   4895  C  CD    . LYS B 2  56  ? 124.708 109.642 94.810  1.00 88.38  ? 56   LYS A CD    1 
ATOM   4896  C  CE    . LYS B 2  56  ? 126.062 109.005 95.070  1.00 101.33 ? 56   LYS A CE    1 
ATOM   4897  N  NZ    . LYS B 2  56  ? 126.261 107.774 94.258  1.00 103.89 ? 56   LYS A NZ    1 
ATOM   4898  N  N     . SER B 2  57  ? 121.123 108.574 98.002  1.00 47.50  ? 57   SER A N     1 
ATOM   4899  C  CA    . SER B 2  57  ? 121.598 108.119 99.303  1.00 39.06  ? 57   SER A CA    1 
ATOM   4900  C  C     . SER B 2  57  ? 120.475 107.574 100.182 1.00 44.32  ? 57   SER A C     1 
ATOM   4901  O  O     . SER B 2  57  ? 119.291 107.670 99.866  1.00 52.59  ? 57   SER A O     1 
ATOM   4902  C  CB    . SER B 2  57  ? 122.301 109.259 100.034 1.00 48.51  ? 57   SER A CB    1 
ATOM   4903  O  OG    . SER B 2  57  ? 121.379 110.284 100.338 1.00 59.86  ? 57   SER A OG    1 
ATOM   4904  N  N     . THR B 2  58  ? 120.882 106.999 101.313 1.00 37.88  ? 58   THR A N     1 
ATOM   4905  C  CA    . THR B 2  58  ? 120.003 106.288 102.234 1.00 44.37  ? 58   THR A CA    1 
ATOM   4906  C  C     . THR B 2  58  ? 119.657 107.044 103.509 1.00 45.31  ? 58   THR A C     1 
ATOM   4907  O  O     . THR B 2  58  ? 118.968 106.485 104.362 1.00 51.82  ? 58   THR A O     1 
ATOM   4908  C  CB    . THR B 2  58  ? 120.634 104.961 102.616 1.00 44.41  ? 58   THR A CB    1 
ATOM   4909  O  OG1   . THR B 2  58  ? 121.876 105.212 103.278 1.00 40.28  ? 58   THR A OG1   1 
ATOM   4910  C  CG2   . THR B 2  58  ? 120.903 104.159 101.380 1.00 39.63  ? 58   THR A CG2   1 
ATOM   4911  N  N     . GLU B 2  59  ? 120.136 108.267 103.686 1.00 45.29  ? 59   GLU A N     1 
ATOM   4912  C  CA    . GLU B 2  59  ? 120.072 108.910 104.992 1.00 44.32  ? 59   GLU A CA    1 
ATOM   4913  C  C     . GLU B 2  59  ? 118.641 109.027 105.485 1.00 43.00  ? 59   GLU A C     1 
ATOM   4914  O  O     . GLU B 2  59  ? 117.696 109.082 104.701 1.00 48.93  ? 59   GLU A O     1 
ATOM   4915  C  CB    . GLU B 2  59  ? 120.675 110.304 104.925 1.00 89.42  ? 59   GLU A CB    1 
ATOM   4916  C  CG    . GLU B 2  59  ? 122.140 110.326 104.621 1.00 102.22 ? 59   GLU A CG    1 
ATOM   4917  C  CD    . GLU B 2  59  ? 122.644 111.731 104.447 1.00 113.49 ? 59   GLU A CD    1 
ATOM   4918  O  OE1   . GLU B 2  59  ? 121.799 112.647 104.375 1.00 108.58 ? 59   GLU A OE1   1 
ATOM   4919  O  OE2   . GLU B 2  59  ? 123.876 111.920 104.382 1.00 121.98 ? 59   GLU A OE2   1 
ATOM   4920  N  N     . LEU B 2  60  ? 118.482 109.055 106.802 1.00 48.28  ? 60   LEU A N     1 
ATOM   4921  C  CA    . LEU B 2  60  ? 117.179 109.353 107.374 1.00 51.26  ? 60   LEU A CA    1 
ATOM   4922  C  C     . LEU B 2  60  ? 116.872 110.828 107.201 1.00 57.13  ? 60   LEU A C     1 
ATOM   4923  O  O     . LEU B 2  60  ? 117.696 111.686 107.520 1.00 61.75  ? 60   LEU A O     1 
ATOM   4924  C  CB    . LEU B 2  60  ? 117.142 108.976 108.843 1.00 45.79  ? 60   LEU A CB    1 
ATOM   4925  C  CG    . LEU B 2  60  ? 117.331 107.479 108.991 1.00 37.53  ? 60   LEU A CG    1 
ATOM   4926  C  CD1   . LEU B 2  60  ? 117.328 107.075 110.445 1.00 34.62  ? 60   LEU A CD1   1 
ATOM   4927  C  CD2   . LEU B 2  60  ? 116.244 106.792 108.224 1.00 35.47  ? 60   LEU A CD2   1 
ATOM   4928  N  N     . LEU B 2  61  ? 115.679 111.123 106.710 1.00 35.46  ? 61   LEU A N     1 
ATOM   4929  C  CA    . LEU B 2  61  ? 115.370 112.451 106.225 1.00 36.33  ? 61   LEU A CA    1 
ATOM   4930  C  C     . LEU B 2  61  ? 114.697 113.330 107.258 1.00 40.29  ? 61   LEU A C     1 
ATOM   4931  O  O     . LEU B 2  61  ? 114.426 114.494 106.970 1.00 43.92  ? 61   LEU A O     1 
ATOM   4932  C  CB    . LEU B 2  61  ? 114.489 112.340 104.997 1.00 36.30  ? 61   LEU A CB    1 
ATOM   4933  C  CG    . LEU B 2  61  ? 115.180 111.467 103.966 1.00 34.10  ? 61   LEU A CG    1 
ATOM   4934  C  CD1   . LEU B 2  61  ? 114.320 111.345 102.749 1.00 34.70  ? 61   LEU A CD1   1 
ATOM   4935  C  CD2   . LEU B 2  61  ? 116.524 112.026 103.622 1.00 20.24  ? 61   LEU A CD2   1 
ATOM   4936  N  N     . ILE B 2  62  ? 114.422 112.821 108.448 1.00 40.91  ? 62   ILE A N     1 
ATOM   4937  C  CA    . ILE B 2  62  ? 113.781 113.604 109.492 1.00 33.54  ? 62   ILE A CA    1 
ATOM   4938  C  C     . ILE B 2  62  ? 114.714 113.653 110.682 1.00 39.58  ? 62   ILE A C     1 
ATOM   4939  O  O     . ILE B 2  62  ? 115.113 112.609 111.206 1.00 44.65  ? 62   ILE A O     1 
ATOM   4940  C  CB    . ILE B 2  62  ? 112.435 113.011 109.900 1.00 23.36  ? 62   ILE A CB    1 
ATOM   4941  C  CG1   . ILE B 2  62  ? 111.481 113.053 108.724 1.00 28.82  ? 62   ILE A CG1   1 
ATOM   4942  C  CG2   . ILE B 2  62  ? 111.880 113.790 111.043 1.00 29.34  ? 62   ILE A CG2   1 
ATOM   4943  C  CD1   . ILE B 2  62  ? 110.243 112.246 108.951 1.00 17.27  ? 62   ILE A CD1   1 
ATOM   4944  N  N     . ARG B 2  63  ? 115.063 114.855 111.109 1.00 34.45  ? 63   ARG A N     1 
ATOM   4945  C  CA    . ARG B 2  63  ? 115.968 114.984 112.235 1.00 41.99  ? 63   ARG A CA    1 
ATOM   4946  C  C     . ARG B 2  63  ? 115.393 114.273 113.451 1.00 44.80  ? 63   ARG A C     1 
ATOM   4947  O  O     . ARG B 2  63  ? 114.195 114.347 113.721 1.00 47.45  ? 63   ARG A O     1 
ATOM   4948  C  CB    . ARG B 2  63  ? 116.233 116.459 112.506 1.00 41.10  ? 63   ARG A CB    1 
ATOM   4949  C  CG    . ARG B 2  63  ? 116.981 117.078 111.362 1.00 35.99  ? 63   ARG A CG    1 
ATOM   4950  C  CD    . ARG B 2  63  ? 118.381 116.532 111.391 1.00 45.29  ? 63   ARG A CD    1 
ATOM   4951  N  NE    . ARG B 2  63  ? 119.192 116.894 110.237 1.00 57.70  ? 63   ARG A NE    1 
ATOM   4952  C  CZ    . ARG B 2  63  ? 119.364 116.107 109.180 1.00 60.85  ? 63   ARG A CZ    1 
ATOM   4953  N  NH1   . ARG B 2  63  ? 118.787 114.917 109.139 1.00 58.68  ? 63   ARG A NH1   1 
ATOM   4954  N  NH2   . ARG B 2  63  ? 120.123 116.498 108.168 1.00 61.85  ? 63   ARG A NH2   1 
ATOM   4955  N  N     . LYS B 2  64  ? 116.256 113.552 114.164 1.00 38.16  ? 64   LYS A N     1 
ATOM   4956  C  CA    . LYS B 2  64  ? 115.830 112.632 115.209 1.00 45.64  ? 64   LYS A CA    1 
ATOM   4957  C  C     . LYS B 2  64  ? 114.965 113.289 116.274 1.00 49.97  ? 64   LYS A C     1 
ATOM   4958  O  O     . LYS B 2  64  ? 113.751 113.065 116.321 1.00 52.49  ? 64   LYS A O     1 
ATOM   4959  C  CB    . LYS B 2  64  ? 117.036 112.013 115.897 1.00 73.09  ? 64   LYS A CB    1 
ATOM   4960  C  CG    . LYS B 2  64  ? 117.650 110.834 115.201 1.00 77.96  ? 64   LYS A CG    1 
ATOM   4961  C  CD    . LYS B 2  64  ? 118.409 111.262 113.971 1.00 77.86  ? 64   LYS A CD    1 
ATOM   4962  C  CE    . LYS B 2  64  ? 119.121 110.088 113.335 1.00 82.44  ? 64   LYS A CE    1 
ATOM   4963  N  NZ    . LYS B 2  64  ? 119.893 110.500 112.135 1.00 86.64  ? 64   LYS A NZ    1 
ATOM   4964  N  N     . LEU B 2  65  ? 115.572 114.108 117.122 1.00 33.39  ? 65   LEU A N     1 
ATOM   4965  C  CA    . LEU B 2  65  ? 114.886 114.562 118.325 1.00 35.23  ? 65   LEU A CA    1 
ATOM   4966  C  C     . LEU B 2  65  ? 113.503 115.138 118.087 1.00 37.38  ? 65   LEU A C     1 
ATOM   4967  O  O     . LEU B 2  65  ? 112.620 114.895 118.926 1.00 39.83  ? 65   LEU A O     1 
ATOM   4968  C  CB    . LEU B 2  65  ? 115.759 115.565 119.071 1.00 40.82  ? 65   LEU A CB    1 
ATOM   4969  C  CG    . LEU B 2  65  ? 116.982 114.824 119.572 1.00 48.41  ? 65   LEU A CG    1 
ATOM   4970  C  CD1   . LEU B 2  65  ? 117.909 115.752 120.310 1.00 50.51  ? 65   LEU A CD1   1 
ATOM   4971  C  CD2   . LEU B 2  65  ? 116.544 113.690 120.458 1.00 49.93  ? 65   LEU A CD2   1 
ATOM   4972  N  N     . PRO B 2  66  ? 113.229 115.873 117.015 1.00 36.15  ? 66   PRO A N     1 
ATOM   4973  C  CA    . PRO B 2  66  ? 111.833 116.220 116.761 1.00 34.73  ? 66   PRO A CA    1 
ATOM   4974  C  C     . PRO B 2  66  ? 110.981 114.982 116.674 1.00 35.62  ? 66   PRO A C     1 
ATOM   4975  O  O     . PRO B 2  66  ? 109.921 114.897 117.306 1.00 53.61  ? 66   PRO A O     1 
ATOM   4976  C  CB    . PRO B 2  66  ? 111.895 116.957 115.428 1.00 24.50  ? 66   PRO A CB    1 
ATOM   4977  C  CG    . PRO B 2  66  ? 113.235 117.472 115.361 1.00 34.74  ? 66   PRO A CG    1 
ATOM   4978  C  CD    . PRO B 2  66  ? 114.110 116.461 116.004 1.00 32.22  ? 66   PRO A CD    1 
ATOM   4979  N  N     . PHE B 2  67  ? 111.453 113.984 115.938 1.00 25.16  ? 67   PHE A N     1 
ATOM   4980  C  CA    . PHE B 2  67  ? 110.642 112.798 115.743 1.00 28.46  ? 67   PHE A CA    1 
ATOM   4981  C  C     . PHE B 2  67  ? 110.459 112.054 117.047 1.00 34.47  ? 67   PHE A C     1 
ATOM   4982  O  O     . PHE B 2  67  ? 109.348 111.631 117.369 1.00 40.45  ? 67   PHE A O     1 
ATOM   4983  C  CB    . PHE B 2  67  ? 111.276 111.902 114.700 1.00 27.70  ? 67   PHE A CB    1 
ATOM   4984  C  CG    . PHE B 2  67  ? 110.449 110.742 114.346 1.00 22.76  ? 67   PHE A CG    1 
ATOM   4985  C  CD1   . PHE B 2  67  ? 109.402 110.884 113.477 1.00 25.87  ? 67   PHE A CD1   1 
ATOM   4986  C  CD2   . PHE B 2  67  ? 110.719 109.511 114.860 1.00 21.32  ? 67   PHE A CD2   1 
ATOM   4987  C  CE1   . PHE B 2  67  ? 108.636 109.820 113.138 1.00 17.00  ? 67   PHE A CE1   1 
ATOM   4988  C  CE2   . PHE B 2  67  ? 109.955 108.441 114.521 1.00 17.02  ? 67   PHE A CE2   1 
ATOM   4989  C  CZ    . PHE B 2  67  ? 108.914 108.594 113.659 1.00 21.02  ? 67   PHE A CZ    1 
ATOM   4990  N  N     . GLN B 2  68  ? 111.520 111.913 117.832 1.00 22.61  ? 68   GLN A N     1 
ATOM   4991  C  CA    . GLN B 2  68  ? 111.367 111.180 119.077 1.00 29.43  ? 68   GLN A CA    1 
ATOM   4992  C  C     . GLN B 2  68  ? 110.399 111.879 120.018 1.00 38.15  ? 68   GLN A C     1 
ATOM   4993  O  O     . GLN B 2  68  ? 109.549 111.230 120.639 1.00 36.63  ? 68   GLN A O     1 
ATOM   4994  C  CB    . GLN B 2  68  ? 112.705 110.978 119.756 1.00 15.77  ? 68   GLN A CB    1 
ATOM   4995  C  CG    . GLN B 2  68  ? 112.564 110.097 120.951 1.00 31.15  ? 68   GLN A CG    1 
ATOM   4996  C  CD    . GLN B 2  68  ? 113.881 109.735 121.553 1.00 46.48  ? 68   GLN A CD    1 
ATOM   4997  O  OE1   . GLN B 2  68  ? 114.931 110.112 121.042 1.00 51.59  ? 68   GLN A OE1   1 
ATOM   4998  N  NE2   . GLN B 2  68  ? 113.843 108.983 122.642 1.00 48.47  ? 68   GLN A NE2   1 
ATOM   4999  N  N     . ARG B 2  69  ? 110.497 113.200 120.145 1.00 23.71  ? 69   ARG A N     1 
ATOM   5000  C  CA    . ARG B 2  69  ? 109.506 113.863 120.979 1.00 31.13  ? 69   ARG A CA    1 
ATOM   5001  C  C     . ARG B 2  69  ? 108.113 113.670 120.417 1.00 34.97  ? 69   ARG A C     1 
ATOM   5002  O  O     . ARG B 2  69  ? 107.149 113.535 121.178 1.00 38.58  ? 69   ARG A O     1 
ATOM   5003  C  CB    . ARG B 2  69  ? 109.803 115.346 121.126 1.00 25.25  ? 69   ARG A CB    1 
ATOM   5004  C  CG    . ARG B 2  69  ? 111.047 115.645 121.902 1.00 23.77  ? 69   ARG A CG    1 
ATOM   5005  C  CD    . ARG B 2  69  ? 111.013 117.070 122.361 1.00 28.04  ? 69   ARG A CD    1 
ATOM   5006  N  NE    . ARG B 2  69  ? 110.849 117.987 121.246 1.00 23.73  ? 69   ARG A NE    1 
ATOM   5007  C  CZ    . ARG B 2  69  ? 111.853 118.457 120.525 1.00 31.44  ? 69   ARG A CZ    1 
ATOM   5008  N  NH1   . ARG B 2  69  ? 113.092 118.089 120.806 1.00 30.97  ? 69   ARG A NH1   1 
ATOM   5009  N  NH2   . ARG B 2  69  ? 111.620 119.294 119.528 1.00 39.97  ? 69   ARG A NH2   1 
ATOM   5010  N  N     . LEU B 2  70  ? 107.986 113.629 119.093 1.00 38.67  ? 70   LEU A N     1 
ATOM   5011  C  CA    . LEU B 2  70  ? 106.684 113.357 118.503 1.00 27.62  ? 70   LEU A CA    1 
ATOM   5012  C  C     . LEU B 2  70  ? 106.140 112.023 118.984 1.00 36.22  ? 70   LEU A C     1 
ATOM   5013  O  O     . LEU B 2  70  ? 105.015 111.940 119.494 1.00 37.83  ? 70   LEU A O     1 
ATOM   5014  C  CB    . LEU B 2  70  ? 106.784 113.369 116.990 1.00 23.41  ? 70   LEU A CB    1 
ATOM   5015  C  CG    . LEU B 2  70  ? 105.459 112.979 116.372 1.00 38.78  ? 70   LEU A CG    1 
ATOM   5016  C  CD1   . LEU B 2  70  ? 104.432 113.997 116.745 1.00 48.68  ? 70   LEU A CD1   1 
ATOM   5017  C  CD2   . LEU B 2  70  ? 105.601 112.917 114.893 1.00 33.55  ? 70   LEU A CD2   1 
ATOM   5018  N  N     . VAL B 2  71  ? 106.936 110.968 118.849 1.00 24.67  ? 71   VAL A N     1 
ATOM   5019  C  CA    . VAL B 2  71  ? 106.468 109.645 119.228 1.00 20.73  ? 71   VAL A CA    1 
ATOM   5020  C  C     . VAL B 2  71  ? 106.083 109.618 120.693 1.00 20.99  ? 71   VAL A C     1 
ATOM   5021  O  O     . VAL B 2  71  ? 104.980 109.195 121.047 1.00 28.21  ? 71   VAL A O     1 
ATOM   5022  C  CB    . VAL B 2  71  ? 107.530 108.590 118.913 1.00 22.42  ? 71   VAL A CB    1 
ATOM   5023  C  CG1   . VAL B 2  71  ? 107.083 107.309 119.440 1.00 16.88  ? 71   VAL A CG1   1 
ATOM   5024  C  CG2   . VAL B 2  71  ? 107.691 108.472 117.446 1.00 13.50  ? 71   VAL A CG2   1 
ATOM   5025  N  N     . ARG B 2  72  ? 106.974 110.077 121.571 1.00 23.76  ? 72   ARG A N     1 
ATOM   5026  C  CA    . ARG B 2  72  ? 106.642 110.056 122.991 1.00 31.08  ? 72   ARG A CA    1 
ATOM   5027  C  C     . ARG B 2  72  ? 105.333 110.774 123.262 1.00 38.82  ? 72   ARG A C     1 
ATOM   5028  O  O     . ARG B 2  72  ? 104.493 110.286 124.030 1.00 28.38  ? 72   ARG A O     1 
ATOM   5029  C  CB    . ARG B 2  72  ? 107.761 110.679 123.808 1.00 18.42  ? 72   ARG A CB    1 
ATOM   5030  C  CG    . ARG B 2  72  ? 109.016 109.867 123.805 1.00 21.20  ? 72   ARG A CG    1 
ATOM   5031  C  CD    . ARG B 2  72  ? 110.090 110.528 124.617 1.00 37.29  ? 72   ARG A CD    1 
ATOM   5032  N  NE    . ARG B 2  72  ? 111.314 109.749 124.577 1.00 49.88  ? 72   ARG A NE    1 
ATOM   5033  C  CZ    . ARG B 2  72  ? 111.564 108.740 125.394 1.00 52.11  ? 72   ARG A CZ    1 
ATOM   5034  N  NH1   . ARG B 2  72  ? 110.675 108.411 126.314 1.00 42.58  ? 72   ARG A NH1   1 
ATOM   5035  N  NH2   . ARG B 2  72  ? 112.700 108.070 125.299 1.00 52.34  ? 72   ARG A NH2   1 
ATOM   5036  N  N     . GLU B 2  73  ? 105.127 111.923 122.624 1.00 35.28  ? 73   GLU A N     1 
ATOM   5037  C  CA    . GLU B 2  73  ? 103.853 112.605 122.781 1.00 25.21  ? 73   GLU A CA    1 
ATOM   5038  C  C     . GLU B 2  73  ? 102.701 111.688 122.430 1.00 31.91  ? 73   GLU A C     1 
ATOM   5039  O  O     . GLU B 2  73  ? 101.788 111.488 123.233 1.00 46.59  ? 73   GLU A O     1 
ATOM   5040  C  CB    . GLU B 2  73  ? 103.788 113.848 121.914 1.00 70.56  ? 73   GLU A CB    1 
ATOM   5041  C  CG    . GLU B 2  73  ? 102.456 114.536 122.056 1.00 73.38  ? 73   GLU A CG    1 
ATOM   5042  C  CD    . GLU B 2  73  ? 102.327 115.755 121.179 1.00 97.64  ? 73   GLU A CD    1 
ATOM   5043  O  OE1   . GLU B 2  73  ? 103.263 116.032 120.412 1.00 103.15 ? 73   GLU A OE1   1 
ATOM   5044  O  OE2   . GLU B 2  73  ? 101.285 116.438 121.253 1.00 107.53 ? 73   GLU A OE2   1 
ATOM   5045  N  N     . ILE B 2  74  ? 102.730 111.109 121.231 1.00 34.78  ? 74   ILE A N     1 
ATOM   5046  C  CA    . ILE B 2  74  ? 101.594 110.295 120.814 1.00 29.18  ? 74   ILE A CA    1 
ATOM   5047  C  C     . ILE B 2  74  ? 101.394 109.114 121.747 1.00 33.69  ? 74   ILE A C     1 
ATOM   5048  O  O     . ILE B 2  74  ? 100.264 108.668 121.961 1.00 42.35  ? 74   ILE A O     1 
ATOM   5049  C  CB    . ILE B 2  74  ? 101.768 109.845 119.359 1.00 45.13  ? 74   ILE A CB    1 
ATOM   5050  C  CG1   . ILE B 2  74  ? 101.679 111.045 118.441 1.00 48.84  ? 74   ILE A CG1   1 
ATOM   5051  C  CG2   . ILE B 2  74  ? 100.693 108.901 118.968 1.00 46.59  ? 74   ILE A CG2   1 
ATOM   5052  C  CD1   . ILE B 2  74  ? 101.992 110.717 117.035 1.00 3.68   ? 74   ILE A CD1   1 
ATOM   5053  N  N     . ALA B 2  75  ? 102.461 108.611 122.348 1.00 22.98  ? 75   ALA A N     1 
ATOM   5054  C  CA    . ALA B 2  75  ? 102.297 107.476 123.237 1.00 25.91  ? 75   ALA A CA    1 
ATOM   5055  C  C     . ALA B 2  75  ? 101.823 107.872 124.622 1.00 34.28  ? 75   ALA A C     1 
ATOM   5056  O  O     . ALA B 2  75  ? 101.415 106.996 125.384 1.00 37.95  ? 75   ALA A O     1 
ATOM   5057  C  CB    . ALA B 2  75  ? 103.600 106.698 123.360 1.00 24.66  ? 75   ALA A CB    1 
ATOM   5058  N  N     . GLN B 2  76  ? 101.875 109.155 124.983 1.00 34.99  ? 76   GLN A N     1 
ATOM   5059  C  CA    . GLN B 2  76  ? 101.315 109.554 126.272 1.00 30.11  ? 76   GLN A CA    1 
ATOM   5060  C  C     . GLN B 2  76  ? 99.868  109.120 126.411 1.00 43.27  ? 76   GLN A C     1 
ATOM   5061  O  O     . GLN B 2  76  ? 99.430  108.728 127.495 1.00 51.30  ? 76   GLN A O     1 
ATOM   5062  C  CB    . GLN B 2  76  ? 101.391 111.063 126.454 1.00 32.24  ? 76   GLN A CB    1 
ATOM   5063  C  CG    . GLN B 2  76  ? 102.778 111.608 126.570 1.00 52.29  ? 76   GLN A CG    1 
ATOM   5064  C  CD    . GLN B 2  76  ? 102.776 113.114 126.622 1.00 54.26  ? 76   GLN A CD    1 
ATOM   5065  O  OE1   . GLN B 2  76  ? 101.825 113.755 126.175 1.00 55.36  ? 76   GLN A OE1   1 
ATOM   5066  N  NE2   . GLN B 2  76  ? 103.846 113.692 127.155 1.00 33.45  ? 76   GLN A NE2   1 
ATOM   5067  N  N     . ASP B 2  77  ? 99.109  109.179 125.324 1.00 44.66  ? 77   ASP A N     1 
ATOM   5068  C  CA    . ASP B 2  77  ? 97.663  109.081 125.443 1.00 36.74  ? 77   ASP A CA    1 
ATOM   5069  C  C     . ASP B 2  77  ? 97.209  107.671 125.760 1.00 42.47  ? 77   ASP A C     1 
ATOM   5070  O  O     . ASP B 2  77  ? 96.192  107.487 126.432 1.00 65.38  ? 77   ASP A O     1 
ATOM   5071  C  CB    . ASP B 2  77  ? 97.012  109.553 124.155 1.00 47.87  ? 77   ASP A CB    1 
ATOM   5072  C  CG    . ASP B 2  77  ? 97.376  110.970 123.825 1.00 67.14  ? 77   ASP A CG    1 
ATOM   5073  O  OD1   . ASP B 2  77  ? 97.938  111.647 124.710 1.00 67.26  ? 77   ASP A OD1   1 
ATOM   5074  O  OD2   . ASP B 2  77  ? 97.114  111.407 122.687 1.00 78.07  ? 77   ASP A OD2   1 
ATOM   5075  N  N     . PHE B 2  78  ? 97.933  106.665 125.289 1.00 31.82  ? 78   PHE A N     1 
ATOM   5076  C  CA    . PHE B 2  78  ? 97.428  105.300 125.391 1.00 32.26  ? 78   PHE A CA    1 
ATOM   5077  C  C     . PHE B 2  78  ? 97.719  104.736 126.773 1.00 34.64  ? 78   PHE A C     1 
ATOM   5078  O  O     . PHE B 2  78  ? 96.813  104.572 127.592 1.00 40.87  ? 78   PHE A O     1 
ATOM   5079  C  CB    . PHE B 2  78  ? 98.043  104.443 124.290 1.00 20.34  ? 78   PHE A CB    1 
ATOM   5080  C  CG    . PHE B 2  78  ? 97.768  104.961 122.926 1.00 27.56  ? 78   PHE A CG    1 
ATOM   5081  C  CD1   . PHE B 2  78  ? 96.716  105.815 122.705 1.00 35.90  ? 78   PHE A CD1   1 
ATOM   5082  C  CD2   . PHE B 2  78  ? 98.573  104.622 121.871 1.00 24.80  ? 78   PHE A CD2   1 
ATOM   5083  C  CE1   . PHE B 2  78  ? 96.469  106.304 121.463 1.00 31.42  ? 78   PHE A CE1   1 
ATOM   5084  C  CE2   . PHE B 2  78  ? 98.328  105.114 120.629 1.00 26.91  ? 78   PHE A CE2   1 
ATOM   5085  C  CZ    . PHE B 2  78  ? 97.274  105.953 120.424 1.00 21.45  ? 78   PHE A CZ    1 
ATOM   5086  N  N     . LYS B 2  79  ? 98.975  104.449 127.052 1.00 33.30  ? 79   LYS A N     1 
ATOM   5087  C  CA    . LYS B 2  79  ? 99.411  104.209 128.412 1.00 32.91  ? 79   LYS A CA    1 
ATOM   5088  C  C     . LYS B 2  79  ? 100.320 105.362 128.805 1.00 35.65  ? 79   LYS A C     1 
ATOM   5089  O  O     . LYS B 2  79  ? 100.630 106.234 127.995 1.00 38.94  ? 79   LYS A O     1 
ATOM   5090  C  CB    . LYS B 2  79  ? 100.108 102.853 128.527 1.00 27.36  ? 79   LYS A CB    1 
ATOM   5091  C  CG    . LYS B 2  79  ? 100.493 102.448 129.942 1.00 38.42  ? 79   LYS A CG    1 
ATOM   5092  C  CD    . LYS B 2  79  ? 101.206 101.117 129.990 1.00 46.18  ? 79   LYS A CD    1 
ATOM   5093  C  CE    . LYS B 2  79  ? 101.823 100.892 131.356 1.00 55.96  ? 79   LYS A CE    1 
ATOM   5094  N  NZ    . LYS B 2  79  ? 100.807 100.881 132.433 1.00 65.75  ? 79   LYS A NZ    1 
ATOM   5095  N  N     . THR B 2  80  ? 100.750 105.372 130.053 1.00 62.53  ? 80   THR A N     1 
ATOM   5096  C  CA    . THR B 2  80  ? 101.582 106.443 130.560 1.00 68.50  ? 80   THR A CA    1 
ATOM   5097  C  C     . THR B 2  80  ? 102.873 105.875 131.121 1.00 65.75  ? 80   THR A C     1 
ATOM   5098  O  O     . THR B 2  80  ? 102.917 104.739 131.598 1.00 56.31  ? 80   THR A O     1 
ATOM   5099  C  CB    . THR B 2  80  ? 100.844 107.246 131.622 1.00 96.31  ? 80   THR A CB    1 
ATOM   5100  O  OG1   . THR B 2  80  ? 101.658 108.346 132.035 1.00 106.24 ? 80   THR A OG1   1 
ATOM   5101  C  CG2   . THR B 2  80  ? 100.522 106.379 132.816 1.00 88.74  ? 80   THR A CG2   1 
ATOM   5102  N  N     . ASP B 2  81  ? 103.929 106.675 131.035 1.00 87.81  ? 81   ASP A N     1 
ATOM   5103  C  CA    . ASP B 2  81  ? 105.248 106.299 131.528 1.00 87.92  ? 81   ASP A CA    1 
ATOM   5104  C  C     . ASP B 2  81  ? 105.796 105.078 130.798 1.00 85.00  ? 81   ASP A C     1 
ATOM   5105  O  O     . ASP B 2  81  ? 106.271 104.123 131.409 1.00 81.56  ? 81   ASP A O     1 
ATOM   5106  C  CB    . ASP B 2  81  ? 105.220 106.061 133.034 1.00 128.94 ? 81   ASP A CB    1 
ATOM   5107  C  CG    . ASP B 2  81  ? 104.996 107.333 133.806 1.00 142.45 ? 81   ASP A CG    1 
ATOM   5108  O  OD1   . ASP B 2  81  ? 105.149 108.415 133.204 1.00 146.49 ? 81   ASP A OD1   1 
ATOM   5109  O  OD2   . ASP B 2  81  ? 104.669 107.258 135.008 1.00 144.69 ? 81   ASP A OD2   1 
ATOM   5110  N  N     . LEU B 2  82  ? 105.720 105.110 129.476 1.00 57.64  ? 82   LEU A N     1 
ATOM   5111  C  CA    . LEU B 2  82  ? 106.427 104.120 128.690 1.00 44.47  ? 82   LEU A CA    1 
ATOM   5112  C  C     . LEU B 2  82  ? 107.891 104.486 128.539 1.00 48.20  ? 82   LEU A C     1 
ATOM   5113  O  O     . LEU B 2  82  ? 108.283 105.646 128.630 1.00 37.74  ? 82   LEU A O     1 
ATOM   5114  C  CB    . LEU B 2  82  ? 105.806 103.959 127.315 1.00 35.79  ? 82   LEU A CB    1 
ATOM   5115  C  CG    . LEU B 2  82  ? 104.513 103.174 127.301 1.00 46.52  ? 82   LEU A CG    1 
ATOM   5116  C  CD1   . LEU B 2  82  ? 103.957 103.186 125.923 1.00 40.64  ? 82   LEU A CD1   1 
ATOM   5117  C  CD2   . LEU B 2  82  ? 104.812 101.769 127.706 1.00 41.24  ? 82   LEU A CD2   1 
ATOM   5118  N  N     . ARG B 2  83  ? 108.700 103.465 128.294 1.00 36.38  ? 83   ARG A N     1 
ATOM   5119  C  CA    . ARG B 2  83  ? 110.106 103.633 127.980 1.00 33.16  ? 83   ARG A CA    1 
ATOM   5120  C  C     . ARG B 2  83  ? 110.411 102.963 126.655 1.00 30.85  ? 83   ARG A C     1 
ATOM   5121  O  O     . ARG B 2  83  ? 110.124 101.779 126.475 1.00 32.25  ? 83   ARG A O     1 
ATOM   5122  C  CB    . ARG B 2  83  ? 110.980 103.042 129.066 1.00 37.85  ? 83   ARG A CB    1 
ATOM   5123  C  CG    . ARG B 2  83  ? 110.850 103.783 130.339 1.00 52.34  ? 83   ARG A CG    1 
ATOM   5124  C  CD    . ARG B 2  83  ? 111.786 103.267 131.378 1.00 57.77  ? 83   ARG A CD    1 
ATOM   5125  N  NE    . ARG B 2  83  ? 111.551 103.991 132.613 1.00 56.81  ? 83   ARG A NE    1 
ATOM   5126  C  CZ    . ARG B 2  83  ? 112.134 103.708 133.766 1.00 73.31  ? 83   ARG A CZ    1 
ATOM   5127  N  NH1   . ARG B 2  83  ? 113.001 102.710 133.846 1.00 61.45  ? 83   ARG A NH1   1 
ATOM   5128  N  NH2   . ARG B 2  83  ? 111.845 104.428 134.839 1.00 92.81  ? 83   ARG A NH2   1 
ATOM   5129  N  N     . PHE B 2  84  ? 111.007 103.712 125.746 1.00 30.11  ? 84   PHE A N     1 
ATOM   5130  C  CA    . PHE B 2  84  ? 111.337 103.219 124.425 1.00 24.86  ? 84   PHE A CA    1 
ATOM   5131  C  C     . PHE B 2  84  ? 112.785 102.791 124.354 1.00 21.05  ? 84   PHE A C     1 
ATOM   5132  O  O     . PHE B 2  84  ? 113.675 103.567 124.695 1.00 23.40  ? 84   PHE A O     1 
ATOM   5133  C  CB    . PHE B 2  84  ? 111.090 104.299 123.388 1.00 35.10  ? 84   PHE A CB    1 
ATOM   5134  C  CG    . PHE B 2  84  ? 109.666 104.537 123.110 1.00 30.71  ? 84   PHE A CG    1 
ATOM   5135  C  CD1   . PHE B 2  84  ? 108.743 103.572 123.375 1.00 25.51  ? 84   PHE A CD1   1 
ATOM   5136  C  CD2   . PHE B 2  84  ? 109.249 105.710 122.560 1.00 26.21  ? 84   PHE A CD2   1 
ATOM   5137  C  CE1   . PHE B 2  84  ? 107.436 103.778 123.099 1.00 33.56  ? 84   PHE A CE1   1 
ATOM   5138  C  CE2   . PHE B 2  84  ? 107.946 105.917 122.298 1.00 25.68  ? 84   PHE A CE2   1 
ATOM   5139  C  CZ    . PHE B 2  84  ? 107.037 104.952 122.563 1.00 26.34  ? 84   PHE A CZ    1 
ATOM   5140  N  N     . GLN B 2  85  ? 113.026 101.574 123.895 1.00 18.79  ? 85   GLN A N     1 
ATOM   5141  C  CA    . GLN B 2  85  ? 114.361 101.260 123.425 1.00 15.43  ? 85   GLN A CA    1 
ATOM   5142  C  C     . GLN B 2  85  ? 114.654 102.110 122.209 1.00 19.64  ? 85   GLN A C     1 
ATOM   5143  O  O     . GLN B 2  85  ? 113.874 102.129 121.259 1.00 23.06  ? 85   GLN A O     1 
ATOM   5144  C  CB    . GLN B 2  85  ? 114.494 99.787  123.069 1.00 25.75  ? 85   GLN A CB    1 
ATOM   5145  C  CG    . GLN B 2  85  ? 114.509 98.857  124.241 1.00 39.19  ? 85   GLN A CG    1 
ATOM   5146  C  CD    . GLN B 2  85  ? 114.705 97.425  123.814 1.00 40.96  ? 85   GLN A CD    1 
ATOM   5147  O  OE1   . GLN B 2  85  ? 114.383 97.055  122.692 1.00 35.32  ? 85   GLN A OE1   1 
ATOM   5148  N  NE2   . GLN B 2  85  ? 115.253 96.612  124.702 1.00 30.81  ? 85   GLN A NE2   1 
ATOM   5149  N  N     . SER B 2  86  ? 115.779 102.821 122.238 1.00 43.44  ? 86   SER A N     1 
ATOM   5150  C  CA    . SER B 2  86  ? 116.101 103.721 121.140 1.00 40.03  ? 86   SER A CA    1 
ATOM   5151  C  C     . SER B 2  86  ? 116.005 103.020 119.797 1.00 44.71  ? 86   SER A C     1 
ATOM   5152  O  O     . SER B 2  86  ? 115.592 103.630 118.802 1.00 46.31  ? 86   SER A O     1 
ATOM   5153  C  CB    . SER B 2  86  ? 117.494 104.285 121.331 1.00 62.77  ? 86   SER A CB    1 
ATOM   5154  O  OG    . SER B 2  86  ? 118.428 103.232 121.283 1.00 81.55  ? 86   SER A OG    1 
ATOM   5155  N  N     . SER B 2  87  ? 116.353 101.736 119.752 1.00 42.07  ? 87   SER A N     1 
ATOM   5156  C  CA    . SER B 2  87  ? 116.175 100.975 118.525 1.00 39.24  ? 87   SER A CA    1 
ATOM   5157  C  C     . SER B 2  87  ? 114.740 101.047 118.036 1.00 39.98  ? 87   SER A C     1 
ATOM   5158  O  O     . SER B 2  87  ? 114.493 101.148 116.831 1.00 34.15  ? 87   SER A O     1 
ATOM   5159  C  CB    . SER B 2  87  ? 116.589 99.533  118.751 1.00 37.56  ? 87   SER A CB    1 
ATOM   5160  O  OG    . SER B 2  87  ? 115.798 98.975  119.774 1.00 44.24  ? 87   SER A OG    1 
ATOM   5161  N  N     . ALA B 2  88  ? 113.775 101.005 118.952 1.00 33.73  ? 88   ALA A N     1 
ATOM   5162  C  CA    . ALA B 2  88  ? 112.383 101.151 118.548 1.00 36.96  ? 88   ALA A CA    1 
ATOM   5163  C  C     . ALA B 2  88  ? 112.174 102.461 117.814 1.00 27.01  ? 88   ALA A C     1 
ATOM   5164  O  O     . ALA B 2  88  ? 111.821 102.474 116.631 1.00 28.85  ? 88   ALA A O     1 
ATOM   5165  C  CB    . ALA B 2  88  ? 111.458 101.063 119.753 1.00 19.92  ? 88   ALA A CB    1 
ATOM   5166  N  N     . VAL B 2  89  ? 112.397 103.578 118.498 1.00 19.07  ? 89   VAL A N     1 
ATOM   5167  C  CA    . VAL B 2  89  ? 112.203 104.876 117.865 1.00 23.58  ? 89   VAL A CA    1 
ATOM   5168  C  C     . VAL B 2  89  ? 112.862 104.918 116.501 1.00 25.27  ? 89   VAL A C     1 
ATOM   5169  O  O     . VAL B 2  89  ? 112.299 105.457 115.542 1.00 36.84  ? 89   VAL A O     1 
ATOM   5170  C  CB    . VAL B 2  89  ? 112.720 105.992 118.774 1.00 25.47  ? 89   VAL A CB    1 
ATOM   5171  C  CG1   . VAL B 2  89  ? 112.772 107.266 118.011 1.00 31.66  ? 89   VAL A CG1   1 
ATOM   5172  C  CG2   . VAL B 2  89  ? 111.787 106.143 119.930 1.00 23.35  ? 89   VAL A CG2   1 
ATOM   5173  N  N     . MET B 2  90  ? 114.037 104.310 116.370 1.00 25.72  ? 90   MET A N     1 
ATOM   5174  C  CA    . MET B 2  90  ? 114.597 104.150 115.035 1.00 27.47  ? 90   MET A CA    1 
ATOM   5175  C  C     . MET B 2  90  ? 113.651 103.382 114.126 1.00 29.68  ? 90   MET A C     1 
ATOM   5176  O  O     . MET B 2  90  ? 113.484 103.737 112.954 1.00 40.11  ? 90   MET A O     1 
ATOM   5177  C  CB    . MET B 2  90  ? 115.940 103.451 115.113 1.00 26.79  ? 90   MET A CB    1 
ATOM   5178  C  CG    . MET B 2  90  ? 116.981 104.289 115.785 1.00 38.07  ? 90   MET A CG    1 
ATOM   5179  S  SD    . MET B 2  90  ? 117.213 105.791 114.847 1.00 50.83  ? 90   MET A SD    1 
ATOM   5180  C  CE    . MET B 2  90  ? 117.869 105.082 113.346 1.00 187.11 ? 90   MET A CE    1 
ATOM   5181  N  N     . ALA B 2  91  ? 113.006 102.338 114.645 1.00 20.52  ? 91   ALA A N     1 
ATOM   5182  C  CA    . ALA B 2  91  ? 112.102 101.564 113.806 1.00 23.30  ? 91   ALA A CA    1 
ATOM   5183  C  C     . ALA B 2  91  ? 110.957 102.421 113.306 1.00 33.67  ? 91   ALA A C     1 
ATOM   5184  O  O     . ALA B 2  91  ? 110.708 102.498 112.099 1.00 34.92  ? 91   ALA A O     1 
ATOM   5185  C  CB    . ALA B 2  91  ? 111.573 100.352 114.557 1.00 16.79  ? 91   ALA A CB    1 
ATOM   5186  N  N     . LEU B 2  92  ? 110.253 103.086 114.215 1.00 23.28  ? 92   LEU A N     1 
ATOM   5187  C  CA    . LEU B 2  92  ? 109.188 103.973 113.776 1.00 24.69  ? 92   LEU A CA    1 
ATOM   5188  C  C     . LEU B 2  92  ? 109.681 104.939 112.720 1.00 26.64  ? 92   LEU A C     1 
ATOM   5189  O  O     . LEU B 2  92  ? 109.044 105.109 111.679 1.00 17.74  ? 92   LEU A O     1 
ATOM   5190  C  CB    . LEU B 2  92  ? 108.600 104.737 114.947 1.00 18.25  ? 92   LEU A CB    1 
ATOM   5191  C  CG    . LEU B 2  92  ? 107.784 103.803 115.798 1.00 23.77  ? 92   LEU A CG    1 
ATOM   5192  C  CD1   . LEU B 2  92  ? 107.208 104.552 116.946 1.00 9.70   ? 92   LEU A CD1   1 
ATOM   5193  C  CD2   . LEU B 2  92  ? 106.711 103.277 114.935 1.00 7.91   ? 92   LEU A CD2   1 
ATOM   5194  N  N     . GLN B 2  93  ? 110.827 105.569 112.954 1.00 22.96  ? 93   GLN A N     1 
ATOM   5195  C  CA    . GLN B 2  93  ? 111.298 106.534 111.975 1.00 19.23  ? 93   GLN A CA    1 
ATOM   5196  C  C     . GLN B 2  93  ? 111.465 105.891 110.616 1.00 29.39  ? 93   GLN A C     1 
ATOM   5197  O  O     . GLN B 2  93  ? 111.032 106.448 109.604 1.00 32.26  ? 93   GLN A O     1 
ATOM   5198  C  CB    . GLN B 2  93  ? 112.604 107.161 112.417 1.00 21.03  ? 93   GLN A CB    1 
ATOM   5199  C  CG    . GLN B 2  93  ? 113.056 108.234 111.493 1.00 35.83  ? 93   GLN A CG    1 
ATOM   5200  C  CD    . GLN B 2  93  ? 114.238 108.968 112.034 1.00 49.53  ? 93   GLN A CD    1 
ATOM   5201  O  OE1   . GLN B 2  93  ? 114.668 108.724 113.153 1.00 53.24  ? 93   GLN A OE1   1 
ATOM   5202  N  NE2   . GLN B 2  93  ? 114.775 109.879 111.248 1.00 51.50  ? 93   GLN A NE2   1 
ATOM   5203  N  N     . GLU B 2  94  ? 112.055 104.704 110.567 1.00 19.88  ? 94   GLU A N     1 
ATOM   5204  C  CA    . GLU B 2  94  ? 112.288 104.096 109.267 1.00 25.45  ? 94   GLU A CA    1 
ATOM   5205  C  C     . GLU B 2  94  ? 110.983 103.743 108.575 1.00 34.99  ? 94   GLU A C     1 
ATOM   5206  O  O     . GLU B 2  94  ? 110.807 104.018 107.380 1.00 35.02  ? 94   GLU A O     1 
ATOM   5207  C  CB    . GLU B 2  94  ? 113.159 102.862 109.394 1.00 13.08  ? 94   GLU A CB    1 
ATOM   5208  C  CG    . GLU B 2  94  ? 113.407 102.261 108.055 1.00 32.22  ? 94   GLU A CG    1 
ATOM   5209  C  CD    . GLU B 2  94  ? 114.190 103.191 107.152 1.00 37.12  ? 94   GLU A CD    1 
ATOM   5210  O  OE1   . GLU B 2  94  ? 114.850 104.112 107.666 1.00 37.40  ? 94   GLU A OE1   1 
ATOM   5211  O  OE2   . GLU B 2  94  ? 114.128 103.024 105.918 1.00 33.57  ? 94   GLU A OE2   1 
ATOM   5212  N  N     . ALA B 2  95  ? 110.056 103.130 109.299 1.00 20.44  ? 95   ALA A N     1 
ATOM   5213  C  CA    . ALA B 2  95  ? 108.764 102.842 108.702 1.00 25.93  ? 95   ALA A CA    1 
ATOM   5214  C  C     . ALA B 2  95  ? 108.143 104.118 108.166 1.00 31.31  ? 95   ALA A C     1 
ATOM   5215  O  O     . ALA B 2  95  ? 107.990 104.273 106.953 1.00 39.03  ? 95   ALA A O     1 
ATOM   5216  C  CB    . ALA B 2  95  ? 107.831 102.195 109.710 1.00 23.30  ? 95   ALA A CB    1 
ATOM   5217  N  N     . SER B 2  96  ? 107.827 105.051 109.063 1.00 18.55  ? 96   SER A N     1 
ATOM   5218  C  CA    . SER B 2  96  ? 107.116 106.262 108.674 1.00 18.06  ? 96   SER A CA    1 
ATOM   5219  C  C     . SER B 2  96  ? 107.759 106.952 107.488 1.00 22.34  ? 96   SER A C     1 
ATOM   5220  O  O     . SER B 2  96  ? 107.060 107.407 106.581 1.00 30.85  ? 96   SER A O     1 
ATOM   5221  C  CB    . SER B 2  96  ? 107.030 107.217 109.848 1.00 15.85  ? 96   SER A CB    1 
ATOM   5222  O  OG    . SER B 2  96  ? 106.237 106.639 110.853 1.00 25.76  ? 96   SER A OG    1 
ATOM   5223  N  N     . GLU B 2  97  ? 109.080 107.043 107.457 1.00 28.12  ? 97   GLU A N     1 
ATOM   5224  C  CA    . GLU B 2  97  ? 109.665 107.655 106.278 1.00 32.44  ? 97   GLU A CA    1 
ATOM   5225  C  C     . GLU B 2  97  ? 109.406 106.817 105.040 1.00 23.87  ? 97   GLU A C     1 
ATOM   5226  O  O     . GLU B 2  97  ? 109.155 107.367 103.964 1.00 24.13  ? 97   GLU A O     1 
ATOM   5227  C  CB    . GLU B 2  97  ? 111.148 107.908 106.467 1.00 18.56  ? 97   GLU A CB    1 
ATOM   5228  C  CG    . GLU B 2  97  ? 111.407 109.034 107.430 1.00 28.83  ? 97   GLU A CG    1 
ATOM   5229  C  CD    . GLU B 2  97  ? 112.881 109.336 107.602 1.00 49.93  ? 97   GLU A CD    1 
ATOM   5230  O  OE1   . GLU B 2  97  ? 113.716 108.540 107.126 1.00 51.86  ? 97   GLU A OE1   1 
ATOM   5231  O  OE2   . GLU B 2  97  ? 113.208 110.384 108.202 1.00 53.92  ? 97   GLU A OE2   1 
ATOM   5232  N  N     . ALA B 2  98  ? 109.409 105.494 105.160 1.00 12.80  ? 98   ALA A N     1 
ATOM   5233  C  CA    . ALA B 2  98  ? 109.103 104.726 103.959 1.00 16.00  ? 98   ALA A CA    1 
ATOM   5234  C  C     . ALA B 2  98  ? 107.655 104.900 103.534 1.00 30.01  ? 98   ALA A C     1 
ATOM   5235  O  O     . ALA B 2  98  ? 107.353 104.919 102.334 1.00 23.99  ? 98   ALA A O     1 
ATOM   5236  C  CB    . ALA B 2  98  ? 109.409 103.259 104.173 1.00 25.78  ? 98   ALA A CB    1 
ATOM   5237  N  N     . TYR B 2  99  ? 106.755 105.063 104.493 1.00 14.18  ? 99   TYR A N     1 
ATOM   5238  C  CA    . TYR B 2  99  ? 105.354 105.266 104.165 1.00 11.49  ? 99   TYR A CA    1 
ATOM   5239  C  C     . TYR B 2  99  ? 105.137 106.597 103.469 1.00 9.19   ? 99   TYR A C     1 
ATOM   5240  O  O     . TYR B 2  99  ? 104.549 106.645 102.386 1.00 13.92  ? 99   TYR A O     1 
ATOM   5241  C  CB    . TYR B 2  99  ? 104.527 105.159 105.431 1.00 27.78  ? 99   TYR A CB    1 
ATOM   5242  C  CG    . TYR B 2  99  ? 103.098 105.532 105.291 1.00 15.65  ? 99   TYR A CG    1 
ATOM   5243  C  CD1   . TYR B 2  99  ? 102.244 104.770 104.549 1.00 9.03   ? 99   TYR A CD1   1 
ATOM   5244  C  CD2   . TYR B 2  99  ? 102.584 106.592 105.987 1.00 23.92  ? 99   TYR A CD2   1 
ATOM   5245  C  CE1   . TYR B 2  99  ? 100.929 105.094 104.446 1.00 19.26  ? 99   TYR A CE1   1 
ATOM   5246  C  CE2   . TYR B 2  99  ? 101.274 106.920 105.901 1.00 20.34  ? 99   TYR A CE2   1 
ATOM   5247  C  CZ    . TYR B 2  99  ? 100.445 106.170 105.128 1.00 20.79  ? 99   TYR A CZ    1 
ATOM   5248  O  OH    . TYR B 2  99  ? 99.117  106.496 105.036 1.00 30.75  ? 99   TYR A OH    1 
ATOM   5249  N  N     . LEU B 2  100 ? 105.629 107.689 104.048 1.00 18.36  ? 100  LEU A N     1 
ATOM   5250  C  CA    . LEU B 2  100 ? 105.466 108.972 103.383 1.00 23.09  ? 100  LEU A CA    1 
ATOM   5251  C  C     . LEU B 2  100 ? 106.122 108.981 102.019 1.00 26.32  ? 100  LEU A C     1 
ATOM   5252  O  O     . LEU B 2  100 ? 105.589 109.575 101.080 1.00 20.35  ? 100  LEU A O     1 
ATOM   5253  C  CB    . LEU B 2  100 ? 106.019 110.098 104.229 1.00 47.11  ? 100  LEU A CB    1 
ATOM   5254  C  CG    . LEU B 2  100 ? 105.153 110.290 105.443 1.00 55.30  ? 100  LEU A CG    1 
ATOM   5255  C  CD1   . LEU B 2  100 ? 105.685 111.416 106.263 1.00 61.19  ? 100  LEU A CD1   1 
ATOM   5256  C  CD2   . LEU B 2  100 ? 103.791 110.591 104.958 1.00 52.15  ? 100  LEU A CD2   1 
ATOM   5257  N  N     . VAL B 2  101 ? 107.267 108.328 101.872 1.00 2.47   ? 101  VAL A N     1 
ATOM   5258  C  CA    . VAL B 2  101 ? 107.877 108.285 100.551 1.00 8.50   ? 101  VAL A CA    1 
ATOM   5259  C  C     . VAL B 2  101 ? 106.946 107.616 99.553  1.00 6.62   ? 101  VAL A C     1 
ATOM   5260  O  O     . VAL B 2  101 ? 106.695 108.148 98.464  1.00 5.87   ? 101  VAL A O     1 
ATOM   5261  C  CB    . VAL B 2  101 ? 109.232 107.582 100.600 1.00 25.16  ? 101  VAL A CB    1 
ATOM   5262  C  CG1   . VAL B 2  101 ? 109.674 107.315 99.211  1.00 25.99  ? 101  VAL A CG1   1 
ATOM   5263  C  CG2   . VAL B 2  101 ? 110.213 108.472 101.261 1.00 8.32   ? 101  VAL A CG2   1 
ATOM   5264  N  N     . ALA B 2  102 ? 106.421 106.441 99.895  1.00 20.27  ? 102  ALA A N     1 
ATOM   5265  C  CA    . ALA B 2  102 ? 105.480 105.800 98.983  1.00 12.56  ? 102  ALA A CA    1 
ATOM   5266  C  C     . ALA B 2  102 ? 104.339 106.742 98.650  1.00 18.99  ? 102  ALA A C     1 
ATOM   5267  O  O     . ALA B 2  102 ? 104.007 106.958 97.478  1.00 21.06  ? 102  ALA A O     1 
ATOM   5268  C  CB    . ALA B 2  102 ? 104.940 104.512 99.593  1.00 19.30  ? 102  ALA A CB    1 
ATOM   5269  N  N     . LEU B 2  103 ? 103.761 107.348 99.680  1.00 5.22   ? 103  LEU A N     1 
ATOM   5270  C  CA    . LEU B 2  103 ? 102.624 108.232 99.491  1.00 7.23   ? 103  LEU A CA    1 
ATOM   5271  C  C     . LEU B 2  103 ? 102.929 109.325 98.485  1.00 12.92  ? 103  LEU A C     1 
ATOM   5272  O  O     . LEU B 2  103 ? 102.079 109.676 97.665  1.00 5.51   ? 103  LEU A O     1 
ATOM   5273  C  CB    . LEU B 2  103 ? 102.233 108.845 100.823 1.00 4.37   ? 103  LEU A CB    1 
ATOM   5274  C  CG    . LEU B 2  103 ? 101.042 109.752 100.729 1.00 42.63  ? 103  LEU A CG    1 
ATOM   5275  C  CD1   . LEU B 2  103 ? 99.961  108.872 100.285 1.00 3.51   ? 103  LEU A CD1   1 
ATOM   5276  C  CD2   . LEU B 2  103 ? 100.730 110.316 102.075 1.00 38.39  ? 103  LEU A CD2   1 
ATOM   5277  N  N     . PHE B 2  104 ? 104.141 109.871 98.514  1.00 5.96   ? 104  PHE A N     1 
ATOM   5278  C  CA    . PHE B 2  104 ? 104.441 110.927 97.561  1.00 4.41   ? 104  PHE A CA    1 
ATOM   5279  C  C     . PHE B 2  104 ? 104.732 110.407 96.172  1.00 8.60   ? 104  PHE A C     1 
ATOM   5280  O  O     . PHE B 2  104 ? 104.406 111.090 95.202  1.00 5.06   ? 104  PHE A O     1 
ATOM   5281  C  CB    . PHE B 2  104 ? 105.582 111.792 98.054  1.00 10.63  ? 104  PHE A CB    1 
ATOM   5282  C  CG    . PHE B 2  104 ? 105.176 112.723 99.122  1.00 6.11   ? 104  PHE A CG    1 
ATOM   5283  C  CD1   . PHE B 2  104 ? 103.868 113.070 99.257  1.00 7.85   ? 104  PHE A CD1   1 
ATOM   5284  C  CD2   . PHE B 2  104 ? 106.084 113.247 99.993  1.00 2.55   ? 104  PHE A CD2   1 
ATOM   5285  C  CE1   . PHE B 2  104 ? 103.474 113.927 100.235 1.00 1.44   ? 104  PHE A CE1   1 
ATOM   5286  C  CE2   . PHE B 2  104 ? 105.685 114.101 100.976 1.00 3.66   ? 104  PHE A CE2   1 
ATOM   5287  C  CZ    . PHE B 2  104 ? 104.380 114.438 101.096 1.00 12.63  ? 104  PHE A CZ    1 
ATOM   5288  N  N     . GLU B 2  105 ? 105.319 109.224 96.018  1.00 12.15  ? 105  GLU A N     1 
ATOM   5289  C  CA    . GLU B 2  105 ? 105.362 108.673 94.668  1.00 9.09   ? 105  GLU A CA    1 
ATOM   5290  C  C     . GLU B 2  105 ? 103.959 108.600 94.086  1.00 18.88  ? 105  GLU A C     1 
ATOM   5291  O  O     . GLU B 2  105 ? 103.695 109.112 92.989  1.00 23.63  ? 105  GLU A O     1 
ATOM   5292  C  CB    . GLU B 2  105 ? 106.009 107.292 94.651  1.00 16.29  ? 105  GLU A CB    1 
ATOM   5293  C  CG    . GLU B 2  105 ? 107.491 107.283 94.960  1.00 41.35  ? 105  GLU A CG    1 
ATOM   5294  C  CD    . GLU B 2  105 ? 108.090 105.879 94.970  1.00 64.44  ? 105  GLU A CD    1 
ATOM   5295  O  OE1   . GLU B 2  105 ? 107.325 104.898 94.871  1.00 68.49  ? 105  GLU A OE1   1 
ATOM   5296  O  OE2   . GLU B 2  105 ? 109.328 105.757 95.089  1.00 66.69  ? 105  GLU A OE2   1 
ATOM   5297  N  N     . ASP B 2  106 ? 103.027 108.012 94.838  1.00 25.09  ? 106  ASP A N     1 
ATOM   5298  C  CA    . ASP B 2  106 ? 101.684 107.806 94.306  1.00 28.40  ? 106  ASP A CA    1 
ATOM   5299  C  C     . ASP B 2  106 ? 100.992 109.131 94.016  1.00 29.55  ? 106  ASP A C     1 
ATOM   5300  O  O     . ASP B 2  106 ? 100.480 109.357 92.909  1.00 37.11  ? 106  ASP A O     1 
ATOM   5301  C  CB    . ASP B 2  106 ? 100.871 106.975 95.286  1.00 32.50  ? 106  ASP A CB    1 
ATOM   5302  C  CG    . ASP B 2  106 ? 101.421 105.576 95.447  1.00 47.04  ? 106  ASP A CG    1 
ATOM   5303  O  OD1   . ASP B 2  106 ? 102.270 105.184 94.622  1.00 59.38  ? 106  ASP A OD1   1 
ATOM   5304  O  OD2   . ASP B 2  106 ? 101.008 104.863 96.385  1.00 38.57  ? 106  ASP A OD2   1 
ATOM   5305  N  N     . THR B 2  107 ? 100.968 110.023 95.002  1.00 18.31  ? 107  THR A N     1 
ATOM   5306  C  CA    . THR B 2  107 ? 100.404 111.342 94.773  1.00 22.31  ? 107  THR A CA    1 
ATOM   5307  C  C     . THR B 2  107 ? 100.973 111.965 93.517  1.00 20.43  ? 107  THR A C     1 
ATOM   5308  O  O     . THR B 2  107 ? 100.234 112.504 92.692  1.00 24.96  ? 107  THR A O     1 
ATOM   5309  C  CB    . THR B 2  107 ? 100.670 112.246 95.959  1.00 19.00  ? 107  THR A CB    1 
ATOM   5310  O  OG1   . THR B 2  107 ? 99.977  111.741 97.097  1.00 18.56  ? 107  THR A OG1   1 
ATOM   5311  C  CG2   . THR B 2  107 ? 100.159 113.596 95.669  1.00 11.61  ? 107  THR A CG2   1 
ATOM   5312  N  N     . ASN B 2  108 ? 102.286 111.879 93.342  1.00 14.12  ? 108  ASN A N     1 
ATOM   5313  C  CA    . ASN B 2  108 ? 102.871 112.401 92.120  1.00 16.18  ? 108  ASN A CA    1 
ATOM   5314  C  C     . ASN B 2  108 ? 102.228 111.797 90.893  1.00 26.34  ? 108  ASN A C     1 
ATOM   5315  O  O     . ASN B 2  108 ? 101.932 112.511 89.930  1.00 29.34  ? 108  ASN A O     1 
ATOM   5316  C  CB    . ASN B 2  108 ? 104.355 112.142 92.075  1.00 28.24  ? 108  ASN A CB    1 
ATOM   5317  C  CG    . ASN B 2  108 ? 104.973 112.764 90.887  1.00 31.44  ? 108  ASN A CG    1 
ATOM   5318  O  OD1   . ASN B 2  108 ? 104.516 113.797 90.422  1.00 13.82  ? 108  ASN A OD1   1 
ATOM   5319  N  ND2   . ASN B 2  108 ? 105.996 112.133 90.351  1.00 41.30  ? 108  ASN A ND2   1 
ATOM   5320  N  N     . LEU B 2  109 ? 102.006 110.482 90.894  1.00 27.73  ? 109  LEU A N     1 
ATOM   5321  C  CA    . LEU B 2  109 ? 101.303 109.891 89.760  1.00 31.47  ? 109  LEU A CA    1 
ATOM   5322  C  C     . LEU B 2  109 ? 99.966  110.564 89.523  1.00 35.68  ? 109  LEU A C     1 
ATOM   5323  O  O     . LEU B 2  109 ? 99.589  110.822 88.376  1.00 42.89  ? 109  LEU A O     1 
ATOM   5324  C  CB    . LEU B 2  109 ? 101.122 108.396 89.953  1.00 41.25  ? 109  LEU A CB    1 
ATOM   5325  C  CG    . LEU B 2  109 ? 102.438 107.711 89.670  1.00 36.17  ? 109  LEU A CG    1 
ATOM   5326  C  CD1   . LEU B 2  109 ? 102.376 106.247 89.987  1.00 28.40  ? 109  LEU A CD1   1 
ATOM   5327  C  CD2   . LEU B 2  109 ? 102.701 107.918 88.212  1.00 18.56  ? 109  LEU A CD2   1 
ATOM   5328  N  N     . CYS B 2  110 ? 99.247  110.897 90.590  1.00 25.97  ? 110  CYS A N     1 
ATOM   5329  C  CA    . CYS B 2  110 ? 97.962  111.554 90.380  1.00 26.75  ? 110  CYS A CA    1 
ATOM   5330  C  C     . CYS B 2  110 ? 98.132  112.952 89.798  1.00 29.11  ? 110  CYS A C     1 
ATOM   5331  O  O     . CYS B 2  110 ? 97.442  113.328 88.845  1.00 34.26  ? 110  CYS A O     1 
ATOM   5332  C  CB    . CYS B 2  110 ? 97.175  111.600 91.678  1.00 41.45  ? 110  CYS A CB    1 
ATOM   5333  S  SG    . CYS B 2  110 ? 96.657  109.976 92.210  1.00 37.95  ? 110  CYS A SG    1 
ATOM   5334  N  N     . ALA B 2  111 ? 99.039  113.746 90.355  1.00 17.85  ? 111  ALA A N     1 
ATOM   5335  C  CA    . ALA B 2  111 ? 99.184  115.110 89.872  1.00 17.55  ? 111  ALA A CA    1 
ATOM   5336  C  C     . ALA B 2  111 ? 99.585  115.126 88.412  1.00 32.35  ? 111  ALA A C     1 
ATOM   5337  O  O     . ALA B 2  111 ? 99.023  115.877 87.614  1.00 45.26  ? 111  ALA A O     1 
ATOM   5338  C  CB    . ALA B 2  111 ? 100.201 115.865 90.708  1.00 24.07  ? 111  ALA A CB    1 
ATOM   5339  N  N     . ILE B 2  112 ? 100.555 114.300 88.037  1.00 28.35  ? 112  ILE A N     1 
ATOM   5340  C  CA    . ILE B 2  112 ? 100.886 114.183 86.624  1.00 27.82  ? 112  ILE A CA    1 
ATOM   5341  C  C     . ILE B 2  112 ? 99.661  113.783 85.832  1.00 32.84  ? 112  ILE A C     1 
ATOM   5342  O  O     . ILE B 2  112 ? 99.435  114.266 84.719  1.00 35.37  ? 112  ILE A O     1 
ATOM   5343  C  CB    . ILE B 2  112 ? 102.016 113.172 86.422  1.00 31.45  ? 112  ILE A CB    1 
ATOM   5344  C  CG1   . ILE B 2  112 ? 103.285 113.697 87.050  1.00 29.06  ? 112  ILE A CG1   1 
ATOM   5345  C  CG2   . ILE B 2  112 ? 102.224 112.912 84.962  1.00 17.34  ? 112  ILE A CG2   1 
ATOM   5346  C  CD1   . ILE B 2  112 ? 104.339 112.666 87.122  1.00 28.15  ? 112  ILE A CD1   1 
ATOM   5347  N  N     . HIS B 2  113 ? 98.850  112.891 86.391  1.00 27.65  ? 113  HIS A N     1 
ATOM   5348  C  CA    . HIS B 2  113 ? 97.633  112.488 85.703  1.00 24.04  ? 113  HIS A CA    1 
ATOM   5349  C  C     . HIS B 2  113 ? 96.759  113.681 85.363  1.00 26.71  ? 113  HIS A C     1 
ATOM   5350  O  O     . HIS B 2  113 ? 96.174  113.740 84.280  1.00 35.15  ? 113  HIS A O     1 
ATOM   5351  C  CB    . HIS B 2  113 ? 96.857  111.502 86.560  1.00 17.87  ? 113  HIS A CB    1 
ATOM   5352  C  CG    . HIS B 2  113 ? 95.544  111.128 85.981  1.00 24.48  ? 113  HIS A CG    1 
ATOM   5353  N  ND1   . HIS B 2  113 ? 95.431  110.465 84.784  1.00 29.17  ? 113  HIS A ND1   1 
ATOM   5354  C  CD2   . HIS B 2  113 ? 94.286  111.353 86.413  1.00 28.98  ? 113  HIS A CD2   1 
ATOM   5355  C  CE1   . HIS B 2  113 ? 94.155  110.281 84.510  1.00 29.77  ? 113  HIS A CE1   1 
ATOM   5356  N  NE2   . HIS B 2  113 ? 93.439  110.810 85.484  1.00 31.14  ? 113  HIS A NE2   1 
ATOM   5357  N  N     . ALA B 2  114 ? 96.675  114.653 86.256  1.00 33.15  ? 114  ALA A N     1 
ATOM   5358  C  CA    . ALA B 2  114 ? 95.804  115.786 85.994  1.00 34.04  ? 114  ALA A CA    1 
ATOM   5359  C  C     . ALA B 2  114 ? 96.450  116.841 85.115  1.00 45.15  ? 114  ALA A C     1 
ATOM   5360  O  O     . ALA B 2  114 ? 95.854  117.901 84.918  1.00 50.92  ? 114  ALA A O     1 
ATOM   5361  C  CB    . ALA B 2  114 ? 95.356  116.423 87.303  1.00 42.38  ? 114  ALA A CB    1 
ATOM   5362  N  N     . LYS B 2  115 ? 97.656  116.590 84.615  1.00 35.04  ? 115  LYS A N     1 
ATOM   5363  C  CA    . LYS B 2  115 ? 98.417  117.542 83.810  1.00 38.48  ? 115  LYS A CA    1 
ATOM   5364  C  C     . LYS B 2  115 ? 98.833  118.767 84.607  1.00 45.88  ? 115  LYS A C     1 
ATOM   5365  O  O     . LYS B 2  115 ? 98.958  119.858 84.062  1.00 46.78  ? 115  LYS A O     1 
ATOM   5366  C  CB    . LYS B 2  115 ? 97.652  117.962 82.557  1.00 54.02  ? 115  LYS A CB    1 
ATOM   5367  C  CG    . LYS B 2  115 ? 97.450  116.831 81.590  1.00 65.27  ? 115  LYS A CG    1 
ATOM   5368  C  CD    . LYS B 2  115 ? 96.739  117.296 80.344  1.00 79.79  ? 115  LYS A CD    1 
ATOM   5369  C  CE    . LYS B 2  115 ? 96.526  116.133 79.397  1.00 82.47  ? 115  LYS A CE    1 
ATOM   5370  N  NZ    . LYS B 2  115 ? 97.821  115.530 78.974  1.00 77.72  ? 115  LYS A NZ    1 
ATOM   5371  N  N     . ARG B 2  116 ? 99.047  118.594 85.898  1.00 34.98  ? 116  ARG A N     1 
ATOM   5372  C  CA    . ARG B 2  116 ? 99.731  119.562 86.731  1.00 31.58  ? 116  ARG A CA    1 
ATOM   5373  C  C     . ARG B 2  116 ? 101.035 118.939 87.187  1.00 36.43  ? 116  ARG A C     1 
ATOM   5374  O  O     . ARG B 2  116 ? 101.151 117.716 87.262  1.00 43.73  ? 116  ARG A O     1 
ATOM   5375  C  CB    . ARG B 2  116 ? 98.889  119.943 87.943  1.00 36.95  ? 116  ARG A CB    1 
ATOM   5376  C  CG    . ARG B 2  116 ? 97.673  120.715 87.575  1.00 44.37  ? 116  ARG A CG    1 
ATOM   5377  C  CD    . ARG B 2  116 ? 96.829  121.082 88.769  1.00 43.62  ? 116  ARG A CD    1 
ATOM   5378  N  NE    . ARG B 2  116 ? 96.236  119.915 89.395  1.00 47.68  ? 116  ARG A NE    1 
ATOM   5379  C  CZ    . ARG B 2  116 ? 96.627  119.426 90.557  1.00 43.62  ? 116  ARG A CZ    1 
ATOM   5380  N  NH1   . ARG B 2  116 ? 97.595  120.024 91.220  1.00 43.47  ? 116  ARG A NH1   1 
ATOM   5381  N  NH2   . ARG B 2  116 ? 96.038  118.357 91.062  1.00 32.62  ? 116  ARG A NH2   1 
ATOM   5382  N  N     . VAL B 2  117 ? 102.034 119.771 87.469  1.00 31.46  ? 117  VAL A N     1 
ATOM   5383  C  CA    . VAL B 2  117 ? 103.260 119.248 88.043  1.00 31.54  ? 117  VAL A CA    1 
ATOM   5384  C  C     . VAL B 2  117 ? 103.319 119.412 89.541  1.00 34.35  ? 117  VAL A C     1 
ATOM   5385  O  O     . VAL B 2  117 ? 104.250 118.899 90.164  1.00 34.72  ? 117  VAL A O     1 
ATOM   5386  C  CB    . VAL B 2  117 ? 104.486 119.898 87.402  1.00 33.43  ? 117  VAL A CB    1 
ATOM   5387  C  CG1   . VAL B 2  117 ? 104.571 119.485 85.973  1.00 27.69  ? 117  VAL A CG1   1 
ATOM   5388  C  CG2   . VAL B 2  117 ? 104.355 121.376 87.506  1.00 26.61  ? 117  VAL A CG2   1 
ATOM   5389  N  N     . THR B 2  118 ? 102.347 120.075 90.147  1.00 40.82  ? 118  THR A N     1 
ATOM   5390  C  CA    . THR B 2  118 ? 102.421 120.455 91.551  1.00 45.34  ? 118  THR A CA    1 
ATOM   5391  C  C     . THR B 2  118 ? 101.416 119.662 92.364  1.00 46.95  ? 118  THR A C     1 
ATOM   5392  O  O     . THR B 2  118 ? 100.213 119.903 92.265  1.00 57.01  ? 118  THR A O     1 
ATOM   5393  C  CB    . THR B 2  118 ? 102.165 121.944 91.716  1.00 42.15  ? 118  THR A CB    1 
ATOM   5394  O  OG1   . THR B 2  118 ? 103.204 122.679 91.068  1.00 39.01  ? 118  THR A OG1   1 
ATOM   5395  C  CG2   . THR B 2  118 ? 102.143 122.299 93.166  1.00 40.68  ? 118  THR A CG2   1 
ATOM   5396  N  N     . ILE B 2  119 ? 101.908 118.746 93.199  1.00 25.65  ? 119  ILE A N     1 
ATOM   5397  C  CA    . ILE B 2  119 ? 101.020 118.004 94.076  1.00 31.40  ? 119  ILE A CA    1 
ATOM   5398  C  C     . ILE B 2  119 ? 100.243 118.988 94.937  1.00 39.38  ? 119  ILE A C     1 
ATOM   5399  O  O     . ILE B 2  119 ? 100.721 120.075 95.254  1.00 34.77  ? 119  ILE A O     1 
ATOM   5400  C  CB    . ILE B 2  119 ? 101.818 117.022 94.943  1.00 10.21  ? 119  ILE A CB    1 
ATOM   5401  C  CG1   . ILE B 2  119 ? 102.681 117.773 95.927  1.00 12.63  ? 119  ILE A CG1   1 
ATOM   5402  C  CG2   . ILE B 2  119 ? 102.753 116.236 94.099  1.00 58.26  ? 119  ILE A CG2   1 
ATOM   5403  C  CD1   . ILE B 2  119 ? 103.354 116.885 96.899  1.00 57.17  ? 119  ILE A CD1   1 
ATOM   5404  N  N     . MET B 2  120 ? 99.015  118.637 95.272  1.00 36.14  ? 120  MET A N     1 
ATOM   5405  C  CA    . MET B 2  120 ? 98.133  119.517 96.020  1.00 29.06  ? 120  MET A CA    1 
ATOM   5406  C  C     . MET B 2  120 ? 97.324  118.672 96.981  1.00 26.98  ? 120  MET A C     1 
ATOM   5407  O  O     . MET B 2  120 ? 97.224  117.454 96.806  1.00 35.66  ? 120  MET A O     1 
ATOM   5408  C  CB    . MET B 2  120 ? 97.206  120.291 95.080  1.00 59.00  ? 120  MET A CB    1 
ATOM   5409  C  CG    . MET B 2  120 ? 97.902  121.306 94.231  1.00 61.98  ? 120  MET A CG    1 
ATOM   5410  S  SD    . MET B 2  120 ? 96.769  122.023 93.041  1.00 87.12  ? 120  MET A SD    1 
ATOM   5411  C  CE    . MET B 2  120 ? 95.732  122.972 94.137  1.00 63.86  ? 120  MET A CE    1 
ATOM   5412  N  N     . PRO B 2  121 ? 96.722  119.277 98.004  1.00 32.20  ? 121  PRO A N     1 
ATOM   5413  C  CA    . PRO B 2  121 ? 96.015  118.469 99.006  1.00 32.01  ? 121  PRO A CA    1 
ATOM   5414  C  C     . PRO B 2  121 ? 95.038  117.474 98.417  1.00 37.58  ? 121  PRO A C     1 
ATOM   5415  O  O     . PRO B 2  121 ? 95.038  116.301 98.811  1.00 35.49  ? 121  PRO A O     1 
ATOM   5416  C  CB    . PRO B 2  121 ? 95.302  119.524 99.847  1.00 17.91  ? 121  PRO A CB    1 
ATOM   5417  C  CG    . PRO B 2  121 ? 96.122  120.707 99.710  1.00 36.87  ? 121  PRO A CG    1 
ATOM   5418  C  CD    . PRO B 2  121 ? 96.649  120.707 98.321  1.00 36.72  ? 121  PRO A CD    1 
ATOM   5419  N  N     . LYS B 2  122 ? 94.218  117.890 97.459  1.00 29.52  ? 122  LYS A N     1 
ATOM   5420  C  CA    . LYS B 2  122 ? 93.262  116.938 96.925  1.00 32.17  ? 122  LYS A CA    1 
ATOM   5421  C  C     . LYS B 2  122 ? 93.950  115.799 96.203  1.00 31.58  ? 122  LYS A C     1 
ATOM   5422  O  O     . LYS B 2  122 ? 93.373  114.716 96.101  1.00 36.21  ? 122  LYS A O     1 
ATOM   5423  C  CB    . LYS B 2  122 ? 92.258  117.621 96.010  1.00 32.00  ? 122  LYS A CB    1 
ATOM   5424  C  CG    . LYS B 2  122 ? 92.824  118.262 94.788  1.00 30.54  ? 122  LYS A CG    1 
ATOM   5425  C  CD    . LYS B 2  122 ? 91.697  118.929 94.041  1.00 38.02  ? 122  LYS A CD    1 
ATOM   5426  C  CE    . LYS B 2  122 ? 92.171  119.647 92.807  1.00 53.81  ? 122  LYS A CE    1 
ATOM   5427  N  NZ    . LYS B 2  122 ? 91.019  120.269 92.100  1.00 62.99  ? 122  LYS A NZ    1 
ATOM   5428  N  N     . ASP B 2  123 ? 95.179  115.994 95.735  1.00 30.98  ? 123  ASP A N     1 
ATOM   5429  C  CA    . ASP B 2  123 ? 95.920  114.865 95.192  1.00 24.16  ? 123  ASP A CA    1 
ATOM   5430  C  C     . ASP B 2  123 ? 96.155  113.816 96.262  1.00 30.26  ? 123  ASP A C     1 
ATOM   5431  O  O     . ASP B 2  123 ? 95.830  112.640 96.076  1.00 27.34  ? 123  ASP A O     1 
ATOM   5432  C  CB    . ASP B 2  123 ? 97.240  115.329 94.601  1.00 24.33  ? 123  ASP A CB    1 
ATOM   5433  C  CG    . ASP B 2  123 ? 97.058  116.092 93.326  1.00 35.94  ? 123  ASP A CG    1 
ATOM   5434  O  OD1   . ASP B 2  123 ? 95.967  115.990 92.748  1.00 48.50  ? 123  ASP A OD1   1 
ATOM   5435  O  OD2   . ASP B 2  123 ? 97.992  116.794 92.897  1.00 30.02  ? 123  ASP A OD2   1 
ATOM   5436  N  N     . ILE B 2  124 ? 96.709  114.223 97.401  1.00 23.90  ? 124  ILE A N     1 
ATOM   5437  C  CA    . ILE B 2  124 ? 96.944  113.272 98.482  1.00 18.49  ? 124  ILE A CA    1 
ATOM   5438  C  C     . ILE B 2  124 ? 95.643  112.605 98.895  1.00 19.83  ? 124  ILE A C     1 
ATOM   5439  O  O     . ILE B 2  124 ? 95.508  111.377 98.835  1.00 23.10  ? 124  ILE A O     1 
ATOM   5440  C  CB    . ILE B 2  124 ? 97.614  113.962 99.674  1.00 14.96  ? 124  ILE A CB    1 
ATOM   5441  C  CG1   . ILE B 2  124 ? 99.052  114.278 99.348  1.00 17.19  ? 124  ILE A CG1   1 
ATOM   5442  C  CG2   . ILE B 2  124 ? 97.554  113.087 100.865 1.00 56.08  ? 124  ILE A CG2   1 
ATOM   5443  C  CD1   . ILE B 2  124 ? 99.692  115.060 100.408 1.00 21.87  ? 124  ILE A CD1   1 
ATOM   5444  N  N     . GLN B 2  125 ? 94.658  113.409 99.301  1.00 22.39  ? 125  GLN A N     1 
ATOM   5445  C  CA    . GLN B 2  125 ? 93.404  112.834 99.765  1.00 19.00  ? 125  GLN A CA    1 
ATOM   5446  C  C     . GLN B 2  125 ? 92.820  111.882 98.742  1.00 17.26  ? 125  GLN A C     1 
ATOM   5447  O  O     . GLN B 2  125 ? 92.193  110.882 99.107  1.00 15.82  ? 125  GLN A O     1 
ATOM   5448  C  CB    . GLN B 2  125 ? 92.420  113.937 100.104 1.00 63.81  ? 125  GLN A CB    1 
ATOM   5449  C  CG    . GLN B 2  125 ? 92.868  114.735 101.295 1.00 5.50   ? 125  GLN A CG    1 
ATOM   5450  C  CD    . GLN B 2  125 ? 91.959  115.896 101.595 1.00 21.60  ? 125  GLN A CD    1 
ATOM   5451  O  OE1   . GLN B 2  125 ? 91.260  116.395 100.718 1.00 24.02  ? 125  GLN A OE1   1 
ATOM   5452  N  NE2   . GLN B 2  125 ? 91.966  116.340 102.842 1.00 21.61  ? 125  GLN A NE2   1 
ATOM   5453  N  N     . LEU B 2  126 ? 93.058  112.134 97.460  1.00 20.92  ? 126  LEU A N     1 
ATOM   5454  C  CA    . LEU B 2  126 ? 92.752  111.113 96.474  1.00 13.27  ? 126  LEU A CA    1 
ATOM   5455  C  C     . LEU B 2  126 ? 93.557  109.852 96.732  1.00 15.17  ? 126  LEU A C     1 
ATOM   5456  O  O     . LEU B 2  126 ? 92.989  108.772 96.890  1.00 17.36  ? 126  LEU A O     1 
ATOM   5457  C  CB    . LEU B 2  126 ? 93.016  111.613 95.072  1.00 16.65  ? 126  LEU A CB    1 
ATOM   5458  C  CG    . LEU B 2  126 ? 92.876  110.427 94.141  1.00 18.56  ? 126  LEU A CG    1 
ATOM   5459  C  CD1   . LEU B 2  126 ? 91.483  109.922 94.196  1.00 31.29  ? 126  LEU A CD1   1 
ATOM   5460  C  CD2   . LEU B 2  126 ? 93.204  110.851 92.761  1.00 20.19  ? 126  LEU A CD2   1 
ATOM   5461  N  N     . ALA B 2  127 ? 94.883  109.964 96.776  1.00 15.26  ? 127  ALA A N     1 
ATOM   5462  C  CA    . ALA B 2  127 ? 95.713  108.766 96.866  1.00 14.37  ? 127  ALA A CA    1 
ATOM   5463  C  C     . ALA B 2  127 ? 95.298  107.885 98.032  1.00 18.30  ? 127  ALA A C     1 
ATOM   5464  O  O     . ALA B 2  127 ? 95.135  106.667 97.888  1.00 17.93  ? 127  ALA A O     1 
ATOM   5465  C  CB    . ALA B 2  127 ? 97.176  109.153 96.994  1.00 9.61   ? 127  ALA A CB    1 
ATOM   5466  N  N     . ARG B 2  128 ? 95.097  108.487 99.195  1.00 13.34  ? 128  ARG A N     1 
ATOM   5467  C  CA    . ARG B 2  128 ? 94.636  107.697 100.324 1.00 16.08  ? 128  ARG A CA    1 
ATOM   5468  C  C     . ARG B 2  128 ? 93.219  107.198 100.114 1.00 19.25  ? 128  ARG A C     1 
ATOM   5469  O  O     . ARG B 2  128 ? 92.849  106.150 100.645 1.00 13.46  ? 128  ARG A O     1 
ATOM   5470  C  CB    . ARG B 2  128 ? 94.744  108.512 101.601 1.00 9.86   ? 128  ARG A CB    1 
ATOM   5471  C  CG    . ARG B 2  128 ? 96.157  108.857 101.928 1.00 20.51  ? 128  ARG A CG    1 
ATOM   5472  C  CD    . ARG B 2  128 ? 96.237  109.774 103.101 1.00 35.33  ? 128  ARG A CD    1 
ATOM   5473  N  NE    . ARG B 2  128 ? 95.763  109.145 104.316 1.00 33.55  ? 128  ARG A NE    1 
ATOM   5474  C  CZ    . ARG B 2  128 ? 94.660  109.509 104.948 1.00 28.35  ? 128  ARG A CZ    1 
ATOM   5475  N  NH1   . ARG B 2  128 ? 93.925  110.501 104.474 1.00 21.40  ? 128  ARG A NH1   1 
ATOM   5476  N  NH2   . ARG B 2  128 ? 94.296  108.888 106.058 1.00 26.76  ? 128  ARG A NH2   1 
ATOM   5477  N  N     . ARG B 2  129 ? 92.413  107.912 99.342  1.00 20.14  ? 129  ARG A N     1 
ATOM   5478  C  CA    . ARG B 2  129 ? 91.083  107.395 99.069  1.00 22.53  ? 129  ARG A CA    1 
ATOM   5479  C  C     . ARG B 2  129 ? 91.123  106.172 98.164  1.00 23.62  ? 129  ARG A C     1 
ATOM   5480  O  O     . ARG B 2  129 ? 90.246  105.314 98.255  1.00 39.75  ? 129  ARG A O     1 
ATOM   5481  C  CB    . ARG B 2  129 ? 90.224  108.491 98.457  1.00 35.47  ? 129  ARG A CB    1 
ATOM   5482  C  CG    . ARG B 2  129 ? 88.885  108.031 97.976  1.00 34.18  ? 129  ARG A CG    1 
ATOM   5483  C  CD    . ARG B 2  129 ? 88.047  107.531 99.102  1.00 39.35  ? 129  ARG A CD    1 
ATOM   5484  N  NE    . ARG B 2  129 ? 86.802  106.988 98.587  1.00 61.61  ? 129  ARG A NE    1 
ATOM   5485  C  CZ    . ARG B 2  129 ? 86.676  105.742 98.150  1.00 58.65  ? 129  ARG A CZ    1 
ATOM   5486  N  NH1   . ARG B 2  129 ? 87.720  104.929 98.174  1.00 40.56  ? 129  ARG A NH1   1 
ATOM   5487  N  NH2   . ARG B 2  129 ? 85.513  105.310 97.689  1.00 61.89  ? 129  ARG A NH2   1 
ATOM   5488  N  N     . ILE B 2  130 ? 92.118  106.072 97.289  1.00 14.36  ? 130  ILE A N     1 
ATOM   5489  C  CA    . ILE B 2  130 ? 92.214  104.922 96.400  1.00 22.24  ? 130  ILE A CA    1 
ATOM   5490  C  C     . ILE B 2  130 ? 92.795  103.725 97.121  1.00 19.98  ? 130  ILE A C     1 
ATOM   5491  O  O     . ILE B 2  130 ? 92.270  102.614 97.014  1.00 22.23  ? 130  ILE A O     1 
