data_5ZF6
# 
_entry.id   5ZF6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZF6         
WWPDB D_1300006960 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZF6 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yuan, H.S.'       1 ? 
'Golzarroshan, B.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                8630 
_citation.page_last                 8640 
_citation.title                     
'Crystal structure of dimeric human PNPase reveals why disease-linked mutants suffer from low RNA import and degradation activities.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky642 
_citation.pdbx_database_id_PubMed   30020492 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Golzarroshan, B.' 1 ? 
primary 'Lin, C.L.'        2 ? 
primary 'Li, C.L.'         3 ? 
primary 'Yang, W.Z.'       4 ? 
primary 'Chu, L.Y.'        5 ? 
primary 'Agrawal, S.'      6 ? 
primary 'Yuan, H.S.'       7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   117.41 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ZF6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     81.335 
_cell.length_a_esd                 ? 
_cell.length_b                     109.334 
_cell.length_b_esd                 ? 
_cell.length_c                     84.501 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ZF6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Polyribonucleotide nucleotidyltransferase 1, mitochondrial' 70712.727 2  2.7.7.8 ? ? ? 
2 water   nat water                                                        18.015    66 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;3'-5' RNA exonuclease OLD35,PNPase old-35,Polynucleotide phosphorylase 1,PNPase 1,Polynucleotide phosphorylase-like protein
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMASAVAVDLGNRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDY
RQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDI
PWNGPVGAVRIGIIDGEYVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQL
VKETGVTKRTPQKLFTPSPEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNV
VAKEVFRSIVLNEYKRCDGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKDKN
FMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACGGSLALMDSGVPI
SSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAK
KEILQIMNKTISKPRASRKENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEARD
FITEICK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMASAVAVDLGNRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDY
RQKAAAAGRIPTNYLRREIGTSDKEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDI
PWNGPVGAVRIGIIDGEYVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQL
VKETGVTKRTPQKLFTPSPEIVKYTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNV
VAKEVFRSIVLNEYKRCDGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKDKN
FMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACGGSLALMDSGVPI
SSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAK
KEILQIMNKTISKPRASRKENGPVVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEARD
FITEICK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ALA n 
1 23  SER n 
1 24  ALA n 
1 25  VAL n 
1 26  ALA n 
1 27  VAL n 
1 28  ASP n 
1 29  LEU n 
1 30  GLY n 
1 31  ASN n 
1 32  ARG n 
1 33  LYS n 
1 34  LEU n 
1 35  GLU n 
1 36  ILE n 
1 37  SER n 
1 38  SER n 
1 39  GLY n 
1 40  LYS n 
1 41  LEU n 
1 42  ALA n 
1 43  ARG n 
1 44  PHE n 
1 45  ALA n 
1 46  ASP n 
1 47  GLY n 
1 48  SER n 
1 49  ALA n 
1 50  VAL n 
1 51  VAL n 
1 52  GLN n 
1 53  SER n 
1 54  GLY n 
1 55  ASP n 
1 56  THR n 
1 57  ALA n 
1 58  VAL n 
1 59  MET n 
1 60  VAL n 
1 61  THR n 
1 62  ALA n 
1 63  VAL n 
1 64  SER n 
1 65  LYS n 
1 66  THR n 
1 67  LYS n 
1 68  PRO n 
1 69  SER n 
1 70  PRO n 
1 71  SER n 
1 72  GLN n 
1 73  PHE n 
1 74  MET n 
1 75  PRO n 
1 76  LEU n 
1 77  VAL n 
1 78  VAL n 
1 79  ASP n 
1 80  TYR n 
1 81  ARG n 
1 82  GLN n 
1 83  LYS n 
1 84  ALA n 
1 85  ALA n 
1 86  ALA n 
1 87  ALA n 
1 88  GLY n 
1 89  ARG n 
1 90  ILE n 
1 91  PRO n 
1 92  THR n 
1 93  ASN n 
1 94  TYR n 
1 95  LEU n 
1 96  ARG n 
1 97  ARG n 
1 98  GLU n 
1 99  ILE n 
1 100 GLY n 
1 101 THR n 
1 102 SER n 
1 103 ASP n 
1 104 LYS n 
1 105 GLU n 
1 106 ILE n 
1 107 LEU n 
1 108 THR n 
1 109 SER n 
1 110 ARG n 
1 111 ILE n 
1 112 ILE n 
1 113 ASP n 
1 114 ARG n 
1 115 SER n 
1 116 ILE n 
1 117 ARG n 
1 118 PRO n 
1 119 LEU n 
1 120 PHE n 
1 121 PRO n 
1 122 ALA n 
1 123 GLY n 
1 124 TYR n 
1 125 PHE n 
1 126 TYR n 
1 127 ASP n 
1 128 THR n 
1 129 GLN n 
1 130 VAL n 
1 131 LEU n 
1 132 CYS n 
1 133 ASN n 
1 134 LEU n 
1 135 LEU n 
1 136 ALA n 
1 137 VAL n 
1 138 ASP n 
1 139 GLY n 
1 140 VAL n 
1 141 ASN n 
1 142 GLU n 
1 143 PRO n 
1 144 ASP n 
1 145 VAL n 
1 146 LEU n 
1 147 ALA n 
1 148 ILE n 
1 149 ASN n 
1 150 GLY n 
1 151 ALA n 
1 152 SER n 
1 153 VAL n 
1 154 ALA n 
1 155 LEU n 
1 156 SER n 
1 157 LEU n 
1 158 SER n 
1 159 ASP n 
1 160 ILE n 
1 161 PRO n 
1 162 TRP n 
1 163 ASN n 
1 164 GLY n 
1 165 PRO n 
1 166 VAL n 
1 167 GLY n 
1 168 ALA n 
1 169 VAL n 
1 170 ARG n 
1 171 ILE n 
1 172 GLY n 
1 173 ILE n 
1 174 ILE n 
1 175 ASP n 
1 176 GLY n 
1 177 GLU n 
1 178 TYR n 
1 179 VAL n 
1 180 VAL n 
1 181 ASN n 
1 182 PRO n 
1 183 THR n 
1 184 ARG n 
1 185 LYS n 
1 186 GLU n 
1 187 MET n 
1 188 SER n 
1 189 SER n 
1 190 SER n 
1 191 THR n 
1 192 LEU n 
1 193 ASN n 
1 194 LEU n 
1 195 VAL n 
1 196 VAL n 
1 197 ALA n 
1 198 GLY n 
1 199 ALA n 
1 200 PRO n 
1 201 LYS n 
1 202 SER n 
1 203 GLN n 
1 204 ILE n 
1 205 VAL n 
1 206 MET n 
1 207 LEU n 
1 208 GLU n 
1 209 ALA n 
1 210 SER n 
1 211 ALA n 
1 212 GLU n 
1 213 ASN n 
1 214 ILE n 
1 215 LEU n 
1 216 GLN n 
1 217 GLN n 
1 218 ASP n 
1 219 PHE n 
1 220 CYS n 
1 221 HIS n 
1 222 ALA n 
1 223 ILE n 
1 224 LYS n 
1 225 VAL n 
1 226 GLY n 
1 227 VAL n 
1 228 LYS n 
1 229 TYR n 
1 230 THR n 
1 231 GLN n 
1 232 GLN n 
1 233 ILE n 
1 234 ILE n 
1 235 GLN n 
1 236 GLY n 
1 237 ILE n 
1 238 GLN n 
1 239 GLN n 
1 240 LEU n 
1 241 VAL n 
1 242 LYS n 
1 243 GLU n 
1 244 THR n 
1 245 GLY n 
1 246 VAL n 
1 247 THR n 
1 248 LYS n 
1 249 ARG n 
1 250 THR n 
1 251 PRO n 
1 252 GLN n 
1 253 LYS n 
1 254 LEU n 
1 255 PHE n 
1 256 THR n 
1 257 PRO n 
1 258 SER n 
1 259 PRO n 
1 260 GLU n 
1 261 ILE n 
1 262 VAL n 
1 263 LYS n 
1 264 TYR n 
1 265 THR n 
1 266 HIS n 
1 267 LYS n 
1 268 LEU n 
1 269 ALA n 
1 270 MET n 
1 271 GLU n 
1 272 ARG n 
1 273 LEU n 
1 274 TYR n 
1 275 ALA n 
1 276 VAL n 
1 277 PHE n 
1 278 THR n 
1 279 ASP n 
1 280 TYR n 
1 281 GLU n 
1 282 HIS n 
1 283 ASP n 
1 284 LYS n 
1 285 VAL n 
1 286 SER n 
1 287 ARG n 
1 288 ASP n 
1 289 GLU n 
1 290 ALA n 
1 291 VAL n 
1 292 ASN n 
1 293 LYS n 
1 294 ILE n 
1 295 ARG n 
1 296 LEU n 
1 297 ASP n 
1 298 THR n 
1 299 GLU n 
1 300 GLU n 
1 301 GLN n 
1 302 LEU n 
1 303 LYS n 
1 304 GLU n 
1 305 LYS n 
1 306 PHE n 
1 307 PRO n 
1 308 GLU n 
1 309 ALA n 
1 310 ASP n 
1 311 PRO n 
1 312 TYR n 
1 313 GLU n 
1 314 ILE n 
1 315 ILE n 
1 316 GLU n 
1 317 SER n 
1 318 PHE n 
1 319 ASN n 
1 320 VAL n 
1 321 VAL n 
1 322 ALA n 
1 323 LYS n 
1 324 GLU n 
1 325 VAL n 
1 326 PHE n 
1 327 ARG n 
1 328 SER n 
1 329 ILE n 
1 330 VAL n 
1 331 LEU n 
1 332 ASN n 
1 333 GLU n 
1 334 TYR n 
1 335 LYS n 
1 336 ARG n 
1 337 CYS n 
1 338 ASP n 
1 339 GLY n 
1 340 ARG n 
1 341 ASP n 
1 342 LEU n 
1 343 THR n 
1 344 SER n 
1 345 LEU n 
1 346 ARG n 
1 347 ASN n 
1 348 VAL n 
1 349 SER n 
1 350 CYS n 
1 351 GLU n 
1 352 VAL n 
1 353 ASP n 
1 354 MET n 
1 355 PHE n 
1 356 LYS n 
1 357 THR n 
1 358 LEU n 
1 359 HIS n 
1 360 GLY n 
1 361 SER n 
1 362 ALA n 
1 363 LEU n 
1 364 PHE n 
1 365 GLN n 
1 366 ARG n 
1 367 GLY n 
1 368 GLN n 
1 369 THR n 
1 370 GLN n 
1 371 VAL n 
1 372 LEU n 
1 373 CYS n 
1 374 THR n 
1 375 VAL n 
1 376 THR n 
1 377 PHE n 
1 378 ASP n 
1 379 SER n 
1 380 LEU n 
1 381 GLU n 
1 382 SER n 
1 383 GLY n 
1 384 ILE n 
1 385 LYS n 
1 386 SER n 
1 387 ASP n 
1 388 GLN n 
1 389 VAL n 
1 390 ILE n 
1 391 THR n 
1 392 ALA n 
1 393 ILE n 
1 394 ASN n 
1 395 GLY n 
1 396 ILE n 
1 397 LYS n 
1 398 ASP n 
1 399 LYS n 
1 400 ASN n 
1 401 PHE n 
1 402 MET n 
1 403 LEU n 
1 404 HIS n 
1 405 TYR n 
1 406 GLU n 
1 407 PHE n 
1 408 PRO n 
1 409 PRO n 
1 410 TYR n 
1 411 ALA n 
1 412 THR n 
1 413 ASN n 
1 414 GLU n 
1 415 ILE n 
1 416 GLY n 
1 417 LYS n 
1 418 VAL n 
1 419 THR n 
1 420 GLY n 
1 421 LEU n 
1 422 ASN n 
1 423 ARG n 
1 424 ARG n 
1 425 GLU n 
1 426 LEU n 
1 427 GLY n 
1 428 HIS n 
1 429 GLY n 
1 430 ALA n 
1 431 LEU n 
1 432 ALA n 
1 433 GLU n 
1 434 LYS n 
1 435 ALA n 
1 436 LEU n 
1 437 TYR n 
1 438 PRO n 
1 439 VAL n 
1 440 ILE n 
1 441 PRO n 
1 442 ARG n 
1 443 ASP n 
1 444 PHE n 
1 445 PRO n 
1 446 PHE n 
1 447 THR n 
1 448 ILE n 
1 449 ARG n 
1 450 VAL n 
1 451 THR n 
1 452 SER n 
1 453 GLU n 
1 454 VAL n 
1 455 LEU n 
1 456 GLU n 
1 457 SER n 
1 458 ASN n 
1 459 GLY n 
1 460 SER n 
1 461 SER n 
1 462 SER n 
1 463 MET n 
1 464 ALA n 
1 465 SER n 
1 466 ALA n 
1 467 CYS n 
1 468 GLY n 
1 469 GLY n 
1 470 SER n 
1 471 LEU n 
1 472 ALA n 
1 473 LEU n 
1 474 MET n 
1 475 ASP n 
1 476 SER n 
1 477 GLY n 
1 478 VAL n 
1 479 PRO n 
1 480 ILE n 
1 481 SER n 
1 482 SER n 
1 483 ALA n 
1 484 VAL n 
1 485 ALA n 
1 486 GLY n 
1 487 VAL n 
1 488 ALA n 
1 489 ILE n 
1 490 GLY n 
1 491 LEU n 
1 492 VAL n 
1 493 THR n 
1 494 LYS n 
1 495 THR n 
1 496 ASP n 
1 497 PRO n 
1 498 GLU n 
1 499 LYS n 
1 500 GLY n 
1 501 GLU n 
1 502 ILE n 
1 503 GLU n 
1 504 ASP n 
1 505 TYR n 
1 506 ARG n 
1 507 LEU n 
1 508 LEU n 
1 509 THR n 
1 510 ASP n 
1 511 ILE n 
1 512 LEU n 
1 513 GLY n 
1 514 ILE n 
1 515 GLU n 
1 516 ASP n 
1 517 TYR n 
1 518 ASN n 
1 519 GLY n 
1 520 ASP n 
1 521 MET n 
1 522 ASP n 
1 523 PHE n 
1 524 LYS n 
1 525 ILE n 
1 526 ALA n 
1 527 GLY n 
1 528 THR n 
1 529 ASN n 
1 530 LYS n 
1 531 GLY n 
1 532 ILE n 
1 533 THR n 
1 534 ALA n 
1 535 LEU n 
1 536 GLN n 
1 537 ALA n 
1 538 ASP n 
1 539 ILE n 
1 540 LYS n 
1 541 LEU n 
1 542 PRO n 
1 543 GLY n 
1 544 ILE n 
1 545 PRO n 
1 546 ILE n 
1 547 LYS n 
1 548 ILE n 
1 549 VAL n 
1 550 MET n 
1 551 GLU n 
1 552 ALA n 
1 553 ILE n 
1 554 GLN n 
1 555 GLN n 
1 556 ALA n 
1 557 SER n 
1 558 VAL n 
1 559 ALA n 
1 560 LYS n 
1 561 LYS n 
1 562 GLU n 
1 563 ILE n 
1 564 LEU n 
1 565 GLN n 
1 566 ILE n 
1 567 MET n 
1 568 ASN n 
1 569 LYS n 
1 570 THR n 
1 571 ILE n 
1 572 SER n 
1 573 LYS n 
1 574 PRO n 
1 575 ARG n 
1 576 ALA n 
1 577 SER n 
1 578 ARG n 
1 579 LYS n 
1 580 GLU n 
1 581 ASN n 
1 582 GLY n 
1 583 PRO n 
1 584 VAL n 
1 585 VAL n 
1 586 GLU n 
1 587 THR n 
1 588 VAL n 
1 589 GLN n 
1 590 VAL n 
1 591 PRO n 
1 592 LEU n 
1 593 SER n 
1 594 LYS n 
1 595 ARG n 
1 596 ALA n 
1 597 LYS n 
1 598 PHE n 
1 599 VAL n 
1 600 GLY n 
1 601 PRO n 
1 602 GLY n 
1 603 GLY n 
1 604 TYR n 
1 605 ASN n 
1 606 LEU n 
1 607 LYS n 
1 608 LYS n 
1 609 LEU n 
1 610 GLN n 
1 611 ALA n 
1 612 GLU n 
1 613 THR n 
1 614 GLY n 
1 615 VAL n 
1 616 THR n 
1 617 ILE n 
1 618 SER n 
1 619 GLN n 
1 620 VAL n 
1 621 ASP n 
1 622 GLU n 
1 623 GLU n 
1 624 THR n 
1 625 PHE n 
1 626 SER n 
1 627 VAL n 
1 628 PHE n 
1 629 ALA n 
1 630 PRO n 
1 631 THR n 
1 632 PRO n 
1 633 SER n 
1 634 ALA n 
1 635 MET n 
1 636 HIS n 
1 637 GLU n 
1 638 ALA n 
1 639 ARG n 
1 640 ASP n 
1 641 PHE n 
1 642 ILE n 
1 643 THR n 
1 644 GLU n 
1 645 ILE n 
1 646 CYS n 
1 647 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   647 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PNPT1, PNPASE' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PNPT1_HUMAN 
_struct_ref.pdbx_db_accession          Q8TCS8 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AVAVDLGNRKLEISSGKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRREIGTSD
KEILTSRIIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGASVALSLSDIPWNGPVGAVRIGIIDGEYVVNPT
RKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPSPEIVK
YTHKLAMERLYAVFTDYEHDKVSRDEAVNKIRLDTEEQLKEKFPEADPYEIIESFNVVAKEVFRSIVLNEYKRCDGRDLT
SLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESGIKSDQVITAINGIKDKNFMLHYEFPPYATNEIGKVTGLNR
RELGHGALAEKALYPVIPRDFPFTIRVTSEVLESNGSSSMASACGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIE
DYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGIPIKIVMEAIQQASVAKKEILQIMNKTISKPRASRKENGP
VVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTISQVDEETFSVFAPTPSAMHEARDFITEICK
;
_struct_ref.pdbx_align_begin           46 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ZF6 A 24 ? 647 ? Q8TCS8 46 ? 669 ? 46 669 
2 1 5ZF6 B 24 ? 647 ? Q8TCS8 46 ? 669 ? 46 669 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ZF6 MET A 1  ? UNP Q8TCS8 ? ? 'expression tag' 23 1  
1 5ZF6 GLY A 2  ? UNP Q8TCS8 ? ? 'expression tag' 24 2  
1 5ZF6 SER A 3  ? UNP Q8TCS8 ? ? 'expression tag' 25 3  
1 5ZF6 SER A 4  ? UNP Q8TCS8 ? ? 'expression tag' 26 4  
1 5ZF6 HIS A 5  ? UNP Q8TCS8 ? ? 'expression tag' 27 5  
1 5ZF6 HIS A 6  ? UNP Q8TCS8 ? ? 'expression tag' 28 6  
1 5ZF6 HIS A 7  ? UNP Q8TCS8 ? ? 'expression tag' 29 7  
1 5ZF6 HIS A 8  ? UNP Q8TCS8 ? ? 'expression tag' 30 8  
1 5ZF6 HIS A 9  ? UNP Q8TCS8 ? ? 'expression tag' 31 9  
1 5ZF6 HIS A 10 ? UNP Q8TCS8 ? ? 'expression tag' 32 10 
1 5ZF6 SER A 11 ? UNP Q8TCS8 ? ? 'expression tag' 33 11 
1 5ZF6 SER A 12 ? UNP Q8TCS8 ? ? 'expression tag' 34 12 
1 5ZF6 GLY A 13 ? UNP Q8TCS8 ? ? 'expression tag' 35 13 
1 5ZF6 LEU A 14 ? UNP Q8TCS8 ? ? 'expression tag' 36 14 
1 5ZF6 VAL A 15 ? UNP Q8TCS8 ? ? 'expression tag' 37 15 
1 5ZF6 PRO A 16 ? UNP Q8TCS8 ? ? 'expression tag' 38 16 
1 5ZF6 ARG A 17 ? UNP Q8TCS8 ? ? 'expression tag' 39 17 
1 5ZF6 GLY A 18 ? UNP Q8TCS8 ? ? 'expression tag' 40 18 
1 5ZF6 SER A 19 ? UNP Q8TCS8 ? ? 'expression tag' 41 19 
1 5ZF6 HIS A 20 ? UNP Q8TCS8 ? ? 'expression tag' 42 20 
1 5ZF6 MET A 21 ? UNP Q8TCS8 ? ? 'expression tag' 43 21 
1 5ZF6 ALA A 22 ? UNP Q8TCS8 ? ? 'expression tag' 44 22 
1 5ZF6 SER A 23 ? UNP Q8TCS8 ? ? 'expression tag' 45 23 
2 5ZF6 MET B 1  ? UNP Q8TCS8 ? ? 'expression tag' 23 24 
2 5ZF6 GLY B 2  ? UNP Q8TCS8 ? ? 'expression tag' 24 25 
2 5ZF6 SER B 3  ? UNP Q8TCS8 ? ? 'expression tag' 25 26 
2 5ZF6 SER B 4  ? UNP Q8TCS8 ? ? 'expression tag' 26 27 
2 5ZF6 HIS B 5  ? UNP Q8TCS8 ? ? 'expression tag' 27 28 
2 5ZF6 HIS B 6  ? UNP Q8TCS8 ? ? 'expression tag' 28 29 
2 5ZF6 HIS B 7  ? UNP Q8TCS8 ? ? 'expression tag' 29 30 
2 5ZF6 HIS B 8  ? UNP Q8TCS8 ? ? 'expression tag' 30 31 
2 5ZF6 HIS B 9  ? UNP Q8TCS8 ? ? 'expression tag' 31 32 
2 5ZF6 HIS B 10 ? UNP Q8TCS8 ? ? 'expression tag' 32 33 
2 5ZF6 SER B 11 ? UNP Q8TCS8 ? ? 'expression tag' 33 34 
2 5ZF6 SER B 12 ? UNP Q8TCS8 ? ? 'expression tag' 34 35 
2 5ZF6 GLY B 13 ? UNP Q8TCS8 ? ? 'expression tag' 35 36 
2 5ZF6 LEU B 14 ? UNP Q8TCS8 ? ? 'expression tag' 36 37 
2 5ZF6 VAL B 15 ? UNP Q8TCS8 ? ? 'expression tag' 37 38 
2 5ZF6 PRO B 16 ? UNP Q8TCS8 ? ? 'expression tag' 38 39 
2 5ZF6 ARG B 17 ? UNP Q8TCS8 ? ? 'expression tag' 39 40 
2 5ZF6 GLY B 18 ? UNP Q8TCS8 ? ? 'expression tag' 40 41 
2 5ZF6 SER B 19 ? UNP Q8TCS8 ? ? 'expression tag' 41 42 
2 5ZF6 HIS B 20 ? UNP Q8TCS8 ? ? 'expression tag' 42 43 
2 5ZF6 MET B 21 ? UNP Q8TCS8 ? ? 'expression tag' 43 44 
2 5ZF6 ALA B 22 ? UNP Q8TCS8 ? ? 'expression tag' 44 45 
2 5ZF6 SER B 23 ? UNP Q8TCS8 ? ? 'expression tag' 45 46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZF6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.36 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.85 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 2011-06-07 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M citrate buffer (pH 5.0), 10% (v/v) 2-propanol, 26% (v/v) polyethylene glycol 400' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-02-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ZF6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.796 
_reflns.d_resolution_low                 42.157 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32471 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.081 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.03 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.796 
_reflns_shell.d_res_low                   2.89 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1594 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.57 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ZF6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.796 
_refine.ls_d_res_low                             42.157 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28918 
_refine.ls_number_reflns_R_free                  1930 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    88.89 
_refine.ls_percent_reflns_R_free                 6.67 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1967 
_refine.ls_R_factor_R_free                       0.2489 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1929 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3U1K 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.30 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.32 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8489 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             66 
_refine_hist.number_atoms_total               8555 
_refine_hist.d_res_high                       2.796 
_refine_hist.d_res_low                        42.157 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003 ? 8618  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.540 ? 11662 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 3.508 ? 5294  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.043 ? 1380  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003 ? 1501  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7964 2.8664  . . 64  887  42.00 . . . 0.3933 . 0.2491 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8664 2.9438  . . 96  1256 58.00 . . . 0.3140 . 0.2549 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9438 3.0305  . . 119 1679 78.00 . . . 0.3073 . 0.2500 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0305 3.1282  . . 148 1938 90.00 . . . 0.3346 . 0.2444 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1282 3.2400  . . 140 2011 94.00 . . . 0.3176 . 0.2421 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2400 3.3697  . . 145 2056 94.00 . . . 0.2770 . 0.2171 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3697 3.5230  . . 152 2081 96.00 . . . 0.2857 . 0.2047 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5230 3.7086  . . 148 2113 98.00 . . . 0.2594 . 0.1883 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7086 3.9408  . . 171 2113 98.00 . . . 0.2452 . 0.1847 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9408 4.2448  . . 143 2145 99.00 . . . 0.2064 . 0.1715 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2448 4.6715  . . 149 2156 99.00 . . . 0.1923 . 0.1572 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6715 5.3463  . . 154 2154 99.00 . . . 0.2062 . 0.1620 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3463 6.7313  . . 152 2175 99.00 . . . 0.2605 . 0.2049 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.7313 42.1617 . . 149 2224 99.00 . . . 0.2063 . 0.1695 . . . . . . . . . . 
# 
_struct.entry_id                     5ZF6 
_struct.title                        'Crystal structure of the dimeric human PNPase' 
_struct.pdbx_descriptor              'Polyribonucleotide nucleotidyltransferase 1, mitochondrial (E.C.2.7.7.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZF6 
_struct_keywords.text            'dimeric human PNPase, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 103 ? ARG A 117 ? ASP A 125 ARG A 139 1 ? 15 
HELX_P HELX_P2  AA2 PRO A 118 ? PHE A 120 ? PRO A 140 PHE A 142 5 ? 3  
HELX_P HELX_P3  AA3 GLU A 142 ? SER A 158 ? GLU A 164 SER A 180 1 ? 17 
HELX_P HELX_P4  AA4 THR A 183 ? SER A 189 ? THR A 205 SER A 211 1 ? 7  
HELX_P HELX_P5  AA5 LEU A 215 ? GLY A 245 ? LEU A 237 GLY A 267 1 ? 31 
HELX_P HELX_P6  AA6 SER A 258 ? ASP A 279 ? SER A 280 ASP A 301 1 ? 22 
HELX_P HELX_P7  AA7 ASP A 283 ? PHE A 306 ? ASP A 305 PHE A 328 1 ? 24 
HELX_P HELX_P8  AA8 ASP A 310 ? TYR A 334 ? ASP A 332 TYR A 356 1 ? 25 
HELX_P HELX_P9  AA9 HIS A 428 ? TYR A 437 ? HIS A 450 TYR A 459 1 ? 10 
HELX_P HELX_P10 AB1 PRO A 438 ? ILE A 440 ? PRO A 460 ILE A 462 5 ? 3  
HELX_P HELX_P11 AB2 SER A 460 ? SER A 476 ? SER A 482 SER A 498 1 ? 17 
HELX_P HELX_P12 AB3 LEU A 512 ? ASN A 518 ? LEU A 534 ASN A 540 1 ? 7  
HELX_P HELX_P13 AB4 ILE A 546 ? ILE A 571 ? ILE A 568 ILE A 593 1 ? 26 
HELX_P HELX_P14 AB5 PRO A 591 ? GLY A 600 ? PRO A 613 GLY A 622 1 ? 10 
HELX_P HELX_P15 AB6 GLY A 603 ? GLY A 614 ? GLY A 625 GLY A 636 1 ? 12 
HELX_P HELX_P16 AB7 THR A 631 ? GLU A 644 ? THR A 653 GLU A 666 1 ? 14 
HELX_P HELX_P17 AB8 ASP B 103 ? ARG B 117 ? ASP B 125 ARG B 139 1 ? 15 
HELX_P HELX_P18 AB9 PRO B 118 ? PHE B 120 ? PRO B 140 PHE B 142 5 ? 3  
HELX_P HELX_P19 AC1 GLU B 142 ? SER B 158 ? GLU B 164 SER B 180 1 ? 17 
HELX_P HELX_P20 AC2 LYS B 185 ? SER B 190 ? LYS B 207 SER B 212 5 ? 6  
HELX_P HELX_P21 AC3 PRO B 200 ? SER B 202 ? PRO B 222 SER B 224 5 ? 3  
HELX_P HELX_P22 AC4 LEU B 215 ? GLY B 245 ? LEU B 237 GLY B 267 1 ? 31 
HELX_P HELX_P23 AC5 SER B 258 ? PHE B 277 ? SER B 280 PHE B 299 1 ? 20 
HELX_P HELX_P24 AC6 ASP B 283 ? PHE B 306 ? ASP B 305 PHE B 328 1 ? 24 
HELX_P HELX_P25 AC7 ASP B 310 ? TYR B 334 ? ASP B 332 TYR B 356 1 ? 25 
HELX_P HELX_P26 AC8 HIS B 428 ? TYR B 437 ? HIS B 450 TYR B 459 1 ? 10 
HELX_P HELX_P27 AC9 PRO B 438 ? ILE B 440 ? PRO B 460 ILE B 462 5 ? 3  
HELX_P HELX_P28 AD1 SER B 460 ? GLY B 477 ? SER B 482 GLY B 499 1 ? 18 
HELX_P HELX_P29 AD2 LEU B 512 ? ASN B 518 ? LEU B 534 ASN B 540 1 ? 7  
HELX_P HELX_P30 AD3 PRO B 545 ? ILE B 571 ? PRO B 567 ILE B 593 1 ? 27 
HELX_P HELX_P31 AD4 GLY B 600 ? GLY B 602 ? GLY B 622 GLY B 624 5 ? 3  
HELX_P HELX_P32 AD5 GLY B 603 ? GLY B 614 ? GLY B 625 GLY B 636 1 ? 12 
HELX_P HELX_P33 AD6 THR B 631 ? GLU B 644 ? THR B 653 GLU B 666 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 164 A . ? GLY 186 A PRO 165 A ? PRO 187 A 1 -5.84 
2 GLY 164 B . ? GLY 186 B PRO 165 B ? PRO 187 B 1 -1.61 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 8 ? 
AA3 ? 5 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 6 ? 
AA7 ? 8 ? 
AA8 ? 5 ? 
AA9 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA7 6 7 ? anti-parallel 
AA7 7 8 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 25  ? ASP A 28  ? VAL A 47  ASP A 50  
AA1 2 LYS A 33  ? SER A 37  ? LYS A 55  SER A 59  
AA1 3 GLY A 47  ? SER A 53  ? GLY A 69  SER A 75  
AA1 4 THR A 56  ? SER A 64  ? THR A 78  SER A 86  
AA1 5 THR A 128 ? ALA A 136 ? THR A 150 ALA A 158 
AA1 6 LEU A 76  ? TYR A 80  ? LEU A 98  TYR A 102 
AA2 1 GLU A 177 ? VAL A 180 ? GLU A 199 VAL A 202 
AA2 2 GLY A 167 ? ILE A 174 ? GLY A 189 ILE A 196 
AA2 3 LEU A 192 ? ALA A 199 ? LEU A 214 ALA A 221 
AA2 4 GLN A 203 ? ILE A 214 ? GLN A 225 ILE A 236 
AA2 5 ILE A 532 ? ILE A 539 ? ILE A 554 ILE A 561 
AA2 6 MET A 521 ? GLY A 527 ? MET A 543 GLY A 549 
AA2 7 ALA A 485 ? THR A 495 ? ALA A 507 THR A 517 
AA2 8 ILE A 502 ? THR A 509 ? ILE A 524 THR A 531 
AA3 1 GLU A 177 ? VAL A 180 ? GLU A 199 VAL A 202 
AA3 2 GLY A 167 ? ILE A 174 ? GLY A 189 ILE A 196 
AA3 3 LEU A 192 ? ALA A 199 ? LEU A 214 ALA A 221 
AA3 4 GLN A 203 ? ILE A 214 ? GLN A 225 ILE A 236 
AA3 5 ILE A 544 ? PRO A 545 ? ILE A 566 PRO A 567 
AA4 1 VAL A 348 ? VAL A 352 ? VAL A 370 VAL A 374 
AA4 2 GLY A 360 ? ARG A 366 ? GLY A 382 ARG A 388 
AA4 3 THR A 369 ? ASP A 378 ? THR A 391 ASP A 400 
AA4 4 THR A 447 ? GLU A 456 ? THR A 469 GLU A 478 
AA4 5 PHE A 401 ? HIS A 404 ? PHE A 423 HIS A 426 
AA5 1 VAL A 584 ? GLN A 589 ? VAL A 606 GLN A 611 
AA5 2 THR A 624 ? ALA A 629 ? THR A 646 ALA A 651 
AA5 3 THR A 616 ? GLN A 619 ? THR A 638 GLN A 641 
AA6 1 VAL B 25  ? ASP B 28  ? VAL B 47  ASP B 50  
AA6 2 LYS B 33  ? SER B 38  ? LYS B 55  SER B 60  
AA6 3 GLY B 47  ? SER B 53  ? GLY B 69  SER B 75  
AA6 4 THR B 56  ? SER B 64  ? THR B 78  SER B 86  
AA6 5 THR B 128 ? ALA B 136 ? THR B 150 ALA B 158 
AA6 6 LEU B 76  ? ASP B 79  ? LEU B 98  ASP B 101 
AA7 1 GLU B 177 ? VAL B 180 ? GLU B 199 VAL B 202 
AA7 2 GLY B 167 ? ILE B 174 ? GLY B 189 ILE B 196 
AA7 3 LEU B 192 ? ALA B 199 ? LEU B 214 ALA B 221 
AA7 4 GLN B 203 ? ILE B 214 ? GLN B 225 ILE B 236 
AA7 5 ILE B 532 ? ILE B 539 ? ILE B 554 ILE B 561 
AA7 6 MET B 521 ? GLY B 527 ? MET B 543 GLY B 549 
AA7 7 ALA B 485 ? LYS B 494 ? ALA B 507 LYS B 516 
AA7 8 ASP B 504 ? THR B 509 ? ASP B 526 THR B 531 
AA8 1 VAL B 348 ? VAL B 352 ? VAL B 370 VAL B 374 
AA8 2 GLY B 360 ? ARG B 366 ? GLY B 382 ARG B 388 
AA8 3 THR B 369 ? ASP B 378 ? THR B 391 ASP B 400 
AA8 4 THR B 447 ? GLU B 456 ? THR B 469 GLU B 478 
AA8 5 PHE B 401 ? GLU B 406 ? PHE B 423 GLU B 428 
AA9 1 VAL B 584 ? VAL B 588 ? VAL B 606 VAL B 610 
AA9 2 PHE B 625 ? ALA B 629 ? PHE B 647 ALA B 651 
AA9 3 THR B 616 ? SER B 618 ? THR B 638 SER B 640 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 27  ? N VAL A 49  O LEU A 34  ? O LEU A 56  
AA1 2 3 N GLU A 35  ? N GLU A 57  O GLN A 52  ? O GLN A 74  
AA1 3 4 N GLY A 47  ? N GLY A 69  O ALA A 62  ? O ALA A 84  
AA1 4 5 N MET A 59  ? N MET A 81  O ASN A 133 ? O ASN A 155 
AA1 5 6 O CYS A 132 ? O CYS A 154 N ASP A 79  ? N ASP A 101 
AA2 1 2 O VAL A 179 ? O VAL A 201 N GLY A 172 ? N GLY A 194 
AA2 2 3 N GLY A 167 ? N GLY A 189 O GLY A 198 ? O GLY A 220 
AA2 3 4 N ALA A 199 ? N ALA A 221 O GLN A 203 ? O GLN A 225 
AA2 4 5 N LEU A 207 ? N LEU A 229 O ALA A 537 ? O ALA A 559 
AA2 5 6 O GLN A 536 ? O GLN A 558 N LYS A 524 ? N LYS A 546 
AA2 6 7 O GLY A 527 ? O GLY A 549 N ALA A 485 ? N ALA A 507 
AA2 7 8 N GLY A 490 ? N GLY A 512 O LEU A 508 ? O LEU A 530 
AA3 1 2 O VAL A 179 ? O VAL A 201 N GLY A 172 ? N GLY A 194 
AA3 2 3 N GLY A 167 ? N GLY A 189 O GLY A 198 ? O GLY A 220 
AA3 3 4 N ALA A 199 ? N ALA A 221 O GLN A 203 ? O GLN A 225 
AA3 4 5 N ILE A 204 ? N ILE A 226 O ILE A 544 ? O ILE A 566 
AA4 1 2 N SER A 349 ? N SER A 371 O GLN A 365 ? O GLN A 387 
AA4 2 3 N ARG A 366 ? N ARG A 388 O THR A 369 ? O THR A 391 
AA4 3 4 N ASP A 378 ? N ASP A 400 O THR A 447 ? O THR A 469 
AA4 4 5 O VAL A 450 ? O VAL A 472 N MET A 402 ? N MET A 424 
AA5 1 2 N VAL A 588 ? N VAL A 610 O PHE A 625 ? O PHE A 647 
AA5 2 3 O SER A 626 ? O SER A 648 N SER A 618 ? N SER A 640 
AA6 1 2 N VAL B 25  ? N VAL B 47  O ILE B 36  ? O ILE B 58  
AA6 2 3 N GLU B 35  ? N GLU B 57  O GLN B 52  ? O GLN B 74  
AA6 3 4 N GLY B 47  ? N GLY B 69  O ALA B 62  ? O ALA B 84  
AA6 4 5 N MET B 59  ? N MET B 81  O ASN B 133 ? O ASN B 155 
AA6 5 6 O CYS B 132 ? O CYS B 154 N ASP B 79  ? N ASP B 101 
AA7 1 2 O VAL B 179 ? O VAL B 201 N GLY B 172 ? N GLY B 194 
AA7 2 3 N GLY B 167 ? N GLY B 189 O GLY B 198 ? O GLY B 220 
AA7 3 4 N ALA B 199 ? N ALA B 221 O GLN B 203 ? O GLN B 225 
AA7 4 5 N LEU B 207 ? N LEU B 229 O ALA B 537 ? O ALA B 559 
AA7 5 6 O GLN B 536 ? O GLN B 558 N LYS B 524 ? N LYS B 546 
AA7 6 7 O PHE B 523 ? O PHE B 545 N ILE B 489 ? N ILE B 511 
AA7 7 8 N GLY B 490 ? N GLY B 512 O LEU B 508 ? O LEU B 530 
AA8 1 2 N SER B 349 ? N SER B 371 O GLN B 365 ? O GLN B 387 
AA8 2 3 N ARG B 366 ? N ARG B 388 O THR B 369 ? O THR B 391 
AA8 3 4 N LEU B 372 ? N LEU B 394 O GLU B 453 ? O GLU B 475 
AA8 4 5 O VAL B 450 ? O VAL B 472 N MET B 402 ? N MET B 424 
AA9 1 2 N VAL B 588 ? N VAL B 610 O PHE B 625 ? O PHE B 647 
AA9 2 3 O SER B 626 ? O SER B 648 N SER B 618 ? N SER B 640 
# 
_atom_sites.entry_id                    5ZF6 
_atom_sites.fract_transf_matrix[1][1]   0.012295 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006374 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009146 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013330 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 24  ? 96.501  37.760  15.619  1.00 28.54 ? 46  ALA A N   1 
ATOM   2    C CA  . ALA A 1 24  ? 95.145  37.361  15.990  1.00 39.60 ? 46  ALA A CA  1 
ATOM   3    C C   . ALA A 1 24  ? 94.115  37.939  15.020  1.00 50.30 ? 46  ALA A C   1 
ATOM   4    O O   . ALA A 1 24  ? 94.150  39.129  14.705  1.00 55.73 ? 46  ALA A O   1 
ATOM   5    C CB  . ALA A 1 24  ? 94.834  37.797  17.415  1.00 28.54 ? 46  ALA A CB  1 
ATOM   6    N N   . VAL A 1 25  ? 93.199  37.093  14.550  1.00 43.67 ? 47  VAL A N   1 
ATOM   7    C CA  . VAL A 1 25  ? 92.169  37.482  13.593  1.00 39.04 ? 47  VAL A CA  1 
ATOM   8    C C   . VAL A 1 25  ? 90.811  37.402  14.278  1.00 42.56 ? 47  VAL A C   1 
ATOM   9    O O   . VAL A 1 25  ? 90.557  36.483  15.065  1.00 38.71 ? 47  VAL A O   1 
ATOM   10   C CB  . VAL A 1 25  ? 92.201  36.593  12.335  1.00 38.36 ? 47  VAL A CB  1 
ATOM   11   C CG1 . VAL A 1 25  ? 91.297  37.163  11.252  1.00 38.27 ? 47  VAL A CG1 1 
ATOM   12   C CG2 . VAL A 1 25  ? 93.625  36.446  11.821  1.00 44.60 ? 47  VAL A CG2 1 
ATOM   13   N N   . ALA A 1 26  ? 89.941  38.365  13.979  1.00 41.61 ? 48  ALA A N   1 
ATOM   14   C CA  . ALA A 1 26  ? 88.605  38.429  14.555  1.00 39.74 ? 48  ALA A CA  1 
ATOM   15   C C   . ALA A 1 26  ? 87.565  38.071  13.502  1.00 44.45 ? 48  ALA A C   1 
ATOM   16   O O   . ALA A 1 26  ? 87.603  38.589  12.380  1.00 42.73 ? 48  ALA A O   1 
ATOM   17   C CB  . ALA A 1 26  ? 88.319  39.819  15.126  1.00 35.28 ? 48  ALA A CB  1 
ATOM   18   N N   . VAL A 1 27  ? 86.640  37.188  13.866  1.00 39.28 ? 49  VAL A N   1 
ATOM   19   C CA  . VAL A 1 27  ? 85.528  36.801  13.006  1.00 33.89 ? 49  VAL A CA  1 
ATOM   20   C C   . VAL A 1 27  ? 84.249  37.273  13.675  1.00 34.07 ? 49  VAL A C   1 
ATOM   21   O O   . VAL A 1 27  ? 83.904  36.813  14.769  1.00 37.51 ? 49  VAL A O   1 
ATOM   22   C CB  . VAL A 1 27  ? 85.490  35.286  12.757  1.00 31.18 ? 49  VAL A CB  1 
ATOM   23   C CG1 . VAL A 1 27  ? 84.331  34.932  11.834  1.00 25.81 ? 49  VAL A CG1 1 
ATOM   24   C CG2 . VAL A 1 27  ? 86.811  34.814  12.172  1.00 31.37 ? 49  VAL A CG2 1 
ATOM   25   N N   . ASP A 1 28  ? 83.547  38.191  13.027  1.00 44.53 ? 50  ASP A N   1 
ATOM   26   C CA  . ASP A 1 28  ? 82.310  38.729  13.575  1.00 39.56 ? 50  ASP A CA  1 
ATOM   27   C C   . ASP A 1 28  ? 81.153  37.856  13.120  1.00 39.74 ? 50  ASP A C   1 
ATOM   28   O O   . ASP A 1 28  ? 80.827  37.815  11.929  1.00 45.14 ? 50  ASP A O   1 
ATOM   29   C CB  . ASP A 1 28  ? 82.101  40.177  13.145  1.00 46.29 ? 50  ASP A CB  1 
ATOM   30   C CG  . ASP A 1 28  ? 80.676  40.647  13.377  1.00 54.15 ? 50  ASP A CG  1 
ATOM   31   O OD1 . ASP A 1 28  ? 80.392  41.152  14.484  1.00 48.51 ? 50  ASP A OD1 1 
ATOM   32   O OD2 . ASP A 1 28  ? 79.843  40.518  12.451  1.00 55.08 ? 50  ASP A OD2 1 
ATOM   33   N N   . LEU A 1 29  ? 80.530  37.163  14.070  1.00 42.45 ? 51  LEU A N   1 
ATOM   34   C CA  . LEU A 1 29  ? 79.289  36.461  13.787  1.00 43.36 ? 51  LEU A CA  1 
ATOM   35   C C   . LEU A 1 29  ? 78.138  37.455  13.866  1.00 47.67 ? 51  LEU A C   1 
ATOM   36   O O   . LEU A 1 29  ? 78.319  38.645  13.591  1.00 52.06 ? 51  LEU A O   1 
ATOM   37   C CB  . LEU A 1 29  ? 79.096  35.296  14.758  1.00 33.33 ? 51  LEU A CB  1 
ATOM   38   C CG  . LEU A 1 29  ? 80.361  34.466  15.007  1.00 33.44 ? 51  LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 29  ? 80.207  33.586  16.241  1.00 38.80 ? 51  LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 29  ? 80.724  33.627  13.793  1.00 21.08 ? 51  LEU A CD2 1 
ATOM   41   N N   . GLY A 1 30  ? 76.957  36.992  14.243  1.00 46.36 ? 52  GLY A N   1 
ATOM   42   C CA  . GLY A 1 30  ? 75.841  37.905  14.360  1.00 50.52 ? 52  GLY A CA  1 
ATOM   43   C C   . GLY A 1 30  ? 75.930  38.785  15.590  1.00 50.53 ? 52  GLY A C   1 
ATOM   44   O O   . GLY A 1 30  ? 76.289  39.964  15.507  1.00 41.00 ? 52  GLY A O   1 
ATOM   45   N N   . ASN A 1 31  ? 75.618  38.211  16.747  1.00 53.76 ? 53  ASN A N   1 
ATOM   46   C CA  . ASN A 1 31  ? 75.500  38.963  17.985  1.00 49.28 ? 53  ASN A CA  1 
ATOM   47   C C   . ASN A 1 31  ? 76.797  39.011  18.777  1.00 55.35 ? 53  ASN A C   1 
ATOM   48   O O   . ASN A 1 31  ? 76.794  39.495  19.913  1.00 65.50 ? 53  ASN A O   1 
ATOM   49   C CB  . ASN A 1 31  ? 74.383  38.365  18.841  1.00 52.98 ? 53  ASN A CB  1 
ATOM   50   C CG  . ASN A 1 31  ? 73.227  37.843  18.002  1.00 55.68 ? 53  ASN A CG  1 
ATOM   51   O OD1 . ASN A 1 31  ? 73.381  36.889  17.232  1.00 40.17 ? 53  ASN A OD1 1 
ATOM   52   N ND2 . ASN A 1 31  ? 72.064  38.471  18.141  1.00 64.83 ? 53  ASN A ND2 1 
ATOM   53   N N   . ARG A 1 32  ? 77.901  38.531  18.209  1.00 56.60 ? 54  ARG A N   1 
ATOM   54   C CA  . ARG A 1 32  ? 79.169  38.503  18.924  1.00 47.56 ? 54  ARG A CA  1 
ATOM   55   C C   . ARG A 1 32  ? 80.301  38.269  17.933  1.00 43.46 ? 54  ARG A C   1 
ATOM   56   O O   . ARG A 1 32  ? 80.082  37.957  16.759  1.00 40.45 ? 54  ARG A O   1 
ATOM   57   C CB  . ARG A 1 32  ? 79.171  37.423  20.009  1.00 51.77 ? 54  ARG A CB  1 
ATOM   58   C CG  . ARG A 1 32  ? 78.584  36.092  19.560  1.00 46.31 ? 54  ARG A CG  1 
ATOM   59   C CD  . ARG A 1 32  ? 78.064  35.307  20.751  1.00 51.55 ? 54  ARG A CD  1 
ATOM   60   N NE  . ARG A 1 32  ? 77.083  36.070  21.516  1.00 47.44 ? 54  ARG A NE  1 
ATOM   61   C CZ  . ARG A 1 32  ? 75.777  36.051  21.271  1.00 48.92 ? 54  ARG A CZ  1 
ATOM   62   N NH1 . ARG A 1 32  ? 75.300  35.304  20.285  1.00 43.35 ? 54  ARG A NH1 1 
ATOM   63   N NH2 . ARG A 1 32  ? 74.945  36.774  22.010  1.00 52.42 ? 54  ARG A NH2 1 
ATOM   64   N N   . LYS A 1 33  ? 81.523  38.423  18.430  1.00 40.68 ? 55  LYS A N   1 
ATOM   65   C CA  . LYS A 1 33  ? 82.729  38.141  17.672  1.00 38.06 ? 55  LYS A CA  1 
ATOM   66   C C   . LYS A 1 33  ? 83.589  37.152  18.448  1.00 41.78 ? 55  LYS A C   1 
ATOM   67   O O   . LYS A 1 33  ? 83.518  37.075  19.679  1.00 41.70 ? 55  LYS A O   1 
ATOM   68   C CB  . LYS A 1 33  ? 83.527  39.425  17.390  1.00 41.52 ? 55  LYS A CB  1 
ATOM   69   C CG  . LYS A 1 33  ? 84.250  39.992  18.610  1.00 52.12 ? 55  LYS A CG  1 
ATOM   70   C CD  . LYS A 1 33  ? 85.488  40.793  18.224  1.00 56.54 ? 55  LYS A CD  1 
ATOM   71   C CE  . LYS A 1 33  ? 85.656  42.017  19.119  1.00 63.29 ? 55  LYS A CE  1 
ATOM   72   N NZ  . LYS A 1 33  ? 86.256  43.162  18.373  1.00 61.37 ? 55  LYS A NZ  1 
ATOM   73   N N   . LEU A 1 34  ? 84.388  36.381  17.715  1.00 41.46 ? 56  LEU A N   1 
ATOM   74   C CA  . LEU A 1 34  ? 85.400  35.524  18.311  1.00 40.86 ? 56  LEU A CA  1 
ATOM   75   C C   . LEU A 1 34  ? 86.731  35.790  17.625  1.00 35.07 ? 56  LEU A C   1 
ATOM   76   O O   . LEU A 1 34  ? 86.780  36.023  16.413  1.00 28.76 ? 56  LEU A O   1 
ATOM   77   C CB  . LEU A 1 34  ? 85.019  34.030  18.217  1.00 38.15 ? 56  LEU A CB  1 
ATOM   78   C CG  . LEU A 1 34  ? 84.791  33.353  16.862  1.00 41.81 ? 56  LEU A CG  1 
ATOM   79   C CD1 . LEU A 1 34  ? 86.048  32.641  16.389  1.00 41.13 ? 56  LEU A CD1 1 
ATOM   80   C CD2 . LEU A 1 34  ? 83.632  32.372  16.950  1.00 34.84 ? 56  LEU A CD2 1 
ATOM   81   N N   . GLU A 1 35  ? 87.804  35.787  18.408  1.00 37.02 ? 57  GLU A N   1 
ATOM   82   C CA  . GLU A 1 35  ? 89.144  36.012  17.888  1.00 43.23 ? 57  GLU A CA  1 
ATOM   83   C C   . GLU A 1 35  ? 89.967  34.743  18.041  1.00 39.46 ? 57  GLU A C   1 
ATOM   84   O O   . GLU A 1 35  ? 89.879  34.053  19.062  1.00 39.58 ? 57  GLU A O   1 
ATOM   85   C CB  . GLU A 1 35  ? 89.837  37.182  18.595  1.00 43.28 ? 57  GLU A CB  1 
ATOM   86   C CG  . GLU A 1 35  ? 89.817  37.110  20.111  1.00 55.84 ? 57  GLU A CG  1 
ATOM   87   C CD  . GLU A 1 35  ? 89.011  38.237  20.739  1.00 69.57 ? 57  GLU A CD  1 
ATOM   88   O OE1 . GLU A 1 35  ? 89.529  38.898  21.667  1.00 68.79 ? 57  GLU A OE1 1 
ATOM   89   O OE2 . GLU A 1 35  ? 87.859  38.460  20.308  1.00 69.98 ? 57  GLU A OE2 1 
ATOM   90   N N   . ILE A 1 36  ? 90.761  34.440  17.018  1.00 35.65 ? 58  ILE A N   1 
ATOM   91   C CA  . ILE A 1 36  ? 91.565  33.227  16.970  1.00 35.61 ? 58  ILE A CA  1 
ATOM   92   C C   . ILE A 1 36  ? 93.039  33.616  16.967  1.00 31.62 ? 58  ILE A C   1 
ATOM   93   O O   . ILE A 1 36  ? 93.441  34.567  16.287  1.00 32.21 ? 58  ILE A O   1 
ATOM   94   C CB  . ILE A 1 36  ? 91.197  32.369  15.741  1.00 37.15 ? 58  ILE A CB  1 
ATOM   95   C CG1 . ILE A 1 36  ? 91.349  33.169  14.448  1.00 41.06 ? 58  ILE A CG1 1 
ATOM   96   C CG2 . ILE A 1 36  ? 89.760  31.872  15.857  1.00 23.97 ? 58  ILE A CG2 1 
ATOM   97   C CD1 . ILE A 1 36  ? 90.808  32.452  13.222  1.00 38.83 ? 58  ILE A CD1 1 
ATOM   98   N N   . SER A 1 37  ? 93.843  32.887  17.743  1.00 38.13 ? 59  SER A N   1 
ATOM   99   C CA  . SER A 1 37  ? 95.259  33.209  17.894  1.00 33.48 ? 59  SER A CA  1 
ATOM   100  C C   . SER A 1 37  ? 96.126  31.981  17.664  1.00 34.54 ? 59  SER A C   1 
ATOM   101  O O   . SER A 1 37  ? 95.624  30.924  17.271  1.00 39.11 ? 59  SER A O   1 
ATOM   102  C CB  . SER A 1 37  ? 95.538  33.774  19.288  1.00 27.71 ? 59  SER A CB  1 
ATOM   103  O OG  . SER A 1 37  ? 94.459  34.565  19.750  1.00 33.10 ? 59  SER A OG  1 
ATOM   104  N N   . SER A 1 38  ? 97.426  32.108  17.915  1.00 36.43 ? 60  SER A N   1 
ATOM   105  C CA  . SER A 1 38  ? 98.352  30.988  17.896  1.00 37.14 ? 60  SER A CA  1 
ATOM   106  C C   . SER A 1 38  ? 98.871  30.740  19.313  1.00 39.12 ? 60  SER A C   1 
ATOM   107  O O   . SER A 1 38  ? 98.405  31.349  20.284  1.00 38.27 ? 60  SER A O   1 
ATOM   108  C CB  . SER A 1 38  ? 99.488  31.256  16.905  1.00 38.14 ? 60  SER A CB  1 
ATOM   109  O OG  . SER A 1 38  ? 100.306 30.108  16.745  1.00 38.85 ? 60  SER A OG  1 
ATOM   110  N N   . GLY A 1 39  ? 99.840  29.838  19.432  1.00 45.08 ? 61  GLY A N   1 
ATOM   111  C CA  . GLY A 1 39  ? 100.423 29.512  20.723  1.00 37.37 ? 61  GLY A CA  1 
ATOM   112  C C   . GLY A 1 39  ? 101.869 29.945  20.848  1.00 45.41 ? 61  GLY A C   1 
ATOM   113  O O   . GLY A 1 39  ? 102.174 30.932  21.517  1.00 57.58 ? 61  GLY A O   1 
ATOM   114  N N   . ALA A 1 45  ? 103.930 20.258  20.977  1.00 33.75 ? 67  ALA A N   1 
ATOM   115  C CA  . ALA A 1 45  ? 102.772 20.675  20.192  1.00 34.22 ? 67  ALA A CA  1 
ATOM   116  C C   . ALA A 1 45  ? 103.170 21.046  18.766  1.00 36.65 ? 67  ALA A C   1 
ATOM   117  O O   . ALA A 1 45  ? 103.900 22.016  18.555  1.00 41.02 ? 67  ALA A O   1 
ATOM   118  C CB  . ALA A 1 45  ? 102.073 21.850  20.862  1.00 27.75 ? 67  ALA A CB  1 
ATOM   119  N N   . ASP A 1 46  ? 102.685 20.271  17.788  1.00 33.82 ? 68  ASP A N   1 
ATOM   120  C CA  . ASP A 1 46  ? 102.921 20.595  16.383  1.00 29.71 ? 68  ASP A CA  1 
ATOM   121  C C   . ASP A 1 46  ? 102.148 21.832  15.942  1.00 32.51 ? 68  ASP A C   1 
ATOM   122  O O   . ASP A 1 46  ? 102.485 22.426  14.912  1.00 35.52 ? 68  ASP A O   1 
ATOM   123  C CB  . ASP A 1 46  ? 102.551 19.408  15.491  1.00 22.81 ? 68  ASP A CB  1 
ATOM   124  C CG  . ASP A 1 46  ? 103.453 18.206  15.715  1.00 31.77 ? 68  ASP A CG  1 
ATOM   125  O OD1 . ASP A 1 46  ? 104.642 18.410  16.036  1.00 41.54 ? 68  ASP A OD1 1 
ATOM   126  O OD2 . ASP A 1 46  ? 102.975 17.057  15.576  1.00 29.69 ? 68  ASP A OD2 1 
ATOM   127  N N   . GLY A 1 47  ? 101.126 22.227  16.698  1.00 28.08 ? 69  GLY A N   1 
ATOM   128  C CA  . GLY A 1 47  ? 100.381 23.440  16.434  1.00 24.52 ? 69  GLY A CA  1 
ATOM   129  C C   . GLY A 1 47  ? 99.432  23.756  17.573  1.00 29.96 ? 69  GLY A C   1 
ATOM   130  O O   . GLY A 1 47  ? 98.821  22.851  18.151  1.00 27.30 ? 69  GLY A O   1 
ATOM   131  N N   . SER A 1 48  ? 99.304  25.033  17.915  1.00 26.77 ? 70  SER A N   1 
ATOM   132  C CA  . SER A 1 48  ? 98.434  25.454  18.999  1.00 27.45 ? 70  SER A CA  1 
ATOM   133  C C   . SER A 1 48  ? 97.560  26.608  18.532  1.00 31.19 ? 70  SER A C   1 
ATOM   134  O O   . SER A 1 48  ? 97.800  27.221  17.487  1.00 32.57 ? 70  SER A O   1 
ATOM   135  C CB  . SER A 1 48  ? 99.241  25.856  20.238  1.00 28.88 ? 70  SER A CB  1 
ATOM   136  O OG  . SER A 1 48  ? 100.454 26.483  19.861  1.00 45.39 ? 70  SER A OG  1 
ATOM   137  N N   . ALA A 1 49  ? 96.531  26.897  19.324  1.00 26.01 ? 71  ALA A N   1 
ATOM   138  C CA  . ALA A 1 49  ? 95.594  27.957  18.994  1.00 27.84 ? 71  ALA A CA  1 
ATOM   139  C C   . ALA A 1 49  ? 94.831  28.354  20.246  1.00 32.15 ? 71  ALA A C   1 
ATOM   140  O O   . ALA A 1 49  ? 94.642  27.546  21.159  1.00 34.00 ? 71  ALA A O   1 
ATOM   141  C CB  . ALA A 1 49  ? 94.615  27.524  17.900  1.00 29.51 ? 71  ALA A CB  1 
ATOM   142  N N   . VAL A 1 50  ? 94.394  29.609  20.273  1.00 26.55 ? 72  VAL A N   1 
ATOM   143  C CA  . VAL A 1 50  ? 93.524  30.120  21.321  1.00 25.92 ? 72  VAL A CA  1 
ATOM   144  C C   . VAL A 1 50  ? 92.325  30.762  20.640  1.00 30.26 ? 72  VAL A C   1 
ATOM   145  O O   . VAL A 1 50  ? 92.491  31.622  19.765  1.00 31.50 ? 72  VAL A O   1 
ATOM   146  C CB  . VAL A 1 50  ? 94.242  31.128  22.234  1.00 33.53 ? 72  VAL A CB  1 
ATOM   147  C CG1 . VAL A 1 50  ? 93.237  31.865  23.111  1.00 26.04 ? 72  VAL A CG1 1 
ATOM   148  C CG2 . VAL A 1 50  ? 95.282  30.419  23.096  1.00 29.86 ? 72  VAL A CG2 1 
ATOM   149  N N   . VAL A 1 51  ? 91.125  30.328  21.017  1.00 28.07 ? 73  VAL A N   1 
ATOM   150  C CA  . VAL A 1 51  ? 89.876  30.878  20.499  1.00 32.39 ? 73  VAL A CA  1 
ATOM   151  C C   . VAL A 1 51  ? 89.161  31.553  21.658  1.00 32.64 ? 73  VAL A C   1 
ATOM   152  O O   . VAL A 1 51  ? 88.842  30.904  22.663  1.00 29.31 ? 73  VAL A O   1 
ATOM   153  C CB  . VAL A 1 51  ? 88.988  29.798  19.857  1.00 29.64 ? 73  VAL A CB  1 
ATOM   154  C CG1 . VAL A 1 51  ? 87.626  30.379  19.506  1.00 30.68 ? 73  VAL A CG1 1 
ATOM   155  C CG2 . VAL A 1 51  ? 89.651  29.214  18.619  1.00 20.67 ? 73  VAL A CG2 1 
ATOM   156  N N   . GLN A 1 52  ? 88.909  32.852  21.522  1.00 39.53 ? 74  GLN A N   1 
ATOM   157  C CA  . GLN A 1 52  ? 88.317  33.650  22.584  1.00 37.93 ? 74  GLN A CA  1 
ATOM   158  C C   . GLN A 1 52  ? 87.037  34.300  22.085  1.00 36.16 ? 74  GLN A C   1 
ATOM   159  O O   . GLN A 1 52  ? 87.000  34.838  20.972  1.00 34.85 ? 74  GLN A O   1 
ATOM   160  C CB  . GLN A 1 52  ? 89.296  34.718  23.075  1.00 36.87 ? 74  GLN A CB  1 
ATOM   161  C CG  . GLN A 1 52  ? 88.833  35.454  24.318  1.00 41.11 ? 74  GLN A CG  1 
ATOM   162  C CD  . GLN A 1 52  ? 89.867  36.435  24.828  1.00 45.16 ? 74  GLN A CD  1 
ATOM   163  O OE1 . GLN A 1 52  ? 91.066  36.271  24.594  1.00 44.32 ? 74  GLN A OE1 1 
ATOM   164  N NE2 . GLN A 1 52  ? 89.408  37.468  25.528  1.00 47.97 ? 74  GLN A NE2 1 
ATOM   165  N N   . SER A 1 53  ? 85.992  34.238  22.909  1.00 31.28 ? 75  SER A N   1 
ATOM   166  C CA  . SER A 1 53  ? 84.729  34.916  22.641  1.00 34.23 ? 75  SER A CA  1 
ATOM   167  C C   . SER A 1 53  ? 84.223  35.476  23.959  1.00 36.38 ? 75  SER A C   1 
ATOM   168  O O   . SER A 1 53  ? 83.960  34.717  24.896  1.00 37.15 ? 75  SER A O   1 
ATOM   169  C CB  . SER A 1 53  ? 83.702  33.966  22.023  1.00 35.99 ? 75  SER A CB  1 
ATOM   170  O OG  . SER A 1 53  ? 82.635  34.689  21.440  1.00 46.95 ? 75  SER A OG  1 
ATOM   171  N N   . GLY A 1 54  ? 84.088  36.794  24.033  1.00 40.64 ? 76  GLY A N   1 
ATOM   172  C CA  . GLY A 1 54  ? 83.848  37.417  25.322  1.00 36.16 ? 76  GLY A CA  1 
ATOM   173  C C   . GLY A 1 54  ? 85.117  37.344  26.147  1.00 45.27 ? 76  GLY A C   1 
ATOM   174  O O   . GLY A 1 54  ? 86.208  37.686  25.676  1.00 49.34 ? 76  GLY A O   1 
ATOM   175  N N   . ASP A 1 55  ? 84.989  36.885  27.390  1.00 50.39 ? 77  ASP A N   1 
ATOM   176  C CA  . ASP A 1 55  ? 86.144  36.619  28.238  1.00 49.04 ? 77  ASP A CA  1 
ATOM   177  C C   . ASP A 1 55  ? 86.269  35.134  28.561  1.00 46.58 ? 77  ASP A C   1 
ATOM   178  O O   . ASP A 1 55  ? 86.847  34.757  29.583  1.00 55.15 ? 77  ASP A O   1 
ATOM   179  C CB  . ASP A 1 55  ? 86.088  37.456  29.516  1.00 50.10 ? 77  ASP A CB  1 
ATOM   180  C CG  . ASP A 1 55  ? 86.806  38.786  29.367  1.00 59.96 ? 77  ASP A CG  1 
ATOM   181  O OD1 . ASP A 1 55  ? 86.269  39.815  29.828  1.00 60.08 ? 77  ASP A OD1 1 
ATOM   182  O OD2 . ASP A 1 55  ? 87.905  38.801  28.768  1.00 61.53 ? 77  ASP A OD2 1 
ATOM   183  N N   . THR A 1 56  ? 85.713  34.288  27.696  1.00 43.66 ? 78  THR A N   1 
ATOM   184  C CA  . THR A 1 56  ? 85.950  32.852  27.716  1.00 37.67 ? 78  THR A CA  1 
ATOM   185  C C   . THR A 1 56  ? 86.972  32.519  26.638  1.00 33.37 ? 78  THR A C   1 
ATOM   186  O O   . THR A 1 56  ? 86.799  32.904  25.476  1.00 39.90 ? 78  THR A O   1 
ATOM   187  C CB  . THR A 1 56  ? 84.655  32.075  27.471  1.00 37.44 ? 78  THR A CB  1 
ATOM   188  O OG1 . THR A 1 56  ? 83.808  32.176  28.623  1.00 38.46 ? 78  THR A OG1 1 
ATOM   189  C CG2 . THR A 1 56  ? 84.955  30.609  27.194  1.00 34.43 ? 78  THR A CG2 1 
ATOM   190  N N   . ALA A 1 57  ? 88.038  31.818  27.020  1.00 30.98 ? 79  ALA A N   1 
ATOM   191  C CA  . ALA A 1 57  ? 89.125  31.528  26.093  1.00 32.78 ? 79  ALA A CA  1 
ATOM   192  C C   . ALA A 1 57  ? 89.579  30.087  26.259  1.00 30.94 ? 79  ALA A C   1 
ATOM   193  O O   . ALA A 1 57  ? 89.795  29.627  27.384  1.00 35.69 ? 79  ALA A O   1 
ATOM   194  C CB  . ALA A 1 57  ? 90.305  32.481  26.307  1.00 24.05 ? 79  ALA A CB  1 
ATOM   195  N N   . VAL A 1 58  ? 89.727  29.385  25.136  1.00 24.34 ? 80  VAL A N   1 
ATOM   196  C CA  . VAL A 1 58  ? 90.144  27.988  25.114  1.00 25.53 ? 80  VAL A CA  1 
ATOM   197  C C   . VAL A 1 58  ? 91.426  27.882  24.304  1.00 30.56 ? 80  VAL A C   1 
ATOM   198  O O   . VAL A 1 58  ? 91.525  28.460  23.215  1.00 34.78 ? 80  VAL A O   1 
ATOM   199  C CB  . VAL A 1 58  ? 89.056  27.079  24.517  1.00 22.56 ? 80  VAL A CB  1 
ATOM   200  C CG1 . VAL A 1 58  ? 89.466  25.621  24.632  1.00 32.58 ? 80  VAL A CG1 1 
ATOM   201  C CG2 . VAL A 1 58  ? 87.738  27.312  25.214  1.00 28.86 ? 80  VAL A CG2 1 
