data_5ZCJ
# 
_entry.id   5ZCJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.295 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZCJ         
WWPDB D_1300006809 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZCJ 
_pdbx_database_status.recvd_initial_deposition_date   2018-02-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wang, J.' 1 ? 
'Yuan, Z.' 2 ? 
'Cui, Y.'  3 ? 
'Xie, R.'  4 ? 
'Wang, M.' 5 ? 
'Ma, Y.'   6 ? 
'Yu, X.'   7 ? 
'Liu, X.'  8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal structure of complex' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, J.' 1 
primary 'Yuan, Z.' 2 
primary 'Cui, Y.'  3 
primary 'Xie, R.'  4 
primary 'Wang, M.' 5 
primary 'Ma, Y.'   6 
primary 'Yu, X.'   7 
primary 'Liu, X.'  8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.46 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ZCJ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     111.144 
_cell.length_a_esd                 ? 
_cell.length_b                     103.922 
_cell.length_b_esd                 ? 
_cell.length_c                     61.470 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ZCJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tudor-interacting repair regulator protein' 23206.047 2   ? ? ? ? 
2 polymer man 'TP53-binding protein 1'                     19746.084 1   ? ? ? ? 
3 water   nat water                                        18.015    393 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'NUDT16-like protein 1,Protein syndesmos' 
2 p53BP1                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPGSVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRV
LGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFL
SNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS
;
;GPGSVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRV
LGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFL
SNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS
;
A,B ? 
2 'polypeptide(L)' no no 
;GPGSRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILL
CDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKA
ADISLDNLVEGKRKRRSNVS
;
;GPGSRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILL
CDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKA
ADISLDNLVEGKRKRRSNVS
;
C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   SER n 
1 5   VAL n 
1 6   PRO n 
1 7   GLU n 
1 8   LEU n 
1 9   LYS n 
1 10  GLN n 
1 11  ILE n 
1 12  SER n 
1 13  ARG n 
1 14  VAL n 
1 15  GLU n 
1 16  ALA n 
1 17  MET n 
1 18  ARG n 
1 19  LEU n 
1 20  GLY n 
1 21  PRO n 
1 22  GLY n 
1 23  TRP n 
1 24  SER n 
1 25  HIS n 
1 26  SER n 
1 27  CYS n 
1 28  HIS n 
1 29  ALA n 
1 30  MET n 
1 31  LEU n 
1 32  TYR n 
1 33  ALA n 
1 34  ALA n 
1 35  ASN n 
1 36  PRO n 
1 37  GLY n 
1 38  GLN n 
1 39  LEU n 
1 40  PHE n 
1 41  GLY n 
1 42  ARG n 
1 43  ILE n 
1 44  PRO n 
1 45  MET n 
1 46  ARG n 
1 47  PHE n 
1 48  SER n 
1 49  VAL n 
1 50  LEU n 
1 51  MET n 
1 52  GLN n 
1 53  MET n 
1 54  ARG n 
1 55  PHE n 
1 56  ASP n 
1 57  GLY n 
1 58  LEU n 
1 59  LEU n 
1 60  GLY n 
1 61  PHE n 
1 62  PRO n 
1 63  GLY n 
1 64  GLY n 
1 65  PHE n 
1 66  VAL n 
1 67  ASP n 
1 68  ARG n 
1 69  ARG n 
1 70  PHE n 
1 71  TRP n 
1 72  SER n 
1 73  LEU n 
1 74  GLU n 
1 75  ASP n 
1 76  GLY n 
1 77  LEU n 
1 78  ASN n 
1 79  ARG n 
1 80  VAL n 
1 81  LEU n 
1 82  GLY n 
1 83  LEU n 
1 84  GLY n 
1 85  LEU n 
1 86  GLY n 
1 87  CYS n 
1 88  LEU n 
1 89  ARG n 
1 90  LEU n 
1 91  THR n 
1 92  GLU n 
1 93  ALA n 
1 94  ASP n 
1 95  TYR n 
1 96  LEU n 
1 97  SER n 
1 98  SER n 
1 99  HIS n 
1 100 LEU n 
1 101 THR n 
1 102 GLU n 
1 103 GLY n 
1 104 PRO n 
1 105 HIS n 
1 106 ARG n 
1 107 VAL n 
1 108 VAL n 
1 109 ALA n 
1 110 HIS n 
1 111 LEU n 
1 112 TYR n 
1 113 ALA n 
1 114 ARG n 
1 115 GLN n 
1 116 LEU n 
1 117 THR n 
1 118 LEU n 
1 119 GLU n 
1 120 GLN n 
1 121 LEU n 
1 122 HIS n 
1 123 ALA n 
1 124 VAL n 
1 125 GLU n 
1 126 ILE n 
1 127 SER n 
1 128 ALA n 
1 129 VAL n 
1 130 HIS n 
1 131 SER n 
1 132 ARG n 
1 133 ASP n 
1 134 HIS n 
1 135 GLY n 
1 136 LEU n 
1 137 GLU n 
1 138 VAL n 
1 139 LEU n 
1 140 GLY n 
1 141 LEU n 
1 142 VAL n 
1 143 ARG n 
1 144 VAL n 
1 145 PRO n 
1 146 LEU n 
1 147 TYR n 
1 148 THR n 
1 149 GLN n 
1 150 LYS n 
1 151 ASP n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 GLY n 
1 156 PHE n 
1 157 PRO n 
1 158 ASN n 
1 159 PHE n 
1 160 LEU n 
1 161 SER n 
1 162 ASN n 
1 163 ALA n 
1 164 PHE n 
1 165 VAL n 
1 166 SER n 
1 167 THR n 
1 168 ALA n 
1 169 LYS n 
1 170 CYS n 
1 171 GLN n 
1 172 LEU n 
1 173 LEU n 
1 174 PHE n 
1 175 ALA n 
1 176 LEU n 
1 177 LYS n 
1 178 VAL n 
1 179 LEU n 
1 180 ASN n 
1 181 MET n 
1 182 MET n 
1 183 PRO n 
1 184 GLU n 
1 185 GLU n 
1 186 LYS n 
1 187 LEU n 
1 188 VAL n 
1 189 GLU n 
1 190 ALA n 
1 191 LEU n 
1 192 ALA n 
1 193 ALA n 
1 194 ALA n 
1 195 THR n 
1 196 GLU n 
1 197 LYS n 
1 198 GLN n 
1 199 LYS n 
1 200 LYS n 
1 201 ALA n 
1 202 LEU n 
1 203 GLU n 
1 204 LYS n 
1 205 LEU n 
1 206 LEU n 
1 207 PRO n 
1 208 ALA n 
1 209 SER n 
1 210 SER n 
2 1   GLY n 
2 2   PRO n 
2 3   GLY n 
2 4   SER n 
2 5   ARG n 
2 6   SER n 
2 7   ASP n 
2 8   SER n 
2 9   PRO n 
2 10  GLU n 
2 11  ILE n 
2 12  PRO n 
2 13  PHE n 
2 14  GLN n 
2 15  ALA n 
2 16  ALA n 
2 17  ALA n 
2 18  GLY n 
2 19  PRO n 
2 20  SER n 
2 21  ASP n 
2 22  GLY n 
2 23  LEU n 
2 24  ASP n 
2 25  ALA n 
2 26  SER n 
2 27  SER n 
2 28  PRO n 
2 29  GLY n 
2 30  ASN n 
2 31  SER n 
2 32  PHE n 
2 33  VAL n 
2 34  GLY n 
2 35  LEU n 
2 36  ARG n 
2 37  VAL n 
2 38  VAL n 
2 39  ALA n 
2 40  LYS n 
2 41  TRP n 
2 42  SER n 
2 43  SER n 
2 44  ASN n 
2 45  GLY n 
2 46  TYR n 
2 47  PHE n 
2 48  TYR n 
2 49  SER n 
2 50  GLY n 
2 51  LYS n 
2 52  ILE n 
2 53  THR n 
2 54  ARG n 
2 55  ASP n 
2 56  VAL n 
2 57  GLY n 
2 58  ALA n 
2 59  GLY n 
2 60  LYS n 
2 61  TYR n 
2 62  LYS n 
2 63  LEU n 
2 64  LEU n 
2 65  PHE n 
2 66  ASP n 
2 67  ASP n 
2 68  GLY n 
2 69  TYR n 
2 70  GLU n 
2 71  CYS n 
2 72  ASP n 
2 73  VAL n 
2 74  LEU n 
2 75  GLY n 
2 76  LYS n 
2 77  ASP n 
2 78  ILE n 
2 79  LEU n 
2 80  LEU n 
2 81  CYS n 
2 82  ASP n 
2 83  PRO n 
2 84  ILE n 
2 85  PRO n 
2 86  LEU n 
2 87  ASP n 
2 88  THR n 
2 89  GLU n 
2 90  VAL n 
2 91  THR n 
2 92  ALA n 
2 93  LEU n 
2 94  SER n 
2 95  GLU n 
2 96  ASP n 
2 97  GLU n 
2 98  TYR n 
2 99  PHE n 
2 100 SER n 
2 101 ALA n 
2 102 GLY n 
2 103 VAL n 
2 104 VAL n 
2 105 LYS n 
2 106 GLY n 
2 107 HIS n 
2 108 ARG n 
2 109 LYS n 
2 110 GLU n 
2 111 SER n 
2 112 GLY n 
2 113 GLU n 
2 114 LEU n 
2 115 TYR n 
2 116 TYR n 
2 117 SER n 
2 118 ILE n 
2 119 GLU n 
2 120 LYS n 
2 121 GLU n 
2 122 GLY n 
2 123 GLN n 
2 124 ARG n 
2 125 LYS n 
2 126 TRP n 
2 127 TYR n 
2 128 LYS n 
2 129 ARG n 
2 130 MET n 
2 131 ALA n 
2 132 VAL n 
2 133 ILE n 
2 134 LEU n 
2 135 SER n 
2 136 LEU n 
2 137 GLU n 
2 138 GLN n 
2 139 GLY n 
2 140 ASN n 
2 141 ARG n 
2 142 LEU n 
2 143 ARG n 
2 144 GLU n 
2 145 GLN n 
2 146 TYR n 
2 147 GLY n 
2 148 LEU n 
2 149 GLY n 
2 150 PRO n 
2 151 TYR n 
2 152 GLU n 
2 153 ALA n 
2 154 VAL n 
2 155 THR n 
2 156 PRO n 
2 157 LEU n 
2 158 THR n 
2 159 LYS n 
2 160 ALA n 
2 161 ALA n 
2 162 ASP n 
2 163 ILE n 
2 164 SER n 
2 165 LEU n 
2 166 ASP n 
2 167 ASN n 
2 168 LEU n 
2 169 VAL n 
2 170 GLU n 
2 171 GLY n 
2 172 LYS n 
2 173 ARG n 
2 174 LYS n 
2 175 ARG n 
2 176 ARG n 
2 177 SER n 
2 178 ASN n 
2 179 VAL n 
2 180 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 210 Human ? 'NUDT16L1, SDOS, TIRR' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 180 Human ? TP53BP1                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TIRR_HUMAN  Q9BRJ7 ? 1 
;VPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLG
LGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAF
VSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS
;
6    
2 UNP TP53B_HUMAN Q12888 ? 2 
;RSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPI
PLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADIS
LDNLVEGKRKRRSNVS
;
1459 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ZCJ A 5 ? 210 ? Q9BRJ7 6    ? 211  ? 6    211  
2 1 5ZCJ B 5 ? 210 ? Q9BRJ7 6    ? 211  ? 6    211  
3 2 5ZCJ C 5 ? 180 ? Q12888 1459 ? 1634 ? 1459 1634 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ZCJ GLY A 1 ? UNP Q9BRJ7 ? ? 'expression tag' 2    1  
1 5ZCJ PRO A 2 ? UNP Q9BRJ7 ? ? 'expression tag' 3    2  
1 5ZCJ GLY A 3 ? UNP Q9BRJ7 ? ? 'expression tag' 4    3  
1 5ZCJ SER A 4 ? UNP Q9BRJ7 ? ? 'expression tag' 5    4  
2 5ZCJ GLY B 1 ? UNP Q9BRJ7 ? ? 'expression tag' 2    5  
2 5ZCJ PRO B 2 ? UNP Q9BRJ7 ? ? 'expression tag' 3    6  
2 5ZCJ GLY B 3 ? UNP Q9BRJ7 ? ? 'expression tag' 4    7  
2 5ZCJ SER B 4 ? UNP Q9BRJ7 ? ? 'expression tag' 5    8  
3 5ZCJ GLY C 1 ? UNP Q12888 ? ? 'expression tag' 1455 9  
3 5ZCJ PRO C 2 ? UNP Q12888 ? ? 'expression tag' 1456 10 
3 5ZCJ GLY C 3 ? UNP Q12888 ? ? 'expression tag' 1457 11 
3 5ZCJ SER C 4 ? UNP Q12888 ? ? 'expression tag' 1458 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZCJ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.67 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.95 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.7 M Ammonium tartrate, 0.1 M Sodium acetate pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-11-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ZCJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.00 
_reflns.d_resolution_low                 19.92 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       308418 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.35 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.94 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.07 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ZCJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.004 
_refine.ls_d_res_low                             19.917 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     45400 
_refine.ls_number_reflns_R_free                  1966 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.45 
_refine.ls_percent_reflns_R_free                 4.33 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1912 
_refine.ls_R_factor_R_free                       0.2189 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1899 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.15 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.81 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.19 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4116 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             393 
_refine_hist.number_atoms_total               4509 
_refine_hist.d_res_high                       2.004 
_refine_hist.d_res_low                        19.917 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002 ? 4221 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.509 ? 5698 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 4.933 ? 3278 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.038 ? 624  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003 ? 732  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0040 2.0541  . . 133 3017 95.00 . . . 0.2889 . 0.2549 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0541 2.1096  . . 133 2953 94.00 . . . 0.2844 . 0.2420 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1096 2.1716  . . 139 3004 95.00 . . . 0.2355 . 0.2270 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1716 2.2416  . . 141 3110 98.00 . . . 0.2537 . 0.2074 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2416 2.3216  . . 138 3105 98.00 . . . 0.2520 . 0.2020 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3216 2.4144  . . 143 3130 99.00 . . . 0.2293 . 0.2044 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4144 2.5241  . . 141 3142 99.00 . . . 0.2310 . 0.2010 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5241 2.6568  . . 143 3132 99.00 . . . 0.2466 . 0.1938 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6568 2.8229  . . 142 3141 98.00 . . . 0.2260 . 0.1903 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8229 3.0401  . . 142 3098 97.00 . . . 0.1961 . 0.1815 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0401 3.3448  . . 141 3105 98.00 . . . 0.2133 . 0.1725 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3448 3.8258  . . 144 3178 99.00 . . . 0.2067 . 0.1647 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8258 4.8088  . . 143 3158 99.00 . . . 0.1854 . 0.1530 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8088 19.9178 . . 143 3161 98.00 . . . 0.1914 . 0.2029 . . . . . . . . . . 
# 
_struct.entry_id                     5ZCJ 
_struct.title                        'Crystal structure of complex' 
_struct.pdbx_descriptor              'Tudor-interacting repair regulator protein, TP53-binding protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZCJ 
_struct_keywords.text            'complex, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 12  ? MET A 17  ? SER A 13   MET A 18   1 ? 6  
HELX_P HELX_P2  AA2 PHE A 40  ? ARG A 42  ? PHE A 41   ARG A 43   5 ? 3  
HELX_P HELX_P3  AA3 SER A 72  ? LEU A 85  ? SER A 73   LEU A 86   1 ? 14 
HELX_P HELX_P4  AA4 THR A 91  ? ALA A 93  ? THR A 92   ALA A 94   5 ? 3  
HELX_P HELX_P5  AA5 THR A 117 ? VAL A 129 ? THR A 118  VAL A 130  1 ? 13 
HELX_P HELX_P6  AA6 GLY A 155 ? SER A 161 ? GLY A 156  SER A 162  1 ? 7  
HELX_P HELX_P7  AA7 VAL A 165 ? LEU A 179 ? VAL A 166  LEU A 180  1 ? 15 
HELX_P HELX_P8  AA8 PRO A 183 ? LEU A 202 ? PRO A 184  LEU A 203  1 ? 20 
HELX_P HELX_P9  AA9 SER B 12  ? MET B 17  ? SER B 13   MET B 18   1 ? 6  
HELX_P HELX_P10 AB1 PHE B 40  ? ARG B 42  ? PHE B 41   ARG B 43   5 ? 3  
HELX_P HELX_P11 AB2 SER B 72  ? LEU B 85  ? SER B 73   LEU B 86   1 ? 14 
HELX_P HELX_P12 AB3 THR B 91  ? ALA B 93  ? THR B 92   ALA B 94   5 ? 3  
HELX_P HELX_P13 AB4 THR B 117 ? HIS B 130 ? THR B 118  HIS B 131  1 ? 14 
HELX_P HELX_P14 AB5 GLY B 155 ? SER B 161 ? GLY B 156  SER B 162  1 ? 7  
HELX_P HELX_P15 AB6 VAL B 165 ? LEU B 179 ? VAL B 166  LEU B 180  1 ? 15 
HELX_P HELX_P16 AB7 PRO B 183 ? GLU B 203 ? PRO B 184  GLU B 204  1 ? 21 
HELX_P HELX_P17 AB8 SER C 135 ? ARG C 141 ? SER C 1589 ARG C 1595 1 ? 7  
HELX_P HELX_P18 AB9 LEU C 142 ? GLY C 147 ? LEU C 1596 GLY C 1601 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 103 A . ? GLY 104  A PRO 104 A ? PRO 105  A 1 4.11  
2 GLY 103 B . ? GLY 104  B PRO 104 B ? PRO 105  B 1 -3.10 
3 LEU 205 B . ? LEU 206  B LEU 206 B ? LEU 207  B 1 1.78  
4 ASP 82  C . ? ASP 1536 C PRO 83  C ? PRO 1537 C 1 -1.87 
5 GLY 149 C . ? GLY 1603 C PRO 150 C ? PRO 1604 C 1 2.98  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 4 ? 
AA3 ? 6 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 9   ? GLN A 10  ? LYS A 10   GLN A 11   
AA1 2 TYR A 95  ? LEU A 100 ? TYR A 96   LEU A 101  
AA1 3 VAL A 107 ? LEU A 116 ? VAL A 108  LEU A 117  
AA1 4 SER A 24  ? LEU A 39  ? SER A 25   LEU A 40   
AA1 5 ILE A 43  ? ARG A 54  ? ILE A 44   ARG A 55   
AA1 6 GLY A 63  ? VAL A 66  ? GLY A 64   VAL A 67   
AA2 1 LEU A 59  ? GLY A 60  ? LEU A 60   GLY A 61   
AA2 2 ILE A 43  ? ARG A 54  ? ILE A 44   ARG A 55   
AA2 3 SER A 24  ? LEU A 39  ? SER A 25   LEU A 40   
AA2 4 VAL A 138 ? VAL A 144 ? VAL A 139  VAL A 145  
AA3 1 LYS B 9   ? GLN B 10  ? LYS B 10   GLN B 11   
AA3 2 TYR B 95  ? LEU B 100 ? TYR B 96   LEU B 101  
AA3 3 VAL B 107 ? LEU B 116 ? VAL B 108  LEU B 117  
AA3 4 SER B 24  ? LEU B 39  ? SER B 25   LEU B 40   
AA3 5 ILE B 43  ? ARG B 54  ? ILE B 44   ARG B 55   
AA3 6 GLY B 63  ? VAL B 66  ? GLY B 64   VAL B 67   
AA4 1 LEU B 59  ? GLY B 60  ? LEU B 60   GLY B 61   
AA4 2 ILE B 43  ? ARG B 54  ? ILE B 44   ARG B 55   
AA4 3 SER B 24  ? LEU B 39  ? SER B 25   LEU B 40   
AA4 4 VAL B 138 ? ARG B 143 ? VAL B 139  ARG B 144  
AA5 1 GLU C 70  ? LEU C 74  ? GLU C 1524 LEU C 1528 
AA5 2 LYS C 60  ? PHE C 65  ? LYS C 1514 PHE C 1519 
AA5 3 TYR C 48  ? GLY C 57  ? TYR C 1502 GLY C 1511 
AA5 4 ARG C 36  ? ALA C 39  ? ARG C 1490 ALA C 1493 
AA5 5 ILE C 78  ? LEU C 79  ? ILE C 1532 LEU C 1533 
AA6 1 GLN C 123 ? LYS C 128 ? GLN C 1577 LYS C 1582 
AA6 2 GLU C 113 ? LYS C 120 ? GLU C 1567 LYS C 1574 
AA6 3 PHE C 99  ? GLU C 110 ? PHE C 1553 GLU C 1564 
AA6 4 GLU C 89  ? LEU C 93  ? GLU C 1543 LEU C 1547 
AA6 5 VAL C 132 ? ILE C 133 ? VAL C 1586 ILE C 1587 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 9   ? N LYS A 10   O LEU A 100 ? O LEU A 101  
AA1 2 3 N HIS A 99  ? N HIS A 100  O ALA A 109 ? O ALA A 110  
AA1 3 4 O TYR A 112 ? O TYR A 113  N MET A 30  ? N MET A 31   
AA1 4 5 N ASN A 35  ? N ASN A 36   O ARG A 46  ? O ARG A 47   
AA2 1 2 O GLY A 60  ? O GLY A 61   N GLN A 52  ? N GLN A 53   
AA2 2 3 O ARG A 46  ? O ARG A 47   N ASN A 35  ? N ASN A 36   
AA3 1 2 N LYS B 9   ? N LYS B 10   O LEU B 100 ? O LEU B 101  
AA3 2 3 N HIS B 99  ? N HIS B 100  O ALA B 109 ? O ALA B 110  
AA3 3 4 O HIS B 110 ? O HIS B 111  N SER B 26  ? N SER B 27   
AA3 4 5 N LEU B 39  ? N LEU B 40   O ILE B 43  ? O ILE B 44   
AA4 1 2 O GLY B 60  ? O GLY B 61   N GLN B 52  ? N GLN B 53   
AA4 2 3 O ILE B 43  ? O ILE B 44   N LEU B 39  ? N LEU B 40   
AA5 1 2 O VAL C 73  ? O VAL C 1527 N TYR C 61  ? N TYR C 1515 
AA5 2 3 O LYS C 62  ? O LYS C 1516 N THR C 53  ? N THR C 1507 
AA5 3 4 O TYR C 48  ? O TYR C 1502 N ALA C 39  ? N ALA C 1493 
AA5 4 5 N VAL C 38  ? N VAL C 1492 O LEU C 79  ? O LEU C 1533 
AA6 1 2 O TYR C 127 ? O TYR C 1581 N TYR C 116 ? N TYR C 1570 
AA6 2 3 O SER C 117 ? O SER C 1571 N LYS C 105 ? N LYS C 1559 
AA6 3 4 O SER C 100 ? O SER C 1554 N ALA C 92  ? N ALA C 1546 
AA6 4 5 N THR C 91  ? N THR C 1545 O ILE C 133 ? O ILE C 1587 
# 
_atom_sites.entry_id                    5ZCJ 
_atom_sites.fract_transf_matrix[1][1]   0.008997 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000860 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009623 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016342 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 5   ? 20.650 59.611 6.934   1.00 47.83 ?  6    VAL A N   1 
ATOM   2    C CA  . VAL A 1 5   ? 21.806 60.498 6.940   1.00 52.65 ?  6    VAL A CA  1 
ATOM   3    C C   . VAL A 1 5   ? 22.938 59.890 7.765   1.00 46.95 ?  6    VAL A C   1 
ATOM   4    O O   . VAL A 1 5   ? 22.759 59.599 8.949   1.00 38.29 ?  6    VAL A O   1 
ATOM   5    C CB  . VAL A 1 5   ? 21.430 61.897 7.471   1.00 48.10 ?  6    VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 5   ? 22.675 62.669 7.881   1.00 40.48 ?  6    VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 5   ? 20.640 62.669 6.424   1.00 45.83 ?  6    VAL A CG2 1 
ATOM   8    N N   . PRO A 1 6   ? 24.098 59.691 7.139   1.00 45.51 ?  7    PRO A N   1 
ATOM   9    C CA  . PRO A 1 6   ? 25.253 59.175 7.883   1.00 46.38 ?  7    PRO A CA  1 
ATOM   10   C C   . PRO A 1 6   ? 25.713 60.169 8.936   1.00 36.53 ?  7    PRO A C   1 
ATOM   11   O O   . PRO A 1 6   ? 25.719 61.382 8.713   1.00 30.68 ?  7    PRO A O   1 
ATOM   12   C CB  . PRO A 1 6   ? 26.317 58.976 6.797   1.00 42.31 ?  7    PRO A CB  1 
ATOM   13   C CG  . PRO A 1 6   ? 25.925 59.923 5.715   1.00 40.37 ?  7    PRO A CG  1 
ATOM   14   C CD  . PRO A 1 6   ? 24.423 59.934 5.725   1.00 40.86 ?  7    PRO A CD  1 
ATOM   15   N N   . GLU A 1 7   ? 26.103 59.639 10.092  1.00 35.73 ?  8    GLU A N   1 
ATOM   16   C CA  . GLU A 1 7   ? 26.517 60.462 11.219  1.00 35.39 ?  8    GLU A CA  1 
ATOM   17   C C   . GLU A 1 7   ? 27.679 59.790 11.933  1.00 27.02 ?  8    GLU A C   1 
ATOM   18   O O   . GLU A 1 7   ? 27.609 58.600 12.255  1.00 30.34 ?  8    GLU A O   1 
ATOM   19   C CB  . GLU A 1 7   ? 25.352 60.690 12.189  1.00 34.31 ?  8    GLU A CB  1 
ATOM   20   C CG  . GLU A 1 7   ? 25.644 61.706 13.278  1.00 54.01 ?  8    GLU A CG  1 
ATOM   21   C CD  . GLU A 1 7   ? 24.470 62.627 13.551  1.00 67.90 ?  8    GLU A CD  1 
ATOM   22   O OE1 . GLU A 1 7   ? 23.571 62.721 12.688  1.00 64.54 ?  8    GLU A OE1 1 
ATOM   23   O OE2 . GLU A 1 7   ? 24.448 63.261 14.627  1.00 54.86 ?  8    GLU A OE2 1 
ATOM   24   N N   . LEU A 1 8   ? 28.742 60.551 12.172  1.00 16.04 ?  9    LEU A N   1 
ATOM   25   C CA  . LEU A 1 8   ? 29.887 60.041 12.907  1.00 13.52 ?  9    LEU A CA  1 
ATOM   26   C C   . LEU A 1 8   ? 29.629 60.107 14.410  1.00 16.60 ?  9    LEU A C   1 
ATOM   27   O O   . LEU A 1 8   ? 28.777 60.859 14.890  1.00 12.67 ?  9    LEU A O   1 
ATOM   28   C CB  . LEU A 1 8   ? 31.147 60.833 12.561  1.00 12.05 ?  9    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 8   ? 31.565 60.845 11.090  1.00 11.12 ?  9    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 8   ? 32.731 61.794 10.873  1.00 13.13 ?  9    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 8   ? 31.922 59.442 10.633  1.00 13.76 ?  9    LEU A CD2 1 
ATOM   32   N N   . LYS A 1 9   ? 30.381 59.300 15.153  1.00 12.30 ?  10   LYS A N   1 
ATOM   33   C CA  . LYS A 1 9   ? 30.275 59.321 16.605  1.00 11.71 ?  10   LYS A CA  1 
ATOM   34   C C   . LYS A 1 9   ? 30.926 60.582 17.154  1.00 15.70 ?  10   LYS A C   1 
ATOM   35   O O   . LYS A 1 9   ? 32.086 60.880 16.851  1.00 15.18 ?  10   LYS A O   1 
ATOM   36   C CB  . LYS A 1 9   ? 30.929 58.083 17.213  1.00 9.59  ?  10   LYS A CB  1 
ATOM   37   C CG  . LYS A 1 9   ? 30.742 57.986 18.721  1.00 14.44 ?  10   LYS A CG  1 
ATOM   38   C CD  . LYS A 1 9   ? 31.460 56.780 19.305  1.00 12.05 ?  10   LYS A CD  1 
ATOM   39   C CE  . LYS A 1 9   ? 30.997 56.516 20.730  1.00 15.20 ?  10   LYS A CE  1 
ATOM   40   N NZ  . LYS A 1 9   ? 31.747 55.403 21.371  1.00 12.61 ?  10   LYS A NZ  1 
ATOM   41   N N   . GLN A 1 10  ? 30.180 61.319 17.965  1.00 10.58 ?  11   GLN A N   1 
ATOM   42   C CA  . GLN A 1 10  ? 30.699 62.544 18.545  1.00 15.68 ?  11   GLN A CA  1 
ATOM   43   C C   . GLN A 1 10  ? 31.545 62.255 19.773  1.00 15.86 ?  11   GLN A C   1 
ATOM   44   O O   . GLN A 1 10  ? 31.389 61.229 20.443  1.00 10.08 ?  11   GLN A O   1 
ATOM   45   C CB  . GLN A 1 10  ? 29.562 63.482 18.928  1.00 17.81 ?  11   GLN A CB  1 
ATOM   46   C CG  . GLN A 1 10  ? 28.961 64.193 17.754  1.00 24.13 ?  11   GLN A CG  1 
ATOM   47   C CD  . GLN A 1 10  ? 27.929 65.199 18.171  1.00 28.31 ?  11   GLN A CD  1 
ATOM   48   O OE1 . GLN A 1 10  ? 26.740 64.902 18.162  1.00 35.45 ?  11   GLN A OE1 1 
ATOM   49   N NE2 . GLN A 1 10  ? 28.369 66.397 18.537  1.00 32.83 ?  11   GLN A NE2 1 
ATOM   50   N N   . ILE A 1 11  ? 32.444 63.187 20.066  1.00 10.09 ?  12   ILE A N   1 
ATOM   51   C CA  . ILE A 1 11  ? 33.253 63.155 21.275  1.00 10.36 ?  12   ILE A CA  1 
ATOM   52   C C   . ILE A 1 11  ? 33.391 64.584 21.780  1.00 10.83 ?  12   ILE A C   1 
ATOM   53   O O   . ILE A 1 11  ? 33.528 65.524 20.989  1.00 11.02 ?  12   ILE A O   1 
ATOM   54   C CB  . ILE A 1 11  ? 34.629 62.502 21.018  1.00 11.98 ?  12   ILE A CB  1 
ATOM   55   C CG1 . ILE A 1 11  ? 35.383 62.307 22.334  1.00 13.53 ?  12   ILE A CG1 1 
ATOM   56   C CG2 . ILE A 1 11  ? 35.449 63.319 20.020  1.00 11.10 ?  12   ILE A CG2 1 
ATOM   57   C CD1 . ILE A 1 11  ? 36.671 61.530 22.185  1.00 16.01 ?  12   ILE A CD1 1 
ATOM   58   N N   . SER A 1 12  ? 33.316 64.753 23.095  1.00 8.64  ?  13   SER A N   1 
ATOM   59   C CA  . SER A 1 12  ? 33.469 66.079 23.667  1.00 13.79 ?  13   SER A CA  1 
ATOM   60   C C   . SER A 1 12  ? 34.902 66.566 23.478  1.00 11.54 ?  13   SER A C   1 
ATOM   61   O O   . SER A 1 12  ? 35.832 65.780 23.273  1.00 8.86  ?  13   SER A O   1 
ATOM   62   C CB  . SER A 1 12  ? 33.101 66.075 25.150  1.00 15.22 ?  13   SER A CB  1 
ATOM   63   O OG  . SER A 1 12  ? 34.167 65.576 25.940  1.00 13.29 ?  13   SER A OG  1 
ATOM   64   N N   . ARG A 1 13  ? 35.075 67.888 23.549  1.00 12.96 ?  14   ARG A N   1 
ATOM   65   C CA  . ARG A 1 13  ? 36.398 68.460 23.326  1.00 9.23  ?  14   ARG A CA  1 
ATOM   66   C C   . ARG A 1 13  ? 37.384 68.022 24.402  1.00 10.42 ?  14   ARG A C   1 
ATOM   67   O O   . ARG A 1 13  ? 38.528 67.666 24.095  1.00 11.76 ?  14   ARG A O   1 
ATOM   68   C CB  . ARG A 1 13  ? 36.318 69.986 23.264  1.00 13.71 ?  14   ARG A CB  1 
ATOM   69   C CG  . ARG A 1 13  ? 37.676 70.639 23.064  1.00 20.33 ?  14   ARG A CG  1 
ATOM   70   C CD  . ARG A 1 13  ? 37.571 72.116 22.731  1.00 16.59 ?  14   ARG A CD  1 
ATOM   71   N NE  . ARG A 1 13  ? 38.896 72.712 22.575  1.00 23.96 ?  14   ARG A NE  1 
ATOM   72   C CZ  . ARG A 1 13  ? 39.165 73.749 21.789  1.00 21.65 ?  14   ARG A CZ  1 
ATOM   73   N NH1 . ARG A 1 13  ? 38.198 74.316 21.080  1.00 18.05 ?  14   ARG A NH1 1 
ATOM   74   N NH2 . ARG A 1 13  ? 40.403 74.219 21.712  1.00 23.08 ?  14   ARG A NH2 1 
ATOM   75   N N   . VAL A 1 14  ? 36.965 68.044 25.671  1.00 10.60 ?  15   VAL A N   1 
ATOM   76   C CA  . VAL A 1 14  ? 37.873 67.665 26.750  1.00 10.62 ?  15   VAL A CA  1 
ATOM   77   C C   . VAL A 1 14  ? 38.244 66.189 26.646  1.00 9.84  ?  15   VAL A C   1 
ATOM   78   O O   . VAL A 1 14  ? 39.387 65.802 26.917  1.00 7.53  ?  15   VAL A O   1 
ATOM   79   C CB  . VAL A 1 14  ? 37.258 68.012 28.120  1.00 12.92 ?  15   VAL A CB  1 
ATOM   80   C CG1 . VAL A 1 14  ? 35.928 67.296 28.322  1.00 17.51 ?  15   VAL A CG1 1 
ATOM   81   C CG2 . VAL A 1 14  ? 38.231 67.676 29.243  1.00 15.85 ?  15   VAL A CG2 1 
ATOM   82   N N   . GLU A 1 15  ? 37.294 65.343 26.238  1.00 7.99  ?  16   GLU A N   1 
ATOM   83   C CA  . GLU A 1 15  ? 37.611 63.933 26.037  1.00 12.28 ?  16   GLU A CA  1 
ATOM   84   C C   . GLU A 1 15  ? 38.511 63.730 24.825  1.00 10.76 ?  16   GLU A C   1 
ATOM   85   O O   . GLU A 1 15  ? 39.362 62.834 24.832  1.00 13.86 ?  16   GLU A O   1 
ATOM   86   C CB  . GLU A 1 15  ? 36.324 63.118 25.893  1.00 13.69 ?  16   GLU A CB  1 
ATOM   87   C CG  . GLU A 1 15  ? 35.544 62.973 27.193  1.00 23.20 ?  16   GLU A CG  1 
ATOM   88   C CD  . GLU A 1 15  ? 34.092 62.599 26.966  1.00 38.46 ?  16   GLU A CD  1 
ATOM   89   O OE1 . GLU A 1 15  ? 33.478 62.014 27.882  1.00 41.83 ?  16   GLU A OE1 1 
ATOM   90   O OE2 . GLU A 1 15  ? 33.564 62.890 25.872  1.00 41.95 ?  16   GLU A OE2 1 
ATOM   91   N N   . ALA A 1 16  ? 38.347 64.551 23.784  1.00 10.54 ?  17   ALA A N   1 
ATOM   92   C CA  . ALA A 1 16  ? 39.244 64.472 22.636  1.00 11.53 ?  17   ALA A CA  1 
ATOM   93   C C   . ALA A 1 16  ? 40.669 64.859 23.011  1.00 11.25 ?  17   ALA A C   1 
ATOM   94   O O   . ALA A 1 16  ? 41.627 64.310 22.455  1.00 9.71  ?  17   ALA A O   1 
ATOM   95   C CB  . ALA A 1 16  ? 38.731 65.364 21.506  1.00 10.16 ?  17   ALA A CB  1 
ATOM   96   N N   . MET A 1 17  ? 40.831 65.792 23.950  1.00 9.14  ?  18   MET A N   1 
ATOM   97   C CA  . MET A 1 17  ? 42.161 66.200 24.385  1.00 14.16 ?  18   MET A CA  1 
ATOM   98   C C   . MET A 1 17  ? 42.831 65.168 25.279  1.00 16.12 ?  18   MET A C   1 
ATOM   99   O O   . MET A 1 17  ? 44.032 65.290 25.543  1.00 15.66 ?  18   MET A O   1 
ATOM   100  C CB  . MET A 1 17  ? 42.083 67.546 25.107  1.00 15.20 ?  18   MET A CB  1 
ATOM   101  C CG  . MET A 1 17  ? 41.569 68.691 24.239  1.00 16.36 ?  18   MET A CG  1 
ATOM   102  S SD  . MET A 1 17  ? 42.538 68.949 22.737  1.00 29.10 ?  18   MET A SD  1 
ATOM   103  C CE  . MET A 1 17  ? 41.543 68.099 21.511  1.00 18.76 ?  18   MET A CE  1 
ATOM   104  N N   . ARG A 1 18  ? 42.094 64.164 25.748  1.00 14.84 ?  19   ARG A N   1 
ATOM   105  C CA  . ARG A 1 18  ? 42.671 63.087 26.538  1.00 13.30 ?  19   ARG A CA  1 
ATOM   106  C C   . ARG A 1 18  ? 43.131 61.911 25.690  1.00 16.37 ?  19   ARG A C   1 
ATOM   107  O O   . ARG A 1 18  ? 43.767 60.996 26.224  1.00 18.26 ?  19   ARG A O   1 
ATOM   108  C CB  . ARG A 1 18  ? 41.660 62.597 27.581  1.00 16.43 ?  19   ARG A CB  1 
ATOM   109  C CG  . ARG A 1 18  ? 41.491 63.538 28.755  1.00 26.50 ?  19   ARG A CG  1 
ATOM   110  C CD  . ARG A 1 18  ? 40.306 63.135 29.614  1.00 32.19 ?  19   ARG A CD  1 
ATOM   111  N NE  . ARG A 1 18  ? 40.369 61.735 30.024  1.00 26.95 ?  19   ARG A NE  1 
ATOM   112  C CZ  . ARG A 1 18  ? 41.102 61.285 31.038  1.00 26.50 ?  19   ARG A CZ  1 
ATOM   113  N NH1 . ARG A 1 18  ? 41.844 62.124 31.748  1.00 34.99 ?  19   ARG A NH1 1 
ATOM   114  N NH2 . ARG A 1 18  ? 41.095 59.994 31.341  1.00 34.41 ?  19   ARG A NH2 1 
ATOM   115  N N   . LEU A 1 19  ? 42.823 61.912 24.394  1.00 13.24 ?  20   LEU A N   1 
ATOM   116  C CA  . LEU A 1 19  ? 43.264 60.839 23.513  1.00 17.83 ?  20   LEU A CA  1 
ATOM   117  C C   . LEU A 1 19  ? 44.787 60.779 23.466  1.00 13.29 ?  20   LEU A C   1 
ATOM   118  O O   . LEU A 1 19  ? 45.476 61.799 23.543  1.00 16.21 ?  20   LEU A O   1 
ATOM   119  C CB  . LEU A 1 19  ? 42.702 61.041 22.105  1.00 8.34  ?  20   LEU A CB  1 
ATOM   120  C CG  . LEU A 1 19  ? 41.177 61.093 21.983  1.00 13.15 ?  20   LEU A CG  1 
ATOM   121  C CD1 . LEU A 1 19  ? 40.761 61.550 20.594  1.00 9.85  ?  20   LEU A CD1 1 
ATOM   122  C CD2 . LEU A 1 19  ? 40.570 59.740 22.306  1.00 12.61 ?  20   LEU A CD2 1 
ATOM   123  N N   . GLY A 1 20  ? 45.312 59.559 23.336  1.00 15.63 ?  21   GLY A N   1 
ATOM   124  C CA  . GLY A 1 20  ? 46.739 59.345 23.343  1.00 11.67 ?  21   GLY A CA  1 
ATOM   125  C C   . GLY A 1 20  ? 47.391 59.751 22.040  1.00 21.72 ?  21   GLY A C   1 
ATOM   126  O O   . GLY A 1 20  ? 46.741 60.198 21.084  1.00 14.73 ?  21   GLY A O   1 
ATOM   127  N N   . PRO A 1 21  ? 48.716 59.587 21.988  1.00 18.25 ?  22   PRO A N   1 
ATOM   128  C CA  . PRO A 1 21  ? 49.472 60.046 20.810  1.00 21.20 ?  22   PRO A CA  1 
ATOM   129  C C   . PRO A 1 21  ? 49.127 59.309 19.528  1.00 27.21 ?  22   PRO A C   1 
ATOM   130  O O   . PRO A 1 21  ? 49.400 59.834 18.441  1.00 25.47 ?  22   PRO A O   1 
ATOM   131  C CB  . PRO A 1 21  ? 50.934 59.805 21.214  1.00 22.31 ?  22   PRO A CB  1 
ATOM   132  C CG  . PRO A 1 21  ? 50.914 59.706 22.708  1.00 21.98 ?  22   PRO A CG  1 
ATOM   133  C CD  . PRO A 1 21  ? 49.600 59.080 23.049  1.00 19.79 ?  22   PRO A CD  1 
ATOM   134  N N   . GLY A 1 22  ? 48.544 58.114 19.611  1.00 18.31 ?  23   GLY A N   1 
ATOM   135  C CA  . GLY A 1 22  ? 48.154 57.391 18.414  1.00 18.53 ?  23   GLY A CA  1 
ATOM   136  C C   . GLY A 1 22  ? 47.005 58.014 17.649  1.00 22.84 ?  23   GLY A C   1 
ATOM   137  O O   . GLY A 1 22  ? 46.724 57.580 16.526  1.00 16.52 ?  23   GLY A O   1 
ATOM   138  N N   . TRP A 1 23  ? 46.342 59.012 18.224  1.00 10.56 ?  24   TRP A N   1 
ATOM   139  C CA  . TRP A 1 23  ? 45.227 59.682 17.572  1.00 12.83 ?  24   TRP A CA  1 
ATOM   140  C C   . TRP A 1 23  ? 45.723 60.908 16.820  1.00 12.36 ?  24   TRP A C   1 
ATOM   141  O O   . TRP A 1 23  ? 46.422 61.753 17.388  1.00 16.42 ?  24   TRP A O   1 
ATOM   142  C CB  . TRP A 1 23  ? 44.169 60.095 18.595  1.00 11.57 ?  24   TRP A CB  1 
ATOM   143  C CG  . TRP A 1 23  ? 43.312 58.969 19.054  1.00 9.69  ?  24   TRP A CG  1 
ATOM   144  C CD1 . TRP A 1 23  ? 43.546 58.137 20.108  1.00 9.81  ?  24   TRP A CD1 1 
ATOM   145  C CD2 . TRP A 1 23  ? 42.079 58.537 18.467  1.00 8.22  ?  24   TRP A CD2 1 
ATOM   146  N NE1 . TRP A 1 23  ? 42.533 57.217 20.217  1.00 7.57  ?  24   TRP A NE1 1 
ATOM   147  C CE2 . TRP A 1 23  ? 41.620 57.440 19.220  1.00 8.00  ?  24   TRP A CE2 1 
ATOM   148  C CE3 . TRP A 1 23  ? 41.317 58.974 17.377  1.00 7.91  ?  24   TRP A CE3 1 
ATOM   149  C CZ2 . TRP A 1 23  ? 40.433 56.772 18.921  1.00 9.26  ?  24   TRP A CZ2 1 
ATOM   150  C CZ3 . TRP A 1 23  ? 40.142 58.310 17.080  1.00 8.39  ?  24   TRP A CZ3 1 
ATOM   151  C CH2 . TRP A 1 23  ? 39.710 57.221 17.849  1.00 8.28  ?  24   TRP A CH2 1 
ATOM   152  N N   . SER A 1 24  ? 45.364 60.998 15.545  1.00 10.72 ?  25   SER A N   1 
ATOM   153  C CA  . SER A 1 24  ? 45.599 62.203 14.769  1.00 12.46 ?  25   SER A CA  1 
ATOM   154  C C   . SER A 1 24  ? 44.435 63.168 14.955  1.00 12.47 ?  25   SER A C   1 
ATOM   155  O O   . SER A 1 24  ? 43.286 62.757 15.141  1.00 11.00 ?  25   SER A O   1 
ATOM   156  C CB  . SER A 1 24  ? 45.773 61.873 13.285  1.00 15.04 ?  25   SER A CB  1 
ATOM   157  O OG  . SER A 1 24  ? 46.992 61.190 13.053  1.00 19.60 ?  25   SER A OG  1 
ATOM   158  N N   . HIS A 1 25  ? 44.746 64.460 14.912  1.00 7.46  ?  26   HIS A N   1 
ATOM   159  C CA  . HIS A 1 25  ? 43.751 65.517 15.026  1.00 8.64  ?  26   HIS A CA  1 
ATOM   160  C C   . HIS A 1 25  ? 43.711 66.310 13.729  1.00 8.84  ?  26   HIS A C   1 
ATOM   161  O O   . HIS A 1 25  ? 44.756 66.726 13.218  1.00 9.58  ?  26   HIS A O   1 
ATOM   162  C CB  . HIS A 1 25  ? 44.059 66.453 16.199  1.00 9.87  ?  26   HIS A CB  1 
ATOM   163  C CG  . HIS A 1 25  ? 43.970 65.796 17.541  1.00 11.40 ?  26   HIS A CG  1 
ATOM   164  N ND1 . HIS A 1 25  ? 42.999 66.120 18.465  1.00 8.95  ?  26   HIS A ND1 1 
ATOM   165  C CD2 . HIS A 1 25  ? 44.736 64.841 18.120  1.00 13.60 ?  26   HIS A CD2 1 
ATOM   166  C CE1 . HIS A 1 25  ? 43.168 65.390 19.553  1.00 18.26 ?  26   HIS A CE1 1 
ATOM   167  N NE2 . HIS A 1 25  ? 44.214 64.605 19.369  1.00 14.49 ?  26   HIS A NE2 1 
ATOM   168  N N   . SER A 1 26  ? 42.509 66.517 13.200  1.00 7.29  ?  27   SER A N   1 
ATOM   169  C CA  . SER A 1 26  ? 42.299 67.415 12.077  1.00 12.32 ?  27   SER A CA  1 
ATOM   170  C C   . SER A 1 26  ? 41.333 68.515 12.492  1.00 12.37 ?  27   SER A C   1 
ATOM   171  O O   . SER A 1 26  ? 40.441 68.301 13.318  1.00 12.81 ?  27   SER A O   1 
ATOM   172  C CB  . SER A 1 26  ? 41.753 66.676 10.848  1.00 11.05 ?  27   SER A CB  1 
ATOM   173  O OG  . SER A 1 26  ? 40.365 66.428 10.975  1.00 16.20 ?  27   SER A OG  1 
ATOM   174  N N   . CYS A 1 27  ? 41.530 69.699 11.922  1.00 8.19  ?  28   CYS A N   1 
ATOM   175  C CA  . CYS A 1 27  ? 40.669 70.847 12.170  1.00 10.49 ?  28   CYS A CA  1 
ATOM   176  C C   . CYS A 1 27  ? 40.236 71.413 10.829  1.00 10.01 ?  28   CYS A C   1 
ATOM   177  O O   . CYS A 1 27  ? 41.082 71.763 10.000  1.00 8.56  ?  28   CYS A O   1 
ATOM   178  C CB  . CYS A 1 27  ? 41.384 71.914 13.003  1.00 8.76  ?  28   CYS A CB  1 
ATOM   179  S SG  . CYS A 1 27  ? 41.696 71.432 14.716  1.00 14.24 ?  28   CYS A SG  1 
ATOM   180  N N   . HIS A 1 28  ? 38.928 71.493 10.613  1.00 6.70  ?  29   HIS A N   1 
ATOM   181  C CA  . HIS A 1 28  ? 38.377 72.039 9.386   1.00 12.61 ?  29   HIS A CA  1 
ATOM   182  C C   . HIS A 1 28  ? 37.324 73.082 9.726   1.00 11.36 ?  29   HIS A C   1 
ATOM   183  O O   . HIS A 1 28  ? 36.649 72.997 10.755  1.00 12.18 ?  29   HIS A O   1 
ATOM   184  C CB  . HIS A 1 28  ? 37.776 70.937 8.502   1.00 13.57 ?  29   HIS A CB  1 
ATOM   185  C CG  . HIS A 1 28  ? 38.793 69.974 7.972   1.00 12.46 ?  29   HIS A CG  1 
ATOM   186  N ND1 . HIS A 1 28  ? 39.424 70.150 6.760   1.00 16.71 ?  29   HIS A ND1 1 
ATOM   187  C CD2 . HIS A 1 28  ? 39.297 68.832 8.496   1.00 15.00 ?  29   HIS A CD2 1 
ATOM   188  C CE1 . HIS A 1 28  ? 40.270 69.155 6.557   1.00 17.10 ?  29   HIS A CE1 1 
ATOM   189  N NE2 . HIS A 1 28  ? 40.212 68.342 7.596   1.00 16.71 ?  29   HIS A NE2 1 
ATOM   190  N N   . ALA A 1 29  ? 37.195 74.075 8.852   1.00 7.81  ?  30   ALA A N   1 
ATOM   191  C CA  . ALA A 1 29  ? 36.291 75.194 9.065   1.00 10.20 ?  30   ALA A CA  1 
ATOM   192  C C   . ALA A 1 29  ? 35.238 75.217 7.969   1.00 9.89  ?  30   ALA A C   1 
ATOM   193  O O   . ALA A 1 29  ? 35.568 75.118 6.782   1.00 10.38 ?  30   ALA A O   1 
ATOM   194  C CB  . ALA A 1 29  ? 37.055 76.520 9.094   1.00 12.11 ?  30   ALA A CB  1 
ATOM   195  N N   . MET A 1 30  ? 33.976 75.341 8.368   1.00 8.87  ?  31   MET A N   1 
ATOM   196  C CA  . MET A 1 30  ? 32.882 75.602 7.443   1.00 8.49  ?  31   MET A CA  1 
ATOM   197  C C   . MET A 1 30  ? 32.565 77.091 7.501   1.00 11.22 ?  31   MET A C   1 
ATOM   198  O O   . MET A 1 30  ? 32.001 77.578 8.487   1.00 11.25 ?  31   MET A O   1 
ATOM   199  C CB  . MET A 1 30  ? 31.649 74.768 7.782   1.00 10.63 ?  31   MET A CB  1 
ATOM   200  C CG  . MET A 1 30  ? 30.390 75.273 7.097   1.00 19.61 ?  31   MET A CG  1 
ATOM   201  S SD  . MET A 1 30  ? 29.067 74.061 7.038   1.00 29.16 ?  31   MET A SD  1 
ATOM   202  C CE  . MET A 1 30  ? 27.635 75.130 6.916   1.00 23.70 ?  31   MET A CE  1 
ATOM   203  N N   . LEU A 1 31  ? 32.940 77.813 6.452   1.00 10.36 ?  32   LEU A N   1 
ATOM   204  C CA  . LEU A 1 31  ? 32.671 79.238 6.342   1.00 10.26 ?  32   LEU A CA  1 
ATOM   205  C C   . LEU A 1 31  ? 31.438 79.435 5.475   1.00 17.10 ?  32   LEU A C   1 
ATOM   206  O O   . LEU A 1 31  ? 31.323 78.824 4.407   1.00 9.34  ?  32   LEU A O   1 
ATOM   207  C CB  . LEU A 1 31  ? 33.870 79.970 5.743   1.00 8.96  ?  32   LEU A CB  1 
ATOM   208  C CG  . LEU A 1 31  ? 35.204 79.615 6.399   1.00 13.33 ?  32   LEU A CG  1 
ATOM   209  C CD1 . LEU A 1 31  ? 36.361 79.972 5.484   1.00 18.00 ?  32   LEU A CD1 1 
ATOM   210  C CD2 . LEU A 1 31  ? 35.332 80.309 7.748   1.00 10.64 ?  32   LEU A CD2 1 
ATOM   211  N N   . TYR A 1 32  ? 30.516 80.275 5.937   1.00 10.76 ?  33   TYR A N   1 
ATOM   212  C CA  . TYR A 1 32  ? 29.268 80.464 5.218   1.00 10.84 ?  33   TYR A CA  1 
ATOM   213  C C   . TYR A 1 32  ? 28.786 81.895 5.400   1.00 13.31 ?  33   TYR A C   1 
ATOM   214  O O   . TYR A 1 32  ? 29.300 82.653 6.225   1.00 12.47 ?  33   TYR A O   1 
ATOM   215  C CB  . TYR A 1 32  ? 28.201 79.459 5.670   1.00 11.31 ?  33   TYR A CB  1 
ATOM   216  C CG  . TYR A 1 32  ? 27.730 79.625 7.097   1.00 13.74 ?  33   TYR A CG  1 
ATOM   217  C CD1 . TYR A 1 32  ? 28.483 79.142 8.161   1.00 12.69 ?  33   TYR A CD1 1 
ATOM   218  C CD2 . TYR A 1 32  ? 26.521 80.248 7.380   1.00 16.21 ?  33   TYR A CD2 1 
ATOM   219  C CE1 . TYR A 1 32  ? 28.050 79.285 9.468   1.00 15.85 ?  33   TYR A CE1 1 
ATOM   220  C CE2 . TYR A 1 32  ? 26.080 80.395 8.682   1.00 15.27 ?  33   TYR A CE2 1 
ATOM   221  C CZ  . TYR A 1 32  ? 26.846 79.912 9.721   1.00 21.81 ?  33   TYR A CZ  1 
ATOM   222  O OH  . TYR A 1 32  ? 26.407 80.059 11.017  1.00 18.78 ?  33   TYR A OH  1 
ATOM   223  N N   . ALA A 1 33  ? 27.784 82.253 4.603   1.00 13.87 ?  34   ALA A N   1 
ATOM   224  C CA  . ALA A 1 33  ? 27.226 83.594 4.619   1.00 15.22 ?  34   ALA A CA  1 
ATOM   225  C C   . ALA A 1 33  ? 25.805 83.528 4.090   1.00 16.70 ?  34   ALA A C   1 
ATOM   226  O O   . ALA A 1 33  ? 25.516 82.750 3.177   1.00 12.89 ?  34   ALA A O   1 
ATOM   227  C CB  . ALA A 1 33  ? 28.062 84.558 3.768   1.00 16.10 ?  34   ALA A CB  1 
ATOM   228  N N   . ALA A 1 34  ? 24.922 84.335 4.674   1.00 14.18 ?  35   ALA A N   1 
ATOM   229  C CA  . ALA A 1 34  ? 23.611 84.531 4.077   1.00 16.32 ?  35   ALA A CA  1 
ATOM   230  C C   . ALA A 1 34  ? 23.777 85.132 2.689   1.00 14.56 ?  35   ALA A C   1 
ATOM   231  O O   . ALA A 1 34  ? 24.570 86.056 2.486   1.00 13.64 ?  35   ALA A O   1 
ATOM   232  C CB  . ALA A 1 34  ? 22.751 85.440 4.956   1.00 16.95 ?  35   ALA A CB  1 
ATOM   233  N N   . ASN A 1 35  ? 23.047 84.589 1.725   1.00 11.98 ?  36   ASN A N   1 
ATOM   234  C CA  . ASN A 1 35  ? 23.152 85.024 0.333   1.00 14.46 ?  36   ASN A CA  1 
ATOM   235  C C   . ASN A 1 35  ? 21.794 85.499 -0.158  1.00 12.59 ?  36   ASN A C   1 
ATOM   236  O O   . ASN A 1 35  ? 20.910 84.663 -0.427  1.00 17.54 ?  36   ASN A O   1 
ATOM   237  C CB  . ASN A 1 35  ? 23.675 83.889 -0.549  1.00 11.52 ?  36   ASN A CB  1 
ATOM   238  C CG  . ASN A 1 35  ? 24.191 84.381 -1.891  1.00 26.55 ?  36   ASN A CG  1 
ATOM   239  O OD1 . ASN A 1 35  ? 23.795 85.443 -2.374  1.00 19.67 ?  36   ASN A OD1 1 
ATOM   240  N ND2 . ASN A 1 35  ? 25.084 83.607 -2.499  1.00 15.17 ?  36   ASN A ND2 1 
ATOM   241  N N   . PRO A 1 36  ? 21.572 86.810 -0.292  1.00 18.44 ?  37   PRO A N   1 
ATOM   242  C CA  . PRO A 1 36  ? 20.280 87.293 -0.798  1.00 20.52 ?  37   PRO A CA  1 
ATOM   243  C C   . PRO A 1 36  ? 20.151 87.236 -2.310  1.00 23.36 ?  37   PRO A C   1 
ATOM   244  O O   . PRO A 1 36  ? 19.065 87.526 -2.831  1.00 24.83 ?  37   PRO A O   1 
ATOM   245  C CB  . PRO A 1 36  ? 20.240 88.742 -0.299  1.00 17.44 ?  37   PRO A CB  1 
ATOM   246  C CG  . PRO A 1 36  ? 21.675 89.156 -0.301  1.00 24.62 ?  37   PRO A CG  1 
ATOM   247  C CD  . PRO A 1 36  ? 22.482 87.919 0.048   1.00 18.21 ?  37   PRO A CD  1 
ATOM   248  N N   . GLY A 1 37  ? 21.214 86.876 -3.028  1.00 19.45 ?  38   GLY A N   1 
ATOM   249  C CA  . GLY A 1 37  ? 21.139 86.808 -4.471  1.00 23.11 ?  38   GLY A CA  1 
ATOM   250  C C   . GLY A 1 37  ? 20.204 85.717 -4.953  1.00 26.00 ?  38   GLY A C   1 
ATOM   251  O O   . GLY A 1 37  ? 19.849 84.786 -4.228  1.00 16.64 ?  38   GLY A O   1 
ATOM   252  N N   . GLN A 1 38  ? 19.794 85.842 -6.213  1.00 11.77 ?  39   GLN A N   1 
ATOM   253  C CA  . GLN A 1 38  ? 18.887 84.891 -6.843  1.00 13.34 ?  39   GLN A CA  1 
ATOM   254  C C   . GLN A 1 38  ? 19.507 84.404 -8.142  1.00 15.84 ?  39   GLN A C   1 
ATOM   255  O O   . GLN A 1 38  ? 19.840 85.214 -9.014  1.00 19.16 ?  39   GLN A O   1 
ATOM   256  C CB  . GLN A 1 38  ? 17.515 85.521 -7.102  1.00 18.24 ?  39   GLN A CB  1 
ATOM   257  C CG  . GLN A 1 38  ? 16.913 86.204 -5.885  1.00 31.32 ?  39   GLN A CG  1 
ATOM   258  C CD  . GLN A 1 38  ? 15.408 86.047 -5.816  1.00 30.47 ?  39   GLN A CD  1 
ATOM   259  O OE1 . GLN A 1 38  ? 14.761 85.721 -6.811  1.00 40.95 ?  39   GLN A OE1 1 
ATOM   260  N NE2 . GLN A 1 38  ? 14.843 86.273 -4.635  1.00 35.75 ?  39   GLN A NE2 1 
ATOM   261  N N   . LEU A 1 39  ? 19.664 83.088 -8.267  1.00 12.04 ?  40   LEU A N   1 
ATOM   262  C CA  . LEU A 1 39  ? 20.213 82.505 -9.483  1.00 17.10 ?  40   LEU A CA  1 
ATOM   263  C C   . LEU A 1 39  ? 19.256 82.735 -10.646 1.00 15.57 ?  40   LEU A C   1 
ATOM   264  O O   . LEU A 1 39  ? 18.056 82.464 -10.536 1.00 14.05 ?  40   LEU A O   1 
ATOM   265  C CB  . LEU A 1 39  ? 20.469 81.012 -9.284  1.00 11.71 ?  40   LEU A CB  1 
ATOM   266  C CG  . LEU A 1 39  ? 21.110 80.251 -10.447 1.00 18.07 ?  40   LEU A CG  1 
ATOM   267  C CD1 . LEU A 1 39  ? 22.527 80.743 -10.709 1.00 16.12 ?  40   LEU A CD1 1 
ATOM   268  C CD2 . LEU A 1 39  ? 21.102 78.757 -10.166 1.00 10.58 ?  40   LEU A CD2 1 
ATOM   269  N N   . PHE A 1 40  ? 19.791 83.243 -11.758 1.00 12.02 ?  41   PHE A N   1 
ATOM   270  C CA  . PHE A 1 40  ? 19.000 83.686 -12.905 1.00 16.22 ?  41   PHE A CA  1 
ATOM   271  C C   . PHE A 1 40  ? 17.994 84.763 -12.520 1.00 17.04 ?  41   PHE A C   1 
ATOM   272  O O   . PHE A 1 40  ? 17.049 85.031 -13.270 1.00 14.96 ?  41   PHE A O   1 
ATOM   273  C CB  . PHE A 1 40  ? 18.268 82.516 -13.578 1.00 13.68 ?  41   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 40  ? 19.088 81.261 -13.690 1.00 19.69 ?  41   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 40  ? 20.362 81.291 -14.230 1.00 16.83 ?  41   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 40  ? 18.576 80.049 -13.256 1.00 19.94 ?  41   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 40  ? 21.113 80.132 -14.334 1.00 24.85 ?  41   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 40  ? 19.322 78.887 -13.357 1.00 20.35 ?  41   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 40  ? 20.591 78.929 -13.897 1.00 17.73 ?  41   PHE A CZ  1 
ATOM   280  N N   . GLY A 1 41  ? 18.184 85.391 -11.360 1.00 15.41 ?  42   GLY A N   1 
ATOM   281  C CA  . GLY A 1 41  ? 17.186 86.282 -10.805 1.00 16.18 ?  42   GLY A CA  1 
ATOM   282  C C   . GLY A 1 41  ? 15.919 85.602 -10.343 1.00 17.22 ?  42   GLY A C   1 
ATOM   283  O O   . GLY A 1 41  ? 14.928 86.289 -10.079 1.00 15.15 ?  42   GLY A O   1 
ATOM   284  N N   . ARG A 1 42  ? 15.919 84.273 -10.223 1.00 9.74  ?  43   ARG A N   1 
ATOM   285  C CA  . ARG A 1 42  ? 14.686 83.535 -9.974  1.00 14.04 ?  43   ARG A CA  1 
ATOM   286  C C   . ARG A 1 42  ? 14.781 82.600 -8.773  1.00 17.43 ?  43   ARG A C   1 
ATOM   287  O O   . ARG A 1 42  ? 13.783 82.378 -8.081  1.00 17.13 ?  43   ARG A O   1 
ATOM   288  C CB  . ARG A 1 42  ? 14.294 82.733 -11.219 1.00 15.28 ?  43   ARG A CB  1 
ATOM   289  C CG  . ARG A 1 42  ? 14.211 83.560 -12.493 1.00 16.89 ?  43   ARG A CG  1 
ATOM   290  C CD  . ARG A 1 42  ? 13.525 82.795 -13.616 1.00 19.37 ?  43   ARG A CD  1 
ATOM   291  N NE  . ARG A 1 42  ? 14.339 81.696 -14.130 1.00 17.78 ?  43   ARG A NE  1 
ATOM   292  C CZ  . ARG A 1 42  ? 15.118 81.785 -15.204 1.00 24.17 ?  43   ARG A CZ  1 
ATOM   293  N NH1 . ARG A 1 42  ? 15.196 82.928 -15.875 1.00 13.58 ?  43   ARG A NH1 1 
ATOM   294  N NH2 . ARG A 1 42  ? 15.821 80.735 -15.609 1.00 18.02 ?  43   ARG A NH2 1 
ATOM   295  N N   . ILE A 1 43  ? 15.960 82.043 -8.514  1.00 12.86 ?  44   ILE A N   1 
ATOM   296  C CA  . ILE A 1 43  ? 16.124 80.986 -7.526  1.00 16.00 ?  44   ILE A CA  1 
ATOM   297  C C   . ILE A 1 43  ? 16.839 81.574 -6.308  1.00 18.45 ?  44   ILE A C   1 
ATOM   298  O O   . ILE A 1 43  ? 18.043 81.859 -6.380  1.00 11.67 ?  44   ILE A O   1 
ATOM   299  C CB  . ILE A 1 43  ? 16.900 79.791 -8.094  1.00 16.25 ?  44   ILE A CB  1 
ATOM   300  C CG1 . ILE A 1 43  ? 16.184 79.220 -9.319  1.00 13.02 ?  44   ILE A CG1 1 
ATOM   301  C CG2 . ILE A 1 43  ? 17.075 78.720 -7.029  1.00 13.49 ?  44   ILE A CG2 1 
ATOM   302  C CD1 . ILE A 1 43  ? 16.927 78.073 -9.977  1.00 15.29 ?  44   ILE A CD1 1 
ATOM   303  N N   . PRO A 1 44  ? 16.157 81.748 -5.177  1.00 15.73 ?  45   PRO A N   1 
ATOM   304  C CA  . PRO A 1 44  ? 16.835 82.257 -3.976  1.00 14.63 ?  45   PRO A CA  1 
ATOM   305  C C   . PRO A 1 44  ? 17.944 81.314 -3.528  1.00 14.93 ?  45   PRO A C   1 
ATOM   306  O O   . PRO A 1 44  ? 17.750 80.101 -3.419  1.00 16.04 ?  45   PRO A O   1 
ATOM   307  C CB  . PRO A 1 44  ? 15.707 82.339 -2.939  1.00 18.92 ?  45   PRO A CB  1 
ATOM   308  C CG  . PRO A 1 44  ? 14.437 82.335 -3.737  1.00 25.09 ?  45   PRO A CG  1 
ATOM   309  C CD  . PRO A 1 44  ? 14.725 81.498 -4.943  1.00 17.72 ?  45   PRO A CD  1 
ATOM   310  N N   . MET A 1 45  ? 19.120 81.883 -3.271  1.00 14.79 ?  46   MET A N   1 
ATOM   311  C CA  . MET A 1 45  ? 20.282 81.081 -2.913  1.00 18.38 ?  46   MET A CA  1 
ATOM   312  C C   . MET A 1 45  ? 20.414 80.846 -1.416  1.00 18.04 ?  46   MET A C   1 
ATOM   313  O O   . MET A 1 45  ? 21.146 79.933 -1.013  1.00 18.26 ?  46   MET A O   1 
ATOM   314  C CB  . MET A 1 45  ? 21.555 81.739 -3.443  1.00 16.88 ?  46   MET A CB  1 
ATOM   315  C CG  . MET A 1 45  ? 21.649 81.724 -4.954  1.00 22.27 ?  46   MET A CG  1 
ATOM   316  S SD  . MET A 1 45  ? 23.205 82.382 -5.555  1.00 38.54 ?  46   MET A SD  1 
ATOM   317  C CE  . MET A 1 45  ? 22.599 83.457 -6.841  1.00 37.46 ?  46   MET A CE  1 
ATOM   318  N N   . ARG A 1 46  ? 19.740 81.651 -0.591  1.00 10.98 ?  47   ARG A N   1 
ATOM   319  C CA  . ARG A 1 46  ? 19.676 81.457 0.855   1.00 14.32 ?  47   ARG A CA  1 
ATOM   320  C C   . ARG A 1 46  ? 21.042 81.590 1.521   1.00 17.31 ?  47   ARG A C   1 
ATOM   321  O O   . ARG A 1 46  ? 21.300 82.578 2.216   1.00 12.67 ?  47   ARG A O   1 
ATOM   322  C CB  . ARG A 1 46  ? 19.045 80.098 1.174   1.00 16.20 ?  47   ARG A CB  1 
ATOM   323  C CG  . ARG A 1 46  ? 17.691 79.890 0.509   1.00 22.56 ?  47   ARG A CG  1 
ATOM   324  C CD  . ARG A 1 46  ? 16.945 78.720 1.117   1.00 16.00 ?  47   ARG A CD  1 
ATOM   325  N NE  . ARG A 1 46  ? 16.841 78.846 2.567   1.00 29.04 ?  47   ARG A NE  1 
ATOM   326  C CZ  . ARG A 1 46  ? 17.381 77.994 3.431   1.00 31.55 ?  47   ARG A CZ  1 
ATOM   327  N NH1 . ARG A 1 46  ? 18.063 76.945 2.992   1.00 27.40 ?  47   ARG A NH1 1 
ATOM   328  N NH2 . ARG A 1 46  ? 17.237 78.189 4.735   1.00 20.66 ?  47   ARG A NH2 1 
ATOM   329  N N   . PHE A 1 47  ? 21.921 80.608 1.327   1.00 9.72  ?  48   PHE A N   1 
ATOM   330  C CA  . PHE A 1 47  ? 23.248 80.638 1.928   1.00 10.59 ?  48   PHE A CA  1 
ATOM   331  C C   . PHE A 1 47  ? 24.283 80.167 0.917   1.00 12.31 ?  48   PHE A C   1 
ATOM   332  O O   . PHE A 1 47  ? 23.971 79.454 -0.040  1.00 16.94 ?  48   PHE A O   1 
ATOM   333  C CB  . PHE A 1 47  ? 23.338 79.756 3.182   1.00 15.39 ?  48   PHE A CB  1 
ATOM   334  C CG  . PHE A 1 47  ? 22.477 80.215 4.321   1.00 20.55 ?  48   PHE A CG  1 
ATOM   335  C CD1 . PHE A 1 47  ? 21.194 79.719 4.478   1.00 21.75 ?  48   PHE A CD1 1 
ATOM   336  C CD2 . PHE A 1 47  ? 22.957 81.127 5.248   1.00 14.73 ?  48   PHE A CD2 1 
ATOM   337  C CE1 . PHE A 1 47  ? 20.399 80.133 5.530   1.00 22.04 ?  48   PHE A CE1 1 
ATOM   338  C CE2 . PHE A 1 47  ? 22.167 81.545 6.303   1.00 17.34 ?  48   PHE A CE2 1 
ATOM   339  C CZ  . PHE A 1 47  ? 20.886 81.046 6.443   1.00 13.24 ?  48   PHE A CZ  1 
ATOM   340  N N   . SER A 1 48  ? 25.529 80.568 1.154   1.00 11.66 ?  49   SER A N   1 
ATOM   341  C CA  . SER A 1 48  ? 26.679 80.085 0.402   1.00 15.46 ?  49   SER A CA  1 
ATOM   342  C C   . SER A 1 48  ? 27.689 79.507 1.381   1.00 16.99 ?  49   SER A C   1 
ATOM   343  O O   . SER A 1 48  ? 28.033 80.155 2.374   1.00 13.01 ?  49   SER A O   1 
ATOM   344  C CB  . SER A 1 48  ? 27.317 81.203 -0.426  1.00 20.04 ?  49   SER A CB  1 
ATOM   345  O OG  . SER A 1 48  ? 26.526 81.510 -1.562  1.00 21.00 ?  49   SER A OG  1 
ATOM   346  N N   . VAL A 1 49  ? 28.150 78.289 1.108   1.00 13.47 ?  50   VAL A N   1 
ATOM   347  C CA  . VAL A 1 49  ? 29.101 77.584 1.959   1.00 12.02 ?  50   VAL A CA  1 
ATOM   348  C C   . VAL A 1 49  ? 30.337 77.260 1.134   1.00 12.28 ?  50   VAL A C   1 
ATOM   349  O O   . VAL A 1 49  ? 30.227 76.869 -0.033  1.00 13.37 ?  50   VAL A O   1 
ATOM   350  C CB  . VAL A 1 49  ? 28.486 76.298 2.552   1.00 16.67 ?  50   VAL A CB  1 
ATOM   351  C CG1 . VAL A 1 49  ? 29.494 75.576 3.441   1.00 9.72  ?  50   VAL A CG1 1 
ATOM   352  C CG2 . VAL A 1 49  ? 27.221 76.623 3.327   1.00 15.66 ?  50   VAL A CG2 1 
ATOM   353  N N   . LEU A 1 50  ? 31.512 77.420 1.739   1.00 8.80  ?  51   LEU A N   1 
ATOM   354  C CA  . LEU A 1 50  ? 32.775 77.193 1.047   1.00 10.89 ?  51   LEU A CA  1 
ATOM   355  C C   . LEU A 1 50  ? 33.268 75.773 1.303   1.00 13.32 ?  51   LEU A C   1 
ATOM   356  O O   . LEU A 1 50  ? 33.419 75.356 2.456   1.00 7.77  ?  51   LEU A O   1 
ATOM   357  C CB  . LEU A 1 50  ? 33.830 78.207 1.488   1.00 12.12 ?  51   LEU A CB  1 
ATOM   358  C CG  . LEU A 1 50  ? 33.671 79.642 0.982   1.00 17.35 ?  51   LEU A CG  1 
ATOM   359  C CD1 . LEU A 1 50  ? 34.830 80.506 1.458   1.00 12.29 ?  51   LEU A CD1 1 
ATOM   360  C CD2 . LEU A 1 50  ? 33.561 79.673 -0.537  1.00 14.72 ?  51   LEU A CD2 1 
ATOM   361  N N   . MET A 1 51  ? 33.504 75.037 0.225   1.00 10.28 ?  52   MET A N   1 
ATOM   362  C CA  . MET A 1 51  ? 34.257 73.792 0.235   1.00 10.93 ?  52   MET A CA  1 
ATOM   363  C C   . MET A 1 51  ? 35.387 73.924 -0.781  1.00 10.48 ?  52   MET A C   1 
ATOM   364  O O   . MET A 1 51  ? 35.572 74.977 -1.395  1.00 8.95  ?  52   MET A O   1 
ATOM   365  C CB  . MET A 1 51  ? 33.345 72.596 -0.061  1.00 9.54  ?  52   MET A CB  1 
ATOM   366  C CG  . MET A 1 51  ? 32.241 72.420 0.976   1.00 7.09  ?  52   MET A CG  1 
ATOM   367  S SD  . MET A 1 51  ? 31.424 70.810 0.976   1.00 9.24  ?  52   MET A SD  1 
ATOM   368  C CE  . MET A 1 51  ? 32.699 69.763 1.678   1.00 9.38  ?  52   MET A CE  1 
ATOM   369  N N   . GLN A 1 52  ? 36.157 72.855 -0.958  1.00 9.79  ?  53   GLN A N   1 
ATOM   370  C CA  . GLN A 1 52  ? 37.307 72.937 -1.845  1.00 8.15  ?  53   GLN A CA  1 
ATOM   371  C C   . GLN A 1 52  ? 37.584 71.581 -2.472  1.00 9.62  ?  53   GLN A C   1 
ATOM   372  O O   . GLN A 1 52  ? 37.299 70.535 -1.883  1.00 8.10  ?  53   GLN A O   1 
ATOM   373  C CB  . GLN A 1 52  ? 38.558 73.431 -1.106  1.00 9.05  ?  53   GLN A CB  1 
ATOM   374  C CG  . GLN A 1 52  ? 39.050 72.483 -0.023  1.00 13.16 ?  53   GLN A CG  1 
ATOM   375  C CD  . GLN A 1 52  ? 40.148 73.090 0.829   1.00 20.18 ?  53   GLN A CD  1 
ATOM   376  O OE1 . GLN A 1 52  ? 40.228 74.309 0.984   1.00 16.49 ?  53   GLN A OE1 1 
ATOM   377  N NE2 . GLN A 1 52  ? 41.003 72.241 1.386   1.00 14.54 ?  53   GLN A NE2 1 
ATOM   378  N N   . MET A 1 53  ? 38.138 71.619 -3.680  1.00 5.69  ?  54   MET A N   1 
ATOM   379  C CA  . MET A 1 53  ? 38.668 70.425 -4.321  1.00 11.18 ?  54   MET A CA  1 
ATOM   380  C C   . MET A 1 53  ? 40.077 70.183 -3.798  1.00 9.48  ?  54   MET A C   1 
ATOM   381  O O   . MET A 1 53  ? 40.932 71.073 -3.870  1.00 9.14  ?  54   MET A O   1 
ATOM   382  C CB  . MET A 1 53  ? 38.668 70.588 -5.840  1.00 11.18 ?  54   MET A CB  1 
ATOM   383  C CG  . MET A 1 53  ? 39.297 69.424 -6.592  1.00 15.87 ?  54   MET A CG  1 
ATOM   384  S SD  . MET A 1 53  ? 38.351 67.900 -6.436  1.00 18.71 ?  54   MET A SD  1 
ATOM   385  C CE  . MET A 1 53  ? 36.845 68.342 -7.304  1.00 12.42 ?  54   MET A CE  1 
ATOM   386  N N   . ARG A 1 54  ? 40.315 68.995 -3.258  1.00 8.35  ?  55   ARG A N   1 
ATOM   387  C CA  . ARG A 1 54  ? 41.597 68.675 -2.652  1.00 11.63 ?  55   ARG A CA  1 
ATOM   388  C C   . ARG A 1 54  ? 42.531 68.017 -3.664  1.00 12.53 ?  55   ARG A C   1 
ATOM   389  O O   . ARG A 1 54  ? 42.125 67.601 -4.751  1.00 9.02  ?  55   ARG A O   1 
ATOM   390  C CB  . ARG A 1 54  ? 41.401 67.758 -1.445  1.00 14.83 ?  55   ARG A CB  1 
ATOM   391  C CG  . ARG A 1 54  ? 40.462 68.302 -0.382  1.00 14.23 ?  55   ARG A CG  1 
ATOM   392  C CD  . ARG A 1 54  ? 39.786 67.163 0.354   1.00 12.34 ?  55   ARG A CD  1 
ATOM   393  N NE  . ARG A 1 54  ? 40.678 66.018 0.512   1.00 8.94  ?  55   ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 54  ? 41.416 65.789 1.594   1.00 19.53 ?  55   ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 54  ? 41.367 66.624 2.622   1.00 18.53 ?  55   ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 54  ? 42.202 64.723 1.648   1.00 14.81 ?  55   ARG A NH2 1 
ATOM   397  N N   . PHE A 1 55  ? 43.806 67.918 -3.277  1.00 14.97 ?  56   PHE A N   1 
ATOM   398  C CA  . PHE A 1 55  ? 44.815 67.303 -4.134  1.00 12.38 ?  56   PHE A CA  1 
ATOM   399  C C   . PHE A 1 55  ? 44.440 65.881 -4.534  1.00 13.39 ?  56   PHE A C   1 
ATOM   400  O O   . PHE A 1 55  ? 44.804 65.428 -5.625  1.00 15.32 ?  56   PHE A O   1 
ATOM   401  C CB  . PHE A 1 55  ? 46.168 67.301 -3.422  1.00 15.55 ?  56   PHE A CB  1 
ATOM   402  C CG  . PHE A 1 55  ? 46.182 66.482 -2.160  1.00 18.05 ?  56   PHE A CG  1 
ATOM   403  C CD1 . PHE A 1 55  ? 45.785 67.038 -0.955  1.00 13.01 ?  56   PHE A CD1 1 
ATOM   404  C CD2 . PHE A 1 55  ? 46.581 65.155 -2.180  1.00 14.86 ?  56   PHE A CD2 1 
ATOM   405  C CE1 . PHE A 1 55  ? 45.788 66.289 0.206   1.00 14.90 ?  56   PHE A CE1 1 
ATOM   406  C CE2 . PHE A 1 55  ? 46.585 64.399 -1.023  1.00 20.08 ?  56   PHE A CE2 1 
ATOM   407  C CZ  . PHE A 1 55  ? 46.189 64.967 0.172   1.00 15.49 ?  56   PHE A CZ  1 
ATOM   408  N N   . ASP A 1 56  ? 43.726 65.161 -3.670  1.00 9.19  ?  57   ASP A N   1 
ATOM   409  C CA  . ASP A 1 56  ? 43.381 63.771 -3.928  1.00 13.26 ?  57   ASP A CA  1 
ATOM   410  C C   . ASP A 1 56  ? 42.075 63.616 -4.696  1.00 13.03 ?  57   ASP A C   1 
ATOM   411  O O   . ASP A 1 56  ? 41.524 62.513 -4.733  1.00 10.26 ?  57   ASP A O   1 
ATOM   412  C CB  . ASP A 1 56  ? 43.320 62.985 -2.612  1.00 12.45 ?  57   ASP A CB  1 
ATOM   413  C CG  . ASP A 1 56  ? 42.352 63.586 -1.603  1.00 20.77 ?  57   ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 56  ? 41.678 64.585 -1.928  1.00 18.37 ?  57   ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 56  ? 42.272 63.055 -0.475  1.00 16.39 ?  57   ASP A OD2 1 
ATOM   416  N N   . GLY A 1 57  ? 41.570 64.688 -5.304  1.00 12.89 ?  58   GLY A N   1 
ATOM   417  C CA  . GLY A 1 57  ? 40.394 64.609 -6.148  1.00 8.90  ?  58   GLY A CA  1 
ATOM   418  C C   . GLY A 1 57  ? 39.067 64.569 -5.427  1.00 8.62  ?  58   GLY A C   1 
ATOM   419  O O   . GLY A 1 57  ? 38.041 64.328 -6.073  1.00 12.09 ?  58   GLY A O   1 
ATOM   420  N N   . LEU A 1 58  ? 39.045 64.798 -4.119  1.00 8.35  ?  59   LEU A N   1 
ATOM   421  C CA  . LEU A 1 58  ? 37.821 64.756 -3.335  1.00 11.74 ?  59   LEU A CA  1 
ATOM   422  C C   . LEU A 1 58  ? 37.475 66.147 -2.819  1.00 10.79 ?  59   LEU A C   1 
ATOM   423  O O   . LEU A 1 58  ? 38.348 67.004 -2.657  1.00 7.40  ?  59   LEU A O   1 
ATOM   424  C CB  . LEU A 1 58  ? 37.954 63.793 -2.150  1.00 13.53 ?  59   LEU A CB  1 
ATOM   425  C CG  . LEU A 1 58  ? 38.338 62.345 -2.454  1.00 12.04 ?  59   LEU A CG  1 
ATOM   426  C CD1 . LEU A 1 58  ? 38.665 61.612 -1.164  1.00 11.38 ?  59   LEU A CD1 1 
ATOM   427  C CD2 . LEU A 1 58  ? 37.219 61.641 -3.200  1.00 10.50 ?  59   LEU A CD2 1 
ATOM   428  N N   . LEU A 1 59  ? 36.188 66.359 -2.561  1.00 6.55  ?  60   LEU A N   1 
ATOM   429  C CA  . LEU A 1 59  ? 35.731 67.598 -1.950  1.00 10.33 ?  60   LEU A CA  1 
ATOM   430  C C   . LEU A 1 59  ? 35.889 67.529 -0.437  1.00 10.86 ?  60   LEU A C   1 
ATOM   431  O O   . LEU A 1 59  ? 35.694 66.476 0.177   1.00 8.98  ?  60   LEU A O   1 
ATOM   432  C CB  . LEU A 1 59  ? 34.268 67.867 -2.305  1.00 3.72  ?  60   LEU A CB  1 
ATOM   433  C CG  . LEU A 1 59  ? 33.961 68.211 -3.764  1.00 8.67  ?  60   LEU A CG  1 
ATOM   434  C CD1 . LEU A 1 59  ? 32.458 68.282 -3.986  1.00 9.84  ?  60   LEU A CD1 1 
ATOM   435  C CD2 . LEU A 1 59  ? 34.625 69.520 -4.158  1.00 9.71  ?  60   LEU A CD2 1 
ATOM   436  N N   . GLY A 1 60  ? 36.244 68.661 0.161   1.00 8.07  ?  61   GLY A N   1 
ATOM   437  C CA  . GLY A 1 60  ? 36.373 68.741 1.602   1.00 8.71  ?  61   GLY A CA  1 
ATOM   438  C C   . GLY A 1 60  ? 36.326 70.185 2.048   1.00 10.10 ?  61   GLY A C   1 
ATOM   439  O O   . GLY A 1 60  ? 36.182 71.105 1.241   1.00 8.25  ?  61   GLY A O   1 
ATOM   440  N N   . PHE A 1 61  ? 36.449 70.372 3.358   1.00 9.06  ?  62   PHE A N   1 
ATOM   441  C CA  . PHE A 1 61  ? 36.480 71.711 3.923   1.00 5.95  ?  62   PHE A CA  1 
ATOM   442  C C   . PHE A 1 61  ? 37.916 72.207 4.046   1.00 11.12 ?  62   PHE A C   1 
ATOM   443  O O   . PHE A 1 61  ? 38.850 71.405 4.138   1.00 6.74  ?  62   PHE A O   1 
ATOM   444  C CB  . PHE A 1 61  ? 35.823 71.722 5.299   1.00 7.17  ?  62   PHE A CB  1 
ATOM   445  C CG  . PHE A 1 61  ? 34.324 71.671 5.256   1.00 11.24 ?  62   PHE A CG  1 
ATOM   446  C CD1 . PHE A 1 61  ? 33.600 72.713 4.701   1.00 8.97  ?  62   PHE A CD1 1 
ATOM   447  C CD2 . PHE A 1 61  ? 33.640 70.584 5.774   1.00 9.07  ?  62   PHE A CD2 1 