ATOM   5492  C  CB    . ILE B 2  130 ? 93.042  105.262 95.158  1.00 22.18  ? 130  ILE A CB    1 
ATOM   5493  C  CG1   . ILE B 2  130 ? 92.340  106.336 94.366  1.00 16.80  ? 130  ILE A CG1   1 
ATOM   5494  C  CG2   . ILE B 2  130 ? 93.203  104.056 94.309  1.00 16.89  ? 130  ILE A CG2   1 
ATOM   5495  C  CD1   . ILE B 2  130 ? 90.995  105.916 93.968  1.00 18.56  ? 130  ILE A CD1   1 
ATOM   5496  N  N     . ARG B 2  131 ? 93.892  103.911 97.854  1.00 16.90  ? 131  ARG A N     1 
ATOM   5497  C  CA    . ARG B 2  131 ? 94.450  102.757 98.547  1.00 18.42  ? 131  ARG A CA    1 
ATOM   5498  C  C     . ARG B 2  131 ? 93.467  102.135 99.510  1.00 28.18  ? 131  ARG A C     1 
ATOM   5499  O  O     . ARG B 2  131 ? 93.642  100.977 99.889  1.00 37.16  ? 131  ARG A O     1 
ATOM   5500  C  CB    . ARG B 2  131 ? 95.686  103.114 99.340  1.00 29.59  ? 131  ARG A CB    1 
ATOM   5501  C  CG    . ARG B 2  131 ? 96.876  103.474 98.545  1.00 24.99  ? 131  ARG A CG    1 
ATOM   5502  C  CD    . ARG B 2  131 ? 98.007  103.618 99.507  1.00 29.95  ? 131  ARG A CD    1 
ATOM   5503  N  NE    . ARG B 2  131 ? 99.247  103.995 98.863  1.00 39.08  ? 131  ARG A NE    1 
ATOM   5504  C  CZ    . ARG B 2  131 ? 100.364 104.221 99.534  1.00 48.86  ? 131  ARG A CZ    1 
ATOM   5505  N  NH1   . ARG B 2  131 ? 100.373 104.097 100.851 1.00 54.02  ? 131  ARG A NH1   1 
ATOM   5506  N  NH2   . ARG B 2  131 ? 101.468 104.565 98.895  1.00 42.74  ? 131  ARG A NH2   1 
ATOM   5507  N  N     . GLY B 2  132 ? 92.449  102.873 99.926  1.00 28.38  ? 132  GLY A N     1 
ATOM   5508  C  CA    . GLY B 2  132 ? 91.521  102.366 100.906 1.00 27.19  ? 132  GLY A CA    1 
ATOM   5509  C  C     . GLY B 2  132 ? 91.883  102.683 102.332 1.00 32.32  ? 132  GLY A C     1 
ATOM   5510  O  O     . GLY B 2  132 ? 91.490  101.942 103.237 1.00 34.13  ? 132  GLY A O     1 
ATOM   5511  N  N     . GLU B 2  133 ? 92.631  103.749 102.570 1.00 26.56  ? 133  GLU A N     1 
ATOM   5512  C  CA    . GLU B 2  133 ? 93.065  104.068 103.918 1.00 27.05  ? 133  GLU A CA    1 
ATOM   5513  C  C     . GLU B 2  133 ? 92.084  104.953 104.667 1.00 41.53  ? 133  GLU A C     1 
ATOM   5514  O  O     . GLU B 2  133 ? 92.373  105.347 105.799 1.00 51.61  ? 133  GLU A O     1 
ATOM   5515  C  CB    . GLU B 2  133 ? 94.429  104.743 103.887 1.00 51.57  ? 133  GLU A CB    1 
ATOM   5516  C  CG    . GLU B 2  133 ? 95.518  103.869 103.323 1.00 56.11  ? 133  GLU A CG    1 
ATOM   5517  C  CD    . GLU B 2  133 ? 96.861  104.560 103.309 1.00 61.64  ? 133  GLU A CD    1 
ATOM   5518  O  OE1   . GLU B 2  133 ? 96.925  105.752 103.673 1.00 63.54  ? 133  GLU A OE1   1 
ATOM   5519  O  OE2   . GLU B 2  133 ? 97.850  103.918 102.909 1.00 57.87  ? 133  GLU A OE2   1 
ATOM   5520  N  N     . ARG B 2  134 ? 90.949  105.284 104.071 1.00 31.60  ? 134  ARG A N     1 
ATOM   5521  C  CA    . ARG B 2  134 ? 89.936  106.061 104.770 1.00 32.42  ? 134  ARG A CA    1 
ATOM   5522  C  C     . ARG B 2  134 ? 88.687  105.218 104.991 1.00 44.42  ? 134  ARG A C     1 
ATOM   5523  O  O     . ARG B 2  134 ? 88.739  104.169 105.634 1.00 46.45  ? 134  ARG A O     1 
ATOM   5524  C  CB    . ARG B 2  134 ? 89.589  107.331 103.993 1.00 28.56  ? 134  ARG A CB    1 
ATOM   5525  N  N     . ALA C 3  15  ? 108.837 135.113 126.260 1.00 170.00 ? 15   ALA B N     1 
ATOM   5526  C  CA    . ALA C 3  15  ? 110.049 135.284 125.474 1.00 158.81 ? 15   ALA B CA    1 
ATOM   5527  C  C     . ALA C 3  15  ? 111.273 135.258 126.375 1.00 158.30 ? 15   ALA B C     1 
ATOM   5528  O  O     . ALA C 3  15  ? 111.601 134.232 126.963 1.00 173.34 ? 15   ALA B O     1 
ATOM   5529  C  CB    . ALA C 3  15  ? 109.992 136.577 124.688 1.00 143.91 ? 15   ALA B CB    1 
ATOM   5530  N  N     . LYS C 3  16  ? 111.949 136.401 126.479 1.00 163.16 ? 16   LYS B N     1 
ATOM   5531  C  CA    . LYS C 3  16  ? 113.160 136.481 127.289 1.00 161.35 ? 16   LYS B CA    1 
ATOM   5532  C  C     . LYS C 3  16  ? 112.852 136.268 128.768 1.00 163.89 ? 16   LYS B C     1 
ATOM   5533  O  O     . LYS C 3  16  ? 113.430 135.384 129.412 1.00 177.72 ? 16   LYS B O     1 
ATOM   5534  C  CB    . LYS C 3  16  ? 113.835 137.834 127.057 1.00 141.86 ? 16   LYS B CB    1 
ATOM   5535  C  CG    . LYS C 3  16  ? 115.111 138.070 127.832 1.00 138.17 ? 16   LYS B CG    1 
ATOM   5536  C  CD    . LYS C 3  16  ? 115.686 139.425 127.473 1.00 142.58 ? 16   LYS B CD    1 
ATOM   5537  C  CE    . LYS C 3  16  ? 116.914 139.743 128.293 1.00 166.10 ? 16   LYS B CE    1 
ATOM   5538  N  NZ    . LYS C 3  16  ? 117.455 141.081 127.948 1.00 173.81 ? 16   LYS B NZ    1 
ATOM   5539  N  N     . ARG C 3  17  ? 111.940 137.069 129.319 1.00 155.32 ? 17   ARG B N     1 
ATOM   5540  C  CA    . ARG C 3  17  ? 111.585 137.011 130.731 1.00 140.98 ? 17   ARG B CA    1 
ATOM   5541  C  C     . ARG C 3  17  ? 111.088 135.619 131.105 1.00 156.27 ? 17   ARG B C     1 
ATOM   5542  O  O     . ARG C 3  17  ? 111.778 134.876 131.808 1.00 182.86 ? 17   ARG B O     1 
ATOM   5543  C  CB    . ARG C 3  17  ? 110.540 138.086 131.032 1.00 135.74 ? 17   ARG B CB    1 
ATOM   5544  C  CG    . ARG C 3  17  ? 111.004 139.492 130.652 1.00 141.24 ? 17   ARG B CG    1 
ATOM   5545  C  CD    . ARG C 3  17  ? 112.081 139.992 131.607 1.00 140.03 ? 17   ARG B CD    1 
ATOM   5546  N  NE    . ARG C 3  17  ? 112.573 141.335 131.299 1.00 134.52 ? 17   ARG B NE    1 
ATOM   5547  C  CZ    . ARG C 3  17  ? 113.667 141.587 130.582 1.00 149.79 ? 17   ARG B CZ    1 
ATOM   5548  N  NH1   . ARG C 3  17  ? 114.045 142.835 130.344 1.00 155.62 ? 17   ARG B NH1   1 
ATOM   5549  N  NH2   . ARG C 3  17  ? 114.392 140.587 130.109 1.00 157.47 ? 17   ARG B NH2   1 
ATOM   5550  N  N     . HIS C 3  18  ? 109.902 135.254 130.632 1.00 165.32 ? 18   HIS B N     1 
ATOM   5551  C  CA    . HIS C 3  18  ? 109.437 133.876 130.637 1.00 166.46 ? 18   HIS B CA    1 
ATOM   5552  C  C     . HIS C 3  18  ? 109.537 133.344 129.217 1.00 155.50 ? 18   HIS B C     1 
ATOM   5553  O  O     . HIS C 3  18  ? 109.249 134.070 128.262 1.00 164.02 ? 18   HIS B O     1 
ATOM   5554  C  CB    . HIS C 3  18  ? 107.988 133.762 131.115 1.00 136.71 ? 18   HIS B CB    1 
ATOM   5555  C  CG    . HIS C 3  18  ? 107.776 134.205 132.527 1.00 143.63 ? 18   HIS B CG    1 
ATOM   5556  N  ND1   . HIS C 3  18  ? 107.641 135.531 132.878 1.00 166.27 ? 18   HIS B ND1   1 
ATOM   5557  C  CD2   . HIS C 3  18  ? 107.650 133.498 133.674 1.00 146.51 ? 18   HIS B CD2   1 
ATOM   5558  C  CE1   . HIS C 3  18  ? 107.453 135.623 134.182 1.00 160.30 ? 18   HIS B CE1   1 
ATOM   5559  N  NE2   . HIS C 3  18  ? 107.453 134.403 134.689 1.00 152.43 ? 18   HIS B NE2   1 
ATOM   5560  N  N     . ARG C 3  19  ? 109.937 132.081 129.077 1.00 180.54 ? 19   ARG B N     1 
ATOM   5561  C  CA    . ARG C 3  19  ? 110.105 131.502 127.751 1.00 180.54 ? 19   ARG B CA    1 
ATOM   5562  C  C     . ARG C 3  19  ? 108.863 131.664 126.892 1.00 180.54 ? 19   ARG B C     1 
ATOM   5563  O  O     . ARG C 3  19  ? 108.850 132.468 125.955 1.00 180.54 ? 19   ARG B O     1 
ATOM   5564  C  CB    . ARG C 3  19  ? 110.462 130.022 127.847 1.00 190.08 ? 19   ARG B CB    1 
ATOM   5565  C  CG    . ARG C 3  19  ? 111.832 129.783 128.393 1.00 190.08 ? 19   ARG B CG    1 
ATOM   5566  C  CD    . ARG C 3  19  ? 112.857 130.235 127.370 1.00 190.08 ? 19   ARG B CD    1 
ATOM   5567  N  NE    . ARG C 3  19  ? 114.218 129.988 127.822 1.00 190.08 ? 19   ARG B NE    1 
ATOM   5568  C  CZ    . ARG C 3  19  ? 114.941 130.864 128.508 1.00 190.08 ? 19   ARG B CZ    1 
ATOM   5569  N  NH1   . ARG C 3  19  ? 114.427 132.047 128.821 1.00 190.08 ? 19   ARG B NH1   1 
ATOM   5570  N  NH2   . ARG C 3  19  ? 116.175 130.557 128.884 1.00 190.08 ? 19   ARG B NH2   1 
ATOM   5571  N  N     . LYS C 3  20  ? 107.820 130.902 127.207 1.00 173.41 ? 20   LYS B N     1 
ATOM   5572  C  CA    . LYS C 3  20  ? 106.602 130.869 126.401 1.00 173.41 ? 20   LYS B CA    1 
ATOM   5573  C  C     . LYS C 3  20  ? 106.935 130.583 124.939 1.00 173.41 ? 20   LYS B C     1 
ATOM   5574  O  O     . LYS C 3  20  ? 106.204 130.971 124.026 1.00 173.41 ? 20   LYS B O     1 
ATOM   5575  C  CB    . LYS C 3  20  ? 105.812 132.172 126.544 1.00 156.26 ? 20   LYS B CB    1 
ATOM   5576  C  CG    . LYS C 3  20  ? 105.361 132.446 127.975 1.00 156.26 ? 20   LYS B CG    1 
ATOM   5577  C  CD    . LYS C 3  20  ? 104.744 133.821 128.127 1.00 156.26 ? 20   LYS B CD    1 
ATOM   5578  C  CE    . LYS C 3  20  ? 103.470 133.913 127.302 1.00 156.26 ? 20   LYS B CE    1 
ATOM   5579  N  NZ    . LYS C 3  20  ? 102.807 135.241 127.399 1.00 156.26 ? 20   LYS B NZ    1 
ATOM   5580  N  N     . VAL C 3  21  ? 108.067 129.909 124.718 1.00 173.49 ? 21   VAL B N     1 
ATOM   5581  C  CA    . VAL C 3  21  ? 108.520 129.541 123.386 1.00 167.20 ? 21   VAL B CA    1 
ATOM   5582  C  C     . VAL C 3  21  ? 108.180 128.105 123.034 1.00 172.03 ? 21   VAL B C     1 
ATOM   5583  O  O     . VAL C 3  21  ? 108.577 127.634 121.959 1.00 182.04 ? 21   VAL B O     1 
ATOM   5584  C  CB    . VAL C 3  21  ? 110.035 129.775 123.227 1.00 174.35 ? 21   VAL B CB    1 
ATOM   5585  C  CG1   . VAL C 3  21  ? 110.367 131.250 123.407 1.00 158.94 ? 21   VAL B CG1   1 
ATOM   5586  C  CG2   . VAL C 3  21  ? 110.813 128.910 124.205 1.00 164.97 ? 21   VAL B CG2   1 
ATOM   5587  N  N     . LEU C 3  22  ? 107.495 127.380 123.917 1.00 168.87 ? 22   LEU B N     1 
ATOM   5588  C  CA    . LEU C 3  22  ? 107.041 126.044 123.562 1.00 168.87 ? 22   LEU B CA    1 
ATOM   5589  C  C     . LEU C 3  22  ? 106.148 126.122 122.338 1.00 168.87 ? 22   LEU B C     1 
ATOM   5590  O  O     . LEU C 3  22  ? 105.162 126.865 122.312 1.00 168.87 ? 22   LEU B O     1 
ATOM   5591  C  CB    . LEU C 3  22  ? 106.295 125.380 124.719 1.00 176.28 ? 22   LEU B CB    1 
ATOM   5592  C  CG    . LEU C 3  22  ? 107.090 125.004 125.967 1.00 176.28 ? 22   LEU B CG    1 
ATOM   5593  C  CD1   . LEU C 3  22  ? 106.186 124.329 126.987 1.00 176.28 ? 22   LEU B CD1   1 
ATOM   5594  C  CD2   . LEU C 3  22  ? 108.245 124.108 125.595 1.00 176.28 ? 22   LEU B CD2   1 
ATOM   5595  N  N     . ARG C 3  23  ? 106.500 125.349 121.321 1.00 128.53 ? 23   ARG B N     1 
ATOM   5596  C  CA    . ARG C 3  23  ? 105.837 125.463 120.036 1.00 142.14 ? 23   ARG B CA    1 
ATOM   5597  C  C     . ARG C 3  23  ? 104.817 124.348 119.905 1.00 139.47 ? 23   ARG B C     1 
ATOM   5598  O  O     . ARG C 3  23  ? 103.616 124.582 120.060 1.00 131.86 ? 23   ARG B O     1 
ATOM   5599  C  CB    . ARG C 3  23  ? 106.870 125.402 118.916 1.00 94.24  ? 23   ARG B CB    1 
ATOM   5600  C  CG    . ARG C 3  23  ? 106.320 125.605 117.533 1.00 109.80 ? 23   ARG B CG    1 
ATOM   5601  C  CD    . ARG C 3  23  ? 107.432 125.447 116.514 1.00 118.70 ? 23   ARG B CD    1 
ATOM   5602  N  NE    . ARG C 3  23  ? 107.966 124.087 116.526 1.00 125.13 ? 23   ARG B NE    1 
ATOM   5603  C  CZ    . ARG C 3  23  ? 109.094 123.717 115.931 1.00 130.43 ? 23   ARG B CZ    1 
ATOM   5604  N  NH1   . ARG C 3  23  ? 109.818 124.603 115.262 1.00 130.91 ? 23   ARG B NH1   1 
ATOM   5605  N  NH2   . ARG C 3  23  ? 109.492 122.456 115.998 1.00 130.89 ? 23   ARG B NH2   1 
ATOM   5606  N  N     . ASP C 3  24  ? 105.298 123.138 119.642 1.00 86.10  ? 24   ASP B N     1 
ATOM   5607  C  CA    . ASP C 3  24  ? 104.539 121.900 119.694 1.00 89.13  ? 24   ASP B CA    1 
ATOM   5608  C  C     . ASP C 3  24  ? 105.485 120.826 119.189 1.00 83.19  ? 24   ASP B C     1 
ATOM   5609  O  O     . ASP C 3  24  ? 106.490 121.135 118.547 1.00 86.17  ? 24   ASP B O     1 
ATOM   5610  C  CB    . ASP C 3  24  ? 103.270 121.958 118.847 1.00 93.06  ? 24   ASP B CB    1 
ATOM   5611  C  CG    . ASP C 3  24  ? 102.357 120.796 119.100 1.00 103.70 ? 24   ASP B CG    1 
ATOM   5612  O  OD1   . ASP C 3  24  ? 102.738 119.909 119.889 1.00 107.10 ? 24   ASP B OD1   1 
ATOM   5613  O  OD2   . ASP C 3  24  ? 101.246 120.781 118.533 1.00 104.13 ? 24   ASP B OD2   1 
ATOM   5614  N  N     . ASN C 3  25  ? 105.169 119.566 119.475 1.00 68.98  ? 25   ASN B N     1 
ATOM   5615  C  CA    . ASN C 3  25  ? 106.031 118.509 118.962 1.00 68.10  ? 25   ASN B CA    1 
ATOM   5616  C  C     . ASN C 3  25  ? 105.840 118.328 117.468 1.00 67.56  ? 25   ASN B C     1 
ATOM   5617  O  O     . ASN C 3  25  ? 106.813 118.330 116.710 1.00 67.60  ? 25   ASN B O     1 
ATOM   5618  C  CB    . ASN C 3  25  ? 105.781 117.194 119.684 1.00 72.24  ? 25   ASN B CB    1 
ATOM   5619  C  CG    . ASN C 3  25  ? 106.389 117.157 121.065 1.00 72.61  ? 25   ASN B CG    1 
ATOM   5620  O  OD1   . ASN C 3  25  ? 107.363 117.849 121.347 1.00 73.10  ? 25   ASN B OD1   1 
ATOM   5621  N  ND2   . ASN C 3  25  ? 105.819 116.340 121.937 1.00 72.99  ? 25   ASN B ND2   1 
ATOM   5622  N  N     . ILE C 3  26  ? 104.592 118.184 117.017 1.00 51.69  ? 26   ILE B N     1 
ATOM   5623  C  CA    . ILE C 3  26  ? 104.391 117.798 115.629 1.00 51.50  ? 26   ILE B CA    1 
ATOM   5624  C  C     . ILE C 3  26  ? 104.868 118.874 114.675 1.00 60.96  ? 26   ILE B C     1 
ATOM   5625  O  O     . ILE C 3  26  ? 105.219 118.572 113.532 1.00 71.30  ? 26   ILE B O     1 
ATOM   5626  C  CB    . ILE C 3  26  ? 102.929 117.450 115.346 1.00 34.37  ? 26   ILE B CB    1 
ATOM   5627  C  CG1   . ILE C 3  26  ? 102.843 116.779 113.985 1.00 32.20  ? 26   ILE B CG1   1 
ATOM   5628  C  CG2   . ILE C 3  26  ? 102.105 118.696 115.338 1.00 21.39  ? 26   ILE B CG2   1 
ATOM   5629  C  CD1   . ILE C 3  26  ? 101.560 116.089 113.740 1.00 52.98  ? 26   ILE B CD1   1 
ATOM   5630  N  N     . GLN C 3  27  ? 104.953 120.120 115.118 1.00 45.34  ? 27   GLN B N     1 
ATOM   5631  C  CA    . GLN C 3  27  ? 105.675 121.087 114.314 1.00 54.07  ? 27   GLN B CA    1 
ATOM   5632  C  C     . GLN C 3  27  ? 107.146 120.743 114.196 1.00 54.26  ? 27   GLN B C     1 
ATOM   5633  O  O     . GLN C 3  27  ? 107.864 121.430 113.470 1.00 39.87  ? 27   GLN B O     1 
ATOM   5634  C  CB    . GLN C 3  27  ? 105.526 122.476 114.903 1.00 39.84  ? 27   GLN B CB    1 
ATOM   5635  C  CG    . GLN C 3  27  ? 104.127 122.990 114.835 1.00 55.30  ? 27   GLN B CG    1 
ATOM   5636  C  CD    . GLN C 3  27  ? 103.668 123.139 113.415 1.00 69.56  ? 27   GLN B CD    1 
ATOM   5637  O  OE1   . GLN C 3  27  ? 102.907 122.321 112.911 1.00 73.17  ? 27   GLN B OE1   1 
ATOM   5638  N  NE2   . GLN C 3  27  ? 104.148 124.175 112.746 1.00 71.34  ? 27   GLN B NE2   1 
ATOM   5639  N  N     . GLY C 3  28  ? 107.613 119.724 114.915 1.00 67.69  ? 28   GLY B N     1 
ATOM   5640  C  CA    . GLY C 3  28  ? 109.005 119.325 114.803 1.00 63.12  ? 28   GLY B CA    1 
ATOM   5641  C  C     . GLY C 3  28  ? 109.376 118.895 113.400 1.00 57.47  ? 28   GLY B C     1 
ATOM   5642  O  O     . GLY C 3  28  ? 110.412 119.294 112.869 1.00 57.12  ? 28   GLY B O     1 
ATOM   5643  N  N     . ILE C 3  29  ? 108.557 118.045 112.789 1.00 29.77  ? 29   ILE B N     1 
ATOM   5644  C  CA    . ILE C 3  29  ? 108.700 117.851 111.362 1.00 28.91  ? 29   ILE B CA    1 
ATOM   5645  C  C     . ILE C 3  29  ? 108.451 119.196 110.717 1.00 38.63  ? 29   ILE B C     1 
ATOM   5646  O  O     . ILE C 3  29  ? 107.424 119.834 110.970 1.00 44.60  ? 29   ILE B O     1 
ATOM   5647  C  CB    . ILE C 3  29  ? 107.714 116.796 110.856 1.00 29.69  ? 29   ILE B CB    1 
ATOM   5648  C  CG1   . ILE C 3  29  ? 107.933 115.491 111.578 1.00 18.42  ? 29   ILE B CG1   1 
ATOM   5649  C  CG2   . ILE C 3  29  ? 107.923 116.543 109.414 1.00 41.99  ? 29   ILE B CG2   1 
ATOM   5650  C  CD1   . ILE C 3  29  ? 106.951 115.294 112.660 1.00 17.63  ? 29   ILE B CD1   1 
ATOM   5651  N  N     . THR C 3  30  ? 109.379 119.646 109.897 1.00 32.93  ? 30   THR B N     1 
ATOM   5652  C  CA    . THR C 3  30  ? 109.364 121.031 109.463 1.00 34.01  ? 30   THR B CA    1 
ATOM   5653  C  C     . THR C 3  30  ? 108.992 121.142 108.000 1.00 32.86  ? 30   THR B C     1 
ATOM   5654  O  O     . THR C 3  30  ? 108.788 120.152 107.303 1.00 28.24  ? 30   THR B O     1 
ATOM   5655  C  CB    . THR C 3  30  ? 110.726 121.661 109.663 1.00 58.46  ? 30   THR B CB    1 
ATOM   5656  O  OG1   . THR C 3  30  ? 111.676 120.918 108.899 1.00 65.25  ? 30   THR B OG1   1 
ATOM   5657  C  CG2   . THR C 3  30  ? 111.116 121.605 111.097 1.00 46.77  ? 30   THR B CG2   1 
ATOM   5658  N  N     . LYS C 3  31  ? 108.938 122.378 107.533 1.00 30.07  ? 31   LYS B N     1 
ATOM   5659  C  CA    . LYS C 3  31  ? 108.765 122.617 106.104 1.00 29.13  ? 31   LYS B CA    1 
ATOM   5660  C  C     . LYS C 3  31  ? 109.848 121.932 105.284 1.00 30.35  ? 31   LYS B C     1 
ATOM   5661  O  O     . LYS C 3  31  ? 109.526 121.018 104.506 1.00 21.96  ? 31   LYS B O     1 
ATOM   5662  C  CB    . LYS C 3  31  ? 108.706 124.124 105.872 1.00 35.13  ? 31   LYS B CB    1 
ATOM   5663  C  CG    . LYS C 3  31  ? 108.598 124.578 104.443 1.00 43.75  ? 31   LYS B CG    1 
ATOM   5664  C  CD    . LYS C 3  31  ? 108.728 126.099 104.408 1.00 58.63  ? 31   LYS B CD    1 
ATOM   5665  C  CE    . LYS C 3  31  ? 108.878 126.650 103.000 1.00 65.65  ? 31   LYS B CE    1 
ATOM   5666  N  NZ    . LYS C 3  31  ? 107.642 126.457 102.199 1.00 63.50  ? 31   LYS B NZ    1 
ATOM   5667  N  N     . PRO C 3  32  ? 111.130 122.253 105.440 1.00 19.28  ? 32   PRO B N     1 
ATOM   5668  C  CA    . PRO C 3  32  ? 112.118 121.662 104.539 1.00 21.32  ? 32   PRO B CA    1 
ATOM   5669  C  C     . PRO C 3  32  ? 112.312 120.184 104.740 1.00 28.88  ? 32   PRO B C     1 
ATOM   5670  O  O     . PRO C 3  32  ? 112.771 119.520 103.810 1.00 37.22  ? 32   PRO B O     1 
ATOM   5671  C  CB    . PRO C 3  32  ? 113.396 122.435 104.856 1.00 33.54  ? 32   PRO B CB    1 
ATOM   5672  C  CG    . PRO C 3  32  ? 113.231 122.834 106.230 1.00 41.85  ? 32   PRO B CG    1 
ATOM   5673  C  CD    . PRO C 3  32  ? 111.776 123.097 106.451 1.00 35.05  ? 32   PRO B CD    1 
ATOM   5674  N  N     . ALA C 3  33  ? 112.000 119.634 105.908 1.00 30.79  ? 33   ALA B N     1 
ATOM   5675  C  CA    . ALA C 3  33  ? 112.077 118.188 106.055 1.00 16.94  ? 33   ALA B CA    1 
ATOM   5676  C  C     . ALA C 3  33  ? 111.072 117.505 105.146 1.00 23.67  ? 33   ALA B C     1 
ATOM   5677  O  O     . ALA C 3  33  ? 111.438 116.724 104.261 1.00 28.43  ? 33   ALA B O     1 
ATOM   5678  C  CB    . ALA C 3  33  ? 111.839 117.797 107.505 1.00 20.12  ? 33   ALA B CB    1 
ATOM   5679  N  N     . ILE C 3  34  ? 109.791 117.819 105.333 1.00 20.38  ? 34   ILE B N     1 
ATOM   5680  C  CA    . ILE C 3  34  ? 108.758 117.302 104.445 1.00 9.99   ? 34   ILE B CA    1 
ATOM   5681  C  C     . ILE C 3  34  ? 109.188 117.481 103.008 1.00 15.90  ? 34   ILE B C     1 
ATOM   5682  O  O     . ILE C 3  34  ? 109.130 116.557 102.191 1.00 21.66  ? 34   ILE B O     1 
ATOM   5683  C  CB    . ILE C 3  34  ? 107.427 118.016 104.701 1.00 13.19  ? 34   ILE B CB    1 
ATOM   5684  C  CG1   . ILE C 3  34  ? 106.879 117.631 106.053 1.00 8.40   ? 34   ILE B CG1   1 
ATOM   5685  C  CG2   . ILE C 3  34  ? 106.456 117.678 103.633 1.00 12.49  ? 34   ILE B CG2   1 
ATOM   5686  C  CD1   . ILE C 3  34  ? 105.716 118.451 106.447 1.00 13.10  ? 34   ILE B CD1   1 
ATOM   5687  N  N     . ARG C 3  35  ? 109.673 118.668 102.696 1.00 17.78  ? 35   ARG B N     1 
ATOM   5688  C  CA    . ARG C 3  35  ? 110.098 118.940 101.342 1.00 23.15  ? 35   ARG B CA    1 
ATOM   5689  C  C     . ARG C 3  35  ? 111.190 117.983 100.900 1.00 15.94  ? 35   ARG B C     1 
ATOM   5690  O  O     . ARG C 3  35  ? 111.212 117.567 99.741  1.00 26.06  ? 35   ARG B O     1 
ATOM   5691  C  CB    . ARG C 3  35  ? 110.535 120.384 101.287 1.00 29.77  ? 35   ARG B CB    1 
ATOM   5692  C  CG    . ARG C 3  35  ? 110.877 120.960 99.984  1.00 58.26  ? 35   ARG B CG    1 
ATOM   5693  C  CD    . ARG C 3  35  ? 111.051 122.390 100.324 1.00 73.96  ? 35   ARG B CD    1 
ATOM   5694  N  NE    . ARG C 3  35  ? 111.538 123.223 99.256  1.00 78.66  ? 35   ARG B NE    1 
ATOM   5695  C  CZ    . ARG C 3  35  ? 111.669 124.530 99.394  1.00 80.07  ? 35   ARG B CZ    1 
ATOM   5696  N  NH1   . ARG C 3  35  ? 111.337 125.095 100.546 1.00 81.28  ? 35   ARG B NH1   1 
ATOM   5697  N  NH2   . ARG C 3  35  ? 112.138 125.267 98.399  1.00 79.71  ? 35   ARG B NH2   1 
ATOM   5698  N  N     . ARG C 3  36  ? 112.068 117.569 101.805 1.00 16.07  ? 36   ARG B N     1 
ATOM   5699  C  CA    . ARG C 3  36  ? 113.051 116.569 101.415 1.00 14.93  ? 36   ARG B CA    1 
ATOM   5700  C  C     . ARG C 3  36  ? 112.381 115.242 101.130 1.00 27.20  ? 36   ARG B C     1 
ATOM   5701  O  O     . ARG C 3  36  ? 112.684 114.596 100.125 1.00 39.38  ? 36   ARG B O     1 
ATOM   5702  C  CB    . ARG C 3  36  ? 114.124 116.400 102.481 1.00 13.36  ? 36   ARG B CB    1 
ATOM   5703  C  CG    . ARG C 3  36  ? 115.122 117.528 102.537 1.00 18.32  ? 36   ARG B CG    1 
ATOM   5704  C  CD    . ARG C 3  36  ? 116.296 117.161 103.406 1.00 14.30  ? 36   ARG B CD    1 
ATOM   5705  N  NE    . ARG C 3  36  ? 115.868 116.934 104.769 1.00 19.52  ? 36   ARG B NE    1 
ATOM   5706  C  CZ    . ARG C 3  36  ? 115.733 117.906 105.652 1.00 20.79  ? 36   ARG B CZ    1 
ATOM   5707  N  NH1   . ARG C 3  36  ? 116.004 119.148 105.299 1.00 22.87  ? 36   ARG B NH1   1 
ATOM   5708  N  NH2   . ARG C 3  36  ? 115.328 117.639 106.878 1.00 9.26   ? 36   ARG B NH2   1 
ATOM   5709  N  N     . LEU C 3  37  ? 111.463 114.817 101.999 1.00 12.89  ? 37   LEU B N     1 
ATOM   5710  C  CA    . LEU C 3  37  ? 110.736 113.579 101.739 1.00 10.13  ? 37   LEU B CA    1 
ATOM   5711  C  C     . LEU C 3  37  ? 110.138 113.576 100.350 1.00 18.79  ? 37   LEU B C     1 
ATOM   5712  O  O     . LEU C 3  37  ? 110.358 112.644 99.572  1.00 17.66  ? 37   LEU B O     1 
ATOM   5713  C  CB    . LEU C 3  37  ? 109.645 113.362 102.769 1.00 7.88   ? 37   LEU B CB    1 
ATOM   5714  C  CG    . LEU C 3  37  ? 110.202 112.894 104.083 1.00 15.00  ? 37   LEU B CG    1 
ATOM   5715  C  CD1   . LEU C 3  37  ? 109.103 112.822 105.090 1.00 11.47  ? 37   LEU B CD1   1 
ATOM   5716  C  CD2   . LEU C 3  37  ? 110.774 111.544 103.824 1.00 12.72  ? 37   LEU B CD2   1 
ATOM   5717  N  N     . ALA C 3  38  ? 109.392 114.617 100.009 1.00 21.77  ? 38   ALA B N     1 
ATOM   5718  C  CA    . ALA C 3  38  ? 108.918 114.714 98.643  1.00 19.18  ? 38   ALA B CA    1 
ATOM   5719  C  C     . ALA C 3  38  ? 110.068 114.525 97.673  1.00 18.20  ? 38   ALA B C     1 
ATOM   5720  O  O     . ALA C 3  38  ? 110.022 113.645 96.811  1.00 4.72   ? 38   ALA B O     1 
ATOM   5721  C  CB    . ALA C 3  38  ? 108.237 116.051 98.410  1.00 23.01  ? 38   ALA B CB    1 
ATOM   5722  N  N     . ARG C 3  39  ? 111.139 115.302 97.834  1.00 13.47  ? 39   ARG B N     1 
ATOM   5723  C  CA    . ARG C 3  39  ? 112.207 115.227 96.849  1.00 16.56  ? 39   ARG B CA    1 
ATOM   5724  C  C     . ARG C 3  39  ? 112.679 113.809 96.656  1.00 25.02  ? 39   ARG B C     1 
ATOM   5725  O  O     . ARG C 3  39  ? 113.034 113.427 95.544  1.00 28.40  ? 39   ARG B O     1 
ATOM   5726  C  CB    . ARG C 3  39  ? 113.385 116.094 97.237  1.00 17.21  ? 39   ARG B CB    1 
ATOM   5727  C  CG    . ARG C 3  39  ? 113.052 117.526 97.317  1.00 19.50  ? 39   ARG B CG    1 
ATOM   5728  C  CD    . ARG C 3  39  ? 112.564 118.027 96.018  1.00 27.30  ? 39   ARG B CD    1 
ATOM   5729  N  NE    . ARG C 3  39  ? 112.276 119.437 96.152  1.00 36.06  ? 39   ARG B NE    1 
ATOM   5730  C  CZ    . ARG C 3  39  ? 111.579 120.124 95.272  1.00 40.83  ? 39   ARG B CZ    1 
ATOM   5731  N  NH1   . ARG C 3  39  ? 111.100 119.511 94.213  1.00 42.24  ? 39   ARG B NH1   1 
ATOM   5732  N  NH2   . ARG C 3  39  ? 111.359 121.412 95.458  1.00 34.13  ? 39   ARG B NH2   1 
ATOM   5733  N  N     . ARG C 3  40  ? 112.675 113.002 97.704  1.00 22.16  ? 40   ARG B N     1 
ATOM   5734  C  CA    . ARG C 3  40  ? 112.981 111.609 97.457  1.00 64.92  ? 40   ARG B CA    1 
ATOM   5735  C  C     . ARG C 3  40  ? 111.850 110.940 96.717  1.00 19.43  ? 40   ARG B C     1 
ATOM   5736  O  O     . ARG C 3  40  ? 112.083 110.034 95.919  1.00 40.78  ? 40   ARG B O     1 
ATOM   5737  C  CB    . ARG C 3  40  ? 113.268 110.866 98.748  1.00 18.95  ? 40   ARG B CB    1 
ATOM   5738  C  CG    . ARG C 3  40  ? 113.575 109.423 98.493  1.00 20.01  ? 40   ARG B CG    1 
ATOM   5739  C  CD    . ARG C 3  40  ? 113.941 108.684 99.735  1.00 21.08  ? 40   ARG B CD    1 
ATOM   5740  N  NE    . ARG C 3  40  ? 115.197 109.176 100.264 1.00 19.01  ? 40   ARG B NE    1 
ATOM   5741  C  CZ    . ARG C 3  40  ? 115.773 108.699 101.351 1.00 25.70  ? 40   ARG B CZ    1 
ATOM   5742  N  NH1   . ARG C 3  40  ? 115.210 107.706 102.013 1.00 35.81  ? 40   ARG B NH1   1 
ATOM   5743  N  NH2   . ARG C 3  40  ? 116.915 109.210 101.770 1.00 21.18  ? 40   ARG B NH2   1 
ATOM   5744  N  N     . GLY C 3  41  ? 110.623 111.380 96.940  1.00 12.98  ? 41   GLY B N     1 
ATOM   5745  C  CA    . GLY C 3  41  ? 109.538 110.691 96.284  1.00 11.03  ? 41   GLY B CA    1 
ATOM   5746  C  C     . GLY C 3  41  ? 109.536 110.849 94.788  1.00 16.64  ? 41   GLY B C     1 
ATOM   5747  O  O     . GLY C 3  41  ? 108.974 110.006 94.089  1.00 29.97  ? 41   GLY B O     1 
ATOM   5748  N  N     . GLY C 3  42  ? 110.167 111.891 94.279  1.00 7.59   ? 42   GLY B N     1 
ATOM   5749  C  CA    . GLY C 3  42  ? 110.075 112.232 92.880  1.00 8.47   ? 42   GLY B CA    1 
ATOM   5750  C  C     . GLY C 3  42  ? 109.250 113.459 92.616  1.00 17.14  ? 42   GLY B C     1 
ATOM   5751  O  O     . GLY C 3  42  ? 109.268 113.962 91.493  1.00 18.61  ? 42   GLY B O     1 
ATOM   5752  N  N     . VAL C 3  43  ? 108.530 113.958 93.619  1.00 9.19   ? 43   VAL B N     1 
ATOM   5753  C  CA    . VAL C 3  43  ? 107.782 115.193 93.468  1.00 10.20  ? 43   VAL B CA    1 
ATOM   5754  C  C     . VAL C 3  43  ? 108.703 116.283 92.994  1.00 19.63  ? 43   VAL B C     1 
ATOM   5755  O  O     . VAL C 3  43  ? 109.847 116.384 93.439  1.00 20.56  ? 43   VAL B O     1 
ATOM   5756  C  CB    . VAL C 3  43  ? 107.145 115.589 94.805  1.00 25.30  ? 43   VAL B CB    1 
ATOM   5757  C  CG1   . VAL C 3  43  ? 106.440 116.887 94.663  1.00 24.09  ? 43   VAL B CG1   1 
ATOM   5758  C  CG2   . VAL C 3  43  ? 106.198 114.554 95.225  1.00 29.16  ? 43   VAL B CG2   1 
ATOM   5759  N  N     . LYS C 3  44  ? 108.221 117.111 92.079  1.00 32.20  ? 44   LYS B N     1 
ATOM   5760  C  CA    . LYS C 3  44  ? 109.038 118.204 91.585  1.00 23.59  ? 44   LYS B CA    1 
ATOM   5761  C  C     . LYS C 3  44  ? 108.678 119.512 92.266  1.00 23.12  ? 44   LYS B C     1 
ATOM   5762  O  O     . LYS C 3  44  ? 109.525 120.136 92.900  1.00 33.69  ? 44   LYS B O     1 
ATOM   5763  C  CB    . LYS C 3  44  ? 108.928 118.340 90.072  1.00 23.89  ? 44   LYS B CB    1 
ATOM   5764  C  CG    . LYS C 3  44  ? 109.887 119.352 89.532  1.00 21.89  ? 44   LYS B CG    1 
ATOM   5765  C  CD    . LYS C 3  44  ? 109.865 119.347 88.038  1.00 28.85  ? 44   LYS B CD    1 
ATOM   5766  C  CE    . LYS C 3  44  ? 110.818 120.372 87.475  1.00 36.30  ? 44   LYS B CE    1 
ATOM   5767  N  NZ    . LYS C 3  44  ? 110.797 120.367 85.988  1.00 36.93  ? 44   LYS B NZ    1 
ATOM   5768  N  N     . ARG C 3  45  ? 107.445 119.956 92.135  1.00 29.55  ? 45   ARG B N     1 
ATOM   5769  C  CA    . ARG C 3  45  ? 107.063 121.262 92.635  1.00 32.10  ? 45   ARG B CA    1 
ATOM   5770  C  C     . ARG C 3  45  ? 105.936 121.122 93.641  1.00 33.69  ? 45   ARG B C     1 
ATOM   5771  O  O     . ARG C 3  45  ? 104.836 120.711 93.283  1.00 35.42  ? 45   ARG B O     1 
ATOM   5772  C  CB    . ARG C 3  45  ? 106.656 122.152 91.474  1.00 42.62  ? 45   ARG B CB    1 
ATOM   5773  C  CG    . ARG C 3  45  ? 106.187 123.485 91.889  1.00 50.39  ? 45   ARG B CG    1 
ATOM   5774  C  CD    . ARG C 3  45  ? 106.038 124.372 90.706  1.00 52.72  ? 45   ARG B CD    1 
ATOM   5775  N  NE    . ARG C 3  45  ? 105.587 125.671 91.147  1.00 61.11  ? 45   ARG B NE    1 
ATOM   5776  C  CZ    . ARG C 3  45  ? 105.640 126.757 90.402  1.00 68.07  ? 45   ARG B CZ    1 
ATOM   5777  N  NH1   . ARG C 3  45  ? 106.150 126.694 89.190  1.00 62.97  ? 45   ARG B NH1   1 
ATOM   5778  N  NH2   . ARG C 3  45  ? 105.209 127.906 90.884  1.00 70.43  ? 45   ARG B NH2   1 
ATOM   5779  N  N     . ILE C 3  46  ? 106.190 121.493 94.858  1.00 31.85  ? 46   ILE B N     1 
ATOM   5780  C  CA    . ILE C 3  46  ? 105.270 121.231 95.953  1.00 26.73  ? 46   ILE B CA    1 
ATOM   5781  C  C     . ILE C 3  46  ? 104.368 122.428 96.173  1.00 28.93  ? 46   ILE B C     1 
ATOM   5782  O  O     . ILE C 3  46  ? 104.830 123.567 96.187  1.00 37.79  ? 46   ILE B O     1 
ATOM   5783  C  CB    . ILE C 3  46  ? 106.056 120.923 97.227  1.00 29.79  ? 46   ILE B CB    1 
ATOM   5784  C  CG1   . ILE C 3  46  ? 106.877 119.676 97.047  1.00 32.12  ? 46   ILE B CG1   1 
ATOM   5785  C  CG2   . ILE C 3  46  ? 105.139 120.718 98.364  1.00 26.42  ? 46   ILE B CG2   1 
ATOM   5786  C  CD1   . ILE C 3  46  ? 107.795 119.484 98.188  1.00 30.87  ? 46   ILE B CD1   1 
ATOM   5787  N  N     . SER C 3  47  ? 103.083 122.180 96.369  1.00 24.70  ? 47   SER B N     1 
ATOM   5788  C  CA    . SER C 3  47  ? 102.180 123.248 96.742  1.00 22.48  ? 47   SER B CA    1 
ATOM   5789  C  C     . SER C 3  47  ? 102.401 123.649 98.184  1.00 28.09  ? 47   SER B C     1 
ATOM   5790  O  O     . SER C 3  47  ? 103.071 122.968 98.944  1.00 34.44  ? 47   SER B O     1 
ATOM   5791  C  CB    . SER C 3  47  ? 100.736 122.841 96.566  1.00 26.16  ? 47   SER B CB    1 
ATOM   5792  O  OG    . SER C 3  47  ? 99.909  123.883 97.029  1.00 32.97  ? 47   SER B OG    1 
ATOM   5793  N  N     . GLY C 3  48  ? 101.853 124.803 98.548  1.00 30.94  ? 48   GLY B N     1 
ATOM   5794  C  CA    . GLY C 3  48  ? 102.080 125.339 99.875  1.00 23.20  ? 48   GLY B CA    1 
ATOM   5795  C  C     . GLY C 3  48  ? 101.204 124.763 100.959 1.00 40.61  ? 48   GLY B C     1 
ATOM   5796  O  O     . GLY C 3  48  ? 101.557 124.863 102.135 1.00 57.63  ? 48   GLY B O     1 
ATOM   5797  N  N     . LEU C 3  49  ? 100.064 124.184 100.610 1.00 32.66  ? 49   LEU B N     1 
ATOM   5798  C  CA    . LEU C 3  49  ? 99.192  123.644 101.641 1.00 36.05  ? 49   LEU B CA    1 
ATOM   5799  C  C     . LEU C 3  49  ? 99.590  122.253 102.085 1.00 36.86  ? 49   LEU B C     1 
ATOM   5800  O  O     . LEU C 3  49  ? 99.216  121.848 103.186 1.00 43.66  ? 49   LEU B O     1 
ATOM   5801  C  CB    . LEU C 3  49  ? 97.754  123.616 101.149 1.00 37.11  ? 49   LEU B CB    1 
ATOM   5802  C  CG    . LEU C 3  49  ? 97.174  124.996 100.885 1.00 34.37  ? 49   LEU B CG    1 
ATOM   5803  C  CD1   . LEU C 3  49  ? 95.804  124.873 100.265 1.00 35.68  ? 49   LEU B CD1   1 
ATOM   5804  C  CD2   . LEU C 3  49  ? 97.108  125.784 102.175 1.00 22.51  ? 49   LEU B CD2   1 
ATOM   5805  N  N     . ILE C 3  50  ? 100.352 121.527 101.267 1.00 48.14  ? 50   ILE B N     1 
ATOM   5806  C  CA    . ILE C 3  50  ? 100.662 120.128 101.536 1.00 37.29  ? 50   ILE B CA    1 
ATOM   5807  C  C     . ILE C 3  50  ? 101.198 119.919 102.933 1.00 31.33  ? 50   ILE B C     1 
ATOM   5808  O  O     . ILE C 3  50  ? 100.996 118.858 103.523 1.00 37.94  ? 50   ILE B O     1 
ATOM   5809  C  CB    . ILE C 3  50  ? 101.645 119.601 100.483 1.00 20.13  ? 50   ILE B CB    1 
ATOM   5810  C  CG1   . ILE C 3  50  ? 100.948 119.497 99.150  1.00 31.36  ? 50   ILE B CG1   1 
ATOM   5811  C  CG2   . ILE C 3  50  ? 102.160 118.267 100.848 1.00 13.69  ? 50   ILE B CG2   1 
ATOM   5812  C  CD1   . ILE C 3  50  ? 99.805  118.570 99.202  1.00 14.89  ? 50   ILE B CD1   1 
ATOM   5813  N  N     . TYR C 3  51  ? 101.860 120.915 103.498 1.00 32.27  ? 51   TYR B N     1 
ATOM   5814  C  CA    . TYR C 3  51  ? 102.544 120.711 104.763 1.00 36.36  ? 51   TYR B CA    1 
ATOM   5815  C  C     . TYR C 3  51  ? 101.584 120.290 105.864 1.00 42.65  ? 51   TYR B C     1 
ATOM   5816  O  O     . TYR C 3  51  ? 101.662 119.152 106.345 1.00 46.33  ? 51   TYR B O     1 
ATOM   5817  C  CB    . TYR C 3  51  ? 103.321 121.960 105.130 1.00 16.18  ? 51   TYR B CB    1 
ATOM   5818  C  CG    . TYR C 3  51  ? 104.290 122.295 104.038 1.00 29.15  ? 51   TYR B CG    1 
ATOM   5819  C  CD1   . TYR C 3  51  ? 104.857 121.296 103.277 1.00 38.23  ? 51   TYR B CD1   1 
ATOM   5820  C  CD2   . TYR C 3  51  ? 104.646 123.597 103.766 1.00 38.67  ? 51   TYR B CD2   1 
ATOM   5821  C  CE1   . TYR C 3  51  ? 105.725 121.583 102.269 1.00 47.71  ? 51   TYR B CE1   1 
ATOM   5822  C  CE2   . TYR C 3  51  ? 105.523 123.887 102.761 1.00 45.02  ? 51   TYR B CE2   1 
ATOM   5823  C  CZ    . TYR C 3  51  ? 106.059 122.874 102.020 1.00 53.56  ? 51   TYR B CZ    1 
ATOM   5824  O  OH    . TYR C 3  51  ? 106.939 123.152 101.014 1.00 65.64  ? 51   TYR B OH    1 
ATOM   5825  N  N     . GLU C 3  52  ? 100.662 121.169 106.258 1.00 52.04  ? 52   GLU B N     1 
ATOM   5826  C  CA    . GLU C 3  52  ? 99.729  120.807 107.319 1.00 51.92  ? 52   GLU B CA    1 
ATOM   5827  C  C     . GLU C 3  52  ? 99.060  119.473 107.039 1.00 60.95  ? 52   GLU B C     1 
ATOM   5828  O  O     . GLU C 3  52  ? 98.841  118.663 107.950 1.00 65.94  ? 52   GLU B O     1 
ATOM   5829  C  CB    . GLU C 3  52  ? 98.673  121.887 107.494 1.00 43.92  ? 52   GLU B CB    1 
ATOM   5830  C  CG    . GLU C 3  52  ? 97.692  121.546 108.581 1.00 67.92  ? 52   GLU B CG    1 
ATOM   5831  C  CD    . GLU C 3  52  ? 98.344  121.462 109.946 1.00 73.71  ? 52   GLU B CD    1 
ATOM   5832  O  OE1   . GLU C 3  52  ? 99.468  121.981 110.112 1.00 69.35  ? 52   GLU B OE1   1 
ATOM   5833  O  OE2   . GLU C 3  52  ? 97.739  120.857 110.857 1.00 81.82  ? 52   GLU B OE2   1 
ATOM   5834  N  N     . GLU C 3  53  ? 98.766  119.210 105.774 1.00 39.64  ? 53   GLU B N     1 
ATOM   5835  C  CA    . GLU C 3  53  ? 98.223  117.918 105.405 1.00 36.00  ? 53   GLU B CA    1 
ATOM   5836  C  C     . GLU C 3  53  ? 99.136  116.793 105.855 1.00 44.65  ? 53   GLU B C     1 
ATOM   5837  O  O     . GLU C 3  53  ? 98.754  115.946 106.671 1.00 43.41  ? 53   GLU B O     1 
ATOM   5838  C  CB    . GLU C 3  53  ? 98.038  117.861 103.901 1.00 46.61  ? 53   GLU B CB    1 
ATOM   5839  C  CG    . GLU C 3  53  ? 97.407  116.609 103.456 1.00 50.72  ? 53   GLU B CG    1 
ATOM   5840  C  CD    . GLU C 3  53  ? 95.996  116.550 103.914 1.00 66.59  ? 53   GLU B CD    1 
ATOM   5841  O  OE1   . GLU C 3  53  ? 95.472  117.609 104.305 1.00 74.35  ? 53   GLU B OE1   1 
ATOM   5842  O  OE2   . GLU C 3  53  ? 95.405  115.454 103.896 1.00 61.66  ? 53   GLU B OE2   1 
ATOM   5843  N  N     . THR C 3  54  ? 100.368 116.791 105.358 1.00 31.14  ? 54   THR B N     1 
ATOM   5844  C  CA    . THR C 3  54  ? 101.251 115.669 105.622 1.00 27.28  ? 54   THR B CA    1 
ATOM   5845  C  C     . THR C 3  54  ? 101.513 115.505 107.101 1.00 29.34  ? 54   THR B C     1 
ATOM   5846  O  O     . THR C 3  54  ? 101.713 114.383 107.573 1.00 30.88  ? 54   THR B O     1 
ATOM   5847  C  CB    . THR C 3  54  ? 102.542 115.838 104.856 1.00 19.14  ? 54   THR B CB    1 
ATOM   5848  O  OG1   . THR C 3  54  ? 102.248 115.773 103.462 1.00 27.08  ? 54   THR B OG1   1 
ATOM   5849  C  CG2   . THR C 3  54  ? 103.494 114.742 105.193 1.00 11.23  ? 54   THR B CG2   1 
ATOM   5850  N  N     . ARG C 3  55  ? 101.463 116.583 107.868 1.00 23.16  ? 55   ARG B N     1 
ATOM   5851  C  CA    . ARG C 3  55  ? 101.421 116.378 109.306 1.00 25.75  ? 55   ARG B CA    1 
ATOM   5852  C  C     . ARG C 3  55  ? 100.187 115.585 109.698 1.00 29.43  ? 55   ARG B C     1 
ATOM   5853  O  O     . ARG C 3  55  ? 100.266 114.676 110.533 1.00 28.08  ? 55   ARG B O     1 
ATOM   5854  C  CB    . ARG C 3  55  ? 101.474 117.706 110.033 1.00 23.53  ? 55   ARG B CB    1 
ATOM   5855  C  CG    . ARG C 3  55  ? 102.808 118.345 109.903 1.00 24.07  ? 55   ARG B CG    1 
ATOM   5856  C  CD    . ARG C 3  55  ? 102.805 119.686 110.521 1.00 34.89  ? 55   ARG B CD    1 
ATOM   5857  N  NE    . ARG C 3  55  ? 104.121 120.275 110.424 1.00 40.48  ? 55   ARG B NE    1 
ATOM   5858  C  CZ    . ARG C 3  55  ? 104.563 120.878 109.339 1.00 45.30  ? 55   ARG B CZ    1 
ATOM   5859  N  NH1   . ARG C 3  55  ? 103.780 120.955 108.278 1.00 40.91  ? 55   ARG B NH1   1 
ATOM   5860  N  NH2   . ARG C 3  55  ? 105.779 121.398 109.313 1.00 53.53  ? 55   ARG B NH2   1 
ATOM   5861  N  N     . GLY C 3  56  ? 99.051  115.877 109.082 1.00 21.69  ? 56   GLY B N     1 
ATOM   5862  C  CA    . GLY C 3  56  ? 97.879  115.071 109.358 1.00 31.97  ? 56   GLY B CA    1 
ATOM   5863  C  C     . GLY C 3  56  ? 98.099  113.593 109.104 1.00 29.81  ? 56   GLY B C     1 
ATOM   5864  O  O     . GLY C 3  56  ? 97.947  112.767 110.015 1.00 28.10  ? 56   GLY B O     1 
ATOM   5865  N  N     . VAL C 3  57  ? 98.499  113.251 107.879 1.00 20.83  ? 57   VAL B N     1 
ATOM   5866  C  CA    . VAL C 3  57  ? 98.750  111.852 107.540 1.00 20.46  ? 57   VAL B CA    1 
ATOM   5867  C  C     . VAL C 3  57  ? 99.688  111.211 108.544 1.00 25.15  ? 57   VAL B C     1 
ATOM   5868  O  O     . VAL C 3  57  ? 99.395  110.155 109.122 1.00 36.52  ? 57   VAL B O     1 
ATOM   5869  C  CB    . VAL C 3  57  ? 99.327  111.740 106.127 1.00 27.12  ? 57   VAL B CB    1 
ATOM   5870  C  CG1   . VAL C 3  57  ? 99.824  110.348 105.911 1.00 28.37  ? 57   VAL B CG1   1 
ATOM   5871  C  CG2   . VAL C 3  57  ? 98.271  112.069 105.137 1.00 25.87  ? 57   VAL B CG2   1 
ATOM   5872  N  N     . LEU C 3  58  ? 100.839 111.837 108.758 1.00 16.32  ? 58   LEU B N     1 
ATOM   5873  C  CA    . LEU C 3  58  ? 101.840 111.238 109.621 1.00 20.43  ? 58   LEU B CA    1 
ATOM   5874  C  C     . LEU C 3  58  ? 101.266 110.955 110.994 1.00 30.74  ? 58   LEU B C     1 
ATOM   5875  O  O     . LEU C 3  58  ? 101.407 109.847 111.521 1.00 32.59  ? 58   LEU B O     1 
ATOM   5876  C  CB    . LEU C 3  58  ? 103.040 112.153 109.730 1.00 12.52  ? 58   LEU B CB    1 
ATOM   5877  C  CG    . LEU C 3  58  ? 104.137 111.521 110.538 1.00 15.77  ? 58   LEU B CG    1 
ATOM   5878  C  CD1   . LEU C 3  58  ? 104.556 110.281 109.819 1.00 11.79  ? 58   LEU B CD1   1 
ATOM   5879  C  CD2   . LEU C 3  58  ? 105.274 112.490 110.621 1.00 8.15   ? 58   LEU B CD2   1 
ATOM   5880  N  N     . LYS C 3  59  ? 100.570 111.931 111.573 1.00 32.54  ? 59   LYS B N     1 
ATOM   5881  C  CA    . LYS C 3  59  ? 100.063 111.723 112.920 1.00 27.76  ? 59   LYS B CA    1 
ATOM   5882  C  C     . LYS C 3  59  ? 99.058  110.586 112.972 1.00 24.01  ? 59   LYS B C     1 
ATOM   5883  O  O     . LYS C 3  59  ? 99.022  109.840 113.957 1.00 20.62  ? 59   LYS B O     1 
ATOM   5884  C  CB    . LYS C 3  59  ? 99.445  112.993 113.475 1.00 65.38  ? 59   LYS B CB    1 
ATOM   5885  C  CG    . LYS C 3  59  ? 99.028  112.827 114.911 1.00 13.67  ? 59   LYS B CG    1 
ATOM   5886  C  CD    . LYS C 3  59  ? 98.460  114.090 115.524 1.00 29.54  ? 59   LYS B CD    1 
ATOM   5887  C  CE    . LYS C 3  59  ? 97.018  114.301 115.137 1.00 37.75  ? 59   LYS B CE    1 
ATOM   5888  N  NZ    . LYS C 3  59  ? 96.469  115.497 115.813 1.00 28.24  ? 59   LYS B NZ    1 
ATOM   5889  N  N     . VAL C 3  60  ? 98.250  110.399 111.931 1.00 22.14  ? 60   VAL B N     1 
ATOM   5890  C  CA    . VAL C 3  60  ? 97.398  109.213 111.935 1.00 23.89  ? 60   VAL B CA    1 
ATOM   5891  C  C     . VAL C 3  60  ? 98.245  107.954 111.958 1.00 29.41  ? 60   VAL B C     1 
ATOM   5892  O  O     . VAL C 3  60  ? 98.136  107.126 112.873 1.00 35.40  ? 60   VAL B O     1 
ATOM   5893  C  CB    . VAL C 3  60  ? 96.443  109.205 110.741 1.00 22.72  ? 60   VAL B CB    1 
ATOM   5894  C  CG1   . VAL C 3  60  ? 95.863  107.839 110.600 1.00 15.27  ? 60   VAL B CG1   1 
ATOM   5895  C  CG2   . VAL C 3  60  ? 95.342  110.176 111.001 1.00 25.07  ? 60   VAL B CG2   1 
ATOM   5896  N  N     . PHE C 3  61  ? 99.112  107.797 110.959 1.00 52.27  ? 61   PHE B N     1 
ATOM   5897  C  CA    . PHE C 3  61  ? 99.880  106.562 110.854 1.00 15.74  ? 61   PHE B CA    1 
ATOM   5898  C  C     . PHE C 3  61  ? 100.528 106.208 112.177 1.00 18.82  ? 61   PHE B C     1 
ATOM   5899  O  O     . PHE C 3  61  ? 100.431 105.069 112.654 1.00 17.53  ? 61   PHE B O     1 
ATOM   5900  C  CB    . PHE C 3  61  ? 100.942 106.703 109.785 1.00 15.06  ? 61   PHE B CB    1 
ATOM   5901  C  CG    . PHE C 3  61  ? 101.790 105.501 109.626 1.00 15.01  ? 61   PHE B CG    1 
ATOM   5902  C  CD1   . PHE C 3  61  ? 101.390 104.475 108.832 1.00 11.32  ? 61   PHE B CD1   1 
ATOM   5903  C  CD2   . PHE C 3  61  ? 102.988 105.400 110.267 1.00 29.52  ? 61   PHE B CD2   1 
ATOM   5904  C  CE1   . PHE C 3  61  ? 102.170 103.379 108.676 1.00 15.46  ? 61   PHE B CE1   1 
ATOM   5905  C  CE2   . PHE C 3  61  ? 103.766 104.307 110.110 1.00 23.02  ? 61   PHE B CE2   1 
ATOM   5906  C  CZ    . PHE C 3  61  ? 103.356 103.297 109.315 1.00 13.92  ? 61   PHE B CZ    1 
ATOM   5907  N  N     . LEU C 3  62  ? 101.165 107.187 112.809 1.00 17.14  ? 62   LEU B N     1 
ATOM   5908  C  CA    . LEU C 3  62  ? 101.782 106.900 114.091 1.00 17.19  ? 62   LEU B CA    1 
ATOM   5909  C  C     . LEU C 3  62  ? 100.753 106.500 115.133 1.00 27.27  ? 62   LEU B C     1 
ATOM   5910  O  O     . LEU C 3  62  ? 101.012 105.595 115.932 1.00 28.90  ? 62   LEU B O     1 
ATOM   5911  C  CB    . LEU C 3  62  ? 102.614 108.077 114.564 1.00 22.05  ? 62   LEU B CB    1 
ATOM   5912  C  CG    . LEU C 3  62  ? 103.848 108.078 113.698 1.00 8.14   ? 62   LEU B CG    1 
ATOM   5913  C  CD1   . LEU C 3  62  ? 104.746 109.228 114.008 1.00 19.03  ? 62   LEU B CD1   1 
ATOM   5914  C  CD2   . LEU C 3  62  ? 104.540 106.798 113.961 1.00 7.30   ? 62   LEU B CD2   1 
ATOM   5915  N  N     . GLU C 3  63  ? 99.580  107.134 115.155 1.00 12.19  ? 63   GLU B N     1 
ATOM   5916  C  CA    . GLU C 3  63  ? 98.609  106.673 116.140 1.00 18.22  ? 63   GLU B CA    1 
ATOM   5917  C  C     . GLU C 3  63  ? 98.317  105.200 115.966 1.00 18.98  ? 63   GLU B C     1 
ATOM   5918  O  O     . GLU C 3  63  ? 98.273  104.456 116.950 1.00 17.31  ? 63   GLU B O     1 
ATOM   5919  C  CB    . GLU C 3  63  ? 97.310  107.461 116.101 1.00 35.60  ? 63   GLU B CB    1 
ATOM   5920  C  CG    . GLU C 3  63  ? 97.383  108.811 116.762 1.00 43.37  ? 63   GLU B CG    1 
ATOM   5921  C  CD    . GLU C 3  63  ? 96.018  109.448 116.922 1.00 50.24  ? 63   GLU B CD    1 
ATOM   5922  O  OE1   . GLU C 3  63  ? 95.042  108.899 116.376 1.00 50.36  ? 63   GLU B OE1   1 
ATOM   5923  O  OE2   . GLU C 3  63  ? 95.915  110.483 117.611 1.00 50.31  ? 63   GLU B OE2   1 
ATOM   5924  N  N     . ASN C 3  64  ? 98.129  104.748 114.735 1.00 21.09  ? 64   ASN B N     1 
ATOM   5925  C  CA    . ASN C 3  64  ? 97.895  103.320 114.564 1.00 22.28  ? 64   ASN B CA    1 
ATOM   5926  C  C     . ASN C 3  64  ? 99.056  102.476 115.068 1.00 20.03  ? 64   ASN B C     1 
ATOM   5927  O  O     . ASN C 3  64  ? 98.903  101.719 116.039 1.00 23.11  ? 64   ASN B O     1 
ATOM   5928  C  CB    . ASN C 3  64  ? 97.590  102.990 113.113 1.00 32.30  ? 64   ASN B CB    1 
ATOM   5929  C  CG    . ASN C 3  64  ? 96.190  103.371 112.731 1.00 29.10  ? 64   ASN B CG    1 
ATOM   5930  O  OD1   . ASN C 3  64  ? 95.317  103.465 113.584 1.00 32.40  ? 64   ASN B OD1   1 
ATOM   5931  N  ND2   . ASN C 3  64  ? 95.960  103.589 111.448 1.00 35.07  ? 64   ASN B ND2   1 
ATOM   5932  N  N     . VAL C 3  65  ? 100.219 102.592 114.425 1.00 18.83  ? 65   VAL B N     1 
ATOM   5933  C  CA    . VAL C 3  65  ? 101.316 101.688 114.762 1.00 16.84  ? 65   VAL B CA    1 
ATOM   5934  C  C     . VAL C 3  65  ? 101.588 101.703 116.251 1.00 15.22  ? 65   VAL B C     1 
ATOM   5935  O  O     . VAL C 3  65  ? 101.661 100.655 116.899 1.00 21.70  ? 65   VAL B O     1 
ATOM   5936  C  CB    . VAL C 3  65  ? 102.582 102.056 113.989 1.00 42.21  ? 65   VAL B CB    1 
ATOM   5937  C  CG1   . VAL C 3  65  ? 103.684 101.172 114.431 1.00 37.90  ? 65   VAL B CG1   1 
ATOM   5938  C  CG2   . VAL C 3  65  ? 102.342 101.874 112.549 1.00 3.46   ? 65   VAL B CG2   1 
ATOM   5939  N  N     . ILE C 3  66  ? 101.734 102.892 116.821 1.00 12.88  ? 66   ILE B N     1 
ATOM   5940  C  CA    . ILE C 3  66  ? 102.059 102.966 118.235 1.00 5.32   ? 66   ILE B CA    1 
ATOM   5941  C  C     . ILE C 3  66  ? 100.956 102.355 119.075 1.00 17.82  ? 66   ILE B C     1 
ATOM   5942  O  O     . ILE C 3  66  ? 101.234 101.679 120.066 1.00 17.68  ? 66   ILE B O     1 
ATOM   5943  C  CB    . ILE C 3  66  ? 102.354 104.406 118.651 1.00 4.41   ? 66   ILE B CB    1 
ATOM   5944  C  CG1   . ILE C 3  66  ? 103.703 104.808 118.117 1.00 7.43   ? 66   ILE B CG1   1 
ATOM   5945  C  CG2   . ILE C 3  66  ? 102.367 104.525 120.121 1.00 5.16   ? 66   ILE B CG2   1 
ATOM   5946  C  CD1   . ILE C 3  66  ? 103.971 106.235 118.304 1.00 16.64  ? 66   ILE B CD1   1 
ATOM   5947  N  N     . ARG C 3  67  ? 99.692  102.562 118.703 1.00 16.21  ? 67   ARG B N     1 
ATOM   5948  C  CA    . ARG C 3  67  ? 98.634  101.897 119.457 1.00 13.92  ? 67   ARG B CA    1 
ATOM   5949  C  C     . ARG C 3  67  ? 98.894  100.407 119.543 1.00 14.94  ? 67   ARG B C     1 
ATOM   5950  O  O     . ARG C 3  67  ? 98.893  99.824  120.633 1.00 19.34  ? 67   ARG B O     1 
ATOM   5951  C  CB    . ARG C 3  67  ? 97.262  102.127 118.844 1.00 15.98  ? 67   ARG B CB    1 
ATOM   5952  C  CG    . ARG C 3  67  ? 96.223  101.342 119.612 1.00 29.83  ? 67   ARG B CG    1 
ATOM   5953  C  CD    . ARG C 3  67  ? 94.797  101.480 119.102 1.00 50.67  ? 67   ARG B CD    1 
ATOM   5954  N  NE    . ARG C 3  67  ? 94.184  102.781 119.330 1.00 61.05  ? 67   ARG B NE    1 
ATOM   5955  C  CZ    . ARG C 3  67  ? 93.904  103.642 118.364 1.00 59.31  ? 67   ARG B CZ    1 
ATOM   5956  N  NH1   . ARG C 3  67  ? 94.184  103.332 117.112 1.00 56.56  ? 67   ARG B NH1   1 
ATOM   5957  N  NH2   . ARG C 3  67  ? 93.335  104.802 118.646 1.00 51.27  ? 67   ARG B NH2   1 
ATOM   5958  N  N     . ASP C 3  68  ? 99.154  99.769  118.409 1.00 22.68  ? 68   ASP B N     1 
ATOM   5959  C  CA    . ASP C 3  68  ? 99.350  98.330  118.482 1.00 15.12  ? 68   ASP B CA    1 
ATOM   5960  C  C     . ASP C 3  68  ? 100.575 97.978  119.313 1.00 19.92  ? 68   ASP B C     1 
ATOM   5961  O  O     . ASP C 3  68  ? 100.499 97.140  120.219 1.00 26.45  ? 68   ASP B O     1 
ATOM   5962  C  CB    . ASP C 3  68  ? 99.437  97.726  117.092 1.00 16.42  ? 68   ASP B CB    1 
ATOM   5963  C  CG    . ASP C 3  68  ? 98.118  97.767  116.381 1.00 47.50  ? 68   ASP B CG    1 
ATOM   5964  O  OD1   . ASP C 3  68  ? 97.135  98.152  117.034 1.00 47.28  ? 68   ASP B OD1   1 
ATOM   5965  O  OD2   . ASP C 3  68  ? 98.041  97.384  115.198 1.00 58.82  ? 68   ASP B OD2   1 
ATOM   5966  N  N     . ALA C 3  69  ? 101.712 98.615  119.041 1.00 10.25  ? 69   ALA B N     1 
ATOM   5967  C  CA    . ALA C 3  69  ? 102.919 98.279  119.791 1.00 8.07   ? 69   ALA B CA    1 
ATOM   5968  C  C     . ALA C 3  69  ? 102.684 98.397  121.288 1.00 13.29  ? 69   ALA B C     1 
ATOM   5969  O  O     . ALA C 3  69  ? 103.033 97.496  122.057 1.00 10.52  ? 69   ALA B O     1 
ATOM   5970  C  CB    . ALA C 3  69  ? 104.076 99.171  119.369 1.00 12.39  ? 69   ALA B CB    1 
ATOM   5971  N  N     . VAL C 3  70  ? 102.078 99.496  121.717 1.00 13.04  ? 70   VAL B N     1 
ATOM   5972  C  CA    . VAL C 3  70  ? 101.726 99.636  123.122 1.00 16.00  ? 70   VAL B CA    1 
ATOM   5973  C  C     . VAL C 3  70  ? 100.936 98.432  123.592 1.00 17.12  ? 70   VAL B C     1 
ATOM   5974  O  O     . VAL C 3  70  ? 101.241 97.849  124.634 1.00 5.64   ? 70   VAL B O     1 
ATOM   5975  C  CB    . VAL C 3  70  ? 100.954 100.938 123.354 1.00 11.76  ? 70   VAL B CB    1 
ATOM   5976  C  CG1   . VAL C 3  70  ? 100.397 100.954 124.730 1.00 10.75  ? 70   VAL B CG1   1 
ATOM   5977  C  CG2   . VAL C 3  70  ? 101.882 102.073 123.200 1.00 6.21   ? 70   VAL B CG2   1 
ATOM   5978  N  N     . THR C 3  71  ? 99.924  98.022  122.829 1.00 18.69  ? 71   THR B N     1 
ATOM   5979  C  CA    . THR C 3  71  ? 99.121  96.882  123.266 1.00 9.99   ? 71   THR B CA    1 
ATOM   5980  C  C     . THR C 3  71  ? 99.975  95.653  123.506 1.00 6.49   ? 71   THR B C     1 
ATOM   5981  O  O     . THR C 3  71  ? 99.943  95.069  124.593 1.00 13.94  ? 71   THR B O     1 
ATOM   5982  C  CB    . THR C 3  71  ? 98.034  96.561  122.261 1.00 16.09  ? 71   THR B CB    1 
ATOM   5983  O  OG1   . THR C 3  71  ? 96.996  97.538  122.358 1.00 17.67  ? 71   THR B OG1   1 
ATOM   5984  C  CG2   . THR C 3  71  ? 97.492  95.208  122.542 1.00 6.43   ? 71   THR B CG2   1 
ATOM   5985  N  N     . TYR C 3  72  ? 100.741 95.235  122.502 1.00 12.71  ? 72   TYR B N     1 
ATOM   5986  C  CA    . TYR C 3  72  ? 101.646 94.113  122.714 1.00 21.07  ? 72   TYR B CA    1 
ATOM   5987  C  C     . TYR C 3  72  ? 102.431 94.276  123.998 1.00 29.80  ? 72   TYR B C     1 
ATOM   5988  O  O     . TYR C 3  72  ? 102.505 93.356  124.816 1.00 18.61  ? 72   TYR B O     1 
ATOM   5989  C  CB    . TYR C 3  72  ? 102.607 93.969  121.551 1.00 31.71  ? 72   TYR B CB    1 
ATOM   5990  C  CG    . TYR C 3  72  ? 102.036 93.264  120.392 1.00 31.79  ? 72   TYR B CG    1 
ATOM   5991  C  CD1   . TYR C 3  72  ? 102.218 91.926  120.250 1.00 28.69  ? 72   TYR B CD1   1 
ATOM   5992  C  CD2   . TYR C 3  72  ? 101.296 93.923  119.460 1.00 33.03  ? 72   TYR B CD2   1 
ATOM   5993  C  CE1   . TYR C 3  72  ? 101.701 91.270  119.205 1.00 26.94  ? 72   TYR B CE1   1 
ATOM   5994  C  CE2   . TYR C 3  72  ? 100.772 93.272  118.412 1.00 31.50  ? 72   TYR B CE2   1 
ATOM   5995  C  CZ    . TYR C 3  72  ? 100.973 91.940  118.285 1.00 32.91  ? 72   TYR B CZ    1 
ATOM   5996  O  OH    . TYR C 3  72  ? 100.439 91.263  117.218 1.00 45.99  ? 72   TYR B OH    1 
ATOM   5997  N  N     . THR C 3  73  ? 102.999 95.457  124.207 1.00 16.97  ? 73   THR B N     1 
ATOM   5998  C  CA    . THR C 3  73  ? 103.821 95.661  125.388 1.00 18.59  ? 73   THR B CA    1 
ATOM   5999  C  C     . THR C 3  73  ? 103.032 95.453  126.670 1.00 26.02  ? 73   THR B C     1 
ATOM   6000  O  O     . THR C 3  73  ? 103.435 94.663  127.527 1.00 21.35  ? 73   THR B O     1 
ATOM   6001  C  CB    . THR C 3  73  ? 104.438 97.035  125.349 1.00 20.36  ? 73   THR B CB    1 
ATOM   6002  O  OG1   . THR C 3  73  ? 105.423 97.054  124.318 1.00 29.22  ? 73   THR B OG1   1 
ATOM   6003  C  CG2   . THR C 3  73  ? 105.068 97.325  126.638 1.00 10.19  ? 73   THR B CG2   1 
ATOM   6004  N  N     . GLU C 3  74  ? 101.899 96.135  126.825 1.00 12.21  ? 74   GLU B N     1 
ATOM   6005  C  CA    . GLU C 3  74  ? 101.087 95.889  128.012 1.00 15.28  ? 74   GLU B CA    1 
ATOM   6006  C  C     . GLU C 3  74  ? 100.751 94.424  128.178 1.00 19.13  ? 74   GLU B C     1 
ATOM   6007  O  O     . GLU C 3  74  ? 100.527 93.966  129.299 1.00 27.73  ? 74   GLU B O     1 
ATOM   6008  C  CB    . GLU C 3  74  ? 99.785  96.680  127.994 1.00 16.49  ? 74   GLU B CB    1 
ATOM   6009  C  CG    . GLU C 3  74  ? 99.922  98.148  128.289 1.00 31.52  ? 74   GLU B CG    1 
ATOM   6010  C  CD    . GLU C 3  74  ? 98.576  98.842  128.336 1.00 54.01  ? 74   GLU B CD    1 
ATOM   6011  O  OE1   . GLU C 3  74  ? 97.570  98.210  127.958 1.00 55.46  ? 74   GLU B OE1   1 
ATOM   6012  O  OE2   . GLU C 3  74  ? 98.520  100.014 128.760 1.00 65.86  ? 74   GLU B OE2   1 
ATOM   6013  N  N     . HIS C 3  75  ? 100.698 93.667  127.090 1.00 12.60  ? 75   HIS B N     1 
ATOM   6014  C  CA    . HIS C 3  75  ? 100.395 92.260  127.275 1.00 18.55  ? 75   HIS B CA    1 
ATOM   6015  C  C     . HIS C 3  75  ? 101.528 91.505  127.938 1.00 30.98  ? 75   HIS B C     1 
ATOM   6016  O  O     . HIS C 3  75  ? 101.278 90.546  128.670 1.00 43.35  ? 75   HIS B O     1 
ATOM   6017  C  CB    . HIS C 3  75  ? 100.076 91.567  125.973 1.00 28.35  ? 75   HIS B CB    1 
ATOM   6018  C  CG    . HIS C 3  75  ? 100.023 90.094  126.135 1.00 28.49  ? 75   HIS B CG    1 
ATOM   6019  N  ND1   . HIS C 3  75  ? 99.116  89.481  126.963 1.00 32.35  ? 75   HIS B ND1   1 
ATOM   6020  C  CD2   . HIS C 3  75  ? 100.838 89.120  125.680 1.00 30.67  ? 75   HIS B CD2   1 
ATOM   6021  C  CE1   . HIS C 3  75  ? 99.336  88.181  126.965 1.00 38.09  ? 75   HIS B CE1   1 
ATOM   6022  N  NE2   . HIS C 3  75  ? 100.376 87.936  126.194 1.00 37.13  ? 75   HIS B NE2   1 
ATOM   6023  N  N     . ALA C 3  76  ? 102.765 91.879  127.688 1.00 33.44  ? 76   ALA B N     1 
ATOM   6024  C  CA    . ALA C 3  76  ? 103.855 91.125  128.279 1.00 29.61  ? 76   ALA B CA    1 
ATOM   6025  C  C     . ALA C 3  76  ? 104.238 91.640  129.650 1.00 26.13  ? 76   ALA B C     1 
ATOM   6026  O  O     . ALA C 3  76  ? 105.213 91.159  130.224 1.00 26.64  ? 76   ALA B O     1 
ATOM   6027  C  CB    . ALA C 3  76  ? 105.072 91.141  127.363 1.00 30.49  ? 76   ALA B CB    1 
ATOM   6028  N  N     . LYS C 3  77  ? 103.501 92.611  130.173 1.00 28.34  ? 77   LYS B N     1 
ATOM   6029  C  CA    . LYS C 3  77  ? 103.778 93.251  131.453 1.00 30.41  ? 77   LYS B CA    1 
ATOM   6030  C  C     . LYS C 3  77  ? 105.104 93.989  131.463 1.00 28.87  ? 77   LYS B C     1 
ATOM   6031  O  O     . LYS C 3  77  ? 105.645 94.269  132.526 1.00 34.79  ? 77   LYS B O     1 
ATOM   6032  C  CB    . LYS C 3  77  ? 103.752 92.247  132.604 1.00 40.61  ? 77   LYS B CB    1 
ATOM   6033  C  CG    . LYS C 3  77  ? 102.406 91.640  132.894 1.00 51.88  ? 77   LYS B CG    1 
ATOM   6034  C  CD    . LYS C 3  77  ? 102.539 90.676  134.056 1.00 59.03  ? 77   LYS B CD    1 
ATOM   6035  C  CE    . LYS C 3  77  ? 101.216 90.090  134.483 1.00 67.31  ? 77   LYS B CE    1 
ATOM   6036  N  NZ    . LYS C 3  77  ? 101.394 89.173  135.638 1.00 71.57  ? 77   LYS B NZ    1 
ATOM   6037  N  N     . ARG C 3  78  ? 105.629 94.348  130.309 1.00 27.00  ? 78   ARG B N     1 
ATOM   6038  C  CA    . ARG C 3  78  ? 106.813 95.180  130.252 1.00 25.17  ? 78   ARG B CA    1 
ATOM   6039  C  C     . ARG C 3  78  ? 106.395 96.631  130.136 1.00 22.58  ? 78   ARG B C     1 
ATOM   6040  O  O     . ARG C 3  78  ? 105.328 96.938  129.615 1.00 33.97  ? 78   ARG B O     1 
ATOM   6041  C  CB    . ARG C 3  78  ? 107.701 94.777  129.080 1.00 36.94  ? 78   ARG B CB    1 
ATOM   6042  C  CG    . ARG C 3  78  ? 108.385 93.459  129.316 1.00 39.23  ? 78   ARG B CG    1 
ATOM   6043  C  CD    . ARG C 3  78  ? 109.321 93.048  128.199 1.00 31.46  ? 78   ARG B CD    1 
ATOM   6044  N  NE    . ARG C 3  78  ? 108.623 92.652  126.989 1.00 33.23  ? 78   ARG B NE    1 
ATOM   6045  C  CZ    . ARG C 3  78  ? 108.491 93.419  125.920 1.00 41.08  ? 78   ARG B CZ    1 
ATOM   6046  N  NH1   . ARG C 3  78  ? 109.006 94.631  125.915 1.00 36.76  ? 78   ARG B NH1   1 
ATOM   6047  N  NH2   . ARG C 3  78  ? 107.840 92.974  124.860 1.00 17.19  ? 78   ARG B NH2   1 
ATOM   6048  N  N     . LYS C 3  79  ? 107.184 97.519  130.720 1.00 37.15  ? 79   LYS B N     1 
ATOM   6049  C  CA    . LYS C 3  79  ? 106.998 98.943  130.500 1.00 41.23  ? 79   LYS B CA    1 
ATOM   6050  C  C     . LYS C 3  79  ? 107.940 99.494  129.447 1.00 42.20  ? 79   LYS B C     1 
ATOM   6051  O  O     . LYS C 3  79  ? 107.987 100.709 129.244 1.00 42.33  ? 79   LYS B O     1 
ATOM   6052  C  CB    . LYS C 3  79  ? 107.142 99.702  131.807 1.00 42.84  ? 79   LYS B CB    1 
ATOM   6053  C  CG    . LYS C 3  79  ? 106.003 99.384  132.732 1.00 54.38  ? 79   LYS B CG    1 
ATOM   6054  C  CD    . LYS C 3  79  ? 106.140 100.023 134.093 1.00 65.37  ? 79   LYS B CD    1 
ATOM   6055  C  CE    . LYS C 3  79  ? 104.947 99.653  134.961 1.00 68.94  ? 79   LYS B CE    1 
ATOM   6056  N  NZ    . LYS C 3  79  ? 105.049 100.189 136.337 1.00 69.01  ? 79   LYS B NZ    1 
ATOM   6057  N  N     . THR C 3  80  ? 108.703 98.631  128.790 1.00 42.19  ? 80   THR B N     1 
ATOM   6058  C  CA    . THR C 3  80  ? 109.678 99.023  127.784 1.00 29.39  ? 80   THR B CA    1 
ATOM   6059  C  C     . THR C 3  80  ? 109.172 98.601  126.421 1.00 38.66  ? 80   THR B C     1 
ATOM   6060  O  O     . THR C 3  80  ? 109.117 97.408  126.126 1.00 57.23  ? 80   THR B O     1 
ATOM   6061  C  CB    . THR C 3  80  ? 111.019 98.362  128.050 1.00 44.57  ? 80   THR B CB    1 
ATOM   6062  O  OG1   . THR C 3  80  ? 111.494 98.748  129.340 1.00 63.67  ? 80   THR B OG1   1 
ATOM   6063  C  CG2   . THR C 3  80  ? 112.007 98.779  127.016 1.00 50.24  ? 80   THR B CG2   1 
ATOM   6064  N  N     . VAL C 3  81  ? 108.849 99.563  125.573 1.00 17.23  ? 81   VAL B N     1 
ATOM   6065  C  CA    . VAL C 3  81  ? 108.446 99.229  124.217 1.00 15.58  ? 81   VAL B CA    1 
ATOM   6066  C  C     . VAL C 3  81  ? 109.702 98.909  123.428 1.00 27.27  ? 81   VAL B C     1 
ATOM   6067  O  O     . VAL C 3  81  ? 110.553 99.772  123.227 1.00 27.15  ? 81   VAL B O     1 
ATOM   6068  C  CB    . VAL C 3  81  ? 107.683 100.385 123.581 1.00 14.61  ? 81   VAL B CB    1 
ATOM   6069  C  CG1   . VAL C 3  81  ? 107.381 100.069 122.179 1.00 10.20  ? 81   VAL B CG1   1 
ATOM   6070  C  CG2   . VAL C 3  81  ? 106.440 100.640 124.347 1.00 27.52  ? 81   VAL B CG2   1 
ATOM   6071  N  N     . THR C 3  82  ? 109.818 97.685  122.970 1.00 25.53  ? 82   THR B N     1 
ATOM   6072  C  CA    . THR C 3  82  ? 111.072 97.233  122.404 1.00 17.30  ? 82   THR B CA    1 
ATOM   6073  C  C     . THR C 3  82  ? 111.066 97.429  120.898 1.00 23.45  ? 82   THR B C     1 
ATOM   6074  O  O     . THR C 3  82  ? 110.193 98.090  120.341 1.00 23.65  ? 82   THR B O     1 
ATOM   6075  C  CB    . THR C 3  82  ? 111.314 95.785  122.781 1.00 34.69  ? 82   THR B CB    1 
ATOM   6076  O  OG1   . THR C 3  82  ? 110.163 95.024  122.423 1.00 23.04  ? 82   THR B OG1   1 
ATOM   6077  C  CG2   . THR C 3  82  ? 111.531 95.667  124.247 1.00 37.00  ? 82   THR B CG2   1 
ATOM   6078  N  N     . ALA C 3  83  ? 112.077 96.891  120.224 1.00 28.08  ? 83   ALA B N     1 
ATOM   6079  C  CA    . ALA C 3  83  ? 112.078 96.908  118.772 1.00 20.72  ? 83   ALA B CA    1 
ATOM   6080  C  C     . ALA C 3  83  ? 111.237 95.781  118.212 1.00 30.53  ? 83   ALA B C     1 
ATOM   6081  O  O     . ALA C 3  83  ? 110.445 95.995  117.289 1.00 28.35  ? 83   ALA B O     1 
ATOM   6082  C  CB    . ALA C 3  83  ? 113.501 96.811  118.246 1.00 22.40  ? 83   ALA B CB    1 
ATOM   6083  N  N     . MET C 3  84  ? 111.377 94.580  118.764 1.00 37.62  ? 84   MET B N     1 
ATOM   6084  C  CA    . MET C 3  84  ? 110.596 93.463  118.263 1.00 41.09  ? 84   MET B CA    1 
ATOM   6085  C  C     . MET C 3  84  ? 109.116 93.772  118.273 1.00 42.29  ? 84   MET B C     1 
ATOM   6086  O  O     . MET C 3  84  ? 108.367 93.255  117.439 1.00 37.04  ? 84   MET B O     1 
ATOM   6087  C  CB    . MET C 3  84  ? 110.847 92.225  119.096 1.00 52.25  ? 84   MET B CB    1 