ATOM   202  N N   . MET A 1 59  ? 92.402  27.147  24.832  1.00 32.37 ? 81  MET A N   1 
ATOM   203  C CA  . MET A 1 59  ? 93.620  26.815  24.105  1.00 32.75 ? 81  MET A CA  1 
ATOM   204  C C   . MET A 1 59  ? 93.564  25.350  23.694  1.00 31.45 ? 81  MET A C   1 
ATOM   205  O O   . MET A 1 59  ? 93.243  24.484  24.516  1.00 29.30 ? 81  MET A O   1 
ATOM   206  C CB  . MET A 1 59  ? 94.873  27.081  24.945  1.00 32.01 ? 81  MET A CB  1 
ATOM   207  C CG  . MET A 1 59  ? 96.174  26.696  24.240  1.00 31.23 ? 81  MET A CG  1 
ATOM   208  S SD  . MET A 1 59  ? 97.664  27.256  25.094  1.00 36.65 ? 81  MET A SD  1 
ATOM   209  C CE  . MET A 1 59  ? 98.951  26.593  24.038  1.00 21.05 ? 81  MET A CE  1 
ATOM   210  N N   . VAL A 1 60  ? 93.869  25.081  22.427  1.00 24.24 ? 82  VAL A N   1 
ATOM   211  C CA  . VAL A 1 60  ? 93.829  23.738  21.866  1.00 22.29 ? 82  VAL A CA  1 
ATOM   212  C C   . VAL A 1 60  ? 95.181  23.443  21.233  1.00 26.36 ? 82  VAL A C   1 
ATOM   213  O O   . VAL A 1 60  ? 95.670  24.231  20.415  1.00 29.40 ? 82  VAL A O   1 
ATOM   214  C CB  . VAL A 1 60  ? 92.701  23.588  20.824  1.00 24.83 ? 82  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 60  ? 92.602  22.158  20.353  1.00 23.71 ? 82  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 60  ? 91.372  24.039  21.404  1.00 27.85 ? 82  VAL A CG2 1 
ATOM   217  N N   . THR A 1 61  ? 95.783  22.316  21.607  1.00 23.00 ? 83  THR A N   1 
ATOM   218  C CA  . THR A 1 61  ? 97.059  21.888  21.046  1.00 23.45 ? 83  THR A CA  1 
ATOM   219  C C   . THR A 1 61  ? 96.865  20.622  20.226  1.00 22.85 ? 83  THR A C   1 
ATOM   220  O O   . THR A 1 61  ? 96.073  19.749  20.592  1.00 30.52 ? 83  THR A O   1 
ATOM   221  C CB  . THR A 1 61  ? 98.102  21.631  22.139  1.00 22.89 ? 83  THR A CB  1 
ATOM   222  O OG1 . THR A 1 61  ? 97.465  21.063  23.289  1.00 27.90 ? 83  THR A OG1 1 
ATOM   223  C CG2 . THR A 1 61  ? 98.799  22.925  22.528  1.00 21.97 ? 83  THR A CG2 1 
ATOM   224  N N   . ALA A 1 62  ? 97.599  20.522  19.122  1.00 22.86 ? 84  ALA A N   1 
ATOM   225  C CA  . ALA A 1 62  ? 97.538  19.363  18.244  1.00 19.86 ? 84  ALA A CA  1 
ATOM   226  C C   . ALA A 1 62  ? 98.944  18.842  18.003  1.00 22.29 ? 84  ALA A C   1 
ATOM   227  O O   . ALA A 1 62  ? 99.831  19.600  17.595  1.00 26.04 ? 84  ALA A O   1 
ATOM   228  C CB  . ALA A 1 62  ? 96.871  19.710  16.909  1.00 26.04 ? 84  ALA A CB  1 
ATOM   229  N N   . VAL A 1 63  ? 99.143  17.551  18.248  1.00 22.85 ? 85  VAL A N   1 
ATOM   230  C CA  . VAL A 1 63  ? 100.420 16.893  18.017  1.00 23.76 ? 85  VAL A CA  1 
ATOM   231  C C   . VAL A 1 63  ? 100.155 15.594  17.270  1.00 23.45 ? 85  VAL A C   1 
ATOM   232  O O   . VAL A 1 63  ? 99.117  14.949  17.454  1.00 18.44 ? 85  VAL A O   1 
ATOM   233  C CB  . VAL A 1 63  ? 101.182 16.640  19.342  1.00 23.95 ? 85  VAL A CB  1 
ATOM   234  C CG1 . VAL A 1 63  ? 100.429 15.648  20.233  1.00 18.67 ? 85  VAL A CG1 1 
ATOM   235  C CG2 . VAL A 1 63  ? 102.595 16.156  19.067  1.00 24.30 ? 85  VAL A CG2 1 
ATOM   236  N N   . SER A 1 64  ? 101.093 15.222  16.400  1.00 23.69 ? 86  SER A N   1 
ATOM   237  C CA  . SER A 1 64  ? 100.963 14.016  15.588  1.00 26.25 ? 86  SER A CA  1 
ATOM   238  C C   . SER A 1 64  ? 102.342 13.405  15.402  1.00 25.57 ? 86  SER A C   1 
ATOM   239  O O   . SER A 1 64  ? 103.245 14.057  14.865  1.00 23.50 ? 86  SER A O   1 
ATOM   240  C CB  . SER A 1 64  ? 100.320 14.326  14.230  1.00 26.61 ? 86  SER A CB  1 
ATOM   241  O OG  . SER A 1 64  ? 100.171 13.156  13.445  1.00 23.53 ? 86  SER A OG  1 
ATOM   242  N N   . LYS A 1 65  ? 102.496 12.157  15.841  1.00 24.19 ? 87  LYS A N   1 
ATOM   243  C CA  . LYS A 1 65  ? 103.779 11.475  15.745  1.00 27.10 ? 87  LYS A CA  1 
ATOM   244  C C   . LYS A 1 65  ? 104.184 11.294  14.287  1.00 27.55 ? 87  LYS A C   1 
ATOM   245  O O   . LYS A 1 65  ? 103.341 11.209  13.391  1.00 30.25 ? 87  LYS A O   1 
ATOM   246  C CB  . LYS A 1 65  ? 103.710 10.114  16.442  1.00 29.56 ? 87  LYS A CB  1 
ATOM   247  C CG  . LYS A 1 65  ? 103.765 10.193  17.956  1.00 28.98 ? 87  LYS A CG  1 
ATOM   248  C CD  . LYS A 1 65  ? 103.621 8.824   18.596  1.00 29.35 ? 87  LYS A CD  1 
ATOM   249  C CE  . LYS A 1 65  ? 104.000 8.878   20.066  1.00 40.38 ? 87  LYS A CE  1 
ATOM   250  N NZ  . LYS A 1 65  ? 103.423 10.078  20.746  1.00 44.87 ? 87  LYS A NZ  1 
ATOM   251  N N   . THR A 1 66  ? 105.495 11.247  14.049  1.00 28.18 ? 88  THR A N   1 
ATOM   252  C CA  . THR A 1 66  ? 106.001 10.971  12.712  1.00 29.63 ? 88  THR A CA  1 
ATOM   253  C C   . THR A 1 66  ? 106.269 9.492   12.481  1.00 22.77 ? 88  THR A C   1 
ATOM   254  O O   . THR A 1 66  ? 106.565 9.104   11.348  1.00 30.08 ? 88  THR A O   1 
ATOM   255  C CB  . THR A 1 66  ? 107.284 11.769  12.430  1.00 30.25 ? 88  THR A CB  1 
ATOM   256  O OG1 . THR A 1 66  ? 108.372 11.226  13.190  1.00 31.68 ? 88  THR A OG1 1 
ATOM   257  C CG2 . THR A 1 66  ? 107.094 13.248  12.773  1.00 21.10 ? 88  THR A CG2 1 
ATOM   258  N N   . LYS A 1 67  ? 106.167 8.668   13.506  1.00 23.17 ? 89  LYS A N   1 
ATOM   259  C CA  . LYS A 1 67  ? 106.372 7.238   13.313  1.00 31.11 ? 89  LYS A CA  1 
ATOM   260  C C   . LYS A 1 67  ? 105.030 6.546   13.179  1.00 30.95 ? 89  LYS A C   1 
ATOM   261  O O   . LYS A 1 67  ? 104.116 6.832   13.965  1.00 40.73 ? 89  LYS A O   1 
ATOM   262  C CB  . LYS A 1 67  ? 107.153 6.639   14.481  1.00 29.92 ? 89  LYS A CB  1 
ATOM   263  C CG  . LYS A 1 67  ? 108.095 5.507   14.086  1.00 39.68 ? 89  LYS A CG  1 
ATOM   264  C CD  . LYS A 1 67  ? 109.179 5.982   13.122  1.00 43.39 ? 89  LYS A CD  1 
ATOM   265  C CE  . LYS A 1 67  ? 109.829 4.811   12.391  1.00 52.04 ? 89  LYS A CE  1 
ATOM   266  N NZ  . LYS A 1 67  ? 109.023 4.328   11.227  1.00 46.28 ? 89  LYS A NZ  1 
ATOM   267  N N   . PRO A 1 68  ? 104.863 5.658   12.202  1.00 33.51 ? 90  PRO A N   1 
ATOM   268  C CA  . PRO A 1 68  ? 103.560 5.009   12.010  1.00 36.23 ? 90  PRO A CA  1 
ATOM   269  C C   . PRO A 1 68  ? 103.127 4.230   13.243  1.00 36.86 ? 90  PRO A C   1 
ATOM   270  O O   . PRO A 1 68  ? 103.935 3.581   13.908  1.00 44.98 ? 90  PRO A O   1 
ATOM   271  C CB  . PRO A 1 68  ? 103.802 4.079   10.816  1.00 40.46 ? 90  PRO A CB  1 
ATOM   272  C CG  . PRO A 1 68  ? 104.953 4.696   10.088  1.00 41.41 ? 90  PRO A CG  1 
ATOM   273  C CD  . PRO A 1 68  ? 105.824 5.295   11.149  1.00 39.16 ? 90  PRO A CD  1 
ATOM   274  N N   . SER A 1 69  ? 101.835 4.303   13.543  1.00 43.34 ? 91  SER A N   1 
ATOM   275  C CA  . SER A 1 69  ? 101.295 3.567   14.674  1.00 48.45 ? 91  SER A CA  1 
ATOM   276  C C   . SER A 1 69  ? 101.260 2.072   14.364  1.00 54.76 ? 91  SER A C   1 
ATOM   277  O O   . SER A 1 69  ? 101.009 1.681   13.218  1.00 52.55 ? 91  SER A O   1 
ATOM   278  C CB  . SER A 1 69  ? 99.889  4.058   15.015  1.00 43.93 ? 91  SER A CB  1 
ATOM   279  O OG  . SER A 1 69  ? 99.176  3.078   15.751  1.00 47.53 ? 91  SER A OG  1 
ATOM   280  N N   . PRO A 1 70  ? 101.501 1.215   15.359  1.00 55.24 ? 92  PRO A N   1 
ATOM   281  C CA  . PRO A 1 70  ? 101.422 -0.234  15.112  1.00 51.51 ? 92  PRO A CA  1 
ATOM   282  C C   . PRO A 1 70  ? 100.040 -0.698  14.706  1.00 53.78 ? 92  PRO A C   1 
ATOM   283  O O   . PRO A 1 70  ? 99.920  -1.741  14.051  1.00 53.05 ? 92  PRO A O   1 
ATOM   284  C CB  . PRO A 1 70  ? 101.844 -0.843  16.456  1.00 61.07 ? 92  PRO A CB  1 
ATOM   285  C CG  . PRO A 1 70  ? 101.559 0.227   17.464  1.00 62.15 ? 92  PRO A CG  1 
ATOM   286  C CD  . PRO A 1 70  ? 101.839 1.522   16.761  1.00 58.77 ? 92  PRO A CD  1 
ATOM   287  N N   . SER A 1 71  ? 98.995  0.042   15.067  1.00 58.09 ? 93  SER A N   1 
ATOM   288  C CA  . SER A 1 71  ? 97.638  -0.336  14.714  1.00 62.03 ? 93  SER A CA  1 
ATOM   289  C C   . SER A 1 71  ? 97.368  -0.057  13.237  1.00 61.25 ? 93  SER A C   1 
ATOM   290  O O   . SER A 1 71  ? 98.172  0.556   12.530  1.00 59.73 ? 93  SER A O   1 
ATOM   291  C CB  . SER A 1 71  ? 96.633  0.407   15.592  1.00 56.23 ? 93  SER A CB  1 
ATOM   292  O OG  . SER A 1 71  ? 96.701  -0.048  16.932  1.00 61.47 ? 93  SER A OG  1 
ATOM   293  N N   . GLN A 1 72  ? 96.206  -0.515  12.773  1.00 63.37 ? 94  GLN A N   1 
ATOM   294  C CA  . GLN A 1 72  ? 95.809  -0.385  11.376  1.00 62.40 ? 94  GLN A CA  1 
ATOM   295  C C   . GLN A 1 72  ? 94.709  0.653   11.179  1.00 59.39 ? 94  GLN A C   1 
ATOM   296  O O   . GLN A 1 72  ? 94.012  0.630   10.161  1.00 58.36 ? 94  GLN A O   1 
ATOM   297  C CB  . GLN A 1 72  ? 95.365  -1.742  10.829  1.00 62.93 ? 94  GLN A CB  1 
ATOM   298  C CG  . GLN A 1 72  ? 96.180  -2.911  11.358  1.00 74.04 ? 94  GLN A CG  1 
ATOM   299  C CD  . GLN A 1 72  ? 95.543  -3.571  12.571  1.00 82.59 ? 94  GLN A CD  1 
ATOM   300  O OE1 . GLN A 1 72  ? 94.371  -3.952  12.544  1.00 77.85 ? 94  GLN A OE1 1 
ATOM   301  N NE2 . GLN A 1 72  ? 96.317  -3.712  13.643  1.00 74.85 ? 94  GLN A NE2 1 
ATOM   302  N N   . PHE A 1 73  ? 94.532  1.558   12.139  1.00 56.82 ? 95  PHE A N   1 
ATOM   303  C CA  . PHE A 1 73  ? 93.572  2.645   11.993  1.00 51.18 ? 95  PHE A CA  1 
ATOM   304  C C   . PHE A 1 73  ? 94.287  3.981   12.140  1.00 46.79 ? 95  PHE A C   1 
ATOM   305  O O   . PHE A 1 73  ? 95.518  4.043   12.054  1.00 46.84 ? 95  PHE A O   1 
ATOM   306  C CB  . PHE A 1 73  ? 92.442  2.520   13.015  1.00 48.84 ? 95  PHE A CB  1 
ATOM   307  C CG  . PHE A 1 73  ? 92.917  2.286   14.429  1.00 56.53 ? 95  PHE A CG  1 
ATOM   308  C CD1 . PHE A 1 73  ? 93.558  3.290   15.143  1.00 55.82 ? 95  PHE A CD1 1 
ATOM   309  C CD2 . PHE A 1 73  ? 92.713  1.062   15.046  1.00 58.21 ? 95  PHE A CD2 1 
ATOM   310  C CE1 . PHE A 1 73  ? 93.993  3.073   16.434  1.00 57.76 ? 95  PHE A CE1 1 
ATOM   311  C CE2 . PHE A 1 73  ? 93.144  0.842   16.341  1.00 58.19 ? 95  PHE A CE2 1 
ATOM   312  C CZ  . PHE A 1 73  ? 93.785  1.849   17.035  1.00 59.24 ? 95  PHE A CZ  1 
ATOM   313  N N   . MET A 1 74  ? 93.537  5.051   12.367  1.00 39.55 ? 96  MET A N   1 
ATOM   314  C CA  . MET A 1 74  ? 94.149  6.330   12.696  1.00 34.06 ? 96  MET A CA  1 
ATOM   315  C C   . MET A 1 74  ? 93.933  6.611   14.173  1.00 38.44 ? 96  MET A C   1 
ATOM   316  O O   . MET A 1 74  ? 92.786  6.827   14.595  1.00 37.85 ? 96  MET A O   1 
ATOM   317  C CB  . MET A 1 74  ? 93.566  7.460   11.849  1.00 33.17 ? 96  MET A CB  1 
ATOM   318  C CG  . MET A 1 74  ? 94.047  8.832   12.272  1.00 34.03 ? 96  MET A CG  1 
ATOM   319  S SD  . MET A 1 74  ? 93.270  10.147  11.333  1.00 32.31 ? 96  MET A SD  1 
ATOM   320  C CE  . MET A 1 74  ? 91.575  9.557   11.294  1.00 24.62 ? 96  MET A CE  1 
ATOM   321  N N   . PRO A 1 75  ? 94.978  6.611   14.993  1.00 38.36 ? 97  PRO A N   1 
ATOM   322  C CA  . PRO A 1 75  ? 94.788  6.894   16.418  1.00 29.61 ? 97  PRO A CA  1 
ATOM   323  C C   . PRO A 1 75  ? 94.575  8.378   16.654  1.00 29.88 ? 97  PRO A C   1 
ATOM   324  O O   . PRO A 1 75  ? 95.531  9.160   16.648  1.00 38.87 ? 97  PRO A O   1 
ATOM   325  C CB  . PRO A 1 75  ? 96.090  6.399   17.062  1.00 35.27 ? 97  PRO A CB  1 
ATOM   326  C CG  . PRO A 1 75  ? 96.955  5.879   15.933  1.00 32.03 ? 97  PRO A CG  1 
ATOM   327  C CD  . PRO A 1 75  ? 96.394  6.411   14.658  1.00 37.90 ? 97  PRO A CD  1 
ATOM   328  N N   . LEU A 1 76  ? 93.322  8.774   16.858  1.00 23.57 ? 98  LEU A N   1 
ATOM   329  C CA  . LEU A 1 76  ? 92.962  10.168  17.078  1.00 20.02 ? 98  LEU A CA  1 
ATOM   330  C C   . LEU A 1 76  ? 92.143  10.252  18.354  1.00 16.44 ? 98  LEU A C   1 
ATOM   331  O O   . LEU A 1 76  ? 91.086  9.621   18.452  1.00 18.31 ? 98  LEU A O   1 
ATOM   332  C CB  . LEU A 1 76  ? 92.175  10.729  15.888  1.00 21.23 ? 98  LEU A CB  1 
ATOM   333  C CG  . LEU A 1 76  ? 91.701  12.180  15.983  1.00 17.24 ? 98  LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 76  ? 92.878  13.123  15.836  1.00 17.81 ? 98  LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 76  ? 90.639  12.466  14.936  1.00 15.84 ? 98  LEU A CD2 1 
ATOM   336  N N   . VAL A 1 77  ? 92.630  11.017  19.332  1.00 15.68 ? 99  VAL A N   1 
ATOM   337  C CA  . VAL A 1 77  ? 91.902  11.245  20.574  1.00 19.70 ? 99  VAL A CA  1 
ATOM   338  C C   . VAL A 1 77  ? 91.847  12.743  20.844  1.00 20.39 ? 99  VAL A C   1 
ATOM   339  O O   . VAL A 1 77  ? 92.811  13.474  20.578  1.00 18.90 ? 99  VAL A O   1 
ATOM   340  C CB  . VAL A 1 77  ? 92.527  10.487  21.773  1.00 17.89 ? 99  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 77  ? 92.656  9.001   21.462  1.00 20.84 ? 99  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 77  ? 93.874  11.075  22.167  1.00 24.14 ? 99  VAL A CG2 1 
ATOM   343  N N   . VAL A 1 78  ? 90.702  13.199  21.351  1.00 14.89 ? 100 VAL A N   1 
ATOM   344  C CA  . VAL A 1 78  ? 90.463  14.599  21.688  1.00 18.11 ? 100 VAL A CA  1 
ATOM   345  C C   . VAL A 1 78  ? 90.175  14.672  23.184  1.00 22.70 ? 100 VAL A C   1 
ATOM   346  O O   . VAL A 1 78  ? 89.240  14.025  23.676  1.00 26.05 ? 100 VAL A O   1 
ATOM   347  C CB  . VAL A 1 78  ? 89.297  15.193  20.877  1.00 20.14 ? 100 VAL A CB  1 
ATOM   348  C CG1 . VAL A 1 78  ? 88.801  16.493  21.502  1.00 18.60 ? 100 VAL A CG1 1 
ATOM   349  C CG2 . VAL A 1 78  ? 89.716  15.419  19.436  1.00 18.34 ? 100 VAL A CG2 1 
ATOM   350  N N   . ASP A 1 79  ? 90.975  15.454  23.905  1.00 22.61 ? 101 ASP A N   1 
ATOM   351  C CA  . ASP A 1 79  ? 90.844  15.615  25.350  1.00 25.53 ? 101 ASP A CA  1 
ATOM   352  C C   . ASP A 1 79  ? 90.350  17.029  25.631  1.00 27.26 ? 101 ASP A C   1 
ATOM   353  O O   . ASP A 1 79  ? 91.065  18.003  25.369  1.00 33.93 ? 101 ASP A O   1 
ATOM   354  C CB  . ASP A 1 79  ? 92.180  15.345  26.041  1.00 29.93 ? 101 ASP A CB  1 
ATOM   355  C CG  . ASP A 1 79  ? 92.015  14.730  27.413  1.00 36.94 ? 101 ASP A CG  1 
ATOM   356  O OD1 . ASP A 1 79  ? 90.866  14.586  27.880  1.00 45.41 ? 101 ASP A OD1 1 
ATOM   357  O OD2 . ASP A 1 79  ? 93.045  14.389  28.033  1.00 44.57 ? 101 ASP A OD2 1 
ATOM   358  N N   . TYR A 1 80  ? 89.137  17.145  26.166  1.00 27.60 ? 102 TYR A N   1 
ATOM   359  C CA  . TYR A 1 80  ? 88.511  18.439  26.420  1.00 38.31 ? 102 TYR A CA  1 
ATOM   360  C C   . TYR A 1 80  ? 88.419  18.700  27.922  1.00 38.83 ? 102 TYR A C   1 
ATOM   361  O O   . TYR A 1 80  ? 87.983  17.830  28.684  1.00 36.96 ? 102 TYR A O   1 
ATOM   362  C CB  . TYR A 1 80  ? 87.123  18.505  25.776  1.00 28.32 ? 102 TYR A CB  1 
ATOM   363  C CG  . TYR A 1 80  ? 86.367  19.777  26.083  1.00 28.18 ? 102 TYR A CG  1 
ATOM   364  C CD1 . TYR A 1 80  ? 86.656  20.963  25.421  1.00 28.96 ? 102 TYR A CD1 1 
ATOM   365  C CD2 . TYR A 1 80  ? 85.360  19.791  27.041  1.00 31.07 ? 102 TYR A CD2 1 
ATOM   366  C CE1 . TYR A 1 80  ? 85.962  22.127  25.707  1.00 26.15 ? 102 TYR A CE1 1 
ATOM   367  C CE2 . TYR A 1 80  ? 84.663  20.944  27.330  1.00 25.78 ? 102 TYR A CE2 1 
ATOM   368  C CZ  . TYR A 1 80  ? 84.967  22.108  26.663  1.00 28.36 ? 102 TYR A CZ  1 
ATOM   369  O OH  . TYR A 1 80  ? 84.270  23.258  26.959  1.00 33.68 ? 102 TYR A OH  1 
ATOM   370  N N   . ARG A 1 81  ? 88.815  19.906  28.332  1.00 41.11 ? 103 ARG A N   1 
ATOM   371  C CA  . ARG A 1 81  ? 88.896  20.307  29.733  1.00 42.79 ? 103 ARG A CA  1 
ATOM   372  C C   . ARG A 1 81  ? 87.625  21.019  30.183  1.00 52.68 ? 103 ARG A C   1 
ATOM   373  O O   . ARG A 1 81  ? 87.037  21.800  29.430  1.00 55.63 ? 103 ARG A O   1 
ATOM   374  C CB  . ARG A 1 81  ? 90.097  21.232  29.954  1.00 44.48 ? 103 ARG A CB  1 
ATOM   375  C CG  . ARG A 1 81  ? 91.316  20.561  30.577  1.00 52.23 ? 103 ARG A CG  1 
ATOM   376  C CD  . ARG A 1 81  ? 91.585  19.201  29.953  1.00 46.94 ? 103 ARG A CD  1 
ATOM   377  N NE  . ARG A 1 81  ? 92.570  18.442  30.716  1.00 44.09 ? 103 ARG A NE  1 
ATOM   378  C CZ  . ARG A 1 81  ? 93.211  17.379  30.247  1.00 47.80 ? 103 ARG A CZ  1 
ATOM   379  N NH1 . ARG A 1 81  ? 92.960  16.957  29.017  1.00 52.21 ? 103 ARG A NH1 1 
ATOM   380  N NH2 . ARG A 1 81  ? 94.094  16.736  31.001  1.00 42.41 ? 103 ARG A NH2 1 
ATOM   381  N N   . GLN A 1 82  ? 87.217  20.766  31.425  1.00 55.44 ? 104 GLN A N   1 
ATOM   382  C CA  . GLN A 1 82  ? 86.078  21.466  32.018  1.00 60.64 ? 104 GLN A CA  1 
ATOM   383  C C   . GLN A 1 82  ? 86.367  21.868  33.465  1.00 58.79 ? 104 GLN A C   1 
ATOM   384  O O   . GLN A 1 82  ? 87.393  22.481  33.761  1.00 48.15 ? 104 GLN A O   1 
ATOM   385  C CB  . GLN A 1 82  ? 84.820  20.596  31.961  1.00 59.59 ? 104 GLN A CB  1 
ATOM   386  C CG  . GLN A 1 82  ? 83.724  21.010  32.942  1.00 68.94 ? 104 GLN A CG  1 
ATOM   387  C CD  . GLN A 1 82  ? 82.570  20.018  32.993  1.00 78.67 ? 104 GLN A CD  1 
ATOM   388  O OE1 . GLN A 1 82  ? 82.623  18.953  32.377  1.00 72.25 ? 104 GLN A OE1 1 
ATOM   389  N NE2 . GLN A 1 82  ? 81.518  20.366  33.732  1.00 81.24 ? 104 GLN A NE2 1 
ATOM   390  N N   . SER A 1 102 ? 83.241  13.492  33.721  1.00 55.64 ? 124 SER A N   1 
ATOM   391  C CA  . SER A 1 102 ? 82.056  14.291  33.422  1.00 58.84 ? 124 SER A CA  1 
ATOM   392  C C   . SER A 1 102 ? 81.410  13.858  32.110  1.00 56.87 ? 124 SER A C   1 
ATOM   393  O O   . SER A 1 102 ? 82.095  13.444  31.175  1.00 54.21 ? 124 SER A O   1 
ATOM   394  C CB  . SER A 1 102 ? 82.410  15.778  33.359  1.00 50.27 ? 124 SER A CB  1 
ATOM   395  O OG  . SER A 1 102 ? 81.296  16.543  32.932  1.00 51.72 ? 124 SER A OG  1 
ATOM   396  N N   . ASP A 1 103 ? 80.081  13.961  32.042  1.00 53.45 ? 125 ASP A N   1 
ATOM   397  C CA  . ASP A 1 103 ? 79.384  13.589  30.817  1.00 46.67 ? 125 ASP A CA  1 
ATOM   398  C C   . ASP A 1 103 ? 79.611  14.621  29.719  1.00 46.53 ? 125 ASP A C   1 
ATOM   399  O O   . ASP A 1 103 ? 79.802  14.260  28.552  1.00 38.00 ? 125 ASP A O   1 
ATOM   400  C CB  . ASP A 1 103 ? 77.891  13.413  31.093  1.00 45.16 ? 125 ASP A CB  1 
ATOM   401  C CG  . ASP A 1 103 ? 77.566  12.067  31.715  1.00 52.46 ? 125 ASP A CG  1 
ATOM   402  O OD1 . ASP A 1 103 ? 78.499  11.258  31.915  1.00 48.59 ? 125 ASP A OD1 1 
ATOM   403  O OD2 . ASP A 1 103 ? 76.377  11.815  32.004  1.00 58.20 ? 125 ASP A OD2 1 
ATOM   404  N N   . LYS A 1 104 ? 79.606  15.909  30.076  1.00 46.45 ? 126 LYS A N   1 
ATOM   405  C CA  . LYS A 1 104 ? 79.768  16.954  29.069  1.00 45.03 ? 126 LYS A CA  1 
ATOM   406  C C   . LYS A 1 104 ? 81.148  16.911  28.424  1.00 44.76 ? 126 LYS A C   1 
ATOM   407  O O   . LYS A 1 104 ? 81.288  17.244  27.241  1.00 42.24 ? 126 LYS A O   1 
ATOM   408  C CB  . LYS A 1 104 ? 79.514  18.332  29.684  1.00 46.51 ? 126 LYS A CB  1 
ATOM   409  C CG  . LYS A 1 104 ? 78.916  19.334  28.701  1.00 43.94 ? 126 LYS A CG  1 
ATOM   410  C CD  . LYS A 1 104 ? 79.441  20.739  28.938  1.00 44.66 ? 126 LYS A CD  1 
ATOM   411  C CE  . LYS A 1 104 ? 78.799  21.733  27.982  1.00 45.70 ? 126 LYS A CE  1 
ATOM   412  N NZ  . LYS A 1 104 ? 77.364  21.988  28.304  1.00 45.77 ? 126 LYS A NZ  1 
ATOM   413  N N   . GLU A 1 105 ? 82.177  16.515  29.175  1.00 44.62 ? 127 GLU A N   1 
ATOM   414  C CA  . GLU A 1 105 ? 83.500  16.384  28.577  1.00 36.80 ? 127 GLU A CA  1 
ATOM   415  C C   . GLU A 1 105 ? 83.534  15.261  27.551  1.00 34.95 ? 127 GLU A C   1 
ATOM   416  O O   . GLU A 1 105 ? 84.226  15.375  26.534  1.00 35.47 ? 127 GLU A O   1 
ATOM   417  C CB  . GLU A 1 105 ? 84.549  16.150  29.664  1.00 44.17 ? 127 GLU A CB  1 
ATOM   418  C CG  . GLU A 1 105 ? 84.887  17.405  30.451  1.00 55.75 ? 127 GLU A CG  1 
ATOM   419  C CD  . GLU A 1 105 ? 85.830  17.149  31.615  1.00 58.52 ? 127 GLU A CD  1 
ATOM   420  O OE1 . GLU A 1 105 ? 85.550  16.244  32.430  1.00 54.19 ? 127 GLU A OE1 1 
ATOM   421  O OE2 . GLU A 1 105 ? 86.850  17.864  31.716  1.00 60.15 ? 127 GLU A OE2 1 
ATOM   422  N N   . ILE A 1 106 ? 82.790  14.180  27.794  1.00 34.97 ? 128 ILE A N   1 
ATOM   423  C CA  . ILE A 1 106 ? 82.727  13.085  26.830  1.00 32.15 ? 128 ILE A CA  1 
ATOM   424  C C   . ILE A 1 106 ? 81.979  13.525  25.579  1.00 27.53 ? 128 ILE A C   1 
ATOM   425  O O   . ILE A 1 106 ? 82.433  13.297  24.452  1.00 23.90 ? 128 ILE A O   1 
ATOM   426  C CB  . ILE A 1 106 ? 82.076  11.846  27.472  1.00 35.46 ? 128 ILE A CB  1 
ATOM   427  C CG1 . ILE A 1 106 ? 82.864  11.405  28.708  1.00 34.46 ? 128 ILE A CG1 1 
ATOM   428  C CG2 . ILE A 1 106 ? 81.973  10.712  26.469  1.00 31.21 ? 128 ILE A CG2 1 
ATOM   429  C CD1 . ILE A 1 106 ? 84.329  11.128  28.440  1.00 29.45 ? 128 ILE A CD1 1 
ATOM   430  N N   . LEU A 1 107 ? 80.825  14.170  25.764  1.00 32.92 ? 129 LEU A N   1 
ATOM   431  C CA  . LEU A 1 107 ? 80.022  14.627  24.634  1.00 29.27 ? 129 LEU A CA  1 
ATOM   432  C C   . LEU A 1 107 ? 80.769  15.671  23.812  1.00 29.56 ? 129 LEU A C   1 
ATOM   433  O O   . LEU A 1 107 ? 80.822  15.587  22.579  1.00 31.76 ? 129 LEU A O   1 
ATOM   434  C CB  . LEU A 1 107 ? 78.694  15.190  25.139  1.00 34.56 ? 129 LEU A CB  1 
ATOM   435  C CG  . LEU A 1 107 ? 77.814  14.255  25.977  1.00 42.78 ? 129 LEU A CG  1 
ATOM   436  C CD1 . LEU A 1 107 ? 76.442  14.874  26.227  1.00 49.98 ? 129 LEU A CD1 1 
ATOM   437  C CD2 . LEU A 1 107 ? 77.675  12.888  25.313  1.00 29.89 ? 129 LEU A CD2 1 
ATOM   438  N N   . THR A 1 108 ? 81.352  16.670  24.483  1.00 25.64 ? 130 THR A N   1 
ATOM   439  C CA  . THR A 1 108 ? 82.105  17.699  23.774  1.00 20.97 ? 130 THR A CA  1 
ATOM   440  C C   . THR A 1 108 ? 83.287  17.102  23.023  1.00 23.94 ? 130 THR A C   1 
ATOM   441  O O   . THR A 1 108 ? 83.552  17.473  21.874  1.00 26.28 ? 130 THR A O   1 
ATOM   442  C CB  . THR A 1 108 ? 82.589  18.774  24.747  1.00 23.11 ? 130 THR A CB  1 
ATOM   443  O OG1 . THR A 1 108 ? 81.482  19.271  25.510  1.00 26.78 ? 130 THR A OG1 1 
ATOM   444  C CG2 . THR A 1 108 ? 83.237  19.923  23.989  1.00 19.86 ? 130 THR A CG2 1 
ATOM   445  N N   . SER A 1 109 ? 84.009  16.172  23.653  1.00 25.70 ? 131 SER A N   1 
ATOM   446  C CA  . SER A 1 109 ? 85.166  15.576  22.992  1.00 27.39 ? 131 SER A CA  1 
ATOM   447  C C   . SER A 1 109 ? 84.754  14.836  21.727  1.00 26.93 ? 131 SER A C   1 
ATOM   448  O O   . SER A 1 109 ? 85.448  14.900  20.705  1.00 21.93 ? 131 SER A O   1 
ATOM   449  C CB  . SER A 1 109 ? 85.895  14.641  23.952  1.00 23.41 ? 131 SER A CB  1 
ATOM   450  O OG  . SER A 1 109 ? 86.350  15.359  25.085  1.00 34.52 ? 131 SER A OG  1 
ATOM   451  N N   . ARG A 1 110 ? 83.617  14.141  21.771  1.00 25.58 ? 132 ARG A N   1 
ATOM   452  C CA  . ARG A 1 110 ? 83.148  13.439  20.584  1.00 23.07 ? 132 ARG A CA  1 
ATOM   453  C C   . ARG A 1 110 ? 82.729  14.419  19.496  1.00 28.00 ? 132 ARG A C   1 
ATOM   454  O O   . ARG A 1 110 ? 83.051  14.218  18.320  1.00 25.10 ? 132 ARG A O   1 
ATOM   455  C CB  . ARG A 1 110 ? 81.995  12.503  20.943  1.00 27.40 ? 132 ARG A CB  1 
ATOM   456  C CG  . ARG A 1 110 ? 81.681  11.480  19.860  1.00 38.22 ? 132 ARG A CG  1 
ATOM   457  C CD  . ARG A 1 110 ? 80.259  10.954  19.979  1.00 49.76 ? 132 ARG A CD  1 
ATOM   458  N NE  . ARG A 1 110 ? 79.263  11.977  19.666  1.00 53.80 ? 132 ARG A NE  1 
ATOM   459  C CZ  . ARG A 1 110 ? 78.239  12.290  20.456  1.00 61.71 ? 132 ARG A CZ  1 
ATOM   460  N NH1 . ARG A 1 110 ? 78.070  11.659  21.613  1.00 52.19 ? 132 ARG A NH1 1 
ATOM   461  N NH2 . ARG A 1 110 ? 77.382  13.235  20.089  1.00 56.46 ? 132 ARG A NH2 1 
ATOM   462  N N   . ILE A 1 111 ? 82.021  15.492  19.866  1.00 24.99 ? 133 ILE A N   1 
ATOM   463  C CA  . ILE A 1 111 ? 81.582  16.471  18.872  1.00 24.00 ? 133 ILE A CA  1 
ATOM   464  C C   . ILE A 1 111 ? 82.785  17.107  18.181  1.00 24.12 ? 133 ILE A C   1 
ATOM   465  O O   . ILE A 1 111 ? 82.767  17.354  16.967  1.00 16.55 ? 133 ILE A O   1 
ATOM   466  C CB  . ILE A 1 111 ? 80.676  17.532  19.525  1.00 22.80 ? 133 ILE A CB  1 
ATOM   467  C CG1 . ILE A 1 111 ? 79.348  16.909  19.950  1.00 31.55 ? 133 ILE A CG1 1 
ATOM   468  C CG2 . ILE A 1 111 ? 80.414  18.678  18.566  1.00 21.03 ? 133 ILE A CG2 1 
ATOM   469  C CD1 . ILE A 1 111 ? 78.309  17.927  20.382  1.00 28.83 ? 133 ILE A CD1 1 
ATOM   470  N N   . ILE A 1 112 ? 83.850  17.377  18.940  1.00 21.52 ? 134 ILE A N   1 
ATOM   471  C CA  . ILE A 1 112 ? 85.085  17.860  18.331  1.00 14.70 ? 134 ILE A CA  1 
ATOM   472  C C   . ILE A 1 112 ? 85.662  16.798  17.408  1.00 18.90 ? 134 ILE A C   1 
ATOM   473  O O   . ILE A 1 112 ? 86.199  17.109  16.338  1.00 22.82 ? 134 ILE A O   1 
ATOM   474  C CB  . ILE A 1 112 ? 86.096  18.274  19.417  1.00 20.06 ? 134 ILE A CB  1 
ATOM   475  C CG1 . ILE A 1 112 ? 85.505  19.364  20.320  1.00 19.76 ? 134 ILE A CG1 1 
ATOM   476  C CG2 . ILE A 1 112 ? 87.408  18.735  18.781  1.00 13.40 ? 134 ILE A CG2 1 
ATOM   477  C CD1 . ILE A 1 112 ? 86.446  19.867  21.384  1.00 10.87 ? 134 ILE A CD1 1 
ATOM   478  N N   . ASP A 1 113 ? 85.549  15.526  17.803  1.00 18.30 ? 135 ASP A N   1 
ATOM   479  C CA  . ASP A 1 113 ? 86.127  14.443  17.014  1.00 17.35 ? 135 ASP A CA  1 
ATOM   480  C C   . ASP A 1 113 ? 85.444  14.321  15.657  1.00 20.95 ? 135 ASP A C   1 
ATOM   481  O O   . ASP A 1 113 ? 86.117  14.243  14.621  1.00 18.08 ? 135 ASP A O   1 
ATOM   482  C CB  . ASP A 1 113 ? 86.037  13.124  17.782  1.00 17.25 ? 135 ASP A CB  1 
ATOM   483  C CG  . ASP A 1 113 ? 86.775  11.992  17.089  1.00 18.29 ? 135 ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 113 ? 86.312  11.535  16.019  1.00 23.51 ? 135 ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 113 ? 87.821  11.556  17.615  1.00 19.86 ? 135 ASP A OD2 1 
ATOM   486  N N   . ARG A 1 114 ? 84.106  14.299  15.642  1.00 17.46 ? 136 ARG A N   1 
ATOM   487  C CA  . ARG A 1 114 ? 83.386  14.200  14.376  1.00 17.21 ? 136 ARG A CA  1 
ATOM   488  C C   . ARG A 1 114 ? 83.624  15.411  13.484  1.00 15.53 ? 136 ARG A C   1 
ATOM   489  O O   . ARG A 1 114 ? 83.470  15.304  12.263  1.00 18.72 ? 136 ARG A O   1 
ATOM   490  C CB  . ARG A 1 114 ? 81.884  14.023  14.613  1.00 16.42 ? 136 ARG A CB  1 
ATOM   491  C CG  . ARG A 1 114 ? 81.520  13.289  15.885  1.00 16.87 ? 136 ARG A CG  1 
ATOM   492  C CD  . ARG A 1 114 ? 80.237  12.487  15.736  1.00 21.93 ? 136 ARG A CD  1 
ATOM   493  N NE  . ARG A 1 114 ? 79.097  13.308  15.319  1.00 30.42 ? 136 ARG A NE  1 
ATOM   494  C CZ  . ARG A 1 114 ? 78.299  13.989  16.141  1.00 37.24 ? 136 ARG A CZ  1 
ATOM   495  N NH1 . ARG A 1 114 ? 78.498  13.970  17.456  1.00 43.51 ? 136 ARG A NH1 1 
ATOM   496  N NH2 . ARG A 1 114 ? 77.296  14.698  15.643  1.00 27.51 ? 136 ARG A NH2 1 
ATOM   497  N N   . SER A 1 115 ? 84.010  16.552  14.061  1.00 14.50 ? 137 SER A N   1 
ATOM   498  C CA  . SER A 1 115 ? 84.235  17.760  13.276  1.00 15.16 ? 137 SER A CA  1 
ATOM   499  C C   . SER A 1 115 ? 85.601  17.795  12.601  1.00 16.93 ? 137 SER A C   1 
ATOM   500  O O   . SER A 1 115 ? 85.786  18.580  11.665  1.00 17.41 ? 137 SER A O   1 
ATOM   501  C CB  . SER A 1 115 ? 84.077  18.999  14.159  1.00 13.64 ? 137 SER A CB  1 
ATOM   502  O OG  . SER A 1 115 ? 82.855  18.964  14.874  1.00 15.61 ? 137 SER A OG  1 
ATOM   503  N N   . ILE A 1 116 ? 86.558  16.984  13.050  1.00 17.04 ? 138 ILE A N   1 
ATOM   504  C CA  . ILE A 1 116 ? 87.898  16.995  12.476  1.00 13.35 ? 138 ILE A CA  1 
ATOM   505  C C   . ILE A 1 116 ? 88.325  15.645  11.924  1.00 14.60 ? 138 ILE A C   1 
ATOM   506  O O   . ILE A 1 116 ? 89.240  15.602  11.086  1.00 16.31 ? 138 ILE A O   1 
ATOM   507  C CB  . ILE A 1 116 ? 88.939  17.491  13.500  1.00 13.06 ? 138 ILE A CB  1 
ATOM   508  C CG1 . ILE A 1 116 ? 89.046  16.503  14.665  1.00 16.97 ? 138 ILE A CG1 1 
ATOM   509  C CG2 . ILE A 1 116 ? 88.584  18.881  13.987  1.00 17.09 ? 138 ILE A CG2 1 
ATOM   510  C CD1 . ILE A 1 116 ? 90.248  16.736  15.558  1.00 11.76 ? 138 ILE A CD1 1 
ATOM   511  N N   . ARG A 1 117 ? 87.714  14.543  12.356  1.00 15.88 ? 139 ARG A N   1 
ATOM   512  C CA  . ARG A 1 117 ? 88.124  13.228  11.868  1.00 14.65 ? 139 ARG A CA  1 
ATOM   513  C C   . ARG A 1 117 ? 87.959  13.035  10.363  1.00 18.00 ? 139 ARG A C   1 
ATOM   514  O O   . ARG A 1 117 ? 88.873  12.458  9.748   1.00 23.83 ? 139 ARG A O   1 
ATOM   515  C CB  . ARG A 1 117 ? 87.361  12.135  12.624  1.00 14.05 ? 139 ARG A CB  1 
ATOM   516  C CG  . ARG A 1 117 ? 87.791  10.728  12.273  1.00 11.53 ? 139 ARG A CG  1 
ATOM   517  C CD  . ARG A 1 117 ? 87.161  9.722   13.219  1.00 14.83 ? 139 ARG A CD  1 
ATOM   518  N NE  . ARG A 1 117 ? 87.666  9.866   14.579  1.00 13.43 ? 139 ARG A NE  1 
ATOM   519  C CZ  . ARG A 1 117 ? 88.684  9.167   15.072  1.00 18.62 ? 139 ARG A CZ  1 
ATOM   520  N NH1 . ARG A 1 117 ? 89.304  8.270   14.315  1.00 21.93 ? 139 ARG A NH1 1 
ATOM   521  N NH2 . ARG A 1 117 ? 89.086  9.362   16.321  1.00 15.23 ? 139 ARG A NH2 1 
ATOM   522  N N   . PRO A 1 118 ? 86.864  13.457  9.714   1.00 17.38 ? 140 PRO A N   1 
ATOM   523  C CA  . PRO A 1 118 ? 86.693  13.129  8.288   1.00 15.21 ? 140 PRO A CA  1 
ATOM   524  C C   . PRO A 1 118 ? 87.673  13.824  7.360   1.00 20.64 ? 140 PRO A C   1 
ATOM   525  O O   . PRO A 1 118 ? 87.695  13.487  6.168   1.00 23.65 ? 140 PRO A O   1 
ATOM   526  C CB  . PRO A 1 118 ? 85.257  13.579  7.989   1.00 15.78 ? 140 PRO A CB  1 
ATOM   527  C CG  . PRO A 1 118 ? 84.590  13.671  9.314   1.00 19.01 ? 140 PRO A CG  1 
ATOM   528  C CD  . PRO A 1 118 ? 85.659  14.112  10.254  1.00 17.57 ? 140 PRO A CD  1 
ATOM   529  N N   . LEU A 1 119 ? 88.480  14.766  7.845   1.00 17.26 ? 141 LEU A N   1 
ATOM   530  C CA  . LEU A 1 119 ? 89.331  15.554  6.965   1.00 17.84 ? 141 LEU A CA  1 
ATOM   531  C C   . LEU A 1 119 ? 90.796  15.139  6.996   1.00 22.17 ? 141 LEU A C   1 
ATOM   532  O O   . LEU A 1 119 ? 91.603  15.718  6.259   1.00 22.62 ? 141 LEU A O   1 
ATOM   533  C CB  . LEU A 1 119 ? 89.206  17.040  7.301   1.00 18.27 ? 141 LEU A CB  1 
ATOM   534  C CG  . LEU A 1 119 ? 87.806  17.595  7.567   1.00 17.88 ? 141 LEU A CG  1 
ATOM   535  C CD1 . LEU A 1 119 ? 87.895  19.088  7.623   1.00 19.98 ? 141 LEU A CD1 1 
ATOM   536  C CD2 . LEU A 1 119 ? 86.813  17.186  6.496   1.00 23.90 ? 141 LEU A CD2 1 
ATOM   537  N N   . PHE A 1 120 ? 91.164  14.166  7.818   1.00 23.43 ? 142 PHE A N   1 
ATOM   538  C CA  . PHE A 1 120 ? 92.494  13.589  7.702   1.00 22.35 ? 142 PHE A CA  1 
ATOM   539  C C   . PHE A 1 120 ? 92.566  12.748  6.430   1.00 22.13 ? 142 PHE A C   1 
ATOM   540  O O   . PHE A 1 120 ? 91.596  12.065  6.082   1.00 21.82 ? 142 PHE A O   1 
ATOM   541  C CB  . PHE A 1 120 ? 92.822  12.721  8.916   1.00 24.67 ? 142 PHE A CB  1 
ATOM   542  C CG  . PHE A 1 120 ? 93.056  13.501  10.178  1.00 22.21 ? 142 PHE A CG  1 
ATOM   543  C CD1 . PHE A 1 120 ? 94.274  14.115  10.413  1.00 18.88 ? 142 PHE A CD1 1 
ATOM   544  C CD2 . PHE A 1 120 ? 92.058  13.613  11.132  1.00 20.29 ? 142 PHE A CD2 1 
ATOM   545  C CE1 . PHE A 1 120 ? 94.493  14.832  11.572  1.00 19.33 ? 142 PHE A CE1 1 
ATOM   546  C CE2 . PHE A 1 120 ? 92.268  14.330  12.294  1.00 22.22 ? 142 PHE A CE2 1 
ATOM   547  C CZ  . PHE A 1 120 ? 93.490  14.943  12.514  1.00 21.25 ? 142 PHE A CZ  1 
ATOM   548  N N   . PRO A 1 121 ? 93.682  12.789  5.705   1.00 22.80 ? 143 PRO A N   1 
ATOM   549  C CA  . PRO A 1 121 ? 93.821  11.915  4.537   1.00 26.35 ? 143 PRO A CA  1 
ATOM   550  C C   . PRO A 1 121 ? 93.706  10.453  4.935   1.00 24.31 ? 143 PRO A C   1 
ATOM   551  O O   . PRO A 1 121 ? 94.044  10.060  6.054   1.00 26.48 ? 143 PRO A O   1 
ATOM   552  C CB  . PRO A 1 121 ? 95.220  12.248  4.000   1.00 23.67 ? 143 PRO A CB  1 
ATOM   553  C CG  . PRO A 1 121 ? 95.908  12.980  5.106   1.00 25.37 ? 143 PRO A CG  1 
ATOM   554  C CD  . PRO A 1 121 ? 94.831  13.693  5.856   1.00 28.68 ? 143 PRO A CD  1 
ATOM   555  N N   . ALA A 1 122 ? 93.191  9.649   4.010   1.00 26.96 ? 144 ALA A N   1 
ATOM   556  C CA  . ALA A 1 122 ? 93.083  8.219   4.253   1.00 30.55 ? 144 ALA A CA  1 
ATOM   557  C C   . ALA A 1 122 ? 94.468  7.609   4.426   1.00 28.90 ? 144 ALA A C   1 
ATOM   558  O O   . ALA A 1 122 ? 95.452  8.068   3.839   1.00 33.25 ? 144 ALA A O   1 
ATOM   559  C CB  . ALA A 1 122 ? 92.342  7.532   3.105   1.00 26.71 ? 144 ALA A CB  1 
ATOM   560  N N   . GLY A 1 123 ? 94.542  6.569   5.251   1.00 23.58 ? 145 GLY A N   1 
ATOM   561  C CA  . GLY A 1 123 ? 95.816  5.931   5.500   1.00 31.69 ? 145 GLY A CA  1 
ATOM   562  C C   . GLY A 1 123 ? 96.769  6.719   6.369   1.00 35.36 ? 145 GLY A C   1 
ATOM   563  O O   . GLY A 1 123 ? 97.968  6.427   6.376   1.00 36.15 ? 145 GLY A O   1 
ATOM   564  N N   . TYR A 1 124 ? 96.276  7.715   7.107   1.00 29.31 ? 146 TYR A N   1 
ATOM   565  C CA  . TYR A 1 124 ? 97.124  8.502   8.004   1.00 32.00 ? 146 TYR A CA  1 
ATOM   566  C C   . TYR A 1 124 ? 97.165  7.827   9.377   1.00 36.16 ? 146 TYR A C   1 
ATOM   567  O O   . TYR A 1 124 ? 96.595  8.294   10.365  1.00 32.93 ? 146 TYR A O   1 
ATOM   568  C CB  . TYR A 1 124 ? 96.626  9.941   8.091   1.00 25.86 ? 146 TYR A CB  1 
ATOM   569  C CG  . TYR A 1 124 ? 97.566  10.866  8.832   1.00 25.27 ? 146 TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 124 ? 98.734  11.329  8.236   1.00 28.67 ? 146 TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 124 ? 97.289  11.273  10.133  1.00 29.76 ? 146 TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 124 ? 99.602  12.170  8.916   1.00 28.84 ? 146 TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 124 ? 98.148  12.115  10.821  1.00 23.87 ? 146 TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 124 ? 99.301  12.558  10.209  1.00 26.82 ? 146 TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 124 ? 100.153 13.394  10.892  1.00 30.18 ? 146 TYR A OH  1 
ATOM   576  N N   . PHE A 1 125 ? 97.872  6.697   9.419   1.00 37.22 ? 147 PHE A N   1 
ATOM   577  C CA  . PHE A 1 125 ? 97.929  5.864   10.623  1.00 40.04 ? 147 PHE A CA  1 
ATOM   578  C C   . PHE A 1 125 ? 99.044  6.374   11.539  1.00 36.16 ? 147 PHE A C   1 
ATOM   579  O O   . PHE A 1 125 ? 100.073 5.731   11.747  1.00 37.40 ? 147 PHE A O   1 
ATOM   580  C CB  . PHE A 1 125 ? 98.137  4.398   10.255  1.00 33.77 ? 147 PHE A CB  1 
ATOM   581  C CG  . PHE A 1 125 ? 97.061  3.818   9.368   1.00 41.35 ? 147 PHE A CG  1 
ATOM   582  C CD1 . PHE A 1 125 ? 95.894  4.515   9.094   1.00 42.11 ? 147 PHE A CD1 1 
ATOM   583  C CD2 . PHE A 1 125 ? 97.224  2.562   8.808   1.00 48.89 ? 147 PHE A CD2 1 
ATOM   584  C CE1 . PHE A 1 125 ? 94.917  3.972   8.277   1.00 38.98 ? 147 PHE A CE1 1 
ATOM   585  C CE2 . PHE A 1 125 ? 96.249  2.016   7.991   1.00 44.33 ? 147 PHE A CE2 1 
ATOM   586  C CZ  . PHE A 1 125 ? 95.096  2.723   7.725   1.00 34.73 ? 147 PHE A CZ  1 
ATOM   587  N N   . TYR A 1 126 ? 98.816  7.563   12.097  1.00 36.88 ? 148 TYR A N   1 
ATOM   588  C CA  . TYR A 1 126 ? 99.790  8.220   12.962  1.00 31.52 ? 148 TYR A CA  1 
ATOM   589  C C   . TYR A 1 126 ? 99.096  8.776   14.197  1.00 29.66 ? 148 TYR A C   1 
ATOM   590  O O   . TYR A 1 126 ? 98.113  9.515   14.079  1.00 31.23 ? 148 TYR A O   1 
ATOM   591  C CB  . TYR A 1 126 ? 100.517 9.343   12.222  1.00 30.38 ? 148 TYR A CB  1 
ATOM   592  C CG  . TYR A 1 126 ? 101.249 8.896   10.977  1.00 36.33 ? 148 TYR A CG  1 
ATOM   593  C CD1 . TYR A 1 126 ? 102.567 8.455   11.038  1.00 30.03 ? 148 TYR A CD1 1 
ATOM   594  C CD2 . TYR A 1 126 ? 100.623 8.926   9.737   1.00 38.24 ? 148 TYR A CD2 1 
ATOM   595  C CE1 . TYR A 1 126 ? 103.239 8.055   9.895   1.00 36.57 ? 148 TYR A CE1 1 
ATOM   596  C CE2 . TYR A 1 126 ? 101.286 8.528   8.590   1.00 35.19 ? 148 TYR A CE2 1 
ATOM   597  C CZ  . TYR A 1 126 ? 102.591 8.094   8.673   1.00 39.54 ? 148 TYR A CZ  1 
ATOM   598  O OH  . TYR A 1 126 ? 103.240 7.698   7.526   1.00 43.90 ? 148 TYR A OH  1 
ATOM   599  N N   . ASP A 1 127 ? 99.623  8.432   15.372  1.00 32.47 ? 149 ASP A N   1 
ATOM   600  C CA  . ASP A 1 127 ? 99.048  8.872   16.639  1.00 34.18 ? 149 ASP A CA  1 
ATOM   601  C C   . ASP A 1 127 ? 98.933  10.391  16.682  1.00 35.20 ? 149 ASP A C   1 
ATOM   602  O O   . ASP A 1 127 ? 99.942  11.102  16.617  1.00 37.63 ? 149 ASP A O   1 
ATOM   603  C CB  . ASP A 1 127 ? 99.907  8.365   17.801  1.00 37.87 ? 149 ASP A CB  1 
ATOM   604  C CG  . ASP A 1 127 ? 99.199  8.464   19.146  1.00 43.16 ? 149 ASP A CG  1 
ATOM   605  O OD1 . ASP A 1 127 ? 99.202  9.560   19.751  1.00 47.12 ? 149 ASP A OD1 1 
ATOM   606  O OD2 . ASP A 1 127 ? 98.639  7.444   19.600  1.00 40.24 ? 149 ASP A OD2 1 
ATOM   607  N N   . THR A 1 128 ? 97.701  10.885  16.792  1.00 29.11 ? 150 THR A N   1 
ATOM   608  C CA  . THR A 1 128 ? 97.414  12.314  16.805  1.00 30.74 ? 150 THR A CA  1 
ATOM   609  C C   . THR A 1 128 ? 96.617  12.652  18.056  1.00 23.95 ? 150 THR A C   1 
ATOM   610  O O   . THR A 1 128 ? 95.648  11.959  18.384  1.00 24.82 ? 150 THR A O   1 
ATOM   611  C CB  . THR A 1 128 ? 96.639  12.734  15.547  1.00 27.77 ? 150 THR A CB  1 
ATOM   612  O OG1 . THR A 1 128 ? 97.351  12.305  14.378  1.00 26.22 ? 150 THR A OG1 1 
ATOM   613  C CG2 . THR A 1 128 ? 96.464  14.248  15.500  1.00 22.58 ? 150 THR A CG2 1 
ATOM   614  N N   . GLN A 1 129 ? 97.026  13.714  18.751  1.00 22.95 ? 151 GLN A N   1 
ATOM   615  C CA  . GLN A 1 129 ? 96.391  14.152  19.988  1.00 24.51 ? 151 GLN A CA  1 
ATOM   616  C C   . GLN A 1 129 ? 95.941  15.597  19.849  1.00 24.64 ? 151 GLN A C   1 
ATOM   617  O O   . GLN A 1 129 ? 96.701  16.445  19.368  1.00 27.50 ? 151 GLN A O   1 
ATOM   618  C CB  . GLN A 1 129 ? 97.345  14.034  21.179  1.00 36.51 ? 151 GLN A CB  1 
ATOM   619  C CG  . GLN A 1 129 ? 97.678  12.620  21.614  1.00 41.99 ? 151 GLN A CG  1 
ATOM   620  C CD  . GLN A 1 129 ? 98.618  12.613  22.803  1.00 61.34 ? 151 GLN A CD  1 
ATOM   621  O OE1 . GLN A 1 129 ? 99.819  12.381  22.657  1.00 70.33 ? 151 GLN A OE1 1 
ATOM   622  N NE2 . GLN A 1 129 ? 98.078  12.887  23.988  1.00 46.52 ? 151 GLN A NE2 1 
ATOM   623  N N   . VAL A 1 130 ? 94.715  15.879  20.284  1.00 20.25 ? 152 VAL A N   1 
ATOM   624  C CA  . VAL A 1 130 ? 94.155  17.226  20.259  1.00 19.77 ? 152 VAL A CA  1 
ATOM   625  C C   . VAL A 1 130 ? 93.705  17.544  21.676  1.00 18.91 ? 152 VAL A C   1 
ATOM   626  O O   . VAL A 1 130 ? 92.685  17.021  22.140  1.00 23.00 ? 152 VAL A O   1 
ATOM   627  C CB  . VAL A 1 130 ? 92.993  17.363  19.264  1.00 17.31 ? 152 VAL A CB  1 
ATOM   628  C CG1 . VAL A 1 130 ? 92.306  18.699  19.439  1.00 14.27 ? 152 VAL A CG1 1 
ATOM   629  C CG2 . VAL A 1 130 ? 93.495  17.218  17.837  1.00 13.06 ? 152 VAL A CG2 1 
ATOM   630  N N   . LEU A 1 131 ? 94.467  18.382  22.368  1.00 27.07 ? 153 LEU A N   1 
ATOM   631  C CA  . LEU A 1 131 ? 94.214  18.701  23.766  1.00 29.05 ? 153 LEU A CA  1 
ATOM   632  C C   . LEU A 1 131 ? 93.590  20.087  23.860  1.00 28.05 ? 153 LEU A C   1 
ATOM   633  O O   . LEU A 1 131 ? 94.206  21.080  23.456  1.00 25.52 ? 153 LEU A O   1 
ATOM   634  C CB  . LEU A 1 131 ? 95.507  18.633  24.582  1.00 31.42 ? 153 LEU A CB  1 
ATOM   635  C CG  . LEU A 1 131 ? 95.508  19.336  25.945  1.00 35.62 ? 153 LEU A CG  1 
ATOM   636  C CD1 . LEU A 1 131 ? 94.562  18.651  26.904  1.00 30.47 ? 153 LEU A CD1 1 
ATOM   637  C CD2 . LEU A 1 131 ? 96.907  19.396  26.539  1.00 32.32 ? 153 LEU A CD2 1 
ATOM   638  N N   . CYS A 1 132 ? 92.370  20.148  24.385  1.00 26.91 ? 154 CYS A N   1 
ATOM   639  C CA  . CYS A 1 132 ? 91.683  21.406  24.639  1.00 28.46 ? 154 CYS A CA  1 
ATOM   640  C C   . CYS A 1 132 ? 91.813  21.748  26.115  1.00 31.96 ? 154 CYS A C   1 
ATOM   641  O O   . CYS A 1 132 ? 91.597  20.888  26.975  1.00 33.22 ? 154 CYS A O   1 
ATOM   642  C CB  . CYS A 1 132 ? 90.211  21.314  24.242  1.00 25.62 ? 154 CYS A CB  1 
ATOM   643  S SG  . CYS A 1 132 ? 89.948  20.553  22.627  1.00 34.98 ? 154 CYS A SG  1 
ATOM   644  N N   . ASN A 1 133 ? 92.173  22.996  26.406  1.00 35.47 ? 155 ASN A N   1 
ATOM   645  C CA  . ASN A 1 133 ? 92.405  23.448  27.773  1.00 33.19 ? 155 ASN A CA  1 
ATOM   646  C C   . ASN A 1 133 ? 91.683  24.769  28.001  1.00 34.40 ? 155 ASN A C   1 
ATOM   647  O O   . ASN A 1 133 ? 91.974  25.764  27.328  1.00 30.94 ? 155 ASN A O   1 
ATOM   648  C CB  . ASN A 1 133 ? 93.902  23.594  28.051  1.00 36.58 ? 155 ASN A CB  1 
ATOM   649  C CG  . ASN A 1 133 ? 94.184  24.309  29.354  1.00 40.93 ? 155 ASN A CG  1 
ATOM   650  O OD1 . ASN A 1 133 ? 95.018  25.213  29.406  1.00 46.05 ? 155 ASN A OD1 1 
ATOM   651  N ND2 . ASN A 1 133 ? 93.488  23.910  30.418  1.00 31.80 ? 155 ASN A ND2 1 
ATOM   652  N N   . LEU A 1 134 ? 90.751  24.776  28.953  1.00 40.26 ? 156 LEU A N   1 
ATOM   653  C CA  . LEU A 1 134 ? 89.973  25.968  29.276  1.00 34.59 ? 156 LEU A CA  1 
ATOM   654  C C   . LEU A 1 134 ? 90.788  26.891  30.174  1.00 38.81 ? 156 LEU A C   1 
ATOM   655  O O   . LEU A 1 134 ? 91.169  26.508  31.286  1.00 44.27 ? 156 LEU A O   1 
ATOM   656  C CB  . LEU A 1 134 ? 88.669  25.575  29.966  1.00 35.28 ? 156 LEU A CB  1 
ATOM   657  C CG  . LEU A 1 134 ? 87.393  25.502  29.127  1.00 41.91 ? 156 LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 134 ? 87.593  24.645  27.881  1.00 37.32 ? 156 LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 134 ? 86.253  24.960  29.976  1.00 43.86 ? 156 LEU A CD2 1 
ATOM   660  N N   . LEU A 1 135 ? 91.047  28.108  29.701  1.00 32.77 ? 157 LEU A N   1 
ATOM   661  C CA  . LEU A 1 135 ? 91.790  29.083  30.490  1.00 31.16 ? 157 LEU A CA  1 
ATOM   662  C C   . LEU A 1 135 ? 90.876  29.971  31.329  1.00 37.99 ? 157 LEU A C   1 
ATOM   663  O O   . LEU A 1 135 ? 91.238  30.350  32.449  1.00 42.42 ? 157 LEU A O   1 
ATOM   664  C CB  . LEU A 1 135 ? 92.652  29.949  29.571  1.00 27.55 ? 157 LEU A CB  1 
ATOM   665  C CG  . LEU A 1 135 ? 93.607  29.184  28.658  1.00 28.39 ? 157 LEU A CG  1 
ATOM   666  C CD1 . LEU A 1 135 ? 94.172  30.094  27.583  1.00 22.39 ? 157 LEU A CD1 1 
ATOM   667  C CD2 . LEU A 1 135 ? 94.723  28.559  29.474  1.00 31.12 ? 157 LEU A CD2 1 
ATOM   668  N N   . ALA A 1 136 ? 89.698  30.312  30.809  1.00 34.67 ? 158 ALA A N   1 
ATOM   669  C CA  . ALA A 1 136 ? 88.777  31.206  31.494  1.00 33.45 ? 158 ALA A CA  1 
ATOM   670  C C   . ALA A 1 136 ? 87.355  30.894  31.053  1.00 45.32 ? 158 ALA A C   1 
ATOM   671  O O   . ALA A 1 136 ? 87.115  30.591  29.881  1.00 46.96 ? 158 ALA A O   1 
ATOM   672  C CB  . ALA A 1 136 ? 89.104  32.676  31.206  1.00 32.05 ? 158 ALA A CB  1 
ATOM   673  N N   . VAL A 1 137 ? 86.420  30.968  31.997  1.00 42.37 ? 159 VAL A N   1 
ATOM   674  C CA  . VAL A 1 137 ? 85.003  30.745  31.734  1.00 40.86 ? 159 VAL A CA  1 
ATOM   675  C C   . VAL A 1 137 ? 84.234  31.877  32.399  1.00 51.42 ? 159 VAL A C   1 
ATOM   676  O O   . VAL A 1 137 ? 84.135  31.924  33.632  1.00 58.55 ? 159 VAL A O   1 
ATOM   677  C CB  . VAL A 1 137 ? 84.519  29.381  32.246  1.00 41.35 ? 159 VAL A CB  1 
ATOM   678  C CG1 . VAL A 1 137 ? 83.017  29.239  32.040  1.00 46.24 ? 159 VAL A CG1 1 
ATOM   679  C CG2 . VAL A 1 137 ? 85.258  28.254  31.544  1.00 40.54 ? 159 VAL A CG2 1 
ATOM   680  N N   . ASP A 1 138 ? 83.685  32.785  31.589  1.00 49.57 ? 160 ASP A N   1 
ATOM   681  C CA  . ASP A 1 138 ? 82.963  33.943  32.104  1.00 44.22 ? 160 ASP A CA  1 
ATOM   682  C C   . ASP A 1 138 ? 81.519  33.636  32.481  1.00 42.25 ? 160 ASP A C   1 
ATOM   683  O O   . ASP A 1 138 ? 80.786  34.560  32.851  1.00 42.67 ? 160 ASP A O   1 
ATOM   684  C CB  . ASP A 1 138 ? 82.999  35.086  31.080  1.00 46.68 ? 160 ASP A CB  1 
ATOM   685  C CG  . ASP A 1 138 ? 82.326  34.727  29.755  1.00 44.77 ? 160 ASP A CG  1 
ATOM   686  O OD1 . ASP A 1 138 ? 81.685  33.660  29.657  1.00 42.03 ? 160 ASP A OD1 1 
ATOM   687  O OD2 . ASP A 1 138 ? 82.441  35.527  28.801  1.00 42.35 ? 160 ASP A OD2 1 
ATOM   688  N N   . GLY A 1 139 ? 81.090  32.378  32.391  1.00 44.39 ? 161 GLY A N   1 
ATOM   689  C CA  . GLY A 1 139 ? 79.718  32.014  32.679  1.00 44.36 ? 161 GLY A CA  1 
ATOM   690  C C   . GLY A 1 139 ? 78.698  32.472  31.660  1.00 49.27 ? 161 GLY A C   1 
ATOM   691  O O   . GLY A 1 139 ? 77.512  32.158  31.814  1.00 46.96 ? 161 GLY A O   1 
ATOM   692  N N   . VAL A 1 140 ? 79.113  33.199  30.624  1.00 49.98 ? 162 VAL A N   1 
ATOM   693  C CA  . VAL A 1 140 ? 78.210  33.715  29.597  1.00 47.98 ? 162 VAL A CA  1 
ATOM   694  C C   . VAL A 1 140 ? 78.408  32.987  28.270  1.00 43.09 ? 162 VAL A C   1 
ATOM   695  O O   . VAL A 1 140 ? 77.471  32.395  27.730  1.00 39.74 ? 162 VAL A O   1 
ATOM   696  C CB  . VAL A 1 140 ? 78.377  35.242  29.429  1.00 46.73 ? 162 VAL A CB  1 
ATOM   697  C CG1 . VAL A 1 140 ? 77.167  35.835  28.721  1.00 45.56 ? 162 VAL A CG1 1 
ATOM   698  C CG2 . VAL A 1 140 ? 78.591  35.903  30.782  1.00 46.50 ? 162 VAL A CG2 1 
ATOM   699  N N   . ASN A 1 141 ? 79.622  33.023  27.726  1.00 41.67 ? 163 ASN A N   1 
ATOM   700  C CA  . ASN A 1 141 ? 79.926  32.390  26.449  1.00 35.53 ? 163 ASN A CA  1 
ATOM   701  C C   . ASN A 1 141 ? 80.422  30.967  26.692  1.00 35.12 ? 163 ASN A C   1 
ATOM   702  O O   . ASN A 1 141 ? 81.412  30.761  27.405  1.00 33.14 ? 163 ASN A O   1 
ATOM   703  C CB  . ASN A 1 141 ? 80.964  33.204  25.681  1.00 35.83 ? 163 ASN A CB  1 
ATOM   704  C CG  . ASN A 1 141 ? 80.476  34.603  25.346  1.00 41.34 ? 163 ASN A CG  1 
ATOM   705  O OD1 . ASN A 1 141 ? 79.693  34.797  24.412  1.00 39.02 ? 163 ASN A OD1 1 
ATOM   706  N ND2 . ASN A 1 141 ? 80.937  35.588  26.109  1.00 43.32 ? 163 ASN A ND2 1 
ATOM   707  N N   . GLU A 1 142 ? 79.738  29.991  26.098  1.00 37.31 ? 164 GLU A N   1 
ATOM   708  C CA  . GLU A 1 142 ? 80.084  28.592  26.321  1.00 33.62 ? 164 GLU A CA  1 
ATOM   709  C C   . GLU A 1 142 ? 81.349  28.230  25.550  1.00 33.99 ? 164 GLU A C   1 
ATOM   710  O O   . GLU A 1 142 ? 81.473  28.585  24.369  1.00 36.01 ? 164 GLU A O   1 
ATOM   711  C CB  . GLU A 1 142 ? 78.930  27.684  25.902  1.00 35.09 ? 164 GLU A CB  1 