ATOM   448  C CE1 . PHE A 1 61  ? 32.217 72.672 4.661   1.00 8.48  ?  62   PHE A CE1 1 
ATOM   449  C CE2 . PHE A 1 61  ? 32.256 70.536 5.737   1.00 17.15 ?  62   PHE A CE2 1 
ATOM   450  C CZ  . PHE A 1 61  ? 31.545 71.583 5.180   1.00 10.32 ?  62   PHE A CZ  1 
ATOM   451  N N   . PRO A 1 62  ? 38.120 73.525 4.044   1.00 7.50  ?  63   PRO A N   1 
ATOM   452  C CA  . PRO A 1 62  ? 39.455 74.059 4.334   1.00 6.91  ?  63   PRO A CA  1 
ATOM   453  C C   . PRO A 1 62  ? 39.930 73.610 5.709   1.00 13.49 ?  63   PRO A C   1 
ATOM   454  O O   . PRO A 1 62  ? 39.140 73.470 6.644   1.00 10.02 ?  63   PRO A O   1 
ATOM   455  C CB  . PRO A 1 62  ? 39.252 75.577 4.274   1.00 12.60 ?  63   PRO A CB  1 
ATOM   456  C CG  . PRO A 1 62  ? 38.041 75.762 3.414   1.00 11.07 ?  63   PRO A CG  1 
ATOM   457  C CD  . PRO A 1 62  ? 37.158 74.589 3.711   1.00 5.00  ?  63   PRO A CD  1 
ATOM   458  N N   . GLY A 1 63  ? 41.235 73.374 5.822   1.00 9.90  ?  64   GLY A N   1 
ATOM   459  C CA  . GLY A 1 63  ? 41.833 72.878 7.039   1.00 12.89 ?  64   GLY A CA  1 
ATOM   460  C C   . GLY A 1 63  ? 42.649 71.636 6.756   1.00 12.81 ?  64   GLY A C   1 
ATOM   461  O O   . GLY A 1 63  ? 43.039 71.371 5.614   1.00 13.31 ?  64   GLY A O   1 
ATOM   462  N N   . GLY A 1 64  ? 42.914 70.872 7.805   1.00 6.61  ?  65   GLY A N   1 
ATOM   463  C CA  . GLY A 1 64  ? 43.707 69.667 7.676   1.00 9.85  ?  65   GLY A CA  1 
ATOM   464  C C   . GLY A 1 64  ? 44.179 69.193 9.037   1.00 15.97 ?  65   GLY A C   1 
ATOM   465  O O   . GLY A 1 64  ? 43.681 69.628 10.075  1.00 10.52 ?  65   GLY A O   1 
ATOM   466  N N   . PHE A 1 65  ? 45.154 68.287 9.004   1.00 10.99 ?  66   PHE A N   1 
ATOM   467  C CA  . PHE A 1 65  ? 45.723 67.765 10.238  1.00 13.42 ?  66   PHE A CA  1 
ATOM   468  C C   . PHE A 1 65  ? 46.472 68.860 10.986  1.00 12.07 ?  66   PHE A C   1 
ATOM   469  O O   . PHE A 1 65  ? 47.103 69.730 10.379  1.00 12.34 ?  66   PHE A O   1 
ATOM   470  C CB  . PHE A 1 65  ? 46.662 66.596 9.944   1.00 15.64 ?  66   PHE A CB  1 
ATOM   471  C CG  . PHE A 1 65  ? 45.954 65.338 9.539   1.00 14.25 ?  66   PHE A CG  1 
ATOM   472  C CD1 . PHE A 1 65  ? 45.253 64.594 10.473  1.00 16.84 ?  66   PHE A CD1 1 
ATOM   473  C CD2 . PHE A 1 65  ? 45.988 64.898 8.227   1.00 22.20 ?  66   PHE A CD2 1 
ATOM   474  C CE1 . PHE A 1 65  ? 44.599 63.434 10.106  1.00 15.44 ?  66   PHE A CE1 1 
ATOM   475  C CE2 . PHE A 1 65  ? 45.336 63.737 7.853   1.00 27.81 ?  66   PHE A CE2 1 
ATOM   476  C CZ  . PHE A 1 65  ? 44.641 63.004 8.794   1.00 24.58 ?  66   PHE A CZ  1 
ATOM   477  N N   . VAL A 1 66  ? 46.396 68.816 12.315  1.00 9.91  ?  67   VAL A N   1 
ATOM   478  C CA  . VAL A 1 66  ? 47.061 69.790 13.170  1.00 10.97 ?  67   VAL A CA  1 
ATOM   479  C C   . VAL A 1 66  ? 47.915 69.057 14.193  1.00 17.55 ?  67   VAL A C   1 
ATOM   480  O O   . VAL A 1 66  ? 47.655 67.899 14.538  1.00 12.73 ?  67   VAL A O   1 
ATOM   481  C CB  . VAL A 1 66  ? 46.053 70.726 13.878  1.00 15.87 ?  67   VAL A CB  1 
ATOM   482  C CG1 . VAL A 1 66  ? 45.188 71.450 12.857  1.00 8.59  ?  67   VAL A CG1 1 
ATOM   483  C CG2 . VAL A 1 66  ? 45.189 69.944 14.858  1.00 14.98 ?  67   VAL A CG2 1 
ATOM   484  N N   . ASP A 1 67  ? 48.951 69.740 14.672  1.00 9.65  ?  68   ASP A N   1 
ATOM   485  C CA  . ASP A 1 67  ? 49.814 69.232 15.731  1.00 8.77  ?  68   ASP A CA  1 
ATOM   486  C C   . ASP A 1 67  ? 49.324 69.807 17.056  1.00 12.02 ?  68   ASP A C   1 
ATOM   487  O O   . ASP A 1 67  ? 49.316 71.030 17.243  1.00 13.93 ?  68   ASP A O   1 
ATOM   488  C CB  . ASP A 1 67  ? 51.272 69.615 15.469  1.00 12.26 ?  68   ASP A CB  1 
ATOM   489  C CG  . ASP A 1 67  ? 52.254 68.881 16.373  1.00 20.15 ?  68   ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 67  ? 51.859 68.430 17.469  1.00 11.53 ?  68   ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 67  ? 53.436 68.761 15.984  1.00 21.06 ?  68   ASP A OD2 1 
ATOM   492  N N   . ARG A 1 68  ? 48.911 68.929 17.968  1.00 15.01 ?  69   ARG A N   1 
ATOM   493  C CA  . ARG A 1 68  ? 48.329 69.345 19.238  1.00 18.77 ?  69   ARG A CA  1 
ATOM   494  C C   . ARG A 1 68  ? 49.276 69.174 20.419  1.00 17.66 ?  69   ARG A C   1 
ATOM   495  O O   . ARG A 1 68  ? 48.863 69.404 21.561  1.00 20.05 ?  69   ARG A O   1 
ATOM   496  C CB  . ARG A 1 68  ? 47.035 68.567 19.505  1.00 23.08 ?  69   ARG A CB  1 
ATOM   497  C CG  . ARG A 1 68  ? 47.252 67.094 19.806  1.00 23.17 ?  69   ARG A CG  1 
ATOM   498  C CD  . ARG A 1 68  ? 46.325 66.604 20.907  1.00 31.14 ?  69   ARG A CD  1 
ATOM   499  N NE  . ARG A 1 68  ? 46.428 67.410 22.119  1.00 39.37 ?  69   ARG A NE  1 
ATOM   500  C CZ  . ARG A 1 68  ? 46.196 66.948 23.343  1.00 32.47 ?  69   ARG A CZ  1 
ATOM   501  N NH1 . ARG A 1 68  ? 46.311 67.751 24.391  1.00 37.47 ?  69   ARG A NH1 1 
ATOM   502  N NH2 . ARG A 1 68  ? 45.849 65.681 23.520  1.00 40.93 ?  69   ARG A NH2 1 
ATOM   503  N N   . ARG A 1 69  ? 50.529 68.782 20.176  1.00 16.11 ?  70   ARG A N   1 
ATOM   504  C CA  . ARG A 1 69  ? 51.467 68.571 21.275  1.00 15.60 ?  70   ARG A CA  1 
ATOM   505  C C   . ARG A 1 69  ? 51.674 69.849 22.080  1.00 17.49 ?  70   ARG A C   1 
ATOM   506  O O   . ARG A 1 69  ? 51.554 69.849 23.310  1.00 25.08 ?  70   ARG A O   1 
ATOM   507  C CB  . ARG A 1 69  ? 52.805 68.065 20.736  1.00 13.52 ?  70   ARG A CB  1 
ATOM   508  C CG  . ARG A 1 69  ? 52.772 66.695 20.084  1.00 17.33 ?  70   ARG A CG  1 
ATOM   509  C CD  . ARG A 1 69  ? 54.113 66.406 19.427  1.00 17.20 ?  70   ARG A CD  1 
ATOM   510  N NE  . ARG A 1 69  ? 54.437 67.410 18.416  1.00 15.30 ?  70   ARG A NE  1 
ATOM   511  C CZ  . ARG A 1 69  ? 55.671 67.806 18.118  1.00 17.78 ?  70   ARG A CZ  1 
ATOM   512  N NH1 . ARG A 1 69  ? 56.711 67.286 18.755  1.00 9.83  ?  70   ARG A NH1 1 
ATOM   513  N NH2 . ARG A 1 69  ? 55.865 68.727 17.183  1.00 10.95 ?  70   ARG A NH2 1 
ATOM   514  N N   . PHE A 1 70  ? 51.983 70.953 21.399  1.00 18.82 ?  71   PHE A N   1 
ATOM   515  C CA  . PHE A 1 70  ? 52.363 72.194 22.065  1.00 16.64 ?  71   PHE A CA  1 
ATOM   516  C C   . PHE A 1 70  ? 51.451 73.363 21.719  1.00 22.58 ?  71   PHE A C   1 
ATOM   517  O O   . PHE A 1 70  ? 51.762 74.502 22.086  1.00 20.21 ?  71   PHE A O   1 
ATOM   518  C CB  . PHE A 1 70  ? 53.810 72.563 21.718  1.00 20.97 ?  71   PHE A CB  1 
ATOM   519  C CG  . PHE A 1 70  ? 54.820 71.538 22.147  1.00 25.26 ?  71   PHE A CG  1 
ATOM   520  C CD1 . PHE A 1 70  ? 55.415 71.614 23.395  1.00 35.43 ?  71   PHE A CD1 1 
ATOM   521  C CD2 . PHE A 1 70  ? 55.184 70.507 21.299  1.00 19.31 ?  71   PHE A CD2 1 
ATOM   522  C CE1 . PHE A 1 70  ? 56.347 70.674 23.792  1.00 41.90 ?  71   PHE A CE1 1 
ATOM   523  C CE2 . PHE A 1 70  ? 56.114 69.562 21.690  1.00 20.91 ?  71   PHE A CE2 1 
ATOM   524  C CZ  . PHE A 1 70  ? 56.697 69.647 22.938  1.00 28.26 ?  71   PHE A CZ  1 
ATOM   525  N N   . TRP A 1 71  ? 50.342 73.125 21.023  1.00 20.33 ?  72   TRP A N   1 
ATOM   526  C CA  . TRP A 1 71  ? 49.502 74.213 20.548  1.00 22.50 ?  72   TRP A CA  1 
ATOM   527  C C   . TRP A 1 71  ? 48.035 73.863 20.732  1.00 21.36 ?  72   TRP A C   1 
ATOM   528  O O   . TRP A 1 71  ? 47.653 72.690 20.744  1.00 17.20 ?  72   TRP A O   1 
ATOM   529  C CB  . TRP A 1 71  ? 49.775 74.527 19.070  1.00 21.50 ?  72   TRP A CB  1 
ATOM   530  C CG  . TRP A 1 71  ? 51.220 74.754 18.768  1.00 28.09 ?  72   TRP A CG  1 
ATOM   531  C CD1 . TRP A 1 71  ? 51.885 75.947 18.782  1.00 24.62 ?  72   TRP A CD1 1 
ATOM   532  C CD2 . TRP A 1 71  ? 52.188 73.759 18.416  1.00 19.17 ?  72   TRP A CD2 1 
ATOM   533  N NE1 . TRP A 1 71  ? 53.206 75.755 18.455  1.00 22.47 ?  72   TRP A NE1 1 
ATOM   534  C CE2 . TRP A 1 71  ? 53.418 74.421 18.226  1.00 22.70 ?  72   TRP A CE2 1 
ATOM   535  C CE3 . TRP A 1 71  ? 52.134 72.373 18.241  1.00 15.42 ?  72   TRP A CE3 1 
ATOM   536  C CZ2 . TRP A 1 71  ? 54.583 73.744 17.869  1.00 17.01 ?  72   TRP A CZ2 1 
ATOM   537  C CZ3 . TRP A 1 71  ? 53.291 71.703 17.887  1.00 15.94 ?  72   TRP A CZ3 1 
ATOM   538  C CH2 . TRP A 1 71  ? 54.499 72.389 17.705  1.00 16.78 ?  72   TRP A CH2 1 
ATOM   539  N N   . SER A 1 72  ? 47.215 74.900 20.878  1.00 20.10 ?  73   SER A N   1 
ATOM   540  C CA  . SER A 1 72  ? 45.775 74.719 20.903  1.00 18.36 ?  73   SER A CA  1 
ATOM   541  C C   . SER A 1 72  ? 45.272 74.300 19.524  1.00 16.55 ?  73   SER A C   1 
ATOM   542  O O   . SER A 1 72  ? 45.951 74.470 18.507  1.00 14.81 ?  73   SER A O   1 
ATOM   543  C CB  . SER A 1 72  ? 45.080 76.008 21.342  1.00 19.58 ?  73   SER A CB  1 
ATOM   544  O OG  . SER A 1 72  ? 45.304 77.046 20.401  1.00 13.85 ?  73   SER A OG  1 
ATOM   545  N N   . LEU A 1 73  ? 44.060 73.740 19.499  1.00 18.18 ?  74   LEU A N   1 
ATOM   546  C CA  . LEU A 1 73  ? 43.438 73.410 18.222  1.00 14.20 ?  74   LEU A CA  1 
ATOM   547  C C   . LEU A 1 73  ? 43.236 74.653 17.368  1.00 13.94 ?  74   LEU A C   1 
ATOM   548  O O   . LEU A 1 73  ? 43.319 74.582 16.137  1.00 11.62 ?  74   LEU A O   1 
ATOM   549  C CB  . LEU A 1 73  ? 42.101 72.705 18.449  1.00 12.63 ?  74   LEU A CB  1 
ATOM   550  C CG  . LEU A 1 73  ? 42.117 71.389 19.225  1.00 17.32 ?  74   LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 73  ? 40.692 70.923 19.471  1.00 17.46 ?  74   LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 73  ? 42.911 70.330 18.476  1.00 13.54 ?  74   LEU A CD2 1 
ATOM   553  N N   . GLU A 1 74  ? 42.977 75.798 18.003  1.00 13.18 ?  75   GLU A N   1 
ATOM   554  C CA  . GLU A 1 74  ? 42.754 77.030 17.254  1.00 14.74 ?  75   GLU A CA  1 
ATOM   555  C C   . GLU A 1 74  ? 44.026 77.486 16.551  1.00 13.95 ?  75   GLU A C   1 
ATOM   556  O O   . GLU A 1 74  ? 43.979 77.927 15.397  1.00 17.32 ?  75   GLU A O   1 
ATOM   557  C CB  . GLU A 1 74  ? 42.235 78.123 18.189  1.00 18.10 ?  75   GLU A CB  1 
ATOM   558  C CG  . GLU A 1 74  ? 40.771 77.972 18.573  1.00 18.58 ?  75   GLU A CG  1 
ATOM   559  C CD  . GLU A 1 74  ? 40.521 76.787 19.489  1.00 25.88 ?  75   GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 74  ? 41.392 76.490 20.335  1.00 16.64 ?  75   GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 74  ? 39.454 76.150 19.361  1.00 17.05 ?  75   GLU A OE2 1 
ATOM   562  N N   . ASP A 1 75  ? 45.171 77.392 17.232  1.00 14.27 ?  76   ASP A N   1 
ATOM   563  C CA  . ASP A 1 75  ? 46.432 77.774 16.606  1.00 12.57 ?  76   ASP A CA  1 
ATOM   564  C C   . ASP A 1 75  ? 46.760 76.863 15.429  1.00 16.45 ?  76   ASP A C   1 
ATOM   565  O O   . ASP A 1 75  ? 47.178 77.337 14.365  1.00 14.16 ?  76   ASP A O   1 
ATOM   566  C CB  . ASP A 1 75  ? 47.559 77.749 17.637  1.00 24.97 ?  76   ASP A CB  1 
ATOM   567  C CG  . ASP A 1 75  ? 47.531 78.952 18.559  1.00 26.81 ?  76   ASP A CG  1 
ATOM   568  O OD1 . ASP A 1 75  ? 46.646 79.816 18.386  1.00 34.19 ?  76   ASP A OD1 1 
ATOM   569  O OD2 . ASP A 1 75  ? 48.397 79.034 19.455  1.00 45.01 ?  76   ASP A OD2 1 
ATOM   570  N N   . GLY A 1 76  ? 46.578 75.552 15.601  1.00 14.57 ?  77   GLY A N   1 
ATOM   571  C CA  . GLY A 1 76  ? 46.813 74.636 14.498  1.00 16.61 ?  77   GLY A CA  1 
ATOM   572  C C   . GLY A 1 76  ? 45.880 74.885 13.330  1.00 12.86 ?  77   GLY A C   1 
ATOM   573  O O   . GLY A 1 76  ? 46.302 74.874 12.171  1.00 16.83 ?  77   GLY A O   1 
ATOM   574  N N   . LEU A 1 77  ? 44.599 75.123 13.620  1.00 13.01 ?  78   LEU A N   1 
ATOM   575  C CA  . LEU A 1 77  ? 43.640 75.422 12.563  1.00 10.05 ?  78   LEU A CA  1 
ATOM   576  C C   . LEU A 1 77  ? 44.030 76.689 11.814  1.00 16.20 ?  78   LEU A C   1 
ATOM   577  O O   . LEU A 1 77  ? 44.022 76.723 10.577  1.00 11.96 ?  78   LEU A O   1 
ATOM   578  C CB  . LEU A 1 77  ? 42.236 75.557 13.153  1.00 10.92 ?  78   LEU A CB  1 
ATOM   579  C CG  . LEU A 1 77  ? 41.171 76.142 12.223  1.00 16.84 ?  78   LEU A CG  1 
ATOM   580  C CD1 . LEU A 1 77  ? 40.819 75.157 11.117  1.00 17.51 ?  78   LEU A CD1 1 
ATOM   581  C CD2 . LEU A 1 77  ? 39.932 76.545 13.005  1.00 15.38 ?  78   LEU A CD2 1 
ATOM   582  N N   . ASN A 1 78  ? 44.379 77.746 12.552  1.00 11.85 ?  79   ASN A N   1 
ATOM   583  C CA  . ASN A 1 78  ? 44.751 79.001 11.909  1.00 22.08 ?  79   ASN A CA  1 
ATOM   584  C C   . ASN A 1 78  ? 46.041 78.863 11.110  1.00 12.24 ?  79   ASN A C   1 
ATOM   585  O O   . ASN A 1 78  ? 46.229 79.575 10.117  1.00 15.34 ?  79   ASN A O   1 
ATOM   586  C CB  . ASN A 1 78  ? 44.878 80.109 12.955  1.00 18.71 ?  79   ASN A CB  1 
ATOM   587  C CG  . ASN A 1 78  ? 43.530 80.576 13.473  1.00 25.74 ?  79   ASN A CG  1 
ATOM   588  O OD1 . ASN A 1 78  ? 42.540 80.585 12.739  1.00 22.48 ?  79   ASN A OD1 1 
ATOM   589  N ND2 . ASN A 1 78  ? 43.483 80.963 14.743  1.00 18.15 ?  79   ASN A ND2 1 
ATOM   590  N N   . ARG A 1 79  ? 46.934 77.959 11.520  1.00 14.51 ?  80   ARG A N   1 
ATOM   591  C CA  . ARG A 1 79  ? 48.135 77.698 10.732  1.00 16.41 ?  80   ARG A CA  1 
ATOM   592  C C   . ARG A 1 79  ? 47.782 77.074 9.388   1.00 18.81 ?  80   ARG A C   1 
ATOM   593  O O   . ARG A 1 79  ? 48.274 77.508 8.340   1.00 15.34 ?  80   ARG A O   1 
ATOM   594  C CB  . ARG A 1 79  ? 49.091 76.788 11.505  1.00 19.44 ?  80   ARG A CB  1 
ATOM   595  C CG  . ARG A 1 79  ? 49.915 77.484 12.573  1.00 36.40 ?  80   ARG A CG  1 
ATOM   596  C CD  . ARG A 1 79  ? 51.079 76.607 13.014  1.00 37.63 ?  80   ARG A CD  1 
ATOM   597  N NE  . ARG A 1 79  ? 50.632 75.289 13.458  1.00 39.84 ?  80   ARG A NE  1 
ATOM   598  C CZ  . ARG A 1 79  ? 50.544 74.920 14.732  1.00 38.73 ?  80   ARG A CZ  1 
ATOM   599  N NH1 . ARG A 1 79  ? 50.876 75.769 15.694  1.00 46.14 ?  80   ARG A NH1 1 
ATOM   600  N NH2 . ARG A 1 79  ? 50.124 73.701 15.044  1.00 21.13 ?  80   ARG A NH2 1 
ATOM   601  N N   . VAL A 1 80  ? 46.927 76.049 9.399   1.00 18.60 ?  81   VAL A N   1 
ATOM   602  C CA  . VAL A 1 80  ? 46.552 75.383 8.156   1.00 23.91 ?  81   VAL A CA  1 
ATOM   603  C C   . VAL A 1 80  ? 45.678 76.294 7.302   1.00 20.56 ?  81   VAL A C   1 
ATOM   604  O O   . VAL A 1 80  ? 45.814 76.332 6.072   1.00 20.71 ?  81   VAL A O   1 
ATOM   605  C CB  . VAL A 1 80  ? 45.855 74.045 8.456   1.00 17.65 ?  81   VAL A CB  1 
ATOM   606  C CG1 . VAL A 1 80  ? 45.531 73.322 7.162   1.00 29.54 ?  81   VAL A CG1 1 
ATOM   607  C CG2 . VAL A 1 80  ? 46.733 73.179 9.345   1.00 19.83 ?  81   VAL A CG2 1 
ATOM   608  N N   . LEU A 1 81  ? 44.767 77.039 7.934   1.00 16.17 ?  82   LEU A N   1 
ATOM   609  C CA  . LEU A 1 81  ? 43.955 77.994 7.186   1.00 18.74 ?  82   LEU A CA  1 
ATOM   610  C C   . LEU A 1 81  ? 44.813 79.094 6.577   1.00 21.76 ?  82   LEU A C   1 
ATOM   611  O O   . LEU A 1 81  ? 44.493 79.606 5.498   1.00 18.11 ?  82   LEU A O   1 
ATOM   612  C CB  . LEU A 1 81  ? 42.879 78.601 8.086   1.00 18.82 ?  82   LEU A CB  1 
ATOM   613  C CG  . LEU A 1 81  ? 41.718 77.685 8.478   1.00 15.92 ?  82   LEU A CG  1 
ATOM   614  C CD1 . LEU A 1 81  ? 40.664 78.462 9.253   1.00 16.91 ?  82   LEU A CD1 1 
ATOM   615  C CD2 . LEU A 1 81  ? 41.112 77.027 7.250   1.00 16.12 ?  82   LEU A CD2 1 
ATOM   616  N N   . GLY A 1 82  ? 45.904 79.468 7.248   1.00 19.47 ?  83   GLY A N   1 
ATOM   617  C CA  . GLY A 1 82  ? 46.817 80.435 6.667   1.00 12.87 ?  83   GLY A CA  1 
ATOM   618  C C   . GLY A 1 82  ? 47.465 79.938 5.392   1.00 17.49 ?  83   GLY A C   1 
ATOM   619  O O   . GLY A 1 82  ? 47.719 80.721 4.476   1.00 16.07 ?  83   GLY A O   1 
ATOM   620  N N   . LEU A 1 83  ? 47.730 78.632 5.309   1.00 16.10 ?  84   LEU A N   1 
ATOM   621  C CA  . LEU A 1 83  ? 48.357 78.069 4.118   1.00 20.08 ?  84   LEU A CA  1 
ATOM   622  C C   . LEU A 1 83  ? 47.347 77.850 2.996   1.00 23.17 ?  84   LEU A C   1 
ATOM   623  O O   . LEU A 1 83  ? 47.669 78.059 1.821   1.00 23.43 ?  84   LEU A O   1 
ATOM   624  C CB  . LEU A 1 83  ? 49.048 76.749 4.466   1.00 21.77 ?  84   LEU A CB  1 
ATOM   625  C CG  . LEU A 1 83  ? 50.256 76.821 5.402   1.00 32.64 ?  84   LEU A CG  1 
ATOM   626  C CD1 . LEU A 1 83  ? 50.615 75.436 5.920   1.00 23.48 ?  84   LEU A CD1 1 
ATOM   627  C CD2 . LEU A 1 83  ? 51.442 77.457 4.696   1.00 26.07 ?  84   LEU A CD2 1 
ATOM   628  N N   . GLY A 1 84  ? 46.129 77.434 3.336   1.00 20.38 ?  85   GLY A N   1 
ATOM   629  C CA  . GLY A 1 84  ? 45.144 77.077 2.334   1.00 20.86 ?  85   GLY A CA  1 
ATOM   630  C C   . GLY A 1 84  ? 44.210 78.197 1.926   1.00 21.91 ?  85   GLY A C   1 
ATOM   631  O O   . GLY A 1 84  ? 43.606 78.144 0.849   1.00 19.96 ?  85   GLY A O   1 
ATOM   632  N N   . LEU A 1 85  ? 44.072 79.213 2.773   1.00 17.27 ?  86   LEU A N   1 
ATOM   633  C CA  . LEU A 1 85  ? 43.192 80.339 2.490   1.00 19.45 ?  86   LEU A CA  1 
ATOM   634  C C   . LEU A 1 85  ? 43.898 81.685 2.483   1.00 19.65 ?  86   LEU A C   1 
ATOM   635  O O   . LEU A 1 85  ? 43.504 82.565 1.715   1.00 18.88 ?  86   LEU A O   1 
ATOM   636  C CB  . LEU A 1 85  ? 42.042 80.391 3.510   1.00 23.59 ?  86   LEU A CB  1 
ATOM   637  C CG  . LEU A 1 85  ? 40.992 79.280 3.423   1.00 18.89 ?  86   LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 85  ? 39.955 79.442 4.521   1.00 15.81 ?  86   LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 85  ? 40.326 79.270 2.054   1.00 14.35 ?  86   LEU A CD2 1 
ATOM   640  N N   . GLY A 1 86  ? 44.922 81.873 3.311   1.00 24.92 ?  87   GLY A N   1 
ATOM   641  C CA  . GLY A 1 86  ? 45.654 83.121 3.335   1.00 27.91 ?  87   GLY A CA  1 
ATOM   642  C C   . GLY A 1 86  ? 45.048 84.214 4.179   1.00 32.27 ?  87   GLY A C   1 
ATOM   643  O O   . GLY A 1 86  ? 45.483 85.366 4.074   1.00 30.22 ?  87   GLY A O   1 
ATOM   644  N N   . CYS A 1 87  ? 44.068 83.896 5.017   1.00 31.18 ?  88   CYS A N   1 
ATOM   645  C CA  . CYS A 1 87  ? 43.379 84.904 5.808   1.00 46.31 ?  88   CYS A CA  1 
ATOM   646  C C   . CYS A 1 87  ? 42.671 84.210 6.964   1.00 42.24 ?  88   CYS A C   1 
ATOM   647  O O   . CYS A 1 87  ? 42.827 83.005 7.179   1.00 36.52 ?  88   CYS A O   1 
ATOM   648  C CB  . CYS A 1 87  ? 42.395 85.698 4.945   1.00 38.31 ?  88   CYS A CB  1 
ATOM   649  S SG  . CYS A 1 87  ? 41.245 84.660 4.009   1.00 34.96 ?  88   CYS A SG  1 
ATOM   650  N N   . LEU A 1 88  ? 41.899 84.999 7.717   1.00 30.99 ?  89   LEU A N   1 
ATOM   651  C CA  . LEU A 1 88  ? 41.018 84.524 8.779   1.00 30.25 ?  89   LEU A CA  1 
ATOM   652  C C   . LEU A 1 88  ? 41.775 84.027 10.003  1.00 29.05 ?  89   LEU A C   1 
ATOM   653  O O   . LEU A 1 88  ? 42.728 83.248 9.891   1.00 38.24 ?  89   LEU A O   1 
ATOM   654  C CB  . LEU A 1 88  ? 40.094 83.419 8.262   1.00 38.55 ?  89   LEU A CB  1 
ATOM   655  C CG  . LEU A 1 88  ? 38.807 83.883 7.587   1.00 42.37 ?  89   LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 88  ? 38.010 82.683 7.132   1.00 31.98 ?  89   LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 88  ? 37.988 84.746 8.532   1.00 37.88 ?  89   LEU A CD2 1 
ATOM   658  N N   . ARG A 1 89  ? 41.349 84.480 11.179  1.00 28.25 ?  90   ARG A N   1 
ATOM   659  C CA  . ARG A 1 89  ? 41.818 83.962 12.459  1.00 33.54 ?  90   ARG A CA  1 
ATOM   660  C C   . ARG A 1 89  ? 40.591 83.515 13.241  1.00 24.41 ?  90   ARG A C   1 
ATOM   661  O O   . ARG A 1 89  ? 39.834 84.351 13.746  1.00 29.84 ?  90   ARG A O   1 
ATOM   662  C CB  . ARG A 1 89  ? 42.614 85.014 13.231  1.00 24.66 ?  90   ARG A CB  1 
ATOM   663  C CG  . ARG A 1 89  ? 44.019 85.256 12.699  1.00 49.83 ?  90   ARG A CG  1 
ATOM   664  C CD  . ARG A 1 89  ? 44.748 83.949 12.427  1.00 47.85 ?  90   ARG A CD  1 
ATOM   665  N NE  . ARG A 1 89  ? 46.130 83.985 12.899  1.00 65.03 ?  90   ARG A NE  1 
ATOM   666  C CZ  . ARG A 1 89  ? 47.124 83.293 12.352  1.00 58.61 ?  90   ARG A CZ  1 
ATOM   667  N NH1 . ARG A 1 89  ? 46.893 82.510 11.307  1.00 54.81 ?  90   ARG A NH1 1 
ATOM   668  N NH2 . ARG A 1 89  ? 48.351 83.385 12.847  1.00 77.91 ?  90   ARG A NH2 1 
ATOM   669  N N   . LEU A 1 90  ? 40.386 82.208 13.324  1.00 19.81 ?  91   LEU A N   1 
ATOM   670  C CA  . LEU A 1 90  ? 39.248 81.663 14.045  1.00 23.52 ?  91   LEU A CA  1 
ATOM   671  C C   . LEU A 1 90  ? 39.605 81.453 15.513  1.00 20.13 ?  91   LEU A C   1 
ATOM   672  O O   . LEU A 1 90  ? 40.775 81.336 15.885  1.00 18.96 ?  91   LEU A O   1 
ATOM   673  C CB  . LEU A 1 90  ? 38.786 80.349 13.411  1.00 19.83 ?  91   LEU A CB  1 
ATOM   674  C CG  . LEU A 1 90  ? 37.661 80.439 12.373  1.00 31.64 ?  91   LEU A CG  1 
ATOM   675  C CD1 . LEU A 1 90  ? 37.885 81.582 11.392  1.00 28.55 ?  91   LEU A CD1 1 
ATOM   676  C CD2 . LEU A 1 90  ? 37.516 79.122 11.630  1.00 23.24 ?  91   LEU A CD2 1 
ATOM   677  N N   . THR A 1 91  ? 38.574 81.418 16.353  1.00 16.30 ?  92   THR A N   1 
ATOM   678  C CA  . THR A 1 91  ? 38.745 81.334 17.795  1.00 18.36 ?  92   THR A CA  1 
ATOM   679  C C   . THR A 1 91  ? 37.957 80.147 18.332  1.00 19.55 ?  92   THR A C   1 
ATOM   680  O O   . THR A 1 91  ? 37.267 79.442 17.590  1.00 16.47 ?  92   THR A O   1 
ATOM   681  C CB  . THR A 1 91  ? 38.300 82.631 18.485  1.00 24.31 ?  92   THR A CB  1 
ATOM   682  O OG1 . THR A 1 91  ? 36.881 82.780 18.354  1.00 26.35 ?  92   THR A OG1 1 
ATOM   683  C CG2 . THR A 1 91  ? 38.989 83.838 17.860  1.00 18.14 ?  92   THR A CG2 1 
ATOM   684  N N   . GLU A 1 92  ? 38.066 79.934 19.647  1.00 18.09 ?  93   GLU A N   1 
ATOM   685  C CA  . GLU A 1 92  ? 37.293 78.890 20.313  1.00 16.81 ?  93   GLU A CA  1 
ATOM   686  C C   . GLU A 1 92  ? 35.793 79.123 20.201  1.00 14.90 ?  93   GLU A C   1 
ATOM   687  O O   . GLU A 1 92  ? 35.018 78.164 20.287  1.00 17.46 ?  93   GLU A O   1 
ATOM   688  C CB  . GLU A 1 92  ? 37.695 78.795 21.786  1.00 32.12 ?  93   GLU A CB  1 
ATOM   689  C CG  . GLU A 1 92  ? 38.503 77.557 22.131  1.00 41.59 ?  93   GLU A CG  1 
ATOM   690  C CD  . GLU A 1 92  ? 39.136 77.635 23.506  1.00 58.82 ?  93   GLU A CD  1 
ATOM   691  O OE1 . GLU A 1 92  ? 38.638 76.959 24.432  1.00 56.78 ?  93   GLU A OE1 1 
ATOM   692  O OE2 . GLU A 1 92  ? 40.131 78.374 23.660  1.00 59.26 ?  93   GLU A OE2 1 
ATOM   693  N N   . ALA A 1 93  ? 35.366 80.373 20.017  1.00 20.54 ?  94   ALA A N   1 
ATOM   694  C CA  . ALA A 1 93  ? 33.949 80.663 19.831  1.00 20.96 ?  94   ALA A CA  1 
ATOM   695  C C   . ALA A 1 93  ? 33.402 80.083 18.533  1.00 16.30 ?  94   ALA A C   1 
ATOM   696  O O   . ALA A 1 93  ? 32.181 79.958 18.392  1.00 14.31 ?  94   ALA A O   1 
ATOM   697  C CB  . ALA A 1 93  ? 33.710 82.173 19.860  1.00 24.11 ?  94   ALA A CB  1 
ATOM   698  N N   . ASP A 1 94  ? 34.269 79.739 17.583  1.00 12.11 ?  95   ASP A N   1 
ATOM   699  C CA  . ASP A 1 94  ? 33.846 79.138 16.326  1.00 14.69 ?  95   ASP A CA  1 
ATOM   700  C C   . ASP A 1 94  ? 33.867 77.617 16.363  1.00 13.88 ?  95   ASP A C   1 
ATOM   701  O O   . ASP A 1 94  ? 33.466 76.982 15.382  1.00 12.97 ?  95   ASP A O   1 
ATOM   702  C CB  . ASP A 1 94  ? 34.728 79.636 15.178  1.00 14.87 ?  95   ASP A CB  1 
ATOM   703  C CG  . ASP A 1 94  ? 34.839 81.147 15.141  1.00 22.30 ?  95   ASP A CG  1 
ATOM   704  O OD1 . ASP A 1 94  ? 33.790 81.818 15.048  1.00 15.91 ?  95   ASP A OD1 1 
ATOM   705  O OD2 . ASP A 1 94  ? 35.975 81.662 15.208  1.00 15.15 ?  95   ASP A OD2 1 
ATOM   706  N N   . TYR A 1 95  ? 34.327 77.022 17.463  1.00 15.43 ?  96   TYR A N   1 
ATOM   707  C CA  . TYR A 1 95  ? 34.314 75.573 17.598  1.00 13.70 ?  96   TYR A CA  1 
ATOM   708  C C   . TYR A 1 95  ? 32.881 75.061 17.613  1.00 14.95 ?  96   TYR A C   1 
ATOM   709  O O   . TYR A 1 95  ? 32.019 75.610 18.305  1.00 11.88 ?  96   TYR A O   1 
ATOM   710  C CB  . TYR A 1 95  ? 35.042 75.162 18.876  1.00 13.08 ?  96   TYR A CB  1 
ATOM   711  C CG  . TYR A 1 95  ? 34.951 73.687 19.198  1.00 15.24 ?  96   TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 95  ? 35.774 72.767 18.563  1.00 11.59 ?  96   TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 95  ? 34.046 73.216 20.142  1.00 13.90 ?  96   TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 95  ? 35.697 71.417 18.858  1.00 15.31 ?  96   TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 95  ? 33.961 71.870 20.442  1.00 14.49 ?  96   TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 95  ? 34.788 70.975 19.798  1.00 12.12 ?  96   TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 95  ? 34.705 69.634 20.096  1.00 13.15 ?  96   TYR A OH  1 
ATOM   718  N N   . LEU A 1 96  ? 32.627 74.004 16.845  1.00 10.79 ?  97   LEU A N   1 
ATOM   719  C CA  . LEU A 1 96  ? 31.290 73.440 16.714  1.00 11.62 ?  97   LEU A CA  1 
ATOM   720  C C   . LEU A 1 96  ? 31.173 72.047 17.313  1.00 12.79 ?  97   LEU A C   1 
ATOM   721  O O   . LEU A 1 96  ? 30.312 71.815 18.167  1.00 15.46 ?  97   LEU A O   1 
ATOM   722  C CB  . LEU A 1 96  ? 30.876 73.412 15.234  1.00 12.57 ?  97   LEU A CB  1 
ATOM   723  C CG  . LEU A 1 96  ? 29.398 73.150 14.940  1.00 15.22 ?  97   LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 96  ? 28.515 74.143 15.681  1.00 17.25 ?  97   LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 96  ? 29.138 73.211 13.442  1.00 17.28 ?  97   LEU A CD2 1 
ATOM   726  N N   . SER A 1 97  ? 32.020 71.108 16.896  1.00 15.16 ?  98   SER A N   1 
ATOM   727  C CA  . SER A 1 97  ? 31.912 69.737 17.374  1.00 13.72 ?  98   SER A CA  1 
ATOM   728  C C   . SER A 1 97  ? 33.205 68.993 17.074  1.00 10.34 ?  98   SER A C   1 
ATOM   729  O O   . SER A 1 97  ? 34.087 69.489 16.369  1.00 9.59  ?  98   SER A O   1 
ATOM   730  C CB  . SER A 1 97  ? 30.718 69.019 16.736  1.00 19.12 ?  98   SER A CB  1 
ATOM   731  O OG  . SER A 1 97  ? 30.869 68.942 15.328  1.00 31.63 ?  98   SER A OG  1 
ATOM   732  N N   . SER A 1 98  ? 33.303 67.789 17.632  1.00 11.07 ?  99   SER A N   1 
ATOM   733  C CA  . SER A 1 98  ? 34.390 66.862 17.350  1.00 9.44  ?  99   SER A CA  1 
ATOM   734  C C   . SER A 1 98  ? 33.791 65.492 17.074  1.00 12.45 ?  99   SER A C   1 
ATOM   735  O O   . SER A 1 98  ? 32.905 65.041 17.807  1.00 12.17 ?  99   SER A O   1 
ATOM   736  C CB  . SER A 1 98  ? 35.384 66.786 18.514  1.00 12.73 ?  99   SER A CB  1 
ATOM   737  O OG  . SER A 1 98  ? 35.975 68.049 18.768  1.00 12.97 ?  99   SER A OG  1 
ATOM   738  N N   . HIS A 1 99  ? 34.269 64.838 16.018  1.00 12.57 ?  100  HIS A N   1 
ATOM   739  C CA  . HIS A 1 99  ? 33.786 63.524 15.623  1.00 13.90 ?  100  HIS A CA  1 
ATOM   740  C C   . HIS A 1 99  ? 34.960 62.575 15.444  1.00 8.49  ?  100  HIS A C   1 
ATOM   741  O O   . HIS A 1 99  ? 36.033 62.978 14.984  1.00 10.73 ?  100  HIS A O   1 
ATOM   742  C CB  . HIS A 1 99  ? 32.986 63.583 14.314  1.00 11.89 ?  100  HIS A CB  1 
ATOM   743  C CG  . HIS A 1 99  ? 31.690 64.324 14.421  1.00 9.13  ?  100  HIS A CG  1 
ATOM   744  N ND1 . HIS A 1 99  ? 31.581 65.675 14.171  1.00 13.78 ?  100  HIS A ND1 1 
ATOM   745  C CD2 . HIS A 1 99  ? 30.443 63.898 14.730  1.00 13.54 ?  100  HIS A CD2 1 
ATOM   746  C CE1 . HIS A 1 99  ? 30.325 66.051 14.331  1.00 16.88 ?  100  HIS A CE1 1 
ATOM   747  N NE2 . HIS A 1 99  ? 29.613 64.991 14.671  1.00 15.27 ?  100  HIS A NE2 1 
ATOM   748  N N   . LEU A 1 100 ? 34.749 61.314 15.811  1.00 9.99  ?  101  LEU A N   1 
ATOM   749  C CA  . LEU A 1 100 ? 35.690 60.257 15.471  1.00 12.13 ?  101  LEU A CA  1 
ATOM   750  C C   . LEU A 1 100 ? 35.412 59.781 14.049  1.00 14.08 ?  101  LEU A C   1 
ATOM   751  O O   . LEU A 1 100 ? 34.271 59.450 13.711  1.00 13.80 ?  101  LEU A O   1 
ATOM   752  C CB  . LEU A 1 100 ? 35.570 59.098 16.459  1.00 6.55  ?  101  LEU A CB  1 
ATOM   753  C CG  . LEU A 1 100 ? 35.680 59.458 17.943  1.00 6.91  ?  101  LEU A CG  1 
ATOM   754  C CD1 . LEU A 1 100 ? 35.527 58.216 18.808  1.00 10.61 ?  101  LEU A CD1 1 
ATOM   755  C CD2 . LEU A 1 100 ? 37.004 60.151 18.230  1.00 5.97  ?  101  LEU A CD2 1 
ATOM   756  N N   . THR A 1 101 ? 36.449 59.761 13.214  1.00 7.04  ?  102  THR A N   1 
ATOM   757  C CA  . THR A 1 101 ? 36.269 59.358 11.827  1.00 9.54  ?  102  THR A CA  1 
ATOM   758  C C   . THR A 1 101 ? 36.029 57.851 11.735  1.00 12.38 ?  102  THR A C   1 
ATOM   759  O O   . THR A 1 101 ? 36.212 57.100 12.698  1.00 13.70 ?  102  THR A O   1 
ATOM   760  C CB  . THR A 1 101 ? 37.479 59.757 10.982  1.00 12.50 ?  102  THR A CB  1 
ATOM   761  O OG1 . THR A 1 101 ? 38.602 58.940 11.333  1.00 11.59 ?  102  THR A OG1 1 
ATOM   762  C CG2 . THR A 1 101 ? 37.828 61.224 11.209  1.00 10.77 ?  102  THR A CG2 1 
ATOM   763  N N   . GLU A 1 102 ? 35.622 57.409 10.547  1.00 8.89  ?  103  GLU A N   1 
ATOM   764  C CA  . GLU A 1 102 ? 35.215 56.024 10.344  1.00 20.47 ?  103  GLU A CA  1 
ATOM   765  C C   . GLU A 1 102 ? 36.386 55.051 10.271  1.00 23.94 ?  103  GLU A C   1 
ATOM   766  O O   . GLU A 1 102 ? 36.156 53.842 10.167  1.00 30.21 ?  103  GLU A O   1 
ATOM   767  C CB  . GLU A 1 102 ? 34.367 55.907 9.074   1.00 18.91 ?  103  GLU A CB  1 
ATOM   768  C CG  . GLU A 1 102 ? 35.134 56.117 7.784   1.00 29.59 ?  103  GLU A CG  1 
ATOM   769  C CD  . GLU A 1 102 ? 34.271 55.901 6.555   1.00 51.30 ?  103  GLU A CD  1 
ATOM   770  O OE1 . GLU A 1 102 ? 33.054 56.176 6.624   1.00 44.43 ?  103  GLU A OE1 1 
ATOM   771  O OE2 . GLU A 1 102 ? 34.809 55.457 5.519   1.00 50.49 ?  103  GLU A OE2 1 
ATOM   772  N N   . GLY A 1 103 ? 37.624 55.532 10.323  1.00 21.02 ?  104  GLY A N   1 
ATOM   773  C CA  . GLY A 1 103 ? 38.769 54.655 10.367  1.00 26.40 ?  104  GLY A CA  1 
ATOM   774  C C   . GLY A 1 103 ? 39.233 54.215 8.993   1.00 27.26 ?  104  GLY A C   1 
ATOM   775  O O   . GLY A 1 103 ? 38.804 54.754 7.967   1.00 25.70 ?  104  GLY A O   1 
ATOM   776  N N   . PRO A 1 104 ? 40.116 53.204 8.940   1.00 24.19 ?  105  PRO A N   1 
ATOM   777  C CA  . PRO A 1 104 ? 40.619 52.420 10.076  1.00 17.93 ?  105  PRO A CA  1 
ATOM   778  C C   . PRO A 1 104 ? 41.620 53.161 10.961  1.00 14.46 ?  105  PRO A C   1 
ATOM   779  O O   . PRO A 1 104 ? 41.892 52.721 12.077  1.00 13.11 ?  105  PRO A O   1 
ATOM   780  C CB  . PRO A 1 104 ? 41.297 51.231 9.396   1.00 18.65 ?  105  PRO A CB  1 
ATOM   781  C CG  . PRO A 1 104 ? 41.758 51.775 8.096   1.00 17.65 ?  105  PRO A CG  1 
ATOM   782  C CD  . PRO A 1 104 ? 40.683 52.734 7.663   1.00 17.68 ?  105  PRO A CD  1 
ATOM   783  N N   . HIS A 1 105 ? 42.159 54.272 10.473  1.00 16.00 ?  106  HIS A N   1 
ATOM   784  C CA  . HIS A 1 105 ? 43.110 55.035 11.262  1.00 19.44 ?  106  HIS A CA  1 
ATOM   785  C C   . HIS A 1 105 ? 42.390 55.864 12.316  1.00 10.85 ?  106  HIS A C   1 
ATOM   786  O O   . HIS A 1 105 ? 41.251 56.302 12.127  1.00 14.14 ?  106  HIS A O   1 
ATOM   787  C CB  . HIS A 1 105 ? 43.962 55.925 10.361  1.00 25.20 ?  106  HIS A CB  1 
ATOM   788  C CG  . HIS A 1 105 ? 45.086 55.190 9.704   1.00 34.65 ?  106  HIS A CG  1 
ATOM   789  N ND1 . HIS A 1 105 ? 46.301 54.985 10.322  1.00 33.07 ?  106  HIS A ND1 1 
ATOM   790  C CD2 . HIS A 1 105 ? 45.164 54.572 8.502   1.00 33.76 ?  106  HIS A CD2 1 
ATOM   791  C CE1 . HIS A 1 105 ? 47.086 54.288 9.520   1.00 39.51 ?  106  HIS A CE1 1 
ATOM   792  N NE2 . HIS A 1 105 ? 46.418 54.021 8.412   1.00 40.37 ?  106  HIS A NE2 1 
ATOM   793  N N   . ARG A 1 106 ? 43.067 56.061 13.444  1.00 10.84 ?  107  ARG A N   1 
ATOM   794  C CA  . ARG A 1 106 ? 42.495 56.757 14.594  1.00 15.87 ?  107  ARG A CA  1 
ATOM   795  C C   . ARG A 1 106 ? 42.614 58.257 14.359  1.00 8.78  ?  107  ARG A C   1 
ATOM   796  O O   . ARG A 1 106 ? 43.688 58.840 14.521  1.00 8.97  ?  107  ARG A O   1 
ATOM   797  C CB  . ARG A 1 106 ? 43.208 56.342 15.875  1.00 13.47 ?  107  ARG A CB  1 
ATOM   798  C CG  . ARG A 1 106 ? 43.192 54.846 16.155  1.00 10.38 ?  107  ARG A CG  1 
ATOM   799  C CD  . ARG A 1 106 ? 44.202 54.512 17.238  1.00 9.18  ?  107  ARG A CD  1 
ATOM   800  N NE  . ARG A 1 106 ? 44.089 53.142 17.731  1.00 11.77 ?  107  ARG A NE  1 
ATOM   801  C CZ  . ARG A 1 106 ? 44.709 52.098 17.191  1.00 14.20 ?  107  ARG A CZ  1 
ATOM   802  N NH1 . ARG A 1 106 ? 45.487 52.259 16.128  1.00 9.81  ?  107  ARG A NH1 1 
ATOM   803  N NH2 . ARG A 1 106 ? 44.552 50.889 17.714  1.00 14.03 ?  107  ARG A NH2 1 
ATOM   804  N N   . VAL A 1 107 ? 41.506 58.890 13.976  1.00 5.97  ?  108  VAL A N   1 
ATOM   805  C CA  . VAL A 1 107 ? 41.471 60.321 13.695  1.00 8.46  ?  108  VAL A CA  1 
ATOM   806  C C   . VAL A 1 107 ? 40.255 60.922 14.384  1.00 8.31  ?  108  VAL A C   1 
ATOM   807  O O   . VAL A 1 107 ? 39.149 60.378 14.287  1.00 9.10  ?  108  VAL A O   1 
ATOM   808  C CB  . VAL A 1 107 ? 41.422 60.614 12.181  1.00 10.49 ?  108  VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 107 ? 41.412 62.118 11.928  1.00 8.61  ?  108  VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 107 ? 42.591 59.959 11.463  1.00 9.45  ?  108  VAL A CG2 1 
ATOM   811  N N   . VAL A 1 108 ? 40.458 62.037 15.081  1.00 6.66  ?  109  VAL A N   1 
ATOM   812  C CA  . VAL A 1 108 ? 39.368 62.849 15.609  1.00 11.61 ?  109  VAL A CA  1 
ATOM   813  C C   . VAL A 1 108 ? 39.311 64.128 14.785  1.00 9.71  ?  109  VAL A C   1 
ATOM   814  O O   . VAL A 1 108 ? 40.336 64.789 14.576  1.00 9.37  ?  109  VAL A O   1 
ATOM   815  C CB  . VAL A 1 108 ? 39.541 63.142 17.112  1.00 7.23  ?  109  VAL A CB  1 
ATOM   816  C CG1 . VAL A 1 108 ? 40.916 63.728 17.406  1.00 10.55 ?  109  VAL A CG1 1 
ATOM   817  C CG2 . VAL A 1 108 ? 38.436 64.070 17.609  1.00 4.58  ?  109  VAL A CG2 1 
ATOM   818  N N   . ALA A 1 109 ? 38.123 64.455 14.287  1.00 9.03  ?  110  ALA A N   1 
ATOM   819  C CA  . ALA A 1 109 ? 37.932 65.573 13.370  1.00 14.54 ?  110  ALA A CA  1 
ATOM   820  C C   . ALA A 1 109 ? 37.182 66.680 14.099  1.00 13.19 ?  110  ALA A C   1 
ATOM   821  O O   . ALA A 1 109 ? 36.017 66.507 14.472  1.00 11.63 ?  110  ALA A O   1 
ATOM   822  C CB  . ALA A 1 109 ? 37.179 65.128 12.119  1.00 11.14 ?  110  ALA A CB  1 
ATOM   823  N N   . HIS A 1 110 ? 37.849 67.814 14.296  1.00 11.70 ?  111  HIS A N   1 
ATOM   824  C CA  . HIS A 1 110 ? 37.243 68.969 14.943  1.00 11.34 ?  111  HIS A CA  1 
ATOM   825  C C   . HIS A 1 110 ? 36.680 69.908 13.885  1.00 11.37 ?  111  HIS A C   1 
ATOM   826  O O   . HIS A 1 110 ? 37.388 70.301 12.952  1.00 9.88  ?  111  HIS A O   1 
ATOM   827  C CB  . HIS A 1 110 ? 38.266 69.696 15.817  1.00 11.71 ?  111  HIS A CB  1 
ATOM   828  C CG  . HIS A 1 110 ? 39.024 68.790 16.737  1.00 10.68 ?  111  HIS A CG  1 
ATOM   829  N ND1 . HIS A 1 110 ? 38.437 68.159 17.813  1.00 10.26 ?  111  HIS A ND1 1 
ATOM   830  C CD2 . HIS A 1 110 ? 40.322 68.404 16.737  1.00 12.87 ?  111  HIS A CD2 1 
ATOM   831  C CE1 . HIS A 1 110 ? 39.341 67.426 18.438  1.00 12.47 ?  111  HIS A CE1 1 
ATOM   832  N NE2 . HIS A 1 110 ? 40.493 67.557 17.806  1.00 7.61  ?  111  HIS A NE2 1 
ATOM   833  N N   . LEU A 1 111 ? 35.408 70.264 14.031  1.00 12.03 ?  112  LEU A N   1 
ATOM   834  C CA  . LEU A 1 111 ? 34.709 71.098 13.065  1.00 6.97  ?  112  LEU A CA  1 
ATOM   835  C C   . LEU A 1 111 ? 34.515 72.495 13.634  1.00 10.63 ?  112  LEU A C   1 
ATOM   836  O O   . LEU A 1 111 ? 34.016 72.651 14.754  1.00 7.93  ?  112  LEU A O   1 
ATOM   837  C CB  . LEU A 1 111 ? 33.355 70.491 12.693  1.00 7.57  ?  112  LEU A CB  1 
ATOM   838  C CG  . LEU A 1 111 ? 32.537 71.282 11.672  1.00 10.83 ?  112  LEU A CG  1 
ATOM   839  C CD1 . LEU A 1 111 ? 33.330 71.477 10.388  1.00 12.24 ?  112  LEU A CD1 1 
ATOM   840  C CD2 . LEU A 1 111 ? 31.211 70.589 11.391  1.00 12.76 ?  112  LEU A CD2 1 
ATOM   841  N N   . TYR A 1 112 ? 34.907 73.500 12.860  1.00 10.41 ?  113  TYR A N   1 
ATOM   842  C CA  . TYR A 1 112 ? 34.674 74.896 13.186  1.00 9.45  ?  113  TYR A CA  1 
ATOM   843  C C   . TYR A 1 112 ? 33.726 75.501 12.160  1.00 15.25 ?  113  TYR A C   1 
ATOM   844  O O   . TYR A 1 112 ? 33.680 75.072 11.003  1.00 13.56 ?  113  TYR A O   1 
ATOM   845  C CB  . TYR A 1 112 ? 35.987 75.689 13.217  1.00 12.08 ?  113  TYR A CB  1 
ATOM   846  C CG  . TYR A 1 112 ? 36.879 75.360 14.395  1.00 18.46 ?  113  TYR A CG  1 
ATOM   847  C CD1 . TYR A 1 112 ? 37.595 74.171 14.440  1.00 16.33 ?  113  TYR A CD1 1 
ATOM   848  C CD2 . TYR A 1 112 ? 37.009 76.243 15.458  1.00 13.81 ?  113  TYR A CD2 1 
ATOM   849  C CE1 . TYR A 1 112 ? 38.412 73.868 15.514  1.00 16.12 ?  113  TYR A CE1 1 
ATOM   850  C CE2 . TYR A 1 112 ? 37.823 75.948 16.538  1.00 11.63 ?  113  TYR A CE2 1 
ATOM   851  C CZ  . TYR A 1 112 ? 38.521 74.761 16.561  1.00 17.00 ?  113  TYR A CZ  1 
ATOM   852  O OH  . TYR A 1 112 ? 39.331 74.467 17.633  1.00 16.82 ?  113  TYR A OH  1 
ATOM   853  N N   . ALA A 1 113 ? 32.963 76.500 12.594  1.00 8.96  ?  114  ALA A N   1 
ATOM   854  C CA  . ALA A 1 113 ? 32.007 77.169 11.726  1.00 11.42 ?  114  ALA A CA  1 
ATOM   855  C C   . ALA A 1 113 ? 31.961 78.647 12.074  1.00 10.28 ?  114  ALA A C   1 
ATOM   856  O O   . ALA A 1 113 ? 31.969 79.017 13.251  1.00 13.97 ?  114  ALA A O   1 
ATOM   857  C CB  . ALA A 1 113 ? 30.607 76.553 11.850  1.00 9.57  ?  114  ALA A CB  1 
ATOM   858  N N   . ARG A 1 114 ? 31.916 79.488 11.044  1.00 12.24 ?  115  ARG A N   1 
ATOM   859  C CA  . ARG A 1 114 ? 31.879 80.930 11.236  1.00 13.82 ?  115  ARG A CA  1 
ATOM   860  C C   . ARG A 1 114 ? 31.053 81.554 10.125  1.00 18.15 ?  115  ARG A C   1 
ATOM   861  O O   . ARG A 1 114 ? 31.315 81.312 8.942   1.00 12.07 ?  115  ARG A O   1 
ATOM   862  C CB  . ARG A 1 114 ? 33.294 81.521 11.249  1.00 15.74 ?  115  ARG A CB  1 
ATOM   863  C CG  . ARG A 1 114 ? 33.367 82.977 10.821  1.00 25.85 ?  115  ARG A CG  1 
ATOM   864  C CD  . ARG A 1 114 ? 33.157 83.911 11.999  1.00 24.10 ?  115  ARG A CD  1 
ATOM   865  N NE  . ARG A 1 114 ? 34.227 83.793 12.985  1.00 34.83 ?  115  ARG A NE  1 
ATOM   866  C CZ  . ARG A 1 114 ? 35.333 84.529 12.979  1.00 48.66 ?  115  ARG A CZ  1 
ATOM   867  N NH1 . ARG A 1 114 ? 35.519 85.441 12.034  1.00 44.27 ?  115  ARG A NH1 1 
ATOM   868  N NH2 . ARG A 1 114 ? 36.254 84.353 13.917  1.00 29.76 ?  115  ARG A NH2 1 
ATOM   869  N N   . GLN A 1 115 ? 30.058 82.349 10.507  1.00 13.27 ?  116  GLN A N   1 
ATOM   870  C CA  . GLN A 1 115 ? 29.231 83.064 9.546   1.00 17.80 ?  116  GLN A CA  1 
ATOM   871  C C   . GLN A 1 115 ? 29.885 84.401 9.225   1.00 11.86 ?  116  GLN A C   1 
ATOM   872  O O   . GLN A 1 115 ? 30.153 85.202 10.127  1.00 21.31 ?  116  GLN A O   1 
ATOM   873  C CB  . GLN A 1 115 ? 27.817 83.279 10.079  1.00 11.91 ?  116  GLN A CB  1 
ATOM   874  C CG  . GLN A 1 115 ? 26.941 84.089 9.133   1.00 8.81  ?  116  GLN A CG  1 
ATOM   875  C CD  . GLN A 1 115 ? 25.487 84.125 9.558   1.00 19.37 ?  116  GLN A CD  1 
ATOM   876  O OE1 . GLN A 1 115 ? 25.107 83.533 10.566  1.00 29.71 ?  116  GLN A OE1 1 
ATOM   877  N NE2 . GLN A 1 115 ? 24.663 84.823 8.784   1.00 15.54 ?  116  GLN A NE2 1 
ATOM   878  N N   . LEU A 1 116 ? 30.148 84.633 7.947   1.00 13.33 ?  117  LEU A N   1 
ATOM   879  C CA  . LEU A 1 116 ? 30.678 85.894 7.458   1.00 14.25 ?  117  LEU A CA  1 
ATOM   880  C C   . LEU A 1 116 ? 29.591 86.634 6.695   1.00 12.33 ?  117  LEU A C   1 
ATOM   881  O O   . LEU A 1 116 ? 28.504 86.108 6.447   1.00 10.76 ?  117  LEU A O   1 
ATOM   882  C CB  . LEU A 1 116 ? 31.893 85.659 6.553   1.00 14.82 ?  117  LEU A CB  1 
ATOM   883  C CG  . LEU A 1 116 ? 33.020 84.784 7.105   1.00 17.78 ?  117  LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 116 ? 33.985 84.390 5.996   1.00 16.04 ?  117  LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 116 ? 33.753 85.504 8.222   1.00 18.99 ?  117  LEU A CD2 1 
ATOM   886  N N   . THR A 1 117 ? 29.889 87.876 6.335   1.00 16.78 ?  118  THR A N   1 
ATOM   887  C CA  . THR A 1 117 ? 29.094 88.521 5.307   1.00 15.70 ?  118  THR A CA  1 
ATOM   888  C C   . THR A 1 117 ? 29.488 87.954 3.948   1.00 11.34 ?  118  THR A C   1 
ATOM   889  O O   . THR A 1 117 ? 30.571 87.388 3.777   1.00 13.41 ?  118  THR A O   1 
ATOM   890  C CB  . THR A 1 117 ? 29.292 90.037 5.322   1.00 18.62 ?  118  THR A CB  1 
ATOM   891  O OG1 . THR A 1 117 ? 30.607 90.351 4.852   1.00 15.74 ?  118  THR A OG1 1 
ATOM   892  C CG2 . THR A 1 117 ? 29.117 90.587 6.731   1.00 17.54 ?  118  THR A CG2 1 
ATOM   893  N N   . LEU A 1 118 ? 28.584 88.095 2.977   1.00 17.35 ?  119  LEU A N   1 
ATOM   894  C CA  . LEU A 1 118 ? 28.882 87.612 1.632   1.00 15.99 ?  119  LEU A CA  1 
ATOM   895  C C   . LEU A 1 118 ? 30.126 88.289 1.071   1.00 21.61 ?  119  LEU A C   1 
ATOM   896  O O   . LEU A 1 118 ? 30.923 87.657 0.368   1.00 18.27 ?  119  LEU A O   1 
ATOM   897  C CB  . LEU A 1 118 ? 27.681 87.834 0.714   1.00 14.36 ?  119  LEU A CB  1 
ATOM   898  C CG  . LEU A 1 118 ? 27.659 87.021 -0.583  1.00 22.55 ?  119  LEU A CG  1 
ATOM   899  C CD1 . LEU A 1 118 ? 27.762 85.531 -0.290  1.00 18.43 ?  119  LEU A CD1 1 
ATOM   900  C CD2 . LEU A 1 118 ? 26.403 87.325 -1.384  1.00 22.44 ?  119  LEU A CD2 1 
ATOM   901  N N   . GLU A 1 119 ? 30.318 89.572 1.389   1.00 17.47 ?  120  GLU A N   1 
ATOM   902  C CA  . GLU A 1 119 ? 31.523 90.270 0.953   1.00 20.04 ?  120  GLU A CA  1 
ATOM   903  C C   . GLU A 1 119 ? 32.767 89.686 1.612   1.00 16.77 ?  120  GLU A C   1 
ATOM   904  O O   . GLU A 1 119 ? 33.818 89.571 0.972   1.00 16.69 ?  120  GLU A O   1 
ATOM   905  C CB  . GLU A 1 119 ? 31.401 91.763 1.256   1.00 19.61 ?  120  GLU A CB  1 
ATOM   906  C CG  . GLU A 1 119 ? 32.655 92.561 0.949   1.00 33.46 ?  120  GLU A CG  1 
ATOM   907  C CD  . GLU A 1 119 ? 32.646 93.935 1.586   1.00 59.00 ?  120  GLU A CD  1 
ATOM   908  O OE1 . GLU A 1 119 ? 31.915 94.818 1.090   1.00 65.72 ?  120  GLU A OE1 1 
ATOM   909  O OE2 . GLU A 1 119 ? 33.370 94.132 2.584   1.00 63.20 ?  120  GLU A OE2 1 
ATOM   910  N N   . GLN A 1 120 ? 32.668 89.313 2.891   1.00 16.16 ?  121  GLN A N   1 
ATOM   911  C CA  . GLN A 1 120 ? 33.797 88.679 3.562   1.00 16.01 ?  121  GLN A CA  1 
ATOM   912  C C   . GLN A 1 120 ? 34.084 87.304 2.974   1.00 9.77  ?  121  GLN A C   1 
ATOM   913  O O   . GLN A 1 120 ? 35.249 86.933 2.786   1.00 13.98 ?  121  GLN A O   1 
ATOM   914  C CB  . GLN A 1 120 ? 33.527 88.571 5.063   1.00 19.15 ?  121  GLN A CB  1 
ATOM   915  C CG  . GLN A 1 120 ? 33.629 89.887 5.812   1.00 17.76 ?  121  GLN A CG  1 
ATOM   916  C CD  . GLN A 1 120 ? 33.091 89.792 7.226   1.00 21.39 ?  121  GLN A CD  1 
ATOM   917  O OE1 . GLN A 1 120 ? 32.255 88.940 7.530   1.00 25.94 ?  121  GLN A OE1 1 
ATOM   918  N NE2 . GLN A 1 120 ? 33.563 90.673 8.099   1.00 30.65 ?  121  GLN A NE2 1 
ATOM   919  N N   . LEU A 1 121 ? 33.032 86.534 2.682   1.00 11.87 ?  122  LEU A N   1 
ATOM   920  C CA  . LEU A 1 121 ? 33.211 85.224 2.064   1.00 16.33 ?  122  LEU A CA  1 
ATOM   921  C C   . LEU A 1 121 ? 33.910 85.345 0.716   1.00 17.06 ?  122  LEU A C   1 
ATOM   922  O O   . LEU A 1 121 ? 34.811 84.558 0.402   1.00 13.32 ?  122  LEU A O   1 
ATOM   923  C CB  . LEU A 1 121 ? 31.857 84.533 1.907   1.00 16.08 ?  122  LEU A CB  1 
ATOM   924  C CG  . LEU A 1 121 ? 31.862 83.038 1.581   1.00 26.10 ?  122  LEU A CG  1 
ATOM   925  C CD1 . LEU A 1 121 ? 31.648 82.212 2.839   1.00 20.78 ?  122  LEU A CD1 1 
ATOM   926  C CD2 . LEU A 1 121 ? 30.803 82.714 0.538   1.00 26.60 ?  122  LEU A CD2 1 
ATOM   927  N N   . HIS A 1 122 ? 33.512 86.333 -0.090  1.00 13.27 ?  123  HIS A N   1 
ATOM   928  C CA  . HIS A 1 122 ? 34.170 86.551 -1.374  1.00 11.04 ?  123  HIS A CA  1 
ATOM   929  C C   . HIS A 1 122 ? 35.628 86.950 -1.185  1.00 16.62 ?  123  HIS A C   1 
ATOM   930  O O   . HIS A 1 122 ? 36.492 86.564 -1.981  1.00 12.39 ?  123  HIS A O   1 
ATOM   931  C CB  . HIS A 1 122 ? 33.420 87.616 -2.173  1.00 14.90 ?  123  HIS A CB  1 
ATOM   932  C CG  . HIS A 1 122 ? 33.901 87.764 -3.583  1.00 20.64 ?  123  HIS A CG  1 
ATOM   933  N ND1 . HIS A 1 122 ? 33.777 88.938 -4.294  1.00 21.77 ?  123  HIS A ND1 1 
ATOM   934  C CD2 . HIS A 1 122 ? 34.507 86.883 -4.416  1.00 23.26 ?  123  HIS A CD2 1 
ATOM   935  C CE1 . HIS A 1 122 ? 34.284 88.775 -5.503  1.00 21.86 ?  123  HIS A CE1 1 
ATOM   936  N NE2 . HIS A 1 122 ? 34.734 87.537 -5.602  1.00 23.52 ?  123  HIS A NE2 1 
ATOM   937  N N   . ALA A 1 123 ? 35.921 87.726 -0.136  1.00 16.54 ?  124  ALA A N   1 
ATOM   938  C CA  . ALA A 1 123 ? 37.304 88.096 0.144   1.00 12.03 ?  124  ALA A CA  1 
ATOM   939  C C   . ALA A 1 123 ? 38.141 86.882 0.523   1.00 12.36 ?  124  ALA A C   1 
ATOM   940  O O   . ALA A 1 123 ? 39.345 86.846 0.245   1.00 14.67 ?  124  ALA A O   1 
ATOM   941  C CB  . ALA A 1 123 ? 37.354 89.146 1.255   1.00 11.01 ?  124  ALA A CB  1 
ATOM   942  N N   . VAL A 1 124 ? 37.525 85.884 1.160   1.00 12.83 ?  125  VAL A N   1 
ATOM   943  C CA  . VAL A 1 124 ? 38.225 84.633 1.429   1.00 11.16 ?  125  VAL A CA  1 
ATOM   944  C C   . VAL A 1 124 ? 38.539 83.912 0.124   1.00 9.74  ?  125  VAL A C   1 
ATOM   945  O O   . VAL A 1 124 ? 39.639 83.376 -0.058  1.00 9.90  ?  125  VAL A O   1 
ATOM   946  C CB  . VAL A 1 124 ? 37.394 83.753 2.381   1.00 15.04 ?  125  VAL A CB  1 
ATOM   947  C CG1 . VAL A 1 124 ? 37.985 82.353 2.472   1.00 14.81 ?  125  VAL A CG1 1 
ATOM   948  C CG2 . VAL A 1 124 ? 37.309 84.396 3.758   1.00 11.04 ?  125  VAL A CG2 1 
ATOM   949  N N   . GLU A 1 125 ? 37.580 83.892 -0.806  1.00 8.76  ?  126  GLU A N   1 
ATOM   950  C CA  . GLU A 1 125 ? 37.819 83.280 -2.110  1.00 11.36 ?  126  GLU A CA  1 
ATOM   951  C C   . GLU A 1 125 ? 38.959 83.973 -2.844  1.00 14.16 ?  126  GLU A C   1 
ATOM   952  O O   . GLU A 1 125 ? 39.819 83.312 -3.439  1.00 14.20 ?  126  GLU A O   1 
ATOM   953  C CB  . GLU A 1 125 ? 36.542 83.324 -2.949  1.00 8.49  ?  126  GLU A CB  1 
ATOM   954  C CG  . GLU A 1 125 ? 35.408 82.475 -2.407  1.00 13.00 ?  126  GLU A CG  1 
ATOM   955  C CD  . GLU A 1 125 ? 34.097 82.726 -3.127  1.00 20.62 ?  126  GLU A CD  1 
ATOM   956  O OE1 . GLU A 1 125 ? 33.792 83.900 -3.427  1.00 17.09 ?  126  GLU A OE1 1 
ATOM   957  O OE2 . GLU A 1 125 ? 33.373 81.747 -3.399  1.00 14.14 ?  126  GLU A OE2 1 
ATOM   958  N N   . ILE A 1 126 ? 38.985 85.308 -2.811  1.00 12.27 ?  127  ILE A N   1 
ATOM   959  C CA  . ILE A 1 126 ? 40.051 86.051 -3.477  1.00 10.45 ?  127  ILE A CA  1 
ATOM   960  C C   . ILE A 1 126 ? 41.396 85.748 -2.828  1.00 12.30 ?  127  ILE A C   1 
ATOM   961  O O   . ILE A 1 126 ? 42.414 85.597 -3.514  1.00 14.87 ?  127  ILE A O   1 
ATOM   962  C CB  . ILE A 1 126 ? 39.738 87.559 -3.459  1.00 17.73 ?  127  ILE A CB  1 
ATOM   963  C CG1 . ILE A 1 126 ? 38.508 87.853 -4.320  1.00 15.87 ?  127  ILE A CG1 1 
ATOM   964  C CG2 . ILE A 1 126 ? 40.941 88.364 -3.934  1.00 16.48 ?  127  ILE A CG2 1 
ATOM   965  C CD1 . ILE A 1 126 ? 37.907 89.220 -4.076  1.00 16.75 ?  127  ILE A CD1 1 
ATOM   966  N N   . SER A 1 127 ? 41.421 85.650 -1.499  1.00 14.64 ?  128  SER A N   1 
ATOM   967  C CA  . SER A 1 127 ? 42.667 85.333 -0.810  1.00 14.40 ?  128  SER A CA  1 
ATOM   968  C C   . SER A 1 127 ? 43.114 83.902 -1.080  1.00 13.04 ?  128  SER A C   1 
ATOM   969  O O   . SER A 1 127 ? 44.318 83.623 -1.090  1.00 14.18 ?  128  SER A O   1 
ATOM   970  C CB  . SER A 1 127 ? 42.504 85.561 0.693   1.00 16.88 ?  128  SER A CB  1 
ATOM   971  O OG  . SER A 1 127 ? 43.641 85.100 1.399   1.00 22.87 ?  128  SER A OG  1 
ATOM   972  N N   . ALA A 1 128 ? 42.168 82.989 -1.309  1.00 12.53 ?  129  ALA A N   1 
ATOM   973  C CA  . ALA A 1 128 ? 42.516 81.580 -1.465  1.00 11.76 ?  129  ALA A CA  1 
ATOM   974  C C   . ALA A 1 128 ? 43.290 81.328 -2.755  1.00 14.83 ?  129  ALA A C   1 
ATOM   975  O O   . ALA A 1 128 ? 44.186 80.476 -2.787  1.00 10.81 ?  129  ALA A O   1 
ATOM   976  C CB  . ALA A 1 128 ? 41.253 80.723 -1.423  1.00 10.00 ?  129  ALA A CB  1 
ATOM   977  N N   A VAL A 1 129 ? 42.961 82.057 -3.826  0.50 13.40 ?  130  VAL A N   1 
ATOM   978  N N   B VAL A 1 129 ? 42.961 82.053 -3.827  0.50 13.35 ?  130  VAL A N   1 
ATOM   979  C CA  A VAL A 1 129 ? 43.642 81.868 -5.104  0.50 14.79 ?  130  VAL A CA  1 
ATOM   980  C CA  B VAL A 1 129 ? 43.655 81.848 -5.092  0.50 14.82 ?  130  VAL A CA  1 
ATOM   981  C C   A VAL A 1 129 ? 45.062 82.412 -5.099  0.50 15.60 ?  130  VAL A C   1 
ATOM   982  C C   B VAL A 1 129 ? 45.105 82.305 -5.017  0.50 15.67 ?  130  VAL A C   1 
ATOM   983  O O   A VAL A 1 129 ? 45.832 82.111 -6.018  0.50 14.25 ?  130  VAL A O   1 
ATOM   984  O O   B VAL A 1 129 ? 45.945 81.827 -5.788  0.50 14.68 ?  130  VAL A O   1 
ATOM   985  C CB  A VAL A 1 129 ? 42.844 82.511 -6.258  0.50 16.05 ?  130  VAL A CB  1 
ATOM   986  C CB  B VAL A 1 129 ? 42.901 82.569 -6.223  0.50 16.03 ?  130  VAL A CB  1 
ATOM   987  C CG1 A VAL A 1 129 ? 41.391 82.057 -6.221  0.50 19.97 ?  130  VAL A CG1 1 
ATOM   988  C CG1 B VAL A 1 129 ? 43.420 82.132 -7.585  0.50 13.84 ?  130  VAL A CG1 1 
ATOM   989  C CG2 A VAL A 1 129 ? 42.938 84.027 -6.202  0.50 10.68 ?  130  VAL A CG2 1 
ATOM   990  C CG2 B VAL A 1 129 ? 41.426 82.283 -6.105  0.50 19.95 ?  130  VAL A CG2 1 
ATOM   991  N N   . HIS A 1 130 ? 45.427 83.207 -4.094  1.00 14.34 ?  131  HIS A N   1 
ATOM   992  C CA  . HIS A 1 130 ? 46.792 83.677 -3.911  1.00 16.95 ?  131  HIS A CA  1 
ATOM   993  C C   . HIS A 1 130 ? 47.530 82.909 -2.821  1.00 19.17 ?  131  HIS A C   1 
ATOM   994  O O   . HIS A 1 130 ? 48.652 83.284 -2.468  1.00 21.13 ?  131  HIS A O   1 
ATOM   995  C CB  . HIS A 1 130 ? 46.800 85.171 -3.577  1.00 15.21 ?  131  HIS A CB  1 
ATOM   996  C CG  . HIS A 1 130 ? 46.184 86.035 -4.632  1.00 17.83 ?  131  HIS A CG  1 
ATOM   997  N ND1 . HIS A 1 130 ? 46.786 86.267 -5.850  1.00 23.79 ?  131  HIS A ND1 1 
ATOM   998  C CD2 . HIS A 1 130 ? 45.022 86.730 -4.649  1.00 21.01 ?  131  HIS A CD2 1 
ATOM   999  C CE1 . HIS A 1 130 ? 46.020 87.064 -6.573  1.00 17.86 ?  131  HIS A CE1 1 
ATOM   1000 N NE2 . HIS A 1 130 ? 44.944 87.360 -5.867  1.00 17.16 ?  131  HIS A NE2 1 
ATOM   1001 N N   . SER A 1 131 ? 46.930 81.847 -2.287  1.00 14.99 ?  132  SER A N   1 
ATOM   1002 C CA  . SER A 1 131 ? 47.470 81.177 -1.116  1.00 20.43 ?  132  SER A CA  1 
ATOM   1003 C C   . SER A 1 131 ? 48.611 80.235 -1.492  1.00 25.62 ?  132  SER A C   1 
ATOM   1004 O O   . SER A 1 131 ? 48.782 79.846 -2.650  1.00 19.05 ?  132  SER A O   1 
ATOM   1005 C CB  . SER A 1 131 ? 46.372 80.400 -0.386  1.00 18.71 ?  132  SER A CB  1 
ATOM   1006 O OG  . SER A 1 131 ? 46.122 79.157 -1.019  1.00 29.43 ?  132  SER A OG  1 
ATOM   1007 N N   . ARG A 1 132 ? 49.390 79.862 -0.474  1.00 21.15 ?  133  ARG A N   1 
ATOM   1008 C CA  . ARG A 1 132 ? 50.552 79.003 -0.681  1.00 31.36 ?  133  ARG A CA  1 
ATOM   1009 C C   . ARG A 1 132 ? 50.136 77.615 -1.150  1.00 23.02 ?  133  ARG A C   1 
ATOM   1010 O O   . ARG A 1 132 ? 50.825 76.998 -1.971  1.00 26.42 ?  133  ARG A O   1 
ATOM   1011 C CB  . ARG A 1 132 ? 51.373 78.893 0.608   1.00 28.84 ?  133  ARG A CB  1 
ATOM   1012 C CG  . ARG A 1 132 ? 52.281 80.082 0.956   1.00 50.24 ?  133  ARG A CG  1 
ATOM   1013 C CD  . ARG A 1 132 ? 51.500 81.350 1.259   1.00 83.63 ?  133  ARG A CD  1 
ATOM   1014 N NE  . ARG A 1 132 ? 50.251 81.046 1.944   1.00 50.24 ?  133  ARG A NE  1 
ATOM   1015 C CZ  . ARG A 1 132 ? 49.151 81.784 1.851   1.00 39.62 ?  133  ARG A CZ  1 
ATOM   1016 N NH1 . ARG A 1 132 ? 49.143 82.890 1.116   1.00 64.11 ?  133  ARG A NH1 1 
ATOM   1017 N NH2 . ARG A 1 132 ? 48.060 81.414 2.498   1.00 39.76 ?  133  ARG A NH2 1 
ATOM   1018 N N   . ASP A 1 133 ? 49.020 77.104 -0.630  1.00 16.70 ?  134  ASP A N   1 
ATOM   1019 C CA  . ASP A 1 133 ? 48.556 75.768 -0.975  1.00 17.00 ?  134  ASP A CA  1 
ATOM   1020 C C   . ASP A 1 133 ? 47.812 75.713 -2.301  1.00 14.46 ?  134  ASP A C   1 
ATOM   1021 O O   . ASP A 1 133 ? 47.500 74.611 -2.764  1.00 15.38 ?  134  ASP A O   1 
ATOM   1022 C CB  . ASP A 1 133 ? 47.649 75.219 0.130   1.00 19.89 ?  134  ASP A CB  1 
ATOM   1023 C CG  . ASP A 1 133 ? 48.422 74.769 1.354   1.00 32.88 ?  134  ASP A CG  1 
ATOM   1024 O OD1 . ASP A 1 133 ? 49.661 74.928 1.371   1.00 37.48 ?  134  ASP A OD1 1 
ATOM   1025 O OD2 . ASP A 1 133 ? 47.789 74.255 2.300   1.00 46.45 ?  134  ASP A OD2 1 
ATOM   1026 N N   . HIS A 1 134 ? 47.513 76.855 -2.919  1.00 16.90 ?  135  HIS A N   1 
ATOM   1027 C CA  . HIS A 1 134 ? 46.761 76.842 -4.167  1.00 20.55 ?  135  HIS A CA  1 
ATOM   1028 C C   . HIS A 1 134 ? 47.590 76.216 -5.280  1.00 18.68 ?  135  HIS A C   1 
ATOM   1029 O O   . HIS A 1 134 ? 48.742 76.600 -5.507  1.00 16.58 ?  135  HIS A O   1 
ATOM   1030 C CB  . HIS A 1 134 ? 46.339 78.253 -4.566  1.00 13.24 ?  135  HIS A CB  1 
ATOM   1031 C CG  . HIS A 1 134 ? 45.701 78.320 -5.918  1.00 19.76 ?  135  HIS A CG  1 
ATOM   1032 N ND1 . HIS A 1 134 ? 44.376 78.004 -6.132  1.00 18.17 ?  135  HIS A ND1 1 
ATOM   1033 C CD2 . HIS A 1 134 ? 46.212 78.637 -7.131  1.00 20.94 ?  135  HIS A CD2 1 
ATOM   1034 C CE1 . HIS A 1 134 ? 44.096 78.138 -7.416  1.00 17.22 ?  135  HIS A CE1 1 
ATOM   1035 N NE2 . HIS A 1 134 ? 45.193 78.520 -8.045  1.00 20.66 ?  135  HIS A NE2 1 
ATOM   1036 N N   . GLY A 1 135 ? 46.995 75.259 -5.986  1.00 15.29 ?  136  GLY A N   1 
ATOM   1037 C CA  . GLY A 1 135 ? 47.712 74.508 -6.991  1.00 22.34 ?  136  GLY A CA  1 
ATOM   1038 C C   . GLY A 1 135 ? 48.537 73.364 -6.451  1.00 21.07 ?  136  GLY A C   1 
ATOM   1039 O O   . GLY A 1 135 ? 49.196 72.673 -7.238  1.00 20.48 ?  136  GLY A O   1 
ATOM   1040 N N   . LEU A 1 136 ? 48.530 73.146 -5.137  1.00 18.73 ?  137  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 136 ? 49.246 72.030 -4.535  1.00 20.64 ?  137  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 136 ? 48.277 71.156 -3.751  1.00 17.28 ?  137  LEU A C   1 
ATOM   1043 O O   . LEU A 1 136 ? 47.725 70.193 -4.293  1.00 17.72 ?  137  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 136 ? 50.375 72.537 -3.634  1.00 23.38 ?  137  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 136 ? 51.480 73.327 -4.339  1.00 30.80 ?  137  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 136 ? 52.282 74.153 -3.344  1.00 43.82 ?  137  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 136 ? 52.392 72.398 -5.122  1.00 35.28 ?  137  LEU A CD2 1 
ATOM   1048 N N   . GLU A 1 137 ? 48.052 71.490 -2.478  1.00 11.41 ?  138  GLU A N   1 
ATOM   1049 C CA  . GLU A 1 137 ? 47.109 70.730 -1.666  1.00 15.09 ?  138  GLU A CA  1 
ATOM   1050 C C   . GLU A 1 137 ? 45.663 71.113 -1.956  1.00 9.61  ?  138  GLU A C   1 
ATOM   1051 O O   . GLU A 1 137 ? 44.763 70.278 -1.801  1.00 10.69 ?  138  GLU A O   1 
ATOM   1052 C CB  . GLU A 1 137 ? 47.413 70.927 -0.180  1.00 21.04 ?  138  GLU A CB  1 
ATOM   1053 C CG  . GLU A 1 137 ? 48.712 70.288 0.284   1.00 32.56 ?  138  GLU A CG  1 
ATOM   1054 C CD  . GLU A 1 137 ? 49.896 71.231 0.190   1.00 47.05 ?  138  GLU A CD  1 
ATOM   1055 O OE1 . GLU A 1 137 ? 49.732 72.343 -0.356  1.00 35.20 ?  138  GLU A OE1 1 
ATOM   1056 O OE2 . GLU A 1 137 ? 50.990 70.861 0.666   1.00 55.05 ?  138  GLU A OE2 1 
ATOM   1057 N N   . VAL A 1 138 ? 45.420 72.354 -2.367  1.00 9.75  ?  139  VAL A N   1 
ATOM   1058 C CA  . VAL A 1 138 ? 44.081 72.852 -2.663  1.00 9.85  ?  139  VAL A CA  1 
ATOM   1059 C C   . VAL A 1 138 ? 44.014 73.151 -4.153  1.00 10.39 ?  139  VAL A C   1 
ATOM   1060 O O   . VAL A 1 138 ? 44.832 73.917 -4.679  1.00 13.66 ?  139  VAL A O   1 
ATOM   1061 C CB  . VAL A 1 138 ? 43.742 74.099 -1.833  1.00 8.52  ?  139  VAL A CB  1 
ATOM   1062 C CG1 . VAL A 1 138 ? 42.322 74.566 -2.131  1.00 11.37 ?  139  VAL A CG1 1 
ATOM   1063 C CG2 . VAL A 1 138 ? 43.921 73.816 -0.346  1.00 12.52 ?  139  VAL A CG2 1 
ATOM   1064 N N   . LEU A 1 139 ? 43.041 72.552 -4.834  1.00 9.89  ?  140  LEU A N   1 
ATOM   1065 C CA  . LEU A 1 139 ? 42.898 72.699 -6.276  1.00 12.12 ?  140  LEU A CA  1 
ATOM   1066 C C   . LEU A 1 139 ? 41.825 73.703 -6.670  1.00 16.72 ?  140  LEU A C   1 
ATOM   1067 O O   . LEU A 1 139 ? 41.621 73.935 -7.866  1.00 10.54 ?  140  LEU A O   1 
ATOM   1068 C CB  . LEU A 1 139 ? 42.600 71.338 -6.911  1.00 6.69  ?  140  LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 139 ? 43.727 70.318 -6.727  1.00 15.22 ?  140  LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 139 ? 43.434 69.029 -7.477  1.00 14.29 ?  140  LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 139 ? 45.054 70.918 -7.172  1.00 15.03 ?  140  LEU A CD2 1 
ATOM   1072 N N   . GLY A 1 140 ? 41.144 74.309 -5.701  1.00 10.17 ?  141  GLY A N   1 
ATOM   1073 C CA  . GLY A 1 140 ? 40.126 75.295 -5.996  1.00 9.76  ?  141  GLY A CA  1 
ATOM   1074 C C   . GLY A 1 140 ? 38.981 75.279 -5.006  1.00 11.94 ?  141  GLY A C   1 
ATOM   1075 O O   . GLY A 1 140 ? 38.532 74.211 -4.581  1.00 14.81 ?  141  GLY A O   1 
ATOM   1076 N N   . LEU A 1 141 ? 38.506 76.460 -4.624  1.00 10.25 ?  142  LEU A N   1 
ATOM   1077 C CA  . LEU A 1 141 ? 37.344 76.561 -3.757  1.00 11.30 ?  142  LEU A CA  1 
ATOM   1078 C C   . LEU A 1 141 ? 36.066 76.471 -4.578  1.00 9.13  ?  142  LEU A C   1 
ATOM   1079 O O   . LEU A 1 141 ? 36.006 76.919 -5.726  1.00 13.71 ?  142  LEU A O   1 
ATOM   1080 C CB  . LEU A 1 141 ? 37.364 77.875 -2.975  1.00 12.18 ?  142  LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 141 ? 37.911 77.842 -1.547  1.00 24.37 ?  142  LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 141 ? 39.311 77.249 -1.508  1.00 16.55 ?  142  LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 141 ? 37.896 79.240 -0.946  1.00 15.82 ?  142  LEU A CD2 1 
ATOM   1084 N N   . VAL A 1 142 ? 35.038 75.872 -3.982  1.00 9.74  ?  143  VAL A N   1 
ATOM   1085 C CA  . VAL A 1 142 ? 33.722 75.793 -4.600  1.00 9.49  ?  143  VAL A CA  1 
ATOM   1086 C C   . VAL A 1 142 ? 32.675 76.171 -3.565  1.00 15.66 ?  143  VAL A C   1 
ATOM   1087 O O   . VAL A 1 142 ? 32.824 75.895 -2.370  1.00 15.92 ?  143  VAL A O   1 
ATOM   1088 C CB  . VAL A 1 142 ? 33.421 74.392 -5.184  1.00 11.89 ?  143  VAL A CB  1 
ATOM   1089 C CG1 . VAL A 1 142 ? 34.387 74.061 -6.315  1.00 13.11 ?  143  VAL A CG1 1 
ATOM   1090 C CG2 . VAL A 1 142 ? 33.474 73.330 -4.094  1.00 11.20 ?  143  VAL A CG2 1 
ATOM   1091 N N   . ARG A 1 143 ? 31.612 76.815 -4.032  1.00 12.05 ?  144  ARG A N   1 
ATOM   1092 C CA  . ARG A 1 143 ? 30.475 77.136 -3.184  1.00 17.61 ?  144  ARG A CA  1 
ATOM   1093 C C   . ARG A 1 143 ? 29.438 76.026 -3.270  1.00 13.52 ?  144  ARG A C   1 