ATOM   6088  C  CG    . MET C 3  84  ? 112.250 91.737  119.036 1.00 61.18  ? 84   MET B CG    1 
ATOM   6089  S  SD    . MET C 3  84  ? 112.699 91.186  117.385 1.00 83.60  ? 84   MET B SD    1 
ATOM   6090  C  CE    . MET C 3  84  ? 114.383 90.640  117.672 1.00 131.77 ? 84   MET B CE    1 
ATOM   6091  N  N     . ASP C 3  85  ? 108.669 94.617  119.194 1.00 36.87  ? 85   ASP B N     1 
ATOM   6092  C  CA    . ASP C 3  85  ? 107.246 94.894  119.257 1.00 31.51  ? 85   ASP B CA    1 
ATOM   6093  C  C     . ASP C 3  85  ? 106.800 95.776  118.109 1.00 33.99  ? 85   ASP B C     1 
ATOM   6094  O  O     . ASP C 3  85  ? 105.843 95.445  117.408 1.00 44.41  ? 85   ASP B O     1 
ATOM   6095  C  CB    . ASP C 3  85  ? 106.894 95.506  120.589 1.00 43.27  ? 85   ASP B CB    1 
ATOM   6096  C  CG    . ASP C 3  85  ? 107.025 94.513  121.685 1.00 50.30  ? 85   ASP B CG    1 
ATOM   6097  O  OD1   . ASP C 3  85  ? 107.181 93.322  121.347 1.00 52.70  ? 85   ASP B OD1   1 
ATOM   6098  O  OD2   . ASP C 3  85  ? 106.957 94.894  122.868 1.00 44.36  ? 85   ASP B OD2   1 
ATOM   6099  N  N     . VAL C 3  86  ? 107.479 96.893  117.879 1.00 11.28  ? 86   VAL B N     1 
ATOM   6100  C  CA    . VAL C 3  86  ? 107.124 97.693  116.717 1.00 12.10  ? 86   VAL B CA    1 
ATOM   6101  C  C     . VAL C 3  86  ? 107.195 96.858  115.453 1.00 18.32  ? 86   VAL B C     1 
ATOM   6102  O  O     . VAL C 3  86  ? 106.290 96.906  114.611 1.00 26.30  ? 86   VAL B O     1 
ATOM   6103  C  CB    . VAL C 3  86  ? 108.006 98.933  116.623 1.00 45.01  ? 86   VAL B CB    1 
ATOM   6104  C  CG1   . VAL C 3  86  ? 107.838 99.529  115.289 1.00 50.72  ? 86   VAL B CG1   1 
ATOM   6105  C  CG2   . VAL C 3  86  ? 107.554 99.913  117.640 1.00 48.10  ? 86   VAL B CG2   1 
ATOM   6106  N  N     . VAL C 3  87  ? 108.231 96.038  115.317 1.00 15.87  ? 87   VAL B N     1 
ATOM   6107  C  CA    . VAL C 3  87  ? 108.257 95.149  114.164 1.00 12.51  ? 87   VAL B CA    1 
ATOM   6108  C  C     . VAL C 3  87  ? 107.008 94.291  114.110 1.00 17.26  ? 87   VAL B C     1 
ATOM   6109  O  O     . VAL C 3  87  ? 106.522 93.972  113.024 1.00 25.58  ? 87   VAL B O     1 
ATOM   6110  C  CB    . VAL C 3  87  ? 109.509 94.272  114.171 1.00 30.87  ? 87   VAL B CB    1 
ATOM   6111  C  CG1   . VAL C 3  87  ? 109.476 93.337  113.003 1.00 20.52  ? 87   VAL B CG1   1 
ATOM   6112  C  CG2   . VAL C 3  87  ? 110.717 95.124  114.095 1.00 19.23  ? 87   VAL B CG2   1 
ATOM   6113  N  N     . TYR C 3  88  ? 106.450 93.908  115.258 1.00 27.36  ? 88   TYR B N     1 
ATOM   6114  C  CA    . TYR C 3  88  ? 105.233 93.109  115.181 1.00 28.30  ? 88   TYR B CA    1 
ATOM   6115  C  C     . TYR C 3  88  ? 104.027 93.942  114.797 1.00 32.47  ? 88   TYR B C     1 
ATOM   6116  O  O     . TYR C 3  88  ? 103.199 93.492  114.004 1.00 37.03  ? 88   TYR B O     1 
ATOM   6117  C  CB    . TYR C 3  88  ? 104.967 92.363  116.474 1.00 30.81  ? 88   TYR B CB    1 
ATOM   6118  C  CG    . TYR C 3  88  ? 105.928 91.250  116.633 1.00 41.87  ? 88   TYR B CG    1 
ATOM   6119  C  CD1   . TYR C 3  88  ? 106.432 90.623  115.526 1.00 51.55  ? 88   TYR B CD1   1 
ATOM   6120  C  CD2   . TYR C 3  88  ? 106.299 90.791  117.870 1.00 43.69  ? 88   TYR B CD2   1 
ATOM   6121  C  CE1   . TYR C 3  88  ? 107.316 89.602  115.634 1.00 61.23  ? 88   TYR B CE1   1 
ATOM   6122  C  CE2   . TYR C 3  88  ? 107.181 89.759  117.993 1.00 50.81  ? 88   TYR B CE2   1 
ATOM   6123  C  CZ    . TYR C 3  88  ? 107.688 89.168  116.864 1.00 59.89  ? 88   TYR B CZ    1 
ATOM   6124  O  OH    . TYR C 3  88  ? 108.572 88.126  116.952 1.00 66.83  ? 88   TYR B OH    1 
ATOM   6125  N  N     . ALA C 3  89  ? 103.886 95.142  115.341 1.00 21.40  ? 89   ALA B N     1 
ATOM   6126  C  CA    . ALA C 3  89  ? 102.737 95.953  114.971 1.00 14.72  ? 89   ALA B CA    1 
ATOM   6127  C  C     . ALA C 3  89  ? 102.711 96.185  113.473 1.00 27.10  ? 89   ALA B C     1 
ATOM   6128  O  O     . ALA C 3  89  ? 101.686 95.971  112.812 1.00 38.76  ? 89   ALA B O     1 
ATOM   6129  C  CB    . ALA C 3  89  ? 102.763 97.272  115.722 1.00 15.04  ? 89   ALA B CB    1 
ATOM   6130  N  N     . LEU C 3  90  ? 103.846 96.580  112.907 1.00 25.45  ? 90   LEU B N     1 
ATOM   6131  C  CA    . LEU C 3  90  ? 103.909 96.738  111.461 1.00 31.69  ? 90   LEU B CA    1 
ATOM   6132  C  C     . LEU C 3  90  ? 103.643 95.419  110.757 1.00 43.32  ? 90   LEU B C     1 
ATOM   6133  O  O     . LEU C 3  90  ? 102.838 95.354  109.825 1.00 37.14  ? 90   LEU B O     1 
ATOM   6134  C  CB    . LEU C 3  90  ? 105.257 97.303  111.058 1.00 33.92  ? 90   LEU B CB    1 
ATOM   6135  C  CG    . LEU C 3  90  ? 105.387 98.712  111.575 1.00 40.56  ? 90   LEU B CG    1 
ATOM   6136  C  CD1   . LEU C 3  90  ? 106.752 99.226  111.335 1.00 38.58  ? 90   LEU B CD1   1 
ATOM   6137  C  CD2   . LEU C 3  90  ? 104.415 99.498  110.815 1.00 31.39  ? 90   LEU B CD2   1 
ATOM   6138  N  N     . LYS C 3  91  ? 104.285 94.346  111.205 1.00 32.08  ? 91   LYS B N     1 
ATOM   6139  C  CA    . LYS C 3  91  ? 104.033 93.047  110.598 1.00 30.92  ? 91   LYS B CA    1 
ATOM   6140  C  C     . LYS C 3  91  ? 102.558 92.728  110.579 1.00 34.69  ? 91   LYS B C     1 
ATOM   6141  O  O     . LYS C 3  91  ? 102.093 91.953  109.743 1.00 38.31  ? 91   LYS B O     1 
ATOM   6142  C  CB    . LYS C 3  91  ? 104.780 91.968  111.364 1.00 20.10  ? 91   LYS B CB    1 
ATOM   6143  C  CG    . LYS C 3  91  ? 104.546 90.561  110.882 1.00 37.62  ? 91   LYS B CG    1 
ATOM   6144  C  CD    . LYS C 3  91  ? 105.340 89.592  111.733 1.00 63.27  ? 91   LYS B CD    1 
ATOM   6145  C  CE    . LYS C 3  91  ? 105.068 88.156  111.374 1.00 81.45  ? 91   LYS B CE    1 
ATOM   6146  N  NZ    . LYS C 3  91  ? 105.835 87.243  112.255 1.00 88.00  ? 91   LYS B NZ    1 
ATOM   6147  N  N     . ARG C 3  92  ? 101.810 93.312  111.497 1.00 48.61  ? 92   ARG B N     1 
ATOM   6148  C  CA    . ARG C 3  92  ? 100.381 93.077  111.553 1.00 43.69  ? 92   ARG B CA    1 
ATOM   6149  C  C     . ARG C 3  92  ? 99.616  93.959  110.585 1.00 50.76  ? 92   ARG B C     1 
ATOM   6150  O  O     . ARG C 3  92  ? 98.655  93.503  109.965 1.00 52.53  ? 92   ARG B O     1 
ATOM   6151  C  CB    . ARG C 3  92  ? 99.889  93.282  112.970 1.00 40.91  ? 92   ARG B CB    1 
ATOM   6152  C  CG    . ARG C 3  92  ? 98.446  93.094  113.112 1.00 52.61  ? 92   ARG B CG    1 
ATOM   6153  C  CD    . ARG C 3  92  ? 98.119  93.211  114.535 1.00 56.50  ? 92   ARG B CD    1 
ATOM   6154  N  NE    . ARG C 3  92  ? 96.687  93.191  114.710 1.00 67.28  ? 92   ARG B NE    1 
ATOM   6155  C  CZ    . ARG C 3  92  ? 95.929  94.272  114.599 1.00 82.05  ? 92   ARG B CZ    1 
ATOM   6156  N  NH1   . ARG C 3  92  ? 96.477  95.445  114.315 1.00 82.11  ? 92   ARG B NH1   1 
ATOM   6157  N  NH2   . ARG C 3  92  ? 94.623  94.179  114.772 1.00 83.28  ? 92   ARG B NH2   1 
ATOM   6158  N  N     . GLN C 3  93  ? 100.014 95.212  110.423 1.00 32.65  ? 93   GLN B N     1 
ATOM   6159  C  CA    . GLN C 3  93  ? 99.257  96.024  109.482 1.00 27.76  ? 93   GLN B CA    1 
ATOM   6160  C  C     . GLN C 3  93  ? 99.641  95.773  108.039 1.00 32.34  ? 93   GLN B C     1 
ATOM   6161  O  O     . GLN C 3  93  ? 99.136  96.472  107.163 1.00 25.97  ? 93   GLN B O     1 
ATOM   6162  C  CB    . GLN C 3  93  ? 99.426  97.501  109.760 1.00 44.37  ? 93   GLN B CB    1 
ATOM   6163  C  CG    . GLN C 3  93  ? 98.906  97.933  111.065 1.00 60.27  ? 93   GLN B CG    1 
ATOM   6164  C  CD    . GLN C 3  93  ? 99.034  99.407  111.211 1.00 70.57  ? 93   GLN B CD    1 
ATOM   6165  O  OE1   . GLN C 3  93  ? 99.777  100.042 110.471 1.00 77.50  ? 93   GLN B OE1   1 
ATOM   6166  N  NE2   . GLN C 3  93  ? 98.333  99.971  112.175 1.00 63.76  ? 93   GLN B NE2   1 
ATOM   6167  N  N     . GLY C 3  94  ? 100.552 94.847  107.772 1.00 39.95  ? 94   GLY B N     1 
ATOM   6168  C  CA    . GLY C 3  94  ? 100.904 94.492  106.415 1.00 42.24  ? 94   GLY B CA    1 
ATOM   6169  C  C     . GLY C 3  94  ? 102.077 95.244  105.845 1.00 35.83  ? 94   GLY B C     1 
ATOM   6170  O  O     . GLY C 3  94  ? 102.379 95.081  104.663 1.00 46.65  ? 94   GLY B O     1 
ATOM   6171  N  N     . ARG C 3  95  ? 102.742 96.063  106.643 1.00 23.69  ? 95   ARG B N     1 
ATOM   6172  C  CA    . ARG C 3  95  ? 103.818 96.931  106.202 1.00 25.88  ? 95   ARG B CA    1 
ATOM   6173  C  C     . ARG C 3  95  ? 105.196 96.341  106.417 1.00 42.63  ? 95   ARG B C     1 
ATOM   6174  O  O     . ARG C 3  95  ? 106.157 97.103  106.525 1.00 36.81  ? 95   ARG B O     1 
ATOM   6175  C  CB    . ARG C 3  95  ? 103.707 98.292  106.858 1.00 32.17  ? 95   ARG B CB    1 
ATOM   6176  C  CG    . ARG C 3  95  ? 102.455 98.936  106.420 1.00 40.51  ? 95   ARG B CG    1 
ATOM   6177  C  CD    . ARG C 3  95  ? 102.354 100.375 106.785 1.00 48.61  ? 95   ARG B CD    1 
ATOM   6178  N  NE    . ARG C 3  95  ? 101.053 100.851 106.351 1.00 56.25  ? 95   ARG B NE    1 
ATOM   6179  C  CZ    . ARG C 3  95  ? 100.759 101.144 105.092 1.00 69.89  ? 95   ARG B CZ    1 
ATOM   6180  N  NH1   . ARG C 3  95  ? 101.673 101.012 104.143 1.00 77.54  ? 95   ARG B NH1   1 
ATOM   6181  N  NH2   . ARG C 3  95  ? 99.545  101.558 104.781 1.00 69.83  ? 95   ARG B NH2   1 
ATOM   6182  N  N     . THR C 3  96  ? 105.311 95.018  106.505 1.00 20.21  ? 96   THR B N     1 
ATOM   6183  C  CA    . THR C 3  96  ? 106.368 94.332  107.236 1.00 23.22  ? 96   THR B CA    1 
ATOM   6184  C  C     . THR C 3  96  ? 107.710 95.015  107.086 1.00 23.86  ? 96   THR B C     1 
ATOM   6185  O  O     . THR C 3  96  ? 108.117 95.374  105.986 1.00 33.83  ? 96   THR B O     1 
ATOM   6186  C  CB    . THR C 3  96  ? 106.508 92.917  106.692 1.00 37.87  ? 96   THR B CB    1 
ATOM   6187  O  OG1   . THR C 3  96  ? 105.243 92.258  106.701 1.00 43.99  ? 96   THR B OG1   1 
ATOM   6188  C  CG2   . THR C 3  96  ? 107.475 92.141  107.534 1.00 34.86  ? 96   THR B CG2   1 
ATOM   6189  N  N     . LEU C 3  97  ? 108.392 95.189  108.204 1.00 23.02  ? 97   LEU B N     1 
ATOM   6190  C  CA    . LEU C 3  97  ? 109.704 95.807  108.252 1.00 20.07  ? 97   LEU B CA    1 
ATOM   6191  C  C     . LEU C 3  97  ? 110.767 94.743  108.453 1.00 31.52  ? 97   LEU B C     1 
ATOM   6192  O  O     . LEU C 3  97  ? 110.529 93.740  109.125 1.00 29.43  ? 97   LEU B O     1 
ATOM   6193  C  CB    . LEU C 3  97  ? 109.763 96.819  109.384 1.00 23.30  ? 97   LEU B CB    1 
ATOM   6194  C  CG    . LEU C 3  97  ? 111.123 97.361  109.744 1.00 30.29  ? 97   LEU B CG    1 
ATOM   6195  C  CD1   . LEU C 3  97  ? 111.671 98.048  108.577 1.00 39.34  ? 97   LEU B CD1   1 
ATOM   6196  C  CD2   . LEU C 3  97  ? 110.969 98.337  110.842 1.00 26.77  ? 97   LEU B CD2   1 
ATOM   6197  N  N     . TYR C 3  98  ? 111.934 94.956  107.867 1.00 19.90  ? 98   TYR B N     1 
ATOM   6198  C  CA    . TYR C 3  98  ? 113.057 94.062  108.053 1.00 26.40  ? 98   TYR B CA    1 
ATOM   6199  C  C     . TYR C 3  98  ? 114.195 94.761  108.761 1.00 24.72  ? 98   TYR B C     1 
ATOM   6200  O  O     . TYR C 3  98  ? 114.274 95.985  108.807 1.00 18.19  ? 98   TYR B O     1 
ATOM   6201  C  CB    . TYR C 3  98  ? 113.598 93.526  106.740 1.00 24.31  ? 98   TYR B CB    1 
ATOM   6202  C  CG    . TYR C 3  98  ? 112.791 92.450  106.126 1.00 18.06  ? 98   TYR B CG    1 
ATOM   6203  C  CD1   . TYR C 3  98  ? 112.095 91.579  106.903 1.00 16.56  ? 98   TYR B CD1   1 
ATOM   6204  C  CD2   . TYR C 3  98  ? 112.811 92.238  104.779 1.00 14.20  ? 98   TYR B CD2   1 
ATOM   6205  C  CE1   . TYR C 3  98  ? 111.378 90.568  106.348 1.00 20.84  ? 98   TYR B CE1   1 
ATOM   6206  C  CE2   . TYR C 3  98  ? 112.099 91.232  104.219 1.00 10.77  ? 98   TYR B CE2   1 
ATOM   6207  C  CZ    . TYR C 3  98  ? 111.383 90.402  105.004 1.00 17.80  ? 98   TYR B CZ    1 
ATOM   6208  O  OH    . TYR C 3  98  ? 110.666 89.386  104.444 1.00 19.09  ? 98   TYR B OH    1 
ATOM   6209  N  N     . GLY C 3  99  ? 115.079 93.955  109.316 1.00 36.66  ? 99   GLY B N     1 
ATOM   6210  C  CA    . GLY C 3  99  ? 116.368 94.406  109.770 1.00 46.38  ? 99   GLY B CA    1 
ATOM   6211  C  C     . GLY C 3  99  ? 116.522 94.499  111.265 1.00 51.37  ? 99   GLY B C     1 
ATOM   6212  O  O     . GLY C 3  99  ? 117.657 94.545  111.747 1.00 53.11  ? 99   GLY B O     1 
ATOM   6213  N  N     . PHE C 3  100 ? 115.437 94.549  112.017 1.00 55.06  ? 100  PHE B N     1 
ATOM   6214  C  CA    . PHE C 3  100 ? 115.565 94.725  113.452 1.00 35.37  ? 100  PHE B CA    1 
ATOM   6215  C  C     . PHE C 3  100 ? 115.409 93.440  114.246 1.00 34.07  ? 100  PHE B C     1 
ATOM   6216  O  O     . PHE C 3  100 ? 115.602 93.456  115.462 1.00 44.42  ? 100  PHE B O     1 
ATOM   6217  C  CB    . PHE C 3  100 ? 114.587 95.788  113.910 1.00 34.47  ? 100  PHE B CB    1 
ATOM   6218  C  CG    . PHE C 3  100 ? 114.871 97.109  113.301 1.00 36.13  ? 100  PHE B CG    1 
ATOM   6219  C  CD1   . PHE C 3  100 ? 116.106 97.355  112.743 1.00 32.64  ? 100  PHE B CD1   1 
ATOM   6220  C  CD2   . PHE C 3  100 ? 113.930 98.096  113.265 1.00 33.12  ? 100  PHE B CD2   1 
ATOM   6221  C  CE1   . PHE C 3  100 ? 116.394 98.555  112.167 1.00 42.21  ? 100  PHE B CE1   1 
ATOM   6222  C  CE2   . PHE C 3  100 ? 114.222 99.301  112.687 1.00 30.31  ? 100  PHE B CE2   1 
ATOM   6223  C  CZ    . PHE C 3  100 ? 115.454 99.532  112.141 1.00 38.50  ? 100  PHE B CZ    1 
ATOM   6224  N  N     . GLY C 3  101 ? 115.110 92.327  113.595 1.00 51.40  ? 101  GLY B N     1 
ATOM   6225  C  CA    . GLY C 3  101 ? 115.099 91.050  114.277 1.00 38.26  ? 101  GLY B CA    1 
ATOM   6226  C  C     . GLY C 3  101 ? 113.753 90.365  114.297 1.00 38.58  ? 101  GLY B C     1 
ATOM   6227  O  O     . GLY C 3  101 ? 112.980 90.494  113.355 1.00 40.85  ? 101  GLY B O     1 
ATOM   6228  N  N     . ALA D 4  12  ? 74.923  63.041  140.354 1.00 122.46 ? 12   ALA C N     1 
ATOM   6229  C  CA    . ALA D 4  12  ? 75.803  63.724  139.415 1.00 130.77 ? 12   ALA C CA    1 
ATOM   6230  C  C     . ALA D 4  12  ? 75.004  64.377  138.294 1.00 143.55 ? 12   ALA C C     1 
ATOM   6231  O  O     . ALA D 4  12  ? 74.992  63.882  137.169 1.00 142.84 ? 12   ALA C O     1 
ATOM   6232  C  CB    . ALA D 4  12  ? 76.824  62.752  138.841 1.00 107.73 ? 12   ALA C CB    1 
ATOM   6233  N  N     . LYS D 4  13  ? 74.339  65.487  138.603 1.00 142.23 ? 13   LYS C N     1 
ATOM   6234  C  CA    . LYS D 4  13  ? 73.540  66.194  137.613 1.00 131.77 ? 13   LYS C CA    1 
ATOM   6235  C  C     . LYS D 4  13  ? 74.430  67.021  136.691 1.00 135.84 ? 13   LYS C C     1 
ATOM   6236  O  O     . LYS D 4  13  ? 75.468  67.546  137.101 1.00 137.24 ? 13   LYS C O     1 
ATOM   6237  C  CB    . LYS D 4  13  ? 72.517  67.104  138.291 1.00 127.50 ? 13   LYS C CB    1 
ATOM   6238  N  N     . ALA D 4  14  ? 74.008  67.138  135.436 1.00 136.28 ? 14   ALA C N     1 
ATOM   6239  C  CA    . ALA D 4  14  ? 74.769  67.844  134.418 1.00 121.70 ? 14   ALA C CA    1 
ATOM   6240  C  C     . ALA D 4  14  ? 74.187  69.228  134.176 1.00 120.69 ? 14   ALA C C     1 
ATOM   6241  O  O     . ALA D 4  14  ? 72.968  69.412  134.190 1.00 118.41 ? 14   ALA C O     1 
ATOM   6242  C  CB    . ALA D 4  14  ? 74.782  67.058  133.108 1.00 134.04 ? 14   ALA C CB    1 
ATOM   6243  N  N     . LYS D 4  15  ? 75.068  70.198  133.960 1.00 108.55 ? 15   LYS C N     1 
ATOM   6244  C  CA    . LYS D 4  15  ? 74.666  71.534  133.554 1.00 105.07 ? 15   LYS C CA    1 
ATOM   6245  C  C     . LYS D 4  15  ? 75.685  72.053  132.554 1.00 103.99 ? 15   LYS C C     1 
ATOM   6246  O  O     . LYS D 4  15  ? 76.891  71.906  132.760 1.00 102.87 ? 15   LYS C O     1 
ATOM   6247  C  CB    . LYS D 4  15  ? 74.554  72.481  134.750 1.00 100.29 ? 15   LYS C CB    1 
ATOM   6248  C  CG    . LYS D 4  15  ? 73.983  73.826  134.369 1.00 105.61 ? 15   LYS C CG    1 
ATOM   6249  C  CD    . LYS D 4  15  ? 74.033  74.846  135.494 1.00 116.36 ? 15   LYS C CD    1 
ATOM   6250  C  CE    . LYS D 4  15  ? 73.055  74.541  136.603 1.00 118.93 ? 15   LYS C CE    1 
ATOM   6251  N  NZ    . LYS D 4  15  ? 73.128  75.599  137.646 1.00 119.16 ? 15   LYS C NZ    1 
ATOM   6252  N  N     . THR D 4  16  ? 75.200  72.657  131.475 1.00 100.49 ? 16   THR C N     1 
ATOM   6253  C  CA    . THR D 4  16  ? 76.057  73.007  130.353 1.00 88.86  ? 16   THR C CA    1 
ATOM   6254  C  C     . THR D 4  16  ? 76.883  74.250  130.646 1.00 90.93  ? 16   THR C C     1 
ATOM   6255  O  O     . THR D 4  16  ? 76.432  75.175  131.324 1.00 92.85  ? 16   THR C O     1 
ATOM   6256  C  CB    . THR D 4  16  ? 75.223  73.251  129.105 1.00 89.17  ? 16   THR C CB    1 
ATOM   6257  O  OG1   . THR D 4  16  ? 74.312  74.323  129.359 1.00 82.87  ? 16   THR C OG1   1 
ATOM   6258  C  CG2   . THR D 4  16  ? 74.441  72.013  128.751 1.00 82.40  ? 16   THR C CG2   1 
ATOM   6259  N  N     . ARG D 4  17  ? 78.102  74.276  130.102 1.00 82.41  ? 17   ARG C N     1 
ATOM   6260  C  CA    . ARG D 4  17  ? 78.965  75.423  130.340 1.00 69.39  ? 17   ARG C CA    1 
ATOM   6261  C  C     . ARG D 4  17  ? 78.404  76.686  129.720 1.00 69.35  ? 17   ARG C C     1 
ATOM   6262  O  O     . ARG D 4  17  ? 78.668  77.785  130.213 1.00 71.69  ? 17   ARG C O     1 
ATOM   6263  C  CB    . ARG D 4  17  ? 80.376  75.163  129.829 1.00 96.88  ? 17   ARG C CB    1 
ATOM   6264  C  CG    . ARG D 4  17  ? 81.148  74.221  130.712 1.00 100.20 ? 17   ARG C CG    1 
ATOM   6265  C  CD    . ARG D 4  17  ? 82.598  74.059  130.287 1.00 101.57 ? 17   ARG C CD    1 
ATOM   6266  N  NE    . ARG D 4  17  ? 82.785  73.362  129.026 1.00 98.23  ? 17   ARG C NE    1 
ATOM   6267  C  CZ    . ARG D 4  17  ? 83.979  73.120  128.502 1.00 106.05 ? 17   ARG C CZ    1 
ATOM   6268  N  NH1   . ARG D 4  17  ? 85.067  73.527  129.132 1.00 100.06 ? 17   ARG C NH1   1 
ATOM   6269  N  NH2   . ARG D 4  17  ? 84.089  72.474  127.354 1.00 122.31 ? 17   ARG C NH2   1 
ATOM   6270  N  N     . SER D 4  18  ? 77.625  76.564  128.653 1.00 68.06  ? 18   SER C N     1 
ATOM   6271  C  CA    . SER D 4  18  ? 76.925  77.735  128.148 1.00 68.91  ? 18   SER C CA    1 
ATOM   6272  C  C     . SER D 4  18  ? 75.993  78.296  129.210 1.00 74.26  ? 18   SER C C     1 
ATOM   6273  O  O     . SER D 4  18  ? 75.991  79.501  129.483 1.00 69.46  ? 18   SER C O     1 
ATOM   6274  C  CB    . SER D 4  18  ? 76.152  77.375  126.886 1.00 78.10  ? 18   SER C CB    1 
ATOM   6275  O  OG    . SER D 4  18  ? 77.038  76.986  125.857 1.00 84.13  ? 18   SER C OG    1 
ATOM   6276  N  N     . SER D 4  19  ? 75.205  77.424  129.834 1.00 76.67  ? 19   SER C N     1 
ATOM   6277  C  CA    . SER D 4  19  ? 74.268  77.859  130.861 1.00 82.35  ? 19   SER C CA    1 
ATOM   6278  C  C     . SER D 4  19  ? 74.994  78.536  132.011 1.00 77.48  ? 19   SER C C     1 
ATOM   6279  O  O     . SER D 4  19  ? 74.672  79.668  132.383 1.00 71.12  ? 19   SER C O     1 
ATOM   6280  C  CB    . SER D 4  19  ? 73.463  76.665  131.356 1.00 55.77  ? 19   SER C CB    1 
ATOM   6281  O  OG    . SER D 4  19  ? 74.331  75.684  131.886 1.00 58.42  ? 19   SER C OG    1 
ATOM   6282  N  N     . ARG D 4  20  ? 75.978  77.850  132.596 1.00 66.67  ? 20   ARG C N     1 
ATOM   6283  C  CA    . ARG D 4  20  ? 76.804  78.479  133.618 1.00 63.13  ? 20   ARG C CA    1 
ATOM   6284  C  C     . ARG D 4  20  ? 77.314  79.829  133.151 1.00 74.39  ? 20   ARG C C     1 
ATOM   6285  O  O     . ARG D 4  20  ? 77.367  80.786  133.927 1.00 86.89  ? 20   ARG C O     1 
ATOM   6286  C  CB    . ARG D 4  20  ? 77.986  77.588  133.977 1.00 81.75  ? 20   ARG C CB    1 
ATOM   6287  C  CG    . ARG D 4  20  ? 77.656  76.336  134.723 1.00 87.75  ? 20   ARG C CG    1 
ATOM   6288  C  CD    . ARG D 4  20  ? 78.938  75.588  135.018 1.00 94.64  ? 20   ARG C CD    1 
ATOM   6289  N  NE    . ARG D 4  20  ? 78.706  74.361  135.767 1.00 110.10 ? 20   ARG C NE    1 
ATOM   6290  C  CZ    . ARG D 4  20  ? 78.622  74.305  137.090 1.00 119.71 ? 20   ARG C CZ    1 
ATOM   6291  N  NH1   . ARG D 4  20  ? 78.762  75.408  137.809 1.00 119.98 ? 20   ARG C NH1   1 
ATOM   6292  N  NH2   . ARG D 4  20  ? 78.407  73.147  137.695 1.00 123.30 ? 20   ARG C NH2   1 
ATOM   6293  N  N     . ALA D 4  21  ? 77.692  79.928  131.884 1.00 70.45  ? 21   ALA C N     1 
ATOM   6294  C  CA    . ALA D 4  21  ? 78.216  81.190  131.391 1.00 68.49  ? 21   ALA C CA    1 
ATOM   6295  C  C     . ALA D 4  21  ? 77.116  82.229  131.266 1.00 68.48  ? 21   ALA C C     1 
ATOM   6296  O  O     . ALA D 4  21  ? 77.318  83.399  131.603 1.00 71.15  ? 21   ALA C O     1 
ATOM   6297  C  CB    . ALA D 4  21  ? 78.905  80.978  130.049 1.00 66.97  ? 21   ALA C CB    1 
ATOM   6298  N  N     . GLY D 4  22  ? 75.939  81.821  130.817 1.00 79.43  ? 22   GLY C N     1 
ATOM   6299  C  CA    . GLY D 4  22  ? 74.939  82.782  130.416 1.00 77.58  ? 22   GLY C CA    1 
ATOM   6300  C  C     . GLY D 4  22  ? 75.085  83.231  128.987 1.00 77.03  ? 22   GLY C C     1 
ATOM   6301  O  O     . GLY D 4  22  ? 74.736  84.370  128.666 1.00 80.49  ? 22   GLY C O     1 
ATOM   6302  N  N     . LEU D 4  23  ? 75.604  82.373  128.121 1.00 81.73  ? 23   LEU C N     1 
ATOM   6303  C  CA    . LEU D 4  23  ? 75.850  82.698  126.731 1.00 80.79  ? 23   LEU C CA    1 
ATOM   6304  C  C     . LEU D 4  23  ? 75.118  81.722  125.829 1.00 78.01  ? 23   LEU C C     1 
ATOM   6305  O  O     . LEU D 4  23  ? 74.773  80.610  126.230 1.00 69.40  ? 23   LEU C O     1 
ATOM   6306  C  CB    . LEU D 4  23  ? 77.331  82.637  126.416 1.00 58.74  ? 23   LEU C CB    1 
ATOM   6307  C  CG    . LEU D 4  23  ? 78.120  83.533  127.339 1.00 48.03  ? 23   LEU C CG    1 
ATOM   6308  C  CD1   . LEU D 4  23  ? 79.575  83.447  126.966 1.00 36.41  ? 23   LEU C CD1   1 
ATOM   6309  C  CD2   . LEU D 4  23  ? 77.587  84.939  127.256 1.00 35.40  ? 23   LEU C CD2   1 
ATOM   6310  N  N     . GLN D 4  24  ? 74.894  82.142  124.596 1.00 81.96  ? 24   GLN C N     1 
ATOM   6311  C  CA    . GLN D 4  24  ? 74.225  81.297  123.630 1.00 76.71  ? 24   GLN C CA    1 
ATOM   6312  C  C     . GLN D 4  24  ? 75.184  80.594  122.682 1.00 73.16  ? 24   GLN C C     1 
ATOM   6313  O  O     . GLN D 4  24  ? 74.733  79.824  121.837 1.00 84.66  ? 24   GLN C O     1 
ATOM   6314  C  CB    . GLN D 4  24  ? 73.229  82.136  122.849 1.00 97.57  ? 24   GLN C CB    1 
ATOM   6315  C  CG    . GLN D 4  24  ? 72.354  82.944  123.769 1.00 105.45 ? 24   GLN C CG    1 
ATOM   6316  C  CD    . GLN D 4  24  ? 71.680  82.100  124.816 1.00 111.39 ? 24   GLN C CD    1 
ATOM   6317  O  OE1   . GLN D 4  24  ? 71.210  81.002  124.536 1.00 110.08 ? 24   GLN C OE1   1 
ATOM   6318  N  NE2   . GLN D 4  24  ? 71.641  82.602  126.040 1.00 120.67 ? 24   GLN C NE2   1 
ATOM   6319  N  N     . PHE D 4  25  ? 76.438  80.851  122.768 1.00 44.68  ? 25   PHE C N     1 
ATOM   6320  C  CA    . PHE D 4  25  ? 77.235  80.011  121.888 1.00 52.65  ? 25   PHE C CA    1 
ATOM   6321  C  C     . PHE D 4  25  ? 77.746  78.764  122.589 1.00 59.71  ? 25   PHE C C     1 
ATOM   6322  O  O     . PHE D 4  25  ? 77.982  78.777  123.794 1.00 66.47  ? 25   PHE C O     1 
ATOM   6323  C  CB    . PHE D 4  25  ? 78.411  80.773  121.304 1.00 81.73  ? 25   PHE C CB    1 
ATOM   6324  C  CG    . PHE D 4  25  ? 78.039  81.593  120.138 1.00 30.82  ? 25   PHE C CG    1 
ATOM   6325  C  CD1   . PHE D 4  25  ? 77.872  80.991  118.926 1.00 29.93  ? 25   PHE C CD1   1 
ATOM   6326  C  CD2   . PHE D 4  25  ? 77.870  82.941  120.229 1.00 30.41  ? 25   PHE C CD2   1 
ATOM   6327  C  CE1   . PHE D 4  25  ? 77.532  81.705  117.837 1.00 28.94  ? 25   PHE C CE1   1 
ATOM   6328  C  CE2   . PHE D 4  25  ? 77.528  83.656  119.128 1.00 32.92  ? 25   PHE C CE2   1 
ATOM   6329  C  CZ    . PHE D 4  25  ? 77.365  83.033  117.938 1.00 32.20  ? 25   PHE C CZ    1 
ATOM   6330  N  N     . PRO D 4  26  ? 77.949  77.691  121.866 1.00 43.43  ? 26   PRO C N     1 
ATOM   6331  C  CA    . PRO D 4  26  ? 78.258  76.410  122.509 1.00 44.63  ? 26   PRO C CA    1 
ATOM   6332  C  C     . PRO D 4  26  ? 79.680  76.313  123.014 1.00 44.97  ? 26   PRO C C     1 
ATOM   6333  O  O     . PRO D 4  26  ? 80.540  75.758  122.329 1.00 53.27  ? 26   PRO C O     1 
ATOM   6334  C  CB    . PRO D 4  26  ? 78.021  75.412  121.382 1.00 57.58  ? 26   PRO C CB    1 
ATOM   6335  C  CG    . PRO D 4  26  ? 78.390  76.199  120.172 1.00 54.83  ? 26   PRO C CG    1 
ATOM   6336  C  CD    . PRO D 4  26  ? 77.847  77.556  120.408 1.00 57.74  ? 26   PRO C CD    1 
ATOM   6337  N  N     . VAL D 4  27  ? 79.931  76.820  124.217 1.00 41.67  ? 27   VAL C N     1 
ATOM   6338  C  CA    . VAL D 4  27  ? 81.294  76.921  124.719 1.00 39.63  ? 27   VAL C CA    1 
ATOM   6339  C  C     . VAL D 4  27  ? 82.046  75.627  124.506 1.00 39.20  ? 27   VAL C C     1 
ATOM   6340  O  O     . VAL D 4  27  ? 83.205  75.627  124.085 1.00 44.03  ? 27   VAL C O     1 
ATOM   6341  C  CB    . VAL D 4  27  ? 81.281  77.318  126.198 1.00 18.45  ? 27   VAL C CB    1 
ATOM   6342  C  CG1   . VAL D 4  27  ? 82.676  77.307  126.744 1.00 62.03  ? 27   VAL C CG1   1 
ATOM   6343  C  CG2   . VAL D 4  27  ? 80.666  78.670  126.329 1.00 30.75  ? 27   VAL C CG2   1 
ATOM   6344  N  N     . GLY D 4  28  ? 81.391  74.503  124.748 1.00 40.80  ? 28   GLY C N     1 
ATOM   6345  C  CA    . GLY D 4  28  ? 82.046  73.233  124.508 1.00 43.74  ? 28   GLY C CA    1 
ATOM   6346  C  C     . GLY D 4  28  ? 82.612  73.138  123.110 1.00 50.45  ? 28   GLY C C     1 
ATOM   6347  O  O     . GLY D 4  28  ? 83.784  72.809  122.919 1.00 50.75  ? 28   GLY C O     1 
ATOM   6348  N  N     . ARG D 4  29  ? 81.794  73.464  122.114 1.00 49.68  ? 29   ARG C N     1 
ATOM   6349  C  CA    . ARG D 4  29  ? 82.244  73.346  120.738 1.00 43.19  ? 29   ARG C CA    1 
ATOM   6350  C  C     . ARG D 4  29  ? 83.439  74.238  120.471 1.00 44.15  ? 29   ARG C C     1 
ATOM   6351  O  O     . ARG D 4  29  ? 84.415  73.810  119.845 1.00 49.37  ? 29   ARG C O     1 
ATOM   6352  C  CB    . ARG D 4  29  ? 81.110  73.677  119.783 1.00 46.73  ? 29   ARG C CB    1 
ATOM   6353  C  CG    . ARG D 4  29  ? 81.537  73.599  118.354 1.00 53.65  ? 29   ARG C CG    1 
ATOM   6354  C  CD    . ARG D 4  29  ? 80.375  73.788  117.429 1.00 52.29  ? 29   ARG C CD    1 
ATOM   6355  N  NE    . ARG D 4  29  ? 79.442  72.689  117.600 1.00 53.63  ? 29   ARG C NE    1 
ATOM   6356  C  CZ    . ARG D 4  29  ? 78.297  72.570  116.949 1.00 53.03  ? 29   ARG C CZ    1 
ATOM   6357  N  NH1   . ARG D 4  29  ? 77.939  73.476  116.055 1.00 51.22  ? 29   ARG C NH1   1 
ATOM   6358  N  NH2   . ARG D 4  29  ? 77.519  71.531  117.187 1.00 44.10  ? 29   ARG C NH2   1 
ATOM   6359  N  N     . VAL D 4  30  ? 83.390  75.481  120.937 1.00 26.18  ? 30   VAL C N     1 
ATOM   6360  C  CA    . VAL D 4  30  ? 84.558  76.341  120.821 1.00 29.09  ? 30   VAL C CA    1 
ATOM   6361  C  C     . VAL D 4  30  ? 85.779  75.644  121.389 1.00 31.37  ? 30   VAL C C     1 
ATOM   6362  O  O     . VAL D 4  30  ? 86.785  75.462  120.701 1.00 36.33  ? 30   VAL C O     1 
ATOM   6363  C  CB    . VAL D 4  30  ? 84.313  77.683  121.513 1.00 27.81  ? 30   VAL C CB    1 
ATOM   6364  C  CG1   . VAL D 4  30  ? 85.604  78.373  121.704 1.00 17.63  ? 30   VAL C CG1   1 
ATOM   6365  C  CG2   . VAL D 4  30  ? 83.441  78.516  120.645 1.00 20.91  ? 30   VAL C CG2   1 
ATOM   6366  N  N     . HIS D 4  31  ? 85.692  75.196  122.636 1.00 33.57  ? 31   HIS C N     1 
ATOM   6367  C  CA    . HIS D 4  31  ? 86.848  74.560  123.250 1.00 36.46  ? 31   HIS C CA    1 
ATOM   6368  C  C     . HIS D 4  31  ? 87.386  73.443  122.378 1.00 43.40  ? 31   HIS C C     1 
ATOM   6369  O  O     . HIS D 4  31  ? 88.602  73.305  122.207 1.00 46.03  ? 31   HIS C O     1 
ATOM   6370  C  CB    . HIS D 4  31  ? 86.488  74.019  124.620 1.00 29.68  ? 31   HIS C CB    1 
ATOM   6371  C  CG    . HIS D 4  31  ? 87.638  73.396  125.333 1.00 46.31  ? 31   HIS C CG    1 
ATOM   6372  N  ND1   . HIS D 4  31  ? 88.739  74.116  125.732 1.00 45.66  ? 31   HIS C ND1   1 
ATOM   6373  C  CD2   . HIS D 4  31  ? 87.868  72.117  125.705 1.00 63.48  ? 31   HIS C CD2   1 
ATOM   6374  C  CE1   . HIS D 4  31  ? 89.595  73.308  126.330 1.00 57.69  ? 31   HIS C CE1   1 
ATOM   6375  N  NE2   . HIS D 4  31  ? 89.091  72.089  126.325 1.00 68.59  ? 31   HIS C NE2   1 
ATOM   6376  N  N     . ARG D 4  32  ? 86.497  72.651  121.788 1.00 33.80  ? 32   ARG C N     1 
ATOM   6377  C  CA    . ARG D 4  32  ? 86.964  71.613  120.881 1.00 37.78  ? 32   ARG C CA    1 
ATOM   6378  C  C     . ARG D 4  32  ? 87.751  72.212  119.732 1.00 44.96  ? 32   ARG C C     1 
ATOM   6379  O  O     . ARG D 4  32  ? 88.839  71.734  119.399 1.00 43.89  ? 32   ARG C O     1 
ATOM   6380  C  CB    . ARG D 4  32  ? 85.793  70.794  120.361 1.00 50.59  ? 32   ARG C CB    1 
ATOM   6381  C  CG    . ARG D 4  32  ? 86.186  69.728  119.378 1.00 52.60  ? 32   ARG C CG    1 
ATOM   6382  C  CD    . ARG D 4  32  ? 85.012  68.819  119.116 1.00 60.30  ? 32   ARG C CD    1 
ATOM   6383  N  NE    . ARG D 4  32  ? 83.900  69.515  118.491 1.00 58.85  ? 32   ARG C NE    1 
ATOM   6384  C  CZ    . ARG D 4  32  ? 83.738  69.632  117.182 1.00 58.60  ? 32   ARG C CZ    1 
ATOM   6385  N  NH1   . ARG D 4  32  ? 84.603  69.077  116.354 1.00 46.95  ? 32   ARG C NH1   1 
ATOM   6386  N  NH2   . ARG D 4  32  ? 82.696  70.286  116.701 1.00 56.81  ? 32   ARG C NH2   1 
ATOM   6387  N  N     . LEU D 4  33  ? 87.236  73.278  119.127 1.00 33.65  ? 33   LEU C N     1 
ATOM   6388  C  CA    . LEU D 4  33  ? 87.950  73.864  118.001 1.00 27.29  ? 33   LEU C CA    1 
ATOM   6389  C  C     . LEU D 4  33  ? 89.316  74.379  118.421 1.00 35.73  ? 33   LEU C C     1 
ATOM   6390  O  O     . LEU D 4  33  ? 90.320  74.096  117.763 1.00 45.90  ? 33   LEU C O     1 
ATOM   6391  C  CB    . LEU D 4  33  ? 87.132  74.971  117.365 1.00 33.16  ? 33   LEU C CB    1 
ATOM   6392  C  CG    . LEU D 4  33  ? 85.910  74.383  116.698 1.00 37.53  ? 33   LEU C CG    1 
ATOM   6393  C  CD1   . LEU D 4  33  ? 85.091  75.472  116.063 1.00 39.89  ? 33   LEU C CD1   1 
ATOM   6394  C  CD2   . LEU D 4  33  ? 86.360  73.378  115.682 1.00 19.51  ? 33   LEU C CD2   1 
ATOM   6395  N  N     . LEU D 4  34  ? 89.384  75.125  119.519 1.00 36.72  ? 34   LEU C N     1 
ATOM   6396  C  CA    . LEU D 4  34  ? 90.679  75.628  119.949 1.00 37.51  ? 34   LEU C CA    1 
ATOM   6397  C  C     . LEU D 4  34  ? 91.664  74.496  120.181 1.00 41.45  ? 34   LEU C C     1 
ATOM   6398  O  O     . LEU D 4  34  ? 92.841  74.619  119.839 1.00 36.81  ? 34   LEU C O     1 
ATOM   6399  C  CB    . LEU D 4  34  ? 90.546  76.474  121.204 1.00 34.05  ? 34   LEU C CB    1 
ATOM   6400  C  CG    . LEU D 4  34  ? 89.793  77.759  120.961 1.00 26.06  ? 34   LEU C CG    1 
ATOM   6401  C  CD1   . LEU D 4  34  ? 89.733  78.561  122.215 1.00 22.99  ? 34   LEU C CD1   1 
ATOM   6402  C  CD2   . LEU D 4  34  ? 90.494  78.508  119.901 1.00 17.63  ? 34   LEU C CD2   1 
ATOM   6403  N  N     . ARG D 4  35  ? 91.218  73.378  120.752 1.00 37.16  ? 35   ARG C N     1 
ATOM   6404  C  CA    . ARG D 4  35  ? 92.167  72.285  120.931 1.00 36.48  ? 35   ARG C CA    1 
ATOM   6405  C  C     . ARG D 4  35  ? 92.610  71.725  119.591 1.00 43.91  ? 35   ARG C C     1 
ATOM   6406  O  O     . ARG D 4  35  ? 93.801  71.706  119.275 1.00 52.84  ? 35   ARG C O     1 
ATOM   6407  C  CB    . ARG D 4  35  ? 91.586  71.172  121.798 1.00 40.89  ? 35   ARG C CB    1 
ATOM   6408  C  CG    . ARG D 4  35  ? 91.466  71.515  123.253 1.00 62.41  ? 35   ARG C CG    1 
ATOM   6409  C  CD    . ARG D 4  35  ? 90.977  70.326  124.036 1.00 76.39  ? 35   ARG C CD    1 
ATOM   6410  N  NE    . ARG D 4  35  ? 89.666  69.875  123.595 1.00 92.98  ? 35   ARG C NE    1 
ATOM   6411  C  CZ    . ARG D 4  35  ? 89.026  68.836  124.119 1.00 97.05  ? 35   ARG C CZ    1 
ATOM   6412  N  NH1   . ARG D 4  35  ? 89.585  68.148  125.101 1.00 97.15  ? 35   ARG C NH1   1 
ATOM   6413  N  NH2   . ARG D 4  35  ? 87.830  68.483  123.664 1.00 89.26  ? 35   ARG C NH2   1 
ATOM   6414  N  N     . LYS D 4  36  ? 91.667  71.292  118.775 1.00 31.40  ? 36   LYS C N     1 
ATOM   6415  C  CA    . LYS D 4  36  ? 92.008  70.456  117.639 1.00 33.38  ? 36   LYS C CA    1 
ATOM   6416  C  C     . LYS D 4  36  ? 92.328  71.253  116.393 1.00 35.32  ? 36   LYS C C     1 
ATOM   6417  O  O     . LYS D 4  36  ? 92.461  70.667  115.321 1.00 39.75  ? 36   LYS C O     1 
ATOM   6418  C  CB    . LYS D 4  36  ? 90.889  69.459  117.374 1.00 51.42  ? 36   LYS C CB    1 
ATOM   6419  N  N     . GLY D 4  37  ? 92.421  72.563  116.495 1.00 36.36  ? 37   GLY C N     1 
ATOM   6420  C  CA    . GLY D 4  37  ? 92.922  73.323  115.377 1.00 32.93  ? 37   GLY C CA    1 
ATOM   6421  C  C     . GLY D 4  37  ? 94.410  73.565  115.398 1.00 43.25  ? 37   GLY C C     1 
ATOM   6422  O  O     . GLY D 4  37  ? 94.949  74.145  114.453 1.00 49.42  ? 37   GLY C O     1 
ATOM   6423  N  N     . ASN D 4  38  ? 95.099  73.123  116.448 1.00 26.32  ? 38   ASN C N     1 
ATOM   6424  C  CA    . ASN D 4  38  ? 96.520  73.398  116.640 1.00 24.52  ? 38   ASN C CA    1 
ATOM   6425  C  C     . ASN D 4  38  ? 96.809  74.894  116.642 1.00 22.32  ? 38   ASN C C     1 
ATOM   6426  O  O     . ASN D 4  38  ? 97.598  75.409  115.855 1.00 30.30  ? 38   ASN C O     1 
ATOM   6427  C  CB    . ASN D 4  38  ? 97.373  72.672  115.609 1.00 76.32  ? 38   ASN C CB    1 
ATOM   6428  C  CG    . ASN D 4  38  ? 97.460  71.209  115.891 1.00 80.03  ? 38   ASN C CG    1 
ATOM   6429  O  OD1   . ASN D 4  38  ? 97.269  70.379  115.010 1.00 75.12  ? 38   ASN C OD1   1 
ATOM   6430  N  ND2   . ASN D 4  38  ? 97.749  70.874  117.141 1.00 73.33  ? 38   ASN C ND2   1 
ATOM   6431  N  N     . TYR D 4  39  ? 96.131  75.589  117.544 1.00 33.93  ? 39   TYR C N     1 
ATOM   6432  C  CA    . TYR D 4  39  ? 96.484  76.969  117.816 1.00 28.81  ? 39   TYR C CA    1 
ATOM   6433  C  C     . TYR D 4  39  ? 97.610  77.045  118.828 1.00 34.60  ? 39   TYR C C     1 
ATOM   6434  O  O     . TYR D 4  39  ? 98.670  77.601  118.544 1.00 35.79  ? 39   TYR C O     1 
ATOM   6435  C  CB    . TYR D 4  39  ? 95.253  77.737  118.254 1.00 25.48  ? 39   TYR C CB    1 
ATOM   6436  C  CG    . TYR D 4  39  ? 94.309  77.848  117.102 1.00 26.91  ? 39   TYR C CG    1 
ATOM   6437  C  CD1   . TYR D 4  39  ? 94.788  78.052  115.834 1.00 32.18  ? 39   TYR C CD1   1 
ATOM   6438  C  CD2   . TYR D 4  39  ? 92.957  77.727  117.267 1.00 28.02  ? 39   TYR C CD2   1 
ATOM   6439  C  CE1   . TYR D 4  39  ? 93.951  78.148  114.770 1.00 32.70  ? 39   TYR C CE1   1 
ATOM   6440  C  CE2   . TYR D 4  39  ? 92.112  77.818  116.204 1.00 33.18  ? 39   TYR C CE2   1 
ATOM   6441  C  CZ    . TYR D 4  39  ? 92.615  78.028  114.958 1.00 37.34  ? 39   TYR C CZ    1 
ATOM   6442  O  OH    . TYR D 4  39  ? 91.772  78.120  113.885 1.00 38.42  ? 39   TYR C OH    1 
ATOM   6443  N  N     . ALA D 4  40  ? 97.405  76.517  120.019 1.00 32.25  ? 40   ALA C N     1 
ATOM   6444  C  CA    . ALA D 4  40  ? 98.530  76.310  120.913 1.00 31.14  ? 40   ALA C CA    1 
ATOM   6445  C  C     . ALA D 4  40  ? 98.473  74.890  121.444 1.00 39.05  ? 40   ALA C C     1 
ATOM   6446  O  O     . ALA D 4  40  ? 97.541  74.139  121.159 1.00 42.16  ? 40   ALA C O     1 
ATOM   6447  C  CB    . ALA D 4  40  ? 98.538  77.325  122.056 1.00 31.58  ? 40   ALA C CB    1 
ATOM   6448  N  N     . GLU D 4  41  ? 99.473  74.512  122.232 1.00 36.74  ? 41   GLU C N     1 
ATOM   6449  C  CA    . GLU D 4  41  ? 99.464  73.157  122.756 1.00 33.18  ? 41   GLU C CA    1 
ATOM   6450  C  C     . GLU D 4  41  ? 98.398  72.986  123.819 1.00 40.80  ? 41   GLU C C     1 
ATOM   6451  O  O     . GLU D 4  41  ? 97.726  71.953  123.868 1.00 51.56  ? 41   GLU C O     1 
ATOM   6452  C  CB    . GLU D 4  41  ? 100.823 72.783  123.326 1.00 47.49  ? 41   GLU C CB    1 
ATOM   6453  C  CG    . GLU D 4  41  ? 100.826 71.379  123.903 1.00 71.25  ? 41   GLU C CG    1 
ATOM   6454  C  CD    . GLU D 4  41  ? 102.165 70.961  124.471 1.00 83.31  ? 41   GLU C CD    1 
ATOM   6455  O  OE1   . GLU D 4  41  ? 103.116 71.764  124.412 1.00 78.24  ? 41   GLU C OE1   1 
ATOM   6456  O  OE2   . GLU D 4  41  ? 102.260 69.830  124.992 1.00 90.62  ? 41   GLU C OE2   1 
ATOM   6457  N  N     . ARG D 4  42  ? 98.219  73.983  124.675 1.00 37.12  ? 42   ARG C N     1 
ATOM   6458  C  CA    . ARG D 4  42  ? 97.391  73.840  125.862 1.00 40.54  ? 42   ARG C CA    1 
ATOM   6459  C  C     . ARG D 4  42  ? 96.434  75.010  125.961 1.00 37.18  ? 42   ARG C C     1 
ATOM   6460  O  O     . ARG D 4  42  ? 96.869  76.148  126.132 1.00 36.46  ? 42   ARG C O     1 
ATOM   6461  C  CB    . ARG D 4  42  ? 98.264  73.768  127.103 1.00 52.58  ? 42   ARG C CB    1 
ATOM   6462  C  CG    . ARG D 4  42  ? 99.130  72.556  127.123 1.00 58.30  ? 42   ARG C CG    1 
ATOM   6463  C  CD    . ARG D 4  42  ? 100.010 72.597  128.317 1.00 68.08  ? 42   ARG C CD    1 
ATOM   6464  N  NE    . ARG D 4  42  ? 99.192  72.748  129.503 1.00 75.01  ? 42   ARG C NE    1 
ATOM   6465  C  CZ    . ARG D 4  42  ? 99.681  72.876  130.723 1.00 78.67  ? 42   ARG C CZ    1 
ATOM   6466  N  NH1   . ARG D 4  42  ? 100.986 72.848  130.913 1.00 76.54  ? 42   ARG C NH1   1 
ATOM   6467  N  NH2   . ARG D 4  42  ? 98.867  73.023  131.752 1.00 78.42  ? 42   ARG C NH2   1 
ATOM   6468  N  N     . VAL D 4  43  ? 95.147  74.735  125.886 1.00 35.51  ? 43   VAL C N     1 
ATOM   6469  C  CA    . VAL D 4  43  ? 94.141  75.783  125.869 1.00 23.71  ? 43   VAL C CA    1 
ATOM   6470  C  C     . VAL D 4  43  ? 93.666  76.040  127.283 1.00 29.59  ? 43   VAL C C     1 
ATOM   6471  O  O     . VAL D 4  43  ? 93.268  75.111  127.986 1.00 31.18  ? 43   VAL C O     1 
ATOM   6472  C  CB    . VAL D 4  43  ? 92.965  75.393  124.976 1.00 37.39  ? 43   VAL C CB    1 
ATOM   6473  C  CG1   . VAL D 4  43  ? 91.927  76.454  125.044 1.00 36.12  ? 43   VAL C CG1   1 
ATOM   6474  C  CG2   . VAL D 4  43  ? 93.435  75.186  123.573 1.00 33.92  ? 43   VAL C CG2   1 
ATOM   6475  N  N     . GLY D 4  44  ? 93.685  77.295  127.694 1.00 23.74  ? 44   GLY C N     1 
ATOM   6476  C  CA    . GLY D 4  44  ? 93.222  77.645  129.020 1.00 25.11  ? 44   GLY C CA    1 
ATOM   6477  C  C     . GLY D 4  44  ? 91.766  77.294  129.208 1.00 25.27  ? 44   GLY C C     1 
ATOM   6478  O  O     . GLY D 4  44  ? 91.031  77.011  128.269 1.00 31.32  ? 44   GLY C O     1 
ATOM   6479  N  N     . ALA D 4  45  ? 91.344  77.290  130.467 1.00 32.06  ? 45   ALA C N     1 
ATOM   6480  C  CA    . ALA D 4  45  ? 89.967  76.934  130.765 1.00 33.08  ? 45   ALA C CA    1 
ATOM   6481  C  C     . ALA D 4  45  ? 89.005  78.095  130.614 1.00 34.25  ? 45   ALA C C     1 
ATOM   6482  O  O     . ALA D 4  45  ? 87.802  77.865  130.492 1.00 40.97  ? 45   ALA C O     1 
ATOM   6483  C  CB    . ALA D 4  45  ? 89.856  76.375  132.177 1.00 41.98  ? 45   ALA C CB    1 
ATOM   6484  N  N     . GLY D 4  46  ? 89.491  79.326  130.643 1.00 34.86  ? 46   GLY C N     1 
ATOM   6485  C  CA    . GLY D 4  46  ? 88.597  80.453  130.509 1.00 30.83  ? 46   GLY C CA    1 
ATOM   6486  C  C     . GLY D 4  46  ? 88.432  80.881  129.069 1.00 32.64  ? 46   GLY C C     1 
ATOM   6487  O  O     . GLY D 4  46  ? 87.415  81.476  128.689 1.00 46.99  ? 46   GLY C O     1 
ATOM   6488  N  N     . ALA D 4  47  ? 89.430  80.562  128.255 1.00 36.06  ? 47   ALA C N     1 
ATOM   6489  C  CA    . ALA D 4  47  ? 89.440  81.021  126.871 1.00 28.68  ? 47   ALA C CA    1 
ATOM   6490  C  C     . ALA D 4  47  ? 88.178  80.670  126.114 1.00 39.74  ? 47   ALA C C     1 
ATOM   6491  O  O     . ALA D 4  47  ? 87.602  81.567  125.481 1.00 46.01  ? 47   ALA C O     1 
ATOM   6492  C  CB    . ALA D 4  47  ? 90.663  80.465  126.140 1.00 26.15  ? 47   ALA C CB    1 
ATOM   6493  N  N     . PRO D 4  48  ? 87.690  79.438  126.123 1.00 30.05  ? 48   PRO C N     1 
ATOM   6494  C  CA    . PRO D 4  48  ? 86.460  79.173  125.383 1.00 26.03  ? 48   PRO C CA    1 
ATOM   6495  C  C     . PRO D 4  48  ? 85.347  80.096  125.812 1.00 33.41  ? 48   PRO C C     1 
ATOM   6496  O  O     . PRO D 4  48  ? 84.708  80.728  124.965 1.00 34.48  ? 48   PRO C O     1 
ATOM   6497  C  CB    . PRO D 4  48  ? 86.168  77.715  125.725 1.00 23.83  ? 48   PRO C CB    1 
ATOM   6498  C  CG    . PRO D 4  48  ? 87.454  77.153  126.061 1.00 27.68  ? 48   PRO C CG    1 
ATOM   6499  C  CD    . PRO D 4  48  ? 88.156  78.228  126.805 1.00 29.32  ? 48   PRO C CD    1 
ATOM   6500  N  N     . VAL D 4  49  ? 85.145  80.246  127.118 1.00 30.93  ? 49   VAL C N     1 
ATOM   6501  C  CA    . VAL D 4  49  ? 84.084  81.113  127.611 1.00 31.87  ? 49   VAL C CA    1 
ATOM   6502  C  C     . VAL D 4  49  ? 84.236  82.505  127.037 1.00 33.00  ? 49   VAL C C     1 
ATOM   6503  O  O     . VAL D 4  49  ? 83.331  83.036  126.385 1.00 41.49  ? 49   VAL C O     1 
ATOM   6504  C  CB    . VAL D 4  49  ? 84.096  81.160  129.139 1.00 27.83  ? 49   VAL C CB    1 
ATOM   6505  C  CG1   . VAL D 4  49  ? 83.145  82.213  129.594 1.00 29.96  ? 49   VAL C CG1   1 
ATOM   6506  C  CG2   . VAL D 4  49  ? 83.714  79.822  129.696 1.00 22.14  ? 49   VAL C CG2   1 
ATOM   6507  N  N     . TYR D 4  50  ? 85.394  83.105  127.258 1.00 26.95  ? 50   TYR C N     1 
ATOM   6508  C  CA    . TYR D 4  50  ? 85.588  84.487  126.854 1.00 28.48  ? 50   TYR C CA    1 
ATOM   6509  C  C     . TYR D 4  50  ? 85.333  84.655  125.367 1.00 28.34  ? 50   TYR C C     1 
ATOM   6510  O  O     . TYR D 4  50  ? 84.554  85.518  124.939 1.00 26.68  ? 50   TYR C O     1 
ATOM   6511  C  CB    . TYR D 4  50  ? 87.003  84.897  127.181 1.00 32.89  ? 50   TYR C CB    1 
ATOM   6512  C  CG    . TYR D 4  50  ? 87.257  86.345  127.079 1.00 28.89  ? 50   TYR C CG    1 
ATOM   6513  C  CD1   . TYR D 4  50  ? 87.059  87.153  128.159 1.00 30.11  ? 50   TYR C CD1   1 
ATOM   6514  C  CD2   . TYR D 4  50  ? 87.670  86.910  125.909 1.00 30.38  ? 50   TYR C CD2   1 
ATOM   6515  C  CE1   . TYR D 4  50  ? 87.301  88.467  128.097 1.00 26.44  ? 50   TYR C CE1   1 
ATOM   6516  C  CE2   . TYR D 4  50  ? 87.908  88.235  125.832 1.00 29.16  ? 50   TYR C CE2   1 
ATOM   6517  C  CZ    . TYR D 4  50  ? 87.718  89.015  126.933 1.00 29.55  ? 50   TYR C CZ    1 
ATOM   6518  O  OH    . TYR D 4  50  ? 87.951  90.364  126.882 1.00 37.61  ? 50   TYR C OH    1 
ATOM   6519  N  N     . LEU D 4  51  ? 85.976  83.820  124.562 1.00 37.55  ? 51   LEU C N     1 
ATOM   6520  C  CA    . LEU D 4  51  ? 85.819  83.926  123.123 1.00 32.19  ? 51   LEU C CA    1 
ATOM   6521  C  C     . LEU D 4  51  ? 84.355  83.837  122.732 1.00 32.40  ? 51   LEU C C     1 
ATOM   6522  O  O     . LEU D 4  51  ? 83.828  84.718  122.039 1.00 32.58  ? 51   LEU C O     1 
ATOM   6523  C  CB    . LEU D 4  51  ? 86.627  82.836  122.445 1.00 15.22  ? 51   LEU C CB    1 
ATOM   6524  C  CG    . LEU D 4  51  ? 86.538  82.864  120.946 1.00 14.33  ? 51   LEU C CG    1 
ATOM   6525  C  CD1   . LEU D 4  51  ? 87.058  84.166  120.517 1.00 46.48  ? 51   LEU C CD1   1 
ATOM   6526  C  CD2   . LEU D 4  51  ? 87.425  81.808  120.454 1.00 14.18  ? 51   LEU C CD2   1 
ATOM   6527  N  N     . ALA D 4  52  ? 83.673  82.789  123.193 1.00 24.15  ? 52   ALA C N     1 
ATOM   6528  C  CA    . ALA D 4  52  ? 82.264  82.635  122.868 1.00 23.94  ? 52   ALA C CA    1 
ATOM   6529  C  C     . ALA D 4  52  ? 81.493  83.894  123.193 1.00 31.94  ? 52   ALA C C     1 
ATOM   6530  O  O     . ALA D 4  52  ? 80.664  84.343  122.397 1.00 20.40  ? 52   ALA C O     1 
ATOM   6531  C  CB    . ALA D 4  52  ? 81.673  81.453  123.615 1.00 31.77  ? 52   ALA C CB    1 
ATOM   6532  N  N     . ALA D 4  53  ? 81.767  84.496  124.346 1.00 37.32  ? 53   ALA C N     1 
ATOM   6533  C  CA    . ALA D 4  53  ? 81.114  85.758  124.654 1.00 17.21  ? 53   ALA C CA    1 
ATOM   6534  C  C     . ALA D 4  53  ? 81.339  86.759  123.540 1.00 27.07  ? 53   ALA C C     1 
ATOM   6535  O  O     . ALA D 4  53  ? 80.392  87.385  123.051 1.00 39.64  ? 53   ALA C O     1 
ATOM   6536  C  CB    . ALA D 4  53  ? 81.621  86.317  125.975 1.00 33.95  ? 53   ALA C CB    1 
ATOM   6537  N  N     . VAL D 4  54  ? 82.586  86.907  123.100 1.00 27.55  ? 54   VAL C N     1 
ATOM   6538  C  CA    . VAL D 4  54  ? 82.856  87.887  122.053 1.00 25.24  ? 54   VAL C CA    1 
ATOM   6539  C  C     . VAL D 4  54  ? 82.010  87.603  120.824 1.00 25.26  ? 54   VAL C C     1 
ATOM   6540  O  O     . VAL D 4  54  ? 81.248  88.462  120.360 1.00 29.56  ? 54   VAL C O     1 
ATOM   6541  C  CB    . VAL D 4  54  ? 84.344  87.917  121.700 1.00 16.50  ? 54   VAL C CB    1 
ATOM   6542  C  CG1   . VAL D 4  54  ? 84.531  88.757  120.492 1.00 17.29  ? 54   VAL C CG1   1 
ATOM   6543  C  CG2   . VAL D 4  54  ? 85.095  88.514  122.822 1.00 17.34  ? 54   VAL C CG2   1 
ATOM   6544  N  N     . LEU D 4  55  ? 82.129  86.391  120.279 1.00 27.89  ? 55   LEU C N     1 
ATOM   6545  C  CA    . LEU D 4  55  ? 81.373  86.063  119.077 1.00 25.28  ? 55   LEU C CA    1 
ATOM   6546  C  C     . LEU D 4  55  ? 79.904  86.391  119.249 1.00 35.35  ? 55   LEU C C     1 
ATOM   6547  O  O     . LEU D 4  55  ? 79.284  86.996  118.364 1.00 29.00  ? 55   LEU C O     1 
ATOM   6548  C  CB    . LEU D 4  55  ? 81.546  84.598  118.734 1.00 12.68  ? 55   LEU C CB    1 
ATOM   6549  C  CG    . LEU D 4  55  ? 82.983  84.300  118.386 1.00 19.10  ? 55   LEU C CG    1 
ATOM   6550  C  CD1   . LEU D 4  55  ? 83.163  82.835  118.164 1.00 18.79  ? 55   LEU C CD1   1 
ATOM   6551  C  CD2   . LEU D 4  55  ? 83.317  85.059  117.154 1.00 10.62  ? 55   LEU C CD2   1 
ATOM   6552  N  N     . GLU D 4  56  ? 79.338  86.028  120.397 1.00 25.73  ? 56   GLU C N     1 
ATOM   6553  C  CA    . GLU D 4  56  ? 77.962  86.404  120.660 1.00 25.99  ? 56   GLU C CA    1 
ATOM   6554  C  C     . GLU D 4  56  ? 77.771  87.886  120.466 1.00 28.61  ? 56   GLU C C     1 
ATOM   6555  O  O     . GLU D 4  56  ? 76.856  88.319  119.769 1.00 24.97  ? 56   GLU C O     1 
ATOM   6556  C  CB    . GLU D 4  56  ? 77.546  86.024  122.066 1.00 27.00  ? 56   GLU C CB    1 
ATOM   6557  C  CG    . GLU D 4  56  ? 76.107  86.365  122.303 1.00 35.11  ? 56   GLU C CG    1 
ATOM   6558  C  CD    . GLU D 4  56  ? 75.664  86.008  123.682 1.00 59.25  ? 56   GLU C CD    1 
ATOM   6559  O  OE1   . GLU D 4  56  ? 76.504  85.509  124.445 1.00 63.77  ? 56   GLU C OE1   1 
ATOM   6560  O  OE2   . GLU D 4  56  ? 74.481  86.230  124.013 1.00 66.65  ? 56   GLU C OE2   1 
ATOM   6561  N  N     . TYR D 4  57  ? 78.642  88.685  121.058 1.00 29.18  ? 57   TYR C N     1 
ATOM   6562  C  CA    . TYR D 4  57  ? 78.455  90.120  120.961 1.00 25.16  ? 57   TYR C CA    1 
ATOM   6563  C  C     . TYR D 4  57  ? 78.443  90.579  119.515 1.00 26.53  ? 57   TYR C C     1 
ATOM   6564  O  O     . TYR D 4  57  ? 77.521  91.282  119.087 1.00 21.49  ? 57   TYR C O     1 
ATOM   6565  C  CB    . TYR D 4  57  ? 79.534  90.846  121.731 1.00 33.45  ? 57   TYR C CB    1 
ATOM   6566  C  CG    . TYR D 4  57  ? 79.402  92.307  121.528 1.00 41.52  ? 57   TYR C CG    1 
ATOM   6567  C  CD1   . TYR D 4  57  ? 78.443  93.016  122.200 1.00 39.42  ? 57   TYR C CD1   1 
ATOM   6568  C  CD2   . TYR D 4  57  ? 80.209  92.974  120.637 1.00 53.25  ? 57   TYR C CD2   1 
ATOM   6569  C  CE1   . TYR D 4  57  ? 78.307  94.353  122.014 1.00 47.67  ? 57   TYR C CE1   1 
ATOM   6570  C  CE2   . TYR D 4  57  ? 80.078  94.310  120.445 1.00 52.62  ? 57   TYR C CE2   1 
ATOM   6571  C  CZ    . TYR D 4  57  ? 79.125  94.999  121.135 1.00 55.00  ? 57   TYR C CZ    1 
ATOM   6572  O  OH    . TYR D 4  57  ? 78.985  96.349  120.950 1.00 51.62  ? 57   TYR C OH    1 
ATOM   6573  N  N     . LEU D 4  58  ? 79.456  90.200  118.740 1.00 28.57  ? 58   LEU C N     1 
ATOM   6574  C  CA    . LEU D 4  58  ? 79.503  90.671  117.360 1.00 30.18  ? 58   LEU C CA    1 
ATOM   6575  C  C     . LEU D 4  58  ? 78.258  90.257  116.589 1.00 34.04  ? 58   LEU C C     1 
ATOM   6576  O  O     . LEU D 4  58  ? 77.589  91.096  115.968 1.00 29.77  ? 58   LEU C O     1 
ATOM   6577  C  CB    . LEU D 4  58  ? 80.753  90.164  116.669 1.00 14.88  ? 58   LEU C CB    1 
ATOM   6578  C  CG    . LEU D 4  58  ? 81.917  90.888  117.295 1.00 14.97  ? 58   LEU C CG    1 
ATOM   6579  C  CD1   . LEU D 4  58  ? 83.203  90.339  116.780 1.00 12.65  ? 58   LEU C CD1   1 
ATOM   6580  C  CD2   . LEU D 4  58  ? 81.777  92.328  116.935 1.00 48.41  ? 58   LEU C CD2   1 
ATOM   6581  N  N     . THR D 4  59  ? 77.920  88.971  116.621 1.00 21.80  ? 59   THR C N     1 
ATOM   6582  C  CA    . THR D 4  59  ? 76.733  88.546  115.897 1.00 24.59  ? 59   THR C CA    1 
ATOM   6583  C  C     . THR D 4  59  ? 75.509  89.312  116.355 1.00 28.82  ? 59   THR C C     1 
ATOM   6584  O  O     . THR D 4  59  ? 74.654  89.676  115.541 1.00 30.34  ? 59   THR C O     1 
ATOM   6585  C  CB    . THR D 4  59  ? 76.529  87.060  116.066 1.00 22.90  ? 59   THR C CB    1 
ATOM   6586  O  OG1   . THR D 4  59  ? 77.552  86.380  115.343 1.00 20.99  ? 59   THR C OG1   1 
ATOM   6587  C  CG2   . THR D 4  59  ? 75.205  86.668  115.538 1.00 18.26  ? 59   THR C CG2   1 
ATOM   6588  N  N     . ALA D 4  60  ? 75.423  89.603  117.644 1.00 26.48  ? 60   ALA C N     1 
ATOM   6589  C  CA    . ALA D 4  60  ? 74.329  90.432  118.117 1.00 26.19  ? 60   ALA C CA    1 
ATOM   6590  C  C     . ALA D 4  60  ? 74.314  91.768  117.396 1.00 29.68  ? 60   ALA C C     1 
ATOM   6591  O  O     . ALA D 4  60  ? 73.254  92.235  116.972 1.00 23.94  ? 60   ALA C O     1 
ATOM   6592  C  CB    . ALA D 4  60  ? 74.428  90.631  119.623 1.00 25.01  ? 60   ALA C CB    1 
ATOM   6593  N  N     . GLU D 4  61  ? 75.479  92.387  117.217 1.00 20.66  ? 61   GLU C N     1 
ATOM   6594  C  CA    . GLU D 4  61  ? 75.500  93.663  116.514 1.00 24.89  ? 61   GLU C CA    1 
ATOM   6595  C  C     . GLU D 4  61  ? 75.008  93.517  115.084 1.00 31.57  ? 61   GLU C C     1 
ATOM   6596  O  O     . GLU D 4  61  ? 74.033  94.164  114.682 1.00 35.03  ? 61   GLU C O     1 
ATOM   6597  C  CB    . GLU D 4  61  ? 76.894  94.267  116.542 1.00 27.95  ? 61   GLU C CB    1 
ATOM   6598  C  CG    . GLU D 4  61  ? 77.261  94.760  117.895 1.00 48.02  ? 61   GLU C CG    1 
ATOM   6599  C  CD    . GLU D 4  61  ? 76.283  95.788  118.381 1.00 55.21  ? 61   GLU C CD    1 
ATOM   6600  O  OE1   . GLU D 4  61  ? 75.885  96.648  117.575 1.00 59.13  ? 61   GLU C OE1   1 
ATOM   6601  O  OE2   . GLU D 4  61  ? 75.891  95.729  119.562 1.00 52.49  ? 61   GLU C OE2   1 
ATOM   6602  N  N     . ILE D 4  62  ? 75.660  92.661  114.298 1.00 33.59  ? 62   ILE C N     1 
ATOM   6603  C  CA    . ILE D 4  62  ? 75.294  92.582  112.888 1.00 35.76  ? 62   ILE C CA    1 
ATOM   6604  C  C     . ILE D 4  62  ? 73.822  92.260  112.735 1.00 28.90  ? 62   ILE C C     1 
ATOM   6605  O  O     . ILE D 4  62  ? 73.118  92.895  111.945 1.00 22.01  ? 62   ILE C O     1 
ATOM   6606  C  CB    . ILE D 4  62  ? 76.164  91.563  112.145 1.00 20.01  ? 62   ILE C CB    1 
ATOM   6607  C  CG1   . ILE D 4  62  ? 77.575  92.088  112.018 1.00 20.54  ? 62   ILE C CG1   1 
ATOM   6608  C  CG2   . ILE D 4  62  ? 75.629  91.319  110.775 1.00 42.19  ? 62   ILE C CG2   1 
ATOM   6609  C  CD1   . ILE D 4  62  ? 78.498  91.083  111.435 1.00 44.00  ? 62   ILE C CD1   1 
ATOM   6610  N  N     . LEU D 4  63  ? 73.319  91.295  113.497 1.00 27.79  ? 63   LEU C N     1 
ATOM   6611  C  CA    . LEU D 4  63  ? 71.906  90.972  113.368 1.00 25.24  ? 63   LEU C CA    1 
ATOM   6612  C  C     . LEU D 4  63  ? 71.035  92.160  113.728 1.00 27.36  ? 63   LEU C C     1 
ATOM   6613  O  O     . LEU D 4  63  ? 70.119  92.506  112.983 1.00 32.35  ? 63   LEU C O     1 
ATOM   6614  C  CB    . LEU D 4  63  ? 71.540  89.770  114.216 1.00 17.21  ? 63   LEU C CB    1 
ATOM   6615  C  CG    . LEU D 4  63  ? 72.155  88.530  113.617 1.00 30.07  ? 63   LEU C CG    1 
ATOM   6616  C  CD1   . LEU D 4  63  ? 71.759  87.345  114.429 1.00 38.30  ? 63   LEU C CD1   1 
ATOM   6617  C  CD2   . LEU D 4  63  ? 71.691  88.391  112.208 1.00 17.89  ? 63   LEU C CD2   1 
ATOM   6618  N  N     . GLU D 4  64  ? 71.300  92.804  114.863 1.00 35.21  ? 64   GLU C N     1 
ATOM   6619  C  CA    . GLU D 4  64  ? 70.469  93.938  115.247 1.00 34.38  ? 64   GLU C CA    1 
ATOM   6620  C  C     . GLU D 4  64  ? 70.377  94.952  114.120 1.00 31.97  ? 64   GLU C C     1 
ATOM   6621  O  O     . GLU D 4  64  ? 69.281  95.284  113.649 1.00 44.85  ? 64   GLU C O     1 
ATOM   6622  C  CB    . GLU D 4  64  ? 71.016  94.602  116.501 1.00 28.02  ? 64   GLU C CB    1 
ATOM   6623  C  CG    . GLU D 4  64  ? 70.180  95.778  116.939 1.00 32.56  ? 64   GLU C CG    1 
ATOM   6624  C  CD    . GLU D 4  64  ? 70.693  96.414  118.206 1.00 49.22  ? 64   GLU C CD    1 
ATOM   6625  O  OE1   . GLU D 4  64  ? 71.749  95.979  118.704 1.00 49.06  ? 64   GLU C OE1   1 
ATOM   6626  O  OE2   . GLU D 4  64  ? 70.036  97.344  118.714 1.00 58.03  ? 64   GLU C OE2   1 
ATOM   6627  N  N     . LEU D 4  65  ? 71.526  95.433  113.652 1.00 43.87  ? 65   LEU C N     1 
ATOM   6628  C  CA    . LEU D 4  65  ? 71.498  96.425  112.587 1.00 41.64  ? 65   LEU C CA    1 
ATOM   6629  C  C     . LEU D 4  65  ? 70.737  95.902  111.379 1.00 39.40  ? 65   LEU C C     1 
ATOM   6630  O  O     . LEU D 4  65  ? 69.876  96.595  110.824 1.00 35.47  ? 65   LEU C O     1 
ATOM   6631  C  CB    . LEU D 4  65  ? 72.912  96.825  112.196 1.00 46.79  ? 65   LEU C CB    1 
ATOM   6632  C  CG    . LEU D 4  65  ? 73.674  97.569  113.276 1.00 39.88  ? 65   LEU C CG    1 
ATOM   6633  C  CD1   . LEU D 4  65  ? 75.067  97.836  112.801 1.00 44.60  ? 65   LEU C CD1   1 
ATOM   6634  C  CD2   . LEU D 4  65  ? 72.979  98.858  113.585 1.00 36.72  ? 65   LEU C CD2   1 
ATOM   6635  N  N     . ALA D 4  66  ? 71.024  94.668  110.972 1.00 26.78  ? 66   ALA C N     1 
ATOM   6636  C  CA    . ALA D 4  66  ? 70.358  94.111  109.806 1.00 32.33  ? 66   ALA C CA    1 
ATOM   6637  C  C     . ALA D 4  66  ? 68.851  94.160  109.977 1.00 39.01  ? 66   ALA C C     1 
ATOM   6638  O  O     . ALA D 4  66  ? 68.137  94.744  109.157 1.00 44.59  ? 66   ALA C O     1 
ATOM   6639  C  CB    . ALA D 4  66  ? 70.826  92.684  109.570 1.00 26.99  ? 66   ALA C CB    1 
ATOM   6640  N  N     . GLY D 4  67  ? 68.356  93.570  111.060 1.00 48.50  ? 67   GLY C N     1 
ATOM   6641  C  CA    . GLY D 4  67  ? 66.930  93.594  111.323 1.00 47.05  ? 67   GLY C CA    1 
ATOM   6642  C  C     . GLY D 4  67  ? 66.345  94.982  111.210 1.00 47.74  ? 67   GLY C C     1 
ATOM   6643  O  O     . GLY D 4  67  ? 65.341  95.189  110.529 1.00 41.27  ? 67   GLY C O     1 
ATOM   6644  N  N     . ASN D 4  68  ? 66.984  95.961  111.851 1.00 49.73  ? 68   ASN C N     1 
ATOM   6645  C  CA    . ASN D 4  68  ? 66.510  97.330  111.706 1.00 45.95  ? 68   ASN C CA    1 
ATOM   6646  C  C     . ASN D 4  68  ? 66.382  97.705  110.241 1.00 55.42  ? 68   ASN C C     1 
ATOM   6647  O  O     . ASN D 4  68  ? 65.364  98.262  109.816 1.00 58.55  ? 68   ASN C O     1 
ATOM   6648  C  CB    . ASN D 4  68  ? 67.441  98.295  112.424 1.00 48.48  ? 68   ASN C CB    1 
ATOM   6649  C  CG    . ASN D 4  68  ? 67.310  98.205  113.915 1.00 57.33  ? 68   ASN C CG    1 
ATOM   6650  O  OD1   . ASN D 4  68  ? 66.299  97.733  114.428 1.00 56.06  ? 68   ASN C OD1   1 
ATOM   6651  N  ND2   . ASN D 4  68  ? 68.325  98.671  114.629 1.00 53.69  ? 68   ASN C ND2   1 
ATOM   6652  N  N     . ALA D 4  69  ? 67.394  97.372  109.443 1.00 59.81  ? 69   ALA C N     1 
ATOM   6653  C  CA    . ALA D 4  69  ? 67.347  97.735  108.033 1.00 47.04  ? 69   ALA C CA    1 
ATOM   6654  C  C     . ALA D 4  69  ? 66.163  97.081  107.339 1.00 49.74  ? 69   ALA C C     1 
ATOM   6655  O  O     . ALA D 4  69  ? 65.380  97.752  106.655 1.00 54.41  ? 69   ALA C O     1 
ATOM   6656  C  CB    . ALA D 4  69  ? 68.651  97.349  107.349 1.00 55.98  ? 69   ALA C CB    1 
ATOM   6657  N  N     . ALA D 4  70  ? 66.009  95.770  107.509 1.00 40.96  ? 70   ALA C N     1 
ATOM   6658  C  CA    . ALA D 4  70  ? 64.900  95.077  106.869 1.00 58.74  ? 70   ALA C CA    1 
ATOM   6659  C  C     . ALA D 4  70  ? 63.571  95.690  107.269 1.00 67.84  ? 70   ALA C C     1 
ATOM   6660  O  O     . ALA D 4  70  ? 62.685  95.881  106.428 1.00 73.99  ? 70   ALA C O     1 
ATOM   6661  C  CB    . ALA D 4  70  ? 64.927  93.600  107.233 1.00 64.91  ? 70   ALA C CB    1 
ATOM   6662  N  N     . ARG D 4  71  ? 63.414  96.001  108.552 1.00 68.12  ? 71   ARG C N     1 
ATOM   6663  C  CA    . ARG D 4  71  ? 62.204  96.672  109.001 1.00 75.28  ? 71   ARG C CA    1 
ATOM   6664  C  C     . ARG D 4  71  ? 62.003  97.974  108.253 1.00 74.86  ? 71   ARG C C     1 
ATOM   6665  O  O     . ARG D 4  71  ? 60.877  98.325  107.892 1.00 75.37  ? 71   ARG C O     1 
ATOM   6666  C  CB    . ARG D 4  71  ? 62.275  96.924  110.501 1.00 59.17  ? 71   ARG C CB    1 
ATOM   6667  C  CG    . ARG D 4  71  ? 61.058  97.591  111.066 1.00 77.16  ? 71   ARG C CG    1 
ATOM   6668  C  CD    . ARG D 4  71  ? 61.256  97.845  112.535 1.00 85.67  ? 71   ARG C CD    1 
ATOM   6669  N  NE    . ARG D 4  71  ? 62.355  98.773  112.769 1.00 87.39  ? 71   ARG C NE    1 
ATOM   6670  C  CZ    . ARG D 4  71  ? 62.942  98.952  113.947 1.00 83.86  ? 71   ARG C CZ    1 
ATOM   6671  N  NH1   . ARG D 4  71  ? 62.534  98.264  115.003 1.00 82.57  ? 71   ARG C NH1   1 
ATOM   6672  N  NH2   . ARG D 4  71  ? 63.937  99.818  114.071 1.00 78.31  ? 71   ARG C NH2   1 
ATOM   6673  N  N     . ASP D 4  72  ? 63.087  98.696  107.990 1.00 64.76  ? 72   ASP C N     1 
ATOM   6674  C  CA    . ASP D 4  72  ? 62.947  99.937  107.248 1.00 74.16  ? 72   ASP C CA    1 
ATOM   6675  C  C     . ASP D 4  72  ? 62.599  99.693  105.789 1.00 85.71  ? 72   ASP C C     1 
ATOM   6676  O  O     . ASP D 4  72  ? 62.135  100.614 105.115 1.00 89.31  ? 72   ASP C O     1 
ATOM   6677  C  CB    . ASP D 4  72  ? 64.223  100.757 107.368 1.00 85.13  ? 72   ASP C CB    1 
ATOM   6678  C  CG    . ASP D 4  72  ? 64.490  101.185 108.791 1.00 97.98  ? 72   ASP C CG    1 
ATOM   6679  O  OD1   . ASP D 4  72  ? 63.578  101.037 109.629 1.00 93.26  ? 72   ASP C OD1   1 
ATOM   6680  O  OD2   . ASP D 4  72  ? 65.602  101.671 109.075 1.00 101.34 ? 72   ASP C OD2   1 
ATOM   6681  N  N     . ASN D 4  73  ? 62.818  98.485  105.284 1.00 85.24  ? 73   ASN C N     1 
ATOM   6682  C  CA    . ASN D 4  73  ? 62.272  98.088  103.995 1.00 78.62  ? 73   ASN C CA    1 
ATOM   6683  C  C     . ASN D 4  73  ? 60.960  97.332  104.111 1.00 71.29  ? 73   ASN C C     1 
ATOM   6684  O  O     . ASN D 4  73  ? 60.457  96.841  103.098 1.00 79.39  ? 73   ASN C O     1 