ATOM   712  C CG  . GLU A 1 142 ? 77.925  27.419  27.013  1.00 44.89 ? 164 GLU A CG  1 
ATOM   713  C CD  . GLU A 1 142 ? 78.267  26.189  27.830  1.00 48.72 ? 164 GLU A CD  1 
ATOM   714  O OE1 . GLU A 1 142 ? 78.930  25.279  27.286  1.00 48.73 ? 164 GLU A OE1 1 
ATOM   715  O OE2 . GLU A 1 142 ? 77.869  26.129  29.013  1.00 47.95 ? 164 GLU A OE2 1 
ATOM   716  N N   . PRO A 1 143 ? 82.303  27.528  26.169  1.00 32.30 ? 165 PRO A N   1 
ATOM   717  C CA  . PRO A 1 143 ? 83.567  27.226  25.487  1.00 25.87 ? 165 PRO A CA  1 
ATOM   718  C C   . PRO A 1 143 ? 83.544  25.992  24.595  1.00 22.11 ? 165 PRO A C   1 
ATOM   719  O O   . PRO A 1 143 ? 84.508  25.790  23.843  1.00 22.34 ? 165 PRO A O   1 
ATOM   720  C CB  . PRO A 1 143 ? 84.538  27.028  26.661  1.00 19.46 ? 165 PRO A CB  1 
ATOM   721  C CG  . PRO A 1 143 ? 83.687  26.481  27.746  1.00 25.73 ? 165 PRO A CG  1 
ATOM   722  C CD  . PRO A 1 143 ? 82.302  27.063  27.567  1.00 28.72 ? 165 PRO A CD  1 
ATOM   723  N N   . ASP A 1 144 ? 82.489  25.174  24.639  1.00 21.44 ? 166 ASP A N   1 
ATOM   724  C CA  . ASP A 1 144 ? 82.502  23.937  23.864  1.00 21.15 ? 166 ASP A CA  1 
ATOM   725  C C   . ASP A 1 144 ? 82.624  24.215  22.367  1.00 26.26 ? 166 ASP A C   1 
ATOM   726  O O   . ASP A 1 144 ? 83.406  23.556  21.671  1.00 23.62 ? 166 ASP A O   1 
ATOM   727  C CB  . ASP A 1 144 ? 81.260  23.097  24.182  1.00 22.86 ? 166 ASP A CB  1 
ATOM   728  C CG  . ASP A 1 144 ? 79.956  23.798  23.832  1.00 27.50 ? 166 ASP A CG  1 
ATOM   729  O OD1 . ASP A 1 144 ? 79.987  24.970  23.391  1.00 26.74 ? 166 ASP A OD1 1 
ATOM   730  O OD2 . ASP A 1 144 ? 78.891  23.162  24.004  1.00 20.47 ? 166 ASP A OD2 1 
ATOM   731  N N   . VAL A 1 145 ? 81.882  25.201  21.852  1.00 24.78 ? 167 VAL A N   1 
ATOM   732  C CA  . VAL A 1 145 ? 82.023  25.541  20.437  1.00 22.28 ? 167 VAL A CA  1 
ATOM   733  C C   . VAL A 1 145 ? 83.361  26.219  20.172  1.00 22.52 ? 167 VAL A C   1 
ATOM   734  O O   . VAL A 1 145 ? 83.936  26.067  19.087  1.00 23.09 ? 167 VAL A O   1 
ATOM   735  C CB  . VAL A 1 145 ? 80.853  26.418  19.958  1.00 22.67 ? 167 VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 145 ? 79.636  25.557  19.678  1.00 23.85 ? 167 VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 145 ? 80.541  27.502  20.981  1.00 28.81 ? 167 VAL A CG2 1 
ATOM   738  N N   . LEU A 1 146 ? 83.879  26.978  21.142  1.00 23.01 ? 168 LEU A N   1 
ATOM   739  C CA  . LEU A 1 146 ? 85.189  27.594  20.965  1.00 22.55 ? 168 LEU A CA  1 
ATOM   740  C C   . LEU A 1 146 ? 86.282  26.544  20.844  1.00 23.16 ? 168 LEU A C   1 
ATOM   741  O O   . LEU A 1 146 ? 87.258  26.747  20.111  1.00 25.81 ? 168 LEU A O   1 
ATOM   742  C CB  . LEU A 1 146 ? 85.491  28.542  22.126  1.00 22.87 ? 168 LEU A CB  1 
ATOM   743  C CG  . LEU A 1 146 ? 84.478  29.665  22.359  1.00 29.29 ? 168 LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 146 ? 84.916  30.560  23.509  1.00 26.72 ? 168 LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 146 ? 84.285  30.475  21.089  1.00 29.41 ? 168 LEU A CD2 1 
ATOM   746  N N   . ALA A 1 147 ? 86.133  25.415  21.541  1.00 21.38 ? 169 ALA A N   1 
ATOM   747  C CA  . ALA A 1 147 ? 87.138  24.362  21.457  1.00 22.02 ? 169 ALA A CA  1 
ATOM   748  C C   . ALA A 1 147 ? 87.142  23.703  20.080  1.00 22.74 ? 169 ALA A C   1 
ATOM   749  O O   . ALA A 1 147 ? 88.213  23.406  19.535  1.00 20.65 ? 169 ALA A O   1 
ATOM   750  C CB  . ALA A 1 147 ? 86.903  23.326  22.555  1.00 22.73 ? 169 ALA A CB  1 
ATOM   751  N N   . ILE A 1 148 ? 85.958  23.461  19.503  1.00 19.71 ? 170 ILE A N   1 
ATOM   752  C CA  . ILE A 1 148 ? 85.894  22.907  18.150  1.00 17.58 ? 170 ILE A CA  1 
ATOM   753  C C   . ILE A 1 148 ? 86.704  23.769  17.190  1.00 21.79 ? 170 ILE A C   1 
ATOM   754  O O   . ILE A 1 148 ? 87.553  23.268  16.444  1.00 20.07 ? 170 ILE A O   1 
ATOM   755  C CB  . ILE A 1 148 ? 84.435  22.777  17.674  1.00 15.43 ? 170 ILE A CB  1 
ATOM   756  C CG1 . ILE A 1 148 ? 83.575  22.042  18.695  1.00 16.46 ? 170 ILE A CG1 1 
ATOM   757  C CG2 . ILE A 1 148 ? 84.379  22.044  16.347  1.00 10.56 ? 170 ILE A CG2 1 
ATOM   758  C CD1 . ILE A 1 148 ? 82.147  21.858  18.231  1.00 13.28 ? 170 ILE A CD1 1 
ATOM   759  N N   . ASN A 1 149 ? 86.453  25.084  17.201  1.00 20.79 ? 171 ASN A N   1 
ATOM   760  C CA  . ASN A 1 149 ? 87.217  25.991  16.349  1.00 19.11 ? 171 ASN A CA  1 
ATOM   761  C C   . ASN A 1 149 ? 88.702  25.932  16.676  1.00 21.08 ? 171 ASN A C   1 
ATOM   762  O O   . ASN A 1 149 ? 89.544  25.976  15.771  1.00 22.26 ? 171 ASN A O   1 
ATOM   763  C CB  . ASN A 1 149 ? 86.695  27.420  16.494  1.00 22.34 ? 171 ASN A CB  1 
ATOM   764  C CG  . ASN A 1 149 ? 85.241  27.553  16.093  1.00 21.68 ? 171 ASN A CG  1 
ATOM   765  O OD1 . ASN A 1 149 ? 84.910  27.577  14.906  1.00 17.26 ? 171 ASN A OD1 1 
ATOM   766  N ND2 . ASN A 1 149 ? 84.363  27.642  17.084  1.00 23.60 ? 171 ASN A ND2 1 
ATOM   767  N N   . GLY A 1 150 ? 89.041  25.826  17.964  1.00 20.78 ? 172 GLY A N   1 
ATOM   768  C CA  . GLY A 1 150 ? 90.439  25.688  18.342  1.00 23.16 ? 172 GLY A CA  1 
ATOM   769  C C   . GLY A 1 150 ? 91.102  24.481  17.705  1.00 22.38 ? 172 GLY A C   1 
ATOM   770  O O   . GLY A 1 150 ? 92.202  24.581  17.153  1.00 20.18 ? 172 GLY A O   1 
ATOM   771  N N   . ALA A 1 151 ? 90.437  23.322  17.768  1.00 18.88 ? 173 ALA A N   1 
ATOM   772  C CA  . ALA A 1 151 ? 90.962  22.128  17.113  1.00 15.24 ? 173 ALA A CA  1 
ATOM   773  C C   . ALA A 1 151 ? 91.157  22.350  15.620  1.00 23.75 ? 173 ALA A C   1 
ATOM   774  O O   . ALA A 1 151 ? 92.090  21.796  15.024  1.00 23.00 ? 173 ALA A O   1 
ATOM   775  C CB  . ALA A 1 151 ? 90.030  20.945  17.360  1.00 13.44 ? 173 ALA A CB  1 
ATOM   776  N N   . SER A 1 152 ? 90.296  23.162  15.002  1.00 19.94 ? 174 SER A N   1 
ATOM   777  C CA  . SER A 1 152 ? 90.464  23.481  13.589  1.00 22.74 ? 174 SER A CA  1 
ATOM   778  C C   . SER A 1 152 ? 91.669  24.386  13.373  1.00 24.66 ? 174 SER A C   1 
ATOM   779  O O   . SER A 1 152 ? 92.519  24.112  12.518  1.00 28.84 ? 174 SER A O   1 
ATOM   780  C CB  . SER A 1 152 ? 89.192  24.135  13.047  1.00 21.70 ? 174 SER A CB  1 
ATOM   781  O OG  . SER A 1 152 ? 89.352  24.523  11.694  1.00 20.10 ? 174 SER A OG  1 
ATOM   782  N N   . VAL A 1 153 ? 91.759  25.474  14.143  1.00 21.67 ? 175 VAL A N   1 
ATOM   783  C CA  . VAL A 1 153 ? 92.868  26.409  13.984  1.00 24.04 ? 175 VAL A CA  1 
ATOM   784  C C   . VAL A 1 153 ? 94.192  25.724  14.299  1.00 23.47 ? 175 VAL A C   1 
ATOM   785  O O   . VAL A 1 153 ? 95.173  25.869  13.559  1.00 22.65 ? 175 VAL A O   1 
ATOM   786  C CB  . VAL A 1 153 ? 92.648  27.656  14.865  1.00 26.33 ? 175 VAL A CB  1 
ATOM   787  C CG1 . VAL A 1 153 ? 93.746  28.686  14.623  1.00 28.34 ? 175 VAL A CG1 1 
ATOM   788  C CG2 . VAL A 1 153 ? 91.279  28.269  14.593  1.00 21.52 ? 175 VAL A CG2 1 
ATOM   789  N N   . ALA A 1 154 ? 94.235  24.959  15.393  1.00 19.92 ? 176 ALA A N   1 
ATOM   790  C CA  . ALA A 1 154 ? 95.466  24.276  15.780  1.00 23.20 ? 176 ALA A CA  1 
ATOM   791  C C   . ALA A 1 154 ? 95.960  23.358  14.668  1.00 25.62 ? 176 ALA A C   1 
ATOM   792  O O   . ALA A 1 154 ? 97.128  23.418  14.269  1.00 21.04 ? 176 ALA A O   1 
ATOM   793  C CB  . ALA A 1 154 ? 95.244  23.487  17.072  1.00 20.50 ? 176 ALA A CB  1 
ATOM   794  N N   . LEU A 1 155 ? 95.078  22.500  14.151  1.00 25.05 ? 177 LEU A N   1 
ATOM   795  C CA  . LEU A 1 155 ? 95.478  21.598  13.078  1.00 23.37 ? 177 LEU A CA  1 
ATOM   796  C C   . LEU A 1 155 ? 95.856  22.375  11.822  1.00 24.80 ? 177 LEU A C   1 
ATOM   797  O O   . LEU A 1 155 ? 96.796  22.001  11.110  1.00 23.95 ? 177 LEU A O   1 
ATOM   798  C CB  . LEU A 1 155 ? 94.355  20.603  12.785  1.00 22.36 ? 177 LEU A CB  1 
ATOM   799  C CG  . LEU A 1 155 ? 94.206  19.426  13.750  1.00 18.72 ? 177 LEU A CG  1 
ATOM   800  C CD1 . LEU A 1 155 ? 92.923  18.658  13.472  1.00 19.96 ? 177 LEU A CD1 1 
ATOM   801  C CD2 . LEU A 1 155 ? 95.402  18.502  13.652  1.00 21.17 ? 177 LEU A CD2 1 
ATOM   802  N N   . SER A 1 156 ? 95.141  23.466  11.539  1.00 19.61 ? 178 SER A N   1 
ATOM   803  C CA  . SER A 1 156 ? 95.438  24.242  10.341  1.00 21.75 ? 178 SER A CA  1 
ATOM   804  C C   . SER A 1 156 ? 96.798  24.917  10.445  1.00 29.25 ? 178 SER A C   1 
ATOM   805  O O   . SER A 1 156 ? 97.534  24.994  9.455   1.00 36.36 ? 178 SER A O   1 
ATOM   806  C CB  . SER A 1 156 ? 94.340  25.275  10.094  1.00 22.81 ? 178 SER A CB  1 
ATOM   807  O OG  . SER A 1 156 ? 93.311  24.733  9.284   1.00 23.37 ? 178 SER A OG  1 
ATOM   808  N N   . LEU A 1 157 ? 97.150  25.407  11.635  1.00 32.31 ? 179 LEU A N   1 
ATOM   809  C CA  . LEU A 1 157 ? 98.453  26.022  11.855  1.00 28.37 ? 179 LEU A CA  1 
ATOM   810  C C   . LEU A 1 157 ? 99.566  25.001  12.041  1.00 25.68 ? 179 LEU A C   1 
ATOM   811  O O   . LEU A 1 157 ? 100.741 25.378  11.991  1.00 29.63 ? 179 LEU A O   1 
ATOM   812  C CB  . LEU A 1 157 ? 98.401  26.942  13.076  1.00 24.68 ? 179 LEU A CB  1 
ATOM   813  C CG  . LEU A 1 157 ? 97.496  28.170  12.963  1.00 29.78 ? 179 LEU A CG  1 
ATOM   814  C CD1 . LEU A 1 157 ? 97.462  28.927  14.283  1.00 36.24 ? 179 LEU A CD1 1 
ATOM   815  C CD2 . LEU A 1 157 ? 97.954  29.076  11.834  1.00 24.70 ? 179 LEU A CD2 1 
ATOM   816  N N   . SER A 1 158 ? 99.230  23.730  12.251  1.00 27.16 ? 180 SER A N   1 
ATOM   817  C CA  . SER A 1 158 ? 100.224 22.695  12.480  1.00 28.10 ? 180 SER A CA  1 
ATOM   818  C C   . SER A 1 158 ? 100.743 22.152  11.152  1.00 34.11 ? 180 SER A C   1 
ATOM   819  O O   . SER A 1 158 ? 100.278 22.520  10.069  1.00 37.60 ? 180 SER A O   1 
ATOM   820  C CB  . SER A 1 158 ? 99.635  21.565  13.321  1.00 28.11 ? 180 SER A CB  1 
ATOM   821  O OG  . SER A 1 158 ? 98.971  20.622  12.497  1.00 24.07 ? 180 SER A OG  1 
ATOM   822  N N   . ASP A 1 159 ? 101.722 21.257  11.240  1.00 30.34 ? 181 ASP A N   1 
ATOM   823  C CA  . ASP A 1 159 ? 102.259 20.566  10.079  1.00 29.19 ? 181 ASP A CA  1 
ATOM   824  C C   . ASP A 1 159 ? 101.573 19.233  9.832   1.00 30.70 ? 181 ASP A C   1 
ATOM   825  O O   . ASP A 1 159 ? 102.098 18.415  9.070   1.00 30.77 ? 181 ASP A O   1 
ATOM   826  C CB  . ASP A 1 159 ? 103.764 20.344  10.247  1.00 37.03 ? 181 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 159 ? 104.087 19.322  11.331  1.00 39.56 ? 181 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 159 ? 103.293 19.190  12.290  1.00 36.22 ? 181 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 159 ? 105.136 18.651  11.225  1.00 37.66 ? 181 ASP A OD2 1 
ATOM   830  N N   . ILE A 1 160 ? 100.429 18.992  10.464  1.00 30.93 ? 182 ILE A N   1 
ATOM   831  C CA  . ILE A 1 160 ? 99.748  17.705  10.398  1.00 28.75 ? 182 ILE A CA  1 
ATOM   832  C C   . ILE A 1 160 ? 98.813  17.721  9.189   1.00 29.06 ? 182 ILE A C   1 
ATOM   833  O O   . ILE A 1 160 ? 97.927  18.586  9.128   1.00 27.46 ? 182 ILE A O   1 
ATOM   834  C CB  . ILE A 1 160 ? 98.964  17.418  11.681  1.00 25.23 ? 182 ILE A CB  1 
ATOM   835  C CG1 . ILE A 1 160 ? 99.859  17.599  12.907  1.00 29.58 ? 182 ILE A CG1 1 
ATOM   836  C CG2 . ILE A 1 160 ? 98.378  16.026  11.633  1.00 26.85 ? 182 ILE A CG2 1 
ATOM   837  C CD1 . ILE A 1 160 ? 99.091  17.735  14.210  1.00 25.68 ? 182 ILE A CD1 1 
ATOM   838  N N   . PRO A 1 161 ? 98.965  16.793  8.234   1.00 31.92 ? 183 PRO A N   1 
ATOM   839  C CA  . PRO A 1 161 ? 98.045  16.744  7.086   1.00 25.80 ? 183 PRO A CA  1 
ATOM   840  C C   . PRO A 1 161 ? 96.579  16.765  7.497   1.00 26.68 ? 183 PRO A C   1 
ATOM   841  O O   . PRO A 1 161 ? 96.083  15.828  8.131   1.00 29.58 ? 183 PRO A O   1 
ATOM   842  C CB  . PRO A 1 161 ? 98.414  15.421  6.402   1.00 22.07 ? 183 PRO A CB  1 
ATOM   843  C CG  . PRO A 1 161 ? 99.840  15.192  6.780   1.00 26.59 ? 183 PRO A CG  1 
ATOM   844  C CD  . PRO A 1 161 ? 99.994  15.741  8.171   1.00 32.40 ? 183 PRO A CD  1 
ATOM   845  N N   . TRP A 1 162 ? 95.887  17.844  7.146   1.00 21.91 ? 184 TRP A N   1 
ATOM   846  C CA  . TRP A 1 162 ? 94.489  18.033  7.523   1.00 20.06 ? 184 TRP A CA  1 
ATOM   847  C C   . TRP A 1 162 ? 93.879  19.019  6.542   1.00 21.14 ? 184 TRP A C   1 
ATOM   848  O O   . TRP A 1 162 ? 94.318  20.172  6.477   1.00 28.21 ? 184 TRP A O   1 
ATOM   849  C CB  . TRP A 1 162 ? 94.376  18.546  8.962   1.00 19.78 ? 184 TRP A CB  1 
ATOM   850  C CG  . TRP A 1 162 ? 92.999  18.431  9.538   1.00 19.55 ? 184 TRP A CG  1 
ATOM   851  C CD1 . TRP A 1 162 ? 92.345  17.281  9.883   1.00 18.99 ? 184 TRP A CD1 1 
ATOM   852  C CD2 . TRP A 1 162 ? 92.103  19.505  9.838   1.00 15.16 ? 184 TRP A CD2 1 
ATOM   853  N NE1 . TRP A 1 162 ? 91.099  17.574  10.375  1.00 15.08 ? 184 TRP A NE1 1 
ATOM   854  C CE2 . TRP A 1 162 ? 90.924  18.933  10.357  1.00 14.53 ? 184 TRP A CE2 1 
ATOM   855  C CE3 . TRP A 1 162 ? 92.182  20.894  9.715   1.00 18.11 ? 184 TRP A CE3 1 
ATOM   856  C CZ2 . TRP A 1 162 ? 89.835  19.702  10.754  1.00 14.59 ? 184 TRP A CZ2 1 
ATOM   857  C CZ3 . TRP A 1 162 ? 91.099  21.657  10.113  1.00 18.20 ? 184 TRP A CZ3 1 
ATOM   858  C CH2 . TRP A 1 162 ? 89.941  21.059  10.626  1.00 17.09 ? 184 TRP A CH2 1 
ATOM   859  N N   . ASN A 1 163 ? 92.881  18.574  5.780   1.00 18.65 ? 185 ASN A N   1 
ATOM   860  C CA  . ASN A 1 163 ? 92.336  19.373  4.680   1.00 24.41 ? 185 ASN A CA  1 
ATOM   861  C C   . ASN A 1 163 ? 91.170  20.230  5.178   1.00 23.55 ? 185 ASN A C   1 
ATOM   862  O O   . ASN A 1 163 ? 90.004  20.025  4.837   1.00 26.59 ? 185 ASN A O   1 
ATOM   863  C CB  . ASN A 1 163 ? 91.919  18.470  3.526   1.00 22.73 ? 185 ASN A CB  1 
ATOM   864  C CG  . ASN A 1 163 ? 92.990  17.465  3.163   1.00 27.78 ? 185 ASN A CG  1 
ATOM   865  O OD1 . ASN A 1 163 ? 93.958  17.796  2.477   1.00 26.27 ? 185 ASN A OD1 1 
ATOM   866  N ND2 . ASN A 1 163 ? 92.827  16.229  3.627   1.00 33.89 ? 185 ASN A ND2 1 
ATOM   867  N N   . GLY A 1 164 ? 91.517  21.221  5.995   1.00 22.61 ? 186 GLY A N   1 
ATOM   868  C CA  . GLY A 1 164 ? 90.546  22.143  6.533   1.00 18.27 ? 186 GLY A CA  1 
ATOM   869  C C   . GLY A 1 164 ? 90.565  23.472  5.806   1.00 20.71 ? 186 GLY A C   1 
ATOM   870  O O   . GLY A 1 164 ? 90.753  23.534  4.587   1.00 25.01 ? 186 GLY A O   1 
ATOM   871  N N   . PRO A 1 165 ? 90.345  24.571  6.541   1.00 22.89 ? 187 PRO A N   1 
ATOM   872  C CA  . PRO A 1 165 ? 89.972  24.527  7.956   1.00 25.31 ? 187 PRO A CA  1 
ATOM   873  C C   . PRO A 1 165 ? 88.483  24.274  8.141   1.00 18.64 ? 187 PRO A C   1 
ATOM   874  O O   . PRO A 1 165 ? 87.754  24.127  7.160   1.00 19.45 ? 187 PRO A O   1 
ATOM   875  C CB  . PRO A 1 165 ? 90.356  25.918  8.463   1.00 19.61 ? 187 PRO A CB  1 
ATOM   876  C CG  . PRO A 1 165 ? 90.205  26.793  7.281   1.00 22.89 ? 187 PRO A CG  1 
ATOM   877  C CD  . PRO A 1 165 ? 90.536  25.953  6.067   1.00 23.19 ? 187 PRO A CD  1 
ATOM   878  N N   . VAL A 1 166 ? 88.045  24.229  9.393   1.00 17.33 ? 188 VAL A N   1 
ATOM   879  C CA  . VAL A 1 166 ? 86.654  23.986  9.745   1.00 18.27 ? 188 VAL A CA  1 
ATOM   880  C C   . VAL A 1 166 ? 86.163  25.155  10.586  1.00 13.90 ? 188 VAL A C   1 
ATOM   881  O O   . VAL A 1 166 ? 86.907  25.695  11.409  1.00 15.55 ? 188 VAL A O   1 
ATOM   882  C CB  . VAL A 1 166 ? 86.498  22.646  10.499  1.00 18.32 ? 188 VAL A CB  1 
ATOM   883  C CG1 . VAL A 1 166 ? 85.295  22.665  11.437  1.00 18.78 ? 188 VAL A CG1 1 
ATOM   884  C CG2 . VAL A 1 166 ? 86.361  21.519  9.514   1.00 12.64 ? 188 VAL A CG2 1 
ATOM   885  N N   . GLY A 1 167 ? 84.923  25.566  10.352  1.00 13.74 ? 189 GLY A N   1 
ATOM   886  C CA  . GLY A 1 167 ? 84.241  26.512  11.211  1.00 16.85 ? 189 GLY A CA  1 
ATOM   887  C C   . GLY A 1 167 ? 83.090  25.809  11.905  1.00 17.86 ? 189 GLY A C   1 
ATOM   888  O O   . GLY A 1 167 ? 82.499  24.877  11.358  1.00 20.71 ? 189 GLY A O   1 
ATOM   889  N N   . ALA A 1 168 ? 82.776  26.254  13.117  1.00 16.43 ? 190 ALA A N   1 
ATOM   890  C CA  . ALA A 1 168 ? 81.703  25.647  13.887  1.00 12.38 ? 190 ALA A CA  1 
ATOM   891  C C   . ALA A 1 168 ? 81.026  26.713  14.727  1.00 15.68 ? 190 ALA A C   1 
ATOM   892  O O   . ALA A 1 168 ? 81.696  27.583  15.293  1.00 17.95 ? 190 ALA A O   1 
ATOM   893  C CB  . ALA A 1 168 ? 82.221  24.521  14.787  1.00 16.01 ? 190 ALA A CB  1 
ATOM   894  N N   . VAL A 1 169 ? 79.695  26.640  14.803  1.00 14.40 ? 191 VAL A N   1 
ATOM   895  C CA  . VAL A 1 169 ? 78.902  27.553  15.612  1.00 13.43 ? 191 VAL A CA  1 
ATOM   896  C C   . VAL A 1 169 ? 77.747  26.790  16.244  1.00 13.75 ? 191 VAL A C   1 
ATOM   897  O O   . VAL A 1 169 ? 77.393  25.684  15.826  1.00 13.54 ? 191 VAL A O   1 
ATOM   898  C CB  . VAL A 1 169 ? 78.351  28.744  14.796  1.00 14.79 ? 191 VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 169 ? 79.477  29.674  14.363  1.00 15.93 ? 191 VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 169 ? 77.552  28.244  13.601  1.00 12.83 ? 191 VAL A CG2 1 
ATOM   901  N N   . ARG A 1 170 ? 77.164  27.398  17.270  1.00 12.43 ? 192 ARG A N   1 
ATOM   902  C CA  . ARG A 1 170 ? 75.894  26.956  17.818  1.00 14.00 ? 192 ARG A CA  1 
ATOM   903  C C   . ARG A 1 170 ? 74.800  27.880  17.304  1.00 20.85 ? 192 ARG A C   1 
ATOM   904  O O   . ARG A 1 170 ? 75.023  29.081  17.122  1.00 19.88 ? 192 ARG A O   1 
ATOM   905  C CB  . ARG A 1 170 ? 75.909  26.957  19.347  1.00 17.78 ? 192 ARG A CB  1 
ATOM   906  C CG  . ARG A 1 170 ? 74.545  26.684  19.980  1.00 16.63 ? 192 ARG A CG  1 
ATOM   907  C CD  . ARG A 1 170 ? 74.651  26.493  21.488  1.00 19.65 ? 192 ARG A CD  1 
ATOM   908  N NE  . ARG A 1 170 ? 75.066  25.137  21.833  1.00 17.89 ? 192 ARG A NE  1 
ATOM   909  C CZ  . ARG A 1 170 ? 76.265  24.823  22.312  1.00 23.47 ? 192 ARG A CZ  1 
ATOM   910  N NH1 . ARG A 1 170 ? 77.170  25.774  22.517  1.00 23.47 ? 192 ARG A NH1 1 
ATOM   911  N NH2 . ARG A 1 170 ? 76.559  23.558  22.589  1.00 22.44 ? 192 ARG A NH2 1 
ATOM   912  N N   . ILE A 1 171 ? 73.626  27.313  17.046  1.00 19.61 ? 193 ILE A N   1 
ATOM   913  C CA  . ILE A 1 171 ? 72.471  28.077  16.600  1.00 21.71 ? 193 ILE A CA  1 
ATOM   914  C C   . ILE A 1 171 ? 71.323  27.799  17.556  1.00 21.01 ? 193 ILE A C   1 
ATOM   915  O O   . ILE A 1 171 ? 70.997  26.639  17.825  1.00 19.57 ? 193 ILE A O   1 
ATOM   916  C CB  . ILE A 1 171 ? 72.077  27.736  15.151  1.00 19.28 ? 193 ILE A CB  1 
ATOM   917  C CG1 . ILE A 1 171 ? 73.146  28.236  14.183  1.00 15.53 ? 193 ILE A CG1 1 
ATOM   918  C CG2 . ILE A 1 171 ? 70.739  28.369  14.802  1.00 14.20 ? 193 ILE A CG2 1 
ATOM   919  C CD1 . ILE A 1 171 ? 73.144  29.741  14.026  1.00 17.60 ? 193 ILE A CD1 1 
ATOM   920  N N   . GLY A 1 172 ? 70.724  28.865  18.079  1.00 22.96 ? 194 GLY A N   1 
ATOM   921  C CA  . GLY A 1 172 ? 69.536  28.744  18.886  1.00 20.24 ? 194 GLY A CA  1 
ATOM   922  C C   . GLY A 1 172 ? 68.463  29.679  18.368  1.00 26.89 ? 194 GLY A C   1 
ATOM   923  O O   . GLY A 1 172 ? 68.743  30.684  17.718  1.00 30.98 ? 194 GLY A O   1 
ATOM   924  N N   . ILE A 1 173 ? 67.219  29.319  18.658  1.00 24.62 ? 195 ILE A N   1 
ATOM   925  C CA  . ILE A 1 173 ? 66.066  30.145  18.332  1.00 24.63 ? 195 ILE A CA  1 
ATOM   926  C C   . ILE A 1 173 ? 65.529  30.690  19.646  1.00 31.72 ? 195 ILE A C   1 
ATOM   927  O O   . ILE A 1 173 ? 64.934  29.950  20.441  1.00 31.67 ? 195 ILE A O   1 
ATOM   928  C CB  . ILE A 1 173 ? 64.996  29.361  17.562  1.00 24.35 ? 195 ILE A CB  1 
ATOM   929  C CG1 . ILE A 1 173 ? 65.555  28.878  16.223  1.00 17.95 ? 195 ILE A CG1 1 
ATOM   930  C CG2 . ILE A 1 173 ? 63.758  30.218  17.341  1.00 29.32 ? 195 ILE A CG2 1 
ATOM   931  C CD1 . ILE A 1 173 ? 64.774  27.729  15.617  1.00 16.40 ? 195 ILE A CD1 1 
ATOM   932  N N   . ILE A 1 174 ? 65.755  31.980  19.885  1.00 30.81 ? 196 ILE A N   1 
ATOM   933  C CA  . ILE A 1 174 ? 65.304  32.662  21.093  1.00 33.88 ? 196 ILE A CA  1 
ATOM   934  C C   . ILE A 1 174 ? 64.219  33.648  20.685  1.00 34.75 ? 196 ILE A C   1 
ATOM   935  O O   . ILE A 1 174 ? 64.507  34.681  20.065  1.00 32.58 ? 196 ILE A O   1 
ATOM   936  C CB  . ILE A 1 174 ? 66.458  33.371  21.815  1.00 34.74 ? 196 ILE A CB  1 
ATOM   937  C CG1 . ILE A 1 174 ? 67.448  32.346  22.365  1.00 33.99 ? 196 ILE A CG1 1 
ATOM   938  C CG2 . ILE A 1 174 ? 65.925  34.250  22.939  1.00 30.69 ? 196 ILE A CG2 1 
ATOM   939  C CD1 . ILE A 1 174 ? 68.607  32.052  21.441  1.00 33.67 ? 196 ILE A CD1 1 
ATOM   940  N N   . ASP A 1 175 ? 62.972  33.328  21.036  1.00 37.13 ? 197 ASP A N   1 
ATOM   941  C CA  . ASP A 1 175 ? 61.814  34.164  20.714  1.00 37.93 ? 197 ASP A CA  1 
ATOM   942  C C   . ASP A 1 175 ? 61.694  34.369  19.205  1.00 37.37 ? 197 ASP A C   1 
ATOM   943  O O   . ASP A 1 175 ? 61.471  35.480  18.718  1.00 45.09 ? 197 ASP A O   1 
ATOM   944  C CB  . ASP A 1 175 ? 61.876  35.505  21.452  1.00 35.85 ? 197 ASP A CB  1 
ATOM   945  C CG  . ASP A 1 175 ? 61.953  35.339  22.960  1.00 43.82 ? 197 ASP A CG  1 
ATOM   946  O OD1 . ASP A 1 175 ? 61.200  34.502  23.507  1.00 41.47 ? 197 ASP A OD1 1 
ATOM   947  O OD2 . ASP A 1 175 ? 62.766  36.044  23.597  1.00 40.14 ? 197 ASP A OD2 1 
ATOM   948  N N   . GLY A 1 176 ? 61.854  33.275  18.460  1.00 36.62 ? 198 GLY A N   1 
ATOM   949  C CA  . GLY A 1 176 ? 61.716  33.290  17.020  1.00 34.90 ? 198 GLY A CA  1 
ATOM   950  C C   . GLY A 1 176 ? 62.901  33.833  16.251  1.00 36.55 ? 198 GLY A C   1 
ATOM   951  O O   . GLY A 1 176 ? 62.905  33.747  15.015  1.00 37.20 ? 198 GLY A O   1 
ATOM   952  N N   . GLU A 1 177 ? 63.903  34.390  16.925  1.00 30.90 ? 199 GLU A N   1 
ATOM   953  C CA  . GLU A 1 177 ? 65.060  34.975  16.260  1.00 32.16 ? 199 GLU A CA  1 
ATOM   954  C C   . GLU A 1 177 ? 66.230  34.004  16.329  1.00 30.58 ? 199 GLU A C   1 
ATOM   955  O O   . GLU A 1 177 ? 66.536  33.469  17.400  1.00 34.08 ? 199 GLU A O   1 
ATOM   956  C CB  . GLU A 1 177 ? 65.438  36.316  16.894  1.00 36.95 ? 199 GLU A CB  1 
ATOM   957  C CG  . GLU A 1 177 ? 65.668  37.434  15.877  1.00 54.71 ? 199 GLU A CG  1 
ATOM   958  C CD  . GLU A 1 177 ? 64.369  38.017  15.342  1.00 60.87 ? 199 GLU A CD  1 
ATOM   959  O OE1 . GLU A 1 177 ? 64.006  37.697  14.189  1.00 63.39 ? 199 GLU A OE1 1 
ATOM   960  O OE2 . GLU A 1 177 ? 63.715  38.799  16.069  1.00 53.96 ? 199 GLU A OE2 1 
ATOM   961  N N   . TYR A 1 178 ? 66.879  33.781  15.185  1.00 28.00 ? 200 TYR A N   1 
ATOM   962  C CA  . TYR A 1 178 ? 67.968  32.814  15.076  1.00 22.36 ? 200 TYR A CA  1 
ATOM   963  C C   . TYR A 1 178 ? 69.262  33.458  15.556  1.00 19.47 ? 200 TYR A C   1 
ATOM   964  O O   . TYR A 1 178 ? 69.836  34.305  14.866  1.00 22.36 ? 200 TYR A O   1 
ATOM   965  C CB  . TYR A 1 178 ? 68.096  32.317  13.638  1.00 20.78 ? 200 TYR A CB  1 
ATOM   966  C CG  . TYR A 1 178 ? 66.873  31.574  13.153  1.00 20.93 ? 200 TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 178 ? 65.769  32.256  12.669  1.00 22.35 ? 200 TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 178 ? 66.815  30.188  13.197  1.00 22.20 ? 200 TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 178 ? 64.642  31.577  12.238  1.00 24.80 ? 200 TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 178 ? 65.694  29.503  12.764  1.00 18.75 ? 200 TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 178 ? 64.611  30.202  12.289  1.00 18.01 ? 200 TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 178 ? 63.494  29.522  11.860  1.00 25.39 ? 200 TYR A OH  1 
ATOM   973  N N   . VAL A 1 179 ? 69.728  33.051  16.733  1.00 19.80 ? 201 VAL A N   1 
ATOM   974  C CA  . VAL A 1 179 ? 70.921  33.615  17.352  1.00 27.48 ? 201 VAL A CA  1 
ATOM   975  C C   . VAL A 1 179 ? 72.078  32.645  17.158  1.00 25.46 ? 201 VAL A C   1 
ATOM   976  O O   . VAL A 1 179 ? 71.938  31.440  17.403  1.00 26.12 ? 201 VAL A O   1 
ATOM   977  C CB  . VAL A 1 179 ? 70.688  33.900  18.846  1.00 30.56 ? 201 VAL A CB  1 
ATOM   978  C CG1 . VAL A 1 179 ? 71.849  34.693  19.425  1.00 31.80 ? 201 VAL A CG1 1 
ATOM   979  C CG2 . VAL A 1 179 ? 69.379  34.642  19.042  1.00 24.60 ? 201 VAL A CG2 1 
ATOM   980  N N   . VAL A 1 180 ? 73.220  33.169  16.724  1.00 22.89 ? 202 VAL A N   1 
ATOM   981  C CA  . VAL A 1 180 ? 74.422  32.368  16.526  1.00 22.01 ? 202 VAL A CA  1 
ATOM   982  C C   . VAL A 1 180 ? 75.256  32.422  17.799  1.00 27.36 ? 202 VAL A C   1 
ATOM   983  O O   . VAL A 1 180 ? 75.482  33.501  18.359  1.00 35.00 ? 202 VAL A O   1 
ATOM   984  C CB  . VAL A 1 180 ? 75.221  32.867  15.311  1.00 24.33 ? 202 VAL A CB  1 
ATOM   985  C CG1 . VAL A 1 180 ? 75.356  34.381  15.350  1.00 29.38 ? 202 VAL A CG1 1 
ATOM   986  C CG2 . VAL A 1 180 ? 76.586  32.200  15.253  1.00 23.17 ? 202 VAL A CG2 1 
ATOM   987  N N   . ASN A 1 181 ? 75.705  31.259  18.255  1.00 29.36 ? 203 ASN A N   1 
ATOM   988  C CA  . ASN A 1 181 ? 76.461  31.132  19.504  1.00 26.33 ? 203 ASN A CA  1 
ATOM   989  C C   . ASN A 1 181 ? 75.732  31.817  20.662  1.00 33.08 ? 203 ASN A C   1 
ATOM   990  O O   . ASN A 1 181 ? 76.276  32.770  21.258  1.00 36.33 ? 203 ASN A O   1 
ATOM   991  C CB  . ASN A 1 181 ? 77.864  31.669  19.346  1.00 23.91 ? 203 ASN A CB  1 
ATOM   992  C CG  . ASN A 1 181 ? 78.786  30.705  18.631  1.00 21.85 ? 203 ASN A CG  1 
ATOM   993  O OD1 . ASN A 1 181 ? 78.346  29.666  18.143  1.00 25.53 ? 203 ASN A OD1 1 
ATOM   994  N ND2 . ASN A 1 181 ? 80.068  31.038  18.568  1.00 23.22 ? 203 ASN A ND2 1 
ATOM   995  N N   . PRO A 1 182 ? 74.528  31.382  21.016  1.00 31.36 ? 204 PRO A N   1 
ATOM   996  C CA  . PRO A 1 182 ? 73.793  32.048  22.096  1.00 29.26 ? 204 PRO A CA  1 
ATOM   997  C C   . PRO A 1 182 ? 74.520  31.923  23.424  1.00 30.94 ? 204 PRO A C   1 
ATOM   998  O O   . PRO A 1 182 ? 75.273  30.976  23.662  1.00 36.69 ? 204 PRO A O   1 
ATOM   999  C CB  . PRO A 1 182 ? 72.449  31.311  22.124  1.00 30.55 ? 204 PRO A CB  1 
ATOM   1000 C CG  . PRO A 1 182 ? 72.737  29.980  21.514  1.00 30.35 ? 204 PRO A CG  1 
ATOM   1001 C CD  . PRO A 1 182 ? 73.787  30.225  20.477  1.00 24.54 ? 204 PRO A CD  1 
ATOM   1002 N N   . THR A 1 183 ? 74.292  32.908  24.288  1.00 35.74 ? 205 THR A N   1 
ATOM   1003 C CA  . THR A 1 183 ? 74.892  32.913  25.612  1.00 32.03 ? 205 THR A CA  1 
ATOM   1004 C C   . THR A 1 183 ? 74.248  31.842  26.488  1.00 29.13 ? 205 THR A C   1 
ATOM   1005 O O   . THR A 1 183 ? 73.264  31.196  26.111  1.00 27.64 ? 205 THR A O   1 
ATOM   1006 C CB  . THR A 1 183 ? 74.740  34.289  26.262  1.00 31.48 ? 205 THR A CB  1 
ATOM   1007 O OG1 . THR A 1 183 ? 73.346  34.596  26.403  1.00 30.29 ? 205 THR A OG1 1 
ATOM   1008 C CG2 . THR A 1 183 ? 75.406  35.363  25.409  1.00 26.28 ? 205 THR A CG2 1 
ATOM   1009 N N   . ARG A 1 184 ? 74.820  31.650  27.677  1.00 31.99 ? 206 ARG A N   1 
ATOM   1010 C CA  . ARG A 1 184 ? 74.217  30.726  28.630  1.00 34.12 ? 206 ARG A CA  1 
ATOM   1011 C C   . ARG A 1 184 ? 72.785  31.139  28.943  1.00 32.08 ? 206 ARG A C   1 
ATOM   1012 O O   . ARG A 1 184 ? 71.866  30.313  28.909  1.00 29.67 ? 206 ARG A O   1 
ATOM   1013 C CB  . ARG A 1 184 ? 75.058  30.654  29.905  1.00 37.40 ? 206 ARG A CB  1 
ATOM   1014 C CG  . ARG A 1 184 ? 74.796  29.407  30.744  1.00 45.85 ? 206 ARG A CG  1 
ATOM   1015 C CD  . ARG A 1 184 ? 75.951  29.111  31.697  1.00 54.64 ? 206 ARG A CD  1 
ATOM   1016 N NE  . ARG A 1 184 ? 77.255  29.239  31.047  1.00 58.08 ? 206 ARG A NE  1 
ATOM   1017 C CZ  . ARG A 1 184 ? 78.338  28.553  31.401  1.00 66.48 ? 206 ARG A CZ  1 
ATOM   1018 N NH1 . ARG A 1 184 ? 78.278  27.681  32.399  1.00 70.69 ? 206 ARG A NH1 1 
ATOM   1019 N NH2 . ARG A 1 184 ? 79.484  28.735  30.755  1.00 63.35 ? 206 ARG A NH2 1 
ATOM   1020 N N   . LYS A 1 185 ? 72.575  32.427  29.223  1.00 35.62 ? 207 LYS A N   1 
ATOM   1021 C CA  . LYS A 1 185 ? 71.225  32.919  29.471  1.00 32.81 ? 207 LYS A CA  1 
ATOM   1022 C C   . LYS A 1 185 ? 70.352  32.778  28.230  1.00 31.44 ? 207 LYS A C   1 
ATOM   1023 O O   . LYS A 1 185 ? 69.184  32.378  28.328  1.00 30.37 ? 207 LYS A O   1 
ATOM   1024 C CB  . LYS A 1 185 ? 71.278  34.374  29.940  1.00 33.18 ? 207 LYS A CB  1 
ATOM   1025 C CG  . LYS A 1 185 ? 69.916  35.046  30.041  1.00 46.69 ? 207 LYS A CG  1 
ATOM   1026 C CD  . LYS A 1 185 ? 69.982  36.348  30.832  1.00 57.50 ? 207 LYS A CD  1 
ATOM   1027 C CE  . LYS A 1 185 ? 69.247  36.229  32.164  1.00 56.56 ? 207 LYS A CE  1 
ATOM   1028 N NZ  . LYS A 1 185 ? 68.854  37.560  32.711  1.00 49.03 ? 207 LYS A NZ  1 
ATOM   1029 N N   . GLU A 1 186 ? 70.902  33.084  27.051  1.00 26.41 ? 208 GLU A N   1 
ATOM   1030 C CA  . GLU A 1 186 ? 70.118  32.960  25.825  1.00 33.54 ? 208 GLU A CA  1 
ATOM   1031 C C   . GLU A 1 186 ? 69.745  31.506  25.549  1.00 35.27 ? 208 GLU A C   1 
ATOM   1032 O O   . GLU A 1 186 ? 68.649  31.225  25.050  1.00 33.47 ? 208 GLU A O   1 
ATOM   1033 C CB  . GLU A 1 186 ? 70.888  33.553  24.644  1.00 32.49 ? 208 GLU A CB  1 
ATOM   1034 C CG  . GLU A 1 186 ? 70.773  35.067  24.513  1.00 29.42 ? 208 GLU A CG  1 
ATOM   1035 C CD  . GLU A 1 186 ? 71.640  35.632  23.395  1.00 30.45 ? 208 GLU A CD  1 
ATOM   1036 O OE1 . GLU A 1 186 ? 72.714  35.059  23.118  1.00 32.34 ? 208 GLU A OE1 1 
ATOM   1037 O OE2 . GLU A 1 186 ? 71.247  36.650  22.790  1.00 32.11 ? 208 GLU A OE2 1 
ATOM   1038 N N   . MET A 1 187 ? 70.636  30.566  25.880  1.00 36.13 ? 209 MET A N   1 
ATOM   1039 C CA  . MET A 1 187 ? 70.352  29.158  25.627  1.00 26.54 ? 209 MET A CA  1 
ATOM   1040 C C   . MET A 1 187 ? 69.218  28.639  26.500  1.00 24.60 ? 209 MET A C   1 
ATOM   1041 O O   . MET A 1 187 ? 68.484  27.737  26.083  1.00 25.66 ? 209 MET A O   1 
ATOM   1042 C CB  . MET A 1 187 ? 71.611  28.321  25.844  1.00 26.31 ? 209 MET A CB  1 
ATOM   1043 C CG  . MET A 1 187 ? 72.273  27.865  24.557  1.00 32.35 ? 209 MET A CG  1 
ATOM   1044 S SD  . MET A 1 187 ? 73.710  26.820  24.855  1.00 49.25 ? 209 MET A SD  1 
ATOM   1045 C CE  . MET A 1 187 ? 74.540  27.769  26.120  1.00 36.08 ? 209 MET A CE  1 
ATOM   1046 N N   . SER A 1 188 ? 69.054  29.195  27.704  1.00 36.40 ? 210 SER A N   1 
ATOM   1047 C CA  . SER A 1 188 ? 68.010  28.718  28.609  1.00 39.44 ? 210 SER A CA  1 
ATOM   1048 C C   . SER A 1 188 ? 66.616  28.946  28.039  1.00 34.64 ? 210 SER A C   1 
ATOM   1049 O O   . SER A 1 188 ? 65.678  28.218  28.384  1.00 29.13 ? 210 SER A O   1 
ATOM   1050 C CB  . SER A 1 188 ? 68.141  29.409  29.966  1.00 28.03 ? 210 SER A CB  1 
ATOM   1051 O OG  . SER A 1 188 ? 68.108  30.815  29.807  1.00 35.72 ? 210 SER A OG  1 
ATOM   1052 N N   . SER A 1 189 ? 66.458  29.947  27.176  1.00 30.55 ? 211 SER A N   1 
ATOM   1053 C CA  . SER A 1 189 ? 65.180  30.252  26.549  1.00 33.36 ? 211 SER A CA  1 
ATOM   1054 C C   . SER A 1 189 ? 65.201  29.967  25.050  1.00 34.60 ? 211 SER A C   1 
ATOM   1055 O O   . SER A 1 189 ? 64.493  30.616  24.275  1.00 34.88 ? 211 SER A O   1 
ATOM   1056 C CB  . SER A 1 189 ? 64.793  31.703  26.818  1.00 36.33 ? 211 SER A CB  1 
ATOM   1057 O OG  . SER A 1 189 ? 65.938  32.535  26.832  1.00 42.60 ? 211 SER A OG  1 
ATOM   1058 N N   . SER A 1 190 ? 66.004  28.995  24.632  1.00 30.06 ? 212 SER A N   1 
ATOM   1059 C CA  . SER A 1 190 ? 66.129  28.633  23.228  1.00 30.35 ? 212 SER A CA  1 
ATOM   1060 C C   . SER A 1 190 ? 65.361  27.350  22.949  1.00 23.83 ? 212 SER A C   1 
ATOM   1061 O O   . SER A 1 190 ? 65.442  26.387  23.716  1.00 28.75 ? 212 SER A O   1 
ATOM   1062 C CB  . SER A 1 190 ? 67.596  28.451  22.838  1.00 28.39 ? 212 SER A CB  1 
ATOM   1063 O OG  . SER A 1 190 ? 67.707  27.925  21.528  1.00 26.38 ? 212 SER A OG  1 
ATOM   1064 N N   . THR A 1 191 ? 64.620  27.340  21.846  1.00 17.92 ? 213 THR A N   1 
ATOM   1065 C CA  . THR A 1 191 ? 63.900  26.146  21.432  1.00 19.59 ? 213 THR A CA  1 
ATOM   1066 C C   . THR A 1 191 ? 64.754  25.204  20.597  1.00 17.86 ? 213 THR A C   1 
ATOM   1067 O O   . THR A 1 191 ? 64.236  24.198  20.105  1.00 17.94 ? 213 THR A O   1 
ATOM   1068 C CB  . THR A 1 191 ? 62.640  26.522  20.646  1.00 22.25 ? 213 THR A CB  1 
ATOM   1069 O OG1 . THR A 1 191 ? 62.965  27.500  19.651  1.00 23.54 ? 213 THR A OG1 1 
ATOM   1070 C CG2 . THR A 1 191 ? 61.585  27.085  21.581  1.00 19.63 ? 213 THR A CG2 1 
ATOM   1071 N N   . LEU A 1 192 ? 66.044  25.491  20.434  1.00 18.69 ? 214 LEU A N   1 
ATOM   1072 C CA  . LEU A 1 192 ? 66.902  24.643  19.618  1.00 15.90 ? 214 LEU A CA  1 
ATOM   1073 C C   . LEU A 1 192 ? 68.352  24.820  20.042  1.00 14.91 ? 214 LEU A C   1 
ATOM   1074 O O   . LEU A 1 192 ? 68.817  25.951  20.207  1.00 17.40 ? 214 LEU A O   1 
ATOM   1075 C CB  . LEU A 1 192 ? 66.731  24.977  18.135  1.00 20.31 ? 214 LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 192 ? 67.844  24.519  17.195  1.00 20.13 ? 214 LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 192 ? 67.735  23.025  16.920  1.00 15.69 ? 214 LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 192 ? 67.782  25.313  15.913  1.00 16.52 ? 214 LEU A CD2 1 
ATOM   1079 N N   . ASN A 1 193 ? 69.059  23.704  20.219  1.00 21.69 ? 215 ASN A N   1 
ATOM   1080 C CA  . ASN A 1 193 ? 70.501  23.684  20.472  1.00 20.12 ? 215 ASN A CA  1 
ATOM   1081 C C   . ASN A 1 193 ? 71.141  22.939  19.300  1.00 17.13 ? 215 ASN A C   1 
ATOM   1082 O O   . ASN A 1 193 ? 71.317  21.719  19.332  1.00 16.06 ? 215 ASN A O   1 
ATOM   1083 C CB  . ASN A 1 193 ? 70.836  23.033  21.822  1.00 13.13 ? 215 ASN A CB  1 
ATOM   1084 C CG  . ASN A 1 193 ? 72.282  23.268  22.241  1.00 17.27 ? 215 ASN A CG  1 
ATOM   1085 O OD1 . ASN A 1 193 ? 73.198  23.188  21.423  1.00 26.48 ? 215 ASN A OD1 1 
ATOM   1086 N ND2 . ASN A 1 193 ? 72.492  23.558  23.520  1.00 20.23 ? 215 ASN A ND2 1 
ATOM   1087 N N   . LEU A 1 194 ? 71.482  23.687  18.259  1.00 19.37 ? 216 LEU A N   1 
ATOM   1088 C CA  . LEU A 1 194 ? 72.038  23.148  17.026  1.00 16.40 ? 216 LEU A CA  1 
ATOM   1089 C C   . LEU A 1 194 ? 73.517  23.499  16.981  1.00 18.24 ? 216 LEU A C   1 
ATOM   1090 O O   . LEU A 1 194 ? 73.877  24.676  17.091  1.00 21.26 ? 216 LEU A O   1 
ATOM   1091 C CB  . LEU A 1 194 ? 71.298  23.723  15.816  1.00 14.95 ? 216 LEU A CB  1 
ATOM   1092 C CG  . LEU A 1 194 ? 71.626  23.309  14.381  1.00 13.35 ? 216 LEU A CG  1 
ATOM   1093 C CD1 . LEU A 1 194 ? 72.729  24.176  13.804  1.00 16.93 ? 216 LEU A CD1 1 
ATOM   1094 C CD2 . LEU A 1 194 ? 71.997  21.848  14.301  1.00 17.42 ? 216 LEU A CD2 1 
ATOM   1095 N N   . VAL A 1 195 ? 74.368  22.487  16.839  1.00 15.80 ? 217 VAL A N   1 
ATOM   1096 C CA  . VAL A 1 195 ? 75.800  22.686  16.645  1.00 17.87 ? 217 VAL A CA  1 
ATOM   1097 C C   . VAL A 1 195 ? 76.156  22.153  15.265  1.00 19.11 ? 217 VAL A C   1 
ATOM   1098 O O   . VAL A 1 195 ? 75.887  20.986  14.951  1.00 16.80 ? 217 VAL A O   1 
ATOM   1099 C CB  . VAL A 1 195 ? 76.634  22.002  17.738  1.00 18.21 ? 217 VAL A CB  1 
ATOM   1100 C CG1 . VAL A 1 195 ? 78.121  22.171  17.444  1.00 10.91 ? 217 VAL A CG1 1 
ATOM   1101 C CG2 . VAL A 1 195 ? 76.291  22.577  19.106  1.00 15.46 ? 217 VAL A CG2 1 
ATOM   1102 N N   . VAL A 1 196 ? 76.753  23.009  14.439  1.00 14.43 ? 218 VAL A N   1 
ATOM   1103 C CA  . VAL A 1 196 ? 77.115  22.663  13.072  1.00 15.08 ? 218 VAL A CA  1 
ATOM   1104 C C   . VAL A 1 196 ? 78.586  22.985  12.861  1.00 12.83 ? 218 VAL A C   1 
ATOM   1105 O O   . VAL A 1 196 ? 79.078  24.020  13.321  1.00 15.12 ? 218 VAL A O   1 
ATOM   1106 C CB  . VAL A 1 196 ? 76.233  23.409  12.043  1.00 19.66 ? 218 VAL A CB  1 
ATOM   1107 C CG1 . VAL A 1 196 ? 76.289  24.907  12.275  1.00 18.14 ? 218 VAL A CG1 1 
ATOM   1108 C CG2 . VAL A 1 196 ? 76.660  23.082  10.620  1.00 13.97 ? 218 VAL A CG2 1 
ATOM   1109 N N   . ALA A 1 197 ? 79.292  22.091  12.179  1.00 14.45 ? 219 ALA A N   1 
ATOM   1110 C CA  . ALA A 1 197 ? 80.669  22.322  11.770  1.00 14.51 ? 219 ALA A CA  1 
ATOM   1111 C C   . ALA A 1 197 ? 80.733  22.239  10.254  1.00 17.91 ? 219 ALA A C   1 
ATOM   1112 O O   . ALA A 1 197 ? 80.244  21.271  9.660   1.00 14.30 ? 219 ALA A O   1 
ATOM   1113 C CB  . ALA A 1 197 ? 81.628  21.314  12.409  1.00 15.06 ? 219 ALA A CB  1 
ATOM   1114 N N   . GLY A 1 198 ? 81.321  23.260  9.634   1.00 21.72 ? 220 GLY A N   1 
ATOM   1115 C CA  . GLY A 1 198 ? 81.340  23.358  8.190   1.00 18.31 ? 220 GLY A CA  1 
ATOM   1116 C C   . GLY A 1 198 ? 82.721  23.314  7.569   1.00 19.69 ? 220 GLY A C   1 
ATOM   1117 O O   . GLY A 1 198 ? 83.657  23.964  8.045   1.00 18.50 ? 220 GLY A O   1 
ATOM   1118 N N   . ALA A 1 199 ? 82.853  22.537  6.508   1.00 21.83 ? 221 ALA A N   1 
ATOM   1119 C CA  . ALA A 1 199 ? 84.041  22.483  5.676   1.00 19.68 ? 221 ALA A CA  1 
ATOM   1120 C C   . ALA A 1 199 ? 83.938  23.523  4.568   1.00 21.61 ? 221 ALA A C   1 
ATOM   1121 O O   . ALA A 1 199 ? 82.854  24.054  4.306   1.00 20.88 ? 221 ALA A O   1 
ATOM   1122 C CB  . ALA A 1 199 ? 84.199  21.083  5.084   1.00 22.53 ? 221 ALA A CB  1 
ATOM   1123 N N   . PRO A 1 200 ? 85.049  23.856  3.909   1.00 19.71 ? 222 PRO A N   1 
ATOM   1124 C CA  . PRO A 1 200 ? 84.988  24.830  2.814   1.00 21.72 ? 222 PRO A CA  1 
ATOM   1125 C C   . PRO A 1 200 ? 83.981  24.421  1.748   1.00 25.27 ? 222 PRO A C   1 
ATOM   1126 O O   . PRO A 1 200 ? 83.608  23.252  1.620   1.00 25.05 ? 222 PRO A O   1 
ATOM   1127 C CB  . PRO A 1 200 ? 86.415  24.829  2.258   1.00 21.53 ? 222 PRO A CB  1 
ATOM   1128 C CG  . PRO A 1 200 ? 87.255  24.422  3.405   1.00 24.12 ? 222 PRO A CG  1 
ATOM   1129 C CD  . PRO A 1 200 ? 86.436  23.457  4.210   1.00 21.24 ? 222 PRO A CD  1 
ATOM   1130 N N   . LYS A 1 201 ? 83.538  25.421  0.978   1.00 27.94 ? 223 LYS A N   1 
ATOM   1131 C CA  . LYS A 1 201 ? 82.496  25.257  -0.040  1.00 22.10 ? 223 LYS A CA  1 
ATOM   1132 C C   . LYS A 1 201 ? 81.161  24.843  0.579   1.00 21.18 ? 223 LYS A C   1 
ATOM   1133 O O   . LYS A 1 201 ? 80.394  24.086  -0.025  1.00 20.09 ? 223 LYS A O   1 
ATOM   1134 C CB  . LYS A 1 201 ? 82.919  24.263  -1.128  1.00 21.22 ? 223 LYS A CB  1 
ATOM   1135 C CG  . LYS A 1 201 ? 84.073  24.742  -1.996  1.00 24.51 ? 223 LYS A CG  1 
ATOM   1136 C CD  . LYS A 1 201 ? 84.462  23.691  -3.030  1.00 37.35 ? 223 LYS A CD  1 
ATOM   1137 C CE  . LYS A 1 201 ? 85.660  22.867  -2.563  1.00 52.65 ? 223 LYS A CE  1 
ATOM   1138 N NZ  . LYS A 1 201 ? 85.967  21.722  -3.472  1.00 41.88 ? 223 LYS A NZ  1 
ATOM   1139 N N   . SER A 1 202 ? 80.889  25.338  1.791   1.00 24.88 ? 224 SER A N   1 
ATOM   1140 C CA  . SER A 1 202 ? 79.606  25.159  2.480   1.00 23.25 ? 224 SER A CA  1 
ATOM   1141 C C   . SER A 1 202 ? 79.219  23.685  2.603   1.00 23.53 ? 224 SER A C   1 
ATOM   1142 O O   . SER A 1 202 ? 78.079  23.292  2.346   1.00 20.63 ? 224 SER A O   1 
ATOM   1143 C CB  . SER A 1 202 ? 78.500  25.955  1.788   1.00 22.08 ? 224 SER A CB  1 
ATOM   1144 O OG  . SER A 1 202 ? 78.513  27.302  2.220   1.00 25.57 ? 224 SER A OG  1 
ATOM   1145 N N   . GLN A 1 203 ? 80.186  22.867  3.008   1.00 23.73 ? 225 GLN A N   1 
ATOM   1146 C CA  . GLN A 1 203 ? 79.970  21.448  3.250   1.00 17.09 ? 225 GLN A CA  1 
ATOM   1147 C C   . GLN A 1 203 ? 79.828  21.194  4.744   1.00 18.65 ? 225 GLN A C   1 
ATOM   1148 O O   . GLN A 1 203 ? 80.544  21.788  5.556   1.00 19.63 ? 225 GLN A O   1 
ATOM   1149 C CB  . GLN A 1 203 ? 81.123  20.620  2.686   1.00 20.31 ? 225 GLN A CB  1 
ATOM   1150 C CG  . GLN A 1 203 ? 81.405  20.872  1.218   1.00 20.28 ? 225 GLN A CG  1 
ATOM   1151 C CD  . GLN A 1 203 ? 80.415  20.171  0.307   1.00 18.85 ? 225 GLN A CD  1 
ATOM   1152 O OE1 . GLN A 1 203 ? 79.272  20.597  0.182   1.00 17.64 ? 225 GLN A OE1 1 
ATOM   1153 N NE2 . GLN A 1 203 ? 80.851  19.082  -0.326  1.00 25.52 ? 225 GLN A NE2 1 
ATOM   1154 N N   . ILE A 1 204 ? 78.902  20.307  5.103   1.00 21.98 ? 226 ILE A N   1 
ATOM   1155 C CA  . ILE A 1 204 ? 78.619  19.976  6.497   1.00 19.10 ? 226 ILE A CA  1 
ATOM   1156 C C   . ILE A 1 204 ? 79.392  18.720  6.878   1.00 20.57 ? 226 ILE A C   1 
ATOM   1157 O O   . ILE A 1 204 ? 79.308  17.696  6.186   1.00 16.23 ? 226 ILE A O   1 
ATOM   1158 C CB  . ILE A 1 204 ? 77.112  19.776  6.725   1.00 15.22 ? 226 ILE A CB  1 
ATOM   1159 C CG1 . ILE A 1 204 ? 76.333  21.011  6.273   1.00 15.17 ? 226 ILE A CG1 1 
ATOM   1160 C CG2 . ILE A 1 204 ? 76.834  19.457  8.185   1.00 15.65 ? 226 ILE A CG2 1 
ATOM   1161 C CD1 . ILE A 1 204 ? 74.842  20.890  6.482   1.00 18.56 ? 226 ILE A CD1 1 
ATOM   1162 N N   . VAL A 1 205 ? 80.137  18.790  7.982   1.00 17.75 ? 227 VAL A N   1 
ATOM   1163 C CA  . VAL A 1 205 ? 80.869  17.638  8.480   1.00 18.32 ? 227 VAL A CA  1 
ATOM   1164 C C   . VAL A 1 205 ? 80.282  17.090  9.778   1.00 16.80 ? 227 VAL A C   1 
ATOM   1165 O O   . VAL A 1 205 ? 80.388  15.883  10.027  1.00 17.99 ? 227 VAL A O   1 
ATOM   1166 C CB  . VAL A 1 205 ? 82.368  17.964  8.656   1.00 14.52 ? 227 VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 205 ? 82.967  18.434  7.341   1.00 16.86 ? 227 VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 205 ? 82.564  19.016  9.719   1.00 18.93 ? 227 VAL A CG2 1 
ATOM   1169 N N   . MET A 1 206 ? 79.659  17.929  10.604  1.00 18.07 ? 228 MET A N   1 
ATOM   1170 C CA  . MET A 1 206 ? 79.142  17.489  11.893  1.00 19.52 ? 228 MET A CA  1 
ATOM   1171 C C   . MET A 1 206 ? 77.848  18.230  12.188  1.00 17.54 ? 228 MET A C   1 
ATOM   1172 O O   . MET A 1 206 ? 77.799  19.459  12.088  1.00 19.66 ? 228 MET A O   1 
ATOM   1173 C CB  . MET A 1 206 ? 80.163  17.733  13.013  1.00 14.59 ? 228 MET A CB  1 
ATOM   1174 C CG  . MET A 1 206 ? 79.756  17.142  14.357  1.00 18.99 ? 228 MET A CG  1 
ATOM   1175 S SD  . MET A 1 206 ? 78.635  18.218  15.276  1.00 16.46 ? 228 MET A SD  1 
ATOM   1176 C CE  . MET A 1 206 ? 79.468  19.791  15.074  1.00 15.00 ? 228 MET A CE  1 
ATOM   1177 N N   . LEU A 1 207 ? 76.816  17.482  12.578  1.00 18.13 ? 229 LEU A N   1 
ATOM   1178 C CA  . LEU A 1 207 ? 75.502  18.044  12.880  1.00 17.81 ? 229 LEU A CA  1 
ATOM   1179 C C   . LEU A 1 207 ? 74.966  17.360  14.129  1.00 22.38 ? 229 LEU A C   1 
ATOM   1180 O O   . LEU A 1 207 ? 74.637  16.170  14.092  1.00 25.82 ? 229 LEU A O   1 
ATOM   1181 C CB  . LEU A 1 207 ? 74.537  17.860  11.710  1.00 16.38 ? 229 LEU A CB  1 
ATOM   1182 C CG  . LEU A 1 207 ? 74.318  19.053  10.789  1.00 17.43 ? 229 LEU A CG  1 
ATOM   1183 C CD1 . LEU A 1 207 ? 73.226  18.742  9.773   1.00 15.40 ? 229 LEU A CD1 1 
ATOM   1184 C CD2 . LEU A 1 207 ? 73.969  20.279  11.609  1.00 21.68 ? 229 LEU A CD2 1 
ATOM   1185 N N   . GLU A 1 208 ? 74.873  18.108  15.225  1.00 23.43 ? 230 GLU A N   1 
ATOM   1186 C CA  . GLU A 1 208 ? 74.320  17.617  16.480  1.00 25.94 ? 230 GLU A CA  1 
ATOM   1187 C C   . GLU A 1 208 ? 73.290  18.625  16.965  1.00 22.52 ? 230 GLU A C   1 
ATOM   1188 O O   . GLU A 1 208 ? 73.590  19.819  17.060  1.00 25.39 ? 230 GLU A O   1 
ATOM   1189 C CB  . GLU A 1 208 ? 75.418  17.416  17.535  1.00 26.52 ? 230 GLU A CB  1 
ATOM   1190 C CG  . GLU A 1 208 ? 75.580  15.979  18.020  1.00 33.54 ? 230 GLU A CG  1 
ATOM   1191 C CD  . GLU A 1 208 ? 74.460  15.551  18.943  1.00 44.65 ? 230 GLU A CD  1 
ATOM   1192 O OE1 . GLU A 1 208 ? 74.133  14.343  18.978  1.00 44.48 ? 230 GLU A OE1 1 
ATOM   1193 O OE2 . GLU A 1 208 ? 73.902  16.430  19.635  1.00 42.87 ? 230 GLU A OE2 1 
ATOM   1194 N N   . ALA A 1 209 ? 72.082  18.155  17.265  1.00 17.86 ? 231 ALA A N   1 
ATOM   1195 C CA  . ALA A 1 209 ? 71.020  19.073  17.636  1.00 15.33 ? 231 ALA A CA  1 
ATOM   1196 C C   . ALA A 1 209 ? 70.033  18.409  18.584  1.00 22.88 ? 231 ALA A C   1 
ATOM   1197 O O   . ALA A 1 209 ? 69.770  17.204  18.501  1.00 19.00 ? 231 ALA A O   1 
ATOM   1198 C CB  . ALA A 1 209 ? 70.271  19.587  16.404  1.00 21.18 ? 231 ALA A CB  1 
ATOM   1199 N N   . SER A 1 210 ? 69.494  19.225  19.488  1.00 21.71 ? 232 SER A N   1 
ATOM   1200 C CA  . SER A 1 210 ? 68.315  18.904  20.280  1.00 22.97 ? 232 SER A CA  1 
ATOM   1201 C C   . SER A 1 210 ? 67.355  20.075  20.140  1.00 21.75 ? 232 SER A C   1 
ATOM   1202 O O   . SER A 1 210 ? 67.779  21.232  20.206  1.00 25.56 ? 232 SER A O   1 
ATOM   1203 C CB  . SER A 1 210 ? 68.669  18.669  21.753  1.00 20.34 ? 232 SER A CB  1 
ATOM   1204 O OG  . SER A 1 210 ? 68.860  19.898  22.432  1.00 18.93 ? 232 SER A OG  1 
ATOM   1205 N N   . ALA A 1 211 ? 66.074  19.785  19.937  1.00 20.71 ? 233 ALA A N   1 
ATOM   1206 C CA  . ALA A 1 211 ? 65.107  20.833  19.651  1.00 22.97 ? 233 ALA A CA  1 
ATOM   1207 C C   . ALA A 1 211 ? 63.811  20.562  20.398  1.00 23.29 ? 233 ALA A C   1 
ATOM   1208 O O   . ALA A 1 211 ? 63.432  19.411  20.625  1.00 20.69 ? 233 ALA A O   1 
ATOM   1209 C CB  . ALA A 1 211 ? 64.826  20.950  18.143  1.00 21.45 ? 233 ALA A CB  1 
ATOM   1210 N N   . GLU A 1 212 ? 63.124  21.647  20.758  1.00 24.28 ? 234 GLU A N   1 
ATOM   1211 C CA  . GLU A 1 212 ? 61.865  21.576  21.496  1.00 22.59 ? 234 GLU A CA  1 
ATOM   1212 C C   . GLU A 1 212 ? 60.690  21.322  20.548  1.00 19.30 ? 234 GLU A C   1 
ATOM   1213 O O   . GLU A 1 212 ? 59.713  22.068  20.506  1.00 26.23 ? 234 GLU A O   1 
ATOM   1214 C CB  . GLU A 1 212 ? 61.662  22.856  22.295  1.00 24.43 ? 234 GLU A CB  1 
ATOM   1215 C CG  . GLU A 1 212 ? 62.440  22.903  23.595  1.00 27.05 ? 234 GLU A CG  1 
ATOM   1216 C CD  . GLU A 1 212 ? 62.036  21.793  24.543  1.00 39.52 ? 234 GLU A CD  1 
ATOM   1217 O OE1 . GLU A 1 212 ? 62.937  21.187  25.166  1.00 43.40 ? 234 GLU A OE1 1 
ATOM   1218 O OE2 . GLU A 1 212 ? 60.818  21.524  24.660  1.00 43.72 ? 234 GLU A OE2 1 
ATOM   1219 N N   . ASN A 1 213 ? 60.805  20.238  19.776  1.00 22.49 ? 235 ASN A N   1 
ATOM   1220 C CA  . ASN A 1 213 ? 59.772  19.830  18.820  1.00 22.68 ? 235 ASN A CA  1 
ATOM   1221 C C   . ASN A 1 213 ? 59.507  20.912  17.776  1.00 22.36 ? 235 ASN A C   1 