ATOM   1094 O O   . ARG A 1 143 ? 29.182 75.479 -4.346  1.00 13.35 ?  144  ARG A O   1 
ATOM   1095 C CB  . ARG A 1 143 ? 29.847 78.468 -3.591  1.00 15.59 ?  144  ARG A CB  1 
ATOM   1096 C CG  . ARG A 1 143 ? 30.696 79.682 -3.265  1.00 15.08 ?  144  ARG A CG  1 
ATOM   1097 C CD  . ARG A 1 143 ? 29.906 80.957 -3.486  1.00 15.64 ?  144  ARG A CD  1 
ATOM   1098 N NE  . ARG A 1 143 ? 30.741 82.149 -3.389  1.00 15.31 ?  144  ARG A NE  1 
ATOM   1099 C CZ  . ARG A 1 143 ? 30.280 83.388 -3.510  1.00 22.73 ?  144  ARG A CZ  1 
ATOM   1100 N NH1 . ARG A 1 143 ? 28.988 83.595 -3.730  1.00 17.74 ?  144  ARG A NH1 1 
ATOM   1101 N NH2 . ARG A 1 143 ? 31.107 84.420 -3.410  1.00 17.15 ?  144  ARG A NH2 1 
ATOM   1102 N N   . VAL A 1 144 ? 28.852 75.690 -2.127  1.00 7.43  ?  145  VAL A N   1 
ATOM   1103 C CA  . VAL A 1 144 ? 27.814 74.667 -2.072  1.00 8.73  ?  145  VAL A CA  1 
ATOM   1104 C C   . VAL A 1 144 ? 26.497 75.291 -2.515  1.00 10.69 ?  145  VAL A C   1 
ATOM   1105 O O   . VAL A 1 144 ? 26.063 76.296 -1.933  1.00 14.51 ?  145  VAL A O   1 
ATOM   1106 C CB  . VAL A 1 144 ? 27.693 74.064 -0.663  1.00 13.92 ?  145  VAL A CB  1 
ATOM   1107 C CG1 . VAL A 1 144 ? 26.623 72.983 -0.640  1.00 10.96 ?  145  VAL A CG1 1 
ATOM   1108 C CG2 . VAL A 1 144 ? 29.030 73.510 -0.206  1.00 11.89 ?  145  VAL A CG2 1 
ATOM   1109 N N   . PRO A 1 145 ? 25.838 74.753 -3.543  1.00 10.15 ?  146  PRO A N   1 
ATOM   1110 C CA  . PRO A 1 145 ? 24.487 75.221 -3.885  1.00 15.63 ?  146  PRO A CA  1 
ATOM   1111 C C   . PRO A 1 145 ? 23.470 74.569 -2.959  1.00 16.49 ?  146  PRO A C   1 
ATOM   1112 O O   . PRO A 1 145 ? 23.402 73.342 -2.862  1.00 12.40 ?  146  PRO A O   1 
ATOM   1113 C CB  . PRO A 1 145 ? 24.312 74.761 -5.337  1.00 12.64 ?  146  PRO A CB  1 
ATOM   1114 C CG  . PRO A 1 145 ? 25.174 73.534 -5.442  1.00 9.87  ?  146  PRO A CG  1 
ATOM   1115 C CD  . PRO A 1 145 ? 26.319 73.707 -4.465  1.00 12.37 ?  146  PRO A CD  1 
ATOM   1116 N N   . LEU A 1 146 ? 22.692 75.392 -2.260  1.00 11.53 ?  147  LEU A N   1 
ATOM   1117 C CA  . LEU A 1 146 ? 21.731 74.897 -1.283  1.00 14.41 ?  147  LEU A CA  1 
ATOM   1118 C C   . LEU A 1 146 ? 20.309 74.843 -1.824  1.00 15.35 ?  147  LEU A C   1 
ATOM   1119 O O   . LEU A 1 146 ? 19.404 74.398 -1.112  1.00 21.05 ?  147  LEU A O   1 
ATOM   1120 C CB  . LEU A 1 146 ? 21.776 75.757 -0.016  1.00 16.85 ?  147  LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 146 ? 23.039 75.602 0.832   1.00 26.01 ?  147  LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 146 ? 22.904 76.364 2.140   1.00 24.46 ?  147  LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 146 ? 23.335 74.131 1.092   1.00 18.71 ?  147  LEU A CD2 1 
ATOM   1124 N N   . TYR A 1 147 ? 20.097 75.279 -3.058  1.00 9.60  ?  148  TYR A N   1 
ATOM   1125 C CA  . TYR A 1 147 ? 18.802 75.218 -3.716  1.00 10.86 ?  148  TYR A CA  1 
ATOM   1126 C C   . TYR A 1 147 ? 18.657 73.903 -4.473  1.00 12.81 ?  148  TYR A C   1 
ATOM   1127 O O   . TYR A 1 147 ? 19.638 73.223 -4.781  1.00 15.14 ?  148  TYR A O   1 
ATOM   1128 C CB  . TYR A 1 147 ? 18.650 76.393 -4.682  1.00 16.83 ?  148  TYR A CB  1 
ATOM   1129 C CG  . TYR A 1 147 ? 19.876 76.580 -5.546  1.00 17.94 ?  148  TYR A CG  1 
ATOM   1130 C CD1 . TYR A 1 147 ? 20.027 75.874 -6.735  1.00 13.19 ?  148  TYR A CD1 1 
ATOM   1131 C CD2 . TYR A 1 147 ? 20.898 77.438 -5.159  1.00 15.47 ?  148  TYR A CD2 1 
ATOM   1132 C CE1 . TYR A 1 147 ? 21.153 76.029 -7.518  1.00 11.00 ?  148  TYR A CE1 1 
ATOM   1133 C CE2 . TYR A 1 147 ? 22.028 77.597 -5.935  1.00 18.59 ?  148  TYR A CE2 1 
ATOM   1134 C CZ  . TYR A 1 147 ? 22.149 76.891 -7.114  1.00 14.48 ?  148  TYR A CZ  1 
ATOM   1135 O OH  . TYR A 1 147 ? 23.273 77.047 -7.890  1.00 12.30 ?  148  TYR A OH  1 
ATOM   1136 N N   . THR A 1 148 ? 17.411 73.554 -4.782  1.00 14.81 ?  149  THR A N   1 
ATOM   1137 C CA  . THR A 1 148 ? 17.106 72.396 -5.612  1.00 14.36 ?  149  THR A CA  1 
ATOM   1138 C C   . THR A 1 148 ? 16.220 72.843 -6.763  1.00 22.37 ?  149  THR A C   1 
ATOM   1139 O O   . THR A 1 148 ? 15.199 73.503 -6.544  1.00 14.71 ?  149  THR A O   1 
ATOM   1140 C CB  . THR A 1 148 ? 16.416 71.287 -4.808  1.00 18.81 ?  149  THR A CB  1 
ATOM   1141 O OG1 . THR A 1 148 ? 17.301 70.813 -3.785  1.00 14.43 ?  149  THR A OG1 1 
ATOM   1142 C CG2 . THR A 1 148 ? 16.041 70.123 -5.717  1.00 22.62 ?  149  THR A CG2 1 
ATOM   1143 N N   . GLN A 1 149 ? 16.614 72.495 -7.985  1.00 17.04 ?  150  GLN A N   1 
ATOM   1144 C CA  . GLN A 1 149 ? 15.832 72.865 -9.152  1.00 19.41 ?  150  GLN A CA  1 
ATOM   1145 C C   . GLN A 1 149 ? 14.583 71.993 -9.257  1.00 20.87 ?  150  GLN A C   1 
ATOM   1146 O O   . GLN A 1 149 ? 14.408 71.012 -8.528  1.00 16.98 ?  150  GLN A O   1 
ATOM   1147 C CB  . GLN A 1 149 ? 16.675 72.757 -10.421 1.00 14.57 ?  150  GLN A CB  1 
ATOM   1148 C CG  . GLN A 1 149 ? 17.695 73.872 -10.569 1.00 14.31 ?  150  GLN A CG  1 
ATOM   1149 C CD  . GLN A 1 149 ? 18.526 73.739 -11.827 1.00 30.20 ?  150  GLN A CD  1 
ATOM   1150 O OE1 . GLN A 1 149 ? 19.492 72.978 -11.868 1.00 23.96 ?  150  GLN A OE1 1 
ATOM   1151 N NE2 . GLN A 1 149 ? 18.156 74.486 -12.863 1.00 20.74 ?  150  GLN A NE2 1 
ATOM   1152 N N   . LYS A 1 150 ? 13.706 72.365 -10.193 1.00 26.18 ?  151  LYS A N   1 
ATOM   1153 C CA  . LYS A 1 150 ? 12.418 71.693 -10.327 1.00 26.86 ?  151  LYS A CA  1 
ATOM   1154 C C   . LYS A 1 150 ? 12.559 70.228 -10.720 1.00 27.25 ?  151  LYS A C   1 
ATOM   1155 O O   . LYS A 1 150 ? 11.630 69.446 -10.487 1.00 26.27 ?  151  LYS A O   1 
ATOM   1156 C CB  . LYS A 1 150 ? 11.547 72.428 -11.349 1.00 30.66 ?  151  LYS A CB  1 
ATOM   1157 C CG  . LYS A 1 150 ? 10.883 73.684 -10.798 1.00 39.31 ?  151  LYS A CG  1 
ATOM   1158 C CD  . LYS A 1 150 ? 9.922  74.306 -11.804 1.00 43.61 ?  151  LYS A CD  1 
ATOM   1159 C CE  . LYS A 1 150 ? 10.661 75.143 -12.841 1.00 53.48 ?  151  LYS A CE  1 
ATOM   1160 N NZ  . LYS A 1 150 ? 10.697 74.483 -14.178 1.00 49.79 ?  151  LYS A NZ  1 
ATOM   1161 N N   . ASP A 1 151 ? 13.691 69.833 -11.302 1.00 28.52 ?  152  ASP A N   1 
ATOM   1162 C CA  . ASP A 1 151 ? 13.908 68.436 -11.659 1.00 20.25 ?  152  ASP A CA  1 
ATOM   1163 C C   . ASP A 1 151 ? 14.296 67.571 -10.466 1.00 29.33 ?  152  ASP A C   1 
ATOM   1164 O O   . ASP A 1 151 ? 14.583 66.384 -10.653 1.00 26.53 ?  152  ASP A O   1 
ATOM   1165 C CB  . ASP A 1 151 ? 14.977 68.326 -12.753 1.00 21.72 ?  152  ASP A CB  1 
ATOM   1166 C CG  . ASP A 1 151 ? 16.351 68.779 -12.286 1.00 22.60 ?  152  ASP A CG  1 
ATOM   1167 O OD1 . ASP A 1 151 ? 16.465 69.342 -11.177 1.00 22.87 ?  152  ASP A OD1 1 
ATOM   1168 O OD2 . ASP A 1 151 ? 17.325 68.571 -13.039 1.00 27.09 ?  152  ASP A OD2 1 
ATOM   1169 N N   . ARG A 1 152 ? 14.321 68.141 -9.259  1.00 21.09 ?  153  ARG A N   1 
ATOM   1170 C CA  . ARG A 1 152 ? 14.579 67.481 -7.980  1.00 25.80 ?  153  ARG A CA  1 
ATOM   1171 C C   . ARG A 1 152 ? 16.033 67.061 -7.786  1.00 15.17 ?  153  ARG A C   1 
ATOM   1172 O O   . ARG A 1 152 ? 16.342 66.434 -6.766  1.00 22.40 ?  153  ARG A O   1 
ATOM   1173 C CB  . ARG A 1 152 ? 13.687 66.249 -7.760  1.00 24.71 ?  153  ARG A CB  1 
ATOM   1174 C CG  . ARG A 1 152 ? 12.209 66.482 -8.031  1.00 35.95 ?  153  ARG A CG  1 
ATOM   1175 C CD  . ARG A 1 152 ? 11.659 67.608 -7.171  1.00 42.16 ?  153  ARG A CD  1 
ATOM   1176 N NE  . ARG A 1 152 ? 11.210 67.133 -5.866  1.00 65.03 ?  153  ARG A NE  1 
ATOM   1177 C CZ  . ARG A 1 152 ? 9.948  66.832 -5.576  1.00 72.00 ?  153  ARG A CZ  1 
ATOM   1178 N NH1 . ARG A 1 152 ? 9.006  66.956 -6.500  1.00 60.41 ?  153  ARG A NH1 1 
ATOM   1179 N NH2 . ARG A 1 152 ? 9.628  66.407 -4.361  1.00 81.12 ?  153  ARG A NH2 1 
ATOM   1180 N N   . VAL A 1 153 ? 16.937 67.381 -8.712  1.00 17.80 ?  154  VAL A N   1 
ATOM   1181 C CA  . VAL A 1 153 ? 18.330 66.966 -8.565  1.00 15.67 ?  154  VAL A CA  1 
ATOM   1182 C C   . VAL A 1 153 ? 19.271 68.140 -8.801  1.00 11.99 ?  154  VAL A C   1 
ATOM   1183 O O   . VAL A 1 153 ? 20.362 68.198 -8.221  1.00 15.28 ?  154  VAL A O   1 
ATOM   1184 C CB  . VAL A 1 153 ? 18.669 65.798 -9.511  1.00 28.46 ?  154  VAL A CB  1 
ATOM   1185 C CG1 . VAL A 1 153 ? 17.983 64.521 -9.047  1.00 28.11 ?  154  VAL A CG1 1 
ATOM   1186 C CG2 . VAL A 1 153 ? 18.276 66.133 -10.942 1.00 18.25 ?  154  VAL A CG2 1 
ATOM   1187 N N   . GLY A 1 154 ? 18.866 69.076 -9.657  1.00 13.04 ?  155  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 154 ? 19.696 70.225 -9.964  1.00 15.23 ?  155  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 154 ? 20.039 71.056 -8.744  1.00 14.32 ?  155  GLY A C   1 
ATOM   1190 O O   . GLY A 1 154 ? 19.147 71.508 -8.021  1.00 12.76 ?  155  GLY A O   1 
ATOM   1191 N N   . GLY A 1 155 ? 21.330 71.261 -8.501  1.00 9.08  ?  156  GLY A N   1 
ATOM   1192 C CA  . GLY A 1 155 ? 21.758 72.009 -7.337  1.00 7.07  ?  156  GLY A CA  1 
ATOM   1193 C C   . GLY A 1 155 ? 22.265 71.134 -6.210  1.00 9.55  ?  156  GLY A C   1 
ATOM   1194 O O   . GLY A 1 155 ? 23.214 70.366 -6.393  1.00 9.66  ?  156  GLY A O   1 
ATOM   1195 N N   . PHE A 1 156 ? 21.628 71.238 -5.041  1.00 8.35  ?  157  PHE A N   1 
ATOM   1196 C CA  . PHE A 1 156 ? 22.119 70.545 -3.850  1.00 10.23 ?  157  PHE A CA  1 
ATOM   1197 C C   . PHE A 1 156 ? 22.193 69.030 -4.012  1.00 8.55  ?  157  PHE A C   1 
ATOM   1198 O O   . PHE A 1 156 ? 23.236 68.450 -3.658  1.00 9.77  ?  157  PHE A O   1 
ATOM   1199 C CB  . PHE A 1 156 ? 21.260 70.934 -2.641  1.00 7.92  ?  157  PHE A CB  1 
ATOM   1200 C CG  . PHE A 1 156 ? 21.864 70.550 -1.318  1.00 13.24 ?  157  PHE A CG  1 
ATOM   1201 C CD1 . PHE A 1 156 ? 23.210 70.764 -1.067  1.00 9.70  ?  157  PHE A CD1 1 
ATOM   1202 C CD2 . PHE A 1 156 ? 21.085 69.978 -0.326  1.00 12.83 ?  157  PHE A CD2 1 
ATOM   1203 C CE1 . PHE A 1 156 ? 23.769 70.414 0.147   1.00 12.56 ?  157  PHE A CE1 1 
ATOM   1204 C CE2 . PHE A 1 156 ? 21.638 69.625 0.891   1.00 14.61 ?  157  PHE A CE2 1 
ATOM   1205 C CZ  . PHE A 1 156 ? 22.982 69.842 1.127   1.00 13.23 ?  157  PHE A CZ  1 
ATOM   1206 N N   . PRO A 1 157 ? 21.162 68.329 -4.507  1.00 8.30  ?  158  PRO A N   1 
ATOM   1207 C CA  . PRO A 1 157 ? 21.302 66.868 -4.655  1.00 12.21 ?  158  PRO A CA  1 
ATOM   1208 C C   . PRO A 1 157 ? 22.438 66.465 -5.579  1.00 12.49 ?  158  PRO A C   1 
ATOM   1209 O O   . PRO A 1 157 ? 23.192 65.539 -5.254  1.00 13.15 ?  158  PRO A O   1 
ATOM   1210 C CB  . PRO A 1 157 ? 19.934 66.437 -5.208  1.00 14.38 ?  158  PRO A CB  1 
ATOM   1211 C CG  . PRO A 1 157 ? 18.997 67.517 -4.796  1.00 7.22  ?  158  PRO A CG  1 
ATOM   1212 C CD  . PRO A 1 157 ? 19.801 68.778 -4.864  1.00 8.82  ?  158  PRO A CD  1 
ATOM   1213 N N   . ASN A 1 158 ? 22.585 67.137 -6.724  1.00 11.79 ?  159  ASN A N   1 
ATOM   1214 C CA  . ASN A 1 158 ? 23.714 66.851 -7.604  1.00 11.10 ?  159  ASN A CA  1 
ATOM   1215 C C   . ASN A 1 158 ? 25.040 67.093 -6.895  1.00 12.06 ?  159  ASN A C   1 
ATOM   1216 O O   . ASN A 1 158 ? 25.981 66.302 -7.037  1.00 9.78  ?  159  ASN A O   1 
ATOM   1217 C CB  . ASN A 1 158 ? 23.635 67.703 -8.868  1.00 9.03  ?  159  ASN A CB  1 
ATOM   1218 C CG  . ASN A 1 158 ? 22.791 67.071 -9.952  1.00 16.97 ?  159  ASN A CG  1 
ATOM   1219 O OD1 . ASN A 1 158 ? 22.485 65.881 -9.905  1.00 12.80 ?  159  ASN A OD1 1 
ATOM   1220 N ND2 . ASN A 1 158 ? 22.422 67.865 -10.948 1.00 11.53 ?  159  ASN A ND2 1 
ATOM   1221 N N   . PHE A 1 159 ? 25.136 68.188 -6.135  1.00 8.36  ?  160  PHE A N   1 
ATOM   1222 C CA  . PHE A 1 159 ? 26.370 68.478 -5.413  1.00 13.44 ?  160  PHE A CA  1 
ATOM   1223 C C   . PHE A 1 159 ? 26.714 67.360 -4.439  1.00 9.84  ?  160  PHE A C   1 
ATOM   1224 O O   . PHE A 1 159 ? 27.884 66.984 -4.300  1.00 9.72  ?  160  PHE A O   1 
ATOM   1225 C CB  . PHE A 1 159 ? 26.252 69.809 -4.669  1.00 10.21 ?  160  PHE A CB  1 
ATOM   1226 C CG  . PHE A 1 159 ? 27.493 70.183 -3.905  1.00 8.49  ?  160  PHE A CG  1 
ATOM   1227 C CD1 . PHE A 1 159 ? 28.544 70.826 -4.539  1.00 13.54 ?  160  PHE A CD1 1 
ATOM   1228 C CD2 . PHE A 1 159 ? 27.613 69.880 -2.558  1.00 9.32  ?  160  PHE A CD2 1 
ATOM   1229 C CE1 . PHE A 1 159 ? 29.690 71.166 -3.841  1.00 9.45  ?  160  PHE A CE1 1 
ATOM   1230 C CE2 . PHE A 1 159 ? 28.756 70.215 -1.855  1.00 12.38 ?  160  PHE A CE2 1 
ATOM   1231 C CZ  . PHE A 1 159 ? 29.796 70.858 -2.498  1.00 8.53  ?  160  PHE A CZ  1 
ATOM   1232 N N   . LEU A 1 160 ? 25.705 66.815 -3.755  1.00 7.12  ?  161  LEU A N   1 
ATOM   1233 C CA  . LEU A 1 160 ? 25.942 65.732 -2.809  1.00 11.30 ?  161  LEU A CA  1 
ATOM   1234 C C   . LEU A 1 160 ? 26.337 64.434 -3.499  1.00 14.49 ?  161  LEU A C   1 
ATOM   1235 O O   . LEU A 1 160 ? 26.839 63.522 -2.834  1.00 12.62 ?  161  LEU A O   1 
ATOM   1236 C CB  . LEU A 1 160 ? 24.700 65.503 -1.946  1.00 9.41  ?  161  LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 160 ? 24.354 66.603 -0.940  1.00 14.84 ?  161  LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 160 ? 23.080 66.253 -0.190  1.00 9.95  ?  161  LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 160 ? 25.506 66.836 0.030   1.00 11.70 ?  161  LEU A CD2 1 
ATOM   1240 N N   . SER A 1 161 ? 26.121 64.325 -4.810  1.00 12.61 ?  162  SER A N   1 
ATOM   1241 C CA  . SER A 1 161 ? 26.510 63.129 -5.546  1.00 12.42 ?  162  SER A CA  1 
ATOM   1242 C C   . SER A 1 161 ? 27.967 63.153 -5.985  1.00 10.38 ?  162  SER A C   1 
ATOM   1243 O O   . SER A 1 161 ? 28.417 62.202 -6.631  1.00 13.84 ?  162  SER A O   1 
ATOM   1244 C CB  . SER A 1 161 ? 25.609 62.940 -6.770  1.00 11.68 ?  162  SER A CB  1 
ATOM   1245 O OG  . SER A 1 161 ? 25.976 63.823 -7.815  1.00 11.23 ?  162  SER A OG  1 
ATOM   1246 N N   . ASN A 1 162 ? 28.709 64.209 -5.658  1.00 10.21 ?  163  ASN A N   1 
ATOM   1247 C CA  . ASN A 1 162 ? 30.125 64.275 -5.976  1.00 10.14 ?  163  ASN A CA  1 
ATOM   1248 C C   . ASN A 1 162 ? 30.920 63.383 -5.025  1.00 7.23  ?  163  ASN A C   1 
ATOM   1249 O O   . ASN A 1 162 ? 30.369 62.716 -4.145  1.00 9.98  ?  163  ASN A O   1 
ATOM   1250 C CB  . ASN A 1 162 ? 30.619 65.718 -5.917  1.00 12.89 ?  163  ASN A CB  1 
ATOM   1251 C CG  . ASN A 1 162 ? 30.210 66.522 -7.133  1.00 13.76 ?  163  ASN A CG  1 
ATOM   1252 O OD1 . ASN A 1 162 ? 30.745 66.331 -8.224  1.00 16.76 ?  163  ASN A OD1 1 
ATOM   1253 N ND2 . ASN A 1 162 ? 29.261 67.430 -6.951  1.00 7.87  ?  163  ASN A ND2 1 
ATOM   1254 N N   . ALA A 1 163 ? 32.239 63.376 -5.200  1.00 10.59 ?  164  ALA A N   1 
ATOM   1255 C CA  . ALA A 1 163 ? 33.132 62.546 -4.402  1.00 12.47 ?  164  ALA A CA  1 
ATOM   1256 C C   . ALA A 1 163 ? 33.680 63.368 -3.242  1.00 9.32  ?  164  ALA A C   1 
ATOM   1257 O O   . ALA A 1 163 ? 34.398 64.351 -3.455  1.00 11.72 ?  164  ALA A O   1 
ATOM   1258 C CB  . ALA A 1 163 ? 34.269 61.992 -5.261  1.00 10.74 ?  164  ALA A CB  1 
ATOM   1259 N N   . PHE A 1 164 ? 33.343 62.964 -2.022  1.00 8.09  ?  165  PHE A N   1 
ATOM   1260 C CA  . PHE A 1 164 ? 33.740 63.670 -0.815  1.00 10.56 ?  165  PHE A CA  1 
ATOM   1261 C C   . PHE A 1 164 ? 34.703 62.827 0.007   1.00 13.54 ?  165  PHE A C   1 
ATOM   1262 O O   . PHE A 1 164 ? 34.677 61.594 -0.044  1.00 9.60  ?  165  PHE A O   1 
ATOM   1263 C CB  . PHE A 1 164 ? 32.532 64.003 0.067   1.00 8.06  ?  165  PHE A CB  1 
ATOM   1264 C CG  . PHE A 1 164 ? 31.610 65.033 -0.511  1.00 11.63 ?  165  PHE A CG  1 
ATOM   1265 C CD1 . PHE A 1 164 ? 30.671 64.682 -1.465  1.00 11.22 ?  165  PHE A CD1 1 
ATOM   1266 C CD2 . PHE A 1 164 ? 31.664 66.348 -0.080  1.00 12.66 ?  165  PHE A CD2 1 
ATOM   1267 C CE1 . PHE A 1 164 ? 29.813 65.626 -1.991  1.00 11.68 ?  165  PHE A CE1 1 
ATOM   1268 C CE2 . PHE A 1 164 ? 30.807 67.299 -0.603  1.00 8.69  ?  165  PHE A CE2 1 
ATOM   1269 C CZ  . PHE A 1 164 ? 29.881 66.937 -1.558  1.00 9.63  ?  165  PHE A CZ  1 
ATOM   1270 N N   . VAL A 1 165 ? 35.547 63.508 0.783   1.00 11.10 ?  166  VAL A N   1 
ATOM   1271 C CA  . VAL A 1 165 ? 36.075 62.883 1.986   1.00 16.68 ?  166  VAL A CA  1 
ATOM   1272 C C   . VAL A 1 165 ? 34.893 62.552 2.881   1.00 14.04 ?  166  VAL A C   1 
ATOM   1273 O O   . VAL A 1 165 ? 34.047 63.414 3.153   1.00 10.60 ?  166  VAL A O   1 
ATOM   1274 C CB  . VAL A 1 165 ? 37.078 63.811 2.687   1.00 16.43 ?  166  VAL A CB  1 
ATOM   1275 C CG1 . VAL A 1 165 ? 37.510 63.216 4.021   1.00 15.65 ?  166  VAL A CG1 1 
ATOM   1276 C CG2 . VAL A 1 165 ? 38.280 64.056 1.797   1.00 12.59 ?  166  VAL A CG2 1 
ATOM   1277 N N   . SER A 1 166 ? 34.807 61.291 3.313   1.00 9.68  ?  167  SER A N   1 
ATOM   1278 C CA  . SER A 1 166 ? 33.625 60.846 4.048   1.00 14.24 ?  167  SER A CA  1 
ATOM   1279 C C   . SER A 1 166 ? 33.375 61.712 5.277   1.00 15.10 ?  167  SER A C   1 
ATOM   1280 O O   . SER A 1 166 ? 32.222 62.008 5.612   1.00 10.96 ?  167  SER A O   1 
ATOM   1281 C CB  . SER A 1 166 ? 33.774 59.377 4.445   1.00 17.36 ?  167  SER A CB  1 
ATOM   1282 O OG  . SER A 1 166 ? 34.882 59.193 5.309   1.00 37.23 ?  167  SER A OG  1 
ATOM   1283 N N   . THR A 1 167 ? 34.444 62.147 5.947   1.00 8.76  ?  168  THR A N   1 
ATOM   1284 C CA  . THR A 1 167 ? 34.286 63.008 7.114   1.00 8.33  ?  168  THR A CA  1 
ATOM   1285 C C   . THR A 1 167 ? 33.646 64.339 6.736   1.00 11.76 ?  168  THR A C   1 
ATOM   1286 O O   . THR A 1 167 ? 32.791 64.855 7.466   1.00 13.43 ?  168  THR A O   1 
ATOM   1287 C CB  . THR A 1 167 ? 35.642 63.238 7.783   1.00 17.30 ?  168  THR A CB  1 
ATOM   1288 O OG1 . THR A 1 167 ? 36.242 61.976 8.102   1.00 13.35 ?  168  THR A OG1 1 
ATOM   1289 C CG2 . THR A 1 167 ? 35.477 64.052 9.057   1.00 14.30 ?  168  THR A CG2 1 
ATOM   1290 N N   . ALA A 1 168 ? 34.035 64.902 5.589   1.00 8.66  ?  169  ALA A N   1 
ATOM   1291 C CA  . ALA A 1 168 ? 33.542 66.220 5.202   1.00 7.34  ?  169  ALA A CA  1 
ATOM   1292 C C   . ALA A 1 168 ? 32.065 66.177 4.831   1.00 9.33  ?  169  ALA A C   1 
ATOM   1293 O O   . ALA A 1 168 ? 31.317 67.115 5.131   1.00 9.61  ?  169  ALA A O   1 
ATOM   1294 C CB  . ALA A 1 168 ? 34.371 66.772 4.043   1.00 11.87 ?  169  ALA A CB  1 
ATOM   1295 N N   . LYS A 1 169 ? 31.626 65.104 4.171   1.00 7.93  ?  170  LYS A N   1 
ATOM   1296 C CA  . LYS A 1 169 ? 30.212 64.987 3.833   1.00 11.89 ?  170  LYS A CA  1 
ATOM   1297 C C   . LYS A 1 169 ? 29.359 64.869 5.089   1.00 9.40  ?  170  LYS A C   1 
ATOM   1298 O O   . LYS A 1 169 ? 28.275 65.459 5.169   1.00 12.00 ?  170  LYS A O   1 
ATOM   1299 C CB  . LYS A 1 169 ? 29.987 63.789 2.910   1.00 7.96  ?  170  LYS A CB  1 
ATOM   1300 C CG  . LYS A 1 169 ? 28.608 63.761 2.266   1.00 17.54 ?  170  LYS A CG  1 
ATOM   1301 C CD  . LYS A 1 169 ? 28.494 62.641 1.243   1.00 19.60 ?  170  LYS A CD  1 
ATOM   1302 C CE  . LYS A 1 169 ? 27.181 62.727 0.479   1.00 28.79 ?  170  LYS A CE  1 
ATOM   1303 N NZ  . LYS A 1 169 ? 26.988 61.563 -0.427  1.00 27.06 ?  170  LYS A NZ  1 
ATOM   1304 N N   . CYS A 1 170 ? 29.836 64.116 6.083   1.00 10.25 ?  171  CYS A N   1 
ATOM   1305 C CA  . CYS A 1 170 ? 29.134 64.046 7.360   1.00 7.99  ?  171  CYS A CA  1 
ATOM   1306 C C   . CYS A 1 170 ? 29.127 65.400 8.055   1.00 12.10 ?  171  CYS A C   1 
ATOM   1307 O O   . CYS A 1 170 ? 28.104 65.814 8.614   1.00 8.83  ?  171  CYS A O   1 
ATOM   1308 C CB  . CYS A 1 170 ? 29.778 62.991 8.260   1.00 14.56 ?  171  CYS A CB  1 
ATOM   1309 S SG  . CYS A 1 170 ? 29.654 61.298 7.647   1.00 21.00 ?  171  CYS A SG  1 
ATOM   1310 N N   . GLN A 1 171 ? 30.261 66.106 8.031   1.00 8.21  ?  172  GLN A N   1 
ATOM   1311 C CA  . GLN A 1 171 ? 30.339 67.407 8.687   1.00 11.10 ?  172  GLN A CA  1 
ATOM   1312 C C   . GLN A 1 171 ? 29.424 68.423 8.015   1.00 11.49 ?  172  GLN A C   1 
ATOM   1313 O O   . GLN A 1 171 ? 28.797 69.247 8.693   1.00 11.18 ?  172  GLN A O   1 
ATOM   1314 C CB  . GLN A 1 171 ? 31.782 67.911 8.688   1.00 11.51 ?  172  GLN A CB  1 
ATOM   1315 C CG  . GLN A 1 171 ? 32.690 67.201 9.675   1.00 6.89  ?  172  GLN A CG  1 
ATOM   1316 C CD  . GLN A 1 171 ? 34.149 67.559 9.475   1.00 13.05 ?  172  GLN A CD  1 
ATOM   1317 O OE1 . GLN A 1 171 ? 34.585 67.834 8.356   1.00 16.10 ?  172  GLN A OE1 1 
ATOM   1318 N NE2 . GLN A 1 171 ? 34.913 67.558 10.560  1.00 14.88 ?  172  GLN A NE2 1 
ATOM   1319 N N   . LEU A 1 172 ? 29.342 68.388 6.682   1.00 9.42  ?  173  LEU A N   1 
ATOM   1320 C CA  . LEU A 1 172 ? 28.484 69.325 5.964   1.00 12.72 ?  173  LEU A CA  1 
ATOM   1321 C C   . LEU A 1 172 ? 27.021 69.126 6.339   1.00 13.68 ?  173  LEU A C   1 
ATOM   1322 O O   . LEU A 1 172 ? 26.311 70.088 6.651   1.00 12.17 ?  173  LEU A O   1 
ATOM   1323 C CB  . LEU A 1 172 ? 28.676 69.165 4.455   1.00 5.36  ?  173  LEU A CB  1 
ATOM   1324 C CG  . LEU A 1 172 ? 27.715 69.962 3.566   1.00 11.26 ?  173  LEU A CG  1 
ATOM   1325 C CD1 . LEU A 1 172 ? 27.933 71.464 3.727   1.00 8.25  ?  173  LEU A CD1 1 
ATOM   1326 C CD2 . LEU A 1 172 ? 27.853 69.544 2.106   1.00 9.04  ?  173  LEU A CD2 1 
ATOM   1327 N N   . LEU A 1 173 ? 26.554 67.876 6.317   1.00 9.92  ?  174  LEU A N   1 
ATOM   1328 C CA  . LEU A 1 173 ? 25.163 67.600 6.663   1.00 14.35 ?  174  LEU A CA  1 
ATOM   1329 C C   . LEU A 1 173 ? 24.894 67.890 8.134   1.00 18.31 ?  174  LEU A C   1 
ATOM   1330 O O   . LEU A 1 173 ? 23.813 68.376 8.489   1.00 13.95 ?  174  LEU A O   1 
ATOM   1331 C CB  . LEU A 1 173 ? 24.822 66.150 6.327   1.00 13.88 ?  174  LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 173 ? 24.969 65.778 4.851   1.00 20.95 ?  174  LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 173 ? 24.812 64.277 4.652   1.00 16.32 ?  174  LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 173 ? 23.967 66.547 4.004   1.00 21.08 ?  174  LEU A CD2 1 
ATOM   1335 N N   . PHE A 1 174 ? 25.866 67.599 9.001   1.00 14.10 ?  175  PHE A N   1 
ATOM   1336 C CA  . PHE A 1 174 ? 25.717 67.892 10.424  1.00 13.55 ?  175  PHE A CA  1 
ATOM   1337 C C   . PHE A 1 174 ? 25.596 69.392 10.661  1.00 14.48 ?  175  PHE A C   1 
ATOM   1338 O O   . PHE A 1 174 ? 24.702 69.851 11.381  1.00 15.99 ?  175  PHE A O   1 
ATOM   1339 C CB  . PHE A 1 174 ? 26.905 67.306 11.194  1.00 13.86 ?  175  PHE A CB  1 
ATOM   1340 C CG  . PHE A 1 174 ? 26.966 67.716 12.643  1.00 16.00 ?  175  PHE A CG  1 
ATOM   1341 C CD1 . PHE A 1 174 ? 26.271 67.004 13.607  1.00 15.94 ?  175  PHE A CD1 1 
ATOM   1342 C CD2 . PHE A 1 174 ? 27.739 68.796 13.042  1.00 10.57 ?  175  PHE A CD2 1 
ATOM   1343 C CE1 . PHE A 1 174 ? 26.332 67.372 14.940  1.00 21.04 ?  175  PHE A CE1 1 
ATOM   1344 C CE2 . PHE A 1 174 ? 27.801 69.170 14.373  1.00 13.65 ?  175  PHE A CE2 1 
ATOM   1345 C CZ  . PHE A 1 174 ? 27.098 68.456 15.323  1.00 12.75 ?  175  PHE A CZ  1 
ATOM   1346 N N   . ALA A 1 175 ? 26.484 70.177 10.045  1.00 11.26 ?  176  ALA A N   1 
ATOM   1347 C CA  . ALA A 1 175 ? 26.497 71.615 10.291  1.00 11.28 ?  176  ALA A CA  1 
ATOM   1348 C C   . ALA A 1 175 ? 25.265 72.295 9.703   1.00 12.08 ?  176  ALA A C   1 
ATOM   1349 O O   . ALA A 1 175 ? 24.665 73.162 10.347  1.00 10.87 ?  176  ALA A O   1 
ATOM   1350 C CB  . ALA A 1 175 ? 27.775 72.233 9.727   1.00 7.07  ?  176  ALA A CB  1 
ATOM   1351 N N   . LEU A 1 176 ? 24.871 71.917 8.484   1.00 9.54  ?  177  LEU A N   1 
ATOM   1352 C CA  . LEU A 1 176 ? 23.674 72.507 7.890   1.00 11.35 ?  177  LEU A CA  1 
ATOM   1353 C C   . LEU A 1 176 ? 22.443 72.265 8.754   1.00 16.86 ?  177  LEU A C   1 
ATOM   1354 O O   . LEU A 1 176 ? 21.535 73.104 8.791   1.00 16.15 ?  177  LEU A O   1 
ATOM   1355 C CB  . LEU A 1 176 ? 23.453 71.951 6.483   1.00 11.49 ?  177  LEU A CB  1 
ATOM   1356 C CG  . LEU A 1 176 ? 24.416 72.424 5.392   1.00 9.70  ?  177  LEU A CG  1 
ATOM   1357 C CD1 . LEU A 1 176 ? 24.189 71.640 4.106   1.00 8.69  ?  177  LEU A CD1 1 
ATOM   1358 C CD2 . LEU A 1 176 ? 24.272 73.919 5.149   1.00 6.79  ?  177  LEU A CD2 1 
ATOM   1359 N N   . LYS A 1 177 ? 22.398 71.135 9.461   1.00 9.60  ?  178  LYS A N   1 
ATOM   1360 C CA  . LYS A 1 177 ? 21.271 70.846 10.342  1.00 16.70 ?  178  LYS A CA  1 
ATOM   1361 C C   . LYS A 1 177 ? 21.329 71.689 11.612  1.00 13.15 ?  178  LYS A C   1 
ATOM   1362 O O   . LYS A 1 177 ? 20.384 72.420 11.930  1.00 13.49 ?  178  LYS A O   1 
ATOM   1363 C CB  . LYS A 1 177 ? 21.250 69.355 10.687  1.00 19.30 ?  178  LYS A CB  1 
ATOM   1364 C CG  . LYS A 1 177 ? 20.195 68.967 11.711  1.00 23.45 ?  178  LYS A CG  1 
ATOM   1365 C CD  . LYS A 1 177 ? 20.365 67.521 12.152  1.00 24.24 ?  178  LYS A CD  1 
ATOM   1366 C CE  . LYS A 1 177 ? 19.266 67.099 13.114  1.00 39.04 ?  178  LYS A CE  1 
ATOM   1367 N NZ  . LYS A 1 177 ? 19.285 67.892 14.374  1.00 54.60 ?  178  LYS A NZ  1 
ATOM   1368 N N   . VAL A 1 178 ? 22.437 71.600 12.353  1.00 13.02 ?  179  VAL A N   1 
ATOM   1369 C CA  . VAL A 1 178 ? 22.498 72.222 13.673  1.00 15.54 ?  179  VAL A CA  1 
ATOM   1370 C C   . VAL A 1 178 ? 22.662 73.735 13.608  1.00 15.53 ?  179  VAL A C   1 
ATOM   1371 O O   . VAL A 1 178 ? 22.415 74.417 14.610  1.00 17.04 ?  179  VAL A O   1 
ATOM   1372 C CB  . VAL A 1 178 ? 23.632 71.612 14.514  1.00 12.88 ?  179  VAL A CB  1 
ATOM   1373 C CG1 . VAL A 1 178 ? 23.439 70.110 14.652  1.00 15.68 ?  179  VAL A CG1 1 
ATOM   1374 C CG2 . VAL A 1 178 ? 24.985 71.932 13.901  1.00 15.64 ?  179  VAL A CG2 1 
ATOM   1375 N N   . LEU A 1 179 ? 23.076 74.286 12.469  1.00 12.72 ?  180  LEU A N   1 
ATOM   1376 C CA  . LEU A 1 179 ? 23.130 75.731 12.296  1.00 13.14 ?  180  LEU A CA  1 
ATOM   1377 C C   . LEU A 1 179 ? 21.824 76.299 11.755  1.00 18.36 ?  180  LEU A C   1 
ATOM   1378 O O   . LEU A 1 179 ? 21.760 77.496 11.458  1.00 18.42 ?  180  LEU A O   1 
ATOM   1379 C CB  . LEU A 1 179 ? 24.293 76.117 11.378  1.00 14.77 ?  180  LEU A CB  1 
ATOM   1380 C CG  . LEU A 1 179 ? 25.690 75.763 11.900  1.00 12.83 ?  180  LEU A CG  1 
ATOM   1381 C CD1 . LEU A 1 179 ? 26.764 76.179 10.906  1.00 17.61 ?  180  LEU A CD1 1 
ATOM   1382 C CD2 . LEU A 1 179 ? 25.937 76.395 13.264  1.00 13.91 ?  180  LEU A CD2 1 
ATOM   1383 N N   . ASN A 1 180 ? 20.792 75.462 11.619  1.00 12.58 ?  181  ASN A N   1 
ATOM   1384 C CA  . ASN A 1 180 ? 19.463 75.891 11.178  1.00 18.33 ?  181  ASN A CA  1 
ATOM   1385 C C   . ASN A 1 180 ? 19.505 76.523 9.789   1.00 19.77 ?  181  ASN A C   1 
ATOM   1386 O O   . ASN A 1 180 ? 18.792 77.486 9.502   1.00 26.20 ?  181  ASN A O   1 
ATOM   1387 C CB  . ASN A 1 180 ? 18.827 76.843 12.192  1.00 19.19 ?  181  ASN A CB  1 
ATOM   1388 C CG  . ASN A 1 180 ? 18.683 76.216 13.562  1.00 27.46 ?  181  ASN A CG  1 
ATOM   1389 O OD1 . ASN A 1 180 ? 18.342 75.040 13.684  1.00 30.59 ?  181  ASN A OD1 1 
ATOM   1390 N ND2 . ASN A 1 180 ? 18.949 76.997 14.601  1.00 45.74 ?  181  ASN A ND2 1 
ATOM   1391 N N   . MET A 1 181 ? 20.349 75.975 8.916   1.00 20.05 ?  182  MET A N   1 
ATOM   1392 C CA  . MET A 1 181 ? 20.419 76.432 7.535   1.00 19.33 ?  182  MET A CA  1 
ATOM   1393 C C   . MET A 1 181 ? 19.569 75.596 6.590   1.00 23.95 ?  182  MET A C   1 
ATOM   1394 O O   . MET A 1 181 ? 19.165 76.100 5.537   1.00 19.73 ?  182  MET A O   1 
ATOM   1395 C CB  . MET A 1 181 ? 21.875 76.431 7.050   1.00 14.34 ?  182  MET A CB  1 
ATOM   1396 C CG  . MET A 1 181 ? 22.801 77.278 7.912   1.00 19.31 ?  182  MET A CG  1 
ATOM   1397 S SD  . MET A 1 181 ? 24.554 77.031 7.560   1.00 21.20 ?  182  MET A SD  1 
ATOM   1398 C CE  . MET A 1 181 ? 24.638 77.567 5.852   1.00 10.03 ?  182  MET A CE  1 
ATOM   1399 N N   . MET A 1 182 ? 19.284 74.340 6.943   1.00 19.01 ?  183  MET A N   1 
ATOM   1400 C CA  . MET A 1 182 ? 18.449 73.457 6.148   1.00 20.49 ?  183  MET A CA  1 
ATOM   1401 C C   . MET A 1 182 ? 17.670 72.562 7.099   1.00 21.59 ?  183  MET A C   1 
ATOM   1402 O O   . MET A 1 182 ? 18.251 72.051 8.067   1.00 22.39 ?  183  MET A O   1 
ATOM   1403 C CB  . MET A 1 182 ? 19.271 72.593 5.184   1.00 20.27 ?  183  MET A CB  1 
ATOM   1404 C CG  . MET A 1 182 ? 19.939 73.360 4.052   1.00 37.98 ?  183  MET A CG  1 
ATOM   1405 S SD  . MET A 1 182 ? 18.967 73.357 2.534   1.00 44.49 ?  183  MET A SD  1 
ATOM   1406 C CE  . MET A 1 182 ? 18.729 71.598 2.289   1.00 23.21 ?  183  MET A CE  1 
ATOM   1407 N N   . PRO A 1 183 ? 16.374 72.360 6.867   1.00 23.46 ?  184  PRO A N   1 
ATOM   1408 C CA  . PRO A 1 183 ? 15.628 71.392 7.677   1.00 19.82 ?  184  PRO A CA  1 
ATOM   1409 C C   . PRO A 1 183 ? 16.144 69.981 7.444   1.00 20.18 ?  184  PRO A C   1 
ATOM   1410 O O   . PRO A 1 183 ? 16.580 69.628 6.346   1.00 16.81 ?  184  PRO A O   1 
ATOM   1411 C CB  . PRO A 1 183 ? 14.183 71.546 7.183   1.00 28.71 ?  184  PRO A CB  1 
ATOM   1412 C CG  . PRO A 1 183 ? 14.149 72.868 6.476   1.00 25.37 ?  184  PRO A CG  1 
ATOM   1413 C CD  . PRO A 1 183 ? 15.513 73.038 5.885   1.00 25.30 ?  184  PRO A CD  1 
ATOM   1414 N N   . GLU A 1 184 ? 16.094 69.171 8.505   1.00 14.93 ?  185  GLU A N   1 
ATOM   1415 C CA  . GLU A 1 184 ? 16.628 67.814 8.422   1.00 23.85 ?  185  GLU A CA  1 
ATOM   1416 C C   . GLU A 1 184 ? 15.915 66.999 7.351   1.00 21.66 ?  185  GLU A C   1 
ATOM   1417 O O   . GLU A 1 184 ? 16.547 66.209 6.640   1.00 18.41 ?  185  GLU A O   1 
ATOM   1418 C CB  . GLU A 1 184 ? 16.521 67.118 9.779   1.00 23.45 ?  185  GLU A CB  1 
ATOM   1419 C CG  . GLU A 1 184 ? 16.879 65.640 9.734   1.00 33.66 ?  185  GLU A CG  1 
ATOM   1420 C CD  . GLU A 1 184 ? 17.305 65.096 11.081  1.00 59.73 ?  185  GLU A CD  1 
ATOM   1421 O OE1 . GLU A 1 184 ? 18.291 64.329 11.124  1.00 63.95 ?  185  GLU A OE1 1 
ATOM   1422 O OE2 . GLU A 1 184 ? 16.655 65.432 12.094  1.00 46.55 ?  185  GLU A OE2 1 
ATOM   1423 N N   . GLU A 1 185 ? 14.599 67.181 7.214   1.00 20.43 ?  186  GLU A N   1 
ATOM   1424 C CA  . GLU A 1 185 ? 13.847 66.416 6.224   1.00 22.42 ?  186  GLU A CA  1 
ATOM   1425 C C   . GLU A 1 185 ? 14.332 66.715 4.811   1.00 20.90 ?  186  GLU A C   1 
ATOM   1426 O O   . GLU A 1 185 ? 14.400 65.814 3.967   1.00 21.34 ?  186  GLU A O   1 
ATOM   1427 C CB  . GLU A 1 185 ? 12.352 66.711 6.356   1.00 26.79 ?  186  GLU A CB  1 
ATOM   1428 C CG  . GLU A 1 185 ? 12.005 68.193 6.379   1.00 36.32 ?  186  GLU A CG  1 
ATOM   1429 C CD  . GLU A 1 185 ? 11.670 68.696 7.771   1.00 71.67 ?  186  GLU A CD  1 
ATOM   1430 O OE1 . GLU A 1 185 ? 10.587 69.294 7.940   1.00 85.45 ?  186  GLU A OE1 1 
ATOM   1431 O OE2 . GLU A 1 185 ? 12.491 68.500 8.694   1.00 45.63 ?  186  GLU A OE2 1 
ATOM   1432 N N   . LYS A 1 186 ? 14.684 67.973 4.537   1.00 18.23 ?  187  LYS A N   1 
ATOM   1433 C CA  . LYS A 1 186 ? 15.184 68.324 3.213   1.00 23.27 ?  187  LYS A CA  1 
ATOM   1434 C C   . LYS A 1 186 ? 16.589 67.784 2.983   1.00 19.78 ?  187  LYS A C   1 
ATOM   1435 O O   . LYS A 1 186 ? 16.939 67.434 1.850   1.00 19.18 ?  187  LYS A O   1 
ATOM   1436 C CB  . LYS A 1 186 ? 15.151 69.840 3.026   1.00 18.62 ?  187  LYS A CB  1 
ATOM   1437 C CG  . LYS A 1 186 ? 13.751 70.426 3.117   1.00 33.01 ?  187  LYS A CG  1 
ATOM   1438 C CD  . LYS A 1 186 ? 13.545 71.549 2.116   1.00 37.60 ?  187  LYS A CD  1 
ATOM   1439 C CE  . LYS A 1 186 ? 12.073 71.911 2.000   1.00 49.34 ?  187  LYS A CE  1 
ATOM   1440 N NZ  . LYS A 1 186 ? 11.218 70.694 1.912   1.00 48.22 ?  187  LYS A NZ  1 
ATOM   1441 N N   . LEU A 1 187 ? 17.405 67.711 4.038   1.00 15.57 ?  188  LEU A N   1 
ATOM   1442 C CA  . LEU A 1 187 ? 18.715 67.082 3.910   1.00 15.84 ?  188  LEU A CA  1 
ATOM   1443 C C   . LEU A 1 187 ? 18.580 65.601 3.579   1.00 16.04 ?  188  LEU A C   1 
ATOM   1444 O O   . LEU A 1 187 ? 19.314 65.077 2.733   1.00 19.98 ?  188  LEU A O   1 
ATOM   1445 C CB  . LEU A 1 187 ? 19.519 67.272 5.197   1.00 17.46 ?  188  LEU A CB  1 
ATOM   1446 C CG  . LEU A 1 187 ? 19.944 68.699 5.548   1.00 19.44 ?  188  LEU A CG  1 
ATOM   1447 C CD1 . LEU A 1 187 ? 20.579 68.746 6.931   1.00 16.83 ?  188  LEU A CD1 1 
ATOM   1448 C CD2 . LEU A 1 187 ? 20.899 69.246 4.500   1.00 14.58 ?  188  LEU A CD2 1 
ATOM   1449 N N   . VAL A 1 188 ? 17.643 64.911 4.235   1.00 18.08 ?  189  VAL A N   1 
ATOM   1450 C CA  . VAL A 1 188 ? 17.420 63.496 3.950   1.00 19.05 ?  189  VAL A CA  1 
ATOM   1451 C C   . VAL A 1 188 ? 16.955 63.310 2.512   1.00 19.34 ?  189  VAL A C   1 
ATOM   1452 O O   . VAL A 1 188 ? 17.425 62.412 1.802   1.00 20.19 ?  189  VAL A O   1 
ATOM   1453 C CB  . VAL A 1 188 ? 16.410 62.901 4.949   1.00 23.08 ?  189  VAL A CB  1 
ATOM   1454 C CG1 . VAL A 1 188 ? 16.091 61.459 4.587   1.00 23.57 ?  189  VAL A CG1 1 
ATOM   1455 C CG2 . VAL A 1 188 ? 16.946 62.991 6.371   1.00 16.98 ?  189  VAL A CG2 1 
ATOM   1456 N N   . GLU A 1 189 ? 16.033 64.161 2.055   1.00 23.16 ?  190  GLU A N   1 
ATOM   1457 C CA  . GLU A 1 189 ? 15.506 64.026 0.701   1.00 26.35 ?  190  GLU A CA  1 
ATOM   1458 C C   . GLU A 1 189 ? 16.569 64.334 -0.346  1.00 19.08 ?  190  GLU A C   1 
ATOM   1459 O O   . GLU A 1 189 ? 16.647 63.655 -1.377  1.00 20.17 ?  190  GLU A O   1 
ATOM   1460 C CB  . GLU A 1 189 ? 14.290 64.935 0.519   1.00 28.22 ?  190  GLU A CB  1 
ATOM   1461 C CG  . GLU A 1 189 ? 13.084 64.524 1.350   1.00 56.19 ?  190  GLU A CG  1 
ATOM   1462 C CD  . GLU A 1 189 ? 11.870 65.394 1.089   1.00 63.04 ?  190  GLU A CD  1 
ATOM   1463 O OE1 . GLU A 1 189 ? 11.977 66.341 0.283   1.00 61.53 ?  190  GLU A OE1 1 
ATOM   1464 O OE2 . GLU A 1 189 ? 10.808 65.131 1.694   1.00 61.37 ?  190  GLU A OE2 1 
ATOM   1465 N N   . ALA A 1 190 ? 17.392 65.358 -0.108  1.00 19.34 ?  191  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 190 ? 18.463 65.672 -1.047  1.00 19.09 ?  191  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 190 ? 19.488 64.546 -1.105  1.00 18.92 ?  191  ALA A C   1 
ATOM   1468 O O   . ALA A 1 190 ? 19.992 64.207 -2.182  1.00 13.85 ?  191  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 190 ? 19.134 66.990 -0.662  1.00 18.37 ?  191  ALA A CB  1 
ATOM   1470 N N   . LEU A 1 191 ? 19.804 63.952 0.047   1.00 19.50 ?  192  LEU A N   1 
ATOM   1471 C CA  . LEU A 1 191 ? 20.758 62.851 0.074   1.00 19.02 ?  192  LEU A CA  1 
ATOM   1472 C C   . LEU A 1 191 ? 20.191 61.599 -0.583  1.00 17.58 ?  192  LEU A C   1 
ATOM   1473 O O   . LEU A 1 191 ? 20.940 60.830 -1.197  1.00 19.81 ?  192  LEU A O   1 
ATOM   1474 C CB  . LEU A 1 191 ? 21.172 62.559 1.514   1.00 18.05 ?  192  LEU A CB  1 
ATOM   1475 C CG  . LEU A 1 191 ? 22.313 61.563 1.702   1.00 22.10 ?  192  LEU A CG  1 
ATOM   1476 C CD1 . LEU A 1 191 ? 23.620 62.134 1.176   1.00 18.23 ?  192  LEU A CD1 1 
ATOM   1477 C CD2 . LEU A 1 191 ? 22.430 61.203 3.165   1.00 25.37 ?  192  LEU A CD2 1 
ATOM   1478 N N   . ALA A 1 192 ? 18.880 61.378 -0.466  1.00 19.71 ?  193  ALA A N   1 
ATOM   1479 C CA  . ALA A 1 192 ? 18.265 60.228 -1.121  1.00 22.38 ?  193  ALA A CA  1 
ATOM   1480 C C   . ALA A 1 192 ? 18.270 60.388 -2.636  1.00 23.25 ?  193  ALA A C   1 
ATOM   1481 O O   . ALA A 1 192 ? 18.505 59.418 -3.367  1.00 22.25 ?  193  ALA A O   1 
ATOM   1482 C CB  . ALA A 1 192 ? 16.840 60.032 -0.605  1.00 18.43 ?  193  ALA A CB  1 
ATOM   1483 N N   . ALA A 1 193 ? 18.011 61.603 -3.128  1.00 19.04 ?  194  ALA A N   1 
ATOM   1484 C CA  . ALA A 1 193 ? 18.061 61.840 -4.566  1.00 18.76 ?  194  ALA A CA  1 
ATOM   1485 C C   . ALA A 1 193 ? 19.486 61.732 -5.092  1.00 22.39 ?  194  ALA A C   1 
ATOM   1486 O O   . ALA A 1 193 ? 19.708 61.237 -6.204  1.00 27.89 ?  194  ALA A O   1 
ATOM   1487 C CB  . ALA A 1 193 ? 17.466 63.209 -4.894  1.00 15.43 ?  194  ALA A CB  1 
ATOM   1488 N N   . ALA A 1 194 ? 20.464 62.189 -4.306  1.00 15.07 ?  195  ALA A N   1 
ATOM   1489 C CA  . ALA A 1 194 ? 21.862 62.059 -4.702  1.00 16.38 ?  195  ALA A CA  1 
ATOM   1490 C C   . ALA A 1 194 ? 22.271 60.595 -4.794  1.00 21.57 ?  195  ALA A C   1 
ATOM   1491 O O   . ALA A 1 194 ? 22.879 60.167 -5.782  1.00 20.11 ?  195  ALA A O   1 
ATOM   1492 C CB  . ALA A 1 194 ? 22.758 62.805 -3.713  1.00 15.22 ?  195  ALA A CB  1 
ATOM   1493 N N   . THR A 1 195 ? 21.944 59.811 -3.764  1.00 19.56 ?  196  THR A N   1 
ATOM   1494 C CA  . THR A 1 195 ? 22.263 58.388 -3.782  1.00 22.77 ?  196  THR A CA  1 
ATOM   1495 C C   . THR A 1 195 ? 21.559 57.686 -4.935  1.00 25.22 ?  196  THR A C   1 
ATOM   1496 O O   . THR A 1 195 ? 22.138 56.805 -5.583  1.00 22.52 ?  196  THR A O   1 
ATOM   1497 C CB  . THR A 1 195 ? 21.878 57.751 -2.447  1.00 26.06 ?  196  THR A CB  1 
ATOM   1498 O OG1 . THR A 1 195 ? 22.543 58.441 -1.382  1.00 23.43 ?  196  THR A OG1 1 
ATOM   1499 C CG2 . THR A 1 195 ? 22.278 56.282 -2.417  1.00 28.77 ?  196  THR A CG2 1 
ATOM   1500 N N   . GLU A 1 196 ? 20.309 58.068 -5.208  1.00 20.42 ?  197  GLU A N   1 
ATOM   1501 C CA  . GLU A 1 196 ? 19.590 57.523 -6.356  1.00 24.47 ?  197  GLU A CA  1 
ATOM   1502 C C   . GLU A 1 196 ? 20.355 57.776 -7.650  1.00 30.50 ?  197  GLU A C   1 
ATOM   1503 O O   . GLU A 1 196 ? 20.563 56.859 -8.452  1.00 32.70 ?  197  GLU A O   1 
ATOM   1504 C CB  . GLU A 1 196 ? 18.190 58.134 -6.430  1.00 28.18 ?  197  GLU A CB  1 
ATOM   1505 C CG  . GLU A 1 196 ? 17.352 57.643 -7.598  1.00 47.96 ?  197  GLU A CG  1 
ATOM   1506 C CD  . GLU A 1 196 ? 16.557 56.398 -7.263  1.00 72.83 ?  197  GLU A CD  1 
ATOM   1507 O OE1 . GLU A 1 196 ? 15.361 56.530 -6.927  1.00 84.60 ?  197  GLU A OE1 1 
ATOM   1508 O OE2 . GLU A 1 196 ? 17.126 55.288 -7.334  1.00 73.63 ?  197  GLU A OE2 1 
ATOM   1509 N N   . LYS A 1 197 ? 20.790 59.021 -7.862  1.00 26.34 ?  198  LYS A N   1 
ATOM   1510 C CA  . LYS A 1 197 ? 21.541 59.355 -9.068  1.00 28.13 ?  198  LYS A CA  1 
ATOM   1511 C C   . LYS A 1 197 ? 22.833 58.551 -9.159  1.00 33.29 ?  198  LYS A C   1 
ATOM   1512 O O   . LYS A 1 197 ? 23.227 58.115 -10.248 1.00 30.32 ?  198  LYS A O   1 
ATOM   1513 C CB  . LYS A 1 197 ? 21.834 60.855 -9.096  1.00 24.93 ?  198  LYS A CB  1 
ATOM   1514 C CG  . LYS A 1 197 ? 22.846 61.280 -10.142 1.00 28.31 ?  198  LYS A CG  1 
ATOM   1515 C CD  . LYS A 1 197 ? 22.981 62.790 -10.176 1.00 30.90 ?  198  LYS A CD  1 
ATOM   1516 C CE  . LYS A 1 197 ? 24.147 63.230 -11.045 1.00 27.00 ?  198  LYS A CE  1 
ATOM   1517 N NZ  . LYS A 1 197 ? 25.460 62.823 -10.469 1.00 23.04 ?  198  LYS A NZ  1 
ATOM   1518 N N   . GLN A 1 198 ? 23.504 58.338 -8.024  1.00 22.50 ?  199  GLN A N   1 
ATOM   1519 C CA  . GLN A 1 198 ? 24.710 57.516 -8.025  1.00 27.94 ?  199  GLN A CA  1 
ATOM   1520 C C   . GLN A 1 198 ? 24.386 56.063 -8.352  1.00 35.87 ?  199  GLN A C   1 
ATOM   1521 O O   . GLN A 1 198 ? 25.180 55.377 -9.006  1.00 34.10 ?  199  GLN A O   1 
ATOM   1522 C CB  . GLN A 1 198 ? 25.416 57.614 -6.672  1.00 23.97 ?  199  GLN A CB  1 
ATOM   1523 C CG  . GLN A 1 198 ? 25.963 58.994 -6.353  1.00 24.65 ?  199  GLN A CG  1 
ATOM   1524 C CD  . GLN A 1 198 ? 26.497 59.092 -4.938  1.00 22.62 ?  199  GLN A CD  1 
ATOM   1525 O OE1 . GLN A 1 198 ? 25.962 58.477 -4.016  1.00 26.29 ?  199  GLN A OE1 1 
ATOM   1526 N NE2 . GLN A 1 198 ? 27.560 59.867 -4.759  1.00 19.93 ?  199  GLN A NE2 1 
ATOM   1527 N N   . LYS A 1 199 ? 23.226 55.577 -7.904  1.00 32.44 ?  200  LYS A N   1 
ATOM   1528 C CA  . LYS A 1 199 ? 22.832 54.202 -8.197  1.00 40.93 ?  200  LYS A CA  1 
ATOM   1529 C C   . LYS A 1 199 ? 22.574 54.009 -9.686  1.00 43.74 ?  200  LYS A C   1 
ATOM   1530 O O   . LYS A 1 199 ? 23.062 53.048 -10.292 1.00 40.35 ?  200  LYS A O   1 
ATOM   1531 C CB  . LYS A 1 199 ? 21.589 53.828 -7.389  1.00 41.90 ?  200  LYS A CB  1 
ATOM   1532 C CG  . LYS A 1 199 ? 21.874 53.131 -6.071  1.00 44.61 ?  200  LYS A CG  1 
ATOM   1533 C CD  . LYS A 1 199 ? 20.726 52.208 -5.692  1.00 47.78 ?  200  LYS A CD  1 
ATOM   1534 C CE  . LYS A 1 199 ? 20.332 52.378 -4.234  1.00 59.69 ?  200  LYS A CE  1 
ATOM   1535 N NZ  . LYS A 1 199 ? 19.329 51.359 -3.812  1.00 82.36 ?  200  LYS A NZ  1 
ATOM   1536 N N   . LYS A 1 200 ? 21.805 54.916 -10.292 1.00 43.75 ?  201  LYS A N   1 
ATOM   1537 C CA  . LYS A 1 200 ? 21.460 54.773 -11.702 1.00 42.39 ?  201  LYS A CA  1 
ATOM   1538 C C   . LYS A 1 200 ? 22.664 55.002 -12.606 1.00 47.47 ?  201  LYS A C   1 
ATOM   1539 O O   . LYS A 1 200 ? 22.706 54.473 -13.722 1.00 57.24 ?  201  LYS A O   1 
ATOM   1540 C CB  . LYS A 1 200 ? 20.336 55.742 -12.067 1.00 42.09 ?  201  LYS A CB  1 
ATOM   1541 C CG  . LYS A 1 200 ? 19.192 55.767 -11.067 1.00 52.12 ?  201  LYS A CG  1 
ATOM   1542 C CD  . LYS A 1 200 ? 17.842 55.630 -11.748 1.00 61.98 ?  201  LYS A CD  1 
ATOM   1543 C CE  . LYS A 1 200 ? 16.741 55.366 -10.733 1.00 66.88 ?  201  LYS A CE  1 
ATOM   1544 N NZ  . LYS A 1 200 ? 15.399 55.266 -11.371 1.00 86.82 ?  201  LYS A NZ  1 
ATOM   1545 N N   . ALA A 1 201 ? 23.645 55.783 -12.147 1.00 42.61 ?  202  ALA A N   1 
ATOM   1546 C CA  . ALA A 1 201 ? 24.817 56.054 -12.973 1.00 47.26 ?  202  ALA A CA  1 
ATOM   1547 C C   . ALA A 1 201 ? 25.642 54.792 -13.196 1.00 52.45 ?  202  ALA A C   1 
ATOM   1548 O O   . ALA A 1 201 ? 26.196 54.590 -14.283 1.00 56.32 ?  202  ALA A O   1 
ATOM   1549 C CB  . ALA A 1 201 ? 25.670 57.148 -12.332 1.00 38.10 ?  202  ALA A CB  1 
ATOM   1550 N N   . LEU A 1 202 ? 25.730 53.929 -12.183 1.00 50.70 ?  203  LEU A N   1 
ATOM   1551 C CA  . LEU A 1 202 ? 26.502 52.699 -12.300 1.00 59.50 ?  203  LEU A CA  1 
ATOM   1552 C C   . LEU A 1 202 ? 25.794 51.623 -13.112 1.00 55.34 ?  203  LEU A C   1 
ATOM   1553 O O   . LEU A 1 202 ? 26.402 50.585 -13.396 1.00 59.05 ?  203  LEU A O   1 
ATOM   1554 C CB  . LEU A 1 202 ? 26.839 52.156 -10.909 1.00 51.12 ?  203  LEU A CB  1 
ATOM   1555 C CG  . LEU A 1 202 ? 27.941 52.908 -10.160 1.00 47.46 ?  203  LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1 202 ? 28.147 52.326 -8.770  1.00 53.65 ?  203  LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1 202 ? 29.239 52.885 -10.953 1.00 52.92 ?  203  LEU A CD2 1 
ATOM   1558 N N   . GLU A 1 203 ? 24.538 51.838 -13.490 1.00 55.71 ?  204  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 203 ? 23.815 50.879 -14.316 1.00 57.40 ?  204  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 203 ? 24.130 51.091 -15.793 1.00 56.43 ?  204  GLU A C   1 
ATOM   1561 O O   . GLU A 1 203 ? 23.337 50.736 -16.665 1.00 61.51 ?  204  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 203 ? 22.308 50.989 -14.076 1.00 57.44 ?  204  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 203 ? 21.886 50.704 -12.644 1.00 52.33 ?  204  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 203 ? 20.457 51.126 -12.363 1.00 71.39 ?  204  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 203 ? 19.797 51.644 -13.288 1.00 62.21 ?  204  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 203 ? 19.994 50.938 -11.218 1.00 70.80 ?  204  GLU A OE2 1 
ATOM   1567 N N   . VAL B 1 5   ? 35.525 53.322 -21.488 1.00 42.61 ?  6    VAL B N   1 
ATOM   1568 C CA  . VAL B 1 5   ? 35.608 54.759 -21.718 1.00 52.86 ?  6    VAL B CA  1 
ATOM   1569 C C   . VAL B 1 5   ? 34.341 55.260 -22.400 1.00 51.99 ?  6    VAL B C   1 
ATOM   1570 O O   . VAL B 1 5   ? 33.965 54.761 -23.461 1.00 59.22 ?  6    VAL B O   1 
ATOM   1571 C CB  . VAL B 1 5   ? 36.849 55.118 -22.553 1.00 37.08 ?  6    VAL B CB  1 
ATOM   1572 C CG1 . VAL B 1 5   ? 37.047 56.627 -22.588 1.00 32.31 ?  6    VAL B CG1 1 
ATOM   1573 C CG2 . VAL B 1 5   ? 38.082 54.426 -21.994 1.00 41.52 ?  6    VAL B CG2 1 
ATOM   1574 N N   . PRO B 1 6   ? 33.678 56.243 -21.789 1.00 49.96 ?  7    PRO B N   1 
ATOM   1575 C CA  . PRO B 1 6   ? 32.475 56.824 -22.407 1.00 44.24 ?  7    PRO B CA  1 
ATOM   1576 C C   . PRO B 1 6   ? 32.844 57.595 -23.665 1.00 41.06 ?  7    PRO B C   1 
ATOM   1577 O O   . PRO B 1 6   ? 33.677 58.503 -23.631 1.00 44.24 ?  7    PRO B O   1 
ATOM   1578 C CB  . PRO B 1 6   ? 31.926 57.748 -21.313 1.00 54.39 ?  7    PRO B CB  1 
ATOM   1579 C CG  . PRO B 1 6   ? 33.122 58.097 -20.484 1.00 46.07 ?  7    PRO B CG  1 
ATOM   1580 C CD  . PRO B 1 6   ? 33.993 56.869 -20.493 1.00 46.22 ?  7    PRO B CD  1 
ATOM   1581 N N   . GLU B 1 7   ? 32.220 57.225 -24.780 1.00 50.31 ?  8    GLU B N   1 
ATOM   1582 C CA  . GLU B 1 7   ? 32.515 57.811 -26.080 1.00 47.53 ?  8    GLU B CA  1 
ATOM   1583 C C   . GLU B 1 7   ? 31.244 58.384 -26.688 1.00 40.50 ?  8    GLU B C   1 
ATOM   1584 O O   . GLU B 1 7   ? 30.235 57.680 -26.808 1.00 46.97 ?  8    GLU B O   1 
ATOM   1585 C CB  . GLU B 1 7   ? 33.130 56.775 -27.024 1.00 44.58 ?  8    GLU B CB  1 
ATOM   1586 C CG  . GLU B 1 7   ? 34.590 56.467 -26.741 1.00 52.08 ?  8    GLU B CG  1 
ATOM   1587 C CD  . GLU B 1 7   ? 35.339 56.017 -27.979 1.00 60.75 ?  8    GLU B CD  1 
ATOM   1588 O OE1 . GLU B 1 7   ? 34.947 54.989 -28.572 1.00 46.66 ?  8    GLU B OE1 1 
ATOM   1589 O OE2 . GLU B 1 7   ? 36.318 56.692 -28.362 1.00 56.65 ?  8    GLU B OE2 1 
ATOM   1590 N N   . LEU B 1 8   ? 31.298 59.655 -27.068 1.00 37.23 ?  9    LEU B N   1 
ATOM   1591 C CA  . LEU B 1 8   ? 30.212 60.296 -27.791 1.00 37.62 ?  9    LEU B CA  1 
ATOM   1592 C C   . LEU B 1 8   ? 30.480 60.231 -29.288 1.00 33.90 ?  9    LEU B C   1 
ATOM   1593 O O   . LEU B 1 8   ? 31.631 60.252 -29.733 1.00 31.15 ?  9    LEU B O   1 
ATOM   1594 C CB  . LEU B 1 8   ? 30.052 61.754 -27.357 1.00 31.68 ?  9    LEU B CB  1 
ATOM   1595 C CG  . LEU B 1 8   ? 29.517 62.007 -25.948 1.00 32.42 ?  9    LEU B CG  1 
ATOM   1596 C CD1 . LEU B 1 8   ? 29.472 63.499 -25.656 1.00 23.29 ?  9    LEU B CD1 1 
ATOM   1597 C CD2 . LEU B 1 8   ? 28.142 61.381 -25.781 1.00 28.60 ?  9    LEU B CD2 1 
ATOM   1598 N N   . LYS B 1 9   ? 29.403 60.146 -30.066 1.00 31.35 ?  10   LYS B N   1 
ATOM   1599 C CA  . LYS B 1 9   ? 29.544 60.149 -31.515 1.00 33.42 ?  10   LYS B CA  1 
ATOM   1600 C C   . LYS B 1 9   ? 30.139 61.472 -31.975 1.00 29.63 ?  10   LYS B C   1 
ATOM   1601 O O   . LYS B 1 9   ? 29.518 62.529 -31.820 1.00 29.90 ?  10   LYS B O   1 
ATOM   1602 C CB  . LYS B 1 9   ? 28.200 59.902 -32.204 1.00 28.97 ?  10   LYS B CB  1 
ATOM   1603 C CG  . LYS B 1 9   ? 28.296 59.900 -33.724 1.00 36.00 ?  10   LYS B CG  1 
ATOM   1604 C CD  . LYS B 1 9   ? 26.926 59.906 -34.379 1.00 48.17 ?  10   LYS B CD  1 
ATOM   1605 C CE  . LYS B 1 9   ? 26.959 59.205 -35.729 1.00 62.38 ?  10   LYS B CE  1 
ATOM   1606 N NZ  . LYS B 1 9   ? 28.026 59.747 -36.617 1.00 53.41 ?  10   LYS B NZ  1 
ATOM   1607 N N   . GLN B 1 10  ? 31.346 61.425 -32.526 1.00 27.26 ?  11   GLN B N   1 
ATOM   1608 C CA  . GLN B 1 10  ? 31.989 62.626 -33.031 1.00 18.39 ?  11   GLN B CA  1 
ATOM   1609 C C   . GLN B 1 10  ? 31.463 62.957 -34.419 1.00 32.12 ?  11   GLN B C   1 
ATOM   1610 O O   . GLN B 1 10  ? 31.225 62.067 -35.240 1.00 43.02 ?  11   GLN B O   1 
ATOM   1611 C CB  . GLN B 1 10  ? 33.507 62.446 -33.075 1.00 30.28 ?  11   GLN B CB  1 
ATOM   1612 C CG  . GLN B 1 10  ? 34.271 63.712 -33.432 1.00 24.21 ?  11   GLN B CG  1 
ATOM   1613 C CD  . GLN B 1 10  ? 35.775 63.509 -33.429 1.00 30.96 ?  11   GLN B CD  1 
ATOM   1614 O OE1 . GLN B 1 10  ? 36.263 62.398 -33.219 1.00 24.17 ?  11   GLN B OE1 1 
ATOM   1615 N NE2 . GLN B 1 10  ? 36.517 64.584 -33.666 1.00 23.15 ?  11   GLN B NE2 1 
ATOM   1616 N N   . ILE B 1 11  ? 31.270 64.247 -34.672 1.00 22.93 ?  12   ILE B N   1 
ATOM   1617 C CA  . ILE B 1 11  ? 30.887 64.738 -35.986 1.00 29.16 ?  12   ILE B CA  1 
ATOM   1618 C C   . ILE B 1 11  ? 31.758 65.940 -36.309 1.00 27.84 ?  12   ILE B C   1 
ATOM   1619 O O   . ILE B 1 11  ? 32.198 66.671 -35.417 1.00 27.32 ?  12   ILE B O   1 
ATOM   1620 C CB  . ILE B 1 11  ? 29.388 65.104 -36.061 1.00 47.35 ?  12   ILE B CB  1 
ATOM   1621 C CG1 . ILE B 1 11  ? 28.988 65.975 -34.870 1.00 40.81 ?  12   ILE B CG1 1 
ATOM   1622 C CG2 . ILE B 1 11  ? 28.533 63.848 -36.127 1.00 45.10 ?  12   ILE B CG2 1 
ATOM   1623 C CD1 . ILE B 1 11  ? 28.915 67.443 -35.191 1.00 30.43 ?  12   ILE B CD1 1 
ATOM   1624 N N   . SER B 1 12  ? 32.016 66.137 -37.595 1.00 31.14 ?  13   SER B N   1 
ATOM   1625 C CA  . SER B 1 12  ? 32.885 67.222 -38.010 1.00 33.17 ?  13   SER B CA  1 
ATOM   1626 C C   . SER B 1 12  ? 32.159 68.561 -37.888 1.00 32.55 ?  13   SER B C   1 
ATOM   1627 O O   . SER B 1 12  ? 30.963 68.629 -37.590 1.00 40.36 ?  13   SER B O   1 
ATOM   1628 C CB  . SER B 1 12  ? 33.383 66.987 -39.431 1.00 41.81 ?  13   SER B CB  1 
ATOM   1629 O OG  . SER B 1 12  ? 32.291 66.800 -40.312 1.00 41.42 ?  13   SER B OG  1 
ATOM   1630 N N   . ARG B 1 13  ? 32.901 69.643 -38.134 1.00 34.58 ?  14   ARG B N   1 
ATOM   1631 C CA  . ARG B 1 13  ? 32.391 70.976 -37.832 1.00 27.87 ?  14   ARG B CA  1 
ATOM   1632 C C   . ARG B 1 13  ? 31.337 71.431 -38.837 1.00 44.00 ?  14   ARG B C   1 
ATOM   1633 O O   . ARG B 1 13  ? 30.250 71.869 -38.444 1.00 37.01 ?  14   ARG B O   1 
ATOM   1634 C CB  . ARG B 1 13  ? 33.539 71.985 -37.771 1.00 30.29 ?  14   ARG B CB  1 
ATOM   1635 C CG  . ARG B 1 13  ? 33.061 73.414 -37.553 1.00 34.69 ?  14   ARG B CG  1 
ATOM   1636 C CD  . ARG B 1 13  ? 34.092 74.275 -36.839 1.00 34.21 ?  14   ARG B CD  1 
ATOM   1637 N NE  . ARG B 1 13  ? 33.812 75.700 -37.002 1.00 50.21 ?  14   ARG B NE  1 
ATOM   1638 C CZ  . ARG B 1 13  ? 34.023 76.619 -36.064 1.00 51.95 ?  14   ARG B CZ  1 
ATOM   1639 N NH1 . ARG B 1 13  ? 34.517 76.267 -34.884 1.00 50.46 ?  14   ARG B NH1 1 
ATOM   1640 N NH2 . ARG B 1 13  ? 33.739 77.892 -36.304 1.00 29.01 ?  14   ARG B NH2 1 
ATOM   1641 N N   . VAL B 1 14  ? 31.638 71.349 -40.137 1.00 42.56 ?  15   VAL B N   1 
ATOM   1642 C CA  . VAL B 1 14  ? 30.699 71.867 -41.129 1.00 41.78 ?  15   VAL B CA  1 
ATOM   1643 C C   . VAL B 1 14  ? 29.430 71.026 -41.196 1.00 28.60 ?  15   VAL B C   1 
ATOM   1644 O O   . VAL B 1 14  ? 28.407 71.502 -41.697 1.00 50.30 ?  15   VAL B O   1 
ATOM   1645 C CB  . VAL B 1 14  ? 31.357 71.982 -42.521 1.00 48.78 ?  15   VAL B CB  1 
ATOM   1646 C CG1 . VAL B 1 14  ? 32.762 72.556 -42.404 1.00 40.69 ?  15   VAL B CG1 1 
ATOM   1647 C CG2 . VAL B 1 14  ? 31.364 70.646 -43.249 1.00 35.18 ?  15   VAL B CG2 1 
ATOM   1648 N N   . GLU B 1 15  ? 29.457 69.787 -40.695 1.00 33.10 ?  16   GLU B N   1 
ATOM   1649 C CA  . GLU B 1 15  ? 28.217 69.026 -40.571 1.00 40.85 ?  16   GLU B CA  1 
ATOM   1650 C C   . GLU B 1 15  ? 27.355 69.560 -39.437 1.00 48.01 ?  16   GLU B C   1 
ATOM   1651 O O   . GLU B 1 15  ? 26.122 69.555 -39.531 1.00 38.90 ?  16   GLU B O   1 
ATOM   1652 C CB  . GLU B 1 15  ? 28.511 67.547 -40.338 1.00 40.01 ?  16   GLU B CB  1 
ATOM   1653 C CG  . GLU B 1 15  ? 28.411 66.691 -41.574 1.00 69.15 ?  16   GLU B CG  1 
ATOM   1654 C CD  . GLU B 1 15  ? 29.596 66.894 -42.478 1.00 63.80 ?  16   GLU B CD  1 
ATOM   1655 O OE1 . GLU B 1 15  ? 29.415 67.414 -43.596 1.00 61.92 ?  16   GLU B OE1 1 
ATOM   1656 O OE2 . GLU B 1 15  ? 30.719 66.575 -42.043 1.00 67.21 ?  16   GLU B OE2 1 
ATOM   1657 N N   . ALA B 1 16  ? 27.985 70.005 -38.348 1.00 42.53 ?  17   ALA B N   1 
ATOM   1658 C CA  . ALA B 1 16  ? 27.224 70.573 -37.242 1.00 39.78 ?  17   ALA B CA  1 
ATOM   1659 C C   . ALA B 1 16  ? 26.559 71.881 -37.648 1.00 35.51 ?  17   ALA B C   1 
ATOM   1660 O O   . ALA B 1 16  ? 25.426 72.162 -37.238 1.00 34.53 ?  17   ALA B O   1 
ATOM   1661 C CB  . ALA B 1 16  ? 28.133 70.790 -36.034 1.00 35.60 ?  17   ALA B CB  1 
ATOM   1662 N N   . MET B 1 17  ? 27.244 72.690 -38.457 1.00 35.18 ?  18   MET B N   1 
ATOM   1663 C CA  . MET B 1 17  ? 26.702 73.976 -38.875 1.00 27.74 ?  18   MET B CA  1 
ATOM   1664 C C   . MET B 1 17  ? 25.542 73.842 -39.849 1.00 40.87 ?  18   MET B C   1 
ATOM   1665 O O   . MET B 1 17  ? 24.859 74.838 -40.109 1.00 40.23 ?  18   MET B O   1 
ATOM   1666 C CB  . MET B 1 17  ? 27.808 74.830 -39.495 1.00 30.81 ?  18   MET B CB  1 
ATOM   1667 C CG  . MET B 1 17  ? 28.917 75.213 -38.522 1.00 48.74 ?  18   MET B CG  1 
ATOM   1668 S SD  . MET B 1 17  ? 28.332 76.207 -37.133 1.00 56.55 ?  18   MET B SD  1 
ATOM   1669 C CE  . MET B 1 17  ? 28.144 74.963 -35.855 1.00 36.30 ?  18   MET B CE  1 
ATOM   1670 N N   . ARG B 1 18  ? 25.302 72.647 -40.388 1.00 33.75 ?  19   ARG B N   1 
ATOM   1671 C CA  . ARG B 1 18  ? 24.206 72.412 -41.316 1.00 49.65 ?  19   ARG B CA  1 
ATOM   1672 C C   . ARG B 1 18  ? 23.047 71.665 -40.671 1.00 53.12 ?  19   ARG B C   1 
ATOM   1673 O O   . ARG B 1 18  ? 22.099 71.288 -41.368 1.00 56.93 ?  19   ARG B O   1 
ATOM   1674 C CB  . ARG B 1 18  ? 24.709 71.648 -42.542 1.00 32.99 ?  19   ARG B CB  1 
ATOM   1675 C CG  . ARG B 1 18  ? 25.832 72.351 -43.279 1.00 34.49 ?  19   ARG B CG  1 
ATOM   1676 C CD  . ARG B 1 18  ? 26.438 71.446 -44.336 1.00 35.87 ?  19   ARG B CD  1 
ATOM   1677 N NE  . ARG B 1 18  ? 25.407 70.798 -45.141 1.00 29.98 ?  19   ARG B NE  1 
ATOM   1678 C CZ  . ARG B 1 18  ? 24.672 71.419 -46.058 1.00 26.74 ?  19   ARG B CZ  1 
ATOM   1679 N NH1 . ARG B 1 18  ? 24.854 72.711 -46.296 1.00 24.66 ?  19   ARG B NH1 1 
ATOM   1680 N NH2 . ARG B 1 18  ? 23.755 70.747 -46.740 1.00 27.27 ?  19   ARG B NH2 1 
ATOM   1681 N N   . LEU B 1 19  ? 23.101 71.437 -39.362 1.00 41.82 ?  20   LEU B N   1 
ATOM   1682 C CA  . LEU B 1 19  ? 21.986 70.813 -38.670 1.00 41.40 ?  20   LEU B CA  1 
ATOM   1683 C C   . LEU B 1 19  ? 20.809 71.779 -38.590 1.00 45.52 ?  20   LEU B C   1 
ATOM   1684 O O   . LEU B 1 19  ? 20.977 73.002 -38.611 1.00 36.37 ?  20   LEU B O   1 
ATOM   1685 C CB  . LEU B 1 19  ? 22.408 70.368 -37.271 1.00 46.05 ?  20   LEU B CB  1 
ATOM   1686 C CG  . LEU B 1 19  ? 23.292 69.120 -37.225 1.00 41.74 ?  20   LEU B CG  1 
ATOM   1687 C CD1 . LEU B 1 19  ? 23.753 68.830 -35.804 1.00 33.15 ?  20   LEU B CD1 1 
ATOM   1688 C CD2 . LEU B 1 19  ? 22.557 67.923 -37.810 1.00 42.42 ?  20   LEU B CD2 1 
ATOM   1689 N N   . GLY B 1 20  ? 19.603 71.213 -38.499 1.00 50.81 ?  21   GLY B N   1 
ATOM   1690 C CA  . GLY B 1 20  ? 18.404 72.001 -38.515 1.00 58.28 ?  21   GLY B CA  1 
ATOM   1691 C C   . GLY B 1 20  ? 18.249 72.843 -37.261 1.00 46.73 ?  21   GLY B C   1 
ATOM   1692 O O   . GLY B 1 20  ? 19.079 72.803 -36.343 1.00 37.79 ?  21   GLY B O   1 
ATOM   1693 N N   . PRO B 1 21  ? 17.166 73.626 -37.215 1.00 54.17 ?  22   PRO B N   1 
ATOM   1694 C CA  . PRO B 1 21  ? 16.925 74.473 -36.037 1.00 44.81 ?  22   PRO B CA  1 
ATOM   1695 C C   . PRO B 1 21  ? 16.599 73.687 -34.781 1.00 42.93 ?  22   PRO B C   1 
ATOM   1696 O O   . PRO B 1 21  ? 16.672 74.254 -33.683 1.00 54.00 ?  22   PRO B O   1 
ATOM   1697 C CB  . PRO B 1 21  ? 15.743 75.349 -36.470 1.00 51.57 ?  22   PRO B CB  1 
ATOM   1698 C CG  . PRO B 1 21  ? 15.040 74.537 -37.508 1.00 51.17 ?  22   PRO B CG  1 
ATOM   1699 C CD  . PRO B 1 21  ? 16.118 73.785 -38.238 1.00 55.98 ?  22   PRO B CD  1 
ATOM   1700 N N   . GLY B 1 22  ? 16.245 72.408 -34.900 1.00 39.24 ?  23   GLY B N   1 
ATOM   1701 C CA  . GLY B 1 22  ? 15.979 71.583 -33.739 1.00 31.38 ?  23   GLY B CA  1 
ATOM   1702 C C   . GLY B 1 22  ? 17.204 71.156 -32.960 1.00 40.59 ?  23   GLY B C   1 
ATOM   1703 O O   . GLY B 1 22  ? 17.073 70.383 -32.006 1.00 42.56 ?  23   GLY B O   1 
ATOM   1704 N N   . TRP B 1 23  ? 18.386 71.634 -33.336 1.00 33.48 ?  24   TRP B N   1 
ATOM   1705 C CA  . TRP B 1 23  ? 19.634 71.289 -32.670 1.00 37.82 ?  24   TRP B CA  1 
ATOM   1706 C C   . TRP B 1 23  ? 20.143 72.490 -31.888 1.00 27.51 ?  24   TRP B C   1 
ATOM   1707 O O   . TRP B 1 23  ? 20.240 73.595 -32.433 1.00 24.76 ?  24   TRP B O   1 
ATOM   1708 C CB  . TRP B 1 23  ? 20.691 70.838 -33.681 1.00 29.15 ?  24   TRP B CB  1 
ATOM   1709 C CG  . TRP B 1 23  ? 20.488 69.444 -34.180 1.00 34.45 ?  24   TRP B CG  1 
ATOM   1710 C CD1 . TRP B 1 23  ? 19.753 69.060 -35.263 1.00 33.93 ?  24   TRP B CD1 1 
ATOM   1711 C CD2 . TRP B 1 23  ? 21.026 68.243 -33.613 1.00 34.68 ?  24   TRP B CD2 1 
ATOM   1712 N NE1 . TRP B 1 23  ? 19.800 67.695 -35.407 1.00 34.07 ?  24   TRP B NE1 1 
ATOM   1713 C CE2 . TRP B 1 23  ? 20.575 67.170 -34.407 1.00 39.16 ?  24   TRP B CE2 1 
ATOM   1714 C CE3 . TRP B 1 23  ? 21.846 67.972 -32.514 1.00 27.17 ?  24   TRP B CE3 1 
ATOM   1715 C CZ2 . TRP B 1 23  ? 20.916 65.847 -34.135 1.00 38.97 ?  24   TRP B CZ2 1 
ATOM   1716 C CZ3 . TRP B 1 23  ? 22.182 66.658 -32.245 1.00 29.59 ?  24   TRP B CZ3 1 
ATOM   1717 C CH2 . TRP B 1 23  ? 21.718 65.612 -33.052 1.00 36.47 ?  24   TRP B CH2 1 
ATOM   1718 N N   . SER B 1 24  ? 20.462 72.272 -30.618 1.00 23.76 ?  25   SER B N   1 
ATOM   1719 C CA  . SER B 1 24  ? 21.105 73.290 -29.804 1.00 25.93 ?  25   SER B CA  1 
ATOM   1720 C C   . SER B 1 24  ? 22.618 73.132 -29.882 1.00 23.55 ?  25   SER B C   1 
ATOM   1721 O O   . SER B 1 24  ? 23.138 72.027 -30.061 1.00 24.48 ?  25   SER B O   1 
ATOM   1722 C CB  . SER B 1 24  ? 20.641 73.201 -28.350 1.00 28.76 ?  25   SER B CB  1 
ATOM   1723 O OG  . SER B 1 24  ? 19.232 73.317 -28.258 1.00 31.89 ?  25   SER B OG  1 
ATOM   1724 N N   . HIS B 1 25  ? 23.323 74.252 -29.751 1.00 22.10 ?  26   HIS B N   1 
ATOM   1725 C CA  . HIS B 1 25  ? 24.776 74.282 -29.830 1.00 19.91 ?  26   HIS B CA  1 
ATOM   1726 C C   . HIS B 1 25  ? 25.344 74.815 -28.525 1.00 23.92 ?  26   HIS B C   1 
ATOM   1727 O O   . HIS B 1 25  ? 24.889 75.847 -28.020 1.00 21.08 ?  26   HIS B O   1 
ATOM   1728 C CB  . HIS B 1 25  ? 25.249 75.149 -31.001 1.00 17.47 ?  26   HIS B CB  1 
ATOM   1729 C CG  . HIS B 1 25  ? 24.838 74.629 -32.343 1.00 34.39 ?  26   HIS B CG  1 
ATOM   1730 N ND1 . HIS B 1 25  ? 25.746 74.182 -33.278 1.00 26.57 ?  26   HIS B ND1 1 
ATOM   1731 C CD2 . HIS B 1 25  ? 23.615 74.484 -32.906 1.00 28.77 ?  26   HIS B CD2 1 
ATOM   1732 C CE1 . HIS B 1 25  ? 25.101 73.784 -34.360 1.00 34.25 ?  26   HIS B CE1 1 
ATOM   1733 N NE2 . HIS B 1 25  ? 23.807 73.956 -34.160 1.00 31.62 ?  26   HIS B NE2 1 
ATOM   1734 N N   . SER B 1 26  ? 26.331 74.108 -27.982 1.00 14.69 ?  27   SER B N   1 
ATOM   1735 C CA  . SER B 1 26  ? 27.074 74.560 -26.818 1.00 21.35 ?  27   SER B CA  1 
ATOM   1736 C C   . SER B 1 26  ? 28.556 74.608 -27.160 1.00 20.84 ?  27   SER B C   1 
ATOM   1737 O O   . SER B 1 26  ? 29.058 73.787 -27.934 1.00 20.69 ?  27   SER B O   1 
ATOM   1738 C CB  . SER B 1 26  ? 26.843 73.645 -25.607 1.00 21.23 ?  27   SER B CB  1 
ATOM   1739 O OG  . SER B 1 26  ? 27.493 72.397 -25.772 1.00 23.59 ?  27   SER B OG  1 
ATOM   1740 N N   . CYS B 1 27  ? 29.250 75.587 -26.586 1.00 11.35 ?  28   CYS B N   1 
ATOM   1741 C CA  . CYS B 1 27  ? 30.683 75.755 -26.780 1.00 18.98 ?  28   CYS B CA  1 