ATOM   6685  C  CB    . ASN D 4  73  ? 63.279  97.247  103.221 1.00 88.42  ? 73   ASN C CB    1 
ATOM   6686  C  CG    . ASN D 4  73  ? 64.313  98.087  102.535 1.00 105.64 ? 73   ASN C CG    1 
ATOM   6687  O  OD1   . ASN D 4  73  ? 64.076  98.601  101.448 1.00 114.79 ? 73   ASN C OD1   1 
ATOM   6688  N  ND2   . ASN D 4  73  ? 65.455  98.268  103.176 1.00 102.18 ? 73   ASN C ND2   1 
ATOM   6689  N  N     . LYS D 4  74  ? 60.414  97.202  105.317 1.00 76.10  ? 74   LYS C N     1 
ATOM   6690  C  CA    . LYS D 4  74  ? 59.110  96.582  105.532 1.00 81.12  ? 74   LYS C CA    1 
ATOM   6691  C  C     . LYS D 4  74  ? 59.096  95.122  105.095 1.00 70.68  ? 74   LYS C C     1 
ATOM   6692  O  O     . LYS D 4  74  ? 58.048  94.576  104.749 1.00 82.06  ? 74   LYS C O     1 
ATOM   6693  C  CB    . LYS D 4  74  ? 58.002  97.363  104.825 1.00 64.89  ? 74   LYS C CB    1 
ATOM   6694  C  CG    . LYS D 4  74  ? 57.790  98.733  105.411 1.00 73.34  ? 74   LYS C CG    1 
ATOM   6695  C  CD    . LYS D 4  74  ? 56.786  99.514  104.604 1.00 91.82  ? 74   LYS C CD    1 
ATOM   6696  C  CE    . LYS D 4  74  ? 56.579  100.897 105.186 1.00 101.49 ? 74   LYS C CE    1 
ATOM   6697  N  NZ    . LYS D 4  74  ? 55.665  101.715 104.338 1.00 105.05 ? 74   LYS C NZ    1 
ATOM   6698  N  N     . LYS D 4  75  ? 60.257  94.485  105.102 1.00 71.91  ? 75   LYS C N     1 
ATOM   6699  C  CA    . LYS D 4  75  ? 60.358  93.046  104.934 1.00 77.26  ? 75   LYS C CA    1 
ATOM   6700  C  C     . LYS D 4  75  ? 60.469  92.400  106.305 1.00 80.93  ? 75   LYS C C     1 
ATOM   6701  O  O     . LYS D 4  75  ? 61.121  92.938  107.202 1.00 89.33  ? 75   LYS C O     1 
ATOM   6702  C  CB    . LYS D 4  75  ? 61.575  92.677  104.094 1.00 75.67  ? 75   LYS C CB    1 
ATOM   6703  C  CG    . LYS D 4  75  ? 61.606  93.290  102.725 1.00 81.92  ? 75   LYS C CG    1 
ATOM   6704  C  CD    . LYS D 4  75  ? 60.484  92.778  101.882 1.00 91.90  ? 75   LYS C CD    1 
ATOM   6705  C  CE    . LYS D 4  75  ? 60.611  93.306  100.471 1.00 101.16 ? 75   LYS C CE    1 
ATOM   6706  N  NZ    . LYS D 4  75  ? 59.512  92.805  99.599  1.00 106.11 ? 75   LYS C NZ    1 
ATOM   6707  N  N     . THR D 4  76  ? 59.838  91.243  106.467 1.00 75.63  ? 76   THR C N     1 
ATOM   6708  C  CA    . THR D 4  76  ? 59.872  90.593  107.768 1.00 86.45  ? 76   THR C CA    1 
ATOM   6709  C  C     . THR D 4  76  ? 61.180  89.866  108.013 1.00 84.59  ? 76   THR C C     1 
ATOM   6710  O  O     . THR D 4  76  ? 61.556  89.666  109.170 1.00 75.40  ? 76   THR C O     1 
ATOM   6711  C  CB    . THR D 4  76  ? 58.738  89.593  107.894 1.00 116.24 ? 76   THR C CB    1 
ATOM   6712  O  OG1   . THR D 4  76  ? 58.932  88.560  106.927 1.00 113.29 ? 76   THR C OG1   1 
ATOM   6713  C  CG2   . THR D 4  76  ? 57.423  90.268  107.626 1.00 108.64 ? 76   THR C CG2   1 
ATOM   6714  N  N     . ARG D 4  77  ? 61.877  89.454  106.960 1.00 78.35  ? 77   ARG C N     1 
ATOM   6715  C  CA    . ARG D 4  77  ? 63.044  88.605  107.113 1.00 71.15  ? 77   ARG C CA    1 
ATOM   6716  C  C     . ARG D 4  77  ? 64.290  89.296  106.594 1.00 65.71  ? 77   ARG C C     1 
ATOM   6717  O  O     . ARG D 4  77  ? 64.229  90.213  105.776 1.00 78.75  ? 77   ARG C O     1 
ATOM   6718  C  CB    . ARG D 4  77  ? 62.885  87.280  106.385 1.00 89.47  ? 77   ARG C CB    1 
ATOM   6719  C  CG    . ARG D 4  77  ? 61.760  86.441  106.889 1.00 108.81 ? 77   ARG C CG    1 
ATOM   6720  C  CD    . ARG D 4  77  ? 61.710  85.202  106.069 1.00 114.52 ? 77   ARG C CD    1 
ATOM   6721  N  NE    . ARG D 4  77  ? 61.690  85.570  104.668 1.00 114.26 ? 77   ARG C NE    1 
ATOM   6722  C  CZ    . ARG D 4  77  ? 61.637  84.698  103.676 1.00 115.14 ? 77   ARG C CZ    1 
ATOM   6723  N  NH1   . ARG D 4  77  ? 61.582  83.405  103.936 1.00 102.06 ? 77   ARG C NH1   1 
ATOM   6724  N  NH2   . ARG D 4  77  ? 61.633  85.121  102.426 1.00 126.51 ? 77   ARG C NH2   1 
ATOM   6725  N  N     . ILE D 4  78  ? 65.425  88.822  107.073 1.00 52.83  ? 78   ILE C N     1 
ATOM   6726  C  CA    . ILE D 4  78  ? 66.714  89.398  106.734 1.00 52.98  ? 78   ILE C CA    1 
ATOM   6727  C  C     . ILE D 4  78  ? 67.305  88.656  105.548 1.00 47.56  ? 78   ILE C C     1 
ATOM   6728  O  O     . ILE D 4  78  ? 67.400  87.426  105.555 1.00 38.93  ? 78   ILE C O     1 
ATOM   6729  C  CB    . ILE D 4  78  ? 67.654  89.353  107.941 1.00 26.91  ? 78   ILE C CB    1 
ATOM   6730  C  CG1   . ILE D 4  78  ? 67.198  90.362  108.979 1.00 25.39  ? 78   ILE C CG1   1 
ATOM   6731  C  CG2   . ILE D 4  78  ? 69.037  89.639  107.521 1.00 60.47  ? 78   ILE C CG2   1 
ATOM   6732  C  CD1   . ILE D 4  78  ? 67.969  90.302  110.230 1.00 25.62  ? 78   ILE C CD1   1 
ATOM   6733  N  N     . ILE D 4  79  ? 67.705  89.402  104.529 1.00 31.12  ? 79   ILE C N     1 
ATOM   6734  C  CA    . ILE D 4  79  ? 68.236  88.820  103.300 1.00 30.67  ? 79   ILE C CA    1 
ATOM   6735  C  C     . ILE D 4  79  ? 69.584  89.464  103.017 1.00 41.07  ? 79   ILE C C     1 
ATOM   6736  O  O     . ILE D 4  79  ? 69.887  90.542  103.549 1.00 47.59  ? 79   ILE C O     1 
ATOM   6737  C  CB    . ILE D 4  79  ? 67.262  89.021  102.122 1.00 44.40  ? 79   ILE C CB    1 
ATOM   6738  C  CG1   . ILE D 4  79  ? 66.936  90.501  101.984 1.00 44.10  ? 79   ILE C CG1   1 
ATOM   6739  C  CG2   . ILE D 4  79  ? 66.031  88.206  102.334 1.00 41.53  ? 79   ILE C CG2   1 
ATOM   6740  C  CD1   . ILE D 4  79  ? 66.161  90.841  100.750 1.00 41.47  ? 79   ILE C CD1   1 
ATOM   6741  N  N     . PRO D 4  80  ? 70.412  88.837  102.174 1.00 43.62  ? 80   PRO C N     1 
ATOM   6742  C  CA    . PRO D 4  80  ? 71.789  89.319  102.014 1.00 25.67  ? 80   PRO C CA    1 
ATOM   6743  C  C     . PRO D 4  80  ? 71.905  90.807  101.799 1.00 26.92  ? 80   PRO C C     1 
ATOM   6744  O  O     . PRO D 4  80  ? 72.779  91.442  102.393 1.00 33.48  ? 80   PRO C O     1 
ATOM   6745  C  CB    . PRO D 4  80  ? 72.270  88.543  100.793 1.00 25.19  ? 80   PRO C CB    1 
ATOM   6746  C  CG    . PRO D 4  80  ? 71.519  87.313  100.843 1.00 29.24  ? 80   PRO C CG    1 
ATOM   6747  C  CD    . PRO D 4  80  ? 70.165  87.662  101.328 1.00 35.45  ? 80   PRO C CD    1 
ATOM   6748  N  N     . ARG D 4  81  ? 71.031  91.387  100.985 1.00 43.92  ? 81   ARG C N     1 
ATOM   6749  C  CA    . ARG D 4  81  ? 71.045  92.828  100.789 1.00 33.99  ? 81   ARG C CA    1 
ATOM   6750  C  C     . ARG D 4  81  ? 71.040  93.566  102.114 1.00 36.43  ? 81   ARG C C     1 
ATOM   6751  O  O     . ARG D 4  81  ? 71.715  94.588  102.272 1.00 38.49  ? 81   ARG C O     1 
ATOM   6752  C  CB    . ARG D 4  81  ? 69.839  93.240  99.962  1.00 36.35  ? 81   ARG C CB    1 
ATOM   6753  C  CG    . ARG D 4  81  ? 69.711  94.713  99.811  1.00 28.91  ? 81   ARG C CG    1 
ATOM   6754  C  CD    . ARG D 4  81  ? 70.870  95.260  99.060  1.00 36.03  ? 81   ARG C CD    1 
ATOM   6755  N  NE    . ARG D 4  81  ? 70.782  96.702  98.963  1.00 44.87  ? 81   ARG C NE    1 
ATOM   6756  C  CZ    . ARG D 4  81  ? 71.762  97.468  98.516  1.00 47.14  ? 81   ARG C CZ    1 
ATOM   6757  N  NH1   . ARG D 4  81  ? 72.891  96.922  98.098  1.00 57.41  ? 81   ARG C NH1   1 
ATOM   6758  N  NH2   . ARG D 4  81  ? 71.606  98.778  98.468  1.00 43.32  ? 81   ARG C NH2   1 
ATOM   6759  N  N     . HIS D 4  82  ? 70.305  93.050  103.090 1.00 33.00  ? 82   HIS C N     1 
ATOM   6760  C  CA    . HIS D 4  82  ? 70.198  93.750  104.357 1.00 33.57  ? 82   HIS C CA    1 
ATOM   6761  C  C     . HIS D 4  82  ? 71.467  93.620  105.173 1.00 38.72  ? 82   HIS C C     1 
ATOM   6762  O  O     . HIS D 4  82  ? 71.813  94.535  105.923 1.00 43.42  ? 82   HIS C O     1 
ATOM   6763  C  CB    . HIS D 4  82  ? 69.011  93.218  105.128 1.00 39.34  ? 82   HIS C CB    1 
ATOM   6764  C  CG    . HIS D 4  82  ? 67.724  93.364  104.394 1.00 49.56  ? 82   HIS C CG    1 
ATOM   6765  N  ND1   . HIS D 4  82  ? 66.612  92.608  104.683 1.00 50.95  ? 82   HIS C ND1   1 
ATOM   6766  C  CD2   . HIS D 4  82  ? 67.372  94.180  103.377 1.00 53.24  ? 82   HIS C CD2   1 
ATOM   6767  C  CE1   . HIS D 4  82  ? 65.629  92.949  103.872 1.00 53.14  ? 82   HIS C CE1   1 
ATOM   6768  N  NE2   . HIS D 4  82  ? 66.065  93.900  103.068 1.00 53.93  ? 82   HIS C NE2   1 
ATOM   6769  N  N     . LEU D 4  83  ? 72.176  92.504  105.050 1.00 37.39  ? 83   LEU C N     1 
ATOM   6770  C  CA    . LEU D 4  83  ? 73.491  92.428  105.669 1.00 47.12  ? 83   LEU C CA    1 
ATOM   6771  C  C     . LEU D 4  83  ? 74.452  93.398  105.005 1.00 40.30  ? 83   LEU C C     1 
ATOM   6772  O  O     . LEU D 4  83  ? 75.195  94.109  105.683 1.00 41.24  ? 83   LEU C O     1 
ATOM   6773  C  CB    . LEU D 4  83  ? 74.024  91.010  105.598 1.00 21.19  ? 83   LEU C CB    1 
ATOM   6774  C  CG    . LEU D 4  83  ? 73.177  90.121  106.470 1.00 24.70  ? 83   LEU C CG    1 
ATOM   6775  C  CD1   . LEU D 4  83  ? 73.630  88.719  106.347 1.00 24.50  ? 83   LEU C CD1   1 
ATOM   6776  C  CD2   . LEU D 4  83  ? 73.351  90.591  107.858 1.00 24.44  ? 83   LEU C CD2   1 
ATOM   6777  N  N     . GLN D 4  84  ? 74.447  93.440  103.676 1.00 40.44  ? 84   GLN C N     1 
ATOM   6778  C  CA    . GLN D 4  84  ? 75.254  94.416  102.959 1.00 38.00  ? 84   GLN C CA    1 
ATOM   6779  C  C     . GLN D 4  84  ? 75.036  95.814  103.507 1.00 36.02  ? 84   GLN C C     1 
ATOM   6780  O  O     . GLN D 4  84  ? 75.995  96.528  103.809 1.00 35.71  ? 84   GLN C O     1 
ATOM   6781  C  CB    . GLN D 4  84  ? 74.905  94.385  101.482 1.00 36.19  ? 84   GLN C CB    1 
ATOM   6782  C  CG    . GLN D 4  84  ? 75.682  95.361  100.660 1.00 35.58  ? 84   GLN C CG    1 
ATOM   6783  C  CD    . GLN D 4  84  ? 77.089  94.932  100.426 1.00 44.27  ? 84   GLN C CD    1 
ATOM   6784  O  OE1   . GLN D 4  84  ? 77.332  93.907  99.804  1.00 49.78  ? 84   GLN C OE1   1 
ATOM   6785  N  NE2   . GLN D 4  84  ? 78.034  95.711  100.909 1.00 46.94  ? 84   GLN C NE2   1 
ATOM   6786  N  N     . LEU D 4  85  ? 73.777  96.224  103.651 1.00 36.69  ? 85   LEU C N     1 
ATOM   6787  C  CA    . LEU D 4  85  ? 73.520  97.596  104.073 1.00 44.79  ? 85   LEU C CA    1 
ATOM   6788  C  C     . LEU D 4  85  ? 73.848  97.798  105.541 1.00 43.09  ? 85   LEU C C     1 
ATOM   6789  O  O     . LEU D 4  85  ? 74.387  98.843  105.924 1.00 43.41  ? 85   LEU C O     1 
ATOM   6790  C  CB    . LEU D 4  85  ? 72.076  97.978  103.795 1.00 51.63  ? 85   LEU C CB    1 
ATOM   6791  C  CG    . LEU D 4  85  ? 71.773  98.006  102.306 1.00 55.36  ? 85   LEU C CG    1 
ATOM   6792  C  CD1   . LEU D 4  85  ? 70.336  98.382  102.057 1.00 57.54  ? 85   LEU C CD1   1 
ATOM   6793  C  CD2   . LEU D 4  85  ? 72.695  98.971  101.637 1.00 46.60  ? 85   LEU C CD2   1 
ATOM   6794  N  N     . ALA D 4  86  ? 73.542  96.815  106.378 1.00 33.80  ? 86   ALA C N     1 
ATOM   6795  C  CA    . ALA D 4  86  ? 73.837  96.966  107.794 1.00 42.35  ? 86   ALA C CA    1 
ATOM   6796  C  C     . ALA D 4  86  ? 75.330  97.007  108.050 1.00 46.74  ? 86   ALA C C     1 
ATOM   6797  O  O     . ALA D 4  86  ? 75.773  97.609  109.029 1.00 58.98  ? 86   ALA C O     1 
ATOM   6798  C  CB    . ALA D 4  86  ? 73.205  95.833  108.587 1.00 55.70  ? 86   ALA C CB    1 
ATOM   6799  N  N     . VAL D 4  87  ? 76.115  96.361  107.201 1.00 31.58  ? 87   VAL C N     1 
ATOM   6800  C  CA    . VAL D 4  87  ? 77.559  96.387  107.361 1.00 29.89  ? 87   VAL C CA    1 
ATOM   6801  C  C     . VAL D 4  87  ? 78.158  97.656  106.778 1.00 32.76  ? 87   VAL C C     1 
ATOM   6802  O  O     . VAL D 4  87  ? 79.019  98.285  107.392 1.00 32.39  ? 87   VAL C O     1 
ATOM   6803  C  CB    . VAL D 4  87  ? 78.166  95.130  106.727 1.00 30.84  ? 87   VAL C CB    1 
ATOM   6804  C  CG1   . VAL D 4  87  ? 79.648  95.258  106.654 1.00 33.30  ? 87   VAL C CG1   1 
ATOM   6805  C  CG2   . VAL D 4  87  ? 77.804  93.929  107.548 1.00 29.69  ? 87   VAL C CG2   1 
ATOM   6806  N  N     . ARG D 4  88  ? 77.723  98.067  105.598 1.00 34.10  ? 88   ARG C N     1 
ATOM   6807  C  CA    . ARG D 4  88  ? 78.388  99.203  104.987 1.00 36.97  ? 88   ARG C CA    1 
ATOM   6808  C  C     . ARG D 4  88  ? 77.969  100.530 105.593 1.00 41.42  ? 88   ARG C C     1 
ATOM   6809  O  O     . ARG D 4  88  ? 78.729  101.495 105.512 1.00 52.66  ? 88   ARG C O     1 
ATOM   6810  C  CB    . ARG D 4  88  ? 78.128  99.219  103.495 1.00 46.88  ? 88   ARG C CB    1 
ATOM   6811  C  CG    . ARG D 4  88  ? 78.689  98.038  102.767 1.00 43.59  ? 88   ARG C CG    1 
ATOM   6812  C  CD    . ARG D 4  88  ? 80.183  98.133  102.583 1.00 37.93  ? 88   ARG C CD    1 
ATOM   6813  N  NE    . ARG D 4  88  ? 80.697  96.999  101.826 1.00 6.74   ? 88   ARG C NE    1 
ATOM   6814  C  CZ    . ARG D 4  88  ? 81.187  95.895  102.373 1.00 52.74  ? 88   ARG C CZ    1 
ATOM   6815  N  NH1   . ARG D 4  88  ? 81.250  95.768  103.684 1.00 41.94  ? 88   ARG C NH1   1 
ATOM   6816  N  NH2   . ARG D 4  88  ? 81.623  94.920  101.602 1.00 44.18  ? 88   ARG C NH2   1 
ATOM   6817  N  N     . ASN D 4  89  ? 76.776  100.627 106.179 1.00 45.22  ? 89   ASN C N     1 
ATOM   6818  C  CA    . ASN D 4  89  ? 76.404  101.895 106.801 1.00 47.96  ? 89   ASN C CA    1 
ATOM   6819  C  C     . ASN D 4  89  ? 77.145  102.112 108.108 1.00 52.47  ? 89   ASN C C     1 
ATOM   6820  O  O     . ASN D 4  89  ? 77.741  103.171 108.321 1.00 59.06  ? 89   ASN C O     1 
ATOM   6821  C  CB    . ASN D 4  89  ? 74.902  101.968 107.013 1.00 84.83  ? 89   ASN C CB    1 
ATOM   6822  C  CG    . ASN D 4  89  ? 74.177  102.308 105.753 1.00 83.70  ? 89   ASN C CG    1 
ATOM   6823  O  OD1   . ASN D 4  89  ? 74.742  102.932 104.861 1.00 84.21  ? 89   ASN C OD1   1 
ATOM   6824  N  ND2   . ASN D 4  89  ? 72.924  101.899 105.657 1.00 74.82  ? 89   ASN C ND2   1 
ATOM   6825  N  N     . ASP D 4  90  ? 77.112  101.130 109.001 1.00 65.86  ? 90   ASP C N     1 
ATOM   6826  C  CA    . ASP D 4  90  ? 77.921  101.211 110.206 1.00 53.80  ? 90   ASP C CA    1 
ATOM   6827  C  C     . ASP D 4  90  ? 79.379  101.378 109.826 1.00 54.79  ? 90   ASP C C     1 
ATOM   6828  O  O     . ASP D 4  90  ? 79.926  100.583 109.062 1.00 71.56  ? 90   ASP C O     1 
ATOM   6829  C  CB    . ASP D 4  90  ? 77.746  99.955  111.048 1.00 33.57  ? 90   ASP C CB    1 
ATOM   6830  C  CG    . ASP D 4  90  ? 78.622  99.956  112.274 1.00 60.44  ? 90   ASP C CG    1 
ATOM   6831  O  OD1   . ASP D 4  90  ? 78.357  100.749 113.198 1.00 72.07  ? 90   ASP C OD1   1 
ATOM   6832  O  OD2   . ASP D 4  90  ? 79.592  99.174  112.305 1.00 69.59  ? 90   ASP C OD2   1 
ATOM   6833  N  N     . GLU D 4  91  ? 80.013  102.415 110.354 1.00 66.61  ? 91   GLU C N     1 
ATOM   6834  C  CA    . GLU D 4  91  ? 81.384  102.682 109.953 1.00 64.19  ? 91   GLU C CA    1 
ATOM   6835  C  C     . GLU D 4  91  ? 82.357  101.736 110.633 1.00 61.10  ? 91   GLU C C     1 
ATOM   6836  O  O     . GLU D 4  91  ? 83.360  101.338 110.031 1.00 61.40  ? 91   GLU C O     1 
ATOM   6837  C  CB    . GLU D 4  91  ? 81.728  104.133 110.258 1.00 90.14  ? 91   GLU C CB    1 
ATOM   6838  C  CG    . GLU D 4  91  ? 83.068  104.582 109.743 1.00 122.64 ? 91   GLU C CG    1 
ATOM   6839  C  CD    . GLU D 4  91  ? 83.285  106.071 109.944 1.00 154.02 ? 91   GLU C CD    1 
ATOM   6840  O  OE1   . GLU D 4  91  ? 82.403  106.723 110.540 1.00 160.11 ? 91   GLU C OE1   1 
ATOM   6841  O  OE2   . GLU D 4  91  ? 84.327  106.595 109.498 1.00 159.89 ? 91   GLU C OE2   1 
ATOM   6842  N  N     . GLU D 4  92  ? 82.064  101.353 111.867 1.00 56.80  ? 92   GLU C N     1 
ATOM   6843  C  CA    . GLU D 4  92  ? 82.878  100.422 112.631 1.00 48.51  ? 92   GLU C CA    1 
ATOM   6844  C  C     . GLU D 4  92  ? 83.044  99.095  111.905 1.00 51.06  ? 92   GLU C C     1 
ATOM   6845  O  O     . GLU D 4  92  ? 84.152  98.733  111.491 1.00 55.00  ? 92   GLU C O     1 
ATOM   6846  C  CB    . GLU D 4  92  ? 82.228  100.225 113.990 1.00 29.80  ? 92   GLU C CB    1 
ATOM   6847  C  CG    . GLU D 4  92  ? 82.202  101.507 114.788 1.00 55.03  ? 92   GLU C CG    1 
ATOM   6848  C  CD    . GLU D 4  92  ? 81.288  101.444 115.993 1.00 71.32  ? 92   GLU C CD    1 
ATOM   6849  O  OE1   . GLU D 4  92  ? 80.451  100.517 116.065 1.00 82.46  ? 92   GLU C OE1   1 
ATOM   6850  O  OE2   . GLU D 4  92  ? 81.410  102.323 116.873 1.00 68.13  ? 92   GLU C OE2   1 
ATOM   6851  N  N     . LEU D 4  93  ? 81.946  98.359  111.745 1.00 40.91  ? 93   LEU C N     1 
ATOM   6852  C  CA    . LEU D 4  93  ? 82.018  97.095  111.028 1.00 32.98  ? 93   LEU C CA    1 
ATOM   6853  C  C     . LEU D 4  93  ? 82.633  97.277  109.657 1.00 48.67  ? 93   LEU C C     1 
ATOM   6854  O  O     . LEU D 4  93  ? 83.448  96.459  109.223 1.00 56.49  ? 93   LEU C O     1 
ATOM   6855  C  CB    . LEU D 4  93  ? 80.635  96.477  110.907 1.00 34.20  ? 93   LEU C CB    1 
ATOM   6856  C  CG    . LEU D 4  93  ? 80.110  96.004  112.246 1.00 44.62  ? 93   LEU C CG    1 
ATOM   6857  C  CD1   . LEU D 4  93  ? 78.697  95.558  112.106 1.00 41.22  ? 93   LEU C CD1   1 
ATOM   6858  C  CD2   . LEU D 4  93  ? 80.963  94.867  112.713 1.00 29.82  ? 93   LEU C CD2   1 
ATOM   6859  N  N     . ASN D 4  94  ? 82.261  98.348  108.961 1.00 50.30  ? 94   ASN C N     1 
ATOM   6860  C  CA    . ASN D 4  94  ? 82.884  98.621  107.678 1.00 47.65  ? 94   ASN C CA    1 
ATOM   6861  C  C     . ASN D 4  94  ? 84.389  98.578  107.792 1.00 53.78  ? 94   ASN C C     1 
ATOM   6862  O  O     . ASN D 4  94  ? 85.068  98.017  106.931 1.00 62.76  ? 94   ASN C O     1 
ATOM   6863  C  CB    . ASN D 4  94  ? 82.453  99.973  107.143 1.00 45.82  ? 94   ASN C CB    1 
ATOM   6864  C  CG    . ASN D 4  94  ? 83.017  100.239 105.787 1.00 53.88  ? 94   ASN C CG    1 
ATOM   6865  O  OD1   . ASN D 4  94  ? 83.275  99.313  105.033 1.00 57.89  ? 94   ASN C OD1   1 
ATOM   6866  N  ND2   . ASN D 4  94  ? 83.224  101.503 105.465 1.00 58.93  ? 94   ASN C ND2   1 
ATOM   6867  N  N     . LYS D 4  95  ? 84.930  99.151  108.859 1.00 60.18  ? 95   LYS C N     1 
ATOM   6868  C  CA    . LYS D 4  95  ? 86.364  99.046  109.068 1.00 53.16  ? 95   LYS C CA    1 
ATOM   6869  C  C     . LYS D 4  95  ? 86.773  97.607  109.322 1.00 60.80  ? 95   LYS C C     1 
ATOM   6870  O  O     . LYS D 4  95  ? 87.842  97.177  108.883 1.00 76.59  ? 95   LYS C O     1 
ATOM   6871  C  CB    . LYS D 4  95  ? 86.792  99.932  110.228 1.00 46.34  ? 95   LYS C CB    1 
ATOM   6872  C  CG    . LYS D 4  95  ? 88.270  99.907  110.481 1.00 61.73  ? 95   LYS C CG    1 
ATOM   6873  C  CD    . LYS D 4  95  ? 89.027  100.535 109.344 1.00 92.87  ? 95   LYS C CD    1 
ATOM   6874  C  CE    . LYS D 4  95  ? 90.508  100.511 109.638 1.00 108.67 ? 95   LYS C CE    1 
ATOM   6875  N  NZ    . LYS D 4  95  ? 90.824  101.304 110.856 1.00 113.07 ? 95   LYS C NZ    1 
ATOM   6876  N  N     . LEU D 4  96  ? 85.939  96.846  110.027 1.00 57.56  ? 96   LEU C N     1 
ATOM   6877  C  CA    . LEU D 4  96  ? 86.285  95.455  110.299 1.00 49.46  ? 96   LEU C CA    1 
ATOM   6878  C  C     . LEU D 4  96  ? 86.220  94.607  109.039 1.00 51.47  ? 96   LEU C C     1 
ATOM   6879  O  O     . LEU D 4  96  ? 87.171  93.895  108.708 1.00 57.64  ? 96   LEU C O     1 
ATOM   6880  C  CB    . LEU D 4  96  ? 85.366  94.881  111.371 1.00 26.32  ? 96   LEU C CB    1 
ATOM   6881  C  CG    . LEU D 4  96  ? 85.502  93.380  111.584 1.00 23.22  ? 96   LEU C CG    1 
ATOM   6882  C  CD1   . LEU D 4  96  ? 86.902  93.058  111.974 1.00 59.90  ? 96   LEU C CD1   1 
ATOM   6883  C  CD2   . LEU D 4  96  ? 84.560  92.932  112.657 1.00 62.18  ? 96   LEU C CD2   1 
ATOM   6884  N  N     . LEU D 4  97  ? 85.112  94.667  108.321 1.00 39.73  ? 97   LEU C N     1 
ATOM   6885  C  CA    . LEU D 4  97  ? 84.868  93.760  107.215 1.00 45.51  ? 97   LEU C CA    1 
ATOM   6886  C  C     . LEU D 4  97  ? 85.381  94.284  105.892 1.00 41.38  ? 97   LEU C C     1 
ATOM   6887  O  O     . LEU D 4  97  ? 85.094  93.683  104.858 1.00 24.86  ? 97   LEU C O     1 
ATOM   6888  C  CB    . LEU D 4  97  ? 83.384  93.462  107.096 1.00 28.11  ? 97   LEU C CB    1 
ATOM   6889  C  CG    . LEU D 4  97  ? 82.847  92.728  108.306 1.00 26.01  ? 97   LEU C CG    1 
ATOM   6890  C  CD1   . LEU D 4  97  ? 81.377  92.544  108.165 1.00 15.71  ? 97   LEU C CD1   1 
ATOM   6891  C  CD2   . LEU D 4  97  ? 83.521  91.406  108.424 1.00 27.13  ? 97   LEU C CD2   1 
ATOM   6892  N  N     . GLY D 4  98  ? 86.126  95.379  105.894 1.00 48.57  ? 98   GLY C N     1 
ATOM   6893  C  CA    . GLY D 4  98  ? 86.405  96.122  104.682 1.00 43.29  ? 98   GLY C CA    1 
ATOM   6894  C  C     . GLY D 4  98  ? 86.936  95.345  103.499 1.00 51.10  ? 98   GLY C C     1 
ATOM   6895  O  O     . GLY D 4  98  ? 86.797  95.790  102.359 1.00 58.03  ? 98   GLY C O     1 
ATOM   6896  N  N     . ARG D 4  99  ? 87.537  94.190  103.735 1.00 31.96  ? 99   ARG C N     1 
ATOM   6897  C  CA    . ARG D 4  99  ? 88.052  93.377  102.646 1.00 33.54  ? 99   ARG C CA    1 
ATOM   6898  C  C     . ARG D 4  99  ? 87.065  92.337  102.150 1.00 36.69  ? 99   ARG C C     1 
ATOM   6899  O  O     . ARG D 4  99  ? 87.428  91.537  101.291 1.00 45.56  ? 99   ARG C O     1 
ATOM   6900  C  CB    . ARG D 4  99  ? 89.331  92.668  103.076 1.00 37.69  ? 99   ARG C CB    1 
ATOM   6901  C  CG    . ARG D 4  99  ? 90.443  93.597  103.450 1.00 57.23  ? 99   ARG C CG    1 
ATOM   6902  C  CD    . ARG D 4  99  ? 90.950  94.348  102.239 1.00 82.95  ? 99   ARG C CD    1 
ATOM   6903  N  NE    . ARG D 4  99  ? 91.983  95.304  102.615 1.00 111.84 ? 99   ARG C NE    1 
ATOM   6904  C  CZ    . ARG D 4  99  ? 93.257  94.981  102.788 1.00 132.02 ? 99   ARG C CZ    1 
ATOM   6905  N  NH1   . ARG D 4  99  ? 93.648  93.727  102.622 1.00 138.16 ? 99   ARG C NH1   1 
ATOM   6906  N  NH2   . ARG D 4  99  ? 94.138  95.907  103.135 1.00 135.66 ? 99   ARG C NH2   1 
ATOM   6907  N  N     . VAL D 4  100 ? 85.858  92.311  102.653 1.00 31.65  ? 100  VAL C N     1 
ATOM   6908  C  CA    . VAL D 4  100 ? 84.968  91.183  102.430 1.00 29.23  ? 100  VAL C CA    1 
ATOM   6909  C  C     . VAL D 4  100 ? 84.047  91.442  101.255 1.00 30.33  ? 100  VAL C C     1 
ATOM   6910  O  O     . VAL D 4  100 ? 83.563  92.555  101.059 1.00 31.87  ? 100  VAL C O     1 
ATOM   6911  C  CB    . VAL D 4  100 ? 84.149  90.901  103.686 1.00 22.77  ? 100  VAL C CB    1 
ATOM   6912  C  CG1   . VAL D 4  100 ? 83.182  89.873  103.376 1.00 25.57  ? 100  VAL C CG1   1 
ATOM   6913  C  CG2   . VAL D 4  100 ? 85.039  90.452  104.787 1.00 21.69  ? 100  VAL C CG2   1 
ATOM   6914  N  N     . THR D 4  101 ? 83.790  90.403  100.480 1.00 35.21  ? 101  THR C N     1 
ATOM   6915  C  CA    . THR D 4  101 ? 82.820  90.425  99.399  1.00 32.20  ? 101  THR C CA    1 
ATOM   6916  C  C     . THR D 4  101 ? 81.636  89.577  99.815  1.00 40.99  ? 101  THR C C     1 
ATOM   6917  O  O     . THR D 4  101 ? 81.726  88.349  99.830  1.00 41.35  ? 101  THR C O     1 
ATOM   6918  C  CB    . THR D 4  101 ? 83.428  89.866  98.125  1.00 46.65  ? 101  THR C CB    1 
ATOM   6919  O  OG1   . THR D 4  101 ? 84.485  90.718  97.677  1.00 55.76  ? 101  THR C OG1   1 
ATOM   6920  C  CG2   . THR D 4  101 ? 82.377  89.733  97.070  1.00 34.01  ? 101  THR C CG2   1 
ATOM   6921  N  N     . ILE D 4  102 ? 80.535  90.212  100.123 1.00 31.12  ? 102  ILE C N     1 
ATOM   6922  C  CA    . ILE D 4  102 ? 79.354  89.479  100.540 1.00 31.75  ? 102  ILE C CA    1 
ATOM   6923  C  C     . ILE D 4  102 ? 78.613  89.005  99.307  1.00 35.98  ? 102  ILE C C     1 
ATOM   6924  O  O     . ILE D 4  102 ? 78.466  89.748  98.337  1.00 47.00  ? 102  ILE C O     1 
ATOM   6925  C  CB    . ILE D 4  102 ? 78.472  90.359  101.427 1.00 41.45  ? 102  ILE C CB    1 
ATOM   6926  C  CG1   . ILE D 4  102 ? 79.158  90.582  102.756 1.00 39.66  ? 102  ILE C CG1   1 
ATOM   6927  C  CG2   . ILE D 4  102 ? 77.175  89.716  101.653 1.00 27.98  ? 102  ILE C CG2   1 
ATOM   6928  C  CD1   . ILE D 4  102 ? 78.461  91.553  103.604 1.00 36.72  ? 102  ILE C CD1   1 
ATOM   6929  N  N     . ALA D 4  103 ? 78.168  87.757  99.324  1.00 24.27  ? 103  ALA C N     1 
ATOM   6930  C  CA    . ALA D 4  103 ? 77.400  87.240  98.208  1.00 29.94  ? 103  ALA C CA    1 
ATOM   6931  C  C     . ALA D 4  103 ? 76.090  87.997  98.089  1.00 42.60  ? 103  ALA C C     1 
ATOM   6932  O  O     . ALA D 4  103 ? 75.612  88.599  99.046  1.00 55.37  ? 103  ALA C O     1 
ATOM   6933  C  CB    . ALA D 4  103 ? 77.121  85.757  98.399  1.00 21.72  ? 103  ALA C CB    1 
ATOM   6934  N  N     . GLN D 4  104 ? 75.521  87.993  96.886  1.00 43.34  ? 104  GLN C N     1 
ATOM   6935  C  CA    . GLN D 4  104 ? 74.223  88.621  96.652  1.00 48.72  ? 104  GLN C CA    1 
ATOM   6936  C  C     . GLN D 4  104 ? 74.230  90.061  97.131  1.00 43.22  ? 104  GLN C C     1 
ATOM   6937  O  O     . GLN D 4  104 ? 73.203  90.613  97.511  1.00 48.33  ? 104  GLN C O     1 
ATOM   6938  C  CB    . GLN D 4  104 ? 73.114  87.840  97.349  1.00 40.53  ? 104  GLN C CB    1 
ATOM   6939  C  CG    . GLN D 4  104 ? 72.953  86.439  96.846  1.00 59.10  ? 104  GLN C CG    1 
ATOM   6940  C  CD    . GLN D 4  104 ? 72.541  86.403  95.406  1.00 76.65  ? 104  GLN C CD    1 
ATOM   6941  O  OE1   . GLN D 4  104 ? 71.702  87.186  94.974  1.00 75.25  ? 104  GLN C OE1   1 
ATOM   6942  N  NE2   . GLN D 4  104 ? 73.136  85.502  94.644  1.00 83.57  ? 104  GLN C NE2   1 
ATOM   6943  N  N     . GLY D 4  105 ? 75.400  90.672  97.124  1.00 47.96  ? 105  GLY C N     1 
ATOM   6944  C  CA    . GLY D 4  105 ? 75.627  91.845  97.931  1.00 44.29  ? 105  GLY C CA    1 
ATOM   6945  C  C     . GLY D 4  105 ? 74.880  93.094  97.544  1.00 44.08  ? 105  GLY C C     1 
ATOM   6946  O  O     . GLY D 4  105 ? 74.147  93.648  98.359  1.00 49.81  ? 105  GLY C O     1 
ATOM   6947  N  N     . GLY D 4  106 ? 75.043  93.548  96.317  1.00 46.48  ? 106  GLY C N     1 
ATOM   6948  C  CA    . GLY D 4  106 ? 74.626  94.889  95.981  1.00 38.72  ? 106  GLY C CA    1 
ATOM   6949  C  C     . GLY D 4  106 ? 75.611  95.895  96.533  1.00 52.43  ? 106  GLY C C     1 
ATOM   6950  O  O     . GLY D 4  106 ? 76.652  95.553  97.087  1.00 49.08  ? 106  GLY C O     1 
ATOM   6951  N  N     . VAL D 4  107 ? 75.274  97.171  96.374  1.00 35.61  ? 107  VAL C N     1 
ATOM   6952  C  CA    . VAL D 4  107 ? 76.142  98.259  96.793  1.00 34.47  ? 107  VAL C CA    1 
ATOM   6953  C  C     . VAL D 4  107 ? 75.289  99.310  97.481  1.00 39.29  ? 107  VAL C C     1 
ATOM   6954  O  O     . VAL D 4  107 ? 74.094  99.430  97.208  1.00 48.85  ? 107  VAL C O     1 
ATOM   6955  C  CB    . VAL D 4  107 ? 76.889  98.852  95.588  1.00 37.03  ? 107  VAL C CB    1 
ATOM   6956  C  CG1   . VAL D 4  107 ? 77.746  100.012 95.998  1.00 33.99  ? 107  VAL C CG1   1 
ATOM   6957  C  CG2   . VAL D 4  107 ? 77.731  97.799  94.944  1.00 37.59  ? 107  VAL C CG2   1 
ATOM   6958  N  N     . LEU D 4  108 ? 75.892  100.048 98.408  1.00 50.97  ? 108  LEU C N     1 
ATOM   6959  C  CA    . LEU D 4  108 ? 75.240  101.234 98.935  1.00 52.59  ? 108  LEU C CA    1 
ATOM   6960  C  C     . LEU D 4  108 ? 74.850  102.156 97.789  1.00 57.79  ? 108  LEU C C     1 
ATOM   6961  O  O     . LEU D 4  108 ? 75.681  102.419 96.912  1.00 71.07  ? 108  LEU C O     1 
ATOM   6962  C  CB    . LEU D 4  108 ? 76.160  101.998 99.877  1.00 38.32  ? 108  LEU C CB    1 
ATOM   6963  C  CG    . LEU D 4  108 ? 76.436  101.444 101.252 1.00 42.79  ? 108  LEU C CG    1 
ATOM   6964  C  CD1   . LEU D 4  108 ? 77.480  102.308 101.903 1.00 37.20  ? 108  LEU C CD1   1 
ATOM   6965  C  CD2   . LEU D 4  108 ? 75.159  101.501 102.034 1.00 54.49  ? 108  LEU C CD2   1 
ATOM   6966  N  N     . PRO D 4  109 ? 73.625  102.671 97.759  1.00 59.85  ? 109  PRO C N     1 
ATOM   6967  C  CA    . PRO D 4  109 ? 73.280  103.628 96.708  1.00 64.63  ? 109  PRO C CA    1 
ATOM   6968  C  C     . PRO D 4  109 ? 74.175  104.846 96.828  1.00 62.79  ? 109  PRO C C     1 
ATOM   6969  O  O     . PRO D 4  109 ? 74.220  105.510 97.862  1.00 73.61  ? 109  PRO C O     1 
ATOM   6970  C  CB    . PRO D 4  109 ? 71.820  103.958 97.008  1.00 53.76  ? 109  PRO C CB    1 
ATOM   6971  C  CG    . PRO D 4  109 ? 71.320  102.761 97.721  1.00 48.02  ? 109  PRO C CG    1 
ATOM   6972  C  CD    . PRO D 4  109 ? 72.458  102.304 98.569  1.00 53.26  ? 109  PRO C CD    1 
ATOM   6973  N  N     . ASN D 4  110 ? 74.879  105.145 95.747  1.00 80.12  ? 110  ASN C N     1 
ATOM   6974  C  CA    . ASN D 4  110 ? 75.917  106.161 95.781  1.00 80.72  ? 110  ASN C CA    1 
ATOM   6975  C  C     . ASN D 4  110 ? 75.946  106.866 94.439  1.00 74.66  ? 110  ASN C C     1 
ATOM   6976  O  O     . ASN D 4  110 ? 76.009  106.210 93.397  1.00 77.90  ? 110  ASN C O     1 
ATOM   6977  C  CB    . ASN D 4  110 ? 77.273  105.526 96.081  1.00 86.08  ? 110  ASN C CB    1 
ATOM   6978  C  CG    . ASN D 4  110 ? 78.349  106.546 96.312  1.00 101.62 ? 110  ASN C CG    1 
ATOM   6979  O  OD1   . ASN D 4  110 ? 78.216  107.704 95.926  1.00 102.77 ? 110  ASN C OD1   1 
ATOM   6980  N  ND2   . ASN D 4  110 ? 79.435  106.123 96.943  1.00 102.54 ? 110  ASN C ND2   1 
ATOM   6981  N  N     . ILE D 4  111 ? 75.927  108.191 94.465  1.00 103.20 ? 111  ILE C N     1 
ATOM   6982  C  CA    . ILE D 4  111 ? 75.970  108.990 93.250  1.00 100.22 ? 111  ILE C CA    1 
ATOM   6983  C  C     . ILE D 4  111 ? 76.875  110.179 93.514  1.00 110.87 ? 111  ILE C C     1 
ATOM   6984  O  O     . ILE D 4  111 ? 76.692  110.894 94.503  1.00 107.50 ? 111  ILE C O     1 
ATOM   6985  C  CB    . ILE D 4  111 ? 74.571  109.467 92.826  1.00 104.72 ? 111  ILE C CB    1 
ATOM   6986  C  CG1   . ILE D 4  111 ? 73.666  108.271 92.542  1.00 108.74 ? 111  ILE C CG1   1 
ATOM   6987  C  CG2   . ILE D 4  111 ? 74.676  110.328 91.595  1.00 99.86  ? 111  ILE C CG2   1 
ATOM   6988  C  CD1   . ILE D 4  111 ? 72.203  108.618 92.412  1.00 107.13 ? 111  ILE C CD1   1 
ATOM   6989  N  N     . GLN D 4  112 ? 77.844  110.393 92.636  1.00 106.95 ? 112  GLN C N     1 
ATOM   6990  C  CA    . GLN D 4  112 ? 78.798  111.467 92.837  1.00 99.59  ? 112  GLN C CA    1 
ATOM   6991  C  C     . GLN D 4  112 ? 78.139  112.826 92.635  1.00 107.22 ? 112  GLN C C     1 
ATOM   6992  O  O     . GLN D 4  112 ? 77.078  112.951 92.023  1.00 114.33 ? 112  GLN C O     1 
ATOM   6993  C  CB    . GLN D 4  112 ? 79.979  111.304 91.894  1.00 98.59  ? 112  GLN C CB    1 
ATOM   6994  C  CG    . GLN D 4  112 ? 80.771  110.068 92.190  1.00 92.07  ? 112  GLN C CG    1 
ATOM   6995  C  CD    . GLN D 4  112 ? 81.311  110.075 93.594  1.00 102.21 ? 112  GLN C CD    1 
ATOM   6996  O  OE1   . GLN D 4  112 ? 81.714  111.117 94.108  1.00 100.59 ? 112  GLN C OE1   1 
ATOM   6997  N  NE2   . GLN D 4  112 ? 81.328  108.911 94.227  1.00 105.99 ? 112  GLN C NE2   1 
ATOM   6998  N  N     . SER D 4  113 ? 78.788  113.856 93.175  1.00 115.69 ? 113  SER C N     1 
ATOM   6999  C  CA    . SER D 4  113 ? 78.197  115.188 93.165  1.00 122.29 ? 113  SER C CA    1 
ATOM   7000  C  C     . SER D 4  113 ? 78.060  115.726 91.750  1.00 123.63 ? 113  SER C C     1 
ATOM   7001  O  O     . SER D 4  113 ? 77.003  116.239 91.370  1.00 129.39 ? 113  SER C O     1 
ATOM   7002  C  CB    . SER D 4  113 ? 79.039  116.139 94.012  1.00 115.94 ? 113  SER C CB    1 
ATOM   7003  O  OG    . SER D 4  113 ? 79.024  115.759 95.374  1.00 121.47 ? 113  SER C OG    1 
ATOM   7004  N  N     . VAL D 4  114 ? 79.123  115.621 90.951  1.00 114.72 ? 114  VAL C N     1 
ATOM   7005  C  CA    . VAL D 4  114 ? 79.145  116.326 89.679  1.00 110.99 ? 114  VAL C CA    1 
ATOM   7006  C  C     . VAL D 4  114 ? 78.161  115.742 88.682  1.00 116.51 ? 114  VAL C C     1 
ATOM   7007  O  O     . VAL D 4  114 ? 77.831  116.399 87.690  1.00 130.03 ? 114  VAL C O     1 
ATOM   7008  C  CB    . VAL D 4  114 ? 80.553  116.321 89.063  1.00 73.32  ? 114  VAL C CB    1 
ATOM   7009  C  CG1   . VAL D 4  114 ? 81.551  116.964 90.011  1.00 75.15  ? 114  VAL C CG1   1 
ATOM   7010  C  CG2   . VAL D 4  114 ? 80.957  114.917 88.691  1.00 81.17  ? 114  VAL C CG2   1 
ATOM   7011  N  N     . LEU D 4  115 ? 77.672  114.528 88.913  1.00 95.31  ? 115  LEU C N     1 
ATOM   7012  C  CA    . LEU D 4  115 ? 76.867  113.882 87.888  1.00 101.59 ? 115  LEU C CA    1 
ATOM   7013  C  C     . LEU D 4  115 ? 75.457  114.444 87.825  1.00 107.43 ? 115  LEU C C     1 
ATOM   7014  O  O     . LEU D 4  115 ? 74.859  114.481 86.746  1.00 104.03 ? 115  LEU C O     1 
ATOM   7015  C  CB    . LEU D 4  115 ? 76.828  112.383 88.137  1.00 93.92  ? 115  LEU C CB    1 
ATOM   7016  C  CG    . LEU D 4  115 ? 78.254  111.858 88.179  1.00 86.06  ? 115  LEU C CG    1 
ATOM   7017  C  CD1   . LEU D 4  115 ? 78.278  110.371 88.407  1.00 91.44  ? 115  LEU C CD1   1 
ATOM   7018  C  CD2   . LEU D 4  115 ? 78.979  112.231 86.918  1.00 89.18  ? 115  LEU C CD2   1 
ATOM   7019  N  N     . LEU D 4  116 ? 74.921  114.889 88.952  1.00 110.83 ? 116  LEU C N     1 
ATOM   7020  C  CA    . LEU D 4  116 ? 73.557  115.385 88.975  1.00 108.24 ? 116  LEU C CA    1 
ATOM   7021  C  C     . LEU D 4  116 ? 73.433  116.619 88.087  1.00 119.52 ? 116  LEU C C     1 
ATOM   7022  O  O     . LEU D 4  116 ? 74.378  117.409 87.988  1.00 114.06 ? 116  LEU C O     1 
ATOM   7023  C  CB    . LEU D 4  116 ? 73.149  115.721 90.407  1.00 112.15 ? 116  LEU C CB    1 
ATOM   7024  C  CG    . LEU D 4  116 ? 73.167  114.499 91.319  1.00 113.73 ? 116  LEU C CG    1 
ATOM   7025  C  CD1   . LEU D 4  116 ? 72.894  114.890 92.751  1.00 106.92 ? 116  LEU C CD1   1 
ATOM   7026  C  CD2   . LEU D 4  116 ? 72.152  113.487 90.842  1.00 128.58 ? 116  LEU C CD2   1 
ATOM   7027  N  N     . PRO D 4  117 ? 72.299  116.812 87.422  1.00 106.83 ? 117  PRO C N     1 
ATOM   7028  C  CA    . PRO D 4  117 ? 72.135  117.996 86.577  1.00 109.12 ? 117  PRO C CA    1 
ATOM   7029  C  C     . PRO D 4  117 ? 72.062  119.263 87.412  1.00 118.25 ? 117  PRO C C     1 
ATOM   7030  O  O     . PRO D 4  117 ? 71.823  119.235 88.620  1.00 109.21 ? 117  PRO C O     1 
ATOM   7031  C  CB    . PRO D 4  117 ? 70.814  117.731 85.850  1.00 101.68 ? 117  PRO C CB    1 
ATOM   7032  C  CG    . PRO D 4  117 ? 70.064  116.842 86.770  1.00 97.18  ? 117  PRO C CG    1 
ATOM   7033  C  CD    . PRO D 4  117 ? 71.096  115.964 87.420  1.00 104.13 ? 117  PRO C CD    1 
ATOM   7034  N  N     . LYS D 4  118 ? 72.280  120.388 86.742  1.00 92.20  ? 118  LYS C N     1 
ATOM   7035  C  CA    . LYS D 4  118 ? 72.269  121.684 87.405  1.00 97.09  ? 118  LYS C CA    1 
ATOM   7036  C  C     . LYS D 4  118 ? 70.874  122.032 87.908  1.00 97.04  ? 118  LYS C C     1 
ATOM   7037  O  O     . LYS D 4  118 ? 69.876  121.536 87.386  1.00 96.72  ? 118  LYS C O     1 
ATOM   7038  C  CB    . LYS D 4  118 ? 72.773  122.774 86.459  1.00 102.74 ? 118  LYS C CB    1 
ATOM   7039  N  N     . THR E 5  29  ? 76.899  61.494  106.904 1.00 130.03 ? 29   THR D N     1 
ATOM   7040  C  CA    . THR E 5  29  ? 77.833  62.402  107.555 1.00 131.98 ? 29   THR D CA    1 
ATOM   7041  C  C     . THR E 5  29  ? 77.149  63.712  107.868 1.00 128.96 ? 29   THR D C     1 
ATOM   7042  O  O     . THR E 5  29  ? 76.405  64.236  107.048 1.00 126.91 ? 29   THR D O     1 
ATOM   7043  C  CB    . THR E 5  29  ? 79.071  62.672  106.683 1.00 135.20 ? 29   THR D CB    1 
ATOM   7044  O  OG1   . THR E 5  29  ? 79.803  61.455  106.501 1.00 142.85 ? 29   THR D OG1   1 
ATOM   7045  C  CG2   . THR E 5  29  ? 79.976  63.706  107.326 1.00 124.97 ? 29   THR D CG2   1 
ATOM   7046  N  N     . ARG E 5  30  ? 77.401  64.233  109.063 1.00 115.05 ? 30   ARG D N     1 
ATOM   7047  C  CA    . ARG E 5  30  ? 76.852  65.510  109.488 1.00 106.34 ? 30   ARG D CA    1 
ATOM   7048  C  C     . ARG E 5  30  ? 77.902  66.601  109.345 1.00 102.98 ? 30   ARG D C     1 
ATOM   7049  O  O     . ARG E 5  30  ? 79.049  66.434  109.771 1.00 103.84 ? 30   ARG D O     1 
ATOM   7050  C  CB    . ARG E 5  30  ? 76.350  65.436  110.928 1.00 115.19 ? 30   ARG D CB    1 
ATOM   7051  C  CG    . ARG E 5  30  ? 77.407  65.079  111.937 1.00 115.95 ? 30   ARG D CG    1 
ATOM   7052  C  CD    . ARG E 5  30  ? 76.787  65.007  113.297 1.00 118.38 ? 30   ARG D CD    1 
ATOM   7053  N  NE    . ARG E 5  30  ? 75.733  64.006  113.292 1.00 121.03 ? 30   ARG D NE    1 
ATOM   7054  C  CZ    . ARG E 5  30  ? 75.946  62.705  113.435 1.00 118.83 ? 30   ARG D CZ    1 
ATOM   7055  N  NH1   . ARG E 5  30  ? 77.180  62.251  113.594 1.00 121.78 ? 30   ARG D NH1   1 
ATOM   7056  N  NH2   . ARG E 5  30  ? 74.927  61.859  113.414 1.00 106.91 ? 30   ARG D NH2   1 
ATOM   7057  N  N     . LYS E 5  31  ? 77.510  67.703  108.725 1.00 85.45  ? 31   LYS D N     1 
ATOM   7058  C  CA    . LYS E 5  31  ? 78.352  68.880  108.594 1.00 74.13  ? 31   LYS D CA    1 
ATOM   7059  C  C     . LYS E 5  31  ? 77.820  69.906  109.577 1.00 78.37  ? 31   LYS D C     1 
ATOM   7060  O  O     . LYS E 5  31  ? 76.754  70.484  109.356 1.00 85.93  ? 31   LYS D O     1 
ATOM   7061  C  CB    . LYS E 5  31  ? 78.308  69.411  107.165 1.00 65.36  ? 31   LYS D CB    1 
ATOM   7062  N  N     . GLU E 5  32  ? 78.553  70.133  110.657 1.00 63.13  ? 32   GLU D N     1 
ATOM   7063  C  CA    . GLU E 5  32  ? 78.052  71.030  111.681 1.00 50.06  ? 32   GLU D CA    1 
ATOM   7064  C  C     . GLU E 5  32  ? 78.148  72.476  111.223 1.00 51.38  ? 32   GLU D C     1 
ATOM   7065  O  O     . GLU E 5  32  ? 78.880  72.817  110.293 1.00 52.99  ? 32   GLU D O     1 
ATOM   7066  C  CB    . GLU E 5  32  ? 78.827  70.871  112.976 1.00 53.50  ? 32   GLU D CB    1 
ATOM   7067  C  CG    . GLU E 5  32  ? 80.263  71.255  112.839 1.00 62.03  ? 32   GLU D CG    1 
ATOM   7068  C  CD    . GLU E 5  32  ? 80.984  71.164  114.150 1.00 74.47  ? 32   GLU D CD    1 
ATOM   7069  O  OE1   . GLU E 5  32  ? 80.299  71.191  115.191 1.00 65.46  ? 32   GLU D OE1   1 
ATOM   7070  O  OE2   . GLU E 5  32  ? 82.227  71.059  114.147 1.00 76.79  ? 32   GLU D OE2   1 
ATOM   7071  N  N     . SER E 5  33  ? 77.386  73.333  111.889 1.00 48.49  ? 33   SER D N     1 
ATOM   7072  C  CA    . SER E 5  33  ? 77.458  74.762  111.642 1.00 47.20  ? 33   SER D CA    1 
ATOM   7073  C  C     . SER E 5  33  ? 76.911  75.484  112.861 1.00 40.06  ? 33   SER D C     1 
ATOM   7074  O  O     . SER E 5  33  ? 76.466  74.865  113.828 1.00 47.65  ? 33   SER D O     1 
ATOM   7075  C  CB    . SER E 5  33  ? 76.692  75.143  110.381 1.00 50.90  ? 33   SER D CB    1 
ATOM   7076  O  OG    . SER E 5  33  ? 75.315  74.883  110.547 1.00 43.96  ? 33   SER D OG    1 
ATOM   7077  N  N     . TYR E 5  34  ? 76.949  76.803  112.805 1.00 36.33  ? 34   TYR D N     1 
ATOM   7078  C  CA    . TYR E 5  34  ? 76.478  77.647  113.884 1.00 41.31  ? 34   TYR D CA    1 
ATOM   7079  C  C     . TYR E 5  34  ? 75.048  78.098  113.703 1.00 46.19  ? 34   TYR D C     1 
ATOM   7080  O  O     . TYR E 5  34  ? 74.600  78.981  114.436 1.00 38.65  ? 34   TYR D O     1 
ATOM   7081  C  CB    . TYR E 5  34  ? 77.381  78.855  114.034 1.00 28.26  ? 34   TYR D CB    1 
ATOM   7082  C  CG    . TYR E 5  34  ? 78.737  78.478  114.511 1.00 39.92  ? 34   TYR D CG    1 
ATOM   7083  C  CD1   . TYR E 5  34  ? 78.895  77.571  115.525 1.00 38.70  ? 34   TYR D CD1   1 
ATOM   7084  C  CD2   . TYR E 5  34  ? 79.856  79.004  113.930 1.00 34.26  ? 34   TYR D CD2   1 
ATOM   7085  C  CE1   . TYR E 5  34  ? 80.131  77.218  115.961 1.00 38.57  ? 34   TYR D CE1   1 
ATOM   7086  C  CE2   . TYR E 5  34  ? 81.092  78.655  114.354 1.00 31.66  ? 34   TYR D CE2   1 
ATOM   7087  C  CZ    . TYR E 5  34  ? 81.227  77.763  115.367 1.00 43.32  ? 34   TYR D CZ    1 
ATOM   7088  O  OH    . TYR E 5  34  ? 82.479  77.413  115.785 1.00 50.62  ? 34   TYR D OH    1 
ATOM   7089  N  N     . ALA E 5  35  ? 74.341  77.551  112.725 1.00 44.72  ? 35   ALA D N     1 
ATOM   7090  C  CA    . ALA E 5  35  ? 73.000  78.009  112.403 1.00 44.30  ? 35   ALA D CA    1 
ATOM   7091  C  C     . ALA E 5  35  ? 72.144  78.239  113.639 1.00 52.74  ? 35   ALA D C     1 
ATOM   7092  O  O     . ALA E 5  35  ? 71.827  79.388  113.965 1.00 58.21  ? 35   ALA D O     1 
ATOM   7093  C  CB    . ALA E 5  35  ? 72.310  77.002  111.489 1.00 51.45  ? 35   ALA D CB    1 
ATOM   7094  N  N     . ILE E 5  36  ? 71.794  77.170  114.353 1.00 50.83  ? 36   ILE D N     1 
ATOM   7095  C  CA    . ILE E 5  36  ? 70.763  77.302  115.376 1.00 58.47  ? 36   ILE D CA    1 
ATOM   7096  C  C     . ILE E 5  36  ? 71.148  78.350  116.402 1.00 51.74  ? 36   ILE D C     1 
ATOM   7097  O  O     . ILE E 5  36  ? 70.282  79.024  116.968 1.00 44.40  ? 36   ILE D O     1 
ATOM   7098  C  CB    . ILE E 5  36  ? 70.483  75.952  116.044 1.00 49.60  ? 36   ILE D CB    1 
ATOM   7099  C  CG1   . ILE E 5  36  ? 71.643  75.537  116.922 1.00 49.05  ? 36   ILE D CG1   1 
ATOM   7100  C  CG2   . ILE E 5  36  ? 70.329  74.896  115.002 1.00 65.95  ? 36   ILE D CG2   1 
ATOM   7101  C  CD1   . ILE E 5  36  ? 71.318  74.343  117.765 1.00 54.58  ? 36   ILE D CD1   1 
ATOM   7102  N  N     . TYR E 5  37  ? 72.440  78.528  116.643 1.00 38.98  ? 37   TYR D N     1 
ATOM   7103  C  CA    . TYR E 5  37  ? 72.876  79.527  117.604 1.00 41.27  ? 37   TYR D CA    1 
ATOM   7104  C  C     . TYR E 5  37  ? 72.527  80.922  117.123 1.00 47.62  ? 37   TYR D C     1 
ATOM   7105  O  O     . TYR E 5  37  ? 71.836  81.684  117.815 1.00 47.11  ? 37   TYR D O     1 
ATOM   7106  C  CB    . TYR E 5  37  ? 74.368  79.377  117.815 1.00 52.61  ? 37   TYR D CB    1 
ATOM   7107  C  CG    . TYR E 5  37  ? 74.673  78.033  118.363 1.00 52.53  ? 37   TYR D CG    1 
ATOM   7108  C  CD1   . TYR E 5  37  ? 74.026  77.579  119.480 1.00 55.68  ? 37   TYR D CD1   1 
ATOM   7109  C  CD2   . TYR E 5  37  ? 75.522  77.177  117.708 1.00 42.43  ? 37   TYR D CD2   1 
ATOM   7110  C  CE1   . TYR E 5  37  ? 74.275  76.345  119.977 1.00 55.79  ? 37   TYR D CE1   1 
ATOM   7111  C  CE2   . TYR E 5  37  ? 75.766  75.932  118.187 1.00 48.82  ? 37   TYR D CE2   1 
ATOM   7112  C  CZ    . TYR E 5  37  ? 75.145  75.523  119.329 1.00 59.53  ? 37   TYR D CZ    1 
ATOM   7113  O  OH    . TYR E 5  37  ? 75.382  74.271  119.832 1.00 65.90  ? 37   TYR D OH    1 
ATOM   7114  N  N     . VAL E 5  38  ? 72.984  81.266  115.921 1.00 42.21  ? 38   VAL D N     1 
ATOM   7115  C  CA    . VAL E 5  38  ? 72.601  82.534  115.322 1.00 37.73  ? 38   VAL D CA    1 
ATOM   7116  C  C     . VAL E 5  38  ? 71.107  82.717  115.420 1.00 32.27  ? 38   VAL D C     1 
ATOM   7117  O  O     . VAL E 5  38  ? 70.614  83.802  115.742 1.00 42.44  ? 38   VAL D O     1 
ATOM   7118  C  CB    . VAL E 5  38  ? 73.059  82.594  113.863 1.00 36.02  ? 38   VAL D CB    1 
ATOM   7119  C  CG1   . VAL E 5  38  ? 72.511  83.829  113.226 1.00 28.27  ? 38   VAL D CG1   1 
ATOM   7120  C  CG2   . VAL E 5  38  ? 74.549  82.587  113.806 1.00 24.52  ? 38   VAL D CG2   1 
ATOM   7121  N  N     . TYR E 5  39  ? 70.361  81.648  115.180 1.00 46.86  ? 39   TYR D N     1 
ATOM   7122  C  CA    . TYR E 5  39  ? 68.918  81.782  115.196 1.00 53.98  ? 39   TYR D CA    1 
ATOM   7123  C  C     . TYR E 5  39  ? 68.421  82.162  116.582 1.00 56.32  ? 39   TYR D C     1 
ATOM   7124  O  O     . TYR E 5  39  ? 67.582  83.060  116.722 1.00 60.41  ? 39   TYR D O     1 
ATOM   7125  C  CB    . TYR E 5  39  ? 68.287  80.491  114.715 1.00 65.41  ? 39   TYR D CB    1 
ATOM   7126  C  CG    . TYR E 5  39  ? 66.817  80.594  114.581 1.00 77.87  ? 39   TYR D CG    1 
ATOM   7127  C  CD1   . TYR E 5  39  ? 66.261  81.259  113.513 1.00 75.70  ? 39   TYR D CD1   1 
ATOM   7128  C  CD2   . TYR E 5  39  ? 65.980  80.025  115.512 1.00 94.27  ? 39   TYR D CD2   1 
ATOM   7129  C  CE1   . TYR E 5  39  ? 64.911  81.359  113.375 1.00 88.74  ? 39   TYR D CE1   1 
ATOM   7130  C  CE2   . TYR E 5  39  ? 64.625  80.119  115.386 1.00 98.45  ? 39   TYR D CE2   1 
ATOM   7131  C  CZ    . TYR E 5  39  ? 64.092  80.787  114.312 1.00 100.58 ? 39   TYR D CZ    1 
ATOM   7132  O  OH    . TYR E 5  39  ? 62.733  80.884  114.170 1.00 104.50 ? 39   TYR D OH    1 
ATOM   7133  N  N     . LYS E 5  40  ? 68.951  81.523  117.625 1.00 44.89  ? 40   LYS D N     1 
ATOM   7134  C  CA    . LYS E 5  40  ? 68.575  81.912  118.978 1.00 45.46  ? 40   LYS D CA    1 
ATOM   7135  C  C     . LYS E 5  40  ? 68.840  83.386  119.214 1.00 49.48  ? 40   LYS D C     1 
ATOM   7136  O  O     . LYS E 5  40  ? 67.936  84.138  119.594 1.00 52.76  ? 40   LYS D O     1 
ATOM   7137  C  CB    . LYS E 5  40  ? 69.319  81.085  120.015 1.00 40.96  ? 40   LYS D CB    1 
ATOM   7138  C  CG    . LYS E 5  40  ? 68.843  79.677  120.154 1.00 53.20  ? 40   LYS D CG    1 
ATOM   7139  C  CD    . LYS E 5  40  ? 69.630  78.999  121.250 1.00 66.63  ? 40   LYS D CD    1 
ATOM   7140  C  CE    . LYS E 5  40  ? 69.144  77.591  121.498 1.00 74.90  ? 40   LYS D CE    1 
ATOM   7141  N  NZ    . LYS E 5  40  ? 69.943  76.917  122.557 1.00 81.51  ? 40   LYS D NZ    1 
ATOM   7142  N  N     . VAL E 5  41  ? 70.081  83.821  118.997 1.00 44.47  ? 41   VAL D N     1 
ATOM   7143  C  CA    . VAL E 5  41  ? 70.405  85.219  119.261 1.00 39.43  ? 41   VAL D CA    1 
ATOM   7144  C  C     . VAL E 5  41  ? 69.449  86.128  118.516 1.00 44.60  ? 41   VAL D C     1 
ATOM   7145  O  O     . VAL E 5  41  ? 68.976  87.145  119.045 1.00 53.88  ? 41   VAL D O     1 
ATOM   7146  C  CB    . VAL E 5  41  ? 71.860  85.511  118.881 1.00 42.86  ? 41   VAL D CB    1 
ATOM   7147  C  CG1   . VAL E 5  41  ? 72.137  86.969  119.044 1.00 30.86  ? 41   VAL D CG1   1 
ATOM   7148  C  CG2   . VAL E 5  41  ? 72.773  84.721  119.753 1.00 32.22  ? 41   VAL D CG2   1 
ATOM   7149  N  N     . LEU E 5  42  ? 69.122  85.757  117.285 1.00 47.93  ? 42   LEU D N     1 
ATOM   7150  C  CA    . LEU E 5  42  ? 68.137  86.520  116.546 1.00 50.09  ? 42   LEU D CA    1 
ATOM   7151  C  C     . LEU E 5  42  ? 66.852  86.632  117.343 1.00 55.40  ? 42   LEU D C     1 
ATOM   7152  O  O     . LEU E 5  42  ? 66.346  87.734  117.576 1.00 55.09  ? 42   LEU D O     1 
ATOM   7153  C  CB    . LEU E 5  42  ? 67.884  85.868  115.199 1.00 59.32  ? 42   LEU D CB    1 
ATOM   7154  C  CG    . LEU E 5  42  ? 66.872  86.652  114.398 1.00 61.09  ? 42   LEU D CG    1 
ATOM   7155  C  CD1   . LEU E 5  42  ? 67.429  88.019  114.185 1.00 58.18  ? 42   LEU D CD1   1 
ATOM   7156  C  CD2   . LEU E 5  42  ? 66.637  85.980  113.082 1.00 56.17  ? 42   LEU D CD2   1 
ATOM   7157  N  N     . LYS E 5  43  ? 66.336  85.499  117.819 1.00 49.39  ? 43   LYS D N     1 
ATOM   7158  C  CA    . LYS E 5  43  ? 65.106  85.535  118.599 1.00 55.39  ? 43   LYS D CA    1 
ATOM   7159  C  C     . LYS E 5  43  ? 65.233  86.350  119.873 1.00 62.03  ? 43   LYS D C     1 
ATOM   7160  O  O     . LYS E 5  43  ? 64.220  86.834  120.381 1.00 62.73  ? 43   LYS D O     1 
ATOM   7161  C  CB    . LYS E 5  43  ? 64.638  84.123  118.933 1.00 54.52  ? 43   LYS D CB    1 
ATOM   7162  C  CG    . LYS E 5  43  ? 64.204  83.351  117.719 1.00 64.59  ? 43   LYS D CG    1 
ATOM   7163  C  CD    . LYS E 5  43  ? 63.098  84.126  117.041 1.00 70.54  ? 43   LYS D CD    1 
ATOM   7164  C  CE    . LYS E 5  43  ? 62.513  83.378  115.880 1.00 68.01  ? 43   LYS D CE    1 
ATOM   7165  N  NZ    . LYS E 5  43  ? 61.448  84.135  115.184 1.00 64.93  ? 43   LYS D NZ    1 
ATOM   7166  N  N     . GLN E 5  44  ? 66.434  86.533  120.398 1.00 62.07  ? 44   GLN D N     1 
ATOM   7167  C  CA    . GLN E 5  44  ? 66.597  87.432  121.526 1.00 50.68  ? 44   GLN D CA    1 
ATOM   7168  C  C     . GLN E 5  44  ? 66.888  88.855  121.103 1.00 54.74  ? 44   GLN D C     1 
ATOM   7169  O  O     . GLN E 5  44  ? 67.175  89.691  121.961 1.00 66.93  ? 44   GLN D O     1 
ATOM   7170  C  CB    . GLN E 5  44  ? 67.702  86.956  122.458 1.00 66.75  ? 44   GLN D CB    1 
ATOM   7171  C  CG    . GLN E 5  44  ? 67.380  85.675  123.163 1.00 82.56  ? 44   GLN D CG    1 
ATOM   7172  C  CD    . GLN E 5  44  ? 68.459  85.272  124.139 1.00 104.91 ? 44   GLN D CD    1 
ATOM   7173  O  OE1   . GLN E 5  44  ? 69.602  85.718  124.043 1.00 103.13 ? 44   GLN D OE1   1 
ATOM   7174  N  NE2   . GLN E 5  44  ? 68.104  84.413  125.081 1.00 113.82 ? 44   GLN D NE2   1 
ATOM   7175  N  N     . VAL E 5  45  ? 66.856  89.152  119.812 1.00 62.58  ? 45   VAL D N     1 
ATOM   7176  C  CA    . VAL E 5  45  ? 66.986  90.524  119.330 1.00 62.27  ? 45   VAL D CA    1 
ATOM   7177  C  C     . VAL E 5  45  ? 65.690  91.023  118.696 1.00 60.71  ? 45   VAL D C     1 
ATOM   7178  O  O     . VAL E 5  45  ? 65.064  91.954  119.199 1.00 57.10  ? 45   VAL D O     1 
ATOM   7179  C  CB    . VAL E 5  45  ? 68.177  90.662  118.363 1.00 47.05  ? 45   VAL D CB    1 
ATOM   7180  C  CG1   . VAL E 5  45  ? 68.184  92.034  117.758 1.00 41.66  ? 45   VAL D CG1   1 
ATOM   7181  C  CG2   . VAL E 5  45  ? 69.444  90.437  119.122 1.00 46.63  ? 45   VAL D CG2   1 
ATOM   7182  N  N     . HIS E 5  46  ? 65.272  90.413  117.591 1.00 62.58  ? 46   HIS D N     1 
ATOM   7183  C  CA    . HIS E 5  46  ? 64.049  90.796  116.887 1.00 56.67  ? 46   HIS D CA    1 
ATOM   7184  C  C     . HIS E 5  46  ? 63.089  89.621  116.911 1.00 69.68  ? 46   HIS D C     1 
ATOM   7185  O  O     . HIS E 5  46  ? 63.065  88.811  115.973 1.00 76.45  ? 46   HIS D O     1 
ATOM   7186  C  CB    . HIS E 5  46  ? 64.331  91.213  115.451 1.00 46.07  ? 46   HIS D CB    1 
ATOM   7187  C  CG    . HIS E 5  46  ? 65.080  92.494  115.329 1.00 55.50  ? 46   HIS D CG    1 
ATOM   7188  N  ND1   . HIS E 5  46  ? 64.523  93.706  115.665 1.00 58.39  ? 46   HIS D ND1   1 
ATOM   7189  C  CD2   . HIS E 5  46  ? 66.323  92.762  114.873 1.00 70.15  ? 46   HIS D CD2   1 
ATOM   7190  C  CE1   . HIS E 5  46  ? 65.399  94.666  115.438 1.00 57.50  ? 46   HIS D CE1   1 
ATOM   7191  N  NE2   . HIS E 5  46  ? 66.500  94.120  114.956 1.00 67.91  ? 46   HIS D NE2   1 
ATOM   7192  N  N     . PRO E 5  47  ? 62.258  89.512  117.941 1.00 74.80  ? 47   PRO D N     1 
ATOM   7193  C  CA    . PRO E 5  47  ? 61.388  88.335  118.075 1.00 70.07  ? 47   PRO D CA    1 
ATOM   7194  C  C     . PRO E 5  47  ? 60.619  87.997  116.820 1.00 73.19  ? 47   PRO D C     1 
ATOM   7195  O  O     . PRO E 5  47  ? 60.266  86.834  116.604 1.00 80.90  ? 47   PRO D O     1 
ATOM   7196  C  CB    . PRO E 5  47  ? 60.444  88.743  119.210 1.00 78.34  ? 47   PRO D CB    1 
ATOM   7197  C  CG    . PRO E 5  47  ? 61.232  89.718  120.005 1.00 74.36  ? 47   PRO D CG    1 
ATOM   7198  C  CD    . PRO E 5  47  ? 62.050  90.485  119.021 1.00 73.95  ? 47   PRO D CD    1 
ATOM   7199  N  N     . ASP E 5  48  ? 60.357  88.984  115.975 1.00 72.81  ? 48   ASP D N     1 
ATOM   7200  C  CA    . ASP E 5  48  ? 59.575  88.746  114.774 1.00 94.89  ? 48   ASP D CA    1 
ATOM   7201  C  C     . ASP E 5  48  ? 60.411  88.084  113.692 1.00 93.81  ? 48   ASP D C     1 
ATOM   7202  O  O     . ASP E 5  48  ? 59.980  87.116  113.059 1.00 100.87 ? 48   ASP D O     1 
ATOM   7203  C  CB    . ASP E 5  48  ? 59.032  90.072  114.260 1.00 118.09 ? 48   ASP D CB    1 
ATOM   7204  C  CG    . ASP E 5  48  ? 58.214  90.786  115.288 1.00 125.77 ? 48   ASP D CG    1 
ATOM   7205  O  OD1   . ASP E 5  48  ? 57.841  90.144  116.290 1.00 120.44 ? 48   ASP D OD1   1 
ATOM   7206  O  OD2   . ASP E 5  48  ? 57.958  91.991  115.105 1.00 125.06 ? 48   ASP D OD2   1 
ATOM   7207  N  N     . THR E 5  49  ? 61.619  88.591  113.490 1.00 82.17  ? 49   THR D N     1 
ATOM   7208  C  CA    . THR E 5  49  ? 62.306  88.449  112.218 1.00 67.69  ? 49   THR D CA    1 
ATOM   7209  C  C     . THR E 5  49  ? 62.678  87.008  111.925 1.00 70.97  ? 49   THR D C     1 
ATOM   7210  O  O     . THR E 5  49  ? 63.138  86.277  112.800 1.00 78.92  ? 49   THR D O     1 
ATOM   7211  C  CB    . THR E 5  49  ? 63.557  89.310  112.226 1.00 86.13  ? 49   THR D CB    1 
ATOM   7212  O  OG1   . THR E 5  49  ? 63.178  90.677  112.409 1.00 83.42  ? 49   THR D OG1   1 
ATOM   7213  C  CG2   . THR E 5  49  ? 64.293  89.175  110.932 1.00 81.13  ? 49   THR D CG2   1 
ATOM   7214  N  N     . GLY E 5  50  ? 62.462  86.601  110.688 1.00 46.18  ? 50   GLY D N     1 
ATOM   7215  C  CA    . GLY E 5  50  ? 63.021  85.372  110.183 1.00 52.28  ? 50   GLY D CA    1 
ATOM   7216  C  C     . GLY E 5  50  ? 64.268  85.678  109.391 1.00 61.58  ? 50   GLY D C     1 
ATOM   7217  O  O     . GLY E 5  50  ? 64.522  86.814  109.022 1.00 71.65  ? 50   GLY D O     1 
ATOM   7218  N  N     . ILE E 5  51  ? 65.061  84.652  109.123 1.00 37.10  ? 51   ILE D N     1 
ATOM   7219  C  CA    . ILE E 5  51  ? 66.346  84.851  108.478 1.00 43.48  ? 51   ILE D CA    1 
ATOM   7220  C  C     . ILE E 5  51  ? 66.492  83.815  107.381 1.00 47.30  ? 51   ILE D C     1 
ATOM   7221  O  O     . ILE E 5  51  ? 66.449  82.611  107.645 1.00 49.20  ? 51   ILE D O     1 
ATOM   7222  C  CB    . ILE E 5  51  ? 67.493  84.786  109.495 1.00 42.87  ? 51   ILE D CB    1 
ATOM   7223  C  CG1   . ILE E 5  51  ? 68.823  85.095  108.845 1.00 48.07  ? 51   ILE D CG1   1 
ATOM   7224  C  CG2   . ILE E 5  51  ? 67.529  83.472  110.207 1.00 33.61  ? 51   ILE D CG2   1 
ATOM   7225  C  CD1   . ILE E 5  51  ? 69.898  85.312  109.855 1.00 44.52  ? 51   ILE D CD1   1 
ATOM   7226  N  N     . SER E 5  52  ? 66.627  84.277  106.150 1.00 41.14  ? 52   SER D N     1 
ATOM   7227  C  CA    . SER E 5  52  ? 66.600  83.360  105.030 1.00 30.29  ? 52   SER D CA    1 
ATOM   7228  C  C     . SER E 5  52  ? 67.816  82.461  105.057 1.00 34.98  ? 52   SER D C     1 
ATOM   7229  O  O     . SER E 5  52  ? 68.825  82.762  105.688 1.00 30.07  ? 52   SER D O     1 
ATOM   7230  C  CB    . SER E 5  52  ? 66.561  84.113  103.712 1.00 59.56  ? 52   SER D CB    1 
ATOM   7231  O  OG    . SER E 5  52  ? 67.741  84.863  103.546 1.00 58.82  ? 52   SER D OG    1 
ATOM   7232  N  N     . SER E 5  53  ? 67.710  81.338  104.355 1.00 21.59  ? 53   SER D N     1 
ATOM   7233  C  CA    . SER E 5  53  ? 68.782  80.354  104.387 1.00 28.52  ? 53   SER D CA    1 
ATOM   7234  C  C     . SER E 5  53  ? 70.101  80.960  103.944 1.00 33.24  ? 53   SER D C     1 
ATOM   7235  O  O     . SER E 5  53  ? 71.131  80.770  104.598 1.00 35.21  ? 53   SER D O     1 
ATOM   7236  C  CB    . SER E 5  53  ? 68.436  79.165  103.509 1.00 14.39  ? 53   SER D CB    1 
ATOM   7237  O  OG    . SER E 5  53  ? 69.522  78.262  103.485 1.00 35.30  ? 53   SER D OG    1 
ATOM   7238  N  N     . LYS E 5  54  ? 70.093  81.694  102.836 1.00 27.99  ? 54   LYS D N     1 
ATOM   7239  C  CA    . LYS E 5  54  ? 71.332  82.287  102.355 1.00 26.47  ? 54   LYS D CA    1 
ATOM   7240  C  C     . LYS E 5  54  ? 71.965  83.155  103.430 1.00 26.44  ? 54   LYS D C     1 
ATOM   7241  O  O     . LYS E 5  54  ? 73.155  83.019  103.734 1.00 39.28  ? 54   LYS D O     1 
ATOM   7242  C  CB    . LYS E 5  54  ? 71.069  83.098  101.097 1.00 20.55  ? 54   LYS D CB    1 
ATOM   7243  N  N     . ALA E 5  55  ? 71.176  84.028  104.046 1.00 25.56  ? 55   ALA D N     1 
ATOM   7244  C  CA    . ALA E 5  55  ? 71.723  84.868  105.099 1.00 22.86  ? 55   ALA D CA    1 
ATOM   7245  C  C     . ALA E 5  55  ? 72.303  84.028  106.216 1.00 22.78  ? 55   ALA D C     1 
ATOM   7246  O  O     . ALA E 5  55  ? 73.337  84.376  106.789 1.00 32.62  ? 55   ALA D O     1 
ATOM   7247  C  CB    . ALA E 5  55  ? 70.654  85.799  105.645 1.00 35.12  ? 55   ALA D CB    1 
ATOM   7248  N  N     . MET E 5  56  ? 71.665  82.910  106.535 1.00 20.16  ? 56   MET D N     1 
ATOM   7249  C  CA    . MET E 5  56  ? 72.221  82.055  107.569 1.00 24.26  ? 56   MET D CA    1 
ATOM   7250  C  C     . MET E 5  56  ? 73.568  81.508  107.149 1.00 22.25  ? 56   MET D C     1 
ATOM   7251  O  O     . MET E 5  56  ? 74.481  81.390  107.971 1.00 27.92  ? 56   MET D O     1 
ATOM   7252  C  CB    . MET E 5  56  ? 71.272  80.917  107.893 1.00 22.09  ? 56   MET D CB    1 
ATOM   7253  C  CG    . MET E 5  56  ? 71.806  80.030  108.961 1.00 57.76  ? 56   MET D CG    1 
ATOM   7254  S  SD    . MET E 5  56  ? 72.062  81.016  110.426 1.00 38.70  ? 56   MET D SD    1 
ATOM   7255  C  CE    . MET E 5  56  ? 70.369  81.326  110.879 1.00 25.81  ? 56   MET D CE    1 
ATOM   7256  N  N     . SER E 5  57  ? 73.723  81.178  105.871 1.00 19.61  ? 57   SER D N     1 
ATOM   7257  C  CA    . SER E 5  57  ? 75.035  80.766  105.400 1.00 21.41  ? 57   SER D CA    1 
ATOM   7258  C  C     . SER E 5  57  ? 76.054  81.872  105.603 1.00 24.84  ? 57   SER D C     1 
ATOM   7259  O  O     . SER E 5  57  ? 77.156  81.627  106.102 1.00 17.23  ? 57   SER D O     1 
ATOM   7260  C  CB    . SER E 5  57  ? 74.979  80.368  103.938 1.00 15.33  ? 57   SER D CB    1 
ATOM   7261  O  OG    . SER E 5  57  ? 76.284  80.084  103.485 1.00 45.01  ? 57   SER D OG    1 
ATOM   7262  N  N     . ILE E 5  58  ? 75.708  83.103  105.234 1.00 13.43  ? 58   ILE D N     1 
ATOM   7263  C  CA    . ILE E 5  58  ? 76.663  84.188  105.419 1.00 17.82  ? 58   ILE D CA    1 
ATOM   7264  C  C     . ILE E 5  58  ? 77.053  84.307  106.877 1.00 21.18  ? 58   ILE D C     1 
ATOM   7265  O  O     . ILE E 5  58  ? 78.230  84.225  107.219 1.00 21.18  ? 58   ILE D O     1 
ATOM   7266  C  CB    . ILE E 5  58  ? 76.121  85.515  104.893 1.00 22.27  ? 58   ILE D CB    1 
ATOM   7267  C  CG1   . ILE E 5  58  ? 76.140  85.512  103.386 1.00 13.62  ? 58   ILE D CG1   1 
ATOM   7268  C  CG2   . ILE E 5  58  ? 76.975  86.616  105.380 1.00 8.82   ? 58   ILE D CG2   1 
ATOM   7269  C  CD1   . ILE E 5  58  ? 75.520  86.726  102.825 1.00 26.13  ? 58   ILE D CD1   1 
ATOM   7270  N  N     . MET E 5  59  ? 76.079  84.493  107.761 1.00 13.31  ? 59   MET D N     1 
ATOM   7271  C  CA    . MET E 5  59  ? 76.427  84.605  109.171 1.00 10.96  ? 59   MET D CA    1 
ATOM   7272  C  C     . MET E 5  59  ? 77.293  83.443  109.623 1.00 21.82  ? 59   MET D C     1 
ATOM   7273  O  O     . MET E 5  59  ? 78.204  83.617  110.438 1.00 23.69  ? 59   MET D O     1 
ATOM   7274  C  CB    . MET E 5  59  ? 75.180  84.698  110.032 1.00 15.82  ? 59   MET D CB    1 
ATOM   7275  C  CG    . MET E 5  59  ? 74.487  86.002  109.912 1.00 16.72  ? 59   MET D CG    1 
ATOM   7276  S  SD    . MET E 5  59  ? 75.656  87.253  110.379 1.00 32.56  ? 59   MET D SD    1 
ATOM   7277  C  CE    . MET E 5  59  ? 75.964  86.739  112.053 1.00 30.17  ? 59   MET D CE    1 
ATOM   7278  N  N     . ASN E 5  60  ? 77.047  82.256  109.090 1.00 16.62  ? 60   ASN D N     1 
ATOM   7279  C  CA    . ASN E 5  60  ? 77.933  81.152  109.410 1.00 12.98  ? 60   ASN D CA    1 
ATOM   7280  C  C     . ASN E 5  60  ? 79.367  81.457  109.015 1.00 24.61  ? 60   ASN D C     1 