ATOM   1222 O O   . ASN A 1 213 ? 58.379  21.071  17.305  1.00 20.54 ? 235 ASN A O   1 
ATOM   1223 C CB  . ASN A 1 213 ? 58.473  19.450  19.540  1.00 20.70 ? 235 ASN A CB  1 
ATOM   1224 C CG  . ASN A 1 213 ? 57.609  18.498  18.733  1.00 24.81 ? 235 ASN A CG  1 
ATOM   1225 O OD1 . ASN A 1 213 ? 58.061  17.905  17.753  1.00 26.87 ? 235 ASN A OD1 1 
ATOM   1226 N ND2 . ASN A 1 213 ? 56.355  18.347  19.144  1.00 25.65 ? 235 ASN A ND2 1 
ATOM   1227 N N   . ILE A 1 214 ? 60.548  21.663  17.399  1.00 23.11 ? 236 ILE A N   1 
ATOM   1228 C CA  . ILE A 1 214 ? 60.352  22.796  16.499  1.00 21.79 ? 236 ILE A CA  1 
ATOM   1229 C C   . ILE A 1 214 ? 59.947  22.308  15.112  1.00 23.94 ? 236 ILE A C   1 
ATOM   1230 O O   . ILE A 1 214 ? 60.106  21.135  14.754  1.00 22.84 ? 236 ILE A O   1 
ATOM   1231 C CB  . ILE A 1 214 ? 61.611  23.676  16.432  1.00 19.31 ? 236 ILE A CB  1 
ATOM   1232 C CG1 . ILE A 1 214 ? 62.710  22.989  15.624  1.00 18.54 ? 236 ILE A CG1 1 
ATOM   1233 C CG2 . ILE A 1 214 ? 62.110  23.997  17.823  1.00 19.92 ? 236 ILE A CG2 1 
ATOM   1234 C CD1 . ILE A 1 214 ? 63.966  23.824  15.497  1.00 20.90 ? 236 ILE A CD1 1 
ATOM   1235 N N   . LEU A 1 215 ? 59.409  23.233  14.323  1.00 27.35 ? 237 LEU A N   1 
ATOM   1236 C CA  . LEU A 1 215 ? 58.947  22.902  12.985  1.00 25.38 ? 237 LEU A CA  1 
ATOM   1237 C C   . LEU A 1 215 ? 60.124  22.583  12.070  1.00 19.59 ? 237 LEU A C   1 
ATOM   1238 O O   . LEU A 1 215 ? 61.239  23.081  12.250  1.00 18.20 ? 237 LEU A O   1 
ATOM   1239 C CB  . LEU A 1 215 ? 58.130  24.054  12.400  1.00 25.52 ? 237 LEU A CB  1 
ATOM   1240 C CG  . LEU A 1 215 ? 56.634  24.069  12.708  1.00 13.22 ? 237 LEU A CG  1 
ATOM   1241 C CD1 . LEU A 1 215 ? 55.954  25.135  11.885  1.00 17.90 ? 237 LEU A CD1 1 
ATOM   1242 C CD2 . LEU A 1 215 ? 56.020  22.713  12.428  1.00 22.49 ? 237 LEU A CD2 1 
ATOM   1243 N N   . GLN A 1 216 ? 59.857  21.739  11.074  1.00 20.90 ? 238 GLN A N   1 
ATOM   1244 C CA  . GLN A 1 216 ? 60.901  21.316  10.147  1.00 24.05 ? 238 GLN A CA  1 
ATOM   1245 C C   . GLN A 1 216 ? 61.538  22.509  9.443   1.00 26.33 ? 238 GLN A C   1 
ATOM   1246 O O   . GLN A 1 216 ? 62.762  22.678  9.468   1.00 24.89 ? 238 GLN A O   1 
ATOM   1247 C CB  . GLN A 1 216 ? 60.314  20.339  9.133   1.00 23.42 ? 238 GLN A CB  1 
ATOM   1248 C CG  . GLN A 1 216 ? 61.326  19.677  8.238   1.00 17.62 ? 238 GLN A CG  1 
ATOM   1249 C CD  . GLN A 1 216 ? 60.773  18.416  7.623   1.00 26.82 ? 238 GLN A CD  1 
ATOM   1250 O OE1 . GLN A 1 216 ? 60.337  17.510  8.339   1.00 26.12 ? 238 GLN A OE1 1 
ATOM   1251 N NE2 . GLN A 1 216 ? 60.768  18.350  6.291   1.00 22.14 ? 238 GLN A NE2 1 
ATOM   1252 N N   . GLN A 1 217 ? 60.717  23.355  8.811   1.00 26.18 ? 239 GLN A N   1 
ATOM   1253 C CA  . GLN A 1 217 ? 61.260  24.500  8.089   1.00 20.19 ? 239 GLN A CA  1 
ATOM   1254 C C   . GLN A 1 217 ? 62.060  25.412  9.010   1.00 22.66 ? 239 GLN A C   1 
ATOM   1255 O O   . GLN A 1 217 ? 63.006  26.068  8.559   1.00 29.51 ? 239 GLN A O   1 
ATOM   1256 C CB  . GLN A 1 217 ? 60.136  25.273  7.393   1.00 22.54 ? 239 GLN A CB  1 
ATOM   1257 C CG  . GLN A 1 217 ? 58.971  25.669  8.290   1.00 29.87 ? 239 GLN A CG  1 
ATOM   1258 C CD  . GLN A 1 217 ? 57.821  24.674  8.243   1.00 28.11 ? 239 GLN A CD  1 
ATOM   1259 O OE1 . GLN A 1 217 ? 58.031  23.464  8.133   1.00 28.68 ? 239 GLN A OE1 1 
ATOM   1260 N NE2 . GLN A 1 217 ? 56.597  25.183  8.329   1.00 25.37 ? 239 GLN A NE2 1 
ATOM   1261 N N   . ASP A 1 218 ? 61.713  25.455  10.300  1.00 21.36 ? 240 ASP A N   1 
ATOM   1262 C CA  . ASP A 1 218 ? 62.528  26.200  11.256  1.00 24.33 ? 240 ASP A CA  1 
ATOM   1263 C C   . ASP A 1 218 ? 63.855  25.496  11.503  1.00 25.24 ? 240 ASP A C   1 
ATOM   1264 O O   . ASP A 1 218 ? 64.907  26.144  11.573  1.00 24.12 ? 240 ASP A O   1 
ATOM   1265 C CB  . ASP A 1 218 ? 61.774  26.381  12.574  1.00 26.45 ? 240 ASP A CB  1 
ATOM   1266 C CG  . ASP A 1 218 ? 60.737  27.485  12.512  1.00 32.12 ? 240 ASP A CG  1 
ATOM   1267 O OD1 . ASP A 1 218 ? 59.964  27.526  11.531  1.00 26.17 ? 240 ASP A OD1 1 
ATOM   1268 O OD2 . ASP A 1 218 ? 60.691  28.308  13.451  1.00 35.76 ? 240 ASP A OD2 1 
ATOM   1269 N N   . PHE A 1 219 ? 63.823  24.169  11.641  1.00 25.73 ? 241 PHE A N   1 
ATOM   1270 C CA  . PHE A 1 219 ? 65.058  23.415  11.821  1.00 22.25 ? 241 PHE A CA  1 
ATOM   1271 C C   . PHE A 1 219 ? 65.958  23.539  10.598  1.00 21.93 ? 241 PHE A C   1 
ATOM   1272 O O   . PHE A 1 219 ? 67.167  23.765  10.727  1.00 18.61 ? 241 PHE A O   1 
ATOM   1273 C CB  . PHE A 1 219 ? 64.735  21.949  12.105  1.00 17.28 ? 241 PHE A CB  1 
ATOM   1274 C CG  . PHE A 1 219 ? 65.895  21.168  12.638  1.00 18.93 ? 241 PHE A CG  1 
ATOM   1275 C CD1 . PHE A 1 219 ? 66.191  21.176  13.990  1.00 18.51 ? 241 PHE A CD1 1 
ATOM   1276 C CD2 . PHE A 1 219 ? 66.692  20.422  11.789  1.00 20.45 ? 241 PHE A CD2 1 
ATOM   1277 C CE1 . PHE A 1 219 ? 67.264  20.457  14.484  1.00 17.70 ? 241 PHE A CE1 1 
ATOM   1278 C CE2 . PHE A 1 219 ? 67.764  19.700  12.280  1.00 21.23 ? 241 PHE A CE2 1 
ATOM   1279 C CZ  . PHE A 1 219 ? 68.050  19.721  13.631  1.00 15.60 ? 241 PHE A CZ  1 
ATOM   1280 N N   . CYS A 1 220 ? 65.383  23.401  9.401   1.00 19.05 ? 242 CYS A N   1 
ATOM   1281 C CA  . CYS A 1 220 ? 66.167  23.553  8.182   1.00 17.62 ? 242 CYS A CA  1 
ATOM   1282 C C   . CYS A 1 220 ? 66.767  24.949  8.086   1.00 24.75 ? 242 CYS A C   1 
ATOM   1283 O O   . CYS A 1 220 ? 67.918  25.112  7.664   1.00 27.10 ? 242 CYS A O   1 
ATOM   1284 C CB  . CYS A 1 220 ? 65.297  23.269  6.960   1.00 24.42 ? 242 CYS A CB  1 
ATOM   1285 S SG  . CYS A 1 220 ? 64.969  21.531  6.636   1.00 25.46 ? 242 CYS A SG  1 
ATOM   1286 N N   . HIS A 1 221 ? 66.001  25.973  8.473   1.00 21.30 ? 243 HIS A N   1 
ATOM   1287 C CA  . HIS A 1 221 ? 66.506  27.334  8.348   1.00 20.24 ? 243 HIS A CA  1 
ATOM   1288 C C   . HIS A 1 221 ? 67.694  27.576  9.264   1.00 19.99 ? 243 HIS A C   1 
ATOM   1289 O O   . HIS A 1 221 ? 68.602  28.336  8.908   1.00 19.58 ? 243 HIS A O   1 
ATOM   1290 C CB  . HIS A 1 221 ? 65.404  28.349  8.641   1.00 21.22 ? 243 HIS A CB  1 
ATOM   1291 C CG  . HIS A 1 221 ? 65.815  29.761  8.368   1.00 25.29 ? 243 HIS A CG  1 
ATOM   1292 N ND1 . HIS A 1 221 ? 65.922  30.712  9.361   1.00 22.12 ? 243 HIS A ND1 1 
ATOM   1293 C CD2 . HIS A 1 221 ? 66.177  30.376  7.216   1.00 20.90 ? 243 HIS A CD2 1 
ATOM   1294 C CE1 . HIS A 1 221 ? 66.318  31.855  8.830   1.00 25.02 ? 243 HIS A CE1 1 
ATOM   1295 N NE2 . HIS A 1 221 ? 66.482  31.677  7.531   1.00 26.35 ? 243 HIS A NE2 1 
ATOM   1296 N N   . ALA A 1 222 ? 67.708  26.944  10.439  1.00 22.26 ? 244 ALA A N   1 
ATOM   1297 C CA  . ALA A 1 222 ? 68.831  27.113  11.354  1.00 19.06 ? 244 ALA A CA  1 
ATOM   1298 C C   . ALA A 1 222 ? 70.099  26.484  10.792  1.00 19.53 ? 244 ALA A C   1 
ATOM   1299 O O   . ALA A 1 222 ? 71.193  27.047  10.928  1.00 18.22 ? 244 ALA A O   1 
ATOM   1300 C CB  . ALA A 1 222 ? 68.489  26.511  12.713  1.00 18.98 ? 244 ALA A CB  1 
ATOM   1301 N N   . ILE A 1 223 ? 69.969  25.315  10.161  1.00 15.27 ? 245 ILE A N   1 
ATOM   1302 C CA  . ILE A 1 223 ? 71.122  24.667  9.545   1.00 18.76 ? 245 ILE A CA  1 
ATOM   1303 C C   . ILE A 1 223 ? 71.731  25.570  8.483   1.00 20.56 ? 245 ILE A C   1 
ATOM   1304 O O   . ILE A 1 223 ? 72.954  25.744  8.418   1.00 19.27 ? 245 ILE A O   1 
ATOM   1305 C CB  . ILE A 1 223 ? 70.716  23.303  8.960   1.00 24.03 ? 245 ILE A CB  1 
ATOM   1306 C CG1 . ILE A 1 223 ? 70.275  22.352  10.074  1.00 20.80 ? 245 ILE A CG1 1 
ATOM   1307 C CG2 . ILE A 1 223 ? 71.864  22.707  8.167   1.00 23.83 ? 245 ILE A CG2 1 
ATOM   1308 C CD1 . ILE A 1 223 ? 69.750  21.034  9.564   1.00 18.51 ? 245 ILE A CD1 1 
ATOM   1309 N N   . LYS A 1 224 ? 70.886  26.165  7.637   1.00 25.75 ? 246 LYS A N   1 
ATOM   1310 C CA  . LYS A 1 224 ? 71.385  27.071  6.609   1.00 20.82 ? 246 LYS A CA  1 
ATOM   1311 C C   . LYS A 1 224 ? 72.107  28.261  7.229   1.00 16.94 ? 246 LYS A C   1 
ATOM   1312 O O   . LYS A 1 224 ? 73.186  28.648  6.768   1.00 21.69 ? 246 LYS A O   1 
ATOM   1313 C CB  . LYS A 1 224 ? 70.234  27.535  5.717   1.00 22.96 ? 246 LYS A CB  1 
ATOM   1314 C CG  . LYS A 1 224 ? 69.681  26.438  4.819   1.00 24.08 ? 246 LYS A CG  1 
ATOM   1315 C CD  . LYS A 1 224 ? 68.435  26.886  4.073   1.00 32.03 ? 246 LYS A CD  1 
ATOM   1316 C CE  . LYS A 1 224 ? 67.901  25.766  3.187   1.00 37.25 ? 246 LYS A CE  1 
ATOM   1317 N NZ  . LYS A 1 224 ? 66.584  26.097  2.572   1.00 43.58 ? 246 LYS A NZ  1 
ATOM   1318 N N   . VAL A 1 225 ? 71.536  28.844  8.285   1.00 16.30 ? 247 VAL A N   1 
ATOM   1319 C CA  . VAL A 1 225 ? 72.176  29.977  8.947   1.00 18.78 ? 247 VAL A CA  1 
ATOM   1320 C C   . VAL A 1 225 ? 73.517  29.559  9.534   1.00 21.58 ? 247 VAL A C   1 
ATOM   1321 O O   . VAL A 1 225 ? 74.531  30.248  9.361   1.00 22.72 ? 247 VAL A O   1 
ATOM   1322 C CB  . VAL A 1 225 ? 71.249  30.566  10.026  1.00 18.98 ? 247 VAL A CB  1 
ATOM   1323 C CG1 . VAL A 1 225 ? 72.014  31.537  10.916  1.00 13.55 ? 247 VAL A CG1 1 
ATOM   1324 C CG2 . VAL A 1 225 ? 70.055  31.256  9.382   1.00 17.39 ? 247 VAL A CG2 1 
ATOM   1325 N N   . GLY A 1 226 ? 73.544  28.418  10.230  1.00 17.23 ? 248 GLY A N   1 
ATOM   1326 C CA  . GLY A 1 226 ? 74.788  27.959  10.829  1.00 17.14 ? 248 GLY A CA  1 
ATOM   1327 C C   . GLY A 1 226 ? 75.894  27.760  9.808   1.00 22.03 ? 248 GLY A C   1 
ATOM   1328 O O   . GLY A 1 226 ? 77.030  28.199  10.008  1.00 19.01 ? 248 GLY A O   1 
ATOM   1329 N N   . VAL A 1 227 ? 75.569  27.109  8.689   1.00 21.73 ? 249 VAL A N   1 
ATOM   1330 C CA  . VAL A 1 227 ? 76.574  26.845  7.663   1.00 17.24 ? 249 VAL A CA  1 
ATOM   1331 C C   . VAL A 1 227 ? 77.125  28.152  7.104   1.00 21.74 ? 249 VAL A C   1 
ATOM   1332 O O   . VAL A 1 227 ? 78.318  28.254  6.785   1.00 21.99 ? 249 VAL A O   1 
ATOM   1333 C CB  . VAL A 1 227 ? 75.981  25.948  6.561   1.00 16.43 ? 249 VAL A CB  1 
ATOM   1334 C CG1 . VAL A 1 227 ? 76.888  25.915  5.331   1.00 15.86 ? 249 VAL A CG1 1 
ATOM   1335 C CG2 . VAL A 1 227 ? 75.746  24.539  7.104   1.00 14.19 ? 249 VAL A CG2 1 
ATOM   1336 N N   . LYS A 1 228 ? 76.276  29.179  6.995   1.00 21.28 ? 250 LYS A N   1 
ATOM   1337 C CA  . LYS A 1 228 ? 76.757  30.473  6.520   1.00 23.19 ? 250 LYS A CA  1 
ATOM   1338 C C   . LYS A 1 228 ? 77.824  31.034  7.448   1.00 23.01 ? 250 LYS A C   1 
ATOM   1339 O O   . LYS A 1 228 ? 78.828  31.590  6.988   1.00 25.94 ? 250 LYS A O   1 
ATOM   1340 C CB  . LYS A 1 228 ? 75.595  31.460  6.379   1.00 25.18 ? 250 LYS A CB  1 
ATOM   1341 C CG  . LYS A 1 228 ? 74.916  31.428  5.008   1.00 39.19 ? 250 LYS A CG  1 
ATOM   1342 C CD  . LYS A 1 228 ? 73.964  32.606  4.812   1.00 47.19 ? 250 LYS A CD  1 
ATOM   1343 C CE  . LYS A 1 228 ? 73.012  32.376  3.639   1.00 32.74 ? 250 LYS A CE  1 
ATOM   1344 N NZ  . LYS A 1 228 ? 71.682  31.852  4.086   1.00 29.53 ? 250 LYS A NZ  1 
ATOM   1345 N N   . TYR A 1 229 ? 77.639  30.873  8.760   1.00 25.21 ? 251 TYR A N   1 
ATOM   1346 C CA  . TYR A 1 229 ? 78.586  31.426  9.720   1.00 29.37 ? 251 TYR A CA  1 
ATOM   1347 C C   . TYR A 1 229 ? 79.837  30.573  9.883   1.00 22.84 ? 251 TYR A C   1 
ATOM   1348 O O   . TYR A 1 229 ? 80.880  31.102  10.281  1.00 20.06 ? 251 TYR A O   1 
ATOM   1349 C CB  . TYR A 1 229 ? 77.904  31.626  11.075  1.00 26.58 ? 251 TYR A CB  1 
ATOM   1350 C CG  . TYR A 1 229 ? 77.040  32.866  11.113  1.00 32.12 ? 251 TYR A CG  1 
ATOM   1351 C CD1 . TYR A 1 229 ? 77.608  34.131  11.003  1.00 28.86 ? 251 TYR A CD1 1 
ATOM   1352 C CD2 . TYR A 1 229 ? 75.658  32.774  11.242  1.00 30.00 ? 251 TYR A CD2 1 
ATOM   1353 C CE1 . TYR A 1 229 ? 76.829  35.269  11.031  1.00 35.04 ? 251 TYR A CE1 1 
ATOM   1354 C CE2 . TYR A 1 229 ? 74.868  33.907  11.273  1.00 35.01 ? 251 TYR A CE2 1 
ATOM   1355 C CZ  . TYR A 1 229 ? 75.460  35.154  11.166  1.00 40.97 ? 251 TYR A CZ  1 
ATOM   1356 O OH  . TYR A 1 229 ? 74.683  36.293  11.193  1.00 44.55 ? 251 TYR A OH  1 
ATOM   1357 N N   . THR A 1 230 ? 79.766  29.273  9.586   1.00 25.74 ? 252 THR A N   1 
ATOM   1358 C CA  . THR A 1 230 ? 80.989  28.478  9.560   1.00 24.19 ? 252 THR A CA  1 
ATOM   1359 C C   . THR A 1 230 ? 81.922  28.939  8.445   1.00 26.53 ? 252 THR A C   1 
ATOM   1360 O O   . THR A 1 230 ? 83.148  28.889  8.606   1.00 26.89 ? 252 THR A O   1 
ATOM   1361 C CB  . THR A 1 230 ? 80.666  26.990  9.401   1.00 19.15 ? 252 THR A CB  1 
ATOM   1362 O OG1 . THR A 1 230 ? 80.031  26.762  8.138   1.00 16.17 ? 252 THR A OG1 1 
ATOM   1363 C CG2 . THR A 1 230 ? 79.743  26.528  10.510  1.00 17.81 ? 252 THR A CG2 1 
ATOM   1364 N N   . GLN A 1 231 ? 81.366  29.399  7.317   1.00 23.24 ? 253 GLN A N   1 
ATOM   1365 C CA  . GLN A 1 231 ? 82.206  29.884  6.226   1.00 19.86 ? 253 GLN A CA  1 
ATOM   1366 C C   . GLN A 1 231 ? 82.928  31.168  6.616   1.00 23.51 ? 253 GLN A C   1 
ATOM   1367 O O   . GLN A 1 231 ? 84.078  31.382  6.218   1.00 25.13 ? 253 GLN A O   1 
ATOM   1368 C CB  . GLN A 1 231 ? 81.368  30.099  4.965   1.00 17.83 ? 253 GLN A CB  1 
ATOM   1369 C CG  . GLN A 1 231 ? 80.570  28.885  4.520   1.00 15.20 ? 253 GLN A CG  1 
ATOM   1370 C CD  . GLN A 1 231 ? 81.441  27.665  4.294   1.00 20.68 ? 253 GLN A CD  1 
ATOM   1371 O OE1 . GLN A 1 231 ? 82.121  27.551  3.273   1.00 20.62 ? 253 GLN A OE1 1 
ATOM   1372 N NE2 . GLN A 1 231 ? 81.426  26.742  5.251   1.00 21.39 ? 253 GLN A NE2 1 
ATOM   1373 N N   . GLN A 1 232 ? 82.271  32.033  7.396   1.00 24.70 ? 254 GLN A N   1 
ATOM   1374 C CA  . GLN A 1 232 ? 82.926  33.250  7.870   1.00 25.94 ? 254 GLN A CA  1 
ATOM   1375 C C   . GLN A 1 232 ? 84.116  32.921  8.757   1.00 26.32 ? 254 GLN A C   1 
ATOM   1376 O O   . GLN A 1 232 ? 85.131  33.627  8.738   1.00 28.90 ? 254 GLN A O   1 
ATOM   1377 C CB  . GLN A 1 232 ? 81.936  34.130  8.635   1.00 27.22 ? 254 GLN A CB  1 
ATOM   1378 C CG  . GLN A 1 232 ? 80.536  34.159  8.051   1.00 33.28 ? 254 GLN A CG  1 
ATOM   1379 C CD  . GLN A 1 232 ? 80.335  35.308  7.088   1.00 45.91 ? 254 GLN A CD  1 
ATOM   1380 O OE1 . GLN A 1 232 ? 81.299  35.930  6.630   1.00 49.86 ? 254 GLN A OE1 1 
ATOM   1381 N NE2 . GLN A 1 232 ? 79.078  35.598  6.771   1.00 40.29 ? 254 GLN A NE2 1 
ATOM   1382 N N   . ILE A 1 233 ? 84.004  31.858  9.555   1.00 25.06 ? 255 ILE A N   1 
ATOM   1383 C CA  . ILE A 1 233 ? 85.114  31.453  10.408  1.00 26.23 ? 255 ILE A CA  1 
ATOM   1384 C C   . ILE A 1 233 ? 86.248  30.878  9.567   1.00 23.84 ? 255 ILE A C   1 
ATOM   1385 O O   . ILE A 1 233 ? 87.430  31.083  9.871   1.00 25.01 ? 255 ILE A O   1 
ATOM   1386 C CB  . ILE A 1 233 ? 84.622  30.452  11.472  1.00 25.18 ? 255 ILE A CB  1 
ATOM   1387 C CG1 . ILE A 1 233 ? 83.523  31.085  12.330  1.00 18.05 ? 255 ILE A CG1 1 
ATOM   1388 C CG2 . ILE A 1 233 ? 85.781  29.962  12.335  1.00 18.48 ? 255 ILE A CG2 1 
ATOM   1389 C CD1 . ILE A 1 233 ? 82.901  30.141  13.321  1.00 12.19 ? 255 ILE A CD1 1 
ATOM   1390 N N   . ILE A 1 234 ? 85.907  30.166  8.489   1.00 23.99 ? 256 ILE A N   1 
ATOM   1391 C CA  . ILE A 1 234 ? 86.930  29.547  7.650   1.00 31.24 ? 256 ILE A CA  1 
ATOM   1392 C C   . ILE A 1 234 ? 87.803  30.605  6.981   1.00 34.05 ? 256 ILE A C   1 
ATOM   1393 O O   . ILE A 1 234 ? 89.009  30.396  6.794   1.00 32.89 ? 256 ILE A O   1 
ATOM   1394 C CB  . ILE A 1 234 ? 86.270  28.610  6.621   1.00 30.18 ? 256 ILE A CB  1 
ATOM   1395 C CG1 . ILE A 1 234 ? 85.630  27.414  7.330   1.00 21.33 ? 256 ILE A CG1 1 
ATOM   1396 C CG2 . ILE A 1 234 ? 87.285  28.128  5.595   1.00 25.94 ? 256 ILE A CG2 1 
ATOM   1397 C CD1 . ILE A 1 234 ? 84.964  26.432  6.393   1.00 19.26 ? 256 ILE A CD1 1 
ATOM   1398 N N   . GLN A 1 235 ? 87.225  31.755  6.620   1.00 32.08 ? 257 GLN A N   1 
ATOM   1399 C CA  . GLN A 1 235 ? 88.037  32.847  6.091   1.00 26.96 ? 257 GLN A CA  1 
ATOM   1400 C C   . GLN A 1 235 ? 89.012  33.361  7.141   1.00 29.35 ? 257 GLN A C   1 
ATOM   1401 O O   . GLN A 1 235 ? 90.180  33.628  6.837   1.00 37.21 ? 257 GLN A O   1 
ATOM   1402 C CB  . GLN A 1 235 ? 87.142  33.982  5.599   1.00 31.49 ? 257 GLN A CB  1 
ATOM   1403 C CG  . GLN A 1 235 ? 86.010  33.531  4.698   1.00 42.81 ? 257 GLN A CG  1 
ATOM   1404 C CD  . GLN A 1 235 ? 85.014  34.640  4.426   1.00 45.12 ? 257 GLN A CD  1 
ATOM   1405 O OE1 . GLN A 1 235 ? 85.314  35.818  4.626   1.00 44.22 ? 257 GLN A OE1 1 
ATOM   1406 N NE2 . GLN A 1 235 ? 83.820  34.269  3.970   1.00 46.28 ? 257 GLN A NE2 1 
ATOM   1407 N N   . GLY A 1 236 ? 88.551  33.506  8.383   1.00 27.26 ? 258 GLY A N   1 
ATOM   1408 C CA  . GLY A 1 236 ? 89.439  33.959  9.439   1.00 28.57 ? 258 GLY A CA  1 
ATOM   1409 C C   . GLY A 1 236 ? 90.627  33.038  9.632   1.00 30.65 ? 258 GLY A C   1 
ATOM   1410 O O   . GLY A 1 236 ? 91.770  33.494  9.727   1.00 32.61 ? 258 GLY A O   1 
ATOM   1411 N N   . ILE A 1 237 ? 90.377  31.729  9.675   1.00 30.34 ? 259 ILE A N   1 
ATOM   1412 C CA  . ILE A 1 237 ? 91.466  30.776  9.859   1.00 30.96 ? 259 ILE A CA  1 
ATOM   1413 C C   . ILE A 1 237 ? 92.402  30.792  8.658   1.00 35.08 ? 259 ILE A C   1 
ATOM   1414 O O   . ILE A 1 237 ? 93.628  30.762  8.812   1.00 36.08 ? 259 ILE A O   1 
ATOM   1415 C CB  . ILE A 1 237 ? 90.901  29.371  10.129  1.00 25.27 ? 259 ILE A CB  1 
ATOM   1416 C CG1 . ILE A 1 237 ? 89.907  29.434  11.290  1.00 23.02 ? 259 ILE A CG1 1 
ATOM   1417 C CG2 . ILE A 1 237 ? 92.031  28.392  10.428  1.00 22.81 ? 259 ILE A CG2 1 
ATOM   1418 C CD1 . ILE A 1 237 ? 89.199  28.137  11.567  1.00 25.72 ? 259 ILE A CD1 1 
ATOM   1419 N N   . GLN A 1 238 ? 91.843  30.859  7.446   1.00 33.97 ? 260 GLN A N   1 
ATOM   1420 C CA  . GLN A 1 238 ? 92.675  30.905  6.247   1.00 29.71 ? 260 GLN A CA  1 
ATOM   1421 C C   . GLN A 1 238 ? 93.557  32.147  6.230   1.00 35.79 ? 260 GLN A C   1 
ATOM   1422 O O   . GLN A 1 238 ? 94.721  32.086  5.816   1.00 39.90 ? 260 GLN A O   1 
ATOM   1423 C CB  . GLN A 1 238 ? 91.796  30.848  5.001   1.00 20.05 ? 260 GLN A CB  1 
ATOM   1424 C CG  . GLN A 1 238 ? 91.321  29.448  4.677   1.00 26.31 ? 260 GLN A CG  1 
ATOM   1425 C CD  . GLN A 1 238 ? 90.341  29.411  3.524   1.00 34.67 ? 260 GLN A CD  1 
ATOM   1426 O OE1 . GLN A 1 238 ? 89.637  30.388  3.259   1.00 40.16 ? 260 GLN A OE1 1 
ATOM   1427 N NE2 . GLN A 1 238 ? 90.286  28.276  2.831   1.00 34.05 ? 260 GLN A NE2 1 
ATOM   1428 N N   . GLN A 1 239 ? 93.022  33.284  6.681   1.00 33.21 ? 261 GLN A N   1 
ATOM   1429 C CA  . GLN A 1 239 ? 93.838  34.489  6.785   1.00 37.42 ? 261 GLN A CA  1 
ATOM   1430 C C   . GLN A 1 239 ? 94.944  34.312  7.815   1.00 42.08 ? 261 GLN A C   1 
ATOM   1431 O O   . GLN A 1 239 ? 96.088  34.719  7.583   1.00 47.63 ? 261 GLN A O   1 
ATOM   1432 C CB  . GLN A 1 239 ? 92.965  35.692  7.141   1.00 45.91 ? 261 GLN A CB  1 
ATOM   1433 C CG  . GLN A 1 239 ? 92.400  36.428  5.936   1.00 52.22 ? 261 GLN A CG  1 
ATOM   1434 C CD  . GLN A 1 239 ? 91.504  37.585  6.330   1.00 58.11 ? 261 GLN A CD  1 
ATOM   1435 O OE1 . GLN A 1 239 ? 91.451  37.973  7.499   1.00 53.33 ? 261 GLN A OE1 1 
ATOM   1436 N NE2 . GLN A 1 239 ? 90.793  38.142  5.353   1.00 58.84 ? 261 GLN A NE2 1 
ATOM   1437 N N   . LEU A 1 240 ? 94.622  33.701  8.959   1.00 41.02 ? 262 LEU A N   1 
ATOM   1438 C CA  . LEU A 1 240 ? 95.640  33.444  9.971   1.00 35.09 ? 262 LEU A CA  1 
ATOM   1439 C C   . LEU A 1 240 ? 96.700  32.474  9.464   1.00 36.00 ? 262 LEU A C   1 
ATOM   1440 O O   . LEU A 1 240 ? 97.869  32.577  9.853   1.00 38.51 ? 262 LEU A O   1 
ATOM   1441 C CB  . LEU A 1 240 ? 94.984  32.910  11.246  1.00 32.60 ? 262 LEU A CB  1 
ATOM   1442 C CG  . LEU A 1 240 ? 95.889  32.722  12.466  1.00 33.46 ? 262 LEU A CG  1 
ATOM   1443 C CD1 . LEU A 1 240 ? 96.577  34.022  12.827  1.00 40.14 ? 262 LEU A CD1 1 
ATOM   1444 C CD2 . LEU A 1 240 ? 95.098  32.190  13.650  1.00 33.29 ? 262 LEU A CD2 1 
ATOM   1445 N N   . VAL A 1 241 ? 96.319  31.534  8.594   1.00 37.43 ? 263 VAL A N   1 
ATOM   1446 C CA  . VAL A 1 241 ? 97.298  30.615  8.016   1.00 38.38 ? 263 VAL A CA  1 
ATOM   1447 C C   . VAL A 1 241 ? 98.301  31.374  7.156   1.00 46.24 ? 263 VAL A C   1 
ATOM   1448 O O   . VAL A 1 241 ? 99.510  31.117  7.213   1.00 50.04 ? 263 VAL A O   1 
ATOM   1449 C CB  . VAL A 1 241 ? 96.590  29.510  7.210   1.00 36.26 ? 263 VAL A CB  1 
ATOM   1450 C CG1 . VAL A 1 241 ? 97.613  28.642  6.492   1.00 37.76 ? 263 VAL A CG1 1 
ATOM   1451 C CG2 . VAL A 1 241 ? 95.729  28.659  8.119   1.00 37.35 ? 263 VAL A CG2 1 
ATOM   1452 N N   . LYS A 1 242 ? 97.818  32.321  6.346   1.00 48.70 ? 264 LYS A N   1 
ATOM   1453 C CA  . LYS A 1 242 ? 98.720  33.093  5.497   1.00 48.42 ? 264 LYS A CA  1 
ATOM   1454 C C   . LYS A 1 242 ? 99.555  34.077  6.308   1.00 47.62 ? 264 LYS A C   1 
ATOM   1455 O O   . LYS A 1 242 ? 100.670 34.420  5.900   1.00 50.70 ? 264 LYS A O   1 
ATOM   1456 C CB  . LYS A 1 242 ? 97.926  33.826  4.414   1.00 48.99 ? 264 LYS A CB  1 
ATOM   1457 C CG  . LYS A 1 242 ? 97.327  32.903  3.358   1.00 51.02 ? 264 LYS A CG  1 
ATOM   1458 C CD  . LYS A 1 242 ? 97.278  33.566  1.987   1.00 53.41 ? 264 LYS A CD  1 
ATOM   1459 C CE  . LYS A 1 242 ? 97.303  32.531  0.866   1.00 49.54 ? 264 LYS A CE  1 
ATOM   1460 N NZ  . LYS A 1 242 ? 98.549  31.712  0.883   1.00 50.50 ? 264 LYS A NZ  1 
ATOM   1461 N N   . GLU A 1 243 ? 99.040  34.536  7.451   1.00 48.43 ? 265 GLU A N   1 
ATOM   1462 C CA  . GLU A 1 243 ? 99.809  35.419  8.324   1.00 46.86 ? 265 GLU A CA  1 
ATOM   1463 C C   . GLU A 1 243 ? 100.883 34.646  9.081   1.00 48.07 ? 265 GLU A C   1 
ATOM   1464 O O   . GLU A 1 243 ? 102.046 35.064  9.127   1.00 53.35 ? 265 GLU A O   1 
ATOM   1465 C CB  . GLU A 1 243 ? 98.879  36.138  9.307   1.00 39.41 ? 265 GLU A CB  1 
ATOM   1466 C CG  . GLU A 1 243 ? 98.037  37.253  8.700   1.00 34.92 ? 265 GLU A CG  1 
ATOM   1467 C CD  . GLU A 1 243 ? 97.133  37.921  9.728   1.00 43.13 ? 265 GLU A CD  1 
ATOM   1468 O OE1 . GLU A 1 243 ? 97.393  37.757  10.939  1.00 44.82 ? 265 GLU A OE1 1 
ATOM   1469 O OE2 . GLU A 1 243 ? 96.165  38.607  9.328   1.00 40.56 ? 265 GLU A OE2 1 
ATOM   1470 N N   . THR A 1 244 ? 100.506 33.519  9.689   1.00 46.99 ? 266 THR A N   1 
ATOM   1471 C CA  . THR A 1 244 ? 101.473 32.716  10.430  1.00 45.39 ? 266 THR A CA  1 
ATOM   1472 C C   . THR A 1 244 ? 102.493 32.079  9.497   1.00 50.35 ? 266 THR A C   1 
ATOM   1473 O O   . THR A 1 244 ? 103.696 32.081  9.786   1.00 58.88 ? 266 THR A O   1 
ATOM   1474 C CB  . THR A 1 244 ? 100.747 31.638  11.238  1.00 42.77 ? 266 THR A CB  1 
ATOM   1475 O OG1 . THR A 1 244 ? 100.006 32.249  12.301  1.00 44.37 ? 266 THR A OG1 1 
ATOM   1476 C CG2 . THR A 1 244 ? 101.737 30.636  11.821  1.00 45.39 ? 266 THR A CG2 1 
ATOM   1477 N N   . GLY A 1 245 ? 102.036 31.543  8.368   1.00 47.14 ? 267 GLY A N   1 
ATOM   1478 C CA  . GLY A 1 245 ? 102.893 30.776  7.489   1.00 41.76 ? 267 GLY A CA  1 
ATOM   1479 C C   . GLY A 1 245 ? 102.915 29.321  7.906   1.00 40.41 ? 267 GLY A C   1 
ATOM   1480 O O   . GLY A 1 245 ? 103.377 28.995  9.003   1.00 51.39 ? 267 GLY A O   1 
ATOM   1481 N N   . VAL A 1 246 ? 102.412 28.438  7.047   1.00 38.67 ? 268 VAL A N   1 
ATOM   1482 C CA  . VAL A 1 246 ? 102.248 27.028  7.380   1.00 39.33 ? 268 VAL A CA  1 
ATOM   1483 C C   . VAL A 1 246 ? 102.888 26.185  6.289   1.00 43.53 ? 268 VAL A C   1 
ATOM   1484 O O   . VAL A 1 246 ? 102.577 26.350  5.104   1.00 54.39 ? 268 VAL A O   1 
ATOM   1485 C CB  . VAL A 1 246 ? 100.763 26.653  7.550   1.00 38.11 ? 268 VAL A CB  1 
ATOM   1486 C CG1 . VAL A 1 246 ? 100.586 25.142  7.521   1.00 38.82 ? 268 VAL A CG1 1 
ATOM   1487 C CG2 . VAL A 1 246 ? 100.210 27.241  8.844   1.00 34.29 ? 268 VAL A CG2 1 
ATOM   1488 N N   . THR A 1 247 ? 103.784 25.288  6.689   1.00 40.25 ? 269 THR A N   1 
ATOM   1489 C CA  . THR A 1 247 ? 104.353 24.283  5.801   1.00 44.77 ? 269 THR A CA  1 
ATOM   1490 C C   . THR A 1 247 ? 104.087 22.920  6.421   1.00 48.79 ? 269 THR A C   1 
ATOM   1491 O O   . THR A 1 247 ? 104.571 22.629  7.521   1.00 51.20 ? 269 THR A O   1 
ATOM   1492 C CB  . THR A 1 247 ? 105.853 24.502  5.590   1.00 40.98 ? 269 THR A CB  1 
ATOM   1493 O OG1 . THR A 1 247 ? 106.080 25.844  5.144   1.00 42.52 ? 269 THR A OG1 1 
ATOM   1494 C CG2 . THR A 1 247 ? 106.389 23.532  4.546   1.00 41.73 ? 269 THR A CG2 1 
ATOM   1495 N N   . LYS A 1 248 ? 103.313 22.095  5.725   1.00 44.68 ? 270 LYS A N   1 
ATOM   1496 C CA  . LYS A 1 248 ? 102.860 20.830  6.279   1.00 44.93 ? 270 LYS A CA  1 
ATOM   1497 C C   . LYS A 1 248 ? 103.826 19.703  5.925   1.00 36.73 ? 270 LYS A C   1 
ATOM   1498 O O   . LYS A 1 248 ? 104.551 19.764  4.929   1.00 42.57 ? 270 LYS A O   1 
ATOM   1499 C CB  . LYS A 1 248 ? 101.445 20.512  5.786   1.00 41.49 ? 270 LYS A CB  1 
ATOM   1500 C CG  . LYS A 1 248 ? 100.460 21.656  6.039   1.00 36.84 ? 270 LYS A CG  1 
ATOM   1501 C CD  . LYS A 1 248 ? 99.030  21.169  6.141   1.00 34.50 ? 270 LYS A CD  1 
ATOM   1502 C CE  . LYS A 1 248 ? 98.604  21.033  7.590   1.00 30.51 ? 270 LYS A CE  1 
ATOM   1503 N NZ  . LYS A 1 248 ? 97.986  22.263  8.152   1.00 34.47 ? 270 LYS A NZ  1 
ATOM   1504 N N   . ARG A 1 249 ? 103.833 18.674  6.767   1.00 32.61 ? 271 ARG A N   1 
ATOM   1505 C CA  . ARG A 1 249 ? 104.798 17.595  6.647   1.00 33.72 ? 271 ARG A CA  1 
ATOM   1506 C C   . ARG A 1 249 ? 104.477 16.689  5.460   1.00 34.59 ? 271 ARG A C   1 
ATOM   1507 O O   . ARG A 1 249 ? 103.378 16.707  4.899   1.00 42.76 ? 271 ARG A O   1 
ATOM   1508 C CB  . ARG A 1 249 ? 104.826 16.761  7.929   1.00 30.96 ? 271 ARG A CB  1 
ATOM   1509 C CG  . ARG A 1 249 ? 103.698 15.731  8.012   1.00 32.68 ? 271 ARG A CG  1 
ATOM   1510 C CD  . ARG A 1 249 ? 103.723 14.951  9.319   1.00 25.97 ? 271 ARG A CD  1 
ATOM   1511 N NE  . ARG A 1 249 ? 103.564 15.829  10.474  1.00 26.51 ? 271 ARG A NE  1 
ATOM   1512 C CZ  . ARG A 1 249 ? 103.417 15.400  11.722  1.00 27.54 ? 271 ARG A CZ  1 
ATOM   1513 N NH1 . ARG A 1 249 ? 103.407 14.097  11.977  1.00 29.54 ? 271 ARG A NH1 1 
ATOM   1514 N NH2 . ARG A 1 249 ? 103.281 16.270  12.715  1.00 21.63 ? 271 ARG A NH2 1 
ATOM   1515 N N   . THR A 1 250 ? 105.470 15.887  5.084   1.00 32.53 ? 272 THR A N   1 
ATOM   1516 C CA  . THR A 1 250 ? 105.288 14.768  4.168   1.00 31.62 ? 272 THR A CA  1 
ATOM   1517 C C   . THR A 1 250 ? 105.389 13.484  4.978   1.00 42.24 ? 272 THR A C   1 
ATOM   1518 O O   . THR A 1 250 ? 106.496 13.114  5.402   1.00 48.82 ? 272 THR A O   1 
ATOM   1519 C CB  . THR A 1 250 ? 106.342 14.785  3.058   1.00 37.92 ? 272 THR A CB  1 
ATOM   1520 O OG1 . THR A 1 250 ? 106.102 15.889  2.175   1.00 45.45 ? 272 THR A OG1 1 
ATOM   1521 C CG2 . THR A 1 250 ? 106.309 13.484  2.268   1.00 40.21 ? 272 THR A CG2 1 
ATOM   1522 N N   . PRO A 1 251 ? 104.284 12.792  5.243   1.00 41.25 ? 273 PRO A N   1 
ATOM   1523 C CA  . PRO A 1 251 ? 104.342 11.608  6.109   1.00 44.61 ? 273 PRO A CA  1 
ATOM   1524 C C   . PRO A 1 251 ? 105.158 10.485  5.483   1.00 46.69 ? 273 PRO A C   1 
ATOM   1525 O O   . PRO A 1 251 ? 105.434 10.477  4.281   1.00 45.19 ? 273 PRO A O   1 
ATOM   1526 C CB  . PRO A 1 251 ? 102.869 11.209  6.265   1.00 42.23 ? 273 PRO A CB  1 
ATOM   1527 C CG  . PRO A 1 251 ? 102.168 11.852  5.116   1.00 39.66 ? 273 PRO A CG  1 
ATOM   1528 C CD  . PRO A 1 251 ? 102.905 13.126  4.848   1.00 39.12 ? 273 PRO A CD  1 
ATOM   1529 N N   . GLN A 1 252 ? 105.551 9.532   6.338   1.00 46.88 ? 274 GLN A N   1 
ATOM   1530 C CA  . GLN A 1 252 ? 106.315 8.371   5.889   1.00 48.99 ? 274 GLN A CA  1 
ATOM   1531 C C   . GLN A 1 252 ? 105.596 7.659   4.754   1.00 44.00 ? 274 GLN A C   1 
ATOM   1532 O O   . GLN A 1 252 ? 106.148 7.464   3.666   1.00 46.62 ? 274 GLN A O   1 
ATOM   1533 C CB  . GLN A 1 252 ? 106.528 7.399   7.051   1.00 49.86 ? 274 GLN A CB  1 
ATOM   1534 C CG  . GLN A 1 252 ? 106.963 8.029   8.364   1.00 61.84 ? 274 GLN A CG  1 
ATOM   1535 C CD  . GLN A 1 252 ? 108.312 7.507   8.854   1.00 55.98 ? 274 GLN A CD  1 
ATOM   1536 O OE1 . GLN A 1 252 ? 108.483 6.305   9.075   1.00 52.67 ? 274 GLN A OE1 1 
ATOM   1537 N NE2 . GLN A 1 252 ? 109.273 8.415   9.031   1.00 42.90 ? 274 GLN A NE2 1 
ATOM   1538 N N   . LYS A 1 253 ? 104.358 7.251   5.008   1.00 43.72 ? 275 LYS A N   1 
ATOM   1539 C CA  . LYS A 1 253 ? 103.562 6.485   4.066   1.00 46.22 ? 275 LYS A CA  1 
ATOM   1540 C C   . LYS A 1 253 ? 102.098 6.727   4.399   1.00 39.80 ? 275 LYS A C   1 
ATOM   1541 O O   . LYS A 1 253 ? 101.738 6.850   5.572   1.00 36.90 ? 275 LYS A O   1 
ATOM   1542 C CB  . LYS A 1 253 ? 103.907 4.990   4.151   1.00 51.17 ? 275 LYS A CB  1 
ATOM   1543 C CG  . LYS A 1 253 ? 103.509 4.144   2.943   1.00 47.88 ? 275 LYS A CG  1 
ATOM   1544 C CD  . LYS A 1 253 ? 103.549 2.649   3.273   1.00 41.93 ? 275 LYS A CD  1 
ATOM   1545 C CE  . LYS A 1 253 ? 104.934 2.063   3.033   1.00 48.46 ? 275 LYS A CE  1 
ATOM   1546 N NZ  . LYS A 1 253 ? 104.916 0.574   2.979   1.00 48.42 ? 275 LYS A NZ  1 
ATOM   1547 N N   . LEU A 1 254 ? 101.266 6.818   3.369   1.00 34.90 ? 276 LEU A N   1 
ATOM   1548 C CA  . LEU A 1 254 ? 99.820  6.820   3.541   1.00 31.49 ? 276 LEU A CA  1 
ATOM   1549 C C   . LEU A 1 254 ? 99.340  5.405   3.249   1.00 32.11 ? 276 LEU A C   1 
ATOM   1550 O O   . LEU A 1 254 ? 99.375  4.952   2.100   1.00 37.73 ? 276 LEU A O   1 
ATOM   1551 C CB  . LEU A 1 254 ? 99.154  7.849   2.632   1.00 34.49 ? 276 LEU A CB  1 
ATOM   1552 C CG  . LEU A 1 254 ? 99.332  9.305   3.072   1.00 30.99 ? 276 LEU A CG  1 
ATOM   1553 C CD1 . LEU A 1 254 ? 98.894  10.267  1.976   1.00 33.05 ? 276 LEU A CD1 1 
ATOM   1554 C CD2 . LEU A 1 254 ? 98.579  9.581   4.361   1.00 27.28 ? 276 LEU A CD2 1 
ATOM   1555 N N   . PHE A 1 255 ? 98.909  4.702   4.293   1.00 30.93 ? 277 PHE A N   1 
ATOM   1556 C CA  . PHE A 1 255 ? 98.653  3.266   4.209   1.00 35.19 ? 277 PHE A CA  1 
ATOM   1557 C C   . PHE A 1 255 ? 97.312  3.017   3.517   1.00 35.59 ? 277 PHE A C   1 
ATOM   1558 O O   . PHE A 1 255 ? 96.321  2.588   4.114   1.00 37.16 ? 277 PHE A O   1 
ATOM   1559 C CB  . PHE A 1 255 ? 98.714  2.644   5.595   1.00 38.74 ? 277 PHE A CB  1 
ATOM   1560 C CG  . PHE A 1 255 ? 99.996  2.933   6.319   1.00 43.37 ? 277 PHE A CG  1 
ATOM   1561 C CD1 . PHE A 1 255 ? 101.112 2.135   6.121   1.00 50.17 ? 277 PHE A CD1 1 
ATOM   1562 C CD2 . PHE A 1 255 ? 100.095 4.014   7.178   1.00 38.69 ? 277 PHE A CD2 1 
ATOM   1563 C CE1 . PHE A 1 255 ? 102.299 2.401   6.776   1.00 44.72 ? 277 PHE A CE1 1 
ATOM   1564 C CE2 . PHE A 1 255 ? 101.283 4.284   7.837   1.00 43.68 ? 277 PHE A CE2 1 
ATOM   1565 C CZ  . PHE A 1 255 ? 102.385 3.476   7.635   1.00 40.77 ? 277 PHE A CZ  1 
ATOM   1566 N N   . THR A 1 256 ? 97.303  3.299   2.216   1.00 37.29 ? 278 THR A N   1 
ATOM   1567 C CA  . THR A 1 256 ? 96.192  3.016   1.330   1.00 33.06 ? 278 THR A CA  1 
ATOM   1568 C C   . THR A 1 256 ? 96.618  1.990   0.288   1.00 30.56 ? 278 THR A C   1 
ATOM   1569 O O   . THR A 1 256 ? 97.745  2.056   -0.217  1.00 30.90 ? 278 THR A O   1 
ATOM   1570 C CB  . THR A 1 256 ? 95.703  4.288   0.624   1.00 32.32 ? 278 THR A CB  1 
ATOM   1571 O OG1 . THR A 1 256 ? 96.772  4.848   -0.149  1.00 30.28 ? 278 THR A OG1 1 
ATOM   1572 C CG2 . THR A 1 256 ? 95.234  5.313   1.644   1.00 34.45 ? 278 THR A CG2 1 
ATOM   1573 N N   . PRO A 1 257 ? 95.757  1.032   -0.043  1.00 27.78 ? 279 PRO A N   1 
ATOM   1574 C CA  . PRO A 1 257 ? 96.154  -0.020  -0.984  1.00 23.32 ? 279 PRO A CA  1 
ATOM   1575 C C   . PRO A 1 257 ? 96.442  0.537   -2.367  1.00 22.65 ? 279 PRO A C   1 
ATOM   1576 O O   . PRO A 1 257 ? 95.842  1.518   -2.814  1.00 24.08 ? 279 PRO A O   1 
ATOM   1577 C CB  . PRO A 1 257 ? 94.944  -0.961  -1.000  1.00 26.99 ? 279 PRO A CB  1 
ATOM   1578 C CG  . PRO A 1 257 ? 93.807  -0.139  -0.512  1.00 29.38 ? 279 PRO A CG  1 
ATOM   1579 C CD  . PRO A 1 257 ? 94.390  0.841   0.463   1.00 29.80 ? 279 PRO A CD  1 
ATOM   1580 N N   . SER A 1 258 ? 97.390  -0.103  -3.042  1.00 22.62 ? 280 SER A N   1 
ATOM   1581 C CA  . SER A 1 258 ? 97.817  0.362   -4.345  1.00 23.05 ? 280 SER A CA  1 
ATOM   1582 C C   . SER A 1 258 ? 96.761  0.034   -5.399  1.00 31.69 ? 280 SER A C   1 
ATOM   1583 O O   . SER A 1 258 ? 95.995  -0.924  -5.247  1.00 31.75 ? 280 SER A O   1 
ATOM   1584 C CB  . SER A 1 258 ? 99.148  -0.280  -4.725  1.00 26.60 ? 280 SER A CB  1 
ATOM   1585 O OG  . SER A 1 258 ? 98.965  -1.620  -5.144  1.00 27.38 ? 280 SER A OG  1 
ATOM   1586 N N   . PRO A 1 259 ? 96.696  0.818   -6.480  1.00 31.27 ? 281 PRO A N   1 
ATOM   1587 C CA  . PRO A 1 259 ? 95.751  0.489   -7.562  1.00 33.22 ? 281 PRO A CA  1 
ATOM   1588 C C   . PRO A 1 259 ? 95.933  -0.911  -8.133  1.00 30.19 ? 281 PRO A C   1 
ATOM   1589 O O   . PRO A 1 259 ? 94.937  -1.542  -8.509  1.00 31.90 ? 281 PRO A O   1 
ATOM   1590 C CB  . PRO A 1 259 ? 96.037  1.572   -8.612  1.00 31.92 ? 281 PRO A CB  1 
ATOM   1591 C CG  . PRO A 1 259 ? 96.588  2.717   -7.821  1.00 30.62 ? 281 PRO A CG  1 
ATOM   1592 C CD  . PRO A 1 259 ? 97.384  2.100   -6.711  1.00 21.96 ? 281 PRO A CD  1 
ATOM   1593 N N   . GLU A 1 260 ? 97.168  -1.418  -8.201  1.00 28.17 ? 282 GLU A N   1 
ATOM   1594 C CA  . GLU A 1 260 ? 97.394  -2.760  -8.734  1.00 29.39 ? 282 GLU A CA  1 
ATOM   1595 C C   . GLU A 1 260 ? 96.688  -3.816  -7.894  1.00 31.34 ? 282 GLU A C   1 
ATOM   1596 O O   . GLU A 1 260 ? 95.897  -4.614  -8.412  1.00 31.45 ? 282 GLU A O   1 
ATOM   1597 C CB  . GLU A 1 260 ? 98.892  -3.055  -8.802  1.00 28.70 ? 282 GLU A CB  1 
ATOM   1598 C CG  . GLU A 1 260 ? 99.649  -2.194  -9.791  1.00 45.41 ? 282 GLU A CG  1 
ATOM   1599 C CD  . GLU A 1 260 ? 100.105 -0.885  -9.179  1.00 47.12 ? 282 GLU A CD  1 
ATOM   1600 O OE1 . GLU A 1 260 ? 99.767  -0.627  -8.003  1.00 37.62 ? 282 GLU A OE1 1 
ATOM   1601 O OE2 . GLU A 1 260 ? 100.794 -0.114  -9.876  1.00 49.81 ? 282 GLU A OE2 1 
ATOM   1602 N N   . ILE A 1 261 ? 96.969  -3.842  -6.591  1.00 29.87 ? 283 ILE A N   1 
ATOM   1603 C CA  . ILE A 1 261 ? 96.372  -4.870  -5.746  1.00 31.38 ? 283 ILE A CA  1 
ATOM   1604 C C   . ILE A 1 261 ? 94.862  -4.677  -5.652  1.00 28.82 ? 283 ILE A C   1 
ATOM   1605 O O   . ILE A 1 261 ? 94.110  -5.652  -5.539  1.00 28.96 ? 283 ILE A O   1 
ATOM   1606 C CB  . ILE A 1 261 ? 97.055  -4.881  -4.362  1.00 25.68 ? 283 ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 261 ? 96.529  -6.032  -3.507  1.00 21.26 ? 283 ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 261 ? 96.876  -3.550  -3.650  1.00 29.78 ? 283 ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 261 ? 97.366  -6.298  -2.278  1.00 31.57 ? 283 ILE A CD1 1 
ATOM   1610 N N   . VAL A 1 262 ? 94.387  -3.433  -5.729  1.00 28.54 ? 284 VAL A N   1 
ATOM   1611 C CA  . VAL A 1 262 ? 92.948  -3.196  -5.723  1.00 26.83 ? 284 VAL A CA  1 
ATOM   1612 C C   . VAL A 1 262 ? 92.328  -3.663  -7.035  1.00 25.97 ? 284 VAL A C   1 
ATOM   1613 O O   . VAL A 1 262 ? 91.235  -4.242  -7.051  1.00 25.08 ? 284 VAL A O   1 
ATOM   1614 C CB  . VAL A 1 262 ? 92.656  -1.711  -5.444  1.00 26.52 ? 284 VAL A CB  1 
ATOM   1615 C CG1 . VAL A 1 262 ? 91.222  -1.366  -5.814  1.00 25.57 ? 284 VAL A CG1 1 
ATOM   1616 C CG2 . VAL A 1 262 ? 92.919  -1.392  -3.981  1.00 22.09 ? 284 VAL A CG2 1 
ATOM   1617 N N   . LYS A 1 263 ? 93.020  -3.429  -8.155  1.00 25.34 ? 285 LYS A N   1 
ATOM   1618 C CA  . LYS A 1 263 ? 92.528  -3.911  -9.441  1.00 25.89 ? 285 LYS A CA  1 
ATOM   1619 C C   . LYS A 1 263 ? 92.473  -5.434  -9.470  1.00 26.99 ? 285 LYS A C   1 
ATOM   1620 O O   . LYS A 1 263 ? 91.485  -6.021  -9.928  1.00 25.19 ? 285 LYS A O   1 
ATOM   1621 C CB  . LYS A 1 263 ? 93.410  -3.378  -10.571 1.00 26.01 ? 285 LYS A CB  1 
ATOM   1622 C CG  . LYS A 1 263 ? 92.940  -3.737  -11.974 1.00 28.97 ? 285 LYS A CG  1 
ATOM   1623 C CD  . LYS A 1 263 ? 94.127  -3.949  -12.910 1.00 37.79 ? 285 LYS A CD  1 
ATOM   1624 C CE  . LYS A 1 263 ? 93.688  -4.121  -14.360 1.00 38.42 ? 285 LYS A CE  1 
ATOM   1625 N NZ  . LYS A 1 263 ? 93.583  -2.816  -15.071 1.00 37.50 ? 285 LYS A NZ  1 
ATOM   1626 N N   . TYR A 1 264 ? 93.525  -6.093  -8.980  1.00 26.97 ? 286 TYR A N   1 
ATOM   1627 C CA  . TYR A 1 264 ? 93.519  -7.550  -8.923  1.00 25.97 ? 286 TYR A CA  1 
ATOM   1628 C C   . TYR A 1 264 ? 92.449  -8.060  -7.965  1.00 28.80 ? 286 TYR A C   1 
ATOM   1629 O O   . TYR A 1 264 ? 91.773  -9.055  -8.255  1.00 26.94 ? 286 TYR A O   1 
ATOM   1630 C CB  . TYR A 1 264 ? 94.900  -8.068  -8.517  1.00 29.04 ? 286 TYR A CB  1 
ATOM   1631 C CG  . TYR A 1 264 ? 95.064  -9.555  -8.733  1.00 35.90 ? 286 TYR A CG  1 
ATOM   1632 C CD1 . TYR A 1 264 ? 95.379  -10.064 -9.989  1.00 31.26 ? 286 TYR A CD1 1 
ATOM   1633 C CD2 . TYR A 1 264 ? 94.886  -10.452 -7.686  1.00 33.14 ? 286 TYR A CD2 1 
ATOM   1634 C CE1 . TYR A 1 264 ? 95.521  -11.424 -10.193 1.00 35.58 ? 286 TYR A CE1 1 
ATOM   1635 C CE2 . TYR A 1 264 ? 95.027  -11.813 -7.881  1.00 37.72 ? 286 TYR A CE2 1 
ATOM   1636 C CZ  . TYR A 1 264 ? 95.343  -12.294 -9.136  1.00 38.45 ? 286 TYR A CZ  1 
ATOM   1637 O OH  . TYR A 1 264 ? 95.482  -13.649 -9.333  1.00 36.19 ? 286 TYR A OH  1 
ATOM   1638 N N   . THR A 1 265 ? 92.287  -7.397  -6.815  1.00 24.93 ? 287 THR A N   1 
ATOM   1639 C CA  . THR A 1 265 ? 91.213  -7.760  -5.896  1.00 21.79 ? 287 THR A CA  1 
ATOM   1640 C C   . THR A 1 265 ? 89.857  -7.666  -6.579  1.00 24.51 ? 287 THR A C   1 
ATOM   1641 O O   . THR A 1 265 ? 88.995  -8.531  -6.385  1.00 28.20 ? 287 THR A O   1 
ATOM   1642 C CB  . THR A 1 265 ? 91.240  -6.861  -4.661  1.00 24.62 ? 287 THR A CB  1 
ATOM   1643 O OG1 . THR A 1 265 ? 92.556  -6.850  -4.098  1.00 30.47 ? 287 THR A OG1 1 
ATOM   1644 C CG2 . THR A 1 265 ? 90.256  -7.360  -3.620  1.00 19.12 ? 287 THR A CG2 1 
ATOM   1645 N N   . HIS A 1 266 ? 89.655  -6.622  -7.387  1.00 26.38 ? 288 HIS A N   1 
ATOM   1646 C CA  . HIS A 1 266 ? 88.400  -6.473  -8.117  1.00 27.91 ? 288 HIS A CA  1 
ATOM   1647 C C   . HIS A 1 266 ? 88.216  -7.592  -9.140  1.00 27.63 ? 288 HIS A C   1 
ATOM   1648 O O   . HIS A 1 266 ? 87.100  -8.081  -9.344  1.00 29.37 ? 288 HIS A O   1 
ATOM   1649 C CB  . HIS A 1 266 ? 88.355  -5.098  -8.789  1.00 27.68 ? 288 HIS A CB  1 
ATOM   1650 C CG  . HIS A 1 266 ? 87.010  -4.730  -9.334  1.00 30.64 ? 288 HIS A CG  1 
ATOM   1651 N ND1 . HIS A 1 266 ? 86.639  -4.985  -10.639 1.00 37.72 ? 288 HIS A ND1 1 
ATOM   1652 C CD2 . HIS A 1 266 ? 85.948  -4.123  -8.754  1.00 31.83 ? 288 HIS A CD2 1 
ATOM   1653 C CE1 . HIS A 1 266 ? 85.406  -4.555  -10.837 1.00 33.55 ? 288 HIS A CE1 1 
ATOM   1654 N NE2 . HIS A 1 266 ? 84.964  -4.028  -9.709  1.00 42.47 ? 288 HIS A NE2 1 
ATOM   1655 N N   . LYS A 1 267 ? 89.303  -8.020  -9.785  1.00 29.45 ? 289 LYS A N   1 
ATOM   1656 C CA  . LYS A 1 267 ? 89.218  -9.134  -10.727 1.00 28.71 ? 289 LYS A CA  1 
ATOM   1657 C C   . LYS A 1 267 ? 88.803  -10.428 -10.034 1.00 31.67 ? 289 LYS A C   1 
ATOM   1658 O O   . LYS A 1 267 ? 88.160  -11.287 -10.649 1.00 35.78 ? 289 LYS A O   1 
ATOM   1659 C CB  . LYS A 1 267 ? 90.564  -9.312  -11.434 1.00 28.31 ? 289 LYS A CB  1 
ATOM   1660 C CG  . LYS A 1 267 ? 90.618  -10.450 -12.445 1.00 29.63 ? 289 LYS A CG  1 
ATOM   1661 C CD  . LYS A 1 267 ? 92.060  -10.828 -12.789 1.00 29.36 ? 289 LYS A CD  1 
ATOM   1662 C CE  . LYS A 1 267 ? 92.687  -9.835  -13.764 1.00 45.94 ? 289 LYS A CE  1 
ATOM   1663 N NZ  . LYS A 1 267 ? 93.374  -8.697  -13.074 1.00 40.33 ? 289 LYS A NZ  1 
ATOM   1664 N N   . LEU A 1 268 ? 89.140  -10.579 -8.756  1.00 25.54 ? 290 LEU A N   1 
ATOM   1665 C CA  . LEU A 1 268 ? 88.887  -11.819 -8.036  1.00 27.21 ? 290 LEU A CA  1 
ATOM   1666 C C   . LEU A 1 268 ? 87.520  -11.861 -7.365  1.00 32.49 ? 290 LEU A C   1 
ATOM   1667 O O   . LEU A 1 268 ? 86.907  -12.934 -7.289  1.00 30.26 ? 290 LEU A O   1 
ATOM   1668 C CB  . LEU A 1 268 ? 89.962  -12.030 -6.970  1.00 35.21 ? 290 LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 268 ? 91.109  -12.991 -7.263  1.00 33.47 ? 290 LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 268 ? 91.691  -12.725 -8.635  1.00 26.85 ? 290 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 268 ? 92.167  -12.842 -6.184  1.00 30.83 ? 290 LEU A CD2 1 
ATOM   1672 N N   . ALA A 1 269 ? 87.024  -10.724 -6.875  1.00 29.20 ? 291 ALA A N   1 
ATOM   1673 C CA  . ALA A 1 269 ? 85.872  -10.728 -5.990  1.00 23.59 ? 291 ALA A CA  1 
ATOM   1674 C C   . ALA A 1 269 ? 84.656  -9.967  -6.504  1.00 23.54 ? 291 ALA A C   1 
ATOM   1675 O O   . ALA A 1 269 ? 83.568  -10.157 -5.949  1.00 24.09 ? 291 ALA A O   1 
ATOM   1676 C CB  . ALA A 1 269 ? 86.263  -10.163 -4.617  1.00 22.12 ? 291 ALA A CB  1 
ATOM   1677 N N   . MET A 1 270 ? 84.794  -9.131  -7.540  1.00 24.27 ? 292 MET A N   1 
ATOM   1678 C CA  . MET A 1 270 ? 83.692  -8.259  -7.948  1.00 25.72 ? 292 MET A CA  1 
ATOM   1679 C C   . MET A 1 270 ? 82.422  -9.051  -8.243  1.00 30.05 ? 292 MET A C   1 
ATOM   1680 O O   . MET A 1 270 ? 81.351  -8.745  -7.705  1.00 30.43 ? 292 MET A O   1 
ATOM   1681 C CB  . MET A 1 270 ? 84.085  -7.427  -9.170  1.00 26.46 ? 292 MET A CB  1 
ATOM   1682 C CG  . MET A 1 270 ? 82.944  -6.571  -9.713  1.00 36.04 ? 292 MET A CG  1 
ATOM   1683 S SD  . MET A 1 270 ? 82.192  -7.211  -11.226 1.00 53.84 ? 292 MET A SD  1 
ATOM   1684 C CE  . MET A 1 270 ? 80.551  -6.494  -11.143 1.00 39.45 ? 292 MET A CE  1 
ATOM   1685 N N   . GLU A 1 271 ? 82.519  -10.076 -9.094  1.00 31.55 ? 293 GLU A N   1 
ATOM   1686 C CA  . GLU A 1 271 ? 81.312  -10.775 -9.524  1.00 29.85 ? 293 GLU A CA  1 
ATOM   1687 C C   . GLU A 1 271 ? 80.747  -11.658 -8.417  1.00 29.89 ? 293 GLU A C   1 
ATOM   1688 O O   . GLU A 1 271 ? 79.524  -11.787 -8.289  1.00 33.81 ? 293 GLU A O   1 
ATOM   1689 C CB  . GLU A 1 271 ? 81.594  -11.597 -10.783 1.00 34.28 ? 293 GLU A CB  1 
ATOM   1690 C CG  . GLU A 1 271 ? 81.572  -10.790 -12.083 1.00 29.32 ? 293 GLU A CG  1 
ATOM   1691 C CD  . GLU A 1 271 ? 80.190  -10.262 -12.430 1.00 43.82 ? 293 GLU A CD  1 
ATOM   1692 O OE1 . GLU A 1 271 ? 79.188  -10.861 -11.982 1.00 53.75 ? 293 GLU A OE1 1 
ATOM   1693 O OE2 . GLU A 1 271 ? 80.103  -9.249  -13.159 1.00 47.08 ? 293 GLU A OE2 1 
ATOM   1694 N N   . ARG A 1 272 ? 81.615  -12.269 -7.604  1.00 25.54 ? 294 ARG A N   1 
ATOM   1695 C CA  . ARG A 1 272 ? 81.122  -13.067 -6.484  1.00 25.59 ? 294 ARG A CA  1 
ATOM   1696 C C   . ARG A 1 272 ? 80.454  -12.188 -5.433  1.00 28.02 ? 294 ARG A C   1 
ATOM   1697 O O   . ARG A 1 272 ? 79.436  -12.578 -4.847  1.00 26.34 ? 294 ARG A O   1 
ATOM   1698 C CB  . ARG A 1 272 ? 82.262  -13.876 -5.863  1.00 27.50 ? 294 ARG A CB  1 
ATOM   1699 C CG  . ARG A 1 272 ? 82.699  -15.070 -6.702  1.00 28.40 ? 294 ARG A CG  1 
ATOM   1700 C CD  . ARG A 1 272 ? 83.978  -15.689 -6.172  1.00 20.79 ? 294 ARG A CD  1 
ATOM   1701 N NE  . ARG A 1 272 ? 83.773  -16.309 -4.868  1.00 38.90 ? 294 ARG A NE  1 
ATOM   1702 C CZ  . ARG A 1 272 ? 84.737  -16.878 -4.148  1.00 42.74 ? 294 ARG A CZ  1 
ATOM   1703 N NH1 . ARG A 1 272 ? 85.981  -16.908 -4.611  1.00 38.64 ? 294 ARG A NH1 1 
ATOM   1704 N NH2 . ARG A 1 272 ? 84.454  -17.418 -2.967  1.00 35.14 ? 294 ARG A NH2 1 
ATOM   1705 N N   . LEU A 1 273 ? 81.010  -10.998 -5.185  1.00 25.84 ? 295 LEU A N   1 
ATOM   1706 C CA  . LEU A 1 273 ? 80.396  -10.079 -4.232  1.00 22.04 ? 295 LEU A CA  1 
ATOM   1707 C C   . LEU A 1 273 ? 79.104  -9.498  -4.786  1.00 22.46 ? 295 LEU A C   1 
ATOM   1708 O O   . LEU A 1 273 ? 78.140  -9.292  -4.040  1.00 20.43 ? 295 LEU A O   1 
ATOM   1709 C CB  . LEU A 1 273 ? 81.370  -8.958  -3.877  1.00 20.16 ? 295 LEU A CB  1 
ATOM   1710 C CG  . LEU A 1 273 ? 82.460  -9.289  -2.860  1.00 16.74 ? 295 LEU A CG  1 
ATOM   1711 C CD1 . LEU A 1 273 ? 83.604  -8.297  -2.965  1.00 12.45 ? 295 LEU A CD1 1 
ATOM   1712 C CD2 . LEU A 1 273 ? 81.882  -9.299  -1.460  1.00 20.50 ? 295 LEU A CD2 1 
ATOM   1713 N N   . TYR A 1 274 ? 79.066  -9.222  -6.092  1.00 20.00 ? 296 TYR A N   1 
ATOM   1714 C CA  . TYR A 1 274 ? 77.849  -8.684  -6.688  1.00 24.57 ? 296 TYR A CA  1 
ATOM   1715 C C   . TYR A 1 274 ? 76.686  -9.654  -6.527  1.00 29.22 ? 296 TYR A C   1 
ATOM   1716 O O   . TYR A 1 274 ? 75.557  -9.240  -6.239  1.00 28.77 ? 296 TYR A O   1 
ATOM   1717 C CB  . TYR A 1 274 ? 78.075  -8.360  -8.166  1.00 23.35 ? 296 TYR A CB  1 
ATOM   1718 C CG  . TYR A 1 274 ? 76.835  -7.842  -8.858  1.00 26.19 ? 296 TYR A CG  1 
ATOM   1719 C CD1 . TYR A 1 274 ? 75.950  -8.710  -9.485  1.00 30.09 ? 296 TYR A CD1 1 
ATOM   1720 C CD2 . TYR A 1 274 ? 76.544  -6.487  -8.878  1.00 26.17 ? 296 TYR A CD2 1 
ATOM   1721 C CE1 . TYR A 1 274 ? 74.811  -8.245  -10.110 1.00 24.87 ? 296 TYR A CE1 1 
ATOM   1722 C CE2 . TYR A 1 274 ? 75.405  -6.013  -9.503  1.00 31.49 ? 296 TYR A CE2 1 
ATOM   1723 C CZ  . TYR A 1 274 ? 74.543  -6.898  -10.117 1.00 27.52 ? 296 TYR A CZ  1 
ATOM   1724 O OH  . TYR A 1 274 ? 73.408  -6.432  -10.742 1.00 41.16 ? 296 TYR A OH  1 
ATOM   1725 N N   . ALA A 1 275 ? 76.942  -10.951 -6.717  1.00 29.10 ? 297 ALA A N   1 
ATOM   1726 C CA  . ALA A 1 275 ? 75.883  -11.938 -6.545  1.00 28.51 ? 297 ALA A CA  1 
ATOM   1727 C C   . ALA A 1 275 ? 75.440  -12.034 -5.092  1.00 30.08 ? 297 ALA A C   1 
ATOM   1728 O O   . ALA A 1 275 ? 74.266  -12.312 -4.823  1.00 36.01 ? 297 ALA A O   1 
ATOM   1729 C CB  . ALA A 1 275 ? 76.346  -13.302 -7.056  1.00 30.98 ? 297 ALA A CB  1 
ATOM   1730 N N   . VAL A 1 276 ? 76.354  -11.799 -4.148  1.00 26.51 ? 298 VAL A N   1 
ATOM   1731 C CA  . VAL A 1 276 ? 75.992  -11.846 -2.735  1.00 26.40 ? 298 VAL A CA  1 
ATOM   1732 C C   . VAL A 1 276 ? 75.111  -10.657 -2.368  1.00 32.31 ? 298 VAL A C   1 
ATOM   1733 O O   . VAL A 1 276 ? 74.098  -10.808 -1.674  1.00 40.21 ? 298 VAL A O   1 