ATOM   1742 C C   . CYS B 1 27  ? 31.358 75.807 -25.422 1.00 23.53 ?  28   CYS B C   1 
ATOM   1743 O O   . CYS B 1 27  ? 30.955 76.588 -24.554 1.00 15.02 ?  28   CYS B O   1 
ATOM   1744 C CB  . CYS B 1 27  ? 30.994 77.024 -27.580 1.00 15.63 ?  28   CYS B CB  1 
ATOM   1745 S SG  . CYS B 1 27  ? 30.406 76.985 -29.289 1.00 19.32 ?  28   CYS B SG  1 
ATOM   1746 N N   . HIS B 1 28  ? 32.377 74.974 -25.238 1.00 12.52 ?  29   HIS B N   1 
ATOM   1747 C CA  . HIS B 1 28  ? 33.130 74.932 -23.996 1.00 16.73 ?  29   HIS B CA  1 
ATOM   1748 C C   . HIS B 1 28  ? 34.620 74.940 -24.304 1.00 18.75 ?  29   HIS B C   1 
ATOM   1749 O O   . HIS B 1 28  ? 35.053 74.521 -25.380 1.00 15.13 ?  29   HIS B O   1 
ATOM   1750 C CB  . HIS B 1 28  ? 32.760 73.703 -23.159 1.00 17.28 ?  29   HIS B CB  1 
ATOM   1751 C CG  . HIS B 1 28  ? 31.367 73.751 -22.612 1.00 17.84 ?  29   HIS B CG  1 
ATOM   1752 N ND1 . HIS B 1 28  ? 30.279 73.265 -23.304 1.00 22.88 ?  29   HIS B ND1 1 
ATOM   1753 C CD2 . HIS B 1 28  ? 30.884 74.241 -21.446 1.00 15.64 ?  29   HIS B CD2 1 
ATOM   1754 C CE1 . HIS B 1 28  ? 29.186 73.447 -22.584 1.00 20.89 ?  29   HIS B CE1 1 
ATOM   1755 N NE2 . HIS B 1 28  ? 29.525 74.038 -21.453 1.00 22.13 ?  29   HIS B NE2 1 
ATOM   1756 N N   . ALA B 1 29  ? 35.399 75.433 -23.347 1.00 10.99 ?  30   ALA B N   1 
ATOM   1757 C CA  . ALA B 1 29  ? 36.834 75.604 -23.514 1.00 14.24 ?  30   ALA B CA  1 
ATOM   1758 C C   . ALA B 1 29  ? 37.573 74.814 -22.447 1.00 16.75 ?  30   ALA B C   1 
ATOM   1759 O O   . ALA B 1 29  ? 37.255 74.920 -21.257 1.00 12.51 ?  30   ALA B O   1 
ATOM   1760 C CB  . ALA B 1 29  ? 37.222 77.081 -23.438 1.00 10.35 ?  30   ALA B CB  1 
ATOM   1761 N N   . MET B 1 30  ? 38.555 74.024 -22.873 1.00 13.35 ?  31   MET B N   1 
ATOM   1762 C CA  . MET B 1 30  ? 39.483 73.369 -21.962 1.00 15.02 ?  31   MET B CA  1 
ATOM   1763 C C   . MET B 1 30  ? 40.782 74.164 -21.970 1.00 19.11 ?  31   MET B C   1 
ATOM   1764 O O   . MET B 1 30  ? 41.524 74.149 -22.959 1.00 14.85 ?  31   MET B O   1 
ATOM   1765 C CB  . MET B 1 30  ? 39.730 71.915 -22.355 1.00 21.75 ?  31   MET B CB  1 
ATOM   1766 C CG  . MET B 1 30  ? 40.930 71.305 -21.642 1.00 23.03 ?  31   MET B CG  1 
ATOM   1767 S SD  . MET B 1 30  ? 41.118 69.536 -21.914 1.00 31.52 ?  31   MET B SD  1 
ATOM   1768 C CE  . MET B 1 30  ? 42.807 69.296 -21.379 1.00 24.97 ?  31   MET B CE  1 
ATOM   1769 N N   . LEU B 1 31  ? 41.046 74.871 -20.878 1.00 12.44 ?  32   LEU B N   1 
ATOM   1770 C CA  . LEU B 1 31  ? 42.287 75.607 -20.701 1.00 11.79 ?  32   LEU B CA  1 
ATOM   1771 C C   . LEU B 1 31  ? 43.244 74.758 -19.879 1.00 12.51 ?  32   LEU B C   1 
ATOM   1772 O O   . LEU B 1 31  ? 42.865 74.228 -18.828 1.00 10.84 ?  32   LEU B O   1 
ATOM   1773 C CB  . LEU B 1 31  ? 42.032 76.947 -20.014 1.00 11.98 ?  32   LEU B CB  1 
ATOM   1774 C CG  . LEU B 1 31  ? 40.883 77.761 -20.610 1.00 11.81 ?  32   LEU B CG  1 
ATOM   1775 C CD1 . LEU B 1 31  ? 40.568 78.963 -19.736 1.00 15.23 ?  32   LEU B CD1 1 
ATOM   1776 C CD2 . LEU B 1 31  ? 41.215 78.190 -22.033 1.00 10.10 ?  32   LEU B CD2 1 
ATOM   1777 N N   . TYR B 1 32  ? 44.478 74.625 -20.357 1.00 12.77 ?  33   TYR B N   1 
ATOM   1778 C CA  . TYR B 1 32  ? 45.438 73.756 -19.694 1.00 10.03 ?  33   TYR B CA  1 
ATOM   1779 C C   . TYR B 1 32  ? 46.836 74.335 -19.839 1.00 11.91 ?  33   TYR B C   1 
ATOM   1780 O O   . TYR B 1 32  ? 47.092 75.198 -20.682 1.00 13.40 ?  33   TYR B O   1 
ATOM   1781 C CB  . TYR B 1 32  ? 45.381 72.326 -20.248 1.00 13.42 ?  33   TYR B CB  1 
ATOM   1782 C CG  . TYR B 1 32  ? 45.861 72.191 -21.676 1.00 20.68 ?  33   TYR B CG  1 
ATOM   1783 C CD1 . TYR B 1 32  ? 45.054 72.569 -22.741 1.00 13.70 ?  33   TYR B CD1 1 
ATOM   1784 C CD2 . TYR B 1 32  ? 47.121 71.676 -21.960 1.00 18.61 ?  33   TYR B CD2 1 
ATOM   1785 C CE1 . TYR B 1 32  ? 45.489 72.445 -24.048 1.00 17.54 ?  33   TYR B CE1 1 
ATOM   1786 C CE2 . TYR B 1 32  ? 47.564 71.547 -23.263 1.00 17.90 ?  33   TYR B CE2 1 
ATOM   1787 C CZ  . TYR B 1 32  ? 46.744 71.932 -24.302 1.00 20.86 ?  33   TYR B CZ  1 
ATOM   1788 O OH  . TYR B 1 32  ? 47.181 71.806 -25.599 1.00 23.87 ?  33   TYR B OH  1 
ATOM   1789 N N   . ALA B 1 33  ? 47.740 73.842 -18.997 1.00 13.84 ?  34   ALA B N   1 
ATOM   1790 C CA  . ALA B 1 33  ? 49.112 74.319 -18.974 1.00 11.95 ?  34   ALA B CA  1 
ATOM   1791 C C   . ALA B 1 33  ? 50.024 73.186 -18.538 1.00 13.58 ?  34   ALA B C   1 
ATOM   1792 O O   . ALA B 1 33  ? 49.633 72.324 -17.746 1.00 14.73 ?  34   ALA B O   1 
ATOM   1793 C CB  . ALA B 1 33  ? 49.274 75.518 -18.033 1.00 11.29 ?  34   ALA B CB  1 
ATOM   1794 N N   . ALA B 1 34  ? 51.244 73.190 -19.069 1.00 13.19 ?  35   ALA B N   1 
ATOM   1795 C CA  . ALA B 1 34  ? 52.261 72.263 -18.596 1.00 16.31 ?  35   ALA B CA  1 
ATOM   1796 C C   . ALA B 1 34  ? 52.667 72.635 -17.177 1.00 8.02  ?  35   ALA B C   1 
ATOM   1797 O O   . ALA B 1 34  ? 52.982 73.796 -16.897 1.00 13.19 ?  35   ALA B O   1 
ATOM   1798 C CB  . ALA B 1 34  ? 53.475 72.284 -19.522 1.00 13.36 ?  35   ALA B CB  1 
ATOM   1799 N N   . ASN B 1 35  ? 52.649 71.654 -16.279 1.00 11.07 ?  36   ASN B N   1 
ATOM   1800 C CA  . ASN B 1 35  ? 52.941 71.893 -14.870 1.00 9.99  ?  36   ASN B CA  1 
ATOM   1801 C C   . ASN B 1 35  ? 54.228 71.181 -14.478 1.00 10.91 ?  36   ASN B C   1 
ATOM   1802 O O   . ASN B 1 35  ? 54.238 69.944 -14.382 1.00 11.67 ?  36   ASN B O   1 
ATOM   1803 C CB  . ASN B 1 35  ? 51.780 71.416 -13.995 1.00 10.67 ?  36   ASN B CB  1 
ATOM   1804 C CG  . ASN B 1 35  ? 51.844 71.967 -12.580 1.00 20.18 ?  36   ASN B CG  1 
ATOM   1805 O OD1 . ASN B 1 35  ? 52.926 72.195 -12.035 1.00 13.73 ?  36   ASN B OD1 1 
ATOM   1806 N ND2 . ASN B 1 35  ? 50.681 72.186 -11.980 1.00 14.92 ?  36   ASN B ND2 1 
ATOM   1807 N N   . PRO B 1 36  ? 55.326 71.900 -14.238 1.00 9.67  ?  37   PRO B N   1 
ATOM   1808 C CA  . PRO B 1 36  ? 56.577 71.242 -13.842 1.00 13.60 ?  37   PRO B CA  1 
ATOM   1809 C C   . PRO B 1 36  ? 56.674 70.938 -12.357 1.00 24.13 ?  37   PRO B C   1 
ATOM   1810 O O   . PRO B 1 36  ? 57.695 70.394 -11.921 1.00 18.94 ?  37   PRO B O   1 
ATOM   1811 C CB  . PRO B 1 36  ? 57.636 72.268 -14.259 1.00 15.09 ?  37   PRO B CB  1 
ATOM   1812 C CG  . PRO B 1 36  ? 56.953 73.584 -14.048 1.00 20.47 ?  37   PRO B CG  1 
ATOM   1813 C CD  . PRO B 1 36  ? 55.480 73.362 -14.340 1.00 10.70 ?  37   PRO B CD  1 
ATOM   1814 N N   . GLY B 1 37  ? 55.648 71.272 -11.573 1.00 16.43 ?  38   GLY B N   1 
ATOM   1815 C CA  . GLY B 1 37  ? 55.707 71.087 -10.140 1.00 19.02 ?  38   GLY B CA  1 
ATOM   1816 C C   . GLY B 1 37  ? 55.517 69.645 -9.718  1.00 16.27 ?  38   GLY B C   1 
ATOM   1817 O O   . GLY B 1 37  ? 55.098 68.782 -10.489 1.00 24.57 ?  38   GLY B O   1 
ATOM   1818 N N   . GLN B 1 38  ? 55.836 69.391 -8.451  1.00 17.97 ?  39   GLN B N   1 
ATOM   1819 C CA  . GLN B 1 38  ? 55.731 68.064 -7.860  1.00 19.98 ?  39   GLN B CA  1 
ATOM   1820 C C   . GLN B 1 38  ? 54.889 68.152 -6.597  1.00 25.92 ?  39   GLN B C   1 
ATOM   1821 O O   . GLN B 1 38  ? 55.102 69.041 -5.767  1.00 25.72 ?  39   GLN B O   1 
ATOM   1822 C CB  . GLN B 1 38  ? 57.117 67.495 -7.534  1.00 31.37 ?  39   GLN B CB  1 
ATOM   1823 C CG  . GLN B 1 38  ? 57.475 66.242 -8.310  1.00 42.66 ?  39   GLN B CG  1 
ATOM   1824 C CD  . GLN B 1 38  ? 58.817 65.670 -7.901  1.00 51.90 ?  39   GLN B CD  1 
ATOM   1825 O OE1 . GLN B 1 38  ? 59.572 66.298 -7.158  1.00 63.14 ?  39   GLN B OE1 1 
ATOM   1826 N NE2 . GLN B 1 38  ? 59.122 64.471 -8.384  1.00 49.43 ?  39   GLN B NE2 1 
ATOM   1827 N N   . LEU B 1 39  ? 53.934 67.237 -6.455  1.00 24.64 ?  40   LEU B N   1 
ATOM   1828 C CA  . LEU B 1 39  ? 53.113 67.182 -5.253  1.00 35.44 ?  40   LEU B CA  1 
ATOM   1829 C C   . LEU B 1 39  ? 53.853 66.394 -4.181  1.00 29.96 ?  40   LEU B C   1 
ATOM   1830 O O   . LEU B 1 39  ? 54.231 65.238 -4.405  1.00 26.38 ?  40   LEU B O   1 
ATOM   1831 C CB  . LEU B 1 39  ? 51.756 66.549 -5.550  1.00 25.90 ?  40   LEU B CB  1 
ATOM   1832 C CG  . LEU B 1 39  ? 50.812 66.449 -4.349  1.00 26.67 ?  40   LEU B CG  1 
ATOM   1833 C CD1 . LEU B 1 39  ? 50.557 67.827 -3.755  1.00 25.79 ?  40   LEU B CD1 1 
ATOM   1834 C CD2 . LEU B 1 39  ? 49.505 65.781 -4.740  1.00 26.07 ?  40   LEU B CD2 1 
ATOM   1835 N N   . PHE B 1 40  ? 54.062 67.023 -3.023  1.00 38.34 ?  41   PHE B N   1 
ATOM   1836 C CA  . PHE B 1 40  ? 54.788 66.415 -1.907  1.00 37.51 ?  41   PHE B CA  1 
ATOM   1837 C C   . PHE B 1 40  ? 56.216 66.049 -2.300  1.00 45.95 ?  41   PHE B C   1 
ATOM   1838 O O   . PHE B 1 40  ? 56.793 65.096 -1.767  1.00 42.96 ?  41   PHE B O   1 
ATOM   1839 C CB  . PHE B 1 40  ? 54.050 65.186 -1.366  1.00 30.91 ?  41   PHE B CB  1 
ATOM   1840 C CG  . PHE B 1 40  ? 52.617 65.451 -0.994  1.00 34.98 ?  41   PHE B CG  1 
ATOM   1841 C CD1 . PHE B 1 40  ? 52.242 66.662 -0.435  1.00 35.28 ?  41   PHE B CD1 1 
ATOM   1842 C CD2 . PHE B 1 40  ? 51.645 64.487 -1.206  1.00 29.42 ?  41   PHE B CD2 1 
ATOM   1843 C CE1 . PHE B 1 40  ? 50.923 66.907 -0.093  1.00 32.67 ?  41   PHE B CE1 1 
ATOM   1844 C CE2 . PHE B 1 40  ? 50.326 64.725 -0.867  1.00 38.41 ?  41   PHE B CE2 1 
ATOM   1845 C CZ  . PHE B 1 40  ? 49.965 65.938 -0.310  1.00 24.38 ?  41   PHE B CZ  1 
ATOM   1846 N N   . GLY B 1 41  ? 56.788 66.808 -3.234  1.00 38.26 ?  42   GLY B N   1 
ATOM   1847 C CA  . GLY B 1 41  ? 58.133 66.546 -3.723  1.00 39.13 ?  42   GLY B CA  1 
ATOM   1848 C C   . GLY B 1 41  ? 58.356 65.132 -4.210  1.00 36.61 ?  42   GLY B C   1 
ATOM   1849 O O   . GLY B 1 41  ? 59.449 64.586 -4.032  1.00 47.91 ?  42   GLY B O   1 
ATOM   1850 N N   . ARG B 1 42  ? 57.345 64.521 -4.826  1.00 32.05 ?  43   ARG B N   1 
ATOM   1851 C CA  . ARG B 1 42  ? 57.442 63.119 -5.213  1.00 32.61 ?  43   ARG B CA  1 
ATOM   1852 C C   . ARG B 1 42  ? 56.624 62.815 -6.460  1.00 31.94 ?  43   ARG B C   1 
ATOM   1853 O O   . ARG B 1 42  ? 57.069 62.063 -7.334  1.00 39.38 ?  43   ARG B O   1 
ATOM   1854 C CB  . ARG B 1 42  ? 56.984 62.221 -4.061  1.00 37.04 ?  43   ARG B CB  1 
ATOM   1855 C CG  . ARG B 1 42  ? 57.097 60.732 -4.340  1.00 50.64 ?  43   ARG B CG  1 
ATOM   1856 C CD  . ARG B 1 42  ? 57.105 59.926 -3.047  1.00 61.81 ?  43   ARG B CD  1 
ATOM   1857 N NE  . ARG B 1 42  ? 57.782 60.630 -1.960  1.00 74.23 ?  43   ARG B NE  1 
ATOM   1858 C CZ  . ARG B 1 42  ? 59.100 60.773 -1.861  1.00 82.09 ?  43   ARG B CZ  1 
ATOM   1859 N NH1 . ARG B 1 42  ? 59.901 60.256 -2.784  1.00 71.40 ?  43   ARG B NH1 1 
ATOM   1860 N NH2 . ARG B 1 42  ? 59.620 61.435 -0.836  1.00 75.09 ?  43   ARG B NH2 1 
ATOM   1861 N N   . ILE B 1 43  ? 55.433 63.388 -6.551  1.00 29.91 ?  44   ILE B N   1 
ATOM   1862 C CA  . ILE B 1 43  ? 54.456 63.038 -7.577  1.00 26.20 ?  44   ILE B CA  1 
ATOM   1863 C C   . ILE B 1 43  ? 54.431 64.151 -8.618  1.00 23.14 ?  44   ILE B C   1 
ATOM   1864 O O   . ILE B 1 43  ? 54.034 65.281 -8.300  1.00 23.62 ?  44   ILE B O   1 
ATOM   1865 C CB  . ILE B 1 43  ? 53.062 62.818 -6.973  1.00 31.52 ?  44   ILE B CB  1 
ATOM   1866 C CG1 . ILE B 1 43  ? 53.122 61.746 -5.884  1.00 35.04 ?  44   ILE B CG1 1 
ATOM   1867 C CG2 . ILE B 1 43  ? 52.088 62.412 -8.050  1.00 30.19 ?  44   ILE B CG2 1 
ATOM   1868 C CD1 . ILE B 1 43  ? 51.798 61.496 -5.200  1.00 29.92 ?  44   ILE B CD1 1 
ATOM   1869 N N   . PRO B 1 44  ? 54.826 63.885 -9.863  1.00 22.17 ?  45   PRO B N   1 
ATOM   1870 C CA  . PRO B 1 44  ? 54.777 64.933 -10.889 1.00 16.51 ?  45   PRO B CA  1 
ATOM   1871 C C   . PRO B 1 44  ? 53.341 65.287 -11.244 1.00 11.30 ?  45   PRO B C   1 
ATOM   1872 O O   . PRO B 1 44  ? 52.491 64.413 -11.418 1.00 11.03 ?  45   PRO B O   1 
ATOM   1873 C CB  . PRO B 1 44  ? 55.506 64.301 -12.084 1.00 14.86 ?  45   PRO B CB  1 
ATOM   1874 C CG  . PRO B 1 44  ? 56.175 63.060 -11.543 1.00 30.52 ?  45   PRO B CG  1 
ATOM   1875 C CD  . PRO B 1 44  ? 55.329 62.612 -10.399 1.00 21.28 ?  45   PRO B CD  1 
ATOM   1876 N N   . MET B 1 45  ? 53.078 66.591 -11.348 1.00 17.12 ?  46   MET B N   1 
ATOM   1877 C CA  . MET B 1 45  ? 51.742 67.048 -11.715 1.00 17.50 ?  46   MET B CA  1 
ATOM   1878 C C   . MET B 1 45  ? 51.533 67.045 -13.224 1.00 13.63 ?  46   MET B C   1 
ATOM   1879 O O   . MET B 1 45  ? 50.390 66.932 -13.683 1.00 18.45 ?  46   MET B O   1 
ATOM   1880 C CB  . MET B 1 45  ? 51.494 68.444 -11.142 1.00 15.22 ?  46   MET B CB  1 
ATOM   1881 C CG  . MET B 1 45  ? 51.310 68.453 -9.632  1.00 20.75 ?  46   MET B CG  1 
ATOM   1882 S SD  . MET B 1 45  ? 51.610 70.063 -8.886  1.00 31.82 ?  46   MET B SD  1 
ATOM   1883 C CE  . MET B 1 45  ? 51.026 69.769 -7.219  1.00 36.23 ?  46   MET B CE  1 
ATOM   1884 N N   . ARG B 1 46  ? 52.613 67.178 -13.997 1.00 10.75 ?  47   ARG B N   1 
ATOM   1885 C CA  . ARG B 1 46  ? 52.598 67.052 -15.453 1.00 15.98 ?  47   ARG B CA  1 
ATOM   1886 C C   . ARG B 1 46  ? 51.788 68.155 -16.128 1.00 12.28 ?  47   ARG B C   1 
ATOM   1887 O O   . ARG B 1 46  ? 52.351 68.983 -16.852 1.00 12.28 ?  47   ARG B O   1 
ATOM   1888 C CB  . ARG B 1 46  ? 52.075 65.673 -15.864 1.00 15.19 ?  47   ARG B CB  1 
ATOM   1889 C CG  . ARG B 1 46  ? 52.898 64.521 -15.298 1.00 24.20 ?  47   ARG B CG  1 
ATOM   1890 C CD  . ARG B 1 46  ? 52.412 63.172 -15.803 1.00 30.83 ?  47   ARG B CD  1 
ATOM   1891 N NE  . ARG B 1 46  ? 52.546 63.050 -17.252 1.00 62.67 ?  47   ARG B NE  1 
ATOM   1892 C CZ  . ARG B 1 46  ? 51.521 63.002 -18.096 1.00 47.44 ?  47   ARG B CZ  1 
ATOM   1893 N NH1 . ARG B 1 46  ? 50.277 63.059 -17.638 1.00 32.76 ?  47   ARG B NH1 1 
ATOM   1894 N NH2 . ARG B 1 46  ? 51.739 62.895 -19.399 1.00 37.85 ?  47   ARG B NH2 1 
ATOM   1895 N N   . PHE B 1 47  ? 50.474 68.175 -15.911 1.00 9.45  ?  48   PHE B N   1 
ATOM   1896 C CA  . PHE B 1 47  ? 49.613 69.190 -16.504 1.00 14.38 ?  48   PHE B CA  1 
ATOM   1897 C C   . PHE B 1 47  ? 48.554 69.625 -15.503 1.00 15.68 ?  48   PHE B C   1 
ATOM   1898 O O   . PHE B 1 47  ? 48.175 68.870 -14.603 1.00 15.91 ?  48   PHE B O   1 
ATOM   1899 C CB  . PHE B 1 47  ? 48.906 68.688 -17.772 1.00 10.68 ?  48   PHE B CB  1 
ATOM   1900 C CG  . PHE B 1 47  ? 49.830 68.374 -18.913 1.00 14.26 ?  48   PHE B CG  1 
ATOM   1901 C CD1 . PHE B 1 47  ? 50.307 67.087 -19.100 1.00 11.93 ?  48   PHE B CD1 1 
ATOM   1902 C CD2 . PHE B 1 47  ? 50.202 69.359 -19.813 1.00 10.62 ?  48   PHE B CD2 1 
ATOM   1903 C CE1 . PHE B 1 47  ? 51.150 66.792 -20.155 1.00 18.10 ?  48   PHE B CE1 1 
ATOM   1904 C CE2 . PHE B 1 47  ? 51.044 69.071 -20.868 1.00 14.73 ?  48   PHE B CE2 1 
ATOM   1905 C CZ  . PHE B 1 47  ? 51.519 67.785 -21.039 1.00 14.54 ?  48   PHE B CZ  1 
ATOM   1906 N N   . SER B 1 48  ? 48.071 70.853 -15.680 1.00 13.80 ?  49   SER B N   1 
ATOM   1907 C CA  . SER B 1 48  ? 46.914 71.371 -14.963 1.00 18.20 ?  49   SER B CA  1 
ATOM   1908 C C   . SER B 1 48  ? 45.882 71.831 -15.982 1.00 19.40 ?  49   SER B C   1 
ATOM   1909 O O   . SER B 1 48  ? 46.208 72.595 -16.895 1.00 14.73 ?  49   SER B O   1 
ATOM   1910 C CB  . SER B 1 48  ? 47.299 72.532 -14.039 1.00 15.72 ?  49   SER B CB  1 
ATOM   1911 O OG  . SER B 1 48  ? 48.173 72.106 -13.006 1.00 24.18 ?  49   SER B OG  1 
ATOM   1912 N N   . VAL B 1 49  ? 44.647 71.357 -15.837 1.00 15.54 ?  50   VAL B N   1 
ATOM   1913 C CA  . VAL B 1 49  ? 43.553 71.772 -16.702 1.00 18.73 ?  50   VAL B CA  1 
ATOM   1914 C C   . VAL B 1 49  ? 42.424 72.301 -15.827 1.00 15.85 ?  50   VAL B C   1 
ATOM   1915 O O   . VAL B 1 49  ? 42.194 71.821 -14.713 1.00 13.44 ?  50   VAL B O   1 
ATOM   1916 C CB  . VAL B 1 49  ? 43.071 70.625 -17.629 1.00 17.33 ?  50   VAL B CB  1 
ATOM   1917 C CG1 . VAL B 1 49  ? 43.877 69.361 -17.386 1.00 21.18 ?  50   VAL B CG1 1 
ATOM   1918 C CG2 . VAL B 1 49  ? 41.577 70.359 -17.475 1.00 14.83 ?  50   VAL B CG2 1 
ATOM   1919 N N   . LEU B 1 50  ? 41.730 73.316 -16.334 1.00 12.71 ?  51   LEU B N   1 
ATOM   1920 C CA  . LEU B 1 50  ? 40.695 74.015 -15.585 1.00 8.87  ?  51   LEU B CA  1 
ATOM   1921 C C   . LEU B 1 50  ? 39.320 73.441 -15.895 1.00 14.31 ?  51   LEU B C   1 
ATOM   1922 O O   . LEU B 1 50  ? 38.921 73.358 -17.061 1.00 14.01 ?  51   LEU B O   1 
ATOM   1923 C CB  . LEU B 1 50  ? 40.714 75.512 -15.903 1.00 11.84 ?  51   LEU B CB  1 
ATOM   1924 C CG  . LEU B 1 50  ? 41.606 76.434 -15.067 1.00 18.58 ?  51   LEU B CG  1 
ATOM   1925 C CD1 . LEU B 1 50  ? 42.931 75.780 -14.723 1.00 29.73 ?  51   LEU B CD1 1 
ATOM   1926 C CD2 . LEU B 1 50  ? 41.827 77.753 -15.796 1.00 9.36  ?  51   LEU B CD2 1 
ATOM   1927 N N   . MET B 1 51  ? 38.608 73.047 -14.848 1.00 10.64 ?  52   MET B N   1 
ATOM   1928 C CA  . MET B 1 51  ? 37.180 72.770 -14.895 1.00 9.50  ?  52   MET B CA  1 
ATOM   1929 C C   . MET B 1 51  ? 36.504 73.630 -13.833 1.00 16.97 ?  52   MET B C   1 
ATOM   1930 O O   . MET B 1 51  ? 37.156 74.416 -13.143 1.00 12.56 ?  52   MET B O   1 
ATOM   1931 C CB  . MET B 1 51  ? 36.899 71.277 -14.696 1.00 11.43 ?  52   MET B CB  1 
ATOM   1932 C CG  . MET B 1 51  ? 37.472 70.408 -15.812 1.00 9.60  ?  52   MET B CG  1 
ATOM   1933 S SD  . MET B 1 51  ? 36.956 68.683 -15.758 1.00 10.30 ?  52   MET B SD  1 
ATOM   1934 C CE  . MET B 1 51  ? 35.307 68.786 -16.451 1.00 9.15  ?  52   MET B CE  1 
ATOM   1935 N N   . GLN B 1 52  ? 35.188 73.490 -13.699 1.00 9.70  ?  53   GLN B N   1 
ATOM   1936 C CA  . GLN B 1 52  ? 34.462 74.360 -12.786 1.00 13.24 ?  53   GLN B CA  1 
ATOM   1937 C C   . GLN B 1 52  ? 33.258 73.638 -12.205 1.00 14.58 ?  53   GLN B C   1 
ATOM   1938 O O   . GLN B 1 52  ? 32.671 72.757 -12.839 1.00 9.13  ?  53   GLN B O   1 
ATOM   1939 C CB  . GLN B 1 52  ? 34.004 75.647 -13.482 1.00 9.54  ?  53   GLN B CB  1 
ATOM   1940 C CG  . GLN B 1 52  ? 33.027 75.424 -14.622 1.00 20.59 ?  53   GLN B CG  1 
ATOM   1941 C CD  . GLN B 1 52  ? 32.713 76.701 -15.375 1.00 13.22 ?  53   GLN B CD  1 
ATOM   1942 O OE1 . GLN B 1 52  ? 33.548 77.600 -15.468 1.00 15.52 ?  53   GLN B OE1 1 
ATOM   1943 N NE2 . GLN B 1 52  ? 31.503 76.789 -15.914 1.00 12.10 ?  53   GLN B NE2 1 
ATOM   1944 N N   . MET B 1 53  ? 32.903 74.024 -10.983 1.00 10.99 ?  54   MET B N   1 
ATOM   1945 C CA  . MET B 1 53  ? 31.647 73.603 -10.383 1.00 14.83 ?  54   MET B CA  1 
ATOM   1946 C C   . MET B 1 53  ? 30.539 74.523 -10.874 1.00 8.97  ?  54   MET B C   1 
ATOM   1947 O O   . MET B 1 53  ? 30.632 75.747 -10.738 1.00 10.86 ?  54   MET B O   1 
ATOM   1948 C CB  . MET B 1 53  ? 31.738 73.640 -8.858  1.00 9.58  ?  54   MET B CB  1 
ATOM   1949 C CG  . MET B 1 53  ? 30.438 73.294 -8.151  1.00 19.38 ?  54   MET B CG  1 
ATOM   1950 S SD  . MET B 1 53  ? 29.998 71.554 -8.317  1.00 17.86 ?  54   MET B SD  1 
ATOM   1951 C CE  . MET B 1 53  ? 31.369 70.783 -7.455  1.00 16.95 ?  54   MET B CE  1 
ATOM   1952 N N   . ARG B 1 54  ? 29.498 73.936 -11.450 1.00 11.79 ?  55   ARG B N   1 
ATOM   1953 C CA  . ARG B 1 54  ? 28.412 74.706 -12.032 1.00 12.37 ?  55   ARG B CA  1 
ATOM   1954 C C   . ARG B 1 54  ? 27.303 74.944 -11.009 1.00 12.54 ?  55   ARG B C   1 
ATOM   1955 O O   . ARG B 1 54  ? 27.278 74.355 -9.927  1.00 12.18 ?  55   ARG B O   1 
ATOM   1956 C CB  . ARG B 1 54  ? 27.849 73.994 -13.260 1.00 13.90 ?  55   ARG B CB  1 
ATOM   1957 C CG  . ARG B 1 54  ? 28.877 73.651 -14.320 1.00 10.97 ?  55   ARG B CG  1 
ATOM   1958 C CD  . ARG B 1 54  ? 28.468 72.392 -15.064 1.00 9.90  ?  55   ARG B CD  1 
ATOM   1959 N NE  . ARG B 1 54  ? 27.047 72.404 -15.404 1.00 15.42 ?  55   ARG B NE  1 
ATOM   1960 C CZ  . ARG B 1 54  ? 26.548 72.932 -16.517 1.00 19.72 ?  55   ARG B CZ  1 
ATOM   1961 N NH1 . ARG B 1 54  ? 27.354 73.491 -17.409 1.00 24.18 ?  55   ARG B NH1 1 
ATOM   1962 N NH2 . ARG B 1 54  ? 25.241 72.900 -16.739 1.00 15.18 ?  55   ARG B NH2 1 
ATOM   1963 N N   . PHE B 1 55  ? 26.368 75.823 -11.382 1.00 13.31 ?  56   PHE B N   1 
ATOM   1964 C CA  . PHE B 1 55  ? 25.231 76.132 -10.520 1.00 13.27 ?  56   PHE B CA  1 
ATOM   1965 C C   . PHE B 1 55  ? 24.426 74.887 -10.166 1.00 13.41 ?  56   PHE B C   1 
ATOM   1966 O O   . PHE B 1 55  ? 23.840 74.816 -9.080  1.00 8.83  ?  56   PHE B O   1 
ATOM   1967 C CB  . PHE B 1 55  ? 24.327 77.160 -11.201 1.00 11.09 ?  56   PHE B CB  1 
ATOM   1968 C CG  . PHE B 1 55  ? 23.693 76.657 -12.469 1.00 14.58 ?  56   PHE B CG  1 
ATOM   1969 C CD1 . PHE B 1 55  ? 24.357 76.760 -13.679 1.00 14.68 ?  56   PHE B CD1 1 
ATOM   1970 C CD2 . PHE B 1 55  ? 22.438 76.069 -12.449 1.00 13.83 ?  56   PHE B CD2 1 
ATOM   1971 C CE1 . PHE B 1 55  ? 23.781 76.291 -14.844 1.00 15.87 ?  56   PHE B CE1 1 
ATOM   1972 C CE2 . PHE B 1 55  ? 21.858 75.596 -13.610 1.00 15.85 ?  56   PHE B CE2 1 
ATOM   1973 C CZ  . PHE B 1 55  ? 22.529 75.708 -14.809 1.00 12.36 ?  56   PHE B CZ  1 
ATOM   1974 N N   . ASP B 1 56  ? 24.375 73.904 -11.063 1.00 10.42 ?  57   ASP B N   1 
ATOM   1975 C CA  . ASP B 1 56  ? 23.564 72.716 -10.843 1.00 9.83  ?  57   ASP B CA  1 
ATOM   1976 C C   . ASP B 1 56  ? 24.306 71.623 -10.083 1.00 12.23 ?  57   ASP B C   1 
ATOM   1977 O O   . ASP B 1 56  ? 23.813 70.495 -10.013 1.00 11.77 ?  57   ASP B O   1 
ATOM   1978 C CB  . ASP B 1 56  ? 23.037 72.172 -12.177 1.00 11.19 ?  57   ASP B CB  1 
ATOM   1979 C CG  . ASP B 1 56  ? 24.142 71.886 -13.181 1.00 15.55 ?  57   ASP B CG  1 
ATOM   1980 O OD1 . ASP B 1 56  ? 25.334 72.006 -12.831 1.00 16.15 ?  57   ASP B OD1 1 
ATOM   1981 O OD2 . ASP B 1 56  ? 23.810 71.538 -14.332 1.00 19.45 ?  57   ASP B OD2 1 
ATOM   1982 N N   . GLY B 1 57  ? 25.469 71.931 -9.512  1.00 7.47  ?  58   GLY B N   1 
ATOM   1983 C CA  . GLY B 1 57  ? 26.181 70.980 -8.684  1.00 11.55 ?  58   GLY B CA  1 
ATOM   1984 C C   . GLY B 1 57  ? 27.046 69.990 -9.429  1.00 13.62 ?  58   GLY B C   1 
ATOM   1985 O O   . GLY B 1 57  ? 27.545 69.043 -8.811  1.00 13.90 ?  58   GLY B O   1 
ATOM   1986 N N   . LEU B 1 58  ? 27.242 70.175 -10.729 1.00 11.88 ?  59   LEU B N   1 
ATOM   1987 C CA  . LEU B 1 58  ? 28.032 69.267 -11.544 1.00 12.55 ?  59   LEU B CA  1 
ATOM   1988 C C   . LEU B 1 58  ? 29.314 69.951 -12.000 1.00 11.87 ?  59   LEU B C   1 
ATOM   1989 O O   . LEU B 1 58  ? 29.387 71.181 -12.087 1.00 10.85 ?  59   LEU B O   1 
ATOM   1990 C CB  . LEU B 1 58  ? 27.235 68.794 -12.765 1.00 10.68 ?  59   LEU B CB  1 
ATOM   1991 C CG  . LEU B 1 58  ? 25.859 68.182 -12.493 1.00 12.73 ?  59   LEU B CG  1 
ATOM   1992 C CD1 . LEU B 1 58  ? 25.130 67.898 -13.798 1.00 17.11 ?  59   LEU B CD1 1 
ATOM   1993 C CD2 . LEU B 1 58  ? 25.988 66.914 -11.668 1.00 12.71 ?  59   LEU B CD2 1 
ATOM   1994 N N   . LEU B 1 59  ? 30.329 69.140 -12.286 1.00 9.86  ?  60   LEU B N   1 
ATOM   1995 C CA  . LEU B 1 59  ? 31.583 69.639 -12.829 1.00 5.93  ?  60   LEU B CA  1 
ATOM   1996 C C   . LEU B 1 59  ? 31.487 69.738 -14.345 1.00 8.94  ?  60   LEU B C   1 
ATOM   1997 O O   . LEU B 1 59  ? 30.886 68.882 -14.999 1.00 13.21 ?  60   LEU B O   1 
ATOM   1998 C CB  . LEU B 1 59  ? 32.749 68.729 -12.439 1.00 9.91  ?  60   LEU B CB  1 
ATOM   1999 C CG  . LEU B 1 59  ? 33.166 68.751 -10.968 1.00 14.69 ?  60   LEU B CG  1 
ATOM   2000 C CD1 . LEU B 1 59  ? 34.281 67.746 -10.715 1.00 12.06 ?  60   LEU B CD1 1 
ATOM   2001 C CD2 . LEU B 1 59  ? 33.593 70.151 -10.556 1.00 7.41  ?  60   LEU B CD2 1 
ATOM   2002 N N   . GLY B 1 60  ? 32.079 70.790 -14.895 1.00 9.84  ?  61   GLY B N   1 
ATOM   2003 C CA  . GLY B 1 60  ? 32.097 70.975 -16.327 1.00 9.52  ?  61   GLY B CA  1 
ATOM   2004 C C   . GLY B 1 60  ? 33.197 71.931 -16.728 1.00 12.95 ?  61   GLY B C   1 
ATOM   2005 O O   . GLY B 1 60  ? 33.996 72.373 -15.901 1.00 9.77  ?  61   GLY B O   1 
ATOM   2006 N N   . PHE B 1 61  ? 33.231 72.240 -18.014 1.00 7.46  ?  62   PHE B N   1 
ATOM   2007 C CA  . PHE B 1 61  ? 34.183 73.197 -18.548 1.00 9.83  ?  62   PHE B CA  1 
ATOM   2008 C C   . PHE B 1 61  ? 33.558 74.579 -18.624 1.00 11.43 ?  62   PHE B C   1 
ATOM   2009 O O   . PHE B 1 61  ? 32.333 74.716 -18.691 1.00 9.03  ?  62   PHE B O   1 
ATOM   2010 C CB  . PHE B 1 61  ? 34.644 72.770 -19.945 1.00 10.49 ?  62   PHE B CB  1 
ATOM   2011 C CG  . PHE B 1 61  ? 35.598 71.611 -19.944 1.00 14.90 ?  62   PHE B CG  1 
ATOM   2012 C CD1 . PHE B 1 61  ? 36.867 71.744 -19.409 1.00 8.63  ?  62   PHE B CD1 1 
ATOM   2013 C CD2 . PHE B 1 61  ? 35.229 70.393 -20.490 1.00 16.80 ?  62   PHE B CD2 1 
ATOM   2014 C CE1 . PHE B 1 61  ? 37.751 70.682 -19.411 1.00 11.75 ?  62   PHE B CE1 1 
ATOM   2015 C CE2 . PHE B 1 61  ? 36.109 69.326 -20.496 1.00 19.89 ?  62   PHE B CE2 1 
ATOM   2016 C CZ  . PHE B 1 61  ? 37.372 69.472 -19.956 1.00 10.32 ?  62   PHE B CZ  1 
ATOM   2017 N N   . PRO B 1 62  ? 34.372 75.632 -18.601 1.00 8.33  ?  63   PRO B N   1 
ATOM   2018 C CA  . PRO B 1 62  ? 33.842 76.968 -18.891 1.00 9.12  ?  63   PRO B CA  1 
ATOM   2019 C C   . PRO B 1 62  ? 33.223 77.002 -20.279 1.00 19.67 ?  63   PRO B C   1 
ATOM   2020 O O   . PRO B 1 62  ? 33.768 76.449 -21.236 1.00 11.17 ?  63   PRO B O   1 
ATOM   2021 C CB  . PRO B 1 62  ? 35.077 77.870 -18.799 1.00 12.77 ?  63   PRO B CB  1 
ATOM   2022 C CG  . PRO B 1 62  ? 36.029 77.116 -17.931 1.00 13.56 ?  63   PRO B CG  1 
ATOM   2023 C CD  . PRO B 1 62  ? 35.802 75.670 -18.251 1.00 7.56  ?  63   PRO B CD  1 
ATOM   2024 N N   . GLY B 1 63  ? 32.069 77.639 -20.379 1.00 13.57 ?  64   GLY B N   1 
ATOM   2025 C CA  . GLY B 1 63  ? 31.336 77.699 -21.620 1.00 15.75 ?  64   GLY B CA  1 
ATOM   2026 C C   . GLY B 1 63  ? 29.850 77.602 -21.361 1.00 16.69 ?  64   GLY B C   1 
ATOM   2027 O O   . GLY B 1 63  ? 29.392 77.639 -20.220 1.00 15.92 ?  64   GLY B O   1 
ATOM   2028 N N   . GLY B 1 64  ? 29.089 77.483 -22.440 1.00 8.81  ?  65   GLY B N   1 
ATOM   2029 C CA  . GLY B 1 64  ? 27.651 77.358 -22.313 1.00 12.68 ?  65   GLY B CA  1 
ATOM   2030 C C   . GLY B 1 64  ? 26.993 77.290 -23.672 1.00 22.62 ?  65   GLY B C   1 
ATOM   2031 O O   . GLY B 1 64  ? 27.660 77.186 -24.704 1.00 16.55 ?  65   GLY B O   1 
ATOM   2032 N N   . PHE B 1 65  ? 25.664 77.347 -23.653 1.00 15.17 ?  66   PHE B N   1 
ATOM   2033 C CA  . PHE B 1 65  ? 24.895 77.311 -24.887 1.00 14.25 ?  66   PHE B CA  1 
ATOM   2034 C C   . PHE B 1 65  ? 25.155 78.558 -25.723 1.00 14.51 ?  66   PHE B C   1 
ATOM   2035 O O   . PHE B 1 65  ? 25.385 79.651 -25.199 1.00 19.34 ?  66   PHE B O   1 
ATOM   2036 C CB  . PHE B 1 65  ? 23.402 77.193 -24.581 1.00 20.42 ?  66   PHE B CB  1 
ATOM   2037 C CG  . PHE B 1 65  ? 22.972 75.812 -24.185 1.00 22.11 ?  66   PHE B CG  1 
ATOM   2038 C CD1 . PHE B 1 65  ? 23.050 74.763 -25.087 1.00 24.16 ?  66   PHE B CD1 1 
ATOM   2039 C CD2 . PHE B 1 65  ? 22.483 75.562 -22.913 1.00 27.47 ?  66   PHE B CD2 1 
ATOM   2040 C CE1 . PHE B 1 65  ? 22.651 73.488 -24.726 1.00 23.61 ?  66   PHE B CE1 1 
ATOM   2041 C CE2 . PHE B 1 65  ? 22.083 74.290 -22.547 1.00 32.15 ?  66   PHE B CE2 1 
ATOM   2042 C CZ  . PHE B 1 65  ? 22.167 73.252 -23.454 1.00 26.35 ?  66   PHE B CZ  1 
ATOM   2043 N N   . VAL B 1 66  ? 25.118 78.382 -27.040 1.00 13.54 ?  67   VAL B N   1 
ATOM   2044 C CA  . VAL B 1 66  ? 25.307 79.469 -27.992 1.00 14.81 ?  67   VAL B CA  1 
ATOM   2045 C C   . VAL B 1 66  ? 24.085 79.528 -28.897 1.00 23.09 ?  67   VAL B C   1 
ATOM   2046 O O   . VAL B 1 66  ? 23.722 78.527 -29.527 1.00 19.91 ?  67   VAL B O   1 
ATOM   2047 C CB  . VAL B 1 66  ? 26.593 79.290 -28.819 1.00 17.90 ?  67   VAL B CB  1 
ATOM   2048 C CG1 . VAL B 1 66  ? 26.677 80.354 -29.901 1.00 22.03 ?  67   VAL B CG1 1 
ATOM   2049 C CG2 . VAL B 1 66  ? 27.815 79.346 -27.914 1.00 10.98 ?  67   VAL B CG2 1 
ATOM   2050 N N   . ASP B 1 67  ? 23.449 80.696 -28.953 1.00 21.30 ?  68   ASP B N   1 
ATOM   2051 C CA  . ASP B 1 67  ? 22.291 80.919 -29.815 1.00 28.84 ?  68   ASP B CA  1 
ATOM   2052 C C   . ASP B 1 67  ? 22.808 81.355 -31.180 1.00 18.89 ?  68   ASP B C   1 
ATOM   2053 O O   . ASP B 1 67  ? 23.208 82.506 -31.369 1.00 21.01 ?  68   ASP B O   1 
ATOM   2054 C CB  . ASP B 1 67  ? 21.357 81.958 -29.204 1.00 34.31 ?  68   ASP B CB  1 
ATOM   2055 C CG  . ASP B 1 67  ? 19.964 81.916 -29.802 1.00 43.16 ?  68   ASP B CG  1 
ATOM   2056 O OD1 . ASP B 1 67  ? 19.845 81.764 -31.034 1.00 39.33 ?  68   ASP B OD1 1 
ATOM   2057 O OD2 . ASP B 1 67  ? 18.984 82.032 -29.035 1.00 57.36 ?  68   ASP B OD2 1 
ATOM   2058 N N   . ARG B 1 68  ? 22.801 80.427 -32.140 1.00 19.21 ?  69   ARG B N   1 
ATOM   2059 C CA  . ARG B 1 68  ? 23.360 80.700 -33.458 1.00 28.24 ?  69   ARG B CA  1 
ATOM   2060 C C   . ARG B 1 68  ? 22.546 81.709 -34.256 1.00 32.42 ?  69   ARG B C   1 
ATOM   2061 O O   . ARG B 1 68  ? 23.029 82.184 -35.290 1.00 35.03 ?  69   ARG B O   1 
ATOM   2062 C CB  . ARG B 1 68  ? 23.492 79.400 -34.253 1.00 27.23 ?  69   ARG B CB  1 
ATOM   2063 C CG  . ARG B 1 68  ? 24.559 78.457 -33.724 1.00 33.94 ?  69   ARG B CG  1 
ATOM   2064 C CD  . ARG B 1 68  ? 24.799 77.314 -34.693 1.00 30.56 ?  69   ARG B CD  1 
ATOM   2065 N NE  . ARG B 1 68  ? 25.183 77.804 -36.013 1.00 43.58 ?  69   ARG B NE  1 
ATOM   2066 C CZ  . ARG B 1 68  ? 24.786 77.257 -37.156 1.00 51.97 ?  69   ARG B CZ  1 
ATOM   2067 N NH1 . ARG B 1 68  ? 23.986 76.199 -37.144 1.00 43.92 ?  69   ARG B NH1 1 
ATOM   2068 N NH2 . ARG B 1 68  ? 25.185 77.768 -38.314 1.00 57.11 ?  69   ARG B NH2 1 
ATOM   2069 N N   . ARG B 1 69  ? 21.334 82.050 -33.809 1.00 32.82 ?  70   ARG B N   1 
ATOM   2070 C CA  . ARG B 1 69  ? 20.559 83.075 -34.499 1.00 40.19 ?  70   ARG B CA  1 
ATOM   2071 C C   . ARG B 1 69  ? 21.235 84.438 -34.418 1.00 40.16 ?  70   ARG B C   1 
ATOM   2072 O O   . ARG B 1 69  ? 21.012 85.293 -35.283 1.00 47.78 ?  70   ARG B O   1 
ATOM   2073 C CB  . ARG B 1 69  ? 19.147 83.155 -33.917 1.00 38.39 ?  70   ARG B CB  1 
ATOM   2074 C CG  . ARG B 1 69  ? 18.391 81.835 -33.902 1.00 49.44 ?  70   ARG B CG  1 
ATOM   2075 C CD  . ARG B 1 69  ? 16.948 82.034 -33.462 1.00 47.01 ?  70   ARG B CD  1 
ATOM   2076 N NE  . ARG B 1 69  ? 16.852 82.687 -32.159 1.00 49.01 ?  70   ARG B NE  1 
ATOM   2077 C CZ  . ARG B 1 69  ? 16.491 82.072 -31.037 1.00 64.11 ?  70   ARG B CZ  1 
ATOM   2078 N NH1 . ARG B 1 69  ? 16.184 80.783 -31.055 1.00 65.86 ?  70   ARG B NH1 1 
ATOM   2079 N NH2 . ARG B 1 69  ? 16.433 82.748 -29.897 1.00 60.68 ?  70   ARG B NH2 1 
ATOM   2080 N N   . PHE B 1 70  ? 22.066 84.659 -33.399 1.00 35.61 ?  71   PHE B N   1 
ATOM   2081 C CA  . PHE B 1 70  ? 22.706 85.952 -33.190 1.00 35.99 ?  71   PHE B CA  1 
ATOM   2082 C C   . PHE B 1 70  ? 24.217 85.893 -33.025 1.00 40.30 ?  71   PHE B C   1 
ATOM   2083 O O   . PHE B 1 70  ? 24.868 86.932 -33.185 1.00 43.29 ?  71   PHE B O   1 
ATOM   2084 C CB  . PHE B 1 70  ? 22.113 86.649 -31.956 1.00 41.68 ?  71   PHE B CB  1 
ATOM   2085 C CG  . PHE B 1 70  ? 20.618 86.773 -31.992 1.00 58.19 ?  71   PHE B CG  1 
ATOM   2086 C CD1 . PHE B 1 70  ? 20.001 87.587 -32.928 1.00 50.07 ?  71   PHE B CD1 1 
ATOM   2087 C CD2 . PHE B 1 70  ? 19.829 86.077 -31.091 1.00 56.35 ?  71   PHE B CD2 1 
ATOM   2088 C CE1 . PHE B 1 70  ? 18.625 87.704 -32.965 1.00 51.86 ?  71   PHE B CE1 1 
ATOM   2089 C CE2 . PHE B 1 70  ? 18.451 86.191 -31.122 1.00 56.34 ?  71   PHE B CE2 1 
ATOM   2090 C CZ  . PHE B 1 70  ? 17.849 87.006 -32.061 1.00 56.60 ?  71   PHE B CZ  1 
ATOM   2091 N N   . TRP B 1 71  ? 24.797 84.736 -32.715 1.00 25.56 ?  72   TRP B N   1 
ATOM   2092 C CA  . TRP B 1 71  ? 26.221 84.639 -32.432 1.00 29.77 ?  72   TRP B CA  1 
ATOM   2093 C C   . TRP B 1 71  ? 26.850 83.515 -33.239 1.00 19.72 ?  72   TRP B C   1 
ATOM   2094 O O   . TRP B 1 71  ? 26.238 82.461 -33.438 1.00 24.23 ?  72   TRP B O   1 
ATOM   2095 C CB  . TRP B 1 71  ? 26.481 84.386 -30.939 1.00 23.79 ?  72   TRP B CB  1 
ATOM   2096 C CG  . TRP B 1 71  ? 26.188 85.556 -30.058 1.00 26.57 ?  72   TRP B CG  1 
ATOM   2097 C CD1 . TRP B 1 71  ? 26.863 86.740 -30.016 1.00 32.35 ?  72   TRP B CD1 1 
ATOM   2098 C CD2 . TRP B 1 71  ? 25.150 85.650 -29.077 1.00 31.63 ?  72   TRP B CD2 1 
ATOM   2099 N NE1 . TRP B 1 71  ? 26.305 87.570 -29.075 1.00 39.91 ?  72   TRP B NE1 1 
ATOM   2100 C CE2 . TRP B 1 71  ? 25.251 86.923 -28.483 1.00 31.54 ?  72   TRP B CE2 1 
ATOM   2101 C CE3 . TRP B 1 71  ? 24.142 84.783 -28.645 1.00 47.30 ?  72   TRP B CE3 1 
ATOM   2102 C CZ2 . TRP B 1 71  ? 24.383 87.351 -27.481 1.00 45.55 ?  72   TRP B CZ2 1 
ATOM   2103 C CZ3 . TRP B 1 71  ? 23.281 85.209 -27.649 1.00 57.04 ?  72   TRP B CZ3 1 
ATOM   2104 C CH2 . TRP B 1 71  ? 23.407 86.481 -27.078 1.00 53.43 ?  72   TRP B CH2 1 
ATOM   2105 N N   . SER B 1 72  ? 28.076 83.748 -33.698 1.00 26.42 ?  73   SER B N   1 
ATOM   2106 C CA  . SER B 1 72  ? 28.907 82.656 -34.172 1.00 26.25 ?  73   SER B CA  1 
ATOM   2107 C C   . SER B 1 72  ? 29.331 81.787 -32.991 1.00 26.48 ?  73   SER B C   1 
ATOM   2108 O O   . SER B 1 72  ? 29.128 82.135 -31.824 1.00 20.00 ?  73   SER B O   1 
ATOM   2109 C CB  . SER B 1 72  ? 30.134 83.192 -34.904 1.00 20.12 ?  73   SER B CB  1 
ATOM   2110 O OG  . SER B 1 72  ? 31.031 83.809 -33.996 1.00 25.39 ?  73   SER B OG  1 
ATOM   2111 N N   . LEU B 1 73  ? 29.928 80.635 -33.303 1.00 19.58 ?  74   LEU B N   1 
ATOM   2112 C CA  . LEU B 1 73  ? 30.402 79.754 -32.240 1.00 27.64 ?  74   LEU B CA  1 
ATOM   2113 C C   . LEU B 1 73  ? 31.454 80.445 -31.384 1.00 22.29 ?  74   LEU B C   1 
ATOM   2114 O O   . LEU B 1 73  ? 31.422 80.353 -30.151 1.00 17.09 ?  74   LEU B O   1 
ATOM   2115 C CB  . LEU B 1 73  ? 30.964 78.463 -32.832 1.00 28.00 ?  74   LEU B CB  1 
ATOM   2116 C CG  . LEU B 1 73  ? 29.972 77.462 -33.419 1.00 26.53 ?  74   LEU B CG  1 
ATOM   2117 C CD1 . LEU B 1 73  ? 30.671 76.133 -33.639 1.00 27.91 ?  74   LEU B CD1 1 
ATOM   2118 C CD2 . LEU B 1 73  ? 28.759 77.297 -32.516 1.00 21.46 ?  74   LEU B CD2 1 
ATOM   2119 N N   . GLU B 1 74  ? 32.385 81.157 -32.022 1.00 16.88 ?  75   GLU B N   1 
ATOM   2120 C CA  . GLU B 1 74  ? 33.462 81.805 -31.283 1.00 19.12 ?  75   GLU B CA  1 
ATOM   2121 C C   . GLU B 1 74  ? 32.945 82.985 -30.470 1.00 22.94 ?  75   GLU B C   1 
ATOM   2122 O O   . GLU B 1 74  ? 33.349 83.176 -29.317 1.00 19.72 ?  75   GLU B O   1 
ATOM   2123 C CB  . GLU B 1 74  ? 34.563 82.255 -32.245 1.00 18.50 ?  75   GLU B CB  1 
ATOM   2124 C CG  . GLU B 1 74  ? 35.401 81.117 -32.825 1.00 24.85 ?  75   GLU B CG  1 
ATOM   2125 C CD  . GLU B 1 74  ? 34.617 80.219 -33.768 1.00 34.68 ?  75   GLU B CD  1 
ATOM   2126 O OE1 . GLU B 1 74  ? 33.725 80.731 -34.477 1.00 29.27 ?  75   GLU B OE1 1 
ATOM   2127 O OE2 . GLU B 1 74  ? 34.888 79.001 -33.794 1.00 37.41 ?  75   GLU B OE2 1 
ATOM   2128 N N   . ASP B 1 75  ? 32.052 83.790 -31.052 1.00 21.71 ?  76   ASP B N   1 
ATOM   2129 C CA  . ASP B 1 75  ? 31.500 84.926 -30.320 1.00 17.96 ?  76   ASP B CA  1 
ATOM   2130 C C   . ASP B 1 75  ? 30.605 84.465 -29.177 1.00 18.77 ?  76   ASP B C   1 
ATOM   2131 O O   . ASP B 1 75  ? 30.601 85.073 -28.100 1.00 17.42 ?  76   ASP B O   1 
ATOM   2132 C CB  . ASP B 1 75  ? 30.730 85.843 -31.269 1.00 25.01 ?  76   ASP B CB  1 
ATOM   2133 C CG  . ASP B 1 75  ? 31.644 86.716 -32.105 1.00 34.37 ?  76   ASP B CG  1 
ATOM   2134 O OD1 . ASP B 1 75  ? 32.862 86.740 -31.826 1.00 35.32 ?  76   ASP B OD1 1 
ATOM   2135 O OD2 . ASP B 1 75  ? 31.146 87.380 -33.037 1.00 36.99 ?  76   ASP B OD2 1 
ATOM   2136 N N   . GLY B 1 76  ? 29.835 83.397 -29.393 1.00 16.94 ?  77   GLY B N   1 
ATOM   2137 C CA  . GLY B 1 76  ? 29.012 82.865 -28.321 1.00 20.35 ?  77   GLY B CA  1 
ATOM   2138 C C   . GLY B 1 76  ? 29.840 82.288 -27.190 1.00 21.00 ?  77   GLY B C   1 
ATOM   2139 O O   . GLY B 1 76  ? 29.510 82.462 -26.014 1.00 17.44 ?  77   GLY B O   1 
ATOM   2140 N N   . LEU B 1 77  ? 30.927 81.592 -27.530 1.00 21.63 ?  78   LEU B N   1 
ATOM   2141 C CA  . LEU B 1 77  ? 31.834 81.084 -26.506 1.00 17.30 ?  78   LEU B CA  1 
ATOM   2142 C C   . LEU B 1 77  ? 32.468 82.227 -25.727 1.00 12.11 ?  78   LEU B C   1 
ATOM   2143 O O   . LEU B 1 77  ? 32.456 82.236 -24.490 1.00 15.32 ?  78   LEU B O   1 
ATOM   2144 C CB  . LEU B 1 77  ? 32.911 80.209 -27.147 1.00 17.40 ?  78   LEU B CB  1 
ATOM   2145 C CG  . LEU B 1 77  ? 34.078 79.825 -26.235 1.00 18.48 ?  78   LEU B CG  1 
ATOM   2146 C CD1 . LEU B 1 77  ? 33.604 78.903 -25.121 1.00 18.43 ?  78   LEU B CD1 1 
ATOM   2147 C CD2 . LEU B 1 77  ? 35.205 79.184 -27.031 1.00 20.33 ?  78   LEU B CD2 1 
ATOM   2148 N N   . ASN B 1 78  ? 33.022 83.211 -26.439 1.00 11.90 ?  79   ASN B N   1 
ATOM   2149 C CA  . ASN B 1 78  ? 33.693 84.322 -25.779 1.00 14.14 ?  79   ASN B CA  1 
ATOM   2150 C C   . ASN B 1 78  ? 32.736 85.178 -24.961 1.00 15.59 ?  79   ASN B C   1 
ATOM   2151 O O   . ASN B 1 78  ? 33.185 85.880 -24.050 1.00 12.44 ?  79   ASN B O   1 
ATOM   2152 C CB  . ASN B 1 78  ? 34.421 85.183 -26.813 1.00 18.91 ?  79   ASN B CB  1 
ATOM   2153 C CG  . ASN B 1 78  ? 35.664 84.507 -27.355 1.00 26.08 ?  79   ASN B CG  1 
ATOM   2154 O OD1 . ASN B 1 78  ? 36.359 83.793 -26.632 1.00 21.02 ?  79   ASN B OD1 1 
ATOM   2155 N ND2 . ASN B 1 78  ? 35.948 84.724 -28.635 1.00 16.55 ?  79   ASN B ND2 1 
ATOM   2156 N N   . ARG B 1 79  ? 31.434 85.133 -25.254 1.00 14.58 ?  80   ARG B N   1 
ATOM   2157 C CA  . ARG B 1 79  ? 30.477 85.873 -24.438 1.00 13.62 ?  80   ARG B CA  1 
ATOM   2158 C C   . ARG B 1 79  ? 30.442 85.338 -23.012 1.00 17.00 ?  80   ARG B C   1 
ATOM   2159 O O   . ARG B 1 79  ? 30.572 86.099 -22.048 1.00 12.93 ?  80   ARG B O   1 
ATOM   2160 C CB  . ARG B 1 79  ? 29.085 85.818 -25.067 1.00 11.78 ?  80   ARG B CB  1 
ATOM   2161 C CG  . ARG B 1 79  ? 28.059 86.695 -24.359 1.00 12.06 ?  80   ARG B CG  1 
ATOM   2162 C CD  . ARG B 1 79  ? 26.642 86.377 -24.814 1.00 10.87 ?  80   ARG B CD  1 
ATOM   2163 N NE  . ARG B 1 79  ? 26.201 85.069 -24.340 1.00 16.64 ?  80   ARG B NE  1 
ATOM   2164 C CZ  . ARG B 1 79  ? 25.533 84.868 -23.209 1.00 15.94 ?  80   ARG B CZ  1 
ATOM   2165 N NH1 . ARG B 1 79  ? 25.218 85.894 -22.428 1.00 10.75 ?  80   ARG B NH1 1 
ATOM   2166 N NH2 . ARG B 1 79  ? 25.177 83.639 -22.861 1.00 18.61 ?  80   ARG B NH2 1 
ATOM   2167 N N   . VAL B 1 80  ? 30.264 84.026 -22.856 1.00 14.12 ?  81   VAL B N   1 
ATOM   2168 C CA  . VAL B 1 80  ? 30.205 83.466 -21.512 1.00 16.88 ?  81   VAL B CA  1 
ATOM   2169 C C   . VAL B 1 80  ? 31.594 83.294 -20.914 1.00 17.02 ?  81   VAL B C   1 
ATOM   2170 O O   . VAL B 1 80  ? 31.733 83.283 -19.683 1.00 17.30 ?  81   VAL B O   1 
ATOM   2171 C CB  . VAL B 1 80  ? 29.435 82.136 -21.517 1.00 27.46 ?  81   VAL B CB  1 
ATOM   2172 C CG1 . VAL B 1 80  ? 28.653 81.988 -22.811 1.00 25.15 ?  81   VAL B CG1 1 
ATOM   2173 C CG2 . VAL B 1 80  ? 30.376 80.979 -21.326 1.00 28.75 ?  81   VAL B CG2 1 
ATOM   2174 N N   . LEU B 1 81  ? 32.634 83.175 -21.745 1.00 14.37 ?  82   LEU B N   1 
ATOM   2175 C CA  . LEU B 1 81  ? 33.987 83.182 -21.203 1.00 18.84 ?  82   LEU B CA  1 
ATOM   2176 C C   . LEU B 1 81  ? 34.296 84.521 -20.551 1.00 15.77 ?  82   LEU B C   1 
ATOM   2177 O O   . LEU B 1 81  ? 34.954 84.574 -19.506 1.00 15.12 ?  82   LEU B O   1 
ATOM   2178 C CB  . LEU B 1 81  ? 35.010 82.871 -22.296 1.00 19.51 ?  82   LEU B CB  1 
ATOM   2179 C CG  . LEU B 1 81  ? 35.133 81.428 -22.794 1.00 19.08 ?  82   LEU B CG  1 
ATOM   2180 C CD1 . LEU B 1 81  ? 36.353 81.273 -23.693 1.00 20.60 ?  82   LEU B CD1 1 
ATOM   2181 C CD2 . LEU B 1 81  ? 35.191 80.441 -21.638 1.00 15.50 ?  82   LEU B CD2 1 
ATOM   2182 N N   . GLY B 1 82  ? 33.824 85.616 -21.152 1.00 17.50 ?  83   GLY B N   1 
ATOM   2183 C CA  . GLY B 1 82  ? 33.989 86.917 -20.529 1.00 16.67 ?  83   GLY B CA  1 
ATOM   2184 C C   . GLY B 1 82  ? 33.242 87.040 -19.216 1.00 17.43 ?  83   GLY B C   1 
ATOM   2185 O O   . GLY B 1 82  ? 33.711 87.707 -18.290 1.00 18.72 ?  83   GLY B O   1 
ATOM   2186 N N   . LEU B 1 83  ? 32.079 86.392 -19.113 1.00 15.79 ?  84   LEU B N   1 
ATOM   2187 C CA  . LEU B 1 83  ? 31.303 86.420 -17.878 1.00 13.82 ?  84   LEU B CA  1 
ATOM   2188 C C   . LEU B 1 83  ? 31.922 85.538 -16.800 1.00 17.74 ?  84   LEU B C   1 
ATOM   2189 O O   . LEU B 1 83  ? 31.891 85.891 -15.616 1.00 16.39 ?  84   LEU B O   1 
ATOM   2190 C CB  . LEU B 1 83  ? 29.865 85.977 -18.153 1.00 11.16 ?  84   LEU B CB  1 
ATOM   2191 C CG  . LEU B 1 83  ? 28.958 86.972 -18.872 1.00 20.33 ?  84   LEU B CG  1 
ATOM   2192 C CD1 . LEU B 1 83  ? 27.715 86.274 -19.395 1.00 25.04 ?  84   LEU B CD1 1 
ATOM   2193 C CD2 . LEU B 1 83  ? 28.589 88.129 -17.954 1.00 9.10  ?  84   LEU B CD2 1 
ATOM   2194 N N   . GLY B 1 84  ? 32.483 84.394 -17.188 1.00 15.20 ?  85   GLY B N   1 
ATOM   2195 C CA  . GLY B 1 84  ? 32.972 83.416 -16.234 1.00 14.05 ?  85   GLY B CA  1 
ATOM   2196 C C   . GLY B 1 84  ? 34.447 83.519 -15.909 1.00 18.32 ?  85   GLY B C   1 
ATOM   2197 O O   . GLY B 1 84  ? 34.870 83.182 -14.799 1.00 22.45 ?  85   GLY B O   1 
ATOM   2198 N N   . LEU B 1 85  ? 35.240 83.965 -16.872 1.00 17.46 ?  86   LEU B N   1 
ATOM   2199 C CA  . LEU B 1 85  ? 36.673 84.153 -16.686 1.00 24.73 ?  86   LEU B CA  1 
ATOM   2200 C C   . LEU B 1 85  ? 37.119 85.578 -16.960 1.00 28.31 ?  86   LEU B C   1 
ATOM   2201 O O   . LEU B 1 85  ? 37.889 86.140 -16.178 1.00 36.72 ?  86   LEU B O   1 
ATOM   2202 C CB  . LEU B 1 85  ? 37.457 83.196 -17.597 1.00 15.91 ?  86   LEU B CB  1 
ATOM   2203 C CG  . LEU B 1 85  ? 36.928 81.766 -17.720 1.00 20.76 ?  86   LEU B CG  1 
ATOM   2204 C CD1 . LEU B 1 85  ? 37.632 81.037 -18.850 1.00 19.23 ?  86   LEU B CD1 1 
ATOM   2205 C CD2 . LEU B 1 85  ? 37.096 81.010 -16.411 1.00 20.50 ?  86   LEU B CD2 1 
ATOM   2206 N N   . GLY B 1 86  ? 36.652 86.174 -18.053 1.00 31.73 ?  87   GLY B N   1 
ATOM   2207 C CA  . GLY B 1 86  ? 37.002 87.538 -18.385 1.00 33.97 ?  87   GLY B CA  1 
ATOM   2208 C C   . GLY B 1 86  ? 38.199 87.657 -19.305 1.00 41.74 ?  87   GLY B C   1 
ATOM   2209 O O   . GLY B 1 86  ? 38.049 87.863 -20.513 1.00 60.37 ?  87   GLY B O   1 
ATOM   2210 N N   . CYS B 1 87  ? 39.395 87.492 -18.744 1.00 37.50 ?  88   CYS B N   1 
ATOM   2211 C CA  . CYS B 1 87  ? 40.643 87.870 -19.399 1.00 45.16 ?  88   CYS B CA  1 
ATOM   2212 C C   . CYS B 1 87  ? 41.039 86.991 -20.582 1.00 45.64 ?  88   CYS B C   1 
ATOM   2213 O O   . CYS B 1 87  ? 42.226 86.914 -20.912 1.00 59.88 ?  88   CYS B O   1 
ATOM   2214 C CB  . CYS B 1 87  ? 41.777 87.848 -18.375 1.00 47.56 ?  88   CYS B CB  1 
ATOM   2215 S SG  . CYS B 1 87  ? 42.121 86.191 -17.730 1.00 51.73 ?  88   CYS B SG  1 
ATOM   2216 N N   . LEU B 1 88  ? 40.085 86.333 -21.237 1.00 33.72 ?  89   LEU B N   1 
ATOM   2217 C CA  . LEU B 1 88  ? 40.439 85.407 -22.303 1.00 35.79 ?  89   LEU B CA  1 
ATOM   2218 C C   . LEU B 1 88  ? 39.509 85.559 -23.496 1.00 32.74 ?  89   LEU B C   1 
ATOM   2219 O O   . LEU B 1 88  ? 38.299 85.745 -23.338 1.00 35.51 ?  89   LEU B O   1 
ATOM   2220 C CB  . LEU B 1 88  ? 40.412 83.954 -21.814 1.00 42.21 ?  89   LEU B CB  1 
ATOM   2221 C CG  . LEU B 1 88  ? 41.782 83.300 -21.632 1.00 45.01 ?  89   LEU B CG  1 
ATOM   2222 C CD1 . LEU B 1 88  ? 41.660 81.793 -21.715 1.00 38.15 ?  89   LEU B CD1 1 
ATOM   2223 C CD2 . LEU B 1 88  ? 42.774 83.816 -22.664 1.00 35.20 ?  89   LEU B CD2 1 
ATOM   2224 N N   . ARG B 1 89  ? 40.091 85.467 -24.690 1.00 25.81 ?  90   ARG B N   1 
ATOM   2225 C CA  . ARG B 1 89  ? 39.349 85.455 -25.944 1.00 29.65 ?  90   ARG B CA  1 
ATOM   2226 C C   . ARG B 1 89  ? 39.910 84.343 -26.816 1.00 26.10 ?  90   ARG B C   1 
ATOM   2227 O O   . ARG B 1 89  ? 41.104 84.343 -27.131 1.00 30.83 ?  90   ARG B O   1 
ATOM   2228 C CB  . ARG B 1 89  ? 39.445 86.804 -26.662 1.00 38.13 ?  90   ARG B CB  1 
ATOM   2229 C CG  . ARG B 1 89  ? 38.975 86.763 -28.106 1.00 39.38 ?  90   ARG B CG  1 
ATOM   2230 C CD  . ARG B 1 89  ? 38.936 88.150 -28.725 1.00 56.90 ?  90   ARG B CD  1 
ATOM   2231 N NE  . ARG B 1 89  ? 40.264 88.748 -28.832 1.00 65.26 ?  90   ARG B NE  1 
ATOM   2232 C CZ  . ARG B 1 89  ? 40.655 89.827 -28.161 1.00 74.28 ?  90   ARG B CZ  1 
ATOM   2233 N NH1 . ARG B 1 89  ? 39.817 90.432 -27.331 1.00 65.83 ?  90   ARG B NH1 1 
ATOM   2234 N NH2 . ARG B 1 89  ? 41.882 90.302 -28.321 1.00 72.46 ?  90   ARG B NH2 1 
ATOM   2235 N N   . LEU B 1 90  ? 39.059 83.396 -27.195 1.00 20.92 ?  91   LEU B N   1 
ATOM   2236 C CA  . LEU B 1 90  ? 39.463 82.292 -28.052 1.00 25.77 ?  91   LEU B CA  1 
ATOM   2237 C C   . LEU B 1 90  ? 39.035 82.548 -29.492 1.00 23.96 ?  91   LEU B C   1 
ATOM   2238 O O   . LEU B 1 90  ? 38.152 83.362 -29.768 1.00 20.79 ?  91   LEU B O   1 
ATOM   2239 C CB  . LEU B 1 90  ? 38.869 80.971 -27.558 1.00 17.48 ?  91   LEU B CB  1 
ATOM   2240 C CG  . LEU B 1 90  ? 39.290 80.509 -26.163 1.00 23.92 ?  91   LEU B CG  1 
ATOM   2241 C CD1 . LEU B 1 90  ? 38.913 79.054 -25.961 1.00 20.95 ?  91   LEU B CD1 1 
ATOM   2242 C CD2 . LEU B 1 90  ? 40.782 80.711 -25.955 1.00 24.72 ?  91   LEU B CD2 1 
ATOM   2243 N N   . THR B 1 91  ? 39.679 81.837 -30.415 1.00 21.14 ?  92   THR B N   1 
ATOM   2244 C CA  . THR B 1 91  ? 39.391 81.957 -31.837 1.00 21.20 ?  92   THR B CA  1 
ATOM   2245 C C   . THR B 1 91  ? 39.076 80.581 -32.411 1.00 24.70 ?  92   THR B C   1 
ATOM   2246 O O   . THR B 1 91  ? 39.107 79.562 -31.711 1.00 17.40 ?  92   THR B O   1 
ATOM   2247 C CB  . THR B 1 91  ? 40.560 82.595 -32.601 1.00 25.21 ?  92   THR B CB  1 
ATOM   2248 O OG1 . THR B 1 91  ? 41.606 81.630 -32.767 1.00 27.54 ?  92   THR B OG1 1 
ATOM   2249 C CG2 . THR B 1 91  ? 41.104 83.804 -31.854 1.00 19.23 ?  92   THR B CG2 1 
ATOM   2250 N N   . GLU B 1 92  ? 38.775 80.558 -33.711 1.00 22.97 ?  93   GLU B N   1 
ATOM   2251 C CA  . GLU B 1 92  ? 38.537 79.288 -34.386 1.00 24.19 ?  93   GLU B CA  1 
ATOM   2252 C C   . GLU B 1 92  ? 39.790 78.420 -34.436 1.00 14.78 ?  93   GLU B C   1 
ATOM   2253 O O   . GLU B 1 92  ? 39.681 77.197 -34.577 1.00 25.54 ?  93   GLU B O   1 
ATOM   2254 C CB  . GLU B 1 92  ? 38.024 79.528 -35.804 1.00 40.51 ?  93   GLU B CB  1 
ATOM   2255 C CG  . GLU B 1 92  ? 38.890 80.457 -36.632 1.00 56.52 ?  93   GLU B CG  1 
ATOM   2256 C CD  . GLU B 1 92  ? 38.248 80.796 -37.959 1.00 65.30 ?  93   GLU B CD  1 
ATOM   2257 O OE1 . GLU B 1 92  ? 37.661 79.888 -38.582 1.00 59.67 ?  93   GLU B OE1 1 
ATOM   2258 O OE2 . GLU B 1 92  ? 38.310 81.975 -38.367 1.00 61.37 ?  93   GLU B OE2 1 
ATOM   2259 N N   . ALA B 1 93  ? 40.979 79.014 -34.315 1.00 11.95 ?  94   ALA B N   1 
ATOM   2260 C CA  . ALA B 1 93  ? 42.195 78.209 -34.253 1.00 22.28 ?  94   ALA B CA  1 
ATOM   2261 C C   . ALA B 1 93  ? 42.255 77.358 -32.992 1.00 23.30 ?  94   ALA B C   1 
ATOM   2262 O O   . ALA B 1 93  ? 43.026 76.393 -32.942 1.00 27.03 ?  94   ALA B O   1 
ATOM   2263 C CB  . ALA B 1 93  ? 43.425 79.110 -34.332 1.00 15.87 ?  94   ALA B CB  1 
ATOM   2264 N N   . ASP B 1 94  ? 41.469 77.697 -31.974 1.00 19.91 ?  95   ASP B N   1 
ATOM   2265 C CA  . ASP B 1 94  ? 41.400 76.926 -30.740 1.00 17.71 ?  95   ASP B CA  1 
ATOM   2266 C C   . ASP B 1 94  ? 40.368 75.808 -30.802 1.00 18.89 ?  95   ASP B C   1 
ATOM   2267 O O   . ASP B 1 94  ? 40.262 75.031 -29.847 1.00 20.25 ?  95   ASP B O   1 
ATOM   2268 C CB  . ASP B 1 94  ? 41.083 77.849 -29.559 1.00 14.44 ?  95   ASP B CB  1 
ATOM   2269 C CG  . ASP B 1 94  ? 42.110 78.951 -29.386 1.00 19.67 ?  95   ASP B CG  1 
ATOM   2270 O OD1 . ASP B 1 94  ? 43.313 78.635 -29.273 1.00 23.02 ?  95   ASP B OD1 1 
ATOM   2271 O OD2 . ASP B 1 94  ? 41.715 80.136 -29.365 1.00 18.69 ?  95   ASP B OD2 1 
ATOM   2272 N N   . TYR B 1 95  ? 39.607 75.713 -31.891 1.00 14.09 ?  96   TYR B N   1 
ATOM   2273 C CA  . TYR B 1 95  ? 38.590 74.678 -32.005 1.00 15.40 ?  96   TYR B CA  1 
ATOM   2274 C C   . TYR B 1 95  ? 39.234 73.297 -32.002 1.00 19.51 ?  96   TYR B C   1 
ATOM   2275 O O   . TYR B 1 95  ? 40.290 73.082 -32.603 1.00 22.63 ?  96   TYR B O   1 
ATOM   2276 C CB  . TYR B 1 95  ? 37.765 74.878 -33.279 1.00 24.00 ?  96   TYR B CB  1 
ATOM   2277 C CG  . TYR B 1 95  ? 36.859 73.714 -33.613 1.00 20.06 ?  96   TYR B CG  1 
ATOM   2278 C CD1 . TYR B 1 95  ? 35.599 73.601 -33.040 1.00 21.18 ?  96   TYR B CD1 1 
ATOM   2279 C CD2 . TYR B 1 95  ? 37.263 72.727 -34.507 1.00 18.27 ?  96   TYR B CD2 1 
ATOM   2280 C CE1 . TYR B 1 95  ? 34.768 72.537 -33.343 1.00 23.88 ?  96   TYR B CE1 1 
ATOM   2281 C CE2 . TYR B 1 95  ? 36.441 71.662 -34.813 1.00 21.90 ?  96   TYR B CE2 1 
ATOM   2282 C CZ  . TYR B 1 95  ? 35.196 71.571 -34.232 1.00 19.62 ?  96   TYR B CZ  1 
ATOM   2283 O OH  . TYR B 1 95  ? 34.378 70.508 -34.541 1.00 18.92 ?  96   TYR B OH  1 
ATOM   2284 N N   . LEU B 1 96  ? 38.583 72.356 -31.322 1.00 17.47 ?  97   LEU B N   1 
ATOM   2285 C CA  . LEU B 1 96  ? 39.106 71.010 -31.133 1.00 20.76 ?  97   LEU B CA  1 
ATOM   2286 C C   . LEU B 1 96  ? 38.211 69.945 -31.744 1.00 19.59 ?  97   LEU B C   1 
ATOM   2287 O O   . LEU B 1 96  ? 38.680 69.141 -32.560 1.00 20.63 ?  97   LEU B O   1 
ATOM   2288 C CB  . LEU B 1 96  ? 39.302 70.731 -29.633 1.00 21.43 ?  97   LEU B CB  1 
ATOM   2289 C CG  . LEU B 1 96  ? 40.650 70.199 -29.142 1.00 28.83 ?  97   LEU B CG  1 
ATOM   2290 C CD1 . LEU B 1 96  ? 40.451 68.941 -28.307 1.00 23.27 ?  97   LEU B CD1 1 
ATOM   2291 C CD2 . LEU B 1 96  ? 41.603 69.942 -30.298 1.00 20.08 ?  97   LEU B CD2 1 
ATOM   2292 N N   . SER B 1 97  ? 36.933 69.911 -31.375 1.00 17.62 ?  98   SER B N   1 
ATOM   2293 C CA  . SER B 1 97  ? 36.053 68.838 -31.812 1.00 15.61 ?  98   SER B CA  1 
ATOM   2294 C C   . SER B 1 97  ? 34.604 69.261 -31.622 1.00 23.80 ?  98   SER B C   1 
ATOM   2295 O O   . SER B 1 97  ? 34.306 70.283 -30.999 1.00 14.73 ?  98   SER B O   1 
ATOM   2296 C CB  . SER B 1 97  ? 36.337 67.544 -31.046 1.00 32.76 ?  98   SER B CB  1 
ATOM   2297 O OG  . SER B 1 97  ? 36.021 67.696 -29.671 1.00 33.56 ?  98   SER B OG  1 
ATOM   2298 N N   . SER B 1 98  ? 33.707 68.448 -32.176 1.00 19.95 ?  99   SER B N   1 
ATOM   2299 C CA  . SER B 1 98  ? 32.270 68.575 -31.976 1.00 21.29 ?  99   SER B CA  1 
ATOM   2300 C C   . SER B 1 98  ? 31.698 67.182 -31.770 1.00 28.37 ?  99   SER B C   1 
ATOM   2301 O O   . SER B 1 98  ? 32.004 66.265 -32.538 1.00 30.26 ?  99   SER B O   1 
ATOM   2302 C CB  . SER B 1 98  ? 31.589 69.256 -33.170 1.00 18.03 ?  99   SER B CB  1 
ATOM   2303 O OG  . SER B 1 98  ? 32.112 70.554 -33.390 1.00 22.95 ?  99   SER B OG  1 
ATOM   2304 N N   . HIS B 1 99  ? 30.881 67.023 -30.733 1.00 16.56 ?  100  HIS B N   1 
ATOM   2305 C CA  . HIS B 1 99  ? 30.249 65.750 -30.430 1.00 18.01 ?  100  HIS B CA  1 
ATOM   2306 C C   . HIS B 1 99  ? 28.748 65.940 -30.278 1.00 29.37 ?  100  HIS B C   1 
ATOM   2307 O O   . HIS B 1 99  ? 28.279 67.002 -29.860 1.00 27.19 ?  100  HIS B O   1 
ATOM   2308 C CB  . HIS B 1 99  ? 30.812 65.120 -29.147 1.00 20.86 ?  100  HIS B CB  1 
ATOM   2309 C CG  . HIS B 1 99  ? 32.268 64.783 -29.226 1.00 25.45 ?  100  HIS B CG  1 
ATOM   2310 N ND1 . HIS B 1 99  ? 33.260 65.733 -29.112 1.00 22.59 ?  100  HIS B ND1 1 
ATOM   2311 C CD2 . HIS B 1 99  ? 32.900 63.600 -29.413 1.00 21.92 ?  100  HIS B CD2 1 
ATOM   2312 C CE1 . HIS B 1 99  ? 34.440 65.149 -29.221 1.00 24.31 ?  100  HIS B CE1 1 
ATOM   2313 N NE2 . HIS B 1 99  ? 34.249 63.855 -29.405 1.00 26.10 ?  100  HIS B NE2 1 
ATOM   2314 N N   . LEU B 1 100 ? 28.000 64.897 -30.625 1.00 24.12 ?  101  LEU B N   1 
ATOM   2315 C CA  . LEU B 1 100 ? 26.563 64.863 -30.395 1.00 26.11 ?  101  LEU B CA  1 
ATOM   2316 C C   . LEU B 1 100 ? 26.305 64.252 -29.024 1.00 30.43 ?  101  LEU B C   1 
ATOM   2317 O O   . LEU B 1 100 ? 26.757 63.136 -28.741 1.00 32.41 ?  101  LEU B O   1 
ATOM   2318 C CB  . LEU B 1 100 ? 25.853 64.071 -31.491 1.00 26.01 ?  101  LEU B CB  1 
ATOM   2319 C CG  . LEU B 1 100 ? 26.184 64.478 -32.928 1.00 27.24 ?  101  LEU B CG  1 
ATOM   2320 C CD1 . LEU B 1 100 ? 25.579 63.496 -33.918 1.00 35.35 ?  101  LEU B CD1 1 
ATOM   2321 C CD2 . LEU B 1 100 ? 25.706 65.895 -33.207 1.00 25.85 ?  101  LEU B CD2 1 
ATOM   2322 N N   . THR B 1 101 ? 25.589 64.984 -28.175 1.00 29.98 ?  102  THR B N   1 
ATOM   2323 C CA  . THR B 1 101 ? 25.381 64.558 -26.802 1.00 26.36 ?  102  THR B CA  1 
ATOM   2324 C C   . THR B 1 101 ? 24.474 63.330 -26.746 1.00 35.90 ?  102  THR B C   1 
ATOM   2325 O O   . THR B 1 101 ? 23.846 62.934 -27.732 1.00 31.04 ?  102  THR B O   1 
ATOM   2326 C CB  . THR B 1 101 ? 24.773 65.690 -25.974 1.00 28.70 ?  102  THR B CB  1 
ATOM   2327 O OG1 . THR B 1 101 ? 23.426 65.925 -26.403 1.00 34.85 ?  102  THR B OG1 1 
ATOM   2328 C CG2 . THR B 1 101 ? 25.582 66.965 -26.145 1.00 27.81 ?  102  THR B CG2 1 
ATOM   2329 N N   . GLU B 1 102 ? 24.412 62.726 -25.562 1.00 40.50 ?  103  GLU B N   1 
ATOM   2330 C CA  . GLU B 1 102 ? 23.510 61.612 -25.325 1.00 54.89 ?  103  GLU B CA  1 
ATOM   2331 C C   . GLU B 1 102 ? 22.065 62.112 -25.293 1.00 48.09 ?  103  GLU B C   1 
ATOM   2332 O O   . GLU B 1 102 ? 21.775 63.287 -25.538 1.00 48.02 ?  103  GLU B O   1 
ATOM   2333 C CB  . GLU B 1 102 ? 23.877 60.901 -24.024 1.00 51.20 ?  103  GLU B CB  1 
ATOM   2334 C CG  . GLU B 1 102 ? 25.010 59.891 -24.154 1.00 70.61 ?  103  GLU B CG  1 
ATOM   2335 C CD  . GLU B 1 102 ? 24.613 58.504 -23.682 1.00 85.85 ?  103  GLU B CD  1 
ATOM   2336 O OE1 . GLU B 1 102 ? 23.401 58.254 -23.519 1.00 77.52 ?  103  GLU B OE1 1 
ATOM   2337 O OE2 . GLU B 1 102 ? 25.514 57.665 -23.470 1.00 91.26 ?  103  GLU B OE2 1 
ATOM   2338 N N   . GLY B 1 103 ? 21.144 61.205 -24.984 1.00 58.91 ?  104  GLY B N   1 
ATOM   2339 C CA  . GLY B 1 103 ? 19.743 61.545 -24.915 1.00 69.11 ?  104  GLY B CA  1 
ATOM   2340 C C   . GLY B 1 103 ? 19.444 62.513 -23.788 1.00 79.94 ?  104  GLY B C   1 
ATOM   2341 O O   . GLY B 1 103 ? 20.256 62.713 -22.879 1.00 79.22 ?  104  GLY B O   1 
ATOM   2342 N N   . PRO B 1 104 ? 18.259 63.141 -23.826 1.00 74.05 ?  105  PRO B N   1 
ATOM   2343 C CA  . PRO B 1 104 ? 17.288 62.992 -24.913 1.00 66.28 ?  105  PRO B CA  1 
ATOM   2344 C C   . PRO B 1 104 ? 17.314 64.135 -25.933 1.00 62.91 ?  105  PRO B C   1 
ATOM   2345 O O   . PRO B 1 104 ? 16.960 63.923 -27.093 1.00 60.51 ?  105  PRO B O   1 
ATOM   2346 C CB  . PRO B 1 104 ? 15.956 62.967 -24.167 1.00 65.68 ?  105  PRO B CB  1 
ATOM   2347 C CG  . PRO B 1 104 ? 16.187 63.884 -23.002 1.00 63.83 ?  105  PRO B CG  1 
ATOM   2348 C CD  . PRO B 1 104 ? 17.662 63.803 -22.652 1.00 68.42 ?  105  PRO B CD  1 
ATOM   2349 N N   . HIS B 1 105 ? 17.729 65.325 -25.505 1.00 58.60 ?  106  HIS B N   1 
ATOM   2350 C CA  . HIS B 1 105 ? 17.701 66.491 -26.374 1.00 55.52 ?  106  HIS B CA  1 
ATOM   2351 C C   . HIS B 1 105 ? 18.779 66.397 -27.451 1.00 53.69 ?  106  HIS B C   1 
ATOM   2352 O O   . HIS B 1 105 ? 19.764 65.662 -27.328 1.00 55.19 ?  106  HIS B O   1 
ATOM   2353 C CB  . HIS B 1 105 ? 17.885 67.772 -25.558 1.00 59.72 ?  106  HIS B CB  1 
ATOM   2354 C CG  . HIS B 1 105 ? 17.070 68.927 -26.052 1.00 71.45 ?  106  HIS B CG  1 
ATOM   2355 N ND1 . HIS B 1 105 ? 17.257 69.494 -27.294 1.00 75.64 ?  106  HIS B ND1 1 
ATOM   2356 C CD2 . HIS B 1 105 ? 16.062 69.620 -25.470 1.00 82.35 ?  106  HIS B CD2 1 
ATOM   2357 C CE1 . HIS B 1 105 ? 16.400 70.487 -27.456 1.00 81.81 ?  106  HIS B CE1 1 
ATOM   2358 N NE2 . HIS B 1 105 ? 15.664 70.584 -26.364 1.00 94.94 ?  106  HIS B NE2 1 
ATOM   2359 N N   . ARG B 1 106 ? 18.578 67.161 -28.523 1.00 48.31 ?  107  ARG B N   1 
ATOM   2360 C CA  . ARG B 1 106 ? 19.506 67.212 -29.651 1.00 40.20 ?  107  ARG B CA  1 
ATOM   2361 C C   . ARG B 1 106 ? 20.454 68.386 -29.430 1.00 39.54 ?  107  ARG B C   1 
ATOM   2362 O O   . ARG B 1 106 ? 20.118 69.535 -29.730 1.00 32.24 ?  107  ARG B O   1 
ATOM   2363 C CB  . ARG B 1 106 ? 18.752 67.345 -30.970 1.00 39.15 ?  107  ARG B CB  1 
ATOM   2364 C CG  . ARG B 1 106 ? 17.497 66.495 -31.061 1.00 39.51 ?  107  ARG B CG  1 
ATOM   2365 C CD  . ARG B 1 106 ? 16.940 66.500 -32.475 1.00 50.33 ?  107  ARG B CD  1 
ATOM   2366 N NE  . ARG B 1 106 ? 15.530 66.874 -32.508 1.00 56.70 ?  107  ARG B NE  1 
ATOM   2367 C CZ  . ARG B 1 106 ? 14.828 67.037 -33.624 1.00 71.76 ?  107  ARG B CZ  1 
ATOM   2368 N NH1 . ARG B 1 106 ? 13.548 67.378 -33.562 1.00 83.17 ?  107  ARG B NH1 1 
ATOM   2369 N NH2 . ARG B 1 106 ? 15.407 66.862 -34.804 1.00 76.11 ?  107  ARG B NH2 1 
ATOM   2370 N N   . VAL B 1 107 ? 21.641 68.094 -28.903 1.00 27.29 ?  108  VAL B N   1 
ATOM   2371 C CA  . VAL B 1 107 ? 22.656 69.103 -28.629 1.00 19.70 ?  108  VAL B CA  1 
ATOM   2372 C C   . VAL B 1 107 ? 23.966 68.654 -29.261 1.00 27.31 ?  108  VAL B C   1 
ATOM   2373 O O   . VAL B 1 107 ? 24.363 67.492 -29.119 1.00 28.83 ?  108  VAL B O   1 
ATOM   2374 C CB  . VAL B 1 107 ? 22.843 69.336 -27.117 1.00 28.49 ?  108  VAL B CB  1 
ATOM   2375 C CG1 . VAL B 1 107 ? 23.910 70.393 -26.867 1.00 21.95 ?  108  VAL B CG1 1 
ATOM   2376 C CG2 . VAL B 1 107 ? 21.525 69.738 -26.469 1.00 37.61 ?  108  VAL B CG2 1 
ATOM   2377 N N   . VAL B 1 108 ? 24.628 69.567 -29.964 1.00 18.13 ?  109  VAL B N   1 
ATOM   2378 C CA  . VAL B 1 108 ? 25.978 69.349 -30.468 1.00 28.07 ?  109  VAL B CA  1 
ATOM   2379 C C   . VAL B 1 108 ? 26.925 70.177 -29.609 1.00 25.06 ?  109  VAL B C   1 
ATOM   2380 O O   . VAL B 1 108 ? 26.764 71.398 -29.487 1.00 22.56 ?  109  VAL B O   1 
ATOM   2381 C CB  . VAL B 1 108 ? 26.097 69.701 -31.960 1.00 29.92 ?  109  VAL B CB  1 
ATOM   2382 C CG1 . VAL B 1 108 ? 25.477 71.060 -32.254 1.00 27.26 ?  109  VAL B CG1 1 
ATOM   2383 C CG2 . VAL B 1 108 ? 27.552 69.657 -32.404 1.00 23.46 ?  109  VAL B CG2 1 
ATOM   2384 N N   . ALA B 1 109 ? 27.896 69.508 -28.992 1.00 20.52 ?  110  ALA B N   1 
ATOM   2385 C CA  . ALA B 1 109 ? 28.810 70.136 -28.045 1.00 18.41 ?  110  ALA B CA  1 
ATOM   2386 C C   . ALA B 1 109 ? 30.139 70.404 -28.742 1.00 19.48 ?  110  ALA B C   1 
ATOM   2387 O O   . ALA B 1 109 ? 30.855 69.468 -29.113 1.00 16.07 ?  110  ALA B O   1 
ATOM   2388 C CB  . ALA B 1 109 ? 29.002 69.253 -26.815 1.00 19.49 ?  110  ALA B CB  1 
ATOM   2389 N N   . HIS B 1 110 ? 30.464 71.681 -28.916 1.00 14.36 ?  111  HIS B N   1 
ATOM   2390 C CA  . HIS B 1 110 ? 31.719 72.089 -29.531 1.00 17.20 ?  111  HIS B CA  1 
ATOM   2391 C C   . HIS B 1 110 ? 32.763 72.328 -28.449 1.00 20.15 ?  111  HIS B C   1 
ATOM   2392 O O   . HIS B 1 110 ? 32.493 73.015 -27.459 1.00 16.85 ?  111  HIS B O   1 
ATOM   2393 C CB  . HIS B 1 110 ? 31.519 73.351 -30.368 1.00 14.09 ?  111  HIS B CB  1 