ATOM   7281  O  O     . ASN E 5  60  ? 80.237  81.579  109.885 1.00 31.87  ? 60   ASN D O     1 
ATOM   7282  C  CB    . ASN E 5  60  ? 77.481  79.880  108.732 1.00 44.49  ? 60   ASN D CB    1 
ATOM   7283  C  CG    . ASN E 5  60  ? 78.287  78.713  109.160 1.00 11.94  ? 60   ASN D CG    1 
ATOM   7284  O  OD1   . ASN E 5  60  ? 78.791  78.682  110.275 1.00 21.84  ? 60   ASN D OD1   1 
ATOM   7285  N  ND2   . ASN E 5  60  ? 78.434  77.740  108.281 1.00 56.69  ? 60   ASN D ND2   1 
ATOM   7286  N  N     . SER E 5  61  ? 79.632  81.589  107.712 1.00 12.23  ? 61   SER D N     1 
ATOM   7287  C  CA    . SER E 5  61  ? 81.007  81.813  107.281 1.00 14.80  ? 61   SER D CA    1 
ATOM   7288  C  C     . SER E 5  61  ? 81.619  83.004  107.975 1.00 15.76  ? 61   SER D C     1 
ATOM   7289  O  O     . SER E 5  61  ? 82.829  83.034  108.203 1.00 19.93  ? 61   SER D O     1 
ATOM   7290  C  CB    . SER E 5  61  ? 81.085  82.005  105.778 1.00 21.79  ? 61   SER D CB    1 
ATOM   7291  O  OG    . SER E 5  61  ? 80.796  80.796  105.114 1.00 47.48  ? 61   SER D OG    1 
ATOM   7292  N  N     . PHE E 5  62  ? 80.810  83.979  108.337 1.00 14.25  ? 62   PHE D N     1 
ATOM   7293  C  CA    . PHE E 5  62  ? 81.291  85.063  109.163 1.00 10.41  ? 62   PHE D CA    1 
ATOM   7294  C  C     . PHE E 5  62  ? 81.871  84.501  110.441 1.00 20.40  ? 62   PHE D C     1 
ATOM   7295  O  O     . PHE E 5  62  ? 83.085  84.552  110.649 1.00 19.81  ? 62   PHE D O     1 
ATOM   7296  C  CB    . PHE E 5  62  ? 80.172  86.022  109.494 1.00 12.55  ? 62   PHE D CB    1 
ATOM   7297  C  CG    . PHE E 5  62  ? 80.579  87.105  110.403 1.00 25.45  ? 62   PHE D CG    1 
ATOM   7298  C  CD1   . PHE E 5  62  ? 81.165  88.235  109.914 1.00 26.62  ? 62   PHE D CD1   1 
ATOM   7299  C  CD2   . PHE E 5  62  ? 80.385  86.993  111.751 1.00 18.05  ? 62   PHE D CD2   1 
ATOM   7300  C  CE1   . PHE E 5  62  ? 81.537  89.233  110.749 1.00 29.51  ? 62   PHE D CE1   1 
ATOM   7301  C  CE2   . PHE E 5  62  ? 80.760  87.988  112.587 1.00 25.87  ? 62   PHE D CE2   1 
ATOM   7302  C  CZ    . PHE E 5  62  ? 81.336  89.109  112.088 1.00 25.85  ? 62   PHE D CZ    1 
ATOM   7303  N  N     . VAL E 5  63  ? 81.016  83.939  111.292 1.00 9.57   ? 63   VAL D N     1 
ATOM   7304  C  CA    . VAL E 5  63  ? 81.472  83.529  112.615 1.00 11.72  ? 63   VAL D CA    1 
ATOM   7305  C  C     . VAL E 5  63  ? 82.695  82.636  112.528 1.00 16.16  ? 63   VAL D C     1 
ATOM   7306  O  O     . VAL E 5  63  ? 83.643  82.791  113.306 1.00 27.53  ? 63   VAL D O     1 
ATOM   7307  C  CB    . VAL E 5  63  ? 80.343  82.845  113.384 1.00 15.47  ? 63   VAL D CB    1 
ATOM   7308  C  CG1   . VAL E 5  63  ? 80.897  82.267  114.627 1.00 6.34   ? 63   VAL D CG1   1 
ATOM   7309  C  CG2   . VAL E 5  63  ? 79.311  83.855  113.720 1.00 39.58  ? 63   VAL D CG2   1 
ATOM   7310  N  N     . ASN E 5  64  ? 82.720  81.708  111.576 1.00 10.85  ? 64   ASN D N     1 
ATOM   7311  C  CA    . ASN E 5  64  ? 83.949  80.943  111.417 1.00 19.70  ? 64   ASN D CA    1 
ATOM   7312  C  C     . ASN E 5  64  ? 85.121  81.851  111.115 1.00 21.19  ? 64   ASN D C     1 
ATOM   7313  O  O     . ASN E 5  64  ? 86.206  81.683  111.678 1.00 12.12  ? 64   ASN D O     1 
ATOM   7314  C  CB    . ASN E 5  64  ? 83.810  79.894  110.331 1.00 7.61   ? 64   ASN D CB    1 
ATOM   7315  C  CG    . ASN E 5  64  ? 83.077  78.685  110.809 1.00 28.12  ? 64   ASN D CG    1 
ATOM   7316  O  OD1   . ASN E 5  64  ? 83.610  77.906  111.591 1.00 35.28  ? 64   ASN D OD1   1 
ATOM   7317  N  ND2   . ASN E 5  64  ? 81.857  78.499  110.336 1.00 36.40  ? 64   ASN D ND2   1 
ATOM   7318  N  N     . ASP E 5  65  ? 84.925  82.828  110.239 1.00 11.29  ? 65   ASP D N     1 
ATOM   7319  C  CA    . ASP E 5  65  ? 86.021  83.722  109.894 1.00 6.66   ? 65   ASP D CA    1 
ATOM   7320  C  C     . ASP E 5  65  ? 86.542  84.458  111.119 1.00 17.40  ? 65   ASP D C     1 
ATOM   7321  O  O     . ASP E 5  65  ? 87.711  84.314  111.491 1.00 20.04  ? 65   ASP D O     1 
ATOM   7322  C  CB    . ASP E 5  65  ? 85.578  84.704  108.831 1.00 9.16   ? 65   ASP D CB    1 
ATOM   7323  C  CG    . ASP E 5  65  ? 86.716  85.472  108.273 1.00 31.85  ? 65   ASP D CG    1 
ATOM   7324  O  OD1   . ASP E 5  65  ? 87.865  85.155  108.635 1.00 50.41  ? 65   ASP D OD1   1 
ATOM   7325  O  OD2   . ASP E 5  65  ? 86.467  86.391  107.471 1.00 31.12  ? 65   ASP D OD2   1 
ATOM   7326  N  N     . VAL E 5  66  ? 85.697  85.281  111.741 1.00 15.17  ? 66   VAL D N     1 
ATOM   7327  C  CA    . VAL E 5  66  ? 86.132  86.026  112.918 1.00 16.27  ? 66   VAL D CA    1 
ATOM   7328  C  C     . VAL E 5  66  ? 86.811  85.111  113.915 1.00 23.58  ? 66   VAL D C     1 
ATOM   7329  O  O     . VAL E 5  66  ? 87.852  85.453  114.489 1.00 16.29  ? 66   VAL D O     1 
ATOM   7330  C  CB    . VAL E 5  66  ? 84.950  86.752  113.565 1.00 20.72  ? 66   VAL D CB    1 
ATOM   7331  C  CG1   . VAL E 5  66  ? 85.356  87.273  114.899 1.00 14.89  ? 66   VAL D CG1   1 
ATOM   7332  C  CG2   . VAL E 5  66  ? 84.549  87.886  112.706 1.00 18.18  ? 66   VAL D CG2   1 
ATOM   7333  N  N     . PHE E 5  67  ? 86.259  83.925  114.119 1.00 13.83  ? 67   PHE D N     1 
ATOM   7334  C  CA    . PHE E 5  67  ? 86.910  82.995  115.024 1.00 7.20   ? 67   PHE D CA    1 
ATOM   7335  C  C     . PHE E 5  67  ? 88.339  82.712  114.595 1.00 15.94  ? 67   PHE D C     1 
ATOM   7336  O  O     . PHE E 5  67  ? 89.254  82.738  115.420 1.00 31.60  ? 67   PHE D O     1 
ATOM   7337  C  CB    . PHE E 5  67  ? 86.122  81.711  115.106 1.00 43.93  ? 67   PHE D CB    1 
ATOM   7338  C  CG    . PHE E 5  67  ? 86.801  80.665  115.870 1.00 15.09  ? 67   PHE D CG    1 
ATOM   7339  C  CD1   . PHE E 5  67  ? 86.761  80.659  117.224 1.00 21.85  ? 67   PHE D CD1   1 
ATOM   7340  C  CD2   . PHE E 5  67  ? 87.485  79.681  115.227 1.00 9.80   ? 67   PHE D CD2   1 
ATOM   7341  C  CE1   . PHE E 5  67  ? 87.385  79.690  117.914 1.00 22.55  ? 67   PHE D CE1   1 
ATOM   7342  C  CE2   . PHE E 5  67  ? 88.106  78.712  115.917 1.00 3.27   ? 67   PHE D CE2   1 
ATOM   7343  C  CZ    . PHE E 5  67  ? 88.059  78.715  117.262 1.00 11.25  ? 67   PHE D CZ    1 
ATOM   7344  N  N     . GLU E 5  68  ? 88.563  82.461  113.306 1.00 10.85  ? 68   GLU D N     1 
ATOM   7345  C  CA    . GLU E 5  68  ? 89.927  82.171  112.878 1.00 23.63  ? 68   GLU D CA    1 
ATOM   7346  C  C     . GLU E 5  68  ? 90.843  83.362  113.086 1.00 22.56  ? 68   GLU D C     1 
ATOM   7347  O  O     . GLU E 5  68  ? 92.004  83.190  113.462 1.00 24.47  ? 68   GLU D O     1 
ATOM   7348  C  CB    . GLU E 5  68  ? 89.980  81.740  111.423 1.00 31.08  ? 68   GLU D CB    1 
ATOM   7349  C  CG    . GLU E 5  68  ? 89.348  80.411  111.148 1.00 57.01  ? 68   GLU D CG    1 
ATOM   7350  C  CD    . GLU E 5  68  ? 89.481  80.013  109.694 1.00 76.82  ? 68   GLU D CD    1 
ATOM   7351  O  OE1   . GLU E 5  68  ? 89.999  80.828  108.904 1.00 75.54  ? 68   GLU D OE1   1 
ATOM   7352  O  OE2   . GLU E 5  68  ? 89.059  78.896  109.332 1.00 84.60  ? 68   GLU D OE2   1 
ATOM   7353  N  N     . ARG E 5  69  ? 90.365  84.577  112.835 1.00 6.53   ? 69   ARG D N     1 
ATOM   7354  C  CA    . ARG E 5  69  ? 91.228  85.720  113.103 1.00 10.46  ? 69   ARG D CA    1 
ATOM   7355  C  C     . ARG E 5  69  ? 91.626  85.756  114.563 1.00 26.63  ? 69   ARG D C     1 
ATOM   7356  O  O     . ARG E 5  69  ? 92.816  85.810  114.889 1.00 30.71  ? 69   ARG D O     1 
ATOM   7357  C  CB    . ARG E 5  69  ? 90.556  87.027  112.723 1.00 17.65  ? 69   ARG D CB    1 
ATOM   7358  C  CG    . ARG E 5  69  ? 90.395  87.256  111.257 1.00 20.41  ? 69   ARG D CG    1 
ATOM   7359  C  CD    . ARG E 5  69  ? 89.742  88.587  111.035 1.00 27.23  ? 69   ARG D CD    1 
ATOM   7360  N  NE    . ARG E 5  69  ? 89.371  88.787  109.648 1.00 36.68  ? 69   ARG D NE    1 
ATOM   7361  C  CZ    . ARG E 5  69  ? 88.619  89.795  109.232 1.00 38.14  ? 69   ARG D CZ    1 
ATOM   7362  N  NH1   . ARG E 5  69  ? 88.171  90.675  110.105 1.00 38.28  ? 69   ARG D NH1   1 
ATOM   7363  N  NH2   . ARG E 5  69  ? 88.305  89.920  107.954 1.00 42.65  ? 69   ARG D NH2   1 
ATOM   7364  N  N     . ILE E 5  70  ? 90.648  85.701  115.465 1.00 13.69  ? 70   ILE D N     1 
ATOM   7365  C  CA    . ILE E 5  70  ? 90.965  85.861  116.880 1.00 23.22  ? 70   ILE D CA    1 
ATOM   7366  C  C     . ILE E 5  70  ? 91.893  84.756  117.359 1.00 23.56  ? 70   ILE D C     1 
ATOM   7367  O  O     . ILE E 5  70  ? 92.968  85.023  117.900 1.00 31.30  ? 70   ILE D O     1 
ATOM   7368  C  CB    . ILE E 5  70  ? 89.694  85.924  117.728 1.00 15.32  ? 70   ILE D CB    1 
ATOM   7369  C  CG1   . ILE E 5  70  ? 89.027  87.266  117.532 1.00 12.10  ? 70   ILE D CG1   1 
ATOM   7370  C  CG2   . ILE E 5  70  ? 90.042  85.743  119.152 1.00 10.73  ? 70   ILE D CG2   1 
ATOM   7371  C  CD1   . ILE E 5  70  ? 87.735  87.380  118.243 1.00 44.71  ? 70   ILE D CD1   1 
ATOM   7372  N  N     . ALA E 5  71  ? 91.505  83.502  117.176 1.00 25.27  ? 71   ALA D N     1 
ATOM   7373  C  CA    . ALA E 5  71  ? 92.399  82.452  117.640 1.00 35.61  ? 71   ALA D CA    1 
ATOM   7374  C  C     . ALA E 5  71  ? 93.745  82.504  116.945 1.00 45.37  ? 71   ALA D C     1 
ATOM   7375  O  O     . ALA E 5  71  ? 94.735  82.049  117.515 1.00 48.75  ? 71   ALA D O     1 
ATOM   7376  C  CB    . ALA E 5  71  ? 91.786  81.082  117.441 1.00 43.65  ? 71   ALA D CB    1 
ATOM   7377  N  N     . GLY E 5  72  ? 93.818  83.058  115.745 1.00 47.05  ? 72   GLY D N     1 
ATOM   7378  C  CA    . GLY E 5  72  ? 95.115  83.261  115.141 1.00 30.02  ? 72   GLY D CA    1 
ATOM   7379  C  C     . GLY E 5  72  ? 95.953  84.208  115.968 1.00 47.08  ? 72   GLY D C     1 
ATOM   7380  O  O     . GLY E 5  72  ? 97.062  83.866  116.400 1.00 47.36  ? 72   GLY D O     1 
ATOM   7381  N  N     . GLU E 5  73  ? 95.419  85.401  116.223 1.00 44.66  ? 73   GLU D N     1 
ATOM   7382  C  CA    . GLU E 5  73  ? 96.163  86.367  117.015 1.00 36.40  ? 73   GLU D CA    1 
ATOM   7383  C  C     . GLU E 5  73  ? 96.562  85.781  118.351 1.00 42.20  ? 73   GLU D C     1 
ATOM   7384  O  O     . GLU E 5  73  ? 97.743  85.753  118.695 1.00 57.17  ? 73   GLU D O     1 
ATOM   7385  C  CB    . GLU E 5  73  ? 95.353  87.629  117.223 1.00 46.42  ? 73   GLU D CB    1 
ATOM   7386  C  CG    . GLU E 5  73  ? 95.141  88.361  115.966 1.00 61.08  ? 73   GLU D CG    1 
ATOM   7387  C  CD    . GLU E 5  73  ? 96.441  88.674  115.305 1.00 81.55  ? 73   GLU D CD    1 
ATOM   7388  O  OE1   . GLU E 5  73  ? 97.409  88.987  116.025 1.00 77.13  ? 73   GLU D OE1   1 
ATOM   7389  O  OE2   . GLU E 5  73  ? 96.502  88.609  114.065 1.00 89.07  ? 73   GLU D OE2   1 
ATOM   7390  N  N     . ALA E 5  74  ? 95.593  85.289  119.117 1.00 24.69  ? 74   ALA D N     1 
ATOM   7391  C  CA    . ALA E 5  74  ? 95.931  84.709  120.406 1.00 36.38  ? 74   ALA D CA    1 
ATOM   7392  C  C     . ALA E 5  74  ? 96.998  83.652  120.268 1.00 40.40  ? 74   ALA D C     1 
ATOM   7393  O  O     . ALA E 5  74  ? 97.847  83.512  121.150 1.00 41.90  ? 74   ALA D O     1 
ATOM   7394  C  CB    . ALA E 5  74  ? 94.703  84.109  121.064 1.00 35.22  ? 74   ALA D CB    1 
ATOM   7395  N  N     . SER E 5  75  ? 96.988  82.910  119.172 1.00 78.38  ? 75   SER D N     1 
ATOM   7396  C  CA    . SER E 5  75  ? 98.071  81.974  118.955 1.00 78.90  ? 75   SER D CA    1 
ATOM   7397  C  C     . SER E 5  75  ? 99.401  82.690  118.949 1.00 17.47  ? 75   SER D C     1 
ATOM   7398  O  O     . SER E 5  75  ? 100.198 82.526  119.876 1.00 21.86  ? 75   SER D O     1 
ATOM   7399  C  CB    . SER E 5  75  ? 97.909  81.223  117.652 1.00 41.34  ? 75   SER D CB    1 
ATOM   7400  O  OG    . SER E 5  75  ? 99.055  80.436  117.434 1.00 56.71  ? 75   SER D OG    1 
ATOM   7401  N  N     . ARG E 5  76  ? 99.661  83.503  117.936 1.00 47.88  ? 76   ARG D N     1 
ATOM   7402  C  CA    . ARG E 5  76  ? 101.039 83.959  117.881 1.00 36.32  ? 76   ARG D CA    1 
ATOM   7403  C  C     . ARG E 5  76  ? 101.378 85.019  118.919 1.00 50.61  ? 76   ARG D C     1 
ATOM   7404  O  O     . ARG E 5  76  ? 102.555 85.359  119.056 1.00 59.79  ? 76   ARG D O     1 
ATOM   7405  C  CB    . ARG E 5  76  ? 101.414 84.417  116.481 1.00 66.70  ? 76   ARG D CB    1 
ATOM   7406  C  CG    . ARG E 5  76  ? 100.632 85.514  115.856 1.00 72.40  ? 76   ARG D CG    1 
ATOM   7407  C  CD    . ARG E 5  76  ? 101.243 85.725  114.479 1.00 76.82  ? 76   ARG D CD    1 
ATOM   7408  N  NE    . ARG E 5  76  ? 100.557 86.705  113.650 1.00 98.59  ? 76   ARG D NE    1 
ATOM   7409  C  CZ    . ARG E 5  76  ? 99.552  86.403  112.841 1.00 103.46 ? 76   ARG D CZ    1 
ATOM   7410  N  NH1   . ARG E 5  76  ? 99.130  85.151  112.760 1.00 100.05 ? 76   ARG D NH1   1 
ATOM   7411  N  NH2   . ARG E 5  76  ? 98.978  87.344  112.107 1.00 99.23  ? 76   ARG D NH2   1 
ATOM   7412  N  N     . LEU E 5  77  ? 100.410 85.517  119.686 1.00 43.79  ? 77   LEU D N     1 
ATOM   7413  C  CA    . LEU E 5  77  ? 100.756 86.147  120.955 1.00 40.74  ? 77   LEU D CA    1 
ATOM   7414  C  C     . LEU E 5  77  ? 101.280 85.139  121.951 1.00 48.34  ? 77   LEU D C     1 
ATOM   7415  O  O     . LEU E 5  77  ? 102.314 85.364  122.585 1.00 55.48  ? 77   LEU D O     1 
ATOM   7416  C  CB    . LEU E 5  77  ? 99.576  86.883  121.548 1.00 54.44  ? 77   LEU D CB    1 
ATOM   7417  C  CG    . LEU E 5  77  ? 99.644  88.298  121.087 1.00 53.19  ? 77   LEU D CG    1 
ATOM   7418  C  CD1   . LEU E 5  77  ? 98.446  89.011  121.561 1.00 52.93  ? 77   LEU D CD1   1 
ATOM   7419  C  CD2   . LEU E 5  77  ? 100.835 88.786  121.813 1.00 45.61  ? 77   LEU D CD2   1 
ATOM   7420  N  N     . ALA E 5  78  ? 100.576 84.031  122.126 1.00 34.56  ? 78   ALA D N     1 
ATOM   7421  C  CA    . ALA E 5  78  ? 101.136 82.995  122.968 1.00 30.75  ? 78   ALA D CA    1 
ATOM   7422  C  C     . ALA E 5  78  ? 102.511 82.598  122.498 1.00 45.11  ? 78   ALA D C     1 
ATOM   7423  O  O     . ALA E 5  78  ? 103.309 82.103  123.294 1.00 58.05  ? 78   ALA D O     1 
ATOM   7424  C  CB    . ALA E 5  78  ? 100.241 81.771  122.983 1.00 50.12  ? 78   ALA D CB    1 
ATOM   7425  N  N     . HIS E 5  79  ? 102.813 82.807  121.223 1.00 40.49  ? 79   HIS D N     1 
ATOM   7426  C  CA    . HIS E 5  79  ? 104.140 82.467  120.741 1.00 44.82  ? 79   HIS D CA    1 
ATOM   7427  C  C     . HIS E 5  79  ? 105.175 83.543  121.034 1.00 40.31  ? 79   HIS D C     1 
ATOM   7428  O  O     . HIS E 5  79  ? 106.283 83.220  121.459 1.00 39.46  ? 79   HIS D O     1 
ATOM   7429  C  CB    . HIS E 5  79  ? 104.095 82.177  119.254 1.00 61.67  ? 79   HIS D CB    1 
ATOM   7430  C  CG    . HIS E 5  79  ? 105.430 81.868  118.676 1.00 89.95  ? 79   HIS D CG    1 
ATOM   7431  N  ND1   . HIS E 5  79  ? 106.249 80.891  119.192 1.00 100.33 ? 79   HIS D ND1   1 
ATOM   7432  C  CD2   . HIS E 5  79  ? 106.082 82.384  117.610 1.00 100.50 ? 79   HIS D CD2   1 
ATOM   7433  C  CE1   . HIS E 5  79  ? 107.359 80.832  118.481 1.00 108.09 ? 79   HIS D CE1   1 
ATOM   7434  N  NE2   . HIS E 5  79  ? 107.281 81.725  117.512 1.00 106.97 ? 79   HIS D NE2   1 
ATOM   7435  N  N     . TYR E 5  80  ? 104.864 84.818  120.815 1.00 40.15  ? 80   TYR D N     1 
ATOM   7436  C  CA    . TYR E 5  80  ? 105.925 85.807  120.974 1.00 39.99  ? 80   TYR D CA    1 
ATOM   7437  C  C     . TYR E 5  80  ? 106.416 85.920  122.400 1.00 40.73  ? 80   TYR D C     1 
ATOM   7438  O  O     . TYR E 5  80  ? 107.520 86.416  122.615 1.00 50.05  ? 80   TYR D O     1 
ATOM   7439  C  CB    . TYR E 5  80  ? 105.496 87.195  120.520 1.00 62.08  ? 80   TYR D CB    1 
ATOM   7440  C  CG    . TYR E 5  80  ? 105.222 87.311  119.051 1.00 73.65  ? 80   TYR D CG    1 
ATOM   7441  C  CD1   . TYR E 5  80  ? 105.934 86.567  118.135 1.00 72.20  ? 80   TYR D CD1   1 
ATOM   7442  C  CD2   . TYR E 5  80  ? 104.281 88.201  118.575 1.00 73.47  ? 80   TYR D CD2   1 
ATOM   7443  C  CE1   . TYR E 5  80  ? 105.686 86.681  116.789 1.00 72.70  ? 80   TYR D CE1   1 
ATOM   7444  C  CE2   . TYR E 5  80  ? 104.033 88.326  117.237 1.00 79.53  ? 80   TYR D CE2   1 
ATOM   7445  C  CZ    . TYR E 5  80  ? 104.735 87.567  116.347 1.00 82.69  ? 80   TYR D CZ    1 
ATOM   7446  O  OH    . TYR E 5  80  ? 104.481 87.692  115.002 1.00 82.74  ? 80   TYR D OH    1 
ATOM   7447  N  N     . ASN E 5  81  ? 105.630 85.509  123.377 1.00 30.54  ? 81   ASN D N     1 
ATOM   7448  C  CA    . ASN E 5  81  ? 106.095 85.518  124.750 1.00 35.14  ? 81   ASN D CA    1 
ATOM   7449  C  C     . ASN E 5  81  ? 106.628 84.173  125.189 1.00 42.24  ? 81   ASN D C     1 
ATOM   7450  O  O     . ASN E 5  81  ? 107.048 84.031  126.338 1.00 37.31  ? 81   ASN D O     1 
ATOM   7451  C  CB    . ASN E 5  81  ? 104.975 85.951  125.675 1.00 20.64  ? 81   ASN D CB    1 
ATOM   7452  C  CG    . ASN E 5  81  ? 104.635 87.386  125.501 1.00 19.93  ? 81   ASN D CG    1 
ATOM   7453  O  OD1   . ASN E 5  81  ? 105.324 88.260  126.010 1.00 37.22  ? 81   ASN D OD1   1 
ATOM   7454  N  ND2   . ASN E 5  81  ? 103.582 87.652  124.752 1.00 62.94  ? 81   ASN D ND2   1 
ATOM   7455  N  N     . LYS E 5  82  ? 106.602 83.184  124.311 1.00 37.64  ? 82   LYS D N     1 
ATOM   7456  C  CA    . LYS E 5  82  ? 107.055 81.837  124.611 1.00 39.29  ? 82   LYS D CA    1 
ATOM   7457  C  C     . LYS E 5  82  ? 106.271 81.210  125.750 1.00 34.60  ? 82   LYS D C     1 
ATOM   7458  O  O     . LYS E 5  82  ? 106.737 80.265  126.377 1.00 38.50  ? 82   LYS D O     1 
ATOM   7459  C  CB    . LYS E 5  82  ? 108.554 81.825  124.901 1.00 24.99  ? 82   LYS D CB    1 
ATOM   7460  C  CG    . LYS E 5  82  ? 109.365 82.191  123.673 1.00 28.25  ? 82   LYS D CG    1 
ATOM   7461  C  CD    . LYS E 5  82  ? 110.799 82.567  123.991 1.00 50.78  ? 82   LYS D CD    1 
ATOM   7462  C  CE    . LYS E 5  82  ? 111.569 81.398  124.571 1.00 61.44  ? 82   LYS D CE    1 
ATOM   7463  N  NZ    . LYS E 5  82  ? 112.982 81.762  124.878 1.00 50.68  ? 82   LYS D NZ    1 
ATOM   7464  N  N     . ARG E 5  83  ? 105.073 81.703  126.020 1.00 52.36  ? 83   ARG D N     1 
ATOM   7465  C  CA    . ARG E 5  83  ? 104.119 80.908  126.765 1.00 47.42  ? 83   ARG D CA    1 
ATOM   7466  C  C     . ARG E 5  83  ? 103.683 79.741  125.906 1.00 59.86  ? 83   ARG D C     1 
ATOM   7467  O  O     . ARG E 5  83  ? 103.737 79.795  124.680 1.00 67.17  ? 83   ARG D O     1 
ATOM   7468  C  CB    . ARG E 5  83  ? 102.893 81.725  127.138 1.00 49.11  ? 83   ARG D CB    1 
ATOM   7469  C  CG    . ARG E 5  83  ? 103.144 82.902  128.027 1.00 73.62  ? 83   ARG D CG    1 
ATOM   7470  C  CD    . ARG E 5  83  ? 103.390 82.471  129.433 1.00 89.60  ? 83   ARG D CD    1 
ATOM   7471  N  NE    . ARG E 5  83  ? 103.509 83.627  130.304 1.00 101.59 ? 83   ARG D NE    1 
ATOM   7472  C  CZ    . ARG E 5  83  ? 104.659 84.209  130.606 1.00 110.30 ? 83   ARG D CZ    1 
ATOM   7473  N  NH1   . ARG E 5  83  ? 105.791 83.734  130.114 1.00 110.42 ? 83   ARG D NH1   1 
ATOM   7474  N  NH2   . ARG E 5  83  ? 104.677 85.260  131.408 1.00 109.17 ? 83   ARG D NH2   1 
ATOM   7475  N  N     . SER E 5  84  ? 103.262 78.673  126.552 1.00 54.71  ? 84   SER D N     1 
ATOM   7476  C  CA    . SER E 5  84  ? 102.726 77.537  125.833 1.00 61.46  ? 84   SER D CA    1 
ATOM   7477  C  C     . SER E 5  84  ? 101.209 77.506  125.811 1.00 58.62  ? 84   SER D C     1 
ATOM   7478  O  O     . SER E 5  84  ? 100.639 76.616  125.180 1.00 51.60  ? 84   SER D O     1 
ATOM   7479  C  CB    . SER E 5  84  ? 103.252 76.250  126.447 1.00 65.98  ? 84   SER D CB    1 
ATOM   7480  O  OG    . SER E 5  84  ? 102.829 76.166  127.791 1.00 73.03  ? 84   SER D OG    1 
ATOM   7481  N  N     . THR E 5  85  ? 100.538 78.452  126.463 1.00 54.93  ? 85   THR D N     1 
ATOM   7482  C  CA    . THR E 5  85  ? 99.132  78.290  126.808 1.00 48.73  ? 85   THR D CA    1 
ATOM   7483  C  C     . THR E 5  85  ? 98.316  79.518  126.449 1.00 48.68  ? 85   THR D C     1 
ATOM   7484  O  O     . THR E 5  85  ? 98.491  80.577  127.053 1.00 60.77  ? 85   THR D O     1 
ATOM   7485  C  CB    . THR E 5  85  ? 98.992  78.006  128.298 1.00 47.67  ? 85   THR D CB    1 
ATOM   7486  O  OG1   . THR E 5  85  ? 99.625  76.762  128.603 1.00 67.76  ? 85   THR D OG1   1 
ATOM   7487  C  CG2   . THR E 5  85  ? 97.552  77.943  128.689 1.00 46.74  ? 85   THR D CG2   1 
ATOM   7488  N  N     . ILE E 5  86  ? 97.388  79.360  125.509 1.00 37.80  ? 86   ILE D N     1 
ATOM   7489  C  CA    . ILE E 5  86  ? 96.345  80.355  125.320 1.00 33.20  ? 86   ILE D CA    1 
ATOM   7490  C  C     . ILE E 5  86  ? 95.533  80.476  126.594 1.00 34.13  ? 86   ILE D C     1 
ATOM   7491  O  O     . ILE E 5  86  ? 95.013  79.480  127.103 1.00 40.83  ? 86   ILE D O     1 
ATOM   7492  C  CB    . ILE E 5  86  ? 95.435  79.941  124.165 1.00 23.78  ? 86   ILE D CB    1 
ATOM   7493  C  CG1   . ILE E 5  86  ? 96.173  79.979  122.857 1.00 21.26  ? 86   ILE D CG1   1 
ATOM   7494  C  CG2   . ILE E 5  86  ? 94.260  80.825  124.094 1.00 15.68  ? 86   ILE D CG2   1 
ATOM   7495  C  CD1   . ILE E 5  86  ? 95.365  79.410  121.767 1.00 21.47  ? 86   ILE D CD1   1 
ATOM   7496  N  N     . THR E 5  87  ? 95.392  81.686  127.113 1.00 28.93  ? 87   THR D N     1 
ATOM   7497  C  CA    . THR E 5  87  ? 94.507  81.888  128.248 1.00 29.53  ? 87   THR D CA    1 
ATOM   7498  C  C     . THR E 5  87  ? 93.564  83.030  127.945 1.00 24.83  ? 87   THR D C     1 
ATOM   7499  O  O     . THR E 5  87  ? 93.585  83.610  126.863 1.00 29.35  ? 87   THR D O     1 
ATOM   7500  C  CB    . THR E 5  87  ? 95.262  82.200  129.537 1.00 33.72  ? 87   THR D CB    1 
ATOM   7501  O  OG1   . THR E 5  87  ? 95.982  83.421  129.376 1.00 32.31  ? 87   THR D OG1   1 
ATOM   7502  C  CG2   . THR E 5  87  ? 96.227  81.102  129.865 1.00 31.25  ? 87   THR D CG2   1 
ATOM   7503  N  N     . SER E 5  88  ? 92.738  83.365  128.930 1.00 34.67  ? 88   SER D N     1 
ATOM   7504  C  CA    . SER E 5  88  ? 91.784  84.442  128.735 1.00 39.33  ? 88   SER D CA    1 
ATOM   7505  C  C     . SER E 5  88  ? 92.494  85.742  128.418 1.00 39.81  ? 88   SER D C     1 
ATOM   7506  O  O     . SER E 5  88  ? 92.038  86.516  127.573 1.00 47.98  ? 88   SER D O     1 
ATOM   7507  C  CB    . SER E 5  88  ? 90.921  84.610  129.972 1.00 14.37  ? 88   SER D CB    1 
ATOM   7508  O  OG    . SER E 5  88  ? 91.722  85.039  131.047 1.00 31.93  ? 88   SER D OG    1 
ATOM   7509  N  N     . ARG E 5  89  ? 93.625  85.994  129.062 1.00 19.83  ? 89   ARG D N     1 
ATOM   7510  C  CA    . ARG E 5  89  ? 94.239  87.303  128.914 1.00 19.34  ? 89   ARG D CA    1 
ATOM   7511  C  C     . ARG E 5  89  ? 94.653  87.553  127.473 1.00 24.29  ? 89   ARG D C     1 
ATOM   7512  O  O     . ARG E 5  89  ? 94.432  88.648  126.945 1.00 37.52  ? 89   ARG D O     1 
ATOM   7513  C  CB    . ARG E 5  89  ? 95.419  87.443  129.862 1.00 58.07  ? 89   ARG D CB    1 
ATOM   7514  C  CG    . ARG E 5  89  ? 95.952  88.840  129.927 1.00 61.31  ? 89   ARG D CG    1 
ATOM   7515  C  CD    . ARG E 5  89  ? 96.907  88.993  131.085 1.00 75.53  ? 89   ARG D CD    1 
ATOM   7516  N  NE    . ARG E 5  89  ? 97.294  90.386  131.259 1.00 79.48  ? 89   ARG D NE    1 
ATOM   7517  C  CZ    . ARG E 5  89  ? 97.915  90.859  132.330 1.00 68.69  ? 89   ARG D CZ    1 
ATOM   7518  N  NH1   . ARG E 5  89  ? 98.214  90.055  133.337 1.00 59.71  ? 89   ARG D NH1   1 
ATOM   7519  N  NH2   . ARG E 5  89  ? 98.224  92.141  132.399 1.00 71.88  ? 89   ARG D NH2   1 
ATOM   7520  N  N     . GLU E 5  90  ? 95.214  86.547  126.802 1.00 27.96  ? 90   GLU D N     1 
ATOM   7521  C  CA    . GLU E 5  90  ? 95.484  86.710  125.380 1.00 27.41  ? 90   GLU D CA    1 
ATOM   7522  C  C     . GLU E 5  90  ? 94.216  87.066  124.630 1.00 29.99  ? 90   GLU D C     1 
ATOM   7523  O  O     . GLU E 5  90  ? 94.122  88.141  124.035 1.00 28.23  ? 90   GLU D O     1 
ATOM   7524  C  CB    . GLU E 5  90  ? 96.114  85.458  124.791 1.00 42.15  ? 90   GLU D CB    1 
ATOM   7525  C  CG    . GLU E 5  90  ? 97.531  85.303  125.186 1.00 47.36  ? 90   GLU D CG    1 
ATOM   7526  C  CD    . GLU E 5  90  ? 97.669  84.699  126.538 1.00 69.81  ? 90   GLU D CD    1 
ATOM   7527  O  OE1   . GLU E 5  90  ? 96.622  84.375  127.134 1.00 65.26  ? 90   GLU D OE1   1 
ATOM   7528  O  OE2   . GLU E 5  90  ? 98.815  84.563  127.017 1.00 78.40  ? 90   GLU D OE2   1 
ATOM   7529  N  N     . ILE E 5  91  ? 93.206  86.199  124.696 1.00 21.39  ? 91   ILE D N     1 
ATOM   7530  C  CA    . ILE E 5  91  ? 91.987  86.443  123.937 1.00 14.92  ? 91   ILE D CA    1 
ATOM   7531  C  C     . ILE E 5  91  ? 91.530  87.868  124.138 1.00 13.09  ? 91   ILE D C     1 
ATOM   7532  O  O     . ILE E 5  91  ? 91.159  88.557  123.186 1.00 17.54  ? 91   ILE D O     1 
ATOM   7533  C  CB    . ILE E 5  91  ? 90.894  85.452  124.339 1.00 16.17  ? 91   ILE D CB    1 
ATOM   7534  C  CG1   . ILE E 5  91  ? 91.376  84.047  124.120 1.00 14.83  ? 91   ILE D CG1   1 
ATOM   7535  C  CG2   . ILE E 5  91  ? 89.727  85.645  123.458 1.00 11.29  ? 91   ILE D CG2   1 
ATOM   7536  C  CD1   . ILE E 5  91  ? 91.645  83.793  122.709 1.00 47.11  ? 91   ILE D CD1   1 
ATOM   7537  N  N     . GLN E 5  92  ? 91.608  88.356  125.370 1.00 14.22  ? 92   GLN D N     1 
ATOM   7538  C  CA    . GLN E 5  92  ? 91.312  89.757  125.605 1.00 24.61  ? 92   GLN D CA    1 
ATOM   7539  C  C     . GLN E 5  92  ? 92.196  90.648  124.751 1.00 28.35  ? 92   GLN D C     1 
ATOM   7540  O  O     . GLN E 5  92  ? 91.703  91.541  124.053 1.00 27.87  ? 92   GLN D O     1 
ATOM   7541  C  CB    . GLN E 5  92  ? 91.473  90.084  127.077 1.00 11.65  ? 92   GLN D CB    1 
ATOM   7542  C  CG    . GLN E 5  92  ? 91.154  91.501  127.383 1.00 14.06  ? 92   GLN D CG    1 
ATOM   7543  C  CD    . GLN E 5  92  ? 91.057  91.750  128.858 1.00 19.47  ? 92   GLN D CD    1 
ATOM   7544  O  OE1   . GLN E 5  92  ? 91.013  90.817  129.653 1.00 37.01  ? 92   GLN D OE1   1 
ATOM   7545  N  NE2   . GLN E 5  92  ? 91.056  93.015  129.241 1.00 17.80  ? 92   GLN D NE2   1 
ATOM   7546  N  N     . THR E 5  93  ? 93.504  90.404  124.757 1.00 5.15   ? 93   THR D N     1 
ATOM   7547  C  CA    . THR E 5  93  ? 94.380  91.251  123.958 1.00 10.88  ? 93   THR D CA    1 
ATOM   7548  C  C     . THR E 5  93  ? 94.015  91.179  122.486 1.00 5.44   ? 93   THR D C     1 
ATOM   7549  O  O     . THR E 5  93  ? 93.669  92.194  121.873 1.00 13.43  ? 93   THR D O     1 
ATOM   7550  C  CB    . THR E 5  93  ? 95.833  90.867  124.166 1.00 5.48   ? 93   THR D CB    1 
ATOM   7551  O  OG1   . THR E 5  93  ? 96.220  91.209  125.496 1.00 5.77   ? 93   THR D OG1   1 
ATOM   7552  C  CG2   . THR E 5  93  ? 96.686  91.613  123.218 1.00 6.54   ? 93   THR D CG2   1 
ATOM   7553  N  N     . ALA E 5  94  ? 94.045  89.980  121.910 1.00 8.81   ? 94   ALA D N     1 
ATOM   7554  C  CA    . ALA E 5  94  ? 93.748  89.820  120.494 1.00 9.72   ? 94   ALA D CA    1 
ATOM   7555  C  C     . ALA E 5  94  ? 92.461  90.525  120.113 1.00 20.04  ? 94   ALA D C     1 
ATOM   7556  O  O     . ALA E 5  94  ? 92.395  91.215  119.088 1.00 16.48  ? 94   ALA D O     1 
ATOM   7557  C  CB    . ALA E 5  94  ? 93.658  88.343  120.155 1.00 24.44  ? 94   ALA D CB    1 
ATOM   7558  N  N     . VAL E 5  95  ? 91.432  90.385  120.939 1.00 23.71  ? 95   VAL D N     1 
ATOM   7559  C  CA    . VAL E 5  95  ? 90.212  91.135  120.700 1.00 14.25  ? 95   VAL D CA    1 
ATOM   7560  C  C     . VAL E 5  95  ? 90.503  92.621  120.674 1.00 20.89  ? 95   VAL D C     1 
ATOM   7561  O  O     . VAL E 5  95  ? 89.941  93.358  119.864 1.00 18.63  ? 95   VAL D O     1 
ATOM   7562  C  CB    . VAL E 5  95  ? 89.153  90.787  121.749 1.00 20.85  ? 95   VAL D CB    1 
ATOM   7563  C  CG1   . VAL E 5  95  ? 88.050  91.752  121.661 1.00 16.24  ? 95   VAL D CG1   1 
ATOM   7564  C  CG2   . VAL E 5  95  ? 88.614  89.429  121.467 1.00 17.43  ? 95   VAL D CG2   1 
ATOM   7565  N  N     . ARG E 5  96  ? 91.404  93.089  121.527 1.00 13.32  ? 96   ARG D N     1 
ATOM   7566  C  CA    . ARG E 5  96  ? 91.702  94.511  121.460 1.00 17.32  ? 96   ARG D CA    1 
ATOM   7567  C  C     . ARG E 5  96  ? 92.545  94.888  120.259 1.00 20.78  ? 96   ARG D C     1 
ATOM   7568  O  O     . ARG E 5  96  ? 92.636  96.074  119.946 1.00 26.73  ? 96   ARG D O     1 
ATOM   7569  C  CB    . ARG E 5  96  ? 92.385  94.978  122.730 1.00 7.84   ? 96   ARG D CB    1 
ATOM   7570  C  CG    . ARG E 5  96  ? 91.442  95.116  123.880 1.00 18.03  ? 96   ARG D CG    1 
ATOM   7571  C  CD    . ARG E 5  96  ? 92.204  95.344  125.134 1.00 43.44  ? 96   ARG D CD    1 
ATOM   7572  N  NE    . ARG E 5  96  ? 93.070  96.495  125.004 1.00 62.54  ? 96   ARG D NE    1 
ATOM   7573  C  CZ    . ARG E 5  96  ? 93.995  96.808  125.897 1.00 58.94  ? 96   ARG D CZ    1 
ATOM   7574  N  NH1   . ARG E 5  96  ? 94.154  96.044  126.968 1.00 42.86  ? 96   ARG D NH1   1 
ATOM   7575  N  NH2   . ARG E 5  96  ? 94.765  97.871  125.718 1.00 58.43  ? 96   ARG D NH2   1 
ATOM   7576  N  N     . LEU E 5  97  ? 93.186  93.932  119.593 1.00 21.81  ? 97   LEU D N     1 
ATOM   7577  C  CA    . LEU E 5  97  ? 93.876  94.300  118.365 1.00 17.78  ? 97   LEU D CA    1 
ATOM   7578  C  C     . LEU E 5  97  ? 92.941  94.332  117.173 1.00 23.56  ? 97   LEU D C     1 
ATOM   7579  O  O     . LEU E 5  97  ? 93.012  95.252  116.357 1.00 31.83  ? 97   LEU D O     1 
ATOM   7580  C  CB    . LEU E 5  97  ? 95.024  93.350  118.073 1.00 14.50  ? 97   LEU D CB    1 
ATOM   7581  C  CG    . LEU E 5  97  ? 96.137  93.437  119.092 1.00 26.37  ? 97   LEU D CG    1 
ATOM   7582  C  CD1   . LEU E 5  97  ? 97.259  92.521  118.707 1.00 15.88  ? 97   LEU D CD1   1 
ATOM   7583  C  CD2   . LEU E 5  97  ? 96.593  94.842  119.147 1.00 28.79  ? 97   LEU D CD2   1 
ATOM   7584  N  N     . LEU E 5  98  ? 92.073  93.337  117.031 1.00 17.74  ? 98   LEU D N     1 
ATOM   7585  C  CA    . LEU E 5  98  ? 91.324  93.248  115.785 1.00 24.42  ? 98   LEU D CA    1 
ATOM   7586  C  C     . LEU E 5  98  ? 90.193  94.263  115.720 1.00 29.27  ? 98   LEU D C     1 
ATOM   7587  O  O     . LEU E 5  98  ? 90.065  94.998  114.737 1.00 36.01  ? 98   LEU D O     1 
ATOM   7588  C  CB    . LEU E 5  98  ? 90.784  91.843  115.612 1.00 20.31  ? 98   LEU D CB    1 
ATOM   7589  C  CG    . LEU E 5  98  ? 91.943  90.871  115.639 1.00 36.73  ? 98   LEU D CG    1 
ATOM   7590  C  CD1   . LEU E 5  98  ? 91.428  89.459  115.514 1.00 52.81  ? 98   LEU D CD1   1 
ATOM   7591  C  CD2   . LEU E 5  98  ? 92.914  91.202  114.543 1.00 44.80  ? 98   LEU D CD2   1 
ATOM   7592  N  N     . LEU E 5  99  ? 89.374  94.326  116.750 1.00 22.91  ? 99   LEU D N     1 
ATOM   7593  C  CA    . LEU E 5  99  ? 88.135  95.072  116.666 1.00 15.21  ? 99   LEU D CA    1 
ATOM   7594  C  C     . LEU E 5  99  ? 88.416  96.559  116.810 1.00 27.87  ? 99   LEU D C     1 
ATOM   7595  O  O     . LEU E 5  99  ? 89.034  96.964  117.795 1.00 42.10  ? 99   LEU D O     1 
ATOM   7596  C  CB    . LEU E 5  99  ? 87.192  94.623  117.753 1.00 23.65  ? 99   LEU D CB    1 
ATOM   7597  C  CG    . LEU E 5  99  ? 87.022  93.118  117.764 1.00 27.04  ? 99   LEU D CG    1 
ATOM   7598  C  CD1   . LEU E 5  99  ? 86.024  92.726  118.803 1.00 34.01  ? 99   LEU D CD1   1 
ATOM   7599  C  CD2   . LEU E 5  99  ? 86.626  92.622  116.422 1.00 27.45  ? 99   LEU D CD2   1 
ATOM   7600  N  N     . PRO E 5  100 ? 88.000  97.395  115.866 1.00 38.18  ? 100  PRO D N     1 
ATOM   7601  C  CA    . PRO E 5  100 ? 88.256  98.834  115.990 1.00 35.61  ? 100  PRO D CA    1 
ATOM   7602  C  C     . PRO E 5  100 ? 87.435  99.463  117.105 1.00 50.15  ? 100  PRO D C     1 
ATOM   7603  O  O     . PRO E 5  100 ? 86.212  99.314  117.152 1.00 66.12  ? 100  PRO D O     1 
ATOM   7604  C  CB    . PRO E 5  100 ? 87.826  99.376  114.628 1.00 40.31  ? 100  PRO D CB    1 
ATOM   7605  C  CG    . PRO E 5  100 ? 87.894  98.218  113.729 1.00 38.69  ? 100  PRO D CG    1 
ATOM   7606  C  CD    . PRO E 5  100 ? 87.485  97.045  114.539 1.00 35.36  ? 100  PRO D CD    1 
ATOM   7607  N  N     . GLY E 5  101 ? 88.107  100.202 117.974 1.00 44.32  ? 101  GLY D N     1 
ATOM   7608  C  CA    . GLY E 5  101 ? 87.424  101.167 118.821 1.00 42.62  ? 101  GLY D CA    1 
ATOM   7609  C  C     . GLY E 5  101 ? 86.297  100.608 119.672 1.00 50.07  ? 101  GLY D C     1 
ATOM   7610  O  O     . GLY E 5  101 ? 86.482  99.749  120.552 1.00 55.06  ? 101  GLY D O     1 
ATOM   7611  N  N     . GLU E 5  102 ? 85.108  101.160 119.443 1.00 46.13  ? 102  GLU D N     1 
ATOM   7612  C  CA    . GLU E 5  102 ? 83.973  100.866 120.302 1.00 43.50  ? 102  GLU D CA    1 
ATOM   7613  C  C     . GLU E 5  102 ? 83.721  99.375  120.413 1.00 48.98  ? 102  GLU D C     1 
ATOM   7614  O  O     . GLU E 5  102 ? 83.458  98.863  121.508 1.00 52.53  ? 102  GLU D O     1 
ATOM   7615  C  CB    . GLU E 5  102 ? 82.740  101.585 119.777 1.00 62.05  ? 102  GLU D CB    1 
ATOM   7616  C  CG    . GLU E 5  102 ? 82.910  103.073 119.818 1.00 75.22  ? 102  GLU D CG    1 
ATOM   7617  C  CD    . GLU E 5  102 ? 83.277  103.558 121.204 1.00 86.47  ? 102  GLU D CD    1 
ATOM   7618  O  OE1   . GLU E 5  102 ? 82.714  103.037 122.191 1.00 93.21  ? 102  GLU D OE1   1 
ATOM   7619  O  OE2   . GLU E 5  102 ? 84.139  104.453 121.312 1.00 88.79  ? 102  GLU D OE2   1 
ATOM   7620  N  N     . LEU E 5  103 ? 83.804  98.656  119.295 1.00 30.10  ? 103  LEU D N     1 
ATOM   7621  C  CA    . LEU E 5  103 ? 83.669  97.211  119.368 1.00 36.79  ? 103  LEU D CA    1 
ATOM   7622  C  C     . LEU E 5  103 ? 84.683  96.621  120.329 1.00 43.73  ? 103  LEU D C     1 
ATOM   7623  O  O     . LEU E 5  103 ? 84.380  95.668  121.053 1.00 46.51  ? 103  LEU D O     1 
ATOM   7624  C  CB    . LEU E 5  103 ? 83.820  96.593  117.990 1.00 42.37  ? 103  LEU D CB    1 
ATOM   7625  C  CG    . LEU E 5  103 ? 82.659  96.929  117.085 1.00 43.56  ? 103  LEU D CG    1 
ATOM   7626  C  CD1   . LEU E 5  103 ? 82.871  96.320  115.730 1.00 50.94  ? 103  LEU D CD1   1 
ATOM   7627  C  CD2   . LEU E 5  103 ? 81.426  96.386  117.723 1.00 26.43  ? 103  LEU D CD2   1 
ATOM   7628  N  N     . ALA E 5  104 ? 85.888  97.178  120.364 1.00 27.76  ? 104  ALA D N     1 
ATOM   7629  C  CA    . ALA E 5  104 ? 86.859  96.698  121.331 1.00 23.05  ? 104  ALA D CA    1 
ATOM   7630  C  C     . ALA E 5  104 ? 86.346  96.907  122.741 1.00 29.39  ? 104  ALA D C     1 
ATOM   7631  O  O     . ALA E 5  104 ? 86.284  95.962  123.532 1.00 37.97  ? 104  ALA D O     1 
ATOM   7632  C  CB    . ALA E 5  104 ? 88.202  97.391  121.136 1.00 26.06  ? 104  ALA D CB    1 
ATOM   7633  N  N     . LYS E 5  105 ? 85.932  98.130  123.065 1.00 33.04  ? 105  LYS D N     1 
ATOM   7634  C  CA    . LYS E 5  105 ? 85.512  98.403  124.438 1.00 29.94  ? 105  LYS D CA    1 
ATOM   7635  C  C     . LYS E 5  105 ? 84.356  97.502  124.859 1.00 33.88  ? 105  LYS D C     1 
ATOM   7636  O  O     . LYS E 5  105 ? 84.454  96.748  125.839 1.00 42.06  ? 105  LYS D O     1 
ATOM   7637  C  CB    . LYS E 5  105 ? 85.139  99.871  124.590 1.00 35.38  ? 105  LYS D CB    1 
ATOM   7638  C  CG    . LYS E 5  105 ? 86.328  100.799 124.496 1.00 54.06  ? 105  LYS D CG    1 
ATOM   7639  C  CD    . LYS E 5  105 ? 85.910  102.245 124.663 1.00 69.06  ? 105  LYS D CD    1 
ATOM   7640  C  CE    . LYS E 5  105 ? 87.100  103.185 124.576 1.00 71.19  ? 105  LYS D CE    1 
ATOM   7641  N  NZ    . LYS E 5  105 ? 88.065  102.940 125.679 1.00 67.21  ? 105  LYS D NZ    1 
ATOM   7642  N  N     . HIS E 5  106 ? 83.254  97.549  124.116 1.00 40.53  ? 106  HIS D N     1 
ATOM   7643  C  CA    . HIS E 5  106 ? 82.103  96.742  124.496 1.00 32.48  ? 106  HIS D CA    1 
ATOM   7644  C  C     . HIS E 5  106 ? 82.458  95.265  124.538 1.00 42.37  ? 106  HIS D C     1 
ATOM   7645  O  O     . HIS E 5  106 ? 82.161  94.576  125.517 1.00 46.71  ? 106  HIS D O     1 
ATOM   7646  C  CB    . HIS E 5  106 ? 80.945  96.994  123.540 1.00 32.32  ? 106  HIS D CB    1 
ATOM   7647  C  CG    . HIS E 5  106 ? 80.451  98.400  123.570 1.00 47.83  ? 106  HIS D CG    1 
ATOM   7648  N  ND1   . HIS E 5  106 ? 79.800  98.931  124.660 1.00 35.12  ? 106  HIS D ND1   1 
ATOM   7649  C  CD2   . HIS E 5  106 ? 80.516  99.389  122.651 1.00 57.39  ? 106  HIS D CD2   1 
ATOM   7650  C  CE1   . HIS E 5  106 ? 79.483  100.188 124.411 1.00 51.65  ? 106  HIS D CE1   1 
ATOM   7651  N  NE2   . HIS E 5  106 ? 79.906  100.491 123.198 1.00 55.41  ? 106  HIS D NE2   1 
ATOM   7652  N  N     . ALA E 5  107 ? 83.109  94.764  123.490 1.00 33.76  ? 107  ALA D N     1 
ATOM   7653  C  CA    . ALA E 5  107 ? 83.427  93.343  123.443 1.00 23.69  ? 107  ALA D CA    1 
ATOM   7654  C  C     . ALA E 5  107 ? 84.220  92.918  124.665 1.00 33.45  ? 107  ALA D C     1 
ATOM   7655  O  O     . ALA E 5  107 ? 83.917  91.894  125.284 1.00 35.94  ? 107  ALA D O     1 
ATOM   7656  C  CB    . ALA E 5  107 ? 84.195  93.019  122.170 1.00 25.60  ? 107  ALA D CB    1 
ATOM   7657  N  N     . VAL E 5  108 ? 85.225  93.702  125.045 1.00 39.83  ? 108  VAL D N     1 
ATOM   7658  C  CA    . VAL E 5  108 ? 85.952  93.406  126.271 1.00 38.15  ? 108  VAL D CA    1 
ATOM   7659  C  C     . VAL E 5  108 ? 85.003  93.355  127.454 1.00 47.37  ? 108  VAL D C     1 
ATOM   7660  O  O     . VAL E 5  108 ? 85.121  92.483  128.323 1.00 46.21  ? 108  VAL D O     1 
ATOM   7661  C  CB    . VAL E 5  108 ? 87.068  94.431  126.494 1.00 32.90  ? 108  VAL D CB    1 
ATOM   7662  C  CG1   . VAL E 5  108 ? 87.633  94.272  127.874 1.00 24.08  ? 108  VAL D CG1   1 
ATOM   7663  C  CG2   . VAL E 5  108 ? 88.148  94.220  125.480 1.00 28.55  ? 108  VAL D CG2   1 
ATOM   7664  N  N     . SER E 5  109 ? 84.040  94.273  127.508 1.00 46.63  ? 109  SER D N     1 
ATOM   7665  C  CA    . SER E 5  109 ? 83.074  94.209  128.600 1.00 46.77  ? 109  SER D CA    1 
ATOM   7666  C  C     . SER E 5  109 ? 82.337  92.875  128.606 1.00 47.74  ? 109  SER D C     1 
ATOM   7667  O  O     . SER E 5  109 ? 82.318  92.170  129.624 1.00 44.80  ? 109  SER D O     1 
ATOM   7668  C  CB    . SER E 5  109 ? 82.087  95.364  128.509 1.00 38.79  ? 109  SER D CB    1 
ATOM   7669  O  OG    . SER E 5  109 ? 81.117  95.252  129.534 1.00 49.08  ? 109  SER D OG    1 
ATOM   7670  N  N     . GLU E 5  110 ? 81.730  92.511  127.472 1.00 60.02  ? 110  GLU D N     1 
ATOM   7671  C  CA    . GLU E 5  110 ? 81.031  91.236  127.363 1.00 55.71  ? 110  GLU D CA    1 
ATOM   7672  C  C     . GLU E 5  110 ? 81.887  90.097  127.870 1.00 52.80  ? 110  GLU D C     1 
ATOM   7673  O  O     . GLU E 5  110 ? 81.456  89.300  128.708 1.00 59.85  ? 110  GLU D O     1 
ATOM   7674  C  CB    . GLU E 5  110 ? 80.640  90.965  125.915 1.00 47.90  ? 110  GLU D CB    1 
ATOM   7675  C  CG    . GLU E 5  110 ? 79.532  91.828  125.382 1.00 64.76  ? 110  GLU D CG    1 
ATOM   7676  C  CD    . GLU E 5  110 ? 78.232  91.604  126.113 1.00 79.07  ? 110  GLU D CD    1 
ATOM   7677  O  OE1   . GLU E 5  110 ? 77.943  90.442  126.461 1.00 86.53  ? 110  GLU D OE1   1 
ATOM   7678  O  OE2   . GLU E 5  110 ? 77.492  92.585  126.331 1.00 81.04  ? 110  GLU D OE2   1 
ATOM   7679  N  N     . GLY E 5  111 ? 83.108  90.014  127.384 1.00 39.85  ? 111  GLY D N     1 
ATOM   7680  C  CA    . GLY E 5  111 ? 83.949  88.924  127.802 1.00 45.36  ? 111  GLY D CA    1 
ATOM   7681  C  C     . GLY E 5  111 ? 84.153  88.909  129.296 1.00 45.51  ? 111  GLY D C     1 
ATOM   7682  O  O     . GLY E 5  111 ? 83.819  87.923  129.955 1.00 51.36  ? 111  GLY D O     1 
ATOM   7683  N  N     . THR E 5  112 ? 84.667  90.007  129.846 1.00 45.96  ? 112  THR D N     1 
ATOM   7684  C  CA    . THR E 5  112 ? 84.988  90.022  131.264 1.00 49.61  ? 112  THR D CA    1 
ATOM   7685  C  C     . THR E 5  112 ? 83.788  89.609  132.092 1.00 59.67  ? 112  THR D C     1 
ATOM   7686  O  O     . THR E 5  112 ? 83.876  88.705  132.933 1.00 58.90  ? 112  THR D O     1 
ATOM   7687  C  CB    . THR E 5  112 ? 85.461  91.403  131.676 1.00 56.53  ? 112  THR D CB    1 
ATOM   7688  O  OG1   . THR E 5  112 ? 86.643  91.727  130.942 1.00 58.57  ? 112  THR D OG1   1 
ATOM   7689  C  CG2   . THR E 5  112 ? 85.779  91.414  133.144 1.00 71.47  ? 112  THR D CG2   1 
ATOM   7690  N  N     . LYS E 5  113 ? 82.645  90.246  131.845 1.00 54.51  ? 113  LYS D N     1 
ATOM   7691  C  CA    . LYS E 5  113 ? 81.431  89.887  132.565 1.00 45.95  ? 113  LYS D CA    1 
ATOM   7692  C  C     . LYS E 5  113 ? 81.158  88.396  132.464 1.00 50.91  ? 113  LYS D C     1 
ATOM   7693  O  O     . LYS E 5  113 ? 80.932  87.722  133.475 1.00 59.65  ? 113  LYS D O     1 
ATOM   7694  C  CB    . LYS E 5  113 ? 80.256  90.683  132.014 1.00 47.09  ? 113  LYS D CB    1 
ATOM   7695  C  CG    . LYS E 5  113 ? 78.944  90.355  132.658 1.00 65.42  ? 113  LYS D CG    1 
ATOM   7696  C  CD    . LYS E 5  113 ? 77.845  91.206  132.070 1.00 76.73  ? 113  LYS D CD    1 
ATOM   7697  C  CE    . LYS E 5  113 ? 77.464  90.718  130.691 1.00 75.33  ? 113  LYS D CE    1 
ATOM   7698  N  NZ    . LYS E 5  113 ? 76.374  91.538  130.109 1.00 73.98  ? 113  LYS D NZ    1 
ATOM   7699  N  N     . ALA E 5  114 ? 81.216  87.859  131.247 1.00 45.42  ? 114  ALA D N     1 
ATOM   7700  C  CA    . ALA E 5  114 ? 80.877  86.458  131.044 1.00 48.07  ? 114  ALA D CA    1 
ATOM   7701  C  C     . ALA E 5  114 ? 81.799  85.542  131.833 1.00 52.48  ? 114  ALA D C     1 
ATOM   7702  O  O     . ALA E 5  114 ? 81.338  84.613  132.500 1.00 59.84  ? 114  ALA D O     1 
ATOM   7703  C  CB    . ALA E 5  114 ? 80.927  86.117  129.563 1.00 48.02  ? 114  ALA D CB    1 
ATOM   7704  N  N     . VAL E 5  115 ? 83.106  85.780  131.769 1.00 38.01  ? 115  VAL D N     1 
ATOM   7705  C  CA    . VAL E 5  115 ? 84.028  84.931  132.515 1.00 45.26  ? 115  VAL D CA    1 
ATOM   7706  C  C     . VAL E 5  115 ? 83.734  85.015  133.998 1.00 55.71  ? 115  VAL D C     1 
ATOM   7707  O  O     . VAL E 5  115 ? 83.640  83.995  134.689 1.00 62.39  ? 115  VAL D O     1 
ATOM   7708  C  CB    . VAL E 5  115 ? 85.482  85.313  132.223 1.00 47.09  ? 115  VAL D CB    1 
ATOM   7709  C  CG1   . VAL E 5  115 ? 86.390  84.572  133.156 1.00 39.77  ? 115  VAL D CG1   1 
ATOM   7710  C  CG2   . VAL E 5  115 ? 85.815  84.948  130.820 1.00 50.71  ? 115  VAL D CG2   1 
ATOM   7711  N  N     . THR E 5  116 ? 83.597  86.234  134.512 1.00 50.99  ? 116  THR D N     1 
ATOM   7712  C  CA    . THR E 5  116 ? 83.262  86.416  135.916 1.00 57.89  ? 116  THR D CA    1 
ATOM   7713  C  C     . THR E 5  116 ? 82.086  85.536  136.310 1.00 57.61  ? 116  THR D C     1 
ATOM   7714  O  O     . THR E 5  116 ? 82.207  84.645  137.160 1.00 62.74  ? 116  THR D O     1 
ATOM   7715  C  CB    . THR E 5  116 ? 82.949  87.880  136.177 1.00 53.49  ? 116  THR D CB    1 
ATOM   7716  O  OG1   . THR E 5  116 ? 84.115  88.660  135.913 1.00 42.39  ? 116  THR D OG1   1 
ATOM   7717  C  CG2   . THR E 5  116 ? 82.540  88.067  137.607 1.00 50.64  ? 116  THR D CG2   1 
ATOM   7718  N  N     . LYS E 5  117 ? 80.938  85.769  135.676 1.00 61.97  ? 117  LYS D N     1 
ATOM   7719  C  CA    . LYS E 5  117 ? 79.754  84.973  135.963 1.00 62.99  ? 117  LYS D CA    1 
ATOM   7720  C  C     . LYS E 5  117 ? 80.025  83.486  135.808 1.00 64.34  ? 117  LYS D C     1 
ATOM   7721  O  O     . LYS E 5  117 ? 79.395  82.668  136.482 1.00 66.29  ? 117  LYS D O     1 
ATOM   7722  C  CB    . LYS E 5  117 ? 78.613  85.412  135.052 1.00 50.87  ? 117  LYS D CB    1 
ATOM   7723  C  CG    . LYS E 5  117 ? 77.291  84.740  135.316 1.00 62.84  ? 117  LYS D CG    1 
ATOM   7724  C  CD    . LYS E 5  117 ? 76.220  85.296  134.393 1.00 70.13  ? 117  LYS D CD    1 
ATOM   7725  C  CE    . LYS E 5  117 ? 74.921  84.514  134.508 1.00 81.62  ? 117  LYS D CE    1 
ATOM   7726  N  NZ    . LYS E 5  117 ? 74.320  84.585  135.870 1.00 82.03  ? 117  LYS D NZ    1 
ATOM   7727  N  N     . TYR E 5  118 ? 80.964  83.113  134.944 1.00 58.43  ? 118  TYR D N     1 
ATOM   7728  C  CA    . TYR E 5  118 ? 81.322  81.706  134.828 1.00 52.69  ? 118  TYR D CA    1 
ATOM   7729  C  C     . TYR E 5  118 ? 81.994  81.210  136.091 1.00 63.95  ? 118  TYR D C     1 
ATOM   7730  O  O     . TYR E 5  118 ? 81.752  80.083  136.528 1.00 68.01  ? 118  TYR D O     1 
ATOM   7731  C  CB    . TYR E 5  118 ? 82.253  81.496  133.646 1.00 52.24  ? 118  TYR D CB    1 
ATOM   7732  C  CG    . TYR E 5  118 ? 82.740  80.084  133.489 1.00 54.71  ? 118  TYR D CG    1 
ATOM   7733  C  CD1   . TYR E 5  118 ? 81.997  79.157  132.805 1.00 53.47  ? 118  TYR D CD1   1 
ATOM   7734  C  CD2   . TYR E 5  118 ? 83.938  79.680  134.035 1.00 49.27  ? 118  TYR D CD2   1 
ATOM   7735  C  CE1   . TYR E 5  118 ? 82.437  77.877  132.650 1.00 50.66  ? 118  TYR D CE1   1 
ATOM   7736  C  CE2   . TYR E 5  118 ? 84.380  78.399  133.890 1.00 55.17  ? 118  TYR D CE2   1 
ATOM   7737  C  CZ    . TYR E 5  118 ? 83.625  77.502  133.196 1.00 60.79  ? 118  TYR D CZ    1 
ATOM   7738  O  OH    . TYR E 5  118 ? 84.056  76.213  133.046 1.00 68.84  ? 118  TYR D OH    1 
ATOM   7739  N  N     . THR E 5  119 ? 82.862  82.028  136.675 1.00 66.02  ? 119  THR D N     1 
ATOM   7740  C  CA    . THR E 5  119 ? 83.615  81.586  137.837 1.00 74.70  ? 119  THR D CA    1 
ATOM   7741  C  C     . THR E 5  119 ? 82.774  81.625  139.101 1.00 74.07  ? 119  THR D C     1 
ATOM   7742  O  O     . THR E 5  119 ? 83.008  80.829  140.017 1.00 72.05  ? 119  THR D O     1 
ATOM   7743  C  CB    . THR E 5  119 ? 84.862  82.448  138.001 1.00 82.48  ? 119  THR D CB    1 
ATOM   7744  O  OG1   . THR E 5  119 ? 85.665  82.335  136.824 1.00 91.27  ? 119  THR D OG1   1 
ATOM   7745  C  CG2   . THR E 5  119 ? 85.681  81.984  139.175 1.00 69.07  ? 119  THR D CG2   1 
ATOM   7746  N  N     . SER E 5  120 ? 81.792  82.527  139.164 1.00 87.84  ? 120  SER D N     1 
ATOM   7747  C  CA    . SER E 5  120 ? 80.924  82.599  140.336 1.00 86.31  ? 120  SER D CA    1 
ATOM   7748  C  C     . SER E 5  120 ? 80.368  81.232  140.703 1.00 95.41  ? 120  SER D C     1 
ATOM   7749  O  O     . SER E 5  120 ? 80.335  80.860  141.880 1.00 99.10  ? 120  SER D O     1 
ATOM   7750  C  CB    . SER E 5  120 ? 79.780  83.578  140.084 1.00 72.77  ? 120  SER D CB    1 
ATOM   7751  O  OG    . SER E 5  120 ? 80.269  84.890  139.896 1.00 71.45  ? 120  SER D OG    1 
ATOM   7752  N  N     . ALA E 5  121 ? 79.937  80.468  139.708 1.00 103.08 ? 121  ALA D N     1 
ATOM   7753  C  CA    . ALA E 5  121 ? 79.432  79.123  139.935 1.00 97.41  ? 121  ALA D CA    1 
ATOM   7754  C  C     . ALA E 5  121 ? 80.349  78.097  139.286 1.00 102.36 ? 121  ALA D C     1 
ATOM   7755  O  O     . ALA E 5  121 ? 81.417  78.442  138.784 1.00 99.06  ? 121  ALA D O     1 
ATOM   7756  C  CB    . ALA E 5  121 ? 78.022  78.988  139.399 1.00 84.49  ? 121  ALA D CB    1 
ATOM   7757  N  N     . ARG F 2  40  ? 62.385  112.631 73.586  1.00 104.82 ? 40   ARG E N     1 
ATOM   7758  C  CA    . ARG F 2  40  ? 63.773  112.222 73.747  1.00 120.92 ? 40   ARG E CA    1 
ATOM   7759  C  C     . ARG F 2  40  ? 64.374  112.967 74.921  1.00 119.35 ? 40   ARG E C     1 
ATOM   7760  O  O     . ARG F 2  40  ? 64.369  114.198 74.946  1.00 117.73 ? 40   ARG E O     1 
ATOM   7761  C  CB    . ARG F 2  40  ? 64.584  112.497 72.481  1.00 111.86 ? 40   ARG E CB    1 
ATOM   7762  C  CG    . ARG F 2  40  ? 64.230  111.609 71.314  1.00 120.04 ? 40   ARG E CG    1 
ATOM   7763  C  CD    . ARG F 2  40  ? 64.959  112.044 70.059  1.00 119.82 ? 40   ARG E CD    1 
ATOM   7764  N  NE    . ARG F 2  40  ? 66.406  111.917 70.175  1.00 112.05 ? 40   ARG E NE    1 
ATOM   7765  C  CZ    . ARG F 2  40  ? 67.077  110.798 69.931  1.00 107.75 ? 40   ARG E CZ    1 
ATOM   7766  N  NH1   . ARG F 2  40  ? 66.429  109.703 69.563  1.00 102.94 ? 40   ARG E NH1   1 
ATOM   7767  N  NH2   . ARG F 2  40  ? 68.396  110.773 70.056  1.00 111.96 ? 40   ARG E NH2   1 
ATOM   7768  N  N     . TYR F 2  41  ? 64.889  112.223 75.888  1.00 124.44 ? 41   TYR E N     1 
ATOM   7769  C  CA    . TYR F 2  41  ? 65.577  112.843 77.000  1.00 111.30 ? 41   TYR E CA    1 
ATOM   7770  C  C     . TYR F 2  41  ? 66.868  113.489 76.524  1.00 107.07 ? 41   TYR E C     1 
ATOM   7771  O  O     . TYR F 2  41  ? 67.413  113.146 75.474  1.00 105.80 ? 41   TYR E O     1 
ATOM   7772  C  CB    . TYR F 2  41  ? 65.900  111.807 78.062  1.00 99.82  ? 41   TYR E CB    1 
ATOM   7773  C  CG    . TYR F 2  41  ? 64.699  111.154 78.676  1.00 99.86  ? 41   TYR E CG    1 
ATOM   7774  C  CD1   . TYR F 2  41  ? 64.084  111.705 79.786  1.00 93.82  ? 41   TYR E CD1   1 
ATOM   7775  C  CD2   . TYR F 2  41  ? 64.188  109.978 78.158  1.00 98.42  ? 41   TYR E CD2   1 
ATOM   7776  C  CE1   . TYR F 2  41  ? 62.996  111.106 80.361  1.00 87.39  ? 41   TYR E CE1   1 
ATOM   7777  C  CE2   . TYR F 2  41  ? 63.100  109.373 78.727  1.00 98.41  ? 41   TYR E CE2   1 
ATOM   7778  C  CZ    . TYR F 2  41  ? 62.507  109.943 79.828  1.00 94.98  ? 41   TYR E CZ    1 
ATOM   7779  O  OH    . TYR F 2  41  ? 61.414  109.347 80.406  1.00 98.56  ? 41   TYR E OH    1 
ATOM   7780  N  N     . ARG F 2  42  ? 67.358  114.442 77.306  1.00 111.62 ? 42   ARG E N     1 
ATOM   7781  C  CA    . ARG F 2  42  ? 68.710  114.907 77.086  1.00 113.12 ? 42   ARG E CA    1 
ATOM   7782  C  C     . ARG F 2  42  ? 69.689  113.796 77.440  1.00 112.99 ? 42   ARG E C     1 
ATOM   7783  O  O     . ARG F 2  42  ? 69.420  112.988 78.331  1.00 112.04 ? 42   ARG E O     1 
ATOM   7784  C  CB    . ARG F 2  42  ? 69.025  116.129 77.929  1.00 117.76 ? 42   ARG E CB    1 
ATOM   7785  C  CG    . ARG F 2  42  ? 68.322  117.387 77.527  1.00 127.38 ? 42   ARG E CG    1 
ATOM   7786  C  CD    . ARG F 2  42  ? 68.890  118.521 78.344  1.00 138.74 ? 42   ARG E CD    1 
ATOM   7787  N  NE    . ARG F 2  42  ? 68.276  119.803 78.040  1.00 158.15 ? 42   ARG E NE    1 
ATOM   7788  C  CZ    . ARG F 2  42  ? 68.590  120.930 78.665  1.00 168.15 ? 42   ARG E CZ    1 
ATOM   7789  N  NH1   . ARG F 2  42  ? 69.515  120.920 79.615  1.00 166.66 ? 42   ARG E NH1   1 
ATOM   7790  N  NH2   . ARG F 2  42  ? 67.988  122.066 78.339  1.00 170.30 ? 42   ARG E NH2   1 
ATOM   7791  N  N     . PRO F 2  43  ? 70.824  113.728 76.755  1.00 101.76 ? 43   PRO E N     1 
ATOM   7792  C  CA    . PRO F 2  43  ? 71.835  112.740 77.123  1.00 103.11 ? 43   PRO E CA    1 
ATOM   7793  C  C     . PRO F 2  43  ? 72.210  112.891 78.585  1.00 103.44 ? 43   PRO E C     1 
ATOM   7794  O  O     . PRO F 2  43  ? 72.323  114.001 79.105  1.00 95.30  ? 43   PRO E O     1 
ATOM   7795  C  CB    . PRO F 2  43  ? 73.005  113.076 76.199  1.00 104.01 ? 43   PRO E CB    1 
ATOM   7796  C  CG    . PRO F 2  43  ? 72.366  113.694 75.028  1.00 100.80 ? 43   PRO E CG    1 
ATOM   7797  C  CD    . PRO F 2  43  ? 71.223  114.495 75.569  1.00 105.96 ? 43   PRO E CD    1 
ATOM   7798  N  N     . GLY F 2  44  ? 72.368  111.759 79.254  1.00 98.85  ? 44   GLY E N     1 
ATOM   7799  C  CA    . GLY F 2  44  ? 72.736  111.730 80.642  1.00 88.18  ? 44   GLY E CA    1 
ATOM   7800  C  C     . GLY F 2  44  ? 71.601  111.434 81.599  1.00 91.62  ? 44   GLY E C     1 
ATOM   7801  O  O     . GLY F 2  44  ? 71.865  110.993 82.722  1.00 93.12  ? 44   GLY E O     1 
ATOM   7802  N  N     . THR F 2  45  ? 70.351  111.652 81.198  1.00 87.05  ? 45   THR E N     1 
ATOM   7803  C  CA    . THR F 2  45  ? 69.267  111.344 82.120  1.00 81.33  ? 45   THR E CA    1 
ATOM   7804  C  C     . THR F 2  45  ? 68.963  109.858 82.145  1.00 77.04  ? 45   THR E C     1 
ATOM   7805  O  O     . THR F 2  45  ? 68.732  109.284 83.217  1.00 85.51  ? 45   THR E O     1 
ATOM   7806  C  CB    . THR F 2  45  ? 68.019  112.116 81.753  1.00 90.85  ? 45   THR E CB    1 
ATOM   7807  O  OG1   . THR F 2  45  ? 68.309  113.514 81.802  1.00 100.14 ? 45   THR E OG1   1 
ATOM   7808  C  CG2   . THR F 2  45  ? 66.927  111.806 82.748  1.00 81.29  ? 45   THR E CG2   1 
ATOM   7809  N  N     . VAL F 2  46  ? 68.957  109.221 80.976  1.00 64.74  ? 46   VAL E N     1 
ATOM   7810  C  CA    . VAL F 2  46  ? 68.858  107.768 80.937  1.00 70.83  ? 46   VAL E CA    1 
ATOM   7811  C  C     . VAL F 2  46  ? 69.942  107.155 81.806  1.00 75.58  ? 46   VAL E C     1 
ATOM   7812  O  O     . VAL F 2  46  ? 69.718  106.165 82.516  1.00 74.06  ? 46   VAL E O     1 
ATOM   7813  C  CB    . VAL F 2  46  ? 68.963  107.273 79.489  1.00 78.71  ? 46   VAL E CB    1 
ATOM   7814  C  CG1   . VAL F 2  46  ? 68.813  105.771 79.442  1.00 75.19  ? 46   VAL E CG1   1 
ATOM   7815  C  CG2   . VAL F 2  46  ? 67.945  107.969 78.624  1.00 81.50  ? 46   VAL E CG2   1 
ATOM   7816  N  N     . ALA F 2  47  ? 71.131  107.749 81.778  1.00 62.35  ? 47   ALA E N     1 
ATOM   7817  C  CA    . ALA F 2  47  ? 72.222  107.257 82.599  1.00 58.41  ? 47   ALA E CA    1 
ATOM   7818  C  C     . ALA F 2  47  ? 71.825  107.234 84.063  1.00 60.74  ? 47   ALA E C     1 
ATOM   7819  O  O     . ALA F 2  47  ? 71.783  106.172 84.685  1.00 56.68  ? 47   ALA E O     1 
ATOM   7820  C  CB    . ALA F 2  47  ? 73.459  108.121 82.391  1.00 53.55  ? 47   ALA E CB    1 
ATOM   7821  N  N     . LEU F 2  48  ? 71.489  108.394 84.622  1.00 44.77  ? 48   LEU E N     1 
ATOM   7822  C  CA    . LEU F 2  48  ? 71.149  108.426 86.037  1.00 45.35  ? 48   LEU E CA    1 
ATOM   7823  C  C     . LEU F 2  48  ? 70.030  107.457 86.353  1.00 48.05  ? 48   LEU E C     1 
ATOM   7824  O  O     . LEU F 2  48  ? 70.087  106.734 87.355  1.00 61.50  ? 48   LEU E O     1 
ATOM   7825  C  CB    . LEU F 2  48  ? 70.747  109.824 86.477  1.00 44.32  ? 48   LEU E CB    1 
ATOM   7826  C  CG    . LEU F 2  48  ? 71.886  110.705 86.953  1.00 54.38  ? 48   LEU E CG    1 
ATOM   7827  C  CD1   . LEU F 2  48  ? 72.765  111.097 85.789  1.00 53.42  ? 48   LEU E CD1   1 
ATOM   7828  C  CD2   . LEU F 2  48  ? 71.335  111.914 87.668  1.00 60.34  ? 48   LEU E CD2   1 
ATOM   7829  N  N     . ARG F 2  49  ? 69.009  107.412 85.506  1.00 53.98  ? 49   ARG E N     1 
ATOM   7830  C  CA    . ARG F 2  49  ? 67.902  106.522 85.803  1.00 60.25  ? 49   ARG E CA    1 
ATOM   7831  C  C     . ARG F 2  49  ? 68.390  105.083 85.896  1.00 62.99  ? 49   ARG E C     1 
ATOM   7832  O  O     . ARG F 2  49  ? 67.982  104.335 86.797  1.00 58.89  ? 49   ARG E O     1 
ATOM   7833  C  CB    . ARG F 2  49  ? 66.814  106.697 84.753  1.00 74.15  ? 49   ARG E CB    1 
ATOM   7834  C  CG    . ARG F 2  49  ? 65.509  106.036 85.091  1.00 87.02  ? 49   ARG E CG    1 
ATOM   7835  C  CD    . ARG F 2  49  ? 64.450  106.414 84.078  1.00 107.12 ? 49   ARG E CD    1 
ATOM   7836  N  NE    . ARG F 2  49  ? 64.779  105.914 82.752  1.00 113.46 ? 49   ARG E NE    1 
ATOM   7837  C  CZ    . ARG F 2  49  ? 65.292  106.662 81.786  1.00 110.06 ? 49   ARG E CZ    1 
ATOM   7838  N  NH1   . ARG F 2  49  ? 65.540  107.944 82.004  1.00 89.77  ? 49   ARG E NH1   1 
ATOM   7839  N  NH2   . ARG F 2  49  ? 65.568  106.124 80.607  1.00 116.69 ? 49   ARG E NH2   1 
ATOM   7840  N  N     . GLU F 2  50  ? 69.327  104.698 85.029  1.00 44.93  ? 50   GLU E N     1 
ATOM   7841  C  CA    . GLU F 2  50  ? 69.976  103.408 85.224  1.00 42.46  ? 50   GLU E CA    1 
ATOM   7842  C  C     . GLU F 2  50  ? 70.657  103.347 86.580  1.00 43.77  ? 50   GLU E C     1 
ATOM   7843  O  O     . GLU F 2  50  ? 70.333  102.491 87.403  1.00 40.97  ? 50   GLU E O     1 
ATOM   7844  C  CB    . GLU F 2  50  ? 70.981  103.110 84.115  1.00 53.56  ? 50   GLU E CB    1 
ATOM   7845  C  CG    . GLU F 2  50  ? 70.360  102.758 82.794  1.00 51.59  ? 50   GLU E CG    1 
ATOM   7846  C  CD    . GLU F 2  50  ? 71.393  102.339 81.771  1.00 78.91  ? 50   GLU E CD    1 
ATOM   7847  O  OE1   . GLU F 2  50  ? 72.598  102.490 82.050  1.00 81.20  ? 50   GLU E OE1   1 
ATOM   7848  O  OE2   . GLU F 2  50  ? 71.006  101.845 80.691  1.00 90.13  ? 50   GLU E OE2   1 
ATOM   7849  N  N     . ILE F 2  51  ? 71.578  104.276 86.846  1.00 44.13  ? 51   ILE E N     1 
ATOM   7850  C  CA    . ILE F 2  51  ? 72.399  104.173 88.047  1.00 42.33  ? 51   ILE E CA    1 
ATOM   7851  C  C     . ILE F 2  51  ? 71.539  103.906 89.264  1.00 41.59  ? 51   ILE E C     1 
ATOM   7852  O  O     . ILE F 2  51  ? 71.851  103.031 90.080  1.00 52.23  ? 51   ILE E O     1 
ATOM   7853  C  CB    . ILE F 2  51  ? 73.252  105.431 88.239  1.00 36.90  ? 51   ILE E CB    1 
ATOM   7854  C  CG1   . ILE F 2  51  ? 74.341  105.489 87.189  1.00 38.22  ? 51   ILE E CG1   1 
ATOM   7855  C  CG2   . ILE F 2  51  ? 73.878  105.418 89.592  1.00 29.31  ? 51   ILE E CG2   1 
ATOM   7856  C  CD1   . ILE F 2  51  ? 75.140  106.746 87.261  1.00 38.26  ? 51   ILE E CD1   1 
ATOM   7857  N  N     . ARG F 2  52  ? 70.425  104.619 89.392  1.00 33.21  ? 52   ARG E N     1 
ATOM   7858  C  CA    . ARG F 2  52  ? 69.496  104.277 90.459  1.00 44.03  ? 52   ARG E CA    1 
ATOM   7859  C  C     . ARG F 2  52  ? 69.014  102.844 90.309  1.00 49.87  ? 52   ARG E C     1 
ATOM   7860  O  O     . ARG F 2  52  ? 69.046  102.059 91.268  1.00 51.17  ? 52   ARG E O     1 
ATOM   7861  C  CB    . ARG F 2  52  ? 68.320  105.240 90.465  1.00 55.48  ? 52   ARG E CB    1 
ATOM   7862  C  CG    . ARG F 2  52  ? 68.696  106.641 90.865  1.00 67.57  ? 52   ARG E CG    1 
ATOM   7863  C  CD    . ARG F 2  52  ? 67.503  107.575 90.773  1.00 76.97  ? 52   ARG E CD    1 
ATOM   7864  N  NE    . ARG F 2  52  ? 67.853  108.923 91.198  1.00 88.09  ? 52   ARG E NE    1 
ATOM   7865  C  CZ    . ARG F 2  52  ? 68.442  109.816 90.414  1.00 96.90  ? 52   ARG E CZ    1 
ATOM   7866  N  NH1   . ARG F 2  52  ? 68.748  109.503 89.164  1.00 89.42  ? 52   ARG E NH1   1 
ATOM   7867  N  NH2   . ARG F 2  52  ? 68.729  111.020 90.882  1.00 101.57 ? 52   ARG E NH2   1 
ATOM   7868  N  N     . ARG F 2  53  ? 68.597  102.473 89.098  1.00 42.28  ? 53   ARG E N     1 
ATOM   7869  C  CA    . ARG F 2  53  ? 68.048  101.137 88.900  1.00 38.70  ? 53   ARG E CA    1 
ATOM   7870  C  C     . ARG F 2  53  ? 69.004  100.057 89.385  1.00 43.39  ? 53   ARG E C     1 
ATOM   7871  O  O     . ARG F 2  53  ? 68.632  99.203  90.191  1.00 45.95  ? 53   ARG E O     1 
ATOM   7872  C  CB    . ARG F 2  53  ? 67.720  100.918 87.433  1.00 52.75  ? 53   ARG E CB    1 
ATOM   7873  C  CG    . ARG F 2  53  ? 67.200  99.549  87.157  1.00 59.50  ? 53   ARG E CG    1 
ATOM   7874  C  CD    . ARG F 2  53  ? 66.972  99.388  85.692  1.00 61.56  ? 53   ARG E CD    1 
ATOM   7875  N  NE    . ARG F 2  53  ? 66.462  98.067  85.383  1.00 72.45  ? 53   ARG E NE    1 
ATOM   7876  C  CZ    . ARG F 2  53  ? 66.074  97.700  84.172  1.00 73.40  ? 53   ARG E CZ    1 
ATOM   7877  N  NH1   . ARG F 2  53  ? 66.155  98.560  83.170  1.00 67.26  ? 53   ARG E NH1   1 