ATOM   1734 C CB  . VAL A 1 276 ? 77.258  -11.900 -1.861  1.00 31.88 ? 298 VAL A CB  1 
ATOM   1735 C CG1 . VAL A 1 276 ? 76.908  -11.620 -0.405  1.00 25.68 ? 298 VAL A CG1 1 
ATOM   1736 C CG2 . VAL A 1 276 ? 77.954  -13.250 -2.008  1.00 29.02 ? 298 VAL A CG2 1 
ATOM   1737 N N   . PHE A 1 277 ? 75.474  -9.461  -2.832  1.00 31.71 ? 299 PHE A N   1 
ATOM   1738 C CA  . PHE A 1 277 ? 74.738  -8.248  -2.497  1.00 28.20 ? 299 PHE A CA  1 
ATOM   1739 C C   . PHE A 1 277 ? 73.428  -8.106  -3.260  1.00 26.98 ? 299 PHE A C   1 
ATOM   1740 O O   . PHE A 1 277 ? 72.624  -7.234  -2.914  1.00 30.06 ? 299 PHE A O   1 
ATOM   1741 C CB  . PHE A 1 277 ? 75.611  -7.021  -2.754  1.00 27.61 ? 299 PHE A CB  1 
ATOM   1742 C CG  . PHE A 1 277 ? 76.784  -6.909  -1.829  1.00 21.37 ? 299 PHE A CG  1 
ATOM   1743 C CD1 . PHE A 1 277 ? 76.650  -7.204  -0.482  1.00 24.62 ? 299 PHE A CD1 1 
ATOM   1744 C CD2 . PHE A 1 277 ? 78.019  -6.506  -2.303  1.00 16.62 ? 299 PHE A CD2 1 
ATOM   1745 C CE1 . PHE A 1 277 ? 77.727  -7.098  0.374   1.00 26.61 ? 299 PHE A CE1 1 
ATOM   1746 C CE2 . PHE A 1 277 ? 79.098  -6.399  -1.455  1.00 18.72 ? 299 PHE A CE2 1 
ATOM   1747 C CZ  . PHE A 1 277 ? 78.955  -6.696  -0.115  1.00 24.98 ? 299 PHE A CZ  1 
ATOM   1748 N N   . THR A 1 278 ? 73.197  -8.919  -4.289  1.00 27.09 ? 300 THR A N   1 
ATOM   1749 C CA  . THR A 1 278 ? 71.899  -8.976  -4.943  1.00 31.07 ? 300 THR A CA  1 
ATOM   1750 C C   . THR A 1 278 ? 71.062  -10.165 -4.489  1.00 33.24 ? 300 THR A C   1 
ATOM   1751 O O   . THR A 1 278 ? 69.895  -10.264 -4.882  1.00 40.18 ? 300 THR A O   1 
ATOM   1752 C CB  . THR A 1 278 ? 72.063  -9.022  -6.467  1.00 23.41 ? 300 THR A CB  1 
ATOM   1753 O OG1 . THR A 1 278 ? 72.861  -10.154 -6.827  1.00 33.28 ? 300 THR A OG1 1 
ATOM   1754 C CG2 . THR A 1 278 ? 72.741  -7.760  -6.961  1.00 23.66 ? 300 THR A CG2 1 
ATOM   1755 N N   . ASP A 1 279 ? 71.622  -11.061 -3.678  1.00 32.48 ? 301 ASP A N   1 
ATOM   1756 C CA  . ASP A 1 279 ? 70.874  -12.178 -3.101  1.00 37.50 ? 301 ASP A CA  1 
ATOM   1757 C C   . ASP A 1 279 ? 70.058  -11.642 -1.931  1.00 38.66 ? 301 ASP A C   1 
ATOM   1758 O O   . ASP A 1 279 ? 70.582  -11.434 -0.834  1.00 39.02 ? 301 ASP A O   1 
ATOM   1759 C CB  . ASP A 1 279 ? 71.821  -13.292 -2.666  1.00 36.13 ? 301 ASP A CB  1 
ATOM   1760 C CG  . ASP A 1 279 ? 71.089  -14.511 -2.123  1.00 43.36 ? 301 ASP A CG  1 
ATOM   1761 O OD1 . ASP A 1 279 ? 69.845  -14.565 -2.215  1.00 43.32 ? 301 ASP A OD1 1 
ATOM   1762 O OD2 . ASP A 1 279 ? 71.767  -15.422 -1.602  1.00 47.50 ? 301 ASP A OD2 1 
ATOM   1763 N N   . TYR A 1 280 ? 68.762  -11.432 -2.164  1.00 38.38 ? 302 TYR A N   1 
ATOM   1764 C CA  . TYR A 1 280 ? 67.907  -10.728 -1.216  1.00 38.94 ? 302 TYR A CA  1 
ATOM   1765 C C   . TYR A 1 280 ? 67.468  -11.584 -0.035  1.00 46.20 ? 302 TYR A C   1 
ATOM   1766 O O   . TYR A 1 280 ? 66.885  -11.044 0.912   1.00 50.72 ? 302 TYR A O   1 
ATOM   1767 C CB  . TYR A 1 280 ? 66.674  -10.183 -1.935  1.00 35.02 ? 302 TYR A CB  1 
ATOM   1768 C CG  . TYR A 1 280 ? 67.000  -9.225  -3.056  1.00 35.65 ? 302 TYR A CG  1 
ATOM   1769 C CD1 . TYR A 1 280 ? 68.128  -8.415  -2.998  1.00 39.77 ? 302 TYR A CD1 1 
ATOM   1770 C CD2 . TYR A 1 280 ? 66.182  -9.129  -4.172  1.00 34.26 ? 302 TYR A CD2 1 
ATOM   1771 C CE1 . TYR A 1 280 ? 68.431  -7.535  -4.021  1.00 35.35 ? 302 TYR A CE1 1 
ATOM   1772 C CE2 . TYR A 1 280 ? 66.476  -8.250  -5.201  1.00 35.51 ? 302 TYR A CE2 1 
ATOM   1773 C CZ  . TYR A 1 280 ? 67.601  -7.458  -5.121  1.00 37.52 ? 302 TYR A CZ  1 
ATOM   1774 O OH  . TYR A 1 280 ? 67.897  -6.583  -6.142  1.00 43.73 ? 302 TYR A OH  1 
ATOM   1775 N N   . GLU A 1 281 ? 67.723  -12.891 -0.056  1.00 43.31 ? 303 GLU A N   1 
ATOM   1776 C CA  . GLU A 1 281 ? 67.339  -13.730 1.071   1.00 45.69 ? 303 GLU A CA  1 
ATOM   1777 C C   . GLU A 1 281 ? 68.331  -13.659 2.225   1.00 46.82 ? 303 GLU A C   1 
ATOM   1778 O O   . GLU A 1 281 ? 68.049  -14.202 3.298   1.00 49.77 ? 303 GLU A O   1 
ATOM   1779 C CB  . GLU A 1 281 ? 67.173  -15.185 0.618   1.00 50.51 ? 303 GLU A CB  1 
ATOM   1780 C CG  . GLU A 1 281 ? 66.560  -15.351 -0.770  1.00 59.98 ? 303 GLU A CG  1 
ATOM   1781 C CD  . GLU A 1 281 ? 65.197  -14.681 -0.921  1.00 62.01 ? 303 GLU A CD  1 
ATOM   1782 O OE1 . GLU A 1 281 ? 64.492  -14.493 0.097   1.00 58.78 ? 303 GLU A OE1 1 
ATOM   1783 O OE2 . GLU A 1 281 ? 64.832  -14.342 -2.069  1.00 53.39 ? 303 GLU A OE2 1 
ATOM   1784 N N   . HIS A 1 282 ? 69.474  -13.006 2.031   1.00 44.13 ? 304 HIS A N   1 
ATOM   1785 C CA  . HIS A 1 282 ? 70.474  -12.913 3.084   1.00 38.50 ? 304 HIS A CA  1 
ATOM   1786 C C   . HIS A 1 282 ? 69.949  -12.085 4.247   1.00 40.11 ? 304 HIS A C   1 
ATOM   1787 O O   . HIS A 1 282 ? 69.336  -11.031 4.057   1.00 41.60 ? 304 HIS A O   1 
ATOM   1788 C CB  . HIS A 1 282 ? 71.758  -12.276 2.552   1.00 41.26 ? 304 HIS A CB  1 
ATOM   1789 C CG  . HIS A 1 282 ? 72.679  -13.233 1.860   1.00 39.99 ? 304 HIS A CG  1 
ATOM   1790 N ND1 . HIS A 1 282 ? 73.389  -14.205 2.532   1.00 40.04 ? 304 HIS A ND1 1 
ATOM   1791 C CD2 . HIS A 1 282 ? 73.027  -13.348 0.556   1.00 37.52 ? 304 HIS A CD2 1 
ATOM   1792 C CE1 . HIS A 1 282 ? 74.124  -14.885 1.670   1.00 39.92 ? 304 HIS A CE1 1 
ATOM   1793 N NE2 . HIS A 1 282 ? 73.922  -14.385 0.463   1.00 32.63 ? 304 HIS A NE2 1 
ATOM   1794 N N   . ASP A 1 283 ? 70.195  -12.569 5.455   1.00 39.95 ? 305 ASP A N   1 
ATOM   1795 C CA  . ASP A 1 283 ? 69.996  -11.771 6.648   1.00 42.60 ? 305 ASP A CA  1 
ATOM   1796 C C   . ASP A 1 283 ? 71.359  -11.229 7.084   1.00 39.55 ? 305 ASP A C   1 
ATOM   1797 O O   . ASP A 1 283 ? 72.353  -11.345 6.359   1.00 36.01 ? 305 ASP A O   1 
ATOM   1798 C CB  . ASP A 1 283 ? 69.280  -12.597 7.723   1.00 39.07 ? 305 ASP A CB  1 
ATOM   1799 C CG  . ASP A 1 283 ? 70.223  -13.468 8.530   1.00 47.99 ? 305 ASP A CG  1 
ATOM   1800 O OD1 . ASP A 1 283 ? 70.905  -14.328 7.932   1.00 51.77 ? 305 ASP A OD1 1 
ATOM   1801 O OD2 . ASP A 1 283 ? 70.277  -13.292 9.768   1.00 47.92 ? 305 ASP A OD2 1 
ATOM   1802 N N   . LYS A 1 284 ? 71.414  -10.615 8.267   1.00 34.41 ? 306 LYS A N   1 
ATOM   1803 C CA  . LYS A 1 284 ? 72.649  -9.965  8.699   1.00 35.46 ? 306 LYS A CA  1 
ATOM   1804 C C   . LYS A 1 284 ? 73.811  -10.953 8.758   1.00 37.63 ? 306 LYS A C   1 
ATOM   1805 O O   . LYS A 1 284 ? 74.887  -10.692 8.210   1.00 36.77 ? 306 LYS A O   1 
ATOM   1806 C CB  . LYS A 1 284 ? 72.440  -9.290  10.055  1.00 35.26 ? 306 LYS A CB  1 
ATOM   1807 C CG  . LYS A 1 284 ? 73.718  -8.795  10.713  1.00 29.73 ? 306 LYS A CG  1 
ATOM   1808 C CD  . LYS A 1 284 ? 73.422  -8.166  12.064  1.00 29.37 ? 306 LYS A CD  1 
ATOM   1809 C CE  . LYS A 1 284 ? 74.631  -8.224  12.978  1.00 33.00 ? 306 LYS A CE  1 
ATOM   1810 N NZ  . LYS A 1 284 ? 74.272  -7.849  14.371  1.00 41.42 ? 306 LYS A NZ  1 
ATOM   1811 N N   . VAL A 1 285 ? 73.607  -12.104 9.401   1.00 42.43 ? 307 VAL A N   1 
ATOM   1812 C CA  . VAL A 1 285 ? 74.727  -13.012 9.636   1.00 40.57 ? 307 VAL A CA  1 
ATOM   1813 C C   . VAL A 1 285 ? 75.068  -13.803 8.380   1.00 38.57 ? 307 VAL A C   1 
ATOM   1814 O O   . VAL A 1 285 ? 76.246  -14.030 8.082   1.00 38.04 ? 307 VAL A O   1 
ATOM   1815 C CB  . VAL A 1 285 ? 74.434  -13.945 10.827  1.00 40.23 ? 307 VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 285 ? 74.690  -13.216 12.144  1.00 36.55 ? 307 VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 285 ? 73.012  -14.488 10.758  1.00 45.38 ? 307 VAL A CG2 1 
ATOM   1818 N N   . SER A 1 286 ? 74.055  -14.246 7.630   1.00 39.49 ? 308 SER A N   1 
ATOM   1819 C CA  . SER A 1 286 ? 74.329  -15.069 6.456   1.00 42.80 ? 308 SER A CA  1 
ATOM   1820 C C   . SER A 1 286 ? 75.019  -14.270 5.359   1.00 42.16 ? 308 SER A C   1 
ATOM   1821 O O   . SER A 1 286 ? 75.844  -14.820 4.621   1.00 46.72 ? 308 SER A O   1 
ATOM   1822 C CB  . SER A 1 286 ? 73.036  -15.691 5.927   1.00 37.47 ? 308 SER A CB  1 
ATOM   1823 O OG  . SER A 1 286 ? 72.380  -14.814 5.032   1.00 40.03 ? 308 SER A OG  1 
ATOM   1824 N N   . ARG A 1 287 ? 74.697  -12.982 5.235   1.00 40.24 ? 309 ARG A N   1 
ATOM   1825 C CA  . ARG A 1 287 ? 75.392  -12.137 4.272   1.00 35.29 ? 309 ARG A CA  1 
ATOM   1826 C C   . ARG A 1 287 ? 76.820  -11.854 4.720   1.00 37.87 ? 309 ARG A C   1 
ATOM   1827 O O   . ARG A 1 287 ? 77.744  -11.850 3.897   1.00 35.62 ? 309 ARG A O   1 
ATOM   1828 C CB  . ARG A 1 287 ? 74.618  -10.836 4.071   1.00 37.33 ? 309 ARG A CB  1 
ATOM   1829 C CG  . ARG A 1 287 ? 75.310  -9.811  3.194   1.00 32.13 ? 309 ARG A CG  1 
ATOM   1830 C CD  . ARG A 1 287 ? 74.628  -8.454  3.309   1.00 28.29 ? 309 ARG A CD  1 
ATOM   1831 N NE  . ARG A 1 287 ? 73.196  -8.535  3.029   1.00 25.83 ? 309 ARG A NE  1 
ATOM   1832 C CZ  . ARG A 1 287 ? 72.241  -8.365  3.940   1.00 30.45 ? 309 ARG A CZ  1 
ATOM   1833 N NH1 . ARG A 1 287 ? 72.560  -8.106  5.203   1.00 25.24 ? 309 ARG A NH1 1 
ATOM   1834 N NH2 . ARG A 1 287 ? 70.965  -8.458  3.587   1.00 30.86 ? 309 ARG A NH2 1 
ATOM   1835 N N   . ASP A 1 288 ? 77.021  -11.616 6.022   1.00 33.39 ? 310 ASP A N   1 
ATOM   1836 C CA  . ASP A 1 288 ? 78.374  -11.424 6.536   1.00 38.56 ? 310 ASP A CA  1 
ATOM   1837 C C   . ASP A 1 288 ? 79.216  -12.680 6.347   1.00 39.64 ? 310 ASP A C   1 
ATOM   1838 O O   . ASP A 1 288 ? 80.419  -12.594 6.070   1.00 36.86 ? 310 ASP A O   1 
ATOM   1839 C CB  . ASP A 1 288 ? 78.329  -11.026 8.014   1.00 42.31 ? 310 ASP A CB  1 
ATOM   1840 C CG  . ASP A 1 288 ? 78.047  -9.544  8.221   1.00 42.99 ? 310 ASP A CG  1 
ATOM   1841 O OD1 . ASP A 1 288 ? 77.734  -8.848  7.230   1.00 43.52 ? 310 ASP A OD1 1 
ATOM   1842 O OD2 . ASP A 1 288 ? 78.137  -9.076  9.378   1.00 37.94 ? 310 ASP A OD2 1 
ATOM   1843 N N   . GLU A 1 289 ? 78.599  -13.857 6.485   1.00 42.45 ? 311 GLU A N   1 
ATOM   1844 C CA  . GLU A 1 289 ? 79.331  -15.102 6.281   1.00 45.35 ? 311 GLU A CA  1 
ATOM   1845 C C   . GLU A 1 289 ? 79.704  -15.288 4.816   1.00 45.38 ? 311 GLU A C   1 
ATOM   1846 O O   . GLU A 1 289 ? 80.832  -15.691 4.502   1.00 48.65 ? 311 GLU A O   1 
ATOM   1847 C CB  . GLU A 1 289 ? 78.504  -16.287 6.778   1.00 48.50 ? 311 GLU A CB  1 
ATOM   1848 C CG  . GLU A 1 289 ? 79.308  -17.328 7.549   1.00 68.73 ? 311 GLU A CG  1 
ATOM   1849 C CD  . GLU A 1 289 ? 80.000  -18.337 6.643   1.00 79.00 ? 311 GLU A CD  1 
ATOM   1850 O OE1 . GLU A 1 289 ? 80.833  -19.120 7.150   1.00 77.12 ? 311 GLU A OE1 1 
ATOM   1851 O OE2 . GLU A 1 289 ? 79.714  -18.349 5.426   1.00 77.30 ? 311 GLU A OE2 1 
ATOM   1852 N N   . ALA A 1 290 ? 78.771  -15.003 3.906   1.00 42.99 ? 312 ALA A N   1 
ATOM   1853 C CA  . ALA A 1 290 ? 79.059  -15.149 2.484   1.00 42.80 ? 312 ALA A CA  1 
ATOM   1854 C C   . ALA A 1 290 ? 80.166  -14.201 2.045   1.00 39.95 ? 312 ALA A C   1 
ATOM   1855 O O   . ALA A 1 290 ? 81.020  -14.566 1.228   1.00 36.55 ? 312 ALA A O   1 
ATOM   1856 C CB  . ALA A 1 290 ? 77.792  -14.911 1.664   1.00 40.96 ? 312 ALA A CB  1 
ATOM   1857 N N   . VAL A 1 291 ? 80.169  -12.978 2.580   1.00 43.48 ? 313 VAL A N   1 
ATOM   1858 C CA  . VAL A 1 291 ? 81.210  -12.016 2.235   1.00 38.18 ? 313 VAL A CA  1 
ATOM   1859 C C   . VAL A 1 291 ? 82.559  -12.469 2.779   1.00 36.09 ? 313 VAL A C   1 
ATOM   1860 O O   . VAL A 1 291 ? 83.594  -12.315 2.119   1.00 36.70 ? 313 VAL A O   1 
ATOM   1861 C CB  . VAL A 1 291 ? 80.831  -10.612 2.743   1.00 29.78 ? 313 VAL A CB  1 
ATOM   1862 C CG1 . VAL A 1 291 ? 82.057  -9.707  2.792   1.00 18.72 ? 313 VAL A CG1 1 
ATOM   1863 C CG2 . VAL A 1 291 ? 79.749  -10.004 1.860   1.00 23.47 ? 313 VAL A CG2 1 
ATOM   1864 N N   . ASN A 1 292 ? 82.577  -13.046 3.983   1.00 37.37 ? 314 ASN A N   1 
ATOM   1865 C CA  . ASN A 1 292 ? 83.846  -13.514 4.527   1.00 41.28 ? 314 ASN A CA  1 
ATOM   1866 C C   . ASN A 1 292 ? 84.355  -14.744 3.786   1.00 43.45 ? 314 ASN A C   1 
ATOM   1867 O O   . ASN A 1 292 ? 85.570  -14.912 3.633   1.00 40.58 ? 314 ASN A O   1 
ATOM   1868 C CB  . ASN A 1 292 ? 83.717  -13.803 6.021   1.00 42.64 ? 314 ASN A CB  1 
ATOM   1869 C CG  . ASN A 1 292 ? 84.918  -13.306 6.809   1.00 52.48 ? 314 ASN A CG  1 
ATOM   1870 O OD1 . ASN A 1 292 ? 85.170  -12.102 6.881   1.00 56.47 ? 314 ASN A OD1 1 
ATOM   1871 N ND2 . ASN A 1 292 ? 85.672  -14.232 7.391   1.00 55.70 ? 314 ASN A ND2 1 
ATOM   1872 N N   . LYS A 1 293 ? 83.451  -15.606 3.313   1.00 42.48 ? 315 LYS A N   1 
ATOM   1873 C CA  . LYS A 1 293 ? 83.882  -16.751 2.519   1.00 34.66 ? 315 LYS A CA  1 
ATOM   1874 C C   . LYS A 1 293 ? 84.623  -16.308 1.266   1.00 34.79 ? 315 LYS A C   1 
ATOM   1875 O O   . LYS A 1 293 ? 85.562  -16.983 0.829   1.00 49.67 ? 315 LYS A O   1 
ATOM   1876 C CB  . LYS A 1 293 ? 82.680  -17.621 2.149   1.00 41.53 ? 315 LYS A CB  1 
ATOM   1877 C CG  . LYS A 1 293 ? 83.053  -19.015 1.662   1.00 43.96 ? 315 LYS A CG  1 
ATOM   1878 C CD  . LYS A 1 293 ? 81.851  -19.744 1.079   1.00 41.70 ? 315 LYS A CD  1 
ATOM   1879 C CE  . LYS A 1 293 ? 81.729  -19.499 -0.417  1.00 55.45 ? 315 LYS A CE  1 
ATOM   1880 N NZ  . LYS A 1 293 ? 80.695  -20.373 -1.044  1.00 61.20 ? 315 LYS A NZ  1 
ATOM   1881 N N   . ILE A 1 294 ? 84.225  -15.178 0.682   1.00 30.87 ? 316 ILE A N   1 
ATOM   1882 C CA  . ILE A 1 294 ? 84.925  -14.663 -0.489  1.00 32.09 ? 316 ILE A CA  1 
ATOM   1883 C C   . ILE A 1 294 ? 86.200  -13.932 -0.080  1.00 33.98 ? 316 ILE A C   1 
ATOM   1884 O O   . ILE A 1 294 ? 87.156  -13.855 -0.862  1.00 34.24 ? 316 ILE A O   1 
ATOM   1885 C CB  . ILE A 1 294 ? 83.987  -13.759 -1.307  1.00 31.83 ? 316 ILE A CB  1 
ATOM   1886 C CG1 . ILE A 1 294 ? 82.677  -14.486 -1.603  1.00 31.36 ? 316 ILE A CG1 1 
ATOM   1887 C CG2 . ILE A 1 294 ? 84.642  -13.317 -2.609  1.00 29.47 ? 316 ILE A CG2 1 
ATOM   1888 C CD1 . ILE A 1 294 ? 81.598  -13.584 -2.147  1.00 38.66 ? 316 ILE A CD1 1 
ATOM   1889 N N   . ARG A 1 295 ? 86.249  -13.398 1.142   1.00 32.11 ? 317 ARG A N   1 
ATOM   1890 C CA  . ARG A 1 295 ? 87.451  -12.701 1.587   1.00 31.09 ? 317 ARG A CA  1 
ATOM   1891 C C   . ARG A 1 295 ? 88.609  -13.669 1.787   1.00 40.83 ? 317 ARG A C   1 
ATOM   1892 O O   . ARG A 1 295 ? 89.741  -13.382 1.379   1.00 41.25 ? 317 ARG A O   1 
ATOM   1893 C CB  . ARG A 1 295 ? 87.169  -11.931 2.876   1.00 31.49 ? 317 ARG A CB  1 
ATOM   1894 C CG  . ARG A 1 295 ? 88.397  -11.264 3.475   1.00 34.60 ? 317 ARG A CG  1 
ATOM   1895 C CD  . ARG A 1 295 ? 88.224  -11.013 4.963   1.00 33.91 ? 317 ARG A CD  1 
ATOM   1896 N NE  . ARG A 1 295 ? 87.084  -10.143 5.234   1.00 39.38 ? 317 ARG A NE  1 
ATOM   1897 C CZ  . ARG A 1 295 ? 87.167  -8.823  5.372   1.00 45.03 ? 317 ARG A CZ  1 
ATOM   1898 N NH1 . ARG A 1 295 ? 88.346  -8.214  5.266   1.00 36.23 ? 317 ARG A NH1 1 
ATOM   1899 N NH2 . ARG A 1 295 ? 86.072  -8.110  5.616   1.00 39.48 ? 317 ARG A NH2 1 
ATOM   1900 N N   . LEU A 1 296 ? 88.342  -14.825 2.406   1.00 40.64 ? 318 LEU A N   1 
ATOM   1901 C CA  . LEU A 1 296 ? 89.416  -15.767 2.715   1.00 37.74 ? 318 LEU A CA  1 
ATOM   1902 C C   . LEU A 1 296 ? 90.018  -16.360 1.447   1.00 40.50 ? 318 LEU A C   1 
ATOM   1903 O O   . LEU A 1 296 ? 91.241  -16.528 1.356   1.00 39.84 ? 318 LEU A O   1 
ATOM   1904 C CB  . LEU A 1 296 ? 88.900  -16.872 3.636   1.00 33.44 ? 318 LEU A CB  1 
ATOM   1905 C CG  . LEU A 1 296 ? 88.138  -16.412 4.882   1.00 42.85 ? 318 LEU A CG  1 
ATOM   1906 C CD1 . LEU A 1 296 ? 87.354  -17.562 5.500   1.00 45.55 ? 318 LEU A CD1 1 
ATOM   1907 C CD2 . LEU A 1 296 ? 89.074  -15.781 5.907   1.00 39.10 ? 318 LEU A CD2 1 
ATOM   1908 N N   . ASP A 1 297 ? 89.182  -16.680 0.457   1.00 34.07 ? 319 ASP A N   1 
ATOM   1909 C CA  . ASP A 1 297 ? 89.715  -17.163 -0.812  1.00 36.17 ? 319 ASP A CA  1 
ATOM   1910 C C   . ASP A 1 297 ? 90.524  -16.079 -1.512  1.00 33.95 ? 319 ASP A C   1 
ATOM   1911 O O   . ASP A 1 297 ? 91.612  -16.347 -2.032  1.00 33.76 ? 319 ASP A O   1 
ATOM   1912 C CB  . ASP A 1 297 ? 88.579  -17.656 -1.709  1.00 41.07 ? 319 ASP A CB  1 
ATOM   1913 C CG  . ASP A 1 297 ? 88.013  -18.992 -1.256  1.00 53.79 ? 319 ASP A CG  1 
ATOM   1914 O OD1 . ASP A 1 297 ? 88.516  -19.550 -0.255  1.00 50.55 ? 319 ASP A OD1 1 
ATOM   1915 O OD2 . ASP A 1 297 ? 87.063  -19.485 -1.903  1.00 54.35 ? 319 ASP A OD2 1 
ATOM   1916 N N   . THR A 1 298 ? 90.017  -14.842 -1.512  1.00 40.05 ? 320 THR A N   1 
ATOM   1917 C CA  . THR A 1 298 ? 90.686  -13.758 -2.225  1.00 38.61 ? 320 THR A CA  1 
ATOM   1918 C C   . THR A 1 298 ? 91.966  -13.331 -1.523  1.00 36.57 ? 320 THR A C   1 
ATOM   1919 O O   . THR A 1 298 ? 92.998  -13.128 -2.173  1.00 39.46 ? 320 THR A O   1 
ATOM   1920 C CB  . THR A 1 298 ? 89.746  -12.564 -2.375  1.00 34.93 ? 320 THR A CB  1 
ATOM   1921 O OG1 . THR A 1 298 ? 88.563  -12.967 -3.078  1.00 39.55 ? 320 THR A OG1 1 
ATOM   1922 C CG2 . THR A 1 298 ? 90.436  -11.438 -3.134  1.00 30.56 ? 320 THR A CG2 1 
ATOM   1923 N N   . GLU A 1 299 ? 91.914  -13.173 -0.200  1.00 36.40 ? 321 GLU A N   1 
ATOM   1924 C CA  . GLU A 1 299 ? 93.096  -12.756 0.544   1.00 37.98 ? 321 GLU A CA  1 
ATOM   1925 C C   . GLU A 1 299 ? 94.211  -13.787 0.465   1.00 46.38 ? 321 GLU A C   1 
ATOM   1926 O O   . GLU A 1 299 ? 95.379  -13.446 0.647   1.00 45.32 ? 321 GLU A O   1 
ATOM   1927 C CB  . GLU A 1 299 ? 92.725  -12.482 1.998   1.00 37.68 ? 321 GLU A CB  1 
ATOM   1928 C CG  . GLU A 1 299 ? 91.942  -11.197 2.189   1.00 38.07 ? 321 GLU A CG  1 
ATOM   1929 C CD  . GLU A 1 299 ? 91.867  -10.753 3.635   1.00 48.68 ? 321 GLU A CD  1 
ATOM   1930 O OE1 . GLU A 1 299 ? 91.225  -9.711  3.905   1.00 49.80 ? 321 GLU A OE1 1 
ATOM   1931 O OE2 . GLU A 1 299 ? 92.444  -11.447 4.502   1.00 53.75 ? 321 GLU A OE2 1 
ATOM   1932 N N   . GLU A 1 300 ? 93.879  -15.040 0.186   1.00 48.86 ? 322 GLU A N   1 
ATOM   1933 C CA  . GLU A 1 300 ? 94.916  -16.033 -0.037  1.00 46.22 ? 322 GLU A CA  1 
ATOM   1934 C C   . GLU A 1 300 ? 95.548  -15.851 -1.416  1.00 46.22 ? 322 GLU A C   1 
ATOM   1935 O O   . GLU A 1 300 ? 96.781  -15.895 -1.539  1.00 51.18 ? 322 GLU A O   1 
ATOM   1936 C CB  . GLU A 1 300 ? 94.364  -17.428 0.143   1.00 48.16 ? 322 GLU A CB  1 
ATOM   1937 C CG  . GLU A 1 300 ? 95.329  -18.506 0.647   1.00 63.52 ? 322 GLU A CG  1 
ATOM   1938 C CD  . GLU A 1 300 ? 96.327  -18.061 1.727   1.00 71.74 ? 322 GLU A CD  1 
ATOM   1939 O OE1 . GLU A 1 300 ? 97.487  -18.537 1.679   1.00 63.12 ? 322 GLU A OE1 1 
ATOM   1940 O OE2 . GLU A 1 300 ? 95.962  -17.292 2.640   1.00 69.79 ? 322 GLU A OE2 1 
ATOM   1941 N N   . GLN A 1 301 ? 94.750  -15.603 -2.461  1.00 41.06 ? 323 GLN A N   1 
ATOM   1942 C CA  . GLN A 1 301 ? 95.331  -15.415 -3.791  1.00 42.95 ? 323 GLN A CA  1 
ATOM   1943 C C   . GLN A 1 301 ? 96.100  -14.100 -3.884  1.00 44.24 ? 323 GLN A C   1 
ATOM   1944 O O   . GLN A 1 301 ? 97.077  -13.998 -4.636  1.00 45.21 ? 323 GLN A O   1 
ATOM   1945 C CB  . GLN A 1 301 ? 94.227  -15.475 -4.837  1.00 35.58 ? 323 GLN A CB  1 
ATOM   1946 C CG  . GLN A 1 301 ? 93.365  -16.708 -4.702  1.00 39.54 ? 323 GLN A CG  1 
ATOM   1947 C CD  . GLN A 1 301 ? 92.414  -16.879 -5.864  1.00 45.28 ? 323 GLN A CD  1 
ATOM   1948 O OE1 . GLN A 1 301 ? 92.792  -16.694 -7.021  1.00 38.48 ? 323 GLN A OE1 1 
ATOM   1949 N NE2 . GLN A 1 301 ? 91.178  -17.272 -5.565  1.00 38.77 ? 323 GLN A NE2 1 
ATOM   1950 N N   . LEU A 1 302 ? 95.676  -13.087 -3.122  1.00 38.28 ? 324 LEU A N   1 
ATOM   1951 C CA  . LEU A 1 302 ? 96.407  -11.824 -3.090  1.00 40.87 ? 324 LEU A CA  1 
ATOM   1952 C C   . LEU A 1 302 ? 97.798  -12.005 -2.493  1.00 45.38 ? 324 LEU A C   1 
ATOM   1953 O O   . LEU A 1 302 ? 98.769  -11.412 -2.978  1.00 37.06 ? 324 LEU A O   1 
ATOM   1954 C CB  . LEU A 1 302 ? 95.618  -10.776 -2.301  1.00 38.22 ? 324 LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 302 ? 94.314  -10.248 -2.905  1.00 31.52 ? 324 LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 302 ? 93.652  -9.276  -1.947  1.00 27.73 ? 324 LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 302 ? 94.568  -9.592  -4.250  1.00 28.88 ? 324 LEU A CD2 1 
ATOM   1958 N N   . LYS A 1 303 ? 97.914  -12.806 -1.426  1.00 46.61 ? 325 LYS A N   1 
ATOM   1959 C CA  . LYS A 1 303 ? 99.222  -13.052 -0.830  1.00 41.49 ? 325 LYS A CA  1 
ATOM   1960 C C   . LYS A 1 303 ? 100.151 -13.777 -1.795  1.00 46.42 ? 325 LYS A C   1 
ATOM   1961 O O   . LYS A 1 303 ? 101.366 -13.550 -1.769  1.00 43.79 ? 325 LYS A O   1 
ATOM   1962 C CB  . LYS A 1 303 ? 99.069  -13.853 0.461   1.00 43.20 ? 325 LYS A CB  1 
ATOM   1963 C CG  . LYS A 1 303 ? 98.505  -13.052 1.622   1.00 49.21 ? 325 LYS A CG  1 
ATOM   1964 C CD  . LYS A 1 303 ? 98.296  -13.923 2.852   1.00 49.50 ? 325 LYS A CD  1 
ATOM   1965 C CE  . LYS A 1 303 ? 99.594  -14.589 3.278   1.00 59.75 ? 325 LYS A CE  1 
ATOM   1966 N NZ  . LYS A 1 303 ? 99.395  -15.506 4.434   1.00 63.42 ? 325 LYS A NZ  1 
ATOM   1967 N N   . GLU A 1 304 ? 99.609  -14.645 -2.653  1.00 44.32 ? 326 GLU A N   1 
ATOM   1968 C CA  . GLU A 1 304 ? 100.460 -15.318 -3.629  1.00 45.20 ? 326 GLU A CA  1 
ATOM   1969 C C   . GLU A 1 304 ? 100.866 -14.370 -4.750  1.00 45.42 ? 326 GLU A C   1 
ATOM   1970 O O   . GLU A 1 304 ? 102.034 -14.345 -5.153  1.00 48.23 ? 326 GLU A O   1 
ATOM   1971 C CB  . GLU A 1 304 ? 99.761  -16.558 -4.190  1.00 44.39 ? 326 GLU A CB  1 
ATOM   1972 C CG  . GLU A 1 304 ? 99.160  -17.487 -3.135  1.00 58.81 ? 326 GLU A CG  1 
ATOM   1973 C CD  . GLU A 1 304 ? 100.160 -17.954 -2.078  1.00 79.80 ? 326 GLU A CD  1 
ATOM   1974 O OE1 . GLU A 1 304 ? 99.711  -18.328 -0.972  1.00 81.35 ? 326 GLU A OE1 1 
ATOM   1975 O OE2 . GLU A 1 304 ? 101.382 -17.975 -2.347  1.00 81.44 ? 326 GLU A OE2 1 
ATOM   1976 N N   . LYS A 1 305 ? 99.921  -13.576 -5.260  1.00 41.04 ? 327 LYS A N   1 
ATOM   1977 C CA  . LYS A 1 305 ? 100.258 -12.617 -6.308  1.00 35.14 ? 327 LYS A CA  1 
ATOM   1978 C C   . LYS A 1 305 ? 101.106 -11.469 -5.772  1.00 39.18 ? 327 LYS A C   1 
ATOM   1979 O O   . LYS A 1 305 ? 101.939 -10.922 -6.504  1.00 32.48 ? 327 LYS A O   1 
ATOM   1980 C CB  . LYS A 1 305 ? 98.985  -12.075 -6.955  1.00 36.84 ? 327 LYS A CB  1 
ATOM   1981 C CG  . LYS A 1 305 ? 99.225  -11.251 -8.210  1.00 34.97 ? 327 LYS A CG  1 
ATOM   1982 C CD  . LYS A 1 305 ? 99.387  -12.145 -9.426  1.00 39.83 ? 327 LYS A CD  1 
ATOM   1983 C CE  . LYS A 1 305 ? 99.440  -11.334 -10.710 1.00 42.03 ? 327 LYS A CE  1 
ATOM   1984 N NZ  . LYS A 1 305 ? 99.262  -12.194 -11.919 1.00 39.98 ? 327 LYS A NZ  1 
ATOM   1985 N N   . PHE A 1 306 ? 100.914 -11.093 -4.506  1.00 41.59 ? 328 PHE A N   1 
ATOM   1986 C CA  . PHE A 1 306 ? 101.652 -9.996  -3.878  1.00 36.57 ? 328 PHE A CA  1 
ATOM   1987 C C   . PHE A 1 306 ? 102.261 -10.491 -2.574  1.00 41.79 ? 328 PHE A C   1 
ATOM   1988 O O   . PHE A 1 306 ? 101.771 -10.167 -1.484  1.00 43.50 ? 328 PHE A O   1 
ATOM   1989 C CB  . PHE A 1 306 ? 100.748 -8.786  -3.634  1.00 33.73 ? 328 PHE A CB  1 
ATOM   1990 C CG  . PHE A 1 306 ? 99.956  -8.367  -4.837  1.00 29.81 ? 328 PHE A CG  1 
ATOM   1991 C CD1 . PHE A 1 306 ? 100.497 -7.497  -5.769  1.00 29.91 ? 328 PHE A CD1 1 
ATOM   1992 C CD2 . PHE A 1 306 ? 98.670  -8.847  -5.040  1.00 30.96 ? 328 PHE A CD2 1 
ATOM   1993 C CE1 . PHE A 1 306 ? 99.772  -7.111  -6.884  1.00 29.34 ? 328 PHE A CE1 1 
ATOM   1994 C CE2 . PHE A 1 306 ? 97.940  -8.467  -6.149  1.00 34.64 ? 328 PHE A CE2 1 
ATOM   1995 C CZ  . PHE A 1 306 ? 98.492  -7.597  -7.075  1.00 33.82 ? 328 PHE A CZ  1 
ATOM   1996 N N   . PRO A 1 307 ? 103.339 -11.280 -2.646  1.00 46.13 ? 329 PRO A N   1 
ATOM   1997 C CA  . PRO A 1 307 ? 103.995 -11.713 -1.403  1.00 41.98 ? 329 PRO A CA  1 
ATOM   1998 C C   . PRO A 1 307 ? 104.649 -10.570 -0.651  1.00 43.35 ? 329 PRO A C   1 
ATOM   1999 O O   . PRO A 1 307 ? 104.768 -10.640 0.579   1.00 44.30 ? 329 PRO A O   1 
ATOM   2000 C CB  . PRO A 1 307 ? 105.029 -12.737 -1.889  1.00 46.15 ? 329 PRO A CB  1 
ATOM   2001 C CG  . PRO A 1 307 ? 105.310 -12.343 -3.303  1.00 40.01 ? 329 PRO A CG  1 
ATOM   2002 C CD  . PRO A 1 307 ? 104.022 -11.792 -3.847  1.00 40.43 ? 329 PRO A CD  1 
ATOM   2003 N N   . GLU A 1 308 ? 105.068 -9.514  -1.352  1.00 44.58 ? 330 GLU A N   1 
ATOM   2004 C CA  . GLU A 1 308 ? 105.670 -8.351  -0.715  1.00 48.75 ? 330 GLU A CA  1 
ATOM   2005 C C   . GLU A 1 308 ? 104.645 -7.429  -0.064  1.00 49.38 ? 330 GLU A C   1 
ATOM   2006 O O   . GLU A 1 308 ? 105.037 -6.491  0.640   1.00 46.56 ? 330 GLU A O   1 
ATOM   2007 C CB  . GLU A 1 308 ? 106.492 -7.563  -1.740  1.00 48.02 ? 330 GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 308 ? 107.980 -7.876  -1.715  1.00 46.04 ? 330 GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 308 ? 108.594 -7.652  -0.345  1.00 63.23 ? 330 GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 308 ? 108.914 -6.489  -0.014  1.00 57.09 ? 330 GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 308 ? 108.751 -8.641  0.405   1.00 69.01 ? 330 GLU A OE2 1 
ATOM   2012 N N   . ALA A 1 309 ? 103.354 -7.669  -0.273  1.00 45.90 ? 331 ALA A N   1 
ATOM   2013 C CA  . ALA A 1 309 ? 102.324 -6.818  0.302   1.00 45.32 ? 331 ALA A CA  1 
ATOM   2014 C C   . ALA A 1 309 ? 102.153 -7.097  1.792   1.00 43.97 ? 331 ALA A C   1 
ATOM   2015 O O   . ALA A 1 309 ? 102.188 -8.251  2.231   1.00 40.20 ? 331 ALA A O   1 
ATOM   2016 C CB  . ALA A 1 309 ? 100.996 -7.027  -0.427  1.00 41.18 ? 331 ALA A CB  1 
ATOM   2017 N N   . ASP A 1 310 ? 101.984 -6.028  2.564   1.00 40.64 ? 332 ASP A N   1 
ATOM   2018 C CA  . ASP A 1 310 ? 101.629 -6.154  3.971   1.00 43.78 ? 332 ASP A CA  1 
ATOM   2019 C C   . ASP A 1 310 ? 100.305 -6.909  4.095   1.00 41.50 ? 332 ASP A C   1 
ATOM   2020 O O   . ASP A 1 310 ? 99.425  -6.750  3.241   1.00 43.67 ? 332 ASP A O   1 
ATOM   2021 C CB  . ASP A 1 310 ? 101.505 -4.754  4.586   1.00 48.52 ? 332 ASP A CB  1 
ATOM   2022 C CG  . ASP A 1 310 ? 101.974 -4.680  6.030   1.00 65.04 ? 332 ASP A CG  1 
ATOM   2023 O OD1 . ASP A 1 310 ? 102.179 -5.728  6.674   1.00 63.67 ? 332 ASP A OD1 1 
ATOM   2024 O OD2 . ASP A 1 310 ? 102.134 -3.545  6.528   1.00 82.70 ? 332 ASP A OD2 1 
ATOM   2025 N N   . PRO A 1 311 ? 100.137 -7.763  5.112   1.00 48.48 ? 333 PRO A N   1 
ATOM   2026 C CA  . PRO A 1 311 ? 98.796  -8.314  5.382   1.00 47.77 ? 333 PRO A CA  1 
ATOM   2027 C C   . PRO A 1 311 ? 97.729  -7.253  5.590   1.00 45.53 ? 333 PRO A C   1 
ATOM   2028 O O   . PRO A 1 311 ? 96.554  -7.502  5.287   1.00 38.00 ? 333 PRO A O   1 
ATOM   2029 C CB  . PRO A 1 311 ? 99.006  -9.152  6.654   1.00 46.54 ? 333 PRO A CB  1 
ATOM   2030 C CG  . PRO A 1 311 ? 100.396 -8.812  7.145   1.00 41.35 ? 333 PRO A CG  1 
ATOM   2031 C CD  . PRO A 1 311 ? 101.161 -8.441  5.921   1.00 44.13 ? 333 PRO A CD  1 
ATOM   2032 N N   . TYR A 1 312 ? 98.098  -6.080  6.114   1.00 47.02 ? 334 TYR A N   1 
ATOM   2033 C CA  . TYR A 1 312 ? 97.121  -5.012  6.294   1.00 38.44 ? 334 TYR A CA  1 
ATOM   2034 C C   . TYR A 1 312 ? 96.713  -4.399  4.963   1.00 36.34 ? 334 TYR A C   1 
ATOM   2035 O O   . TYR A 1 312 ? 95.580  -3.925  4.820   1.00 33.29 ? 334 TYR A O   1 
ATOM   2036 C CB  . TYR A 1 312 ? 97.683  -3.940  7.225   1.00 51.87 ? 334 TYR A CB  1 
ATOM   2037 C CG  . TYR A 1 312 ? 98.110  -4.470  8.577   1.00 75.42 ? 334 TYR A CG  1 
ATOM   2038 C CD1 . TYR A 1 312 ? 97.382  -5.469  9.218   1.00 77.38 ? 334 TYR A CD1 1 
ATOM   2039 C CD2 . TYR A 1 312 ? 99.240  -3.971  9.215   1.00 72.63 ? 334 TYR A CD2 1 
ATOM   2040 C CE1 . TYR A 1 312 ? 97.769  -5.955  10.456  1.00 81.58 ? 334 TYR A CE1 1 
ATOM   2041 C CE2 . TYR A 1 312 ? 99.634  -4.451  10.451  1.00 78.23 ? 334 TYR A CE2 1 
ATOM   2042 C CZ  . TYR A 1 312 ? 98.895  -5.441  11.067  1.00 84.87 ? 334 TYR A CZ  1 
ATOM   2043 O OH  . TYR A 1 312 ? 99.285  -5.918  12.298  1.00 88.40 ? 334 TYR A OH  1 
ATOM   2044 N N   . GLU A 1 313 ? 97.620  -4.397  3.983   1.00 32.95 ? 335 GLU A N   1 
ATOM   2045 C CA  . GLU A 1 313 ? 97.261  -3.979  2.634   1.00 28.88 ? 335 GLU A CA  1 
ATOM   2046 C C   . GLU A 1 313 ? 96.351  -4.997  1.956   1.00 31.85 ? 335 GLU A C   1 
ATOM   2047 O O   . GLU A 1 313 ? 95.555  -4.631  1.086   1.00 31.27 ? 335 GLU A O   1 
ATOM   2048 C CB  . GLU A 1 313 ? 98.526  -3.757  1.807   1.00 31.25 ? 335 GLU A CB  1 
ATOM   2049 C CG  . GLU A 1 313 ? 98.304  -3.032  0.488   1.00 33.19 ? 335 GLU A CG  1 
ATOM   2050 C CD  . GLU A 1 313 ? 99.610  -2.714  -0.225  1.00 44.42 ? 335 GLU A CD  1 
ATOM   2051 O OE1 . GLU A 1 313 ? 100.678 -3.146  0.264   1.00 45.24 ? 335 GLU A OE1 1 
ATOM   2052 O OE2 . GLU A 1 313 ? 99.568  -2.031  -1.273  1.00 42.88 ? 335 GLU A OE2 1 
ATOM   2053 N N   . ILE A 1 314 ? 96.449  -6.272  2.338   1.00 31.83 ? 336 ILE A N   1 
ATOM   2054 C CA  . ILE A 1 314 ? 95.571  -7.284  1.760   1.00 29.08 ? 336 ILE A CA  1 
ATOM   2055 C C   . ILE A 1 314 ? 94.155  -7.128  2.297   1.00 30.66 ? 336 ILE A C   1 
ATOM   2056 O O   . ILE A 1 314 ? 93.179  -7.223  1.544   1.00 29.87 ? 336 ILE A O   1 
ATOM   2057 C CB  . ILE A 1 314 ? 96.122  -8.696  2.032   1.00 31.90 ? 336 ILE A CB  1 
ATOM   2058 C CG1 . ILE A 1 314 ? 97.597  -8.797  1.631   1.00 29.60 ? 336 ILE A CG1 1 
ATOM   2059 C CG2 . ILE A 1 314 ? 95.289  -9.740  1.304   1.00 32.79 ? 336 ILE A CG2 1 
ATOM   2060 C CD1 . ILE A 1 314 ? 97.830  -9.083  0.162   1.00 31.08 ? 336 ILE A CD1 1 
ATOM   2061 N N   . ILE A 1 315 ? 94.019  -6.886  3.603   1.00 39.13 ? 337 ILE A N   1 
ATOM   2062 C CA  . ILE A 1 315 ? 92.694  -6.762  4.211   1.00 36.44 ? 337 ILE A CA  1 
ATOM   2063 C C   . ILE A 1 315 ? 91.957  -5.560  3.640   1.00 32.76 ? 337 ILE A C   1 
ATOM   2064 O O   . ILE A 1 315 ? 90.769  -5.638  3.303   1.00 30.77 ? 337 ILE A O   1 
ATOM   2065 C CB  . ILE A 1 315 ? 92.808  -6.666  5.743   1.00 26.91 ? 337 ILE A CB  1 
ATOM   2066 C CG1 . ILE A 1 315 ? 93.529  -7.887  6.311   1.00 33.28 ? 337 ILE A CG1 1 
ATOM   2067 C CG2 . ILE A 1 315 ? 91.435  -6.532  6.367   1.00 29.56 ? 337 ILE A CG2 1 
ATOM   2068 C CD1 . ILE A 1 315 ? 93.963  -7.717  7.746   1.00 33.84 ? 337 ILE A CD1 1 
ATOM   2069 N N   . GLU A 1 316 ? 92.652  -4.426  3.523   1.00 31.97 ? 338 GLU A N   1 
ATOM   2070 C CA  . GLU A 1 316 ? 91.993  -3.203  3.081   1.00 31.93 ? 338 GLU A CA  1 
ATOM   2071 C C   . GLU A 1 316 ? 91.701  -3.226  1.585   1.00 36.10 ? 338 GLU A C   1 
ATOM   2072 O O   . GLU A 1 316 ? 90.736  -2.595  1.134   1.00 31.09 ? 338 GLU A O   1 
ATOM   2073 C CB  . GLU A 1 316 ? 92.843  -1.988  3.459   1.00 23.32 ? 338 GLU A CB  1 
ATOM   2074 C CG  . GLU A 1 316 ? 92.283  -0.646  3.002   1.00 27.73 ? 338 GLU A CG  1 
ATOM   2075 C CD  . GLU A 1 316 ? 91.008  -0.231  3.724   1.00 25.58 ? 338 GLU A CD  1 
ATOM   2076 O OE1 . GLU A 1 316 ? 90.505  -0.988  4.583   1.00 25.28 ? 338 GLU A OE1 1 
ATOM   2077 O OE2 . GLU A 1 316 ? 90.509  0.874   3.427   1.00 28.61 ? 338 GLU A OE2 1 
ATOM   2078 N N   . SER A 1 317 ? 92.508  -3.950  0.803   1.00 34.78 ? 339 SER A N   1 
ATOM   2079 C CA  . SER A 1 317 ? 92.197  -4.121  -0.612  1.00 28.47 ? 339 SER A CA  1 
ATOM   2080 C C   . SER A 1 317 ? 90.837  -4.783  -0.795  1.00 26.75 ? 339 SER A C   1 
ATOM   2081 O O   . SER A 1 317 ? 90.002  -4.306  -1.574  1.00 25.04 ? 339 SER A O   1 
ATOM   2082 C CB  . SER A 1 317 ? 93.288  -4.934  -1.303  1.00 27.14 ? 339 SER A CB  1 
ATOM   2083 O OG  . SER A 1 317 ? 94.247  -4.081  -1.900  1.00 30.85 ? 339 SER A OG  1 
ATOM   2084 N N   . PHE A 1 318 ? 90.590  -5.882  -0.076  1.00 21.22 ? 340 PHE A N   1 
ATOM   2085 C CA  . PHE A 1 318 ? 89.287  -6.529  -0.175  1.00 22.62 ? 340 PHE A CA  1 
ATOM   2086 C C   . PHE A 1 318 ? 88.174  -5.608  0.308   1.00 27.02 ? 340 PHE A C   1 
ATOM   2087 O O   . PHE A 1 318 ? 87.103  -5.541  -0.307  1.00 25.77 ? 340 PHE A O   1 
ATOM   2088 C CB  . PHE A 1 318 ? 89.264  -7.836  0.616   1.00 21.79 ? 340 PHE A CB  1 
ATOM   2089 C CG  . PHE A 1 318 ? 87.941  -8.545  0.547   1.00 21.98 ? 340 PHE A CG  1 
ATOM   2090 C CD1 . PHE A 1 318 ? 87.622  -9.328  -0.550  1.00 22.50 ? 340 PHE A CD1 1 
ATOM   2091 C CD2 . PHE A 1 318 ? 87.003  -8.401  1.555   1.00 19.88 ? 340 PHE A CD2 1 
ATOM   2092 C CE1 . PHE A 1 318 ? 86.402  -9.968  -0.630  1.00 24.28 ? 340 PHE A CE1 1 
ATOM   2093 C CE2 . PHE A 1 318 ? 85.778  -9.036  1.480   1.00 21.47 ? 340 PHE A CE2 1 
ATOM   2094 C CZ  . PHE A 1 318 ? 85.477  -9.821  0.387   1.00 20.96 ? 340 PHE A CZ  1 
ATOM   2095 N N   . ASN A 1 319 ? 88.407  -4.894  1.413   1.00 29.53 ? 341 ASN A N   1 
ATOM   2096 C CA  . ASN A 1 319 ? 87.385  -3.997  1.942   1.00 22.98 ? 341 ASN A CA  1 
ATOM   2097 C C   . ASN A 1 319 ? 87.052  -2.898  0.943   1.00 21.98 ? 341 ASN A C   1 
ATOM   2098 O O   . ASN A 1 319 ? 85.884  -2.526  0.782   1.00 25.30 ? 341 ASN A O   1 
ATOM   2099 C CB  . ASN A 1 319 ? 87.852  -3.397  3.267   1.00 30.78 ? 341 ASN A CB  1 
ATOM   2100 C CG  . ASN A 1 319 ? 87.733  -4.370  4.425   1.00 30.95 ? 341 ASN A CG  1 
ATOM   2101 O OD1 . ASN A 1 319 ? 86.967  -5.334  4.371   1.00 31.79 ? 341 ASN A OD1 1 
ATOM   2102 N ND2 . ASN A 1 319 ? 88.492  -4.116  5.484   1.00 35.15 ? 341 ASN A ND2 1 
ATOM   2103 N N   . VAL A 1 320 ? 88.065  -2.371  0.254   1.00 24.30 ? 342 VAL A N   1 
ATOM   2104 C CA  . VAL A 1 320 ? 87.821  -1.341  -0.751  1.00 22.81 ? 342 VAL A CA  1 
ATOM   2105 C C   . VAL A 1 320 ? 86.953  -1.890  -1.878  1.00 21.88 ? 342 VAL A C   1 
ATOM   2106 O O   . VAL A 1 320 ? 86.004  -1.234  -2.327  1.00 24.39 ? 342 VAL A O   1 
ATOM   2107 C CB  . VAL A 1 320 ? 89.159  -0.791  -1.277  1.00 18.71 ? 342 VAL A CB  1 
ATOM   2108 C CG1 . VAL A 1 320 ? 88.963  -0.100  -2.619  1.00 18.59 ? 342 VAL A CG1 1 
ATOM   2109 C CG2 . VAL A 1 320 ? 89.773  0.149   -0.257  1.00 13.27 ? 342 VAL A CG2 1 
ATOM   2110 N N   . VAL A 1 321 ? 87.247  -3.106  -2.339  1.00 19.17 ? 343 VAL A N   1 
ATOM   2111 C CA  . VAL A 1 321 ? 86.505  -3.668  -3.462  1.00 18.02 ? 343 VAL A CA  1 
ATOM   2112 C C   . VAL A 1 321 ? 85.098  -4.072  -3.033  1.00 16.54 ? 343 VAL A C   1 
ATOM   2113 O O   . VAL A 1 321 ? 84.133  -3.891  -3.784  1.00 23.42 ? 343 VAL A O   1 
ATOM   2114 C CB  . VAL A 1 321 ? 87.281  -4.846  -4.078  1.00 23.27 ? 343 VAL A CB  1 
ATOM   2115 C CG1 . VAL A 1 321 ? 86.421  -5.586  -5.091  1.00 22.87 ? 343 VAL A CG1 1 
ATOM   2116 C CG2 . VAL A 1 321 ? 88.554  -4.345  -4.740  1.00 22.07 ? 343 VAL A CG2 1 
ATOM   2117 N N   . ALA A 1 322 ? 84.949  -4.620  -1.827  1.00 18.03 ? 344 ALA A N   1 
ATOM   2118 C CA  . ALA A 1 322 ? 83.610  -4.967  -1.357  1.00 19.95 ? 344 ALA A CA  1 
ATOM   2119 C C   . ALA A 1 322 ? 82.769  -3.717  -1.138  1.00 22.16 ? 344 ALA A C   1 
ATOM   2120 O O   . ALA A 1 322 ? 81.562  -3.716  -1.408  1.00 21.04 ? 344 ALA A O   1 
ATOM   2121 C CB  . ALA A 1 322 ? 83.688  -5.794  -0.075  1.00 11.93 ? 344 ALA A CB  1 
ATOM   2122 N N   . LYS A 1 323 ? 83.392  -2.641  -0.657  1.00 20.96 ? 345 LYS A N   1 
ATOM   2123 C CA  . LYS A 1 323 ? 82.674  -1.385  -0.479  1.00 18.09 ? 345 LYS A CA  1 
ATOM   2124 C C   . LYS A 1 323 ? 82.208  -0.827  -1.820  1.00 21.49 ? 345 LYS A C   1 
ATOM   2125 O O   . LYS A 1 323 ? 81.047  -0.429  -1.966  1.00 24.42 ? 345 LYS A O   1 
ATOM   2126 C CB  . LYS A 1 323 ? 83.562  -0.379  0.254   1.00 19.33 ? 345 LYS A CB  1 
ATOM   2127 C CG  . LYS A 1 323 ? 82.841  0.857   0.765   1.00 20.81 ? 345 LYS A CG  1 
ATOM   2128 C CD  . LYS A 1 323 ? 83.819  1.839   1.398   1.00 18.74 ? 345 LYS A CD  1 
ATOM   2129 C CE  . LYS A 1 323 ? 83.098  3.039   2.002   1.00 20.15 ? 345 LYS A CE  1 
ATOM   2130 N NZ  . LYS A 1 323 ? 84.039  4.163   2.278   1.00 18.59 ? 345 LYS A NZ  1 
ATOM   2131 N N   . GLU A 1 324 ? 83.096  -0.805  -2.819  1.00 20.47 ? 346 GLU A N   1 
ATOM   2132 C CA  . GLU A 1 324 ? 82.734  -0.218  -4.106  1.00 21.11 ? 346 GLU A CA  1 
ATOM   2133 C C   . GLU A 1 324 ? 81.628  -1.011  -4.789  1.00 23.01 ? 346 GLU A C   1 
ATOM   2134 O O   . GLU A 1 324 ? 80.714  -0.424  -5.382  1.00 25.10 ? 346 GLU A O   1 
ATOM   2135 C CB  . GLU A 1 324 ? 83.959  -0.117  -5.014  1.00 23.33 ? 346 GLU A CB  1 
ATOM   2136 C CG  . GLU A 1 324 ? 83.675  0.580   -6.345  1.00 33.07 ? 346 GLU A CG  1 
ATOM   2137 C CD  . GLU A 1 324 ? 82.904  1.889   -6.176  1.00 50.48 ? 346 GLU A CD  1 
ATOM   2138 O OE1 . GLU A 1 324 ? 83.310  2.723   -5.331  1.00 44.59 ? 346 GLU A OE1 1 
ATOM   2139 O OE2 . GLU A 1 324 ? 81.890  2.081   -6.888  1.00 37.64 ? 346 GLU A OE2 1 
ATOM   2140 N N   . VAL A 1 325 ? 81.691  -2.342  -4.718  1.00 20.92 ? 347 VAL A N   1 
ATOM   2141 C CA  . VAL A 1 325 ? 80.643  -3.165  -5.314  1.00 18.39 ? 347 VAL A CA  1 
ATOM   2142 C C   . VAL A 1 325 ? 79.314  -2.907  -4.621  1.00 22.38 ? 347 VAL A C   1 
ATOM   2143 O O   . VAL A 1 325 ? 78.270  -2.768  -5.273  1.00 22.23 ? 347 VAL A O   1 
ATOM   2144 C CB  . VAL A 1 325 ? 81.033  -4.654  -5.254  1.00 20.13 ? 347 VAL A CB  1 
ATOM   2145 C CG1 . VAL A 1 325 ? 79.836  -5.533  -5.591  1.00 15.77 ? 347 VAL A CG1 1 
ATOM   2146 C CG2 . VAL A 1 325 ? 82.201  -4.940  -6.195  1.00 23.28 ? 347 VAL A CG2 1 
ATOM   2147 N N   . PHE A 1 326 ? 79.337  -2.826  -3.287  1.00 26.66 ? 348 PHE A N   1 
ATOM   2148 C CA  . PHE A 1 326 ? 78.120  -2.591  -2.516  1.00 21.62 ? 348 PHE A CA  1 
ATOM   2149 C C   . PHE A 1 326 ? 77.473  -1.261  -2.887  1.00 23.07 ? 348 PHE A C   1 
ATOM   2150 O O   . PHE A 1 326 ? 76.246  -1.173  -3.015  1.00 22.25 ? 348 PHE A O   1 
ATOM   2151 C CB  . PHE A 1 326 ? 78.446  -2.636  -1.024  1.00 15.79 ? 348 PHE A CB  1 
ATOM   2152 C CG  . PHE A 1 326 ? 77.248  -2.530  -0.133  1.00 21.19 ? 348 PHE A CG  1 
ATOM   2153 C CD1 . PHE A 1 326 ? 76.517  -3.660  0.206   1.00 26.36 ? 348 PHE A CD1 1 
ATOM   2154 C CD2 . PHE A 1 326 ? 76.857  -1.305  0.384   1.00 18.29 ? 348 PHE A CD2 1 
ATOM   2155 C CE1 . PHE A 1 326 ? 75.408  -3.569  1.039   1.00 25.81 ? 348 PHE A CE1 1 
ATOM   2156 C CE2 . PHE A 1 326 ? 75.751  -1.207  1.216   1.00 18.98 ? 348 PHE A CE2 1 
ATOM   2157 C CZ  . PHE A 1 326 ? 75.026  -2.341  1.545   1.00 21.34 ? 348 PHE A CZ  1 
ATOM   2158 N N   . ARG A 1 327 ? 78.283  -0.216  -3.071  1.00 21.56 ? 349 ARG A N   1 
ATOM   2159 C CA  . ARG A 1 327 ? 77.742  1.099   -3.392  1.00 23.70 ? 349 ARG A CA  1 
ATOM   2160 C C   . ARG A 1 327 ? 77.321  1.214   -4.852  1.00 26.43 ? 349 ARG A C   1 
ATOM   2161 O O   . ARG A 1 327 ? 76.389  1.967   -5.164  1.00 23.77 ? 349 ARG A O   1 
ATOM   2162 C CB  . ARG A 1 327 ? 78.765  2.184   -3.057  1.00 23.26 ? 349 ARG A CB  1 
ATOM   2163 C CG  . ARG A 1 327 ? 79.224  2.170   -1.614  1.00 16.18 ? 349 ARG A CG  1 
ATOM   2164 C CD  . ARG A 1 327 ? 80.579  2.819   -1.467  1.00 14.31 ? 349 ARG A CD  1 
ATOM   2165 N NE  . ARG A 1 327 ? 80.513  4.261   -1.679  1.00 17.85 ? 349 ARG A NE  1 
ATOM   2166 C CZ  . ARG A 1 327 ? 80.271  5.152   -0.721  1.00 16.69 ? 349 ARG A CZ  1 
ATOM   2167 N NH1 . ARG A 1 327 ? 80.067  4.755   0.528   1.00 15.51 ? 349 ARG A NH1 1 
ATOM   2168 N NH2 . ARG A 1 327 ? 80.236  6.446   -1.011  1.00 16.50 ? 349 ARG A NH2 1 
ATOM   2169 N N   . SER A 1 328 ? 77.985  0.489   -5.758  1.00 28.67 ? 350 SER A N   1 
ATOM   2170 C CA  . SER A 1 328 ? 77.632  0.585   -7.171  1.00 24.51 ? 350 SER A CA  1 
ATOM   2171 C C   . SER A 1 328 ? 76.269  -0.033  -7.455  1.00 22.55 ? 350 SER A C   1 
ATOM   2172 O O   . SER A 1 328 ? 75.604  0.354   -8.421  1.00 23.68 ? 350 SER A O   1 
ATOM   2173 C CB  . SER A 1 328 ? 78.706  -0.077  -8.033  1.00 21.84 ? 350 SER A CB  1 
ATOM   2174 O OG  . SER A 1 328 ? 78.477  -1.470  -8.144  1.00 24.75 ? 350 SER A OG  1 
ATOM   2175 N N   . ILE A 1 329 ? 75.835  -0.987  -6.631  1.00 19.48 ? 351 ILE A N   1 
ATOM   2176 C CA  . ILE A 1 329 ? 74.518  -1.584  -6.827  1.00 22.38 ? 351 ILE A CA  1 
ATOM   2177 C C   . ILE A 1 329 ? 73.423  -0.613  -6.407  1.00 25.65 ? 351 ILE A C   1 
ATOM   2178 O O   . ILE A 1 329 ? 72.363  -0.539  -7.040  1.00 33.09 ? 351 ILE A O   1 
ATOM   2179 C CB  . ILE A 1 329 ? 74.420  -2.917  -6.066  1.00 22.72 ? 351 ILE A CB  1 
ATOM   2180 C CG1 . ILE A 1 329 ? 75.465  -3.901  -6.590  1.00 18.78 ? 351 ILE A CG1 1 
ATOM   2181 C CG2 . ILE A 1 329 ? 73.022  -3.496  -6.181  1.00 19.35 ? 351 ILE A CG2 1 
ATOM   2182 C CD1 . ILE A 1 329 ? 75.602  -5.141  -5.744  1.00 21.43 ? 351 ILE A CD1 1 
ATOM   2183 N N   . VAL A 1 330 ? 73.655  0.145   -5.334  1.00 23.26 ? 352 VAL A N   1 
ATOM   2184 C CA  . VAL A 1 330 ? 72.681  1.150   -4.919  1.00 22.14 ? 352 VAL A CA  1 
ATOM   2185 C C   . VAL A 1 330 ? 72.590  2.259   -5.958  1.00 23.47 ? 352 VAL A C   1 
ATOM   2186 O O   . VAL A 1 330 ? 71.500  2.766   -6.252  1.00 20.80 ? 352 VAL A O   1 
ATOM   2187 C CB  . VAL A 1 330 ? 73.044  1.708   -3.529  1.00 20.89 ? 352 VAL A CB  1 
ATOM   2188 C CG1 . VAL A 1 330 ? 72.066  2.793   -3.122  1.00 16.22 ? 352 VAL A CG1 1 
ATOM   2189 C CG2 . VAL A 1 330 ? 73.072  0.594   -2.489  1.00 21.16 ? 352 VAL A CG2 1 
ATOM   2190 N N   . LEU A 1 331 ? 73.728  2.638   -6.544  1.00 20.63 ? 353 LEU A N   1 
ATOM   2191 C CA  . LEU A 1 331 ? 73.763  3.771   -7.463  1.00 22.16 ? 353 LEU A CA  1 
ATOM   2192 C C   . LEU A 1 331 ? 73.180  3.425   -8.830  1.00 24.39 ? 353 LEU A C   1 
ATOM   2193 O O   . LEU A 1 331 ? 72.461  4.238   -9.423  1.00 22.55 ? 353 LEU A O   1 
ATOM   2194 C CB  . LEU A 1 331 ? 75.197  4.274   -7.618  1.00 17.75 ? 353 LEU A CB  1 
ATOM   2195 C CG  . LEU A 1 331 ? 75.733  5.166   -6.498  1.00 17.48 ? 353 LEU A CG  1 
ATOM   2196 C CD1 . LEU A 1 331 ? 77.220  5.406   -6.679  1.00 17.99 ? 353 LEU A CD1 1 
ATOM   2197 C CD2 . LEU A 1 331 ? 74.977  6.484   -6.447  1.00 13.95 ? 353 LEU A CD2 1 
ATOM   2198 N N   . ASN A 1 332 ? 73.477  2.234   -9.350  1.00 23.16 ? 354 ASN A N   1 
ATOM   2199 C CA  . ASN A 1 332 ? 73.083  1.886   -10.710 1.00 23.87 ? 354 ASN A CA  1 
ATOM   2200 C C   . ASN A 1 332 ? 71.712  1.231   -10.792 1.00 26.71 ? 354 ASN A C   1 
ATOM   2201 O O   . ASN A 1 332 ? 71.023  1.390   -11.807 1.00 28.25 ? 354 ASN A O   1 
ATOM   2202 C CB  . ASN A 1 332 ? 74.124  0.958   -11.340 1.00 23.80 ? 354 ASN A CB  1 
ATOM   2203 C CG  . ASN A 1 332 ? 75.471  1.638   -11.540 1.00 30.25 ? 354 ASN A CG  1 
ATOM   2204 O OD1 . ASN A 1 332 ? 75.547  2.849   -11.766 1.00 31.02 ? 354 ASN A OD1 1 
ATOM   2205 N ND2 . ASN A 1 332 ? 76.542  0.857   -11.455 1.00 31.00 ? 354 ASN A ND2 1 
ATOM   2206 N N   . GLU A 1 333 ? 71.295  0.504   -9.751  1.00 25.59 ? 355 GLU A N   1 
ATOM   2207 C CA  . GLU A 1 333 ? 70.052  -0.253  -9.785  1.00 28.35 ? 355 GLU A CA  1 
ATOM   2208 C C   . GLU A 1 333 ? 69.021  0.215   -8.767  1.00 24.89 ? 355 GLU A C   1 
ATOM   2209 O O   . GLU A 1 333 ? 67.923  -0.352  -8.722  1.00 28.21 ? 355 GLU A O   1 
ATOM   2210 C CB  . GLU A 1 333 ? 70.337  -1.748  -9.576  1.00 29.41 ? 355 GLU A CB  1 
ATOM   2211 C CG  . GLU A 1 333 ? 71.322  -2.331  -10.586 1.00 38.53 ? 355 GLU A CG  1 
ATOM   2212 C CD  . GLU A 1 333 ? 71.865  -3.693  -10.176 1.00 46.96 ? 355 GLU A CD  1 
ATOM   2213 O OE1 . GLU A 1 333 ? 71.085  -4.522  -9.656  1.00 45.79 ? 355 GLU A OE1 1 
ATOM   2214 O OE2 . GLU A 1 333 ? 73.077  -3.935  -10.377 1.00 37.79 ? 355 GLU A OE2 1 
ATOM   2215 N N   . TYR A 1 334 ? 69.340  1.222   -7.950  1.00 28.33 ? 356 TYR A N   1 
ATOM   2216 C CA  . TYR A 1 334 ? 68.404  1.803   -6.978  1.00 24.23 ? 356 TYR A CA  1 
ATOM   2217 C C   . TYR A 1 334 ? 67.796  0.748   -6.058  1.00 23.34 ? 356 TYR A C   1 
ATOM   2218 O O   . TYR A 1 334 ? 66.672  0.902   -5.576  1.00 27.53 ? 356 TYR A O   1 
ATOM   2219 C CB  . TYR A 1 334 ? 67.294  2.598   -7.673  1.00 19.52 ? 356 TYR A CB  1 
ATOM   2220 C CG  . TYR A 1 334 ? 67.779  3.810   -8.439  1.00 27.22 ? 356 TYR A CG  1 
ATOM   2221 C CD1 . TYR A 1 334 ? 68.268  3.689   -9.737  1.00 28.08 ? 356 TYR A CD1 1 
ATOM   2222 C CD2 . TYR A 1 334 ? 67.739  5.078   -7.870  1.00 27.20 ? 356 TYR A CD2 1 
ATOM   2223 C CE1 . TYR A 1 334 ? 68.710  4.796   -10.444 1.00 27.02 ? 356 TYR A CE1 1 
ATOM   2224 C CE2 . TYR A 1 334 ? 68.176  6.193   -8.569  1.00 28.57 ? 356 TYR A CE2 1 
ATOM   2225 C CZ  . TYR A 1 334 ? 68.664  6.045   -9.855  1.00 30.63 ? 356 TYR A CZ  1 
ATOM   2226 O OH  . TYR A 1 334 ? 69.105  7.147   -10.556 1.00 28.69 ? 356 TYR A OH  1 
ATOM   2227 N N   . LYS A 1 335 ? 68.533  -0.328  -5.798  1.00 29.98 ? 357 LYS A N   1 
ATOM   2228 C CA  . LYS A 1 335 ? 68.070  -1.407  -4.937  1.00 30.75 ? 357 LYS A CA  1 
ATOM   2229 C C   . LYS A 1 335 ? 69.123  -1.699  -3.879  1.00 29.20 ? 357 LYS A C   1 
ATOM   2230 O O   . LYS A 1 335 ? 70.326  -1.633  -4.151  1.00 33.18 ? 357 LYS A O   1 
ATOM   2231 C CB  . LYS A 1 335 ? 67.766  -2.676  -5.744  1.00 31.81 ? 357 LYS A CB  1 
ATOM   2232 C CG  . LYS A 1 335 ? 66.576  -2.539  -6.687  1.00 34.01 ? 357 LYS A CG  1 
ATOM   2233 C CD  . LYS A 1 335 ? 65.285  -3.006  -6.025  1.00 38.46 ? 357 LYS A CD  1 
ATOM   2234 C CE  . LYS A 1 335 ? 65.219  -4.529  -5.933  1.00 36.37 ? 357 LYS A CE  1 
ATOM   2235 N NZ  . LYS A 1 335 ? 63.994  -4.988  -5.212  1.00 37.84 ? 357 LYS A NZ  1 
ATOM   2236 N N   . ARG A 1 336 ? 68.667  -2.019  -2.675  1.00 23.44 ? 358 ARG A N   1 
ATOM   2237 C CA  . ARG A 1 336 ? 69.552  -2.295  -1.556  1.00 24.90 ? 358 ARG A CA  1 
ATOM   2238 C C   . ARG A 1 336 ? 69.761  -3.797  -1.403  1.00 26.53 ? 358 ARG A C   1 
ATOM   2239 O O   . ARG A 1 336 ? 69.046  -4.614  -1.987  1.00 28.53 ? 358 ARG A O   1 
ATOM   2240 C CB  . ARG A 1 336 ? 68.988  -1.686  -0.274  1.00 24.78 ? 358 ARG A CB  1 
ATOM   2241 C CG  . ARG A 1 336 ? 68.669  -0.209  -0.412  1.00 22.88 ? 358 ARG A CG  1 
ATOM   2242 C CD  . ARG A 1 336 ? 67.622  0.220   0.593   1.00 23.51 ? 358 ARG A CD  1 
ATOM   2243 N NE  . ARG A 1 336 ? 68.198  0.413   1.918   1.00 24.27 ? 358 ARG A NE  1 
ATOM   2244 C CZ  . ARG A 1 336 ? 67.605  1.094   2.892   1.00 22.50 ? 358 ARG A CZ  1 