ATOM   2394 C CG  . HIS B 1 110 ? 30.392 73.250 -31.347 1.00 25.07 ?  111  HIS B CG  1 
ATOM   2395 N ND1 . HIS B 1 110 ? 30.465 72.479 -32.487 1.00 19.40 ?  111  HIS B ND1 1 
ATOM   2396 C CD2 . HIS B 1 110 ? 29.161 73.814 -31.352 1.00 22.77 ?  111  HIS B CD2 1 
ATOM   2397 C CE1 . HIS B 1 110 ? 29.329 72.578 -33.155 1.00 30.51 ?  111  HIS B CE1 1 
ATOM   2398 N NE2 . HIS B 1 110 ? 28.521 73.380 -32.487 1.00 25.96 ?  111  HIS B NE2 1 
ATOM   2399 N N   . LEU B 1 111 ? 33.951 71.764 -28.642 1.00 21.12 ?  112  LEU B N   1 
ATOM   2400 C CA  . LEU B 1 111 ? 35.028 71.845 -27.666 1.00 15.14 ?  112  LEU B CA  1 
ATOM   2401 C C   . LEU B 1 111 ? 36.171 72.679 -28.225 1.00 15.77 ?  112  LEU B C   1 
ATOM   2402 O O   . LEU B 1 111 ? 36.631 72.441 -29.346 1.00 17.42 ?  112  LEU B O   1 
ATOM   2403 C CB  . LEU B 1 111 ? 35.532 70.451 -27.287 1.00 11.63 ?  112  LEU B CB  1 
ATOM   2404 C CG  . LEU B 1 111 ? 36.641 70.408 -26.234 1.00 15.66 ?  112  LEU B CG  1 
ATOM   2405 C CD1 . LEU B 1 111 ? 36.131 70.932 -24.898 1.00 11.25 ?  112  LEU B CD1 1 
ATOM   2406 C CD2 . LEU B 1 111 ? 37.186 68.995 -26.087 1.00 13.78 ?  112  LEU B CD2 1 
ATOM   2407 N N   . TYR B 1 112 ? 36.618 73.654 -27.443 1.00 10.46 ?  113  TYR B N   1 
ATOM   2408 C CA  . TYR B 1 112 ? 37.791 74.452 -27.757 1.00 15.15 ?  113  TYR B CA  1 
ATOM   2409 C C   . TYR B 1 112 ? 38.875 74.170 -26.724 1.00 15.61 ?  113  TYR B C   1 
ATOM   2410 O O   . TYR B 1 112 ? 38.584 73.815 -25.579 1.00 13.38 ?  113  TYR B O   1 
ATOM   2411 C CB  . TYR B 1 112 ? 37.458 75.949 -27.775 1.00 15.48 ?  113  TYR B CB  1 
ATOM   2412 C CG  . TYR B 1 112 ? 36.528 76.370 -28.894 1.00 17.85 ?  113  TYR B CG  1 
ATOM   2413 C CD1 . TYR B 1 112 ? 35.192 75.988 -28.898 1.00 14.93 ?  113  TYR B CD1 1 
ATOM   2414 C CD2 . TYR B 1 112 ? 36.984 77.159 -29.942 1.00 25.23 ?  113  TYR B CD2 1 
ATOM   2415 C CE1 . TYR B 1 112 ? 34.340 76.371 -29.916 1.00 19.52 ?  113  TYR B CE1 1 
ATOM   2416 C CE2 . TYR B 1 112 ? 36.139 77.548 -30.966 1.00 22.46 ?  113  TYR B CE2 1 
ATOM   2417 C CZ  . TYR B 1 112 ? 34.819 77.151 -30.946 1.00 29.22 ?  113  TYR B CZ  1 
ATOM   2418 O OH  . TYR B 1 112 ? 33.974 77.536 -31.961 1.00 30.83 ?  113  TYR B OH  1 
ATOM   2419 N N   . ALA B 1 113 ? 40.130 74.316 -27.138 1.00 15.72 ?  114  ALA B N   1 
ATOM   2420 C CA  . ALA B 1 113 ? 41.255 74.086 -26.244 1.00 17.26 ?  114  ALA B CA  1 
ATOM   2421 C C   . ALA B 1 113 ? 42.347 75.102 -26.535 1.00 18.29 ?  114  ALA B C   1 
ATOM   2422 O O   . ALA B 1 113 ? 42.555 75.502 -27.683 1.00 19.77 ?  114  ALA B O   1 
ATOM   2423 C CB  . ALA B 1 113 ? 41.809 72.661 -26.380 1.00 16.31 ?  114  ALA B CB  1 
ATOM   2424 N N   . ARG B 1 114 ? 43.042 75.517 -25.478 1.00 14.44 ?  115  ARG B N   1 
ATOM   2425 C CA  . ARG B 1 114 ? 44.091 76.524 -25.593 1.00 17.07 ?  115  ARG B CA  1 
ATOM   2426 C C   . ARG B 1 114 ? 45.143 76.247 -24.531 1.00 22.23 ?  115  ARG B C   1 
ATOM   2427 O O   . ARG B 1 114 ? 44.838 76.273 -23.334 1.00 17.32 ?  115  ARG B O   1 
ATOM   2428 C CB  . ARG B 1 114 ? 43.516 77.934 -25.436 1.00 19.77 ?  115  ARG B CB  1 
ATOM   2429 C CG  . ARG B 1 114 ? 44.538 78.997 -25.059 1.00 26.42 ?  115  ARG B CG  1 
ATOM   2430 C CD  . ARG B 1 114 ? 45.280 79.512 -26.278 1.00 22.82 ?  115  ARG B CD  1 
ATOM   2431 N NE  . ARG B 1 114 ? 44.395 80.210 -27.207 1.00 29.68 ?  115  ARG B NE  1 
ATOM   2432 C CZ  . ARG B 1 114 ? 44.169 81.520 -27.184 1.00 36.04 ?  115  ARG B CZ  1 
ATOM   2433 N NH1 . ARG B 1 114 ? 44.760 82.283 -26.275 1.00 39.30 ?  115  ARG B NH1 1 
ATOM   2434 N NH2 . ARG B 1 114 ? 43.350 82.067 -28.072 1.00 26.19 ?  115  ARG B NH2 1 
ATOM   2435 N N   . GLN B 1 115 ? 46.370 75.975 -24.967 1.00 18.32 ?  116  GLN B N   1 
ATOM   2436 C CA  . GLN B 1 115 ? 47.466 75.759 -24.034 1.00 15.36 ?  116  GLN B CA  1 
ATOM   2437 C C   . GLN B 1 115 ? 48.023 77.097 -23.570 1.00 19.32 ?  116  GLN B C   1 
ATOM   2438 O O   . GLN B 1 115 ? 48.385 77.949 -24.387 1.00 20.26 ?  116  GLN B O   1 
ATOM   2439 C CB  . GLN B 1 115 ? 48.574 74.924 -24.674 1.00 20.86 ?  116  GLN B CB  1 
ATOM   2440 C CG  . GLN B 1 115 ? 49.802 74.777 -23.786 1.00 19.06 ?  116  GLN B CG  1 
ATOM   2441 C CD  . GLN B 1 115 ? 50.761 73.709 -24.272 1.00 25.71 ?  116  GLN B CD  1 
ATOM   2442 O OE1 . GLN B 1 115 ? 50.541 73.086 -25.311 1.00 32.20 ?  116  GLN B OE1 1 
ATOM   2443 N NE2 . GLN B 1 115 ? 51.833 73.488 -23.518 1.00 26.79 ?  116  GLN B NE2 1 
ATOM   2444 N N   . LEU B 1 116 ? 48.082 77.279 -22.258 1.00 14.36 ?  117  LEU B N   1 
ATOM   2445 C CA  . LEU B 1 116 ? 48.668 78.460 -21.647 1.00 16.23 ?  117  LEU B CA  1 
ATOM   2446 C C   . LEU B 1 116 ? 49.919 78.063 -20.877 1.00 13.85 ?  117  LEU B C   1 
ATOM   2447 O O   . LEU B 1 116 ? 50.219 76.881 -20.694 1.00 12.90 ?  117  LEU B O   1 
ATOM   2448 C CB  . LEU B 1 116 ? 47.665 79.143 -20.710 1.00 16.39 ?  117  LEU B CB  1 
ATOM   2449 C CG  . LEU B 1 116 ? 46.269 79.422 -21.270 1.00 24.87 ?  117  LEU B CG  1 
ATOM   2450 C CD1 . LEU B 1 116 ? 45.291 79.684 -20.138 1.00 18.88 ?  117  LEU B CD1 1 
ATOM   2451 C CD2 . LEU B 1 116 ? 46.302 80.597 -22.233 1.00 18.73 ?  117  LEU B CD2 1 
ATOM   2452 N N   . THR B 1 117 ? 50.662 79.071 -20.434 1.00 16.63 ?  118  THR B N   1 
ATOM   2453 C CA  . THR B 1 117 ? 51.657 78.815 -19.409 1.00 22.44 ?  118  THR B CA  1 
ATOM   2454 C C   . THR B 1 117 ? 50.961 78.675 -18.060 1.00 17.67 ?  118  THR B C   1 
ATOM   2455 O O   . THR B 1 117 ? 49.829 79.130 -17.869 1.00 12.85 ?  118  THR B O   1 
ATOM   2456 C CB  . THR B 1 117 ? 52.697 79.935 -19.358 1.00 20.12 ?  118  THR B CB  1 
ATOM   2457 O OG1 . THR B 1 117 ? 52.117 81.105 -18.767 1.00 20.02 ?  118  THR B OG1 1 
ATOM   2458 C CG2 . THR B 1 117 ? 53.189 80.271 -20.762 1.00 22.05 ?  118  THR B CG2 1 
ATOM   2459 N N   . LEU B 1 118 ? 51.641 78.016 -17.120 1.00 14.33 ?  119  LEU B N   1 
ATOM   2460 C CA  . LEU B 1 118 ? 51.068 77.865 -15.787 1.00 14.31 ?  119  LEU B CA  1 
ATOM   2461 C C   . LEU B 1 118 ? 50.801 79.219 -15.145 1.00 17.54 ?  119  LEU B C   1 
ATOM   2462 O O   . LEU B 1 118 ? 49.828 79.372 -14.397 1.00 16.27 ?  119  LEU B O   1 
ATOM   2463 C CB  . LEU B 1 118 ? 51.991 77.025 -14.904 1.00 18.76 ?  119  LEU B CB  1 
ATOM   2464 C CG  . LEU B 1 118 ? 51.386 76.538 -13.586 1.00 27.05 ?  119  LEU B CG  1 
ATOM   2465 C CD1 . LEU B 1 118 ? 50.107 75.755 -13.838 1.00 16.84 ?  119  LEU B CD1 1 
ATOM   2466 C CD2 . LEU B 1 118 ? 52.389 75.699 -12.808 1.00 18.35 ?  119  LEU B CD2 1 
ATOM   2467 N N   . GLU B 1 119 ? 51.640 80.214 -15.442 1.00 17.01 ?  120  GLU B N   1 
ATOM   2468 C CA  . GLU B 1 119 ? 51.419 81.559 -14.921 1.00 15.69 ?  120  GLU B CA  1 
ATOM   2469 C C   . GLU B 1 119 ? 50.170 82.186 -15.530 1.00 16.22 ?  120  GLU B C   1 
ATOM   2470 O O   . GLU B 1 119 ? 49.382 82.824 -14.823 1.00 14.59 ?  120  GLU B O   1 
ATOM   2471 C CB  . GLU B 1 119 ? 52.647 82.432 -15.188 1.00 23.16 ?  120  GLU B CB  1 
ATOM   2472 C CG  . GLU B 1 119 ? 53.971 81.819 -14.734 1.00 31.90 ?  120  GLU B CG  1 
ATOM   2473 C CD  . GLU B 1 119 ? 54.549 80.834 -15.740 1.00 39.01 ?  120  GLU B CD  1 
ATOM   2474 O OE1 . GLU B 1 119 ? 55.090 81.281 -16.772 1.00 57.73 ?  120  GLU B OE1 1 
ATOM   2475 O OE2 . GLU B 1 119 ? 54.460 79.611 -15.498 1.00 38.55 ?  120  GLU B OE2 1 
ATOM   2476 N N   . GLN B 1 120 ? 49.978 82.020 -16.842 1.00 16.26 ?  121  GLN B N   1 
ATOM   2477 C CA  . GLN B 1 120 ? 48.754 82.500 -17.479 1.00 19.81 ?  121  GLN B CA  1 
ATOM   2478 C C   . GLN B 1 120 ? 47.536 81.760 -16.947 1.00 16.07 ?  121  GLN B C   1 
ATOM   2479 O O   . GLN B 1 120 ? 46.472 82.361 -16.755 1.00 18.44 ?  121  GLN B O   1 
ATOM   2480 C CB  . GLN B 1 120 ? 48.845 82.335 -18.995 1.00 17.51 ?  121  GLN B CB  1 
ATOM   2481 C CG  . GLN B 1 120 ? 49.736 83.341 -19.696 1.00 13.98 ?  121  GLN B CG  1 
ATOM   2482 C CD  . GLN B 1 120 ? 50.004 82.955 -21.137 1.00 20.40 ?  121  GLN B CD  1 
ATOM   2483 O OE1 . GLN B 1 120 ? 50.074 81.772 -21.469 1.00 18.93 ?  121  GLN B OE1 1 
ATOM   2484 N NE2 . GLN B 1 120 ? 50.148 83.951 -22.002 1.00 27.39 ?  121  GLN B NE2 1 
ATOM   2485 N N   . LEU B 1 121 ? 47.670 80.450 -16.721 1.00 13.82 ?  122  LEU B N   1 
ATOM   2486 C CA  . LEU B 1 121 ? 46.572 79.670 -16.162 1.00 15.09 ?  122  LEU B CA  1 
ATOM   2487 C C   . LEU B 1 121 ? 46.176 80.185 -14.784 1.00 18.45 ?  122  LEU B C   1 
ATOM   2488 O O   . LEU B 1 121 ? 44.984 80.310 -14.478 1.00 11.11 ?  122  LEU B O   1 
ATOM   2489 C CB  . LEU B 1 121 ? 46.966 78.195 -16.091 1.00 8.98  ?  122  LEU B CB  1 
ATOM   2490 C CG  . LEU B 1 121 ? 45.845 77.155 -16.097 1.00 20.92 ?  122  LEU B CG  1 
ATOM   2491 C CD1 . LEU B 1 121 ? 45.194 77.075 -17.467 1.00 27.67 ?  122  LEU B CD1 1 
ATOM   2492 C CD2 . LEU B 1 121 ? 46.379 75.794 -15.678 1.00 22.66 ?  122  LEU B CD2 1 
ATOM   2493 N N   . HIS B 1 122 ? 47.164 80.489 -13.940 1.00 10.45 ?  123  HIS B N   1 
ATOM   2494 C CA  . HIS B 1 122 ? 46.863 81.063 -12.633 1.00 14.39 ?  123  HIS B CA  1 
ATOM   2495 C C   . HIS B 1 122 ? 46.215 82.434 -12.771 1.00 15.94 ?  123  HIS B C   1 
ATOM   2496 O O   . HIS B 1 122 ? 45.342 82.798 -11.973 1.00 14.79 ?  123  HIS B O   1 
ATOM   2497 C CB  . HIS B 1 122 ? 48.136 81.157 -11.793 1.00 15.87 ?  123  HIS B CB  1 
ATOM   2498 C CG  . HIS B 1 122 ? 47.889 81.543 -10.368 1.00 19.96 ?  123  HIS B CG  1 
ATOM   2499 N ND1 . HIS B 1 122 ? 48.768 82.320 -9.644  1.00 22.81 ?  123  HIS B ND1 1 
ATOM   2500 C CD2 . HIS B 1 122 ? 46.861 81.259 -9.533  1.00 17.27 ?  123  HIS B CD2 1 
ATOM   2501 C CE1 . HIS B 1 122 ? 48.292 82.497 -8.424  1.00 23.22 ?  123  HIS B CE1 1 
ATOM   2502 N NE2 . HIS B 1 122 ? 47.137 81.864 -8.331  1.00 16.89 ?  123  HIS B NE2 1 
ATOM   2503 N N   . ALA B 1 123 ? 46.631 83.211 -13.775 1.00 15.23 ?  124  ALA B N   1 
ATOM   2504 C CA  . ALA B 1 123 ? 46.009 84.509 -14.014 1.00 12.55 ?  124  ALA B CA  1 
ATOM   2505 C C   . ALA B 1 123 ? 44.535 84.353 -14.367 1.00 15.14 ?  124  ALA B C   1 
ATOM   2506 O O   . ALA B 1 123 ? 43.704 85.184 -13.980 1.00 16.92 ?  124  ALA B O   1 
ATOM   2507 C CB  . ALA B 1 123 ? 46.752 85.255 -15.122 1.00 12.10 ?  124  ALA B CB  1 
ATOM   2508 N N   . VAL B 1 124 ? 44.194 83.294 -15.103 1.00 14.22 ?  125  VAL B N   1 
ATOM   2509 C CA  . VAL B 1 124 ? 42.791 83.011 -15.392 1.00 15.04 ?  125  VAL B CA  1 
ATOM   2510 C C   . VAL B 1 124 ? 42.038 82.706 -14.103 1.00 13.00 ?  125  VAL B C   1 
ATOM   2511 O O   . VAL B 1 124 ? 40.912 83.173 -13.898 1.00 12.50 ?  125  VAL B O   1 
ATOM   2512 C CB  . VAL B 1 124 ? 42.677 81.856 -16.404 1.00 15.30 ?  125  VAL B CB  1 
ATOM   2513 C CG1 . VAL B 1 124 ? 41.231 81.390 -16.530 1.00 10.19 ?  125  VAL B CG1 1 
ATOM   2514 C CG2 . VAL B 1 124 ? 43.228 82.278 -17.758 1.00 13.78 ?  125  VAL B CG2 1 
ATOM   2515 N N   . GLU B 1 125 ? 42.652 81.922 -13.212 1.00 11.03 ?  126  GLU B N   1 
ATOM   2516 C CA  . GLU B 1 125 ? 42.019 81.616 -11.932 1.00 12.07 ?  126  GLU B CA  1 
ATOM   2517 C C   . GLU B 1 125 ? 41.785 82.881 -11.114 1.00 13.87 ?  126  GLU B C   1 
ATOM   2518 O O   . GLU B 1 125 ? 40.719 83.049 -10.509 1.00 12.38 ?  126  GLU B O   1 
ATOM   2519 C CB  . GLU B 1 125 ? 42.877 80.624 -11.148 1.00 11.28 ?  126  GLU B CB  1 
ATOM   2520 C CG  . GLU B 1 125 ? 42.909 79.223 -11.735 1.00 14.07 ?  126  GLU B CG  1 
ATOM   2521 C CD  . GLU B 1 125 ? 43.922 78.331 -11.043 1.00 17.02 ?  126  GLU B CD  1 
ATOM   2522 O OE1 . GLU B 1 125 ? 45.032 78.815 -10.735 1.00 15.01 ?  126  GLU B OE1 1 
ATOM   2523 O OE2 . GLU B 1 125 ? 43.607 77.148 -10.802 1.00 19.88 ?  126  GLU B OE2 1 
ATOM   2524 N N   . ILE B 1 126 ? 42.770 83.781 -11.082 1.00 13.54 ?  127  ILE B N   1 
ATOM   2525 C CA  . ILE B 1 126 ? 42.604 85.040 -10.360 1.00 12.10 ?  127  ILE B CA  1 
ATOM   2526 C C   . ILE B 1 126 ? 41.500 85.875 -10.994 1.00 20.39 ?  127  ILE B C   1 
ATOM   2527 O O   . ILE B 1 126 ? 40.721 86.537 -10.296 1.00 17.93 ?  127  ILE B O   1 
ATOM   2528 C CB  . ILE B 1 126 ? 43.939 85.807 -10.312 1.00 13.86 ?  127  ILE B CB  1 
ATOM   2529 C CG1 . ILE B 1 126 ? 44.998 84.990 -9.571  1.00 13.01 ?  127  ILE B CG1 1 
ATOM   2530 C CG2 . ILE B 1 126 ? 43.756 87.165 -9.650  1.00 17.07 ?  127  ILE B CG2 1 
ATOM   2531 C CD1 . ILE B 1 126 ? 46.403 85.544 -9.707  1.00 12.19 ?  127  ILE B CD1 1 
ATOM   2532 N N   . SER B 1 127 ? 41.409 85.854 -12.325 1.00 19.23 ?  128  SER B N   1 
ATOM   2533 C CA  . SER B 1 127 ? 40.381 86.634 -13.005 1.00 15.00 ?  128  SER B CA  1 
ATOM   2534 C C   . SER B 1 127 ? 38.993 86.048 -12.775 1.00 18.19 ?  128  SER B C   1 
ATOM   2535 O O   . SER B 1 127 ? 38.012 86.792 -12.668 1.00 15.52 ?  128  SER B O   1 
ATOM   2536 C CB  . SER B 1 127 ? 40.689 86.710 -14.502 1.00 21.81 ?  128  SER B CB  1 
ATOM   2537 O OG  . SER B 1 127 ? 39.834 87.629 -15.158 1.00 27.92 ?  128  SER B OG  1 
ATOM   2538 N N   . ALA B 1 128 ? 38.894 84.718 -12.689 1.00 10.22 ?  129  ALA B N   1 
ATOM   2539 C CA  . ALA B 1 128 ? 37.591 84.071 -12.580 1.00 15.15 ?  129  ALA B CA  1 
ATOM   2540 C C   . ALA B 1 128 ? 36.907 84.377 -11.254 1.00 15.54 ?  129  ALA B C   1 
ATOM   2541 O O   . ALA B 1 128 ? 35.678 84.496 -11.209 1.00 15.57 ?  129  ALA B O   1 
ATOM   2542 C CB  . ALA B 1 128 ? 37.740 82.562 -12.763 1.00 10.91 ?  129  ALA B CB  1 
ATOM   2543 N N   A VAL B 1 129 ? 37.681 84.512 -10.173 0.50 13.00 ?  130  VAL B N   1 
ATOM   2544 N N   B VAL B 1 129 ? 37.669 84.494 -10.166 0.50 13.03 ?  130  VAL B N   1 
ATOM   2545 C CA  A VAL B 1 129 ? 37.104 84.817 -8.869  0.50 15.14 ?  130  VAL B CA  1 
ATOM   2546 C CA  B VAL B 1 129 ? 37.056 84.817 -8.884  0.50 15.02 ?  130  VAL B CA  1 
ATOM   2547 C C   A VAL B 1 129 ? 36.607 86.256 -8.799  0.50 16.19 ?  130  VAL B C   1 
ATOM   2548 C C   B VAL B 1 129 ? 36.512 86.238 -8.876  0.50 16.27 ?  130  VAL B C   1 
ATOM   2549 O O   A VAL B 1 129 ? 35.800 86.588 -7.923  0.50 17.36 ?  130  VAL B O   1 
ATOM   2550 O O   B VAL B 1 129 ? 35.567 86.536 -8.136  0.50 17.62 ?  130  VAL B O   1 
ATOM   2551 C CB  A VAL B 1 129 ? 38.128 84.523 -7.754  0.50 18.16 ?  130  VAL B CB  1 
ATOM   2552 C CB  B VAL B 1 129 ? 38.067 84.583 -7.748  0.50 18.18 ?  130  VAL B CB  1 
ATOM   2553 C CG1 A VAL B 1 129 ? 39.155 85.641 -7.651  0.50 12.28 ?  130  VAL B CG1 1 
ATOM   2554 C CG1 B VAL B 1 129 ? 37.428 84.827 -6.387  0.50 18.99 ?  130  VAL B CG1 1 
ATOM   2555 C CG2 A VAL B 1 129 ? 37.425 84.303 -6.420  0.50 18.87 ?  130  VAL B CG2 1 
ATOM   2556 C CG2 B VAL B 1 129 ? 38.590 83.171 -7.830  0.50 14.90 ?  130  VAL B CG2 1 
ATOM   2557 N N   . HIS B 1 130 ? 37.062 87.120 -9.705  1.00 14.51 ?  131  HIS B N   1 
ATOM   2558 C CA  . HIS B 1 130 ? 36.559 88.480 -9.829  1.00 16.89 ?  131  HIS B CA  1 
ATOM   2559 C C   . HIS B 1 130 ? 35.518 88.620 -10.933 1.00 14.17 ?  131  HIS B C   1 
ATOM   2560 O O   . HIS B 1 130 ? 35.067 89.737 -11.203 1.00 18.27 ?  131  HIS B O   1 
ATOM   2561 C CB  . HIS B 1 130 ? 37.713 89.453 -10.100 1.00 14.33 ?  131  HIS B CB  1 
ATOM   2562 C CG  . HIS B 1 130 ? 38.704 89.549 -8.982  1.00 17.81 ?  131  HIS B CG  1 
ATOM   2563 N ND1 . HIS B 1 130 ? 38.445 90.230 -7.812  1.00 20.51 ?  131  HIS B ND1 1 
ATOM   2564 C CD2 . HIS B 1 130 ? 39.961 89.058 -8.861  1.00 20.20 ?  131  HIS B CD2 1 
ATOM   2565 C CE1 . HIS B 1 130 ? 39.496 90.150 -7.016  1.00 20.03 ?  131  HIS B CE1 1 
ATOM   2566 N NE2 . HIS B 1 130 ? 40.429 89.444 -7.628  1.00 21.88 ?  131  HIS B NE2 1 
ATOM   2567 N N   . SER B 1 131 ? 35.126 87.519 -11.572 1.00 14.54 ?  132  SER B N   1 
ATOM   2568 C CA  . SER B 1 131 ? 34.297 87.579 -12.765 1.00 21.07 ?  132  SER B CA  1 
ATOM   2569 C C   . SER B 1 131 ? 32.845 87.893 -12.411 1.00 17.99 ?  132  SER B C   1 
ATOM   2570 O O   . SER B 1 131 ? 32.435 87.873 -11.247 1.00 19.67 ?  132  SER B O   1 
ATOM   2571 C CB  . SER B 1 131 ? 34.381 86.267 -13.542 1.00 17.09 ?  132  SER B CB  1 
ATOM   2572 O OG  . SER B 1 131 ? 33.687 85.232 -12.867 1.00 22.59 ?  132  SER B OG  1 
ATOM   2573 N N   . ARG B 1 132 ? 32.057 88.166 -13.453 1.00 15.49 ?  133  ARG B N   1 
ATOM   2574 C CA  . ARG B 1 132 ? 30.691 88.640 -13.257 1.00 18.83 ?  133  ARG B CA  1 
ATOM   2575 C C   . ARG B 1 132 ? 29.769 87.528 -12.769 1.00 19.09 ?  133  ARG B C   1 
ATOM   2576 O O   . ARG B 1 132 ? 28.858 87.782 -11.972 1.00 14.56 ?  133  ARG B O   1 
ATOM   2577 C CB  . ARG B 1 132 ? 30.159 89.245 -14.556 1.00 19.87 ?  133  ARG B CB  1 
ATOM   2578 C CG  . ARG B 1 132 ? 30.739 90.612 -14.891 1.00 19.46 ?  133  ARG B CG  1 
ATOM   2579 C CD  . ARG B 1 132 ? 30.373 91.035 -16.306 1.00 24.16 ?  133  ARG B CD  1 
ATOM   2580 N NE  . ARG B 1 132 ? 30.852 92.379 -16.624 1.00 21.78 ?  133  ARG B NE  1 
ATOM   2581 C CZ  . ARG B 1 132 ? 31.991 92.636 -17.260 1.00 31.62 ?  133  ARG B CZ  1 
ATOM   2582 N NH1 . ARG B 1 132 ? 32.776 91.641 -17.647 1.00 24.28 ?  133  ARG B NH1 1 
ATOM   2583 N NH2 . ARG B 1 132 ? 32.345 93.889 -17.509 1.00 31.41 ?  133  ARG B NH2 1 
ATOM   2584 N N   . ASP B 1 133 ? 29.972 86.296 -13.234 1.00 16.12 ?  134  ASP B N   1 
ATOM   2585 C CA  . ASP B 1 133 ? 29.077 85.200 -12.882 1.00 18.44 ?  134  ASP B CA  1 
ATOM   2586 C C   . ASP B 1 133 ? 29.605 84.338 -11.742 1.00 12.58 ?  134  ASP B C   1 
ATOM   2587 O O   . ASP B 1 133 ? 29.013 83.294 -11.445 1.00 13.01 ?  134  ASP B O   1 
ATOM   2588 C CB  . ASP B 1 133 ? 28.774 84.334 -14.113 1.00 18.38 ?  134  ASP B CB  1 
ATOM   2589 C CG  . ASP B 1 133 ? 29.969 83.514 -14.587 1.00 30.81 ?  134  ASP B CG  1 
ATOM   2590 O OD1 . ASP B 1 133 ? 31.010 83.463 -13.898 1.00 34.93 ?  134  ASP B OD1 1 
ATOM   2591 O OD2 . ASP B 1 133 ? 29.859 82.902 -15.671 1.00 34.84 ?  134  ASP B OD2 1 
ATOM   2592 N N   . HIS B 1 134 ? 30.709 84.732 -11.113 1.00 16.24 ?  135  HIS B N   1 
ATOM   2593 C CA  . HIS B 1 134 ? 31.215 83.984 -9.971  1.00 17.21 ?  135  HIS B CA  1 
ATOM   2594 C C   . HIS B 1 134 ? 30.229 84.081 -8.814  1.00 18.54 ?  135  HIS B C   1 
ATOM   2595 O O   . HIS B 1 134 ? 29.742 85.167 -8.488  1.00 14.28 ?  135  HIS B O   1 
ATOM   2596 C CB  . HIS B 1 134 ? 32.582 84.508 -9.541  1.00 16.20 ?  135  HIS B CB  1 
ATOM   2597 C CG  . HIS B 1 134 ? 33.048 83.949 -8.233  1.00 16.51 ?  135  HIS B CG  1 
ATOM   2598 N ND1 . HIS B 1 134 ? 33.565 82.678 -8.109  1.00 15.32 ?  135  HIS B ND1 1 
ATOM   2599 C CD2 . HIS B 1 134 ? 33.052 84.481 -6.988  1.00 20.12 ?  135  HIS B CD2 1 
ATOM   2600 C CE1 . HIS B 1 134 ? 33.879 82.454 -6.845  1.00 19.35 ?  135  HIS B CE1 1 
ATOM   2601 N NE2 . HIS B 1 134 ? 33.577 83.533 -6.144  1.00 21.03 ?  135  HIS B NE2 1 
ATOM   2602 N N   . GLY B 1 135 ? 29.941 82.943 -8.190  1.00 12.59 ?  136  GLY B N   1 
ATOM   2603 C CA  . GLY B 1 135 ? 28.891 82.873 -7.201  1.00 12.33 ?  136  GLY B CA  1 
ATOM   2604 C C   . GLY B 1 135 ? 27.492 82.821 -7.774  1.00 18.30 ?  136  GLY B C   1 
ATOM   2605 O O   . GLY B 1 135 ? 26.525 82.787 -7.002  1.00 16.76 ?  136  GLY B O   1 
ATOM   2606 N N   . LEU B 1 136 ? 27.354 82.818 -9.104  1.00 12.76 ?  137  LEU B N   1 
ATOM   2607 C CA  . LEU B 1 136 ? 26.055 82.738 -9.748  1.00 11.45 ?  137  LEU B CA  1 
ATOM   2608 C C   . LEU B 1 136 ? 26.029 81.450 -10.558 1.00 15.36 ?  137  LEU B C   1 
ATOM   2609 O O   . LEU B 1 136 ? 25.779 80.373 -10.000 1.00 12.85 ?  137  LEU B O   1 
ATOM   2610 C CB  . LEU B 1 136 ? 25.792 83.988 -10.595 1.00 19.72 ?  137  LEU B CB  1 
ATOM   2611 C CG  . LEU B 1 136 ? 25.601 85.334 -9.891  1.00 20.43 ?  137  LEU B CG  1 
ATOM   2612 C CD1 . LEU B 1 136 ? 25.648 86.467 -10.901 1.00 17.76 ?  137  LEU B CD1 1 
ATOM   2613 C CD2 . LEU B 1 136 ? 24.292 85.372 -9.142  1.00 22.24 ?  137  LEU B CD2 1 
ATOM   2614 N N   . GLU B 1 137 ? 26.285 81.512 -11.866 1.00 8.92  ?  138  GLU B N   1 
ATOM   2615 C CA  . GLU B 1 137 ? 26.281 80.300 -12.676 1.00 8.74  ?  138  GLU B CA  1 
ATOM   2616 C C   . GLU B 1 137 ? 27.525 79.455 -12.437 1.00 10.88 ?  138  GLU B C   1 
ATOM   2617 O O   . GLU B 1 137 ? 27.493 78.238 -12.649 1.00 12.72 ?  138  GLU B O   1 
ATOM   2618 C CB  . GLU B 1 137 ? 26.165 80.662 -14.158 1.00 13.05 ?  138  GLU B CB  1 
ATOM   2619 C CG  . GLU B 1 137 ? 24.734 80.854 -14.643 1.00 19.45 ?  138  GLU B CG  1 
ATOM   2620 C CD  . GLU B 1 137 ? 24.229 82.274 -14.449 1.00 43.42 ?  138  GLU B CD  1 
ATOM   2621 O OE1 . GLU B 1 137 ? 24.927 83.079 -13.798 1.00 21.90 ?  138  GLU B OE1 1 
ATOM   2622 O OE2 . GLU B 1 137 ? 23.133 82.588 -14.960 1.00 30.90 ?  138  GLU B OE2 1 
ATOM   2623 N N   . VAL B 1 138 ? 28.619 80.072 -12.002 1.00 7.57  ?  139  VAL B N   1 
ATOM   2624 C CA  . VAL B 1 138 ? 29.877 79.380 -11.748 1.00 12.08 ?  139  VAL B CA  1 
ATOM   2625 C C   . VAL B 1 138 ? 30.164 79.469 -10.256 1.00 13.90 ?  139  VAL B C   1 
ATOM   2626 O O   . VAL B 1 138 ? 30.270 80.571 -9.702  1.00 12.32 ?  139  VAL B O   1 
ATOM   2627 C CB  . VAL B 1 138 ? 31.032 79.974 -12.568 1.00 11.59 ?  139  VAL B CB  1 
ATOM   2628 C CG1 . VAL B 1 138 ? 32.341 79.282 -12.218 1.00 9.56  ?  139  VAL B CG1 1 
ATOM   2629 C CG2 . VAL B 1 138 ? 30.736 79.854 -14.055 1.00 19.32 ?  139  VAL B CG2 1 
ATOM   2630 N N   . LEU B 1 139 ? 30.289 78.313 -9.608  1.00 7.46  ?  140  LEU B N   1 
ATOM   2631 C CA  . LEU B 1 139 ? 30.491 78.242 -8.168  1.00 8.71  ?  140  LEU B CA  1 
ATOM   2632 C C   . LEU B 1 139 ? 31.956 78.121 -7.776  1.00 9.92  ?  140  LEU B C   1 
ATOM   2633 O O   . LEU B 1 139 ? 32.262 78.094 -6.580  1.00 13.96 ?  140  LEU B O   1 
ATOM   2634 C CB  . LEU B 1 139 ? 29.697 77.069 -7.584  1.00 11.27 ?  140  LEU B CB  1 
ATOM   2635 C CG  . LEU B 1 139 ? 28.185 77.141 -7.815  1.00 16.12 ?  140  LEU B CG  1 
ATOM   2636 C CD1 . LEU B 1 139 ? 27.465 76.049 -7.046  1.00 13.29 ?  140  LEU B CD1 1 
ATOM   2637 C CD2 . LEU B 1 139 ? 27.649 78.511 -7.431  1.00 18.20 ?  140  LEU B CD2 1 
ATOM   2638 N N   . GLY B 1 140 ? 32.857 78.050 -8.737  1.00 12.08 ?  141  GLY B N   1 
ATOM   2639 C CA  . GLY B 1 140 ? 34.280 77.991 -8.465  1.00 11.42 ?  141  GLY B CA  1 
ATOM   2640 C C   . GLY B 1 140 ? 35.006 77.164 -9.509  1.00 14.33 ?  141  GLY B C   1 
ATOM   2641 O O   . GLY B 1 140 ? 34.461 76.254 -10.125 1.00 14.20 ?  141  GLY B O   1 
ATOM   2642 N N   . LEU B 1 141 ? 36.275 77.499 -9.717  1.00 13.06 ?  142  LEU B N   1 
ATOM   2643 C CA  . LEU B 1 141 ? 37.151 76.777 -10.626 1.00 17.56 ?  142  LEU B CA  1 
ATOM   2644 C C   . LEU B 1 141 ? 37.954 75.736 -9.857  1.00 10.28 ?  142  LEU B C   1 
ATOM   2645 O O   . LEU B 1 141 ? 38.319 75.944 -8.697  1.00 15.79 ?  142  LEU B O   1 
ATOM   2646 C CB  . LEU B 1 141 ? 38.106 77.736 -11.340 1.00 10.76 ?  142  LEU B CB  1 
ATOM   2647 C CG  . LEU B 1 141 ? 37.799 78.124 -12.786 1.00 19.19 ?  142  LEU B CG  1 
ATOM   2648 C CD1 . LEU B 1 141 ? 36.381 78.654 -12.923 1.00 14.94 ?  142  LEU B CD1 1 
ATOM   2649 C CD2 . LEU B 1 141 ? 38.813 79.147 -13.282 1.00 16.93 ?  142  LEU B CD2 1 
ATOM   2650 N N   . VAL B 1 142 ? 38.221 74.606 -10.510 1.00 10.39 ?  143  VAL B N   1 
ATOM   2651 C CA  . VAL B 1 142 ? 39.039 73.550 -9.928  1.00 9.51  ?  143  VAL B CA  1 
ATOM   2652 C C   . VAL B 1 142 ? 40.061 73.090 -10.958 1.00 16.82 ?  143  VAL B C   1 
ATOM   2653 O O   . VAL B 1 142 ? 39.804 73.092 -12.167 1.00 12.65 ?  143  VAL B O   1 
ATOM   2654 C CB  . VAL B 1 142 ? 38.196 72.350 -9.427  1.00 11.45 ?  143  VAL B CB  1 
ATOM   2655 C CG1 . VAL B 1 142 ? 37.144 72.809 -8.428  1.00 14.43 ?  143  VAL B CG1 1 
ATOM   2656 C CG2 . VAL B 1 142 ? 37.544 71.616 -10.591 1.00 19.21 ?  143  VAL B CG2 1 
ATOM   2657 N N   . ARG B 1 143 ? 41.238 72.712 -10.469 1.00 13.25 ?  144  ARG B N   1 
ATOM   2658 C CA  . ARG B 1 143 ? 42.265 72.109 -11.303 1.00 11.54 ?  144  ARG B CA  1 
ATOM   2659 C C   . ARG B 1 143 ? 42.117 70.595 -11.286 1.00 14.78 ?  144  ARG B C   1 
ATOM   2660 O O   . ARG B 1 143 ? 41.897 69.992 -10.232 1.00 17.71 ?  144  ARG B O   1 
ATOM   2661 C CB  . ARG B 1 143 ? 43.663 72.498 -10.819 1.00 13.48 ?  144  ARG B CB  1 
ATOM   2662 C CG  . ARG B 1 143 ? 44.034 73.946 -11.062 1.00 12.55 ?  144  ARG B CG  1 
ATOM   2663 C CD  . ARG B 1 143 ? 45.512 74.174 -10.788 1.00 18.71 ?  144  ARG B CD  1 
ATOM   2664 N NE  . ARG B 1 143 ? 45.874 75.586 -10.869 1.00 16.09 ?  144  ARG B NE  1 
ATOM   2665 C CZ  . ARG B 1 143 ? 47.112 76.046 -10.725 1.00 21.93 ?  144  ARG B CZ  1 
ATOM   2666 N NH1 . ARG B 1 143 ? 48.110 75.205 -10.492 1.00 15.39 ?  144  ARG B NH1 1 
ATOM   2667 N NH2 . ARG B 1 143 ? 47.352 77.347 -10.812 1.00 19.44 ?  144  ARG B NH2 1 
ATOM   2668 N N   . VAL B 1 144 ? 42.238 69.985 -12.460 1.00 11.55 ?  145  VAL B N   1 
ATOM   2669 C CA  . VAL B 1 144 ? 42.138 68.534 -12.576 1.00 10.76 ?  145  VAL B CA  1 
ATOM   2670 C C   . VAL B 1 144 ? 43.456 67.910 -12.134 1.00 9.63  ?  145  VAL B C   1 
ATOM   2671 O O   . VAL B 1 144 ? 44.513 68.239 -12.692 1.00 17.36 ?  145  VAL B O   1 
ATOM   2672 C CB  . VAL B 1 144 ? 41.784 68.107 -14.008 1.00 12.87 ?  145  VAL B CB  1 
ATOM   2673 C CG1 . VAL B 1 144 ? 41.739 66.590 -14.108 1.00 9.95  ?  145  VAL B CG1 1 
ATOM   2674 C CG2 . VAL B 1 144 ? 40.454 68.716 -14.430 1.00 15.04 ?  145  VAL B CG2 1 
ATOM   2675 N N   . PRO B 1 145 ? 43.449 67.027 -11.134 1.00 11.38 ?  146  PRO B N   1 
ATOM   2676 C CA  . PRO B 1 145 ? 44.667 66.274 -10.802 1.00 13.39 ?  146  PRO B CA  1 
ATOM   2677 C C   . PRO B 1 145 ? 44.815 65.098 -11.756 1.00 12.55 ?  146  PRO B C   1 
ATOM   2678 O O   . PRO B 1 145 ? 43.956 64.217 -11.807 1.00 19.81 ?  146  PRO B O   1 
ATOM   2679 C CB  . PRO B 1 145 ? 44.414 65.811 -9.363  1.00 11.30 ?  146  PRO B CB  1 
ATOM   2680 C CG  . PRO B 1 145 ? 42.917 65.693 -9.270  1.00 11.77 ?  146  PRO B CG  1 
ATOM   2681 C CD  . PRO B 1 145 ? 42.324 66.693 -10.242 1.00 9.92  ?  146  PRO B CD  1 
ATOM   2682 N N   . LEU B 1 146 ? 45.895 65.097 -12.532 1.00 17.01 ?  147  LEU B N   1 
ATOM   2683 C CA  . LEU B 1 146 ? 46.111 64.045 -13.516 1.00 18.35 ?  147  LEU B CA  1 
ATOM   2684 C C   . LEU B 1 146 ? 46.960 62.900 -12.985 1.00 22.70 ?  147  LEU B C   1 
ATOM   2685 O O   . LEU B 1 146 ? 47.032 61.848 -13.630 1.00 24.63 ?  147  LEU B O   1 
ATOM   2686 C CB  . LEU B 1 146 ? 46.757 64.628 -14.775 1.00 13.55 ?  147  LEU B CB  1 
ATOM   2687 C CG  . LEU B 1 146 ? 45.882 65.639 -15.514 1.00 21.87 ?  147  LEU B CG  1 
ATOM   2688 C CD1 . LEU B 1 146 ? 46.604 66.179 -16.733 1.00 22.92 ?  147  LEU B CD1 1 
ATOM   2689 C CD2 . LEU B 1 146 ? 44.559 65.002 -15.908 1.00 14.82 ?  147  LEU B CD2 1 
ATOM   2690 N N   . TYR B 1 147 ? 47.591 63.078 -11.830 1.00 20.70 ?  148  TYR B N   1 
ATOM   2691 C CA  . TYR B 1 147 ? 48.389 62.041 -11.202 1.00 21.29 ?  148  TYR B CA  1 
ATOM   2692 C C   . TYR B 1 147 ? 47.491 61.039 -10.479 1.00 20.17 ?  148  TYR B C   1 
ATOM   2693 O O   . TYR B 1 147 ? 46.292 61.257 -10.287 1.00 17.69 ?  148  TYR B O   1 
ATOM   2694 C CB  . TYR B 1 147 ? 49.377 62.665 -10.222 1.00 16.01 ?  148  TYR B CB  1 
ATOM   2695 C CG  . TYR B 1 147 ? 48.724 63.665 -9.293  1.00 14.06 ?  148  TYR B CG  1 
ATOM   2696 C CD1 . TYR B 1 147 ? 48.069 63.249 -8.141  1.00 15.33 ?  148  TYR B CD1 1 
ATOM   2697 C CD2 . TYR B 1 147 ? 48.738 65.023 -9.584  1.00 17.64 ?  148  TYR B CD2 1 
ATOM   2698 C CE1 . TYR B 1 147 ? 47.457 64.159 -7.297  1.00 16.15 ?  148  TYR B CE1 1 
ATOM   2699 C CE2 . TYR B 1 147 ? 48.129 65.940 -8.747  1.00 21.35 ?  148  TYR B CE2 1 
ATOM   2700 C CZ  . TYR B 1 147 ? 47.491 65.503 -7.605  1.00 15.00 ?  148  TYR B CZ  1 
ATOM   2701 O OH  . TYR B 1 147 ? 46.884 66.413 -6.769  1.00 14.82 ?  148  TYR B OH  1 
ATOM   2702 N N   . THR B 1 148 ? 48.094 59.928 -10.068 1.00 17.71 ?  149  THR B N   1 
ATOM   2703 C CA  . THR B 1 148 ? 47.427 58.931 -9.242  1.00 17.15 ?  149  THR B CA  1 
ATOM   2704 C C   . THR B 1 148 ? 48.350 58.565 -8.091  1.00 26.10 ?  149  THR B C   1 
ATOM   2705 O O   . THR B 1 148 ? 49.528 58.265 -8.308  1.00 18.01 ?  149  THR B O   1 
ATOM   2706 C CB  . THR B 1 148 ? 47.056 57.682 -10.051 1.00 28.23 ?  149  THR B CB  1 
ATOM   2707 O OG1 . THR B 1 148 ? 46.182 58.050 -11.124 1.00 21.27 ?  149  THR B OG1 1 
ATOM   2708 C CG2 . THR B 1 148 ? 46.351 56.668 -9.165  1.00 23.74 ?  149  THR B CG2 1 
ATOM   2709 N N   . GLN B 1 149 ? 47.817 58.596 -6.873  1.00 22.01 ?  150  GLN B N   1 
ATOM   2710 C CA  . GLN B 1 149 ? 48.624 58.343 -5.690  1.00 26.04 ?  150  GLN B CA  1 
ATOM   2711 C C   . GLN B 1 149 ? 48.918 56.850 -5.550  1.00 28.67 ?  150  GLN B C   1 
ATOM   2712 O O   . GLN B 1 149 ? 48.431 56.013 -6.314  1.00 26.01 ?  150  GLN B O   1 
ATOM   2713 C CB  . GLN B 1 149 ? 47.928 58.888 -4.445  1.00 19.71 ?  150  GLN B CB  1 
ATOM   2714 C CG  . GLN B 1 149 ? 47.978 60.404 -4.333  1.00 27.01 ?  150  GLN B CG  1 
ATOM   2715 C CD  . GLN B 1 149 ? 47.268 60.919 -3.098  1.00 33.90 ?  150  GLN B CD  1 
ATOM   2716 O OE1 . GLN B 1 149 ? 46.067 61.184 -3.123  1.00 30.07 ?  150  GLN B OE1 1 
ATOM   2717 N NE2 . GLN B 1 149 ? 48.011 61.063 -2.007  1.00 42.87 ?  150  GLN B NE2 1 
ATOM   2718 N N   . LYS B 1 150 ? 49.732 56.518 -4.543  1.00 25.11 ?  151  LYS B N   1 
ATOM   2719 C CA  . LYS B 1 150 ? 50.166 55.139 -4.344  1.00 31.90 ?  151  LYS B CA  1 
ATOM   2720 C C   . LYS B 1 150 ? 48.991 54.207 -4.066  1.00 27.32 ?  151  LYS B C   1 
ATOM   2721 O O   . LYS B 1 150 ? 49.047 53.020 -4.410  1.00 32.58 ?  151  LYS B O   1 
ATOM   2722 C CB  . LYS B 1 150 ? 51.194 55.086 -3.210  1.00 38.79 ?  151  LYS B CB  1 
ATOM   2723 C CG  . LYS B 1 150 ? 51.122 53.862 -2.310  1.00 44.77 ?  151  LYS B CG  1 
ATOM   2724 C CD  . LYS B 1 150 ? 52.293 53.833 -1.340  1.00 58.11 ?  151  LYS B CD  1 
ATOM   2725 C CE  . LYS B 1 150 ? 51.856 53.364 0.038   1.00 60.32 ?  151  LYS B CE  1 
ATOM   2726 N NZ  . LYS B 1 150 ? 51.352 54.492 0.870   1.00 64.10 ?  151  LYS B NZ  1 
ATOM   2727 N N   . ASP B 1 151 ? 47.916 54.721 -3.469  1.00 27.79 ?  152  ASP B N   1 
ATOM   2728 C CA  . ASP B 1 151 ? 46.747 53.902 -3.173  1.00 21.32 ?  152  ASP B CA  1 
ATOM   2729 C C   . ASP B 1 151 ? 45.862 53.656 -4.390  1.00 25.56 ?  152  ASP B C   1 
ATOM   2730 O O   . ASP B 1 151 ? 44.801 53.038 -4.246  1.00 33.45 ?  152  ASP B O   1 
ATOM   2731 C CB  . ASP B 1 151 ? 45.928 54.541 -2.046  1.00 28.77 ?  152  ASP B CB  1 
ATOM   2732 C CG  . ASP B 1 151 ? 45.230 55.819 -2.475  1.00 34.57 ?  152  ASP B CG  1 
ATOM   2733 O OD1 . ASP B 1 151 ? 45.666 56.447 -3.464  1.00 26.47 ?  152  ASP B OD1 1 
ATOM   2734 O OD2 . ASP B 1 151 ? 44.247 56.203 -1.807  1.00 37.92 ?  152  ASP B OD2 1 
ATOM   2735 N N   . ARG B 1 152 ? 46.263 54.134 -5.569  1.00 26.18 ?  153  ARG B N   1 
ATOM   2736 C CA  . ARG B 1 152 ? 45.636 53.864 -6.862  1.00 28.17 ?  153  ARG B CA  1 
ATOM   2737 C C   . ARG B 1 152 ? 44.258 54.496 -7.027  1.00 32.80 ?  153  ARG B C   1 
ATOM   2738 O O   . ARG B 1 152 ? 43.559 54.178 -7.999  1.00 24.66 ?  153  ARG B O   1 
ATOM   2739 C CB  . ARG B 1 152 ? 45.530 52.359 -7.139  1.00 31.99 ?  153  ARG B CB  1 
ATOM   2740 C CG  . ARG B 1 152 ? 46.861 51.625 -7.106  1.00 31.70 ?  153  ARG B CG  1 
ATOM   2741 C CD  . ARG B 1 152 ? 46.692 50.160 -7.480  1.00 59.44 ?  153  ARG B CD  1 
ATOM   2742 N NE  . ARG B 1 152 ? 46.449 49.979 -8.908  1.00 72.62 ?  153  ARG B NE  1 
ATOM   2743 C CZ  . ARG B 1 152 ? 47.408 49.900 -9.825  1.00 76.24 ?  153  ARG B CZ  1 
ATOM   2744 N NH1 . ARG B 1 152 ? 48.682 49.987 -9.465  1.00 69.69 ?  153  ARG B NH1 1 
ATOM   2745 N NH2 . ARG B 1 152 ? 47.095 49.733 -11.103 1.00 69.02 ?  153  ARG B NH2 1 
ATOM   2746 N N   . VAL B 1 153 ? 43.838 55.380 -6.122  1.00 22.54 ?  154  VAL B N   1 
ATOM   2747 C CA  . VAL B 1 153 ? 42.563 56.073 -6.293  1.00 22.20 ?  154  VAL B CA  1 
ATOM   2748 C C   . VAL B 1 153 ? 42.751 57.569 -6.075  1.00 25.95 ?  154  VAL B C   1 
ATOM   2749 O O   . VAL B 1 153 ? 42.043 58.386 -6.675  1.00 18.33 ?  154  VAL B O   1 
ATOM   2750 C CB  . VAL B 1 153 ? 41.476 55.512 -5.354  1.00 27.08 ?  154  VAL B CB  1 
ATOM   2751 C CG1 . VAL B 1 153 ? 41.119 54.083 -5.738  1.00 31.74 ?  154  VAL B CG1 1 
ATOM   2752 C CG2 . VAL B 1 153 ? 41.925 55.581 -3.905  1.00 36.58 ?  154  VAL B CG2 1 
ATOM   2753 N N   . GLY B 1 154 ? 43.705 57.938 -5.223  1.00 17.44 ?  155  GLY B N   1 
ATOM   2754 C CA  . GLY B 1 154 ? 43.957 59.335 -4.933  1.00 19.22 ?  155  GLY B CA  1 
ATOM   2755 C C   . GLY B 1 154 ? 44.381 60.124 -6.154  1.00 22.71 ?  155  GLY B C   1 
ATOM   2756 O O   . GLY B 1 154 ? 45.288 59.712 -6.883  1.00 16.49 ?  155  GLY B O   1 
ATOM   2757 N N   . GLY B 1 155 ? 43.726 61.257 -6.393  1.00 11.15 ?  156  GLY B N   1 
ATOM   2758 C CA  . GLY B 1 155 ? 44.040 62.075 -7.546  1.00 8.39  ?  156  GLY B CA  1 
ATOM   2759 C C   . GLY B 1 155 ? 43.061 61.910 -8.691  1.00 14.57 ?  156  GLY B C   1 
ATOM   2760 O O   . GLY B 1 155 ? 41.859 62.136 -8.524  1.00 11.04 ?  156  GLY B O   1 
ATOM   2761 N N   . PHE B 1 156 ? 43.568 61.505 -9.856  1.00 15.66 ?  157  PHE B N   1 
ATOM   2762 C CA  . PHE B 1 156 ? 42.726 61.427 -11.048 1.00 10.27 ?  157  PHE B CA  1 
ATOM   2763 C C   . PHE B 1 156 ? 41.567 60.442 -10.928 1.00 9.00  ?  157  PHE B C   1 
ATOM   2764 O O   . PHE B 1 156 ? 40.453 60.802 -11.348 1.00 10.85 ?  157  PHE B O   1 
ATOM   2765 C CB  . PHE B 1 156 ? 43.596 61.099 -12.269 1.00 12.36 ?  157  PHE B CB  1 
ATOM   2766 C CG  . PHE B 1 156 ? 42.911 61.339 -13.587 1.00 15.48 ?  157  PHE B CG  1 
ATOM   2767 C CD1 . PHE B 1 156 ? 42.139 62.471 -13.788 1.00 11.85 ?  157  PHE B CD1 1 
ATOM   2768 C CD2 . PHE B 1 156 ? 43.047 60.434 -14.626 1.00 14.87 ?  157  PHE B CD2 1 
ATOM   2769 C CE1 . PHE B 1 156 ? 41.511 62.693 -14.998 1.00 13.20 ?  157  PHE B CE1 1 
ATOM   2770 C CE2 . PHE B 1 156 ? 42.422 60.650 -15.839 1.00 14.91 ?  157  PHE B CE2 1 
ATOM   2771 C CZ  . PHE B 1 156 ? 41.653 61.781 -16.025 1.00 16.88 ?  157  PHE B CZ  1 
ATOM   2772 N N   . PRO B 1 157 ? 41.734 59.219 -10.402 1.00 11.75 ?  158  PRO B N   1 
ATOM   2773 C CA  . PRO B 1 157 ? 40.560 58.334 -10.281 1.00 9.33  ?  158  PRO B CA  1 
ATOM   2774 C C   . PRO B 1 157 ? 39.488 58.878 -9.352  1.00 13.09 ?  158  PRO B C   1 
ATOM   2775 O O   . PRO B 1 157 ? 38.298 58.816 -9.686  1.00 11.34 ?  158  PRO B O   1 
ATOM   2776 C CB  . PRO B 1 157 ? 41.160 57.021 -9.755  1.00 12.98 ?  158  PRO B CB  1 
ATOM   2777 C CG  . PRO B 1 157 ? 42.597 57.076 -10.142 1.00 13.93 ?  158  PRO B CG  1 
ATOM   2778 C CD  . PRO B 1 157 ? 42.976 58.519 -10.026 1.00 12.68 ?  158  PRO B CD  1 
ATOM   2779 N N   . ASN B 1 158 ? 39.874 59.404 -8.185  1.00 12.61 ?  159  ASN B N   1 
ATOM   2780 C CA  . ASN B 1 158 ? 38.900 60.049 -7.309  1.00 11.63 ?  159  ASN B CA  1 
ATOM   2781 C C   . ASN B 1 158 ? 38.193 61.192 -8.023  1.00 8.99  ?  159  ASN B C   1 
ATOM   2782 O O   . ASN B 1 158 ? 36.968 61.337 -7.920  1.00 11.75 ?  159  ASN B O   1 
ATOM   2783 C CB  . ASN B 1 158 ? 39.583 60.568 -6.045  1.00 11.89 ?  159  ASN B CB  1 
ATOM   2784 C CG  . ASN B 1 158 ? 39.729 59.508 -4.973  1.00 18.50 ?  159  ASN B CG  1 
ATOM   2785 O OD1 . ASN B 1 158 ? 39.054 58.483 -5.000  1.00 15.27 ?  159  ASN B OD1 1 
ATOM   2786 N ND2 . ASN B 1 158 ? 40.609 59.761 -4.012  1.00 16.70 ?  159  ASN B ND2 1 
ATOM   2787 N N   . PHE B 1 159 ? 38.951 62.016 -8.751  1.00 6.81  ?  160  PHE B N   1 
ATOM   2788 C CA  . PHE B 1 159 ? 38.354 63.133 -9.478  1.00 11.33 ?  160  PHE B CA  1 
ATOM   2789 C C   . PHE B 1 159 ? 37.308 62.651 -10.475 1.00 17.34 ?  160  PHE B C   1 
ATOM   2790 O O   . PHE B 1 159 ? 36.230 63.246 -10.589 1.00 7.89  ?  160  PHE B O   1 
ATOM   2791 C CB  . PHE B 1 159 ? 39.443 63.935 -10.189 1.00 9.54  ?  160  PHE B CB  1 
ATOM   2792 C CG  . PHE B 1 159 ? 38.929 65.146 -10.915 1.00 17.59 ?  160  PHE B CG  1 
ATOM   2793 C CD1 . PHE B 1 159 ? 38.665 66.321 -10.230 1.00 13.32 ?  160  PHE B CD1 1 
ATOM   2794 C CD2 . PHE B 1 159 ? 38.707 65.108 -12.283 1.00 10.86 ?  160  PHE B CD2 1 
ATOM   2795 C CE1 . PHE B 1 159 ? 38.190 67.435 -10.895 1.00 12.70 ?  160  PHE B CE1 1 
ATOM   2796 C CE2 . PHE B 1 159 ? 38.230 66.219 -12.954 1.00 15.76 ?  160  PHE B CE2 1 
ATOM   2797 C CZ  . PHE B 1 159 ? 37.973 67.384 -12.259 1.00 10.39 ?  160  PHE B CZ  1 
ATOM   2798 N N   . LEU B 1 160 ? 37.603 61.567 -11.200 1.00 9.01  ?  161  LEU B N   1 
ATOM   2799 C CA  . LEU B 1 160 ? 36.656 61.036 -12.174 1.00 10.55 ?  161  LEU B CA  1 
ATOM   2800 C C   . LEU B 1 160 ? 35.404 60.467 -11.522 1.00 11.88 ?  161  LEU B C   1 
ATOM   2801 O O   . LEU B 1 160 ? 34.399 60.268 -12.214 1.00 13.34 ?  161  LEU B O   1 
ATOM   2802 C CB  . LEU B 1 160 ? 37.323 59.956 -13.031 1.00 6.21  ?  161  LEU B CB  1 
ATOM   2803 C CG  . LEU B 1 160 ? 38.354 60.430 -14.056 1.00 13.09 ?  161  LEU B CG  1 
ATOM   2804 C CD1 . LEU B 1 160 ? 39.033 59.241 -14.721 1.00 16.83 ?  161  LEU B CD1 1 
ATOM   2805 C CD2 . LEU B 1 160 ? 37.705 61.331 -15.095 1.00 10.69 ?  161  LEU B CD2 1 
ATOM   2806 N N   . SER B 1 161 ? 35.438 60.197 -10.218 1.00 9.30  ?  162  SER B N   1 
ATOM   2807 C CA  . SER B 1 161 ? 34.257 59.712 -9.515  1.00 12.89 ?  162  SER B CA  1 
ATOM   2808 C C   . SER B 1 161 ? 33.326 60.835 -9.078  1.00 13.46 ?  162  SER B C   1 
ATOM   2809 O O   . SER B 1 161 ? 32.291 60.555 -8.465  1.00 10.68 ?  162  SER B O   1 
ATOM   2810 C CB  . SER B 1 161 ? 34.668 58.879 -8.296  1.00 14.09 ?  162  SER B CB  1 
ATOM   2811 O OG  . SER B 1 161 ? 35.315 59.676 -7.321  1.00 17.03 ?  162  SER B OG  1 
ATOM   2812 N N   . ASN B 1 162 ? 33.663 62.089 -9.373  1.00 14.83 ?  163  ASN B N   1 
ATOM   2813 C CA  . ASN B 1 162 ? 32.767 63.196 -9.083  1.00 9.92  ?  163  ASN B CA  1 
ATOM   2814 C C   . ASN B 1 162 ? 31.591 63.187 -10.060 1.00 18.65 ?  163  ASN B C   1 
ATOM   2815 O O   . ASN B 1 162 ? 31.490 62.342 -10.954 1.00 12.58 ?  163  ASN B O   1 
ATOM   2816 C CB  . ASN B 1 162 ? 33.523 64.521 -9.144  1.00 6.99  ?  163  ASN B CB  1 
ATOM   2817 C CG  . ASN B 1 162 ? 34.378 64.763 -7.913  1.00 10.84 ?  163  ASN B CG  1 
ATOM   2818 O OD1 . ASN B 1 162 ? 33.860 64.964 -6.814  1.00 16.47 ?  163  ASN B OD1 1 
ATOM   2819 N ND2 . ASN B 1 162 ? 35.694 64.752 -8.093  1.00 9.08  ?  163  ASN B ND2 1 
ATOM   2820 N N   . ALA B 1 163 ? 30.686 64.147 -9.886  1.00 12.03 ?  164  ALA B N   1 
ATOM   2821 C CA  . ALA B 1 163 ? 29.500 64.268 -10.724 1.00 11.98 ?  164  ALA B CA  1 
ATOM   2822 C C   . ALA B 1 163 ? 29.766 65.288 -11.825 1.00 11.02 ?  164  ALA B C   1 
ATOM   2823 O O   . ALA B 1 163 ? 29.958 66.477 -11.546 1.00 11.51 ?  164  ALA B O   1 
ATOM   2824 C CB  . ALA B 1 163 ? 28.284 64.673 -9.893  1.00 13.87 ?  164  ALA B CB  1 
ATOM   2825 N N   . PHE B 1 164 ? 29.777 64.821 -13.067 1.00 7.36  ?  165  PHE B N   1 
ATOM   2826 C CA  . PHE B 1 164 ? 29.995 65.663 -14.231 1.00 6.19  ?  165  PHE B CA  1 
ATOM   2827 C C   . PHE B 1 164 ? 28.708 65.775 -15.034 1.00 12.62 ?  165  PHE B C   1 
ATOM   2828 O O   . PHE B 1 164 ? 27.830 64.911 -14.966 1.00 12.65 ?  165  PHE B O   1 
ATOM   2829 C CB  . PHE B 1 164 ? 31.093 65.091 -15.139 1.00 8.80  ?  165  PHE B CB  1 
ATOM   2830 C CG  . PHE B 1 164 ? 32.436 64.953 -14.478 1.00 10.63 ?  165  PHE B CG  1 
ATOM   2831 C CD1 . PHE B 1 164 ? 32.680 63.933 -13.573 1.00 10.51 ?  165  PHE B CD1 1 
ATOM   2832 C CD2 . PHE B 1 164 ? 33.464 65.828 -14.787 1.00 6.12  ?  165  PHE B CD2 1 
ATOM   2833 C CE1 . PHE B 1 164 ? 33.921 63.800 -12.971 1.00 10.13 ?  165  PHE B CE1 1 
ATOM   2834 C CE2 . PHE B 1 164 ? 34.705 65.702 -14.190 1.00 7.41  ?  165  PHE B CE2 1 
ATOM   2835 C CZ  . PHE B 1 164 ? 34.933 64.685 -13.280 1.00 11.07 ?  165  PHE B CZ  1 
ATOM   2836 N N   . VAL B 1 165 ? 28.598 66.854 -15.807 1.00 11.45 ?  166  VAL B N   1 
ATOM   2837 C CA  . VAL B 1 165 ? 27.717 66.805 -16.963 1.00 26.44 ?  166  VAL B CA  1 
ATOM   2838 C C   . VAL B 1 165 ? 28.334 65.822 -17.947 1.00 22.61 ?  166  VAL B C   1 
ATOM   2839 O O   . VAL B 1 165 ? 29.526 65.914 -18.268 1.00 21.38 ?  166  VAL B O   1 
ATOM   2840 C CB  . VAL B 1 165 ? 27.513 68.204 -17.573 1.00 32.85 ?  166  VAL B CB  1 
ATOM   2841 C CG1 . VAL B 1 165 ? 28.439 69.219 -16.930 1.00 28.31 ?  166  VAL B CG1 1 
ATOM   2842 C CG2 . VAL B 1 165 ? 27.672 68.188 -19.094 1.00 30.98 ?  166  VAL B CG2 1 
ATOM   2843 N N   . SER B 1 166 ? 27.542 64.834 -18.373 1.00 30.84 ?  167  SER B N   1 
ATOM   2844 C CA  . SER B 1 166 ? 28.106 63.664 -19.045 1.00 30.84 ?  167  SER B CA  1 
ATOM   2845 C C   . SER B 1 166 ? 28.929 64.055 -20.265 1.00 26.80 ?  167  SER B C   1 
ATOM   2846 O O   . SER B 1 166 ? 29.943 63.414 -20.569 1.00 28.93 ?  167  SER B O   1 
ATOM   2847 C CB  . SER B 1 166 ? 26.988 62.699 -19.437 1.00 34.32 ?  167  SER B CB  1 
ATOM   2848 O OG  . SER B 1 166 ? 26.106 63.294 -20.371 1.00 36.02 ?  167  SER B OG  1 
ATOM   2849 N N   . THR B 1 167 ? 28.518 65.111 -20.968 1.00 12.08 ?  168  THR B N   1 
ATOM   2850 C CA  . THR B 1 167 ? 29.289 65.585 -22.111 1.00 13.03 ?  168  THR B CA  1 
ATOM   2851 C C   . THR B 1 167 ? 30.682 66.042 -21.688 1.00 21.60 ?  168  THR B C   1 
ATOM   2852 O O   . THR B 1 167 ? 31.667 65.792 -22.392 1.00 12.55 ?  168  THR B O   1 
ATOM   2853 C CB  . THR B 1 167 ? 28.533 66.718 -22.806 1.00 25.49 ?  168  THR B CB  1 
ATOM   2854 O OG1 . THR B 1 167 ? 27.397 66.181 -23.497 1.00 26.05 ?  168  THR B OG1 1 
ATOM   2855 C CG2 . THR B 1 167 ? 29.429 67.438 -23.792 1.00 23.43 ?  168  THR B CG2 1 
ATOM   2856 N N   . ALA B 1 168 ? 30.783 66.699 -20.528 1.00 19.33 ?  169  ALA B N   1 
ATOM   2857 C CA  . ALA B 1 168 ? 32.065 67.245 -20.090 1.00 12.34 ?  169  ALA B CA  1 
ATOM   2858 C C   . ALA B 1 168 ? 33.062 66.142 -19.757 1.00 11.67 ?  169  ALA B C   1 
ATOM   2859 O O   . ALA B 1 168 ? 34.258 66.274 -20.040 1.00 14.82 ?  169  ALA B O   1 
ATOM   2860 C CB  . ALA B 1 168 ? 31.861 68.162 -18.885 1.00 12.89 ?  169  ALA B CB  1 
ATOM   2861 N N   . LYS B 1 169 ? 32.593 65.053 -19.142 1.00 12.70 ?  170  LYS B N   1 
ATOM   2862 C CA  . LYS B 1 169 ? 33.486 63.940 -18.832 1.00 15.21 ?  170  LYS B CA  1 
ATOM   2863 C C   . LYS B 1 169 ? 34.031 63.304 -20.104 1.00 18.37 ?  170  LYS B C   1 
ATOM   2864 O O   . LYS B 1 169 ? 35.214 62.949 -20.173 1.00 12.50 ?  170  LYS B O   1 
ATOM   2865 C CB  . LYS B 1 169 ? 32.756 62.901 -17.982 1.00 13.74 ?  170  LYS B CB  1 
ATOM   2866 C CG  . LYS B 1 169 ? 33.674 61.942 -17.242 1.00 22.98 ?  170  LYS B CG  1 
ATOM   2867 C CD  . LYS B 1 169 ? 32.879 60.837 -16.568 1.00 23.42 ?  170  LYS B CD  1 
ATOM   2868 C CE  . LYS B 1 169 ? 33.638 60.248 -15.390 1.00 24.10 ?  170  LYS B CE  1 
ATOM   2869 N NZ  . LYS B 1 169 ? 32.947 59.058 -14.821 1.00 22.53 ?  170  LYS B NZ  1 
ATOM   2870 N N   . CYS B 1 170 ? 33.182 63.154 -21.123 1.00 11.52 ?  171  CYS B N   1 
ATOM   2871 C CA  . CYS B 1 170 ? 33.643 62.611 -22.396 1.00 21.92 ?  171  CYS B CA  1 
ATOM   2872 C C   . CYS B 1 170 ? 34.623 63.558 -23.078 1.00 15.47 ?  171  CYS B C   1 
ATOM   2873 O O   . CYS B 1 170 ? 35.619 63.115 -23.660 1.00 15.97 ?  171  CYS B O   1 
ATOM   2874 C CB  . CYS B 1 170 ? 32.451 62.328 -23.310 1.00 22.07 ?  171  CYS B CB  1 
ATOM   2875 S SG  . CYS B 1 170 ? 31.276 61.120 -22.657 1.00 35.88 ?  171  CYS B SG  1 
ATOM   2876 N N   . GLN B 1 171 ? 34.358 64.866 -23.012 1.00 10.51 ?  172  GLN B N   1 
ATOM   2877 C CA  . GLN B 1 171 ? 35.244 65.835 -23.651 1.00 6.80  ?  172  GLN B CA  1 
ATOM   2878 C C   . GLN B 1 171 ? 36.596 65.894 -22.954 1.00 15.66 ?  172  GLN B C   1 
ATOM   2879 O O   . GLN B 1 171 ? 37.629 66.083 -23.608 1.00 11.19 ?  172  GLN B O   1 
ATOM   2880 C CB  . GLN B 1 171 ? 34.593 67.218 -23.663 1.00 16.85 ?  172  GLN B CB  1 
ATOM   2881 C CG  . GLN B 1 171 ? 33.444 67.366 -24.646 1.00 16.12 ?  172  GLN B CG  1 
ATOM   2882 C CD  . GLN B 1 171 ? 32.742 68.703 -24.509 1.00 24.55 ?  172  GLN B CD  1 
ATOM   2883 O OE1 . GLN B 1 171 ? 32.479 69.169 -23.398 1.00 24.51 ?  172  GLN B OE1 1 
ATOM   2884 N NE2 . GLN B 1 171 ? 32.430 69.326 -25.638 1.00 17.25 ?  172  GLN B NE2 1 
ATOM   2885 N N   . LEU B 1 172 ? 36.609 65.753 -21.627 1.00 13.13 ?  173  LEU B N   1 
ATOM   2886 C CA  . LEU B 1 172 ? 37.872 65.750 -20.896 1.00 13.43 ?  173  LEU B CA  1 
ATOM   2887 C C   . LEU B 1 172 ? 38.731 64.559 -21.300 1.00 9.89  ?  173  LEU B C   1 
ATOM   2888 O O   . LEU B 1 172 ? 39.912 64.712 -21.631 1.00 14.77 ?  173  LEU B O   1 
ATOM   2889 C CB  . LEU B 1 172 ? 37.608 65.733 -19.390 1.00 12.26 ?  173  LEU B CB  1 
ATOM   2890 C CG  . LEU B 1 172 ? 38.829 65.459 -18.509 1.00 10.59 ?  173  LEU B CG  1 
ATOM   2891 C CD1 . LEU B 1 172 ? 39.794 66.636 -18.546 1.00 12.38 ?  173  LEU B CD1 1 
ATOM   2892 C CD2 . LEU B 1 172 ? 38.412 65.140 -17.078 1.00 9.18  ?  173  LEU B CD2 1 
ATOM   2893 N N   . LEU B 1 173 ? 38.148 63.358 -21.275 1.00 7.64  ?  174  LEU B N   1 
ATOM   2894 C CA  . LEU B 1 173 ? 38.894 62.161 -21.647 1.00 15.92 ?  174  LEU B CA  1 
ATOM   2895 C C   . LEU B 1 173 ? 39.338 62.218 -23.103 1.00 20.53 ?  174  LEU B C   1 
ATOM   2896 O O   . LEU B 1 173 ? 40.467 61.835 -23.432 1.00 13.04 ?  174  LEU B O   1 
ATOM   2897 C CB  . LEU B 1 173 ? 38.040 60.921 -21.388 1.00 13.70 ?  174  LEU B CB  1 
ATOM   2898 C CG  . LEU B 1 173 ? 37.624 60.723 -19.929 1.00 16.16 ?  174  LEU B CG  1 
ATOM   2899 C CD1 . LEU B 1 173 ? 36.538 59.668 -19.816 1.00 23.85 ?  174  LEU B CD1 1 
ATOM   2900 C CD2 . LEU B 1 173 ? 38.828 60.354 -19.075 1.00 16.10 ?  174  LEU B CD2 1 
ATOM   2901 N N   . PHE B 1 174 ? 38.463 62.699 -23.988 1.00 18.51 ?  175  PHE B N   1 
ATOM   2902 C CA  . PHE B 1 174 ? 38.826 62.843 -25.393 1.00 13.66 ?  175  PHE B CA  1 
ATOM   2903 C C   . PHE B 1 174 ? 40.004 63.795 -25.560 1.00 14.48 ?  175  PHE B C   1 
ATOM   2904 O O   . PHE B 1 174 ? 40.952 63.507 -26.299 1.00 16.67 ?  175  PHE B O   1 
ATOM   2905 C CB  . PHE B 1 174 ? 37.620 63.334 -26.196 1.00 18.35 ?  175  PHE B CB  1 
ATOM   2906 C CG  . PHE B 1 174 ? 37.938 63.682 -27.622 1.00 13.88 ?  175  PHE B CG  1 
ATOM   2907 C CD1 . PHE B 1 174 ? 37.949 62.701 -28.600 1.00 21.59 ?  175  PHE B CD1 1 
ATOM   2908 C CD2 . PHE B 1 174 ? 38.224 64.988 -27.985 1.00 14.88 ?  175  PHE B CD2 1 
ATOM   2909 C CE1 . PHE B 1 174 ? 38.240 63.016 -29.913 1.00 22.70 ?  175  PHE B CE1 1 
ATOM   2910 C CE2 . PHE B 1 174 ? 38.519 65.308 -29.295 1.00 18.98 ?  175  PHE B CE2 1 
ATOM   2911 C CZ  . PHE B 1 174 ? 38.526 64.321 -30.260 1.00 18.21 ?  175  PHE B CZ  1 
ATOM   2912 N N   . ALA B 1 175 ? 39.964 64.936 -24.869 1.00 12.21 ?  176  ALA B N   1 
ATOM   2913 C CA  . ALA B 1 175 ? 40.985 65.958 -25.076 1.00 9.48  ?  176  ALA B CA  1 
ATOM   2914 C C   . ALA B 1 175 ? 42.315 65.561 -24.446 1.00 14.06 ?  176  ALA B C   1 
ATOM   2915 O O   . ALA B 1 175 ? 43.378 65.839 -25.011 1.00 16.53 ?  176  ALA B O   1 
ATOM   2916 C CB  . ALA B 1 175 ? 40.507 67.298 -24.521 1.00 13.55 ?  176  ALA B CB  1 
ATOM   2917 N N   . LEU B 1 176 ? 42.281 64.925 -23.270 1.00 12.03 ?  177  LEU B N   1 
ATOM   2918 C CA  . LEU B 1 176 ? 43.522 64.464 -22.653 1.00 16.13 ?  177  LEU B CA  1 
ATOM   2919 C C   . LEU B 1 176 ? 44.264 63.487 -23.557 1.00 16.43 ?  177  LEU B C   1 
ATOM   2920 O O   . LEU B 1 176 ? 45.500 63.431 -23.533 1.00 16.56 ?  177  LEU B O   1 
ATOM   2921 C CB  . LEU B 1 176 ? 43.232 63.815 -21.298 1.00 10.61 ?  177  LEU B CB  1 
ATOM   2922 C CG  . LEU B 1 176 ? 42.838 64.752 -20.153 1.00 9.59  ?  177  LEU B CG  1 
ATOM   2923 C CD1 . LEU B 1 176 ? 42.463 63.956 -18.910 1.00 11.40 ?  177  LEU B CD1 1 
ATOM   2924 C CD2 . LEU B 1 176 ? 43.955 65.736 -19.847 1.00 9.78  ?  177  LEU B CD2 1 
ATOM   2925 N N   . LYS B 1 177 ? 43.532 62.720 -24.363 1.00 15.97 ?  178  LYS B N   1 
ATOM   2926 C CA  . LYS B 1 177 ? 44.166 61.778 -25.280 1.00 22.50 ?  178  LYS B CA  1 
ATOM   2927 C C   . LYS B 1 177 ? 44.789 62.497 -26.471 1.00 27.29 ?  178  LYS B C   1 
ATOM   2928 O O   . LYS B 1 177 ? 45.992 62.372 -26.729 1.00 23.26 ?  178  LYS B O   1 
ATOM   2929 C CB  . LYS B 1 177 ? 43.140 60.747 -25.750 1.00 20.30 ?  178  LYS B CB  1 
ATOM   2930 C CG  . LYS B 1 177 ? 43.744 59.487 -26.340 1.00 33.65 ?  178  LYS B CG  1 
ATOM   2931 C CD  . LYS B 1 177 ? 42.860 58.947 -27.445 1.00 39.47 ?  178  LYS B CD  1 
ATOM   2932 C CE  . LYS B 1 177 ? 42.900 57.434 -27.503 1.00 59.56 ?  178  LYS B CE  1 
ATOM   2933 N NZ  . LYS B 1 177 ? 41.723 56.897 -28.235 1.00 55.07 ?  178  LYS B NZ  1 
ATOM   2934 N N   . VAL B 1 178 ? 43.983 63.268 -27.208 1.00 19.23 ?  179  VAL B N   1 
ATOM   2935 C CA  . VAL B 1 178 ? 44.453 63.848 -28.463 1.00 15.59 ?  179  VAL B CA  1 
ATOM   2936 C C   . VAL B 1 178 ? 45.446 64.980 -28.243 1.00 21.76 ?  179  VAL B C   1 
ATOM   2937 O O   . VAL B 1 178 ? 46.221 65.299 -29.152 1.00 20.75 ?  179  VAL B O   1 
ATOM   2938 C CB  . VAL B 1 178 ? 43.264 64.334 -29.315 1.00 20.05 ?  179  VAL B CB  1 
ATOM   2939 C CG1 . VAL B 1 178 ? 42.269 63.204 -29.528 1.00 14.84 ?  179  VAL B CG1 1 
ATOM   2940 C CG2 . VAL B 1 178 ? 42.591 65.531 -28.663 1.00 17.12 ?  179  VAL B CG2 1 
ATOM   2941 N N   . LEU B 1 179 ? 45.451 65.604 -27.068 1.00 13.83 ?  180  LEU B N   1 
ATOM   2942 C CA  . LEU B 1 179 ? 46.431 66.636 -26.763 1.00 19.25 ?  180  LEU B CA  1 
ATOM   2943 C C   . LEU B 1 179 ? 47.711 66.062 -26.170 1.00 27.62 ?  180  LEU B C   1 
ATOM   2944 O O   . LEU B 1 179 ? 48.568 66.828 -25.716 1.00 29.03 ?  180  LEU B O   1 
ATOM   2945 C CB  . LEU B 1 179 ? 45.830 67.677 -25.817 1.00 23.26 ?  180  LEU B CB  1 
ATOM   2946 C CG  . LEU B 1 179 ? 44.649 68.464 -26.392 1.00 23.73 ?  180  LEU B CG  1 
ATOM   2947 C CD1 . LEU B 1 179 ? 44.098 69.445 -25.368 1.00 21.03 ?  180  LEU B CD1 1 
ATOM   2948 C CD2 . LEU B 1 179 ? 45.052 69.184 -27.673 1.00 18.81 ?  180  LEU B CD2 1 
ATOM   2949 N N   . ASN B 1 180 ? 47.852 64.734 -26.168 1.00 16.83 ?  181  ASN B N   1 
ATOM   2950 C CA  . ASN B 1 180 ? 49.059 64.051 -25.697 1.00 31.63 ?  181  ASN B CA  1 
ATOM   2951 C C   . ASN B 1 180 ? 49.379 64.408 -24.248 1.00 24.51 ?  181  ASN B C   1 
ATOM   2952 O O   . ASN B 1 180 ? 50.531 64.653 -23.888 1.00 27.29 ?  181  ASN B O   1 
ATOM   2953 C CB  . ASN B 1 180 ? 50.250 64.349 -26.609 1.00 36.97 ?  181  ASN B CB  1 
ATOM   2954 C CG  . ASN B 1 180 ? 50.103 63.718 -27.976 1.00 42.54 ?  181  ASN B CG  1 
ATOM   2955 O OD1 . ASN B 1 180 ? 49.575 62.613 -28.107 1.00 45.47 ?  181  ASN B OD1 1 
ATOM   2956 N ND2 . ASN B 1 180 ? 50.565 64.418 -29.005 1.00 61.82 ?  181  ASN B ND2 1 
ATOM   2957 N N   . MET B 1 181 ? 48.346 64.435 -23.406 1.00 22.18 ?  182  MET B N   1 
ATOM   2958 C CA  . MET B 1 181 ? 48.516 64.733 -21.993 1.00 29.52 ?  182  MET B CA  1 
ATOM   2959 C C   . MET B 1 181 ? 48.394 63.512 -21.096 1.00 29.55 ?  182  MET B C   1 
ATOM   2960 O O   . MET B 1 181 ? 48.950 63.518 -19.994 1.00 26.00 ?  182  MET B O   1 
ATOM   2961 C CB  . MET B 1 181 ? 47.494 65.787 -21.547 1.00 17.59 ?  182  MET B CB  1 
ATOM   2962 C CG  . MET B 1 181 ? 47.454 67.004 -22.454 1.00 26.81 ?  182  MET B CG  1 
ATOM   2963 S SD  . MET B 1 181 ? 46.084 68.107 -22.074 1.00 29.23 ?  182  MET B SD  1 
ATOM   2964 C CE  . MET B 1 181 ? 46.498 68.579 -20.400 1.00 7.36  ?  182  MET B CE  1 
ATOM   2965 N N   . MET B 1 182 ? 47.688 62.471 -21.539 1.00 19.45 ?  183  MET B N   1 
ATOM   2966 C CA  . MET B 1 182 ? 47.553 61.237 -20.791 1.00 20.34 ?  183  MET B CA  1 
ATOM   2967 C C   . MET B 1 182 ? 47.550 60.094 -21.799 1.00 29.31 ?  183  MET B C   1 
ATOM   2968 O O   . MET B 1 182 ? 46.811 60.157 -22.799 1.00 23.82 ?  183  MET B O   1 
ATOM   2969 C CB  . MET B 1 182 ? 46.276 61.205 -19.947 1.00 18.21 ?  183  MET B CB  1 
ATOM   2970 C CG  . MET B 1 182 ? 46.316 62.090 -18.712 1.00 32.46 ?  183  MET B CG  1 
ATOM   2971 S SD  . MET B 1 182 ? 46.880 61.208 -17.246 1.00 40.29 ?  183  MET B SD  1 
ATOM   2972 C CE  . MET B 1 182 ? 45.721 59.843 -17.212 1.00 21.73 ?  183  MET B CE  1 
ATOM   2973 N N   . PRO B 1 183 ? 48.355 59.057 -21.588 1.00 32.56 ?  184  PRO B N   1 
ATOM   2974 C CA  . PRO B 1 183 ? 48.250 57.869 -22.439 1.00 23.27 ?  184  PRO B CA  1 
ATOM   2975 C C   . PRO B 1 183 ? 46.927 57.160 -22.205 1.00 35.29 ?  184  PRO B C   1 
ATOM   2976 O O   . PRO B 1 183 ? 46.385 57.156 -21.097 1.00 31.76 ?  184  PRO B O   1 
ATOM   2977 C CB  . PRO B 1 183 ? 49.438 57.006 -22.000 1.00 29.64 ?  184  PRO B CB  1 
ATOM   2978 C CG  . PRO B 1 183 ? 49.736 57.458 -20.612 1.00 30.58 ?  184  PRO B CG  1 
ATOM   2979 C CD  . PRO B 1 183 ? 49.416 58.924 -20.575 1.00 25.30 ?  184  PRO B CD  1 
ATOM   2980 N N   . GLU B 1 184 ? 46.402 56.563 -23.279 1.00 31.65 ?  185  GLU B N   1 
ATOM   2981 C CA  . GLU B 1 184 ? 45.086 55.936 -23.209 1.00 33.73 ?  185  GLU B CA  1 
ATOM   2982 C C   . GLU B 1 184 ? 45.036 54.836 -22.157 1.00 25.63 ?  185  GLU B C   1 
ATOM   2983 O O   . GLU B 1 184 ? 43.993 54.631 -21.525 1.00 30.57 ?  185  GLU B O   1 
ATOM   2984 C CB  . GLU B 1 184 ? 44.697 55.381 -24.580 1.00 41.41 ?  185  GLU B CB  1 
ATOM   2985 C CG  . GLU B 1 184 ? 43.380 54.622 -24.592 1.00 37.19 ?  185  GLU B CG  1 
ATOM   2986 C CD  . GLU B 1 184 ? 42.955 54.213 -25.986 1.00 61.01 ?  185  GLU B CD  1 
ATOM   2987 O OE1 . GLU B 1 184 ? 43.795 54.274 -26.908 1.00 55.90 ?  185  GLU B OE1 1 
ATOM   2988 O OE2 . GLU B 1 184 ? 41.782 53.823 -26.157 1.00 65.05 ?  185  GLU B OE2 1 
ATOM   2989 N N   . GLU B 1 185 ? 46.147 54.127 -21.946 1.00 27.71 ?  186  GLU B N   1 
ATOM   2990 C CA  . GLU B 1 185 ? 46.161 53.061 -20.949 1.00 29.63 ?  186  GLU B CA  1 
ATOM   2991 C C   . GLU B 1 185 ? 45.928 53.611 -19.547 1.00 26.26 ?  186  GLU B C   1 
ATOM   2992 O O   . GLU B 1 185 ? 45.286 52.960 -18.715 1.00 27.77 ?  186  GLU B O   1 
ATOM   2993 C CB  . GLU B 1 185 ? 47.482 52.295 -21.012 1.00 35.73 ?  186  GLU B CB  1 
ATOM   2994 C CG  . GLU B 1 185 ? 48.711 53.173 -21.177 1.00 39.82 ?  186  GLU B CG  1 
ATOM   2995 C CD  . GLU B 1 185 ? 49.167 53.281 -22.620 1.00 54.38 ?  186  GLU B CD  1 
ATOM   2996 O OE1 . GLU B 1 185 ? 48.368 53.728 -23.470 1.00 41.05 ?  186  GLU B OE1 1 
ATOM   2997 O OE2 . GLU B 1 185 ? 50.326 52.913 -22.905 1.00 91.90 ?  186  GLU B OE2 1 
ATOM   2998 N N   . LYS B 1 186 ? 46.440 54.811 -19.266 1.00 24.34 ?  187  LYS B N   1 
ATOM   2999 C CA  . LYS B 1 186 ? 46.230 55.417 -17.956 1.00 27.62 ?  187  LYS B CA  1 
ATOM   3000 C C   . LYS B 1 186 ? 44.828 55.993 -17.813 1.00 22.69 ?  187  LYS B C   1 
ATOM   3001 O O   . LYS B 1 186 ? 44.287 56.027 -16.702 1.00 21.55 ?  187  LYS B O   1 
ATOM   3002 C CB  . LYS B 1 186 ? 47.278 56.500 -17.700 1.00 28.31 ?  187  LYS B CB  1 
ATOM   3003 C CG  . LYS B 1 186 ? 48.694 55.962 -17.556 1.00 32.82 ?  187  LYS B CG  1 
ATOM   3004 C CD  . LYS B 1 186 ? 49.511 56.794 -16.579 1.00 56.39 ?  187  LYS B CD  1 
ATOM   3005 C CE  . LYS B 1 186 ? 48.922 56.742 -15.177 1.00 76.64 ?  187  LYS B CE  1 
ATOM   3006 N NZ  . LYS B 1 186 ? 49.563 57.728 -14.261 1.00 70.32 ?  187  LYS B NZ  1 
ATOM   3007 N N   . LEU B 1 187 ? 44.225 56.448 -18.914 1.00 19.77 ?  188  LEU B N   1 
ATOM   3008 C CA  . LEU B 1 187 ? 42.838 56.893 -18.856 1.00 22.18 ?  188  LEU B CA  1 
ATOM   3009 C C   . LEU B 1 187 ? 41.902 55.730 -18.555 1.00 20.39 ?  188  LEU B C   1 
ATOM   3010 O O   . LEU B 1 187 ? 40.936 55.881 -17.798 1.00 17.82 ?  188  LEU B O   1 
ATOM   3011 C CB  . LEU B 1 187 ? 42.448 57.570 -20.170 1.00 23.46 ?  188  LEU B CB  1 
ATOM   3012 C CG  . LEU B 1 187 ? 43.144 58.896 -20.477 1.00 19.53 ?  188  LEU B CG  1 
ATOM   3013 C CD1 . LEU B 1 187 ? 42.956 59.277 -21.938 1.00 34.62 ?  188  LEU B CD1 1 
ATOM   3014 C CD2 . LEU B 1 187 ? 42.624 59.993 -19.562 1.00 16.78 ?  188  LEU B CD2 1 
ATOM   3015 N N   . VAL B 1 188 ? 42.181 54.559 -19.130 1.00 24.00 ?  189  VAL B N   1 
ATOM   3016 C CA  . VAL B 1 188 ? 41.326 53.396 -18.914 1.00 20.41 ?  189  VAL B CA  1 
ATOM   3017 C C   . VAL B 1 188 ? 41.392 52.947 -17.459 1.00 18.71 ?  189  VAL B C   1 
ATOM   3018 O O   . VAL B 1 188 ? 40.360 52.714 -16.818 1.00 21.08 ?  189  VAL B O   1 
ATOM   3019 C CB  . VAL B 1 188 ? 41.719 52.258 -19.874 1.00 26.64 ?  189  VAL B CB  1 
ATOM   3020 C CG1 . VAL B 1 188 ? 41.218 50.919 -19.353 1.00 21.68 ?  189  VAL B CG1 1 
ATOM   3021 C CG2 . VAL B 1 188 ? 41.177 52.529 -21.268 1.00 24.14 ?  189  VAL B CG2 1 
ATOM   3022 N N   . GLU B 1 189 ? 42.605 52.822 -16.912 1.00 17.98 ?  190  GLU B N   1 
ATOM   3023 C CA  . GLU B 1 189 ? 42.735 52.305 -15.553 1.00 24.25 ?  190  GLU B CA  1 
ATOM   3024 C C   . GLU B 1 189 ? 42.249 53.308 -14.516 1.00 17.15 ?  190  GLU B C   1 
ATOM   3025 O O   . GLU B 1 189 ? 41.771 52.907 -13.449 1.00 20.95 ?  190  GLU B O   1 
ATOM   3026 C CB  . GLU B 1 189 ? 44.183 51.897 -15.272 1.00 28.41 ?  190  GLU B CB  1 
ATOM   3027 C CG  . GLU B 1 189 ? 45.205 53.008 -15.406 1.00 40.47 ?  190  GLU B CG  1 
ATOM   3028 C CD  . GLU B 1 189 ? 46.627 52.504 -15.237 1.00 56.22 ?  190  GLU B CD  1 
ATOM   3029 O OE1 . GLU B 1 189 ? 47.080 51.703 -16.083 1.00 44.81 ?  190  GLU B OE1 1 
ATOM   3030 O OE2 . GLU B 1 189 ? 47.290 52.903 -14.257 1.00 74.66 ?  190  GLU B OE2 1 
ATOM   3031 N N   . ALA B 1 190 ? 42.357 54.608 -14.802 1.00 16.55 ?  191  ALA B N   1 
ATOM   3032 C CA  . ALA B 1 190 ? 41.769 55.600 -13.908 1.00 17.44 ?  191  ALA B CA  1 
ATOM   3033 C C   . ALA B 1 190 ? 40.250 55.492 -13.901 1.00 18.56 ?  191  ALA B C   1 
ATOM   3034 O O   . ALA B 1 190 ? 39.620 55.574 -12.839 1.00 17.56 ?  191  ALA B O   1 
ATOM   3035 C CB  . ALA B 1 190 ? 42.207 57.006 -14.315 1.00 16.66 ?  191  ALA B CB  1 
ATOM   3036 N N   . LEU B 1 191 ? 39.648 55.296 -15.077 1.00 20.41 ?  192  LEU B N   1 
ATOM   3037 C CA  . LEU B 1 191 ? 38.201 55.125 -15.159 1.00 20.70 ?  192  LEU B CA  1 
ATOM   3038 C C   . LEU B 1 191 ? 37.752 53.863 -14.437 1.00 19.04 ?  192  LEU B C   1 
ATOM   3039 O O   . LEU B 1 191 ? 36.746 53.873 -13.718 1.00 23.59 ?  192  LEU B O   1 
ATOM   3040 C CB  . LEU B 1 191 ? 37.765 55.082 -16.622 1.00 27.99 ?  192  LEU B CB  1 
ATOM   3041 C CG  . LEU B 1 191 ? 37.274 56.381 -17.258 1.00 33.00 ?  192  LEU B CG  1 
ATOM   3042 C CD1 . LEU B 1 191 ? 37.419 56.295 -18.768 1.00 32.88 ?  192  LEU B CD1 1 
ATOM   3043 C CD2 . LEU B 1 191 ? 35.832 56.661 -16.866 1.00 26.84 ?  192  LEU B CD2 1 
ATOM   3044 N N   . ALA B 1 192 ? 38.482 52.760 -14.625 1.00 19.00 ?  193  ALA B N   1 
ATOM   3045 C CA  . ALA B 1 192 ? 38.142 51.523 -13.932 1.00 19.05 ?  193  ALA B CA  1 