ATOM   7878  N  NH2   . ARG F 2  53  ? 65.613  96.476  83.961  1.00 72.89  ? 53   ARG E NH2   1 
ATOM   7879  N  N     . TYR F 2  54  ? 70.245  100.083 88.909  1.00 40.40  ? 54   TYR E N     1 
ATOM   7880  C  CA    . TYR F 2  54  ? 71.170  99.011  89.245  1.00 34.11  ? 54   TYR E CA    1 
ATOM   7881  C  C     . TYR F 2  54  ? 71.642  99.106  90.680  1.00 39.59  ? 54   TYR E C     1 
ATOM   7882  O  O     . TYR F 2  54  ? 71.687  98.093  91.382  1.00 54.16  ? 54   TYR E O     1 
ATOM   7883  C  CB    . TYR F 2  54  ? 72.352  99.010  88.294  1.00 40.52  ? 54   TYR E CB    1 
ATOM   7884  C  CG    . TYR F 2  54  ? 71.958  98.554  86.938  1.00 35.81  ? 54   TYR E CG    1 
ATOM   7885  C  CD1   . TYR F 2  54  ? 71.961  97.219  86.620  1.00 35.81  ? 54   TYR E CD1   1 
ATOM   7886  C  CD2   . TYR F 2  54  ? 71.547  99.450  85.985  1.00 33.06  ? 54   TYR E CD2   1 
ATOM   7887  C  CE1   . TYR F 2  54  ? 71.590  96.792  85.387  1.00 36.36  ? 54   TYR E CE1   1 
ATOM   7888  C  CE2   . TYR F 2  54  ? 71.172  99.033  84.749  1.00 43.91  ? 54   TYR E CE2   1 
ATOM   7889  C  CZ    . TYR F 2  54  ? 71.196  97.703  84.453  1.00 44.74  ? 54   TYR E CZ    1 
ATOM   7890  O  OH    . TYR F 2  54  ? 70.816  97.285  83.206  1.00 39.23  ? 54   TYR E OH    1 
ATOM   7891  N  N     . GLN F 2  55  ? 71.984  100.300 91.152  1.00 39.39  ? 55   GLN E N     1 
ATOM   7892  C  CA    . GLN F 2  55  ? 72.418  100.341 92.536  1.00 39.47  ? 55   GLN E CA    1 
ATOM   7893  C  C     . GLN F 2  55  ? 71.305  99.962  93.486  1.00 43.09  ? 55   GLN E C     1 
ATOM   7894  O  O     . GLN F 2  55  ? 71.564  99.802  94.679  1.00 52.85  ? 55   GLN E O     1 
ATOM   7895  C  CB    . GLN F 2  55  ? 72.959  101.708 92.909  1.00 23.05  ? 55   GLN E CB    1 
ATOM   7896  C  CG    . GLN F 2  55  ? 74.203  102.061 92.171  1.00 28.98  ? 55   GLN E CG    1 
ATOM   7897  C  CD    . GLN F 2  55  ? 74.775  103.354 92.638  1.00 41.43  ? 55   GLN E CD    1 
ATOM   7898  O  OE1   . GLN F 2  55  ? 74.083  104.161 93.233  1.00 49.21  ? 55   GLN E OE1   1 
ATOM   7899  N  NE2   . GLN F 2  55  ? 76.047  103.566 92.374  1.00 35.97  ? 55   GLN E NE2   1 
ATOM   7900  N  N     . LYS F 2  56  ? 70.079  99.813  92.997  1.00 32.96  ? 56   LYS E N     1 
ATOM   7901  C  CA    . LYS F 2  56  ? 69.027  99.310  93.867  1.00 37.82  ? 56   LYS E CA    1 
ATOM   7902  C  C     . LYS F 2  56  ? 69.122  97.799  94.078  1.00 47.01  ? 56   LYS E C     1 
ATOM   7903  O  O     . LYS F 2  56  ? 69.015  97.326  95.212  1.00 46.69  ? 56   LYS E O     1 
ATOM   7904  C  CB    . LYS F 2  56  ? 67.663  99.687  93.301  1.00 33.93  ? 56   LYS E CB    1 
ATOM   7905  C  CG    . LYS F 2  56  ? 66.512  99.223  94.149  1.00 47.67  ? 56   LYS E CG    1 
ATOM   7906  C  CD    . LYS F 2  56  ? 65.188  99.631  93.541  1.00 69.49  ? 56   LYS E CD    1 
ATOM   7907  C  CE    . LYS F 2  56  ? 64.035  98.942  94.249  1.00 84.12  ? 56   LYS E CE    1 
ATOM   7908  N  NZ    . LYS F 2  56  ? 63.970  99.310  95.690  1.00 90.11  ? 56   LYS E NZ    1 
ATOM   7909  N  N     . SER F 2  57  ? 69.323  97.022  93.013  1.00 43.42  ? 57   SER E N     1 
ATOM   7910  C  CA    . SER F 2  57  ? 69.132  95.578  93.093  1.00 39.77  ? 57   SER E CA    1 
ATOM   7911  C  C     . SER F 2  57  ? 70.451  94.813  93.164  1.00 41.36  ? 57   SER E C     1 
ATOM   7912  O  O     . SER F 2  57  ? 71.537  95.366  93.004  1.00 48.60  ? 57   SER E O     1 
ATOM   7913  C  CB    . SER F 2  57  ? 68.328  95.086  91.893  1.00 39.67  ? 57   SER E CB    1 
ATOM   7914  O  OG    . SER F 2  57  ? 69.064  95.274  90.704  1.00 53.37  ? 57   SER E OG    1 
ATOM   7915  N  N     . THR F 2  58  ? 70.327  93.508  93.401  1.00 52.94  ? 58   THR E N     1 
ATOM   7916  C  CA    . THR F 2  58  ? 71.448  92.609  93.649  1.00 48.04  ? 58   THR E CA    1 
ATOM   7917  C  C     . THR F 2  58  ? 71.813  91.698  92.485  1.00 46.74  ? 58   THR E C     1 
ATOM   7918  O  O     . THR F 2  58  ? 72.710  90.869  92.639  1.00 55.46  ? 58   THR E O     1 
ATOM   7919  C  CB    . THR F 2  58  ? 71.148  91.746  94.862  1.00 48.95  ? 58   THR E CB    1 
ATOM   7920  O  OG1   . THR F 2  58  ? 69.986  90.958  94.594  1.00 50.54  ? 58   THR E OG1   1 
ATOM   7921  C  CG2   . THR F 2  58  ? 70.872  92.622  96.045  1.00 42.27  ? 58   THR E CG2   1 
ATOM   7922  N  N     . GLU F 2  59  ? 71.133  91.793  91.351  1.00 52.85  ? 59   GLU E N     1 
ATOM   7923  C  CA    . GLU F 2  59  ? 71.251  90.765  90.324  1.00 53.92  ? 59   GLU E CA    1 
ATOM   7924  C  C     . GLU F 2  59  ? 72.686  90.613  89.853  1.00 54.59  ? 59   GLU E C     1 
ATOM   7925  O  O     . GLU F 2  59  ? 73.484  91.547  89.914  1.00 49.98  ? 59   GLU E O     1 
ATOM   7926  C  CB    . GLU F 2  59  ? 70.384  91.114  89.126  1.00 81.59  ? 59   GLU E CB    1 
ATOM   7927  C  CG    . GLU F 2  59  ? 68.915  91.123  89.412  1.00 96.94  ? 59   GLU E CG    1 
ATOM   7928  C  CD    . GLU F 2  59  ? 68.126  91.595  88.223  1.00 114.05 ? 59   GLU E CD    1 
ATOM   7929  O  OE1   . GLU F 2  59  ? 68.757  92.090  87.266  1.00 113.67 ? 59   GLU E OE1   1 
ATOM   7930  O  OE2   . GLU F 2  59  ? 66.884  91.472  88.243  1.00 122.20 ? 59   GLU E OE2   1 
ATOM   7931  N  N     . LEU F 2  60  ? 73.018  89.417  89.385  1.00 51.58  ? 60   LEU E N     1 
ATOM   7932  C  CA    . LEU F 2  60  ? 74.304  89.218  88.737  1.00 52.59  ? 60   LEU E CA    1 
ATOM   7933  C  C     . LEU F 2  60  ? 74.290  89.865  87.365  1.00 50.73  ? 60   LEU E C     1 
ATOM   7934  O  O     . LEU F 2  60  ? 73.366  89.655  86.578  1.00 66.95  ? 60   LEU E O     1 
ATOM   7935  C  CB    . LEU F 2  60  ? 74.619  87.738  88.618  1.00 40.59  ? 60   LEU E CB    1 
ATOM   7936  C  CG    . LEU F 2  60  ? 74.749  87.131  90.001  1.00 44.97  ? 60   LEU E CG    1 
ATOM   7937  C  CD1   . LEU F 2  60  ? 75.034  85.651  89.917  1.00 40.68  ? 60   LEU E CD1   1 
ATOM   7938  C  CD2   . LEU F 2  60  ? 75.832  87.862  90.733  1.00 35.50  ? 60   LEU E CD2   1 
ATOM   7939  N  N     . LEU F 2  61  ? 75.322  90.640  87.073  1.00 41.50  ? 61   LEU E N     1 
ATOM   7940  C  CA    . LEU F 2  61  ? 75.294  91.538  85.939  1.00 49.18  ? 61   LEU E CA    1 
ATOM   7941  C  C     . LEU F 2  61  ? 75.919  90.953  84.690  1.00 58.35  ? 61   LEU E C     1 
ATOM   7942  O  O     . LEU F 2  61  ? 75.913  91.612  83.652  1.00 59.19  ? 61   LEU E O     1 
ATOM   7943  C  CB    . LEU F 2  61  ? 75.999  92.828  86.307  1.00 51.37  ? 61   LEU E CB    1 
ATOM   7944  C  CG    . LEU F 2  61  ? 75.356  93.410  87.552  1.00 44.17  ? 61   LEU E CG    1 
ATOM   7945  C  CD1   . LEU F 2  61  ? 76.044  94.682  87.930  1.00 38.13  ? 61   LEU E CD1   1 
ATOM   7946  C  CD2   . LEU F 2  61  ? 73.894  93.634  87.330  1.00 28.88  ? 61   LEU E CD2   1 
ATOM   7947  N  N     . ILE F 2  62  ? 76.451  89.744  84.749  1.00 45.29  ? 62   ILE E N     1 
ATOM   7948  C  CA    . ILE F 2  62  ? 77.066  89.113  83.592  1.00 43.61  ? 62   ILE E CA    1 
ATOM   7949  C  C     . ILE F 2  62  ? 76.316  87.832  83.301  1.00 50.39  ? 62   ILE E C     1 
ATOM   7950  O  O     . ILE F 2  62  ? 76.206  86.962  84.171  1.00 47.65  ? 62   ILE E O     1 
ATOM   7951  C  CB    . ILE F 2  62  ? 78.545  88.820  83.825  1.00 33.42  ? 62   ILE E CB    1 
ATOM   7952  C  CG1   . ILE F 2  62  ? 79.299  90.119  84.022  1.00 40.95  ? 62   ILE E CG1   1 
ATOM   7953  C  CG2   . ILE F 2  62  ? 79.090  88.080  82.652  1.00 33.01  ? 62   ILE E CG2   1 
ATOM   7954  C  CD1   . ILE F 2  62  ? 80.690  89.912  84.528  1.00 25.95  ? 62   ILE E CD1   1 
ATOM   7955  N  N     . ARG F 2  63  ? 75.802  87.711  82.089  1.00 41.57  ? 63   ARG E N     1 
ATOM   7956  C  CA    . ARG F 2  63  ? 75.055  86.518  81.740  1.00 45.86  ? 63   ARG E CA    1 
ATOM   7957  C  C     . ARG F 2  63  ? 75.921  85.283  81.937  1.00 50.00  ? 63   ARG E C     1 
ATOM   7958  O  O     . ARG F 2  63  ? 77.107  85.282  81.610  1.00 51.17  ? 63   ARG E O     1 
ATOM   7959  C  CB    . ARG F 2  63  ? 74.546  86.638  80.310  1.00 69.36  ? 63   ARG E CB    1 
ATOM   7960  C  CG    . ARG F 2  63  ? 73.539  87.746  80.200  1.00 51.80  ? 63   ARG E CG    1 
ATOM   7961  C  CD    . ARG F 2  63  ? 72.291  87.290  80.903  1.00 48.25  ? 63   ARG E CD    1 
ATOM   7962  N  NE    . ARG F 2  63  ? 71.273  88.321  81.048  1.00 72.36  ? 63   ARG E NE    1 
ATOM   7963  C  CZ    . ARG F 2  63  ? 71.112  89.052  82.147  1.00 71.98  ? 63   ARG E CZ    1 
ATOM   7964  N  NH1   . ARG F 2  63  ? 71.899  88.858  83.192  1.00 66.37  ? 63   ARG E NH1   1 
ATOM   7965  N  NH2   . ARG F 2  63  ? 70.157  89.967  82.211  1.00 78.15  ? 63   ARG E NH2   1 
ATOM   7966  N  N     . LYS F 2  64  ? 75.324  84.240  82.511  1.00 74.82  ? 64   LYS E N     1 
ATOM   7967  C  CA    . LYS F 2  64  ? 76.064  83.077  82.979  1.00 23.76  ? 64   LYS E CA    1 
ATOM   7968  C  C     . LYS F 2  64  ? 76.923  82.434  81.901  1.00 32.32  ? 64   LYS E C     1 
ATOM   7969  O  O     . LYS F 2  64  ? 78.151  82.560  81.921  1.00 48.48  ? 64   LYS E O     1 
ATOM   7970  C  CB    . LYS F 2  64  ? 75.110  82.020  83.514  1.00 49.02  ? 64   LYS E CB    1 
ATOM   7971  C  CG    . LYS F 2  64  ? 74.648  82.214  84.928  1.00 71.93  ? 64   LYS E CG    1 
ATOM   7972  C  CD    . LYS F 2  64  ? 73.656  83.344  85.027  1.00 94.16  ? 64   LYS E CD    1 
ATOM   7973  C  CE    . LYS F 2  64  ? 73.107  83.465  86.431  1.00 91.46  ? 64   LYS E CE    1 
ATOM   7974  N  NZ    . LYS F 2  64  ? 72.109  84.560  86.537  1.00 78.65  ? 64   LYS E NZ    1 
ATOM   7975  N  N     . LEU F 2  65  ? 76.291  81.759  80.950  1.00 38.50  ? 65   LEU E N     1 
ATOM   7976  C  CA    . LEU F 2  65  ? 77.037  80.893  80.045  1.00 35.89  ? 65   LEU E CA    1 
ATOM   7977  C  C     . LEU F 2  65  ? 78.232  81.550  79.382  1.00 42.41  ? 65   LEU E C     1 
ATOM   7978  O  O     . LEU F 2  65  ? 79.255  80.863  79.216  1.00 54.74  ? 65   LEU E O     1 
ATOM   7979  C  CB    . LEU F 2  65  ? 76.096  80.315  78.992  1.00 37.42  ? 65   LEU E CB    1 
ATOM   7980  C  CG    . LEU F 2  65  ? 75.124  79.396  79.703  1.00 46.77  ? 65   LEU E CG    1 
ATOM   7981  C  CD1   . LEU F 2  65  ? 74.146  78.792  78.732  1.00 40.07  ? 65   LEU E CD1   1 
ATOM   7982  C  CD2   . LEU F 2  65  ? 75.894  78.322  80.421  1.00 41.62  ? 65   LEU E CD2   1 
ATOM   7983  N  N     . PRO F 2  66  ? 78.205  82.820  78.994  1.00 49.98  ? 66   PRO E N     1 
ATOM   7984  C  CA    . PRO F 2  66  ? 79.457  83.428  78.549  1.00 47.05  ? 66   PRO E CA    1 
ATOM   7985  C  C     . PRO F 2  66  ? 80.514  83.316  79.615  1.00 49.08  ? 66   PRO E C     1 
ATOM   7986  O  O     . PRO F 2  66  ? 81.648  82.903  79.342  1.00 55.61  ? 66   PRO E O     1 
ATOM   7987  C  CB    . PRO F 2  66  ? 79.066  84.878  78.292  1.00 35.79  ? 66   PRO E CB    1 
ATOM   7988  C  CG    . PRO F 2  66  ? 77.655  84.831  78.022  1.00 47.03  ? 66   PRO E CG    1 
ATOM   7989  C  CD    . PRO F 2  66  ? 77.094  83.767  78.890  1.00 51.81  ? 66   PRO E CD    1 
ATOM   7990  N  N     . PHE F 2  67  ? 80.149  83.628  80.852  1.00 37.51  ? 67   PHE E N     1 
ATOM   7991  C  CA    . PHE F 2  67  ? 81.141  83.625  81.909  1.00 38.49  ? 67   PHE E CA    1 
ATOM   7992  C  C     . PHE F 2  67  ? 81.647  82.222  82.165  1.00 39.65  ? 67   PHE E C     1 
ATOM   7993  O  O     . PHE F 2  67  ? 82.853  82.012  82.300  1.00 38.23  ? 67   PHE E O     1 
ATOM   7994  C  CB    . PHE F 2  67  ? 80.556  84.221  83.171  1.00 36.76  ? 67   PHE E CB    1 
ATOM   7995  C  CG    . PHE F 2  67  ? 81.536  84.379  84.252  1.00 21.20  ? 67   PHE E CG    1 
ATOM   7996  C  CD1   . PHE F 2  67  ? 82.404  85.436  84.245  1.00 20.58  ? 67   PHE E CD1   1 
ATOM   7997  C  CD2   . PHE F 2  67  ? 81.587  83.489  85.281  1.00 26.42  ? 67   PHE E CD2   1 
ATOM   7998  C  CE1   . PHE F 2  67  ? 83.309  85.595  85.241  1.00 22.74  ? 67   PHE E CE1   1 
ATOM   7999  C  CE2   . PHE F 2  67  ? 82.491  83.646  86.283  1.00 26.28  ? 67   PHE E CE2   1 
ATOM   8000  C  CZ    . PHE F 2  67  ? 83.352  84.699  86.264  1.00 23.91  ? 67   PHE E CZ    1 
ATOM   8001  N  N     . GLN F 2  68  ? 80.754  81.240  82.201  1.00 29.30  ? 68   GLN E N     1 
ATOM   8002  C  CA    . GLN F 2  68  ? 81.220  79.891  82.469  1.00 35.79  ? 68   GLN E CA    1 
ATOM   8003  C  C     . GLN F 2  68  ? 82.153  79.397  81.376  1.00 45.79  ? 68   GLN E C     1 
ATOM   8004  O  O     . GLN F 2  68  ? 83.192  78.792  81.666  1.00 54.53  ? 68   GLN E O     1 
ATOM   8005  C  CB    . GLN F 2  68  ? 80.055  78.938  82.635  1.00 32.04  ? 68   GLN E CB    1 
ATOM   8006  C  CG    . GLN F 2  68  ? 80.531  77.590  83.060  1.00 45.35  ? 68   GLN E CG    1 
ATOM   8007  C  CD    . GLN F 2  68  ? 79.408  76.667  83.398  1.00 68.22  ? 68   GLN E CD    1 
ATOM   8008  O  OE1   . GLN F 2  68  ? 78.243  77.052  83.357  1.00 73.11  ? 68   GLN E OE1   1 
ATOM   8009  N  NE2   . GLN F 2  68  ? 79.743  75.436  83.750  1.00 75.94  ? 68   GLN E NE2   1 
ATOM   8010  N  N     . ARG F 2  69  ? 81.817  79.640  80.112  1.00 32.45  ? 69   ARG E N     1 
ATOM   8011  C  CA    . ARG F 2  69  ? 82.766  79.240  79.083  1.00 36.05  ? 69   ARG E CA    1 
ATOM   8012  C  C     . ARG F 2  69  ? 84.077  79.981  79.243  1.00 44.58  ? 69   ARG E C     1 
ATOM   8013  O  O     . ARG F 2  69  ? 85.145  79.414  78.990  1.00 57.24  ? 69   ARG E O     1 
ATOM   8014  C  CB    . ARG F 2  69  ? 82.206  79.474  77.690  1.00 46.39  ? 69   ARG E CB    1 
ATOM   8015  C  CG    . ARG F 2  69  ? 81.049  78.592  77.341  1.00 45.26  ? 69   ARG E CG    1 
ATOM   8016  C  CD    . ARG F 2  69  ? 80.867  78.579  75.854  1.00 50.64  ? 69   ARG E CD    1 
ATOM   8017  N  NE    . ARG F 2  69  ? 80.691  79.921  75.327  1.00 48.81  ? 69   ARG E NE    1 
ATOM   8018  C  CZ    . ARG F 2  69  ? 79.524  80.539  75.259  1.00 45.42  ? 69   ARG E CZ    1 
ATOM   8019  N  NH1   . ARG F 2  69  ? 78.433  79.930  75.693  1.00 36.62  ? 69   ARG E NH1   1 
ATOM   8020  N  NH2   . ARG F 2  69  ? 79.447  81.760  74.758  1.00 49.45  ? 69   ARG E NH2   1 
ATOM   8021  N  N     . LEU F 2  70  ? 84.024  81.235  79.684  1.00 43.86  ? 70   LEU E N     1 
ATOM   8022  C  CA    . LEU F 2  70  ? 85.258  81.961  79.940  1.00 38.52  ? 70   LEU E CA    1 
ATOM   8023  C  C     . LEU F 2  70  ? 86.115  81.230  80.959  1.00 40.47  ? 70   LEU E C     1 
ATOM   8024  O  O     . LEU F 2  70  ? 87.295  80.945  80.713  1.00 49.89  ? 70   LEU E O     1 
ATOM   8025  C  CB    . LEU F 2  70  ? 84.948  83.365  80.424  1.00 44.86  ? 70   LEU E CB    1 
ATOM   8026  C  CG    . LEU F 2  70  ? 86.225  84.086  80.796  1.00 43.92  ? 70   LEU E CG    1 
ATOM   8027  C  CD1   . LEU F 2  70  ? 87.074  84.228  79.575  1.00 38.72  ? 70   LEU E CD1   1 
ATOM   8028  C  CD2   . LEU F 2  70  ? 85.893  85.429  81.345  1.00 36.63  ? 70   LEU E CD2   1 
ATOM   8029  N  N     . VAL F 2  71  ? 85.530  80.899  82.105  1.00 32.10  ? 71   VAL E N     1 
ATOM   8030  C  CA    . VAL F 2  71  ? 86.296  80.251  83.158  1.00 40.01  ? 71   VAL E CA    1 
ATOM   8031  C  C     . VAL F 2  71  ? 86.879  78.943  82.662  1.00 40.22  ? 71   VAL E C     1 
ATOM   8032  O  O     . VAL F 2  71  ? 88.082  78.703  82.787  1.00 40.60  ? 71   VAL E O     1 
ATOM   8033  C  CB    . VAL F 2  71  ? 85.429  80.037  84.398  1.00 24.76  ? 71   VAL E CB    1 
ATOM   8034  C  CG1   . VAL F 2  71  ? 86.187  79.259  85.368  1.00 18.29  ? 71   VAL E CG1   1 
ATOM   8035  C  CG2   . VAL F 2  71  ? 85.091  81.348  84.999  1.00 30.45  ? 71   VAL E CG2   1 
ATOM   8036  N  N     . ARG F 2  72  ? 86.047  78.081  82.080  1.00 30.59  ? 72   ARG E N     1 
ATOM   8037  C  CA    . ARG F 2  72  ? 86.572  76.807  81.600  1.00 39.55  ? 72   ARG E CA    1 
ATOM   8038  C  C     . ARG F 2  72  ? 87.739  77.013  80.654  1.00 45.64  ? 72   ARG E C     1 
ATOM   8039  O  O     . ARG F 2  72  ? 88.757  76.314  80.746  1.00 44.66  ? 72   ARG E O     1 
ATOM   8040  C  CB    . ARG F 2  72  ? 85.477  76.005  80.918  1.00 42.88  ? 72   ARG E CB    1 
ATOM   8041  C  CG    . ARG F 2  72  ? 84.418  75.532  81.859  1.00 32.32  ? 72   ARG E CG    1 
ATOM   8042  C  CD    . ARG F 2  72  ? 83.359  74.753  81.136  1.00 47.37  ? 72   ARG E CD    1 
ATOM   8043  N  NE    . ARG F 2  72  ? 82.317  74.330  82.055  1.00 60.35  ? 72   ARG E NE    1 
ATOM   8044  C  CZ    . ARG F 2  72  ? 82.387  73.224  82.776  1.00 60.79  ? 72   ARG E CZ    1 
ATOM   8045  N  NH1   . ARG F 2  72  ? 83.442  72.438  82.665  1.00 44.15  ? 72   ARG E NH1   1 
ATOM   8046  N  NH2   . ARG F 2  72  ? 81.402  72.901  83.597  1.00 72.99  ? 72   ARG E NH2   1 
ATOM   8047  N  N     . GLU F 2  73  ? 87.625  77.983  79.750  1.00 57.79  ? 73   GLU E N     1 
ATOM   8048  C  CA    . GLU F 2  73  ? 88.750  78.278  78.878  1.00 58.32  ? 73   GLU E CA    1 
ATOM   8049  C  C     . GLU F 2  73  ? 89.999  78.565  79.684  1.00 63.67  ? 73   GLU E C     1 
ATOM   8050  O  O     . GLU F 2  73  ? 91.036  77.930  79.484  1.00 68.54  ? 73   GLU E O     1 
ATOM   8051  C  CB    . GLU F 2  73  ? 88.449  79.463  77.979  1.00 66.55  ? 73   GLU E CB    1 
ATOM   8052  C  CG    . GLU F 2  73  ? 89.627  79.785  77.099  1.00 82.75  ? 73   GLU E CG    1 
ATOM   8053  C  CD    . GLU F 2  73  ? 89.391  80.984  76.217  1.00 99.69  ? 73   GLU E CD    1 
ATOM   8054  O  OE1   . GLU F 2  73  ? 88.321  81.602  76.335  1.00 92.95  ? 73   GLU E OE1   1 
ATOM   8055  O  OE2   . GLU F 2  73  ? 90.278  81.312  75.403  1.00 109.80 ? 73   GLU E OE2   1 
ATOM   8056  N  N     . ILE F 2  74  ? 89.917  79.517  80.612  1.00 58.55  ? 74   ILE E N     1 
ATOM   8057  C  CA    . ILE F 2  74  ? 91.121  79.892  81.345  1.00 48.20  ? 74   ILE E CA    1 
ATOM   8058  C  C     . ILE F 2  74  ? 91.676  78.715  82.126  1.00 48.42  ? 74   ILE E C     1 
ATOM   8059  O  O     . ILE F 2  74  ? 92.890  78.603  82.313  1.00 51.61  ? 74   ILE E O     1 
ATOM   8060  C  CB    . ILE F 2  74  ? 90.838  81.093  82.254  1.00 30.12  ? 74   ILE E CB    1 
ATOM   8061  C  CG1   . ILE F 2  74  ? 90.561  82.317  81.408  1.00 32.88  ? 74   ILE E CG1   1 
ATOM   8062  C  CG2   . ILE F 2  74  ? 92.012  81.394  83.108  1.00 33.26  ? 74   ILE E CG2   1 
ATOM   8063  C  CD1   . ILE F 2  74  ? 90.125  83.481  82.208  1.00 39.25  ? 74   ILE E CD1   1 
ATOM   8064  N  N     . ALA F 2  75  ? 90.823  77.800  82.559  1.00 43.96  ? 75   ALA E N     1 
ATOM   8065  C  CA    . ALA F 2  75  ? 91.329  76.670  83.317  1.00 46.11  ? 75   ALA E CA    1 
ATOM   8066  C  C     . ALA F 2  75  ? 91.904  75.577  82.437  1.00 57.04  ? 75   ALA E C     1 
ATOM   8067  O  O     . ALA F 2  75  ? 92.578  74.689  82.957  1.00 63.59  ? 75   ALA E O     1 
ATOM   8068  C  CB    . ALA F 2  75  ? 90.234  76.079  84.194  1.00 44.52  ? 75   ALA E CB    1 
ATOM   8069  N  N     . GLN F 2  76  ? 91.652  75.599  81.128  1.00 63.96  ? 76   GLN E N     1 
ATOM   8070  C  CA    . GLN F 2  76  ? 92.298  74.613  80.263  1.00 59.44  ? 76   GLN E CA    1 
ATOM   8071  C  C     . GLN F 2  76  ? 93.807  74.637  80.418  1.00 70.60  ? 76   GLN E C     1 
ATOM   8072  O  O     . GLN F 2  76  ? 94.460  73.591  80.378  1.00 86.10  ? 76   GLN E O     1 
ATOM   8073  C  CB    . GLN F 2  76  ? 91.953  74.864  78.802  1.00 72.49  ? 76   GLN E CB    1 
ATOM   8074  C  CG    . GLN F 2  76  ? 90.517  74.644  78.454  1.00 83.76  ? 76   GLN E CG    1 
ATOM   8075  C  CD    . GLN F 2  76  ? 90.231  75.030  77.026  1.00 90.73  ? 76   GLN E CD    1 
ATOM   8076  O  OE1   . GLN F 2  76  ? 90.966  75.818  76.430  1.00 88.30  ? 76   GLN E OE1   1 
ATOM   8077  N  NE2   . GLN F 2  76  ? 89.153  74.491  76.468  1.00 84.23  ? 76   GLN E NE2   1 
ATOM   8078  N  N     . ASP F 2  77  ? 94.381  75.820  80.599  1.00 60.05  ? 77   ASP E N     1 
ATOM   8079  C  CA    . ASP F 2  77  ? 95.820  75.959  80.446  1.00 62.59  ? 77   ASP E CA    1 
ATOM   8080  C  C     . ASP F 2  77  ? 96.581  75.342  81.602  1.00 58.62  ? 77   ASP E C     1 
ATOM   8081  O  O     . ASP F 2  77  ? 97.697  74.855  81.415  1.00 71.55  ? 77   ASP E O     1 
ATOM   8082  C  CB    . ASP F 2  77  ? 96.180  77.428  80.319  1.00 70.40  ? 77   ASP E CB    1 
ATOM   8083  C  CG    . ASP F 2  77  ? 95.503  78.077  79.149  1.00 82.19  ? 77   ASP E CG    1 
ATOM   8084  O  OD1   . ASP F 2  77  ? 94.948  77.334  78.314  1.00 86.42  ? 77   ASP E OD1   1 
ATOM   8085  O  OD2   . ASP F 2  77  ? 95.513  79.320  79.064  1.00 86.55  ? 77   ASP E OD2   1 
ATOM   8086  N  N     . PHE F 2  78  ? 96.009  75.353  82.798  1.00 52.09  ? 78   PHE E N     1 
ATOM   8087  C  CA    . PHE F 2  78  ? 96.782  74.962  83.972  1.00 52.21  ? 78   PHE E CA    1 
ATOM   8088  C  C     . PHE F 2  78  ? 96.802  73.447  84.103  1.00 57.43  ? 78   PHE E C     1 
ATOM   8089  O  O     . PHE F 2  78  ? 97.828  72.806  83.867  1.00 70.40  ? 78   PHE E O     1 
ATOM   8090  C  CB    . PHE F 2  78  ? 96.199  75.628  85.214  1.00 45.27  ? 78   PHE E CB    1 
ATOM   8091  C  CG    . PHE F 2  78  ? 96.174  77.110  85.123  1.00 46.43  ? 78   PHE E CG    1 
ATOM   8092  C  CD1   . PHE F 2  78  ? 96.997  77.767  84.242  1.00 61.81  ? 78   PHE E CD1   1 
ATOM   8093  C  CD2   . PHE F 2  78  ? 95.313  77.846  85.891  1.00 47.62  ? 78   PHE E CD2   1 
ATOM   8094  C  CE1   . PHE F 2  78  ? 96.968  79.120  84.142  1.00 54.35  ? 78   PHE E CE1   1 
ATOM   8095  C  CE2   . PHE F 2  78  ? 95.281  79.200  85.790  1.00 52.08  ? 78   PHE E CE2   1 
ATOM   8096  C  CZ    . PHE F 2  78  ? 96.111  79.838  84.918  1.00 36.69  ? 78   PHE E CZ    1 
ATOM   8097  N  N     . LYS F 2  79  ? 95.679  72.860  84.464  1.00 49.61  ? 79   LYS E N     1 
ATOM   8098  C  CA    . LYS F 2  79  ? 95.492  71.431  84.319  1.00 61.57  ? 79   LYS E CA    1 
ATOM   8099  C  C     . LYS F 2  79  ? 94.438  71.220  83.244  1.00 75.55  ? 79   LYS E C     1 
ATOM   8100  O  O     . LYS F 2  79  ? 93.853  72.171  82.728  1.00 85.52  ? 79   LYS E O     1 
ATOM   8101  C  CB    . LYS F 2  79  ? 95.097  70.798  85.653  1.00 35.40  ? 79   LYS E CB    1 
ATOM   8102  C  CG    . LYS F 2  79  ? 95.000  69.279  85.638  1.00 48.92  ? 79   LYS E CG    1 
ATOM   8103  C  CD    . LYS F 2  79  ? 94.575  68.713  86.973  1.00 51.78  ? 79   LYS E CD    1 
ATOM   8104  C  CE    . LYS F 2  79  ? 94.210  67.247  86.838  1.00 56.75  ? 79   LYS E CE    1 
ATOM   8105  N  NZ    . LYS F 2  79  ? 95.349  66.430  86.360  1.00 60.14  ? 79   LYS E NZ    1 
ATOM   8106  N  N     . THR F 2  80  ? 94.192  69.969  82.900  1.00 74.12  ? 80   THR E N     1 
ATOM   8107  C  CA    . THR F 2  80  ? 93.246  69.643  81.854  1.00 81.32  ? 80   THR E CA    1 
ATOM   8108  C  C     . THR F 2  80  ? 92.182  68.703  82.394  1.00 81.29  ? 80   THR E C     1 
ATOM   8109  O  O     . THR F 2  80  ? 92.428  67.920  83.313  1.00 70.76  ? 80   THR E O     1 
ATOM   8110  C  CB    . THR F 2  80  ? 93.953  69.020  80.658  1.00 95.70  ? 80   THR E CB    1 
ATOM   8111  O  OG1   . THR F 2  80  ? 93.005  68.794  79.613  1.00 104.27 ? 80   THR E OG1   1 
ATOM   8112  C  CG2   . THR F 2  80  ? 94.601  67.713  81.044  1.00 80.24  ? 80   THR E CG2   1 
ATOM   8113  N  N     . ASP F 2  81  ? 90.989  68.811  81.822  1.00 84.44  ? 81   ASP E N     1 
ATOM   8114  C  CA    . ASP F 2  81  ? 89.850  67.986  82.207  1.00 87.74  ? 81   ASP E CA    1 
ATOM   8115  C  C     . ASP F 2  81  ? 89.456  68.213  83.662  1.00 74.55  ? 81   ASP E C     1 
ATOM   8116  O  O     . ASP F 2  81  ? 89.268  67.272  84.431  1.00 71.66  ? 81   ASP E O     1 
ATOM   8117  C  CB    . ASP F 2  81  ? 90.134  66.510  81.947  1.00 97.42  ? 81   ASP E CB    1 
ATOM   8118  C  CG    . ASP F 2  81  ? 90.211  66.197  80.478  1.00 104.82 ? 81   ASP E CG    1 
ATOM   8119  O  OD1   . ASP F 2  81  ? 89.766  67.044  79.678  1.00 106.77 ? 81   ASP E OD1   1 
ATOM   8120  O  OD2   . ASP F 2  81  ? 90.710  65.111  80.119  1.00 103.84 ? 81   ASP E OD2   1 
ATOM   8121  N  N     . LEU F 2  82  ? 89.339  69.477  84.042  1.00 65.78  ? 82   LEU E N     1 
ATOM   8122  C  CA    . LEU F 2  82  ? 88.737  69.791  85.321  1.00 50.75  ? 82   LEU E CA    1 
ATOM   8123  C  C     . LEU F 2  82  ? 87.224  69.756  85.237  1.00 56.80  ? 82   LEU E C     1 
ATOM   8124  O  O     . LEU F 2  82  ? 86.628  69.930  84.176  1.00 50.73  ? 82   LEU E O     1 
ATOM   8125  C  CB    . LEU F 2  82  ? 89.180  71.154  85.821  1.00 36.22  ? 82   LEU E CB    1 
ATOM   8126  C  CG    . LEU F 2  82  ? 90.587  71.190  86.374  1.00 55.43  ? 82   LEU E CG    1 
ATOM   8127  C  CD1   . LEU F 2  82  ? 90.933  72.593  86.722  1.00 63.25  ? 82   LEU E CD1   1 
ATOM   8128  C  CD2   . LEU F 2  82  ? 90.629  70.347  87.605  1.00 46.39  ? 82   LEU E CD2   1 
ATOM   8129  N  N     . ARG F 2  83  ? 86.604  69.535  86.386  1.00 59.40  ? 83   ARG E N     1 
ATOM   8130  C  CA    . ARG F 2  83  ? 85.162  69.607  86.531  1.00 59.38  ? 83   ARG E CA    1 
ATOM   8131  C  C     . ARG F 2  83  ? 84.814  70.597  87.624  1.00 58.86  ? 83   ARG E C     1 
ATOM   8132  O  O     . ARG F 2  83  ? 85.299  70.479  88.750  1.00 54.56  ? 83   ARG E O     1 
ATOM   8133  C  CB    . ARG F 2  83  ? 84.582  68.249  86.865  1.00 60.57  ? 83   ARG E CB    1 
ATOM   8134  C  CG    . ARG F 2  83  ? 84.740  67.295  85.748  1.00 64.38  ? 83   ARG E CG    1 
ATOM   8135  C  CD    . ARG F 2  83  ? 84.077  65.990  86.035  1.00 80.71  ? 83   ARG E CD    1 
ATOM   8136  N  NE    . ARG F 2  83  ? 84.336  65.086  84.930  1.00 103.73 ? 83   ARG E NE    1 
ATOM   8137  C  CZ    . ARG F 2  83  ? 83.986  63.811  84.912  1.00 113.08 ? 83   ARG E CZ    1 
ATOM   8138  N  NH1   . ARG F 2  83  ? 83.351  63.281  85.947  1.00 109.66 ? 83   ARG E NH1   1 
ATOM   8139  N  NH2   . ARG F 2  83  ? 84.275  63.069  83.855  1.00 113.92 ? 83   ARG E NH2   1 
ATOM   8140  N  N     . PHE F 2  84  ? 83.962  71.551  87.296  1.00 65.43  ? 84   PHE E N     1 
ATOM   8141  C  CA    . PHE F 2  84  ? 83.554  72.584  88.226  1.00 55.46  ? 84   PHE E CA    1 
ATOM   8142  C  C     . PHE F 2  84  ? 82.222  72.247  88.858  1.00 52.83  ? 84   PHE E C     1 
ATOM   8143  O  O     . PHE F 2  84  ? 81.253  71.979  88.150  1.00 59.84  ? 84   PHE E O     1 
ATOM   8144  C  CB    . PHE F 2  84  ? 83.437  73.916  87.508  1.00 43.00  ? 84   PHE E CB    1 
ATOM   8145  C  CG    . PHE F 2  84  ? 84.734  74.520  87.169  1.00 54.85  ? 84   PHE E CG    1 
ATOM   8146  C  CD1   . PHE F 2  84  ? 85.856  74.171  87.856  1.00 57.28  ? 84   PHE E CD1   1 
ATOM   8147  C  CD2   . PHE F 2  84  ? 84.832  75.455  86.184  1.00 50.25  ? 84   PHE E CD2   1 
ATOM   8148  C  CE1   . PHE F 2  84  ? 87.046  74.741  87.564  1.00 62.60  ? 84   PHE E CE1   1 
ATOM   8149  C  CE2   . PHE F 2  84  ? 86.020  76.011  85.887  1.00 46.13  ? 84   PHE E CE2   1 
ATOM   8150  C  CZ    . PHE F 2  84  ? 87.128  75.660  86.577  1.00 57.03  ? 84   PHE E CZ    1 
ATOM   8151  N  N     . GLN F 2  85  ? 82.162  72.280  90.179  1.00 45.16  ? 85   GLN E N     1 
ATOM   8152  C  CA    . GLN F 2  85  ? 80.863  72.372  90.814  1.00 42.47  ? 85   GLN E CA    1 
ATOM   8153  C  C     . GLN F 2  85  ? 80.242  73.702  90.446  1.00 50.59  ? 85   GLN E C     1 
ATOM   8154  O  O     . GLN F 2  85  ? 80.863  74.749  90.618  1.00 52.21  ? 85   GLN E O     1 
ATOM   8155  C  CB    . GLN F 2  85  ? 80.972  72.256  92.326  1.00 47.84  ? 85   GLN E CB    1 
ATOM   8156  C  CG    . GLN F 2  85  ? 81.304  70.885  92.828  1.00 50.44  ? 85   GLN E CG    1 
ATOM   8157  C  CD    . GLN F 2  85  ? 81.334  70.835  94.334  1.00 63.36  ? 85   GLN E CD    1 
ATOM   8158  O  OE1   . GLN F 2  85  ? 81.563  71.843  94.991  1.00 52.48  ? 85   GLN E OE1   1 
ATOM   8159  N  NE2   . GLN F 2  85  ? 81.086  69.661  94.892  1.00 64.70  ? 85   GLN E NE2   1 
ATOM   8160  N  N     . SER F 2  86  ? 79.015  73.663  89.931  1.00 59.85  ? 86   SER E N     1 
ATOM   8161  C  CA    . SER F 2  86  ? 78.374  74.890  89.483  1.00 53.04  ? 86   SER E CA    1 
ATOM   8162  C  C     . SER F 2  86  ? 78.417  75.966  90.554  1.00 57.35  ? 86   SER E C     1 
ATOM   8163  O  O     . SER F 2  86  ? 78.559  77.154  90.240  1.00 65.32  ? 86   SER E O     1 
ATOM   8164  C  CB    . SER F 2  86  ? 76.937  74.606  89.094  1.00 69.65  ? 86   SER E CB    1 
ATOM   8165  O  OG    . SER F 2  86  ? 76.230  74.166  90.231  1.00 85.42  ? 86   SER E OG    1 
ATOM   8166  N  N     . SER F 2  87  ? 78.324  75.571  91.821  1.00 55.52  ? 87   SER E N     1 
ATOM   8167  C  CA    . SER F 2  87  ? 78.474  76.536  92.899  1.00 60.34  ? 87   SER E CA    1 
ATOM   8168  C  C     . SER F 2  87  ? 79.786  77.292  92.781  1.00 60.29  ? 87   SER E C     1 
ATOM   8169  O  O     . SER F 2  87  ? 79.837  78.499  93.034  1.00 53.18  ? 87   SER E O     1 
ATOM   8170  C  CB    . SER F 2  87  ? 78.387  75.827  94.238  1.00 47.08  ? 87   SER E CB    1 
ATOM   8171  O  OG    . SER F 2  87  ? 79.407  74.860  94.322  1.00 66.49  ? 87   SER E OG    1 
ATOM   8172  N  N     . ALA F 2  88  ? 80.858  76.607  92.391  1.00 52.15  ? 88   ALA E N     1 
ATOM   8173  C  CA    . ALA F 2  88  ? 82.124  77.297  92.182  1.00 49.28  ? 88   ALA E CA    1 
ATOM   8174  C  C     . ALA F 2  88  ? 81.968  78.404  91.158  1.00 54.86  ? 88   ALA E C     1 
ATOM   8175  O  O     . ALA F 2  88  ? 82.144  79.585  91.471  1.00 59.72  ? 88   ALA E O     1 
ATOM   8176  C  CB    . ALA F 2  88  ? 83.207  76.320  91.749  1.00 53.41  ? 88   ALA E CB    1 
ATOM   8177  N  N     . VAL F 2  89  ? 81.628  78.041  89.926  1.00 32.82  ? 89   VAL E N     1 
ATOM   8178  C  CA    . VAL F 2  89  ? 81.474  79.047  88.883  1.00 34.47  ? 89   VAL E CA    1 
ATOM   8179  C  C     . VAL F 2  89  ? 80.636  80.211  89.372  1.00 41.41  ? 89   VAL E C     1 
ATOM   8180  O  O     . VAL F 2  89  ? 80.943  81.375  89.091  1.00 52.95  ? 89   VAL E O     1 
ATOM   8181  C  CB    . VAL F 2  89  ? 80.880  78.417  87.622  1.00 39.41  ? 89   VAL E CB    1 
ATOM   8182  C  CG1   . VAL F 2  89  ? 80.474  79.490  86.678  1.00 42.39  ? 89   VAL E CG1   1 
ATOM   8183  C  CG2   . VAL F 2  89  ? 81.917  77.557  86.979  1.00 47.32  ? 89   VAL E CG2   1 
ATOM   8184  N  N     . MET F 2  90  ? 79.597  79.932  90.152  1.00 30.77  ? 90   MET E N     1 
ATOM   8185  C  CA    . MET F 2  90  ? 78.898  81.029  90.807  1.00 39.24  ? 90   MET E CA    1 
ATOM   8186  C  C     . MET F 2  90  ? 79.840  81.843  91.680  1.00 44.15  ? 90   MET E C     1 
ATOM   8187  O  O     . MET F 2  90  ? 79.769  83.077  91.695  1.00 54.91  ? 90   MET E O     1 
ATOM   8188  C  CB    . MET F 2  90  ? 77.742  80.496  91.630  1.00 36.25  ? 90   MET E CB    1 
ATOM   8189  C  CG    . MET F 2  90  ? 76.661  79.907  90.780  1.00 45.23  ? 90   MET E CG    1 
ATOM   8190  S  SD    . MET F 2  90  ? 76.011  81.175  89.704  1.00 57.56  ? 90   MET E SD    1 
ATOM   8191  C  CE    . MET F 2  90  ? 75.304  82.252  90.940  1.00 289.71 ? 90   MET E CE    1 
ATOM   8192  N  N     . ALA F 2  91  ? 80.743  81.179  92.400  1.00 32.94  ? 91   ALA E N     1 
ATOM   8193  C  CA    . ALA F 2  91  ? 81.655  81.917  93.263  1.00 31.62  ? 91   ALA E CA    1 
ATOM   8194  C  C     . ALA F 2  91  ? 82.529  82.855  92.454  1.00 41.99  ? 91   ALA E C     1 
ATOM   8195  O  O     . ALA F 2  91  ? 82.588  84.057  92.730  1.00 36.82  ? 91   ALA E O     1 
ATOM   8196  C  CB    . ALA F 2  91  ? 82.511  80.966  94.084  1.00 36.53  ? 91   ALA E CB    1 
ATOM   8197  N  N     . LEU F 2  92  ? 83.209  82.329  91.441  1.00 24.79  ? 92   LEU E N     1 
ATOM   8198  C  CA    . LEU F 2  92  ? 84.008  83.202  90.597  1.00 18.37  ? 92   LEU E CA    1 
ATOM   8199  C  C     . LEU F 2  92  ? 83.192  84.376  90.098  1.00 24.65  ? 92   LEU E C     1 
ATOM   8200  O  O     . LEU F 2  92  ? 83.633  85.525  90.178  1.00 34.22  ? 92   LEU E O     1 
ATOM   8201  C  CB    . LEU F 2  92  ? 84.592  82.438  89.424  1.00 30.57  ? 92   LEU E CB    1 
ATOM   8202  C  CG    . LEU F 2  92  ? 85.685  81.528  89.912  1.00 26.75  ? 92   LEU E CG    1 
ATOM   8203  C  CD1   . LEU F 2  92  ? 86.258  80.779  88.762  1.00 19.55  ? 92   LEU E CD1   1 
ATOM   8204  C  CD2   . LEU F 2  92  ? 86.710  82.393  90.524  1.00 10.94  ? 92   LEU E CD2   1 
ATOM   8205  N  N     . GLN F 2  93  ? 81.989  84.118  89.597  1.00 38.57  ? 93   GLN E N     1 
ATOM   8206  C  CA    . GLN F 2  93  ? 81.207  85.224  89.072  1.00 30.25  ? 93   GLN E CA    1 
ATOM   8207  C  C     . GLN F 2  93  ? 80.981  86.281  90.131  1.00 34.49  ? 93   GLN E C     1 
ATOM   8208  O  O     . GLN F 2  93  ? 81.151  87.474  89.868  1.00 34.76  ? 93   GLN E O     1 
ATOM   8209  C  CB    . GLN F 2  93  ? 79.878  84.738  88.531  1.00 22.53  ? 93   GLN E CB    1 
ATOM   8210  C  CG    . GLN F 2  93  ? 79.100  85.828  87.884  1.00 29.28  ? 93   GLN E CG    1 
ATOM   8211  C  CD    . GLN F 2  93  ? 77.885  85.304  87.194  1.00 39.55  ? 93   GLN E CD    1 
ATOM   8212  O  OE1   . GLN F 2  93  ? 77.670  84.100  87.128  1.00 40.52  ? 93   GLN E OE1   1 
ATOM   8213  N  NE2   . GLN F 2  93  ? 77.075  86.201  86.667  1.00 45.30  ? 93   GLN E NE2   1 
ATOM   8214  N  N     . GLU F 2  94  ? 80.634  85.870  91.343  1.00 27.33  ? 94   GLU E N     1 
ATOM   8215  C  CA    . GLU F 2  94  ? 80.346  86.869  92.360  1.00 24.17  ? 94   GLU E CA    1 
ATOM   8216  C  C     . GLU F 2  94  ? 81.586  87.668  92.723  1.00 27.45  ? 94   GLU E C     1 
ATOM   8217  O  O     . GLU F 2  94  ? 81.536  88.902  92.820  1.00 31.06  ? 94   GLU E O     1 
ATOM   8218  C  CB    . GLU F 2  94  ? 79.760  86.226  93.600  1.00 20.36  ? 94   GLU E CB    1 
ATOM   8219  C  CG    . GLU F 2  94  ? 79.450  87.260  94.625  1.00 31.01  ? 94   GLU E CG    1 
ATOM   8220  C  CD    . GLU F 2  94  ? 78.382  88.224  94.153  1.00 40.79  ? 94   GLU E CD    1 
ATOM   8221  O  OE1   . GLU F 2  94  ? 77.633  87.880  93.221  1.00 40.14  ? 94   GLU E OE1   1 
ATOM   8222  O  OE2   . GLU F 2  94  ? 78.303  89.345  94.693  1.00 31.14  ? 94   GLU E OE2   1 
ATOM   8223  N  N     . ALA F 2  95  ? 82.706  86.990  92.935  1.00 14.28  ? 95   ALA E N     1 
ATOM   8224  C  CA    . ALA F 2  95  ? 83.934  87.717  93.209  1.00 19.33  ? 95   ALA E CA    1 
ATOM   8225  C  C     . ALA F 2  95  ? 84.212  88.708  92.094  1.00 25.25  ? 95   ALA E C     1 
ATOM   8226  O  O     . ALA F 2  95  ? 84.161  89.919  92.312  1.00 25.98  ? 95   ALA E O     1 
ATOM   8227  C  CB    . ALA F 2  95  ? 85.107  86.765  93.361  1.00 8.35   ? 95   ALA E CB    1 
ATOM   8228  N  N     . SER F 2  96  ? 84.461  88.196  90.889  1.00 16.17  ? 96   SER E N     1 
ATOM   8229  C  CA    . SER F 2  96  ? 84.860  89.048  89.776  1.00 24.26  ? 96   SER E CA    1 
ATOM   8230  C  C     . SER F 2  96  ? 83.935  90.235  89.599  1.00 30.44  ? 96   SER E C     1 
ATOM   8231  O  O     . SER F 2  96  ? 84.397  91.352  89.360  1.00 27.10  ? 96   SER E O     1 
ATOM   8232  C  CB    . SER F 2  96  ? 84.919  88.239  88.496  1.00 13.22  ? 96   SER E CB    1 
ATOM   8233  O  OG    . SER F 2  96  ? 85.942  87.282  88.604  1.00 25.39  ? 96   SER E OG    1 
ATOM   8234  N  N     . GLU F 2  97  ? 82.630  90.035  89.713  1.00 21.32  ? 97   GLU E N     1 
ATOM   8235  C  CA    . GLU F 2  97  ? 81.778  91.205  89.598  1.00 23.77  ? 97   GLU E CA    1 
ATOM   8236  C  C     . GLU F 2  97  ? 82.021  92.174  90.740  1.00 21.35  ? 97   GLU E C     1 
ATOM   8237  O  O     . GLU F 2  97  ? 82.007  93.390  90.531  1.00 26.61  ? 97   GLU E O     1 
ATOM   8238  C  CB    . GLU F 2  97  ? 80.315  90.815  89.513  1.00 32.25  ? 97   GLU E CB    1 
ATOM   8239  C  CG    . GLU F 2  97  ? 79.978  90.187  88.190  1.00 45.30  ? 97   GLU E CG    1 
ATOM   8240  C  CD    . GLU F 2  97  ? 78.511  89.828  88.063  1.00 58.50  ? 97   GLU E CD    1 
ATOM   8241  O  OE1   . GLU F 2  97  ? 77.791  89.884  89.081  1.00 63.42  ? 97   GLU E OE1   1 
ATOM   8242  O  OE2   . GLU F 2  97  ? 78.073  89.504  86.937  1.00 49.29  ? 97   GLU E OE2   1 
ATOM   8243  N  N     . ALA F 2  98  ? 82.294  91.679  91.942  1.00 23.96  ? 98   ALA E N     1 
ATOM   8244  C  CA    . ALA F 2  98  ? 82.574  92.643  93.000  1.00 18.69  ? 98   ALA E CA    1 
ATOM   8245  C  C     . ALA F 2  98  ? 83.887  93.371  92.764  1.00 24.72  ? 98   ALA E C     1 
ATOM   8246  O  O     . ALA F 2  98  ? 84.009  94.560  93.084  1.00 24.71  ? 98   ALA E O     1 
ATOM   8247  C  CB    . ALA F 2  98  ? 82.594  91.959  94.350  1.00 20.76  ? 98   ALA E CB    1 
ATOM   8248  N  N     . TYR F 2  99  ? 84.862  92.692  92.177  1.00 22.08  ? 99   TYR E N     1 
ATOM   8249  C  CA    . TYR F 2  99  ? 86.136  93.329  91.890  1.00 18.31  ? 99   TYR E CA    1 
ATOM   8250  C  C     . TYR F 2  99  ? 85.989  94.408  90.833  1.00 26.72  ? 99   TYR E C     1 
ATOM   8251  O  O     . TYR F 2  99  ? 86.399  95.551  91.048  1.00 22.53  ? 99   TYR E O     1 
ATOM   8252  C  CB    . TYR F 2  99  ? 87.136  92.271  91.470  1.00 20.43  ? 99   TYR E CB    1 
ATOM   8253  C  CG    . TYR F 2  99  ? 88.431  92.785  90.959  1.00 27.35  ? 99   TYR E CG    1 
ATOM   8254  C  CD1   . TYR F 2  99  ? 89.305  93.426  91.786  1.00 16.08  ? 99   TYR E CD1   1 
ATOM   8255  C  CD2   . TYR F 2  99  ? 88.819  92.537  89.671  1.00 25.82  ? 99   TYR E CD2   1 
ATOM   8256  C  CE1   . TYR F 2  99  ? 90.504  93.869  91.327  1.00 23.90  ? 99   TYR E CE1   1 
ATOM   8257  C  CE2   . TYR F 2  99  ? 90.015  92.966  89.203  1.00 26.97  ? 99   TYR E CE2   1 
ATOM   8258  C  CZ    . TYR F 2  99  ? 90.858  93.634  90.033  1.00 41.18  ? 99   TYR E CZ    1 
ATOM   8259  O  OH    . TYR F 2  99  ? 92.071  94.070  89.566  1.00 52.78  ? 99   TYR E OH    1 
ATOM   8260  N  N     . LEU F 2  100 ? 85.378  94.084  89.696  1.00 25.57  ? 100  LEU E N     1 
ATOM   8261  C  CA    . LEU F 2  100 ? 85.192  95.110  88.681  1.00 32.29  ? 100  LEU E CA    1 
ATOM   8262  C  C     . LEU F 2  100 ? 84.363  96.265  89.201  1.00 27.71  ? 100  LEU E C     1 
ATOM   8263  O  O     . LEU F 2  100 ? 84.633  97.420  88.867  1.00 18.99  ? 100  LEU E O     1 
ATOM   8264  C  CB    . LEU F 2  100 ? 84.553  94.535  87.437  1.00 13.16  ? 100  LEU E CB    1 
ATOM   8265  C  CG    . LEU F 2  100 ? 85.525  93.619  86.746  1.00 10.80  ? 100  LEU E CG    1 
ATOM   8266  C  CD1   . LEU F 2  100 ? 84.902  93.072  85.507  1.00 4.01   ? 100  LEU E CD1   1 
ATOM   8267  C  CD2   . LEU F 2  100 ? 86.721  94.424  86.423  1.00 7.99   ? 100  LEU E CD2   1 
ATOM   8268  N  N     . VAL F 2  101 ? 83.360  95.994  90.024  1.00 25.08  ? 101  VAL E N     1 
ATOM   8269  C  CA    . VAL F 2  101 ? 82.592  97.102  90.572  1.00 22.08  ? 101  VAL E CA    1 
ATOM   8270  C  C     . VAL F 2  101 ? 83.487  98.025  91.382  1.00 32.89  ? 101  VAL E C     1 
ATOM   8271  O  O     . VAL F 2  101 ? 83.475  99.249  91.194  1.00 43.87  ? 101  VAL E O     1 
ATOM   8272  C  CB    . VAL F 2  101 ? 81.421  96.592  91.410  1.00 17.99  ? 101  VAL E CB    1 
ATOM   8273  C  CG1   . VAL F 2  101 ? 80.850  97.733  92.165  1.00 14.27  ? 101  VAL E CG1   1 
ATOM   8274  C  CG2   . VAL F 2  101 ? 80.387  96.040  90.507  1.00 14.61  ? 101  VAL E CG2   1 
ATOM   8275  N  N     . ALA F 2  102 ? 84.276  97.466  92.300  1.00 28.82  ? 102  ALA E N     1 
ATOM   8276  C  CA    . ALA F 2  102 ? 85.187  98.318  93.055  1.00 20.76  ? 102  ALA E CA    1 
ATOM   8277  C  C     . ALA F 2  102 ? 86.063  99.123  92.115  1.00 30.63  ? 102  ALA E C     1 
ATOM   8278  O  O     . ALA F 2  102 ? 86.180  100.349 92.237  1.00 25.23  ? 102  ALA E O     1 
ATOM   8279  C  CB    . ALA F 2  102 ? 86.048  97.479  93.991  1.00 13.78  ? 102  ALA E CB    1 
ATOM   8280  N  N     . LEU F 2  103 ? 86.650  98.443  91.136  1.00 21.83  ? 103  LEU E N     1 
ATOM   8281  C  CA    . LEU F 2  103 ? 87.554  99.095  90.204  1.00 8.89   ? 103  LEU E CA    1 
ATOM   8282  C  C     . LEU F 2  103 ? 86.903  100.295 89.544  1.00 16.11  ? 103  LEU E C     1 
ATOM   8283  O  O     . LEU F 2  103 ? 87.545  101.329 89.353  1.00 21.52  ? 103  LEU E O     1 
ATOM   8284  C  CB    . LEU F 2  103 ? 87.998  98.098  89.151  1.00 43.25  ? 103  LEU E CB    1 
ATOM   8285  C  CG    . LEU F 2  103 ? 88.964  98.678  88.159  1.00 39.37  ? 103  LEU E CG    1 
ATOM   8286  C  CD1   . LEU F 2  103 ? 90.123  99.049  88.970  1.00 37.86  ? 103  LEU E CD1   1 
ATOM   8287  C  CD2   . LEU F 2  103 ? 89.343  97.638  87.158  1.00 44.30  ? 103  LEU E CD2   1 
ATOM   8288  N  N     . PHE F 2  104 ? 85.624  100.191 89.197  1.00 18.13  ? 104  PHE E N     1 
ATOM   8289  C  CA    . PHE F 2  104 ? 84.993  101.332 88.553  1.00 20.41  ? 104  PHE E CA    1 
ATOM   8290  C  C     . PHE F 2  104 ? 84.619  102.429 89.524  1.00 24.70  ? 104  PHE E C     1 
ATOM   8291  O  O     . PHE F 2  104 ? 84.666  103.598 89.146  1.00 26.54  ? 104  PHE E O     1 
ATOM   8292  C  CB    . PHE F 2  104 ? 83.785  100.899 87.750  1.00 11.05  ? 104  PHE E CB    1 
ATOM   8293  C  CG    . PHE F 2  104 ? 84.145  100.245 86.479  1.00 22.14  ? 104  PHE E CG    1 
ATOM   8294  C  CD1   . PHE F 2  104 ? 85.365  100.470 85.923  1.00 19.27  ? 104  PHE E CD1   1 
ATOM   8295  C  CD2   . PHE F 2  104 ? 83.282  99.404  85.842  1.00 20.87  ? 104  PHE E CD2   1 
ATOM   8296  C  CE1   . PHE F 2  104 ? 85.716  99.876  84.752  1.00 15.77  ? 104  PHE E CE1   1 
ATOM   8297  C  CE2   . PHE F 2  104 ? 83.640  98.805  84.671  1.00 12.26  ? 104  PHE E CE2   1 
ATOM   8298  C  CZ    . PHE F 2  104 ? 84.857  99.042  84.130  1.00 8.61   ? 104  PHE E CZ    1 
ATOM   8299  N  N     . GLU F 2  105 ? 84.259  102.118 90.766  1.00 18.32  ? 105  GLU E N     1 
ATOM   8300  C  CA    . GLU F 2  105 ? 84.137  103.217 91.718  1.00 19.83  ? 105  GLU E CA    1 
ATOM   8301  C  C     . GLU F 2  105 ? 85.432  104.012 91.770  1.00 33.19  ? 105  GLU E C     1 
ATOM   8302  O  O     . GLU F 2  105 ? 85.436  105.240 91.601  1.00 32.76  ? 105  GLU E O     1 
ATOM   8303  C  CB    . GLU F 2  105 ? 83.777  102.709 93.110  1.00 19.90  ? 105  GLU E CB    1 
ATOM   8304  C  CG    . GLU F 2  105 ? 82.384  102.131 93.233  1.00 38.29  ? 105  GLU E CG    1 
ATOM   8305  C  CD    . GLU F 2  105 ? 82.078  101.601 94.632  1.00 54.35  ? 105  GLU E CD    1 
ATOM   8306  O  OE1   . GLU F 2  105 ? 83.000  101.558 95.473  1.00 59.22  ? 105  GLU E OE1   1 
ATOM   8307  O  OE2   . GLU F 2  105 ? 80.917  101.215 94.886  1.00 55.91  ? 105  GLU E OE2   1 
ATOM   8308  N  N     . ASP F 2  106 ? 86.557  103.317 91.948  1.00 28.87  ? 106  ASP E N     1 
ATOM   8309  C  CA    . ASP F 2  106 ? 87.827  104.016 92.118  1.00 21.64  ? 106  ASP E CA    1 
ATOM   8310  C  C     . ASP F 2  106 ? 88.199  104.803 90.869  1.00 27.31  ? 106  ASP E C     1 
ATOM   8311  O  O     . ASP F 2  106 ? 88.497  106.006 90.936  1.00 35.61  ? 106  ASP E O     1 
ATOM   8312  C  CB    . ASP F 2  106 ? 88.916  103.013 92.468  1.00 23.60  ? 106  ASP E CB    1 
ATOM   8313  C  CG    . ASP F 2  106 ? 88.678  102.353 93.807  1.00 46.75  ? 106  ASP E CG    1 
ATOM   8314  O  OD1   . ASP F 2  106 ? 87.816  102.850 94.559  1.00 56.25  ? 106  ASP E OD1   1 
ATOM   8315  O  OD2   . ASP F 2  106 ? 89.349  101.347 94.118  1.00 46.26  ? 106  ASP E OD2   1 
ATOM   8316  N  N     . THR F 2  107 ? 88.184  104.141 89.716  1.00 29.84  ? 107  THR E N     1 
ATOM   8317  C  CA    . THR F 2  107 ? 88.441  104.845 88.471  1.00 26.19  ? 107  THR E CA    1 
ATOM   8318  C  C     . THR F 2  107 ? 87.592  106.093 88.369  1.00 33.79  ? 107  THR E C     1 
ATOM   8319  O  O     . THR F 2  107 ? 88.088  107.165 88.020  1.00 25.98  ? 107  THR E O     1 
ATOM   8320  C  CB    . THR F 2  107 ? 88.172  103.943 87.285  1.00 5.13   ? 107  THR E CB    1 
ATOM   8321  O  OG1   . THR F 2  107 ? 89.101  102.863 87.297  1.00 13.40  ? 107  THR E OG1   1 
ATOM   8322  C  CG2   . THR F 2  107 ? 88.362  104.703 86.039  1.00 10.08  ? 107  THR E CG2   1 
ATOM   8323  N  N     . ASN F 2  108 ? 86.310  105.979 88.693  1.00 29.03  ? 108  ASN E N     1 
ATOM   8324  C  CA    . ASN F 2  108 ? 85.469  107.163 88.676  1.00 19.79  ? 108  ASN E CA    1 
ATOM   8325  C  C     . ASN F 2  108 ? 86.041  108.264 89.541  1.00 27.60  ? 108  ASN E C     1 
ATOM   8326  O  O     . ASN F 2  108 ? 86.054  109.430 89.135  1.00 27.10  ? 108  ASN E O     1 
ATOM   8327  C  CB    . ASN F 2  108 ? 84.073  106.844 89.146  1.00 62.20  ? 108  ASN E CB    1 
ATOM   8328  C  CG    . ASN F 2  108 ? 83.186  108.019 89.030  1.00 15.78  ? 108  ASN E CG    1 
ATOM   8329  O  OD1   . ASN F 2  108 ? 83.363  108.840 88.144  1.00 13.86  ? 108  ASN E OD1   1 
ATOM   8330  N  ND2   . ASN F 2  108 ? 82.242  108.141 89.939  1.00 26.56  ? 108  ASN E ND2   1 
ATOM   8331  N  N     . LEU F 2  109 ? 86.514  107.926 90.741  1.00 20.46  ? 109  LEU E N     1 
ATOM   8332  C  CA    . LEU F 2  109 ? 87.154  108.955 91.554  1.00 23.31  ? 109  LEU E CA    1 
ATOM   8333  C  C     . LEU F 2  109 ? 88.288  109.628 90.807  1.00 37.58  ? 109  LEU E C     1 
ATOM   8334  O  O     . LEU F 2  109 ? 88.442  110.852 90.876  1.00 39.02  ? 109  LEU E O     1 
ATOM   8335  C  CB    . LEU F 2  109 ? 87.649  108.376 92.868  1.00 20.62  ? 109  LEU E CB    1 
ATOM   8336  C  CG    . LEU F 2  109 ? 86.467  108.191 93.789  1.00 26.28  ? 109  LEU E CG    1 
ATOM   8337  C  CD1   . LEU F 2  109 ? 86.859  107.483 95.051  1.00 14.97  ? 109  LEU E CD1   1 
ATOM   8338  C  CD2   . LEU F 2  109 ? 85.968  109.567 94.096  1.00 44.67  ? 109  LEU E CD2   1 
ATOM   8339  N  N     . CYS F 2  110 ? 89.069  108.863 90.052  1.00 33.40  ? 110  CYS E N     1 
ATOM   8340  C  CA    . CYS F 2  110 ? 90.158  109.498 89.319  1.00 24.96  ? 110  CYS E CA    1 
ATOM   8341  C  C     . CYS F 2  110 ? 89.637  110.414 88.218  1.00 28.75  ? 110  CYS E C     1 
ATOM   8342  O  O     . CYS F 2  110 ? 90.101  111.550 88.070  1.00 28.36  ? 110  CYS E O     1 
ATOM   8343  C  CB    . CYS F 2  110 ? 91.094  108.445 88.750  1.00 31.49  ? 110  CYS E CB    1 
ATOM   8344  S  SG    . CYS F 2  110 ? 91.989  107.578 90.029  1.00 39.45  ? 110  CYS E SG    1 
ATOM   8345  N  N     . ALA F 2  111 ? 88.680  109.945 87.427  1.00 20.86  ? 111  ALA E N     1 
ATOM   8346  C  CA    . ALA F 2  111 ? 88.204  110.765 86.323  1.00 20.29  ? 111  ALA E CA    1 
ATOM   8347  C  C     . ALA F 2  111 ? 87.608  112.061 86.830  1.00 24.98  ? 111  ALA E C     1 
ATOM   8348  O  O     . ALA F 2  111 ? 87.896  113.134 86.299  1.00 27.29  ? 111  ALA E O     1 
ATOM   8349  C  CB    . ALA F 2  111 ? 87.186  110.002 85.496  1.00 12.23  ? 111  ALA E CB    1 
ATOM   8350  N  N     . ILE F 2  112 ? 86.776  111.987 87.863  1.00 19.21  ? 112  ILE E N     1 
ATOM   8351  C  CA    . ILE F 2  112 ? 86.281  113.214 88.469  1.00 20.46  ? 112  ILE E CA    1 
ATOM   8352  C  C     . ILE F 2  112 ? 87.438  114.078 88.919  1.00 23.57  ? 112  ILE E C     1 
ATOM   8353  O  O     . ILE F 2  112 ? 87.408  115.305 88.788  1.00 30.23  ? 112  ILE E O     1 
ATOM   8354  C  CB    . ILE F 2  112 ? 85.354  112.894 89.643  1.00 12.13  ? 112  ILE E CB    1 
ATOM   8355  C  CG1   . ILE F 2  112 ? 84.107  112.212 89.134  1.00 57.90  ? 112  ILE E CG1   1 
ATOM   8356  C  CG2   . ILE F 2  112 ? 84.999  114.148 90.380  1.00 51.05  ? 112  ILE E CG2   1 
ATOM   8357  C  CD1   . ILE F 2  112 ? 83.296  111.644 90.228  1.00 58.48  ? 112  ILE E CD1   1 
ATOM   8358  N  N     . HIS F 2  113 ? 88.478  113.453 89.462  1.00 33.06  ? 113  HIS E N     1 
ATOM   8359  C  CA    . HIS F 2  113 ? 89.643  114.216 89.883  1.00 31.02  ? 113  HIS E CA    1 
ATOM   8360  C  C     . HIS F 2  113 ? 90.210  115.049 88.748  1.00 35.77  ? 113  HIS E C     1 
ATOM   8361  O  O     . HIS F 2  113 ? 90.615  116.194 88.953  1.00 43.71  ? 113  HIS E O     1 
ATOM   8362  C  CB    . HIS F 2  113 ? 90.708  113.278 90.424  1.00 19.89  ? 113  HIS E CB    1 
ATOM   8363  C  CG    . HIS F 2  113 ? 91.975  113.967 90.770  1.00 29.34  ? 113  HIS E CG    1 
ATOM   8364  N  ND1   . HIS F 2  113 ? 92.048  114.920 91.755  1.00 30.93  ? 113  HIS E ND1   1 
ATOM   8365  C  CD2   . HIS F 2  113 ? 93.212  113.869 90.241  1.00 35.76  ? 113  HIS E CD2   1 
ATOM   8366  C  CE1   . HIS F 2  113 ? 93.284  115.370 91.832  1.00 37.33  ? 113  HIS E CE1   1 
ATOM   8367  N  NE2   . HIS F 2  113 ? 94.011  114.747 90.924  1.00 38.36  ? 113  HIS E NE2   1 
ATOM   8368  N  N     . ALA F 2  114 ? 90.225  114.508 87.542  1.00 34.07  ? 114  ALA E N     1 
ATOM   8369  C  CA    . ALA F 2  114 ? 90.812  115.248 86.437  1.00 27.61  ? 114  ALA E CA    1 
ATOM   8370  C  C     . ALA F 2  114 ? 89.856  116.252 85.821  1.00 39.75  ? 114  ALA E C     1 
ATOM   8371  O  O     . ALA F 2  114 ? 90.199  116.858 84.804  1.00 30.37  ? 114  ALA E O     1 
ATOM   8372  C  CB    . ALA F 2  114 ? 91.304  114.291 85.360  1.00 43.52  ? 114  ALA E CB    1 
ATOM   8373  N  N     . LYS F 2  115 ? 88.664  116.417 86.389  1.00 44.88  ? 115  LYS E N     1 
ATOM   8374  C  CA    . LYS F 2  115 ? 87.627  117.300 85.861  1.00 37.18  ? 115  LYS E CA    1 
ATOM   8375  C  C     . LYS F 2  115 ? 87.094  116.825 84.519  1.00 32.14  ? 115  LYS E C     1 
ATOM   8376  O  O     . LYS F 2  115 ? 86.684  117.627 83.688  1.00 25.36  ? 115  LYS E O     1 
ATOM   8377  C  CB    . LYS F 2  115 ? 88.113  118.743 85.756  1.00 43.24  ? 115  LYS E CB    1 
ATOM   8378  C  CG    . LYS F 2  115 ? 88.395  119.363 87.094  1.00 59.87  ? 115  LYS E CG    1 
ATOM   8379  C  CD    . LYS F 2  115 ? 88.821  120.802 86.952  1.00 77.82  ? 115  LYS E CD    1 
ATOM   8380  C  CE    . LYS F 2  115 ? 89.124  121.396 88.313  1.00 79.56  ? 115  LYS E CE    1 
ATOM   8381  N  NZ    . LYS F 2  115 ? 87.926  121.368 89.199  1.00 69.92  ? 115  LYS E NZ    1 
ATOM   8382  N  N     . ARG F 2  116 ? 87.101  115.523 84.302  1.00 25.81  ? 116  ARG E N     1 
ATOM   8383  C  CA    . ARG F 2  116 ? 86.363  114.889 83.228  1.00 20.44  ? 116  ARG E CA    1 
ATOM   8384  C  C     . ARG F 2  116 ? 85.283  114.030 83.854  1.00 20.90  ? 116  ARG E C     1 
ATOM   8385  O  O     . ARG F 2  116 ? 85.421  113.584 84.993  1.00 34.56  ? 116  ARG E O     1 
ATOM   8386  C  CB    . ARG F 2  116 ? 87.275  114.025 82.365  1.00 27.18  ? 116  ARG E CB    1 
ATOM   8387  C  CG    . ARG F 2  116 ? 88.253  114.828 81.584  1.00 38.56  ? 116  ARG E CG    1 
ATOM   8388  C  CD    . ARG F 2  116 ? 89.166  113.977 80.739  1.00 37.55  ? 116  ARG E CD    1 
ATOM   8389  N  NE    . ARG F 2  116 ? 90.058  113.167 81.548  1.00 40.28  ? 116  ARG E NE    1 
ATOM   8390  C  CZ    . ARG F 2  116 ? 89.936  111.861 81.693  1.00 43.68  ? 116  ARG E CZ    1 
ATOM   8391  N  NH1   . ARG F 2  116 ? 88.972  111.224 81.061  1.00 44.64  ? 116  ARG E NH1   1 
ATOM   8392  N  NH2   . ARG F 2  116 ? 90.787  111.193 82.450  1.00 37.67  ? 116  ARG E NH2   1 
ATOM   8393  N  N     . VAL F 2  117 ? 84.189  113.814 83.128  1.00 22.75  ? 117  VAL E N     1 
ATOM   8394  C  CA    . VAL F 2  117 ? 83.182  112.888 83.611  1.00 31.21  ? 117  VAL E CA    1 
ATOM   8395  C  C     . VAL F 2  117 ? 83.301  111.519 82.990  1.00 31.10  ? 117  VAL E C     1 
ATOM   8396  O  O     . VAL F 2  117 ? 82.586  110.606 83.407  1.00 32.05  ? 117  VAL E O     1 
ATOM   8397  C  CB    . VAL F 2  117 ? 81.775  113.439 83.382  1.00 25.00  ? 117  VAL E CB    1 
ATOM   8398  C  CG1   . VAL F 2  117 ? 81.575  114.644 84.236  1.00 23.16  ? 117  VAL E CG1   1 
ATOM   8399  C  CG2   . VAL F 2  117 ? 81.627  113.794 81.945  1.00 34.87  ? 117  VAL E CG2   1 
ATOM   8400  N  N     . THR F 2  118 ? 84.200  111.330 82.037  1.00 28.47  ? 118  THR E N     1 
ATOM   8401  C  CA    . THR F 2  118 ? 84.249  110.108 81.245  1.00 30.32  ? 118  THR E CA    1 
ATOM   8402  C  C     . THR F 2  118 ? 85.494  109.310 81.585  1.00 33.70  ? 118  THR E C     1 
ATOM   8403  O  O     . THR F 2  118 ? 86.600  109.705 81.218  1.00 39.06  ? 118  THR E O     1 
ATOM   8404  C  CB    . THR F 2  118 ? 84.229  110.432 79.760  1.00 37.49  ? 118  THR E CB    1 
ATOM   8405  O  OG1   . THR F 2  118 ? 82.986  111.052 79.426  1.00 41.95  ? 118  THR E OG1   1 
ATOM   8406  C  CG2   . THR F 2  118 ? 84.382  109.179 78.963  1.00 44.70  ? 118  THR E CG2   1 
ATOM   8407  N  N     . ILE F 2  119 ? 85.311  108.168 82.249  1.00 17.30  ? 119  ILE E N     1 
ATOM   8408  C  CA    . ILE F 2  119 ? 86.441  107.303 82.538  1.00 18.90  ? 119  ILE E CA    1 
ATOM   8409  C  C     . ILE F 2  119 ? 87.123  106.929 81.230  1.00 23.27  ? 119  ILE E C     1 
ATOM   8410  O  O     . ILE F 2  119 ? 86.490  106.853 80.179  1.00 27.24  ? 119  ILE E O     1 
ATOM   8411  C  CB    . ILE F 2  119 ? 85.979  106.052 83.297  1.00 9.63   ? 119  ILE E CB    1 
ATOM   8412  C  CG1   . ILE F 2  119 ? 85.132  105.179 82.404  1.00 16.66  ? 119  ILE E CG1   1 
ATOM   8413  C  CG2   . ILE F 2  119 ? 85.108  106.436 84.437  1.00 4.86   ? 119  ILE E CG2   1 
ATOM   8414  C  CD1   . ILE F 2  119 ? 84.788  103.882 83.024  1.00 5.25   ? 119  ILE E CD1   1 
ATOM   8415  N  N     . MET F 2  120 ? 88.430  106.750 81.276  1.00 22.34  ? 120  MET E N     1 
ATOM   8416  C  CA    . MET F 2  120 ? 89.218  106.473 80.088  1.00 19.62  ? 120  MET E CA    1 
ATOM   8417  C  C     . MET F 2  120 ? 90.303  105.484 80.457  1.00 23.50  ? 120  MET E C     1 
ATOM   8418  O  O     . MET F 2  120 ? 90.614  105.316 81.641  1.00 16.13  ? 120  MET E O     1 
ATOM   8419  C  CB    . MET F 2  120 ? 89.835  107.757 79.527  1.00 40.39  ? 120  MET E CB    1 
ATOM   8420  C  CG    . MET F 2  120 ? 88.842  108.712 78.947  1.00 34.32  ? 120  MET E CG    1 
ATOM   8421  S  SD    . MET F 2  120 ? 89.636  110.254 78.490  1.00 73.64  ? 120  MET E SD    1 
ATOM   8422  C  CE    . MET F 2  120 ? 90.609  109.700 77.104  1.00 78.83  ? 120  MET E CE    1 
ATOM   8423  N  N     . PRO F 2  121 ? 90.911  104.815 79.479  1.00 27.08  ? 121  PRO E N     1 
ATOM   8424  C  CA    . PRO F 2  121 ? 91.895  103.779 79.816  1.00 19.84  ? 121  PRO E CA    1 
ATOM   8425  C  C     . PRO F 2  121 ? 92.957  104.233 80.796  1.00 19.44  ? 121  PRO E C     1 
ATOM   8426  O  O     . PRO F 2  121 ? 93.241  103.524 81.770  1.00 19.35  ? 121  PRO E O     1 
ATOM   8427  C  CB    . PRO F 2  121 ? 92.498  103.432 78.458  1.00 8.54   ? 121  PRO E CB    1 
ATOM   8428  C  CG    . PRO F 2  121 ? 91.451  103.744 77.511  1.00 13.76  ? 121  PRO E CG    1 
ATOM   8429  C  CD    . PRO F 2  121 ? 90.746  104.946 78.028  1.00 19.47  ? 121  PRO E CD    1 
ATOM   8430  N  N     . LYS F 2  122 ? 93.538  105.409 80.593  1.00 17.46  ? 122  LYS E N     1 
ATOM   8431  C  CA    . LYS F 2  122 ? 94.578  105.820 81.518  1.00 25.78  ? 122  LYS E CA    1 
ATOM   8432  C  C     . LYS F 2  122 ? 94.032  106.036 82.913  1.00 31.18  ? 122  LYS E C     1 
ATOM   8433  O  O     . LYS F 2  122 ? 94.790  105.930 83.878  1.00 27.96  ? 122  LYS E O     1 
ATOM   8434  C  CB    . LYS F 2  122 ? 95.290  107.069 81.025  1.00 9.37   ? 122  LYS E CB    1 
ATOM   8435  C  CG    . LYS F 2  122 ? 94.446  108.290 80.893  1.00 32.20  ? 122  LYS E CG    1 
ATOM   8436  C  CD    . LYS F 2  122 ? 95.305  109.402 80.344  1.00 36.36  ? 122  LYS E CD    1 
ATOM   8437  C  CE    . LYS F 2  122 ? 94.532  110.674 80.132  1.00 33.32  ? 122  LYS E CE    1 
ATOM   8438  N  NZ    . LYS F 2  122 ? 95.429  111.739 79.609  1.00 37.70  ? 122  LYS E NZ    1 
ATOM   8439  N  N     . ASP F 2  123 ? 92.736  106.293 83.056  1.00 19.69  ? 123  ASP E N     1 
ATOM   8440  C  CA    . ASP F 2  123 ? 92.162  106.334 84.392  1.00 13.19  ? 123  ASP E CA    1 
ATOM   8441  C  C     . ASP F 2  123 ? 92.288  104.982 85.069  1.00 17.49  ? 123  ASP E C     1 
ATOM   8442  O  O     . ASP F 2  123 ? 92.808  104.881 86.185  1.00 19.03  ? 123  ASP E O     1 
ATOM   8443  C  CB    . ASP F 2  123 ? 90.707  106.768 84.336  1.00 8.68   ? 123  ASP E CB    1 
ATOM   8444  C  CG    . ASP F 2  123 ? 90.557  108.218 84.000  1.00 23.08  ? 123  ASP E CG    1 
ATOM   8445  O  OD1   . ASP F 2  123 ? 91.555  108.942 84.122  1.00 31.53  ? 123  ASP E OD1   1 
ATOM   8446  O  OD2   . ASP F 2  123 ? 89.453  108.643 83.612  1.00 22.26  ? 123  ASP E OD2   1 
ATOM   8447  N  N     . ILE F 2  124 ? 91.830  103.925 84.406  1.00 14.50  ? 124  ILE E N     1 
ATOM   8448  C  CA    . ILE F 2  124 ? 91.938  102.591 84.987  1.00 9.41   ? 124  ILE E CA    1 
ATOM   8449  C  C     . ILE F 2  124 ? 93.390  102.262 85.294  1.00 13.76  ? 124  ILE E C     1 
ATOM   8450  O  O     . ILE F 2  124 ? 93.753  101.991 86.445  1.00 19.07  ? 124  ILE E O     1 
ATOM   8451  C  CB    . ILE F 2  124 ? 91.319  101.543 84.058  1.00 12.89  ? 124  ILE E CB    1 
ATOM   8452  C  CG1   . ILE F 2  124 ? 89.816  101.663 84.072  1.00 9.23   ? 124  ILE E CG1   1 
ATOM   8453  C  CG2   . ILE F 2  124 ? 91.715  100.186 84.490  1.00 4.55   ? 124  ILE E CG2   1 
ATOM   8454  C  CD1   . ILE F 2  124 ? 89.189  100.770 83.094  1.00 15.33  ? 124  ILE E CD1   1 
ATOM   8455  N  N     . GLN F 2  125 ? 94.244  102.304 84.270  1.00 18.18  ? 125  GLN E N     1 
ATOM   8456  C  CA    . GLN F 2  125 ? 95.639  101.945 84.482  1.00 11.74  ? 125  GLN E CA    1 
ATOM   8457  C  C     . GLN F 2  125 ? 96.250  102.742 85.615  1.00 11.02  ? 125  GLN E C     1 
ATOM   8458  O  O     . GLN F 2  125 ? 97.105  102.232 86.346  1.00 14.52  ? 125  GLN E O     1 
ATOM   8459  C  CB    . GLN F 2  125 ? 96.426  102.135 83.198  1.00 18.46  ? 125  GLN E CB    1 
ATOM   8460  C  CG    . GLN F 2  125 ? 96.001  101.161 82.137  1.00 27.80  ? 125  GLN E CG    1 
ATOM   8461  C  CD    . GLN F 2  125 ? 96.697  101.390 80.823  1.00 42.67  ? 125  GLN E CD    1 
ATOM   8462  O  OE1   . GLN F 2  125 ? 97.156  102.492 80.534  1.00 54.39  ? 125  GLN E OE1   1 
ATOM   8463  N  NE2   . GLN F 2  125 ? 96.777  100.348 80.011  1.00 31.71  ? 125  GLN E NE2   1 
ATOM   8464  N  N     . LEU F 2  126 ? 95.791  103.971 85.820  1.00 3.75   ? 126  LEU E N     1 
ATOM   8465  C  CA    . LEU F 2  126 ? 96.151  104.660 87.047  1.00 9.00   ? 126  LEU E CA    1 
ATOM   8466  C  C     . LEU F 2  126 ? 95.652  103.899 88.262  1.00 4.48   ? 126  LEU E C     1 
ATOM   8467  O  O     . LEU F 2  126 ? 96.437  103.549 89.143  1.00 14.96  ? 126  LEU E O     1 
ATOM   8468  C  CB    . LEU F 2  126 ? 95.601  106.068 87.062  1.00 10.62  ? 126  LEU E CB    1 
ATOM   8469  C  CG    . LEU F 2  126 ? 95.840  106.626 88.449  1.00 14.06  ? 126  LEU E CG    1 
ATOM   8470  C  CD1   . LEU F 2  126 ? 97.299  106.698 88.705  1.00 7.78   ? 126  LEU E CD1   1 
ATOM   8471  C  CD2   . LEU F 2  126 ? 95.246  107.980 88.538  1.00 16.97  ? 126  LEU E CD2   1 
ATOM   8472  N  N     . ALA F 2  127 ? 94.349  103.634 88.334  1.00 2.11   ? 127  ALA E N     1 
ATOM   8473  C  CA    . ALA F 2  127 ? 93.791  103.044 89.547  1.00 1.98   ? 127  ALA E CA    1 
ATOM   8474  C  C     . ALA F 2  127 ? 94.529  101.776 89.942  1.00 10.19  ? 127  ALA E C     1 