ATOM   2245 N NH1 . ARG A 1 336 ? 66.415  1.643   2.682   1.00 19.24 ? 358 ARG A NH1 1 
ATOM   2246 N NH2 . ARG A 1 336 ? 68.199  1.225   4.072   1.00 17.51 ? 358 ARG A NH2 1 
ATOM   2247 N N   . CYS A 1 337 ? 70.760  -4.155  -0.591  1.00 24.05 ? 359 CYS A N   1 
ATOM   2248 C CA  . CYS A 1 337 ? 71.202  -5.544  -0.509  1.00 24.28 ? 359 CYS A CA  1 
ATOM   2249 C C   . CYS A 1 337 ? 70.172  -6.469  0.123   1.00 26.89 ? 359 CYS A C   1 
ATOM   2250 O O   . CYS A 1 337 ? 70.376  -7.687  0.113   1.00 32.98 ? 359 CYS A O   1 
ATOM   2251 C CB  . CYS A 1 337 ? 72.521  -5.634  0.261   1.00 24.96 ? 359 CYS A CB  1 
ATOM   2252 S SG  . CYS A 1 337 ? 72.426  -5.169  2.001   1.00 19.91 ? 359 CYS A SG  1 
ATOM   2253 N N   . ASP A 1 338 ? 69.080  -5.933  0.669   1.00 26.65 ? 360 ASP A N   1 
ATOM   2254 C CA  . ASP A 1 338 ? 67.971  -6.752  1.140   1.00 28.26 ? 360 ASP A CA  1 
ATOM   2255 C C   . ASP A 1 338 ? 66.750  -6.634  0.231   1.00 30.56 ? 360 ASP A C   1 
ATOM   2256 O O   . ASP A 1 338 ? 65.636  -6.972  0.643   1.00 31.93 ? 360 ASP A O   1 
ATOM   2257 C CB  . ASP A 1 338 ? 67.613  -6.392  2.584   1.00 24.81 ? 360 ASP A CB  1 
ATOM   2258 C CG  . ASP A 1 338 ? 67.209  -4.938  2.749   1.00 26.49 ? 360 ASP A CG  1 
ATOM   2259 O OD1 . ASP A 1 338 ? 67.347  -4.159  1.782   1.00 33.05 ? 360 ASP A OD1 1 
ATOM   2260 O OD2 . ASP A 1 338 ? 66.755  -4.574  3.858   1.00 22.91 ? 360 ASP A OD2 1 
ATOM   2261 N N   . GLY A 1 339 ? 66.941  -6.167  -1.004  1.00 28.08 ? 361 GLY A N   1 
ATOM   2262 C CA  . GLY A 1 339 ? 65.853  -5.980  -1.934  1.00 26.29 ? 361 GLY A CA  1 
ATOM   2263 C C   . GLY A 1 339 ? 65.041  -4.720  -1.734  1.00 31.16 ? 361 GLY A C   1 
ATOM   2264 O O   . GLY A 1 339 ? 64.246  -4.370  -2.617  1.00 37.70 ? 361 GLY A O   1 
ATOM   2265 N N   . ARG A 1 340 ? 65.217  -4.020  -0.616  1.00 27.06 ? 362 ARG A N   1 
ATOM   2266 C CA  . ARG A 1 340 ? 64.444  -2.818  -0.341  1.00 27.86 ? 362 ARG A CA  1 
ATOM   2267 C C   . ARG A 1 340 ? 64.748  -1.725  -1.361  1.00 23.64 ? 362 ARG A C   1 
ATOM   2268 O O   . ARG A 1 340 ? 65.742  -1.771  -2.094  1.00 30.81 ? 362 ARG A O   1 
ATOM   2269 C CB  . ARG A 1 340 ? 64.741  -2.305  1.068   1.00 23.69 ? 362 ARG A CB  1 
ATOM   2270 C CG  . ARG A 1 340 ? 63.859  -2.905  2.141   1.00 18.58 ? 362 ARG A CG  1 
ATOM   2271 C CD  . ARG A 1 340 ? 64.086  -2.225  3.467   1.00 19.75 ? 362 ARG A CD  1 
ATOM   2272 N NE  . ARG A 1 340 ? 65.476  -2.345  3.887   1.00 24.10 ? 362 ARG A NE  1 
ATOM   2273 C CZ  . ARG A 1 340 ? 66.052  -1.545  4.774   1.00 23.92 ? 362 ARG A CZ  1 
ATOM   2274 N NH1 . ARG A 1 340 ? 65.352  -0.565  5.333   1.00 21.35 ? 362 ARG A NH1 1 
ATOM   2275 N NH2 . ARG A 1 340 ? 67.327  -1.724  5.097   1.00 23.32 ? 362 ARG A NH2 1 
ATOM   2276 N N   . ASP A 1 341 ? 63.870  -0.729  -1.402  1.00 24.56 ? 363 ASP A N   1 
ATOM   2277 C CA  . ASP A 1 341 ? 64.107  0.477   -2.181  1.00 31.09 ? 363 ASP A CA  1 
ATOM   2278 C C   . ASP A 1 341 ? 64.589  1.597   -1.269  1.00 26.02 ? 363 ASP A C   1 
ATOM   2279 O O   . ASP A 1 341 ? 64.614  1.471   -0.044  1.00 28.42 ? 363 ASP A O   1 
ATOM   2280 C CB  . ASP A 1 341 ? 62.847  0.903   -2.943  1.00 27.04 ? 363 ASP A CB  1 
ATOM   2281 C CG  . ASP A 1 341 ? 62.228  -0.239  -3.727  1.00 44.58 ? 363 ASP A CG  1 
ATOM   2282 O OD1 . ASP A 1 341 ? 62.745  -0.559  -4.818  1.00 45.64 ? 363 ASP A OD1 1 
ATOM   2283 O OD2 . ASP A 1 341 ? 61.209  -0.799  -3.269  1.00 57.34 ? 363 ASP A OD2 1 
ATOM   2284 N N   . LEU A 1 342 ? 64.955  2.718   -1.893  1.00 26.19 ? 364 LEU A N   1 
ATOM   2285 C CA  . LEU A 1 342 ? 65.709  3.747   -1.188  1.00 21.26 ? 364 LEU A CA  1 
ATOM   2286 C C   . LEU A 1 342 ? 64.928  4.352   -0.026  1.00 23.77 ? 364 LEU A C   1 
ATOM   2287 O O   . LEU A 1 342 ? 65.533  4.783   0.962   1.00 27.44 ? 364 LEU A O   1 
ATOM   2288 C CB  . LEU A 1 342 ? 66.146  4.827   -2.176  1.00 18.43 ? 364 LEU A CB  1 
ATOM   2289 C CG  . LEU A 1 342 ? 66.971  4.269   -3.341  1.00 18.67 ? 364 LEU A CG  1 
ATOM   2290 C CD1 . LEU A 1 342 ? 67.587  5.373   -4.194  1.00 14.33 ? 364 LEU A CD1 1 
ATOM   2291 C CD2 . LEU A 1 342 ? 68.049  3.325   -2.823  1.00 21.51 ? 364 LEU A CD2 1 
ATOM   2292 N N   . THR A 1 343 ? 63.599  4.381   -0.105  1.00 21.62 ? 365 THR A N   1 
ATOM   2293 C CA  . THR A 1 343 ? 62.789  5.010   0.933   1.00 24.43 ? 365 THR A CA  1 
ATOM   2294 C C   . THR A 1 343 ? 62.040  4.005   1.800   1.00 19.69 ? 365 THR A C   1 
ATOM   2295 O O   . THR A 1 343 ? 61.195  4.412   2.604   1.00 20.17 ? 365 THR A O   1 
ATOM   2296 C CB  . THR A 1 343 ? 61.792  5.995   0.313   1.00 17.05 ? 365 THR A CB  1 
ATOM   2297 O OG1 . THR A 1 343 ? 61.072  5.348   -0.741  1.00 24.89 ? 365 THR A OG1 1 
ATOM   2298 C CG2 . THR A 1 343 ? 62.506  7.217   -0.239  1.00 9.94  ? 365 THR A CG2 1 
ATOM   2299 N N   . SER A 1 344 ? 62.334  2.713   1.674   1.00 21.41 ? 366 SER A N   1 
ATOM   2300 C CA  . SER A 1 344 ? 61.539  1.671   2.315   1.00 18.71 ? 366 SER A CA  1 
ATOM   2301 C C   . SER A 1 344 ? 62.012  1.406   3.742   1.00 21.05 ? 366 SER A C   1 
ATOM   2302 O O   . SER A 1 344 ? 63.214  1.264   3.994   1.00 18.80 ? 366 SER A O   1 
ATOM   2303 C CB  . SER A 1 344 ? 61.595  0.379   1.499   1.00 19.86 ? 366 SER A CB  1 
ATOM   2304 O OG  . SER A 1 344 ? 60.933  0.531   0.256   1.00 26.73 ? 366 SER A OG  1 
ATOM   2305 N N   . LEU A 1 345 ? 61.058  1.332   4.667   1.00 26.83 ? 367 LEU A N   1 
ATOM   2306 C CA  . LEU A 1 345 ? 61.325  0.901   6.028   1.00 19.31 ? 367 LEU A CA  1 
ATOM   2307 C C   . LEU A 1 345 ? 61.435  -0.618  6.095   1.00 21.73 ? 367 LEU A C   1 
ATOM   2308 O O   . LEU A 1 345 ? 60.898  -1.346  5.255   1.00 22.56 ? 367 LEU A O   1 
ATOM   2309 C CB  . LEU A 1 345 ? 60.214  1.354   6.976   1.00 14.58 ? 367 LEU A CB  1 
ATOM   2310 C CG  . LEU A 1 345 ? 60.134  2.816   7.405   1.00 24.44 ? 367 LEU A CG  1 
ATOM   2311 C CD1 . LEU A 1 345 ? 58.984  2.995   8.382   1.00 21.83 ? 367 LEU A CD1 1 
ATOM   2312 C CD2 . LEU A 1 345 ? 61.444  3.280   8.023   1.00 23.57 ? 367 LEU A CD2 1 
ATOM   2313 N N   . ARG A 1 346 ? 62.144  -1.096  7.113   1.00 23.15 ? 368 ARG A N   1 
ATOM   2314 C CA  . ARG A 1 346 ? 62.036  -2.501  7.460   1.00 27.50 ? 368 ARG A CA  1 
ATOM   2315 C C   . ARG A 1 346 ? 60.722  -2.737  8.196   1.00 29.49 ? 368 ARG A C   1 
ATOM   2316 O O   . ARG A 1 346 ? 60.077  -1.802  8.673   1.00 34.90 ? 368 ARG A O   1 
ATOM   2317 C CB  . ARG A 1 346 ? 63.215  -2.943  8.325   1.00 28.47 ? 368 ARG A CB  1 
ATOM   2318 C CG  . ARG A 1 346 ? 64.554  -2.913  7.613   1.00 29.65 ? 368 ARG A CG  1 
ATOM   2319 C CD  . ARG A 1 346 ? 65.698  -3.234  8.570   1.00 31.71 ? 368 ARG A CD  1 
ATOM   2320 N NE  . ARG A 1 346 ? 66.136  -2.067  9.337   1.00 25.53 ? 368 ARG A NE  1 
ATOM   2321 C CZ  . ARG A 1 346 ? 67.179  -2.069  10.163  1.00 25.92 ? 368 ARG A CZ  1 
ATOM   2322 N NH1 . ARG A 1 346 ? 67.888  -3.179  10.328  1.00 31.78 ? 368 ARG A NH1 1 
ATOM   2323 N NH2 . ARG A 1 346 ? 67.513  -0.965  10.822  1.00 20.81 ? 368 ARG A NH2 1 
ATOM   2324 N N   . ASN A 1 347 ? 60.318  -4.001  8.273   1.00 32.60 ? 369 ASN A N   1 
ATOM   2325 C CA  . ASN A 1 347 ? 59.078  -4.331  8.961   1.00 34.03 ? 369 ASN A CA  1 
ATOM   2326 C C   . ASN A 1 347 ? 59.167  -3.915  10.424  1.00 31.91 ? 369 ASN A C   1 
ATOM   2327 O O   . ASN A 1 347 ? 60.108  -4.284  11.133  1.00 28.95 ? 369 ASN A O   1 
ATOM   2328 C CB  . ASN A 1 347 ? 58.787  -5.826  8.834   1.00 37.63 ? 369 ASN A CB  1 
ATOM   2329 C CG  . ASN A 1 347 ? 58.226  -6.194  7.470   1.00 54.53 ? 369 ASN A CG  1 
ATOM   2330 O OD1 . ASN A 1 347 ? 58.098  -5.342  6.589   1.00 57.83 ? 369 ASN A OD1 1 
ATOM   2331 N ND2 . ASN A 1 347 ? 57.894  -7.467  7.286   1.00 53.77 ? 369 ASN A ND2 1 
ATOM   2332 N N   . VAL A 1 348 ? 58.194  -3.123  10.867  1.00 33.75 ? 370 VAL A N   1 
ATOM   2333 C CA  . VAL A 1 348 ? 58.180  -2.550  12.209  1.00 28.41 ? 370 VAL A CA  1 
ATOM   2334 C C   . VAL A 1 348 ? 57.012  -3.154  12.979  1.00 34.77 ? 370 VAL A C   1 
ATOM   2335 O O   . VAL A 1 348 ? 55.857  -3.074  12.539  1.00 33.53 ? 370 VAL A O   1 
ATOM   2336 C CB  . VAL A 1 348 ? 58.074  -1.018  12.169  1.00 19.75 ? 370 VAL A CB  1 
ATOM   2337 C CG1 . VAL A 1 348 ? 57.925  -0.463  13.569  1.00 24.86 ? 370 VAL A CG1 1 
ATOM   2338 C CG2 . VAL A 1 348 ? 59.287  -0.420  11.497  1.00 20.86 ? 370 VAL A CG2 1 
ATOM   2339 N N   . SER A 1 349 ? 57.313  -3.757  14.128  1.00 34.55 ? 371 SER A N   1 
ATOM   2340 C CA  . SER A 1 349 ? 56.294  -4.247  15.044  1.00 30.08 ? 371 SER A CA  1 
ATOM   2341 C C   . SER A 1 349 ? 56.687  -3.858  16.460  1.00 29.59 ? 371 SER A C   1 
ATOM   2342 O O   . SER A 1 349 ? 57.855  -3.583  16.745  1.00 33.89 ? 371 SER A O   1 
ATOM   2343 C CB  . SER A 1 349 ? 56.116  -5.767  14.943  1.00 36.24 ? 371 SER A CB  1 
ATOM   2344 O OG  . SER A 1 349 ? 57.267  -6.444  15.413  1.00 36.12 ? 371 SER A OG  1 
ATOM   2345 N N   . CYS A 1 350 ? 55.700  -3.840  17.352  1.00 39.51 ? 372 CYS A N   1 
ATOM   2346 C CA  . CYS A 1 350 ? 55.972  -3.462  18.731  1.00 37.42 ? 372 CYS A CA  1 
ATOM   2347 C C   . CYS A 1 350 ? 54.839  -3.926  19.635  1.00 36.21 ? 372 CYS A C   1 
ATOM   2348 O O   . CYS A 1 350 ? 53.737  -4.245  19.178  1.00 31.58 ? 372 CYS A O   1 
ATOM   2349 C CB  . CYS A 1 350 ? 56.178  -1.951  18.864  1.00 34.86 ? 372 CYS A CB  1 
ATOM   2350 S SG  . CYS A 1 350 ? 55.010  -0.962  17.922  1.00 31.32 ? 372 CYS A SG  1 
ATOM   2351 N N   . GLU A 1 351 ? 55.138  -3.952  20.934  1.00 40.72 ? 373 GLU A N   1 
ATOM   2352 C CA  . GLU A 1 351 ? 54.209  -4.381  21.968  1.00 36.61 ? 373 GLU A CA  1 
ATOM   2353 C C   . GLU A 1 351 ? 54.363  -3.470  23.178  1.00 33.55 ? 373 GLU A C   1 
ATOM   2354 O O   . GLU A 1 351 ? 55.367  -2.770  23.330  1.00 28.60 ? 373 GLU A O   1 
ATOM   2355 C CB  . GLU A 1 351 ? 54.457  -5.840  22.387  1.00 35.71 ? 373 GLU A CB  1 
ATOM   2356 C CG  . GLU A 1 351 ? 53.949  -6.886  21.406  1.00 46.53 ? 373 GLU A CG  1 
ATOM   2357 C CD  . GLU A 1 351 ? 54.621  -8.238  21.598  1.00 54.73 ? 373 GLU A CD  1 
ATOM   2358 O OE1 . GLU A 1 351 ? 54.761  -8.983  20.601  1.00 57.95 ? 373 GLU A OE1 1 
ATOM   2359 O OE2 . GLU A 1 351 ? 55.012  -8.552  22.745  1.00 43.79 ? 373 GLU A OE2 1 
ATOM   2360 N N   . VAL A 1 352 ? 53.353  -3.493  24.050  1.00 36.30 ? 374 VAL A N   1 
ATOM   2361 C CA  . VAL A 1 352 ? 53.413  -2.817  25.339  1.00 36.49 ? 374 VAL A CA  1 
ATOM   2362 C C   . VAL A 1 352 ? 52.894  -3.759  26.417  1.00 37.81 ? 374 VAL A C   1 
ATOM   2363 O O   . VAL A 1 352 ? 52.196  -4.736  26.137  1.00 39.46 ? 374 VAL A O   1 
ATOM   2364 C CB  . VAL A 1 352 ? 52.606  -1.501  25.362  1.00 32.72 ? 374 VAL A CB  1 
ATOM   2365 C CG1 . VAL A 1 352 ? 53.346  -0.411  24.605  1.00 33.18 ? 374 VAL A CG1 1 
ATOM   2366 C CG2 . VAL A 1 352 ? 51.223  -1.726  24.785  1.00 33.93 ? 374 VAL A CG2 1 
ATOM   2367 N N   . ASP A 1 353 ? 53.259  -3.454  27.664  1.00 35.61 ? 375 ASP A N   1 
ATOM   2368 C CA  . ASP A 1 353 ? 52.714  -4.143  28.834  1.00 41.42 ? 375 ASP A CA  1 
ATOM   2369 C C   . ASP A 1 353 ? 52.973  -5.650  28.781  1.00 48.95 ? 375 ASP A C   1 
ATOM   2370 O O   . ASP A 1 353 ? 52.090  -6.459  29.073  1.00 53.24 ? 375 ASP A O   1 
ATOM   2371 C CB  . ASP A 1 353 ? 51.218  -3.851  28.979  1.00 44.34 ? 375 ASP A CB  1 
ATOM   2372 C CG  . ASP A 1 353 ? 50.695  -4.154  30.364  1.00 45.70 ? 375 ASP A CG  1 
ATOM   2373 O OD1 . ASP A 1 353 ? 51.279  -3.645  31.344  1.00 42.19 ? 375 ASP A OD1 1 
ATOM   2374 O OD2 . ASP A 1 353 ? 49.697  -4.900  30.466  1.00 48.94 ? 375 ASP A OD2 1 
ATOM   2375 N N   . MET A 1 354 ? 54.194  -6.037  28.398  1.00 44.39 ? 376 MET A N   1 
ATOM   2376 C CA  . MET A 1 354 ? 54.536  -7.457  28.382  1.00 39.18 ? 376 MET A CA  1 
ATOM   2377 C C   . MET A 1 354 ? 54.956  -7.938  29.762  1.00 43.36 ? 376 MET A C   1 
ATOM   2378 O O   . MET A 1 354 ? 54.612  -9.055  30.166  1.00 44.27 ? 376 MET A O   1 
ATOM   2379 C CB  . MET A 1 354 ? 55.651  -7.733  27.372  1.00 39.45 ? 376 MET A CB  1 
ATOM   2380 C CG  . MET A 1 354 ? 55.527  -6.956  26.076  1.00 41.22 ? 376 MET A CG  1 
ATOM   2381 S SD  . MET A 1 354 ? 56.178  -5.285  26.241  1.00 45.29 ? 376 MET A SD  1 
ATOM   2382 C CE  . MET A 1 354 ? 57.869  -5.625  26.713  1.00 33.30 ? 376 MET A CE  1 
ATOM   2383 N N   . PHE A 1 355 ? 55.690  -7.107  30.495  1.00 46.35 ? 377 PHE A N   1 
ATOM   2384 C CA  . PHE A 1 355 ? 56.190  -7.462  31.815  1.00 45.17 ? 377 PHE A CA  1 
ATOM   2385 C C   . PHE A 1 355 ? 55.206  -7.000  32.881  1.00 53.04 ? 377 PHE A C   1 
ATOM   2386 O O   . PHE A 1 355 ? 54.660  -5.896  32.806  1.00 52.97 ? 377 PHE A O   1 
ATOM   2387 C CB  . PHE A 1 355 ? 57.564  -6.836  32.060  1.00 41.33 ? 377 PHE A CB  1 
ATOM   2388 C CG  . PHE A 1 355 ? 58.643  -7.327  31.123  1.00 43.95 ? 377 PHE A CG  1 
ATOM   2389 C CD1 . PHE A 1 355 ? 58.401  -8.357  30.225  1.00 46.85 ? 377 PHE A CD1 1 
ATOM   2390 C CD2 . PHE A 1 355 ? 59.907  -6.757  31.150  1.00 40.37 ? 377 PHE A CD2 1 
ATOM   2391 C CE1 . PHE A 1 355 ? 59.394  -8.799  29.369  1.00 49.07 ? 377 PHE A CE1 1 
ATOM   2392 C CE2 . PHE A 1 355 ? 60.904  -7.198  30.301  1.00 39.57 ? 377 PHE A CE2 1 
ATOM   2393 C CZ  . PHE A 1 355 ? 60.648  -8.220  29.410  1.00 45.18 ? 377 PHE A CZ  1 
ATOM   2394 N N   . LYS A 1 356 ? 54.992  -7.850  33.884  1.00 63.48 ? 378 LYS A N   1 
ATOM   2395 C CA  . LYS A 1 356 ? 53.920  -7.629  34.846  1.00 66.96 ? 378 LYS A CA  1 
ATOM   2396 C C   . LYS A 1 356 ? 54.314  -6.719  36.003  1.00 67.94 ? 378 LYS A C   1 
ATOM   2397 O O   . LYS A 1 356 ? 53.465  -5.973  36.504  1.00 68.14 ? 378 LYS A O   1 
ATOM   2398 C CB  . LYS A 1 356 ? 53.435  -8.972  35.404  1.00 68.28 ? 378 LYS A CB  1 
ATOM   2399 C CG  . LYS A 1 356 ? 53.017  -9.982  34.339  1.00 74.57 ? 378 LYS A CG  1 
ATOM   2400 C CD  . LYS A 1 356 ? 51.737  -9.556  33.629  1.00 78.24 ? 378 LYS A CD  1 
ATOM   2401 C CE  . LYS A 1 356 ? 51.876  -9.651  32.115  1.00 61.79 ? 378 LYS A CE  1 
ATOM   2402 N NZ  . LYS A 1 356 ? 50.764  -8.951  31.414  1.00 54.17 ? 378 LYS A NZ  1 
ATOM   2403 N N   . THR A 1 357 ? 55.575  -6.751  36.437  1.00 62.91 ? 379 THR A N   1 
ATOM   2404 C CA  . THR A 1 357 ? 55.964  -6.080  37.675  1.00 53.58 ? 379 THR A CA  1 
ATOM   2405 C C   . THR A 1 357 ? 56.306  -4.606  37.481  1.00 54.30 ? 379 THR A C   1 
ATOM   2406 O O   . THR A 1 357 ? 56.031  -3.791  38.368  1.00 56.88 ? 379 THR A O   1 
ATOM   2407 C CB  . THR A 1 357 ? 57.156  -6.802  38.310  1.00 59.72 ? 379 THR A CB  1 
ATOM   2408 O OG1 . THR A 1 357 ? 56.891  -8.209  38.359  1.00 69.69 ? 379 THR A OG1 1 
ATOM   2409 C CG2 . THR A 1 357 ? 57.407  -6.291  39.723  1.00 58.82 ? 379 THR A CG2 1 
ATOM   2410 N N   . LEU A 1 358 ? 56.896  -4.242  36.345  1.00 52.53 ? 380 LEU A N   1 
ATOM   2411 C CA  . LEU A 1 358 ? 57.395  -2.885  36.175  1.00 38.76 ? 380 LEU A CA  1 
ATOM   2412 C C   . LEU A 1 358 ? 56.260  -1.899  35.920  1.00 31.49 ? 380 LEU A C   1 
ATOM   2413 O O   . LEU A 1 358 ? 55.178  -2.251  35.438  1.00 32.74 ? 380 LEU A O   1 
ATOM   2414 C CB  . LEU A 1 358 ? 58.399  -2.816  35.030  1.00 33.43 ? 380 LEU A CB  1 
ATOM   2415 C CG  . LEU A 1 358 ? 59.616  -3.715  35.213  1.00 40.08 ? 380 LEU A CG  1 
ATOM   2416 C CD1 . LEU A 1 358 ? 59.693  -4.696  34.068  1.00 37.02 ? 380 LEU A CD1 1 
ATOM   2417 C CD2 . LEU A 1 358 ? 60.890  -2.887  35.322  1.00 49.57 ? 380 LEU A CD2 1 
ATOM   2418 N N   . HIS A 1 359 ? 56.534  -0.635  36.245  1.00 29.11 ? 381 HIS A N   1 
ATOM   2419 C CA  . HIS A 1 359 ? 55.546  0.422   36.078  1.00 33.44 ? 381 HIS A CA  1 
ATOM   2420 C C   . HIS A 1 359 ? 55.217  0.685   34.613  1.00 36.41 ? 381 HIS A C   1 
ATOM   2421 O O   . HIS A 1 359 ? 54.121  1.175   34.316  1.00 36.46 ? 381 HIS A O   1 
ATOM   2422 C CB  . HIS A 1 359 ? 56.042  1.701   36.759  1.00 28.49 ? 381 HIS A CB  1 
ATOM   2423 C CG  . HIS A 1 359 ? 56.522  1.488   38.164  1.00 30.86 ? 381 HIS A CG  1 
ATOM   2424 N ND1 . HIS A 1 359 ? 57.510  2.258   38.738  1.00 32.56 ? 381 HIS A ND1 1 
ATOM   2425 C CD2 . HIS A 1 359 ? 56.149  0.592   39.108  1.00 33.50 ? 381 HIS A CD2 1 
ATOM   2426 C CE1 . HIS A 1 359 ? 57.727  1.844   39.975  1.00 31.55 ? 381 HIS A CE1 1 
ATOM   2427 N NE2 . HIS A 1 359 ? 56.913  0.835   40.224  1.00 33.16 ? 381 HIS A NE2 1 
ATOM   2428 N N   . GLY A 1 360 ? 56.130  0.365   33.697  1.00 31.16 ? 382 GLY A N   1 
ATOM   2429 C CA  . GLY A 1 360 ? 55.870  0.488   32.275  1.00 32.59 ? 382 GLY A CA  1 
ATOM   2430 C C   . GLY A 1 360 ? 56.861  -0.305  31.447  1.00 30.77 ? 382 GLY A C   1 
ATOM   2431 O O   . GLY A 1 360 ? 58.050  -0.329  31.773  1.00 31.16 ? 382 GLY A O   1 
ATOM   2432 N N   . SER A 1 361 ? 56.395  -0.958  30.382  1.00 26.81 ? 383 SER A N   1 
ATOM   2433 C CA  . SER A 1 361 ? 57.268  -1.784  29.559  1.00 29.42 ? 383 SER A CA  1 
ATOM   2434 C C   . SER A 1 361 ? 56.831  -1.711  28.102  1.00 35.74 ? 383 SER A C   1 
ATOM   2435 O O   . SER A 1 361 ? 55.646  -1.536  27.799  1.00 34.19 ? 383 SER A O   1 
ATOM   2436 C CB  . SER A 1 361 ? 57.272  -3.242  30.032  1.00 26.24 ? 383 SER A CB  1 
ATOM   2437 O OG  . SER A 1 361 ? 55.954  -3.756  30.105  1.00 38.39 ? 383 SER A OG  1 
ATOM   2438 N N   . ALA A 1 362 ? 57.803  -1.857  27.203  1.00 30.48 ? 384 ALA A N   1 
ATOM   2439 C CA  . ALA A 1 362 ? 57.536  -1.838  25.772  1.00 32.35 ? 384 ALA A CA  1 
ATOM   2440 C C   . ALA A 1 362 ? 58.664  -2.549  25.039  1.00 32.39 ? 384 ALA A C   1 
ATOM   2441 O O   . ALA A 1 362 ? 59.805  -2.584  25.507  1.00 34.11 ? 384 ALA A O   1 
ATOM   2442 C CB  . ALA A 1 362 ? 57.379  -0.408  25.245  1.00 35.51 ? 384 ALA A CB  1 
ATOM   2443 N N   . LEU A 1 363 ? 58.327  -3.105  23.877  1.00 31.76 ? 385 LEU A N   1 
ATOM   2444 C CA  . LEU A 1 363 ? 59.276  -3.855  23.058  1.00 34.90 ? 385 LEU A CA  1 
ATOM   2445 C C   . LEU A 1 363 ? 59.106  -3.401  21.616  1.00 31.69 ? 385 LEU A C   1 
ATOM   2446 O O   . LEU A 1 363 ? 58.055  -3.637  21.014  1.00 33.66 ? 385 LEU A O   1 
ATOM   2447 C CB  . LEU A 1 363 ? 59.047  -5.361  23.197  1.00 32.80 ? 385 LEU A CB  1 
ATOM   2448 C CG  . LEU A 1 363 ? 59.877  -6.319  22.347  1.00 31.66 ? 385 LEU A CG  1 
ATOM   2449 C CD1 . LEU A 1 363 ? 61.253  -6.512  22.955  1.00 38.68 ? 385 LEU A CD1 1 
ATOM   2450 C CD2 . LEU A 1 363 ? 59.157  -7.649  22.228  1.00 32.07 ? 385 LEU A CD2 1 
ATOM   2451 N N   . PHE A 1 364 ? 60.126  -2.742  21.070  1.00 29.70 ? 386 PHE A N   1 
ATOM   2452 C CA  . PHE A 1 364 ? 60.094  -2.197  19.718  1.00 31.89 ? 386 PHE A CA  1 
ATOM   2453 C C   . PHE A 1 364 ? 61.088  -2.948  18.845  1.00 30.84 ? 386 PHE A C   1 
ATOM   2454 O O   . PHE A 1 364 ? 62.252  -3.110  19.224  1.00 32.48 ? 386 PHE A O   1 
ATOM   2455 C CB  . PHE A 1 364 ? 60.420  -0.701  19.724  1.00 30.71 ? 386 PHE A CB  1 
ATOM   2456 C CG  . PHE A 1 364 ? 60.390  -0.063  18.359  1.00 31.06 ? 386 PHE A CG  1 
ATOM   2457 C CD1 . PHE A 1 364 ? 59.201  0.402   17.823  1.00 28.38 ? 386 PHE A CD1 1 
ATOM   2458 C CD2 . PHE A 1 364 ? 61.552  0.079   17.617  1.00 28.35 ? 386 PHE A CD2 1 
ATOM   2459 C CE1 . PHE A 1 364 ? 59.171  0.992   16.574  1.00 26.81 ? 386 PHE A CE1 1 
ATOM   2460 C CE2 . PHE A 1 364 ? 61.526  0.665   16.368  1.00 24.95 ? 386 PHE A CE2 1 
ATOM   2461 C CZ  . PHE A 1 364 ? 60.335  1.122   15.846  1.00 26.18 ? 386 PHE A CZ  1 
ATOM   2462 N N   . GLN A 1 365 ? 60.633  -3.395  17.675  1.00 29.98 ? 387 GLN A N   1 
ATOM   2463 C CA  . GLN A 1 365 ? 61.482  -4.128  16.746  1.00 34.79 ? 387 GLN A CA  1 
ATOM   2464 C C   . GLN A 1 365 ? 61.395  -3.502  15.361  1.00 36.10 ? 387 GLN A C   1 
ATOM   2465 O O   . GLN A 1 365 ? 60.296  -3.290  14.834  1.00 26.97 ? 387 GLN A O   1 
ATOM   2466 C CB  . GLN A 1 365 ? 61.091  -5.609  16.689  1.00 37.71 ? 387 GLN A CB  1 
ATOM   2467 C CG  . GLN A 1 365 ? 61.655  -6.346  15.481  1.00 54.06 ? 387 GLN A CG  1 
ATOM   2468 C CD  . GLN A 1 365 ? 62.337  -7.651  15.855  1.00 59.96 ? 387 GLN A CD  1 
ATOM   2469 O OE1 . GLN A 1 365 ? 61.965  -8.304  16.831  1.00 61.40 ? 387 GLN A OE1 1 
ATOM   2470 N NE2 . GLN A 1 365 ? 63.353  -8.028  15.085  1.00 54.89 ? 387 GLN A NE2 1 
ATOM   2471 N N   . ARG A 1 366 ? 62.557  -3.207  14.781  1.00 36.27 ? 388 ARG A N   1 
ATOM   2472 C CA  . ARG A 1 366 ? 62.674  -2.685  13.421  1.00 31.77 ? 388 ARG A CA  1 
ATOM   2473 C C   . ARG A 1 366 ? 63.622  -3.616  12.671  1.00 36.24 ? 388 ARG A C   1 
ATOM   2474 O O   . ARG A 1 366 ? 64.846  -3.507  12.806  1.00 34.62 ? 388 ARG A O   1 
ATOM   2475 C CB  . ARG A 1 366 ? 63.186  -1.248  13.420  1.00 35.79 ? 388 ARG A CB  1 
ATOM   2476 C CG  . ARG A 1 366 ? 62.830  -0.444  12.182  1.00 35.09 ? 388 ARG A CG  1 
ATOM   2477 C CD  . ARG A 1 366 ? 63.003  1.047   12.436  1.00 35.45 ? 388 ARG A CD  1 
ATOM   2478 N NE  . ARG A 1 366 ? 64.371  1.370   12.834  1.00 36.15 ? 388 ARG A NE  1 
ATOM   2479 C CZ  . ARG A 1 366 ? 64.692  2.240   13.786  1.00 33.27 ? 388 ARG A CZ  1 
ATOM   2480 N NH1 . ARG A 1 366 ? 63.744  2.888   14.454  1.00 28.32 ? 388 ARG A NH1 1 
ATOM   2481 N NH2 . ARG A 1 366 ? 65.968  2.463   14.066  1.00 35.03 ? 388 ARG A NH2 1 
ATOM   2482 N N   . GLY A 1 367 ? 63.060  -4.533  11.894  1.00 38.97 ? 389 GLY A N   1 
ATOM   2483 C CA  . GLY A 1 367 ? 63.888  -5.472  11.165  1.00 39.39 ? 389 GLY A CA  1 
ATOM   2484 C C   . GLY A 1 367 ? 64.613  -6.386  12.128  1.00 38.48 ? 389 GLY A C   1 
ATOM   2485 O O   . GLY A 1 367 ? 63.993  -7.097  12.928  1.00 42.92 ? 389 GLY A O   1 
ATOM   2486 N N   . GLN A 1 368 ? 65.944  -6.374  12.065  1.00 38.72 ? 390 GLN A N   1 
ATOM   2487 C CA  . GLN A 1 368 ? 66.775  -7.127  12.994  1.00 45.31 ? 390 GLN A CA  1 
ATOM   2488 C C   . GLN A 1 368 ? 67.261  -6.273  14.158  1.00 42.21 ? 390 GLN A C   1 
ATOM   2489 O O   . GLN A 1 368 ? 68.180  -6.683  14.875  1.00 38.40 ? 390 GLN A O   1 
ATOM   2490 C CB  . GLN A 1 368 ? 67.970  -7.745  12.256  1.00 43.25 ? 390 GLN A CB  1 
ATOM   2491 C CG  . GLN A 1 368 ? 67.613  -8.954  11.399  1.00 43.87 ? 390 GLN A CG  1 
ATOM   2492 C CD  . GLN A 1 368 ? 68.831  -9.730  10.928  1.00 45.08 ? 390 GLN A CD  1 
ATOM   2493 O OE1 . GLN A 1 368 ? 69.014  -9.955  9.728   1.00 34.60 ? 390 GLN A OE1 1 
ATOM   2494 N NE2 . GLN A 1 368 ? 69.669  -10.145 11.872  1.00 46.31 ? 390 GLN A NE2 1 
ATOM   2495 N N   . THR A 1 369 ? 66.675  -5.093  14.351  1.00 43.47 ? 391 THR A N   1 
ATOM   2496 C CA  . THR A 1 369 ? 67.000  -4.208  15.465  1.00 42.09 ? 391 THR A CA  1 
ATOM   2497 C C   . THR A 1 369 ? 65.848  -4.281  16.462  1.00 38.45 ? 391 THR A C   1 
ATOM   2498 O O   . THR A 1 369 ? 64.726  -3.864  16.155  1.00 34.24 ? 391 THR A O   1 
ATOM   2499 C CB  . THR A 1 369 ? 67.230  -2.775  14.981  1.00 36.25 ? 391 THR A CB  1 
ATOM   2500 O OG1 . THR A 1 369 ? 68.369  -2.741  14.112  1.00 35.91 ? 391 THR A OG1 1 
ATOM   2501 C CG2 . THR A 1 369 ? 67.480  -1.840  16.159  1.00 32.03 ? 391 THR A CG2 1 
ATOM   2502 N N   . GLN A 1 370 ? 66.121  -4.821  17.646  1.00 39.26 ? 392 GLN A N   1 
ATOM   2503 C CA  . GLN A 1 370 ? 65.097  -5.026  18.661  1.00 37.70 ? 392 GLN A CA  1 
ATOM   2504 C C   . GLN A 1 370 ? 65.555  -4.417  19.977  1.00 27.55 ? 392 GLN A C   1 
ATOM   2505 O O   . GLN A 1 370 ? 66.652  -4.718  20.456  1.00 35.05 ? 392 GLN A O   1 
ATOM   2506 C CB  . GLN A 1 370 ? 64.787  -6.518  18.844  1.00 40.58 ? 392 GLN A CB  1 
ATOM   2507 C CG  . GLN A 1 370 ? 63.402  -6.796  19.411  1.00 45.56 ? 392 GLN A CG  1 
ATOM   2508 C CD  . GLN A 1 370 ? 63.247  -8.217  19.917  1.00 50.51 ? 392 GLN A CD  1 
ATOM   2509 O OE1 . GLN A 1 370 ? 62.143  -8.761  19.950  1.00 54.66 ? 392 GLN A OE1 1 
ATOM   2510 N NE2 . GLN A 1 370 ? 64.358  -8.826  20.318  1.00 50.33 ? 392 GLN A NE2 1 
ATOM   2511 N N   . VAL A 1 371 ? 64.718  -3.563  20.554  1.00 24.71 ? 393 VAL A N   1 
ATOM   2512 C CA  . VAL A 1 371 ? 64.986  -2.977  21.860  1.00 34.32 ? 393 VAL A CA  1 
ATOM   2513 C C   . VAL A 1 371 ? 63.823  -3.302  22.783  1.00 35.36 ? 393 VAL A C   1 
ATOM   2514 O O   . VAL A 1 371 ? 62.678  -3.459  22.345  1.00 31.10 ? 393 VAL A O   1 
ATOM   2515 C CB  . VAL A 1 371 ? 65.212  -1.449  21.795  1.00 26.46 ? 393 VAL A CB  1 
ATOM   2516 C CG1 . VAL A 1 371 ? 66.517  -1.128  21.079  1.00 24.76 ? 393 VAL A CG1 1 
ATOM   2517 C CG2 . VAL A 1 371 ? 64.036  -0.774  21.114  1.00 31.90 ? 393 VAL A CG2 1 
ATOM   2518 N N   . LEU A 1 372 ? 64.130  -3.411  24.072  1.00 41.23 ? 394 LEU A N   1 
ATOM   2519 C CA  . LEU A 1 372 ? 63.138  -3.629  25.116  1.00 38.48 ? 394 LEU A CA  1 
ATOM   2520 C C   . LEU A 1 372 ? 63.265  -2.492  26.119  1.00 32.41 ? 394 LEU A C   1 
ATOM   2521 O O   . LEU A 1 372 ? 64.320  -2.323  26.742  1.00 29.45 ? 394 LEU A O   1 
ATOM   2522 C CB  . LEU A 1 372 ? 63.336  -4.990  25.788  1.00 37.39 ? 394 LEU A CB  1 
ATOM   2523 C CG  . LEU A 1 372 ? 62.867  -5.144  27.232  1.00 35.67 ? 394 LEU A CG  1 
ATOM   2524 C CD1 . LEU A 1 372 ? 61.353  -5.122  27.308  1.00 39.12 ? 394 LEU A CD1 1 
ATOM   2525 C CD2 . LEU A 1 372 ? 63.409  -6.433  27.814  1.00 45.95 ? 394 LEU A CD2 1 
ATOM   2526 N N   . CYS A 1 373 ? 62.201  -1.708  26.261  1.00 26.86 ? 395 CYS A N   1 
ATOM   2527 C CA  . CYS A 1 373 ? 62.218  -0.504  27.078  1.00 30.03 ? 395 CYS A CA  1 
ATOM   2528 C C   . CYS A 1 373 ? 61.325  -0.677  28.299  1.00 30.51 ? 395 CYS A C   1 
ATOM   2529 O O   . CYS A 1 373 ? 60.269  -1.314  28.223  1.00 27.64 ? 395 CYS A O   1 
ATOM   2530 C CB  . CYS A 1 373 ? 61.766  0.711   26.262  1.00 25.10 ? 395 CYS A CB  1 
ATOM   2531 S SG  . CYS A 1 373 ? 62.973  1.243   25.024  1.00 28.21 ? 395 CYS A SG  1 
ATOM   2532 N N   . THR A 1 374 ? 61.761  -0.113  29.428  1.00 21.76 ? 396 THR A N   1 
ATOM   2533 C CA  . THR A 1 374 ? 61.002  -0.159  30.668  1.00 24.90 ? 396 THR A CA  1 
ATOM   2534 C C   . THR A 1 374 ? 61.026  1.206   31.340  1.00 23.65 ? 396 THR A C   1 
ATOM   2535 O O   . THR A 1 374 ? 62.002  1.954   31.238  1.00 24.36 ? 396 THR A O   1 
ATOM   2536 C CB  . THR A 1 374 ? 61.546  -1.211  31.655  1.00 27.80 ? 396 THR A CB  1 
ATOM   2537 O OG1 . THR A 1 374 ? 62.876  -0.858  32.056  1.00 25.01 ? 396 THR A OG1 1 
ATOM   2538 C CG2 . THR A 1 374 ? 61.545  -2.604  31.035  1.00 23.62 ? 396 THR A CG2 1 
ATOM   2539 N N   . VAL A 1 375 ? 59.941  1.519   32.040  1.00 28.77 ? 397 VAL A N   1 
ATOM   2540 C CA  . VAL A 1 375 ? 59.836  2.727   32.848  1.00 30.75 ? 397 VAL A CA  1 
ATOM   2541 C C   . VAL A 1 375 ? 59.760  2.316   34.310  1.00 35.60 ? 397 VAL A C   1 
ATOM   2542 O O   . VAL A 1 375 ? 59.060  1.360   34.662  1.00 36.90 ? 397 VAL A O   1 
ATOM   2543 C CB  . VAL A 1 375 ? 58.611  3.577   32.459  1.00 29.17 ? 397 VAL A CB  1 
ATOM   2544 C CG1 . VAL A 1 375 ? 58.535  4.824   33.327  1.00 24.37 ? 397 VAL A CG1 1 
ATOM   2545 C CG2 . VAL A 1 375 ? 58.667  3.946   30.984  1.00 30.54 ? 397 VAL A CG2 1 
ATOM   2546 N N   . THR A 1 376 ? 60.486  3.037   35.160  1.00 35.92 ? 398 THR A N   1 
ATOM   2547 C CA  . THR A 1 376 ? 60.463  2.795   36.596  1.00 33.37 ? 398 THR A CA  1 
ATOM   2548 C C   . THR A 1 376 ? 60.414  4.136   37.307  1.00 38.60 ? 398 THR A C   1 
ATOM   2549 O O   . THR A 1 376 ? 61.289  4.985   37.101  1.00 38.86 ? 398 THR A O   1 
ATOM   2550 C CB  . THR A 1 376 ? 61.678  1.974   37.043  1.00 30.61 ? 398 THR A CB  1 
ATOM   2551 O OG1 . THR A 1 376 ? 61.427  0.587   36.784  1.00 38.55 ? 398 THR A OG1 1 
ATOM   2552 C CG2 . THR A 1 376 ? 61.949  2.167   38.527  1.00 24.11 ? 398 THR A CG2 1 
ATOM   2553 N N   . PHE A 1 377 ? 59.379  4.330   38.121  1.00 32.87 ? 399 PHE A N   1 
ATOM   2554 C CA  . PHE A 1 377 ? 59.229  5.550   38.895  1.00 32.54 ? 399 PHE A CA  1 
ATOM   2555 C C   . PHE A 1 377 ? 60.020  5.448   40.191  1.00 34.35 ? 399 PHE A C   1 
ATOM   2556 O O   . PHE A 1 377 ? 60.060  4.394   40.833  1.00 34.75 ? 399 PHE A O   1 
ATOM   2557 C CB  . PHE A 1 377 ? 57.754  5.812   39.198  1.00 36.03 ? 399 PHE A CB  1 
ATOM   2558 C CG  . PHE A 1 377 ? 56.887  5.893   37.973  1.00 33.65 ? 399 PHE A CG  1 
ATOM   2559 C CD1 . PHE A 1 377 ? 57.256  6.683   36.896  1.00 33.89 ? 399 PHE A CD1 1 
ATOM   2560 C CD2 . PHE A 1 377 ? 55.703  5.177   37.898  1.00 27.60 ? 399 PHE A CD2 1 
ATOM   2561 C CE1 . PHE A 1 377 ? 56.458  6.759   35.768  1.00 33.79 ? 399 PHE A CE1 1 
ATOM   2562 C CE2 . PHE A 1 377 ? 54.901  5.247   36.773  1.00 25.78 ? 399 PHE A CE2 1 
ATOM   2563 C CZ  . PHE A 1 377 ? 55.279  6.040   35.707  1.00 31.63 ? 399 PHE A CZ  1 
ATOM   2564 N N   . ASP A 1 378 ? 60.656  6.553   40.569  1.00 41.23 ? 400 ASP A N   1 
ATOM   2565 C CA  . ASP A 1 378 ? 61.447  6.627   41.786  1.00 40.42 ? 400 ASP A CA  1 
ATOM   2566 C C   . ASP A 1 378 ? 61.232  7.989   42.428  1.00 42.06 ? 400 ASP A C   1 
ATOM   2567 O O   . ASP A 1 378 ? 60.655  8.898   41.827  1.00 42.07 ? 400 ASP A O   1 
ATOM   2568 C CB  . ASP A 1 378 ? 62.936  6.383   41.500  1.00 48.50 ? 400 ASP A CB  1 
ATOM   2569 C CG  . ASP A 1 378 ? 63.679  5.839   42.707  1.00 60.61 ? 400 ASP A CG  1 
ATOM   2570 O OD1 . ASP A 1 378 ? 63.096  5.833   43.814  1.00 53.77 ? 400 ASP A OD1 1 
ATOM   2571 O OD2 . ASP A 1 378 ? 64.845  5.417   42.548  1.00 59.95 ? 400 ASP A OD2 1 
ATOM   2572 N N   . SER A 1 379 ? 61.700  8.125   43.666  1.00 46.80 ? 401 SER A N   1 
ATOM   2573 C CA  . SER A 1 379 ? 61.577  9.391   44.376  1.00 41.28 ? 401 SER A CA  1 
ATOM   2574 C C   . SER A 1 379 ? 62.271  10.515  43.612  1.00 47.53 ? 401 SER A C   1 
ATOM   2575 O O   . SER A 1 379 ? 63.221  10.289  42.855  1.00 54.53 ? 401 SER A O   1 
ATOM   2576 C CB  . SER A 1 379 ? 62.170  9.268   45.777  1.00 45.03 ? 401 SER A CB  1 
ATOM   2577 O OG  . SER A 1 379 ? 62.537  10.537  46.281  1.00 55.68 ? 401 SER A OG  1 
ATOM   2578 N N   . LEU A 1 380 ? 61.776  11.741  43.818  1.00 48.46 ? 402 LEU A N   1 
ATOM   2579 C CA  . LEU A 1 380 ? 62.355  12.907  43.156  1.00 49.82 ? 402 LEU A CA  1 
ATOM   2580 C C   . LEU A 1 380 ? 63.747  13.234  43.682  1.00 62.74 ? 402 LEU A C   1 
ATOM   2581 O O   . LEU A 1 380 ? 64.606  13.686  42.914  1.00 70.24 ? 402 LEU A O   1 
ATOM   2582 C CB  . LEU A 1 380 ? 61.428  14.125  43.323  1.00 45.95 ? 402 LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 380 ? 60.187  14.079  42.439  1.00 45.27 ? 402 LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 380 ? 59.599  15.469  42.202  1.00 41.83 ? 402 LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 380 ? 60.556  13.429  41.129  1.00 49.04 ? 402 LEU A CD2 1 
ATOM   2586 N N   . GLU A 1 381 ? 63.986  13.017  44.976  1.00 66.52 ? 403 GLU A N   1 
ATOM   2587 C CA  . GLU A 1 381 ? 65.272  13.297  45.602  1.00 70.59 ? 403 GLU A CA  1 
ATOM   2588 C C   . GLU A 1 381 ? 66.294  12.192  45.356  1.00 70.82 ? 403 GLU A C   1 
ATOM   2589 O O   . GLU A 1 381 ? 67.186  11.983  46.189  1.00 75.23 ? 403 GLU A O   1 
ATOM   2590 C CB  . GLU A 1 381 ? 65.088  13.516  47.106  1.00 70.72 ? 403 GLU A CB  1 
ATOM   2591 C CG  . GLU A 1 381 ? 64.333  14.791  47.466  1.00 74.08 ? 403 GLU A CG  1 
ATOM   2592 C CD  . GLU A 1 381 ? 62.826  14.611  47.422  1.00 77.82 ? 403 GLU A CD  1 
ATOM   2593 O OE1 . GLU A 1 381 ? 62.369  13.482  47.135  1.00 68.70 ? 403 GLU A OE1 1 
ATOM   2594 O OE2 . GLU A 1 381 ? 62.103  15.602  47.666  1.00 72.93 ? 403 GLU A OE2 1 
ATOM   2595 N N   . SER A 1 382 ? 66.184  11.470  44.245  1.00 64.96 ? 404 SER A N   1 
ATOM   2596 C CA  . SER A 1 382 ? 67.153  10.445  43.892  1.00 71.54 ? 404 SER A CA  1 
ATOM   2597 C C   . SER A 1 382 ? 67.741  10.698  42.507  1.00 75.62 ? 404 SER A C   1 
ATOM   2598 O O   . SER A 1 382 ? 67.914  11.847  42.096  1.00 73.86 ? 404 SER A O   1 
ATOM   2599 C CB  . SER A 1 382 ? 66.515  9.055   43.939  1.00 58.46 ? 404 SER A CB  1 
ATOM   2600 O OG  . SER A 1 382 ? 65.473  8.936   42.984  1.00 58.61 ? 404 SER A OG  1 
ATOM   2601 N N   . ASP A 1 398 ? 66.443  19.136  34.954  1.00 52.46 ? 420 ASP A N   1 
ATOM   2602 C CA  . ASP A 1 398 ? 65.305  20.012  34.703  1.00 53.40 ? 420 ASP A CA  1 
ATOM   2603 C C   . ASP A 1 398 ? 63.993  19.245  34.828  1.00 53.35 ? 420 ASP A C   1 
ATOM   2604 O O   . ASP A 1 398 ? 63.210  19.475  35.753  1.00 52.49 ? 420 ASP A O   1 
ATOM   2605 C CB  . ASP A 1 398 ? 65.414  20.652  33.314  1.00 58.90 ? 420 ASP A CB  1 
ATOM   2606 C CG  . ASP A 1 398 ? 64.299  21.654  33.036  1.00 66.39 ? 420 ASP A CG  1 
ATOM   2607 O OD1 . ASP A 1 398 ? 63.192  21.231  32.636  1.00 62.09 ? 420 ASP A OD1 1 
ATOM   2608 O OD2 . ASP A 1 398 ? 64.533  22.870  33.211  1.00 67.68 ? 420 ASP A OD2 1 
ATOM   2609 N N   . LYS A 1 399 ? 63.758  18.327  33.893  1.00 44.39 ? 421 LYS A N   1 
ATOM   2610 C CA  . LYS A 1 399 ? 62.502  17.597  33.830  1.00 47.65 ? 421 LYS A CA  1 
ATOM   2611 C C   . LYS A 1 399 ? 62.515  16.314  34.653  1.00 47.02 ? 421 LYS A C   1 
ATOM   2612 O O   . LYS A 1 399 ? 61.547  15.548  34.589  1.00 47.78 ? 421 LYS A O   1 
ATOM   2613 C CB  . LYS A 1 399 ? 62.147  17.277  32.375  1.00 45.87 ? 421 LYS A CB  1 
ATOM   2614 C CG  . LYS A 1 399 ? 61.152  18.249  31.754  1.00 42.49 ? 421 LYS A CG  1 
ATOM   2615 C CD  . LYS A 1 399 ? 60.974  18.003  30.266  1.00 33.76 ? 421 LYS A CD  1 
ATOM   2616 C CE  . LYS A 1 399 ? 60.263  19.173  29.603  1.00 41.53 ? 421 LYS A CE  1 
ATOM   2617 N NZ  . LYS A 1 399 ? 60.485  19.216  28.129  1.00 45.83 ? 421 LYS A NZ  1 
ATOM   2618 N N   . ASN A 1 400 ? 63.576  16.066  35.422  1.00 43.12 ? 422 ASN A N   1 
ATOM   2619 C CA  . ASN A 1 400 ? 63.662  14.889  36.286  1.00 42.99 ? 422 ASN A CA  1 
ATOM   2620 C C   . ASN A 1 400 ? 63.415  13.612  35.489  1.00 38.38 ? 422 ASN A C   1 
ATOM   2621 O O   . ASN A 1 400 ? 62.591  12.769  35.851  1.00 38.36 ? 422 ASN A O   1 
ATOM   2622 C CB  . ASN A 1 400 ? 62.686  14.997  37.459  1.00 43.20 ? 422 ASN A CB  1 
ATOM   2623 C CG  . ASN A 1 400 ? 63.332  15.564  38.704  1.00 39.42 ? 422 ASN A CG  1 
ATOM   2624 O OD1 . ASN A 1 400 ? 64.441  15.178  39.071  1.00 38.61 ? 422 ASN A OD1 1 
ATOM   2625 N ND2 . ASN A 1 400 ? 62.637  16.482  39.364  1.00 37.10 ? 422 ASN A ND2 1 
ATOM   2626 N N   . PHE A 1 401 ? 64.139  13.481  34.381  1.00 36.83 ? 423 PHE A N   1 
ATOM   2627 C CA  . PHE A 1 401 ? 63.917  12.407  33.423  1.00 28.81 ? 423 PHE A CA  1 
ATOM   2628 C C   . PHE A 1 401 ? 65.264  11.874  32.966  1.00 26.77 ? 423 PHE A C   1 
ATOM   2629 O O   . PHE A 1 401 ? 66.175  12.655  32.675  1.00 22.79 ? 423 PHE A O   1 
ATOM   2630 C CB  . PHE A 1 401 ? 63.097  12.912  32.232  1.00 22.78 ? 423 PHE A CB  1 
ATOM   2631 C CG  . PHE A 1 401 ? 63.069  11.974  31.065  1.00 25.18 ? 423 PHE A CG  1 
ATOM   2632 C CD1 . PHE A 1 401 ? 62.252  10.858  31.076  1.00 25.23 ? 423 PHE A CD1 1 
ATOM   2633 C CD2 . PHE A 1 401 ? 63.845  12.221  29.943  1.00 23.62 ? 423 PHE A CD2 1 
ATOM   2634 C CE1 . PHE A 1 401 ? 62.218  9.997   29.994  1.00 24.60 ? 423 PHE A CE1 1 
ATOM   2635 C CE2 . PHE A 1 401 ? 63.815  11.366  28.862  1.00 20.79 ? 423 PHE A CE2 1 
ATOM   2636 C CZ  . PHE A 1 401 ? 63.001  10.252  28.887  1.00 24.56 ? 423 PHE A CZ  1 
ATOM   2637 N N   . MET A 1 402 ? 65.394  10.549  32.924  1.00 24.38 ? 424 MET A N   1 
ATOM   2638 C CA  . MET A 1 402 ? 66.638  9.912   32.521  1.00 19.89 ? 424 MET A CA  1 
ATOM   2639 C C   . MET A 1 402 ? 66.335  8.721   31.628  1.00 28.76 ? 424 MET A C   1 
ATOM   2640 O O   . MET A 1 402 ? 65.318  8.040   31.790  1.00 30.67 ? 424 MET A O   1 
ATOM   2641 C CB  . MET A 1 402 ? 67.467  9.424   33.717  1.00 30.61 ? 424 MET A CB  1 
ATOM   2642 C CG  . MET A 1 402 ? 67.164  10.106  35.038  1.00 44.09 ? 424 MET A CG  1 
ATOM   2643 S SD  . MET A 1 402 ? 67.894  9.206   36.414  1.00 63.11 ? 424 MET A SD  1 
ATOM   2644 C CE  . MET A 1 402 ? 69.636  9.556   36.142  1.00 46.45 ? 424 MET A CE  1 
ATOM   2645 N N   . LEU A 1 403 ? 67.239  8.476   30.684  1.00 29.14 ? 425 LEU A N   1 
ATOM   2646 C CA  . LEU A 1 403 ? 67.218  7.281   29.855  1.00 23.57 ? 425 LEU A CA  1 
ATOM   2647 C C   . LEU A 1 403 ? 68.606  6.669   29.900  1.00 33.09 ? 425 LEU A C   1 
ATOM   2648 O O   . LEU A 1 403 ? 69.602  7.369   29.688  1.00 36.69 ? 425 LEU A O   1 
ATOM   2649 C CB  . LEU A 1 403 ? 66.813  7.603   28.415  1.00 25.38 ? 425 LEU A CB  1 
ATOM   2650 C CG  . LEU A 1 403 ? 66.648  6.410   27.468  1.00 31.70 ? 425 LEU A CG  1 
ATOM   2651 C CD1 . LEU A 1 403 ? 65.441  6.604   26.563  1.00 29.51 ? 425 LEU A CD1 1 
ATOM   2652 C CD2 . LEU A 1 403 ? 67.903  6.200   26.638  1.00 30.32 ? 425 LEU A CD2 1 
ATOM   2653 N N   . HIS A 1 404 ? 68.675  5.374   30.191  1.00 33.49 ? 426 HIS A N   1 
ATOM   2654 C CA  . HIS A 1 404 ? 69.940  4.665   30.302  1.00 36.37 ? 426 HIS A CA  1 
ATOM   2655 C C   . HIS A 1 404 ? 69.975  3.526   29.295  1.00 35.55 ? 426 HIS A C   1 
ATOM   2656 O O   . HIS A 1 404 ? 68.977  2.826   29.098  1.00 36.40 ? 426 HIS A O   1 
ATOM   2657 C CB  . HIS A 1 404 ? 70.152  4.149   31.725  1.00 39.26 ? 426 HIS A CB  1 
ATOM   2658 C CG  . HIS A 1 404 ? 70.262  5.244   32.740  1.00 52.08 ? 426 HIS A CG  1 
ATOM   2659 N ND1 . HIS A 1 404 ? 71.250  6.205   32.691  1.00 52.61 ? 426 HIS A ND1 1 
ATOM   2660 C CD2 . HIS A 1 404 ? 69.498  5.545   33.817  1.00 57.30 ? 426 HIS A CD2 1 
ATOM   2661 C CE1 . HIS A 1 404 ? 71.097  7.043   33.701  1.00 61.85 ? 426 HIS A CE1 1 
ATOM   2662 N NE2 . HIS A 1 404 ? 70.041  6.665   34.399  1.00 65.43 ? 426 HIS A NE2 1 
ATOM   2663 N N   . TYR A 1 405 ? 71.129  3.351   28.660  1.00 34.00 ? 427 TYR A N   1 
ATOM   2664 C CA  . TYR A 1 405 ? 71.254  2.485   27.490  1.00 46.29 ? 427 TYR A CA  1 
ATOM   2665 C C   . TYR A 1 405 ? 71.798  1.108   27.848  1.00 36.35 ? 427 TYR A C   1 
ATOM   2666 O O   . TYR A 1 405 ? 72.944  0.979   28.272  1.00 48.08 ? 427 TYR A O   1 
ATOM   2667 C CB  . TYR A 1 405 ? 72.153  3.162   26.449  1.00 52.95 ? 427 TYR A CB  1 
ATOM   2668 C CG  . TYR A 1 405 ? 72.211  2.480   25.102  1.00 57.25 ? 427 TYR A CG  1 
ATOM   2669 C CD1 . TYR A 1 405 ? 71.160  2.589   24.194  1.00 53.72 ? 427 TYR A CD1 1 
ATOM   2670 C CD2 . TYR A 1 405 ? 73.330  1.745   24.727  1.00 66.86 ? 427 TYR A CD2 1 
ATOM   2671 C CE1 . TYR A 1 405 ? 71.220  1.970   22.953  1.00 50.72 ? 427 TYR A CE1 1 
ATOM   2672 C CE2 . TYR A 1 405 ? 73.400  1.124   23.492  1.00 66.66 ? 427 TYR A CE2 1 
ATOM   2673 C CZ  . TYR A 1 405 ? 72.344  1.239   22.610  1.00 60.37 ? 427 TYR A CZ  1 
ATOM   2674 O OH  . TYR A 1 405 ? 72.424  0.619   21.384  1.00 61.43 ? 427 TYR A OH  1 
ATOM   2675 N N   . GLY A 1 427 ? 76.312  7.927   25.283  1.00 37.27 ? 449 GLY A N   1 
ATOM   2676 C CA  . GLY A 1 427 ? 76.436  8.066   23.842  1.00 41.86 ? 449 GLY A CA  1 
ATOM   2677 C C   . GLY A 1 427 ? 75.140  7.771   23.111  1.00 41.85 ? 449 GLY A C   1 
ATOM   2678 O O   . GLY A 1 427 ? 74.448  8.682   22.650  1.00 35.77 ? 449 GLY A O   1 
ATOM   2679 N N   . HIS A 1 428 ? 74.814  6.482   22.998  1.00 43.84 ? 450 HIS A N   1 
ATOM   2680 C CA  . HIS A 1 428 ? 73.535  6.096   22.415  1.00 48.36 ? 450 HIS A CA  1 
ATOM   2681 C C   . HIS A 1 428 ? 72.370  6.481   23.320  1.00 46.96 ? 450 HIS A C   1 
ATOM   2682 O O   . HIS A 1 428 ? 71.244  6.660   22.840  1.00 42.25 ? 450 HIS A O   1 
ATOM   2683 C CB  . HIS A 1 428 ? 73.508  4.590   22.139  1.00 57.53 ? 450 HIS A CB  1 
ATOM   2684 C CG  . HIS A 1 428 ? 74.471  4.143   21.080  1.00 58.12 ? 450 HIS A CG  1 
ATOM   2685 N ND1 . HIS A 1 428 ? 75.836  4.125   21.272  1.00 67.60 ? 450 HIS A ND1 1 
ATOM   2686 C CD2 . HIS A 1 428 ? 74.262  3.679   19.825  1.00 50.08 ? 450 HIS A CD2 1 
ATOM   2687 C CE1 . HIS A 1 428 ? 76.427  3.680   20.178  1.00 61.76 ? 450 HIS A CE1 1 
ATOM   2688 N NE2 . HIS A 1 428 ? 75.494  3.402   19.285  1.00 61.06 ? 450 HIS A NE2 1 
ATOM   2689 N N   . GLY A 1 429 ? 72.617  6.609   24.623  1.00 47.82 ? 451 GLY A N   1 
ATOM   2690 C CA  . GLY A 1 429 ? 71.570  6.929   25.573  1.00 41.94 ? 451 GLY A CA  1 
ATOM   2691 C C   . GLY A 1 429 ? 71.241  8.407   25.641  1.00 31.64 ? 451 GLY A C   1 
ATOM   2692 O O   . GLY A 1 429 ? 70.075  8.781   25.796  1.00 29.19 ? 451 GLY A O   1 
ATOM   2693 N N   . ALA A 1 430 ? 72.261  9.260   25.532  1.00 26.31 ? 452 ALA A N   1 
ATOM   2694 C CA  . ALA A 1 430 ? 72.012  10.697  25.564  1.00 28.27 ? 452 ALA A CA  1 
ATOM   2695 C C   . ALA A 1 430 ? 71.226  11.155  24.343  1.00 27.70 ? 452 ALA A C   1 
ATOM   2696 O O   . ALA A 1 430 ? 70.471  12.130  24.422  1.00 22.43 ? 452 ALA A O   1 
ATOM   2697 C CB  . ALA A 1 430 ? 73.332  11.460  25.662  1.00 22.45 ? 452 ALA A CB  1 
ATOM   2698 N N   . LEU A 1 431 ? 71.391  10.468  23.211  1.00 28.23 ? 453 LEU A N   1 
ATOM   2699 C CA  . LEU A 1 431 ? 70.668  10.850  22.005  1.00 25.21 ? 453 LEU A CA  1 
ATOM   2700 C C   . LEU A 1 431 ? 69.204  10.445  22.095  1.00 28.46 ? 453 LEU A C   1 
ATOM   2701 O O   . LEU A 1 431 ? 68.316  11.216  21.713  1.00 28.87 ? 453 LEU A O   1 
ATOM   2702 C CB  . LEU A 1 431 ? 71.329  10.223  20.778  1.00 21.95 ? 453 LEU A CB  1 
ATOM   2703 C CG  . LEU A 1 431 ? 70.631  10.461  19.439  1.00 20.62 ? 453 LEU A CG  1 
ATOM   2704 C CD1 . LEU A 1 431 ? 70.391  11.946  19.204  1.00 25.67 ? 453 LEU A CD1 1 
ATOM   2705 C CD2 . LEU A 1 431 ? 71.441  9.860   18.305  1.00 27.51 ? 453 LEU A CD2 1 
ATOM   2706 N N   . ALA A 1 432 ? 68.932  9.236   22.593  1.00 25.48 ? 454 ALA A N   1 
ATOM   2707 C CA  . ALA A 1 432 ? 67.550  8.835   22.822  1.00 19.80 ? 454 ALA A CA  1 
ATOM   2708 C C   . ALA A 1 432 ? 66.900  9.684   23.905  1.00 22.80 ? 454 ALA A C   1 
ATOM   2709 O O   . ALA A 1 432 ? 65.696  9.955   23.841  1.00 24.61 ? 454 ALA A O   1 
ATOM   2710 C CB  . ALA A 1 432 ? 67.488  7.354   23.189  1.00 21.41 ? 454 ALA A CB  1 
ATOM   2711 N N   . GLU A 1 433 ? 67.681  10.120  24.896  1.00 23.31 ? 455 GLU A N   1 
ATOM   2712 C CA  . GLU A 1 433 ? 67.146  10.991  25.937  1.00 23.39 ? 455 GLU A CA  1 
ATOM   2713 C C   . GLU A 1 433 ? 66.774  12.355  25.372  1.00 25.87 ? 455 GLU A C   1 
ATOM   2714 O O   . GLU A 1 433 ? 65.698  12.886  25.674  1.00 23.23 ? 455 GLU A O   1 
ATOM   2715 C CB  . GLU A 1 433 ? 68.165  11.135  27.066  1.00 26.56 ? 455 GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 433 ? 67.621  11.748  28.345  1.00 22.39 ? 455 GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 433 ? 68.671  11.820  29.436  1.00 21.01 ? 455 GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 433 ? 69.342  12.865  29.547  1.00 20.41 ? 455 GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 433 ? 68.833  10.829  30.180  1.00 31.24 ? 455 GLU A OE2 1 
ATOM   2720 N N   . LYS A 1 434 ? 67.654  12.936  24.552  1.00 28.20 ? 456 LYS A N   1 
ATOM   2721 C CA  . LYS A 1 434 ? 67.352  14.211  23.911  1.00 20.40 ? 456 LYS A CA  1 
ATOM   2722 C C   . LYS A 1 434 ? 66.124  14.107  23.022  1.00 22.95 ? 456 LYS A C   1 
ATOM   2723 O O   . LYS A 1 434 ? 65.362  15.075  22.898  1.00 23.69 ? 456 LYS A O   1 
ATOM   2724 C CB  . LYS A 1 434 ? 68.553  14.683  23.092  1.00 23.55 ? 456 LYS A CB  1 
ATOM   2725 C CG  . LYS A 1 434 ? 69.644  15.348  23.912  1.00 34.15 ? 456 LYS A CG  1 
ATOM   2726 C CD  . LYS A 1 434 ? 70.983  15.299  23.195  1.00 38.54 ? 456 LYS A CD  1 
ATOM   2727 C CE  . LYS A 1 434 ? 70.865  15.786  21.761  1.00 35.38 ? 456 LYS A CE  1 
ATOM   2728 N NZ  . LYS A 1 434 ? 72.181  15.777  21.074  1.00 34.05 ? 456 LYS A NZ  1 
ATOM   2729 N N   . ALA A 1 435 ? 65.912  12.944  22.402  1.00 23.47 ? 457 ALA A N   1 
ATOM   2730 C CA  . ALA A 1 435 ? 64.786  12.788  21.490  1.00 23.39 ? 457 ALA A CA  1 
ATOM   2731 C C   . ALA A 1 435 ? 63.463  12.808  22.240  1.00 21.61 ? 457 ALA A C   1 
ATOM   2732 O O   . ALA A 1 435 ? 62.471  13.344  21.738  1.00 25.88 ? 457 ALA A O   1 
ATOM   2733 C CB  . ALA A 1 435 ? 64.932  11.492  20.688  1.00 16.56 ? 457 ALA A CB  1 
ATOM   2734 N N   . LEU A 1 436 ? 63.429  12.233  23.444  1.00 24.02 ? 458 LEU A N   1 
ATOM   2735 C CA  . LEU A 1 436 ? 62.196  12.155  24.216  1.00 26.53 ? 458 LEU A CA  1 
ATOM   2736 C C   . LEU A 1 436 ? 61.991  13.343  25.146  1.00 28.44 ? 458 LEU A C   1 
ATOM   2737 O O   . LEU A 1 436 ? 60.859  13.572  25.588  1.00 29.82 ? 458 LEU A O   1 
ATOM   2738 C CB  . LEU A 1 436 ? 62.169  10.865  25.045  1.00 20.47 ? 458 LEU A CB  1 
ATOM   2739 C CG  . LEU A 1 436 ? 61.941  9.553   24.292  1.00 19.61 ? 458 LEU A CG  1 
ATOM   2740 C CD1 . LEU A 1 436 ? 62.331  8.373   25.162  1.00 26.21 ? 458 LEU A CD1 1 
ATOM   2741 C CD2 . LEU A 1 436 ? 60.499  9.423   23.837  1.00 19.46 ? 458 LEU A CD2 1 
ATOM   2742 N N   . TYR A 1 437 ? 63.047  14.108  25.431  1.00 25.16 ? 459 TYR A N   1 
ATOM   2743 C CA  . TYR A 1 437 ? 62.982  15.115  26.490  1.00 27.16 ? 459 TYR A CA  1 
ATOM   2744 C C   . TYR A 1 437 ? 61.895  16.164  26.283  1.00 27.74 ? 459 TYR A C   1 
ATOM   2745 O O   . TYR A 1 437 ? 61.131  16.415  27.231  1.00 30.44 ? 459 TYR A O   1 
ATOM   2746 C CB  . TYR A 1 437 ? 64.355  15.773  26.654  1.00 23.97 ? 459 TYR A CB  1 
ATOM   2747 C CG  . TYR A 1 437 ? 64.357  16.935  27.614  1.00 29.94 ? 459 TYR A CG  1 
ATOM   2748 C CD1 . TYR A 1 437 ? 64.575  16.738  28.975  1.00 29.08 ? 459 TYR A CD1 1 
ATOM   2749 C CD2 . TYR A 1 437 ? 64.144  18.237  27.160  1.00 39.47 ? 459 TYR A CD2 1 
ATOM   2750 C CE1 . TYR A 1 437 ? 64.579  17.808  29.859  1.00 42.12 ? 459 TYR A CE1 1 
ATOM   2751 C CE2 . TYR A 1 437 ? 64.143  19.312  28.034  1.00 44.65 ? 459 TYR A CE2 1 
ATOM   2752 C CZ  . TYR A 1 437 ? 64.361  19.092  29.383  1.00 49.62 ? 459 TYR A CZ  1 
ATOM   2753 O OH  . TYR A 1 437 ? 64.363  20.161  30.254  1.00 52.80 ? 459 TYR A OH  1 
ATOM   2754 N N   . PRO A 1 438 ? 61.766  16.816  25.121  1.00 26.20 ? 460 PRO A N   1 
ATOM   2755 C CA  . PRO A 1 438 ? 60.758  17.886  25.002  1.00 30.80 ? 460 PRO A CA  1 