ATOM   3046 C C   . ALA B 1 192 ? 38.269 51.686 -12.423 1.00 20.02 ?  193  ALA B C   1 
ATOM   3047 O O   . ALA B 1 192 ? 37.422 51.198 -11.664 1.00 22.31 ?  193  ALA B O   1 
ATOM   3048 C CB  . ALA B 1 192 ? 39.031 50.382 -14.427 1.00 18.96 ?  193  ALA B CB  1 
ATOM   3049 N N   . ALA B 1 193 ? 39.323 52.368 -11.969 1.00 17.99 ?  194  ALA B N   1 
ATOM   3050 C CA  . ALA B 1 193 ? 39.484 52.614 -10.540 1.00 21.49 ?  194  ALA B CA  1 
ATOM   3051 C C   . ALA B 1 193 ? 38.372 53.510 -10.010 1.00 16.59 ?  194  ALA B C   1 
ATOM   3052 O O   . ALA B 1 193 ? 37.883 53.309 -8.892  1.00 20.06 ?  194  ALA B O   1 
ATOM   3053 C CB  . ALA B 1 193 ? 40.854 53.235 -10.266 1.00 15.41 ?  194  ALA B CB  1 
ATOM   3054 N N   . ALA B 1 194 ? 37.960 54.503 -10.800 1.00 17.15 ?  195  ALA B N   1 
ATOM   3055 C CA  . ALA B 1 194 ? 36.862 55.372 -10.387 1.00 19.83 ?  195  ALA B CA  1 
ATOM   3056 C C   . ALA B 1 194 ? 35.562 54.591 -10.253 1.00 21.82 ?  195  ALA B C   1 
ATOM   3057 O O   . ALA B 1 194 ? 34.803 54.791 -9.297  1.00 25.92 ?  195  ALA B O   1 
ATOM   3058 C CB  . ALA B 1 194 ? 36.698 56.519 -11.383 1.00 12.59 ?  195  ALA B CB  1 
ATOM   3059 N N   . THR B 1 195 ? 35.292 53.692 -11.203 1.00 25.82 ?  196  THR B N   1 
ATOM   3060 C CA  . THR B 1 195 ? 34.062 52.907 -11.157 1.00 26.65 ?  196  THR B CA  1 
ATOM   3061 C C   . THR B 1 195 ? 34.042 51.978 -9.949  1.00 21.32 ?  196  THR B C   1 
ATOM   3062 O O   . THR B 1 195 ? 33.014 51.849 -9.273  1.00 31.35 ?  196  THR B O   1 
ATOM   3063 C CB  . THR B 1 195 ? 33.902 52.106 -12.450 1.00 21.79 ?  196  THR B CB  1 
ATOM   3064 O OG1 . THR B 1 195 ? 33.890 53.001 -13.570 1.00 24.38 ?  196  THR B OG1 1 
ATOM   3065 C CG2 . THR B 1 195 ? 32.605 51.310 -12.430 1.00 32.81 ?  196  THR B CG2 1 
ATOM   3066 N N   . GLU B 1 196 ? 35.170 51.323 -9.660  1.00 27.63 ?  197  GLU B N   1 
ATOM   3067 C CA  . GLU B 1 196 ? 35.225 50.422 -8.514  1.00 28.70 ?  197  GLU B CA  1 
ATOM   3068 C C   . GLU B 1 196 ? 35.058 51.181 -7.204  1.00 33.39 ?  197  GLU B C   1 
ATOM   3069 O O   . GLU B 1 196 ? 34.403 50.690 -6.277  1.00 32.55 ?  197  GLU B O   1 
ATOM   3070 C CB  . GLU B 1 196 ? 36.538 49.641 -8.521  1.00 29.81 ?  197  GLU B CB  1 
ATOM   3071 C CG  . GLU B 1 196 ? 36.616 48.573 -9.602  1.00 61.07 ?  197  GLU B CG  1 
ATOM   3072 C CD  . GLU B 1 196 ? 35.559 47.496 -9.437  1.00 60.14 ?  197  GLU B CD  1 
ATOM   3073 O OE1 . GLU B 1 196 ? 35.067 46.984 -10.465 1.00 55.81 ?  197  GLU B OE1 1 
ATOM   3074 O OE2 . GLU B 1 196 ? 35.223 47.161 -8.281  1.00 50.82 ?  197  GLU B OE2 1 
ATOM   3075 N N   . LYS B 1 197 ? 35.645 52.377 -7.106  1.00 26.30 ?  198  LYS B N   1 
ATOM   3076 C CA  . LYS B 1 197 ? 35.437 53.199 -5.919  1.00 30.40 ?  198  LYS B CA  1 
ATOM   3077 C C   . LYS B 1 197 ? 33.971 53.587 -5.772  1.00 25.36 ?  198  LYS B C   1 
ATOM   3078 O O   . LYS B 1 197 ? 33.434 53.607 -4.657  1.00 34.08 ?  198  LYS B O   1 
ATOM   3079 C CB  . LYS B 1 197 ? 36.315 54.448 -5.982  1.00 28.05 ?  198  LYS B CB  1 
ATOM   3080 C CG  . LYS B 1 197 ? 35.959 55.493 -4.938  1.00 34.39 ?  198  LYS B CG  1 
ATOM   3081 C CD  . LYS B 1 197 ? 36.424 56.874 -5.357  1.00 45.67 ?  198  LYS B CD  1 
ATOM   3082 C CE  . LYS B 1 197 ? 35.953 57.943 -4.379  1.00 37.64 ?  198  LYS B CE  1 
ATOM   3083 N NZ  . LYS B 1 197 ? 34.563 58.398 -4.663  1.00 31.93 ?  198  LYS B NZ  1 
ATOM   3084 N N   . GLN B 1 198 ? 33.307 53.897 -6.888  1.00 30.18 ?  199  GLN B N   1 
ATOM   3085 C CA  . GLN B 1 198 ? 31.886 54.227 -6.836  1.00 31.32 ?  199  GLN B CA  1 
ATOM   3086 C C   . GLN B 1 198 ? 31.059 53.031 -6.382  1.00 39.61 ?  199  GLN B C   1 
ATOM   3087 O O   . GLN B 1 198 ? 30.070 53.190 -5.656  1.00 40.37 ?  199  GLN B O   1 
ATOM   3088 C CB  . GLN B 1 198 ? 31.411 54.720 -8.204  1.00 34.19 ?  199  GLN B CB  1 
ATOM   3089 C CG  . GLN B 1 198 ? 31.864 56.130 -8.554  1.00 33.12 ?  199  GLN B CG  1 
ATOM   3090 C CD  . GLN B 1 198 ? 31.496 56.527 -9.972  1.00 30.43 ?  199  GLN B CD  1 
ATOM   3091 O OE1 . GLN B 1 198 ? 31.113 55.687 -10.786 1.00 49.09 ?  199  GLN B OE1 1 
ATOM   3092 N NE2 . GLN B 1 198 ? 31.609 57.815 -10.273 1.00 40.55 ?  199  GLN B NE2 1 
ATOM   3093 N N   . LYS B 1 199 ? 31.448 51.825 -6.798  1.00 33.56 ?  200  LYS B N   1 
ATOM   3094 C CA  . LYS B 1 199 ? 30.739 50.627 -6.358  1.00 36.37 ?  200  LYS B CA  1 
ATOM   3095 C C   . LYS B 1 199 ? 30.974 50.365 -4.876  1.00 31.08 ?  200  LYS B C   1 
ATOM   3096 O O   . LYS B 1 199 ? 30.032 50.078 -4.129  1.00 37.11 ?  200  LYS B O   1 
ATOM   3097 C CB  . LYS B 1 199 ? 31.171 49.421 -7.193  1.00 41.91 ?  200  LYS B CB  1 
ATOM   3098 C CG  . LYS B 1 199 ? 30.773 49.491 -8.658  1.00 58.05 ?  200  LYS B CG  1 
ATOM   3099 C CD  . LYS B 1 199 ? 30.246 48.148 -9.140  1.00 63.17 ?  200  LYS B CD  1 
ATOM   3100 C CE  . LYS B 1 199 ? 30.944 47.697 -10.414 1.00 65.25 ?  200  LYS B CE  1 
ATOM   3101 N NZ  . LYS B 1 199 ? 30.618 48.568 -11.578 1.00 56.67 ?  200  LYS B NZ  1 
ATOM   3102 N N   . LYS B 1 200 ? 32.231 50.457 -4.433  1.00 35.43 ?  201  LYS B N   1 
ATOM   3103 C CA  . LYS B 1 200 ? 32.542 50.231 -3.025  1.00 34.14 ?  201  LYS B CA  1 
ATOM   3104 C C   . LYS B 1 200 ? 31.831 51.241 -2.133  1.00 40.43 ?  201  LYS B C   1 
ATOM   3105 O O   . LYS B 1 200 ? 31.376 50.898 -1.035  1.00 35.92 ?  201  LYS B O   1 
ATOM   3106 C CB  . LYS B 1 200 ? 34.053 50.299 -2.803  1.00 41.42 ?  201  LYS B CB  1 
ATOM   3107 C CG  . LYS B 1 200 ? 34.814 49.054 -3.228  1.00 39.96 ?  201  LYS B CG  1 
ATOM   3108 C CD  . LYS B 1 200 ? 36.160 49.421 -3.833  1.00 50.10 ?  201  LYS B CD  1 
ATOM   3109 C CE  . LYS B 1 200 ? 37.243 48.434 -3.430  1.00 58.88 ?  201  LYS B CE  1 
ATOM   3110 N NZ  . LYS B 1 200 ? 38.605 49.019 -3.589  1.00 58.75 ?  201  LYS B NZ  1 
ATOM   3111 N N   . ALA B 1 201 ? 31.726 52.492 -2.588  1.00 40.66 ?  202  ALA B N   1 
ATOM   3112 C CA  . ALA B 1 201 ? 31.078 53.520 -1.781  1.00 34.80 ?  202  ALA B CA  1 
ATOM   3113 C C   . ALA B 1 201 ? 29.598 53.220 -1.585  1.00 39.89 ?  202  ALA B C   1 
ATOM   3114 O O   . ALA B 1 201 ? 29.059 53.405 -0.487  1.00 42.10 ?  202  ALA B O   1 
ATOM   3115 C CB  . ALA B 1 201 ? 31.267 54.891 -2.429  1.00 34.59 ?  202  ALA B CB  1 
ATOM   3116 N N   . LEU B 1 202 ? 28.924 52.750 -2.637  1.00 35.39 ?  203  LEU B N   1 
ATOM   3117 C CA  . LEU B 1 202 ? 27.500 52.457 -2.537  1.00 32.16 ?  203  LEU B CA  1 
ATOM   3118 C C   . LEU B 1 202 ? 27.219 51.185 -1.749  1.00 41.63 ?  203  LEU B C   1 
ATOM   3119 O O   . LEU B 1 202 ? 26.081 50.982 -1.315  1.00 36.61 ?  203  LEU B O   1 
ATOM   3120 C CB  . LEU B 1 202 ? 26.883 52.347 -3.933  1.00 36.18 ?  203  LEU B CB  1 
ATOM   3121 C CG  . LEU B 1 202 ? 26.388 53.660 -4.544  1.00 35.57 ?  203  LEU B CG  1 
ATOM   3122 C CD1 . LEU B 1 202 ? 26.031 53.474 -6.010  1.00 37.17 ?  203  LEU B CD1 1 
ATOM   3123 C CD2 . LEU B 1 202 ? 25.201 54.201 -3.762  1.00 35.30 ?  203  LEU B CD2 1 
ATOM   3124 N N   . GLU B 1 203 ? 28.217 50.327 -1.557  1.00 34.12 ?  204  GLU B N   1 
ATOM   3125 C CA  . GLU B 1 203 ? 28.034 49.113 -0.773  1.00 42.69 ?  204  GLU B CA  1 
ATOM   3126 C C   . GLU B 1 203 ? 28.362 49.308 0.700   1.00 42.26 ?  204  GLU B C   1 
ATOM   3127 O O   . GLU B 1 203 ? 28.296 48.342 1.468   1.00 46.12 ?  204  GLU B O   1 
ATOM   3128 C CB  . GLU B 1 203 ? 28.875 47.973 -1.356  1.00 35.58 ?  204  GLU B CB  1 
ATOM   3129 C CG  . GLU B 1 203 ? 28.102 47.104 -2.333  1.00 39.80 ?  204  GLU B CG  1 
ATOM   3130 C CD  . GLU B 1 203 ? 28.940 46.647 -3.506  1.00 52.67 ?  204  GLU B CD  1 
ATOM   3131 O OE1 . GLU B 1 203 ? 30.111 46.267 -3.293  1.00 62.10 ?  204  GLU B OE1 1 
ATOM   3132 O OE2 . GLU B 1 203 ? 28.429 46.676 -4.645  1.00 62.33 ?  204  GLU B OE2 1 
ATOM   3133 N N   . LYS B 1 204 ? 28.716 50.528 1.112   1.00 44.75 ?  205  LYS B N   1 
ATOM   3134 C CA  . LYS B 1 204 ? 28.803 50.819 2.537   1.00 42.39 ?  205  LYS B CA  1 
ATOM   3135 C C   . LYS B 1 204 ? 27.418 50.974 3.150   1.00 40.79 ?  205  LYS B C   1 
ATOM   3136 O O   . LYS B 1 204 ? 27.248 50.757 4.355   1.00 48.78 ?  205  LYS B O   1 
ATOM   3137 C CB  . LYS B 1 204 ? 29.647 52.072 2.773   1.00 43.58 ?  205  LYS B CB  1 
ATOM   3138 C CG  . LYS B 1 204 ? 31.100 51.920 2.342   1.00 47.83 ?  205  LYS B CG  1 
ATOM   3139 C CD  . LYS B 1 204 ? 32.058 52.555 3.340   1.00 54.78 ?  205  LYS B CD  1 
ATOM   3140 C CE  . LYS B 1 204 ? 31.984 54.074 3.299   1.00 59.80 ?  205  LYS B CE  1 
ATOM   3141 N NZ  . LYS B 1 204 ? 33.265 54.696 3.734   1.00 56.49 ?  205  LYS B NZ  1 
ATOM   3142 N N   . LEU B 1 205 ? 26.421 51.342 2.344   1.00 54.39 ?  206  LEU B N   1 
ATOM   3143 C CA  . LEU B 1 205 ? 25.028 51.294 2.766   1.00 48.20 ?  206  LEU B CA  1 
ATOM   3144 C C   . LEU B 1 205 ? 24.437 49.935 2.401   1.00 57.62 ?  206  LEU B C   1 
ATOM   3145 O O   . LEU B 1 205 ? 24.722 49.394 1.329   1.00 58.42 ?  206  LEU B O   1 
ATOM   3146 C CB  . LEU B 1 205 ? 24.213 52.431 2.135   1.00 35.58 ?  206  LEU B CB  1 
ATOM   3147 C CG  . LEU B 1 205 ? 24.127 52.688 0.625   1.00 50.84 ?  206  LEU B CG  1 
ATOM   3148 C CD1 . LEU B 1 205 ? 23.150 51.753 -0.082  1.00 54.14 ?  206  LEU B CD1 1 
ATOM   3149 C CD2 . LEU B 1 205 ? 23.735 54.136 0.375   1.00 28.05 ?  206  LEU B CD2 1 
ATOM   3150 N N   . LEU B 1 206 ? 23.631 49.372 3.303   1.00 59.53 ?  207  LEU B N   1 
ATOM   3151 C CA  . LEU B 1 206 ? 23.256 49.983 4.580   1.00 47.66 ?  207  LEU B CA  1 
ATOM   3152 C C   . LEU B 1 206 ? 24.396 49.948 5.599   1.00 56.21 ?  207  LEU B C   1 
ATOM   3153 O O   . LEU B 1 206 ? 24.716 50.966 6.212   1.00 63.76 ?  207  LEU B O   1 
ATOM   3154 C CB  . LEU B 1 206 ? 22.018 49.273 5.146   1.00 61.36 ?  207  LEU B CB  1 
ATOM   3155 C CG  . LEU B 1 206 ? 21.402 49.655 6.499   1.00 55.24 ?  207  LEU B CG  1 
ATOM   3156 C CD1 . LEU B 1 206 ? 22.057 48.910 7.667   1.00 39.13 ?  207  LEU B CD1 1 
ATOM   3157 C CD2 . LEU B 1 206 ? 21.428 51.163 6.724   1.00 45.15 ?  207  LEU B CD2 1 
ATOM   3158 N N   . PHE C 2 32  ? 35.143 40.636 34.270  1.00 38.76 ?  1486 PHE C N   1 
ATOM   3159 C CA  . PHE C 2 32  ? 35.755 41.014 33.001  1.00 32.06 ?  1486 PHE C CA  1 
ATOM   3160 C C   . PHE C 2 32  ? 36.666 42.225 33.165  1.00 31.54 ?  1486 PHE C C   1 
ATOM   3161 O O   . PHE C 2 32  ? 37.416 42.575 32.253  1.00 29.80 ?  1486 PHE C O   1 
ATOM   3162 C CB  . PHE C 2 32  ? 34.681 41.312 31.952  1.00 32.54 ?  1486 PHE C CB  1 
ATOM   3163 C CG  . PHE C 2 32  ? 33.873 40.111 31.551  1.00 22.24 ?  1486 PHE C CG  1 
ATOM   3164 C CD1 . PHE C 2 32  ? 34.460 39.065 30.860  1.00 31.10 ?  1486 PHE C CD1 1 
ATOM   3165 C CD2 . PHE C 2 32  ? 32.526 40.033 31.858  1.00 29.58 ?  1486 PHE C CD2 1 
ATOM   3166 C CE1 . PHE C 2 32  ? 33.719 37.961 30.488  1.00 32.51 ?  1486 PHE C CE1 1 
ATOM   3167 C CE2 . PHE C 2 32  ? 31.780 38.932 31.488  1.00 30.71 ?  1486 PHE C CE2 1 
ATOM   3168 C CZ  . PHE C 2 32  ? 32.377 37.895 30.801  1.00 32.49 ?  1486 PHE C CZ  1 
ATOM   3169 N N   . VAL C 2 33  ? 36.594 42.862 34.333  1.00 23.61 ?  1487 VAL C N   1 
ATOM   3170 C CA  . VAL C 2 33  ? 37.358 44.079 34.583  1.00 29.68 ?  1487 VAL C CA  1 
ATOM   3171 C C   . VAL C 2 33  ? 38.844 43.744 34.597  1.00 30.49 ?  1487 VAL C C   1 
ATOM   3172 O O   . VAL C 2 33  ? 39.292 42.874 35.351  1.00 36.92 ?  1487 VAL C O   1 
ATOM   3173 C CB  . VAL C 2 33  ? 36.924 44.738 35.898  1.00 32.26 ?  1487 VAL C CB  1 
ATOM   3174 C CG1 . VAL C 2 33  ? 37.830 45.913 36.227  1.00 27.32 ?  1487 VAL C CG1 1 
ATOM   3175 C CG2 . VAL C 2 33  ? 35.472 45.182 35.813  1.00 28.72 ?  1487 VAL C CG2 1 
ATOM   3176 N N   . GLY C 2 34  ? 39.614 44.438 33.760  1.00 27.73 ?  1488 GLY C N   1 
ATOM   3177 C CA  . GLY C 2 34  ? 41.044 44.242 33.669  1.00 27.28 ?  1488 GLY C CA  1 
ATOM   3178 C C   . GLY C 2 34  ? 41.492 43.314 32.561  1.00 20.29 ?  1488 GLY C C   1 
ATOM   3179 O O   . GLY C 2 34  ? 42.702 43.177 32.342  1.00 23.28 ?  1488 GLY C O   1 
ATOM   3180 N N   . LEU C 2 35  ? 40.561 42.677 31.857  1.00 15.92 ?  1489 LEU C N   1 
ATOM   3181 C CA  . LEU C 2 35  ? 40.917 41.735 30.806  1.00 19.71 ?  1489 LEU C CA  1 
ATOM   3182 C C   . LEU C 2 35  ? 41.193 42.466 29.499  1.00 16.38 ?  1489 LEU C C   1 
ATOM   3183 O O   . LEU C 2 35  ? 40.506 43.431 29.151  1.00 11.51 ?  1489 LEU C O   1 
ATOM   3184 C CB  . LEU C 2 35  ? 39.799 40.712 30.604  1.00 17.92 ?  1489 LEU C CB  1 
ATOM   3185 C CG  . LEU C 2 35  ? 39.606 39.695 31.730  1.00 26.73 ?  1489 LEU C CG  1 
ATOM   3186 C CD1 . LEU C 2 35  ? 38.453 38.755 31.417  1.00 23.39 ?  1489 LEU C CD1 1 
ATOM   3187 C CD2 . LEU C 2 35  ? 40.888 38.914 31.969  1.00 25.10 ?  1489 LEU C CD2 1 
ATOM   3188 N N   . ARG C 2 36  ? 42.209 41.999 28.777  1.00 11.12 ?  1490 ARG C N   1 
ATOM   3189 C CA  . ARG C 2 36  ? 42.501 42.542 27.458  1.00 14.06 ?  1490 ARG C CA  1 
ATOM   3190 C C   . ARG C 2 36  ? 41.467 42.055 26.452  1.00 18.17 ?  1490 ARG C C   1 
ATOM   3191 O O   . ARG C 2 36  ? 41.088 40.881 26.443  1.00 13.18 ?  1490 ARG C O   1 
ATOM   3192 C CB  . ARG C 2 36  ? 43.903 42.133 27.009  1.00 16.46 ?  1490 ARG C CB  1 
ATOM   3193 C CG  . ARG C 2 36  ? 44.998 43.071 27.481  1.00 22.49 ?  1490 ARG C CG  1 
ATOM   3194 C CD  . ARG C 2 36  ? 46.130 43.151 26.472  1.00 17.17 ?  1490 ARG C CD  1 
ATOM   3195 N NE  . ARG C 2 36  ? 46.878 44.398 26.601  1.00 28.38 ?  1490 ARG C NE  1 
ATOM   3196 C CZ  . ARG C 2 36  ? 46.608 45.506 25.919  1.00 24.55 ?  1490 ARG C CZ  1 
ATOM   3197 N NH1 . ARG C 2 36  ? 45.606 45.527 25.051  1.00 13.92 ?  1490 ARG C NH1 1 
ATOM   3198 N NH2 . ARG C 2 36  ? 47.342 46.595 26.104  1.00 23.89 ?  1490 ARG C NH2 1 
ATOM   3199 N N   . VAL C 2 37  ? 40.997 42.972 25.606  1.00 13.42 ?  1491 VAL C N   1 
ATOM   3200 C CA  . VAL C 2 37  ? 39.961 42.679 24.624  1.00 15.26 ?  1491 VAL C CA  1 
ATOM   3201 C C   . VAL C 2 37  ? 40.309 43.367 23.311  1.00 11.42 ?  1491 VAL C C   1 
ATOM   3202 O O   . VAL C 2 37  ? 41.218 44.195 23.231  1.00 9.65  ?  1491 VAL C O   1 
ATOM   3203 C CB  . VAL C 2 37  ? 38.558 43.127 25.092  1.00 14.07 ?  1491 VAL C CB  1 
ATOM   3204 C CG1 . VAL C 2 37  ? 38.202 42.510 26.435  1.00 13.62 ?  1491 VAL C CG1 1 
ATOM   3205 C CG2 . VAL C 2 37  ? 38.488 44.644 25.159  1.00 12.98 ?  1491 VAL C CG2 1 
ATOM   3206 N N   . VAL C 2 38  ? 39.569 42.995 22.271  1.00 8.64  ?  1492 VAL C N   1 
ATOM   3207 C CA  . VAL C 2 38  ? 39.526 43.720 21.008  1.00 8.43  ?  1492 VAL C CA  1 
ATOM   3208 C C   . VAL C 2 38  ? 38.069 44.075 20.755  1.00 14.13 ?  1492 VAL C C   1 
ATOM   3209 O O   . VAL C 2 38  ? 37.199 43.198 20.801  1.00 7.43  ?  1492 VAL C O   1 
ATOM   3210 C CB  . VAL C 2 38  ? 40.104 42.890 19.848  1.00 11.73 ?  1492 VAL C CB  1 
ATOM   3211 C CG1 . VAL C 2 38  ? 40.187 43.733 18.588  1.00 13.02 ?  1492 VAL C CG1 1 
ATOM   3212 C CG2 . VAL C 2 38  ? 41.473 42.342 20.216  1.00 10.65 ?  1492 VAL C CG2 1 
ATOM   3213 N N   . ALA C 2 39  ? 37.797 45.354 20.514  1.00 8.76  ?  1493 ALA C N   1 
ATOM   3214 C CA  . ALA C 2 39  ? 36.416 45.805 20.498  1.00 7.62  ?  1493 ALA C CA  1 
ATOM   3215 C C   . ALA C 2 39  ? 36.258 47.012 19.589  1.00 12.71 ?  1493 ALA C C   1 
ATOM   3216 O O   . ALA C 2 39  ? 37.196 47.789 19.391  1.00 10.71 ?  1493 ALA C O   1 
ATOM   3217 C CB  . ALA C 2 39  ? 35.937 46.155 21.912  1.00 14.58 ?  1493 ALA C CB  1 
ATOM   3218 N N   . LYS C 2 40  ? 35.056 47.159 19.041  1.00 8.88  ?  1494 LYS C N   1 
ATOM   3219 C CA  . LYS C 2 40  ? 34.672 48.369 18.333  1.00 9.10  ?  1494 LYS C CA  1 
ATOM   3220 C C   . LYS C 2 40  ? 33.880 49.277 19.264  1.00 12.51 ?  1494 LYS C C   1 
ATOM   3221 O O   . LYS C 2 40  ? 33.171 48.815 20.162  1.00 12.26 ?  1494 LYS C O   1 
ATOM   3222 C CB  . LYS C 2 40  ? 33.854 48.056 17.075  1.00 14.83 ?  1494 LYS C CB  1 
ATOM   3223 C CG  . LYS C 2 40  ? 32.654 47.141 17.269  1.00 16.62 ?  1494 LYS C CG  1 
ATOM   3224 C CD  . LYS C 2 40  ? 32.122 46.684 15.910  1.00 18.52 ?  1494 LYS C CD  1 
ATOM   3225 C CE  . LYS C 2 40  ? 30.973 45.693 16.034  1.00 29.80 ?  1494 LYS C CE  1 
ATOM   3226 N NZ  . LYS C 2 40  ? 29.644 46.366 15.993  1.00 30.78 ?  1494 LYS C NZ  1 
ATOM   3227 N N   . TRP C 2 41  ? 34.032 50.584 19.060  1.00 10.05 ?  1495 TRP C N   1 
ATOM   3228 C CA  . TRP C 2 41  ? 33.299 51.582 19.826  1.00 12.07 ?  1495 TRP C CA  1 
ATOM   3229 C C   . TRP C 2 41  ? 32.186 52.223 19.009  1.00 13.64 ?  1495 TRP C C   1 
ATOM   3230 O O   . TRP C 2 41  ? 31.619 53.236 19.431  1.00 12.73 ?  1495 TRP C O   1 
ATOM   3231 C CB  . TRP C 2 41  ? 34.254 52.647 20.373  1.00 13.41 ?  1495 TRP C CB  1 
ATOM   3232 C CG  . TRP C 2 41  ? 35.348 53.040 19.428  1.00 11.58 ?  1495 TRP C CG  1 
ATOM   3233 C CD1 . TRP C 2 41  ? 36.658 52.655 19.485  1.00 15.16 ?  1495 TRP C CD1 1 
ATOM   3234 C CD2 . TRP C 2 41  ? 35.234 53.908 18.297  1.00 9.76  ?  1495 TRP C CD2 1 
ATOM   3235 N NE1 . TRP C 2 41  ? 37.362 53.223 18.454  1.00 14.25 ?  1495 TRP C NE1 1 
ATOM   3236 C CE2 . TRP C 2 41  ? 36.511 53.998 17.710  1.00 8.54  ?  1495 TRP C CE2 1 
ATOM   3237 C CE3 . TRP C 2 41  ? 34.175 54.618 17.722  1.00 15.67 ?  1495 TRP C CE3 1 
ATOM   3238 C CZ2 . TRP C 2 41  ? 36.757 54.765 16.574  1.00 11.30 ?  1495 TRP C CZ2 1 
ATOM   3239 C CZ3 . TRP C 2 41  ? 34.423 55.379 16.594  1.00 15.63 ?  1495 TRP C CZ3 1 
ATOM   3240 C CH2 . TRP C 2 41  ? 35.703 55.447 16.033  1.00 16.63 ?  1495 TRP C CH2 1 
ATOM   3241 N N   . SER C 2 42  ? 31.876 51.662 17.843  1.00 15.00 ?  1496 SER C N   1 
ATOM   3242 C CA  . SER C 2 42  ? 30.703 52.025 17.063  1.00 15.74 ?  1496 SER C CA  1 
ATOM   3243 C C   . SER C 2 42  ? 30.162 50.757 16.422  1.00 17.30 ?  1496 SER C C   1 
ATOM   3244 O O   . SER C 2 42  ? 30.886 49.774 16.248  1.00 17.84 ?  1496 SER C O   1 
ATOM   3245 C CB  . SER C 2 42  ? 31.022 53.078 15.994  1.00 17.14 ?  1496 SER C CB  1 
ATOM   3246 O OG  . SER C 2 42  ? 31.930 52.565 15.034  1.00 30.28 ?  1496 SER C OG  1 
ATOM   3247 N N   . SER C 2 43  ? 28.875 50.784 16.070  1.00 21.09 ?  1497 SER C N   1 
ATOM   3248 C CA  . SER C 2 43  ? 28.222 49.561 15.616  1.00 24.21 ?  1497 SER C CA  1 
ATOM   3249 C C   . SER C 2 43  ? 28.779 49.072 14.284  1.00 23.34 ?  1497 SER C C   1 
ATOM   3250 O O   . SER C 2 43  ? 28.720 47.871 13.999  1.00 23.16 ?  1497 SER C O   1 
ATOM   3251 C CB  . SER C 2 43  ? 26.711 49.780 15.511  1.00 30.66 ?  1497 SER C CB  1 
ATOM   3252 O OG  . SER C 2 43  ? 26.408 50.907 14.708  1.00 29.97 ?  1497 SER C OG  1 
ATOM   3253 N N   . ASN C 2 44  ? 29.332 49.970 13.466  1.00 17.42 ?  1498 ASN C N   1 
ATOM   3254 C CA  . ASN C 2 44  ? 29.845 49.603 12.151  1.00 22.19 ?  1498 ASN C CA  1 
ATOM   3255 C C   . ASN C 2 44  ? 31.341 49.871 12.012  1.00 21.34 ?  1498 ASN C C   1 
ATOM   3256 O O   . ASN C 2 44  ? 31.855 49.912 10.889  1.00 28.35 ?  1498 ASN C O   1 
ATOM   3257 C CB  . ASN C 2 44  ? 29.074 50.344 11.058  1.00 17.81 ?  1498 ASN C CB  1 
ATOM   3258 C CG  . ASN C 2 44  ? 29.366 51.833 11.046  1.00 42.91 ?  1498 ASN C CG  1 
ATOM   3259 O OD1 . ASN C 2 44  ? 29.649 52.435 12.084  1.00 40.79 ?  1498 ASN C OD1 1 
ATOM   3260 N ND2 . ASN C 2 44  ? 29.304 52.434 9.864   1.00 41.51 ?  1498 ASN C ND2 1 
ATOM   3261 N N   . GLY C 2 45  ? 32.054 50.045 13.126  1.00 15.01 ?  1499 GLY C N   1 
ATOM   3262 C CA  . GLY C 2 45  ? 33.448 50.432 13.081  1.00 17.60 ?  1499 GLY C CA  1 
ATOM   3263 C C   . GLY C 2 45  ? 34.402 49.253 13.151  1.00 15.09 ?  1499 GLY C C   1 
ATOM   3264 O O   . GLY C 2 45  ? 34.012 48.087 13.151  1.00 9.61  ?  1499 GLY C O   1 
ATOM   3265 N N   . TYR C 2 46  ? 35.689 49.586 13.207  1.00 13.15 ?  1500 TYR C N   1 
ATOM   3266 C CA  . TYR C 2 46  ? 36.743 48.595 13.355  1.00 10.61 ?  1500 TYR C CA  1 
ATOM   3267 C C   . TYR C 2 46  ? 36.889 48.182 14.817  1.00 14.11 ?  1500 TYR C C   1 
ATOM   3268 O O   . TYR C 2 46  ? 36.531 48.922 15.738  1.00 9.94  ?  1500 TYR C O   1 
ATOM   3269 C CB  . TYR C 2 46  ? 38.075 49.145 12.842  1.00 8.22  ?  1500 TYR C CB  1 
ATOM   3270 C CG  . TYR C 2 46  ? 38.144 49.338 11.343  1.00 13.19 ?  1500 TYR C CG  1 
ATOM   3271 C CD1 . TYR C 2 46  ? 37.523 50.421 10.730  1.00 16.48 ?  1500 TYR C CD1 1 
ATOM   3272 C CD2 . TYR C 2 46  ? 38.841 48.445 10.543  1.00 17.03 ?  1500 TYR C CD2 1 
ATOM   3273 C CE1 . TYR C 2 46  ? 37.589 50.601 9.360   1.00 16.13 ?  1500 TYR C CE1 1 
ATOM   3274 C CE2 . TYR C 2 46  ? 38.912 48.615 9.172   1.00 16.06 ?  1500 TYR C CE2 1 
ATOM   3275 C CZ  . TYR C 2 46  ? 38.285 49.694 8.587   1.00 20.10 ?  1500 TYR C CZ  1 
ATOM   3276 O OH  . TYR C 2 46  ? 38.354 49.868 7.224   1.00 25.97 ?  1500 TYR C OH  1 
ATOM   3277 N N   . PHE C 2 47  ? 37.434 46.985 15.021  1.00 8.66  ?  1501 PHE C N   1 
ATOM   3278 C CA  . PHE C 2 47  ? 37.751 46.487 16.354  1.00 9.16  ?  1501 PHE C CA  1 
ATOM   3279 C C   . PHE C 2 47  ? 39.171 46.901 16.721  1.00 12.04 ?  1501 PHE C C   1 
ATOM   3280 O O   . PHE C 2 47  ? 40.112 46.633 15.968  1.00 9.01  ?  1501 PHE C O   1 
ATOM   3281 C CB  . PHE C 2 47  ? 37.632 44.963 16.419  1.00 11.08 ?  1501 PHE C CB  1 
ATOM   3282 C CG  . PHE C 2 47  ? 36.231 44.440 16.248  1.00 8.78  ?  1501 PHE C CG  1 
ATOM   3283 C CD1 . PHE C 2 47  ? 35.609 44.463 15.011  1.00 12.72 ?  1501 PHE C CD1 1 
ATOM   3284 C CD2 . PHE C 2 47  ? 35.551 43.890 17.324  1.00 9.09  ?  1501 PHE C CD2 1 
ATOM   3285 C CE1 . PHE C 2 47  ? 34.326 43.968 14.852  1.00 11.12 ?  1501 PHE C CE1 1 
ATOM   3286 C CE2 . PHE C 2 47  ? 34.269 43.391 17.171  1.00 12.78 ?  1501 PHE C CE2 1 
ATOM   3287 C CZ  . PHE C 2 47  ? 33.657 43.430 15.935  1.00 13.36 ?  1501 PHE C CZ  1 
ATOM   3288 N N   . TYR C 2 48  ? 39.327 47.535 17.881  1.00 6.98  ?  1502 TYR C N   1 
ATOM   3289 C CA  . TYR C 2 48  ? 40.626 47.991 18.356  1.00 11.91 ?  1502 TYR C CA  1 
ATOM   3290 C C   . TYR C 2 48  ? 40.958 47.325 19.685  1.00 10.62 ?  1502 TYR C C   1 
ATOM   3291 O O   . TYR C 2 48  ? 40.065 46.931 20.440  1.00 11.50 ?  1502 TYR C O   1 
ATOM   3292 C CB  . TYR C 2 48  ? 40.658 49.515 18.518  1.00 10.18 ?  1502 TYR C CB  1 
ATOM   3293 C CG  . TYR C 2 48  ? 40.426 50.275 17.231  1.00 10.10 ?  1502 TYR C CG  1 
ATOM   3294 C CD1 . TYR C 2 48  ? 39.143 50.619 16.827  1.00 10.69 ?  1502 TYR C CD1 1 
ATOM   3295 C CD2 . TYR C 2 48  ? 41.490 50.652 16.422  1.00 11.94 ?  1502 TYR C CD2 1 
ATOM   3296 C CE1 . TYR C 2 48  ? 38.925 51.314 15.654  1.00 9.50  ?  1502 TYR C CE1 1 
ATOM   3297 C CE2 . TYR C 2 48  ? 41.282 51.348 15.245  1.00 7.81  ?  1502 TYR C CE2 1 
ATOM   3298 C CZ  . TYR C 2 48  ? 39.998 51.676 14.866  1.00 12.98 ?  1502 TYR C CZ  1 
ATOM   3299 O OH  . TYR C 2 48  ? 39.786 52.368 13.695  1.00 13.03 ?  1502 TYR C OH  1 
ATOM   3300 N N   . SER C 2 49  ? 42.253 47.208 19.969  1.00 9.98  ?  1503 SER C N   1 
ATOM   3301 C CA  . SER C 2 49  ? 42.698 46.553 21.190  1.00 7.86  ?  1503 SER C CA  1 
ATOM   3302 C C   . SER C 2 49  ? 42.547 47.481 22.391  1.00 13.58 ?  1503 SER C C   1 
ATOM   3303 O O   . SER C 2 49  ? 42.708 48.700 22.289  1.00 11.26 ?  1503 SER C O   1 
ATOM   3304 C CB  . SER C 2 49  ? 44.152 46.097 21.061  1.00 8.99  ?  1503 SER C CB  1 
ATOM   3305 O OG  . SER C 2 49  ? 45.023 47.194 20.851  1.00 14.02 ?  1503 SER C OG  1 
ATOM   3306 N N   . GLY C 2 50  ? 42.235 46.888 23.534  1.00 9.46  ?  1504 GLY C N   1 
ATOM   3307 C CA  . GLY C 2 50  ? 42.055 47.661 24.743  1.00 7.18  ?  1504 GLY C CA  1 
ATOM   3308 C C   . GLY C 2 50  ? 41.850 46.763 25.940  1.00 8.05  ?  1504 GLY C C   1 
ATOM   3309 O O   . GLY C 2 50  ? 42.134 45.565 25.895  1.00 11.67 ?  1504 GLY C O   1 
ATOM   3310 N N   . LYS C 2 51  ? 41.350 47.361 27.019  1.00 9.55  ?  1505 LYS C N   1 
ATOM   3311 C CA  . LYS C 2 51  ? 41.080 46.642 28.255  1.00 11.44 ?  1505 LYS C CA  1 
ATOM   3312 C C   . LYS C 2 51  ? 39.761 47.118 28.846  1.00 15.87 ?  1505 LYS C C   1 
ATOM   3313 O O   . LYS C 2 51  ? 39.400 48.292 28.734  1.00 14.03 ?  1505 LYS C O   1 
ATOM   3314 C CB  . LYS C 2 51  ? 42.195 46.837 29.293  1.00 12.86 ?  1505 LYS C CB  1 
ATOM   3315 C CG  . LYS C 2 51  ? 43.483 46.087 28.995  1.00 25.38 ?  1505 LYS C CG  1 
ATOM   3316 C CD  . LYS C 2 51  ? 44.414 46.124 30.199  1.00 45.18 ?  1505 LYS C CD  1 
ATOM   3317 C CE  . LYS C 2 51  ? 45.837 45.752 29.820  1.00 44.91 ?  1505 LYS C CE  1 
ATOM   3318 N NZ  . LYS C 2 51  ? 46.828 46.660 30.461  1.00 52.77 ?  1505 LYS C NZ  1 
ATOM   3319 N N   . ILE C 2 52  ? 39.049 46.192 29.481  1.00 13.36 ?  1506 ILE C N   1 
ATOM   3320 C CA  . ILE C 2 52  ? 37.839 46.531 30.222  1.00 17.57 ?  1506 ILE C CA  1 
ATOM   3321 C C   . ILE C 2 52  ? 38.241 47.145 31.556  1.00 16.72 ?  1506 ILE C C   1 
ATOM   3322 O O   . ILE C 2 52  ? 39.067 46.586 32.287  1.00 19.64 ?  1506 ILE C O   1 
ATOM   3323 C CB  . ILE C 2 52  ? 36.957 45.289 30.424  1.00 18.98 ?  1506 ILE C CB  1 
ATOM   3324 C CG1 . ILE C 2 52  ? 36.444 44.774 29.078  1.00 16.02 ?  1506 ILE C CG1 1 
ATOM   3325 C CG2 . ILE C 2 52  ? 35.799 45.602 31.361  1.00 17.48 ?  1506 ILE C CG2 1 
ATOM   3326 C CD1 . ILE C 2 52  ? 35.808 43.408 29.154  1.00 16.98 ?  1506 ILE C CD1 1 
ATOM   3327 N N   . THR C 2 53  ? 37.663 48.304 31.876  1.00 20.84 ?  1507 THR C N   1 
ATOM   3328 C CA  . THR C 2 53  ? 37.999 49.014 33.101  1.00 27.64 ?  1507 THR C CA  1 
ATOM   3329 C C   . THR C 2 53  ? 36.872 49.062 34.120  1.00 28.90 ?  1507 THR C C   1 
ATOM   3330 O O   . THR C 2 53  ? 37.151 49.233 35.311  1.00 31.55 ?  1507 THR C O   1 
ATOM   3331 C CB  . THR C 2 53  ? 38.429 50.455 32.788  1.00 24.66 ?  1507 THR C CB  1 
ATOM   3332 O OG1 . THR C 2 53  ? 37.381 51.129 32.081  1.00 28.74 ?  1507 THR C OG1 1 
ATOM   3333 C CG2 . THR C 2 53  ? 39.691 50.460 31.947  1.00 25.23 ?  1507 THR C CG2 1 
ATOM   3334 N N   . ARG C 2 54  ? 35.619 48.920 33.693  1.00 26.38 ?  1508 ARG C N   1 
ATOM   3335 C CA  . ARG C 2 54  ? 34.487 49.050 34.597  1.00 30.56 ?  1508 ARG C CA  1 
ATOM   3336 C C   . ARG C 2 54  ? 33.310 48.261 34.047  1.00 30.12 ?  1508 ARG C C   1 
ATOM   3337 O O   . ARG C 2 54  ? 33.054 48.277 32.840  1.00 19.61 ?  1508 ARG C O   1 
ATOM   3338 C CB  . ARG C 2 54  ? 34.097 50.522 34.784  1.00 30.72 ?  1508 ARG C CB  1 
ATOM   3339 C CG  . ARG C 2 54  ? 33.361 50.819 36.079  1.00 30.16 ?  1508 ARG C CG  1 
ATOM   3340 C CD  . ARG C 2 54  ? 32.580 52.123 35.984  1.00 35.03 ?  1508 ARG C CD  1 
ATOM   3341 N NE  . ARG C 2 54  ? 33.436 53.295 36.146  1.00 35.75 ?  1508 ARG C NE  1 
ATOM   3342 C CZ  . ARG C 2 54  ? 33.098 54.525 35.770  1.00 48.81 ?  1508 ARG C CZ  1 
ATOM   3343 N NH1 . ARG C 2 54  ? 31.916 54.747 35.211  1.00 58.92 ?  1508 ARG C NH1 1 
ATOM   3344 N NH2 . ARG C 2 54  ? 33.939 55.533 35.954  1.00 43.79 ?  1508 ARG C NH2 1 
ATOM   3345 N N   . ASP C 2 55  ? 32.605 47.567 34.937  1.00 26.75 ?  1509 ASP C N   1 
ATOM   3346 C CA  . ASP C 2 55  ? 31.360 46.886 34.587  1.00 27.71 ?  1509 ASP C CA  1 
ATOM   3347 C C   . ASP C 2 55  ? 30.226 47.883 34.790  1.00 30.26 ?  1509 ASP C C   1 
ATOM   3348 O O   . ASP C 2 55  ? 29.734 48.066 35.906  1.00 41.07 ?  1509 ASP C O   1 
ATOM   3349 C CB  . ASP C 2 55  ? 31.169 45.630 35.431  1.00 40.09 ?  1509 ASP C CB  1 
ATOM   3350 C CG  . ASP C 2 55  ? 30.137 44.682 34.847  1.00 47.72 ?  1509 ASP C CG  1 
ATOM   3351 O OD1 . ASP C 2 55  ? 29.160 45.161 34.232  1.00 45.15 ?  1509 ASP C OD1 1 
ATOM   3352 O OD2 . ASP C 2 55  ? 30.302 43.453 35.004  1.00 69.07 -1 1509 ASP C OD2 1 
ATOM   3353 N N   . VAL C 2 56  ? 29.816 48.541 33.703  1.00 27.13 ?  1510 VAL C N   1 
ATOM   3354 C CA  . VAL C 2 56  ? 28.768 49.552 33.797  1.00 24.52 ?  1510 VAL C CA  1 
ATOM   3355 C C   . VAL C 2 56  ? 27.419 48.907 34.094  1.00 37.84 ?  1510 VAL C C   1 
ATOM   3356 O O   . VAL C 2 56  ? 26.545 49.531 34.709  1.00 53.75 ?  1510 VAL C O   1 
ATOM   3357 C CB  . VAL C 2 56  ? 28.737 50.394 32.506  1.00 32.90 ?  1510 VAL C CB  1 
ATOM   3358 C CG1 . VAL C 2 56  ? 27.644 51.450 32.566  1.00 40.29 ?  1510 VAL C CG1 1 
ATOM   3359 C CG2 . VAL C 2 56  ? 30.093 51.045 32.270  1.00 33.06 ?  1510 VAL C CG2 1 
ATOM   3360 N N   . GLY C 2 57  ? 27.231 47.658 33.690  1.00 36.60 ?  1511 GLY C N   1 
ATOM   3361 C CA  . GLY C 2 57  ? 26.004 46.942 33.959  1.00 36.65 ?  1511 GLY C CA  1 
ATOM   3362 C C   . GLY C 2 57  ? 25.079 46.908 32.752  1.00 37.07 ?  1511 GLY C C   1 
ATOM   3363 O O   . GLY C 2 57  ? 25.191 47.704 31.816  1.00 36.55 ?  1511 GLY C O   1 
ATOM   3364 N N   . ALA C 2 58  ? 24.144 45.956 32.787  1.00 42.17 ?  1512 ALA C N   1 
ATOM   3365 C CA  . ALA C 2 58  ? 23.163 45.760 31.717  1.00 43.71 ?  1512 ALA C CA  1 
ATOM   3366 C C   . ALA C 2 58  ? 23.851 45.534 30.371  1.00 33.77 ?  1512 ALA C C   1 
ATOM   3367 O O   . ALA C 2 58  ? 23.496 46.133 29.354  1.00 32.13 ?  1512 ALA C O   1 
ATOM   3368 C CB  . ALA C 2 58  ? 22.182 46.933 31.645  1.00 43.19 ?  1512 ALA C CB  1 
ATOM   3369 N N   . GLY C 2 59  ? 24.852 44.656 30.374  1.00 33.60 ?  1513 GLY C N   1 
ATOM   3370 C CA  . GLY C 2 59  ? 25.598 44.366 29.167  1.00 31.96 ?  1513 GLY C CA  1 
ATOM   3371 C C   . GLY C 2 59  ? 26.517 45.468 28.697  1.00 27.27 ?  1513 GLY C C   1 
ATOM   3372 O O   . GLY C 2 59  ? 27.070 45.365 27.597  1.00 24.18 ?  1513 GLY C O   1 
ATOM   3373 N N   . LYS C 2 60  ? 26.696 46.521 29.489  1.00 23.04 ?  1514 LYS C N   1 
ATOM   3374 C CA  . LYS C 2 60  ? 27.567 47.633 29.142  1.00 17.67 ?  1514 LYS C CA  1 
ATOM   3375 C C   . LYS C 2 60  ? 28.872 47.543 29.922  1.00 22.04 ?  1514 LYS C C   1 
ATOM   3376 O O   . LYS C 2 60  ? 28.908 47.066 31.059  1.00 23.79 ?  1514 LYS C O   1 
ATOM   3377 C CB  . LYS C 2 60  ? 26.887 48.974 29.432  1.00 27.47 ?  1514 LYS C CB  1 
ATOM   3378 C CG  . LYS C 2 60  ? 26.174 49.595 28.245  1.00 43.94 ?  1514 LYS C CG  1 
ATOM   3379 C CD  . LYS C 2 60  ? 26.066 51.104 28.406  1.00 39.55 ?  1514 LYS C CD  1 
ATOM   3380 C CE  . LYS C 2 60  ? 24.748 51.501 29.054  1.00 46.02 ?  1514 LYS C CE  1 
ATOM   3381 N NZ  . LYS C 2 60  ? 23.722 51.883 28.044  1.00 61.69 ?  1514 LYS C NZ  1 
ATOM   3382 N N   . TYR C 2 61  ? 29.949 48.011 29.296  1.00 15.34 ?  1515 TYR C N   1 
ATOM   3383 C CA  . TYR C 2 61  ? 31.267 48.010 29.910  1.00 15.84 ?  1515 TYR C CA  1 
ATOM   3384 C C   . TYR C 2 61  ? 32.000 49.280 29.512  1.00 17.39 ?  1515 TYR C C   1 
ATOM   3385 O O   . TYR C 2 61  ? 31.841 49.781 28.396  1.00 21.32 ?  1515 TYR C O   1 
ATOM   3386 C CB  . TYR C 2 61  ? 32.099 46.788 29.491  1.00 11.58 ?  1515 TYR C CB  1 
ATOM   3387 C CG  . TYR C 2 61  ? 31.422 45.459 29.737  1.00 19.41 ?  1515 TYR C CG  1 
ATOM   3388 C CD1 . TYR C 2 61  ? 30.549 44.919 28.802  1.00 14.71 ?  1515 TYR C CD1 1 
ATOM   3389 C CD2 . TYR C 2 61  ? 31.662 44.742 30.902  1.00 21.24 ?  1515 TYR C CD2 1 
ATOM   3390 C CE1 . TYR C 2 61  ? 29.928 43.703 29.022  1.00 21.79 ?  1515 TYR C CE1 1 
ATOM   3391 C CE2 . TYR C 2 61  ? 31.047 43.525 31.131  1.00 22.95 ?  1515 TYR C CE2 1 
ATOM   3392 C CZ  . TYR C 2 61  ? 30.181 43.010 30.188  1.00 18.00 ?  1515 TYR C CZ  1 
ATOM   3393 O OH  . TYR C 2 61  ? 29.566 41.799 30.410  1.00 25.93 ?  1515 TYR C OH  1 
ATOM   3394 N N   . LYS C 2 62  ? 32.802 49.800 30.437  1.00 17.48 ?  1516 LYS C N   1 
ATOM   3395 C CA  . LYS C 2 62  ? 33.709 50.895 30.128  1.00 16.21 ?  1516 LYS C CA  1 
ATOM   3396 C C   . LYS C 2 62  ? 35.035 50.310 29.665  1.00 20.34 ?  1516 LYS C C   1 
ATOM   3397 O O   . LYS C 2 62  ? 35.603 49.437 30.329  1.00 18.49 ?  1516 LYS C O   1 
ATOM   3398 C CB  . LYS C 2 62  ? 33.920 51.810 31.334  1.00 19.33 ?  1516 LYS C CB  1 
ATOM   3399 C CG  . LYS C 2 62  ? 34.678 53.085 30.995  1.00 25.64 ?  1516 LYS C CG  1 
ATOM   3400 C CD  . LYS C 2 62  ? 34.450 54.162 32.039  1.00 42.74 ?  1516 LYS C CD  1 
ATOM   3401 C CE  . LYS C 2 62  ? 32.991 54.583 32.097  1.00 43.78 ?  1516 LYS C CE  1 
ATOM   3402 N NZ  . LYS C 2 62  ? 32.673 55.641 31.099  1.00 36.30 ?  1516 LYS C NZ  1 
ATOM   3403 N N   . LEU C 2 63  ? 35.518 50.788 28.524  1.00 12.94 ?  1517 LEU C N   1 
ATOM   3404 C CA  . LEU C 2 63  ? 36.683 50.223 27.865  1.00 11.23 ?  1517 LEU C CA  1 
ATOM   3405 C C   . LEU C 2 63  ? 37.728 51.307 27.659  1.00 15.93 ?  1517 LEU C C   1 
ATOM   3406 O O   . LEU C 2 63  ? 37.430 52.361 27.088  1.00 14.51 ?  1517 LEU C O   1 
ATOM   3407 C CB  . LEU C 2 63  ? 36.291 49.604 26.522  1.00 16.99 ?  1517 LEU C CB  1 
ATOM   3408 C CG  . LEU C 2 63  ? 37.239 48.564 25.931  1.00 25.68 ?  1517 LEU C CG  1 
ATOM   3409 C CD1 . LEU C 2 63  ? 36.431 47.496 25.227  1.00 26.61 ?  1517 LEU C CD1 1 
ATOM   3410 C CD2 . LEU C 2 63  ? 38.228 49.211 24.974  1.00 22.76 ?  1517 LEU C CD2 1 
ATOM   3411 N N   . LEU C 2 64  ? 38.947 51.049 28.123  1.00 12.87 ?  1518 LEU C N   1 
ATOM   3412 C CA  . LEU C 2 64  ? 40.089 51.909 27.841  1.00 11.11 ?  1518 LEU C CA  1 
ATOM   3413 C C   . LEU C 2 64  ? 40.874 51.279 26.698  1.00 16.91 ?  1518 LEU C C   1 
ATOM   3414 O O   . LEU C 2 64  ? 41.555 50.265 26.886  1.00 11.55 ?  1518 LEU C O   1 
ATOM   3415 C CB  . LEU C 2 64  ? 40.971 52.092 29.073  1.00 11.59 ?  1518 LEU C CB  1 
ATOM   3416 C CG  . LEU C 2 64  ? 42.240 52.913 28.833  1.00 16.37 ?  1518 LEU C CG  1 
ATOM   3417 C CD1 . LEU C 2 64  ? 41.883 54.348 28.476  1.00 16.17 ?  1518 LEU C CD1 1 
ATOM   3418 C CD2 . LEU C 2 64  ? 43.162 52.867 30.044  1.00 18.51 ?  1518 LEU C CD2 1 
ATOM   3419 N N   . PHE C 2 65  ? 40.771 51.872 25.514  1.00 6.85  ?  1519 PHE C N   1 
ATOM   3420 C CA  . PHE C 2 65  ? 41.543 51.386 24.383  1.00 9.39  ?  1519 PHE C CA  1 
ATOM   3421 C C   . PHE C 2 65  ? 43.010 51.758 24.557  1.00 13.68 ?  1519 PHE C C   1 
ATOM   3422 O O   . PHE C 2 65  ? 43.349 52.746 25.214  1.00 11.37 ?  1519 PHE C O   1 
ATOM   3423 C CB  . PHE C 2 65  ? 40.989 51.956 23.078  1.00 8.12  ?  1519 PHE C CB  1 
ATOM   3424 C CG  . PHE C 2 65  ? 39.625 51.432 22.728  1.00 10.00 ?  1519 PHE C CG  1 
ATOM   3425 C CD1 . PHE C 2 65  ? 39.486 50.260 22.003  1.00 7.04  ?  1519 PHE C CD1 1 
ATOM   3426 C CD2 . PHE C 2 65  ? 38.484 52.102 23.140  1.00 8.41  ?  1519 PHE C CD2 1 
ATOM   3427 C CE1 . PHE C 2 65  ? 38.231 49.768 21.685  1.00 11.04 ?  1519 PHE C CE1 1 
ATOM   3428 C CE2 . PHE C 2 65  ? 37.227 51.617 22.828  1.00 8.34  ?  1519 PHE C CE2 1 
ATOM   3429 C CZ  . PHE C 2 65  ? 37.100 50.447 22.098  1.00 11.31 ?  1519 PHE C CZ  1 
ATOM   3430 N N   . ASP C 2 66  ? 43.887 50.941 23.969  1.00 10.72 ?  1520 ASP C N   1 
ATOM   3431 C CA  . ASP C 2 66  ? 45.322 51.174 24.096  1.00 11.43 ?  1520 ASP C CA  1 
ATOM   3432 C C   . ASP C 2 66  ? 45.733 52.545 23.576  1.00 15.17 ?  1520 ASP C C   1 
ATOM   3433 O O   . ASP C 2 66  ? 46.779 53.065 23.981  1.00 15.21 ?  1520 ASP C O   1 
ATOM   3434 C CB  . ASP C 2 66  ? 46.096 50.084 23.354  1.00 12.51 ?  1520 ASP C CB  1 
ATOM   3435 C CG  . ASP C 2 66  ? 46.025 48.741 24.053  1.00 14.30 ?  1520 ASP C CG  1 
ATOM   3436 O OD1 . ASP C 2 66  ? 46.055 48.716 25.301  1.00 18.26 ?  1520 ASP C OD1 1 
ATOM   3437 O OD2 . ASP C 2 66  ? 45.941 47.708 23.355  1.00 18.27 -1 1520 ASP C OD2 1 
ATOM   3438 N N   . ASP C 2 67  ? 44.932 53.141 22.695  1.00 11.82 ?  1521 ASP C N   1 
ATOM   3439 C CA  . ASP C 2 67  ? 45.203 54.460 22.144  1.00 12.58 ?  1521 ASP C CA  1 
ATOM   3440 C C   . ASP C 2 67  ? 44.772 55.595 23.066  1.00 11.49 ?  1521 ASP C C   1 
ATOM   3441 O O   . ASP C 2 67  ? 44.970 56.763 22.714  1.00 13.43 ?  1521 ASP C O   1 
ATOM   3442 C CB  . ASP C 2 67  ? 44.507 54.604 20.790  1.00 13.62 ?  1521 ASP C CB  1 
ATOM   3443 C CG  . ASP C 2 67  ? 43.042 54.208 20.844  1.00 13.36 ?  1521 ASP C CG  1 
ATOM   3444 O OD1 . ASP C 2 67  ? 42.290 54.817 21.633  1.00 12.31 ?  1521 ASP C OD1 1 
ATOM   3445 O OD2 . ASP C 2 67  ? 42.642 53.287 20.100  1.00 14.28 -1 1521 ASP C OD2 1 
ATOM   3446 N N   . GLY C 2 68  ? 44.185 55.291 24.222  1.00 7.47  ?  1522 GLY C N   1 
ATOM   3447 C CA  . GLY C 2 68  ? 43.779 56.304 25.173  1.00 10.54 ?  1522 GLY C CA  1 
ATOM   3448 C C   . GLY C 2 68  ? 42.307 56.656 25.150  1.00 15.47 ?  1522 GLY C C   1 
ATOM   3449 O O   . GLY C 2 68  ? 41.831 57.312 26.085  1.00 17.17 ?  1522 GLY C O   1 
ATOM   3450 N N   . TYR C 2 69  ? 41.576 56.249 24.116  1.00 10.78 ?  1523 TYR C N   1 
ATOM   3451 C CA  . TYR C 2 69  ? 40.143 56.508 24.061  1.00 10.52 ?  1523 TYR C CA  1 
ATOM   3452 C C   . TYR C 2 69  ? 39.415 55.621 25.063  1.00 11.33 ?  1523 TYR C C   1 
ATOM   3453 O O   . TYR C 2 69  ? 39.640 54.408 25.115  1.00 12.90 ?  1523 TYR C O   1 
ATOM   3454 C CB  . TYR C 2 69  ? 39.619 56.262 22.646  1.00 9.09  ?  1523 TYR C CB  1 
ATOM   3455 C CG  . TYR C 2 69  ? 38.131 56.473 22.471  1.00 7.71  ?  1523 TYR C CG  1 
ATOM   3456 C CD1 . TYR C 2 69  ? 37.489 57.575 23.026  1.00 10.62 ?  1523 TYR C CD1 1 
ATOM   3457 C CD2 . TYR C 2 69  ? 37.370 55.575 21.737  1.00 12.14 ?  1523 TYR C CD2 1 
ATOM   3458 C CE1 . TYR C 2 69  ? 36.127 57.768 22.858  1.00 13.00 ?  1523 TYR C CE1 1 
ATOM   3459 C CE2 . TYR C 2 69  ? 36.012 55.759 21.563  1.00 11.09 ?  1523 TYR C CE2 1 
ATOM   3460 C CZ  . TYR C 2 69  ? 35.395 56.855 22.125  1.00 11.91 ?  1523 TYR C CZ  1 
ATOM   3461 O OH  . TYR C 2 69  ? 34.041 57.035 21.950  1.00 14.16 ?  1523 TYR C OH  1 
ATOM   3462 N N   . GLU C 2 70  ? 38.545 56.228 25.867  1.00 12.30 ?  1524 GLU C N   1 
ATOM   3463 C CA  . GLU C 2 70  ? 37.765 55.509 26.864  1.00 14.15 ?  1524 GLU C CA  1 
ATOM   3464 C C   . GLU C 2 70  ? 36.293 55.831 26.669  1.00 14.17 ?  1524 GLU C C   1 
ATOM   3465 O O   . GLU C 2 70  ? 35.920 57.004 26.571  1.00 16.94 ?  1524 GLU C O   1 
ATOM   3466 C CB  . GLU C 2 70  ? 38.208 55.873 28.284  1.00 12.27 ?  1524 GLU C CB  1 
ATOM   3467 C CG  . GLU C 2 70  ? 37.603 54.990 29.361  1.00 17.60 ?  1524 GLU C CG  1 
ATOM   3468 C CD  . GLU C 2 70  ? 38.283 55.158 30.705  1.00 30.27 ?  1524 GLU C CD  1 
ATOM   3469 O OE1 . GLU C 2 70  ? 39.016 56.155 30.882  1.00 33.20 ?  1524 GLU C OE1 1 
ATOM   3470 O OE2 . GLU C 2 70  ? 38.086 54.292 31.583  1.00 32.37 -1 1524 GLU C OE2 1 
ATOM   3471 N N   . CYS C 2 71  ? 35.461 54.795 26.613  1.00 10.38 ?  1525 CYS C N   1 
ATOM   3472 C CA  . CYS C 2 71  ? 34.030 54.981 26.412  1.00 11.31 ?  1525 CYS C CA  1 
ATOM   3473 C C   . CYS C 2 71  ? 33.304 53.714 26.839  1.00 10.06 ?  1525 CYS C C   1 
ATOM   3474 O O   . CYS C 2 71  ? 33.922 52.691 27.142  1.00 15.97 ?  1525 CYS C O   1 
ATOM   3475 C CB  . CYS C 2 71  ? 33.710 55.328 24.953  1.00 15.41 ?  1525 CYS C CB  1 
ATOM   3476 S SG  . CYS C 2 71  ? 33.934 53.957 23.790  1.00 15.18 ?  1525 CYS C SG  1 
ATOM   3477 N N   . ASP C 2 72  ? 31.976 53.802 26.863  1.00 11.85 ?  1526 ASP C N   1 
ATOM   3478 C CA  . ASP C 2 72  ? 31.123 52.665 27.180  1.00 14.11 ?  1526 ASP C CA  1 
ATOM   3479 C C   . ASP C 2 72  ? 30.865 51.853 25.917  1.00 15.17 ?  1526 ASP C C   1 
ATOM   3480 O O   . ASP C 2 72  ? 30.540 52.415 24.866  1.00 13.47 ?  1526 ASP C O   1 
ATOM   3481 C CB  . ASP C 2 72  ? 29.802 53.132 27.792  1.00 21.64 ?  1526 ASP C CB  1 
ATOM   3482 C CG  . ASP C 2 72  ? 29.970 53.668 29.200  1.00 27.12 ?  1526 ASP C CG  1 
ATOM   3483 O OD1 . ASP C 2 72  ? 31.098 53.606 29.729  1.00 26.78 ?  1526 ASP C OD1 1 
ATOM   3484 O OD2 . ASP C 2 72  ? 28.975 54.152 29.777  1.00 36.27 -1 1526 ASP C OD2 1 
ATOM   3485 N N   . VAL C 2 73  ? 31.011 50.535 26.024  1.00 14.74 ?  1527 VAL C N   1 
ATOM   3486 C CA  . VAL C 2 73  ? 30.903 49.633 24.884  1.00 15.71 ?  1527 VAL C CA  1 
ATOM   3487 C C   . VAL C 2 73  ? 29.966 48.494 25.260  1.00 18.55 ?  1527 VAL C C   1 
ATOM   3488 O O   . VAL C 2 73  ? 30.078 47.927 26.353  1.00 15.82 ?  1527 VAL C O   1 
ATOM   3489 C CB  . VAL C 2 73  ? 32.279 49.085 24.457  1.00 16.17 ?  1527 VAL C CB  1 
ATOM   3490 C CG1 . VAL C 2 73  ? 32.126 48.028 23.374  1.00 15.08 ?  1527 VAL C CG1 1 
ATOM   3491 C CG2 . VAL C 2 73  ? 33.178 50.215 23.973  1.00 17.13 ?  1527 VAL C CG2 1 
ATOM   3492 N N   . LEU C 2 74  ? 29.041 48.167 24.362  1.00 11.09 ?  1528 LEU C N   1 
ATOM   3493 C CA  . LEU C 2 74  ? 28.161 47.030 24.579  1.00 18.39 ?  1528 LEU C CA  1 
ATOM   3494 C C   . LEU C 2 74  ? 28.933 45.726 24.420  1.00 14.78 ?  1528 LEU C C   1 
ATOM   3495 O O   . LEU C 2 74  ? 29.853 45.618 23.604  1.00 13.97 ?  1528 LEU C O   1 
ATOM   3496 C CB  . LEU C 2 74  ? 26.985 47.070 23.604  1.00 15.02 ?  1528 LEU C CB  1 
ATOM   3497 C CG  . LEU C 2 74  ? 26.014 48.240 23.770  1.00 22.44 ?  1528 LEU C CG  1 
ATOM   3498 C CD1 . LEU C 2 74  ? 25.047 48.313 22.598  1.00 27.45 ?  1528 LEU C CD1 1 
ATOM   3499 C CD2 . LEU C 2 74  ? 25.258 48.119 25.082  1.00 25.60 ?  1528 LEU C CD2 1 
ATOM   3500 N N   . GLY C 2 75  ? 28.546 44.725 25.216  1.00 15.25 ?  1529 GLY C N   1 
ATOM   3501 C CA  . GLY C 2 75  ? 29.241 43.448 25.185  1.00 9.75  ?  1529 GLY C CA  1 
ATOM   3502 C C   . GLY C 2 75  ? 29.210 42.774 23.827  1.00 10.99 ?  1529 GLY C C   1 
ATOM   3503 O O   . GLY C 2 75  ? 30.105 41.990 23.498  1.00 14.51 ?  1529 GLY C O   1 
ATOM   3504 N N   . LYS C 2 76  ? 28.188 43.067 23.020  1.00 9.64  ?  1530 LYS C N   1 
ATOM   3505 C CA  . LYS C 2 76  ? 28.134 42.534 21.664  1.00 12.10 ?  1530 LYS C CA  1 
ATOM   3506 C C   . LYS C 2 76  ? 29.284 43.035 20.799  1.00 11.18 ?  1530 LYS C C   1 
ATOM   3507 O O   . LYS C 2 76  ? 29.598 42.409 19.781  1.00 11.30 ?  1530 LYS C O   1 
ATOM   3508 C CB  . LYS C 2 76  ? 26.801 42.900 21.011  1.00 13.04 ?  1530 LYS C CB  1 
ATOM   3509 C CG  . LYS C 2 76  ? 26.696 44.365 20.619  1.00 21.42 ?  1530 LYS C CG  1 
ATOM   3510 C CD  . LYS C 2 76  ? 25.451 44.633 19.795  1.00 26.32 ?  1530 LYS C CD  1 
ATOM   3511 C CE  . LYS C 2 76  ? 25.478 46.032 19.200  1.00 34.95 ?  1530 LYS C CE  1 
ATOM   3512 N NZ  . LYS C 2 76  ? 26.450 46.145 18.078  1.00 38.00 ?  1530 LYS C NZ  1 
ATOM   3513 N N   . ASP C 2 77  ? 29.919 44.142 21.181  1.00 10.14 ?  1531 ASP C N   1 
ATOM   3514 C CA  . ASP C 2 77  ? 31.007 44.735 20.417  1.00 9.49  ?  1531 ASP C CA  1 
ATOM   3515 C C   . ASP C 2 77  ? 32.380 44.347 20.947  1.00 10.64 ?  1531 ASP C C   1 
ATOM   3516 O O   . ASP C 2 77  ? 33.385 44.889 20.477  1.00 8.85  ?  1531 ASP C O   1 
ATOM   3517 C CB  . ASP C 2 77  ? 30.875 46.260 20.411  1.00 14.16 ?  1531 ASP C CB  1 
ATOM   3518 C CG  . ASP C 2 77  ? 29.599 46.735 19.746  1.00 21.91 ?  1531 ASP C CG  1 
ATOM   3519 O OD1 . ASP C 2 77  ? 29.107 46.039 18.833  1.00 25.15 ?  1531 ASP C OD1 1 
ATOM   3520 O OD2 . ASP C 2 77  ? 29.090 47.806 20.137  1.00 32.88 -1 1531 ASP C OD2 1 
ATOM   3521 N N   . ILE C 2 78  ? 32.450 43.425 21.903  1.00 10.72 ?  1532 ILE C N   1 
ATOM   3522 C CA  . ILE C 2 78  ? 33.688 43.100 22.602  1.00 6.91  ?  1532 ILE C CA  1 
ATOM   3523 C C   . ILE C 2 78  ? 34.088 41.671 22.266  1.00 13.47 ?  1532 ILE C C   1 
ATOM   3524 O O   . ILE C 2 78  ? 33.254 40.760 22.314  1.00 7.45  ?  1532 ILE C O   1 
ATOM   3525 C CB  . ILE C 2 78  ? 33.539 43.282 24.124  1.00 7.76  ?  1532 ILE C CB  1 
ATOM   3526 C CG1 . ILE C 2 78  ? 33.202 44.737 24.452  1.00 10.10 ?  1532 ILE C CG1 1 
ATOM   3527 C CG2 . ILE C 2 78  ? 34.804 42.846 24.848  1.00 14.36 ?  1532 ILE C CG2 1 
ATOM   3528 C CD1 . ILE C 2 78  ? 32.961 44.989 25.925  1.00 8.62  ?  1532 ILE C CD1 1 
ATOM   3529 N N   . LEU C 2 79  ? 35.361 41.480 21.932  1.00 7.15  ?  1533 LEU C N   1 
ATOM   3530 C CA  . LEU C 2 79  ? 35.936 40.162 21.701  1.00 6.51  ?  1533 LEU C CA  1 
ATOM   3531 C C   . LEU C 2 79  ? 36.960 39.870 22.788  1.00 17.56 ?  1533 LEU C C   1 
ATOM   3532 O O   . LEU C 2 79  ? 37.890 40.657 22.996  1.00 10.19 ?  1533 LEU C O   1 
ATOM   3533 C CB  . LEU C 2 79  ? 36.597 40.079 20.323  1.00 8.98  ?  1533 LEU C CB  1 
ATOM   3534 C CG  . LEU C 2 79  ? 35.713 40.337 19.103  1.00 10.85 ?  1533 LEU C CG  1 
ATOM   3535 C CD1 . LEU C 2 79  ? 36.563 40.426 17.845  1.00 8.94  ?  1533 LEU C CD1 1 
ATOM   3536 C CD2 . LEU C 2 79  ? 34.663 39.245 18.968  1.00 7.85  ?  1533 LEU C CD2 1 
ATOM   3537 N N   . LEU C 2 80  ? 36.789 38.743 23.479  1.00 16.14 ?  1534 LEU C N   1 
ATOM   3538 C CA  . LEU C 2 80  ? 37.710 38.332 24.537  1.00 24.31 ?  1534 LEU C CA  1 
ATOM   3539 C C   . LEU C 2 80  ? 38.728 37.366 23.935  1.00 27.28 ?  1534 LEU C C   1 
ATOM   3540 O O   . LEU C 2 80  ? 38.664 36.149 24.114  1.00 26.88 ?  1534 LEU C O   1 
ATOM   3541 C CB  . LEU C 2 80  ? 36.949 37.710 25.707  1.00 21.16 ?  1534 LEU C CB  1 
ATOM   3542 C CG  . LEU C 2 80  ? 37.774 37.267 26.920  1.00 53.95 ?  1534 LEU C CG  1 
ATOM   3543 C CD1 . LEU C 2 80  ? 38.803 38.325 27.290  1.00 47.98 ?  1534 LEU C CD1 1 
ATOM   3544 C CD2 . LEU C 2 80  ? 36.877 36.948 28.109  1.00 43.36 ?  1534 LEU C CD2 1 
ATOM   3545 N N   . CYS C 2 81  ? 39.677 37.929 23.191  1.00 19.29 ?  1535 CYS C N   1 
ATOM   3546 C CA  . CYS C 2 81  ? 40.790 37.157 22.655  1.00 17.03 ?  1535 CYS C CA  1 
ATOM   3547 C C   . CYS C 2 81  ? 42.058 37.991 22.748  1.00 22.46 ?  1535 CYS C C   1 
ATOM   3548 O O   . CYS C 2 81  ? 42.090 39.140 22.296  1.00 20.15 ?  1535 CYS C O   1 
ATOM   3549 C CB  . CYS C 2 81  ? 40.532 36.712 21.207  1.00 25.99 ?  1535 CYS C CB  1 
ATOM   3550 S SG  . CYS C 2 81  ? 40.443 38.025 19.971  1.00 32.92 ?  1535 CYS C SG  1 
ATOM   3551 N N   . ASP C 2 82  ? 43.087 37.414 23.355  1.00 15.93 ?  1536 ASP C N   1 
ATOM   3552 C CA  . ASP C 2 82  ? 44.379 38.068 23.502  1.00 15.40 ?  1536 ASP C CA  1 
ATOM   3553 C C   . ASP C 2 82  ? 45.454 37.008 23.700  1.00 18.36 ?  1536 ASP C C   1 
ATOM   3554 O O   . ASP C 2 82  ? 45.407 36.252 24.678  1.00 26.14 ?  1536 ASP C O   1 
ATOM   3555 C CB  . ASP C 2 82  ? 44.371 39.051 24.673  1.00 18.63 ?  1536 ASP C CB  1 
ATOM   3556 C CG  . ASP C 2 82  ? 45.715 39.723 24.873  1.00 24.43 ?  1536 ASP C CG  1 
ATOM   3557 O OD1 . ASP C 2 82  ? 46.237 40.312 23.901  1.00 18.73 ?  1536 ASP C OD1 1 
ATOM   3558 O OD2 . ASP C 2 82  ? 46.252 39.660 25.999  1.00 23.25 -1 1536 ASP C OD2 1 
ATOM   3559 N N   . PRO C 2 83  ? 46.432 36.908 22.788  1.00 20.33 ?  1537 PRO C N   1 
ATOM   3560 C CA  . PRO C 2 83  ? 46.494 37.746 21.586  1.00 21.19 ?  1537 PRO C CA  1 
ATOM   3561 C C   . PRO C 2 83  ? 45.518 37.285 20.509  1.00 20.77 ?  1537 PRO C C   1 
ATOM   3562 O O   . PRO C 2 83  ? 44.881 36.242 20.669  1.00 15.56 ?  1537 PRO C O   1 
ATOM   3563 C CB  . PRO C 2 83  ? 47.940 37.575 21.120  1.00 20.10 ?  1537 PRO C CB  1 
ATOM   3564 C CG  . PRO C 2 83  ? 48.307 36.206 21.576  1.00 28.32 ?  1537 PRO C CG  1 
ATOM   3565 C CD  . PRO C 2 83  ? 47.580 35.988 22.880  1.00 18.92 ?  1537 PRO C CD  1 
ATOM   3566 N N   . ILE C 2 84  ? 45.388 38.073 19.447  1.00 16.00 ?  1538 ILE C N   1 
ATOM   3567 C CA  . ILE C 2 84  ? 44.593 37.641 18.294  1.00 17.12 ?  1538 ILE C CA  1 
ATOM   3568 C C   . ILE C 2 84  ? 45.149 36.317 17.787  1.00 19.06 ?  1538 ILE C C   1 
ATOM   3569 O O   . ILE C 2 84  ? 46.371 36.202 17.573  1.00 16.28 ?  1538 ILE C O   1 
ATOM   3570 C CB  . ILE C 2 84  ? 44.620 38.715 17.193  1.00 18.61 ?  1538 ILE C CB  1 
ATOM   3571 C CG1 . ILE C 2 84  ? 43.981 40.008 17.705  1.00 15.47 ?  1538 ILE C CG1 1 
ATOM   3572 C CG2 . ILE C 2 84  ? 43.914 38.228 15.940  1.00 11.31 ?  1538 ILE C CG2 1 
ATOM   3573 C CD1 . ILE C 2 84  ? 44.256 41.210 16.832  1.00 14.96 ?  1538 ILE C CD1 1 
ATOM   3574 N N   . PRO C 2 85  ? 44.325 35.289 17.601  1.00 12.65 ?  1539 PRO C N   1 
ATOM   3575 C CA  . PRO C 2 85  ? 44.860 33.946 17.349  1.00 14.43 ?  1539 PRO C CA  1 
ATOM   3576 C C   . PRO C 2 85  ? 45.584 33.845 16.015  1.00 14.89 ?  1539 PRO C C   1 
ATOM   3577 O O   . PRO C 2 85  ? 45.362 34.625 15.086  1.00 9.54  ?  1539 PRO C O   1 
ATOM   3578 C CB  . PRO C 2 85  ? 43.612 33.053 17.366  1.00 14.98 ?  1539 PRO C CB  1 
ATOM   3579 C CG  . PRO C 2 85  ? 42.553 33.867 18.043  1.00 17.63 ?  1539 PRO C CG  1 
ATOM   3580 C CD  . PRO C 2 85  ? 42.857 35.289 17.702  1.00 12.95 ?  1539 PRO C CD  1 
ATOM   3581 N N   . LEU C 2 86  ? 46.467 32.851 15.938  1.00 18.83 ?  1540 LEU C N   1 
ATOM   3582 C CA  . LEU C 2 86  ? 47.181 32.570 14.701  1.00 19.69 ?  1540 LEU C CA  1 
ATOM   3583 C C   . LEU C 2 86  ? 46.201 32.240 13.582  1.00 17.58 ?  1540 LEU C C   1 
ATOM   3584 O O   . LEU C 2 86  ? 45.130 31.673 13.813  1.00 14.80 ?  1540 LEU C O   1 
ATOM   3585 C CB  . LEU C 2 86  ? 48.156 31.408 14.901  1.00 30.54 ?  1540 LEU C CB  1 
ATOM   3586 C CG  . LEU C 2 86  ? 49.260 31.605 15.940  1.00 39.32 ?  1540 LEU C CG  1 
ATOM   3587 C CD1 . LEU C 2 86  ? 49.865 30.269 16.340  1.00 39.88 ?  1540 LEU C CD1 1 
ATOM   3588 C CD2 . LEU C 2 86  ? 50.328 32.537 15.403  1.00 35.35 ?  1540 LEU C CD2 1 
ATOM   3589 N N   . ASP C 2 87  ? 46.581 32.613 12.359  1.00 12.58 ?  1541 ASP C N   1 
ATOM   3590 C CA  . ASP C 2 87  ? 45.827 32.444 11.118  1.00 16.62 ?  1541 ASP C CA  1 
ATOM   3591 C C   . ASP C 2 87  ? 44.623 33.372 11.019  1.00 9.91  ?  1541 ASP C C   1 
ATOM   3592 O O   . ASP C 2 87  ? 43.874 33.284 10.039  1.00 15.00 ?  1541 ASP C O   1 
ATOM   3593 C CB  . ASP C 2 87  ? 45.356 30.997 10.900  1.00 21.02 ?  1541 ASP C CB  1 
ATOM   3594 C CG  . ASP C 2 87  ? 46.429 30.123 10.285  1.00 37.70 ?  1541 ASP C CG  1 
ATOM   3595 O OD1 . ASP C 2 87  ? 47.624 30.458 10.428  1.00 32.70 ?  1541 ASP C OD1 1 
ATOM   3596 O OD2 . ASP C 2 87  ? 46.078 29.102 9.657   1.00 66.51 -1 1541 ASP C OD2 1 
ATOM   3597 N N   . THR C 2 88  ? 44.412 34.261 11.986  1.00 15.32 ?  1542 THR C N   1 
ATOM   3598 C CA  . THR C 2 88  ? 43.322 35.222 11.889  1.00 9.69  ?  1542 THR C CA  1 
ATOM   3599 C C   . THR C 2 88  ? 43.615 36.250 10.805  1.00 13.13 ?  1542 THR C C   1 
ATOM   3600 O O   . THR C 2 88  ? 44.738 36.749 10.687  1.00 12.83 ?  1542 THR C O   1 
ATOM   3601 C CB  . THR C 2 88  ? 43.115 35.936 13.225  1.00 7.59  ?  1542 THR C CB  1 
ATOM   3602 O OG1 . THR C 2 88  ? 42.968 34.971 14.277  1.00 7.94  ?  1542 THR C OG1 1 
ATOM   3603 C CG2 . THR C 2 88  ? 41.879 36.827 13.174  1.00 9.75  ?  1542 THR C CG2 1 
ATOM   3604 N N   . GLU C 2 89  ? 42.599 36.570 10.007  1.00 6.74  ?  1543 GLU C N   1 
ATOM   3605 C CA  . GLU C 2 89  ? 42.713 37.675 9.067   1.00 9.07  ?  1543 GLU C CA  1 
ATOM   3606 C C   . GLU C 2 89  ? 42.447 38.984 9.799   1.00 16.76 ?  1543 GLU C C   1 
ATOM   3607 O O   . GLU C 2 89  ? 41.404 39.147 10.442  1.00 10.63 ?  1543 GLU C O   1 
ATOM   3608 C CB  . GLU C 2 89  ? 41.748 37.512 7.895   1.00 11.98 ?  1543 GLU C CB  1 
ATOM   3609 C CG  . GLU C 2 89  ? 42.042 38.477 6.753   1.00 22.23 ?  1543 GLU C CG  1 
ATOM   3610 C CD  . GLU C 2 89  ? 41.010 38.420 5.645   1.00 36.10 ?  1543 GLU C CD  1 
ATOM   3611 O OE1 . GLU C 2 89  ? 41.262 37.737 4.631   1.00 55.43 ?  1543 GLU C OE1 1 
ATOM   3612 O OE2 . GLU C 2 89  ? 39.949 39.066 5.786   1.00 40.42 -1 1543 GLU C OE2 1 
ATOM   3613 N N   . VAL C 2 90  ? 43.398 39.910 9.712   1.00 12.60 ?  1544 VAL C N   1 
ATOM   3614 C CA  . VAL C 2 90  ? 43.346 41.174 10.425  1.00 10.85 ?  1544 VAL C CA  1 
ATOM   3615 C C   . VAL C 2 90  ? 43.573 42.308 9.430   1.00 15.61 ?  1544 VAL C C   1 
ATOM   3616 O O   . VAL C 2 90  ? 43.778 42.087 8.237   1.00 13.77 ?  1544 VAL C O   1 
ATOM   3617 C CB  . VAL C 2 90  ? 44.379 41.240 11.569  1.00 9.48  ?  1544 VAL C CB  1 
ATOM   3618 C CG1 . VAL C 2 90  ? 44.160 40.105 12.557  1.00 10.68 ?  1544 VAL C CG1 1 
ATOM   3619 C CG2 . VAL C 2 90  ? 45.794 41.199 11.006  1.00 9.13  ?  1544 VAL C CG2 1 
ATOM   3620 N N   . THR C 2 91  ? 43.528 43.534 9.943   1.00 10.32 ?  1545 THR C N   1 
ATOM   3621 C CA  . THR C 2 91  ? 43.878 44.729 9.187   1.00 7.81  ?  1545 THR C CA  1 
ATOM   3622 C C   . THR C 2 91  ? 45.088 45.362 9.855   1.00 11.88 ?  1545 THR C C   1 
ATOM   3623 O O   . THR C 2 91  ? 45.018 45.758 11.024  1.00 14.21 ?  1545 THR C O   1 
ATOM   3624 C CB  . THR C 2 91  ? 42.709 45.715 9.135   1.00 16.08 ?  1545 THR C CB  1 
ATOM   3625 O OG1 . THR C 2 91  ? 41.588 45.089 8.497   1.00 11.40 ?  1545 THR C OG1 1 
ATOM   3626 C CG2 . THR C 2 91  ? 43.099 46.963 8.357   1.00 12.43 ?  1545 THR C CG2 1 
ATOM   3627 N N   . ALA C 2 92  ? 46.196 45.440 9.125   1.00 12.97 ?  1546 ALA C N   1 
ATOM   3628 C CA  . ALA C 2 92  ? 47.462 45.903 9.675   1.00 14.18 ?  1546 ALA C CA  1 
ATOM   3629 C C   . ALA C 2 92  ? 47.720 47.327 9.203   1.00 24.78 ?  1546 ALA C C   1 
ATOM   3630 O O   . ALA C 2 92  ? 47.802 47.582 7.996   1.00 22.12 ?  1546 ALA C O   1 
ATOM   3631 C CB  . ALA C 2 92  ? 48.607 44.980 9.264   1.00 16.44 ?  1546 ALA C CB  1 
ATOM   3632 N N   . LEU C 2 93  ? 47.850 48.246 10.154  1.00 24.11 ?  1547 LEU C N   1 
ATOM   3633 C CA  . LEU C 2 93  ? 48.040 49.660 9.857   1.00 34.43 ?  1547 LEU C CA  1 
ATOM   3634 C C   . LEU C 2 93  ? 49.526 49.961 9.710   1.00 27.31 ?  1547 LEU C C   1 
ATOM   3635 O O   . LEU C 2 93  ? 50.302 49.743 10.646  1.00 37.94 ?  1547 LEU C O   1 
ATOM   3636 C CB  . LEU C 2 93  ? 47.439 50.531 10.959  1.00 35.54 ?  1547 LEU C CB  1 
ATOM   3637 C CG  . LEU C 2 93  ? 45.934 50.467 11.212  1.00 25.19 ?  1547 LEU C CG  1 
ATOM   3638 C CD1 . LEU C 2 93  ? 45.578 51.261 12.459  1.00 25.02 ?  1547 LEU C CD1 1 
ATOM   3639 C CD2 . LEU C 2 93  ? 45.169 50.989 10.011  1.00 24.76 ?  1547 LEU C CD2 1 
ATOM   3640 N N   . SER C 2 94  ? 49.918 50.460 8.544   1.00 48.28 ?  1548 SER C N   1 
ATOM   3641 C CA  . SER C 2 94  ? 51.241 51.042 8.408   1.00 70.26 ?  1548 SER C CA  1 
ATOM   3642 C C   . SER C 2 94  ? 51.222 52.473 8.930   1.00 74.85 ?  1548 SER C C   1 
ATOM   3643 O O   . SER C 2 94  ? 50.180 53.132 8.966   1.00 70.66 ?  1548 SER C O   1 
ATOM   3644 C CB  . SER C 2 94  ? 51.705 51.019 6.950   1.00 56.61 ?  1548 SER C CB  1 
ATOM   3645 O OG  . SER C 2 94  ? 52.313 49.782 6.624   1.00 54.08 ?  1548 SER C OG  1 
ATOM   3646 N N   . GLU C 2 95  ? 52.394 52.951 9.348   1.00 74.63 ?  1549 GLU C N   1 
ATOM   3647 C CA  . GLU C 2 95  ? 52.504 54.336 9.792   1.00 75.05 ?  1549 GLU C CA  1 
ATOM   3648 C C   . GLU C 2 95  ? 52.435 55.329 8.636   1.00 64.39 ?  1549 GLU C C   1 
ATOM   3649 O O   . GLU C 2 95  ? 52.499 56.540 8.876   1.00 69.10 ?  1549 GLU C O   1 
ATOM   3650 C CB  . GLU C 2 95  ? 53.796 54.524 10.589  1.00 67.28 ?  1549 GLU C CB  1 
ATOM   3651 C CG  . GLU C 2 95  ? 53.764 53.848 11.954  1.00 83.89 ?  1549 GLU C CG  1 
ATOM   3652 C CD  . GLU C 2 95  ? 54.638 52.610 12.014  1.00 97.14 ?  1549 GLU C CD  1 
ATOM   3653 O OE1 . GLU C 2 95  ? 55.750 52.692 12.575  1.00 87.42 ?  1549 GLU C OE1 1 
ATOM   3654 O OE2 . GLU C 2 95  ? 54.214 51.556 11.496  1.00 85.63 ?  1549 GLU C OE2 1 
ATOM   3655 N N   . ASP C 2 96  ? 52.302 54.838 7.400   1.00 62.34 ?  1550 ASP C N   1 
ATOM   3656 C CA  . ASP C 2 96  ? 52.067 55.697 6.243   1.00 67.62 ?  1550 ASP C CA  1 
ATOM   3657 C C   . ASP C 2 96  ? 50.713 56.394 6.329   1.00 78.97 ?  1550 ASP C C   1 
ATOM   3658 O O   . ASP C 2 96  ? 50.579 57.531 5.862   1.00 85.78 ?  1550 ASP C O   1 
ATOM   3659 C CB  . ASP C 2 96  ? 52.158 54.847 4.967   1.00 65.72 ?  1550 ASP C CB  1 
ATOM   3660 C CG  . ASP C 2 96  ? 52.241 55.673 3.682   1.00 86.14 ?  1550 ASP C CG  1 
ATOM   3661 O OD1 . ASP C 2 96  ? 51.567 56.715 3.563   1.00 90.33 ?  1550 ASP C OD1 1 
ATOM   3662 O OD2 . ASP C 2 96  ? 52.980 55.255 2.765   1.00 86.95 ?  1550 ASP C OD2 1 
ATOM   3663 N N   . GLU C 2 97  ? 49.739 55.753 6.988   1.00 72.12 ?  1551 GLU C N   1 
ATOM   3664 C CA  . GLU C 2 97  ? 48.294 55.942 6.844   1.00 63.32 ?  1551 GLU C CA  1 
ATOM   3665 C C   . GLU C 2 97  ? 47.818 55.044 5.709   1.00 52.88 ?  1551 GLU C C   1 
ATOM   3666 O O   . GLU C 2 97  ? 46.734 55.239 5.148   1.00 44.73 ?  1551 GLU C O   1 
ATOM   3667 C CB  . GLU C 2 97  ? 47.882 57.400 6.615   1.00 58.94 ?  1551 GLU C CB  1 
ATOM   3668 C CG  . GLU C 2 97  ? 48.141 58.300 7.814   1.00 75.65 ?  1551 GLU C CG  1 
ATOM   3669 C CD  . GLU C 2 97  ? 46.867 58.829 8.444   1.00 72.24 ?  1551 GLU C CD  1 
ATOM   3670 O OE1 . GLU C 2 97  ? 45.893 59.099 7.709   1.00 63.77 ?  1551 GLU C OE1 1 
ATOM   3671 O OE2 . GLU C 2 97  ? 46.839 58.962 9.685   1.00 47.63 ?  1551 GLU C OE2 1 
ATOM   3672 N N   . TYR C 2 98  ? 48.652 54.067 5.365   1.00 56.45 ?  1552 TYR C N   1 
ATOM   3673 C CA  . TYR C 2 98  ? 48.291 52.931 4.533   1.00 55.23 ?  1552 TYR C CA  1 
ATOM   3674 C C   . TYR C 2 98  ? 47.832 51.788 5.429   1.00 49.00 ?  1552 TYR C C   1 
ATOM   3675 O O   . TYR C 2 98  ? 48.276 51.655 6.573   1.00 52.75 ?  1552 TYR C O   1 
ATOM   3676 C CB  . TYR C 2 98  ? 49.490 52.497 3.677   1.00 56.20 ?  1552 TYR C CB  1 
ATOM   3677 C CG  . TYR C 2 98  ? 49.445 51.086 3.103   1.00 68.40 ?  1552 TYR C CG  1 
ATOM   3678 C CD1 . TYR C 2 98  ? 48.909 50.841 1.844   1.00 69.71 ?  1552 TYR C CD1 1 
ATOM   3679 C CD2 . TYR C 2 98  ? 49.981 50.008 3.803   1.00 71.44 ?  1552 TYR C CD2 1 
ATOM   3680 C CE1 . TYR C 2 98  ? 48.881 49.560 1.308   1.00 57.66 ?  1552 TYR C CE1 1 
ATOM   3681 C CE2 . TYR C 2 98  ? 49.956 48.723 3.276   1.00 47.86 ?  1552 TYR C CE2 1 
ATOM   3682 C CZ  . TYR C 2 98  ? 49.406 48.505 2.029   1.00 52.19 ?  1552 TYR C CZ  1 
ATOM   3683 O OH  . TYR C 2 98  ? 49.382 47.233 1.500   1.00 66.03 ?  1552 TYR C OH  1 
ATOM   3684 N N   . PHE C 2 99  ? 46.925 50.969 4.905   1.00 48.00 ?  1553 PHE C N   1 
ATOM   3685 C CA  . PHE C 2 99  ? 46.438 49.807 5.631   1.00 38.29 ?  1553 PHE C CA  1 
ATOM   3686 C C   . PHE C 2 99  ? 46.064 48.727 4.629   1.00 35.07 ?  1553 PHE C C   1 
ATOM   3687 O O   . PHE C 2 99  ? 45.696 49.021 3.489   1.00 31.28 ?  1553 PHE C O   1 
ATOM   3688 C CB  . PHE C 2 99  ? 45.235 50.151 6.516   1.00 32.54 ?  1553 PHE C CB  1 
ATOM   3689 C CG  . PHE C 2 99  ? 43.979 50.447 5.745   1.00 37.76 ?  1553 PHE C CG  1 
ATOM   3690 C CD1 . PHE C 2 99  ? 43.749 51.711 5.226   1.00 37.15 ?  1553 PHE C CD1 1 
ATOM   3691 C CD2 . PHE C 2 99  ? 43.024 49.462 5.546   1.00 35.00 ?  1553 PHE C CD2 1 
ATOM   3692 C CE1 . PHE C 2 99  ? 42.593 51.985 4.520   1.00 36.77 ?  1553 PHE C CE1 1 
ATOM   3693 C CE2 . PHE C 2 99  ? 41.868 49.728 4.840   1.00 29.80 ?  1553 PHE C CE2 1 
ATOM   3694 C CZ  . PHE C 2 99  ? 41.651 50.992 4.327   1.00 39.78 ?  1553 PHE C CZ  1 
ATOM   3695 N N   . SER C 2 100 ? 46.154 47.473 5.066   1.00 24.19 ?  1554 SER C N   1 
ATOM   3696 C CA  . SER C 2 100 ? 45.816 46.355 4.197   1.00 28.39 ?  1554 SER C CA  1 
ATOM   3697 C C   . SER C 2 100 ? 45.531 45.126 5.045   1.00 19.98 ?  1554 SER C C   1 