ATOM   8475  O  O     . ALA F 2  127 ? 94.906  101.592 91.106  1.00 16.21  ? 127  ALA E O     1 
ATOM   8476  C  CB    . ALA F 2  127 ? 92.313  102.754 89.353  1.00 6.91   ? 127  ALA E CB    1 
ATOM   8477  N  N     . ARG F 2  128 ? 94.768  100.898 88.979  1.00 2.91   ? 128  ARG E N     1 
ATOM   8478  C  CA    . ARG F 2  128 ? 95.528  99.700  89.295  1.00 2.69   ? 128  ARG E CA    1 
ATOM   8479  C  C     . ARG F 2  128 ? 96.972  100.027 89.626  1.00 7.50   ? 128  ARG E C     1 
ATOM   8480  O  O     . ARG F 2  128 ? 97.611  99.298  90.387  1.00 6.72   ? 128  ARG E O     1 
ATOM   8481  C  CB    . ARG F 2  128 ? 95.442  98.717  88.140  1.00 3.76   ? 128  ARG E CB    1 
ATOM   8482  C  CG    . ARG F 2  128 ? 94.048  98.237  87.916  1.00 15.43  ? 128  ARG E CG    1 
ATOM   8483  C  CD    . ARG F 2  128 ? 93.955  97.386  86.695  1.00 30.93  ? 128  ARG E CD    1 
ATOM   8484  N  NE    . ARG F 2  128 ? 94.706  96.157  86.830  1.00 34.22  ? 128  ARG E NE    1 
ATOM   8485  C  CZ    . ARG F 2  128 ? 95.794  95.882  86.130  1.00 37.53  ? 128  ARG E CZ    1 
ATOM   8486  N  NH1   . ARG F 2  128 ? 96.247  96.755  85.245  1.00 46.98  ? 128  ARG E NH1   1 
ATOM   8487  N  NH2   . ARG F 2  128 ? 96.424  94.733  86.307  1.00 34.70  ? 128  ARG E NH2   1 
ATOM   8488  N  N     . ARG F 2  129 ? 97.507  101.112 89.087  1.00 11.78  ? 129  ARG E N     1 
ATOM   8489  C  CA    . ARG F 2  129 ? 98.862  101.476 89.467  1.00 4.96   ? 129  ARG E CA    1 
ATOM   8490  C  C     . ARG F 2  129 ? 98.935  101.963 90.906  1.00 10.29  ? 129  ARG E C     1 
ATOM   8491  O  O     . ARG F 2  129 ? 99.968  101.800 91.556  1.00 17.66  ? 129  ARG E O     1 
ATOM   8492  C  CB    . ARG F 2  129 ? 99.395  102.531 88.511  1.00 13.65  ? 129  ARG E CB    1 
ATOM   8493  C  CG    . ARG F 2  129 ? 100.717 103.108 88.904  1.00 17.12  ? 129  ARG E CG    1 
ATOM   8494  C  CD    . ARG F 2  129 ? 101.786 102.070 88.894  1.00 31.40  ? 129  ARG E CD    1 
ATOM   8495  N  NE    . ARG F 2  129 ? 103.029 102.636 89.387  1.00 45.92  ? 129  ARG E NE    1 
ATOM   8496  C  CZ    . ARG F 2  129 ? 103.334 102.711 90.676  1.00 41.57  ? 129  ARG E CZ    1 
ATOM   8497  N  NH1   . ARG F 2  129 ? 102.484 102.252 91.580  1.00 21.97  ? 129  ARG E NH1   1 
ATOM   8498  N  NH2   . ARG F 2  129 ? 104.483 103.243 91.061  1.00 50.13  ? 129  ARG E NH2   1 
ATOM   8499  N  N     . ILE F 2  130 ? 97.867  102.564 91.421  1.00 4.17   ? 130  ILE E N     1 
ATOM   8500  C  CA    . ILE F 2  130 ? 97.875  103.047 92.795  1.00 15.13  ? 130  ILE E CA    1 
ATOM   8501  C  C     . ILE F 2  130 ? 97.646  101.913 93.772  1.00 17.93  ? 130  ILE E C     1 
ATOM   8502  O  O     . ILE F 2  130 ? 98.359  101.794 94.771  1.00 19.18  ? 130  ILE E O     1 
ATOM   8503  C  CB    . ILE F 2  130 ? 96.832  104.150 92.990  1.00 15.24  ? 130  ILE E CB    1 
ATOM   8504  C  CG1   . ILE F 2  130 ? 97.193  105.338 92.135  1.00 13.96  ? 130  ILE E CG1   1 
ATOM   8505  C  CG2   . ILE F 2  130 ? 96.794  104.567 94.414  1.00 19.90  ? 130  ILE E CG2   1 
ATOM   8506  C  CD1   . ILE F 2  130 ? 98.525  105.849 92.462  1.00 20.40  ? 130  ILE E CD1   1 
ATOM   8507  N  N     . ARG F 2  131 ? 96.647  101.068 93.522  1.00 27.99  ? 131  ARG E N     1 
ATOM   8508  C  CA    . ARG F 2  131 ? 96.429  99.977  94.463  1.00 18.75  ? 131  ARG E CA    1 
ATOM   8509  C  C     . ARG F 2  131 ? 97.639  99.084  94.599  1.00 21.30  ? 131  ARG E C     1 
ATOM   8510  O  O     . ARG F 2  131 ? 97.749  98.361  95.589  1.00 23.94  ? 131  ARG E O     1 
ATOM   8511  C  CB    . ARG F 2  131 ? 95.270  99.098  94.054  1.00 30.79  ? 131  ARG E CB    1 
ATOM   8512  C  CG    . ARG F 2  131 ? 93.933  99.718  94.140  1.00 21.99  ? 131  ARG E CG    1 
ATOM   8513  C  CD    . ARG F 2  131 ? 92.941  98.640  93.861  1.00 27.06  ? 131  ARG E CD    1 
ATOM   8514  N  NE    . ARG F 2  131 ? 91.574  99.112  93.891  1.00 28.07  ? 131  ARG E NE    1 
ATOM   8515  C  CZ    . ARG F 2  131 ? 90.539  98.333  93.625  1.00 39.29  ? 131  ARG E CZ    1 
ATOM   8516  N  NH1   . ARG F 2  131 ? 90.738  97.060  93.325  1.00 45.49  ? 131  ARG E NH1   1 
ATOM   8517  N  NH2   . ARG F 2  131 ? 89.311  98.819  93.665  1.00 44.85  ? 131  ARG E NH2   1 
ATOM   8518  N  N     . GLY F 2  132 ? 98.540  99.103  93.629  1.00 42.82  ? 132  GLY E N     1 
ATOM   8519  C  CA    . GLY F 2  132 ? 99.678  98.217  93.659  1.00 44.58  ? 132  GLY E CA    1 
ATOM   8520  C  C     . GLY F 2  132 ? 99.463  96.901  92.960  1.00 50.59  ? 132  GLY E C     1 
ATOM   8521  O  O     . GLY F 2  132 ? 100.115 95.914  93.311  1.00 43.57  ? 132  GLY E O     1 
ATOM   8522  N  N     . GLU F 2  133 ? 98.561  96.841  91.993  1.00 41.19  ? 133  GLU E N     1 
ATOM   8523  C  CA    . GLU F 2  133 ? 98.265  95.585  91.327  1.00 45.06  ? 133  GLU E CA    1 
ATOM   8524  C  C     . GLU F 2  133 ? 99.148  95.328  90.120  1.00 60.58  ? 133  GLU E C     1 
ATOM   8525  O  O     . GLU F 2  133 ? 98.949  94.325  89.431  1.00 67.02  ? 133  GLU E O     1 
ATOM   8526  C  CB    . GLU F 2  133 ? 96.804  95.546  90.901  1.00 85.51  ? 133  GLU E CB    1 
ATOM   8527  C  CG    . GLU F 2  133 ? 95.840  95.613  92.055  1.00 89.34  ? 133  GLU E CG    1 
ATOM   8528  C  CD    . GLU F 2  133 ? 94.399  95.567  91.605  1.00 91.19  ? 133  GLU E CD    1 
ATOM   8529  O  OE1   . GLU F 2  133 ? 94.154  95.557  90.382  1.00 88.55  ? 133  GLU E OE1   1 
ATOM   8530  O  OE2   . GLU F 2  133 ? 93.509  95.565  92.476  1.00 89.47  ? 133  GLU E OE2   1 
ATOM   8531  N  N     . ARG F 2  134 ? 100.102 96.202  89.836  1.00 59.80  ? 134  ARG E N     1 
ATOM   8532  C  CA    . ARG F 2  134 ? 101.030 95.965  88.740  1.00 67.26  ? 134  ARG E CA    1 
ATOM   8533  C  C     . ARG F 2  134 ? 102.438 95.756  89.281  1.00 70.89  ? 134  ARG E C     1 
ATOM   8534  O  O     . ARG F 2  134 ? 102.683 94.840  90.067  1.00 67.58  ? 134  ARG E O     1 
ATOM   8535  C  CB    . ARG F 2  134 ? 101.010 97.128  87.747  1.00 52.48  ? 134  ARG E CB    1 
ATOM   8536  N  N     . ARG G 3  17  ? 82.201  63.102  76.273  1.00 176.20 ? 17   ARG F N     1 
ATOM   8537  C  CA    . ARG G 3  17  ? 83.185  62.183  75.716  1.00 181.14 ? 17   ARG F CA    1 
ATOM   8538  C  C     . ARG G 3  17  ? 84.235  62.931  74.915  1.00 193.53 ? 17   ARG F C     1 
ATOM   8539  O  O     . ARG G 3  17  ? 85.116  62.320  74.313  1.00 198.51 ? 17   ARG F O     1 
ATOM   8540  C  CB    . ARG G 3  17  ? 82.508  61.137  74.830  1.00 158.02 ? 17   ARG F CB    1 
ATOM   8541  N  N     . HIS G 3  18  ? 84.133  64.260  74.908  1.00 190.83 ? 18   HIS F N     1 
ATOM   8542  C  CA    . HIS G 3  18  ? 85.025  65.103  74.124  1.00 186.53 ? 18   HIS F CA    1 
ATOM   8543  C  C     . HIS G 3  18  ? 85.143  66.462  74.799  1.00 200.81 ? 18   HIS F C     1 
ATOM   8544  O  O     . HIS G 3  18  ? 84.323  66.832  75.643  1.00 206.05 ? 18   HIS F O     1 
ATOM   8545  C  CB    . HIS G 3  18  ? 84.526  65.264  72.680  1.00 197.40 ? 18   HIS F CB    1 
ATOM   8546  C  CG    . HIS G 3  18  ? 84.371  63.967  71.944  1.00 201.00 ? 18   HIS F CG    1 
ATOM   8547  N  ND1   . HIS G 3  18  ? 85.447  63.214  71.528  1.00 199.94 ? 18   HIS F ND1   1 
ATOM   8548  C  CD2   . HIS G 3  18  ? 83.265  63.280  71.570  1.00 202.20 ? 18   HIS F CD2   1 
ATOM   8549  C  CE1   . HIS G 3  18  ? 85.011  62.126  70.919  1.00 196.90 ? 18   HIS F CE1   1 
ATOM   8550  N  NE2   . HIS G 3  18  ? 83.691  62.142  70.931  1.00 199.47 ? 18   HIS F NE2   1 
ATOM   8551  N  N     . ARG G 3  19  ? 86.185  67.199  74.426  1.00 186.91 ? 19   ARG F N     1 
ATOM   8552  C  CA    . ARG G 3  19  ? 86.408  68.550  74.924  1.00 179.29 ? 19   ARG F CA    1 
ATOM   8553  C  C     . ARG G 3  19  ? 86.777  69.454  73.759  1.00 171.12 ? 19   ARG F C     1 
ATOM   8554  O  O     . ARG G 3  19  ? 87.828  69.267  73.137  1.00 161.76 ? 19   ARG F O     1 
ATOM   8555  C  CB    . ARG G 3  19  ? 87.508  68.567  75.987  1.00 152.97 ? 19   ARG F CB    1 
ATOM   8556  N  N     . LYS G 3  20  ? 85.929  70.443  73.477  1.00 189.34 ? 20   LYS F N     1 
ATOM   8557  C  CA    . LYS G 3  20  ? 86.197  71.395  72.406  1.00 172.48 ? 20   LYS F CA    1 
ATOM   8558  C  C     . LYS G 3  20  ? 87.227  72.416  72.870  1.00 157.16 ? 20   LYS F C     1 
ATOM   8559  O  O     . LYS G 3  20  ? 87.042  73.071  73.901  1.00 139.60 ? 20   LYS F O     1 
ATOM   8560  C  CB    . LYS G 3  20  ? 84.910  72.098  71.981  1.00 141.46 ? 20   LYS F CB    1 
ATOM   8561  N  N     . VAL G 3  21  ? 88.308  72.561  72.109  1.00 138.34 ? 21   VAL F N     1 
ATOM   8562  C  CA    . VAL G 3  21  ? 89.385  73.457  72.512  1.00 142.08 ? 21   VAL F CA    1 
ATOM   8563  C  C     . VAL G 3  21  ? 88.964  74.883  72.183  1.00 153.31 ? 21   VAL F C     1 
ATOM   8564  O  O     . VAL G 3  21  ? 88.778  75.240  71.015  1.00 164.70 ? 21   VAL F O     1 
ATOM   8565  C  CB    . VAL G 3  21  ? 90.705  73.085  71.825  1.00 151.96 ? 21   VAL F CB    1 
ATOM   8566  C  CG1   . VAL G 3  21  ? 91.799  74.067  72.209  1.00 145.50 ? 21   VAL F CG1   1 
ATOM   8567  C  CG2   . VAL G 3  21  ? 91.102  71.671  72.204  1.00 151.33 ? 21   VAL F CG2   1 
ATOM   8568  N  N     . LEU G 3  22  ? 88.812  75.690  73.220  1.00 161.43 ? 22   LEU F N     1 
ATOM   8569  C  CA    . LEU G 3  22  ? 88.176  76.994  73.173  1.00 142.34 ? 22   LEU F CA    1 
ATOM   8570  C  C     . LEU G 3  22  ? 89.143  78.102  72.761  1.00 125.33 ? 22   LEU F C     1 
ATOM   8571  O  O     . LEU G 3  22  ? 90.360  77.998  72.926  1.00 112.20 ? 22   LEU F O     1 
ATOM   8572  C  CB    . LEU G 3  22  ? 87.556  77.284  74.537  1.00 105.06 ? 22   LEU F CB    1 
ATOM   8573  C  CG    . LEU G 3  22  ? 86.449  76.274  74.836  1.00 97.65  ? 22   LEU F CG    1 
ATOM   8574  C  CD1   . LEU G 3  22  ? 85.980  76.364  76.267  1.00 90.09  ? 22   LEU F CD1   1 
ATOM   8575  C  CD2   . LEU G 3  22  ? 85.298  76.532  73.890  1.00 97.90  ? 22   LEU F CD2   1 
ATOM   8576  N  N     . ARG G 3  23  ? 88.574  79.168  72.200  1.00 103.00 ? 23   ARG F N     1 
ATOM   8577  C  CA    . ARG G 3  23  ? 89.294  80.416  71.981  1.00 111.37 ? 23   ARG F CA    1 
ATOM   8578  C  C     . ARG G 3  23  ? 88.283  81.545  71.826  1.00 120.65 ? 23   ARG F C     1 
ATOM   8579  O  O     . ARG G 3  23  ? 87.091  81.308  71.612  1.00 113.71 ? 23   ARG F O     1 
ATOM   8580  C  CB    . ARG G 3  23  ? 90.211  80.334  70.757  1.00 105.20 ? 23   ARG F CB    1 
ATOM   8581  N  N     . ASP G 3  24  ? 88.770  82.777  71.975  1.00 97.38  ? 24   ASP F N     1 
ATOM   8582  C  CA    . ASP G 3  24  ? 88.004  83.997  71.716  1.00 100.41 ? 24   ASP F CA    1 
ATOM   8583  C  C     . ASP G 3  24  ? 86.736  84.075  72.544  1.00 94.47  ? 24   ASP F C     1 
ATOM   8584  O  O     . ASP G 3  24  ? 85.796  84.784  72.177  1.00 97.45  ? 24   ASP F O     1 
ATOM   8585  C  CB    . ASP G 3  24  ? 87.648  84.129  70.235  1.00 118.83 ? 24   ASP F CB    1 
ATOM   8586  C  CG    . ASP G 3  24  ? 88.860  84.379  69.368  1.00 129.47 ? 24   ASP F CG    1 
ATOM   8587  O  OD1   . ASP G 3  24  ? 89.916  84.759  69.916  1.00 132.87 ? 24   ASP F OD1   1 
ATOM   8588  O  OD2   . ASP G 3  24  ? 88.760  84.190  68.137  1.00 129.90 ? 24   ASP F OD2   1 
ATOM   8589  N  N     . ASN G 3  25  ? 86.691  83.351  73.655  1.00 73.72  ? 25   ASN F N     1 
ATOM   8590  C  CA    . ASN G 3  25  ? 85.486  83.308  74.461  1.00 64.57  ? 25   ASN F CA    1 
ATOM   8591  C  C     . ASN G 3  25  ? 85.396  84.470  75.432  1.00 68.98  ? 25   ASN F C     1 
ATOM   8592  O  O     . ASN G 3  25  ? 84.298  84.782  75.895  1.00 68.75  ? 25   ASN F O     1 
ATOM   8593  C  CB    . ASN G 3  25  ? 85.431  81.985  75.204  1.00 71.90  ? 25   ASN F CB    1 
ATOM   8594  C  CG    . ASN G 3  25  ? 85.383  80.812  74.262  1.00 71.29  ? 25   ASN F CG    1 
ATOM   8595  O  OD1   . ASN G 3  25  ? 84.330  80.454  73.741  1.00 77.12  ? 25   ASN F OD1   1 
ATOM   8596  N  ND2   . ASN G 3  25  ? 86.540  80.231  73.997  1.00 76.07  ? 25   ASN F ND2   1 
ATOM   8597  N  N     . ILE G 3  26  ? 86.519  85.118  75.743  1.00 54.93  ? 26   ILE F N     1 
ATOM   8598  C  CA    . ILE G 3  26  ? 86.469  86.330  76.547  1.00 48.73  ? 26   ILE F CA    1 
ATOM   8599  C  C     . ILE G 3  26  ? 85.548  87.353  75.917  1.00 51.40  ? 26   ILE F C     1 
ATOM   8600  O  O     . ILE G 3  26  ? 84.948  88.175  76.617  1.00 57.60  ? 26   ILE F O     1 
ATOM   8601  C  CB    . ILE G 3  26  ? 87.881  86.893  76.746  1.00 54.78  ? 26   ILE F CB    1 
ATOM   8602  C  CG1   . ILE G 3  26  ? 87.824  88.163  77.589  1.00 56.73  ? 26   ILE F CG1   1 
ATOM   8603  C  CG2   . ILE G 3  26  ? 88.518  87.166  75.409  1.00 54.63  ? 26   ILE F CG2   1 
ATOM   8604  C  CD1   . ILE G 3  26  ? 87.269  87.953  78.949  1.00 50.89  ? 26   ILE F CD1   1 
ATOM   8605  N  N     . GLN G 3  27  ? 85.371  87.290  74.599  1.00 38.68  ? 27   GLN F N     1 
ATOM   8606  C  CA    . GLN G 3  27  ? 84.343  88.093  73.957  1.00 50.73  ? 27   GLN F CA    1 
ATOM   8607  C  C     . GLN G 3  27  ? 82.992  87.871  74.601  1.00 40.69  ? 27   GLN F C     1 
ATOM   8608  O  O     . GLN G 3  27  ? 82.088  88.692  74.424  1.00 30.67  ? 27   GLN F O     1 
ATOM   8609  C  CB    . GLN G 3  27  ? 84.261  87.741  72.479  1.00 57.05  ? 27   GLN F CB    1 
ATOM   8610  C  CG    . GLN G 3  27  ? 85.499  88.090  71.698  1.00 65.26  ? 27   GLN F CG    1 
ATOM   8611  C  CD    . GLN G 3  27  ? 85.720  89.573  71.611  1.00 73.39  ? 27   GLN F CD    1 
ATOM   8612  O  OE1   . GLN G 3  27  ? 84.783  90.338  71.396  1.00 79.40  ? 27   GLN F OE1   1 
ATOM   8613  N  NE2   . GLN G 3  27  ? 86.961  89.994  71.789  1.00 63.97  ? 27   GLN F NE2   1 
ATOM   8614  N  N     . GLY G 3  28  ? 82.836  86.771  75.333  1.00 44.60  ? 28   GLY F N     1 
ATOM   8615  C  CA    . GLY G 3  28  ? 81.611  86.544  76.072  1.00 46.51  ? 28   GLY F CA    1 
ATOM   8616  C  C     . GLY G 3  28  ? 81.211  87.728  76.921  1.00 45.96  ? 28   GLY F C     1 
ATOM   8617  O  O     . GLY G 3  28  ? 80.030  88.055  77.027  1.00 47.21  ? 28   GLY F O     1 
ATOM   8618  N  N     . ILE G 3  29  ? 82.180  88.394  77.535  1.00 42.11  ? 29   ILE F N     1 
ATOM   8619  C  CA    . ILE G 3  29  ? 81.855  89.655  78.178  1.00 28.83  ? 29   ILE F CA    1 
ATOM   8620  C  C     . ILE G 3  29  ? 81.573  90.671  77.088  1.00 40.90  ? 29   ILE F C     1 
ATOM   8621  O  O     . ILE G 3  29  ? 82.416  90.927  76.223  1.00 36.01  ? 29   ILE F O     1 
ATOM   8622  C  CB    . ILE G 3  29  ? 82.986  90.118  79.088  1.00 30.77  ? 29   ILE F CB    1 
ATOM   8623  C  CG1   . ILE G 3  29  ? 83.311  89.006  80.053  1.00 28.47  ? 29   ILE F CG1   1 
ATOM   8624  C  CG2   . ILE G 3  29  ? 82.544  91.305  79.866  1.00 30.98  ? 29   ILE F CG2   1 
ATOM   8625  C  CD1   . ILE G 3  29  ? 82.122  88.575  80.817  1.00 22.95  ? 29   ILE F CD1   1 
ATOM   8626  N  N     . THR G 3  30  ? 80.396  91.261  77.126  1.00 41.42  ? 30   THR F N     1 
ATOM   8627  C  CA    . THR G 3  30  ? 79.902  92.050  76.018  1.00 40.36  ? 30   THR F CA    1 
ATOM   8628  C  C     . THR G 3  30  ? 79.672  93.480  76.445  1.00 40.11  ? 30   THR F C     1 
ATOM   8629  O  O     . THR G 3  30  ? 79.222  93.735  77.563  1.00 44.55  ? 30   THR F O     1 
ATOM   8630  C  CB    . THR G 3  30  ? 78.621  91.474  75.523  1.00 59.05  ? 30   THR F CB    1 
ATOM   8631  O  OG1   . THR G 3  30  ? 77.736  91.353  76.639  1.00 63.37  ? 30   THR F OG1   1 
ATOM   8632  C  CG2   . THR G 3  30  ? 78.872  90.116  74.946  1.00 47.54  ? 30   THR F CG2   1 
ATOM   8633  N  N     . LYS G 3  31  ? 79.929  94.403  75.522  1.00 34.20  ? 31   LYS F N     1 
ATOM   8634  C  CA    . LYS G 3  31  ? 79.818  95.831  75.805  1.00 34.69  ? 31   LYS F CA    1 
ATOM   8635  C  C     . LYS G 3  31  ? 78.590  96.203  76.622  1.00 47.28  ? 31   LYS F C     1 
ATOM   8636  O  O     . LYS G 3  31  ? 78.736  96.963  77.585  1.00 45.28  ? 31   LYS F O     1 
ATOM   8637  C  CB    . LYS G 3  31  ? 79.829  96.605  74.480  1.00 32.43  ? 31   LYS F CB    1 
ATOM   8638  C  CG    . LYS G 3  31  ? 79.750  98.085  74.674  1.00 40.26  ? 31   LYS F CG    1 
ATOM   8639  C  CD    . LYS G 3  31  ? 79.751  98.830  73.358  1.00 54.69  ? 31   LYS F CD    1 
ATOM   8640  C  CE    . LYS G 3  31  ? 78.389  98.834  72.707  1.00 67.72  ? 31   LYS F CE    1 
ATOM   8641  N  NZ    . LYS G 3  31  ? 78.434  99.625  71.455  1.00 65.25  ? 31   LYS F NZ    1 
ATOM   8642  N  N     . PRO G 3  32  ? 77.391  95.704  76.337  1.00 44.40  ? 32   PRO F N     1 
ATOM   8643  C  CA    . PRO G 3  32  ? 76.267  96.050  77.211  1.00 42.26  ? 32   PRO F CA    1 
ATOM   8644  C  C     . PRO G 3  32  ? 76.518  95.689  78.656  1.00 47.30  ? 32   PRO F C     1 
ATOM   8645  O  O     . PRO G 3  32  ? 76.277  96.515  79.541  1.00 56.86  ? 32   PRO F O     1 
ATOM   8646  C  CB    . PRO G 3  32  ? 75.113  95.250  76.613  1.00 59.45  ? 32   PRO F CB    1 
ATOM   8647  C  CG    . PRO G 3  32  ? 75.466  95.124  75.205  1.00 57.66  ? 32   PRO F CG    1 
ATOM   8648  C  CD    . PRO G 3  32  ? 76.940  94.920  75.183  1.00 47.63  ? 32   PRO F CD    1 
ATOM   8649  N  N     . ALA G 3  33  ? 77.026  94.488  78.922  1.00 44.96  ? 33   ALA F N     1 
ATOM   8650  C  CA    . ALA G 3  33  ? 77.241  94.075  80.304  1.00 32.81  ? 33   ALA F CA    1 
ATOM   8651  C  C     . ALA G 3  33  ? 78.184  95.030  81.010  1.00 41.28  ? 33   ALA F C     1 
ATOM   8652  O  O     . ALA G 3  33  ? 77.833  95.628  82.030  1.00 52.11  ? 33   ALA F O     1 
ATOM   8653  C  CB    . ALA G 3  33  ? 77.789  92.655  80.352  1.00 33.50  ? 33   ALA F CB    1 
ATOM   8654  N  N     . ILE G 3  34  ? 79.380  95.210  80.457  1.00 23.13  ? 34   ILE F N     1 
ATOM   8655  C  CA    . ILE G 3  34  ? 80.339  96.119  81.064  1.00 25.07  ? 34   ILE F CA    1 
ATOM   8656  C  C     . ILE G 3  34  ? 79.728  97.486  81.269  1.00 28.62  ? 34   ILE F C     1 
ATOM   8657  O  O     . ILE G 3  34  ? 80.030  98.169  82.251  1.00 41.77  ? 34   ILE F O     1 
ATOM   8658  C  CB    . ILE G 3  34  ? 81.597  96.197  80.206  1.00 14.61  ? 34   ILE F CB    1 
ATOM   8659  C  CG1   . ILE G 3  34  ? 82.224  94.826  80.139  1.00 15.80  ? 34   ILE F CG1   1 
ATOM   8660  C  CG2   . ILE G 3  34  ? 82.565  97.126  80.828  1.00 47.95  ? 34   ILE F CG2   1 
ATOM   8661  C  CD1   . ILE G 3  34  ? 83.316  94.735  79.156  1.00 22.13  ? 34   ILE F CD1   1 
ATOM   8662  N  N     . ARG G 3  35  ? 78.837  97.904  80.377  1.00 30.42  ? 35   ARG F N     1 
ATOM   8663  C  CA    . ARG G 3  35  ? 78.129  99.144  80.649  1.00 31.60  ? 35   ARG F CA    1 
ATOM   8664  C  C     . ARG G 3  35  ? 77.248  99.007  81.878  1.00 29.37  ? 35   ARG F C     1 
ATOM   8665  O  O     . ARG G 3  35  ? 77.137  99.947  82.668  1.00 38.93  ? 35   ARG F O     1 
ATOM   8666  C  CB    . ARG G 3  35  ? 77.322  99.584  79.434  1.00 25.09  ? 35   ARG F CB    1 
ATOM   8667  C  CG    . ARG G 3  35  ? 78.220  99.907  78.269  1.00 41.83  ? 35   ARG F CG    1 
ATOM   8668  C  CD    . ARG G 3  35  ? 77.480  100.397 77.057  1.00 59.62  ? 35   ARG F CD    1 
ATOM   8669  N  NE    . ARG G 3  35  ? 76.908  101.709 77.292  1.00 58.13  ? 35   ARG F NE    1 
ATOM   8670  C  CZ    . ARG G 3  35  ? 75.608  101.932 77.379  1.00 60.98  ? 35   ARG F CZ    1 
ATOM   8671  N  NH1   . ARG G 3  35  ? 74.758  100.929 77.239  1.00 64.94  ? 35   ARG F NH1   1 
ATOM   8672  N  NH2   . ARG G 3  35  ? 75.159  103.154 77.603  1.00 66.37  ? 35   ARG F NH2   1 
ATOM   8673  N  N     . ARG G 3  36  ? 76.641  97.843  82.088  1.00 21.05  ? 36   ARG F N     1 
ATOM   8674  C  CA    . ARG G 3  36  ? 75.857  97.684  83.303  1.00 30.52  ? 36   ARG F CA    1 
ATOM   8675  C  C     . ARG G 3  36  ? 76.742  97.805  84.527  1.00 28.95  ? 36   ARG F C     1 
ATOM   8676  O  O     . ARG G 3  36  ? 76.476  98.625  85.410  1.00 26.66  ? 36   ARG F O     1 
ATOM   8677  C  CB    . ARG G 3  36  ? 75.096  96.364  83.304  1.00 21.60  ? 36   ARG F CB    1 
ATOM   8678  C  CG    . ARG G 3  36  ? 73.913  96.357  82.368  1.00 30.11  ? 36   ARG F CG    1 
ATOM   8679  C  CD    . ARG G 3  36  ? 72.984  95.221  82.680  1.00 26.85  ? 36   ARG F CD    1 
ATOM   8680  N  NE    . ARG G 3  36  ? 73.626  93.937  82.485  1.00 26.88  ? 36   ARG F NE    1 
ATOM   8681  C  CZ    . ARG G 3  36  ? 73.637  93.296  81.328  1.00 28.43  ? 36   ARG F CZ    1 
ATOM   8682  N  NH1   . ARG G 3  36  ? 73.035  93.822  80.276  1.00 23.15  ? 36   ARG F NH1   1 
ATOM   8683  N  NH2   . ARG G 3  36  ? 74.245  92.131  81.224  1.00 28.07  ? 36   ARG F NH2   1 
ATOM   8684  N  N     . LEU G 3  37  ? 77.823  97.029  84.583  1.00 19.71  ? 37   LEU F N     1 
ATOM   8685  C  CA    . LEU G 3  37  ? 78.733  97.137  85.714  1.00 20.21  ? 37   LEU F CA    1 
ATOM   8686  C  C     . LEU G 3  37  ? 79.119  98.578  85.956  1.00 21.38  ? 37   LEU F C     1 
ATOM   8687  O  O     . LEU G 3  37  ? 78.882  99.126  87.035  1.00 21.34  ? 37   LEU F O     1 
ATOM   8688  C  CB    . LEU G 3  37  ? 79.984  96.316  85.480  1.00 27.57  ? 37   LEU F CB    1 
ATOM   8689  C  CG    . LEU G 3  37  ? 79.786  94.833  85.575  1.00 25.53  ? 37   LEU F CG    1 
ATOM   8690  C  CD1   . LEU G 3  37  ? 81.070  94.147  85.228  1.00 17.90  ? 37   LEU F CD1   1 
ATOM   8691  C  CD2   . LEU G 3  37  ? 79.411  94.561  86.975  1.00 19.94  ? 37   LEU F CD2   1 
ATOM   8692  N  N     . ALA G 3  38  ? 79.675  99.225  84.942  1.00 14.14  ? 38   ALA F N     1 
ATOM   8693  C  CA    . ALA G 3  38  ? 80.093  100.603 85.117  1.00 20.15  ? 38   ALA F CA    1 
ATOM   8694  C  C     . ALA G 3  38  ? 78.963  101.452 85.661  1.00 24.24  ? 38   ALA F C     1 
ATOM   8695  O  O     . ALA G 3  38  ? 79.190  102.355 86.470  1.00 13.46  ? 38   ALA F O     1 
ATOM   8696  C  CB    . ALA G 3  38  ? 80.593  101.168 83.799  1.00 23.32  ? 38   ALA F CB    1 
ATOM   8697  N  N     . ARG G 3  39  ? 77.731  101.173 85.247  1.00 10.94  ? 39   ARG F N     1 
ATOM   8698  C  CA    . ARG G 3  39  ? 76.629  101.919 85.829  1.00 10.54  ? 39   ARG F CA    1 
ATOM   8699  C  C     . ARG G 3  39  ? 76.511  101.632 87.310  1.00 13.09  ? 39   ARG F C     1 
ATOM   8700  O  O     . ARG G 3  39  ? 76.273  102.543 88.103  1.00 27.37  ? 39   ARG F O     1 
ATOM   8701  C  CB    . ARG G 3  39  ? 75.322  101.609 85.122  1.00 25.48  ? 39   ARG F CB    1 
ATOM   8702  C  CG    . ARG G 3  39  ? 75.243  102.114 83.714  1.00 27.53  ? 39   ARG F CG    1 
ATOM   8703  C  CD    . ARG G 3  39  ? 75.191  103.619 83.692  1.00 31.79  ? 39   ARG F CD    1 
ATOM   8704  N  NE    . ARG G 3  39  ? 74.808  104.107 82.376  1.00 40.06  ? 39   ARG F NE    1 
ATOM   8705  C  CZ    . ARG G 3  39  ? 75.659  104.406 81.410  1.00 41.64  ? 39   ARG F CZ    1 
ATOM   8706  N  NH1   . ARG G 3  39  ? 76.952  104.272 81.610  1.00 35.27  ? 39   ARG F NH1   1 
ATOM   8707  N  NH2   . ARG G 3  39  ? 75.211  104.836 80.244  1.00 39.04  ? 39   ARG F NH2   1 
ATOM   8708  N  N     . ARG G 3  40  ? 76.688  100.380 87.714  1.00 6.09   ? 40   ARG F N     1 
ATOM   8709  C  CA    . ARG G 3  40  ? 76.554  100.096 89.131  1.00 7.50   ? 40   ARG F CA    1 
ATOM   8710  C  C     . ARG G 3  40  ? 77.613  100.825 89.927  1.00 14.75  ? 40   ARG F C     1 
ATOM   8711  O  O     . ARG G 3  40  ? 77.344  101.330 91.018  1.00 30.87  ? 40   ARG F O     1 
ATOM   8712  C  CB    . ARG G 3  40  ? 76.626  98.605  89.402  1.00 16.86  ? 40   ARG F CB    1 
ATOM   8713  C  CG    . ARG G 3  40  ? 76.558  98.343  90.863  1.00 24.59  ? 40   ARG F CG    1 
ATOM   8714  C  CD    . ARG G 3  40  ? 76.508  96.899  91.194  1.00 20.39  ? 40   ARG F CD    1 
ATOM   8715  N  NE    . ARG G 3  40  ? 75.267  96.310  90.732  1.00 21.43  ? 40   ARG F NE    1 
ATOM   8716  C  CZ    . ARG G 3  40  ? 74.925  95.053  90.959  1.00 33.87  ? 40   ARG F CZ    1 
ATOM   8717  N  NH1   . ARG G 3  40  ? 75.731  94.267  91.653  1.00 34.69  ? 40   ARG F NH1   1 
ATOM   8718  N  NH2   . ARG G 3  40  ? 73.779  94.584  90.501  1.00 34.91  ? 40   ARG F NH2   1 
ATOM   8719  N  N     . GLY G 3  41  ? 78.813  100.929 89.386  1.00 5.60   ? 41   GLY F N     1 
ATOM   8720  C  CA    . GLY G 3  41  ? 79.846  101.586 90.149  1.00 16.42  ? 41   GLY F CA    1 
ATOM   8721  C  C     . GLY G 3  41  ? 79.668  103.074 90.288  1.00 1.30   ? 41   GLY F C     1 
ATOM   8722  O  O     . GLY G 3  41  ? 80.441  103.707 91.011  1.00 13.16  ? 41   GLY F O     1 
ATOM   8723  N  N     . GLY G 3  42  ? 78.683  103.647 89.626  1.00 17.85  ? 42   GLY F N     1 
ATOM   8724  C  CA    . GLY G 3  42  ? 78.476  105.069 89.680  1.00 12.98  ? 42   GLY F CA    1 
ATOM   8725  C  C     . GLY G 3  42  ? 79.064  105.829 88.520  1.00 23.37  ? 42   GLY F C     1 
ATOM   8726  O  O     . GLY G 3  42  ? 78.845  107.037 88.426  1.00 29.79  ? 42   GLY F O     1 
ATOM   8727  N  N     . VAL G 3  43  ? 79.809  105.162 87.642  1.00 23.51  ? 43   VAL F N     1 
ATOM   8728  C  CA    . VAL G 3  43  ? 80.317  105.825 86.452  1.00 20.27  ? 43   VAL F CA    1 
ATOM   8729  C  C     . VAL G 3  43  ? 79.164  106.400 85.661  1.00 30.10  ? 43   VAL F C     1 
ATOM   8730  O  O     . VAL G 3  43  ? 78.125  105.757 85.492  1.00 29.50  ? 43   VAL F O     1 
ATOM   8731  C  CB    . VAL G 3  43  ? 81.105  104.833 85.592  1.00 22.30  ? 43   VAL F CB    1 
ATOM   8732  C  CG1   . VAL G 3  43  ? 81.567  105.495 84.346  1.00 26.46  ? 43   VAL F CG1   1 
ATOM   8733  C  CG2   . VAL G 3  43  ? 82.266  104.332 86.350  1.00 19.44  ? 43   VAL F CG2   1 
ATOM   8734  N  N     . LYS G 3  44  ? 79.336  107.618 85.159  1.00 32.93  ? 44   LYS F N     1 
ATOM   8735  C  CA    . LYS G 3  44  ? 78.259  108.224 84.390  1.00 32.34  ? 44   LYS F CA    1 
ATOM   8736  C  C     . LYS G 3  44  ? 78.384  107.932 82.904  1.00 37.87  ? 44   LYS F C     1 
ATOM   8737  O  O     . LYS G 3  44  ? 77.469  107.373 82.297  1.00 41.81  ? 44   LYS F O     1 
ATOM   8738  C  CB    . LYS G 3  44  ? 78.199  109.730 84.603  1.00 38.72  ? 44   LYS F CB    1 
ATOM   8739  C  CG    . LYS G 3  44  ? 77.006  110.314 83.896  1.00 41.84  ? 44   LYS F CG    1 
ATOM   8740  C  CD    . LYS G 3  44  ? 76.902  111.786 84.112  1.00 45.12  ? 44   LYS F CD    1 
ATOM   8741  C  CE    . LYS G 3  44  ? 75.688  112.355 83.428  1.00 51.71  ? 44   LYS F CE    1 
ATOM   8742  N  NZ    . LYS G 3  44  ? 75.651  113.822 83.640  1.00 46.78  ? 44   LYS F NZ    1 
ATOM   8743  N  N     . ARG G 3  45  ? 79.483  108.350 82.296  1.00 34.64  ? 45   ARG F N     1 
ATOM   8744  C  CA    . ARG G 3  45  ? 79.623  108.325 80.850  1.00 30.95  ? 45   ARG F CA    1 
ATOM   8745  C  C     . ARG G 3  45  ? 80.898  107.603 80.460  1.00 29.92  ? 45   ARG F C     1 
ATOM   8746  O  O     . ARG G 3  45  ? 81.993  108.112 80.684  1.00 36.61  ? 45   ARG F O     1 
ATOM   8747  C  CB    . ARG G 3  45  ? 79.626  109.741 80.317  1.00 49.38  ? 45   ARG F CB    1 
ATOM   8748  C  CG    . ARG G 3  45  ? 79.911  109.822 78.879  1.00 56.97  ? 45   ARG F CG    1 
ATOM   8749  C  CD    . ARG G 3  45  ? 79.722  111.224 78.418  1.00 58.95  ? 45   ARG F CD    1 
ATOM   8750  N  NE    . ARG G 3  45  ? 79.989  111.320 77.001  1.00 63.94  ? 45   ARG F NE    1 
ATOM   8751  C  CZ    . ARG G 3  45  ? 79.615  112.344 76.262  1.00 66.25  ? 45   ARG F CZ    1 
ATOM   8752  N  NH1   . ARG G 3  45  ? 78.936  113.334 76.814  1.00 48.05  ? 45   ARG F NH1   1 
ATOM   8753  N  NH2   . ARG G 3  45  ? 79.893  112.360 74.974  1.00 72.32  ? 45   ARG F NH2   1 
ATOM   8754  N  N     . ILE G 3  46  ? 80.765  106.482 79.840  1.00 20.07  ? 46   ILE F N     1 
ATOM   8755  C  CA    . ILE G 3  46  ? 81.890  105.597 79.598  1.00 18.90  ? 46   ILE F CA    1 
ATOM   8756  C  C     . ILE G 3  46  ? 82.579  105.995 78.310  1.00 24.75  ? 46   ILE F C     1 
ATOM   8757  O  O     . ILE G 3  46  ? 81.918  106.296 77.320  1.00 20.87  ? 46   ILE F O     1 
ATOM   8758  C  CB    . ILE G 3  46  ? 81.398  104.154 79.514  1.00 17.79  ? 46   ILE F CB    1 
ATOM   8759  C  CG1   . ILE G 3  46  ? 80.643  103.802 80.769  1.00 12.68  ? 46   ILE F CG1   1 
ATOM   8760  C  CG2   . ILE G 3  46  ? 82.545  103.228 79.378  1.00 14.36  ? 46   ILE F CG2   1 
ATOM   8761  C  CD1   . ILE G 3  46  ? 79.905  102.533 80.612  1.00 14.23  ? 46   ILE F CD1   1 
ATOM   8762  N  N     . SER G 3  47  ? 83.905  105.983 78.302  1.00 18.93  ? 47   SER F N     1 
ATOM   8763  C  CA    . SER G 3  47  ? 84.617  106.119 77.045  1.00 24.12  ? 47   SER F CA    1 
ATOM   8764  C  C     . SER G 3  47  ? 84.519  104.840 76.243  1.00 24.31  ? 47   SER F C     1 
ATOM   8765  O  O     . SER G 3  47  ? 84.188  103.781 76.760  1.00 29.91  ? 47   SER F O     1 
ATOM   8766  C  CB    . SER G 3  47  ? 86.084  106.438 77.257  1.00 15.30  ? 47   SER F CB    1 
ATOM   8767  O  OG    . SER G 3  47  ? 86.753  106.439 76.014  1.00 23.57  ? 47   SER F OG    1 
ATOM   8768  N  N     . GLY G 3  48  ? 84.813  104.948 74.959  1.00 18.88  ? 48   GLY F N     1 
ATOM   8769  C  CA    . GLY G 3  48  ? 84.676  103.802 74.089  1.00 26.96  ? 48   GLY F CA    1 
ATOM   8770  C  C     . GLY G 3  48  ? 85.819  102.826 74.121  1.00 35.42  ? 48   GLY F C     1 
ATOM   8771  O  O     . GLY G 3  48  ? 85.700  101.741 73.550  1.00 37.55  ? 48   GLY F O     1 
ATOM   8772  N  N     . LEU G 3  49  ? 86.928  103.182 74.743  1.00 19.82  ? 49   LEU F N     1 
ATOM   8773  C  CA    . LEU G 3  49  ? 88.056  102.272 74.780  1.00 23.41  ? 49   LEU F CA    1 
ATOM   8774  C  C     . LEU G 3  49  ? 88.085  101.404 76.023  1.00 23.63  ? 49   LEU F C     1 
ATOM   8775  O  O     . LEU G 3  49  ? 88.860  100.446 76.066  1.00 23.50  ? 49   LEU F O     1 
ATOM   8776  C  CB    . LEU G 3  49  ? 89.352  103.061 74.679  1.00 26.93  ? 49   LEU F CB    1 
ATOM   8777  C  CG    . LEU G 3  49  ? 89.463  103.807 73.360  1.00 17.88  ? 49   LEU F CG    1 
ATOM   8778  C  CD1   . LEU G 3  49  ? 90.697  104.680 73.335  1.00 17.57  ? 49   LEU F CD1   1 
ATOM   8779  C  CD2   . LEU G 3  49  ? 89.493  102.801 72.243  1.00 6.41   ? 49   LEU F CD2   1 
ATOM   8780  N  N     . ILE G 3  50  ? 87.245  101.697 77.017  1.00 23.53  ? 50   ILE F N     1 
ATOM   8781  C  CA    . ILE G 3  50  ? 87.281  100.976 78.284  1.00 21.93  ? 50   ILE F CA    1 
ATOM   8782  C  C     . ILE G 3  50  ? 87.118  99.485  78.078  1.00 23.63  ? 50   ILE F C     1 
ATOM   8783  O  O     . ILE G 3  50  ? 87.589  98.685  78.888  1.00 21.95  ? 50   ILE F O     1 
ATOM   8784  C  CB    . ILE G 3  50  ? 86.196  101.523 79.224  1.00 17.51  ? 50   ILE F CB    1 
ATOM   8785  C  CG1   . ILE G 3  50  ? 86.436  102.994 79.489  1.00 25.05  ? 50   ILE F CG1   1 
ATOM   8786  C  CG2   . ILE G 3  50  ? 86.217  100.823 80.525  1.00 12.11  ? 50   ILE F CG2   1 
ATOM   8787  C  CD1   . ILE G 3  50  ? 87.763  103.261 80.099  1.00 21.39  ? 50   ILE F CD1   1 
ATOM   8788  N  N     . TYR G 3  51  ? 86.482  99.082  76.988  1.00 13.97  ? 51   TYR F N     1 
ATOM   8789  C  CA    . TYR G 3  51  ? 86.068  97.695  76.860  1.00 15.98  ? 51   TYR F CA    1 
ATOM   8790  C  C     . TYR G 3  51  ? 87.263  96.761  76.738  1.00 23.89  ? 51   TYR F C     1 
ATOM   8791  O  O     . TYR G 3  51  ? 87.399  95.810  77.519  1.00 30.97  ? 51   TYR F O     1 
ATOM   8792  C  CB    . TYR G 3  51  ? 85.141  97.564  75.670  1.00 10.08  ? 51   TYR F CB    1 
ATOM   8793  C  CG    . TYR G 3  51  ? 83.982  98.505  75.792  1.00 20.70  ? 51   TYR F CG    1 
ATOM   8794  C  CD1   . TYR G 3  51  ? 83.367  98.711  77.002  1.00 25.11  ? 51   TYR F CD1   1 
ATOM   8795  C  CD2   . TYR G 3  51  ? 83.530  99.218  74.706  1.00 25.82  ? 51   TYR F CD2   1 
ATOM   8796  C  CE1   . TYR G 3  51  ? 82.323  99.576  77.121  1.00 37.62  ? 51   TYR F CE1   1 
ATOM   8797  C  CE2   . TYR G 3  51  ? 82.493  100.092 74.823  1.00 33.06  ? 51   TYR F CE2   1 
ATOM   8798  C  CZ    . TYR G 3  51  ? 81.890  100.261 76.030  1.00 41.25  ? 51   TYR F CZ    1 
ATOM   8799  O  OH    . TYR G 3  51  ? 80.842  101.129 76.145  1.00 41.44  ? 51   TYR F OH    1 
ATOM   8800  N  N     . GLU G 3  52  ? 88.146  97.011  75.776  1.00 24.26  ? 52   GLU F N     1 
ATOM   8801  C  CA    . GLU G 3  52  ? 89.284  96.118  75.609  1.00 29.56  ? 52   GLU F CA    1 
ATOM   8802  C  C     . GLU G 3  52  ? 90.112  96.054  76.880  1.00 30.92  ? 52   GLU F C     1 
ATOM   8803  O  O     . GLU G 3  52  ? 90.520  94.968  77.319  1.00 29.49  ? 52   GLU F O     1 
ATOM   8804  C  CB    . GLU G 3  52  ? 90.138  96.572  74.435  1.00 38.45  ? 52   GLU F CB    1 
ATOM   8805  C  CG    . GLU G 3  52  ? 89.408  96.563  73.099  1.00 47.09  ? 52   GLU F CG    1 
ATOM   8806  C  CD    . GLU G 3  52  ? 88.844  95.198  72.712  1.00 47.13  ? 52   GLU F CD    1 
ATOM   8807  O  OE1   . GLU G 3  52  ? 89.503  94.170  72.981  1.00 51.15  ? 52   GLU F OE1   1 
ATOM   8808  O  OE2   . GLU G 3  52  ? 87.743  95.160  72.120  1.00 34.41  ? 52   GLU F OE2   1 
ATOM   8809  N  N     . GLU G 3  53  ? 90.335  97.204  77.509  1.00 32.82  ? 53   GLU F N     1 
ATOM   8810  C  CA    . GLU G 3  53  ? 91.061  97.226  78.768  1.00 26.37  ? 53   GLU F CA    1 
ATOM   8811  C  C     . GLU G 3  53  ? 90.402  96.321  79.792  1.00 30.06  ? 53   GLU F C     1 
ATOM   8812  O  O     . GLU G 3  53  ? 91.027  95.391  80.311  1.00 28.89  ? 53   GLU F O     1 
ATOM   8813  C  CB    . GLU G 3  53  ? 91.139  98.644  79.307  1.00 28.83  ? 53   GLU F CB    1 
ATOM   8814  C  CG    . GLU G 3  53  ? 91.916  98.720  80.580  1.00 36.72  ? 53   GLU F CG    1 
ATOM   8815  C  CD    . GLU G 3  53  ? 93.376  98.408  80.366  1.00 56.81  ? 53   GLU F CD    1 
ATOM   8816  O  OE1   . GLU G 3  53  ? 93.816  98.432  79.201  1.00 64.70  ? 53   GLU F OE1   1 
ATOM   8817  O  OE2   . GLU G 3  53  ? 94.091  98.135  81.352  1.00 60.41  ? 53   GLU F OE2   1 
ATOM   8818  N  N     . THR G 3  54  ? 89.129  96.574  80.087  1.00 36.77  ? 54   THR F N     1 
ATOM   8819  C  CA    . THR G 3  54  ? 88.435  95.774  81.085  1.00 28.75  ? 54   THR F CA    1 
ATOM   8820  C  C     . THR G 3  54  ? 88.582  94.293  80.810  1.00 23.46  ? 54   THR F C     1 
ATOM   8821  O  O     . THR G 3  54  ? 88.952  93.531  81.701  1.00 19.71  ? 54   THR F O     1 
ATOM   8822  C  CB    . THR G 3  54  ? 86.970  96.156  81.151  1.00 22.96  ? 54   THR F CB    1 
ATOM   8823  O  OG1   . THR G 3  54  ? 86.860  97.453  81.731  1.00 27.98  ? 54   THR F OG1   1 
ATOM   8824  C  CG2   . THR G 3  54  ? 86.238  95.184  81.994  1.00 11.75  ? 54   THR F CG2   1 
ATOM   8825  N  N     . ARG G 3  55  ? 88.334  93.863  79.578  1.00 17.07  ? 55   ARG F N     1 
ATOM   8826  C  CA    . ARG G 3  55  ? 88.551  92.452  79.292  1.00 21.07  ? 55   ARG F CA    1 
ATOM   8827  C  C     . ARG G 3  55  ? 89.955  92.027  79.684  1.00 15.73  ? 55   ARG F C     1 
ATOM   8828  O  O     . ARG G 3  55  ? 90.156  90.928  80.214  1.00 21.33  ? 55   ARG F O     1 
ATOM   8829  C  CB    . ARG G 3  55  ? 88.292  92.153  77.827  1.00 30.63  ? 55   ARG F CB    1 
ATOM   8830  C  CG    . ARG G 3  55  ? 86.842  92.281  77.451  1.00 25.97  ? 55   ARG F CG    1 
ATOM   8831  C  CD    . ARG G 3  55  ? 86.629  91.981  75.993  1.00 29.51  ? 55   ARG F CD    1 
ATOM   8832  N  NE    . ARG G 3  55  ? 85.225  92.081  75.652  1.00 33.52  ? 55   ARG F NE    1 
ATOM   8833  C  CZ    . ARG G 3  55  ? 84.624  93.223  75.369  1.00 36.79  ? 55   ARG F CZ    1 
ATOM   8834  N  NH1   . ARG G 3  55  ? 85.314  94.348  75.386  1.00 33.09  ? 55   ARG F NH1   1 
ATOM   8835  N  NH2   . ARG G 3  55  ? 83.338  93.238  75.067  1.00 48.59  ? 55   ARG F NH2   1 
ATOM   8836  N  N     . GLY G 3  56  ? 90.938  92.900  79.476  1.00 15.62  ? 56   GLY F N     1 
ATOM   8837  C  CA    . GLY G 3  56  ? 92.276  92.587  79.957  1.00 14.77  ? 56   GLY F CA    1 
ATOM   8838  C  C     . GLY G 3  56  ? 92.318  92.372  81.458  1.00 29.27  ? 56   GLY F C     1 
ATOM   8839  O  O     . GLY G 3  56  ? 92.827  91.356  81.944  1.00 36.88  ? 56   GLY F O     1 
ATOM   8840  N  N     . VAL G 3  57  ? 91.768  93.324  82.210  1.00 19.06  ? 57   VAL F N     1 
ATOM   8841  C  CA    . VAL G 3  57  ? 91.750  93.243  83.668  1.00 12.22  ? 57   VAL F CA    1 
ATOM   8842  C  C     . VAL G 3  57  ? 91.126  91.938  84.125  1.00 20.99  ? 57   VAL F C     1 
ATOM   8843  O  O     . VAL G 3  57  ? 91.755  91.118  84.806  1.00 36.48  ? 57   VAL F O     1 
ATOM   8844  C  CB    . VAL G 3  57  ? 90.994  94.441  84.253  1.00 27.58  ? 57   VAL F CB    1 
ATOM   8845  C  CG1   . VAL G 3  57  ? 90.778  94.240  85.709  1.00 28.09  ? 57   VAL F CG1   1 
ATOM   8846  C  CG2   . VAL G 3  57  ? 91.781  95.680  84.021  1.00 20.14  ? 57   VAL F CG2   1 
ATOM   8847  N  N     . LEU G 3  58  ? 89.860  91.750  83.783  1.00 13.53  ? 58   LEU F N     1 
ATOM   8848  C  CA    . LEU G 3  58  ? 89.156  90.541  84.162  1.00 22.69  ? 58   LEU F CA    1 
ATOM   8849  C  C     . LEU G 3  58  ? 89.984  89.311  83.854  1.00 22.94  ? 58   LEU F C     1 
ATOM   8850  O  O     . LEU G 3  58  ? 90.161  88.443  84.711  1.00 26.10  ? 58   LEU F O     1 
ATOM   8851  C  CB    . LEU G 3  58  ? 87.834  90.478  83.427  1.00 9.13   ? 58   LEU F CB    1 
ATOM   8852  C  CG    . LEU G 3  58  ? 87.037  89.253  83.769  1.00 8.71   ? 58   LEU F CG    1 
ATOM   8853  C  CD1   . LEU G 3  58  ? 86.666  89.398  85.199  1.00 3.88   ? 58   LEU F CD1   1 
ATOM   8854  C  CD2   . LEU G 3  58  ? 85.821  89.203  82.898  1.00 13.60  ? 58   LEU F CD2   1 
ATOM   8855  N  N     . LYS G 3  59  ? 90.534  89.228  82.645  1.00 16.39  ? 59   LYS F N     1 
ATOM   8856  C  CA    . LYS G 3  59  ? 91.272  88.022  82.299  1.00 19.43  ? 59   LYS F CA    1 
ATOM   8857  C  C     . LYS G 3  59  ? 92.451  87.809  83.232  1.00 19.11  ? 59   LYS F C     1 
ATOM   8858  O  O     . LYS G 3  59  ? 92.733  86.676  83.634  1.00 15.92  ? 59   LYS F O     1 
ATOM   8859  C  CB    . LYS G 3  59  ? 91.760  88.082  80.867  1.00 18.76  ? 59   LYS F CB    1 
ATOM   8860  C  CG    . LYS G 3  59  ? 92.360  86.783  80.404  1.00 32.39  ? 59   LYS F CG    1 
ATOM   8861  C  CD    . LYS G 3  59  ? 92.937  86.935  79.020  1.00 59.52  ? 59   LYS F CD    1 
ATOM   8862  C  CE    . LYS G 3  59  ? 93.564  85.655  78.548  1.00 70.18  ? 59   LYS F CE    1 
ATOM   8863  N  NZ    . LYS G 3  59  ? 92.515  84.621  78.384  1.00 71.50  ? 59   LYS F NZ    1 
ATOM   8864  N  N     . VAL G 3  60  ? 93.152  88.880  83.597  1.00 19.55  ? 60   VAL F N     1 
ATOM   8865  C  CA    . VAL G 3  60  ? 94.210  88.746  84.598  1.00 26.45  ? 60   VAL F CA    1 
ATOM   8866  C  C     . VAL G 3  60  ? 93.654  88.143  85.876  1.00 35.11  ? 60   VAL F C     1 
ATOM   8867  O  O     . VAL G 3  60  ? 94.111  87.094  86.356  1.00 35.91  ? 60   VAL F O     1 
ATOM   8868  C  CB    . VAL G 3  60  ? 94.864  90.105  84.877  1.00 19.29  ? 60   VAL F CB    1 
ATOM   8869  C  CG1   . VAL G 3  60  ? 95.685  90.029  86.128  1.00 10.72  ? 60   VAL F CG1   1 
ATOM   8870  C  CG2   . VAL G 3  60  ? 95.740  90.495  83.717  1.00 23.75  ? 60   VAL F CG2   1 
ATOM   8871  N  N     . PHE G 3  61  ? 92.644  88.799  86.437  1.00 15.18  ? 61   PHE F N     1 
ATOM   8872  C  CA    . PHE G 3  61  ? 92.108  88.391  87.724  1.00 14.01  ? 61   PHE F CA    1 
ATOM   8873  C  C     . PHE G 3  61  ? 91.776  86.908  87.732  1.00 17.72  ? 61   PHE F C     1 
ATOM   8874  O  O     . PHE G 3  61  ? 92.299  86.136  88.545  1.00 16.72  ? 61   PHE F O     1 
ATOM   8875  C  CB    . PHE G 3  61  ? 90.872  89.219  88.013  1.00 13.08  ? 61   PHE F CB    1 
ATOM   8876  C  CG    . PHE G 3  61  ? 90.282  88.959  89.322  1.00 11.98  ? 61   PHE F CG    1 
ATOM   8877  C  CD1   . PHE G 3  61  ? 90.681  89.669  90.410  1.00 11.26  ? 61   PHE F CD1   1 
ATOM   8878  C  CD2   . PHE G 3  61  ? 89.344  87.985  89.475  1.00 22.52  ? 61   PHE F CD2   1 
ATOM   8879  C  CE1   . PHE G 3  61  ? 90.145  89.426  91.621  1.00 17.69  ? 61   PHE F CE1   1 
ATOM   8880  C  CE2   . PHE G 3  61  ? 88.808  87.738  90.683  1.00 30.20  ? 61   PHE F CE2   1 
ATOM   8881  C  CZ    . PHE G 3  61  ? 89.210  88.458  91.760  1.00 23.99  ? 61   PHE F CZ    1 
ATOM   8882  N  N     . LEU G 3  62  ? 90.940  86.483  86.790  1.00 43.28  ? 62   LEU F N     1 
ATOM   8883  C  CA    . LEU G 3  62  ? 90.566  85.080  86.741  1.00 5.61   ? 62   LEU F CA    1 
ATOM   8884  C  C     . LEU G 3  62  ? 91.768  84.185  86.542  1.00 20.70  ? 62   LEU F C     1 
ATOM   8885  O  O     . LEU G 3  62  ? 91.774  83.054  87.032  1.00 22.35  ? 62   LEU F O     1 
ATOM   8886  C  CB    . LEU G 3  62  ? 89.566  84.828  85.635  1.00 6.89   ? 62   LEU F CB    1 
ATOM   8887  C  CG    . LEU G 3  62  ? 88.315  85.599  85.948  1.00 13.55  ? 62   LEU F CG    1 
ATOM   8888  C  CD1   . LEU G 3  62  ? 87.316  85.424  84.855  1.00 12.46  ? 62   LEU F CD1   1 
ATOM   8889  C  CD2   . LEU G 3  62  ? 87.798  85.099  87.238  1.00 10.02  ? 62   LEU F CD2   1 
ATOM   8890  N  N     . GLU G 3  63  ? 92.786  84.648  85.822  1.00 21.45  ? 63   GLU F N     1 
ATOM   8891  C  CA    . GLU G 3  63  ? 93.987  83.834  85.711  1.00 29.38  ? 63   GLU F CA    1 
ATOM   8892  C  C     . GLU G 3  63  ? 94.567  83.533  87.084  1.00 26.37  ? 63   GLU F C     1 
ATOM   8893  O  O     . GLU G 3  63  ? 94.845  82.372  87.409  1.00 24.45  ? 63   GLU F O     1 
ATOM   8894  C  CB    . GLU G 3  63  ? 95.012  84.512  84.814  1.00 43.01  ? 63   GLU F CB    1 
ATOM   8895  C  CG    . GLU G 3  63  ? 94.697  84.377  83.336  1.00 45.86  ? 63   GLU F CG    1 
ATOM   8896  C  CD    . GLU G 3  63  ? 95.607  85.207  82.450  1.00 54.05  ? 63   GLU F CD    1 
ATOM   8897  O  OE1   . GLU G 3  63  ? 96.278  86.115  82.977  1.00 51.87  ? 63   GLU F OE1   1 
ATOM   8898  O  OE2   . GLU G 3  63  ? 95.668  84.939  81.230  1.00 55.91  ? 63   GLU F OE2   1 
ATOM   8899  N  N     . ASN G 3  64  ? 94.722  84.553  87.926  1.00 28.42  ? 64   ASN F N     1 
ATOM   8900  C  CA    . ASN G 3  64  ? 95.273  84.285  89.252  1.00 26.20  ? 64   ASN F CA    1 
ATOM   8901  C  C     . ASN G 3  64  ? 94.374  83.354  90.054  1.00 20.37  ? 64   ASN F C     1 
ATOM   8902  O  O     . ASN G 3  64  ? 94.789  82.258  90.463  1.00 36.59  ? 64   ASN F O     1 
ATOM   8903  C  CB    . ASN G 3  64  ? 95.490  85.583  90.004  1.00 25.35  ? 64   ASN F CB    1 
ATOM   8904  C  CG    . ASN G 3  64  ? 96.613  86.365  89.447  1.00 38.26  ? 64   ASN F CG    1 
ATOM   8905  O  OD1   . ASN G 3  64  ? 97.496  85.813  88.806  1.00 53.40  ? 64   ASN F OD1   1 
ATOM   8906  N  ND2   . ASN G 3  64  ? 96.598  87.662  89.672  1.00 29.67  ? 64   ASN F ND2   1 
ATOM   8907  N  N     . VAL G 3  65  ? 93.126  83.767  90.275  1.00 13.00  ? 65   VAL F N     1 
ATOM   8908  C  CA    . VAL G 3  65  ? 92.265  82.985  91.155  1.00 17.88  ? 65   VAL F CA    1 
ATOM   8909  C  C     . VAL G 3  65  ? 92.187  81.549  90.688  1.00 23.94  ? 65   VAL F C     1 
ATOM   8910  O  O     . VAL G 3  65  ? 92.316  80.612  91.481  1.00 26.32  ? 65   VAL F O     1 
ATOM   8911  C  CB    . VAL G 3  65  ? 90.872  83.609  91.240  1.00 12.36  ? 65   VAL F CB    1 
ATOM   8912  C  CG1   . VAL G 3  65  ? 89.999  82.721  92.021  1.00 5.68   ? 65   VAL F CG1   1 
ATOM   8913  C  CG2   . VAL G 3  65  ? 90.963  84.928  91.903  1.00 22.12  ? 65   VAL F CG2   1 
ATOM   8914  N  N     . ILE G 3  66  ? 92.020  81.341  89.391  1.00 15.40  ? 66   ILE F N     1 
ATOM   8915  C  CA    . ILE G 3  66  ? 91.867  79.969  88.957  1.00 10.07  ? 66   ILE F CA    1 
ATOM   8916  C  C     . ILE G 3  66  ? 93.171  79.209  89.073  1.00 29.31  ? 66   ILE F C     1 
ATOM   8917  O  O     . ILE G 3  66  ? 93.154  78.001  89.314  1.00 31.87  ? 66   ILE F O     1 
ATOM   8918  C  CB    . ILE G 3  66  ? 91.289  79.925  87.546  1.00 19.61  ? 66   ILE F CB    1 
ATOM   8919  C  CG1   . ILE G 3  66  ? 89.881  80.458  87.606  1.00 14.79  ? 66   ILE F CG1   1 
ATOM   8920  C  CG2   . ILE G 3  66  ? 91.214  78.529  87.052  1.00 16.31  ? 66   ILE F CG2   1 
ATOM   8921  C  CD1   . ILE G 3  66  ? 89.300  80.699  86.288  1.00 25.38  ? 66   ILE F CD1   1 
ATOM   8922  N  N     . ARG G 3  67  ? 94.323  79.867  88.967  1.00 29.84  ? 67   ARG F N     1 
ATOM   8923  C  CA    . ARG G 3  67  ? 95.513  79.047  89.149  1.00 21.95  ? 67   ARG F CA    1 
ATOM   8924  C  C     . ARG G 3  67  ? 95.661  78.611  90.593  1.00 27.34  ? 67   ARG F C     1 
ATOM   8925  O  O     . ARG G 3  67  ? 96.116  77.492  90.854  1.00 35.22  ? 67   ARG F O     1 
ATOM   8926  C  CB    . ARG G 3  67  ? 96.783  79.747  88.697  1.00 32.00  ? 67   ARG F CB    1 
ATOM   8927  C  CG    . ARG G 3  67  ? 97.397  80.689  89.677  1.00 43.58  ? 67   ARG F CG    1 
ATOM   8928  C  CD    . ARG G 3  67  ? 98.754  81.079  89.160  1.00 59.18  ? 67   ARG F CD    1 
ATOM   8929  N  NE    . ARG G 3  67  ? 98.610  81.818  87.917  1.00 70.60  ? 67   ARG F NE    1 
ATOM   8930  C  CZ    . ARG G 3  67  ? 99.554  81.909  86.995  1.00 73.42  ? 67   ARG F CZ    1 
ATOM   8931  N  NH1   . ARG G 3  67  ? 100.702 81.281  87.169  1.00 75.32  ? 67   ARG F NH1   1 
ATOM   8932  N  NH2   . ARG G 3  67  ? 99.340  82.604  85.890  1.00 68.05  ? 67   ARG F NH2   1 
ATOM   8933  N  N     . ASP G 3  68  ? 95.257  79.443  91.549  1.00 25.75  ? 68   ASP F N     1 
ATOM   8934  C  CA    . ASP G 3  68  ? 95.373  78.984  92.927  1.00 24.71  ? 68   ASP F CA    1 
ATOM   8935  C  C     . ASP G 3  68  ? 94.362  77.885  93.223  1.00 28.79  ? 68   ASP F C     1 
ATOM   8936  O  O     . ASP G 3  68  ? 94.707  76.852  93.812  1.00 26.56  ? 68   ASP F O     1 
ATOM   8937  C  CB    . ASP G 3  68  ? 95.213  80.145  93.888  1.00 21.68  ? 68   ASP F CB    1 
ATOM   8938  C  CG    . ASP G 3  68  ? 96.297  81.159  93.718  1.00 47.32  ? 68   ASP F CG    1 
ATOM   8939  O  OD1   . ASP G 3  68  ? 97.229  80.872  92.949  1.00 67.28  ? 68   ASP F OD1   1 
ATOM   8940  O  OD2   . ASP G 3  68  ? 96.244  82.224  94.359  1.00 53.94  ? 68   ASP F OD2   1 
ATOM   8941  N  N     . ALA G 3  69  ? 93.113  78.077  92.807  1.00 18.30  ? 69   ALA F N     1 
ATOM   8942  C  CA    . ALA G 3  69  ? 92.137  77.010  92.957  1.00 22.16  ? 69   ALA F CA    1 
ATOM   8943  C  C     . ALA G 3  69  ? 92.673  75.712  92.393  1.00 17.96  ? 69   ALA F C     1 
ATOM   8944  O  O     . ALA G 3  69  ? 92.707  74.684  93.078  1.00 19.42  ? 69   ALA F O     1 
ATOM   8945  C  CB    . ALA G 3  69  ? 90.841  77.380  92.258  1.00 14.85  ? 69   ALA F CB    1 
ATOM   8946  N  N     . VAL G 3  70  ? 93.127  75.746  91.148  1.00 18.28  ? 70   VAL F N     1 
ATOM   8947  C  CA    . VAL G 3  70  ? 93.650  74.535  90.543  1.00 28.56  ? 70   VAL F CA    1 
ATOM   8948  C  C     . VAL G 3  70  ? 94.761  73.951  91.389  1.00 30.62  ? 70   VAL F C     1 
ATOM   8949  O  O     . VAL G 3  70  ? 94.876  72.732  91.514  1.00 21.33  ? 70   VAL F O     1 
ATOM   8950  C  CB    . VAL G 3  70  ? 94.121  74.810  89.118  1.00 19.66  ? 70   VAL F CB    1 
ATOM   8951  C  CG1   . VAL G 3  70  ? 94.811  73.613  88.592  1.00 19.78  ? 70   VAL F CG1   1 
ATOM   8952  C  CG2   . VAL G 3  70  ? 92.941  75.087  88.283  1.00 10.70  ? 70   VAL F CG2   1 
ATOM   8953  N  N     . THR G 3  71  ? 95.583  74.797  92.006  1.00 17.25  ? 71   THR F N     1 
ATOM   8954  C  CA    . THR G 3  71  ? 96.641  74.263  92.856  1.00 15.36  ? 71   THR F CA    1 
ATOM   8955  C  C     . THR G 3  71  ? 96.077  73.442  94.000  1.00 24.93  ? 71   THR F C     1 
ATOM   8956  O  O     . THR G 3  71  ? 96.425  72.268  94.166  1.00 37.78  ? 71   THR F O     1 
ATOM   8957  C  CB    . THR G 3  71  ? 97.499  75.374  93.409  1.00 29.28  ? 71   THR F CB    1 
ATOM   8958  O  OG1   . THR G 3  71  ? 98.206  75.991  92.336  1.00 27.24  ? 71   THR F OG1   1 
ATOM   8959  C  CG2   . THR G 3  71  ? 98.458  74.791  94.379  1.00 22.06  ? 71   THR F CG2   1 
ATOM   8960  N  N     . TYR G 3  72  ? 95.211  74.048  94.813  1.00 21.49  ? 72   TYR F N     1 
ATOM   8961  C  CA    . TYR G 3  72  ? 94.578  73.284  95.882  1.00 20.58  ? 72   TYR F CA    1 
ATOM   8962  C  C     . TYR G 3  72  ? 94.031  71.972  95.361  1.00 28.21  ? 72   TYR F C     1 
ATOM   8963  O  O     . TYR G 3  72  ? 94.296  70.908  95.926  1.00 38.35  ? 72   TYR F O     1 
ATOM   8964  C  CB    . TYR G 3  72  ? 93.464  74.082  96.533  1.00 31.56  ? 72   TYR F CB    1 
ATOM   8965  C  CG    . TYR G 3  72  ? 93.938  75.152  97.440  1.00 34.46  ? 72   TYR F CG    1 
ATOM   8966  C  CD1   . TYR G 3  72  ? 94.949  74.924  98.307  1.00 34.71  ? 72   TYR F CD1   1 
ATOM   8967  C  CD2   . TYR G 3  72  ? 93.362  76.383  97.435  1.00 35.52  ? 72   TYR F CD2   1 
ATOM   8968  C  CE1   . TYR G 3  72  ? 95.379  75.891  99.140  1.00 32.25  ? 72   TYR F CE1   1 
ATOM   8969  C  CE2   . TYR G 3  72  ? 93.785  77.351  98.261  1.00 34.42  ? 72   TYR F CE2   1 
ATOM   8970  C  CZ    . TYR G 3  72  ? 94.793  77.103  99.115  1.00 35.49  ? 72   TYR F CZ    1 
ATOM   8971  O  OH    . TYR G 3  72  ? 95.230  78.083  99.960  1.00 43.33  ? 72   TYR F OH    1 
ATOM   8972  N  N     . THR G 3  73  ? 93.289  72.023  94.261  1.00 60.44  ? 73   THR F N     1 
ATOM   8973  C  CA    . THR G 3  73  ? 92.721  70.800  93.717  1.00 14.12  ? 73   THR F CA    1 
ATOM   8974  C  C     . THR G 3  73  ? 93.787  69.758  93.436  1.00 20.72  ? 73   THR F C     1 
ATOM   8975  O  O     . THR G 3  73  ? 93.700  68.627  93.918  1.00 25.38  ? 73   THR F O     1 
ATOM   8976  C  CB    . THR G 3  73  ? 91.945  71.111  92.463  1.00 42.02  ? 73   THR F CB    1 
ATOM   8977  O  OG1   . THR G 3  73  ? 90.759  71.812  92.830  1.00 35.25  ? 73   THR F OG1   1 
ATOM   8978  C  CG2   . THR G 3  73  ? 91.600  69.846  91.762  1.00 32.03  ? 73   THR F CG2   1 
ATOM   8979  N  N     . GLU G 3  74  ? 94.806  70.114  92.659  1.00 24.73  ? 74   GLU F N     1 
ATOM   8980  C  CA    . GLU G 3  74  ? 95.883  69.166  92.408  1.00 32.41  ? 74   GLU F CA    1 
ATOM   8981  C  C     . GLU G 3  74  ? 96.407  68.573  93.696  1.00 30.12  ? 74   GLU F C     1 
ATOM   8982  O  O     . GLU G 3  74  ? 96.780  67.399  93.732  1.00 32.76  ? 74   GLU F O     1 
ATOM   8983  C  CB    . GLU G 3  74  ? 97.048  69.819  91.668  1.00 39.05  ? 74   GLU F CB    1 
ATOM   8984  C  CG    . GLU G 3  74  ? 96.808  70.169  90.217  1.00 60.71  ? 74   GLU F CG    1 
ATOM   8985  C  CD    . GLU G 3  74  ? 98.012  70.866  89.588  1.00 74.15  ? 74   GLU F CD    1 
ATOM   8986  O  OE1   . GLU G 3  74  ? 98.946  71.229  90.333  1.00 78.10  ? 74   GLU F OE1   1 
ATOM   8987  O  OE2   . GLU G 3  74  ? 98.031  71.056  88.353  1.00 74.44  ? 74   GLU F OE2   1 
ATOM   8988  N  N     . HIS G 3  75  ? 96.439  69.354  94.769  1.00 39.88  ? 75   HIS F N     1 
ATOM   8989  C  CA    . HIS G 3  75  ? 97.040  68.830  95.985  1.00 34.48  ? 75   HIS F CA    1 
ATOM   8990  C  C     . HIS G 3  75  ? 96.223  67.705  96.591  1.00 40.79  ? 75   HIS F C     1 
ATOM   8991  O  O     . HIS G 3  75  ? 96.787  66.750  97.130  1.00 56.55  ? 75   HIS F O     1 
ATOM   8992  C  CB    . HIS G 3  75  ? 97.230  69.925  97.013  1.00 31.43  ? 75   HIS F CB    1 
ATOM   8993  C  CG    . HIS G 3  75  ? 97.619  69.392  98.343  1.00 42.36  ? 75   HIS F CG    1 
ATOM   8994  N  ND1   . HIS G 3  75  ? 98.708  68.573  98.516  1.00 42.56  ? 75   HIS F ND1   1 
ATOM   8995  C  CD2   . HIS G 3  75  ? 97.048  69.528  99.560  1.00 55.51  ? 75   HIS F CD2   1 
ATOM   8996  C  CE1   . HIS G 3  75  ? 98.801  68.234  99.787  1.00 55.24  ? 75   HIS F CE1   1 
ATOM   8997  N  NE2   . HIS G 3  75  ? 97.806  68.801  100.442 1.00 57.00  ? 75   HIS F NE2   1 
ATOM   8998  N  N     . ALA G 3  76  ? 94.906  67.790  96.525  1.00 37.89  ? 76   ALA F N     1 
ATOM   8999  C  CA    . ALA G 3  76  ? 94.072  66.879  97.288  1.00 44.16  ? 76   ALA F CA    1 
ATOM   9000  C  C     . ALA G 3  76  ? 93.771  65.594  96.547  1.00 43.89  ? 76   ALA F C     1 
ATOM   9001  O  O     . ALA G 3  76  ? 92.971  64.794  97.032  1.00 52.16  ? 76   ALA F O     1 
ATOM   9002  C  CB    . ALA G 3  76  ? 92.770  67.562  97.687  1.00 43.66  ? 76   ALA F CB    1 
ATOM   9003  N  N     . LYS G 3  77  ? 94.379  65.388  95.382  1.00 41.70  ? 77   LYS F N     1 
ATOM   9004  C  CA    . LYS G 3  77  ? 94.103  64.227  94.538  1.00 50.21  ? 77   LYS F CA    1 
ATOM   9005  C  C     . LYS G 3  77  ? 92.649  64.217  94.089  1.00 54.40  ? 77   LYS F C     1 
ATOM   9006  O  O     . LYS G 3  77  ? 91.948  63.216  94.206  1.00 54.40  ? 77   LYS F O     1 
ATOM   9007  C  CB    . LYS G 3  77  ? 94.447  62.921  95.250  1.00 64.69  ? 77   LYS F CB    1 
ATOM   9008  C  CG    . LYS G 3  77  ? 95.902  62.744  95.579  1.00 70.28  ? 77   LYS F CG    1 
ATOM   9009  C  CD    . LYS G 3  77  ? 96.086  61.493  96.410  1.00 79.22  ? 77   LYS F CD    1 
ATOM   9010  C  CE    . LYS G 3  77  ? 97.529  61.295  96.795  1.00 92.41  ? 77   LYS F CE    1 
ATOM   9011  N  NZ    . LYS G 3  77  ? 97.670  60.122  97.686  1.00 99.41  ? 77   LYS F NZ    1 
ATOM   9012  N  N     . ARG G 3  78  ? 92.189  65.351  93.591  1.00 65.26  ? 78   ARG F N     1 
ATOM   9013  C  CA    . ARG G 3  78  ? 90.873  65.433  92.990  1.00 67.60  ? 78   ARG F CA    1 
ATOM   9014  C  C     . ARG G 3  78  ? 91.003  66.011  91.597  1.00 68.61  ? 78   ARG F C     1 
ATOM   9015  O  O     . ARG G 3  78  ? 91.934  66.759  91.307  1.00 72.75  ? 78   ARG F O     1 
ATOM   9016  C  CB    . ARG G 3  78  ? 89.914  66.271  93.830  1.00 73.04  ? 78   ARG F CB    1 
ATOM   9017  C  CG    . ARG G 3  78  ? 89.536  65.568  95.099  1.00 77.68  ? 78   ARG F CG    1 
ATOM   9018  C  CD    . ARG G 3  78  ? 88.471  66.267  95.927  1.00 65.96  ? 78   ARG F CD    1 
ATOM   9019  N  NE    . ARG G 3  78  ? 88.898  67.500  96.568  1.00 73.23  ? 78   ARG F NE    1 
ATOM   9020  C  CZ    . ARG G 3  78  ? 88.520  68.702  96.175  1.00 71.52  ? 78   ARG F CZ    1 
ATOM   9021  N  NH1   . ARG G 3  78  ? 87.710  68.823  95.143  1.00 71.13  ? 78   ARG F NH1   1 
ATOM   9022  N  NH2   . ARG G 3  78  ? 88.941  69.775  96.816  1.00 50.07  ? 78   ARG F NH2   1 
ATOM   9023  N  N     . LYS G 3  79  ? 90.088  65.617  90.726  1.00 78.81  ? 79   LYS F N     1 
ATOM   9024  C  CA    . LYS G 3  79  ? 89.978  66.187  89.397  1.00 79.00  ? 79   LYS F CA    1 
ATOM   9025  C  C     . LYS G 3  79  ? 88.962  67.307  89.343  1.00 82.25  ? 79   LYS F C     1 
ATOM   9026  O  O     . LYS G 3  79  ? 88.634  67.775  88.251  1.00 86.88  ? 79   LYS F O     1 
ATOM   9027  C  CB    . LYS G 3  79  ? 89.603  65.112  88.388  1.00 71.70  ? 79   LYS F CB    1 
ATOM   9028  C  CG    . LYS G 3  79  ? 90.585  63.976  88.316  1.00 87.63  ? 79   LYS F CG    1 
ATOM   9029  C  CD    . LYS G 3  79  ? 91.908  64.446  87.780  1.00 101.28 ? 79   LYS F CD    1 
ATOM   9030  C  CE    . LYS G 3  79  ? 92.898  63.299  87.681  1.00 105.67 ? 79   LYS F CE    1 
ATOM   9031  N  NZ    . LYS G 3  79  ? 92.465  62.277  86.699  1.00 110.40 ? 79   LYS F NZ    1 
ATOM   9032  N  N     . THR G 3  80  ? 88.433  67.721  90.488  1.00 73.51  ? 80   THR F N     1 
ATOM   9033  C  CA    . THR G 3  80  ? 87.241  68.556  90.555  1.00 68.63  ? 80   THR F CA    1 
ATOM   9034  C  C     . THR G 3  80  ? 87.506  69.781  91.409  1.00 74.14  ? 80   THR F C     1 
ATOM   9035  O  O     . THR G 3  80  ? 87.670  69.662  92.622  1.00 88.68  ? 80   THR F O     1 
ATOM   9036  C  CB    . THR G 3  80  ? 86.090  67.761  91.147  1.00 94.67  ? 80   THR F CB    1 
ATOM   9037  O  OG1   . THR G 3  80  ? 85.812  66.630  90.313  1.00 106.76 ? 80   THR F OG1   1 
ATOM   9038  C  CG2   . THR G 3  80  ? 84.868  68.621  91.275  1.00 96.63  ? 80   THR F CG2   1 
ATOM   9039  N  N     . VAL G 3  81  ? 87.505  70.956  90.796  1.00 50.59  ? 81   VAL F N     1 
ATOM   9040  C  CA    . VAL G 3  81  ? 87.514  72.177  91.579  1.00 51.68  ? 81   VAL F CA    1 
ATOM   9041  C  C     . VAL G 3  81  ? 86.193  72.295  92.319  1.00 53.49  ? 81   VAL F C     1 
ATOM   9042  O  O     . VAL G 3  81  ? 85.154  71.840  91.839  1.00 55.21  ? 81   VAL F O     1 
ATOM   9043  C  CB    . VAL G 3  81  ? 87.746  73.375  90.653  1.00 45.71  ? 81   VAL F CB    1 
ATOM   9044  C  CG1   . VAL G 3  81  ? 87.690  74.651  91.413  1.00 34.16  ? 81   VAL F CG1   1 
ATOM   9045  C  CG2   . VAL G 3  81  ? 89.064  73.227  89.974  1.00 47.52  ? 81   VAL F CG2   1 
ATOM   9046  N  N     . THR G 3  82  ? 86.220  72.885  93.508  1.00 42.46  ? 82   THR F N     1 
ATOM   9047  C  CA    . THR G 3  82  ? 85.003  73.016  94.290  1.00 48.62  ? 82   THR F CA    1 
ATOM   9048  C  C     . THR G 3  82  ? 84.970  74.356  94.979  1.00 49.40  ? 82   THR F C     1 
ATOM   9049  O  O     . THR G 3  82  ? 86.004  74.959  95.255  1.00 42.74  ? 82   THR F O     1 
ATOM   9050  C  CB    . THR G 3  82  ? 84.877  71.962  95.370  1.00 60.07  ? 82   THR F CB    1 
ATOM   9051  O  OG1   . THR G 3  82  ? 86.017  72.047  96.224  1.00 47.04  ? 82   THR F OG1   1 
ATOM   9052  C  CG2   . THR G 3  82  ? 84.788  70.588  94.772  1.00 53.02  ? 82   THR F CG2   1 
ATOM   9053  N  N     . ALA G 3  83  ? 83.753  74.770  95.319  1.00 41.59  ? 83   ALA F N     1 
ATOM   9054  C  CA    . ALA G 3  83  ? 83.540  76.084  95.903  1.00 36.07  ? 83   ALA F CA    1 
ATOM   9055  C  C     . ALA G 3  83  ? 84.487  76.336  97.050  1.00 26.23  ? 83   ALA F C     1 
ATOM   9056  O  O     . ALA G 3  83  ? 85.008  77.443  97.197  1.00 30.56  ? 83   ALA F O     1 
ATOM   9057  C  CB    . ALA G 3  83  ? 82.104  76.222  96.384  1.00 53.02  ? 83   ALA F CB    1 
ATOM   9058  N  N     . MET G 3  84  ? 84.733  75.326  97.874  1.00 24.21  ? 84   MET F N     1 
ATOM   9059  C  CA    . MET G 3  84  ? 85.686  75.518  98.953  1.00 33.26  ? 84   MET F CA    1 
ATOM   9060  C  C     . MET G 3  84  ? 87.021  75.989  98.415  1.00 42.75  ? 84   MET F C     1 
ATOM   9061  O  O     . MET G 3  84  ? 87.646  76.891  98.984  1.00 42.59  ? 84   MET F O     1 
ATOM   9062  C  CB    . MET G 3  84  ? 85.860  74.232  99.745  1.00 69.51  ? 84   MET F CB    1 
ATOM   9063  C  CG    . MET G 3  84  ? 84.631  73.845  100.492 1.00 80.67  ? 84   MET F CG    1 
ATOM   9064  S  SD    . MET G 3  84  ? 84.130  75.267  101.468 1.00 96.29  ? 84   MET F SD    1 
ATOM   9065  C  CE    . MET G 3  84  ? 85.579  75.477  102.483 1.00 85.00  ? 84   MET F CE    1 
ATOM   9066  N  N     . ASP G 3  85  ? 87.456  75.427  97.295  1.00 26.69  ? 85   ASP F N     1 
ATOM   9067  C  CA    . ASP G 3  85  ? 88.783  75.754  96.806  1.00 21.96  ? 85   ASP F CA    1 
ATOM   9068  C  C     . ASP G 3  85  ? 88.835  77.175  96.285  1.00 26.89  ? 85   ASP F C     1 
ATOM   9069  O  O     . ASP G 3  85  ? 89.762  77.921  96.601  1.00 26.23  ? 85   ASP F O     1 
ATOM   9070  C  CB    . ASP G 3  85  ? 89.202  74.757  95.746  1.00 39.87  ? 85   ASP F CB    1 