ATOM   2756 C C   . PRO A 1 438 ? 59.330  17.402  25.186  1.00 33.86 ? 460 PRO A C   1 
ATOM   2757 O O   . PRO A 1 438 ? 58.442  18.216  25.472  1.00 32.50 ? 460 PRO A O   1 
ATOM   2758 C CB  . PRO A 1 438 ? 60.982  18.429  23.583  1.00 27.36 ? 460 PRO A CB  1 
ATOM   2759 C CG  . PRO A 1 438 ? 62.347  17.966  23.200  1.00 30.13 ? 460 PRO A CG  1 
ATOM   2760 C CD  . PRO A 1 438 ? 62.516  16.646  23.865  1.00 30.05 ? 460 PRO A CD  1 
ATOM   2761 N N   . VAL A 1 439 ? 59.084  16.104  25.034  1.00 27.52 ? 461 VAL A N   1 
ATOM   2762 C CA  . VAL A 1 439 ? 57.744  15.556  25.186  1.00 22.10 ? 461 VAL A CA  1 
ATOM   2763 C C   . VAL A 1 439 ? 57.429  15.191  26.637  1.00 31.76 ? 461 VAL A C   1 
ATOM   2764 O O   . VAL A 1 439 ? 56.247  15.163  27.020  1.00 35.57 ? 461 VAL A O   1 
ATOM   2765 C CB  . VAL A 1 439 ? 57.610  14.356  24.227  1.00 26.95 ? 461 VAL A CB  1 
ATOM   2766 C CG1 . VAL A 1 439 ? 56.564  13.397  24.681  1.00 27.30 ? 461 VAL A CG1 1 
ATOM   2767 C CG2 . VAL A 1 439 ? 57.280  14.841  22.826  1.00 24.93 ? 461 VAL A CG2 1 
ATOM   2768 N N   . ILE A 1 440 ? 58.447  14.946  27.458  1.00 31.81 ? 462 ILE A N   1 
ATOM   2769 C CA  . ILE A 1 440 ? 58.237  14.639  28.878  1.00 29.40 ? 462 ILE A CA  1 
ATOM   2770 C C   . ILE A 1 440 ? 57.544  15.817  29.553  1.00 30.38 ? 462 ILE A C   1 
ATOM   2771 O O   . ILE A 1 440 ? 57.945  16.978  29.339  1.00 26.46 ? 462 ILE A O   1 
ATOM   2772 C CB  . ILE A 1 440 ? 59.580  14.327  29.561  1.00 35.18 ? 462 ILE A CB  1 
ATOM   2773 C CG1 . ILE A 1 440 ? 60.172  13.032  29.005  1.00 28.35 ? 462 ILE A CG1 1 
ATOM   2774 C CG2 . ILE A 1 440 ? 59.417  14.226  31.075  1.00 30.86 ? 462 ILE A CG2 1 
ATOM   2775 C CD1 . ILE A 1 440 ? 59.257  11.851  29.154  1.00 31.89 ? 462 ILE A CD1 1 
ATOM   2776 N N   . PRO A 1 441 ? 56.513  15.592  30.365  1.00 37.32 ? 463 PRO A N   1 
ATOM   2777 C CA  . PRO A 1 441 ? 55.828  16.707  31.022  1.00 36.45 ? 463 PRO A CA  1 
ATOM   2778 C C   . PRO A 1 441 ? 56.593  17.214  32.230  1.00 32.32 ? 463 PRO A C   1 
ATOM   2779 O O   . PRO A 1 441 ? 57.354  16.484  32.868  1.00 39.29 ? 463 PRO A O   1 
ATOM   2780 C CB  . PRO A 1 441 ? 54.495  16.089  31.452  1.00 35.44 ? 463 PRO A CB  1 
ATOM   2781 C CG  . PRO A 1 441 ? 54.847  14.660  31.721  1.00 32.13 ? 463 PRO A CG  1 
ATOM   2782 C CD  . PRO A 1 441 ? 55.900  14.294  30.702  1.00 36.67 ? 463 PRO A CD  1 
ATOM   2783 N N   . ARG A 1 442 ? 56.373  18.486  32.543  1.00 39.51 ? 464 ARG A N   1 
ATOM   2784 C CA  . ARG A 1 442 ? 56.931  19.049  33.761  1.00 51.13 ? 464 ARG A CA  1 
ATOM   2785 C C   . ARG A 1 442 ? 56.030  18.730  34.953  1.00 59.10 ? 464 ARG A C   1 
ATOM   2786 O O   . ARG A 1 442 ? 54.851  18.391  34.805  1.00 54.18 ? 464 ARG A O   1 
ATOM   2787 C CB  . ARG A 1 442 ? 57.109  20.564  33.633  1.00 49.56 ? 464 ARG A CB  1 
ATOM   2788 C CG  . ARG A 1 442 ? 57.532  21.038  32.255  1.00 52.75 ? 464 ARG A CG  1 
ATOM   2789 C CD  . ARG A 1 442 ? 58.657  22.061  32.342  1.00 59.21 ? 464 ARG A CD  1 
ATOM   2790 N NE  . ARG A 1 442 ? 59.059  22.542  31.022  1.00 71.04 ? 464 ARG A NE  1 
ATOM   2791 C CZ  . ARG A 1 442 ? 60.316  22.799  30.669  1.00 73.09 ? 464 ARG A CZ  1 
ATOM   2792 N NH1 . ARG A 1 442 ? 61.302  22.621  31.541  1.00 70.04 ? 464 ARG A NH1 1 
ATOM   2793 N NH2 . ARG A 1 442 ? 60.588  23.229  29.442  1.00 55.74 ? 464 ARG A NH2 1 
ATOM   2794 N N   . ASP A 1 443 ? 56.612  18.839  36.150  1.00 56.37 ? 465 ASP A N   1 
ATOM   2795 C CA  . ASP A 1 443 ? 55.888  18.643  37.409  1.00 62.25 ? 465 ASP A CA  1 
ATOM   2796 C C   . ASP A 1 443 ? 55.338  17.221  37.526  1.00 58.90 ? 465 ASP A C   1 
ATOM   2797 O O   . ASP A 1 443 ? 54.175  17.004  37.872  1.00 59.32 ? 465 ASP A O   1 
ATOM   2798 C CB  . ASP A 1 443 ? 54.771  19.677  37.569  1.00 62.45 ? 465 ASP A CB  1 
ATOM   2799 C CG  . ASP A 1 443 ? 55.246  21.090  37.312  1.00 75.18 ? 465 ASP A CG  1 
ATOM   2800 O OD1 . ASP A 1 443 ? 56.376  21.422  37.732  1.00 73.39 ? 465 ASP A OD1 1 
ATOM   2801 O OD2 . ASP A 1 443 ? 54.490  21.866  36.687  1.00 78.75 ? 465 ASP A OD2 1 
ATOM   2802 N N   . PHE A 1 444 ? 56.191  16.244  37.235  1.00 51.45 ? 466 PHE A N   1 
ATOM   2803 C CA  . PHE A 1 444 ? 55.729  14.881  37.463  1.00 39.95 ? 466 PHE A CA  1 
ATOM   2804 C C   . PHE A 1 444 ? 56.070  14.445  38.889  1.00 40.10 ? 466 PHE A C   1 
ATOM   2805 O O   . PHE A 1 444 ? 57.145  14.778  39.398  1.00 34.69 ? 466 PHE A O   1 
ATOM   2806 C CB  . PHE A 1 444 ? 56.363  13.923  36.459  1.00 34.76 ? 466 PHE A CB  1 
ATOM   2807 C CG  . PHE A 1 444 ? 55.669  12.597  36.368  1.00 31.93 ? 466 PHE A CG  1 
ATOM   2808 C CD1 . PHE A 1 444 ? 54.434  12.486  35.758  1.00 26.29 ? 466 PHE A CD1 1 
ATOM   2809 C CD2 . PHE A 1 444 ? 56.251  11.459  36.901  1.00 36.43 ? 466 PHE A CD2 1 
ATOM   2810 C CE1 . PHE A 1 444 ? 53.792  11.262  35.679  1.00 27.96 ? 466 PHE A CE1 1 
ATOM   2811 C CE2 . PHE A 1 444 ? 55.616  10.234  36.823  1.00 34.16 ? 466 PHE A CE2 1 
ATOM   2812 C CZ  . PHE A 1 444 ? 54.385  10.135  36.212  1.00 28.47 ? 466 PHE A CZ  1 
ATOM   2813 N N   . PRO A 1 445 ? 55.176  13.710  39.558  1.00 42.12 ? 467 PRO A N   1 
ATOM   2814 C CA  . PRO A 1 445 ? 55.413  13.384  40.977  1.00 35.06 ? 467 PRO A CA  1 
ATOM   2815 C C   . PRO A 1 445 ? 56.624  12.501  41.224  1.00 41.59 ? 467 PRO A C   1 
ATOM   2816 O O   . PRO A 1 445 ? 57.247  12.619  42.286  1.00 46.94 ? 467 PRO A O   1 
ATOM   2817 C CB  . PRO A 1 445 ? 54.113  12.682  41.400  1.00 35.51 ? 467 PRO A CB  1 
ATOM   2818 C CG  . PRO A 1 445 ? 53.475  12.235  40.118  1.00 41.93 ? 467 PRO A CG  1 
ATOM   2819 C CD  . PRO A 1 445 ? 53.845  13.272  39.105  1.00 38.67 ? 467 PRO A CD  1 
ATOM   2820 N N   . PHE A 1 446 ? 56.977  11.618  40.292  1.00 42.56 ? 468 PHE A N   1 
ATOM   2821 C CA  . PHE A 1 446 ? 58.109  10.720  40.463  1.00 41.73 ? 468 PHE A CA  1 
ATOM   2822 C C   . PHE A 1 446 ? 59.180  11.016  39.424  1.00 42.75 ? 468 PHE A C   1 
ATOM   2823 O O   . PHE A 1 446 ? 58.922  11.645  38.395  1.00 52.87 ? 468 PHE A O   1 
ATOM   2824 C CB  . PHE A 1 446 ? 57.687  9.250   40.350  1.00 40.85 ? 468 PHE A CB  1 
ATOM   2825 C CG  . PHE A 1 446 ? 56.367  8.945   40.991  1.00 42.89 ? 468 PHE A CG  1 
ATOM   2826 C CD1 . PHE A 1 446 ? 56.165  9.197   42.338  1.00 39.76 ? 468 PHE A CD1 1 
ATOM   2827 C CD2 . PHE A 1 446 ? 55.329  8.398   40.251  1.00 41.54 ? 468 PHE A CD2 1 
ATOM   2828 C CE1 . PHE A 1 446 ? 54.954  8.916   42.932  1.00 37.35 ? 468 PHE A CE1 1 
ATOM   2829 C CE2 . PHE A 1 446 ? 54.113  8.115   40.842  1.00 43.39 ? 468 PHE A CE2 1 
ATOM   2830 C CZ  . PHE A 1 446 ? 53.926  8.374   42.184  1.00 43.35 ? 468 PHE A CZ  1 
ATOM   2831 N N   . THR A 1 447 ? 60.399  10.562  39.706  1.00 37.80 ? 469 THR A N   1 
ATOM   2832 C CA  . THR A 1 447 ? 61.467  10.632  38.718  1.00 41.46 ? 469 THR A CA  1 
ATOM   2833 C C   . THR A 1 447 ? 61.268  9.527   37.687  1.00 37.55 ? 469 THR A C   1 
ATOM   2834 O O   . THR A 1 447 ? 60.970  8.381   38.039  1.00 35.83 ? 469 THR A O   1 
ATOM   2835 C CB  . THR A 1 447 ? 62.838  10.510  39.390  1.00 45.54 ? 469 THR A CB  1 
ATOM   2836 O OG1 . THR A 1 447 ? 63.160  11.744  40.045  1.00 46.91 ? 469 THR A OG1 1 
ATOM   2837 C CG2 . THR A 1 447 ? 63.917  10.205  38.366  1.00 43.88 ? 469 THR A CG2 1 
ATOM   2838 N N   . ILE A 1 448 ? 61.404  9.874   36.413  1.00 30.35 ? 470 ILE A N   1 
ATOM   2839 C CA  . ILE A 1 448 ? 61.162  8.935   35.328  1.00 32.28 ? 470 ILE A CA  1 
ATOM   2840 C C   . ILE A 1 448 ? 62.502  8.358   34.885  1.00 36.54 ? 470 ILE A C   1 
ATOM   2841 O O   . ILE A 1 448 ? 63.366  9.077   34.368  1.00 29.46 ? 470 ILE A O   1 
ATOM   2842 C CB  . ILE A 1 448 ? 60.418  9.599   34.166  1.00 28.67 ? 470 ILE A CB  1 
ATOM   2843 C CG1 . ILE A 1 448 ? 59.054  10.103  34.643  1.00 28.33 ? 470 ILE A CG1 1 
ATOM   2844 C CG2 . ILE A 1 448 ? 60.257  8.611   33.035  1.00 25.07 ? 470 ILE A CG2 1 
ATOM   2845 C CD1 . ILE A 1 448 ? 58.424  11.131  33.732  1.00 27.52 ? 470 ILE A CD1 1 
ATOM   2846 N N   . ARG A 1 449 ? 62.678  7.055   35.100  1.00 36.58 ? 471 ARG A N   1 
ATOM   2847 C CA  . ARG A 1 449 ? 63.871  6.329   34.681  1.00 31.52 ? 471 ARG A CA  1 
ATOM   2848 C C   . ARG A 1 449 ? 63.464  5.356   33.582  1.00 34.74 ? 471 ARG A C   1 
ATOM   2849 O O   . ARG A 1 449 ? 62.761  4.374   33.843  1.00 37.84 ? 471 ARG A O   1 
ATOM   2850 C CB  . ARG A 1 449 ? 64.510  5.588   35.855  1.00 35.03 ? 471 ARG A CB  1 
ATOM   2851 C CG  . ARG A 1 449 ? 65.055  6.491   36.956  1.00 54.69 ? 471 ARG A CG  1 
ATOM   2852 C CD  . ARG A 1 449 ? 66.103  5.777   37.808  1.00 56.01 ? 471 ARG A CD  1 
ATOM   2853 N NE  . ARG A 1 449 ? 65.558  4.615   38.509  1.00 62.10 ? 471 ARG A NE  1 
ATOM   2854 C CZ  . ARG A 1 449 ? 65.806  3.351   38.171  1.00 62.88 ? 471 ARG A CZ  1 
ATOM   2855 N NH1 . ARG A 1 449 ? 66.590  3.078   37.134  1.00 56.88 ? 471 ARG A NH1 1 
ATOM   2856 N NH2 . ARG A 1 449 ? 65.268  2.356   38.868  1.00 53.89 ? 471 ARG A NH2 1 
ATOM   2857 N N   . VAL A 1 450 ? 63.898  5.630   32.359  1.00 31.81 ? 472 VAL A N   1 
ATOM   2858 C CA  . VAL A 1 450 ? 63.678  4.733   31.232  1.00 26.66 ? 472 VAL A CA  1 
ATOM   2859 C C   . VAL A 1 450 ? 64.949  3.930   31.001  1.00 27.03 ? 472 VAL A C   1 
ATOM   2860 O O   . VAL A 1 450 ? 66.060  4.476   31.043  1.00 27.72 ? 472 VAL A O   1 
ATOM   2861 C CB  . VAL A 1 450 ? 63.273  5.512   29.967  1.00 24.75 ? 472 VAL A CB  1 
ATOM   2862 C CG1 . VAL A 1 450 ? 63.085  4.566   28.788  1.00 22.39 ? 472 VAL A CG1 1 
ATOM   2863 C CG2 . VAL A 1 450 ? 62.007  6.309   30.222  1.00 26.15 ? 472 VAL A CG2 1 
ATOM   2864 N N   . THR A 1 451 ? 64.791  2.629   30.775  1.00 24.60 ? 473 THR A N   1 
ATOM   2865 C CA  . THR A 1 451 ? 65.903  1.747   30.448  1.00 28.10 ? 473 THR A CA  1 
ATOM   2866 C C   . THR A 1 451 ? 65.601  1.056   29.127  1.00 24.22 ? 473 THR A C   1 
ATOM   2867 O O   . THR A 1 451 ? 64.554  0.418   28.983  1.00 24.15 ? 473 THR A O   1 
ATOM   2868 C CB  . THR A 1 451 ? 66.145  0.715   31.551  1.00 21.59 ? 473 THR A CB  1 
ATOM   2869 O OG1 . THR A 1 451 ? 66.748  1.359   32.679  1.00 23.64 ? 473 THR A OG1 1 
ATOM   2870 C CG2 . THR A 1 451 ? 67.073  -0.385  31.055  1.00 21.89 ? 473 THR A CG2 1 
ATOM   2871 N N   . SER A 1 452 ? 66.515  1.187   28.170  1.00 28.03 ? 474 SER A N   1 
ATOM   2872 C CA  . SER A 1 452 ? 66.399  0.549   26.863  1.00 29.35 ? 474 SER A CA  1 
ATOM   2873 C C   . SER A 1 452 ? 67.521  -0.474  26.736  1.00 30.50 ? 474 SER A C   1 
ATOM   2874 O O   . SER A 1 452 ? 68.701  -0.109  26.719  1.00 36.82 ? 474 SER A O   1 
ATOM   2875 C CB  . SER A 1 452 ? 66.466  1.582   25.740  1.00 23.62 ? 474 SER A CB  1 
ATOM   2876 O OG  . SER A 1 452 ? 66.181  0.987   24.487  1.00 25.65 ? 474 SER A OG  1 
ATOM   2877 N N   . GLU A 1 453 ? 67.153  -1.749  26.656  1.00 31.71 ? 475 GLU A N   1 
ATOM   2878 C CA  . GLU A 1 453 ? 68.107  -2.842  26.525  1.00 33.74 ? 475 GLU A CA  1 
ATOM   2879 C C   . GLU A 1 453 ? 68.058  -3.352  25.093  1.00 39.84 ? 475 GLU A C   1 
ATOM   2880 O O   . GLU A 1 453 ? 67.002  -3.801  24.628  1.00 41.69 ? 475 GLU A O   1 
ATOM   2881 C CB  . GLU A 1 453 ? 67.795  -3.972  27.509  1.00 44.23 ? 475 GLU A CB  1 
ATOM   2882 C CG  . GLU A 1 453 ? 67.295  -3.508  28.871  1.00 50.03 ? 475 GLU A CG  1 
ATOM   2883 C CD  . GLU A 1 453 ? 67.973  -4.239  30.016  1.00 70.90 ? 475 GLU A CD  1 
ATOM   2884 O OE1 . GLU A 1 453 ? 69.038  -4.852  29.782  1.00 76.80 ? 475 GLU A OE1 1 
ATOM   2885 O OE2 . GLU A 1 453 ? 67.442  -4.202  31.148  1.00 67.97 ? 475 GLU A OE2 1 
ATOM   2886 N N   . VAL A 1 454 ? 69.191  -3.283  24.400  1.00 31.47 ? 476 VAL A N   1 
ATOM   2887 C CA  . VAL A 1 454 ? 69.263  -3.723  23.011  1.00 30.65 ? 476 VAL A CA  1 
ATOM   2888 C C   . VAL A 1 454 ? 69.459  -5.234  22.982  1.00 35.51 ? 476 VAL A C   1 
ATOM   2889 O O   . VAL A 1 454 ? 70.483  -5.750  23.444  1.00 36.25 ? 476 VAL A O   1 
ATOM   2890 C CB  . VAL A 1 454 ? 70.393  -3.003  22.263  1.00 32.06 ? 476 VAL A CB  1 
ATOM   2891 C CG1 . VAL A 1 454 ? 70.515  -3.539  20.847  1.00 37.90 ? 476 VAL A CG1 1 
ATOM   2892 C CG2 . VAL A 1 454 ? 70.145  -1.509  22.255  1.00 34.08 ? 476 VAL A CG2 1 
ATOM   2893 N N   . LEU A 1 455 ? 68.474  -5.948  22.440  1.00 35.69 ? 477 LEU A N   1 
ATOM   2894 C CA  . LEU A 1 455 ? 68.556  -7.400  22.326  1.00 41.15 ? 477 LEU A CA  1 
ATOM   2895 C C   . LEU A 1 455 ? 69.151  -7.835  20.993  1.00 43.00 ? 477 LEU A C   1 
ATOM   2896 O O   . LEU A 1 455 ? 69.879  -8.832  20.932  1.00 46.49 ? 477 LEU A O   1 
ATOM   2897 C CB  . LEU A 1 455 ? 67.169  -8.025  22.506  1.00 40.37 ? 477 LEU A CB  1 
ATOM   2898 C CG  . LEU A 1 455 ? 66.238  -7.382  23.537  1.00 41.29 ? 477 LEU A CG  1 
ATOM   2899 C CD1 . LEU A 1 455 ? 64.929  -8.151  23.627  1.00 45.07 ? 477 LEU A CD1 1 
ATOM   2900 C CD2 . LEU A 1 455 ? 66.909  -7.291  24.902  1.00 39.24 ? 477 LEU A CD2 1 
ATOM   2901 N N   . GLU A 1 456 ? 68.850  -7.104  19.924  1.00 41.96 ? 478 GLU A N   1 
ATOM   2902 C CA  . GLU A 1 456 ? 69.387  -7.371  18.597  1.00 40.06 ? 478 GLU A CA  1 
ATOM   2903 C C   . GLU A 1 456 ? 69.701  -6.032  17.953  1.00 41.81 ? 478 GLU A C   1 
ATOM   2904 O O   . GLU A 1 456 ? 68.885  -5.108  18.017  1.00 38.42 ? 478 GLU A O   1 
ATOM   2905 C CB  . GLU A 1 456 ? 68.389  -8.162  17.744  1.00 44.54 ? 478 GLU A CB  1 
ATOM   2906 C CG  . GLU A 1 456 ? 69.014  -9.113  16.740  1.00 48.85 ? 478 GLU A CG  1 
ATOM   2907 C CD  . GLU A 1 456 ? 67.989  -9.665  15.763  1.00 58.41 ? 478 GLU A CD  1 
ATOM   2908 O OE1 . GLU A 1 456 ? 66.796  -9.302  15.884  1.00 54.60 ? 478 GLU A OE1 1 
ATOM   2909 O OE2 . GLU A 1 456 ? 68.372  -10.456 14.873  1.00 49.58 ? 478 GLU A OE2 1 
ATOM   2910 N N   . SER A 1 457 ? 70.880  -5.922  17.344  1.00 48.16 ? 479 SER A N   1 
ATOM   2911 C CA  . SER A 1 457 ? 71.350  -4.656  16.794  1.00 42.96 ? 479 SER A CA  1 
ATOM   2912 C C   . SER A 1 457 ? 71.798  -4.860  15.354  1.00 41.64 ? 479 SER A C   1 
ATOM   2913 O O   . SER A 1 457 ? 72.757  -5.597  15.100  1.00 44.78 ? 479 SER A O   1 
ATOM   2914 C CB  . SER A 1 457 ? 72.494  -4.086  17.637  1.00 28.57 ? 479 SER A CB  1 
ATOM   2915 O OG  . SER A 1 457 ? 72.961  -2.865  17.092  1.00 47.98 ? 479 SER A OG  1 
ATOM   2916 N N   . ASN A 1 458 ? 71.106  -4.211  14.420  1.00 34.64 ? 480 ASN A N   1 
ATOM   2917 C CA  . ASN A 1 458 ? 71.512  -4.174  13.015  1.00 39.78 ? 480 ASN A CA  1 
ATOM   2918 C C   . ASN A 1 458 ? 71.216  -2.795  12.436  1.00 33.16 ? 480 ASN A C   1 
ATOM   2919 O O   . ASN A 1 458 ? 70.554  -2.652  11.407  1.00 31.35 ? 480 ASN A O   1 
ATOM   2920 C CB  . ASN A 1 458 ? 70.824  -5.266  12.194  1.00 33.97 ? 480 ASN A CB  1 
ATOM   2921 C CG  . ASN A 1 458 ? 71.403  -5.395  10.785  1.00 33.93 ? 480 ASN A CG  1 
ATOM   2922 O OD1 . ASN A 1 458 ? 72.485  -4.883  10.490  1.00 32.99 ? 480 ASN A OD1 1 
ATOM   2923 N ND2 . ASN A 1 458 ? 70.676  -6.077  9.909   1.00 39.05 ? 480 ASN A ND2 1 
ATOM   2924 N N   . GLY A 1 459 ? 71.705  -1.756  13.103  1.00 31.55 ? 481 GLY A N   1 
ATOM   2925 C CA  . GLY A 1 459 ? 71.512  -0.411  12.601  1.00 32.44 ? 481 GLY A CA  1 
ATOM   2926 C C   . GLY A 1 459 ? 70.596  0.451   13.444  1.00 32.92 ? 481 GLY A C   1 
ATOM   2927 O O   . GLY A 1 459 ? 69.396  0.182   13.555  1.00 33.82 ? 481 GLY A O   1 
ATOM   2928 N N   . SER A 1 460 ? 71.170  1.493   14.046  1.00 41.64 ? 482 SER A N   1 
ATOM   2929 C CA  . SER A 1 460 ? 70.446  2.525   14.788  1.00 38.17 ? 482 SER A CA  1 
ATOM   2930 C C   . SER A 1 460 ? 69.555  1.921   15.876  1.00 37.76 ? 482 SER A C   1 
ATOM   2931 O O   . SER A 1 460 ? 68.326  1.996   15.838  1.00 32.22 ? 482 SER A O   1 
ATOM   2932 C CB  . SER A 1 460 ? 69.619  3.403   13.849  1.00 38.60 ? 482 SER A CB  1 
ATOM   2933 O OG  . SER A 1 460 ? 69.152  4.537   14.554  1.00 41.91 ? 482 SER A OG  1 
ATOM   2934 N N   . SER A 1 461 ? 70.223  1.322   16.861  1.00 43.03 ? 483 SER A N   1 
ATOM   2935 C CA  . SER A 1 461 ? 69.528  0.973   18.092  1.00 35.91 ? 483 SER A CA  1 
ATOM   2936 C C   . SER A 1 461 ? 69.142  2.221   18.874  1.00 29.60 ? 483 SER A C   1 
ATOM   2937 O O   . SER A 1 461 ? 68.153  2.210   19.614  1.00 32.21 ? 483 SER A O   1 
ATOM   2938 C CB  . SER A 1 461 ? 70.402  0.052   18.942  1.00 40.06 ? 483 SER A CB  1 
ATOM   2939 O OG  . SER A 1 461 ? 71.745  0.506   18.964  1.00 40.88 ? 483 SER A OG  1 
ATOM   2940 N N   . SER A 1 462 ? 69.900  3.306   18.709  1.00 33.35 ? 484 SER A N   1 
ATOM   2941 C CA  . SER A 1 462 ? 69.618  4.530   19.447  1.00 33.01 ? 484 SER A CA  1 
ATOM   2942 C C   . SER A 1 462 ? 68.284  5.149   19.041  1.00 34.86 ? 484 SER A C   1 
ATOM   2943 O O   . SER A 1 462 ? 67.587  5.715   19.892  1.00 29.83 ? 484 SER A O   1 
ATOM   2944 C CB  . SER A 1 462 ? 70.752  5.530   19.249  1.00 37.79 ? 484 SER A CB  1 
ATOM   2945 O OG  . SER A 1 462 ? 70.425  6.784   19.820  1.00 38.87 ? 484 SER A OG  1 
ATOM   2946 N N   . MET A 1 463 ? 67.910  5.069   17.757  1.00 35.32 ? 485 MET A N   1 
ATOM   2947 C CA  . MET A 1 463 ? 66.608  5.588   17.349  1.00 26.81 ? 485 MET A CA  1 
ATOM   2948 C C   . MET A 1 463 ? 65.481  4.646   17.740  1.00 29.84 ? 485 MET A C   1 
ATOM   2949 O O   . MET A 1 463 ? 64.369  5.103   18.028  1.00 28.61 ? 485 MET A O   1 
ATOM   2950 C CB  . MET A 1 463 ? 66.579  5.847   15.842  1.00 21.26 ? 485 MET A CB  1 
ATOM   2951 C CG  . MET A 1 463 ? 67.445  7.017   15.394  1.00 22.56 ? 485 MET A CG  1 
ATOM   2952 S SD  . MET A 1 463 ? 66.975  8.612   16.104  1.00 18.84 ? 485 MET A SD  1 
ATOM   2953 C CE  . MET A 1 463 ? 68.099  8.734   17.492  1.00 19.54 ? 485 MET A CE  1 
ATOM   2954 N N   . ALA A 1 464 ? 65.746  3.338   17.754  1.00 31.03 ? 486 ALA A N   1 
ATOM   2955 C CA  . ALA A 1 464 ? 64.750  2.393   18.242  1.00 27.46 ? 486 ALA A CA  1 
ATOM   2956 C C   . ALA A 1 464 ? 64.474  2.609   19.726  1.00 24.29 ? 486 ALA A C   1 
ATOM   2957 O O   . ALA A 1 464 ? 63.329  2.483   20.173  1.00 22.90 ? 486 ALA A O   1 
ATOM   2958 C CB  . ALA A 1 464 ? 65.213  0.960   17.974  1.00 21.68 ? 486 ALA A CB  1 
ATOM   2959 N N   . SER A 1 465 ? 65.511  2.947   20.500  1.00 18.67 ? 487 SER A N   1 
ATOM   2960 C CA  . SER A 1 465 ? 65.323  3.226   21.919  1.00 18.00 ? 487 SER A CA  1 
ATOM   2961 C C   . SER A 1 465 ? 64.394  4.411   22.145  1.00 24.54 ? 487 SER A C   1 
ATOM   2962 O O   . SER A 1 465 ? 63.695  4.464   23.163  1.00 21.84 ? 487 SER A O   1 
ATOM   2963 C CB  . SER A 1 465 ? 66.671  3.489   22.584  1.00 18.31 ? 487 SER A CB  1 
ATOM   2964 O OG  . SER A 1 465 ? 67.545  2.396   22.389  1.00 31.43 ? 487 SER A OG  1 
ATOM   2965 N N   . ALA A 1 466 ? 64.386  5.379   21.225  1.00 25.23 ? 488 ALA A N   1 
ATOM   2966 C CA  . ALA A 1 466 ? 63.459  6.497   21.352  1.00 19.05 ? 488 ALA A CA  1 
ATOM   2967 C C   . ALA A 1 466 ? 62.020  6.035   21.168  1.00 23.01 ? 488 ALA A C   1 
ATOM   2968 O O   . ALA A 1 466 ? 61.136  6.410   21.949  1.00 21.83 ? 488 ALA A O   1 
ATOM   2969 C CB  . ALA A 1 466 ? 63.808  7.586   20.339  1.00 16.92 ? 488 ALA A CB  1 
ATOM   2970 N N   . CYS A 1 467 ? 61.770  5.215   20.144  1.00 22.18 ? 489 CYS A N   1 
ATOM   2971 C CA  . CYS A 1 467 ? 60.417  4.732   19.890  1.00 18.67 ? 489 CYS A CA  1 
ATOM   2972 C C   . CYS A 1 467 ? 59.933  3.845   21.029  1.00 22.86 ? 489 CYS A C   1 
ATOM   2973 O O   . CYS A 1 467 ? 58.797  3.981   21.497  1.00 25.79 ? 489 CYS A O   1 
ATOM   2974 C CB  . CYS A 1 467 ? 60.372  3.981   18.558  1.00 21.97 ? 489 CYS A CB  1 
ATOM   2975 S SG  . CYS A 1 467 ? 61.055  4.909   17.158  1.00 27.21 ? 489 CYS A SG  1 
ATOM   2976 N N   . GLY A 1 468 ? 60.788  2.930   21.494  1.00 24.93 ? 490 GLY A N   1 
ATOM   2977 C CA  . GLY A 1 468 ? 60.419  2.093   22.621  1.00 23.95 ? 490 GLY A CA  1 
ATOM   2978 C C   . GLY A 1 468 ? 60.258  2.871   23.911  1.00 21.96 ? 490 GLY A C   1 
ATOM   2979 O O   . GLY A 1 468 ? 59.466  2.488   24.777  1.00 25.60 ? 490 GLY A O   1 
ATOM   2980 N N   . GLY A 1 469 ? 61.008  3.962   24.066  1.00 20.84 ? 491 GLY A N   1 
ATOM   2981 C CA  . GLY A 1 469 ? 60.807  4.821   25.219  1.00 22.71 ? 491 GLY A CA  1 
ATOM   2982 C C   . GLY A 1 469 ? 59.474  5.540   25.171  1.00 25.33 ? 491 GLY A C   1 
ATOM   2983 O O   . GLY A 1 469 ? 58.816  5.716   26.201  1.00 28.41 ? 491 GLY A O   1 
ATOM   2984 N N   . SER A 1 470 ? 59.057  5.967   23.976  1.00 22.43 ? 492 SER A N   1 
ATOM   2985 C CA  . SER A 1 470 ? 57.750  6.595   23.836  1.00 20.53 ? 492 SER A CA  1 
ATOM   2986 C C   . SER A 1 470 ? 56.633  5.609   24.150  1.00 26.46 ? 492 SER A C   1 
ATOM   2987 O O   . SER A 1 470 ? 55.676  5.951   24.856  1.00 29.75 ? 492 SER A O   1 
ATOM   2988 C CB  . SER A 1 470 ? 57.585  7.163   22.428  1.00 20.07 ? 492 SER A CB  1 
ATOM   2989 O OG  . SER A 1 470 ? 56.227  7.102   22.018  1.00 22.35 ? 492 SER A OG  1 
ATOM   2990 N N   . LEU A 1 471 ? 56.737  4.378   23.640  1.00 25.04 ? 493 LEU A N   1 
ATOM   2991 C CA  . LEU A 1 471 ? 55.712  3.376   23.916  1.00 25.49 ? 493 LEU A CA  1 
ATOM   2992 C C   . LEU A 1 471 ? 55.651  3.047   25.401  1.00 29.29 ? 493 LEU A C   1 
ATOM   2993 O O   . LEU A 1 471 ? 54.567  3.001   25.994  1.00 33.88 ? 493 LEU A O   1 
ATOM   2994 C CB  . LEU A 1 471 ? 55.974  2.108   23.104  1.00 25.21 ? 493 LEU A CB  1 
ATOM   2995 C CG  . LEU A 1 471 ? 55.962  2.208   21.580  1.00 29.89 ? 493 LEU A CG  1 
ATOM   2996 C CD1 . LEU A 1 471 ? 56.370  0.876   20.978  1.00 25.13 ? 493 LEU A CD1 1 
ATOM   2997 C CD2 . LEU A 1 471 ? 54.597  2.641   21.069  1.00 26.12 ? 493 LEU A CD2 1 
ATOM   2998 N N   . ALA A 1 472 ? 56.812  2.814   26.020  1.00 28.95 ? 494 ALA A N   1 
ATOM   2999 C CA  . ALA A 1 472 ? 56.838  2.438   27.429  1.00 28.03 ? 494 ALA A CA  1 
ATOM   3000 C C   . ALA A 1 472 ? 56.295  3.554   28.310  1.00 28.82 ? 494 ALA A C   1 
ATOM   3001 O O   . ALA A 1 472 ? 55.574  3.294   29.280  1.00 32.80 ? 494 ALA A O   1 
ATOM   3002 C CB  . ALA A 1 472 ? 58.261  2.067   27.848  1.00 26.49 ? 494 ALA A CB  1 
ATOM   3003 N N   . LEU A 1 473 ? 56.621  4.805   27.985  1.00 23.74 ? 495 LEU A N   1 
ATOM   3004 C CA  . LEU A 1 473 ? 56.161  5.917   28.807  1.00 28.21 ? 495 LEU A CA  1 
ATOM   3005 C C   . LEU A 1 473 ? 54.650  6.085   28.716  1.00 30.47 ? 495 LEU A C   1 
ATOM   3006 O O   . LEU A 1 473 ? 53.989  6.372   29.721  1.00 32.12 ? 495 LEU A O   1 
ATOM   3007 C CB  . LEU A 1 473 ? 56.885  7.197   28.398  1.00 23.68 ? 495 LEU A CB  1 
ATOM   3008 C CG  . LEU A 1 473 ? 58.249  7.289   29.076  1.00 27.55 ? 495 LEU A CG  1 
ATOM   3009 C CD1 . LEU A 1 473 ? 59.117  8.350   28.434  1.00 23.56 ? 495 LEU A CD1 1 
ATOM   3010 C CD2 . LEU A 1 473 ? 58.066  7.546   30.562  1.00 25.59 ? 495 LEU A CD2 1 
ATOM   3011 N N   . MET A 1 474 ? 54.087  5.915   27.519  1.00 34.93 ? 496 MET A N   1 
ATOM   3012 C CA  . MET A 1 474 ? 52.636  5.920   27.385  1.00 32.77 ? 496 MET A CA  1 
ATOM   3013 C C   . MET A 1 474 ? 52.020  4.722   28.093  1.00 36.79 ? 496 MET A C   1 
ATOM   3014 O O   . MET A 1 474 ? 50.882  4.800   28.570  1.00 38.67 ? 496 MET A O   1 
ATOM   3015 C CB  . MET A 1 474 ? 52.248  5.928   25.905  1.00 31.85 ? 496 MET A CB  1 
ATOM   3016 C CG  . MET A 1 474 ? 52.302  7.298   25.243  1.00 27.14 ? 496 MET A CG  1 
ATOM   3017 S SD  . MET A 1 474 ? 51.783  7.243   23.513  1.00 28.27 ? 496 MET A SD  1 
ATOM   3018 C CE  . MET A 1 474 ? 51.674  8.989   23.142  1.00 27.17 ? 496 MET A CE  1 
ATOM   3019 N N   . ASP A 1 475 ? 52.759  3.612   28.173  1.00 32.81 ? 497 ASP A N   1 
ATOM   3020 C CA  . ASP A 1 475 ? 52.279  2.438   28.892  1.00 31.38 ? 497 ASP A CA  1 
ATOM   3021 C C   . ASP A 1 475 ? 52.292  2.665   30.398  1.00 35.42 ? 497 ASP A C   1 
ATOM   3022 O O   . ASP A 1 475 ? 51.405  2.175   31.106  1.00 38.42 ? 497 ASP A O   1 
ATOM   3023 C CB  . ASP A 1 475 ? 53.135  1.226   28.522  1.00 30.99 ? 497 ASP A CB  1 
ATOM   3024 C CG  . ASP A 1 475 ? 52.669  -0.053  29.189  1.00 39.87 ? 497 ASP A CG  1 
ATOM   3025 O OD1 . ASP A 1 475 ? 51.589  -0.562  28.819  1.00 43.60 ? 497 ASP A OD1 1 
ATOM   3026 O OD2 . ASP A 1 475 ? 53.392  -0.556  30.076  1.00 42.19 ? 497 ASP A OD2 1 
ATOM   3027 N N   . SER A 1 476 ? 53.275  3.411   30.900  1.00 33.97 ? 498 SER A N   1 
ATOM   3028 C CA  . SER A 1 476 ? 53.408  3.674   32.327  1.00 31.35 ? 498 SER A CA  1 
ATOM   3029 C C   . SER A 1 476 ? 52.485  4.781   32.817  1.00 34.03 ? 498 SER A C   1 
ATOM   3030 O O   . SER A 1 476 ? 52.457  5.051   34.024  1.00 33.04 ? 498 SER A O   1 
ATOM   3031 C CB  . SER A 1 476 ? 54.858  4.035   32.662  1.00 29.88 ? 498 SER A CB  1 
ATOM   3032 O OG  . SER A 1 476 ? 55.160  5.363   32.268  1.00 28.29 ? 498 SER A OG  1 
ATOM   3033 N N   . GLY A 1 477 ? 51.744  5.429   31.922  1.00 31.03 ? 499 GLY A N   1 
ATOM   3034 C CA  . GLY A 1 477 ? 50.824  6.474   32.319  1.00 33.04 ? 499 GLY A CA  1 
ATOM   3035 C C   . GLY A 1 477 ? 51.421  7.856   32.441  1.00 28.78 ? 499 GLY A C   1 
ATOM   3036 O O   . GLY A 1 477 ? 50.797  8.729   33.055  1.00 30.78 ? 499 GLY A O   1 
ATOM   3037 N N   . VAL A 1 478 ? 52.601  8.090   31.877  1.00 29.67 ? 500 VAL A N   1 
ATOM   3038 C CA  . VAL A 1 478 ? 53.231  9.406   31.942  1.00 32.33 ? 500 VAL A CA  1 
ATOM   3039 C C   . VAL A 1 478 ? 52.540  10.318  30.935  1.00 35.98 ? 500 VAL A C   1 
ATOM   3040 O O   . VAL A 1 478 ? 52.451  9.978   29.745  1.00 29.17 ? 500 VAL A O   1 
ATOM   3041 C CB  . VAL A 1 478 ? 54.744  9.319   31.687  1.00 31.25 ? 500 VAL A CB  1 
ATOM   3042 C CG1 . VAL A 1 478 ? 55.345  10.712  31.541  1.00 26.66 ? 500 VAL A CG1 1 
ATOM   3043 C CG2 . VAL A 1 478 ? 55.423  8.560   32.819  1.00 30.31 ? 500 VAL A CG2 1 
ATOM   3044 N N   . PRO A 1 479 ? 52.034  11.478  31.364  1.00 38.89 ? 501 PRO A N   1 
ATOM   3045 C CA  . PRO A 1 479 ? 51.274  12.337  30.445  1.00 36.92 ? 501 PRO A CA  1 
ATOM   3046 C C   . PRO A 1 479 ? 52.166  13.057  29.447  1.00 36.26 ? 501 PRO A C   1 
ATOM   3047 O O   . PRO A 1 479 ? 52.375  14.270  29.552  1.00 35.96 ? 501 PRO A O   1 
ATOM   3048 C CB  . PRO A 1 479 ? 50.580  13.324  31.392  1.00 38.96 ? 501 PRO A CB  1 
ATOM   3049 C CG  . PRO A 1 479 ? 51.514  13.424  32.561  1.00 32.20 ? 501 PRO A CG  1 
ATOM   3050 C CD  . PRO A 1 479 ? 52.153  12.065  32.711  1.00 33.11 ? 501 PRO A CD  1 
ATOM   3051 N N   . ILE A 1 480 ? 52.696  12.322  28.476  1.00 35.43 ? 502 ILE A N   1 
ATOM   3052 C CA  . ILE A 1 480 ? 53.565  12.920  27.469  1.00 29.20 ? 502 ILE A CA  1 
ATOM   3053 C C   . ILE A 1 480 ? 52.714  13.626  26.420  1.00 28.25 ? 502 ILE A C   1 
ATOM   3054 O O   . ILE A 1 480 ? 51.567  13.242  26.150  1.00 28.05 ? 502 ILE A O   1 
ATOM   3055 C CB  . ILE A 1 480 ? 54.489  11.856  26.843  1.00 26.35 ? 502 ILE A CB  1 
ATOM   3056 C CG1 . ILE A 1 480 ? 53.721  10.919  25.911  1.00 24.08 ? 502 ILE A CG1 1 
ATOM   3057 C CG2 . ILE A 1 480 ? 55.209  11.064  27.919  1.00 31.86 ? 502 ILE A CG2 1 
ATOM   3058 C CD1 . ILE A 1 480 ? 54.628  10.096  25.031  1.00 19.56 ? 502 ILE A CD1 1 
ATOM   3059 N N   . SER A 1 481 ? 53.281  14.677  25.823  1.00 26.71 ? 503 SER A N   1 
ATOM   3060 C CA  . SER A 1 481 ? 52.522  15.507  24.889  1.00 19.63 ? 503 SER A CA  1 
ATOM   3061 C C   . SER A 1 481 ? 52.186  14.751  23.608  1.00 20.63 ? 503 SER A C   1 
ATOM   3062 O O   . SER A 1 481 ? 51.038  14.769  23.153  1.00 28.87 ? 503 SER A O   1 
ATOM   3063 C CB  . SER A 1 481 ? 53.298  16.784  24.574  1.00 19.08 ? 503 SER A CB  1 
ATOM   3064 O OG  . SER A 1 481 ? 54.680  16.525  24.427  1.00 23.76 ? 503 SER A OG  1 
ATOM   3065 N N   . SER A 1 482 ? 53.171  14.082  23.011  1.00 22.84 ? 504 SER A N   1 
ATOM   3066 C CA  . SER A 1 482 ? 52.938  13.335  21.781  1.00 24.53 ? 504 SER A CA  1 
ATOM   3067 C C   . SER A 1 482 ? 53.983  12.236  21.661  1.00 24.18 ? 504 SER A C   1 
ATOM   3068 O O   . SER A 1 482 ? 55.039  12.294  22.292  1.00 30.14 ? 504 SER A O   1 
ATOM   3069 C CB  . SER A 1 482 ? 52.977  14.253  20.555  1.00 29.58 ? 504 SER A CB  1 
ATOM   3070 O OG  . SER A 1 482 ? 52.893  13.501  19.358  1.00 43.07 ? 504 SER A OG  1 
ATOM   3071 N N   . ALA A 1 483 ? 53.683  11.237  20.836  1.00 22.68 ? 505 ALA A N   1 
ATOM   3072 C CA  . ALA A 1 483 ? 54.636  10.156  20.619  1.00 21.10 ? 505 ALA A CA  1 
ATOM   3073 C C   . ALA A 1 483 ? 55.873  10.664  19.880  1.00 22.32 ? 505 ALA A C   1 
ATOM   3074 O O   . ALA A 1 483 ? 55.848  11.693  19.198  1.00 28.12 ? 505 ALA A O   1 
ATOM   3075 C CB  . ALA A 1 483 ? 53.992  9.013   19.834  1.00 20.69 ? 505 ALA A CB  1 
ATOM   3076 N N   . VAL A 1 484 ? 56.969  9.922   20.026  1.00 23.66 ? 506 VAL A N   1 
ATOM   3077 C CA  . VAL A 1 484 ? 58.255  10.280  19.437  1.00 20.63 ? 506 VAL A CA  1 
ATOM   3078 C C   . VAL A 1 484 ? 58.797  9.076   18.678  1.00 21.05 ? 506 VAL A C   1 
ATOM   3079 O O   . VAL A 1 484 ? 58.847  7.966   19.218  1.00 21.57 ? 506 VAL A O   1 
ATOM   3080 C CB  . VAL A 1 484 ? 59.263  10.740  20.506  1.00 17.48 ? 506 VAL A CB  1 
ATOM   3081 C CG1 . VAL A 1 484 ? 60.663  10.789  19.929  1.00 18.36 ? 506 VAL A CG1 1 
ATOM   3082 C CG2 . VAL A 1 484 ? 58.865  12.095  21.055  1.00 20.06 ? 506 VAL A CG2 1 
ATOM   3083 N N   . ALA A 1 485 ? 59.200  9.296   17.428  1.00 18.93 ? 507 ALA A N   1 
ATOM   3084 C CA  . ALA A 1 485 ? 59.797  8.258   16.602  1.00 16.85 ? 507 ALA A CA  1 
ATOM   3085 C C   . ALA A 1 485 ? 61.135  8.742   16.070  1.00 18.70 ? 507 ALA A C   1 
ATOM   3086 O O   . ALA A 1 485 ? 61.375  9.946   15.941  1.00 22.54 ? 507 ALA A O   1 
ATOM   3087 C CB  . ALA A 1 485 ? 58.895  7.865   15.428  1.00 17.87 ? 507 ALA A CB  1 
ATOM   3088 N N   . GLY A 1 486 ? 62.006  7.786   15.760  1.00 16.96 ? 508 GLY A N   1 
ATOM   3089 C CA  . GLY A 1 486 ? 63.318  8.102   15.240  1.00 14.08 ? 508 GLY A CA  1 
ATOM   3090 C C   . GLY A 1 486 ? 63.706  7.116   14.158  1.00 20.18 ? 508 GLY A C   1 
ATOM   3091 O O   . GLY A 1 486 ? 63.209  5.987   14.101  1.00 20.43 ? 508 GLY A O   1 
ATOM   3092 N N   . VAL A 1 487 ? 64.613  7.565   13.293  1.00 19.14 ? 509 VAL A N   1 
ATOM   3093 C CA  . VAL A 1 487 ? 65.025  6.770   12.146  1.00 17.36 ? 509 VAL A CA  1 
ATOM   3094 C C   . VAL A 1 487 ? 66.398  7.252   11.711  1.00 22.34 ? 509 VAL A C   1 
ATOM   3095 O O   . VAL A 1 487 ? 66.765  8.411   11.931  1.00 21.41 ? 509 VAL A O   1 
ATOM   3096 C CB  . VAL A 1 487 ? 63.986  6.871   11.001  1.00 15.49 ? 509 VAL A CB  1 
ATOM   3097 C CG1 . VAL A 1 487 ? 64.148  8.187   10.255  1.00 19.20 ? 509 VAL A CG1 1 
ATOM   3098 C CG2 . VAL A 1 487 ? 64.112  5.682   10.052  1.00 20.67 ? 509 VAL A CG2 1 
ATOM   3099 N N   . ALA A 1 488 ? 67.164  6.353   11.101  1.00 20.90 ? 510 ALA A N   1 
ATOM   3100 C CA  . ALA A 1 488 ? 68.489  6.672   10.594  1.00 21.97 ? 510 ALA A CA  1 
ATOM   3101 C C   . ALA A 1 488 ? 68.460  6.684   9.072   1.00 20.90 ? 510 ALA A C   1 
ATOM   3102 O O   . ALA A 1 488 ? 67.851  5.810   8.447   1.00 20.85 ? 510 ALA A O   1 
ATOM   3103 C CB  . ALA A 1 488 ? 69.531  5.673   11.097  1.00 19.70 ? 510 ALA A CB  1 
ATOM   3104 N N   . ILE A 1 489 ? 69.114  7.685   8.484   1.00 17.55 ? 511 ILE A N   1 
ATOM   3105 C CA  . ILE A 1 489 ? 69.174  7.858   7.038   1.00 18.10 ? 511 ILE A CA  1 
ATOM   3106 C C   . ILE A 1 489 ? 70.613  7.658   6.590   1.00 16.79 ? 511 ILE A C   1 
ATOM   3107 O O   . ILE A 1 489 ? 71.531  8.288   7.129   1.00 16.16 ? 511 ILE A O   1 
ATOM   3108 C CB  . ILE A 1 489 ? 68.659  9.242   6.606   1.00 18.95 ? 511 ILE A CB  1 
ATOM   3109 C CG1 . ILE A 1 489 ? 67.196  9.429   7.015   1.00 18.11 ? 511 ILE A CG1 1 
ATOM   3110 C CG2 . ILE A 1 489 ? 68.829  9.420   5.105   1.00 13.96 ? 511 ILE A CG2 1 
ATOM   3111 C CD1 . ILE A 1 489 ? 66.229  8.495   6.309   1.00 20.37 ? 511 ILE A CD1 1 
ATOM   3112 N N   . GLY A 1 490 ? 70.809  6.780   5.604   1.00 17.39 ? 512 GLY A N   1 
ATOM   3113 C CA  . GLY A 1 490 ? 72.114  6.538   5.034   1.00 17.60 ? 512 GLY A CA  1 
ATOM   3114 C C   . GLY A 1 490 ? 72.344  7.333   3.757   1.00 21.04 ? 512 GLY A C   1 
ATOM   3115 O O   . GLY A 1 490 ? 71.497  8.092   3.291   1.00 21.81 ? 512 GLY A O   1 
ATOM   3116 N N   . LEU A 1 491 ? 73.531  7.136   3.186   1.00 16.84 ? 513 LEU A N   1 
ATOM   3117 C CA  . LEU A 1 491 ? 73.932  7.900   2.013   1.00 13.92 ? 513 LEU A CA  1 
ATOM   3118 C C   . LEU A 1 491 ? 75.014  7.144   1.261   1.00 13.48 ? 513 LEU A C   1 
ATOM   3119 O O   . LEU A 1 491 ? 75.972  6.660   1.870   1.00 14.64 ? 513 LEU A O   1 
ATOM   3120 C CB  . LEU A 1 491 ? 74.440  9.289   2.410   1.00 14.13 ? 513 LEU A CB  1 
ATOM   3121 C CG  . LEU A 1 491 ? 75.107  10.117  1.316   1.00 13.55 ? 513 LEU A CG  1 
ATOM   3122 C CD1 . LEU A 1 491 ? 74.088  10.554  0.268   1.00 10.67 ? 513 LEU A CD1 1 
ATOM   3123 C CD2 . LEU A 1 491 ? 75.813  11.311  1.933   1.00 12.39 ? 513 LEU A CD2 1 
ATOM   3124 N N   . VAL A 1 492 ? 74.857  7.054   -0.056  1.00 16.51 ? 514 VAL A N   1 
ATOM   3125 C CA  . VAL A 1 492 ? 75.875  6.514   -0.947  1.00 17.25 ? 514 VAL A CA  1 
ATOM   3126 C C   . VAL A 1 492 ? 76.137  7.556   -2.021  1.00 14.76 ? 514 VAL A C   1 
ATOM   3127 O O   . VAL A 1 492 ? 75.195  8.029   -2.663  1.00 18.17 ? 514 VAL A O   1 
ATOM   3128 C CB  . VAL A 1 492 ? 75.434  5.184   -1.585  1.00 16.36 ? 514 VAL A CB  1 
ATOM   3129 C CG1 . VAL A 1 492 ? 76.329  4.848   -2.767  1.00 15.78 ? 514 VAL A CG1 1 
ATOM   3130 C CG2 . VAL A 1 492 ? 75.450  4.070   -0.552  1.00 18.02 ? 514 VAL A CG2 1 
ATOM   3131 N N   . THR A 1 493 ? 77.402  7.922   -2.210  1.00 13.05 ? 515 THR A N   1 
ATOM   3132 C CA  . THR A 1 493 ? 77.762  8.944   -3.181  1.00 17.25 ? 515 THR A CA  1 
ATOM   3133 C C   . THR A 1 493 ? 78.740  8.390   -4.209  1.00 19.17 ? 515 THR A C   1 
ATOM   3134 O O   . THR A 1 493 ? 79.416  7.382   -3.984  1.00 22.47 ? 515 THR A O   1 
ATOM   3135 C CB  . THR A 1 493 ? 78.383  10.183  -2.508  1.00 15.07 ? 515 THR A CB  1 
ATOM   3136 O OG1 . THR A 1 493 ? 79.522  9.791   -1.731  1.00 20.55 ? 515 THR A OG1 1 
ATOM   3137 C CG2 . THR A 1 493 ? 77.377  10.879  -1.608  1.00 13.02 ? 515 THR A CG2 1 
ATOM   3138 N N   . LYS A 1 494 ? 78.785  9.065   -5.357  1.00 25.74 ? 516 LYS A N   1 
ATOM   3139 C CA  . LYS A 1 494 ? 79.831  8.894   -6.359  1.00 30.07 ? 516 LYS A CA  1 
ATOM   3140 C C   . LYS A 1 494 ? 80.361  10.279  -6.689  1.00 29.37 ? 516 LYS A C   1 
ATOM   3141 O O   . LYS A 1 494 ? 79.599  11.143  -7.132  1.00 33.95 ? 516 LYS A O   1 
ATOM   3142 C CB  . LYS A 1 494 ? 79.304  8.204   -7.622  1.00 27.89 ? 516 LYS A CB  1 
ATOM   3143 C CG  . LYS A 1 494 ? 80.397  7.840   -8.621  1.00 37.39 ? 516 LYS A CG  1 
ATOM   3144 C CD  . LYS A 1 494 ? 79.831  7.479   -9.991  1.00 47.43 ? 516 LYS A CD  1 
ATOM   3145 C CE  . LYS A 1 494 ? 79.487  8.720   -10.804 1.00 56.41 ? 516 LYS A CE  1 
ATOM   3146 N NZ  . LYS A 1 494 ? 80.670  9.604   -11.002 1.00 59.47 ? 516 LYS A NZ  1 
ATOM   3147 N N   . THR A 1 495 ? 81.648  10.501  -6.456  1.00 25.73 ? 517 THR A N   1 
ATOM   3148 C CA  . THR A 1 495 ? 82.240  11.818  -6.628  1.00 32.56 ? 517 THR A CA  1 
ATOM   3149 C C   . THR A 1 495 ? 83.147  11.827  -7.849  1.00 35.08 ? 517 THR A C   1 
ATOM   3150 O O   . THR A 1 495 ? 83.905  10.881  -8.080  1.00 34.32 ? 517 THR A O   1 
ATOM   3151 C CB  . THR A 1 495 ? 83.035  12.240  -5.390  1.00 27.28 ? 517 THR A CB  1 
ATOM   3152 O OG1 . THR A 1 495 ? 84.379  11.769  -5.511  1.00 28.10 ? 517 THR A OG1 1 
ATOM   3153 C CG2 . THR A 1 495 ? 82.409  11.658  -4.125  1.00 33.32 ? 517 THR A CG2 1 
ATOM   3154 N N   . ASP A 1 496 ? 83.059  12.894  -8.626  1.00 37.65 ? 518 ASP A N   1 
ATOM   3155 C CA  . ASP A 1 496 ? 83.888  13.028  -9.815  1.00 47.10 ? 518 ASP A CA  1 
ATOM   3156 C C   . ASP A 1 496 ? 85.333  13.272  -9.407  1.00 50.08 ? 518 ASP A C   1 
ATOM   3157 O O   . ASP A 1 496 ? 85.608  14.253  -8.705  1.00 52.46 ? 518 ASP A O   1 
ATOM   3158 C CB  . ASP A 1 496 ? 83.381  14.175  -10.684 1.00 51.33 ? 518 ASP A CB  1 
ATOM   3159 C CG  . ASP A 1 496 ? 83.927  14.121  -12.095 1.00 57.15 ? 518 ASP A CG  1 
ATOM   3160 O OD1 . ASP A 1 496 ? 84.531  13.092  -12.461 1.00 59.13 ? 518 ASP A OD1 1 
ATOM   3161 O OD2 . ASP A 1 496 ? 83.748  15.107  -12.841 1.00 63.81 ? 518 ASP A OD2 1 
ATOM   3162 N N   . PRO A 1 497 ? 86.281  12.416  -9.801  1.00 51.99 ? 519 PRO A N   1 
ATOM   3163 C CA  . PRO A 1 497 ? 87.686  12.695  -9.469  1.00 50.28 ? 519 PRO A CA  1 
ATOM   3164 C C   . PRO A 1 497 ? 88.241  13.906  -10.201 1.00 52.26 ? 519 PRO A C   1 
ATOM   3165 O O   . PRO A 1 497 ? 89.119  14.590  -9.659  1.00 56.52 ? 519 PRO A O   1 
ATOM   3166 C CB  . PRO A 1 497 ? 88.414  11.403  -9.877  1.00 50.27 ? 519 PRO A CB  1 
ATOM   3167 C CG  . PRO A 1 497 ? 87.331  10.368  -10.045 1.00 51.14 ? 519 PRO A CG  1 
ATOM   3168 C CD  . PRO A 1 497 ? 86.120  11.124  -10.487 1.00 47.31 ? 519 PRO A CD  1 
ATOM   3169 N N   . GLU A 1 498 ? 87.760  14.192  -11.415 1.00 53.72 ? 520 GLU A N   1 
ATOM   3170 C CA  . GLU A 1 498 ? 88.217  15.378  -12.132 1.00 54.12 ? 520 GLU A CA  1 
ATOM   3171 C C   . GLU A 1 498 ? 87.811  16.656  -11.408 1.00 59.51 ? 520 GLU A C   1 
ATOM   3172 O O   . GLU A 1 498 ? 88.507  17.675  -11.511 1.00 57.76 ? 520 GLU A O   1 
ATOM   3173 C CB  . GLU A 1 498 ? 87.674  15.369  -13.564 1.00 57.94 ? 520 GLU A CB  1 
ATOM   3174 C CG  . GLU A 1 498 ? 88.262  14.266  -14.439 1.00 59.07 ? 520 GLU A CG  1 
ATOM   3175 C CD  . GLU A 1 498 ? 87.821  14.350  -15.893 1.00 57.54 ? 520 GLU A CD  1 
ATOM   3176 O OE1 . GLU A 1 498 ? 88.519  15.002  -16.698 1.00 54.50 ? 520 GLU A OE1 1 
ATOM   3177 O OE2 . GLU A 1 498 ? 86.778  13.753  -16.233 1.00 57.09 ? 520 GLU A OE2 1 
ATOM   3178 N N   . LYS A 1 499 ? 86.701  16.621  -10.676 1.00 66.67 ? 521 LYS A N   1 
ATOM   3179 C CA  . LYS A 1 499 ? 86.301  17.693  -9.781  1.00 63.08 ? 521 LYS A CA  1 
ATOM   3180 C C   . LYS A 1 499 ? 86.546  17.250  -8.339  1.00 56.31 ? 521 LYS A C   1 
ATOM   3181 O O   . LYS A 1 499 ? 87.242  16.265  -8.073  1.00 62.23 ? 521 LYS A O   1 
ATOM   3182 C CB  . LYS A 1 499 ? 84.833  18.069  -10.016 1.00 59.99 ? 521 LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 499 ? 84.383  17.982  -11.467 1.00 59.13 ? 521 LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 499 ? 85.097  19.006  -12.340 1.00 71.50 ? 521 LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 499 ? 84.803  18.777  -13.820 1.00 74.52 ? 521 LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 499 ? 85.535  19.730  -14.704 1.00 68.46 ? 521 LYS A NZ  1 
ATOM   3187 N N   . GLY A 1 500 ? 85.975  17.991  -7.400  1.00 55.16 ? 522 GLY A N   1 
ATOM   3188 C CA  . GLY A 1 500 ? 86.061  17.613  -6.006  1.00 59.42 ? 522 GLY A CA  1 
ATOM   3189 C C   . GLY A 1 500 ? 84.675  17.487  -5.419  1.00 62.48 ? 522 GLY A C   1 
ATOM   3190 O O   . GLY A 1 500 ? 84.503  17.364  -4.202  1.00 64.35 ? 522 GLY A O   1 
ATOM   3191 N N   . GLU A 1 501 ? 83.678  17.515  -6.294  1.00 60.39 ? 523 GLU A N   1 
ATOM   3192 C CA  . GLU A 1 501 ? 82.281  17.560  -5.899  1.00 50.32 ? 523 GLU A CA  1 
ATOM   3193 C C   . GLU A 1 501 ? 81.652  16.174  -5.971  1.00 41.62 ? 523 GLU A C   1 
ATOM   3194 O O   . GLU A 1 501 ? 82.203  15.232  -6.547  1.00 36.34 ? 523 GLU A O   1 
ATOM   3195 C CB  . GLU A 1 501 ? 81.506  18.541  -6.785  1.00 53.43 ? 523 GLU A CB  1 
ATOM   3196 C CG  . GLU A 1 501 ? 82.324  19.723  -7.277  1.00 54.79 ? 523 GLU A CG  1 
ATOM   3197 C CD  . GLU A 1 501 ? 82.775  20.631  -6.148  1.00 66.94 ? 523 GLU A CD  1 
ATOM   3198 O OE1 . GLU A 1 501 ? 81.938  21.405  -5.633  1.00 66.60 ? 523 GLU A OE1 1 
ATOM   3199 O OE2 . GLU A 1 501 ? 83.967  20.571  -5.775  1.00 67.86 ? 523 GLU A OE2 1 
ATOM   3200 N N   . ILE A 1 502 ? 80.472  16.068  -5.369  1.00 38.36 ? 524 ILE A N   1 
ATOM   3201 C CA  . ILE A 1 502 ? 79.676  14.848  -5.427  1.00 32.09 ? 524 ILE A CA  1 
ATOM   3202 C C   . ILE A 1 502 ? 78.875  14.848  -6.723  1.00 34.07 ? 524 ILE A C   1 
ATOM   3203 O O   . ILE A 1 502 ? 78.179  15.822  -7.037  1.00 34.56 ? 524 ILE A O   1 
ATOM   3204 C CB  . ILE A 1 502 ? 78.761  14.749  -4.196  1.00 27.17 ? 524 ILE A CB  1 
ATOM   3205 C CG1 . ILE A 1 502 ? 79.602  14.494  -2.943  1.00 23.58 ? 524 ILE A CG1 1 
ATOM   3206 C CG2 . ILE A 1 502 ? 77.724  13.655  -4.383  1.00 30.41 ? 524 ILE A CG2 1 
ATOM   3207 C CD1 . ILE A 1 502 ? 78.867  14.734  -1.654  1.00 19.17 ? 524 ILE A CD1 1 
ATOM   3208 N N   . GLU A 1 503 ? 78.978  13.756  -7.486  1.00 32.54 ? 525 GLU A N   1 
ATOM   3209 C CA  . GLU A 1 503 ? 78.374  13.680  -8.813  1.00 31.78 ? 525 GLU A CA  1 
ATOM   3210 C C   . GLU A 1 503 ? 76.996  13.037  -8.814  1.00 27.81 ? 525 GLU A C   1 
ATOM   3211 O O   . GLU A 1 503 ? 76.201  13.300  -9.723  1.00 29.48 ? 525 GLU A O   1 
ATOM   3212 C CB  . GLU A 1 503 ? 79.284  12.895  -9.763  1.00 31.79 ? 525 GLU A CB  1 
ATOM   3213 C CG  . GLU A 1 503 ? 79.068  13.208  -11.227 1.00 48.65 ? 525 GLU A CG  1 
ATOM   3214 C CD  . GLU A 1 503 ? 80.337  13.070  -12.040 1.00 62.79 ? 525 GLU A CD  1 
ATOM   3215 O OE1 . GLU A 1 503 ? 80.751  14.069  -12.669 1.00 63.48 ? 525 GLU A OE1 1 
ATOM   3216 O OE2 . GLU A 1 503 ? 80.923  11.965  -12.042 1.00 64.03 ? 525 GLU A OE2 1 
ATOM   3217 N N   . ASP A 1 504 ? 76.701  12.195  -7.829  1.00 32.67 ? 526 ASP A N   1 
ATOM   3218 C CA  . ASP A 1 504 ? 75.437  11.477  -7.745  1.00 22.19 ? 526 ASP A CA  1 
ATOM   3219 C C   . ASP A 1 504 ? 75.347  10.867  -6.358  1.00 20.40 ? 526 ASP A C   1 
ATOM   3220 O O   . ASP A 1 504 ? 76.374  10.566  -5.742  1.00 19.25 ? 526 ASP A O   1 
ATOM   3221 C CB  . ASP A 1 504 ? 75.337  10.388  -8.822  1.00 20.02 ? 526 ASP A CB  1 
ATOM   3222 C CG  . ASP A 1 504 ? 73.910  9.969   -9.097  1.00 23.59 ? 526 ASP A CG  1 
ATOM   3223 O OD1 . ASP A 1 504 ? 72.981  10.691  -8.668  1.00 30.74 ? 526 ASP A OD1 1 
ATOM   3224 O OD2 . ASP A 1 504 ? 73.718  8.916   -9.744  1.00 21.61 ? 526 ASP A OD2 1 
ATOM   3225 N N   . TYR A 1 505 ? 74.120  10.692  -5.868  1.00 20.06 ? 527 TYR A N   1 
ATOM   3226 C CA  . TYR A 1 505 ? 73.944  10.139  -4.531  1.00 16.51 ? 527 TYR A CA  1 
ATOM   3227 C C   . TYR A 1 505 ? 72.559  9.531   -4.387  1.00 13.43 ? 527 TYR A C   1 
ATOM   3228 O O   . TYR A 1 505 ? 71.634  9.858   -5.131  1.00 20.59 ? 527 TYR A O   1 
ATOM   3229 C CB  . TYR A 1 505 ? 74.172  11.198  -3.447  1.00 13.79 ? 527 TYR A CB  1 
ATOM   3230 C CG  . TYR A 1 505 ? 73.229  12.375  -3.497  1.00 10.24 ? 527 TYR A CG  1 
ATOM   3231 C CD1 . TYR A 1 505 ? 73.540  13.510  -4.238  1.00 12.51 ? 527 TYR A CD1 1 
ATOM   3232 C CD2 . TYR A 1 505 ? 72.041  12.364  -2.786  1.00 10.65 ? 527 TYR A CD2 1 
ATOM   3233 C CE1 . TYR A 1 505 ? 72.680  14.601  -4.275  1.00 11.15 ? 527 TYR A CE1 1 
ATOM   3234 C CE2 . TYR A 1 505 ? 71.176  13.448  -2.814  1.00 11.30 ? 527 TYR A CE2 1 
ATOM   3235 C CZ  . TYR A 1 505 ? 71.499  14.561  -3.561  1.00 13.14 ? 527 TYR A CZ  1 
ATOM   3236 O OH  . TYR A 1 505 ? 70.640  15.635  -3.591  1.00 17.94 ? 527 TYR A OH  1 
ATOM   3237 N N   . ARG A 1 506 ? 72.438  8.632   -3.410  1.00 15.08 ? 528 ARG A N   1 
ATOM   3238 C CA  . ARG A 1 506 ? 71.176  8.009   -3.033  1.00 17.80 ? 528 ARG A CA  1 
ATOM   3239 C C   . ARG A 1 506 ? 71.060  8.020   -1.517  1.00 18.50 ? 528 ARG A C   1 
ATOM   3240 O O   . ARG A 1 506 ? 71.958  7.532   -0.822  1.00 18.84 ? 528 ARG A O   1 
ATOM   3241 C CB  . ARG A 1 506 ? 71.070  6.565   -3.544  1.00 17.72 ? 528 ARG A CB  1 
ATOM   3242 C CG  . ARG A 1 506 ? 71.641  6.330   -4.928  1.00 21.04 ? 528 ARG A CG  1 
ATOM   3243 C CD  . ARG A 1 506 ? 70.569  6.409   -6.001  1.00 22.84 ? 528 ARG A CD  1 
ATOM   3244 N NE  . ARG A 1 506 ? 71.126  6.141   -7.324  1.00 23.35 ? 528 ARG A NE  1 
ATOM   3245 C CZ  . ARG A 1 506 ? 71.543  7.086   -8.160  1.00 23.46 ? 528 ARG A CZ  1 
ATOM   3246 N NH1 . ARG A 1 506 ? 71.456  8.363   -7.811  1.00 22.04 ? 528 ARG A NH1 1 
ATOM   3247 N NH2 . ARG A 1 506 ? 72.044  6.756   -9.344  1.00 18.83 ? 528 ARG A NH2 1 
ATOM   3248 N N   . LEU A 1 507 ? 69.958  8.567   -1.008  1.00 18.99 ? 529 LEU A N   1 
ATOM   3249 C CA  . LEU A 1 507 ? 69.696  8.594   0.425   1.00 15.53 ? 529 LEU A CA  1 
ATOM   3250 C C   . LEU A 1 507 ? 68.950  7.329   0.832   1.00 19.32 ? 529 LEU A C   1 
ATOM   3251 O O   . LEU A 1 507 ? 67.922  6.989   0.237   1.00 23.42 ? 529 LEU A O   1 
ATOM   3252 C CB  . LEU A 1 507 ? 68.890  9.838   0.800   1.00 10.82 ? 529 LEU A CB  1 
ATOM   3253 C CG  . LEU A 1 507 ? 69.705  11.134  0.811   1.00 12.34 ? 529 LEU A CG  1 
ATOM   3254 C CD1 . LEU A 1 507 ? 68.794  12.342  0.878   1.00 19.71 ? 529 LEU A CD1 1 
ATOM   3255 C CD2 . LEU A 1 507 ? 70.686  11.148  1.972   1.00 14.47 ? 529 LEU A CD2 1 
ATOM   3256 N N   . LEU A 1 508 ? 69.472  6.635   1.841   1.00 16.17 ? 530 LEU A N   1 
ATOM   3257 C CA  . LEU A 1 508 ? 68.936  5.348   2.267   1.00 15.89 ? 530 LEU A CA  1 
ATOM   3258 C C   . LEU A 1 508 ? 68.134  5.509   3.553   1.00 17.89 ? 530 LEU A C   1 
ATOM   3259 O O   . LEU A 1 508 ? 68.609  6.125   4.511   1.00 23.30 ? 530 LEU A O   1 
ATOM   3260 C CB  . LEU A 1 508 ? 70.064  4.335   2.464   1.00 13.82 ? 530 LEU A CB  1 
ATOM   3261 C CG  . LEU A 1 508 ? 71.042  4.110   1.307   1.00 12.91 ? 530 LEU A CG  1 
ATOM   3262 C CD1 . LEU A 1 508 ? 71.948  2.927   1.601   1.00 16.67 ? 530 LEU A CD1 1 
ATOM   3263 C CD2 . LEU A 1 508 ? 70.311  3.896   -0.001  1.00 15.76 ? 530 LEU A CD2 1 
ATOM   3264 N N   . THR A 1 509 ? 66.929  4.943   3.573   1.00 17.08 ? 531 THR A N   1 
ATOM   3265 C CA  . THR A 1 509 ? 66.016  5.035   4.708   1.00 15.88 ? 531 THR A CA  1 
ATOM   3266 C C   . THR A 1 509 ? 66.145  3.798   5.588   1.00 17.62 ? 531 THR A C   1 
ATOM   3267 O O   . THR A 1 509 ? 66.040  2.670   5.092   1.00 20.94 ? 531 THR A O   1 