ATOM   3698 O O   . SER C 2 100 ? 45.972 45.021 6.192   1.00 21.09 ?  1554 SER C O   1 
ATOM   3699 C CB  . SER C 2 100 ? 46.934 46.070 3.188   1.00 26.06 ?  1554 SER C CB  1 
ATOM   3700 O OG  . SER C 2 100 ? 48.065 45.506 3.822   1.00 35.27 ?  1554 SER C OG  1 
ATOM   3701 N N   . ALA C 2 101 ? 44.781 44.199 4.459   1.00 15.88 ?  1555 ALA C N   1 
ATOM   3702 C CA  . ALA C 2 101 ? 44.468 42.953 5.137   1.00 18.62 ?  1555 ALA C CA  1 
ATOM   3703 C C   . ALA C 2 101 ? 45.689 42.043 5.172   1.00 20.81 ?  1555 ALA C C   1 
ATOM   3704 O O   . ALA C 2 101 ? 46.546 42.077 4.286   1.00 22.86 ?  1555 ALA C O   1 
ATOM   3705 C CB  . ALA C 2 101 ? 43.304 42.243 4.446   1.00 15.04 ?  1555 ALA C CB  1 
ATOM   3706 N N   . GLY C 2 102 ? 45.763 41.230 6.220   1.00 19.11 ?  1556 GLY C N   1 
ATOM   3707 C CA  . GLY C 2 102 ? 46.844 40.279 6.382   1.00 16.11 ?  1556 GLY C CA  1 
ATOM   3708 C C   . GLY C 2 102 ? 46.381 39.145 7.268   1.00 15.50 ?  1556 GLY C C   1 
ATOM   3709 O O   . GLY C 2 102 ? 45.242 39.121 7.739   1.00 16.97 ?  1556 GLY C O   1 
ATOM   3710 N N   . VAL C 2 103 ? 47.285 38.196 7.493   1.00 14.83 ?  1557 VAL C N   1 
ATOM   3711 C CA  . VAL C 2 103 ? 47.002 37.011 8.293   1.00 12.08 ?  1557 VAL C CA  1 
ATOM   3712 C C   . VAL C 2 103 ? 48.049 36.912 9.390   1.00 10.30 ?  1557 VAL C C   1 
ATOM   3713 O O   . VAL C 2 103 ? 49.250 37.024 9.119   1.00 16.39 ?  1557 VAL C O   1 
ATOM   3714 C CB  . VAL C 2 103 ? 46.992 35.731 7.435   1.00 18.77 ?  1557 VAL C CB  1 
ATOM   3715 C CG1 . VAL C 2 103 ? 46.706 34.517 8.300   1.00 12.33 ?  1557 VAL C CG1 1 
ATOM   3716 C CG2 . VAL C 2 103 ? 45.969 35.847 6.317   1.00 17.19 ?  1557 VAL C CG2 1 
ATOM   3717 N N   . VAL C 2 104 ? 47.595 36.705 10.626  1.00 11.30 ?  1558 VAL C N   1 
ATOM   3718 C CA  . VAL C 2 104 ? 48.512 36.553 11.750  1.00 12.52 ?  1558 VAL C CA  1 
ATOM   3719 C C   . VAL C 2 104 ? 49.264 35.237 11.617  1.00 20.99 ?  1558 VAL C C   1 
ATOM   3720 O O   . VAL C 2 104 ? 48.658 34.166 11.480  1.00 14.72 ?  1558 VAL C O   1 
ATOM   3721 C CB  . VAL C 2 104 ? 47.750 36.621 13.081  1.00 14.29 ?  1558 VAL C CB  1 
ATOM   3722 C CG1 . VAL C 2 104 ? 48.686 36.311 14.235  1.00 13.97 ?  1558 VAL C CG1 1 
ATOM   3723 C CG2 . VAL C 2 104 ? 47.107 37.986 13.258  1.00 6.60  ?  1558 VAL C CG2 1 
ATOM   3724 N N   . LYS C 2 105 ? 50.595 35.309 11.664  1.00 15.47 ?  1559 LYS C N   1 
ATOM   3725 C CA  . LYS C 2 105 ? 51.440 34.129 11.562  1.00 19.27 ?  1559 LYS C CA  1 
ATOM   3726 C C   . LYS C 2 105 ? 52.352 33.934 12.766  1.00 24.16 ?  1559 LYS C C   1 
ATOM   3727 O O   . LYS C 2 105 ? 53.088 32.940 12.809  1.00 23.59 ?  1559 LYS C O   1 
ATOM   3728 C CB  . LYS C 2 105 ? 52.285 34.188 10.280  1.00 18.65 ?  1559 LYS C CB  1 
ATOM   3729 C CG  . LYS C 2 105 ? 51.501 33.885 9.009   1.00 17.55 ?  1559 LYS C CG  1 
ATOM   3730 C CD  . LYS C 2 105 ? 50.971 32.459 9.020   1.00 27.42 ?  1559 LYS C CD  1 
ATOM   3731 C CE  . LYS C 2 105 ? 49.871 32.260 7.989   1.00 28.66 ?  1559 LYS C CE  1 
ATOM   3732 N NZ  . LYS C 2 105 ? 50.344 32.537 6.606   1.00 42.28 ?  1559 LYS C NZ  1 
ATOM   3733 N N   . GLY C 2 106 ? 52.327 34.837 13.741  1.00 21.23 ?  1560 GLY C N   1 
ATOM   3734 C CA  . GLY C 2 106 ? 53.157 34.681 14.922  1.00 21.95 ?  1560 GLY C CA  1 
ATOM   3735 C C   . GLY C 2 106 ? 53.006 35.870 15.849  1.00 26.06 ?  1560 GLY C C   1 
ATOM   3736 O O   . GLY C 2 106 ? 52.526 36.940 15.456  1.00 21.90 ?  1560 GLY C O   1 
ATOM   3737 N N   . HIS C 2 107 ? 53.418 35.656 17.099  1.00 23.87 ?  1561 HIS C N   1 
ATOM   3738 C CA  . HIS C 2 107 ? 53.470 36.711 18.101  1.00 30.57 ?  1561 HIS C CA  1 
ATOM   3739 C C   . HIS C 2 107 ? 54.798 36.653 18.838  1.00 33.74 ?  1561 HIS C C   1 
ATOM   3740 O O   . HIS C 2 107 ? 55.430 35.597 18.936  1.00 33.94 ?  1561 HIS C O   1 
ATOM   3741 C CB  . HIS C 2 107 ? 52.333 36.611 19.130  1.00 39.11 ?  1561 HIS C CB  1 
ATOM   3742 C CG  . HIS C 2 107 ? 51.099 35.949 18.609  1.00 41.18 ?  1561 HIS C CG  1 
ATOM   3743 N ND1 . HIS C 2 107 ? 50.186 36.603 17.811  1.00 61.68 ?  1561 HIS C ND1 1 
ATOM   3744 C CD2 . HIS C 2 107 ? 50.622 34.693 18.778  1.00 37.58 ?  1561 HIS C CD2 1 
ATOM   3745 C CE1 . HIS C 2 107 ? 49.203 35.777 17.506  1.00 33.34 ?  1561 HIS C CE1 1 
ATOM   3746 N NE2 . HIS C 2 107 ? 49.442 34.612 18.080  1.00 44.30 ?  1561 HIS C NE2 1 
ATOM   3747 N N   . ARG C 2 108 ? 55.209 37.803 19.365  1.00 28.79 ?  1562 ARG C N   1 
ATOM   3748 C CA  . ARG C 2 108 ? 56.390 37.889 20.210  1.00 33.50 ?  1562 ARG C CA  1 
ATOM   3749 C C   . ARG C 2 108 ? 56.241 39.101 21.115  1.00 33.56 ?  1562 ARG C C   1 
ATOM   3750 O O   . ARG C 2 108 ? 55.754 40.150 20.684  1.00 25.49 ?  1562 ARG C O   1 
ATOM   3751 C CB  . ARG C 2 108 ? 57.679 37.992 19.385  1.00 40.12 ?  1562 ARG C CB  1 
ATOM   3752 C CG  . ARG C 2 108 ? 57.652 39.092 18.342  1.00 54.48 ?  1562 ARG C CG  1 
ATOM   3753 C CD  . ARG C 2 108 ? 59.029 39.363 17.761  1.00 61.59 ?  1562 ARG C CD  1 
ATOM   3754 N NE  . ARG C 2 108 ? 59.170 40.757 17.351  1.00 72.69 ?  1562 ARG C NE  1 
ATOM   3755 C CZ  . ARG C 2 108 ? 60.285 41.285 16.858  1.00 61.07 ?  1562 ARG C CZ  1 
ATOM   3756 N NH1 . ARG C 2 108 ? 61.368 40.534 16.709  1.00 65.51 ?  1562 ARG C NH1 1 
ATOM   3757 N NH2 . ARG C 2 108 ? 60.318 42.565 16.512  1.00 51.86 ?  1562 ARG C NH2 1 
ATOM   3758 N N   . LYS C 2 109 ? 56.651 38.947 22.368  1.00 39.03 ?  1563 LYS C N   1 
ATOM   3759 C CA  . LYS C 2 109 ? 56.603 40.022 23.352  1.00 34.54 ?  1563 LYS C CA  1 
ATOM   3760 C C   . LYS C 2 109 ? 58.024 40.524 23.570  1.00 40.55 ?  1563 LYS C C   1 
ATOM   3761 O O   . LYS C 2 109 ? 58.870 39.799 24.105  1.00 47.90 ?  1563 LYS C O   1 
ATOM   3762 C CB  . LYS C 2 109 ? 55.974 39.543 24.658  1.00 39.16 ?  1563 LYS C CB  1 
ATOM   3763 C CG  . LYS C 2 109 ? 54.482 39.264 24.559  1.00 50.59 ?  1563 LYS C CG  1 
ATOM   3764 C CD  . LYS C 2 109 ? 54.113 37.968 25.262  1.00 65.85 ?  1563 LYS C CD  1 
ATOM   3765 C CE  . LYS C 2 109 ? 54.290 36.771 24.343  1.00 54.56 ?  1563 LYS C CE  1 
ATOM   3766 N NZ  . LYS C 2 109 ? 54.313 35.488 25.098  1.00 59.25 ?  1563 LYS C NZ  1 
ATOM   3767 N N   . GLU C 2 110 ? 58.285 41.760 23.150  1.00 30.19 ?  1564 GLU C N   1 
ATOM   3768 C CA  . GLU C 2 110 ? 59.603 42.377 23.260  1.00 43.37 ?  1564 GLU C CA  1 
ATOM   3769 C C   . GLU C 2 110 ? 59.501 43.574 24.195  1.00 39.15 ?  1564 GLU C C   1 
ATOM   3770 O O   . GLU C 2 110 ? 58.881 44.586 23.848  1.00 40.41 ?  1564 GLU C O   1 
ATOM   3771 C CB  . GLU C 2 110 ? 60.128 42.796 21.887  1.00 41.29 ?  1564 GLU C CB  1 
ATOM   3772 C CG  . GLU C 2 110 ? 60.380 41.636 20.937  1.00 60.73 ?  1564 GLU C CG  1 
ATOM   3773 C CD  . GLU C 2 110 ? 61.855 41.329 20.772  1.00 79.28 ?  1564 GLU C CD  1 
ATOM   3774 O OE1 . GLU C 2 110 ? 62.200 40.509 19.895  1.00 77.27 ?  1564 GLU C OE1 1 
ATOM   3775 O OE2 . GLU C 2 110 ? 62.670 41.908 21.521  1.00 77.43 -1 1564 GLU C OE2 1 
ATOM   3776 N N   . SER C 2 111 ? 60.108 43.454 25.377  1.00 39.77 ?  1565 SER C N   1 
ATOM   3777 C CA  . SER C 2 111 ? 60.158 44.534 26.364  1.00 43.73 ?  1565 SER C CA  1 
ATOM   3778 C C   . SER C 2 111 ? 58.753 44.996 26.753  1.00 43.92 ?  1565 SER C C   1 
ATOM   3779 O O   . SER C 2 111 ? 58.450 46.191 26.778  1.00 50.07 ?  1565 SER C O   1 
ATOM   3780 C CB  . SER C 2 111 ? 61.003 45.704 25.853  1.00 46.95 ?  1565 SER C CB  1 
ATOM   3781 O OG  . SER C 2 111 ? 61.114 46.722 26.832  1.00 55.85 ?  1565 SER C OG  1 
ATOM   3782 N N   . GLY C 2 112 ? 57.889 44.030 27.056  1.00 42.65 ?  1566 GLY C N   1 
ATOM   3783 C CA  . GLY C 2 112 ? 56.536 44.317 27.485  1.00 52.35 ?  1566 GLY C CA  1 
ATOM   3784 C C   . GLY C 2 112 ? 55.571 44.703 26.386  1.00 52.84 ?  1566 GLY C C   1 
ATOM   3785 O O   . GLY C 2 112 ? 54.392 44.942 26.678  1.00 61.23 ?  1566 GLY C O   1 
ATOM   3786 N N   . GLU C 2 113 ? 56.023 44.771 25.137  1.00 41.27 ?  1567 GLU C N   1 
ATOM   3787 C CA  . GLU C 2 113 ? 55.182 45.139 24.006  1.00 32.32 ?  1567 GLU C CA  1 
ATOM   3788 C C   . GLU C 2 113 ? 54.953 43.917 23.128  1.00 35.57 ?  1567 GLU C C   1 
ATOM   3789 O O   . GLU C 2 113 ? 55.897 43.180 22.826  1.00 27.29 ?  1567 GLU C O   1 
ATOM   3790 C CB  . GLU C 2 113 ? 55.824 46.267 23.194  1.00 34.85 ?  1567 GLU C CB  1 
ATOM   3791 C CG  . GLU C 2 113 ? 55.196 46.493 21.827  1.00 39.93 ?  1567 GLU C CG  1 
ATOM   3792 C CD  . GLU C 2 113 ? 53.847 47.179 21.912  1.00 49.67 ?  1567 GLU C CD  1 
ATOM   3793 O OE1 . GLU C 2 113 ? 53.653 48.003 22.831  1.00 60.12 ?  1567 GLU C OE1 1 
ATOM   3794 O OE2 . GLU C 2 113 ? 52.980 46.895 21.059  1.00 42.40 -1 1567 GLU C OE2 1 
ATOM   3795 N N   . LEU C 2 114 ? 53.704 43.706 22.722  1.00 28.56 ?  1568 LEU C N   1 
ATOM   3796 C CA  . LEU C 2 114 ? 53.350 42.584 21.864  1.00 25.06 ?  1568 LEU C CA  1 
ATOM   3797 C C   . LEU C 2 114 ? 53.489 42.971 20.398  1.00 22.62 ?  1568 LEU C C   1 
ATOM   3798 O O   . LEU C 2 114 ? 53.077 44.059 19.987  1.00 20.98 ?  1568 LEU C O   1 
ATOM   3799 C CB  . LEU C 2 114 ? 51.921 42.118 22.148  1.00 23.34 ?  1568 LEU C CB  1 
ATOM   3800 C CG  . LEU C 2 114 ? 51.388 41.002 21.247  1.00 18.67 ?  1568 LEU C CG  1 
ATOM   3801 C CD1 . LEU C 2 114 ? 52.062 39.679 21.581  1.00 26.83 ?  1568 LEU C CD1 1 
ATOM   3802 C CD2 . LEU C 2 114 ? 49.876 40.887 21.366  1.00 20.74 ?  1568 LEU C CD2 1 
ATOM   3803 N N   . TYR C 2 115 ? 54.072 42.069 19.611  1.00 15.90 ?  1569 TYR C N   1 
ATOM   3804 C CA  . TYR C 2 115 ? 54.237 42.257 18.177  1.00 19.03 ?  1569 TYR C CA  1 
ATOM   3805 C C   . TYR C 2 115 ? 53.589 41.099 17.432  1.00 18.58 ?  1569 TYR C C   1 
ATOM   3806 O O   . TYR C 2 115 ? 53.676 39.945 17.862  1.00 19.33 ?  1569 TYR C O   1 
ATOM   3807 C CB  . TYR C 2 115 ? 55.718 42.354 17.790  1.00 26.13 ?  1569 TYR C CB  1 
ATOM   3808 C CG  . TYR C 2 115 ? 56.411 43.597 18.299  1.00 23.79 ?  1569 TYR C CG  1 
ATOM   3809 C CD1 . TYR C 2 115 ? 57.010 43.619 19.552  1.00 30.28 ?  1569 TYR C CD1 1 
ATOM   3810 C CD2 . TYR C 2 115 ? 56.469 44.748 17.525  1.00 28.17 ?  1569 TYR C CD2 1 
ATOM   3811 C CE1 . TYR C 2 115 ? 57.647 44.752 20.020  1.00 33.06 ?  1569 TYR C CE1 1 
ATOM   3812 C CE2 . TYR C 2 115 ? 57.102 45.887 17.985  1.00 33.95 ?  1569 TYR C CE2 1 
ATOM   3813 C CZ  . TYR C 2 115 ? 57.689 45.883 19.233  1.00 33.30 ?  1569 TYR C CZ  1 
ATOM   3814 O OH  . TYR C 2 115 ? 58.322 47.014 19.696  1.00 51.22 ?  1569 TYR C OH  1 
ATOM   3815 N N   . TYR C 2 116 ? 52.943 41.413 16.312  1.00 15.54 ?  1570 TYR C N   1 
ATOM   3816 C CA  . TYR C 2 116 ? 52.294 40.423 15.464  1.00 14.73 ?  1570 TYR C CA  1 
ATOM   3817 C C   . TYR C 2 116 ? 53.080 40.271 14.169  1.00 17.55 ?  1570 TYR C C   1 
ATOM   3818 O O   . TYR C 2 116 ? 53.438 41.270 13.536  1.00 14.52 ?  1570 TYR C O   1 
ATOM   3819 C CB  . TYR C 2 116 ? 50.853 40.828 15.138  1.00 11.12 ?  1570 TYR C CB  1 
ATOM   3820 C CG  . TYR C 2 116 ? 49.868 40.683 16.276  1.00 18.97 ?  1570 TYR C CG  1 
ATOM   3821 C CD1 . TYR C 2 116 ? 49.290 39.455 16.568  1.00 19.01 ?  1570 TYR C CD1 1 
ATOM   3822 C CD2 . TYR C 2 116 ? 49.496 41.781 17.042  1.00 13.71 ?  1570 TYR C CD2 1 
ATOM   3823 C CE1 . TYR C 2 116 ? 48.380 39.320 17.601  1.00 16.00 ?  1570 TYR C CE1 1 
ATOM   3824 C CE2 . TYR C 2 116 ? 48.588 41.658 18.075  1.00 14.03 ?  1570 TYR C CE2 1 
ATOM   3825 C CZ  . TYR C 2 116 ? 48.033 40.425 18.350  1.00 15.90 ?  1570 TYR C CZ  1 
ATOM   3826 O OH  . TYR C 2 116 ? 47.128 40.296 19.379  1.00 11.99 ?  1570 TYR C OH  1 
ATOM   3827 N N   . SER C 2 117 ? 53.342 39.027 13.777  1.00 15.12 ?  1571 SER C N   1 
ATOM   3828 C CA  . SER C 2 117 ? 53.850 38.730 12.442  1.00 9.90  ?  1571 SER C CA  1 
ATOM   3829 C C   . SER C 2 117 ? 52.651 38.602 11.510  1.00 16.16 ?  1571 SER C C   1 
ATOM   3830 O O   . SER C 2 117 ? 51.838 37.685 11.658  1.00 16.55 ?  1571 SER C O   1 
ATOM   3831 C CB  . SER C 2 117 ? 54.687 37.454 12.440  1.00 20.15 ?  1571 SER C CB  1 
ATOM   3832 O OG  . SER C 2 117 ? 55.215 37.204 11.149  1.00 17.82 ?  1571 SER C OG  1 
ATOM   3833 N N   . ILE C 2 118 ? 52.537 39.526 10.560  1.00 11.44 ?  1572 ILE C N   1 
ATOM   3834 C CA  . ILE C 2 118 ? 51.407 39.593 9.642   1.00 15.19 ?  1572 ILE C CA  1 
ATOM   3835 C C   . ILE C 2 118 ? 51.907 39.281 8.239   1.00 19.45 ?  1572 ILE C C   1 
ATOM   3836 O O   . ILE C 2 118 ? 52.869 39.899 7.766   1.00 19.38 ?  1572 ILE C O   1 
ATOM   3837 C CB  . ILE C 2 118 ? 50.729 40.973 9.688   1.00 17.31 ?  1572 ILE C CB  1 
ATOM   3838 C CG1 . ILE C 2 118 ? 50.362 41.343 11.127  1.00 19.68 ?  1572 ILE C CG1 1 
ATOM   3839 C CG2 . ILE C 2 118 ? 49.499 40.994 8.798   1.00 16.86 ?  1572 ILE C CG2 1 
ATOM   3840 C CD1 . ILE C 2 118 ? 49.336 40.431 11.747  1.00 19.73 ?  1572 ILE C CD1 1 
ATOM   3841 N N   . GLU C 2 119 ? 51.255 38.333 7.574   1.00 18.19 ?  1573 GLU C N   1 
ATOM   3842 C CA  . GLU C 2 119 ? 51.614 37.945 6.217   1.00 20.60 ?  1573 GLU C CA  1 
ATOM   3843 C C   . GLU C 2 119 ? 50.662 38.592 5.221   1.00 24.51 ?  1573 GLU C C   1 
ATOM   3844 O O   . GLU C 2 119 ? 49.439 38.503 5.373   1.00 16.64 ?  1573 GLU C O   1 
ATOM   3845 C CB  . GLU C 2 119 ? 51.590 36.425 6.051   1.00 23.52 ?  1573 GLU C CB  1 
ATOM   3846 C CG  . GLU C 2 119 ? 51.997 35.965 4.657   1.00 23.58 ?  1573 GLU C CG  1 
ATOM   3847 C CD  . GLU C 2 119 ? 52.162 34.463 4.560   1.00 28.02 ?  1573 GLU C CD  1 
ATOM   3848 O OE1 . GLU C 2 119 ? 51.425 33.833 3.773   1.00 34.87 ?  1573 GLU C OE1 1 
ATOM   3849 O OE2 . GLU C 2 119 ? 53.029 33.914 5.272   1.00 32.50 -1 1573 GLU C OE2 1 
ATOM   3850 N N   . LYS C 2 120 ? 51.227 39.241 4.205   1.00 20.41 ?  1574 LYS C N   1 
ATOM   3851 C CA  . LYS C 2 120 ? 50.456 39.880 3.142   1.00 22.29 ?  1574 LYS C CA  1 
ATOM   3852 C C   . LYS C 2 120 ? 51.006 39.410 1.804   1.00 27.08 ?  1574 LYS C C   1 
ATOM   3853 O O   . LYS C 2 120 ? 52.096 39.829 1.399   1.00 30.33 ?  1574 LYS C O   1 
ATOM   3854 C CB  . LYS C 2 120 ? 50.519 41.404 3.251   1.00 22.96 ?  1574 LYS C CB  1 
ATOM   3855 C CG  . LYS C 2 120 ? 50.097 41.936 4.605   1.00 36.70 ?  1574 LYS C CG  1 
ATOM   3856 C CD  . LYS C 2 120 ? 50.366 43.424 4.732   1.00 34.64 ?  1574 LYS C CD  1 
ATOM   3857 C CE  . LYS C 2 120 ? 49.782 43.972 6.022   1.00 31.94 ?  1574 LYS C CE  1 
ATOM   3858 N NZ  . LYS C 2 120 ? 49.505 45.435 5.938   1.00 36.07 ?  1574 LYS C NZ  1 
ATOM   3859 N N   . GLU C 2 121 ? 50.251 38.547 1.124   1.00 32.15 ?  1575 GLU C N   1 
ATOM   3860 C CA  . GLU C 2 121 ? 50.645 37.981 -0.167  1.00 35.68 ?  1575 GLU C CA  1 
ATOM   3861 C C   . GLU C 2 121 ? 52.046 37.374 -0.108  1.00 27.61 ?  1575 GLU C C   1 
ATOM   3862 O O   . GLU C 2 121 ? 52.892 37.600 -0.978  1.00 30.81 ?  1575 GLU C O   1 
ATOM   3863 C CB  . GLU C 2 121 ? 50.543 39.026 -1.281  1.00 34.44 ?  1575 GLU C CB  1 
ATOM   3864 C CG  . GLU C 2 121 ? 49.308 39.910 -1.199  1.00 54.83 ?  1575 GLU C CG  1 
ATOM   3865 C CD  . GLU C 2 121 ? 48.733 40.227 -2.568  1.00 69.07 ?  1575 GLU C CD  1 
ATOM   3866 O OE1 . GLU C 2 121 ? 48.674 41.420 -2.932  1.00 71.76 ?  1575 GLU C OE1 1 
ATOM   3867 O OE2 . GLU C 2 121 ? 48.333 39.281 -3.279  1.00 83.44 -1 1575 GLU C OE2 1 
ATOM   3868 N N   . GLY C 2 122 ? 52.286 36.587 0.940   1.00 22.72 ?  1576 GLY C N   1 
ATOM   3869 C CA  . GLY C 2 122 ? 53.519 35.846 1.081   1.00 23.74 ?  1576 GLY C CA  1 
ATOM   3870 C C   . GLY C 2 122 ? 54.620 36.544 1.848   1.00 21.43 ?  1576 GLY C C   1 
ATOM   3871 O O   . GLY C 2 122 ? 55.598 35.886 2.224   1.00 27.45 ?  1576 GLY C O   1 
ATOM   3872 N N   . GLN C 2 123 ? 54.503 37.847 2.094   1.00 24.67 ?  1577 GLN C N   1 
ATOM   3873 C CA  . GLN C 2 123 ? 55.525 38.600 2.810   1.00 28.64 ?  1577 GLN C CA  1 
ATOM   3874 C C   . GLN C 2 123 ? 55.072 38.860 4.241   1.00 23.32 ?  1577 GLN C C   1 
ATOM   3875 O O   . GLN C 2 123 ? 53.951 39.328 4.466   1.00 27.88 ?  1577 GLN C O   1 
ATOM   3876 C CB  . GLN C 2 123 ? 55.825 39.923 2.103   1.00 23.71 ?  1577 GLN C CB  1 
ATOM   3877 C CG  . GLN C 2 123 ? 56.870 40.775 2.806   1.00 31.26 ?  1577 GLN C CG  1 
ATOM   3878 C CD  . GLN C 2 123 ? 57.145 42.076 2.080   1.00 40.46 ?  1577 GLN C CD  1 
ATOM   3879 O OE1 . GLN C 2 123 ? 56.538 42.365 1.049   1.00 42.54 ?  1577 GLN C OE1 1 
ATOM   3880 N NE2 . GLN C 2 123 ? 58.063 42.869 2.616   1.00 52.51 ?  1577 GLN C NE2 1 
ATOM   3881 N N   . ARG C 2 124 ? 55.947 38.566 5.200   1.00 21.37 ?  1578 ARG C N   1 
ATOM   3882 C CA  . ARG C 2 124 ? 55.656 38.735 6.616   1.00 24.36 ?  1578 ARG C CA  1 
ATOM   3883 C C   . ARG C 2 124 ? 56.437 39.914 7.181   1.00 31.98 ?  1578 ARG C C   1 
ATOM   3884 O O   . ARG C 2 124 ? 57.601 40.127 6.828   1.00 25.29 ?  1578 ARG C O   1 
ATOM   3885 C CB  . ARG C 2 124 ? 55.997 37.468 7.406   1.00 18.77 ?  1578 ARG C CB  1 
ATOM   3886 C CG  . ARG C 2 124 ? 55.209 36.244 6.982   1.00 19.61 ?  1578 ARG C CG  1 
ATOM   3887 C CD  . ARG C 2 124 ? 55.461 35.078 7.920   1.00 21.59 ?  1578 ARG C CD  1 
ATOM   3888 N NE  . ARG C 2 124 ? 54.802 33.860 7.459   1.00 20.84 ?  1578 ARG C NE  1 
ATOM   3889 C CZ  . ARG C 2 124 ? 54.881 32.688 8.078   1.00 21.74 ?  1578 ARG C CZ  1 
ATOM   3890 N NH1 . ARG C 2 124 ? 55.594 32.569 9.190   1.00 27.87 ?  1578 ARG C NH1 1 
ATOM   3891 N NH2 . ARG C 2 124 ? 54.247 31.633 7.585   1.00 32.78 ?  1578 ARG C NH2 1 
ATOM   3892 N N   . LYS C 2 125 ? 55.789 40.675 8.060   1.00 25.29 ?  1579 LYS C N   1 
ATOM   3893 C CA  . LYS C 2 125 ? 56.433 41.785 8.747   1.00 24.44 ?  1579 LYS C CA  1 
ATOM   3894 C C   . LYS C 2 125 ? 55.860 41.886 10.151  1.00 31.23 ?  1579 LYS C C   1 
ATOM   3895 O O   . LYS C 2 125 ? 54.750 41.420 10.425  1.00 25.49 ?  1579 LYS C O   1 
ATOM   3896 C CB  . LYS C 2 125 ? 56.248 43.107 7.992   1.00 31.74 ?  1579 LYS C CB  1 
ATOM   3897 C CG  . LYS C 2 125 ? 57.219 43.303 6.836   1.00 30.95 ?  1579 LYS C CG  1 
ATOM   3898 C CD  . LYS C 2 125 ? 56.799 44.452 5.926   1.00 48.35 ?  1579 LYS C CD  1 
ATOM   3899 C CE  . LYS C 2 125 ? 57.229 45.809 6.478   1.00 69.30 ?  1579 LYS C CE  1 
ATOM   3900 N NZ  . LYS C 2 125 ? 56.343 46.309 7.570   1.00 55.81 ?  1579 LYS C NZ  1 
ATOM   3901 N N   . TRP C 2 126 ? 56.631 42.502 11.043  1.00 20.85 ?  1580 TRP C N   1 
ATOM   3902 C CA  . TRP C 2 126 ? 56.227 42.655 12.433  1.00 24.97 ?  1580 TRP C CA  1 
ATOM   3903 C C   . TRP C 2 126 ? 55.460 43.958 12.625  1.00 25.85 ?  1580 TRP C C   1 
ATOM   3904 O O   . TRP C 2 126 ? 55.855 45.009 12.112  1.00 22.20 ?  1580 TRP C O   1 
ATOM   3905 C CB  . TRP C 2 126 ? 57.445 42.621 13.357  1.00 29.89 ?  1580 TRP C CB  1 
ATOM   3906 C CG  . TRP C 2 126 ? 58.112 41.279 13.418  1.00 37.65 ?  1580 TRP C CG  1 
ATOM   3907 C CD1 . TRP C 2 126 ? 59.312 40.935 12.867  1.00 41.56 ?  1580 TRP C CD1 1 
ATOM   3908 C CD2 . TRP C 2 126 ? 57.615 40.100 14.065  1.00 34.56 ?  1580 TRP C CD2 1 
ATOM   3909 N NE1 . TRP C 2 126 ? 59.594 39.616 13.132  1.00 30.68 ?  1580 TRP C NE1 1 
ATOM   3910 C CE2 . TRP C 2 126 ? 58.568 39.081 13.865  1.00 32.77 ?  1580 TRP C CE2 1 
ATOM   3911 C CE3 . TRP C 2 126 ? 56.458 39.808 14.794  1.00 26.49 ?  1580 TRP C CE3 1 
ATOM   3912 C CZ2 . TRP C 2 126 ? 58.399 37.792 14.367  1.00 23.84 ?  1580 TRP C CZ2 1 
ATOM   3913 C CZ3 . TRP C 2 126 ? 56.292 38.528 15.290  1.00 32.69 ?  1580 TRP C CZ3 1 
ATOM   3914 C CH2 . TRP C 2 126 ? 57.258 37.536 15.075  1.00 34.72 ?  1580 TRP C CH2 1 
ATOM   3915 N N   . TYR C 2 127 ? 54.357 43.877 13.366  1.00 21.98 ?  1581 TYR C N   1 
ATOM   3916 C CA  . TYR C 2 127 ? 53.512 45.026 13.656  1.00 20.57 ?  1581 TYR C CA  1 
ATOM   3917 C C   . TYR C 2 127 ? 53.269 45.109 15.154  1.00 17.30 ?  1581 TYR C C   1 
ATOM   3918 O O   . TYR C 2 127 ? 53.005 44.093 15.804  1.00 16.33 ?  1581 TYR C O   1 
ATOM   3919 C CB  . TYR C 2 127 ? 52.164 44.933 12.927  1.00 15.98 ?  1581 TYR C CB  1 
ATOM   3920 C CG  . TYR C 2 127 ? 52.250 45.040 11.422  1.00 18.52 ?  1581 TYR C CG  1 
ATOM   3921 C CD1 . TYR C 2 127 ? 52.653 43.957 10.651  1.00 17.65 ?  1581 TYR C CD1 1 
ATOM   3922 C CD2 . TYR C 2 127 ? 51.918 46.220 10.771  1.00 20.79 ?  1581 TYR C CD2 1 
ATOM   3923 C CE1 . TYR C 2 127 ? 52.728 44.048 9.275   1.00 22.37 ?  1581 TYR C CE1 1 
ATOM   3924 C CE2 . TYR C 2 127 ? 51.990 46.321 9.395   1.00 28.11 ?  1581 TYR C CE2 1 
ATOM   3925 C CZ  . TYR C 2 127 ? 52.396 45.232 8.652   1.00 26.73 ?  1581 TYR C CZ  1 
ATOM   3926 O OH  . TYR C 2 127 ? 52.470 45.329 7.282   1.00 36.38 ?  1581 TYR C OH  1 
ATOM   3927 N N   . LYS C 2 128 ? 53.353 46.319 15.700  1.00 16.25 ?  1582 LYS C N   1 
ATOM   3928 C CA  . LYS C 2 128 ? 53.010 46.506 17.100  1.00 17.97 ?  1582 LYS C CA  1 
ATOM   3929 C C   . LYS C 2 128 ? 51.507 46.323 17.299  1.00 11.94 ?  1582 LYS C C   1 
ATOM   3930 O O   . LYS C 2 128 ? 50.720 46.349 16.348  1.00 10.93 ?  1582 LYS C O   1 
ATOM   3931 C CB  . LYS C 2 128 ? 53.460 47.884 17.592  1.00 17.29 ?  1582 LYS C CB  1 
ATOM   3932 C CG  . LYS C 2 128 ? 52.687 49.054 17.011  1.00 27.57 ?  1582 LYS C CG  1 
ATOM   3933 C CD  . LYS C 2 128 ? 53.225 50.374 17.546  1.00 39.01 ?  1582 LYS C CD  1 
ATOM   3934 C CE  . LYS C 2 128 ? 52.354 51.545 17.124  1.00 37.48 ?  1582 LYS C CE  1 
ATOM   3935 N NZ  . LYS C 2 128 ? 52.727 52.796 17.842  1.00 54.15 ?  1582 LYS C NZ  1 
ATOM   3936 N N   . ARG C 2 129 ? 51.116 46.135 18.563  1.00 14.31 ?  1583 ARG C N   1 
ATOM   3937 C CA  . ARG C 2 129 ? 49.741 45.748 18.870  1.00 20.86 ?  1583 ARG C CA  1 
ATOM   3938 C C   . ARG C 2 129 ? 48.737 46.774 18.360  1.00 15.31 ?  1583 ARG C C   1 
ATOM   3939 O O   . ARG C 2 129 ? 47.701 46.408 17.792  1.00 10.55 ?  1583 ARG C O   1 
ATOM   3940 C CB  . ARG C 2 129 ? 49.577 45.544 20.377  1.00 17.52 ?  1583 ARG C CB  1 
ATOM   3941 C CG  . ARG C 2 129 ? 48.223 44.974 20.771  1.00 17.98 ?  1583 ARG C CG  1 
ATOM   3942 C CD  . ARG C 2 129 ? 47.868 45.313 22.210  1.00 16.32 ?  1583 ARG C CD  1 
ATOM   3943 N NE  . ARG C 2 129 ? 48.688 44.587 23.176  1.00 21.02 ?  1583 ARG C NE  1 
ATOM   3944 C CZ  . ARG C 2 129 ? 48.419 43.359 23.611  1.00 24.49 ?  1583 ARG C CZ  1 
ATOM   3945 N NH1 . ARG C 2 129 ? 47.353 42.712 23.158  1.00 16.64 ?  1583 ARG C NH1 1 
ATOM   3946 N NH2 . ARG C 2 129 ? 49.215 42.777 24.497  1.00 19.54 ?  1583 ARG C NH2 1 
ATOM   3947 N N   . MET C 2 130 ? 49.025 48.064 18.544  1.00 14.42 ?  1584 MET C N   1 
ATOM   3948 C CA  . MET C 2 130 ? 48.085 49.096 18.123  1.00 18.86 ?  1584 MET C CA  1 
ATOM   3949 C C   . MET C 2 130 ? 47.985 49.226 16.609  1.00 11.18 ?  1584 MET C C   1 
ATOM   3950 O O   . MET C 2 130 ? 47.038 49.852 16.121  1.00 17.00 ?  1584 MET C O   1 
ATOM   3951 C CB  . MET C 2 130 ? 48.469 50.442 18.739  1.00 12.01 ?  1584 MET C CB  1 
ATOM   3952 C CG  . MET C 2 130 ? 47.954 50.627 20.158  1.00 25.15 ?  1584 MET C CG  1 
ATOM   3953 S SD  . MET C 2 130 ? 48.237 52.285 20.810  1.00 28.55 ?  1584 MET C SD  1 
ATOM   3954 C CE  . MET C 2 130 ? 47.661 53.285 19.441  1.00 22.83 ?  1584 MET C CE  1 
ATOM   3955 N N   . ALA C 2 131 ? 48.922 48.654 15.854  1.00 8.51  ?  1585 ALA C N   1 
ATOM   3956 C CA  . ALA C 2 131 ? 48.825 48.662 14.401  1.00 12.88 ?  1585 ALA C CA  1 
ATOM   3957 C C   . ALA C 2 131 ? 47.995 47.507 13.857  1.00 13.74 ?  1585 ALA C C   1 
ATOM   3958 O O   . ALA C 2 131 ? 47.762 47.449 12.645  1.00 18.35 ?  1585 ALA C O   1 
ATOM   3959 C CB  . ALA C 2 131 ? 50.222 48.629 13.776  1.00 10.66 ?  1585 ALA C CB  1 
ATOM   3960 N N   . VAL C 2 132 ? 47.540 46.599 14.716  1.00 12.07 ?  1586 VAL C N   1 
ATOM   3961 C CA  . VAL C 2 132 ? 46.796 45.414 14.305  1.00 9.59  ?  1586 VAL C CA  1 
ATOM   3962 C C   . VAL C 2 132 ? 45.367 45.569 14.806  1.00 7.60  ?  1586 VAL C C   1 
ATOM   3963 O O   . VAL C 2 132 ? 45.119 45.573 16.018  1.00 13.05 ?  1586 VAL C O   1 
ATOM   3964 C CB  . VAL C 2 132 ? 47.436 44.126 14.836  1.00 14.39 ?  1586 VAL C CB  1 
ATOM   3965 C CG1 . VAL C 2 132 ? 46.584 42.918 14.467  1.00 9.87  ?  1586 VAL C CG1 1 
ATOM   3966 C CG2 . VAL C 2 132 ? 48.847 43.978 14.291  1.00 12.10 ?  1586 VAL C CG2 1 
ATOM   3967 N N   . ILE C 2 133 ? 44.426 45.696 13.875  1.00 10.86 ?  1587 ILE C N   1 
ATOM   3968 C CA  . ILE C 2 133 ? 43.020 45.870 14.187  1.00 8.93  ?  1587 ILE C CA  1 
ATOM   3969 C C   . ILE C 2 133 ? 42.214 44.856 13.383  1.00 12.33 ?  1587 ILE C C   1 
ATOM   3970 O O   . ILE C 2 133 ? 42.760 44.068 12.611  1.00 11.87 ?  1587 ILE C O   1 
ATOM   3971 C CB  . ILE C 2 133 ? 42.532 47.307 13.906  1.00 9.80  ?  1587 ILE C CB  1 
ATOM   3972 C CG1 . ILE C 2 133 ? 42.544 47.587 12.404  1.00 15.52 ?  1587 ILE C CG1 1 
ATOM   3973 C CG2 . ILE C 2 133 ? 43.395 48.322 14.639  1.00 11.55 ?  1587 ILE C CG2 1 
ATOM   3974 C CD1 . ILE C 2 133 ? 42.086 48.978 12.047  1.00 14.63 ?  1587 ILE C CD1 1 
ATOM   3975 N N   . LEU C 2 134 ? 40.898 44.886 13.573  1.00 8.56  ?  1588 LEU C N   1 
ATOM   3976 C CA  . LEU C 2 134 ? 39.981 44.023 12.843  1.00 13.84 ?  1588 LEU C CA  1 
ATOM   3977 C C   . LEU C 2 134 ? 38.923 44.883 12.176  1.00 12.68 ?  1588 LEU C C   1 
ATOM   3978 O O   . LEU C 2 134 ? 38.337 45.759 12.820  1.00 12.16 ?  1588 LEU C O   1 
ATOM   3979 C CB  . LEU C 2 134 ? 39.308 43.003 13.766  1.00 15.93 ?  1588 LEU C CB  1 
ATOM   3980 C CG  . LEU C 2 134 ? 40.206 42.041 14.541  1.00 21.39 ?  1588 LEU C CG  1 
ATOM   3981 C CD1 . LEU C 2 134 ? 39.424 41.389 15.672  1.00 11.78 ?  1588 LEU C CD1 1 
ATOM   3982 C CD2 . LEU C 2 134 ? 40.781 40.993 13.608  1.00 15.57 ?  1588 LEU C CD2 1 
ATOM   3983 N N   . SER C 2 135 ? 38.685 44.637 10.891  1.00 9.78  ?  1589 SER C N   1 
ATOM   3984 C CA  . SER C 2 135 ? 37.557 45.264 10.227  1.00 11.22 ?  1589 SER C CA  1 
ATOM   3985 C C   . SER C 2 135 ? 36.254 44.741 10.823  1.00 10.45 ?  1589 SER C C   1 
ATOM   3986 O O   . SER C 2 135 ? 36.230 43.752 11.563  1.00 9.16  ?  1589 SER C O   1 
ATOM   3987 C CB  . SER C 2 135 ? 37.599 45.001 8.721   1.00 18.27 ?  1589 SER C CB  1 
ATOM   3988 O OG  . SER C 2 135 ? 37.110 43.704 8.417   1.00 14.93 ?  1589 SER C OG  1 
ATOM   3989 N N   . LEU C 2 136 ? 35.155 45.425 10.498  1.00 8.40  ?  1590 LEU C N   1 
ATOM   3990 C CA  . LEU C 2 136 ? 33.848 44.989 10.978  1.00 13.71 ?  1590 LEU C CA  1 
ATOM   3991 C C   . LEU C 2 136 ? 33.598 43.528 10.625  1.00 11.69 ?  1590 LEU C C   1 
ATOM   3992 O O   . LEU C 2 136 ? 33.207 42.726 11.480  1.00 12.79 ?  1590 LEU C O   1 
ATOM   3993 C CB  . LEU C 2 136 ? 32.753 45.880 10.393  1.00 13.54 ?  1590 LEU C CB  1 
ATOM   3994 C CG  . LEU C 2 136 ? 31.313 45.451 10.682  1.00 16.97 ?  1590 LEU C CG  1 
ATOM   3995 C CD1 . LEU C 2 136 ? 31.059 45.389 12.182  1.00 22.13 ?  1590 LEU C CD1 1 
ATOM   3996 C CD2 . LEU C 2 136 ? 30.329 46.392 10.004  1.00 15.81 ?  1590 LEU C CD2 1 
ATOM   3997 N N   . GLU C 2 137 ? 33.844 43.161 9.367   1.00 12.12 ?  1591 GLU C N   1 
ATOM   3998 C CA  . GLU C 2 137 ? 33.601 41.790 8.932   1.00 13.54 ?  1591 GLU C CA  1 
ATOM   3999 C C   . GLU C 2 137 ? 34.611 40.825 9.541   1.00 12.56 ?  1591 GLU C C   1 
ATOM   4000 O O   . GLU C 2 137 ? 34.267 39.683 9.868   1.00 16.13 ?  1591 GLU C O   1 
ATOM   4001 C CB  . GLU C 2 137 ? 33.636 41.715 7.404   1.00 20.03 ?  1591 GLU C CB  1 
ATOM   4002 C CG  . GLU C 2 137 ? 32.557 42.537 6.706   1.00 28.71 ?  1591 GLU C CG  1 
ATOM   4003 C CD  . GLU C 2 137 ? 32.901 44.016 6.614   1.00 55.31 ?  1591 GLU C CD  1 
ATOM   4004 O OE1 . GLU C 2 137 ? 34.028 44.396 7.000   1.00 33.41 ?  1591 GLU C OE1 1 
ATOM   4005 O OE2 . GLU C 2 137 ? 32.042 44.798 6.154   1.00 62.79 -1 1591 GLU C OE2 1 
ATOM   4006 N N   . GLN C 2 138 ? 35.863 41.263 9.698   1.00 10.08 ?  1592 GLN C N   1 
ATOM   4007 C CA  . GLN C 2 138 ? 36.885 40.395 10.275  1.00 9.46  ?  1592 GLN C CA  1 
ATOM   4008 C C   . GLN C 2 138 ? 36.586 40.085 11.737  1.00 11.62 ?  1592 GLN C C   1 
ATOM   4009 O O   . GLN C 2 138 ? 36.687 38.931 12.171  1.00 13.13 ?  1592 GLN C O   1 
ATOM   4010 C CB  . GLN C 2 138 ? 38.264 41.043 10.139  1.00 10.70 ?  1592 GLN C CB  1 
ATOM   4011 C CG  . GLN C 2 138 ? 38.847 40.983 8.738   1.00 12.58 ?  1592 GLN C CG  1 
ATOM   4012 C CD  . GLN C 2 138 ? 40.050 41.891 8.575   1.00 17.07 ?  1592 GLN C CD  1 
ATOM   4013 O OE1 . GLN C 2 138 ? 40.351 42.707 9.447   1.00 10.57 ?  1592 GLN C OE1 1 
ATOM   4014 N NE2 . GLN C 2 138 ? 40.744 41.756 7.451   1.00 11.05 ?  1592 GLN C NE2 1 
ATOM   4015 N N   . GLY C 2 139 ? 36.217 41.105 12.514  1.00 6.85  ?  1593 GLY C N   1 
ATOM   4016 C CA  . GLY C 2 139 ? 35.958 40.886 13.927  1.00 6.65  ?  1593 GLY C CA  1 
ATOM   4017 C C   . GLY C 2 139 ? 34.646 40.169 14.180  1.00 14.78 ?  1593 GLY C C   1 
ATOM   4018 O O   . GLY C 2 139 ? 34.537 39.373 15.117  1.00 10.69 ?  1593 GLY C O   1 
ATOM   4019 N N   . ASN C 2 140 ? 33.634 40.436 13.348  1.00 14.63 ?  1594 ASN C N   1 
ATOM   4020 C CA  . ASN C 2 140 ? 32.346 39.768 13.506  1.00 18.88 ?  1594 ASN C CA  1 
ATOM   4021 C C   . ASN C 2 140 ? 32.479 38.254 13.393  1.00 12.94 ?  1594 ASN C C   1 
ATOM   4022 O O   . ASN C 2 140 ? 31.735 37.517 14.049  1.00 15.06 ?  1594 ASN C O   1 
ATOM   4023 C CB  . ASN C 2 140 ? 31.354 40.294 12.467  1.00 13.58 ?  1594 ASN C CB  1 
ATOM   4024 C CG  . ASN C 2 140 ? 30.696 41.597 12.890  1.00 24.77 ?  1594 ASN C CG  1 
ATOM   4025 O OD1 . ASN C 2 140 ? 30.856 42.051 14.024  1.00 24.64 ?  1594 ASN C OD1 1 
ATOM   4026 N ND2 . ASN C 2 140 ? 29.946 42.204 11.976  1.00 25.04 ?  1594 ASN C ND2 1 
ATOM   4027 N N   . ARG C 2 141 ? 33.425 37.773 12.582  1.00 13.07 ?  1595 ARG C N   1 
ATOM   4028 C CA  . ARG C 2 141 ? 33.640 36.339 12.423  1.00 14.61 ?  1595 ARG C CA  1 
ATOM   4029 C C   . ARG C 2 141 ? 34.247 35.684 13.658  1.00 16.20 ?  1595 ARG C C   1 
ATOM   4030 O O   . ARG C 2 141 ? 34.362 34.454 13.692  1.00 10.71 ?  1595 ARG C O   1 
ATOM   4031 C CB  . ARG C 2 141 ? 34.534 36.080 11.208  1.00 13.35 ?  1595 ARG C CB  1 
ATOM   4032 C CG  . ARG C 2 141 ? 33.881 36.444 9.884   1.00 12.98 ?  1595 ARG C CG  1 
ATOM   4033 C CD  . ARG C 2 141 ? 34.899 36.549 8.761   1.00 17.31 ?  1595 ARG C CD  1 
ATOM   4034 N NE  . ARG C 2 141 ? 34.295 37.082 7.543   1.00 21.82 ?  1595 ARG C NE  1 
ATOM   4035 C CZ  . ARG C 2 141 ? 34.964 37.742 6.603   1.00 24.94 ?  1595 ARG C CZ  1 
ATOM   4036 N NH1 . ARG C 2 141 ? 36.267 37.951 6.735   1.00 18.50 ?  1595 ARG C NH1 1 
ATOM   4037 N NH2 . ARG C 2 141 ? 34.329 38.191 5.529   1.00 22.58 ?  1595 ARG C NH2 1 
ATOM   4038 N N   . LEU C 2 142 ? 34.637 36.464 14.665  1.00 15.89 ?  1596 LEU C N   1 
ATOM   4039 C CA  . LEU C 2 142 ? 35.206 35.934 15.896  1.00 13.08 ?  1596 LEU C CA  1 
ATOM   4040 C C   . LEU C 2 142 ? 34.227 35.964 17.061  1.00 14.56 ?  1596 LEU C C   1 
ATOM   4041 O O   . LEU C 2 142 ? 34.596 35.571 18.172  1.00 10.92 ?  1596 LEU C O   1 
ATOM   4042 C CB  . LEU C 2 142 ? 36.469 36.717 16.276  1.00 10.11 ?  1596 LEU C CB  1 
ATOM   4043 C CG  . LEU C 2 142 ? 37.821 36.255 15.723  1.00 12.46 ?  1596 LEU C CG  1 
ATOM   4044 C CD1 . LEU C 2 142 ? 37.855 36.322 14.201  1.00 10.86 ?  1596 LEU C CD1 1 
ATOM   4045 C CD2 . LEU C 2 142 ? 38.951 37.082 16.320  1.00 12.75 ?  1596 LEU C CD2 1 
ATOM   4046 N N   . ARG C 2 143 ? 32.990 36.413 16.836  1.00 11.60 ?  1597 ARG C N   1 
ATOM   4047 C CA  . ARG C 2 143 ? 32.077 36.655 17.948  1.00 15.48 ?  1597 ARG C CA  1 
ATOM   4048 C C   . ARG C 2 143 ? 31.635 35.362 18.623  1.00 14.20 ?  1597 ARG C C   1 
ATOM   4049 O O   . ARG C 2 143 ? 31.389 35.353 19.834  1.00 18.38 ?  1597 ARG C O   1 
ATOM   4050 C CB  . ARG C 2 143 ? 30.864 37.450 17.462  1.00 14.65 ?  1597 ARG C CB  1 
ATOM   4051 C CG  . ARG C 2 143 ? 31.146 38.937 17.296  1.00 14.90 ?  1597 ARG C CG  1 
ATOM   4052 C CD  . ARG C 2 143 ? 29.908 39.710 16.867  1.00 13.24 ?  1597 ARG C CD  1 
ATOM   4053 N NE  . ARG C 2 143 ? 29.432 39.302 15.549  1.00 27.69 ?  1597 ARG C NE  1 
ATOM   4054 C CZ  . ARG C 2 143 ? 28.567 39.999 14.819  1.00 35.74 ?  1597 ARG C CZ  1 
ATOM   4055 N NH1 . ARG C 2 143 ? 28.083 41.147 15.275  1.00 29.55 ?  1597 ARG C NH1 1 
ATOM   4056 N NH2 . ARG C 2 143 ? 28.188 39.551 13.630  1.00 25.22 ?  1597 ARG C NH2 1 
ATOM   4057 N N   . GLU C 2 144 ? 31.533 34.263 17.873  1.00 16.29 ?  1598 GLU C N   1 
ATOM   4058 C CA  . GLU C 2 144 ? 31.099 33.010 18.480  1.00 20.51 ?  1598 GLU C CA  1 
ATOM   4059 C C   . GLU C 2 144 ? 32.171 32.438 19.400  1.00 20.73 ?  1598 GLU C C   1 
ATOM   4060 O O   . GLU C 2 144 ? 31.858 31.925 20.481  1.00 21.88 ?  1598 GLU C O   1 
ATOM   4061 C CB  . GLU C 2 144 ? 30.722 32.000 17.395  1.00 22.42 ?  1598 GLU C CB  1 
ATOM   4062 C CG  . GLU C 2 144 ? 30.332 30.631 17.934  1.00 26.47 ?  1598 GLU C CG  1 
ATOM   4063 C CD  . GLU C 2 144 ? 28.943 30.204 17.500  1.00 45.05 ?  1598 GLU C CD  1 
ATOM   4064 O OE1 . GLU C 2 144 ? 28.138 31.081 17.122  1.00 33.13 ?  1598 GLU C OE1 1 
ATOM   4065 O OE2 . GLU C 2 144 ? 28.656 28.988 17.538  1.00 41.51 -1 1598 GLU C OE2 1 
ATOM   4066 N N   . GLN C 2 145 ? 33.439 32.525 18.997  1.00 16.74 ?  1599 GLN C N   1 
ATOM   4067 C CA  . GLN C 2 145 ? 34.510 31.958 19.810  1.00 15.33 ?  1599 GLN C CA  1 
ATOM   4068 C C   . GLN C 2 145 ? 34.895 32.871 20.969  1.00 16.84 ?  1599 GLN C C   1 
ATOM   4069 O O   . GLN C 2 145 ? 35.234 32.385 22.054  1.00 16.47 ?  1599 GLN C O   1 
ATOM   4070 C CB  . GLN C 2 145 ? 35.737 31.671 18.943  1.00 17.87 ?  1599 GLN C CB  1 
ATOM   4071 C CG  . GLN C 2 145 ? 35.452 30.858 17.692  1.00 32.53 ?  1599 GLN C CG  1 
ATOM   4072 C CD  . GLN C 2 145 ? 34.983 29.452 18.002  1.00 52.07 ?  1599 GLN C CD  1 
ATOM   4073 O OE1 . GLN C 2 145 ? 35.684 28.681 18.657  1.00 67.31 ?  1599 GLN C OE1 1 
ATOM   4074 N NE2 . GLN C 2 145 ? 33.788 29.110 17.531  1.00 40.94 ?  1599 GLN C NE2 1 
ATOM   4075 N N   . TYR C 2 146 ? 34.849 34.191 20.767  1.00 15.48 ?  1600 TYR C N   1 
ATOM   4076 C CA  . TYR C 2 146 ? 35.409 35.127 21.733  1.00 18.35 ?  1600 TYR C CA  1 
ATOM   4077 C C   . TYR C 2 146 ? 34.487 36.270 22.134  1.00 13.18 ?  1600 TYR C C   1 
ATOM   4078 O O   . TYR C 2 146 ? 34.840 37.019 23.051  1.00 14.42 ?  1600 TYR C O   1 
ATOM   4079 C CB  . TYR C 2 146 ? 36.717 35.728 21.194  1.00 12.10 ?  1600 TYR C CB  1 
ATOM   4080 C CG  . TYR C 2 146 ? 37.671 34.696 20.641  1.00 14.45 ?  1600 TYR C CG  1 
ATOM   4081 C CD1 . TYR C 2 146 ? 38.366 33.844 21.487  1.00 22.00 ?  1600 TYR C CD1 1 
ATOM   4082 C CD2 . TYR C 2 146 ? 37.872 34.570 19.272  1.00 17.15 ?  1600 TYR C CD2 1 
ATOM   4083 C CE1 . TYR C 2 146 ? 39.238 32.896 20.988  1.00 22.35 ?  1600 TYR C CE1 1 
ATOM   4084 C CE2 . TYR C 2 146 ? 38.740 33.625 18.762  1.00 20.59 ?  1600 TYR C CE2 1 
ATOM   4085 C CZ  . TYR C 2 146 ? 39.421 32.790 19.626  1.00 23.30 ?  1600 TYR C CZ  1 
ATOM   4086 O OH  . TYR C 2 146 ? 40.287 31.845 19.127  1.00 23.63 ?  1600 TYR C OH  1 
ATOM   4087 N N   . GLY C 2 147 ? 33.332 36.432 21.494  1.00 7.92  ?  1601 GLY C N   1 
ATOM   4088 C CA  . GLY C 2 147 ? 32.487 37.573 21.792  1.00 11.54 ?  1601 GLY C CA  1 
ATOM   4089 C C   . GLY C 2 147 ? 31.860 37.488 23.171  1.00 16.94 ?  1601 GLY C C   1 
ATOM   4090 O O   . GLY C 2 147 ? 31.594 36.409 23.699  1.00 19.49 ?  1601 GLY C O   1 
ATOM   4091 N N   . LEU C 2 148 ? 31.611 38.660 23.757  1.00 16.13 ?  1602 LEU C N   1 
ATOM   4092 C CA  . LEU C 2 148 ? 31.057 38.726 25.107  1.00 16.90 ?  1602 LEU C CA  1 
ATOM   4093 C C   . LEU C 2 148 ? 29.546 38.523 25.109  1.00 19.71 ?  1602 LEU C C   1 
ATOM   4094 O O   . LEU C 2 148 ? 29.026 37.652 25.814  1.00 23.50 ?  1602 LEU C O   1 
ATOM   4095 C CB  . LEU C 2 148 ? 31.407 40.067 25.755  1.00 16.34 ?  1602 LEU C CB  1 
ATOM   4096 C CG  . LEU C 2 148 ? 32.394 40.023 26.918  1.00 26.10 ?  1602 LEU C CG  1 
ATOM   4097 C CD1 . LEU C 2 148 ? 33.717 39.439 26.458  1.00 25.33 ?  1602 LEU C CD1 1 
ATOM   4098 C CD2 . LEU C 2 148 ? 32.586 41.411 27.507  1.00 20.93 ?  1602 LEU C CD2 1 
ATOM   4099 N N   . GLY C 2 149 ? 28.825 39.330 24.337  1.00 14.48 ?  1603 GLY C N   1 
ATOM   4100 C CA  . GLY C 2 149 ? 27.383 39.322 24.377  1.00 18.81 ?  1603 GLY C CA  1 
ATOM   4101 C C   . GLY C 2 149 ? 26.860 40.227 25.475  1.00 18.29 ?  1603 GLY C C   1 
ATOM   4102 O O   . GLY C 2 149 ? 27.632 40.894 26.170  1.00 14.64 ?  1603 GLY C O   1 
ATOM   4103 N N   . PRO C 2 150 ? 25.532 40.261 25.670  1.00 18.97 ?  1604 PRO C N   1 
ATOM   4104 C CA  . PRO C 2 150 ? 24.520 39.463 24.968  1.00 19.64 ?  1604 PRO C CA  1 
ATOM   4105 C C   . PRO C 2 150 ? 24.298 39.904 23.526  1.00 23.76 ?  1604 PRO C C   1 
ATOM   4106 O O   . PRO C 2 150 ? 24.701 41.003 23.143  1.00 21.03 ?  1604 PRO C O   1 
ATOM   4107 C CB  . PRO C 2 150 ? 23.257 39.696 25.801  1.00 17.84 ?  1604 PRO C CB  1 
ATOM   4108 C CG  . PRO C 2 150 ? 23.449 41.056 26.374  1.00 19.44 ?  1604 PRO C CG  1 
ATOM   4109 C CD  . PRO C 2 150 ? 24.923 41.163 26.664  1.00 19.68 ?  1604 PRO C CD  1 
ATOM   4110 N N   . TYR C 2 151 ? 23.665 39.041 22.739  1.00 20.29 ?  1605 TYR C N   1 
ATOM   4111 C CA  . TYR C 2 151 ? 23.410 39.289 21.322  1.00 19.78 ?  1605 TYR C CA  1 
ATOM   4112 C C   . TYR C 2 151 ? 21.901 39.293 21.105  1.00 29.73 ?  1605 TYR C C   1 
ATOM   4113 O O   . TYR C 2 151 ? 21.267 38.234 21.062  1.00 28.43 ?  1605 TYR C O   1 
ATOM   4114 C CB  . TYR C 2 151 ? 24.106 38.242 20.461  1.00 17.97 ?  1605 TYR C CB  1 
ATOM   4115 C CG  . TYR C 2 151 ? 25.609 38.304 20.574  1.00 10.74 ?  1605 TYR C CG  1 
ATOM   4116 C CD1 . TYR C 2 151 ? 26.328 39.295 19.920  1.00 17.12 ?  1605 TYR C CD1 1 
ATOM   4117 C CD2 . TYR C 2 151 ? 26.306 37.389 21.349  1.00 16.19 ?  1605 TYR C CD2 1 
ATOM   4118 C CE1 . TYR C 2 151 ? 27.699 39.364 20.023  1.00 13.62 ?  1605 TYR C CE1 1 
ATOM   4119 C CE2 . TYR C 2 151 ? 27.683 37.449 21.455  1.00 12.50 ?  1605 TYR C CE2 1 
ATOM   4120 C CZ  . TYR C 2 151 ? 28.370 38.442 20.791  1.00 13.17 ?  1605 TYR C CZ  1 
ATOM   4121 O OH  . TYR C 2 151 ? 29.737 38.517 20.890  1.00 20.60 ?  1605 TYR C OH  1 
ATOM   4122 N N   . GLU C 2 152 ? 21.331 40.486 20.976  1.00 38.19 ?  1606 GLU C N   1 
ATOM   4123 C CA  . GLU C 2 152 ? 19.897 40.642 20.775  1.00 48.44 ?  1606 GLU C CA  1 
ATOM   4124 C C   . GLU C 2 152 ? 19.586 40.975 19.319  1.00 35.90 ?  1606 GLU C C   1 
ATOM   4125 O O   . GLU C 2 152 ? 18.459 41.338 18.983  1.00 50.95 ?  1606 GLU C O   1 
ATOM   4126 C CB  . GLU C 2 152 ? 19.343 41.730 21.697  1.00 44.20 ?  1606 GLU C CB  1 
ATOM   4127 C CG  . GLU C 2 152 ? 19.687 41.534 23.167  1.00 53.59 ?  1606 GLU C CG  1 
ATOM   4128 C CD  . GLU C 2 152 ? 20.540 42.659 23.725  1.00 67.62 ?  1606 GLU C CD  1 
ATOM   4129 O OE1 . GLU C 2 152 ? 20.515 42.871 24.956  1.00 63.66 ?  1606 GLU C OE1 1 
ATOM   4130 O OE2 . GLU C 2 152 ? 21.238 43.328 22.934  1.00 60.33 ?  1606 GLU C OE2 1 
HETATM 4131 O O   . HOH D 3 .   ? 31.999 62.296 24.412  1.00 36.48 ?  301  HOH A O   1 
HETATM 4132 O O   . HOH D 3 .   ? 34.296 52.686 10.726  1.00 34.34 ?  302  HOH A O   1 
HETATM 4133 O O   . HOH D 3 .   ? 48.577 77.415 21.077  1.00 33.86 ?  303  HOH A O   1 
HETATM 4134 O O   . HOH D 3 .   ? 49.641 72.101 13.412  1.00 26.47 ?  304  HOH A O   1 
HETATM 4135 O O   . HOH D 3 .   ? 44.298 64.390 22.334  1.00 20.12 ?  305  HOH A O   1 
HETATM 4136 O O   . HOH D 3 .   ? 39.916 58.840 29.565  1.00 37.26 ?  306  HOH A O   1 
HETATM 4137 O O   . HOH D 3 .   ? 51.370 74.208 -0.196  1.00 54.71 ?  307  HOH A O   1 
HETATM 4138 O O   . HOH D 3 .   ? 45.520 82.073 9.316   1.00 31.95 ?  308  HOH A O   1 
HETATM 4139 O O   . HOH D 3 .   ? 26.049 86.223 6.459   1.00 12.47 ?  309  HOH A O   1 
HETATM 4140 O O   . HOH D 3 .   ? 19.750 68.907 -13.259 1.00 29.56 ?  310  HOH A O   1 
HETATM 4141 O O   . HOH D 3 .   ? 15.855 78.579 -2.992  1.00 22.42 ?  311  HOH A O   1 
HETATM 4142 O O   . HOH D 3 .   ? 27.366 63.897 14.780  1.00 26.66 ?  312  HOH A O   1 
HETATM 4143 O O   . HOH D 3 .   ? 18.153 72.423 10.770  1.00 18.74 ?  313  HOH A O   1 
HETATM 4144 O O   . HOH D 3 .   ? 47.855 56.672 21.559  1.00 21.79 ?  314  HOH A O   1 
HETATM 4145 O O   . HOH D 3 .   ? 41.826 75.990 2.003   1.00 14.96 ?  315  HOH A O   1 
HETATM 4146 O O   . HOH D 3 .   ? 31.277 81.354 14.971  1.00 22.85 ?  316  HOH A O   1 
HETATM 4147 O O   . HOH D 3 .   ? 47.391 65.344 14.485  1.00 20.83 ?  317  HOH A O   1 
HETATM 4148 O O   . HOH D 3 .   ? 18.480 84.033 -1.003  1.00 16.64 ?  318  HOH A O   1 
HETATM 4149 O O   . HOH D 3 .   ? 17.041 85.964 -2.492  1.00 31.44 ?  319  HOH A O   1 
HETATM 4150 O O   . HOH D 3 .   ? 30.673 67.172 19.404  1.00 37.12 ?  320  HOH A O   1 
HETATM 4151 O O   . HOH D 3 .   ? 17.776 75.655 0.767   1.00 28.86 ?  321  HOH A O   1 
HETATM 4152 O O   . HOH D 3 .   ? 16.473 65.410 14.682  1.00 55.02 ?  322  HOH A O   1 
HETATM 4153 O O   . HOH D 3 .   ? 17.344 72.397 -1.713  1.00 25.41 ?  323  HOH A O   1 
HETATM 4154 O O   . HOH D 3 .   ? 34.353 76.706 4.504   1.00 9.86  ?  324  HOH A O   1 
HETATM 4155 O O   . HOH D 3 .   ? 32.544 57.473 13.927  1.00 17.93 ?  325  HOH A O   1 
HETATM 4156 O O   . HOH D 3 .   ? 43.934 77.848 -1.776  1.00 20.06 ?  326  HOH A O   1 
HETATM 4157 O O   . HOH D 3 .   ? 15.328 66.455 -4.305  1.00 25.58 ?  327  HOH A O   1 
HETATM 4158 O O   . HOH D 3 .   ? 40.126 69.427 2.888   1.00 10.96 ?  328  HOH A O   1 
HETATM 4159 O O   . HOH D 3 .   ? 26.212 63.842 9.616   1.00 17.33 ?  329  HOH A O   1 
HETATM 4160 O O   . HOH D 3 .   ? 36.782 66.896 7.153   1.00 23.34 ?  330  HOH A O   1 
HETATM 4161 O O   . HOH D 3 .   ? 29.252 59.899 21.406  1.00 30.30 ?  331  HOH A O   1 
HETATM 4162 O O   . HOH D 3 .   ? 54.188 66.410 14.875  1.00 31.23 ?  332  HOH A O   1 
HETATM 4163 O O   . HOH D 3 .   ? 25.968 79.167 -2.799  1.00 15.39 ?  333  HOH A O   1 
HETATM 4164 O O   . HOH D 3 .   ? 32.953 65.966 28.335  1.00 27.08 ?  334  HOH A O   1 
HETATM 4165 O O   . HOH D 3 .   ? 33.485 84.155 16.396  1.00 34.86 ?  335  HOH A O   1 
HETATM 4166 O O   . HOH D 3 .   ? 29.002 61.180 -2.360  1.00 27.70 ?  336  HOH A O   1 
HETATM 4167 O O   . HOH D 3 .   ? 46.326 62.758 20.244  1.00 20.43 ?  337  HOH A O   1 
HETATM 4168 O O   . HOH D 3 .   ? 46.154 58.427 13.433  1.00 22.73 ?  338  HOH A O   1 
HETATM 4169 O O   . HOH D 3 .   ? 34.851 59.357 -1.597  1.00 31.25 ?  339  HOH A O   1 
HETATM 4170 O O   . HOH D 3 .   ? 42.830 70.373 3.081   1.00 22.74 ?  340  HOH A O   1 
HETATM 4171 O O   . HOH D 3 .   ? 39.037 56.995 13.574  1.00 15.01 ?  341  HOH A O   1 
HETATM 4172 O O   . HOH D 3 .   ? 16.509 68.523 -2.515  1.00 22.42 ?  342  HOH A O   1 
HETATM 4173 O O   . HOH D 3 .   ? 45.710 81.483 16.245  1.00 41.24 ?  343  HOH A O   1 
HETATM 4174 O O   . HOH D 3 .   ? 33.681 67.096 13.141  1.00 16.86 ?  344  HOH A O   1 
HETATM 4175 O O   . HOH D 3 .   ? 42.648 77.461 -4.077  1.00 17.10 ?  345  HOH A O   1 
HETATM 4176 O O   . HOH D 3 .   ? 46.917 72.433 16.947  1.00 20.23 ?  346  HOH A O   1 
HETATM 4177 O O   . HOH D 3 .   ? 40.931 72.154 24.369  1.00 37.69 ?  347  HOH A O   1 
HETATM 4178 O O   . HOH D 3 .   ? 38.988 62.191 7.716   1.00 33.09 ?  348  HOH A O   1 
HETATM 4179 O O   . HOH D 3 .   ? 32.017 77.394 20.442  1.00 29.21 ?  349  HOH A O   1 
HETATM 4180 O O   . HOH D 3 .   ? 48.251 72.293 -9.836  1.00 26.88 ?  350  HOH A O   1 
HETATM 4181 O O   . HOH D 3 .   ? 15.311 78.316 -14.309 1.00 35.32 ?  351  HOH A O   1 
HETATM 4182 O O   . HOH D 3 .   ? 23.213 78.303 -2.470  1.00 16.68 ?  352  HOH A O   1 
HETATM 4183 O O   . HOH D 3 .   ? 32.187 67.979 20.877  1.00 31.46 ?  353  HOH A O   1 
HETATM 4184 O O   . HOH D 3 .   ? 32.890 69.566 24.069  1.00 23.47 ?  354  HOH A O   1 
HETATM 4185 O O   . HOH D 3 .   ? 24.639 86.842 -4.664  1.00 32.54 ?  355  HOH A O   1 
HETATM 4186 O O   . HOH D 3 .   ? 36.382 87.363 10.166  1.00 44.98 ?  356  HOH A O   1 
HETATM 4187 O O   . HOH D 3 .   ? 13.011 68.782 -4.463  1.00 43.11 ?  357  HOH A O   1 
HETATM 4188 O O   . HOH D 3 .   ? 19.302 83.957 3.669   1.00 26.80 ?  358  HOH A O   1 
HETATM 4189 O O   . HOH D 3 .   ? 26.652 59.341 1.292   1.00 38.39 ?  359  HOH A O   1 
HETATM 4190 O O   . HOH D 3 .   ? 27.602 60.424 18.721  1.00 21.97 ?  360  HOH A O   1 
HETATM 4191 O O   . HOH D 3 .   ? 46.630 84.939 -0.114  1.00 29.89 ?  361  HOH A O   1 
HETATM 4192 O O   . HOH D 3 .   ? 41.730 65.937 7.428   1.00 29.35 ?  362  HOH A O   1 
HETATM 4193 O O   . HOH D 3 .   ? 42.705 73.966 3.454   1.00 12.69 ?  363  HOH A O   1 
HETATM 4194 O O   . HOH D 3 .   ? 14.176 79.259 -12.662 1.00 27.75 ?  364  HOH A O   1 
HETATM 4195 O O   . HOH D 3 .   ? 38.942 80.784 -4.443  1.00 11.91 ?  365  HOH A O   1 
HETATM 4196 O O   . HOH D 3 .   ? 50.270 79.554 8.325   1.00 38.61 ?  366  HOH A O   1 
HETATM 4197 O O   . HOH D 3 .   ? 28.300 91.518 2.021   1.00 25.71 ?  367  HOH A O   1 
HETATM 4198 O O   . HOH D 3 .   ? 48.088 69.746 7.678   1.00 31.60 ?  368  HOH A O   1 
HETATM 4199 O O   . HOH D 3 .   ? 21.797 85.039 8.681   1.00 31.92 ?  369  HOH A O   1 
HETATM 4200 O O   . HOH D 3 .   ? 15.950 76.264 -13.357 1.00 21.37 ?  370  HOH A O   1 
HETATM 4201 O O   . HOH D 3 .   ? 23.736 64.878 10.786  1.00 27.55 ?  371  HOH A O   1 
HETATM 4202 O O   . HOH D 3 .   ? 17.451 61.178 -7.996  1.00 38.86 ?  372  HOH A O   1 
HETATM 4203 O O   . HOH D 3 .   ? 15.628 68.925 -0.240  1.00 31.26 ?  373  HOH A O   1 
HETATM 4204 O O   . HOH D 3 .   ? 31.416 89.135 10.287  1.00 45.66 ?  374  HOH A O   1 
HETATM 4205 O O   . HOH D 3 .   ? 34.847 59.459 8.400   1.00 15.03 ?  375  HOH A O   1 
HETATM 4206 O O   . HOH D 3 .   ? 44.867 79.720 21.417  1.00 39.53 ?  376  HOH A O   1 
HETATM 4207 O O   . HOH D 3 .   ? 46.733 68.212 6.579   1.00 19.91 ?  377  HOH A O   1 
HETATM 4208 O O   . HOH D 3 .   ? 42.370 78.763 21.843  1.00 36.88 ?  378  HOH A O   1 
HETATM 4209 O O   . HOH D 3 .   ? 21.736 64.893 -12.525 1.00 28.47 ?  379  HOH A O   1 
HETATM 4210 O O   . HOH D 3 .   ? 25.513 88.415 3.893   1.00 26.43 ?  380  HOH A O   1 
HETATM 4211 O O   . HOH D 3 .   ? 37.735 68.109 11.010  1.00 20.57 ?  381  HOH A O   1 
HETATM 4212 O O   . HOH D 3 .   ? 32.969 91.276 -2.753  1.00 39.68 ?  382  HOH A O   1 
HETATM 4213 O O   . HOH D 3 .   ? 19.187 74.575 -15.615 1.00 32.38 ?  383  HOH A O   1 
HETATM 4214 O O   . HOH D 3 .   ? 36.776 59.290 2.431   1.00 28.27 ?  384  HOH A O   1 
HETATM 4215 O O   . HOH D 3 .   ? 15.196 74.949 -3.437  1.00 20.35 ?  385  HOH A O   1 
HETATM 4216 O O   . HOH D 3 .   ? 36.988 68.393 5.472   1.00 19.94 ?  386  HOH A O   1 
HETATM 4217 O O   . HOH D 3 .   ? 29.426 82.489 13.386  1.00 18.38 ?  387  HOH A O   1 
HETATM 4218 O O   . HOH D 3 .   ? 48.379 80.025 14.602  1.00 36.69 ?  388  HOH A O   1 
HETATM 4219 O O   . HOH D 3 .   ? 48.803 81.148 -5.306  1.00 29.51 ?  389  HOH A O   1 
HETATM 4220 O O   . HOH D 3 .   ? 40.875 89.339 -0.292  1.00 28.04 ?  390  HOH A O   1 
HETATM 4221 O O   . HOH D 3 .   ? 17.065 79.179 7.766   1.00 34.81 ?  391  HOH A O   1 
HETATM 4222 O O   . HOH D 3 .   ? 31.565 60.640 -1.452  1.00 20.70 ?  392  HOH A O   1 
HETATM 4223 O O   . HOH D 3 .   ? 9.502  69.733 -8.416  1.00 41.25 ?  393  HOH A O   1 
HETATM 4224 O O   . HOH D 3 .   ? 41.688 55.945 8.027   1.00 36.88 ?  394  HOH A O   1 
HETATM 4225 O O   . HOH D 3 .   ? 43.192 73.046 22.298  1.00 22.08 ?  395  HOH A O   1 
HETATM 4226 O O   . HOH D 3 .   ? 28.023 63.466 11.935  1.00 18.91 ?  396  HOH A O   1 
HETATM 4227 O O   . HOH D 3 .   ? 45.257 73.846 3.888   1.00 29.05 ?  397  HOH A O   1 
HETATM 4228 O O   . HOH D 3 .   ? 45.887 55.035 13.832  1.00 23.96 ?  398  HOH A O   1 
HETATM 4229 O O   . HOH D 3 .   ? 30.108 87.177 -4.158  1.00 24.74 ?  399  HOH A O   1 
HETATM 4230 O O   . HOH D 3 .   ? 21.344 67.214 -13.703 1.00 30.39 ?  400  HOH A O   1 
HETATM 4231 O O   . HOH D 3 .   ? 42.632 66.967 5.353   1.00 26.87 ?  401  HOH A O   1 
HETATM 4232 O O   . HOH D 3 .   ? 14.452 62.032 -2.704  1.00 36.39 ?  402  HOH A O   1 
HETATM 4233 O O   . HOH D 3 .   ? 18.816 60.584 9.149   1.00 48.52 ?  403  HOH A O   1 
HETATM 4234 O O   . HOH D 3 .   ? 39.948 64.411 8.742   1.00 31.12 ?  404  HOH A O   1 
HETATM 4235 O O   . HOH D 3 .   ? 28.023 86.315 -4.690  1.00 30.71 ?  405  HOH A O   1 
HETATM 4236 O O   . HOH D 3 .   ? 50.988 73.883 -9.384  1.00 29.46 ?  406  HOH A O   1 
HETATM 4237 O O   . HOH D 3 .   ? 40.640 81.205 20.680  1.00 33.46 ?  407  HOH A O   1 
HETATM 4238 O O   . HOH D 3 .   ? 57.056 64.898 20.637  1.00 29.57 ?  408  HOH A O   1 
HETATM 4239 O O   . HOH D 3 .   ? 15.854 70.292 11.344  1.00 31.69 ?  409  HOH A O   1 
HETATM 4240 O O   . HOH D 3 .   ? 44.242 60.747 0.023   1.00 32.93 ?  410  HOH A O   1 
HETATM 4241 O O   . HOH D 3 .   ? 22.164 65.947 9.414   1.00 27.99 ?  411  HOH A O   1 
HETATM 4242 O O   . HOH D 3 .   ? 43.634 69.792 1.064   1.00 24.70 ?  412  HOH A O   1 
HETATM 4243 O O   . HOH D 3 .   ? 40.570 78.742 -5.215  1.00 13.65 ?  413  HOH A O   1 
HETATM 4244 O O   . HOH D 3 .   ? 47.762 55.003 15.066  1.00 29.84 ?  414  HOH A O   1 
HETATM 4245 O O   . HOH D 3 .   ? 38.746 59.889 25.752  1.00 21.04 ?  415  HOH A O   1 
HETATM 4246 O O   . HOH D 3 .   ? 27.980 56.558 14.645  1.00 38.99 ?  416  HOH A O   1 
HETATM 4247 O O   . HOH D 3 .   ? 48.920 70.821 24.813  1.00 42.26 ?  417  HOH A O   1 
HETATM 4248 O O   . HOH D 3 .   ? 15.149 71.685 -13.466 1.00 28.62 ?  418  HOH A O   1 
HETATM 4249 O O   . HOH D 3 .   ? 44.632 59.965 29.134  1.00 39.43 ?  419  HOH A O   1 
HETATM 4250 O O   . HOH D 3 .   ? 48.915 65.768 17.388  1.00 21.31 ?  420  HOH A O   1 
HETATM 4251 O O   . HOH D 3 .   ? 33.334 59.840 24.819  1.00 32.06 ?  421  HOH A O   1 
HETATM 4252 O O   . HOH D 3 .   ? 30.077 78.050 15.705  1.00 32.87 ?  422  HOH A O   1 
HETATM 4253 O O   . HOH D 3 .   ? 30.265 65.179 11.157  1.00 27.08 ?  423  HOH A O   1 
HETATM 4254 O O   . HOH D 3 .   ? 39.809 87.269 10.474  1.00 45.36 ?  424  HOH A O   1 
HETATM 4255 O O   . HOH D 3 .   ? 51.555 84.026 -0.842  1.00 54.29 ?  425  HOH A O   1 
HETATM 4256 O O   . HOH D 3 .   ? 27.497 55.926 10.262  1.00 43.06 ?  426  HOH A O   1 
HETATM 4257 O O   . HOH D 3 .   ? 50.621 73.191 10.842  1.00 37.84 ?  427  HOH A O   1 
HETATM 4258 O O   . HOH D 3 .   ? 29.910 85.072 13.488  1.00 39.55 ?  428  HOH A O   1 
HETATM 4259 O O   . HOH D 3 .   ? 13.925 56.415 -3.849  1.00 38.18 ?  429  HOH A O   1 
HETATM 4260 O O   . HOH D 3 .   ? 50.066 71.060 11.410  1.00 32.08 ?  430  HOH A O   1 
HETATM 4261 O O   . HOH D 3 .   ? 43.475 64.696 4.880   1.00 40.18 ?  431  HOH A O   1 
HETATM 4262 O O   . HOH D 3 .   ? 13.368 70.848 11.122  1.00 38.51 ?  432  HOH A O   1 
HETATM 4263 O O   . HOH D 3 .   ? 38.413 66.729 5.056   1.00 34.41 ?  433  HOH A O   1 
HETATM 4264 O O   . HOH D 3 .   ? 36.170 58.430 0.217   1.00 47.39 ?  434  HOH A O   1 
HETATM 4265 O O   . HOH D 3 .   ? 22.066 86.482 10.473  1.00 45.95 ?  435  HOH A O   1 
HETATM 4266 O O   . HOH D 3 .   ? 44.776 69.239 3.412   1.00 33.73 ?  436  HOH A O   1 
HETATM 4267 O O   . HOH D 3 .   ? 36.738 80.344 -6.176  1.00 20.70 ?  437  HOH A O   1 
HETATM 4268 O O   . HOH D 3 .   ? 13.688 76.361 -13.696 1.00 33.25 ?  438  HOH A O   1 
HETATM 4269 O O   . HOH D 3 .   ? 26.439 55.218 12.126  1.00 47.77 ?  439  HOH A O   1 
HETATM 4270 O O   . HOH D 3 .   ? 19.360 86.538 2.522   1.00 35.32 ?  440  HOH A O   1 
HETATM 4271 O O   . HOH D 3 .   ? 48.958 64.048 12.095  1.00 36.99 ?  441  HOH A O   1 
HETATM 4272 O O   . HOH D 3 .   ? 53.274 74.822 1.070   1.00 48.85 ?  442  HOH A O   1 
HETATM 4273 O O   . HOH D 3 .   ? 26.690 82.681 13.722  1.00 42.79 ?  443  HOH A O   1 
HETATM 4274 O O   . HOH D 3 .   ? 35.259 91.682 -1.644  1.00 40.48 ?  444  HOH A O   1 
HETATM 4275 O O   . HOH D 3 .   ? 25.797 90.464 2.933   1.00 44.68 ?  445  HOH A O   1 
HETATM 4276 O O   . HOH D 3 .   ? 43.389 81.968 18.365  1.00 36.22 ?  446  HOH A O   1 
HETATM 4277 O O   . HOH D 3 .   ? 16.682 71.510 -15.156 1.00 37.22 ?  447  HOH A O   1 
HETATM 4278 O O   . HOH D 3 .   ? 47.971 69.774 -9.412  1.00 31.13 ?  448  HOH A O   1 
HETATM 4279 O O   . HOH D 3 .   ? 13.458 76.105 -9.388  1.00 35.94 ?  449  HOH A O   1 
HETATM 4280 O O   . HOH D 3 .   ? 49.555 73.579 25.091  1.00 40.23 ?  450  HOH A O   1 
HETATM 4281 O O   . HOH D 3 .   ? 56.475 76.353 20.783  1.00 28.68 ?  451  HOH A O   1 
HETATM 4282 O O   . HOH D 3 .   ? 29.688 89.431 -3.106  1.00 33.80 ?  452  HOH A O   1 
HETATM 4283 O O   . HOH D 3 .   ? 26.400 57.887 16.514  1.00 43.46 ?  453  HOH A O   1 
HETATM 4284 O O   . HOH D 3 .   ? 42.356 88.363 10.145  1.00 44.85 ?  454  HOH A O   1 
HETATM 4285 O O   . HOH D 3 .   ? 54.155 64.027 15.870  1.00 44.49 ?  455  HOH A O   1 
HETATM 4286 O O   . HOH D 3 .   ? 17.034 84.395 1.291   1.00 35.60 ?  456  HOH A O   1 
HETATM 4287 O O   . HOH D 3 .   ? 18.335 76.663 -16.634 1.00 43.50 ?  457  HOH A O   1 
HETATM 4288 O O   . HOH D 3 .   ? 41.059 63.973 6.179   1.00 46.60 ?  458  HOH A O   1 
HETATM 4289 O O   . HOH D 3 .   ? 49.319 61.449 26.007  1.00 40.64 ?  459  HOH A O   1 
HETATM 4290 O O   . HOH D 3 .   ? 18.724 55.788 -0.731  1.00 34.62 ?  460  HOH A O   1 
HETATM 4291 O O   . HOH D 3 .   ? 10.767 84.167 -5.208  1.00 48.49 ?  461  HOH A O   1 
HETATM 4292 O O   . HOH D 3 .   ? 13.680 79.127 -1.405  1.00 37.85 ?  462  HOH A O   1 
HETATM 4293 O O   . HOH D 3 .   ? 19.523 51.098 0.829   1.00 37.69 ?  463  HOH A O   1 
HETATM 4294 O O   . HOH D 3 .   ? 25.109 89.394 6.078   1.00 32.73 ?  464  HOH A O   1 
HETATM 4295 O O   . HOH D 3 .   ? 15.149 61.478 -8.158  1.00 42.62 ?  465  HOH A O   1 
HETATM 4296 O O   . HOH D 3 .   ? 39.432 91.629 -1.159  1.00 37.08 ?  466  HOH A O   1 
HETATM 4297 O O   . HOH D 3 .   ? 27.659 78.834 16.393  1.00 44.76 ?  467  HOH A O   1 
HETATM 4298 O O   . HOH D 3 .   ? 19.355 54.132 0.999   1.00 35.87 ?  468  HOH A O   1 
HETATM 4299 O O   . HOH D 3 .   ? 12.531 57.887 -2.306  1.00 43.39 ?  469  HOH A O   1 
HETATM 4300 O O   . HOH D 3 .   ? 11.739 79.108 -2.981  1.00 41.69 ?  470  HOH A O   1 
HETATM 4301 O O   . HOH E 3 .   ? 31.477 68.811 -40.820 1.00 43.56 ?  301  HOH B O   1 
HETATM 4302 O O   . HOH E 3 .   ? 30.294 81.439 -17.423 1.00 36.25 ?  302  HOH B O   1 
HETATM 4303 O O   . HOH E 3 .   ? 36.574 51.707 -20.096 1.00 38.45 ?  303  HOH B O   1 
HETATM 4304 O O   . HOH E 3 .   ? 21.965 76.809 -29.399 1.00 22.72 ?  304  HOH B O   1 
HETATM 4305 O O   . HOH E 3 .   ? 33.994 79.966 -16.054 1.00 15.09 ?  305  HOH B O   1 
HETATM 4306 O O   . HOH E 3 .   ? 21.246 73.599 -35.341 1.00 42.58 ?  306  HOH B O   1 
HETATM 4307 O O   . HOH E 3 .   ? 26.522 63.496 -13.340 1.00 32.34 ?  307  HOH B O   1 
HETATM 4308 O O   . HOH E 3 .   ? 35.890 86.317 -23.879 1.00 34.43 ?  308  HOH B O   1 
HETATM 4309 O O   . HOH E 3 .   ? 55.191 67.848 -13.322 1.00 13.62 ?  309  HOH B O   1 
HETATM 4310 O O   . HOH E 3 .   ? 47.144 59.246 -13.154 1.00 28.59 ?  310  HOH B O   1 
HETATM 4311 O O   . HOH E 3 .   ? 39.097 75.090 -18.933 1.00 10.51 ?  311  HOH B O   1 
HETATM 4312 O O   . HOH E 3 .   ? 41.566 76.592 -9.295  1.00 13.33 ?  312  HOH B O   1 
HETATM 4313 O O   . HOH E 3 .   ? 53.717 83.132 -19.061 1.00 33.30 ?  313  HOH B O   1 
HETATM 4314 O O   . HOH E 3 .   ? 51.933 74.885 -20.930 1.00 14.63 ?  314  HOH B O   1 
HETATM 4315 O O   . HOH E 3 .   ? 29.886 74.118 -17.616 1.00 21.54 ?  315  HOH B O   1 
HETATM 4316 O O   . HOH E 3 .   ? 23.086 73.756 -36.768 1.00 34.87 ?  316  HOH B O   1 
HETATM 4317 O O   . HOH E 3 .   ? 31.442 60.236 -12.531 1.00 25.00 ?  317  HOH B O   1 
HETATM 4318 O O   . HOH E 3 .   ? 36.552 88.584 -22.572 1.00 46.33 ?  318  HOH B O   1 
HETATM 4319 O O   . HOH E 3 .   ? 55.798 77.356 -15.919 1.00 34.37 ?  319  HOH B O   1 
HETATM 4320 O O   . HOH E 3 .   ? 26.905 60.507 -29.092 1.00 27.73 ?  320  HOH B O   1 
HETATM 4321 O O   . HOH E 3 .   ? 32.985 68.225 -28.117 1.00 17.49 ?  321  HOH B O   1 
HETATM 4322 O O   . HOH E 3 .   ? 47.868 68.897 -6.804  1.00 20.08 ?  322  HOH B O   1 
HETATM 4323 O O   . HOH E 3 .   ? 35.399 60.383 -24.456 1.00 27.82 ?  323  HOH B O   1 
HETATM 4324 O O   . HOH E 3 .   ? 26.733 81.713 -4.545  1.00 24.33 ?  324  HOH B O   1 
HETATM 4325 O O   . HOH E 3 .   ? 24.022 84.148 -36.846 1.00 41.93 ?  325  HOH B O   1 
HETATM 4326 O O   . HOH E 3 .   ? 21.758 84.745 -15.859 1.00 12.87 ?  326  HOH B O   1 
HETATM 4327 O O   . HOH E 3 .   ? 28.736 86.544 -33.959 1.00 37.38 ?  327  HOH B O   1 
HETATM 4328 O O   . HOH E 3 .   ? 33.029 88.282 -8.627  1.00 25.92 ?  328  HOH B O   1 
HETATM 4329 O O   . HOH E 3 .   ? 47.413 60.305 -25.448 1.00 26.72 ?  329  HOH B O   1 
HETATM 4330 O O   . HOH E 3 .   ? 33.663 89.045 -15.911 1.00 16.73 ?  330  HOH B O   1 
HETATM 4331 O O   . HOH E 3 .   ? 24.497 79.538 -7.737  1.00 20.14 ?  331  HOH B O   1 
HETATM 4332 O O   . HOH E 3 .   ? 33.631 61.068 -27.224 1.00 36.77 ?  332  HOH B O   1 
HETATM 4333 O O   . HOH E 3 .   ? 34.846 86.883 -29.924 1.00 27.65 ?  333  HOH B O   1 
HETATM 4334 O O   . HOH E 3 .   ? 37.954 78.217 -7.188  1.00 12.31 ?  334  HOH B O   1 
HETATM 4335 O O   . HOH E 3 .   ? 33.799 82.481 -12.362 1.00 25.64 ?  335  HOH B O   1 
HETATM 4336 O O   . HOH E 3 .   ? 32.614 88.574 -24.025 1.00 29.23 ?  336  HOH B O   1 
HETATM 4337 O O   . HOH E 3 .   ? 45.827 56.061 -14.409 1.00 34.80 ?  337  HOH B O   1 
HETATM 4338 O O   . HOH E 3 .   ? 53.692 76.329 -17.910 1.00 18.10 ?  338  HOH B O   1 
HETATM 4339 O O   . HOH E 3 .   ? 34.440 81.282 -10.347 1.00 13.14 ?  339  HOH B O   1 
HETATM 4340 O O   . HOH E 3 .   ? 30.626 71.875 -25.686 1.00 24.03 ?  340  HOH B O   1 
HETATM 4341 O O   . HOH E 3 .   ? 51.826 62.508 -22.157 1.00 39.09 ?  341  HOH B O   1 
HETATM 4342 O O   . HOH E 3 .   ? 33.325 56.588 -13.587 1.00 39.35 ?  342  HOH B O   1 
HETATM 4343 O O   . HOH E 3 .   ? 45.882 73.188 -27.646 1.00 33.29 ?  343  HOH B O   1 
HETATM 4344 O O   . HOH E 3 .   ? 26.758 82.585 -25.565 1.00 16.06 ?  344  HOH B O   1 
HETATM 4345 O O   . HOH E 3 .   ? 39.419 80.686 -9.766  1.00 16.57 ?  345  HOH B O   1 
HETATM 4346 O O   . HOH E 3 .   ? 40.217 69.588 -34.866 1.00 11.02 ?  346  HOH B O   1 
HETATM 4347 O O   . HOH E 3 .   ? 34.911 66.973 -34.760 1.00 24.95 ?  347  HOH B O   1 
HETATM 4348 O O   . HOH E 3 .   ? 49.418 69.511 -25.679 1.00 28.69 ?  348  HOH B O   1 