ATOM   9071  C  CG    . ASP G 3  85  ? 89.374  73.379  96.317  1.00 52.60  ? 85   ASP F CG    1 
ATOM   9072  O  OD1   . ASP G 3  85  ? 89.337  73.266  97.557  1.00 57.34  ? 85   ASP F OD1   1 
ATOM   9073  O  OD2   . ASP G 3  85  ? 89.572  72.415  95.550  1.00 33.59  ? 85   ASP F OD2   1 
ATOM   9074  N  N     . VAL G 3  86  ? 87.838  77.586  95.510  1.00 6.13   ? 86   VAL F N     1 
ATOM   9075  C  CA    . VAL G 3  86  ? 87.790  78.984  95.105  1.00 6.31   ? 86   VAL F CA    1 
ATOM   9076  C  C     . VAL G 3  86  ? 87.799  79.884  96.323  1.00 7.81   ? 86   VAL F C     1 
ATOM   9077  O  O     . VAL G 3  86  ? 88.632  80.786  96.437  1.00 5.68   ? 86   VAL F O     1 
ATOM   9078  C  CB    . VAL G 3  86  ? 86.570  79.263  94.227  1.00 8.99   ? 86   VAL F CB    1 
ATOM   9079  C  CG1   . VAL G 3  86  ? 86.384  80.727  94.145  1.00 5.15   ? 86   VAL F CG1   1 
ATOM   9080  C  CG2   . VAL G 3  86  ? 86.822  78.742  92.862  1.00 15.50  ? 86   VAL F CG2   1 
ATOM   9081  N  N     . VAL G 3  87  ? 86.892  79.639  97.266  1.00 40.12  ? 87   VAL F N     1 
ATOM   9082  C  CA    . VAL G 3  87  ? 86.832  80.495  98.444  1.00 10.58  ? 87   VAL F CA    1 
ATOM   9083  C  C     . VAL G 3  87  ? 88.182  80.582  99.117  1.00 14.43  ? 87   VAL F C     1 
ATOM   9084  O  O     . VAL G 3  87  ? 88.544  81.625  99.669  1.00 9.89   ? 87   VAL F O     1 
ATOM   9085  C  CB    . VAL G 3  87  ? 85.778  79.994  99.428  1.00 15.19  ? 87   VAL F CB    1 
ATOM   9086  C  CG1   . VAL G 3  87  ? 85.763  80.882  100.628 1.00 14.75  ? 87   VAL F CG1   1 
ATOM   9087  C  CG2   . VAL G 3  87  ? 84.458  80.020  98.793  1.00 15.78  ? 87   VAL F CG2   1 
ATOM   9088  N  N     . TYR G 3  88  ? 88.965  79.510  99.075  1.00 6.89   ? 88   TYR F N     1 
ATOM   9089  C  CA    . TYR G 3  88  ? 90.295  79.614  99.650  1.00 7.32   ? 88   TYR F CA    1 
ATOM   9090  C  C     . TYR G 3  88  ? 91.216  80.442  98.781  1.00 15.69  ? 88   TYR F C     1 
ATOM   9091  O  O     . TYR G 3  88  ? 92.079  81.146  99.299  1.00 14.65  ? 88   TYR F O     1 
ATOM   9092  C  CB    . TYR G 3  88  ? 90.906  78.251  99.882  1.00 28.53  ? 88   TYR F CB    1 
ATOM   9093  C  CG    . TYR G 3  88  ? 90.221  77.495  100.952 1.00 37.20  ? 88   TYR F CG    1 
ATOM   9094  C  CD1   . TYR G 3  88  ? 89.683  78.147  102.029 1.00 45.57  ? 88   TYR F CD1   1 
ATOM   9095  C  CD2   . TYR G 3  88  ? 90.143  76.127  100.906 1.00 46.02  ? 88   TYR F CD2   1 
ATOM   9096  C  CE1   . TYR G 3  88  ? 89.056  77.460  103.016 1.00 51.86  ? 88   TYR F CE1   1 
ATOM   9097  C  CE2   . TYR G 3  88  ? 89.523  75.429  101.885 1.00 56.21  ? 88   TYR F CE2   1 
ATOM   9098  C  CZ    . TYR G 3  88  ? 88.982  76.098  102.943 1.00 59.06  ? 88   TYR F CZ    1 
ATOM   9099  O  OH    . TYR G 3  88  ? 88.357  75.394  103.942 1.00 68.60  ? 88   TYR F OH    1 
ATOM   9100  N  N     . ALA G 3  89  ? 91.086  80.362  97.466  1.00 10.20  ? 89   ALA F N     1 
ATOM   9101  C  CA    . ALA G 3  89  ? 91.964  81.179  96.650  1.00 6.57   ? 89   ALA F CA    1 
ATOM   9102  C  C     . ALA G 3  89  ? 91.684  82.651  96.880  1.00 15.31  ? 89   ALA F C     1 
ATOM   9103  O  O     . ALA G 3  89  ? 92.608  83.463  96.987  1.00 28.72  ? 89   ALA F O     1 
ATOM   9104  C  CB    . ALA G 3  89  ? 91.806  80.818  95.187  1.00 16.28  ? 89   ALA F CB    1 
ATOM   9105  N  N     . LEU G 3  90  ? 90.416  83.014  96.990  1.00 7.32   ? 90   LEU F N     1 
ATOM   9106  C  CA    . LEU G 3  90  ? 90.098  84.409  97.238  1.00 2.13   ? 90   LEU F CA    1 
ATOM   9107  C  C     . LEU G 3  90  ? 90.527  84.822  98.634  1.00 22.91  ? 90   LEU F C     1 
ATOM   9108  O  O     . LEU G 3  90  ? 91.093  85.901  98.814  1.00 25.99  ? 90   LEU F O     1 
ATOM   9109  C  CB    . LEU G 3  90  ? 88.615  84.648  97.036  1.00 1.60   ? 90   LEU F CB    1 
ATOM   9110  C  CG    . LEU G 3  90  ? 88.163  84.348  95.625  1.00 13.34  ? 90   LEU F CG    1 
ATOM   9111  C  CD1   . LEU G 3  90  ? 86.683  84.436  95.543  1.00 15.10  ? 90   LEU F CD1   1 
ATOM   9112  C  CD2   . LEU G 3  90  ? 88.775  85.346  94.738  1.00 1.86   ? 90   LEU F CD2   1 
ATOM   9113  N  N     . LYS G 3  91  ? 90.273  83.985  99.638  1.00 13.66  ? 91   LYS F N     1 
ATOM   9114  C  CA    . LYS G 3  91  ? 90.794  84.290  100.965 1.00 9.43   ? 91   LYS F CA    1 
ATOM   9115  C  C     . LYS G 3  91  ? 92.293  84.459  100.917 1.00 22.40  ? 91   LYS F C     1 
ATOM   9116  O  O     . LYS G 3  91  ? 92.868  85.237  101.680 1.00 20.83  ? 91   LYS F O     1 
ATOM   9117  C  CB    . LYS G 3  91  ? 90.444  83.177  101.942 1.00 25.70  ? 91   LYS F CB    1 
ATOM   9118  C  CG    . LYS G 3  91  ? 90.848  83.460  103.365 1.00 34.75  ? 91   LYS F CG    1 
ATOM   9119  C  CD    . LYS G 3  91  ? 90.579  82.264  104.256 1.00 60.04  ? 91   LYS F CD    1 
ATOM   9120  C  CE    . LYS G 3  91  ? 89.105  81.918  104.289 1.00 74.52  ? 91   LYS F CE    1 
ATOM   9121  N  NZ    . LYS G 3  91  ? 88.256  82.986  104.868 1.00 88.64  ? 91   LYS F NZ    1 
ATOM   9122  N  N     . ARG G 3  92  ? 92.928  83.740  100.011 1.00 37.19  ? 92   ARG F N     1 
ATOM   9123  C  CA    . ARG G 3  92  ? 94.370  83.753  99.867  1.00 17.34  ? 92   ARG F CA    1 
ATOM   9124  C  C     . ARG G 3  92  ? 94.857  85.104  99.375  1.00 23.36  ? 92   ARG F C     1 
ATOM   9125  O  O     . ARG G 3  92  ? 95.669  85.759  100.031 1.00 41.58  ? 92   ARG F O     1 
ATOM   9126  C  CB    . ARG G 3  92  ? 94.743  82.625  98.915  1.00 24.99  ? 92   ARG F CB    1 
ATOM   9127  C  CG    . ARG G 3  92  ? 96.111  82.561  98.395  1.00 36.76  ? 92   ARG F CG    1 
ATOM   9128  C  CD    . ARG G 3  92  ? 97.108  82.285  99.419  1.00 50.97  ? 92   ARG F CD    1 
ATOM   9129  N  NE    . ARG G 3  92  ? 98.329  82.059  98.686  1.00 53.11  ? 92   ARG F NE    1 
ATOM   9130  C  CZ    . ARG G 3  92  ? 99.074  83.032  98.185  1.00 65.08  ? 92   ARG F CZ    1 
ATOM   9131  N  NH1   . ARG G 3  92  ? 98.717  84.295  98.352  1.00 70.57  ? 92   ARG F NH1   1 
ATOM   9132  N  NH2   . ARG G 3  92  ? 100.178 82.744  97.514  1.00 64.33  ? 92   ARG F NH2   1 
ATOM   9133  N  N     . GLN G 3  93  ? 94.339  85.562  98.238  1.00 21.78  ? 93   GLN F N     1 
ATOM   9134  C  CA    . GLN G 3  93  ? 94.844  86.817  97.699  1.00 24.51  ? 93   GLN F CA    1 
ATOM   9135  C  C     . GLN G 3  93  ? 94.525  88.013  98.570  1.00 32.97  ? 93   GLN F C     1 
ATOM   9136  O  O     . GLN G 3  93  ? 95.079  89.087  98.332  1.00 24.19  ? 93   GLN F O     1 
ATOM   9137  C  CB    . GLN G 3  93  ? 94.261  87.093  96.333  1.00 11.16  ? 93   GLN F CB    1 
ATOM   9138  C  CG    . GLN G 3  93  ? 94.507  86.043  95.341  1.00 27.08  ? 93   GLN F CG    1 
ATOM   9139  C  CD    . GLN G 3  93  ? 93.921  86.443  94.042  1.00 36.16  ? 93   GLN F CD    1 
ATOM   9140  O  OE1   . GLN G 3  93  ? 93.113  87.365  93.984  1.00 43.77  ? 93   GLN F OE1   1 
ATOM   9141  N  NE2   . GLN G 3  93  ? 94.282  85.738  92.985  1.00 32.87  ? 93   GLN F NE2   1 
ATOM   9142  N  N     . GLY G 3  94  ? 93.641  87.871  99.545  1.00 18.68  ? 94   GLY F N     1 
ATOM   9143  C  CA    . GLY G 3  94  ? 93.219  88.985  100.358 1.00 43.46  ? 94   GLY F CA    1 
ATOM   9144  C  C     . GLY G 3  94  ? 91.839  89.527  100.076 1.00 19.00  ? 94   GLY F C     1 
ATOM   9145  O  O     . GLY G 3  94  ? 91.480  90.562  100.642 1.00 20.10  ? 94   GLY F O     1 
ATOM   9146  N  N     . ARG G 3  95  ? 91.054  88.877  99.236  1.00 17.81  ? 95   ARG F N     1 
ATOM   9147  C  CA    . ARG G 3  95  ? 89.656  89.236  99.053  1.00 16.69  ? 95   ARG F CA    1 
ATOM   9148  C  C     . ARG G 3  95  ? 88.835  88.127  99.678  1.00 25.94  ? 95   ARG F C     1 
ATOM   9149  O  O     . ARG G 3  95  ? 88.673  87.063  99.085  1.00 26.17  ? 95   ARG F O     1 
ATOM   9150  C  CB    . ARG G 3  95  ? 89.332  89.378  97.580  1.00 56.18  ? 95   ARG F CB    1 
ATOM   9151  C  CG    . ARG G 3  95  ? 90.213  90.375  96.929  1.00 58.67  ? 95   ARG F CG    1 
ATOM   9152  C  CD    . ARG G 3  95  ? 89.878  90.633  95.491  1.00 23.10  ? 95   ARG F CD    1 
ATOM   9153  N  NE    . ARG G 3  95  ? 90.836  91.602  94.991  1.00 44.03  ? 95   ARG F NE    1 
ATOM   9154  C  CZ    . ARG G 3  95  ? 90.753  92.902  95.231  1.00 50.69  ? 95   ARG F CZ    1 
ATOM   9155  N  NH1   . ARG G 3  95  ? 89.749  93.384  95.949  1.00 49.28  ? 95   ARG F NH1   1 
ATOM   9156  N  NH2   . ARG G 3  95  ? 91.676  93.720  94.758  1.00 40.58  ? 95   ARG F NH2   1 
ATOM   9157  N  N     . THR G 3  96  ? 88.269  88.385  100.842 1.00 32.75  ? 96   THR F N     1 
ATOM   9158  C  CA    . THR G 3  96  ? 87.523  87.337  101.509 1.00 23.97  ? 96   THR F CA    1 
ATOM   9159  C  C     . THR G 3  96  ? 86.162  87.217  100.856 1.00 33.98  ? 96   THR F C     1 
ATOM   9160  O  O     . THR G 3  96  ? 85.589  88.201  100.396 1.00 45.43  ? 96   THR F O     1 
ATOM   9161  C  CB    . THR G 3  96  ? 87.372  87.635  102.997 1.00 43.22  ? 96   THR F CB    1 
ATOM   9162  O  OG1   . THR G 3  96  ? 88.662  87.825  103.587 1.00 45.56  ? 96   THR F OG1   1 
ATOM   9163  C  CG2   . THR G 3  96  ? 86.730  86.475  103.685 1.00 44.46  ? 96   THR F CG2   1 
ATOM   9164  N  N     . LEU G 3  97  ? 85.649  86.003  100.790 1.00 23.41  ? 97   LEU F N     1 
ATOM   9165  C  CA    . LEU G 3  97  ? 84.336  85.782  100.216 1.00 13.28  ? 97   LEU F CA    1 
ATOM   9166  C  C     . LEU G 3  97  ? 83.480  85.053  101.234 1.00 26.03  ? 97   LEU F C     1 
ATOM   9167  O  O     . LEU G 3  97  ? 83.941  84.090  101.850 1.00 32.56  ? 97   LEU F O     1 
ATOM   9168  C  CB    . LEU G 3  97  ? 84.435  84.984  98.930  1.00 16.99  ? 97   LEU F CB    1 
ATOM   9169  C  CG    . LEU G 3  97  ? 83.098  84.703  98.286  1.00 22.63  ? 97   LEU F CG    1 
ATOM   9170  C  CD1   . LEU G 3  97  ? 82.497  86.007  97.908  1.00 21.60  ? 97   LEU F CD1   1 
ATOM   9171  C  CD2   . LEU G 3  97  ? 83.294  83.859  97.074  1.00 24.27  ? 97   LEU F CD2   1 
ATOM   9172  N  N     . TYR G 3  98  ? 82.248  85.508  101.418 1.00 21.70  ? 98   TYR F N     1 
ATOM   9173  C  CA    . TYR G 3  98  ? 81.333  84.890  102.356 1.00 16.72  ? 98   TYR F CA    1 
ATOM   9174  C  C     . TYR G 3  98  ? 80.175  84.236  101.633 1.00 21.46  ? 98   TYR F C     1 
ATOM   9175  O  O     . TYR G 3  98  ? 79.839  84.576  100.503 1.00 17.04  ? 98   TYR F O     1 
ATOM   9176  C  CB    . TYR G 3  98  ? 80.750  85.883  103.348 1.00 23.18  ? 98   TYR F CB    1 
ATOM   9177  C  CG    . TYR G 3  98  ? 81.703  86.410  104.353 1.00 24.52  ? 98   TYR F CG    1 
ATOM   9178  C  CD1   . TYR G 3  98  ? 82.769  85.669  104.763 1.00 23.58  ? 98   TYR F CD1   1 
ATOM   9179  C  CD2   . TYR G 3  98  ? 81.470  87.606  104.977 1.00 17.96  ? 98   TYR F CD2   1 
ATOM   9180  C  CE1   . TYR G 3  98  ? 83.631  86.146  105.705 1.00 27.11  ? 98   TYR F CE1   1 
ATOM   9181  C  CE2   . TYR G 3  98  ? 82.321  88.083  105.924 1.00 20.02  ? 98   TYR F CE2   1 
ATOM   9182  C  CZ    . TYR G 3  98  ? 83.401  87.356  106.279 1.00 24.49  ? 98   TYR F CZ    1 
ATOM   9183  O  OH    . TYR G 3  98  ? 84.254  87.836  107.233 1.00 22.99  ? 98   TYR F OH    1 
ATOM   9184  N  N     . GLY G 3  99  ? 79.567  83.289  102.312 1.00 26.47  ? 99   GLY F N     1 
ATOM   9185  C  CA    . GLY G 3  99  ? 78.315  82.729  101.904 1.00 22.86  ? 99   GLY F CA    1 
ATOM   9186  C  C     . GLY G 3  99  ? 78.417  81.381  101.240 1.00 34.03  ? 99   GLY F C     1 
ATOM   9187  O  O     . GLY G 3  99  ? 77.444  80.625  101.258 1.00 50.69  ? 99   GLY F O     1 
ATOM   9188  N  N     . PHE G 3  100 ? 79.558  81.047  100.673 1.00 47.13  ? 100  PHE F N     1 
ATOM   9189  C  CA    . PHE G 3  100 ? 79.694  79.762  100.021 1.00 29.50  ? 100  PHE F CA    1 
ATOM   9190  C  C     . PHE G 3  100 ? 80.362  78.727  100.902 1.00 37.06  ? 100  PHE F C     1 
ATOM   9191  O  O     . PHE G 3  100 ? 80.543  77.590  100.466 1.00 54.80  ? 100  PHE F O     1 
ATOM   9192  C  CB    . PHE G 3  100 ? 80.439  79.946  98.715  1.00 45.08  ? 100  PHE F CB    1 
ATOM   9193  C  CG    . PHE G 3  100 ? 79.712  80.827  97.766  1.00 43.03  ? 100  PHE F CG    1 
ATOM   9194  C  CD1   . PHE G 3  100 ? 78.347  80.952  97.851  1.00 55.81  ? 100  PHE F CD1   1 
ATOM   9195  C  CD2   . PHE G 3  100 ? 80.381  81.574  96.830  1.00 37.48  ? 100  PHE F CD2   1 
ATOM   9196  C  CE1   . PHE G 3  100 ? 77.661  81.772  96.993  1.00 56.56  ? 100  PHE F CE1   1 
ATOM   9197  C  CE2   . PHE G 3  100 ? 79.695  82.402  95.977  1.00 36.54  ? 100  PHE F CE2   1 
ATOM   9198  C  CZ    . PHE G 3  100 ? 78.336  82.500  96.058  1.00 38.20  ? 100  PHE F CZ    1 
ATOM   9199  N  N     . GLY G 3  101 ? 80.702  79.082  102.127 1.00 50.26  ? 101  GLY F N     1 
ATOM   9200  C  CA    . GLY G 3  101 ? 81.274  78.169  103.094 1.00 41.74  ? 101  GLY F CA    1 
ATOM   9201  C  C     . GLY G 3  101 ? 82.778  78.323  103.211 1.00 60.49  ? 101  GLY F C     1 
ATOM   9202  O  O     . GLY G 3  101 ? 83.477  78.656  102.249 1.00 63.82  ? 101  GLY F O     1 
ATOM   9203  N  N     . GLY G 3  102 ? 83.288  78.079  104.415 1.00 49.87  ? 102  GLY F N     1 
ATOM   9204  C  CA    . GLY G 3  102 ? 84.721  78.082  104.663 1.00 56.25  ? 102  GLY F CA    1 
ATOM   9205  C  C     . GLY G 3  102 ? 85.284  79.309  105.354 1.00 70.78  ? 102  GLY F C     1 
ATOM   9206  O  O     . GLY G 3  102 ? 86.261  79.224  106.103 1.00 72.80  ? 102  GLY F O     1 
ATOM   9207  O  OXT   . GLY G 3  102 ? 84.781  80.418  105.175 1.00 73.86  ? 102  GLY F OXT   1 
ATOM   9208  N  N     . ALA H 4  12  ? 129.299 53.357  115.565 1.00 108.28 ? 12   ALA G N     1 
ATOM   9209  C  CA    . ALA H 4  12  ? 128.169 54.249  115.343 1.00 113.66 ? 12   ALA G CA    1 
ATOM   9210  C  C     . ALA H 4  12  ? 128.643 55.650  114.978 1.00 116.46 ? 12   ALA G C     1 
ATOM   9211  O  O     . ALA H 4  12  ? 128.574 56.563  115.798 1.00 116.35 ? 12   ALA G O     1 
ATOM   9212  C  CB    . ALA H 4  12  ? 127.278 54.296  116.577 1.00 95.82  ? 12   ALA G CB    1 
ATOM   9213  N  N     . LYS H 4  13  ? 129.120 55.817  113.747 1.00 116.63 ? 13   LYS G N     1 
ATOM   9214  C  CA    . LYS H 4  13  ? 129.603 57.112  113.290 1.00 108.67 ? 13   LYS G CA    1 
ATOM   9215  C  C     . LYS H 4  13  ? 128.438 58.026  112.928 1.00 110.54 ? 13   LYS G C     1 
ATOM   9216  O  O     . LYS H 4  13  ? 127.395 57.579  112.446 1.00 117.38 ? 13   LYS G O     1 
ATOM   9217  C  CB    . LYS H 4  13  ? 130.524 56.950  112.080 1.00 95.03  ? 13   LYS G CB    1 
ATOM   9218  C  CG    . LYS H 4  13  ? 131.062 58.268  111.562 1.00 91.22  ? 13   LYS G CG    1 
ATOM   9219  C  CD    . LYS H 4  13  ? 131.915 58.097  110.331 1.00 87.82  ? 13   LYS G CD    1 
ATOM   9220  C  CE    . LYS H 4  13  ? 132.350 59.454  109.814 1.00 81.44  ? 13   LYS G CE    1 
ATOM   9221  N  NZ    . LYS H 4  13  ? 133.169 59.353  108.582 1.00 69.81  ? 13   LYS G NZ    1 
ATOM   9222  N  N     . ALA H 4  14  ? 128.630 59.321  113.159 1.00 123.27 ? 14   ALA G N     1 
ATOM   9223  C  CA    . ALA H 4  14  ? 127.598 60.319  112.925 1.00 110.59 ? 14   ALA G CA    1 
ATOM   9224  C  C     . ALA H 4  14  ? 127.856 61.062  111.623 1.00 105.78 ? 14   ALA G C     1 
ATOM   9225  O  O     . ALA H 4  14  ? 129.004 61.355  111.280 1.00 99.36  ? 14   ALA G O     1 
ATOM   9226  C  CB    . ALA H 4  14  ? 127.533 61.316  114.081 1.00 99.18  ? 14   ALA G CB    1 
ATOM   9227  N  N     . LYS H 4  15  ? 126.782 61.360  110.902 1.00 114.67 ? 15   LYS G N     1 
ATOM   9228  C  CA    . LYS H 4  15  ? 126.850 62.206  109.723 1.00 117.07 ? 15   LYS G CA    1 
ATOM   9229  C  C     . LYS H 4  15  ? 125.607 63.079  109.692 1.00 111.34 ? 15   LYS G C     1 
ATOM   9230  O  O     . LYS H 4  15  ? 124.499 62.594  109.929 1.00 103.44 ? 15   LYS G O     1 
ATOM   9231  C  CB    . LYS H 4  15  ? 126.961 61.382  108.439 1.00 113.04 ? 15   LYS G CB    1 
ATOM   9232  C  CG    . LYS H 4  15  ? 127.195 62.242  107.220 1.00 120.95 ? 15   LYS G CG    1 
ATOM   9233  C  CD    . LYS H 4  15  ? 127.124 61.472  105.912 1.00 122.26 ? 15   LYS G CD    1 
ATOM   9234  C  CE    . LYS H 4  15  ? 128.303 60.550  105.712 1.00 124.69 ? 15   LYS G CE    1 
ATOM   9235  N  NZ    . LYS H 4  15  ? 128.189 59.862  104.398 1.00 124.65 ? 15   LYS G NZ    1 
ATOM   9236  N  N     . THR H 4  16  ? 125.793 64.362  109.402 1.00 93.34  ? 16   THR G N     1 
ATOM   9237  C  CA    . THR H 4  16  ? 124.721 65.334  109.548 1.00 83.08  ? 16   THR G CA    1 
ATOM   9238  C  C     . THR H 4  16  ? 123.726 65.246  108.401 1.00 91.37  ? 16   THR G C     1 
ATOM   9239  O  O     . THR H 4  16  ? 124.089 64.970  107.256 1.00 92.21  ? 16   THR G O     1 
ATOM   9240  C  CB    . THR H 4  16  ? 125.287 66.744  109.601 1.00 86.73  ? 16   THR G CB    1 
ATOM   9241  O  OG1   . THR H 4  16  ? 126.002 67.003  108.391 1.00 73.75  ? 16   THR G OG1   1 
ATOM   9242  C  CG2   . THR H 4  16  ? 126.230 66.883  110.769 1.00 78.26  ? 16   THR G CG2   1 
ATOM   9243  N  N     . ARG H 4  17  ? 122.455 65.510  108.715 1.00 95.03  ? 17   ARG G N     1 
ATOM   9244  C  CA    . ARG H 4  17  ? 121.434 65.437  107.681 1.00 80.18  ? 17   ARG G CA    1 
ATOM   9245  C  C     . ARG H 4  17  ? 121.637 66.495  106.616 1.00 76.85  ? 17   ARG G C     1 
ATOM   9246  O  O     . ARG H 4  17  ? 121.245 66.295  105.465 1.00 79.27  ? 17   ARG G O     1 
ATOM   9247  C  CB    . ARG H 4  17  ? 120.038 65.548  108.280 1.00 97.64  ? 17   ARG G CB    1 
ATOM   9248  C  CG    . ARG H 4  17  ? 119.609 64.292  108.989 1.00 103.59 ? 17   ARG G CG    1 
ATOM   9249  C  CD    . ARG H 4  17  ? 118.170 64.343  109.473 1.00 108.18 ? 17   ARG G CD    1 
ATOM   9250  N  NE    . ARG H 4  17  ? 117.928 65.284  110.554 1.00 116.48 ? 17   ARG G NE    1 
ATOM   9251  C  CZ    . ARG H 4  17  ? 116.737 65.458  111.110 1.00 114.22 ? 17   ARG G CZ    1 
ATOM   9252  N  NH1   . ARG H 4  17  ? 115.702 64.760  110.676 1.00 112.04 ? 17   ARG G NH1   1 
ATOM   9253  N  NH2   . ARG H 4  17  ? 116.577 66.323  112.095 1.00 114.76 ? 17   ARG G NH2   1 
ATOM   9254  N  N     . SER H 4  18  ? 122.250 67.620  106.964 1.00 60.81  ? 18   SER G N     1 
ATOM   9255  C  CA    . SER H 4  18  ? 122.623 68.573  105.931 1.00 68.28  ? 18   SER G CA    1 
ATOM   9256  C  C     . SER H 4  18  ? 123.582 67.933  104.940 1.00 78.00  ? 18   SER G C     1 
ATOM   9257  O  O     . SER H 4  18  ? 123.394 68.023  103.722 1.00 74.83  ? 18   SER G O     1 
ATOM   9258  C  CB    . SER H 4  18  ? 123.246 69.810  106.564 1.00 66.46  ? 18   SER G CB    1 
ATOM   9259  O  OG    . SER H 4  18  ? 122.303 70.477  107.376 1.00 73.61  ? 18   SER G OG    1 
ATOM   9260  N  N     . SER H 4  19  ? 124.611 67.263  105.451 1.00 80.70  ? 19   SER G N     1 
ATOM   9261  C  CA    . SER H 4  19  ? 125.594 66.621  104.589 1.00 79.13  ? 19   SER G CA    1 
ATOM   9262  C  C     . SER H 4  19  ? 124.938 65.589  103.687 1.00 77.21  ? 19   SER G C     1 
ATOM   9263  O  O     . SER H 4  19  ? 125.089 65.633  102.463 1.00 67.69  ? 19   SER G O     1 
ATOM   9264  C  CB    . SER H 4  19  ? 126.681 65.983  105.443 1.00 60.62  ? 19   SER G CB    1 
ATOM   9265  O  OG    . SER H 4  19  ? 126.113 65.025  106.313 1.00 71.24  ? 19   SER G OG    1 
ATOM   9266  N  N     . ARG H 4  20  ? 124.209 64.642  104.280 1.00 59.12  ? 20   ARG G N     1 
ATOM   9267  C  CA    . ARG H 4  20  ? 123.446 63.695  103.477 1.00 57.07  ? 20   ARG G CA    1 
ATOM   9268  C  C     . ARG H 4  20  ? 122.618 64.412  102.429 1.00 72.49  ? 20   ARG G C     1 
ATOM   9269  O  O     . ARG H 4  20  ? 122.502 63.950  101.291 1.00 84.70  ? 20   ARG G O     1 
ATOM   9270  C  CB    . ARG H 4  20  ? 122.528 62.859  104.361 1.00 71.04  ? 20   ARG G CB    1 
ATOM   9271  C  CG    . ARG H 4  20  ? 123.206 61.870  105.253 1.00 83.42  ? 20   ARG G CG    1 
ATOM   9272  C  CD    . ARG H 4  20  ? 122.154 61.114  106.036 1.00 95.12  ? 20   ARG G CD    1 
ATOM   9273  N  NE    . ARG H 4  20  ? 122.733 60.110  106.917 1.00 108.42 ? 20   ARG G NE    1 
ATOM   9274  C  CZ    . ARG H 4  20  ? 123.030 58.873  106.538 1.00 111.30 ? 20   ARG G CZ    1 
ATOM   9275  N  NH1   . ARG H 4  20  ? 122.793 58.488  105.294 1.00 113.54 ? 20   ARG G NH1   1 
ATOM   9276  N  NH2   . ARG H 4  20  ? 123.557 58.020  107.403 1.00 105.17 ? 20   ARG G NH2   1 
ATOM   9277  N  N     . ALA H 4  21  ? 122.036 65.548  102.790 1.00 68.63  ? 21   ALA G N     1 
ATOM   9278  C  CA    . ALA H 4  21  ? 121.208 66.263  101.834 1.00 67.77  ? 21   ALA G CA    1 
ATOM   9279  C  C     . ALA H 4  21  ? 122.053 66.905  100.748 1.00 65.15  ? 21   ALA G C     1 
ATOM   9280  O  O     . ALA H 4  21  ? 121.684 66.883  99.571  1.00 67.09  ? 21   ALA G O     1 
ATOM   9281  C  CB    . ALA H 4  21  ? 120.373 67.314  102.553 1.00 56.97  ? 21   ALA G CB    1 
ATOM   9282  N  N     . GLY H 4  22  ? 123.203 67.452  101.113 1.00 62.66  ? 22   GLY G N     1 
ATOM   9283  C  CA    . GLY H 4  22  ? 123.924 68.309  100.203 1.00 60.77  ? 22   GLY G CA    1 
ATOM   9284  C  C     . GLY H 4  22  ? 123.473 69.745  100.256 1.00 65.04  ? 22   GLY G C     1 
ATOM   9285  O  O     . GLY H 4  22  ? 123.541 70.444  99.242  1.00 70.36  ? 22   GLY G O     1 
ATOM   9286  N  N     . LEU H 4  23  ? 123.002 70.201  101.407 1.00 76.90  ? 23   LEU G N     1 
ATOM   9287  C  CA    . LEU H 4  23  ? 122.485 71.544  101.577 1.00 71.17  ? 23   LEU G CA    1 
ATOM   9288  C  C     . LEU H 4  23  ? 123.243 72.259  102.680 1.00 75.77  ? 23   LEU G C     1 
ATOM   9289  O  O     . LEU H 4  23  ? 123.854 71.637  103.549 1.00 65.51  ? 23   LEU G O     1 
ATOM   9290  C  CB    . LEU H 4  23  ? 121.013 71.514  101.937 1.00 62.15  ? 23   LEU G CB    1 
ATOM   9291  C  CG    . LEU H 4  23  ? 120.219 70.744  100.911 1.00 58.40  ? 23   LEU G CG    1 
ATOM   9292  C  CD1   . LEU H 4  23  ? 118.768 70.767  101.307 1.00 68.10  ? 23   LEU G CD1   1 
ATOM   9293  C  CD2   . LEU H 4  23  ? 120.450 71.335  99.544  1.00 54.43  ? 23   LEU G CD2   1 
ATOM   9294  N  N     . GLN H 4  24  ? 123.187 73.579  102.648 1.00 66.53  ? 24   GLN G N     1 
ATOM   9295  C  CA    . GLN H 4  24  ? 123.848 74.379  103.656 1.00 64.34  ? 24   GLN G CA    1 
ATOM   9296  C  C     . GLN H 4  24  ? 122.908 74.865  104.748 1.00 59.16  ? 24   GLN G C     1 
ATOM   9297  O  O     . GLN H 4  24  ? 123.363 75.529  105.677 1.00 64.53  ? 24   GLN G O     1 
ATOM   9298  C  CB    . GLN H 4  24  ? 124.530 75.556  102.981 1.00 94.05  ? 24   GLN G CB    1 
ATOM   9299  C  CG    . GLN H 4  24  ? 125.364 75.109  101.812 1.00 88.96  ? 24   GLN G CG    1 
ATOM   9300  C  CD    . GLN H 4  24  ? 126.343 74.028  102.179 1.00 93.37  ? 24   GLN G CD    1 
ATOM   9301  O  OE1   . GLN H 4  24  ? 126.967 74.072  103.234 1.00 99.13  ? 24   GLN G OE1   1 
ATOM   9302  N  NE2   . GLN H 4  24  ? 126.474 73.034  101.314 1.00 91.26  ? 24   GLN G NE2   1 
ATOM   9303  N  N     . PHE H 4  25  ? 121.657 74.599  104.650 1.00 48.67  ? 25   PHE G N     1 
ATOM   9304  C  CA    . PHE H 4  25  ? 120.911 75.016  105.827 1.00 49.70  ? 25   PHE G CA    1 
ATOM   9305  C  C     . PHE H 4  25  ? 120.765 73.897  106.843 1.00 53.47  ? 25   PHE G C     1 
ATOM   9306  O  O     . PHE H 4  25  ? 120.721 72.725  106.480 1.00 47.87  ? 25   PHE G O     1 
ATOM   9307  C  CB    . PHE H 4  25  ? 119.533 75.537  105.458 1.00 32.81  ? 25   PHE G CB    1 
ATOM   9308  C  CG    . PHE H 4  25  ? 119.554 76.940  105.008 1.00 35.60  ? 25   PHE G CG    1 
ATOM   9309  C  CD1   . PHE H 4  25  ? 119.644 77.936  105.935 1.00 36.87  ? 25   PHE G CD1   1 
ATOM   9310  C  CD2   . PHE H 4  25  ? 119.472 77.277  103.691 1.00 33.49  ? 25   PHE G CD2   1 
ATOM   9311  C  CE1   . PHE H 4  25  ? 119.667 79.230  105.565 1.00 43.35  ? 25   PHE G CE1   1 
ATOM   9312  C  CE2   . PHE H 4  25  ? 119.494 78.582  103.323 1.00 30.22  ? 25   PHE G CE2   1 
ATOM   9313  C  CZ    . PHE H 4  25  ? 119.587 79.551  104.264 1.00 40.39  ? 25   PHE G CZ    1 
ATOM   9314  N  N     . PRO H 4  26  ? 120.665 74.224  108.108 1.00 43.17  ? 26   PRO G N     1 
ATOM   9315  C  CA    . PRO H 4  26  ? 120.712 73.192  109.147 1.00 47.29  ? 26   PRO G CA    1 
ATOM   9316  C  C     . PRO H 4  26  ? 119.431 72.396  109.272 1.00 45.95  ? 26   PRO G C     1 
ATOM   9317  O  O     . PRO H 4  26  ? 118.600 72.700  110.127 1.00 54.63  ? 26   PRO G O     1 
ATOM   9318  C  CB    . PRO H 4  26  ? 120.959 74.008  110.409 1.00 47.88  ? 26   PRO G CB    1 
ATOM   9319  C  CG    . PRO H 4  26  ? 120.262 75.289  110.107 1.00 44.20  ? 26   PRO G CG    1 
ATOM   9320  C  CD    . PRO H 4  26  ? 120.563 75.570  108.684 1.00 36.75  ? 26   PRO G CD    1 
ATOM   9321  N  N     . VAL H 4  27  ? 119.278 71.364  108.448 1.00 41.83  ? 27   VAL G N     1 
ATOM   9322  C  CA    . VAL H 4  27  ? 118.015 70.641  108.380 1.00 39.19  ? 27   VAL G CA    1 
ATOM   9323  C  C     . VAL H 4  27  ? 117.504 70.314  109.764 1.00 46.11  ? 27   VAL G C     1 
ATOM   9324  O  O     . VAL H 4  27  ? 116.315 70.468  110.056 1.00 58.61  ? 27   VAL G O     1 
ATOM   9325  C  CB    . VAL H 4  27  ? 118.181 69.375  107.535 1.00 54.23  ? 27   VAL G CB    1 
ATOM   9326  C  CG1   . VAL H 4  27  ? 116.917 68.572  107.562 1.00 53.58  ? 27   VAL G CG1   1 
ATOM   9327  C  CG2   . VAL H 4  27  ? 118.536 69.768  106.141 1.00 55.28  ? 27   VAL G CG2   1 
ATOM   9328  N  N     . GLY H 4  28  ? 118.393 69.901  110.652 1.00 54.61  ? 28   GLY G N     1 
ATOM   9329  C  CA    . GLY H 4  28  ? 117.967 69.626  112.009 1.00 61.82  ? 28   GLY G CA    1 
ATOM   9330  C  C     . GLY H 4  28  ? 117.221 70.789  112.620 1.00 57.59  ? 28   GLY G C     1 
ATOM   9331  O  O     . GLY H 4  28  ? 116.119 70.630  113.150 1.00 41.13  ? 28   GLY G O     1 
ATOM   9332  N  N     . ARG H 4  29  ? 117.795 71.983  112.519 1.00 46.67  ? 29   ARG G N     1 
ATOM   9333  C  CA    . ARG H 4  29  ? 117.169 73.144  113.129 1.00 44.46  ? 29   ARG G CA    1 
ATOM   9334  C  C     . ARG H 4  29  ? 115.796 73.401  112.539 1.00 42.46  ? 29   ARG G C     1 
ATOM   9335  O  O     . ARG H 4  29  ? 114.836 73.662  113.273 1.00 32.98  ? 29   ARG G O     1 
ATOM   9336  C  CB    . ARG H 4  29  ? 118.055 74.366  112.967 1.00 50.47  ? 29   ARG G CB    1 
ATOM   9337  C  CG    . ARG H 4  29  ? 117.434 75.592  113.553 1.00 49.59  ? 29   ARG G CG    1 
ATOM   9338  C  CD    . ARG H 4  29  ? 118.380 76.753  113.511 1.00 40.54  ? 29   ARG G CD    1 
ATOM   9339  N  NE    . ARG H 4  29  ? 119.522 76.471  114.360 1.00 45.16  ? 29   ARG G NE    1 
ATOM   9340  C  CZ    . ARG H 4  29  ? 120.554 77.282  114.523 1.00 52.03  ? 29   ARG G CZ    1 
ATOM   9341  N  NH1   . ARG H 4  29  ? 120.587 78.453  113.908 1.00 43.88  ? 29   ARG G NH1   1 
ATOM   9342  N  NH2   . ARG H 4  29  ? 121.545 76.923  115.317 1.00 58.37  ? 29   ARG G NH2   1 
ATOM   9343  N  N     . VAL H 4  30  ? 115.676 73.332  111.218 1.00 33.39  ? 30   VAL G N     1 
ATOM   9344  C  CA    . VAL H 4  30  ? 114.360 73.445  110.607 1.00 23.12  ? 30   VAL G CA    1 
ATOM   9345  C  C     . VAL H 4  30  ? 113.401 72.461  111.248 1.00 22.86  ? 30   VAL G C     1 
ATOM   9346  O  O     . VAL H 4  30  ? 112.354 72.844  111.774 1.00 38.24  ? 30   VAL G O     1 
ATOM   9347  C  CB    . VAL H 4  30  ? 114.446 73.234  109.095 1.00 21.26  ? 30   VAL G CB    1 
ATOM   9348  C  CG1   . VAL H 4  30  ? 113.091 72.986  108.563 1.00 21.24  ? 30   VAL G CG1   1 
ATOM   9349  C  CG2   . VAL H 4  30  ? 114.995 74.465  108.471 1.00 24.07  ? 30   VAL G CG2   1 
ATOM   9350  N  N     . HIS H 4  31  ? 113.765 71.184  111.260 1.00 27.49  ? 31   HIS G N     1 
ATOM   9351  C  CA    . HIS H 4  31  ? 112.864 70.188  111.819 1.00 35.61  ? 31   HIS G CA    1 
ATOM   9352  C  C     . HIS H 4  31  ? 112.423 70.572  113.218 1.00 41.64  ? 31   HIS G C     1 
ATOM   9353  O  O     . HIS H 4  31  ? 111.245 70.441  113.567 1.00 49.05  ? 31   HIS G O     1 
ATOM   9354  C  CB    . HIS H 4  31  ? 113.530 68.827  111.843 1.00 28.41  ? 31   HIS G CB    1 
ATOM   9355  C  CG    . HIS H 4  31  ? 112.646 67.743  112.357 1.00 42.73  ? 31   HIS G CG    1 
ATOM   9356  N  ND1   . HIS H 4  31  ? 111.503 67.347  111.704 1.00 53.54  ? 31   HIS G ND1   1 
ATOM   9357  C  CD2   . HIS H 4  31  ? 112.728 66.980  113.470 1.00 46.74  ? 31   HIS G CD2   1 
ATOM   9358  C  CE1   . HIS H 4  31  ? 110.923 66.379  112.389 1.00 54.55  ? 31   HIS G CE1   1 
ATOM   9359  N  NE2   . HIS H 4  31  ? 111.645 66.139  113.466 1.00 48.94  ? 31   HIS G NE2   1 
ATOM   9360  N  N     . ARG H 4  32  ? 113.345 71.081  114.027 1.00 36.01  ? 32   ARG G N     1 
ATOM   9361  C  CA    . ARG H 4  32  ? 112.953 71.535  115.353 1.00 35.58  ? 32   ARG G CA    1 
ATOM   9362  C  C     . ARG H 4  32  ? 111.896 72.618  115.264 1.00 36.72  ? 32   ARG G C     1 
ATOM   9363  O  O     . ARG H 4  32  ? 110.883 72.567  115.966 1.00 42.02  ? 32   ARG G O     1 
ATOM   9364  C  CB    . ARG H 4  32  ? 114.165 72.029  116.127 1.00 50.36  ? 32   ARG G CB    1 
ATOM   9365  C  CG    . ARG H 4  32  ? 113.837 72.562  117.493 1.00 45.88  ? 32   ARG G CG    1 
ATOM   9366  C  CD    . ARG H 4  32  ? 115.110 72.789  118.269 1.00 63.13  ? 32   ARG G CD    1 
ATOM   9367  N  NE    . ARG H 4  32  ? 115.956 73.804  117.664 1.00 70.38  ? 32   ARG G NE    1 
ATOM   9368  C  CZ    . ARG H 4  32  ? 115.887 75.096  117.947 1.00 77.50  ? 32   ARG G CZ    1 
ATOM   9369  N  NH1   . ARG H 4  32  ? 115.027 75.531  118.849 1.00 88.54  ? 32   ARG G NH1   1 
ATOM   9370  N  NH2   . ARG H 4  32  ? 116.695 75.948  117.344 1.00 74.41  ? 32   ARG G NH2   1 
ATOM   9371  N  N     . LEU H 4  33  ? 112.095 73.597  114.385 1.00 28.06  ? 33   LEU G N     1 
ATOM   9372  C  CA    . LEU H 4  33  ? 111.115 74.670  114.291 1.00 23.16  ? 33   LEU G CA    1 
ATOM   9373  C  C     . LEU H 4  33  ? 109.758 74.142  113.860 1.00 34.58  ? 33   LEU G C     1 
ATOM   9374  O  O     . LEU H 4  33  ? 108.738 74.468  114.472 1.00 38.17  ? 33   LEU G O     1 
ATOM   9375  C  CB    . LEU H 4  33  ? 111.595 75.752  113.342 1.00 49.12  ? 33   LEU G CB    1 
ATOM   9376  C  CG    . LEU H 4  33  ? 112.789 76.460  113.940 1.00 11.31  ? 33   LEU G CG    1 
ATOM   9377  C  CD1   . LEU H 4  33  ? 113.274 77.536  113.008 1.00 13.03  ? 33   LEU G CD1   1 
ATOM   9378  C  CD2   . LEU H 4  33  ? 112.389 77.030  115.267 1.00 54.55  ? 33   LEU G CD2   1 
ATOM   9379  N  N     . LEU H 4  34  ? 109.718 73.314  112.820 1.00 24.28  ? 34   LEU G N     1 
ATOM   9380  C  CA    . LEU H 4  34  ? 108.433 72.788  112.388 1.00 27.18  ? 34   LEU G CA    1 
ATOM   9381  C  C     . LEU H 4  34  ? 107.734 72.043  113.511 1.00 32.78  ? 34   LEU G C     1 
ATOM   9382  O  O     . LEU H 4  34  ? 106.516 72.154  113.665 1.00 30.42  ? 34   LEU G O     1 
ATOM   9383  C  CB    . LEU H 4  34  ? 108.593 71.884  111.178 1.00 24.26  ? 34   LEU G CB    1 
ATOM   9384  C  CG    . LEU H 4  34  ? 109.036 72.637  109.946 1.00 22.79  ? 34   LEU G CG    1 
ATOM   9385  C  CD1   . LEU H 4  34  ? 109.134 71.706  108.788 1.00 13.38  ? 34   LEU G CD1   1 
ATOM   9386  C  CD2   . LEU H 4  34  ? 108.048 73.697  109.676 1.00 22.06  ? 34   LEU G CD2   1 
ATOM   9387  N  N     . ARG H 4  35  ? 108.470 71.280  114.318 1.00 37.58  ? 35   ARG G N     1 
ATOM   9388  C  CA    . ARG H 4  35  ? 107.791 70.603  115.415 1.00 38.76  ? 35   ARG G CA    1 
ATOM   9389  C  C     . ARG H 4  35  ? 107.262 71.605  116.428 1.00 40.73  ? 35   ARG G C     1 
ATOM   9390  O  O     . ARG H 4  35  ? 106.062 71.648  116.709 1.00 38.43  ? 35   ARG G O     1 
ATOM   9391  C  CB    . ARG H 4  35  ? 108.703 69.593  116.105 1.00 33.53  ? 35   ARG G CB    1 
ATOM   9392  C  CG    . ARG H 4  35  ? 108.979 68.356  115.304 1.00 41.63  ? 35   ARG G CG    1 
ATOM   9393  C  CD    . ARG H 4  35  ? 109.804 67.384  116.105 1.00 55.12  ? 35   ARG G CD    1 
ATOM   9394  N  NE    . ARG H 4  35  ? 111.093 67.939  116.489 1.00 71.77  ? 35   ARG G NE    1 
ATOM   9395  C  CZ    . ARG H 4  35  ? 111.995 67.284  117.211 1.00 83.17  ? 35   ARG G CZ    1 
ATOM   9396  N  NH1   . ARG H 4  35  ? 111.740 66.051  117.620 1.00 84.19  ? 35   ARG G NH1   1 
ATOM   9397  N  NH2   . ARG H 4  35  ? 113.151 67.855  117.523 1.00 84.39  ? 35   ARG G NH2   1 
ATOM   9398  N  N     . LYS H 4  36  ? 108.132 72.439  116.965 1.00 25.68  ? 36   LYS G N     1 
ATOM   9399  C  CA    . LYS H 4  36  ? 107.787 73.191  118.156 1.00 30.12  ? 36   LYS G CA    1 
ATOM   9400  C  C     . LYS H 4  36  ? 107.130 74.519  117.849 1.00 24.49  ? 36   LYS G C     1 
ATOM   9401  O  O     . LYS H 4  36  ? 106.947 75.326  118.757 1.00 28.72  ? 36   LYS G O     1 
ATOM   9402  C  CB    . LYS H 4  36  ? 109.023 73.385  119.024 1.00 52.64  ? 36   LYS G CB    1 
ATOM   9403  C  CG    . LYS H 4  36  ? 109.505 72.021  119.441 1.00 56.64  ? 36   LYS G CG    1 
ATOM   9404  C  CD    . LYS H 4  36  ? 110.652 72.023  120.393 1.00 69.57  ? 36   LYS G CD    1 
ATOM   9405  C  CE    . LYS H 4  36  ? 111.048 70.585  120.642 1.00 75.14  ? 36   LYS G CE    1 
ATOM   9406  N  NZ    . LYS H 4  36  ? 109.880 69.815  121.141 1.00 78.75  ? 36   LYS G NZ    1 
ATOM   9407  N  N     . GLY H 4  37  ? 106.801 74.780  116.599 1.00 32.01  ? 37   GLY G N     1 
ATOM   9408  C  CA    . GLY H 4  37  ? 105.996 75.940  116.310 1.00 38.18  ? 37   GLY G CA    1 
ATOM   9409  C  C     . GLY H 4  37  ? 104.511 75.681  116.279 1.00 37.49  ? 37   GLY G C     1 
ATOM   9410  O  O     . GLY H 4  37  ? 103.730 76.620  116.108 1.00 34.37  ? 37   GLY G O     1 
ATOM   9411  N  N     . ASN H 4  38  ? 104.092 74.430  116.454 1.00 33.37  ? 38   ASN G N     1 
ATOM   9412  C  CA    . ASN H 4  38  ? 102.692 74.034  116.329 1.00 35.42  ? 38   ASN G CA    1 
ATOM   9413  C  C     . ASN H 4  38  ? 102.123 74.402  114.964 1.00 34.24  ? 38   ASN G C     1 
ATOM   9414  O  O     . ASN H 4  38  ? 101.137 75.122  114.838 1.00 43.33  ? 38   ASN G O     1 
ATOM   9415  C  CB    . ASN H 4  38  ? 101.846 74.614  117.454 1.00 42.65  ? 38   ASN G CB    1 
ATOM   9416  C  CG    . ASN H 4  38  ? 102.088 73.912  118.749 1.00 55.29  ? 38   ASN G CG    1 
ATOM   9417  O  OD1   . ASN H 4  38  ? 102.297 74.538  119.782 1.00 67.30  ? 38   ASN G OD1   1 
ATOM   9418  N  ND2   . ASN H 4  38  ? 102.067 72.588  118.706 1.00 48.20  ? 38   ASN G ND2   1 
ATOM   9419  N  N     . TYR H 4  39  ? 102.785 73.898  113.933 1.00 27.77  ? 39   TYR G N     1 
ATOM   9420  C  CA    . TYR H 4  39  ? 102.219 73.966  112.599 1.00 29.15  ? 39   TYR G CA    1 
ATOM   9421  C  C     . TYR H 4  39  ? 101.271 72.807  112.359 1.00 37.65  ? 39   TYR G C     1 
ATOM   9422  O  O     . TYR H 4  39  ? 100.092 73.013  112.073 1.00 39.33  ? 39   TYR G O     1 
ATOM   9423  C  CB    . TYR H 4  39  ? 103.331 74.031  111.572 1.00 21.87  ? 39   TYR G CB    1 
ATOM   9424  C  CG    . TYR H 4  39  ? 104.045 75.336  111.705 1.00 20.75  ? 39   TYR G CG    1 
ATOM   9425  C  CD1   . TYR H 4  39  ? 103.345 76.482  111.982 1.00 28.72  ? 39   TYR G CD1   1 
ATOM   9426  C  CD2   . TYR H 4  39  ? 105.404 75.427  111.581 1.00 20.46  ? 39   TYR G CD2   1 
ATOM   9427  C  CE1   . TYR H 4  39  ? 103.972 77.678  112.116 1.00 32.15  ? 39   TYR G CE1   1 
ATOM   9428  C  CE2   . TYR H 4  39  ? 106.040 76.622  111.719 1.00 27.56  ? 39   TYR G CE2   1 
ATOM   9429  C  CZ    . TYR H 4  39  ? 105.318 77.744  111.987 1.00 34.74  ? 39   TYR G CZ    1 
ATOM   9430  O  OH    . TYR H 4  39  ? 105.951 78.949  112.127 1.00 40.15  ? 39   TYR G OH    1 
ATOM   9431  N  N     . ALA H 4  40  ? 101.756 71.584  112.449 1.00 38.35  ? 40   ALA G N     1 
ATOM   9432  C  CA    . ALA H 4  40  ? 100.845 70.456  112.512 1.00 34.74  ? 40   ALA G CA    1 
ATOM   9433  C  C     . ALA H 4  40  ? 101.258 69.564  113.668 1.00 39.94  ? 40   ALA G C     1 
ATOM   9434  O  O     . ALA H 4  40  ? 102.261 69.809  114.337 1.00 43.07  ? 40   ALA G O     1 
ATOM   9435  C  CB    . ALA H 4  40  ? 100.819 69.676  111.198 1.00 47.41  ? 40   ALA G CB    1 
ATOM   9436  N  N     . GLU H 4  41  ? 100.484 68.512  113.909 1.00 40.78  ? 41   GLU G N     1 
ATOM   9437  C  CA    . GLU H 4  41  ? 100.836 67.635  115.013 1.00 39.92  ? 41   GLU G CA    1 
ATOM   9438  C  C     . GLU H 4  41  ? 102.067 66.812  114.689 1.00 39.67  ? 41   GLU G C     1 
ATOM   9439  O  O     . GLU H 4  41  ? 102.925 66.610  115.552 1.00 55.29  ? 41   GLU G O     1 
ATOM   9440  C  CB    . GLU H 4  41  ? 99.680  66.713  115.367 1.00 54.40  ? 41   GLU G CB    1 
ATOM   9441  C  CG    . GLU H 4  41  ? 100.038 65.770  116.502 1.00 70.67  ? 41   GLU G CG    1 
ATOM   9442  C  CD    . GLU H 4  41  ? 98.910  64.842  116.896 1.00 81.62  ? 41   GLU G CD    1 
ATOM   9443  O  OE1   . GLU H 4  41  ? 97.824  64.930  116.291 1.00 85.31  ? 41   GLU G OE1   1 
ATOM   9444  O  OE2   . GLU H 4  41  ? 99.118  64.011  117.805 1.00 83.66  ? 41   GLU G OE2   1 
ATOM   9445  N  N     . ARG H 4  42  ? 102.180 66.334  113.458 1.00 50.27  ? 42   ARG G N     1 
ATOM   9446  C  CA    . ARG H 4  42  ? 103.195 65.355  113.102 1.00 49.07  ? 42   ARG G CA    1 
ATOM   9447  C  C     . ARG H 4  42  ? 103.910 65.796  111.842 1.00 48.13  ? 42   ARG G C     1 
ATOM   9448  O  O     . ARG H 4  42  ? 103.296 65.872  110.779 1.00 46.51  ? 42   ARG G O     1 
ATOM   9449  C  CB    . ARG H 4  42  ? 102.556 63.992  112.894 1.00 62.13  ? 42   ARG G CB    1 
ATOM   9450  C  CG    . ARG H 4  42  ? 101.953 63.447  114.143 1.00 69.76  ? 42   ARG G CG    1 
ATOM   9451  C  CD    . ARG H 4  42  ? 101.279 62.160  113.845 1.00 80.62  ? 42   ARG G CD    1 
ATOM   9452  N  NE    . ARG H 4  42  ? 102.226 61.263  113.215 1.00 87.40  ? 42   ARG G NE    1 
ATOM   9453  C  CZ    . ARG H 4  42  ? 101.917 60.057  112.773 1.00 96.62  ? 42   ARG G CZ    1 
ATOM   9454  N  NH1   . ARG H 4  42  ? 100.688 59.601  112.917 1.00 91.01  ? 42   ARG G NH1   1 
ATOM   9455  N  NH2   . ARG H 4  42  ? 102.837 59.306  112.197 1.00 103.75 ? 42   ARG G NH2   1 
ATOM   9456  N  N     . VAL H 4  43  ? 105.199 66.054  111.949 1.00 27.23  ? 43   VAL G N     1 
ATOM   9457  C  CA    . VAL H 4  43  ? 105.968 66.579  110.833 1.00 24.38  ? 43   VAL G CA    1 
ATOM   9458  C  C     . VAL H 4  43  ? 106.598 65.428  110.078 1.00 28.43  ? 43   VAL G C     1 
ATOM   9459  O  O     . VAL H 4  43  ? 107.272 64.586  110.672 1.00 34.12  ? 43   VAL G O     1 
ATOM   9460  C  CB    . VAL H 4  43  ? 107.045 67.545  111.323 1.00 25.50  ? 43   VAL G CB    1 
ATOM   9461  C  CG1   . VAL H 4  43  ? 107.855 68.001  110.164 1.00 27.64  ? 43   VAL G CG1   1 
ATOM   9462  C  CG2   . VAL H 4  43  ? 106.411 68.701  112.028 1.00 15.61  ? 43   VAL G CG2   1 
ATOM   9463  N  N     . GLY H 4  44  ? 106.401 65.399  108.772 1.00 36.35  ? 44   GLY G N     1 
ATOM   9464  C  CA    . GLY H 4  44  ? 106.988 64.356  107.960 1.00 39.12  ? 44   GLY G CA    1 
ATOM   9465  C  C     . GLY H 4  44  ? 108.496 64.380  108.031 1.00 33.83  ? 44   GLY G C     1 
ATOM   9466  O  O     . GLY H 4  44  ? 109.116 65.330  108.495 1.00 25.40  ? 44   GLY G O     1 
ATOM   9467  N  N     . ALA H 4  45  ? 109.100 63.290  107.577 1.00 33.67  ? 45   ALA G N     1 
ATOM   9468  C  CA    . ALA H 4  45  ? 110.550 63.194  107.629 1.00 40.79  ? 45   ALA G CA    1 
ATOM   9469  C  C     . ALA H 4  45  ? 111.233 63.867  106.456 1.00 45.20  ? 45   ALA G C     1 
ATOM   9470  O  O     . ALA H 4  45  ? 112.425 64.164  106.546 1.00 40.85  ? 45   ALA G O     1 
ATOM   9471  C  CB    . ALA H 4  45  ? 110.984 61.736  107.689 1.00 50.07  ? 45   ALA G CB    1 
ATOM   9472  N  N     . GLY H 4  46  ? 110.529 64.092  105.357 1.00 56.22  ? 46   GLY G N     1 
ATOM   9473  C  CA    . GLY H 4  46  ? 111.156 64.726  104.221 1.00 46.99  ? 46   GLY G CA    1 
ATOM   9474  C  C     . GLY H 4  46  ? 111.010 66.229  104.255 1.00 51.50  ? 46   GLY G C     1 
ATOM   9475  O  O     . GLY H 4  46  ? 111.821 66.966  103.679 1.00 46.90  ? 46   GLY G O     1 
ATOM   9476  N  N     . ALA H 4  47  ? 109.978 66.693  104.949 1.00 44.02  ? 47   ALA G N     1 
ATOM   9477  C  CA    . ALA H 4  47  ? 109.665 68.117  104.959 1.00 33.20  ? 47   ALA G CA    1 
ATOM   9478  C  C     . ALA H 4  47  ? 110.838 68.986  105.357 1.00 39.44  ? 47   ALA G C     1 
ATOM   9479  O  O     . ALA H 4  47  ? 111.124 69.954  104.638 1.00 41.26  ? 47   ALA G O     1 
ATOM   9480  C  CB    . ALA H 4  47  ? 108.474 68.388  105.880 1.00 22.86  ? 47   ALA G CB    1 
ATOM   9481  N  N     . PRO H 4  48  ? 111.550 68.725  106.444 1.00 29.40  ? 48   PRO G N     1 
ATOM   9482  C  CA    . PRO H 4  48  ? 112.678 69.596  106.760 1.00 27.45  ? 48   PRO G CA    1 
ATOM   9483  C  C     . PRO H 4  48  ? 113.645 69.690  105.605 1.00 36.23  ? 48   PRO G C     1 
ATOM   9484  O  O     . PRO H 4  48  ? 114.010 70.796  105.195 1.00 34.88  ? 48   PRO G O     1 
ATOM   9485  C  CB    . PRO H 4  48  ? 113.297 68.918  107.980 1.00 21.62  ? 48   PRO G CB    1 
ATOM   9486  C  CG    . PRO H 4  48  ? 112.211 68.176  108.575 1.00 27.31  ? 48   PRO G CG    1 
ATOM   9487  C  CD    . PRO H 4  48  ? 111.438 67.644  107.425 1.00 23.46  ? 48   PRO G CD    1 
ATOM   9488  N  N     . VAL H 4  49  ? 114.014 68.553  105.022 1.00 37.54  ? 49   VAL G N     1 
ATOM   9489  C  CA    . VAL H 4  49  ? 114.951 68.561  103.908 1.00 33.68  ? 49   VAL G CA    1 
ATOM   9490  C  C     . VAL H 4  49  ? 114.446 69.465  102.805 1.00 30.80  ? 49   VAL G C     1 
ATOM   9491  O  O     . VAL H 4  49  ? 115.118 70.415  102.390 1.00 33.29  ? 49   VAL G O     1 
ATOM   9492  C  CB    . VAL H 4  49  ? 115.168 67.142  103.379 1.00 36.53  ? 49   VAL G CB    1 
ATOM   9493  C  CG1   . VAL H 4  49  ? 115.956 67.216  102.117 1.00 25.62  ? 49   VAL G CG1   1 
ATOM   9494  C  CG2   . VAL H 4  49  ? 115.883 66.317  104.406 1.00 35.16  ? 49   VAL G CG2   1 
ATOM   9495  N  N     . TYR H 4  50  ? 113.242 69.190  102.329 1.00 32.27  ? 50   TYR G N     1 
ATOM   9496  C  CA    . TYR H 4  50  ? 112.724 69.925  101.187 1.00 31.41  ? 50   TYR G CA    1 
ATOM   9497  C  C     . TYR H 4  50  ? 112.708 71.417  101.467 1.00 35.64  ? 50   TYR G C     1 
ATOM   9498  O  O     . TYR H 4  50  ? 113.229 72.226  100.687 1.00 37.38  ? 50   TYR G O     1 
ATOM   9499  C  CB    . TYR H 4  50  ? 111.325 69.443  100.892 1.00 37.55  ? 50   TYR G CB    1 
ATOM   9500  C  CG    . TYR H 4  50  ? 110.783 69.902  99.600  1.00 34.78  ? 50   TYR G CG    1 
ATOM   9501  C  CD1   . TYR H 4  50  ? 110.987 69.164  98.472  1.00 28.48  ? 50   TYR G CD1   1 
ATOM   9502  C  CD2   . TYR H 4  50  ? 110.092 71.072  99.497  1.00 35.36  ? 50   TYR G CD2   1 
ATOM   9503  C  CE1   . TYR H 4  50  ? 110.488 69.548  97.291  1.00 37.44  ? 50   TYR G CE1   1 
ATOM   9504  C  CE2   . TYR H 4  50  ? 109.593 71.474  98.312  1.00 38.97  ? 50   TYR G CE2   1 
ATOM   9505  C  CZ    . TYR H 4  50  ? 109.798 70.708  97.204  1.00 41.07  ? 50   TYR G CZ    1 
ATOM   9506  O  OH    . TYR H 4  50  ? 109.303 71.093  95.986  1.00 44.61  ? 50   TYR G OH    1 
ATOM   9507  N  N     . LEU H 4  51  ? 112.121 71.797  102.594 1.00 30.92  ? 51   LEU G N     1 
ATOM   9508  C  CA    . LEU H 4  51  ? 112.029 73.206  102.931 1.00 31.30  ? 51   LEU G CA    1 
ATOM   9509  C  C     . LEU H 4  51  ? 113.405 73.849  102.940 1.00 40.32  ? 51   LEU G C     1 
ATOM   9510  O  O     . LEU H 4  51  ? 113.637 74.859  102.261 1.00 40.32  ? 51   LEU G O     1 
ATOM   9511  C  CB    . LEU H 4  51  ? 111.352 73.360  104.279 1.00 21.29  ? 51   LEU G CB    1 
ATOM   9512  C  CG    . LEU H 4  51  ? 111.200 74.788  104.717 1.00 16.11  ? 51   LEU G CG    1 
ATOM   9513  C  CD1   . LEU H 4  51  ? 110.379 75.455  103.703 1.00 11.81  ? 51   LEU G CD1   1 
ATOM   9514  C  CD2   . LEU H 4  51  ? 110.469 74.762  105.986 1.00 17.40  ? 51   LEU G CD2   1 
ATOM   9515  N  N     . ALA H 4  52  ? 114.339 73.259  103.684 1.00 29.29  ? 52   ALA G N     1 
ATOM   9516  C  CA    . ALA H 4  52  ? 115.683 73.811  103.738 1.00 28.62  ? 52   ALA G CA    1 
ATOM   9517  C  C     . ALA H 4  52  ? 116.237 74.027  102.349 1.00 38.47  ? 52   ALA G C     1 
ATOM   9518  O  O     . ALA H 4  52  ? 116.830 75.072  102.068 1.00 33.35  ? 52   ALA G O     1 
ATOM   9519  C  CB    . ALA H 4  52  ? 116.601 72.895  104.530 1.00 34.81  ? 52   ALA G CB    1 
ATOM   9520  N  N     . ALA H 4  53  ? 116.035 73.065  101.455 1.00 34.72  ? 53   ALA G N     1 
ATOM   9521  C  CA    . ALA H 4  53  ? 116.471 73.274  100.084 1.00 29.63  ? 53   ALA G CA    1 
ATOM   9522  C  C     . ALA H 4  53  ? 115.886 74.556  99.529  1.00 32.81  ? 53   ALA G C     1 
ATOM   9523  O  O     . ALA H 4  53  ? 116.607 75.389  98.968  1.00 33.83  ? 53   ALA G O     1 
ATOM   9524  C  CB    . ALA H 4  53  ? 116.077 72.093  99.209  1.00 36.48  ? 53   ALA G CB    1 
ATOM   9525  N  N     . VAL H 4  54  ? 114.581 74.752  99.700  1.00 35.92  ? 54   VAL G N     1 
ATOM   9526  C  CA    . VAL H 4  54  ? 113.968 75.956  99.150  1.00 31.08  ? 54   VAL G CA    1 
ATOM   9527  C  C     . VAL H 4  54  ? 114.652 77.199  99.692  1.00 28.25  ? 54   VAL G C     1 
ATOM   9528  O  O     . VAL H 4  54  ? 115.152 78.037  98.930  1.00 32.49  ? 54   VAL G O     1 
ATOM   9529  C  CB    . VAL H 4  54  ? 112.466 75.987  99.438  1.00 29.37  ? 54   VAL G CB    1 
ATOM   9530  C  CG1   . VAL H 4  54  ? 111.935 77.318  99.058  1.00 25.10  ? 54   VAL G CG1   1 
ATOM   9531  C  CG2   . VAL H 4  54  ? 111.797 74.952  98.623  1.00 21.66  ? 54   VAL G CG2   1 
ATOM   9532  N  N     . LEU H 4  55  ? 114.686 77.337  101.019 1.00 23.10  ? 55   LEU G N     1 
ATOM   9533  C  CA    . LEU H 4  55  ? 115.295 78.524  101.605 1.00 34.01  ? 55   LEU G CA    1 
ATOM   9534  C  C     . LEU H 4  55  ? 116.681 78.761  101.043 1.00 43.09  ? 55   LEU G C     1 
ATOM   9535  O  O     . LEU H 4  55  ? 117.028 79.891  100.672 1.00 35.06  ? 55   LEU G O     1 
ATOM   9536  C  CB    . LEU H 4  55  ? 115.358 78.389  103.113 1.00 19.36  ? 55   LEU G CB    1 
ATOM   9537  C  CG    . LEU H 4  55  ? 113.969 78.331  103.699 1.00 24.27  ? 55   LEU G CG    1 
ATOM   9538  C  CD1   . LEU H 4  55  ? 114.043 78.082  105.168 1.00 24.63  ? 55   LEU G CD1   1 
ATOM   9539  C  CD2   . LEU H 4  55  ? 113.307 79.632  103.424 1.00 8.04   ? 55   LEU G CD2   1 
ATOM   9540  N  N     . GLU H 4  56  ? 117.478 77.701  100.941 1.00 33.87  ? 56   GLU G N     1 
ATOM   9541  C  CA    . GLU H 4  56  ? 118.780 77.847  100.318 1.00 19.76  ? 56   GLU G CA    1 
ATOM   9542  C  C     . GLU H 4  56  ? 118.648 78.493  98.963  1.00 27.13  ? 56   GLU G C     1 
ATOM   9543  O  O     . GLU H 4  56  ? 119.342 79.459  98.653  1.00 25.37  ? 56   GLU G O     1 
ATOM   9544  C  CB    . GLU H 4  56  ? 119.475 76.510  100.171 1.00 32.65  ? 56   GLU G CB    1 
ATOM   9545  C  CG    . GLU H 4  56  ? 120.839 76.683  99.579  1.00 37.28  ? 56   GLU G CG    1 
ATOM   9546  C  CD    . GLU H 4  56  ? 121.552 75.384  99.416  1.00 61.99  ? 56   GLU G CD    1 
ATOM   9547  O  OE1   . GLU H 4  56  ? 120.953 74.352  99.756  1.00 73.23  ? 56   GLU G OE1   1 
ATOM   9548  O  OE2   . GLU H 4  56  ? 122.706 75.382  98.941  1.00 63.25  ? 56   GLU G OE2   1 
ATOM   9549  N  N     . TYR H 4  57  ? 117.742 77.988  98.143  1.00 36.11  ? 57   TYR G N     1 
ATOM   9550  C  CA    . TYR H 4  57  ? 117.630 78.529  96.803  1.00 29.19  ? 57   TYR G CA    1 
ATOM   9551  C  C     . TYR H 4  57  ? 117.329 80.016  96.830  1.00 37.57  ? 57   TYR G C     1 
ATOM   9552  O  O     . TYR H 4  57  ? 118.019 80.808  96.180  1.00 35.94  ? 57   TYR G O     1 
ATOM   9553  C  CB    . TYR H 4  57  ? 116.564 77.794  96.023  1.00 33.91  ? 57   TYR G CB    1 
ATOM   9554  C  CG    . TYR H 4  57  ? 116.378 78.430  94.700  1.00 45.57  ? 57   TYR G CG    1 
ATOM   9555  C  CD1   . TYR H 4  57  ? 117.274 78.203  93.689  1.00 44.62  ? 57   TYR G CD1   1 
ATOM   9556  C  CD2   . TYR H 4  57  ? 115.329 79.288  94.466  1.00 54.63  ? 57   TYR G CD2   1 
ATOM   9557  C  CE1   . TYR H 4  57  ? 117.119 78.788  92.476  1.00 47.71  ? 57   TYR G CE1   1 
ATOM   9558  C  CE2   . TYR H 4  57  ? 115.167 79.877  93.256  1.00 52.53  ? 57   TYR G CE2   1 
ATOM   9559  C  CZ    . TYR H 4  57  ? 116.065 79.627  92.260  1.00 56.78  ? 57   TYR G CZ    1 
ATOM   9560  O  OH    . TYR H 4  57  ? 115.911 80.216  91.033  1.00 67.77  ? 57   TYR G OH    1 
ATOM   9561  N  N     . LEU H 4  58  ? 116.300 80.422  97.570  1.00 36.72  ? 58   LEU G N     1 
ATOM   9562  C  CA    . LEU H 4  58  ? 115.950 81.838  97.573  1.00 34.60  ? 58   LEU G CA    1 
ATOM   9563  C  C     . LEU H 4  58  ? 117.115 82.699  98.037  1.00 41.96  ? 58   LEU G C     1 
ATOM   9564  O  O     . LEU H 4  58  ? 117.505 83.659  97.356  1.00 31.78  ? 58   LEU G O     1 
ATOM   9565  C  CB    . LEU H 4  58  ? 114.729 82.080  98.438  1.00 19.51  ? 58   LEU G CB    1 
ATOM   9566  C  CG    . LEU H 4  58  ? 113.559 81.462  97.718  1.00 19.70  ? 58   LEU G CG    1 
ATOM   9567  C  CD1   . LEU H 4  58  ? 112.339 81.519  98.573  1.00 22.67  ? 58   LEU G CD1   1 
ATOM   9568  C  CD2   . LEU H 4  58  ? 113.360 82.240  96.463  1.00 19.67  ? 58   LEU G CD2   1 
ATOM   9569  N  N     . THR H 4  59  ? 117.697 82.370  99.187  1.00 22.48  ? 59   THR G N     1 
ATOM   9570  C  CA    . THR H 4  59  ? 118.816 83.171  99.654  1.00 20.89  ? 59   THR G CA    1 
ATOM   9571  C  C     . THR H 4  59  ? 119.925 83.217  98.622  1.00 28.70  ? 59   THR G C     1 
ATOM   9572  O  O     . THR H 4  59  ? 120.557 84.259  98.423  1.00 30.35  ? 59   THR G O     1 
ATOM   9573  C  CB    . THR H 4  59  ? 119.327 82.629  100.967 1.00 19.19  ? 59   THR G CB    1 
ATOM   9574  O  OG1   . THR H 4  59  ? 118.356 82.898  101.974 1.00 19.01  ? 59   THR G OG1   1 
ATOM   9575  C  CG2   . THR H 4  59  ? 120.604 83.285  101.322 1.00 25.78  ? 59   THR G CG2   1 
ATOM   9576  N  N     . ALA H 4  60  ? 120.153 82.111  97.928  1.00 35.22  ? 60   ALA G N     1 
ATOM   9577  C  CA    . ALA H 4  60  ? 121.126 82.134  96.851  1.00 30.15  ? 60   ALA G CA    1 
ATOM   9578  C  C     . ALA H 4  60  ? 120.769 83.193  95.825  1.00 32.66  ? 60   ALA G C     1 
ATOM   9579  O  O     . ALA H 4  60  ? 121.641 83.944  95.376  1.00 40.33  ? 60   ALA G O     1 
ATOM   9580  C  CB    . ALA H 4  60  ? 121.225 80.761  96.199  1.00 22.22  ? 60   ALA G CB    1 
ATOM   9581  N  N     . GLU H 4  61  ? 119.494 83.298  95.459  1.00 23.66  ? 61   GLU G N     1 
ATOM   9582  C  CA    . GLU H 4  61  ? 119.117 84.317  94.488  1.00 23.83  ? 61   GLU G CA    1 
ATOM   9583  C  C     . GLU H 4  61  ? 119.400 85.714  95.013  1.00 36.10  ? 61   GLU G C     1 
ATOM   9584  O  O     . GLU H 4  61  ? 120.157 86.478  94.400  1.00 37.45  ? 61   GLU G O     1 
ATOM   9585  C  CB    . GLU H 4  61  ? 117.655 84.175  94.103  1.00 21.48  ? 61   GLU G CB    1 
ATOM   9586  C  CG    . GLU H 4  61  ? 117.414 82.975  93.261  1.00 42.35  ? 61   GLU G CG    1 
ATOM   9587  C  CD    . GLU H 4  61  ? 118.238 83.017  92.008  1.00 54.73  ? 61   GLU G CD    1 
ATOM   9588  O  OE1   . GLU H 4  61  ? 118.332 84.100  91.402  1.00 47.20  ? 61   GLU G OE1   1 
ATOM   9589  O  OE2   . GLU H 4  61  ? 118.812 81.977  91.634  1.00 65.88  ? 61   GLU G OE2   1 
ATOM   9590  N  N     . ILE H 4  62  ? 118.812 86.069  96.154  1.00 44.38  ? 62   ILE G N     1 
ATOM   9591  C  CA    . ILE H 4  62  ? 118.963 87.440  96.627  1.00 39.11  ? 62   ILE G CA    1 
ATOM   9592  C  C     . ILE H 4  62  ? 120.427 87.797  96.777  1.00 38.83  ? 62   ILE G C     1 
ATOM   9593  O  O     . ILE H 4  62  ? 120.864 88.864  96.336  1.00 28.87  ? 62   ILE G O     1 
ATOM   9594  C  CB    . ILE H 4  62  ? 118.201 87.664  97.937  1.00 11.79  ? 62   ILE G CB    1 
ATOM   9595  C  CG1   . ILE H 4  62  ? 116.714 87.641  97.678  1.00 24.81  ? 62   ILE G CG1   1 
ATOM   9596  C  CG2   . ILE H 4  62  ? 118.554 88.985  98.529  1.00 55.73  ? 62   ILE G CG2   1 
ATOM   9597  C  CD1   . ILE H 4  62  ? 115.923 87.706  98.932  1.00 36.22  ? 62   ILE G CD1   1 
ATOM   9598  N  N     . LEU H 4  63  ? 121.220 86.911  97.372  1.00 40.80  ? 63   LEU G N     1 
ATOM   9599  C  CA    . LEU H 4  63  ? 122.631 87.232  97.523  1.00 35.05  ? 63   LEU G CA    1 
ATOM   9600  C  C     . LEU H 4  63  ? 123.301 87.416  96.175  1.00 39.18  ? 63   LEU G C     1 
ATOM   9601  O  O     . LEU H 4  63  ? 124.006 88.402  95.962  1.00 40.42  ? 63   LEU G O     1 
ATOM   9602  C  CB    . LEU H 4  63  ? 123.349 86.170  98.332  1.00 19.53  ? 63   LEU G CB    1 
ATOM   9603  C  CG    . LEU H 4  63  ? 122.900 86.247  99.770  1.00 22.64  ? 63   LEU G CG    1 
ATOM   9604  C  CD1   . LEU H 4  63  ? 123.640 85.230  100.570 1.00 32.69  ? 63   LEU G CD1   1 
ATOM   9605  C  CD2   . LEU H 4  63  ? 123.158 87.622  100.284 1.00 10.18  ? 63   LEU G CD2   1 
ATOM   9606  N  N     . GLU H 4  64  ? 123.096 86.485  95.246  1.00 48.02  ? 64   GLU G N     1 
ATOM   9607  C  CA    . GLU H 4  64  ? 123.741 86.623  93.948  1.00 36.17  ? 64   GLU G CA    1 
ATOM   9608  C  C     . GLU H 4  64  ? 123.460 87.986  93.341  1.00 42.46  ? 64   GLU G C     1 
ATOM   9609  O  O     . GLU H 4  64  ? 124.384 88.749  93.030  1.00 51.76  ? 64   GLU G O     1 
ATOM   9610  C  CB    . GLU H 4  64  ? 123.278 85.527  93.001  1.00 39.91  ? 64   GLU G CB    1 
ATOM   9611  C  CG    . GLU H 4  64  ? 123.928 85.627  91.644  1.00 53.33  ? 64   GLU G CG    1 
ATOM   9612  C  CD    . GLU H 4  64  ? 123.505 84.518  90.714  1.00 64.48  ? 64   GLU G CD    1 
ATOM   9613  O  OE1   . GLU H 4  64  ? 122.643 83.709  91.108  1.00 69.64  ? 64   GLU G OE1   1 
ATOM   9614  O  OE2   . GLU H 4  64  ? 124.040 84.446  89.590  1.00 58.66  ? 64   GLU G OE2   1 
ATOM   9615  N  N     . LEU H 4  65  ? 122.180 88.324  93.195  1.00 42.14  ? 65   LEU G N     1 
ATOM   9616  C  CA    . LEU H 4  65  ? 121.851 89.611  92.599  1.00 43.08  ? 65   LEU G CA    1 
ATOM   9617  C  C     . LEU H 4  65  ? 122.501 90.748  93.370  1.00 47.69  ? 65   LEU G C     1 
ATOM   9618  O  O     . LEU H 4  65  ? 123.115 91.645  92.779  1.00 42.73  ? 65   LEU G O     1 
ATOM   9619  C  CB    . LEU H 4  65  ? 120.343 89.799  92.541  1.00 35.72  ? 65   LEU G CB    1 
ATOM   9620  C  CG    . LEU H 4  65  ? 119.628 88.844  91.604  1.00 45.05  ? 65   LEU G CG    1 
ATOM   9621  C  CD1   . LEU H 4  65  ? 118.153 89.076  91.694  1.00 53.07  ? 65   LEU G CD1   1 
ATOM   9622  C  CD2   . LEU H 4  65  ? 120.100 89.068  90.201  1.00 29.30  ? 65   LEU G CD2   1 
ATOM   9623  N  N     . ALA H 4  66  ? 122.398 90.715  94.696  1.00 44.41  ? 66   ALA G N     1 
ATOM   9624  C  CA    . ALA H 4  66  ? 122.971 91.785  95.498  1.00 53.66  ? 66   ALA G CA    1 
ATOM   9625  C  C     . ALA H 4  66  ? 124.447 91.951  95.194  1.00 61.86  ? 66   ALA G C     1 
ATOM   9626  O  O     . ALA H 4  66  ? 124.899 93.033  94.808  1.00 50.70  ? 66   ALA G O     1 
ATOM   9627  C  CB    . ALA H 4  66  ? 122.756 91.499  96.977  1.00 34.12  ? 66   ALA G CB    1 
ATOM   9628  N  N     . GLY H 4  67  ? 125.209 90.871  95.335  1.00 65.28  ? 67   GLY G N     1 
ATOM   9629  C  CA    . GLY H 4  67  ? 126.627 90.928  95.035  1.00 53.97  ? 67   GLY G CA    1 
ATOM   9630  C  C     . GLY H 4  67  ? 126.907 91.552  93.688  1.00 53.90  ? 67   GLY G C     1 
ATOM   9631  O  O     . GLY H 4  67  ? 127.735 92.456  93.574  1.00 53.91  ? 67   GLY G O     1 
ATOM   9632  N  N     . ASN H 4  68  ? 126.199 91.101  92.653  1.00 66.33  ? 68   ASN G N     1 
ATOM   9633  C  CA    . ASN H 4  68  ? 126.371 91.728  91.350  1.00 64.21  ? 68   ASN G CA    1 
ATOM   9634  C  C     . ASN H 4  68  ? 126.195 93.232  91.447  1.00 71.98  ? 68   ASN G C     1 
ATOM   9635  O  O     . ASN H 4  68  ? 127.008 94.000  90.920  1.00 80.23  ? 68   ASN G O     1 
ATOM   9636  C  CB    . ASN H 4  68  ? 125.394 91.140  90.343  1.00 67.78  ? 68   ASN G CB    1 
ATOM   9637  C  CG    . ASN H 4  68  ? 125.770 89.746  89.936  1.00 73.33  ? 68   ASN G CG    1 
ATOM   9638  O  OD1   . ASN H 4  68  ? 126.921 89.341  90.078  1.00 70.83  ? 68   ASN G OD1   1 
ATOM   9639  N  ND2   . ASN H 4  68  ? 124.808 89.002  89.410  1.00 71.03  ? 68   ASN G ND2   1 
ATOM   9640  N  N     . ALA H 4  69  ? 125.155 93.673  92.150  1.00 83.41  ? 69   ALA G N     1 
ATOM   9641  C  CA    . ALA H 4  69  ? 124.911 95.106  92.252  1.00 71.28  ? 69   ALA G CA    1 
ATOM   9642  C  C     . ALA H 4  69  ? 126.077 95.813  92.924  1.00 70.97  ? 69   ALA G C     1 
ATOM   9643  O  O     . ALA H 4  69  ? 126.600 96.807  92.405  1.00 67.18  ? 69   ALA G O     1 
ATOM   9644  C  CB    . ALA H 4  69  ? 123.617 95.365  93.009  1.00 57.70  ? 69   ALA G CB    1 
ATOM   9645  N  N     . ALA H 4  70  ? 126.506 95.309  94.079  1.00 53.44  ? 70   ALA G N     1 
ATOM   9646  C  CA    . ALA H 4  70  ? 127.615 95.939  94.781  1.00 52.35  ? 70   ALA G CA    1 
ATOM   9647  C  C     . ALA H 4  70  ? 128.847 96.016  93.899  1.00 72.62  ? 70   ALA G C     1 
ATOM   9648  O  O     . ALA H 4  70  ? 129.538 97.041  93.866  1.00 77.99  ? 70   ALA G O     1 
ATOM   9649  C  CB    . ALA H 4  70  ? 127.931 95.170  96.055  1.00 66.53  ? 70   ALA G CB    1 
ATOM   9650  N  N     . ARG H 4  71  ? 129.138 94.938  93.177  1.00 77.60  ? 71   ARG G N     1 
ATOM   9651  C  CA    . ARG H 4  71  ? 130.250 94.961  92.241  1.00 78.54  ? 71   ARG G CA    1 
ATOM   9652  C  C     . ARG H 4  71  ? 130.076 96.075  91.229  1.00 71.47  ? 71   ARG G C     1 
ATOM   9653  O  O     . ARG H 4  71  ? 131.044 96.747  90.861  1.00 73.80  ? 71   ARG G O     1 
ATOM   9654  C  CB    . ARG H 4  71  ? 130.365 93.615  91.536  1.00 82.69  ? 71   ARG G CB    1 
ATOM   9655  C  CG    . ARG H 4  71  ? 131.503 93.530  90.565  1.00 91.77  ? 71   ARG G CG    1 
ATOM   9656  C  CD    . ARG H 4  71  ? 131.490 92.188  89.887  1.00 96.27  ? 71   ARG G CD    1 
ATOM   9657  N  NE    . ARG H 4  71  ? 130.282 92.008  89.092  1.00 105.28 ? 71   ARG G NE    1 
ATOM   9658  C  CZ    . ARG H 4  71  ? 129.862 90.835  88.630  1.00 97.14  ? 71   ARG G CZ    1 
ATOM   9659  N  NH1   . ARG H 4  71  ? 130.554 89.735  88.884  1.00 105.47 ? 71   ARG G NH1   1 
ATOM   9660  N  NH2   . ARG H 4  71  ? 128.750 90.762  87.913  1.00 67.71  ? 71   ARG G NH2   1 
ATOM   9661  N  N     . ASP H 4  72  ? 128.846 96.304  90.783  1.00 66.67  ? 72   ASP G N     1 
ATOM   9662  C  CA    . ASP H 4  72  ? 128.627 97.383  89.835  1.00 77.60  ? 72   ASP G CA    1 
ATOM   9663  C  C     . ASP H 4  72  ? 128.784 98.749  90.480  1.00 93.98  ? 72   ASP G C     1 
ATOM   9664  O  O     . ASP H 4  72  ? 128.952 99.740  89.767  1.00 102.68 ? 72   ASP G O     1 
ATOM   9665  C  CB    . ASP H 4  72  ? 127.251 97.241  89.202  1.00 109.10 ? 72   ASP G CB    1 
ATOM   9666  C  CG    . ASP H 4  72  ? 127.130 95.977  88.384  1.00 131.71 ? 72   ASP G CG    1 
ATOM   9667  O  OD1   . ASP H 4  72  ? 128.173 95.340  88.132  1.00