HETATM 4349 O O   . HOH E 3 .   ? 61.778 62.353 -2.612  1.00 47.04 ?  349  HOH B O   1 
HETATM 4350 O O   . HOH E 3 .   ? 45.302 80.124 -30.620 1.00 29.97 ?  350  HOH B O   1 
HETATM 4351 O O   . HOH E 3 .   ? 46.771 70.174 -11.486 1.00 23.56 ?  351  HOH B O   1 
HETATM 4352 O O   . HOH E 3 .   ? 24.920 80.790 -22.643 1.00 29.60 ?  352  HOH B O   1 
HETATM 4353 O O   . HOH E 3 .   ? 43.166 89.466 -6.881  1.00 29.52 ?  353  HOH B O   1 
HETATM 4354 O O   . HOH E 3 .   ? 46.968 75.787 -27.741 1.00 18.16 ?  354  HOH B O   1 
HETATM 4355 O O   . HOH E 3 .   ? 24.866 65.158 -17.433 1.00 39.24 ?  355  HOH B O   1 
HETATM 4356 O O   . HOH E 3 .   ? 47.830 67.324 -12.228 1.00 21.87 ?  356  HOH B O   1 
HETATM 4357 O O   . HOH E 3 .   ? 61.531 63.032 -8.964  1.00 53.99 ?  357  HOH B O   1 
HETATM 4358 O O   . HOH E 3 .   ? 44.538 53.510 -10.613 1.00 30.24 ?  358  HOH B O   1 
HETATM 4359 O O   . HOH E 3 .   ? 53.252 73.617 -9.549  1.00 30.00 ?  359  HOH B O   1 
HETATM 4360 O O   . HOH E 3 .   ? 28.696 76.923 -17.512 1.00 41.16 ?  360  HOH B O   1 
HETATM 4361 O O   . HOH E 3 .   ? 34.289 79.495 -5.075  1.00 18.01 ?  361  HOH B O   1 
HETATM 4362 O O   . HOH E 3 .   ? 43.536 73.634 -29.661 1.00 31.44 ?  362  HOH B O   1 
HETATM 4363 O O   . HOH E 3 .   ? 41.084 72.389 -35.297 1.00 33.98 ?  363  HOH B O   1 
HETATM 4364 O O   . HOH E 3 .   ? 45.107 55.594 -12.219 1.00 24.54 ?  364  HOH B O   1 
HETATM 4365 O O   . HOH E 3 .   ? 44.991 76.277 -29.468 1.00 26.50 ?  365  HOH B O   1 
HETATM 4366 O O   . HOH E 3 .   ? 43.183 58.883 -1.464  1.00 37.30 ?  366  HOH B O   1 
HETATM 4367 O O   . HOH E 3 .   ? 26.228 85.092 -5.214  1.00 23.91 ?  367  HOH B O   1 
HETATM 4368 O O   . HOH E 3 .   ? 49.642 61.655 -14.961 1.00 37.97 ?  368  HOH B O   1 
HETATM 4369 O O   . HOH E 3 .   ? 24.683 78.537 -21.150 1.00 25.47 ?  369  HOH B O   1 
HETATM 4370 O O   . HOH E 3 .   ? 23.200 62.871 -20.792 1.00 48.59 ?  370  HOH B O   1 
HETATM 4371 O O   . HOH E 3 .   ? 42.825 86.589 -24.954 1.00 40.40 ?  371  HOH B O   1 
HETATM 4372 O O   . HOH E 3 .   ? 37.879 83.104 -34.961 1.00 39.85 ?  372  HOH B O   1 
HETATM 4373 O O   . HOH E 3 .   ? 37.344 89.284 -14.155 1.00 28.18 ?  373  HOH B O   1 
HETATM 4374 O O   . HOH E 3 .   ? 29.431 60.750 -9.302  1.00 35.81 ?  374  HOH B O   1 
HETATM 4375 O O   . HOH E 3 .   ? 40.976 58.211 -1.476  1.00 28.32 ?  375  HOH B O   1 
HETATM 4376 O O   . HOH E 3 .   ? 34.568 50.489 -21.303 1.00 49.85 ?  376  HOH B O   1 
HETATM 4377 O O   . HOH E 3 .   ? 33.194 59.071 -32.773 1.00 29.62 ?  377  HOH B O   1 
HETATM 4378 O O   . HOH E 3 .   ? 51.945 61.574 -12.242 1.00 28.49 ?  378  HOH B O   1 
HETATM 4379 O O   . HOH E 3 .   ? 31.154 79.105 -17.809 1.00 14.51 ?  379  HOH B O   1 
HETATM 4380 O O   . HOH E 3 .   ? 43.508 73.577 -31.972 1.00 41.90 ?  380  HOH B O   1 
HETATM 4381 O O   . HOH E 3 .   ? 38.572 57.069 -2.359  1.00 31.89 ?  381  HOH B O   1 
HETATM 4382 O O   . HOH E 3 .   ? 23.800 73.615 -19.321 1.00 45.03 ?  382  HOH B O   1 
HETATM 4383 O O   . HOH E 3 .   ? 50.163 78.146 -9.935  1.00 25.61 ?  383  HOH B O   1 
HETATM 4384 O O   . HOH E 3 .   ? 35.711 68.726 -37.284 1.00 38.62 ?  384  HOH B O   1 
HETATM 4385 O O   . HOH E 3 .   ? 34.795 60.840 -29.743 1.00 29.71 ?  385  HOH B O   1 
HETATM 4386 O O   . HOH E 3 .   ? 30.010 70.310 -21.929 1.00 33.99 ?  386  HOH B O   1 
HETATM 4387 O O   . HOH E 3 .   ? 36.317 44.267 -8.293  1.00 51.38 ?  387  HOH B O   1 
HETATM 4388 O O   . HOH E 3 .   ? 43.241 50.647 -11.928 1.00 47.81 ?  388  HOH B O   1 
HETATM 4389 O O   . HOH E 3 .   ? 26.613 70.538 -23.444 1.00 41.65 ?  389  HOH B O   1 
HETATM 4390 O O   . HOH E 3 .   ? 50.591 80.947 -24.420 1.00 34.79 ?  390  HOH B O   1 
HETATM 4391 O O   . HOH E 3 .   ? 55.451 62.972 -18.364 1.00 41.12 ?  391  HOH B O   1 
HETATM 4392 O O   . HOH E 3 .   ? 29.380 61.781 -13.613 1.00 23.09 ?  392  HOH B O   1 
HETATM 4393 O O   . HOH E 3 .   ? 34.898 69.930 -40.519 1.00 41.12 ?  393  HOH B O   1 
HETATM 4394 O O   . HOH E 3 .   ? 50.849 59.426 -11.453 1.00 19.34 ?  394  HOH B O   1 
HETATM 4395 O O   . HOH E 3 .   ? 51.025 62.054 -31.035 1.00 50.60 ?  395  HOH B O   1 
HETATM 4396 O O   . HOH E 3 .   ? 34.701 51.385 -16.150 1.00 40.28 ?  396  HOH B O   1 
HETATM 4397 O O   . HOH E 3 .   ? 35.391 56.573 2.338   1.00 48.46 ?  397  HOH B O   1 
HETATM 4398 O O   . HOH E 3 .   ? 24.562 86.087 -14.714 1.00 27.09 ?  398  HOH B O   1 
HETATM 4399 O O   . HOH E 3 .   ? 44.650 88.170 -13.500 1.00 27.27 ?  399  HOH B O   1 
HETATM 4400 O O   . HOH E 3 .   ? 21.020 77.804 -32.041 1.00 35.96 ?  400  HOH B O   1 
HETATM 4401 O O   . HOH E 3 .   ? 18.699 74.711 -25.445 1.00 40.68 ?  401  HOH B O   1 
HETATM 4402 O O   . HOH E 3 .   ? 31.151 71.289 -20.236 1.00 21.44 ?  402  HOH B O   1 
HETATM 4403 O O   . HOH E 3 .   ? 36.632 80.670 -9.231  1.00 15.09 ?  403  HOH B O   1 
HETATM 4404 O O   . HOH E 3 .   ? 51.710 82.385 -10.974 1.00 40.52 ?  404  HOH B O   1 
HETATM 4405 O O   . HOH E 3 .   ? 26.292 74.313 -20.384 1.00 30.32 ?  405  HOH B O   1 
HETATM 4406 O O   . HOH E 3 .   ? 39.420 51.406 -6.725  1.00 41.05 ?  406  HOH B O   1 
HETATM 4407 O O   . HOH E 3 .   ? 31.119 87.664 -6.735  1.00 36.26 ?  407  HOH B O   1 
HETATM 4408 O O   . HOH E 3 .   ? 46.194 75.907 -31.913 1.00 47.83 ?  408  HOH B O   1 
HETATM 4409 O O   . HOH E 3 .   ? 31.567 88.217 -27.320 1.00 26.41 ?  409  HOH B O   1 
HETATM 4410 O O   . HOH E 3 .   ? 51.184 76.181 -9.401  1.00 35.22 ?  410  HOH B O   1 
HETATM 4411 O O   . HOH E 3 .   ? 18.636 71.922 -25.204 1.00 47.85 ?  411  HOH B O   1 
HETATM 4412 O O   . HOH E 3 .   ? 50.121 84.696 -12.021 1.00 36.54 ?  412  HOH B O   1 
HETATM 4413 O O   . HOH E 3 .   ? 33.888 57.784 -30.745 1.00 44.84 ?  413  HOH B O   1 
HETATM 4414 O O   . HOH E 3 .   ? 40.418 78.731 -8.052  1.00 16.61 ?  414  HOH B O   1 
HETATM 4415 O O   . HOH E 3 .   ? 33.742 53.808 -17.106 1.00 40.76 ?  415  HOH B O   1 
HETATM 4416 O O   . HOH E 3 .   ? 25.280 62.106 -37.201 1.00 48.13 ?  416  HOH B O   1 
HETATM 4417 O O   . HOH E 3 .   ? 28.424 90.415 -30.023 1.00 46.95 ?  417  HOH B O   1 
HETATM 4418 O O   . HOH E 3 .   ? 24.230 63.811 -14.963 1.00 38.47 ?  418  HOH B O   1 
HETATM 4419 O O   . HOH E 3 .   ? 26.146 72.447 -22.111 1.00 42.71 ?  419  HOH B O   1 
HETATM 4420 O O   . HOH E 3 .   ? 35.503 90.318 -15.200 1.00 33.81 ?  420  HOH B O   1 
HETATM 4421 O O   . HOH E 3 .   ? 42.421 48.234 -2.908  1.00 51.96 ?  421  HOH B O   1 
HETATM 4422 O O   . HOH E 3 .   ? 35.651 88.921 -24.712 1.00 39.46 ?  422  HOH B O   1 
HETATM 4423 O O   . HOH E 3 .   ? 24.973 79.648 -4.983  1.00 28.91 ?  423  HOH B O   1 
HETATM 4424 O O   . HOH E 3 .   ? 45.181 49.002 -4.178  1.00 53.17 ?  424  HOH B O   1 
HETATM 4425 O O   . HOH E 3 .   ? 52.030 79.946 -10.838 1.00 44.01 ?  425  HOH B O   1 
HETATM 4426 O O   . HOH E 3 .   ? 41.780 50.329 -7.672  1.00 52.97 ?  426  HOH B O   1 
HETATM 4427 O O   . HOH E 3 .   ? 34.227 88.450 -27.382 1.00 37.59 ?  427  HOH B O   1 
HETATM 4428 O O   . HOH E 3 .   ? 35.294 93.303 -14.332 1.00 43.01 ?  428  HOH B O   1 
HETATM 4429 O O   . HOH E 3 .   ? 20.020 48.892 0.456   1.00 46.32 ?  429  HOH B O   1 
HETATM 4430 O O   . HOH E 3 .   ? 39.361 72.842 -37.321 1.00 30.05 ?  430  HOH B O   1 
HETATM 4431 O O   . HOH E 3 .   ? 24.128 69.844 -23.199 1.00 48.51 ?  431  HOH B O   1 
HETATM 4432 O O   . HOH F 3 .   ? 29.147 49.502 21.749  1.00 23.05 ?  1701 HOH C O   1 
HETATM 4433 O O   . HOH F 3 .   ? 27.848 40.950 28.959  1.00 23.77 ?  1702 HOH C O   1 
HETATM 4434 O O   . HOH F 3 .   ? 35.154 40.734 36.737  1.00 43.84 ?  1703 HOH C O   1 
HETATM 4435 O O   . HOH F 3 .   ? 34.065 50.097 9.732   1.00 33.60 ?  1704 HOH C O   1 
HETATM 4436 O O   . HOH F 3 .   ? 31.318 40.386 20.295  1.00 22.77 ?  1705 HOH C O   1 
HETATM 4437 O O   . HOH F 3 .   ? 48.895 46.476 29.013  1.00 44.38 ?  1706 HOH C O   1 
HETATM 4438 O O   . HOH F 3 .   ? 37.800 54.013 13.590  1.00 23.27 ?  1707 HOH C O   1 
HETATM 4439 O O   . HOH F 3 .   ? 27.588 44.703 32.230  1.00 43.21 ?  1708 HOH C O   1 
HETATM 4440 O O   . HOH F 3 .   ? 29.639 53.597 35.670  1.00 48.28 ?  1709 HOH C O   1 
HETATM 4441 O O   . HOH F 3 .   ? 38.135 37.048 8.294   1.00 15.75 ?  1710 HOH C O   1 
HETATM 4442 O O   . HOH F 3 .   ? 48.784 40.093 25.613  1.00 24.98 ?  1711 HOH C O   1 
HETATM 4443 O O   . HOH F 3 .   ? 33.577 57.389 29.380  1.00 36.12 ?  1712 HOH C O   1 
HETATM 4444 O O   . HOH F 3 .   ? 45.679 38.592 28.336  1.00 30.27 ?  1713 HOH C O   1 
HETATM 4445 O O   . HOH F 3 .   ? 36.017 59.577 26.012  1.00 19.35 ?  1714 HOH C O   1 
HETATM 4446 O O   . HOH F 3 .   ? 26.382 40.806 12.151  1.00 29.77 ?  1715 HOH C O   1 
HETATM 4447 O O   . HOH F 3 .   ? 45.960 42.490 20.306  1.00 13.65 ?  1716 HOH C O   1 
HETATM 4448 O O   . HOH F 3 .   ? 45.887 44.481 18.311  1.00 12.24 ?  1717 HOH C O   1 
HETATM 4449 O O   . HOH F 3 .   ? 48.309 61.040 10.448  1.00 41.49 ?  1718 HOH C O   1 
HETATM 4450 O O   . HOH F 3 .   ? 29.030 42.862 17.101  1.00 27.90 ?  1719 HOH C O   1 
HETATM 4451 O O   . HOH F 3 .   ? 40.240 59.116 27.270  1.00 30.31 ?  1720 HOH C O   1 
HETATM 4452 O O   . HOH F 3 .   ? 40.668 33.801 15.016  1.00 11.02 ?  1721 HOH C O   1 
HETATM 4453 O O   . HOH F 3 .   ? 32.859 59.431 22.249  1.00 17.23 ?  1722 HOH C O   1 
HETATM 4454 O O   . HOH F 3 .   ? 37.258 43.210 5.777   1.00 24.71 ?  1723 HOH C O   1 
HETATM 4455 O O   . HOH F 3 .   ? 36.904 38.711 34.969  1.00 44.98 ?  1724 HOH C O   1 
HETATM 4456 O O   . HOH F 3 .   ? 39.149 29.444 19.650  1.00 42.41 ?  1725 HOH C O   1 
HETATM 4457 O O   . HOH F 3 .   ? 35.075 51.145 16.296  1.00 13.23 ?  1726 HOH C O   1 
HETATM 4458 O O   . HOH F 3 .   ? 30.250 54.928 23.879  1.00 22.64 ?  1727 HOH C O   1 
HETATM 4459 O O   . HOH F 3 .   ? 38.990 47.589 5.846   1.00 41.69 ?  1728 HOH C O   1 
HETATM 4460 O O   . HOH F 3 .   ? 39.179 37.606 10.864  1.00 13.81 ?  1729 HOH C O   1 
HETATM 4461 O O   . HOH F 3 .   ? 33.222 32.322 12.401  1.00 17.03 ?  1730 HOH C O   1 
HETATM 4462 O O   . HOH F 3 .   ? 45.319 33.549 21.122  1.00 30.88 ?  1731 HOH C O   1 
HETATM 4463 O O   . HOH F 3 .   ? 50.246 29.751 11.036  1.00 41.40 ?  1732 HOH C O   1 
HETATM 4464 O O   . HOH F 3 .   ? 43.290 58.337 28.224  1.00 34.34 ?  1733 HOH C O   1 
HETATM 4465 O O   . HOH F 3 .   ? 25.391 43.530 24.103  1.00 17.11 ?  1734 HOH C O   1 
HETATM 4466 O O   . HOH F 3 .   ? 37.729 33.763 25.239  1.00 35.97 ?  1735 HOH C O   1 
HETATM 4467 O O   . HOH F 3 .   ? 40.215 53.089 18.706  1.00 25.54 ?  1736 HOH C O   1 
HETATM 4468 O O   . HOH F 3 .   ? 44.278 49.812 27.411  1.00 21.04 ?  1737 HOH C O   1 
HETATM 4469 O O   . HOH F 3 .   ? 59.085 43.618 10.250  1.00 34.37 ?  1738 HOH C O   1 
HETATM 4470 O O   . HOH F 3 .   ? 25.684 42.443 14.582  1.00 33.83 ?  1739 HOH C O   1 
HETATM 4471 O O   . HOH F 3 .   ? 53.153 42.047 5.953   1.00 31.47 ?  1740 HOH C O   1 
HETATM 4472 O O   . HOH F 3 .   ? 43.997 43.642 23.500  1.00 14.49 ?  1741 HOH C O   1 
HETATM 4473 O O   . HOH F 3 .   ? 51.185 48.982 20.324  1.00 21.62 ?  1742 HOH C O   1 
HETATM 4474 O O   . HOH F 3 .   ? 43.754 50.689 20.511  1.00 8.95  ?  1743 HOH C O   1 
HETATM 4475 O O   . HOH F 3 .   ? 39.797 48.987 36.397  1.00 46.86 ?  1744 HOH C O   1 
HETATM 4476 O O   . HOH F 3 .   ? 44.767 29.645 15.816  1.00 29.30 ?  1745 HOH C O   1 
HETATM 4477 O O   . HOH F 3 .   ? 51.095 44.496 25.827  1.00 35.52 ?  1746 HOH C O   1 
HETATM 4478 O O   . HOH F 3 .   ? 26.469 37.235 27.060  1.00 25.29 ?  1747 HOH C O   1 
HETATM 4479 O O   . HOH F 3 .   ? 44.247 41.364 22.103  1.00 11.51 ?  1748 HOH C O   1 
HETATM 4480 O O   . HOH F 3 .   ? 57.593 38.780 10.667  1.00 36.21 ?  1749 HOH C O   1 
HETATM 4481 O O   . HOH F 3 .   ? 48.299 55.530 23.868  1.00 30.64 ?  1750 HOH C O   1 
HETATM 4482 O O   . HOH F 3 .   ? 44.556 47.686 18.019  1.00 11.80 ?  1751 HOH C O   1 
HETATM 4483 O O   . HOH F 3 .   ? 43.510 32.696 7.197   1.00 35.73 ?  1752 HOH C O   1 
HETATM 4484 O O   . HOH F 3 .   ? 30.562 56.371 26.430  1.00 26.77 ?  1753 HOH C O   1 
HETATM 4485 O O   . HOH F 3 .   ? 49.653 35.675 2.037   1.00 37.74 ?  1754 HOH C O   1 
HETATM 4486 O O   . HOH F 3 .   ? 40.562 45.622 5.729   1.00 35.96 ?  1755 HOH C O   1 
HETATM 4487 O O   . HOH F 3 .   ? 37.907 38.147 3.781   1.00 29.61 ?  1756 HOH C O   1 
HETATM 4488 O O   . HOH F 3 .   ? 52.532 30.398 11.303  1.00 33.83 ?  1757 HOH C O   1 
HETATM 4489 O O   . HOH F 3 .   ? 42.034 38.352 27.777  1.00 35.01 ?  1758 HOH C O   1 
HETATM 4490 O O   . HOH F 3 .   ? 42.454 34.547 24.062  1.00 31.03 ?  1759 HOH C O   1 
HETATM 4491 O O   . HOH F 3 .   ? 58.624 37.359 4.492   1.00 32.42 ?  1760 HOH C O   1 
HETATM 4492 O O   . HOH F 3 .   ? 54.679 32.962 17.637  1.00 40.01 ?  1761 HOH C O   1 
HETATM 4493 O O   . HOH F 3 .   ? 54.352 48.569 13.938  1.00 30.85 ?  1762 HOH C O   1 
HETATM 4494 O O   . HOH F 3 .   ? 51.211 46.134 23.843  1.00 35.25 ?  1763 HOH C O   1 
HETATM 4495 O O   . HOH F 3 .   ? 37.272 40.107 4.768   1.00 40.87 ?  1764 HOH C O   1 
HETATM 4496 O O   . HOH F 3 .   ? 35.115 47.957 8.789   1.00 21.89 ?  1765 HOH C O   1 
HETATM 4497 O O   . HOH F 3 .   ? 29.309 41.018 33.420  1.00 44.82 ?  1766 HOH C O   1 
HETATM 4498 O O   . HOH F 3 .   ? 36.709 51.950 5.658   1.00 43.02 ?  1767 HOH C O   1 
HETATM 4499 O O   . HOH F 3 .   ? 46.884 31.461 18.667  1.00 33.91 ?  1768 HOH C O   1 
HETATM 4500 O O   . HOH F 3 .   ? 46.628 42.639 1.222   1.00 47.75 ?  1769 HOH C O   1 
HETATM 4501 O O   . HOH F 3 .   ? 35.819 52.677 13.660  1.00 21.15 ?  1770 HOH C O   1 
HETATM 4502 O O   . HOH F 3 .   ? 26.010 43.307 16.814  1.00 37.90 ?  1771 HOH C O   1 
HETATM 4503 O O   . HOH F 3 .   ? 45.398 51.724 1.906   1.00 43.30 ?  1772 HOH C O   1 
HETATM 4504 O O   . HOH F 3 .   ? 27.278 53.170 17.361  1.00 36.48 ?  1773 HOH C O   1 
HETATM 4505 O O   . HOH F 3 .   ? 40.162 33.740 25.515  1.00 53.38 ?  1774 HOH C O   1 
HETATM 4506 O O   . HOH F 3 .   ? 24.245 44.799 25.913  1.00 39.48 ?  1775 HOH C O   1 
HETATM 4507 O O   . HOH F 3 .   ? 50.073 53.553 15.821  1.00 33.41 ?  1776 HOH C O   1 
HETATM 4508 O O   . HOH F 3 .   ? 26.805 42.445 32.330  1.00 48.35 ?  1777 HOH C O   1 
HETATM 4509 O O   . HOH F 3 .   ? 43.203 33.566 22.124  1.00 34.66 ?  1778 HOH C O   1 
HETATM 4510 O O   . HOH F 3 .   ? 27.225 44.527 14.257  1.00 32.45 ?  1779 HOH C O   1 
HETATM 4511 O O   . HOH F 3 .   ? 49.793 51.344 24.589  1.00 45.40 ?  1780 HOH C O   1 
HETATM 4512 O O   . HOH F 3 .   ? 29.647 55.926 9.489   1.00 43.43 ?  1781 HOH C O   1 
HETATM 4513 O O   . HOH F 3 .   ? 49.367 44.325 29.710  1.00 49.35 ?  1782 HOH C O   1 
HETATM 4514 O O   . HOH F 3 .   ? 59.596 39.016 9.524   1.00 46.42 ?  1783 HOH C O   1 
HETATM 4515 O O   . HOH F 3 .   ? 25.357 45.833 14.642  1.00 50.96 ?  1784 HOH C O   1 
HETATM 4516 O O   . HOH F 3 .   ? 31.271 55.547 12.981  1.00 36.15 ?  1785 HOH C O   1 
HETATM 4517 O O   . HOH F 3 .   ? 45.980 52.215 27.876  1.00 40.73 ?  1786 HOH C O   1 
HETATM 4518 O O   . HOH F 3 .   ? 50.109 49.198 23.416  1.00 42.62 ?  1787 HOH C O   1 
HETATM 4519 O O   . HOH F 3 .   ? 59.218 36.864 10.154  1.00 41.28 ?  1788 HOH C O   1 
HETATM 4520 O O   . HOH F 3 .   ? 51.564 28.751 8.735   1.00 43.00 ?  1789 HOH C O   1 
HETATM 4521 O O   . HOH F 3 .   ? 50.310 38.422 26.460  1.00 50.57 ?  1790 HOH C O   1 
HETATM 4522 O O   . HOH F 3 .   ? 42.768 26.658 10.980  1.00 34.91 ?  1791 HOH C O   1 
HETATM 4523 O O   . HOH F 3 .   ? 31.247 58.924 24.885  1.00 40.66 ?  1792 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2    ?    ?   ?   A . n 
A 1 2   PRO 2   3    ?    ?   ?   A . n 
A 1 3   GLY 3   4    ?    ?   ?   A . n 
A 1 4   SER 4   5    ?    ?   ?   A . n 
A 1 5   VAL 5   6    6    VAL VAL A . n 
A 1 6   PRO 6   7    7    PRO PRO A . n 
A 1 7   GLU 7   8    8    GLU GLU A . n 
A 1 8   LEU 8   9    9    LEU LEU A . n 
A 1 9   LYS 9   10   10   LYS LYS A . n 
A 1 10  GLN 10  11   11   GLN GLN A . n 
A 1 11  ILE 11  12   12   ILE ILE A . n 
A 1 12  SER 12  13   13   SER SER A . n 
A 1 13  ARG 13  14   14   ARG ARG A . n 
A 1 14  VAL 14  15   15   VAL VAL A . n 
A 1 15  GLU 15  16   16   GLU GLU A . n 
A 1 16  ALA 16  17   17   ALA ALA A . n 
A 1 17  MET 17  18   18   MET MET A . n 
A 1 18  ARG 18  19   19   ARG ARG A . n 
A 1 19  LEU 19  20   20   LEU LEU A . n 
A 1 20  GLY 20  21   21   GLY GLY A . n 
A 1 21  PRO 21  22   22   PRO PRO A . n 
A 1 22  GLY 22  23   23   GLY GLY A . n 
A 1 23  TRP 23  24   24   TRP TRP A . n 
A 1 24  SER 24  25   25   SER SER A . n 
A 1 25  HIS 25  26   26   HIS HIS A . n 
A 1 26  SER 26  27   27   SER SER A . n 
A 1 27  CYS 27  28   28   CYS CYS A . n 
A 1 28  HIS 28  29   29   HIS HIS A . n 
A 1 29  ALA 29  30   30   ALA ALA A . n 
A 1 30  MET 30  31   31   MET MET A . n 
A 1 31  LEU 31  32   32   LEU LEU A . n 
A 1 32  TYR 32  33   33   TYR TYR A . n 
A 1 33  ALA 33  34   34   ALA ALA A . n 
A 1 34  ALA 34  35   35   ALA ALA A . n 
A 1 35  ASN 35  36   36   ASN ASN A . n 
A 1 36  PRO 36  37   37   PRO PRO A . n 
A 1 37  GLY 37  38   38   GLY GLY A . n 
A 1 38  GLN 38  39   39   GLN GLN A . n 
A 1 39  LEU 39  40   40   LEU LEU A . n 
A 1 40  PHE 40  41   41   PHE PHE A . n 
A 1 41  GLY 41  42   42   GLY GLY A . n 
A 1 42  ARG 42  43   43   ARG ARG A . n 
A 1 43  ILE 43  44   44   ILE ILE A . n 
A 1 44  PRO 44  45   45   PRO PRO A . n 
A 1 45  MET 45  46   46   MET MET A . n 
A 1 46  ARG 46  47   47   ARG ARG A . n 
A 1 47  PHE 47  48   48   PHE PHE A . n 
A 1 48  SER 48  49   49   SER SER A . n 
A 1 49  VAL 49  50   50   VAL VAL A . n 
A 1 50  LEU 50  51   51   LEU LEU A . n 
A 1 51  MET 51  52   52   MET MET A . n 
A 1 52  GLN 52  53   53   GLN GLN A . n 
A 1 53  MET 53  54   54   MET MET A . n 
A 1 54  ARG 54  55   55   ARG ARG A . n 
A 1 55  PHE 55  56   56   PHE PHE A . n 
A 1 56  ASP 56  57   57   ASP ASP A . n 
A 1 57  GLY 57  58   58   GLY GLY A . n 
A 1 58  LEU 58  59   59   LEU LEU A . n 
A 1 59  LEU 59  60   60   LEU LEU A . n 
A 1 60  GLY 60  61   61   GLY GLY A . n 
A 1 61  PHE 61  62   62   PHE PHE A . n 
A 1 62  PRO 62  63   63   PRO PRO A . n 
A 1 63  GLY 63  64   64   GLY GLY A . n 
A 1 64  GLY 64  65   65   GLY GLY A . n 
A 1 65  PHE 65  66   66   PHE PHE A . n 
A 1 66  VAL 66  67   67   VAL VAL A . n 
A 1 67  ASP 67  68   68   ASP ASP A . n 
A 1 68  ARG 68  69   69   ARG ARG A . n 
A 1 69  ARG 69  70   70   ARG ARG A . n 
A 1 70  PHE 70  71   71   PHE PHE A . n 
A 1 71  TRP 71  72   72   TRP TRP A . n 
A 1 72  SER 72  73   73   SER SER A . n 
A 1 73  LEU 73  74   74   LEU LEU A . n 
A 1 74  GLU 74  75   75   GLU GLU A . n 
A 1 75  ASP 75  76   76   ASP ASP A . n 
A 1 76  GLY 76  77   77   GLY GLY A . n 
A 1 77  LEU 77  78   78   LEU LEU A . n 
A 1 78  ASN 78  79   79   ASN ASN A . n 
A 1 79  ARG 79  80   80   ARG ARG A . n 
A 1 80  VAL 80  81   81   VAL VAL A . n 
A 1 81  LEU 81  82   82   LEU LEU A . n 
A 1 82  GLY 82  83   83   GLY GLY A . n 
A 1 83  LEU 83  84   84   LEU LEU A . n 
A 1 84  GLY 84  85   85   GLY GLY A . n 
A 1 85  LEU 85  86   86   LEU LEU A . n 
A 1 86  GLY 86  87   87   GLY GLY A . n 
A 1 87  CYS 87  88   88   CYS CYS A . n 
A 1 88  LEU 88  89   89   LEU LEU A . n 
A 1 89  ARG 89  90   90   ARG ARG A . n 
A 1 90  LEU 90  91   91   LEU LEU A . n 
A 1 91  THR 91  92   92   THR THR A . n 
A 1 92  GLU 92  93   93   GLU GLU A . n 
A 1 93  ALA 93  94   94   ALA ALA A . n 
A 1 94  ASP 94  95   95   ASP ASP A . n 
A 1 95  TYR 95  96   96   TYR TYR A . n 
A 1 96  LEU 96  97   97   LEU LEU A . n 
A 1 97  SER 97  98   98   SER SER A . n 
A 1 98  SER 98  99   99   SER SER A . n 
A 1 99  HIS 99  100  100  HIS HIS A . n 
A 1 100 LEU 100 101  101  LEU LEU A . n 
A 1 101 THR 101 102  102  THR THR A . n 
A 1 102 GLU 102 103  103  GLU GLU A . n 
A 1 103 GLY 103 104  104  GLY GLY A . n 
A 1 104 PRO 104 105  105  PRO PRO A . n 
A 1 105 HIS 105 106  106  HIS HIS A . n 
A 1 106 ARG 106 107  107  ARG ARG A . n 
A 1 107 VAL 107 108  108  VAL VAL A . n 
A 1 108 VAL 108 109  109  VAL VAL A . n 
A 1 109 ALA 109 110  110  ALA ALA A . n 
A 1 110 HIS 110 111  111  HIS HIS A . n 
A 1 111 LEU 111 112  112  LEU LEU A . n 
A 1 112 TYR 112 113  113  TYR TYR A . n 
A 1 113 ALA 113 114  114  ALA ALA A . n 
A 1 114 ARG 114 115  115  ARG ARG A . n 
A 1 115 GLN 115 116  116  GLN GLN A . n 
A 1 116 LEU 116 117  117  LEU LEU A . n 
A 1 117 THR 117 118  118  THR THR A . n 
A 1 118 LEU 118 119  119  LEU LEU A . n 
A 1 119 GLU 119 120  120  GLU GLU A . n 
A 1 120 GLN 120 121  121  GLN GLN A . n 
A 1 121 LEU 121 122  122  LEU LEU A . n 
A 1 122 HIS 122 123  123  HIS HIS A . n 
A 1 123 ALA 123 124  124  ALA ALA A . n 
A 1 124 VAL 124 125  125  VAL VAL A . n 
A 1 125 GLU 125 126  126  GLU GLU A . n 
A 1 126 ILE 126 127  127  ILE ILE A . n 
A 1 127 SER 127 128  128  SER SER A . n 
A 1 128 ALA 128 129  129  ALA ALA A . n 
A 1 129 VAL 129 130  130  VAL VAL A . n 
A 1 130 HIS 130 131  131  HIS HIS A . n 
A 1 131 SER 131 132  132  SER SER A . n 
A 1 132 ARG 132 133  133  ARG ARG A . n 
A 1 133 ASP 133 134  134  ASP ASP A . n 
A 1 134 HIS 134 135  135  HIS HIS A . n 
A 1 135 GLY 135 136  136  GLY GLY A . n 
A 1 136 LEU 136 137  137  LEU LEU A . n 
A 1 137 GLU 137 138  138  GLU GLU A . n 
A 1 138 VAL 138 139  139  VAL VAL A . n 
A 1 139 LEU 139 140  140  LEU LEU A . n 
A 1 140 GLY 140 141  141  GLY GLY A . n 
A 1 141 LEU 141 142  142  LEU LEU A . n 
A 1 142 VAL 142 143  143  VAL VAL A . n 
A 1 143 ARG 143 144  144  ARG ARG A . n 
A 1 144 VAL 144 145  145  VAL VAL A . n 
A 1 145 PRO 145 146  146  PRO PRO A . n 
A 1 146 LEU 146 147  147  LEU LEU A . n 
A 1 147 TYR 147 148  148  TYR TYR A . n 
A 1 148 THR 148 149  149  THR THR A . n 
A 1 149 GLN 149 150  150  GLN GLN A . n 
A 1 150 LYS 150 151  151  LYS LYS A . n 
A 1 151 ASP 151 152  152  ASP ASP A . n 
A 1 152 ARG 152 153  153  ARG ARG A . n 
A 1 153 VAL 153 154  154  VAL VAL A . n 
A 1 154 GLY 154 155  155  GLY GLY A . n 
A 1 155 GLY 155 156  156  GLY GLY A . n 
A 1 156 PHE 156 157  157  PHE PHE A . n 
A 1 157 PRO 157 158  158  PRO PRO A . n 
A 1 158 ASN 158 159  159  ASN ASN A . n 
A 1 159 PHE 159 160  160  PHE PHE A . n 
A 1 160 LEU 160 161  161  LEU LEU A . n 
A 1 161 SER 161 162  162  SER SER A . n 
A 1 162 ASN 162 163  163  ASN ASN A . n 
A 1 163 ALA 163 164  164  ALA ALA A . n 
A 1 164 PHE 164 165  165  PHE PHE A . n 
A 1 165 VAL 165 166  166  VAL VAL A . n 
A 1 166 SER 166 167  167  SER SER A . n 
A 1 167 THR 167 168  168  THR THR A . n 
A 1 168 ALA 168 169  169  ALA ALA A . n 
A 1 169 LYS 169 170  170  LYS LYS A . n 
A 1 170 CYS 170 171  171  CYS CYS A . n 
A 1 171 GLN 171 172  172  GLN GLN A . n 
A 1 172 LEU 172 173  173  LEU LEU A . n 
A 1 173 LEU 173 174  174  LEU LEU A . n 
A 1 174 PHE 174 175  175  PHE PHE A . n 
A 1 175 ALA 175 176  176  ALA ALA A . n 
A 1 176 LEU 176 177  177  LEU LEU A . n 
A 1 177 LYS 177 178  178  LYS LYS A . n 
A 1 178 VAL 178 179  179  VAL VAL A . n 
A 1 179 LEU 179 180  180  LEU LEU A . n 
A 1 180 ASN 180 181  181  ASN ASN A . n 
A 1 181 MET 181 182  182  MET MET A . n 
A 1 182 MET 182 183  183  MET MET A . n 
A 1 183 PRO 183 184  184  PRO PRO A . n 
A 1 184 GLU 184 185  185  GLU GLU A . n 
A 1 185 GLU 185 186  186  GLU GLU A . n 
A 1 186 LYS 186 187  187  LYS LYS A . n 
A 1 187 LEU 187 188  188  LEU LEU A . n 
A 1 188 VAL 188 189  189  VAL VAL A . n 
A 1 189 GLU 189 190  190  GLU GLU A . n 
A 1 190 ALA 190 191  191  ALA ALA A . n 
A 1 191 LEU 191 192  192  LEU LEU A . n 
A 1 192 ALA 192 193  193  ALA ALA A . n 
A 1 193 ALA 193 194  194  ALA ALA A . n 
A 1 194 ALA 194 195  195  ALA ALA A . n 
A 1 195 THR 195 196  196  THR THR A . n 
A 1 196 GLU 196 197  197  GLU GLU A . n 
A 1 197 LYS 197 198  198  LYS LYS A . n 
A 1 198 GLN 198 199  199  GLN GLN A . n 
A 1 199 LYS 199 200  200  LYS LYS A . n 
A 1 200 LYS 200 201  201  LYS LYS A . n 
A 1 201 ALA 201 202  202  ALA ALA A . n 
A 1 202 LEU 202 203  203  LEU LEU A . n 
A 1 203 GLU 203 204  204  GLU GLU A . n 
A 1 204 LYS 204 205  ?    ?   ?   A . n 
A 1 205 LEU 205 206  ?    ?   ?   A . n 
A 1 206 LEU 206 207  ?    ?   ?   A . n 
A 1 207 PRO 207 208  ?    ?   ?   A . n 
A 1 208 ALA 208 209  ?    ?   ?   A . n 
A 1 209 SER 209 210  ?    ?   ?   A . n 
A 1 210 SER 210 211  ?    ?   ?   A . n 
B 1 1   GLY 1   2    ?    ?   ?   B . n 
B 1 2   PRO 2   3    ?    ?   ?   B . n 
B 1 3   GLY 3   4    ?    ?   ?   B . n 
B 1 4   SER 4   5    ?    ?   ?   B . n 
B 1 5   VAL 5   6    6    VAL VAL B . n 
B 1 6   PRO 6   7    7    PRO PRO B . n 
B 1 7   GLU 7   8    8    GLU GLU B . n 
B 1 8   LEU 8   9    9    LEU LEU B . n 
B 1 9   LYS 9   10   10   LYS LYS B . n 
B 1 10  GLN 10  11   11   GLN GLN B . n 
B 1 11  ILE 11  12   12   ILE ILE B . n 
B 1 12  SER 12  13   13   SER SER B . n 
B 1 13  ARG 13  14   14   ARG ARG B . n 
B 1 14  VAL 14  15   15   VAL VAL B . n 
B 1 15  GLU 15  16   16   GLU GLU B . n 
B 1 16  ALA 16  17   17   ALA ALA B . n 
B 1 17  MET 17  18   18   MET MET B . n 
B 1 18  ARG 18  19   19   ARG ARG B . n 
B 1 19  LEU 19  20   20   LEU LEU B . n 
B 1 20  GLY 20  21   21   GLY GLY B . n 
B 1 21  PRO 21  22   22   PRO PRO B . n 
B 1 22  GLY 22  23   23   GLY GLY B . n 
B 1 23  TRP 23  24   24   TRP TRP B . n 
B 1 24  SER 24  25   25   SER SER B . n 
B 1 25  HIS 25  26   26   HIS HIS B . n 
B 1 26  SER 26  27   27   SER SER B . n 
B 1 27  CYS 27  28   28   CYS CYS B . n 
B 1 28  HIS 28  29   29   HIS HIS B . n 
B 1 29  ALA 29  30   30   ALA ALA B . n 
B 1 30  MET 30  31   31   MET MET B . n 
B 1 31  LEU 31  32   32   LEU LEU B . n 
B 1 32  TYR 32  33   33   TYR TYR B . n 
B 1 33  ALA 33  34   34   ALA ALA B . n 
B 1 34  ALA 34  35   35   ALA ALA B . n 
B 1 35  ASN 35  36   36   ASN ASN B . n 
B 1 36  PRO 36  37   37   PRO PRO B . n 
B 1 37  GLY 37  38   38   GLY GLY B . n 
B 1 38  GLN 38  39   39   GLN GLN B . n 
B 1 39  LEU 39  40   40   LEU LEU B . n 
B 1 40  PHE 40  41   41   PHE PHE B . n 
B 1 41  GLY 41  42   42   GLY GLY B . n 
B 1 42  ARG 42  43   43   ARG ARG B . n 
B 1 43  ILE 43  44   44   ILE ILE B . n 
B 1 44  PRO 44  45   45   PRO PRO B . n 
B 1 45  MET 45  46   46   MET MET B . n 
B 1 46  ARG 46  47   47   ARG ARG B . n 
B 1 47  PHE 47  48   48   PHE PHE B . n 
B 1 48  SER 48  49   49   SER SER B . n 
B 1 49  VAL 49  50   50   VAL VAL B . n 
B 1 50  LEU 50  51   51   LEU LEU B . n 
B 1 51  MET 51  52   52   MET MET B . n 
B 1 52  GLN 52  53   53   GLN GLN B . n 
B 1 53  MET 53  54   54   MET MET B . n 
B 1 54  ARG 54  55   55   ARG ARG B . n 
B 1 55  PHE 55  56   56   PHE PHE B . n 
B 1 56  ASP 56  57   57   ASP ASP B . n 
B 1 57  GLY 57  58   58   GLY GLY B . n 
B 1 58  LEU 58  59   59   LEU LEU B . n 
B 1 59  LEU 59  60   60   LEU LEU B . n 
B 1 60  GLY 60  61   61   GLY GLY B . n 
B 1 61  PHE 61  62   62   PHE PHE B . n 
B 1 62  PRO 62  63   63   PRO PRO B . n 
B 1 63  GLY 63  64   64   GLY GLY B . n 
B 1 64  GLY 64  65   65   GLY GLY B . n 
B 1 65  PHE 65  66   66   PHE PHE B . n 
B 1 66  VAL 66  67   67   VAL VAL B . n 
B 1 67  ASP 67  68   68   ASP ASP B . n 
B 1 68  ARG 68  69   69   ARG ARG B . n 
B 1 69  ARG 69  70   70   ARG ARG B . n 
B 1 70  PHE 70  71   71   PHE PHE B . n 
B 1 71  TRP 71  72   72   TRP TRP B . n 
B 1 72  SER 72  73   73   SER SER B . n 
B 1 73  LEU 73  74   74   LEU LEU B . n 
B 1 74  GLU 74  75   75   GLU GLU B . n 
B 1 75  ASP 75  76   76   ASP ASP B . n 
B 1 76  GLY 76  77   77   GLY GLY B . n 
B 1 77  LEU 77  78   78   LEU LEU B . n 
B 1 78  ASN 78  79   79   ASN ASN B . n 
B 1 79  ARG 79  80   80   ARG ARG B . n 
B 1 80  VAL 80  81   81   VAL VAL B . n 
B 1 81  LEU 81  82   82   LEU LEU B . n 
B 1 82  GLY 82  83   83   GLY GLY B . n 
B 1 83  LEU 83  84   84   LEU LEU B . n 
B 1 84  GLY 84  85   85   GLY GLY B . n 
B 1 85  LEU 85  86   86   LEU LEU B . n 
B 1 86  GLY 86  87   87   GLY GLY B . n 
B 1 87  CYS 87  88   88   CYS CYS B . n 
B 1 88  LEU 88  89   89   LEU LEU B . n 
B 1 89  ARG 89  90   90   ARG ARG B . n 
B 1 90  LEU 90  91   91   LEU LEU B . n 
B 1 91  THR 91  92   92   THR THR B . n 
B 1 92  GLU 92  93   93   GLU GLU B . n 
B 1 93  ALA 93  94   94   ALA ALA B . n 
B 1 94  ASP 94  95   95   ASP ASP B . n 
B 1 95  TYR 95  96   96   TYR TYR B . n 
B 1 96  LEU 96  97   97   LEU LEU B . n 
B 1 97  SER 97  98   98   SER SER B . n 
B 1 98  SER 98  99   99   SER SER B . n 
B 1 99  HIS 99  100  100  HIS HIS B . n 
B 1 100 LEU 100 101  101  LEU LEU B . n 
B 1 101 THR 101 102  102  THR THR B . n 
B 1 102 GLU 102 103  103  GLU GLU B . n 
B 1 103 GLY 103 104  104  GLY GLY B . n 
B 1 104 PRO 104 105  105  PRO PRO B . n 
B 1 105 HIS 105 106  106  HIS HIS B . n 
B 1 106 ARG 106 107  107  ARG ARG B . n 
B 1 107 VAL 107 108  108  VAL VAL B . n 
B 1 108 VAL 108 109  109  VAL VAL B . n 
B 1 109 ALA 109 110  110  ALA ALA B . n 
B 1 110 HIS 110 111  111  HIS HIS B . n 
B 1 111 LEU 111 112  112  LEU LEU B . n 
B 1 112 TYR 112 113  113  TYR TYR B . n 
B 1 113 ALA 113 114  114  ALA ALA B . n 
B 1 114 ARG 114 115  115  ARG ARG B . n 
B 1 115 GLN 115 116  116  GLN GLN B . n 
B 1 116 LEU 116 117  117  LEU LEU B . n 
B 1 117 THR 117 118  118  THR THR B . n 
B 1 118 LEU 118 119  119  LEU LEU B . n 
B 1 119 GLU 119 120  120  GLU GLU B . n 
B 1 120 GLN 120 121  121  GLN GLN B . n 
B 1 121 LEU 121 122  122  LEU LEU B . n 
B 1 122 HIS 122 123  123  HIS HIS B . n 
B 1 123 ALA 123 124  124  ALA ALA B . n 
B 1 124 VAL 124 125  125  VAL VAL B . n 
B 1 125 GLU 125 126  126  GLU GLU B . n 
B 1 126 ILE 126 127  127  ILE ILE B . n 
B 1 127 SER 127 128  128  SER SER B . n 
B 1 128 ALA 128 129  129  ALA ALA B . n 
B 1 129 VAL 129 130  130  VAL VAL B . n 
B 1 130 HIS 130 131  131  HIS HIS B . n 
B 1 131 SER 131 132  132  SER SER B . n 
B 1 132 ARG 132 133  133  ARG ARG B . n 
B 1 133 ASP 133 134  134  ASP ASP B . n 
B 1 134 HIS 134 135  135  HIS HIS B . n 
B 1 135 GLY 135 136  136  GLY GLY B . n 
B 1 136 LEU 136 137  137  LEU LEU B . n 
B 1 137 GLU 137 138  138  GLU GLU B . n 
B 1 138 VAL 138 139  139  VAL VAL B . n 
B 1 139 LEU 139 140  140  LEU LEU B . n 
B 1 140 GLY 140 141  141  GLY GLY B . n 
B 1 141 LEU 141 142  142  LEU LEU B . n 
B 1 142 VAL 142 143  143  VAL VAL B . n 
B 1 143 ARG 143 144  144  ARG ARG B . n 
B 1 144 VAL 144 145  145  VAL VAL B . n 
B 1 145 PRO 145 146  146  PRO PRO B . n 
B 1 146 LEU 146 147  147  LEU LEU B . n 
B 1 147 TYR 147 148  148  TYR TYR B . n 
B 1 148 THR 148 149  149  THR THR B . n 
B 1 149 GLN 149 150  150  GLN GLN B . n 
B 1 150 LYS 150 151  151  LYS LYS B . n 
B 1 151 ASP 151 152  152  ASP ASP B . n 
B 1 152 ARG 152 153  153  ARG ARG B . n 
B 1 153 VAL 153 154  154  VAL VAL B . n 
B 1 154 GLY 154 155  155  GLY GLY B . n 
B 1 155 GLY 155 156  156  GLY GLY B . n 
B 1 156 PHE 156 157  157  PHE PHE B . n 
B 1 157 PRO 157 158  158  PRO PRO B . n 
B 1 158 ASN 158 159  159  ASN ASN B . n 
B 1 159 PHE 159 160  160  PHE PHE B . n 
B 1 160 LEU 160 161  161  LEU LEU B . n 
B 1 161 SER 161 162  162  SER SER B . n 
B 1 162 ASN 162 163  163  ASN ASN B . n 
B 1 163 ALA 163 164  164  ALA ALA B . n 
B 1 164 PHE 164 165  165  PHE PHE B . n 
B 1 165 VAL 165 166  166  VAL VAL B . n 
B 1 166 SER 166 167  167  SER SER B . n 
B 1 167 THR 167 168  168  THR THR B . n 
B 1 168 ALA 168 169  169  ALA ALA B . n 
B 1 169 LYS 169 170  170  LYS LYS B . n 
B 1 170 CYS 170 171  171  CYS CYS B . n 
B 1 171 GLN 171 172  172  GLN GLN B . n 
B 1 172 LEU 172 173  173  LEU LEU B . n 
B 1 173 LEU 173 174  174  LEU LEU B . n 
B 1 174 PHE 174 175  175  PHE PHE B . n 
B 1 175 ALA 175 176  176  ALA ALA B . n 
B 1 176 LEU 176 177  177  LEU LEU B . n 
B 1 177 LYS 177 178  178  LYS LYS B . n 
B 1 178 VAL 178 179  179  VAL VAL B . n 
B 1 179 LEU 179 180  180  LEU LEU B . n 
B 1 180 ASN 180 181  181  ASN ASN B . n 
B 1 181 MET 181 182  182  MET MET B . n 
B 1 182 MET 182 183  183  MET MET B . n 
B 1 183 PRO 183 184  184  PRO PRO B . n 
B 1 184 GLU 184 185  185  GLU GLU B . n 
B 1 185 GLU 185 186  186  GLU GLU B . n 
B 1 186 LYS 186 187  187  LYS LYS B . n 
B 1 187 LEU 187 188  188  LEU LEU B . n 
B 1 188 VAL 188 189  189  VAL VAL B . n 
B 1 189 GLU 189 190  190  GLU GLU B . n 
B 1 190 ALA 190 191  191  ALA ALA B . n 
B 1 191 LEU 191 192  192  LEU LEU B . n 
B 1 192 ALA 192 193  193  ALA ALA B . n 
B 1 193 ALA 193 194  194  ALA ALA B . n 
B 1 194 ALA 194 195  195  ALA ALA B . n 
B 1 195 THR 195 196  196  THR THR B . n 
B 1 196 GLU 196 197  197  GLU GLU B . n 
B 1 197 LYS 197 198  198  LYS LYS B . n 
B 1 198 GLN 198 199  199  GLN GLN B . n 
B 1 199 LYS 199 200  200  LYS LYS B . n 
B 1 200 LYS 200 201  201  LYS LYS B . n 
B 1 201 ALA 201 202  202  ALA ALA B . n 
B 1 202 LEU 202 203  203  LEU LEU B . n 
B 1 203 GLU 203 204  204  GLU GLU B . n 
B 1 204 LYS 204 205  205  LYS LYS B . n 
B 1 205 LEU 205 206  206  LEU LEU B . n 
B 1 206 LEU 206 207  207  LEU LEU B . n 
B 1 207 PRO 207 208  ?    ?   ?   B . n 
B 1 208 ALA 208 209  ?    ?   ?   B . n 
B 1 209 SER 209 210  ?    ?   ?   B . n 
B 1 210 SER 210 211  ?    ?   ?   B . n 
C 2 1   GLY 1   1455 ?    ?   ?   C . n 
C 2 2   PRO 2   1456 ?    ?   ?   C . n 
C 2 3   GLY 3   1457 ?    ?   ?   C . n 
C 2 4   SER 4   1458 ?    ?   ?   C . n 
C 2 5   ARG 5   1459 ?    ?   ?   C . n 
C 2 6   SER 6   1460 ?    ?   ?   C . n 
C 2 7   ASP 7   1461 ?    ?   ?   C . n 
C 2 8   SER 8   1462 ?    ?   ?   C . n 
C 2 9   PRO 9   1463 ?    ?   ?   C . n 
C 2 10  GLU 10  1464 ?    ?   ?   C . n 
C 2 11  ILE 11  1465 ?    ?   ?   C . n 
C 2 12  PRO 12  1466 ?    ?   ?   C . n 
C 2 13  PHE 13  1467 ?    ?   ?   C . n 
C 2 14  GLN 14  1468 ?    ?   ?   C . n 
C 2 15  ALA 15  1469 ?    ?   ?   C . n 
C 2 16  ALA 16  1470 ?    ?   ?   C . n 
C 2 17  ALA 17  1471 ?    ?   ?   C . n 
C 2 18  GLY 18  1472 ?    ?   ?   C . n 
C 2 19  PRO 19  1473 ?    ?   ?   C . n 
C 2 20  SER 20  1474 ?    ?   ?   C . n 
C 2 21  ASP 21  1475 ?    ?   ?   C . n 
C 2 22  GLY 22  1476 ?    ?   ?   C . n 
C 2 23  LEU 23  1477 ?    ?   ?   C . n 
C 2 24  ASP 24  1478 ?    ?   ?   C . n 
C 2 25  ALA 25  1479 ?    ?   ?   C . n 
C 2 26  SER 26  1480 ?    ?   ?   C . n 
C 2 27  SER 27  1481 ?    ?   ?   C . n 
C 2 28  PRO 28  1482 ?    ?   ?   C . n 
C 2 29  GLY 29  1483 ?    ?   ?   C . n 
C 2 30  ASN 30  1484 ?    ?   ?   C . n 
C 2 31  SER 31  1485 ?    ?   ?   C . n 
C 2 32  PHE 32  1486 1486 PHE PHE C . n 
C 2 33  VAL 33  1487 1487 VAL VAL C . n 
C 2 34  GLY 34  1488 1488 GLY GLY C . n 
C 2 35  LEU 35  1489 1489 LEU LEU C . n 
C 2 36  ARG 36  1490 1490 ARG ARG C . n 
C 2 37  VAL 37  1491 1491 VAL VAL C . n 
C 2 38  VAL 38  1492 1492 VAL VAL C . n 
C 2 39  ALA 39  1493 1493 ALA ALA C . n 
C 2 40  LYS 40  1494 1494 LYS LYS C . n 
C 2 41  TRP 41  1495 1495 TRP TRP C . n 
C 2 42  SER 42  1496 1496 SER SER C . n 
C 2 43  SER 43  1497 1497 SER SER C . n 
C 2 44  ASN 44  1498 1498 ASN ASN C . n 
C 2 45  GLY 45  1499 1499 GLY GLY C . n 
C 2 46  TYR 46  1500 1500 TYR TYR C . n 
C 2 47  PHE 47  1501 1501 PHE PHE C . n 
C 2 48  TYR 48  1502 1502 TYR TYR C . n 
C 2 49  SER 49  1503 1503 SER SER C . n 
C 2 50  GLY 50  1504 1504 GLY GLY C . n 
C 2 51  LYS 51  1505 1505 LYS LYS C . n 
C 2 52  ILE 52  1506 1506 ILE ILE C . n 
C 2 53  THR 53  1507 1507 THR THR C . n 
C 2 54  ARG 54  1508 1508 ARG ARG C . n 
C 2 55  ASP 55  1509 1509 ASP ASP C . n 
C 2 56  VAL 56  1510 1510 VAL VAL C . n 
C 2 57  GLY 57  1511 1511 GLY GLY C . n 
C 2 58  ALA 58  1512 1512 ALA ALA C . n 
C 2 59  GLY 59  1513 1513 GLY GLY C . n 
C 2 60  LYS 60  1514 1514 LYS LYS C . n 
C 2 61  TYR 61  1515 1515 TYR TYR C . n 
C 2 62  LYS 62  1516 1516 LYS LYS C . n 
C 2 63  LEU 63  1517 1517 LEU LEU C . n 
C 2 64  LEU 64  1518 1518 LEU LEU C . n 
C 2 65  PHE 65  1519 1519 PHE PHE C . n 
C 2 66  ASP 66  1520 1520 ASP ASP C . n 
C 2 67  ASP 67  1521 1521 ASP ASP C . n 
C 2 68  GLY 68  1522 1522 GLY GLY C . n 
C 2 69  TYR 69  1523 1523 TYR TYR C . n 
C 2 70  GLU 70  1524 1524 GLU GLU C . n 
C 2 71  CYS 71  1525 1525 CYS CYS C . n 
C 2 72  ASP 72  1526 1526 ASP ASP C . n 
C 2 73  VAL 73  1527 1527 VAL VAL C . n 
C 2 74  LEU 74  1528 1528 LEU LEU C . n 
C 2 75  GLY 75  1529 1529 GLY GLY C . n 
C 2 76  LYS 76  1530 1530 LYS LYS C . n 
C 2 77  ASP 77  1531 1531 ASP ASP C . n 
C 2 78  ILE 78  1532 1532 ILE ILE C . n 
C 2 79  LEU 79  1533 1533 LEU LEU C . n 
C 2 80  LEU 80  1534 1534 LEU LEU C . n 
C 2 81  CYS 81  1535 1535 CYS CYS C . n 
C 2 82  ASP 82  1536 1536 ASP ASP C . n 
C 2 83  PRO 83  1537 1537 PRO PRO C . n 
C 2 84  ILE 84  1538 1538 ILE ILE C . n 
C 2 85  PRO 85  1539 1539 PRO PRO C . n 
C 2 86  LEU 86  1540 1540 LEU LEU C . n 
C 2 87  ASP 87  1541 1541 ASP ASP C . n 
C 2 88  THR 88  1542 1542 THR THR C . n 
C 2 89  GLU 89  1543 1543 GLU GLU C . n 
C 2 90  VAL 90  1544 1544 VAL VAL C . n 
C 2 91  THR 91  1545 1545 THR THR C . n 
C 2 92  ALA 92  1546 1546 ALA ALA C . n 
C 2 93  LEU 93  1547 1547 LEU LEU C . n 
C 2 94  SER 94  1548 1548 SER SER C . n 
C 2 95  GLU 95  1549 1549 GLU GLU C . n 
C 2 96  ASP 96  1550 1550 ASP ASP C . n 
C 2 97  GLU 97  1551 1551 GLU GLU C . n 
C 2 98  TYR 98  1552 1552 TYR TYR C . n 
C 2 99  PHE 99  1553 1553 PHE PHE C . n 
C 2 100 SER 100 1554 1554 SER SER C . n 
C 2 101 ALA 101 1555 1555 ALA ALA C . n 
C 2 102 GLY 102 1556 1556 GLY GLY C . n 
C 2 103 VAL 103 1557 1557 VAL VAL C . n 
C 2 104 VAL 104 1558 1558 VAL VAL C . n 
C 2 105 LYS 105 1559 1559 LYS LYS C . n 
C 2 106 GLY 106 1560 1560 GLY GLY C . n 
C 2 107 HIS 107 1561 1561 HIS HIS C . n 
C 2 108 ARG 108 1562 1562 ARG ARG C . n 
C 2 109 LYS 109 1563 1563 LYS LYS C . n 
C 2 110 GLU 110 1564 1564 GLU GLU C . n 
C 2 111 SER 111 1565 1565 SER SER C . n 
C 2 112 GLY 112 1566 1566 GLY GLY C . n 
C 2 113 GLU 113 1567 1567 GLU GLU C . n 
C 2 114 LEU 114 1568 1568 LEU LEU C . n 
C 2 115 TYR 115 1569 1569 TYR TYR C . n 
C 2 116 TYR 116 1570 1570 TYR TYR C . n 
C 2 117 SER 117 1571 1571 SER SER C . n 
C 2 118 ILE 118 1572 1572 ILE ILE C . n 
C 2 119 GLU 119 1573 1573 GLU GLU C . n 
C 2 120 LYS 120 1574 1574 LYS LYS C . n 
C 2 121 GLU 121 1575 1575 GLU GLU C . n 
C 2 122 GLY 122 1576 1576 GLY GLY C . n 
C 2 123 GLN 123 1577 1577 GLN GLN C . n 
C 2 124 ARG 124 1578 1578 ARG ARG C . n 
C 2 125 LYS 125 1579 1579 LYS LYS C . n 
C 2 126 TRP 126 1580 1580 TRP TRP C . n 
C 2 127 TYR 127 1581 1581 TYR TYR C . n 
C 2 128 LYS 128 1582 1582 LYS LYS C . n 
C 2 129 ARG 129 1583 1583 ARG ARG C . n 
C 2 130 MET 130 1584 1584 MET MET C . n 
C 2 131 ALA 131 1585 1585 ALA ALA C . n 
C 2 132 VAL 132 1586 1586 VAL VAL C . n 
C 2 133 ILE 133 1587 1587 ILE ILE C . n 
C 2 134 LEU 134 1588 1588 LEU LEU C . n 
C 2 135 SER 135 1589 1589 SER SER C . n 
C 2 136 LEU 136 1590 1590 LEU LEU C . n 
C 2 137 GLU 137 1591 1591 GLU GLU C . n 
C 2 138 GLN 138 1592 1592 GLN GLN C . n 
C 2 139 GLY 139 1593 1593 GLY GLY C . n 
C 2 140 ASN 140 1594 1594 ASN ASN C . n 
C 2 141 ARG 141 1595 1595 ARG ARG C . n 
C 2 142 LEU 142 1596 1596 LEU LEU C . n 
C 2 143 ARG 143 1597 1597 ARG ARG C . n 
C 2 144 GLU 144 1598 1598 GLU GLU C . n 
C 2 145 GLN 145 1599 1599 GLN GLN C . n 
C 2 146 TYR 146 1600 1600 TYR TYR C . n 
C 2 147 GLY 147 1601 1601 GLY GLY C . n 
C 2 148 LEU 148 1602 1602 LEU LEU C . n 
C 2 149 GLY 149 1603 1603 GLY GLY C . n 
C 2 150 PRO 150 1604 1604 PRO PRO C . n 
C 2 151 TYR 151 1605 1605 TYR TYR C . n 
C 2 152 GLU 152 1606 1606 GLU GLU C . n 
C 2 153 ALA 153 1607 ?    ?   ?   C . n 
C 2 154 VAL 154 1608 ?    ?   ?   C . n 
C 2 155 THR 155 1609 ?    ?   ?   C . n 
C 2 156 PRO 156 1610 ?    ?   ?   C . n 
C 2 157 LEU 157 1611 ?    ?   ?   C . n 
C 2 158 THR 158 1612 ?    ?   ?   C . n 
C 2 159 LYS 159 1613 ?    ?   ?   C . n 
C 2 160 ALA 160 1614 ?    ?   ?   C . n 
C 2 161 ALA 161 1615 ?    ?   ?   C . n 
C 2 162 ASP 162 1616 ?    ?   ?   C . n 
C 2 163 ILE 163 1617 ?    ?   ?   C . n 
C 2 164 SER 164 1618 ?    ?   ?   C . n 
C 2 165 LEU 165 1619 ?    ?   ?   C . n 
C 2 166 ASP 166 1620 ?    ?   ?   C . n 
C 2 167 ASN 167 1621 ?    ?   ?   C . n 
C 2 168 LEU 168 1622 ?    ?   ?   C . n 
C 2 169 VAL 169 1623 ?    ?   ?   C . n 
C 2 170 GLU 170 1624 ?    ?   ?   C . n 
C 2 171 GLY 171 1625 ?    ?   ?   C . n 
C 2 172 LYS 172 1626 ?    ?   ?   C . n 
C 2 173 ARG 173 1627 ?    ?   ?   C . n 
C 2 174 LYS 174 1628 ?    ?   ?   C . n 
C 2 175 ARG 175 1629 ?    ?   ?   C . n 
C 2 176 ARG 176 1630 ?    ?   ?   C . n 
C 2 177 SER 177 1631 ?    ?   ?   C . n 
C 2 178 ASN 178 1632 ?    ?   ?   C . n 
C 2 179 VAL 179 1633 ?    ?   ?   C . n 
C 2 180 SER 180 1634 ?    ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 HOH 1   301  392 HOH HOH A . 
D 3 HOH 2   302  338 HOH HOH A . 
D 3 HOH 3   303  138 HOH HOH A . 
D 3 HOH 4   304  48  HOH HOH A . 
D 3 HOH 5   305  393 HOH HOH A . 
D 3 HOH 6   306  222 HOH HOH A . 
D 3 HOH 7   307  318 HOH HOH A . 
D 3 HOH 8   308  118 HOH HOH A . 
D 3 HOH 9   309  18  HOH HOH A . 
D 3 HOH 10  310  143 HOH HOH A . 
D 3 HOH 11  311  84  HOH HOH A . 
D 3 HOH 12  312  391 HOH HOH A . 
D 3 HOH 13  313  49  HOH HOH A . 
D 3 HOH 14  314  25  HOH HOH A . 
D 3 HOH 15  315  32  HOH HOH A . 
D 3 HOH 16  316  74  HOH HOH A . 
D 3 HOH 17  317  46  HOH HOH A . 
D 3 HOH 18  318  30  HOH HOH A . 
D 3 HOH 19  319  290 HOH HOH A . 
D 3 HOH 20  320  270 HOH HOH A . 
D 3 HOH 21  321  101 HOH HOH A . 
D 3 HOH 22  322  320 HOH HOH A . 
D 3 HOH 23  323  99  HOH HOH A . 
D 3 HOH 24  324  2   HOH HOH A . 
D 3 HOH 25  325  45  HOH HOH A . 
D 3 HOH 26  326  58  HOH HOH A . 
D 3 HOH 27  327  113 HOH HOH A . 
D 3 HOH 28  328  27  HOH HOH A . 
D 3 HOH 29  329  70  HOH HOH A . 
D 3 HOH 30  330  108 HOH HOH A . 
D 3 HOH 31  331  181 HOH HOH A . 
D 3 HOH 32  332  146 HOH HOH A . 
D 3 HOH 33  333  22  HOH HOH A . 
D 3 HOH 34  334  98  HOH HOH A . 
D 3 HOH 35  335  344 HOH HOH A . 
D 3 HOH 36  336  125 HOH HOH A . 
D 3 HOH 37  337  64  HOH HOH A . 
D 3 HOH 38  338  133 HOH HOH A . 
D 3 HOH 39  339  226 HOH HOH A . 
D 3 HOH 40  340  105 HOH HOH A . 
D 3 HOH 41  341  17  HOH HOH A . 
D 3 HOH 42  342  79  HOH HOH A . 
D 3 HOH 43  343  301 HOH HOH A . 
D 3 HOH 44  344  35  HOH HOH A . 
D 3 HOH 45  345  50  HOH HOH A . 
D 3 HOH 46  346  115 HOH HOH A . 
D 3 HOH 47  347  207 HOH HOH A . 
D 3 HOH 48  348  224 HOH HOH A . 
D 3 HOH 49  349  205 HOH HOH A . 
D 3 HOH 50  350  124 HOH HOH A . 
D 3 HOH 51  351  268 HOH HOH A . 
D 3 HOH 52  352  19  HOH HOH A . 
D 3 HOH 53  353  185 HOH HOH A . 
D 3 HOH 54  354  122 HOH HOH A . 
D 3 HOH 55  355  155 HOH HOH A . 
D 3 HOH 56  356  327 HOH HOH A . 
D 3 HOH 57  357  308 HOH HOH A . 
D 3 HOH 58  358  72  HOH HOH A . 
D 3 HOH 59  359  141 HOH HOH A . 
D 3 HOH 60  360  57  HOH HOH A . 
D 3 HOH 61  361  135 HOH HOH A . 
D 3 HOH 62  362  177 HOH HOH A . 
D 3 HOH 63  363  7   HOH HOH A . 
D 3 HOH 64  364  86  HOH HOH A . 
D 3 HOH 65  365  16  HOH HOH A . 
D 3 HOH 66  366  329 HOH HOH A . 
D 3 HOH 67  367  132 HOH HOH A . 
D 3 HOH 68  368  198 HOH HOH A . 
D 3 HOH 69  369  173 HOH HOH A . 
D 3 HOH 70  370  61  HOH HOH A . 
D 3 HOH 71  371  166 HOH HOH A . 
D 3 HOH 72  372  317 HOH HOH A . 
D 3 HOH 73  373  175 HOH HOH A . 
D 3 HOH 74  374  383 HOH HOH A . 
D 3 HOH 75  375  31  HOH HOH A . 
D 3 HOH 76  376  199 HOH HOH A . 
D 3 HOH 77  377  137 HOH HOH A . 
D 3 HOH 78  378  272 HOH HOH A . 
D 3 HOH 79  379  148 HOH HOH A . 
D 3 HOH 80  380  123 HOH HOH A . 
D 3 HOH 81  381  394 HOH HOH A . 
D 3 HOH 82  382  295 HOH HOH A . 
D 3 HOH 83  383  314 HOH HOH A . 
D 3 HOH 84  384  134 HOH HOH A . 
D 3 HOH 85  385  39  HOH HOH A . 
D 3 HOH 86  386  92  HOH HOH A . 
D 3 HOH 87  387  28  HOH HOH A . 
D 3 HOH 88  388  240 HOH HOH A . 
D 3 HOH 89  389  339 HOH HOH A . 
D 3 HOH 90  390  169 HOH HOH A . 
D 3 HOH 91  391  279 HOH HOH A . 
D 3 HOH 92  392  54  HOH HOH A . 
D 3 HOH 93  393  373 HOH HOH A . 
D 3 HOH 94  394  206 HOH HOH A . 
D 3 HOH 95  395  42  HOH HOH A . 
D 3 HOH 96  396  262 HOH HOH A . 
D 3 HOH 97  397  164 HOH HOH A . 
D 3 HOH 98  398  75  HOH HOH A . 
D 3 HOH 99  399  109 HOH HOH A . 
D 3 HOH 100 400  158 HOH HOH A . 
D 3 HOH 101 401  147 HOH HOH A . 
D 3 HOH 102 402  250 HOH HOH A . 
D 3 HOH 103 403  227 HOH HOH A . 
D 3 HOH 104 404  126 HOH HOH A . 
D 3 HOH 105 405  269 HOH HOH A . 
D 3 HOH 106 406  116 HOH HOH A . 
D 3 HOH 107 407  186 HOH HOH A . 
D 3 HOH 108 408  162 HOH HOH A . 
D 3 HOH 109 409  248 HOH HOH A . 
D 3 HOH 110 410  234 HOH HOH A . 
D 3 HOH 111 411  140 HOH HOH A . 
D 3 HOH 112 412  214 HOH HOH A . 
D 3 HOH 113 413  12  HOH HOH A . 
D 3 HOH 114 414  117 HOH HOH A . 
D 3 HOH 115 415  145 HOH HOH A . 
D 3 HOH 116 416  193 HOH HOH A . 
D 3 HOH 117 417  377 HOH HOH A . 
D 3 HOH 118 418  178 HOH HOH A . 
D 3 HOH 119 419  258 HOH HOH A . 
D 3 HOH 120 420  40  HOH HOH A . 
D 3 HOH 121 421  191 HOH HOH A . 
D 3 HOH 122 422  197 HOH HOH A . 
D 3 HOH 123 423  265 HOH HOH A . 
D 3 HOH 124 424  365 HOH HOH A . 
D 3 HOH 125 425  362 HOH HOH A . 
D 3 HOH 126 426  204 HOH HOH A . 
D 3 HOH 127 427  225 HOH HOH A . 
D 3 HOH 128 428  292 HOH HOH A . 
D 3 HOH 129 429  255 HOH HOH A . 
D 3 HOH 130 430  340 HOH HOH A . 
D 3 HOH 131 431  361 HOH HOH A . 
D 3 HOH 132 432  291 HOH HOH A . 
D 3 HOH 133 433  307 HOH HOH A . 
D 3 HOH 134 434  355 HOH HOH A . 
D 3 HOH 135 435  321 HOH HOH A . 
D 3 HOH 136 436  217 HOH HOH A . 
D 3 HOH 137 437  55  HOH HOH A . 
D 3 HOH 138 438  144 HOH HOH A . 
D 3 HOH 139 439  241 HOH HOH A . 
D 3 HOH 140 440  252 HOH HOH A . 
D 3 HOH 141 441  371 HOH HOH A . 
D 3 HOH 142 442  388 HOH HOH A . 
D 3 HOH 143 443  330 HOH HOH A . 
D 3 HOH 144 444  396 HOH HOH A . 
D 3 HOH 145 445  276 HOH HOH A . 
D 3 HOH 146 446  395 HOH HOH A . 
D 3 HOH 147 447  130 HOH HOH A . 
D 3 HOH 148 448  167 HOH HOH A . 
D 3 HOH 149 449  303 HOH HOH A . 
D 3 HOH 150 450  348 HOH HOH A . 
D 3 HOH 151 451  266 HOH HOH A . 
D 3 HOH 152 452  142 HOH HOH A . 
D 3 HOH 153 453  210 HOH HOH A . 
D 3 HOH 154 454  333 HOH HOH A . 
D 3 HOH 155 455  298 HOH HOH A . 
D 3 HOH 156 456  343 HOH HOH A . 
D 3 HOH 157 457  349 HOH HOH A . 
D 3 HOH 158 458  359 HOH HOH A . 
D 3 HOH 159 459  323 HOH HOH A . 
D 3 HOH 160 460  168 HOH HOH A . 
D 3 HOH 161 461  386 HOH HOH A . 
D 3 HOH 162 462  285 HOH HOH A . 
D 3 HOH 163 463  277 HOH HOH A . 
D 3 HOH 164 464  238 HOH HOH A . 
D 3 HOH 165 465  345 HOH HOH A . 
D 3 HOH 166 466  287 HOH HOH A . 
D 3 HOH 167 467  247 HOH HOH A . 
D 3 HOH 168 468  149 HOH HOH A . 
D 3 HOH 169 469  297 HOH HOH A . 
D 3 HOH 170 470  370 HOH HOH A . 
E 3 HOH 1   301  97  HOH HOH B . 
E 3 HOH 2   302  282 HOH HOH B . 
E 3 HOH 3   303  256 HOH HOH B . 
E 3 HOH 4   304  62  HOH HOH B . 
E 3 HOH 5   305  33  HOH HOH B . 
E 3 HOH 6   306  219 HOH HOH B . 
E 3 HOH 7   307  346 HOH HOH B . 
E 3 HOH 8   308  223 HOH HOH B . 
E 3 HOH 9   309  43  HOH HOH B . 
E 3 HOH 10  310  76  HOH HOH B . 
E 3 HOH 11  311  3   HOH HOH B . 
E 3 HOH 12  312  14  HOH HOH B . 
E 3 HOH 13  313  202 HOH HOH B . 
E 3 HOH 14  314  24  HOH HOH B . 
E 3 HOH 15  315  65  HOH HOH B . 
E 3 HOH 16  316  286 HOH HOH B . 
E 3 HOH 17  317  78  HOH HOH B . 
E 3 HOH 18  318  274 HOH HOH B . 
E 3 HOH 19  319  249 HOH HOH B . 
E 3 HOH 20  320  82  HOH HOH B . 
E 3 HOH 21  321  398 HOH HOH B . 
E 3 HOH 22  322  59  HOH HOH B . 
E 3 HOH 23  323  289 HOH HOH B . 
E 3 HOH 24  324  120 HOH HOH B . 
E 3 HOH 25  325  397 HOH HOH B . 
E 3 HOH 26  326  9   HOH HOH B . 
E 3 HOH 27  327  150 HOH HOH B . 
E 3 HOH 28  328  139 HOH HOH B . 
E 3 HOH 29  329  63  HOH HOH B . 
E 3 HOH 30  330  71  HOH HOH B . 
E 3 HOH 31  331  41  HOH HOH B . 
E 3 HOH 32  332  213 HOH HOH B . 
E 3 HOH 33  333  103 HOH HOH B . 
E 3 HOH 34  334  13  HOH HOH B . 
E 3 HOH 35  335  131 HOH HOH B . 
E 3 HOH 36  336  128 HOH HOH B . 
E 3 HOH 37  337  243 HOH HOH B . 
E 3 HOH 38  338  38  HOH HOH B . 
E 3 HOH 39  339  37  HOH HOH B . 
E 3 HOH 40  340  110 HOH HOH B . 
E 3 HOH 41  341  239 HOH HOH B . 
E 3 HOH 42  342  261 HOH HOH B . 
E 3 HOH 43  343  201 HOH HOH B . 
E 3 HOH 44  344  80  HOH HOH B . 
E 3 HOH 45  345  23  HOH HOH B . 
E 3 HOH 46  346  5   HOH HOH B . 
E 3 HOH 47  347  87  HOH HOH B . 
E 3 HOH 48  348  336 HOH HOH B . 
E 3 HOH 49  349  352 HOH HOH B . 
E 3 HOH 50  350  183 HOH HOH B . 
E 3 HOH 51  351  106 HOH HOH B . 
E 3 HOH 52  352  165 HOH HOH B . 
E 3 HOH 53  353  399 HOH HOH B . 
E 3 HOH 54  354  53  HOH HOH B . 
E 3 HOH 55  355  351 HOH HOH B . 
E 3 HOH 56  356  56  HOH HOH B . 
E 3 HOH 57  357  319 HOH HOH B . 
E 3 HOH 58  358  229 HOH HOH B . 
E 3 HOH 59  359  160 HOH HOH B . 
E 3 HOH 60  360  278 HOH HOH B . 
E 3 HOH 61  361  36  HOH HOH B . 
E 3 HOH 62  362  192 HOH HOH B . 
E 3 HOH 63  363  235 HOH HOH B . 
E 3 HOH 64  364  91  HOH HOH B . 
E 3 HOH 65  365  93  HOH HOH B . 
E 3 HOH 66  366  342 HOH HOH B . 
E 3 HOH 67  367  267 HOH HOH B . 
E 3 HOH 68  368  382 HOH HOH B . 
E 3 HOH 69  369  104 HOH HOH B . 
E 3 HOH 70  370  375 HOH HOH B . 
E 3 HOH 71  371  310 HOH HOH B . 
E 3 HOH 72  372  216 HOH HOH B . 
E 3 HOH 73  373  179 HOH HOH B . 
E 3 HOH 74  374  242 HOH HOH B . 
E 3 HOH 75  375  119 HOH HOH B . 
E 3 HOH 76  376  316 HOH HOH B . 
E 3 HOH 77  377  69  HOH HOH B . 
E 3 HOH 78  378  200 HOH HOH B . 
E 3 HOH 79  379  29  HOH HOH B . 
E 3 HOH 80  380  188 HOH HOH B . 
E 3 HOH 81  381  280 HOH HOH B . 
E 3 HOH 82  382  260 HOH HOH B . 
E 3 HOH 83  383  112 HOH HOH B . 
E 3 HOH 84  384  294 HOH HOH B . 
E 3 HOH 85  385  273 HOH HOH B . 
E 3 HOH 86  386  300 HOH HOH B . 
E 3 HOH 87  387  387 HOH HOH B . 
E 3 HOH 88  388  218 HOH HOH B . 
E 3 HOH 89  389  237 HOH HOH B . 
E 3 HOH 90  390  284 HOH HOH B . 
E 3 HOH 91  391  372 HOH HOH B . 
E 3 HOH 92  392  94  HOH HOH B . 
E 3 HOH 93  393  341 HOH HOH B . 
E 3 HOH 94  394  83  HOH HOH B . 
E 3 HOH 95  395  312 HOH HOH B . 
E 3 HOH 96  396  354 HOH HOH B . 
E 3 HOH 97  397  254 HOH HOH B . 
E 3 HOH 98  398  263 HOH HOH B . 
E 3 HOH 99  399  311 HOH HOH B . 
E 3 HOH 100 400  114 HOH HOH B . 
E 3 HOH 101 401  350 HOH HOH B . 
E 3 HOH 102 402  264 HOH HOH B . 
E 3 HOH 103 403  52  HOH HOH B . 
E 3 HOH 104 404  357 HOH HOH B . 
E 3 HOH 105 405  203 HOH HOH B . 
E 3 HOH 106 406  358 HOH HOH B . 
E 3 HOH 107 407  209 HOH HOH B . 
E 3 HOH 108 408  309 HOH HOH B . 
E 3 HOH 109 409  121 HOH HOH B . 
E 3 HOH 110 410  244 HOH HOH B . 
E 3 HOH 111 411  366 HOH HOH B . 
E 3 HOH 112 412  334 HOH HOH B . 
E 3 HOH 113 413  313 HOH HOH B . 
E 3 HOH 114 414  51  HOH HOH B . 
E 3 HOH 115 415  385 HOH HOH B . 
E 3 HOH 116 416  326 HOH HOH B . 
E 3 HOH 117 417  325 HOH HOH B . 
E 3 HOH 118 418  332 HOH HOH B . 
E 3 HOH 119 419  271 HOH HOH B . 
E 3 HOH 120 420  228 HOH HOH B . 
E 3 HOH 121 421  389 HOH HOH B . 
E 3 HOH 122 422  360 HOH HOH B . 
E 3 HOH 123 423  245 HOH HOH B . 
E 3 HOH 124 424  353 HOH HOH B . 
E 3 HOH 125 425  378 HOH HOH B . 
E 3 HOH 126 426  381 HOH HOH B . 
E 3 HOH 127 427  251 HOH HOH B . 
E 3 HOH 128 428  315 HOH HOH B . 
E 3 HOH 129 429  305 HOH HOH B . 
E 3 HOH 130 430  331 HOH HOH B . 
E 3 HOH 131 431  328 HOH HOH B . 
F 3 HOH 1   1701 47  HOH HOH C . 
F 3 HOH 2   1702 90  HOH HOH C . 
F 3 HOH 3   1703 189 HOH HOH C . 
F 3 HOH 4   1704 154 HOH HOH C . 
F 3 HOH 5   1705 100 HOH HOH C . 
F 3 HOH 6   1706 299 HOH HOH C . 
F 3 HOH 7   1707 96  HOH HOH C . 
F 3 HOH 8   1708 230 HOH HOH C . 
F 3 HOH 9   1709 257 HOH HOH C . 
F 3 HOH 10  1710 10  HOH HOH C . 
F 3 HOH 11  1711 102 HOH HOH C . 
F 3 HOH 12  1712 176 HOH HOH C . 
F 3 HOH 13  1713 127 HOH HOH C . 
F 3 HOH 14  1714 77  HOH HOH C . 
F 3 HOH 15  1715 170 HOH HOH C . 
F 3 HOH 16  1716 8   HOH HOH C . 
F 3 HOH 17  1717 11  HOH HOH C . 
F 3 HOH 18  1718 196 HOH HOH C . 
F 3 HOH 19  1719 68  HOH HOH C . 
F 3 HOH 20  1720 231 HOH HOH C . 
F 3 HOH 21  1721 6   HOH HOH C . 
F 3 HOH 22  1722 15  HOH HOH C . 
F 3 HOH 23  1723 107 HOH HOH C . 
F 3 HOH 24  1724 212 HOH HOH C . 
F 3 HOH 25  1725 293 HOH HOH C . 
F 3 HOH 26  1726 34  HOH HOH C . 
F 3 HOH 27  1727 85  HOH HOH C . 
F 3 HOH 28  1728 163 HOH HOH C . 
F 3 HOH 29  1729 26  HOH HOH C . 
F 3 HOH 30  1730 44  HOH HOH C . 
F 3 HOH 31  1731 275 HOH HOH C . 
F 3 HOH 32  1732 324 HOH HOH C . 
F 3 HOH 33  1733 136 HOH HOH C . 
F 3 HOH 34  1734 67  HOH HOH C . 
F 3 HOH 35  1735 174 HOH HOH C . 
F 3 HOH 36  1736 129 HOH HOH C . 
F 3 HOH 37  1737 66  HOH HOH C . 
F 3 HOH 38  1738 156 HOH HOH C . 
F 3 HOH 39  1739 172 HOH HOH C . 
F 3 HOH 40  1740 337 HOH HOH C . 
F 3 HOH 41  1741 21  HOH HOH C . 
F 3 HOH 42  1742 60  HOH HOH C . 
F 3 HOH 43  1743 1   HOH HOH C . 
F 3 HOH 44  1744 302 HOH HOH C . 
F 3 HOH 45  1745 73  HOH HOH C . 
F 3 HOH 46  1746 220 HOH HOH C . 
F 3 HOH 47  1747 111 HOH HOH C . 
F 3 HOH 48  1748 20  HOH HOH C . 
F 3 HOH 49  1749 232 HOH HOH C . 
F 3 HOH 50  1750 259 HOH HOH C . 
F 3 HOH 51  1751 4   HOH HOH C . 
F 3 HOH 52  1752 171 HOH HOH C . 
F 3 HOH 53  1753 89  HOH HOH C . 
F 3 HOH 54  1754 184 HOH HOH C . 
F 3 HOH 55  1755 180 HOH HOH C . 
F 3 HOH 56  1756 335 HOH HOH C . 
F 3 HOH 57  1757 356 HOH HOH C . 
F 3 HOH 58  1758 159 HOH HOH C . 
F 3 HOH 59  1759 187 HOH HOH C . 
F 3 HOH 60  1760 161 HOH HOH C . 
F 3 HOH 61  1761 190 HOH HOH C . 
F 3 HOH 62  1762 88  HOH HOH C . 
F 3 HOH 63  1763 151 HOH HOH C . 
F 3 HOH 64  1764 208 HOH HOH C . 
F 3 HOH 65  1765 153 HOH HOH C . 
F 3 HOH 66  1766 367 HOH HOH C . 
F 3 HOH 67  1767 347 HOH HOH C . 
F 3 HOH 68  1768 182 HOH HOH C . 
F 3 HOH 69  1769 384 HOH HOH C . 
F 3 HOH 70  1770 81  HOH HOH C . 
F 3 HOH 71  1771 233 HOH HOH C . 
F 3 HOH 72  1772 236 HOH HOH C . 
F 3 HOH 73  1773 246 HOH HOH C . 
F 3 HOH 74  1774 379 HOH HOH C . 
F 3 HOH 75  1775 288 HOH HOH C . 
F 3 HOH 76  1776 283 HOH HOH C . 
F 3 HOH 77  1777 376 HOH HOH C . 
F 3 HOH 78  1778 281 HOH HOH C . 
F 3 HOH 79  1779 95  HOH HOH C . 
F 3 HOH 80  1780 306 HOH HOH C . 
F 3 HOH 81  1781 304 HOH HOH C . 
F 3 HOH 82  1782 364 HOH HOH C . 
F 3 HOH 83  1783 322 HOH HOH C . 
F 3 HOH 84  1784 374 HOH HOH C . 
F 3 HOH 85  1785 152 HOH HOH C . 
F 3 HOH 86  1786 380 HOH HOH C . 
F 3 HOH 87  1787 195 HOH HOH C . 
F 3 HOH 88  1788 253 HOH HOH C . 
F 3 HOH 89  1789 369 HOH HOH C . 
F 3 HOH 90  1790 368 HOH HOH C . 
F 3 HOH 91  1791 363 HOH HOH C . 
F 3 HOH 92  1792 194 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4700  ? 
1 MORE         -26   ? 
1 'SSA (A^2)'  23910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-06-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(dev_2932)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .            2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .            3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .            4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLY 
_pdbx_validate_close_contact.auth_seq_id_1    83 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    133 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 41   ? ? 57.78   16.92  
2  1 ARG A 47   ? ? 63.71   -72.10 
3  1 LEU A 89   ? ? 70.86   132.06 
4  1 LEU A 137  ? ? -122.22 -87.61 
5  1 VAL A 154  ? ? -131.30 -30.87 
6  1 ARG B 43   ? ? -149.58 -40.69 
7  1 ARG B 47   ? ? 65.58   -66.15 
8  1 CYS B 88   ? ? -70.60  24.86  
9  1 LEU B 137  ? ? -117.61 -98.08 
10 1 VAL B 154  ? ? -131.47 -30.40 
11 1 GLU C 1551 ? ? 86.76   17.60  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2    ? A GLY 1   
2  1 Y 1 A PRO 3    ? A PRO 2   
3  1 Y 1 A GLY 4    ? A GLY 3   
4  1 Y 1 A SER 5    ? A SER 4   
5  1 Y 1 A LYS 205  ? A LYS 204 
6  1 Y 1 A LEU 206  ? A LEU 205 
7  1 Y 1 A LEU 207  ? A LEU 206 
8  1 Y 1 A PRO 208  ? A PRO 207 
9  1 Y 1 A ALA 209  ? A ALA 208 
10 1 Y 1 A SER 210  ? A SER 209 
11 1 Y 1 A SER 211  ? A SER 210 
12 1 Y 1 B GLY 2    ? B GLY 1   
13 1 Y 1 B PRO 3    ? B PRO 2   
14 1 Y 1 B GLY 4    ? B GLY 3   
15 1 Y 1 B SER 5    ? B SER 4   
16 1 Y 1 B PRO 208  ? B PRO 207 
17 1 Y 1 B ALA 209  ? B ALA 208 
18 1 Y 1 B SER 210  ? B SER 209 
19 1 Y 1 B SER 211  ? B SER 210 
20 1 Y 1 C GLY 1455 ? C GLY 1   
21 1 Y 1 C PRO 1456 ? C PRO 2   
22 1 Y 1 C GLY 1457 ? C GLY 3   
23 1 Y 1 C SER 1458 ? C SER 4   
24 1 Y 1 C ARG 1459 ? C ARG 5   
25 1 Y 1 C SER 1460 ? C SER 6   
26 1 Y 1 C ASP 1461 ? C ASP 7   
27 1 Y 1 C SER 1462 ? C SER 8   
28 1 Y 1 C PRO 1463 ? C PRO 9   
29 1 Y 1 C GLU 1464 ? C GLU 10  
30 1 Y 1 C ILE 1465 ? C ILE 11  
31 1 Y 1 C PRO 1466 ? C PRO 12  
32 1 Y 1 C PHE 1467 ? C PHE 13  
33 1 Y 1 C GLN 1468 ? C GLN 14  
34 1 Y 1 C ALA 1469 ? C ALA 15  
35 1 Y 1 C ALA 1470 ? C ALA 16  
36 1 Y 1 C ALA 1471 ? C ALA 17  
37 1 Y 1 C GLY 1472 ? C GLY 18  
38 1 Y 1 C PRO 1473 ? C PRO 19  
39 1 Y 1 C SER 1474 ? C SER 20  
40 1 Y 1 C ASP 1475 ? C ASP 21  
41 1 Y 1 C GLY 1476 ? C GLY 22  
42 1 Y 1 C LEU 1477 ? C LEU 23  
43 1 Y 1 C ASP 1478 ? C ASP 24  
44 1 Y 1 C ALA 1479 ? C ALA 25  
45 1 Y 1 C SER 1480 ? C SER 26  
46 1 Y 1 C SER 1481 ? C SER 27  
47 1 Y 1 C PRO 1482 ? C PRO 28  
48 1 Y 1 C GLY 1483 ? C GLY 29  
49 1 Y 1 C ASN 1484 ? C ASN 30  
50 1 Y 1 C SER 1485 ? C SER 31  
51 1 Y 1 C ALA 1607 ? C ALA 153 
52 1 Y 1 C VAL 1608 ? C VAL 154 
53 1 Y 1 C THR 1609 ? C THR 155 
54 1 Y 1 C PRO 1610 ? C PRO 156 
55 1 Y 1 C LEU 1611 ? C LEU 157 
56 1 Y 1 C THR 1612 ? C THR 158 
57 1 Y 1 C LYS 1613 ? C LYS 159 
58 1 Y 1 C ALA 1614 ? C ALA 160 
59 1 Y 1 C ALA 1615 ? C ALA 161 
60 1 Y 1 C ASP 1616 ? C ASP 162 
61 1 Y 1 C ILE 1617 ? C ILE 163 
62 1 Y 1 C SER 1618 ? C SER 164 
63 1 Y 1 C LEU 1619 ? C LEU 165 
64 1 Y 1 C ASP 1620 ? C ASP 166 
65 1 Y 1 C ASN 1621 ? C ASN 167 
66 1 Y 1 C LEU 1622 ? C LEU 168 
67 1 Y 1 C VAL 1623 ? C VAL 169 
68 1 Y 1 C GLU 1624 ? C GLU 170 
69 1 Y 1 C GLY 1625 ? C GLY 171 
70 1 Y 1 C LYS 1626 ? C LYS 172 
71 1 Y 1 C ARG 1627 ? C ARG 173 
72 1 Y 1 C LYS 1628 ? C LYS 174 
73 1 Y 1 C ARG 1629 ? C ARG 175 
74 1 Y 1 C ARG 1630 ? C ARG 176 
75 1 Y 1 C SER 1631 ? C SER 177 
76 1 Y 1 C ASN 1632 ? C ASN 178 
77 1 Y 1 C VAL 1633 ? C VAL 179 
78 1 Y 1 C SER 1634 ? C SER 180 
# 
_pdbx_audit_support.funding_organization   'National Natural Science Foundation of China' 
_pdbx_audit_support.country                China 
_pdbx_audit_support.grant_number           81672794 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'isothermal titration calorimetry' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#