ATOM   3268 C CB  . THR A 1 509 ? 64.571  5.168   4.224   1.00 18.10 ? 531 THR A CB  1 
ATOM   3269 O OG1 . THR A 1 509 ? 64.400  6.420   3.549   1.00 27.50 ? 531 THR A OG1 1 
ATOM   3270 C CG2 . THR A 1 509 ? 63.606  5.082   5.393   1.00 17.98 ? 531 THR A CG2 1 
ATOM   3271 N N   . ASP A 1 510 ? 66.358  4.012   6.890   1.00 15.72 ? 532 ASP A N   1 
ATOM   3272 C CA  . ASP A 1 510 ? 66.451  2.922   7.857   1.00 16.93 ? 532 ASP A CA  1 
ATOM   3273 C C   . ASP A 1 510 ? 67.553  1.941   7.465   1.00 20.90 ? 532 ASP A C   1 
ATOM   3274 O O   . ASP A 1 510 ? 67.274  0.845   6.964   1.00 20.68 ? 532 ASP A O   1 
ATOM   3275 C CB  . ASP A 1 510 ? 65.100  2.208   7.979   1.00 18.96 ? 532 ASP A CB  1 
ATOM   3276 C CG  . ASP A 1 510 ? 65.092  1.148   9.061   1.00 23.48 ? 532 ASP A CG  1 
ATOM   3277 O OD1 . ASP A 1 510 ? 65.915  1.244   9.997   1.00 31.07 ? 532 ASP A OD1 1 
ATOM   3278 O OD2 . ASP A 1 510 ? 64.263  0.215   8.972   1.00 21.16 ? 532 ASP A OD2 1 
ATOM   3279 N N   . ILE A 1 511 ? 68.807  2.318   7.699   1.00 17.85 ? 533 ILE A N   1 
ATOM   3280 C CA  . ILE A 1 511 ? 69.935  1.595   7.125   1.00 18.22 ? 533 ILE A CA  1 
ATOM   3281 C C   . ILE A 1 511 ? 70.296  0.388   7.977   1.00 21.16 ? 533 ILE A C   1 
ATOM   3282 O O   . ILE A 1 511 ? 70.105  0.371   9.198   1.00 23.19 ? 533 ILE A O   1 
ATOM   3283 C CB  . ILE A 1 511 ? 71.145  2.531   6.954   1.00 16.37 ? 533 ILE A CB  1 
ATOM   3284 C CG1 . ILE A 1 511 ? 71.248  3.500   8.134   1.00 14.93 ? 533 ILE A CG1 1 
ATOM   3285 C CG2 . ILE A 1 511 ? 71.032  3.280   5.656   1.00 12.86 ? 533 ILE A CG2 1 
ATOM   3286 C CD1 . ILE A 1 511 ? 72.466  4.396   8.073   1.00 11.81 ? 533 ILE A CD1 1 
ATOM   3287 N N   . LEU A 1 512 ? 70.830  -0.637  7.316   1.00 23.98 ? 534 LEU A N   1 
ATOM   3288 C CA  . LEU A 1 512 ? 71.408  -1.778  8.003   1.00 23.15 ? 534 LEU A CA  1 
ATOM   3289 C C   . LEU A 1 512 ? 72.797  -1.425  8.522   1.00 24.25 ? 534 LEU A C   1 
ATOM   3290 O O   . LEU A 1 512 ? 73.347  -0.358  8.235   1.00 23.96 ? 534 LEU A O   1 
ATOM   3291 C CB  . LEU A 1 512 ? 71.499  -2.984  7.076   1.00 19.77 ? 534 LEU A CB  1 
ATOM   3292 C CG  . LEU A 1 512 ? 70.277  -3.281  6.215   1.00 21.91 ? 534 LEU A CG  1 
ATOM   3293 C CD1 . LEU A 1 512 ? 70.651  -4.206  5.061   1.00 15.24 ? 534 LEU A CD1 1 
ATOM   3294 C CD2 . LEU A 1 512 ? 69.172  -3.880  7.075   1.00 22.75 ? 534 LEU A CD2 1 
ATOM   3295 N N   . GLY A 1 513 ? 73.368  -2.346  9.299   1.00 25.01 ? 535 GLY A N   1 
ATOM   3296 C CA  . GLY A 1 513 ? 74.746  -2.175  9.720   1.00 17.01 ? 535 GLY A CA  1 
ATOM   3297 C C   . GLY A 1 513 ? 75.699  -2.096  8.543   1.00 15.96 ? 535 GLY A C   1 
ATOM   3298 O O   . GLY A 1 513 ? 76.594  -1.248  8.512   1.00 16.30 ? 535 GLY A O   1 
ATOM   3299 N N   . ILE A 1 514 ? 75.509  -2.968  7.550   1.00 17.52 ? 536 ILE A N   1 
ATOM   3300 C CA  . ILE A 1 514 ? 76.394  -2.963  6.392   1.00 14.22 ? 536 ILE A CA  1 
ATOM   3301 C C   . ILE A 1 514 ? 76.169  -1.716  5.550   1.00 20.06 ? 536 ILE A C   1 
ATOM   3302 O O   . ILE A 1 514 ? 77.076  -1.273  4.833   1.00 22.49 ? 536 ILE A O   1 
ATOM   3303 C CB  . ILE A 1 514 ? 76.210  -4.252  5.569   1.00 11.18 ? 536 ILE A CB  1 
ATOM   3304 C CG1 . ILE A 1 514 ? 77.286  -4.347  4.485   1.00 13.50 ? 536 ILE A CG1 1 
ATOM   3305 C CG2 . ILE A 1 514 ? 74.817  -4.316  4.965   1.00 16.41 ? 536 ILE A CG2 1 
ATOM   3306 C CD1 . ILE A 1 514 ? 77.261  -5.641  3.701   1.00 19.44 ? 536 ILE A CD1 1 
ATOM   3307 N N   . GLU A 1 515 ? 74.974  -1.123  5.620   1.00 18.58 ? 537 GLU A N   1 
ATOM   3308 C CA  . GLU A 1 515 ? 74.720  0.117   4.897   1.00 16.76 ? 537 GLU A CA  1 
ATOM   3309 C C   . GLU A 1 515 ? 75.346  1.317   5.586   1.00 18.06 ? 537 GLU A C   1 
ATOM   3310 O O   . GLU A 1 515 ? 75.584  2.337   4.932   1.00 15.66 ? 537 GLU A O   1 
ATOM   3311 C CB  . GLU A 1 515 ? 73.217  0.343   4.724   1.00 19.20 ? 537 GLU A CB  1 
ATOM   3312 C CG  . GLU A 1 515 ? 72.642  -0.262  3.450   1.00 19.57 ? 537 GLU A CG  1 
ATOM   3313 C CD  . GLU A 1 515 ? 71.134  -0.439  3.513   1.00 22.85 ? 537 GLU A CD  1 
ATOM   3314 O OE1 . GLU A 1 515 ? 70.579  -0.398  4.631   1.00 23.19 ? 537 GLU A OE1 1 
ATOM   3315 O OE2 . GLU A 1 515 ? 70.504  -0.630  2.450   1.00 21.53 ? 537 GLU A OE2 1 
ATOM   3316 N N   . ASP A 1 516 ? 75.615  1.215   6.889   1.00 21.00 ? 538 ASP A N   1 
ATOM   3317 C CA  . ASP A 1 516 ? 76.339  2.268   7.590   1.00 17.28 ? 538 ASP A CA  1 
ATOM   3318 C C   . ASP A 1 516 ? 77.843  2.119   7.397   1.00 20.46 ? 538 ASP A C   1 
ATOM   3319 O O   . ASP A 1 516 ? 78.538  3.106   7.129   1.00 20.24 ? 538 ASP A O   1 
ATOM   3320 C CB  . ASP A 1 516 ? 75.975  2.245   9.076   1.00 15.39 ? 538 ASP A CB  1 
ATOM   3321 C CG  . ASP A 1 516 ? 76.811  3.207   9.907   1.00 20.93 ? 538 ASP A CG  1 
ATOM   3322 O OD1 . ASP A 1 516 ? 77.312  4.213   9.359   1.00 24.67 ? 538 ASP A OD1 1 
ATOM   3323 O OD2 . ASP A 1 516 ? 76.955  2.961   11.123  1.00 22.75 ? 538 ASP A OD2 1 
ATOM   3324 N N   . TYR A 1 517 ? 78.349  0.889   7.515   1.00 21.60 ? 539 TYR A N   1 
ATOM   3325 C CA  . TYR A 1 517 ? 79.785  0.641   7.419   1.00 19.23 ? 539 TYR A CA  1 
ATOM   3326 C C   . TYR A 1 517 ? 80.312  0.977   6.028   1.00 22.07 ? 539 TYR A C   1 
ATOM   3327 O O   . TYR A 1 517 ? 81.338  1.652   5.884   1.00 22.72 ? 539 TYR A O   1 
ATOM   3328 C CB  . TYR A 1 517 ? 80.065  -0.817  7.778   1.00 22.59 ? 539 TYR A CB  1 
ATOM   3329 C CG  . TYR A 1 517 ? 81.464  -1.306  7.491   1.00 32.89 ? 539 TYR A CG  1 
ATOM   3330 C CD1 . TYR A 1 517 ? 82.501  -1.064  8.382   1.00 36.50 ? 539 TYR A CD1 1 
ATOM   3331 C CD2 . TYR A 1 517 ? 81.743  -2.040  6.340   1.00 32.70 ? 539 TYR A CD2 1 
ATOM   3332 C CE1 . TYR A 1 517 ? 83.783  -1.522  8.132   1.00 36.67 ? 539 TYR A CE1 1 
ATOM   3333 C CE2 . TYR A 1 517 ? 83.023  -2.503  6.080   1.00 34.14 ? 539 TYR A CE2 1 
ATOM   3334 C CZ  . TYR A 1 517 ? 84.038  -2.240  6.982   1.00 41.65 ? 539 TYR A CZ  1 
ATOM   3335 O OH  . TYR A 1 517 ? 85.314  -2.695  6.737   1.00 46.99 ? 539 TYR A OH  1 
ATOM   3336 N N   . ASN A 1 518 ? 79.617  0.517   4.989   1.00 22.92 ? 540 ASN A N   1 
ATOM   3337 C CA  . ASN A 1 518 ? 79.974  0.813   3.609   1.00 17.78 ? 540 ASN A CA  1 
ATOM   3338 C C   . ASN A 1 518 ? 79.383  2.123   3.111   1.00 19.30 ? 540 ASN A C   1 
ATOM   3339 O O   . ASN A 1 518 ? 79.570  2.460   1.939   1.00 17.83 ? 540 ASN A O   1 
ATOM   3340 C CB  . ASN A 1 518 ? 79.521  -0.327  2.692   1.00 17.02 ? 540 ASN A CB  1 
ATOM   3341 C CG  . ASN A 1 518 ? 80.381  -1.563  2.836   1.00 23.75 ? 540 ASN A CG  1 
ATOM   3342 O OD1 . ASN A 1 518 ? 81.589  -1.526  2.584   1.00 23.41 ? 540 ASN A OD1 1 
ATOM   3343 N ND2 . ASN A 1 518 ? 79.766  -2.669  3.247   1.00 18.54 ? 540 ASN A ND2 1 
ATOM   3344 N N   . GLY A 1 519 ? 78.675  2.863   3.967   1.00 21.68 ? 541 GLY A N   1 
ATOM   3345 C CA  . GLY A 1 519 ? 78.031  4.097   3.581   1.00 14.89 ? 541 GLY A CA  1 
ATOM   3346 C C   . GLY A 1 519 ? 78.810  5.331   4.007   1.00 16.05 ? 541 GLY A C   1 
ATOM   3347 O O   . GLY A 1 519 ? 79.922  5.260   4.536   1.00 19.32 ? 541 GLY A O   1 
ATOM   3348 N N   . ASP A 1 520 ? 78.188  6.490   3.781   1.00 12.19 ? 542 ASP A N   1 
ATOM   3349 C CA  . ASP A 1 520 ? 78.834  7.776   3.987   1.00 12.91 ? 542 ASP A CA  1 
ATOM   3350 C C   . ASP A 1 520 ? 78.305  8.544   5.185   1.00 15.47 ? 542 ASP A C   1 
ATOM   3351 O O   . ASP A 1 520 ? 78.855  9.604   5.508   1.00 13.76 ? 542 ASP A O   1 
ATOM   3352 C CB  . ASP A 1 520 ? 78.673  8.656   2.737   1.00 13.78 ? 542 ASP A CB  1 
ATOM   3353 C CG  . ASP A 1 520 ? 79.482  8.156   1.559   1.00 16.55 ? 542 ASP A CG  1 
ATOM   3354 O OD1 . ASP A 1 520 ? 80.341  7.266   1.748   1.00 17.24 ? 542 ASP A OD1 1 
ATOM   3355 O OD2 . ASP A 1 520 ? 79.264  8.663   0.439   1.00 17.82 ? 542 ASP A OD2 1 
ATOM   3356 N N   . MET A 1 521 ? 77.266  8.050   5.851   1.00 22.26 ? 543 MET A N   1 
ATOM   3357 C CA  . MET A 1 521 ? 76.516  8.899   6.764   1.00 16.81 ? 543 MET A CA  1 
ATOM   3358 C C   . MET A 1 521 ? 75.590  8.042   7.614   1.00 20.13 ? 543 MET A C   1 
ATOM   3359 O O   . MET A 1 521 ? 74.971  7.102   7.111   1.00 27.68 ? 543 MET A O   1 
ATOM   3360 C CB  . MET A 1 521 ? 75.709  9.933   5.972   1.00 17.34 ? 543 MET A CB  1 
ATOM   3361 C CG  . MET A 1 521 ? 74.917  10.912  6.795   1.00 18.00 ? 543 MET A CG  1 
ATOM   3362 S SD  . MET A 1 521 ? 73.862  11.900  5.722   1.00 8.47  ? 543 MET A SD  1 
ATOM   3363 C CE  . MET A 1 521 ? 72.682  10.670  5.164   1.00 17.19 ? 543 MET A CE  1 
ATOM   3364 N N   . ASP A 1 522 ? 75.506  8.378   8.898   1.00 19.37 ? 544 ASP A N   1 
ATOM   3365 C CA  . ASP A 1 522 ? 74.548  7.803   9.842   1.00 16.25 ? 544 ASP A CA  1 
ATOM   3366 C C   . ASP A 1 522 ? 73.696  8.970   10.345  1.00 20.17 ? 544 ASP A C   1 
ATOM   3367 O O   . ASP A 1 522 ? 73.967  9.547   11.400  1.00 21.19 ? 544 ASP A O   1 
ATOM   3368 C CB  . ASP A 1 522 ? 75.288  7.068   10.995  1.00 25.56 ? 544 ASP A CB  1 
ATOM   3369 C CG  . ASP A 1 522 ? 74.426  6.020   11.691  1.00 28.04 ? 544 ASP A CG  1 
ATOM   3370 O OD1 . ASP A 1 522 ? 73.291  5.762   11.240  1.00 21.34 ? 544 ASP A OD1 1 
ATOM   3371 O OD2 . ASP A 1 522 ? 74.896  5.451   12.703  1.00 32.53 ? 544 ASP A OD2 1 
ATOM   3372 N N   . PHE A 1 523 ? 72.678  9.336   9.561   1.00 22.67 ? 545 PHE A N   1 
ATOM   3373 C CA  . PHE A 1 523 ? 71.846  10.512  9.836   1.00 21.72 ? 545 PHE A CA  1 
ATOM   3374 C C   . PHE A 1 523 ? 70.698  10.087  10.741  1.00 17.92 ? 545 PHE A C   1 
ATOM   3375 O O   . PHE A 1 523 ? 69.643  9.648   10.282  1.00 20.63 ? 545 PHE A O   1 
ATOM   3376 C CB  . PHE A 1 523 ? 71.339  11.127  8.536   1.00 16.80 ? 545 PHE A CB  1 
ATOM   3377 C CG  . PHE A 1 523 ? 70.942  12.576  8.653   1.00 16.67 ? 545 PHE A CG  1 
ATOM   3378 C CD1 . PHE A 1 523 ? 71.873  13.584  8.453   1.00 14.55 ? 545 PHE A CD1 1 
ATOM   3379 C CD2 . PHE A 1 523 ? 69.634  12.930  8.947   1.00 20.65 ? 545 PHE A CD2 1 
ATOM   3380 C CE1 . PHE A 1 523 ? 71.507  14.920  8.553   1.00 15.60 ? 545 PHE A CE1 1 
ATOM   3381 C CE2 . PHE A 1 523 ? 69.261  14.264  9.049   1.00 17.55 ? 545 PHE A CE2 1 
ATOM   3382 C CZ  . PHE A 1 523 ? 70.201  15.260  8.854   1.00 13.91 ? 545 PHE A CZ  1 
ATOM   3383 N N   . LYS A 1 524 ? 70.903  10.218  12.047  1.00 15.71 ? 546 LYS A N   1 
ATOM   3384 C CA  . LYS A 1 524 ? 69.916  9.806   13.040  1.00 21.38 ? 546 LYS A CA  1 
ATOM   3385 C C   . LYS A 1 524 ? 69.129  11.034  13.482  1.00 17.59 ? 546 LYS A C   1 
ATOM   3386 O O   . LYS A 1 524 ? 69.680  11.938  14.118  1.00 20.64 ? 546 LYS A O   1 
ATOM   3387 C CB  . LYS A 1 524 ? 70.590  9.123   14.230  1.00 19.53 ? 546 LYS A CB  1 
ATOM   3388 C CG  . LYS A 1 524 ? 71.168  7.756   13.901  1.00 19.95 ? 546 LYS A CG  1 
ATOM   3389 C CD  . LYS A 1 524 ? 72.318  7.408   14.821  1.00 22.36 ? 546 LYS A CD  1 
ATOM   3390 C CE  . LYS A 1 524 ? 73.436  8.425   14.705  1.00 22.87 ? 546 LYS A CE  1 
ATOM   3391 N NZ  . LYS A 1 524 ? 74.725  7.878   15.202  1.00 32.25 ? 546 LYS A NZ  1 
ATOM   3392 N N   . ILE A 1 525 ? 67.843  11.066  13.146  1.00 15.56 ? 547 ILE A N   1 
ATOM   3393 C CA  . ILE A 1 525 ? 66.976  12.176  13.514  1.00 19.60 ? 547 ILE A CA  1 
ATOM   3394 C C   . ILE A 1 525 ? 65.675  11.615  14.066  1.00 18.65 ? 547 ILE A C   1 
ATOM   3395 O O   . ILE A 1 525 ? 65.203  10.553  13.644  1.00 14.89 ? 547 ILE A O   1 
ATOM   3396 C CB  . ILE A 1 525 ? 66.722  13.121  12.318  1.00 17.84 ? 547 ILE A CB  1 
ATOM   3397 C CG1 . ILE A 1 525 ? 65.882  14.328  12.742  1.00 18.97 ? 547 ILE A CG1 1 
ATOM   3398 C CG2 . ILE A 1 525 ? 66.066  12.374  11.188  1.00 11.72 ? 547 ILE A CG2 1 
ATOM   3399 C CD1 . ILE A 1 525 ? 65.790  15.412  11.681  1.00 18.44 ? 547 ILE A CD1 1 
ATOM   3400 N N   . ALA A 1 526 ? 65.109  12.326  15.039  1.00 17.48 ? 548 ALA A N   1 
ATOM   3401 C CA  . ALA A 1 526 ? 63.901  11.885  15.716  1.00 18.62 ? 548 ALA A CA  1 
ATOM   3402 C C   . ALA A 1 526 ? 63.013  13.087  16.000  1.00 25.14 ? 548 ALA A C   1 
ATOM   3403 O O   . ALA A 1 526 ? 63.477  14.229  16.071  1.00 22.44 ? 548 ALA A O   1 
ATOM   3404 C CB  . ALA A 1 526 ? 64.224  11.144  17.021  1.00 13.49 ? 548 ALA A CB  1 
ATOM   3405 N N   . GLY A 1 527 ? 61.725  12.815  16.165  1.00 26.46 ? 549 GLY A N   1 
ATOM   3406 C CA  . GLY A 1 527 ? 60.793  13.864  16.525  1.00 26.32 ? 549 GLY A CA  1 
ATOM   3407 C C   . GLY A 1 527 ? 59.395  13.313  16.681  1.00 24.81 ? 549 GLY A C   1 
ATOM   3408 O O   . GLY A 1 527 ? 59.201  12.105  16.836  1.00 19.65 ? 549 GLY A O   1 
ATOM   3409 N N   . THR A 1 528 ? 58.421  14.217  16.637  1.00 28.47 ? 550 THR A N   1 
ATOM   3410 C CA  . THR A 1 528 ? 57.015  13.865  16.736  1.00 29.26 ? 550 THR A CA  1 
ATOM   3411 C C   . THR A 1 528 ? 56.368  13.936  15.356  1.00 24.02 ? 550 THR A C   1 
ATOM   3412 O O   . THR A 1 528 ? 57.038  14.126  14.338  1.00 30.74 ? 550 THR A O   1 
ATOM   3413 C CB  . THR A 1 528 ? 56.308  14.788  17.728  1.00 25.67 ? 550 THR A CB  1 
ATOM   3414 O OG1 . THR A 1 528 ? 56.279  16.120  17.199  1.00 20.24 ? 550 THR A OG1 1 
ATOM   3415 C CG2 . THR A 1 528 ? 57.036  14.787  19.062  1.00 19.37 ? 550 THR A CG2 1 
ATOM   3416 N N   . ASN A 1 529 ? 55.042  13.794  15.319  1.00 26.11 ? 551 ASN A N   1 
ATOM   3417 C CA  . ASN A 1 529 ? 54.295  13.910  14.071  1.00 37.10 ? 551 ASN A CA  1 
ATOM   3418 C C   . ASN A 1 529 ? 54.324  15.319  13.494  1.00 30.64 ? 551 ASN A C   1 
ATOM   3419 O O   . ASN A 1 529 ? 53.888  15.510  12.354  1.00 38.43 ? 551 ASN A O   1 
ATOM   3420 C CB  . ASN A 1 529 ? 52.839  13.477  14.291  1.00 37.13 ? 551 ASN A CB  1 
ATOM   3421 C CG  . ASN A 1 529 ? 52.078  14.416  15.229  1.00 47.42 ? 551 ASN A CG  1 
ATOM   3422 O OD1 . ASN A 1 529 ? 52.641  15.362  15.790  1.00 45.16 ? 551 ASN A OD1 1 
ATOM   3423 N ND2 . ASN A 1 529 ? 50.789  14.149  15.407  1.00 51.38 ? 551 ASN A ND2 1 
ATOM   3424 N N   . LYS A 1 530 ? 54.816  16.303  14.249  1.00 25.35 ? 552 LYS A N   1 
ATOM   3425 C CA  . LYS A 1 530 ? 54.706  17.699  13.856  1.00 29.05 ? 552 LYS A CA  1 
ATOM   3426 C C   . LYS A 1 530 ? 55.997  18.488  14.022  1.00 24.39 ? 552 LYS A C   1 
ATOM   3427 O O   . LYS A 1 530 ? 55.996  19.693  13.754  1.00 23.69 ? 552 LYS A O   1 
ATOM   3428 C CB  . LYS A 1 530 ? 53.588  18.380  14.667  1.00 32.80 ? 552 LYS A CB  1 
ATOM   3429 C CG  . LYS A 1 530 ? 52.372  18.784  13.852  1.00 43.23 ? 552 LYS A CG  1 
ATOM   3430 C CD  . LYS A 1 530 ? 51.240  19.263  14.750  1.00 48.01 ? 552 LYS A CD  1 
ATOM   3431 C CE  . LYS A 1 530 ? 50.553  20.483  14.159  1.00 48.21 ? 552 LYS A CE  1 
ATOM   3432 N NZ  . LYS A 1 530 ? 50.349  20.341  12.686  1.00 52.50 ? 552 LYS A NZ  1 
ATOM   3433 N N   . GLY A 1 531 ? 57.085  17.863  14.457  1.00 26.52 ? 553 GLY A N   1 
ATOM   3434 C CA  . GLY A 1 531 ? 58.316  18.600  14.671  1.00 26.38 ? 553 GLY A CA  1 
ATOM   3435 C C   . GLY A 1 531 ? 59.476  17.665  14.930  1.00 23.23 ? 553 GLY A C   1 
ATOM   3436 O O   . GLY A 1 531 ? 59.333  16.439  14.923  1.00 18.51 ? 553 GLY A O   1 
ATOM   3437 N N   . ILE A 1 532 ? 60.637  18.276  15.176  1.00 23.70 ? 554 ILE A N   1 
ATOM   3438 C CA  . ILE A 1 532 ? 61.905  17.569  15.330  1.00 25.01 ? 554 ILE A CA  1 
ATOM   3439 C C   . ILE A 1 532 ? 62.435  17.812  16.737  1.00 24.00 ? 554 ILE A C   1 
ATOM   3440 O O   . ILE A 1 532 ? 62.495  18.960  17.193  1.00 20.65 ? 554 ILE A O   1 
ATOM   3441 C CB  . ILE A 1 532 ? 62.931  18.024  14.274  1.00 20.30 ? 554 ILE A CB  1 
ATOM   3442 C CG1 . ILE A 1 532 ? 62.416  17.720  12.866  1.00 20.14 ? 554 ILE A CG1 1 
ATOM   3443 C CG2 . ILE A 1 532 ? 64.271  17.351  14.503  1.00 15.95 ? 554 ILE A CG2 1 
ATOM   3444 C CD1 . ILE A 1 532 ? 63.181  18.432  11.777  1.00 17.74 ? 554 ILE A CD1 1 
ATOM   3445 N N   . THR A 1 533 ? 62.829  16.734  17.421  1.00 24.50 ? 555 THR A N   1 
ATOM   3446 C CA  . THR A 1 533 ? 63.329  16.838  18.787  1.00 20.50 ? 555 THR A CA  1 
ATOM   3447 C C   . THR A 1 533 ? 64.826  16.611  18.921  1.00 17.30 ? 555 THR A C   1 
ATOM   3448 O O   . THR A 1 533 ? 65.430  17.147  19.853  1.00 16.30 ? 555 THR A O   1 
ATOM   3449 C CB  . THR A 1 533 ? 62.602  15.848  19.708  1.00 21.08 ? 555 THR A CB  1 
ATOM   3450 O OG1 . THR A 1 533 ? 62.917  14.507  19.321  1.00 21.23 ? 555 THR A OG1 1 
ATOM   3451 C CG2 . THR A 1 533 ? 61.097  16.048  19.627  1.00 25.13 ? 555 THR A CG2 1 
ATOM   3452 N N   . ALA A 1 534 ? 65.446  15.841  18.027  1.00 18.23 ? 556 ALA A N   1 
ATOM   3453 C CA  . ALA A 1 534 ? 66.878  15.589  18.143  1.00 21.76 ? 556 ALA A CA  1 
ATOM   3454 C C   . ALA A 1 534 ? 67.438  15.092  16.816  1.00 17.77 ? 556 ALA A C   1 
ATOM   3455 O O   . ALA A 1 534 ? 66.730  14.472  16.014  1.00 14.37 ? 556 ALA A O   1 
ATOM   3456 C CB  . ALA A 1 534 ? 67.180  14.575  19.253  1.00 25.30 ? 556 ALA A CB  1 
ATOM   3457 N N   . LEU A 1 535 ? 68.725  15.367  16.605  1.00 17.68 ? 557 LEU A N   1 
ATOM   3458 C CA  . LEU A 1 535 ? 69.424  14.940  15.401  1.00 20.26 ? 557 LEU A CA  1 
ATOM   3459 C C   . LEU A 1 535 ? 70.905  14.789  15.709  1.00 20.36 ? 557 LEU A C   1 
ATOM   3460 O O   . LEU A 1 535 ? 71.492  15.624  16.403  1.00 22.09 ? 557 LEU A O   1 
ATOM   3461 C CB  . LEU A 1 535 ? 69.234  15.933  14.248  1.00 23.79 ? 557 LEU A CB  1 
ATOM   3462 C CG  . LEU A 1 535 ? 70.339  15.928  13.187  1.00 21.66 ? 557 LEU A CG  1 
ATOM   3463 C CD1 . LEU A 1 535 ? 70.243  14.663  12.347  1.00 23.60 ? 557 LEU A CD1 1 
ATOM   3464 C CD2 . LEU A 1 535 ? 70.282  17.165  12.302  1.00 15.93 ? 557 LEU A CD2 1 
ATOM   3465 N N   . GLN A 1 536 ? 71.497  13.717  15.189  1.00 20.05 ? 558 GLN A N   1 
ATOM   3466 C CA  . GLN A 1 536 ? 72.935  13.481  15.284  1.00 23.77 ? 558 GLN A CA  1 
ATOM   3467 C C   . GLN A 1 536 ? 73.386  12.908  13.947  1.00 19.13 ? 558 GLN A C   1 
ATOM   3468 O O   . GLN A 1 536 ? 73.072  11.759  13.621  1.00 19.43 ? 558 GLN A O   1 
ATOM   3469 C CB  . GLN A 1 536 ? 73.270  12.537  16.442  1.00 23.55 ? 558 GLN A CB  1 
ATOM   3470 C CG  . GLN A 1 536 ? 74.590  11.791  16.300  1.00 26.82 ? 558 GLN A CG  1 
ATOM   3471 C CD  . GLN A 1 536 ? 75.084  11.229  17.618  1.00 34.62 ? 558 GLN A CD  1 
ATOM   3472 O OE1 . GLN A 1 536 ? 74.534  11.530  18.674  1.00 39.17 ? 558 GLN A OE1 1 
ATOM   3473 N NE2 . GLN A 1 536 ? 76.128  10.407  17.562  1.00 40.41 ? 558 GLN A NE2 1 
ATOM   3474 N N   . ALA A 1 537 ? 74.096  13.711  13.161  1.00 17.21 ? 559 ALA A N   1 
ATOM   3475 C CA  . ALA A 1 537 ? 74.573  13.292  11.851  1.00 19.69 ? 559 ALA A CA  1 
ATOM   3476 C C   . ALA A 1 537 ? 76.028  12.853  11.966  1.00 28.75 ? 559 ALA A C   1 
ATOM   3477 O O   . ALA A 1 537 ? 76.903  13.660  12.310  1.00 21.36 ? 559 ALA A O   1 
ATOM   3478 C CB  . ALA A 1 537 ? 74.429  14.416  10.826  1.00 13.13 ? 559 ALA A CB  1 
ATOM   3479 N N   . ASP A 1 538 ? 76.279  11.575  11.686  1.00 20.40 ? 560 ASP A N   1 
ATOM   3480 C CA  . ASP A 1 538 ? 77.633  11.029  11.661  1.00 18.78 ? 560 ASP A CA  1 
ATOM   3481 C C   . ASP A 1 538 ? 78.051  10.952  10.198  1.00 18.62 ? 560 ASP A C   1 
ATOM   3482 O O   . ASP A 1 538 ? 77.795  9.965   9.507   1.00 22.82 ? 560 ASP A O   1 
ATOM   3483 C CB  . ASP A 1 538 ? 77.694  9.671   12.351  1.00 26.33 ? 560 ASP A CB  1 
ATOM   3484 C CG  . ASP A 1 538 ? 77.450  9.764   13.851  1.00 29.15 ? 560 ASP A CG  1 
ATOM   3485 O OD1 . ASP A 1 538 ? 77.861  10.773  14.463  1.00 26.32 ? 560 ASP A OD1 1 
ATOM   3486 O OD2 . ASP A 1 538 ? 76.846  8.828   14.419  1.00 31.51 ? 560 ASP A OD2 1 
ATOM   3487 N N   . ILE A 1 539 ? 78.695  12.013  9.723   1.00 14.64 ? 561 ILE A N   1 
ATOM   3488 C CA  . ILE A 1 539 ? 79.094  12.120  8.325   1.00 16.52 ? 561 ILE A CA  1 
ATOM   3489 C C   . ILE A 1 539 ? 80.531  11.627  8.196   1.00 17.45 ? 561 ILE A C   1 
ATOM   3490 O O   . ILE A 1 539 ? 81.462  12.241  8.727   1.00 17.73 ? 561 ILE A O   1 
ATOM   3491 C CB  . ILE A 1 539 ? 78.946  13.555  7.811   1.00 18.85 ? 561 ILE A CB  1 
ATOM   3492 C CG1 . ILE A 1 539 ? 77.475  13.977  7.863   1.00 14.45 ? 561 ILE A CG1 1 
ATOM   3493 C CG2 . ILE A 1 539 ? 79.503  13.675  6.394   1.00 14.94 ? 561 ILE A CG2 1 
ATOM   3494 C CD1 . ILE A 1 539 ? 77.273  15.458  8.074   1.00 20.11 ? 561 ILE A CD1 1 
ATOM   3495 N N   . LYS A 1 540 ? 80.710  10.507  7.492   1.00 18.14 ? 562 LYS A N   1 
ATOM   3496 C CA  . LYS A 1 540 ? 82.050  9.976   7.271   1.00 20.00 ? 562 LYS A CA  1 
ATOM   3497 C C   . LYS A 1 540 ? 82.792  10.751  6.191   1.00 16.82 ? 562 LYS A C   1 
ATOM   3498 O O   . LYS A 1 540 ? 84.019  10.874  6.253   1.00 19.77 ? 562 LYS A O   1 
ATOM   3499 C CB  . LYS A 1 540 ? 81.973  8.501   6.885   1.00 21.86 ? 562 LYS A CB  1 
ATOM   3500 C CG  . LYS A 1 540 ? 81.651  7.557   8.018   1.00 22.38 ? 562 LYS A CG  1 
ATOM   3501 C CD  . LYS A 1 540 ? 82.079  6.149   7.628   1.00 35.97 ? 562 LYS A CD  1 
ATOM   3502 C CE  . LYS A 1 540 ? 81.081  5.101   8.084   1.00 30.40 ? 562 LYS A CE  1 
ATOM   3503 N NZ  . LYS A 1 540 ? 81.211  3.856   7.279   1.00 25.76 ? 562 LYS A NZ  1 
ATOM   3504 N N   . LEU A 1 541 ? 82.072  11.265  5.196   1.00 18.57 ? 563 LEU A N   1 
ATOM   3505 C CA  . LEU A 1 541 ? 82.687  12.028  4.122   1.00 18.08 ? 563 LEU A CA  1 
ATOM   3506 C C   . LEU A 1 541 ? 83.286  13.327  4.659   1.00 19.81 ? 563 LEU A C   1 
ATOM   3507 O O   . LEU A 1 541 ? 82.912  13.795  5.740   1.00 19.65 ? 563 LEU A O   1 
ATOM   3508 C CB  . LEU A 1 541 ? 81.651  12.339  3.044   1.00 16.50 ? 563 LEU A CB  1 
ATOM   3509 C CG  . LEU A 1 541 ? 81.273  11.202  2.102   1.00 18.18 ? 563 LEU A CG  1 
ATOM   3510 C CD1 . LEU A 1 541 ? 80.193  11.668  1.134   1.00 16.48 ? 563 LEU A CD1 1 
ATOM   3511 C CD2 . LEU A 1 541 ? 82.497  10.698  1.357   1.00 12.95 ? 563 LEU A CD2 1 
ATOM   3512 N N   . PRO A 1 542 ? 84.233  13.942  3.908   1.00 21.21 ? 564 PRO A N   1 
ATOM   3513 C CA  . PRO A 1 542 ? 84.798  15.247  4.264   1.00 20.50 ? 564 PRO A CA  1 
ATOM   3514 C C   . PRO A 1 542 ? 83.854  16.419  3.969   1.00 22.17 ? 564 PRO A C   1 
ATOM   3515 O O   . PRO A 1 542 ? 84.255  17.432  3.392   1.00 21.78 ? 564 PRO A O   1 
ATOM   3516 C CB  . PRO A 1 542 ? 86.063  15.321  3.411   1.00 16.58 ? 564 PRO A CB  1 
ATOM   3517 C CG  . PRO A 1 542 ? 85.739  14.491  2.210   1.00 17.04 ? 564 PRO A CG  1 
ATOM   3518 C CD  . PRO A 1 542 ? 84.902  13.352  2.735   1.00 20.83 ? 564 PRO A CD  1 
ATOM   3519 N N   . GLY A 1 543 ? 82.595  16.268  4.344   1.00 22.78 ? 565 GLY A N   1 
ATOM   3520 C CA  . GLY A 1 543 ? 81.583  17.289  4.139   1.00 19.88 ? 565 GLY A CA  1 
ATOM   3521 C C   . GLY A 1 543 ? 80.605  16.890  3.049   1.00 17.02 ? 565 GLY A C   1 
ATOM   3522 O O   . GLY A 1 543 ? 80.985  16.302  2.029   1.00 20.50 ? 565 GLY A O   1 
ATOM   3523 N N   . ILE A 1 544 ? 79.330  17.199  3.270   1.00 14.82 ? 566 ILE A N   1 
ATOM   3524 C CA  . ILE A 1 544 ? 78.289  16.974  2.268   1.00 15.92 ? 566 ILE A CA  1 
ATOM   3525 C C   . ILE A 1 544 ? 77.509  18.270  2.064   1.00 16.40 ? 566 ILE A C   1 
ATOM   3526 O O   . ILE A 1 544 ? 77.423  19.091  2.991   1.00 13.84 ? 566 ILE A O   1 
ATOM   3527 C CB  . ILE A 1 544 ? 77.360  15.815  2.670   1.00 15.96 ? 566 ILE A CB  1 
ATOM   3528 C CG1 . ILE A 1 544 ? 76.655  16.103  3.994   1.00 12.61 ? 566 ILE A CG1 1 
ATOM   3529 C CG2 . ILE A 1 544 ? 78.133  14.505  2.731   1.00 14.29 ? 566 ILE A CG2 1 
ATOM   3530 C CD1 . ILE A 1 544 ? 75.584  15.095  4.339   1.00 8.14  ? 566 ILE A CD1 1 
ATOM   3531 N N   . PRO A 1 545 ? 76.943  18.503  0.878   1.00 19.34 ? 567 PRO A N   1 
ATOM   3532 C CA  . PRO A 1 545 ? 76.226  19.761  0.634   1.00 12.96 ? 567 PRO A CA  1 
ATOM   3533 C C   . PRO A 1 545 ? 74.978  19.879  1.490   1.00 17.25 ? 567 PRO A C   1 
ATOM   3534 O O   . PRO A 1 545 ? 74.371  18.880  1.884   1.00 18.12 ? 567 PRO A O   1 
ATOM   3535 C CB  . PRO A 1 545 ? 75.859  19.682  -0.853  1.00 11.26 ? 567 PRO A CB  1 
ATOM   3536 C CG  . PRO A 1 545 ? 76.741  18.614  -1.426  1.00 10.68 ? 567 PRO A CG  1 
ATOM   3537 C CD  . PRO A 1 545 ? 76.977  17.648  -0.322  1.00 15.51 ? 567 PRO A CD  1 
ATOM   3538 N N   . ILE A 1 546 ? 74.596  21.132  1.765   1.00 17.16 ? 568 ILE A N   1 
ATOM   3539 C CA  . ILE A 1 546 ? 73.362  21.402  2.503   1.00 17.41 ? 568 ILE A CA  1 
ATOM   3540 C C   . ILE A 1 546 ? 72.191  20.658  1.878   1.00 16.71 ? 568 ILE A C   1 
ATOM   3541 O O   . ILE A 1 546 ? 71.370  20.060  2.582   1.00 18.22 ? 568 ILE A O   1 
ATOM   3542 C CB  . ILE A 1 546 ? 73.089  22.917  2.559   1.00 15.28 ? 568 ILE A CB  1 
ATOM   3543 C CG1 . ILE A 1 546 ? 74.366  23.678  2.910   1.00 21.87 ? 568 ILE A CG1 1 
ATOM   3544 C CG2 . ILE A 1 546 ? 71.989  23.220  3.566   1.00 19.50 ? 568 ILE A CG2 1 
ATOM   3545 C CD1 . ILE A 1 546 ? 74.209  25.185  2.873   1.00 22.55 ? 568 ILE A CD1 1 
ATOM   3546 N N   . LYS A 1 547 ? 72.114  20.667  0.543   1.00 19.81 ? 569 LYS A N   1 
ATOM   3547 C CA  . LYS A 1 547 ? 71.001  20.039  -0.165  1.00 22.11 ? 569 LYS A CA  1 
ATOM   3548 C C   . LYS A 1 547 ? 70.778  18.592  0.272   1.00 21.01 ? 569 LYS A C   1 
ATOM   3549 O O   . LYS A 1 547 ? 69.633  18.161  0.449   1.00 19.88 ? 569 LYS A O   1 
ATOM   3550 C CB  . LYS A 1 547 ? 71.248  20.112  -1.672  1.00 22.34 ? 569 LYS A CB  1 
ATOM   3551 C CG  . LYS A 1 547 ? 70.205  19.394  -2.507  1.00 26.72 ? 569 LYS A CG  1 
ATOM   3552 C CD  . LYS A 1 547 ? 70.592  19.385  -3.974  1.00 38.63 ? 569 LYS A CD  1 
ATOM   3553 C CE  . LYS A 1 547 ? 71.967  18.766  -4.183  1.00 34.72 ? 569 LYS A CE  1 
ATOM   3554 N NZ  . LYS A 1 547 ? 72.242  18.522  -5.632  1.00 53.01 ? 569 LYS A NZ  1 
ATOM   3555 N N   . ILE A 1 548 ? 71.856  17.827  0.457   1.00 19.67 ? 570 ILE A N   1 
ATOM   3556 C CA  . ILE A 1 548 ? 71.700  16.434  0.868   1.00 14.95 ? 570 ILE A CA  1 
ATOM   3557 C C   . ILE A 1 548 ? 71.121  16.354  2.274   1.00 16.99 ? 570 ILE A C   1 
ATOM   3558 O O   . ILE A 1 548 ? 70.267  15.505  2.562   1.00 18.89 ? 570 ILE A O   1 
ATOM   3559 C CB  . ILE A 1 548 ? 73.041  15.686  0.762   1.00 14.15 ? 570 ILE A CB  1 
ATOM   3560 C CG1 . ILE A 1 548 ? 73.534  15.684  -0.690  1.00 11.45 ? 570 ILE A CG1 1 
ATOM   3561 C CG2 . ILE A 1 548 ? 72.898  14.264  1.289   1.00 10.62 ? 570 ILE A CG2 1 
ATOM   3562 C CD1 . ILE A 1 548 ? 74.636  14.686  -0.964  1.00 7.94  ? 570 ILE A CD1 1 
ATOM   3563 N N   . VAL A 1 549 ? 71.561  17.242  3.168   1.00 17.67 ? 571 VAL A N   1 
ATOM   3564 C CA  . VAL A 1 549 ? 71.049  17.228  4.535   1.00 14.92 ? 571 VAL A CA  1 
ATOM   3565 C C   . VAL A 1 549 ? 69.566  17.572  4.555   1.00 15.52 ? 571 VAL A C   1 
ATOM   3566 O O   . VAL A 1 549 ? 68.783  16.960  5.288   1.00 13.80 ? 571 VAL A O   1 
ATOM   3567 C CB  . VAL A 1 549 ? 71.868  18.185  5.416   1.00 14.55 ? 571 VAL A CB  1 
ATOM   3568 C CG1 . VAL A 1 549 ? 71.175  18.403  6.755   1.00 17.38 ? 571 VAL A CG1 1 
ATOM   3569 C CG2 . VAL A 1 549 ? 73.270  17.640  5.610   1.00 10.97 ? 571 VAL A CG2 1 
ATOM   3570 N N   . MET A 1 550 ? 69.153  18.546  3.743   1.00 22.21 ? 572 MET A N   1 
ATOM   3571 C CA  . MET A 1 550 ? 67.747  18.936  3.718   1.00 21.92 ? 572 MET A CA  1 
ATOM   3572 C C   . MET A 1 550 ? 66.878  17.827  3.142   1.00 20.03 ? 572 MET A C   1 
ATOM   3573 O O   . MET A 1 550 ? 65.735  17.631  3.580   1.00 19.98 ? 572 MET A O   1 
ATOM   3574 C CB  . MET A 1 550 ? 67.576  20.229  2.923   1.00 15.65 ? 572 MET A CB  1 
ATOM   3575 C CG  . MET A 1 550 ? 68.559  21.323  3.317   1.00 21.33 ? 572 MET A CG  1 
ATOM   3576 S SD  . MET A 1 550 ? 68.027  22.299  4.738   1.00 29.85 ? 572 MET A SD  1 
ATOM   3577 C CE  . MET A 1 550 ? 68.856  21.460  6.080   1.00 29.01 ? 572 MET A CE  1 
ATOM   3578 N N   . GLU A 1 551 ? 67.404  17.085  2.167   1.00 15.24 ? 573 GLU A N   1 
ATOM   3579 C CA  . GLU A 1 551 ? 66.653  15.963  1.617   1.00 19.97 ? 573 GLU A CA  1 
ATOM   3580 C C   . GLU A 1 551 ? 66.591  14.805  2.607   1.00 22.76 ? 573 GLU A C   1 
ATOM   3581 O O   . GLU A 1 551 ? 65.567  14.115  2.701   1.00 19.05 ? 573 GLU A O   1 
ATOM   3582 C CB  . GLU A 1 551 ? 67.278  15.519  0.292   1.00 19.12 ? 573 GLU A CB  1 
ATOM   3583 C CG  . GLU A 1 551 ? 67.235  16.587  -0.790  1.00 19.51 ? 573 GLU A CG  1 
ATOM   3584 C CD  . GLU A 1 551 ? 67.866  16.144  -2.101  1.00 27.47 ? 573 GLU A CD  1 
ATOM   3585 O OE1 . GLU A 1 551 ? 67.911  16.966  -3.045  1.00 28.93 ? 573 GLU A OE1 1 
ATOM   3586 O OE2 . GLU A 1 551 ? 68.312  14.980  -2.191  1.00 27.45 ? 573 GLU A OE2 1 
ATOM   3587 N N   . ALA A 1 552 ? 67.672  14.587  3.365   1.00 20.84 ? 574 ALA A N   1 
ATOM   3588 C CA  . ALA A 1 552 ? 67.675  13.527  4.369   1.00 16.87 ? 574 ALA A CA  1 
ATOM   3589 C C   . ALA A 1 552 ? 66.678  13.815  5.489   1.00 16.38 ? 574 ALA A C   1 
ATOM   3590 O O   . ALA A 1 552 ? 66.041  12.895  6.012   1.00 17.63 ? 574 ALA A O   1 
ATOM   3591 C CB  . ALA A 1 552 ? 69.087  13.348  4.930   1.00 15.35 ? 574 ALA A CB  1 
ATOM   3592 N N   . ILE A 1 553 ? 66.531  15.083  5.871   1.00 14.83 ? 575 ILE A N   1 
ATOM   3593 C CA  . ILE A 1 553 ? 65.554  15.443  6.894   1.00 15.61 ? 575 ILE A CA  1 
ATOM   3594 C C   . ILE A 1 553 ? 64.140  15.170  6.399   1.00 20.73 ? 575 ILE A C   1 
ATOM   3595 O O   . ILE A 1 553 ? 63.326  14.560  7.103   1.00 24.58 ? 575 ILE A O   1 
ATOM   3596 C CB  . ILE A 1 553 ? 65.730  16.914  7.306   1.00 13.75 ? 575 ILE A CB  1 
ATOM   3597 C CG1 . ILE A 1 553 ? 67.019  17.081  8.110   1.00 16.32 ? 575 ILE A CG1 1 
ATOM   3598 C CG2 . ILE A 1 553 ? 64.531  17.389  8.103   1.00 8.81  ? 575 ILE A CG2 1 
ATOM   3599 C CD1 . ILE A 1 553 ? 67.373  18.516  8.410   1.00 15.65 ? 575 ILE A CD1 1 
ATOM   3600 N N   . GLN A 1 554 ? 63.829  15.615  5.179   1.00 22.24 ? 576 GLN A N   1 
ATOM   3601 C CA  . GLN A 1 554 ? 62.491  15.413  4.632   1.00 23.33 ? 576 GLN A CA  1 
ATOM   3602 C C   . GLN A 1 554 ? 62.206  13.933  4.390   1.00 21.10 ? 576 GLN A C   1 
ATOM   3603 O O   . GLN A 1 554 ? 61.098  13.455  4.667   1.00 22.23 ? 576 GLN A O   1 
ATOM   3604 C CB  . GLN A 1 554 ? 62.331  16.229  3.344   1.00 23.81 ? 576 GLN A CB  1 
ATOM   3605 C CG  . GLN A 1 554 ? 61.220  15.762  2.406   1.00 21.68 ? 576 GLN A CG  1 
ATOM   3606 C CD  . GLN A 1 554 ? 59.837  15.826  3.036   1.00 20.23 ? 576 GLN A CD  1 
ATOM   3607 O OE1 . GLN A 1 554 ? 59.584  16.620  3.947   1.00 16.87 ? 576 GLN A OE1 1 
ATOM   3608 N NE2 . GLN A 1 554 ? 58.935  14.979  2.553   1.00 17.14 ? 576 GLN A NE2 1 
ATOM   3609 N N   . GLN A 1 555 ? 63.191  13.189  3.881   1.00 18.40 ? 577 GLN A N   1 
ATOM   3610 C CA  . GLN A 1 555 ? 62.999  11.755  3.702   1.00 21.16 ? 577 GLN A CA  1 
ATOM   3611 C C   . GLN A 1 555 ? 62.729  11.069  5.033   1.00 18.38 ? 577 GLN A C   1 
ATOM   3612 O O   . GLN A 1 555 ? 61.943  10.114  5.093   1.00 16.19 ? 577 GLN A O   1 
ATOM   3613 C CB  . GLN A 1 555 ? 64.223  11.136  3.017   1.00 20.79 ? 577 GLN A CB  1 
ATOM   3614 C CG  . GLN A 1 555 ? 64.170  9.619   2.874   1.00 17.69 ? 577 GLN A CG  1 
ATOM   3615 C CD  . GLN A 1 555 ? 65.018  9.098   1.720   1.00 23.67 ? 577 GLN A CD  1 
ATOM   3616 O OE1 . GLN A 1 555 ? 65.373  9.845   0.804   1.00 22.14 ? 577 GLN A OE1 1 
ATOM   3617 N NE2 . GLN A 1 555 ? 65.344  7.807   1.761   1.00 19.53 ? 577 GLN A NE2 1 
ATOM   3618 N N   . ALA A 1 556 ? 63.356  11.553  6.109   1.00 20.63 ? 578 ALA A N   1 
ATOM   3619 C CA  . ALA A 1 556 ? 63.157  10.945  7.421   1.00 19.16 ? 578 ALA A CA  1 
ATOM   3620 C C   . ALA A 1 556 ? 61.763  11.234  7.962   1.00 20.70 ? 578 ALA A C   1 
ATOM   3621 O O   . ALA A 1 556 ? 61.171  10.386  8.642   1.00 21.50 ? 578 ALA A O   1 
ATOM   3622 C CB  . ALA A 1 556 ? 64.220  11.445  8.397   1.00 14.75 ? 578 ALA A CB  1 
ATOM   3623 N N   . SER A 1 557 ? 61.226  12.426  7.681   1.00 20.95 ? 579 SER A N   1 
ATOM   3624 C CA  . SER A 1 557 ? 59.868  12.739  8.112   1.00 21.03 ? 579 SER A CA  1 
ATOM   3625 C C   . SER A 1 557 ? 58.856  11.786  7.495   1.00 19.40 ? 579 SER A C   1 
ATOM   3626 O O   . SER A 1 557 ? 57.855  11.443  8.134   1.00 22.92 ? 579 SER A O   1 
ATOM   3627 C CB  . SER A 1 557 ? 59.525  14.186  7.766   1.00 21.95 ? 579 SER A CB  1 
ATOM   3628 O OG  . SER A 1 557 ? 59.927  15.054  8.815   1.00 32.15 ? 579 SER A OG  1 
ATOM   3629 N N   . VAL A 1 558 ? 59.103  11.340  6.264   1.00 18.28 ? 580 VAL A N   1 
ATOM   3630 C CA  . VAL A 1 558 ? 58.238  10.333  5.663   1.00 21.32 ? 580 VAL A CA  1 
ATOM   3631 C C   . VAL A 1 558 ? 58.351  9.022   6.424   1.00 21.16 ? 580 VAL A C   1 
ATOM   3632 O O   . VAL A 1 558 ? 57.348  8.341   6.667   1.00 27.63 ? 580 VAL A O   1 
ATOM   3633 C CB  . VAL A 1 558 ? 58.580  10.156  4.172   1.00 14.46 ? 580 VAL A CB  1 
ATOM   3634 C CG1 . VAL A 1 558 ? 57.558  9.265   3.500   1.00 10.92 ? 580 VAL A CG1 1 
ATOM   3635 C CG2 . VAL A 1 558 ? 58.651  11.505  3.487   1.00 16.24 ? 580 VAL A CG2 1 
ATOM   3636 N N   . ALA A 1 559 ? 59.572  8.651   6.819   1.00 21.61 ? 581 ALA A N   1 
ATOM   3637 C CA  . ALA A 1 559 ? 59.762  7.413   7.568   1.00 22.99 ? 581 ALA A CA  1 
ATOM   3638 C C   . ALA A 1 559 ? 59.222  7.539   8.985   1.00 23.66 ? 581 ALA A C   1 
ATOM   3639 O O   . ALA A 1 559 ? 58.653  6.582   9.526   1.00 23.77 ? 581 ALA A O   1 
ATOM   3640 C CB  . ALA A 1 559 ? 61.243  7.029   7.593   1.00 14.29 ? 581 ALA A CB  1 
ATOM   3641 N N   . LYS A 1 560 ? 59.387  8.715   9.599   1.00 17.57 ? 582 LYS A N   1 
ATOM   3642 C CA  . LYS A 1 560 ? 58.934  8.903   10.972  1.00 24.16 ? 582 LYS A CA  1 
ATOM   3643 C C   . LYS A 1 560 ? 57.419  8.766   11.082  1.00 30.39 ? 582 LYS A C   1 
ATOM   3644 O O   . LYS A 1 560 ? 56.909  8.177   12.044  1.00 30.57 ? 582 LYS A O   1 
ATOM   3645 C CB  . LYS A 1 560 ? 59.391  10.266  11.490  1.00 19.33 ? 582 LYS A CB  1 
ATOM   3646 C CG  . LYS A 1 560 ? 58.754  10.681  12.801  1.00 11.73 ? 582 LYS A CG  1 
ATOM   3647 C CD  . LYS A 1 560 ? 59.207  12.071  13.206  1.00 17.36 ? 582 LYS A CD  1 
ATOM   3648 C CE  . LYS A 1 560 ? 59.055  13.062  12.062  1.00 17.48 ? 582 LYS A CE  1 
ATOM   3649 N NZ  . LYS A 1 560 ? 59.138  14.467  12.543  1.00 18.25 ? 582 LYS A NZ  1 
ATOM   3650 N N   . LYS A 1 561 ? 56.682  9.299   10.104  1.00 23.66 ? 583 LYS A N   1 
ATOM   3651 C CA  . LYS A 1 561 ? 55.229  9.193   10.152  1.00 22.59 ? 583 LYS A CA  1 
ATOM   3652 C C   . LYS A 1 561 ? 54.775  7.750   9.972   1.00 23.82 ? 583 LYS A C   1 
ATOM   3653 O O   . LYS A 1 561 ? 53.802  7.319   10.600  1.00 28.71 ? 583 LYS A O   1 
ATOM   3654 C CB  . LYS A 1 561 ? 54.601  10.098  9.094   1.00 35.12 ? 583 LYS A CB  1 
ATOM   3655 C CG  . LYS A 1 561 ? 54.634  11.577  9.457   1.00 38.69 ? 583 LYS A CG  1 
ATOM   3656 C CD  . LYS A 1 561 ? 53.722  12.394  8.551   1.00 49.43 ? 583 LYS A CD  1 
ATOM   3657 C CE  . LYS A 1 561 ? 54.234  13.820  8.382   1.00 47.26 ? 583 LYS A CE  1 
ATOM   3658 N NZ  . LYS A 1 561 ? 53.836  14.400  7.067   1.00 36.36 ? 583 LYS A NZ  1 
ATOM   3659 N N   . GLU A 1 562 ? 55.470  6.984   9.129   1.00 22.36 ? 584 GLU A N   1 
ATOM   3660 C CA  . GLU A 1 562 ? 55.134  5.572   8.981   1.00 27.44 ? 584 GLU A CA  1 
ATOM   3661 C C   . GLU A 1 562 ? 55.396  4.803   10.268  1.00 24.33 ? 584 GLU A C   1 
ATOM   3662 O O   . GLU A 1 562 ? 54.632  3.896   10.622  1.00 26.35 ? 584 GLU A O   1 
ATOM   3663 C CB  . GLU A 1 562 ? 55.925  4.953   7.833   1.00 29.40 ? 584 GLU A CB  1 
ATOM   3664 C CG  . GLU A 1 562 ? 55.627  5.544   6.478   1.00 35.63 ? 584 GLU A CG  1 
ATOM   3665 C CD  . GLU A 1 562 ? 56.475  4.924   5.391   1.00 44.18 ? 584 GLU A CD  1 
ATOM   3666 O OE1 . GLU A 1 562 ? 57.261  5.660   4.755   1.00 40.34 ? 584 GLU A OE1 1 
ATOM   3667 O OE2 . GLU A 1 562 ? 56.361  3.695   5.181   1.00 53.24 ? 584 GLU A OE2 1 
ATOM   3668 N N   . ILE A 1 563 ? 56.478  5.136   10.975  1.00 24.84 ? 585 ILE A N   1 
ATOM   3669 C CA  . ILE A 1 563 ? 56.767  4.460   12.236  1.00 27.25 ? 585 ILE A CA  1 
ATOM   3670 C C   . ILE A 1 563 ? 55.723  4.823   13.281  1.00 21.20 ? 585 ILE A C   1 
ATOM   3671 O O   . ILE A 1 563 ? 55.236  3.957   14.017  1.00 27.71 ? 585 ILE A O   1 
ATOM   3672 C CB  . ILE A 1 563 ? 58.192  4.791   12.720  1.00 23.69 ? 585 ILE A CB  1 
ATOM   3673 C CG1 . ILE A 1 563 ? 59.235  4.236   11.748  1.00 23.75 ? 585 ILE A CG1 1 
ATOM   3674 C CG2 . ILE A 1 563 ? 58.432  4.210   14.099  1.00 22.86 ? 585 ILE A CG2 1 
ATOM   3675 C CD1 . ILE A 1 563 ? 60.623  4.797   11.944  1.00 17.24 ? 585 ILE A CD1 1 
ATOM   3676 N N   . LEU A 1 564 ? 55.350  6.102   13.352  1.00 20.54 ? 586 LEU A N   1 
ATOM   3677 C CA  . LEU A 1 564 ? 54.362  6.530   14.336  1.00 22.00 ? 586 LEU A CA  1 
ATOM   3678 C C   . LEU A 1 564 ? 53.011  5.868   14.090  1.00 26.48 ? 586 LEU A C   1 
ATOM   3679 O O   . LEU A 1 564 ? 52.317  5.486   15.040  1.00 29.63 ? 586 LEU A O   1 
ATOM   3680 C CB  . LEU A 1 564 ? 54.231  8.053   14.316  1.00 16.05 ? 586 LEU A CB  1 
ATOM   3681 C CG  . LEU A 1 564 ? 55.382  8.800   14.989  1.00 18.45 ? 586 LEU A CG  1 
ATOM   3682 C CD1 . LEU A 1 564 ? 55.214  10.310  14.872  1.00 21.90 ? 586 LEU A CD1 1 
ATOM   3683 C CD2 . LEU A 1 564 ? 55.487  8.383   16.443  1.00 23.63 ? 586 LEU A CD2 1 
ATOM   3684 N N   . GLN A 1 565 ? 52.627  5.710   12.822  1.00 28.36 ? 587 GLN A N   1 
ATOM   3685 C CA  . GLN A 1 565 ? 51.350  5.073   12.521  1.00 31.83 ? 587 GLN A CA  1 
ATOM   3686 C C   . GLN A 1 565 ? 51.322  3.634   13.021  1.00 30.39 ? 587 GLN A C   1 
ATOM   3687 O O   . GLN A 1 565 ? 50.297  3.165   13.530  1.00 38.18 ? 587 GLN A O   1 
ATOM   3688 C CB  . GLN A 1 565 ? 51.070  5.142   11.019  1.00 32.70 ? 587 GLN A CB  1 
ATOM   3689 C CG  . GLN A 1 565 ? 50.644  6.529   10.554  1.00 39.30 ? 587 GLN A CG  1 
ATOM   3690 C CD  . GLN A 1 565 ? 50.125  6.544   9.129   1.00 57.93 ? 587 GLN A CD  1 
ATOM   3691 O OE1 . GLN A 1 565 ? 50.132  5.522   8.440   1.00 57.92 ? 587 GLN A OE1 1 
ATOM   3692 N NE2 . GLN A 1 565 ? 49.670  7.711   8.679   1.00 53.05 ? 587 GLN A NE2 1 
ATOM   3693 N N   . ILE A 1 566 ? 52.442  2.922   12.899  1.00 27.06 ? 588 ILE A N   1 
ATOM   3694 C CA  . ILE A 1 566 ? 52.529  1.575   13.453  1.00 30.08 ? 588 ILE A CA  1 
ATOM   3695 C C   . ILE A 1 566 ? 52.579  1.627   14.976  1.00 32.11 ? 588 ILE A C   1 
ATOM   3696 O O   . ILE A 1 566 ? 51.973  0.792   15.660  1.00 31.70 ? 588 ILE A O   1 
ATOM   3697 C CB  . ILE A 1 566 ? 53.750  0.840   12.867  1.00 33.01 ? 588 ILE A CB  1 
ATOM   3698 C CG1 . ILE A 1 566 ? 53.640  0.755   11.343  1.00 29.77 ? 588 ILE A CG1 1 
ATOM   3699 C CG2 . ILE A 1 566 ? 53.890  -0.549  13.474  1.00 31.25 ? 588 ILE A CG2 1 
ATOM   3700 C CD1 . ILE A 1 566 ? 54.867  0.183   10.677  1.00 28.25 ? 588 ILE A CD1 1 
ATOM   3701 N N   . MET A 1 567 ? 53.296  2.611   15.530  1.00 24.52 ? 589 MET A N   1 
ATOM   3702 C CA  . MET A 1 567 ? 53.391  2.742   16.981  1.00 28.81 ? 589 MET A CA  1 
ATOM   3703 C C   . MET A 1 567 ? 52.036  3.061   17.600  1.00 34.25 ? 589 MET A C   1 
ATOM   3704 O O   . MET A 1 567 ? 51.704  2.564   18.683  1.00 27.54 ? 589 MET A O   1 
ATOM   3705 C CB  . MET A 1 567 ? 54.399  3.831   17.349  1.00 21.51 ? 589 MET A CB  1 
ATOM   3706 C CG  . MET A 1 567 ? 55.846  3.446   17.174  1.00 20.51 ? 589 MET A CG  1 
ATOM   3707 S SD  . MET A 1 567 ? 56.919  4.875   17.399  1.00 21.47 ? 589 MET A SD  1 
ATOM   3708 C CE  . MET A 1 567 ? 56.345  5.488   18.979  1.00 22.68 ? 589 MET A CE  1 
ATOM   3709 N N   . ASN A 1 568 ? 51.246  3.902   16.934  1.00 34.27 ? 590 ASN A N   1 
ATOM   3710 C CA  . ASN A 1 568 ? 49.981  4.335   17.507  1.00 32.37 ? 590 ASN A CA  1 
ATOM   3711 C C   . ASN A 1 568 ? 48.904  3.263   17.418  1.00 30.81 ? 590 ASN A C   1 
ATOM   3712 O O   . ASN A 1 568 ? 47.895  3.357   18.126  1.00 35.01 ? 590 ASN A O   1 
ATOM   3713 C CB  . ASN A 1 568 ? 49.521  5.629   16.828  1.00 29.94 ? 590 ASN A CB  1 
ATOM   3714 C CG  . ASN A 1 568 ? 50.408  6.820   17.181  1.00 28.52 ? 590 ASN A CG  1 
ATOM   3715 O OD1 . ASN A 1 568 ? 50.767  7.021   18.344  1.00 31.20 ? 590 ASN A OD1 1 
ATOM   3716 N ND2 . ASN A 1 568 ? 50.769  7.608   16.175  1.00 26.40 ? 590 ASN A ND2 1 
ATOM   3717 N N   . LYS A 1 569 ? 49.098  2.244   16.578  1.00 26.09 ? 591 LYS A N   1 
ATOM   3718 C CA  . LYS A 1 569 ? 48.172  1.120   16.545  1.00 31.82 ? 591 LYS A CA  1 
ATOM   3719 C C   . LYS A 1 569 ? 48.354  0.196   17.743  1.00 34.36 ? 591 LYS A C   1 
ATOM   3720 O O   . LYS A 1 569 ? 47.428  -0.547  18.085  1.00 34.60 ? 591 LYS A O   1 
ATOM   3721 C CB  . LYS A 1 569 ? 48.335  0.337   15.240  1.00 39.73 ? 591 LYS A CB  1 
ATOM   3722 C CG  . LYS A 1 569 ? 47.580  0.942   14.058  1.00 45.41 ? 591 LYS A CG  1 
ATOM   3723 C CD  . LYS A 1 569 ? 47.122  -0.122  13.072  1.00 46.51 ? 591 LYS A CD  1 
ATOM   3724 C CE  . LYS A 1 569 ? 48.292  -0.963  12.577  1.00 56.68 ? 591 LYS A CE  1 
ATOM   3725 N NZ  . LYS A 1 569 ? 49.370  -0.135  11.963  1.00 47.64 ? 591 LYS A NZ  1 
ATOM   3726 N N   . THR A 1 570 ? 49.526  0.221   18.381  1.00 35.05 ? 592 THR A N   1 
ATOM   3727 C CA  . THR A 1 570 ? 49.729  -0.516  19.623  1.00 26.75 ? 592 THR A CA  1 
ATOM   3728 C C   . THR A 1 570 ? 49.267  0.306   20.822  1.00 33.61 ? 592 THR A C   1 
ATOM   3729 O O   . THR A 1 570 ? 48.559  -0.200  21.700  1.00 43.93 ? 592 THR A O   1 
ATOM   3730 C CB  . THR A 1 570 ? 51.204  -0.906  19.764  1.00 27.79 ? 592 THR A CB  1 
ATOM   3731 O OG1 . THR A 1 570 ? 51.465  -2.083  18.991  1.00 32.30 ? 592 THR A OG1 1 
ATOM   3732 C CG2 . THR A 1 570 ? 51.566  -1.168  21.214  1.00 26.30 ? 592 THR A CG2 1 
ATOM   3733 N N   . ILE A 1 571 ? 49.656  1.578   20.867  1.00 30.82 ? 593 ILE A N   1 
ATOM   3734 C CA  . ILE A 1 571 ? 49.185  2.513   21.880  1.00 25.50 ? 593 ILE A CA  1 
ATOM   3735 C C   . ILE A 1 571 ? 49.335  3.915   21.309  1.00 31.05 ? 593 ILE A C   1 
ATOM   3736 O O   . ILE A 1 571 ? 50.356  4.237   20.689  1.00 34.91 ? 593 ILE A O   1 
ATOM   3737 C CB  . ILE A 1 571 ? 49.948  2.353   23.210  1.00 34.48 ? 593 ILE A CB  1 
ATOM   3738 C CG1 . ILE A 1 571 ? 49.500  3.410   24.219  1.00 38.14 ? 593 ILE A CG1 1 
ATOM   3739 C CG2 . ILE A 1 571 ? 51.452  2.439   22.993  1.00 29.82 ? 593 ILE A CG2 1 
ATOM   3740 C CD1 . ILE A 1 571 ? 49.985  3.149   25.625  1.00 34.33 ? 593 ILE A CD1 1 
ATOM   3741 N N   . SER A 1 572 ? 48.312  4.750   21.486  1.00 34.44 ? 594 SER A N   1 
ATOM   3742 C CA  . SER A 1 572 ? 48.318  6.099   20.942  1.00 38.80 ? 594 SER A CA  1 
ATOM   3743 C C   . SER A 1 572 ? 48.107  7.181   21.988  1.00 42.84 ? 594 SER A C   1 
ATOM   3744 O O   . SER A 1 572 ? 48.214  8.367   21.654  1.00 44.29 ? 594 SER A O   1 
ATOM   3745 C CB  . SER A 1 572 ? 47.242  6.240   19.855  1.00 32.49 ? 594 SER A CB  1 
ATOM   3746 O OG  . SER A 1 572 ? 45.999  5.741   20.313  1.00 41.85 ? 594 SER A OG  1 
ATOM   3747 N N   . LYS A 1 573 ? 47.824  6.816   23.232  1.00 43.67 ? 595 LYS A N   1 
ATOM   3748 C CA  . LYS A 1 573 ? 47.537  7.769   24.290  1.00 42.97 ? 595 LYS A CA  1 
ATOM   3749 C C   . LYS A 1 573 ? 48.190  7.300   25.582  1.00 37.78 ? 595 LYS A C   1 
ATOM   3750 O O   . LYS A 1 573 ? 48.287  6.092   25.832  1.00 37.69 ? 595 LYS A O   1 
ATOM   3751 C CB  . LYS A 1 573 ? 46.019  7.940   24.497  1.00 49.40 ? 595 LYS A CB  1 
ATOM   3752 C CG  . LYS A 1 573 ? 45.218  6.627   24.584  1.00 61.23 ? 595 LYS A CG  1 
ATOM   3753 C CD  . LYS A 1 573 ? 44.962  6.188   26.028  1.00 68.55 ? 595 LYS A CD  1 
ATOM   3754 C CE  . LYS A 1 573 ? 44.752  4.685   26.138  1.00 61.20 ? 595 LYS A CE  1 
ATOM   3755 N NZ  . LYS A 1 573 ? 44.276  4.310   27.498  1.00 66.02 ? 595 LYS A NZ  1 
ATOM   3756 N N   . PRO A 1 574 ? 48.669  8.228   26.404  1.00 38.81 ? 596 PRO A N   1 
ATOM   3757 C CA  . PRO A 1 574 ? 49.109  7.845   27.749  1.00 39.31 ? 596 PRO A CA  1 
ATOM   3758 C C   . PRO A 1 574 ? 47.938  7.289   28.546  1.00 43.29 ? 596 PRO A C   1 
ATOM   3759 O O   . PRO A 1 574 ? 46.833  7.838   28.521  1.00 42.73 ? 596 PRO A O   1 
ATOM   3760 C CB  . PRO A 1 574 ? 49.638  9.159   28.340  1.00 36.47 ? 596 PRO A CB  1 
ATOM   3761 C CG  . PRO A 1 574 ? 49.945  10.026  27.145  1.00 34.35 ? 596 PRO A CG  1 
ATOM   3762 C CD  . PRO A 1 574 ? 48.924  9.651   26.114  1.00 35.64 ? 596 PRO A CD  1 
ATOM   3763 N N   . ARG A 1 575 ? 48.183  6.169   29.231  1.00 41.53 ? 597 ARG A N   1 
ATOM   3764 C CA  . ARG A 1 575 ? 47.172  5.566   30.092  1.00 35.75 ? 597 ARG A CA  1 
ATOM   3765 C C   . ARG A 1 575 ? 46.647  6.590   31.088  1.00 41.85 ? 597 ARG A C   1 
ATOM   3766 O O   . ARG A 1 575 ? 47.419  7.337   31.698  1.00 33.56 ? 597 ARG A O   1 
ATOM   3767 C CB  . ARG A 1 575 ? 47.756  4.366   30.840  1.00 38.55 ? 597 ARG A CB  1 
ATOM   3768 C CG  . ARG A 1 575 ? 48.339  3.292   29.942  1.00 45.57 ? 597 ARG A CG  1 
ATOM   3769 C CD  . ARG A 1 575 ? 47.391  2.116   29.813  1.00 48.92 ? 597 ARG A CD  1 
ATOM   3770 N NE  . ARG A 1 575 ? 47.850  0.969   30.587  1.00 45.97 ? 597 ARG A NE  1 
ATOM   3771 C CZ  . ARG A 1 575 ? 48.696  0.053   30.127  1.00 48.39 ? 597 ARG A CZ  1 
ATOM   3772 N NH1 . ARG A 1 575 ? 49.174  0.149   28.892  1.00 42.15 ? 597 ARG A NH1 1 
ATOM   3773 N NH2 . ARG A 1 575 ? 49.061  -0.961  30.900  1.00 47.11 ? 597 ARG A NH2 1 
ATOM   3774 N N   . ALA A 1 576 ? 45.319  6.616   31.246  1.00 45.86 ? 598 ALA A N   1 
ATOM   3775 C CA  . ALA A 1 576 ? 44.685  7.617   32.099  1.00 36.62 ? 598 ALA A CA  1 
ATOM   3776 C C   . ALA A 1 576 ? 45.218  7.567   33.525  1.00 45.50 ? 598 ALA A C   1 
ATOM   3777 O O   . ALA A 1 576 ? 45.313  8.605   34.190  1.00 49.05 ? 598 ALA A O   1 
ATOM   3778 C CB  . ALA A 1 576 ? 43.170  7.425   32.087  1.00 34.40 ? 598 ALA A CB  1 
ATOM   3779 N N   . SER A 1 577 ? 45.577  6.379   34.005  1.00 45.81 ? 599 SER A N   1 
ATOM   3780 C CA  . SER A 1 577 ? 46.155  6.206   35.328  1.00 45.27 ? 599 SER A CA  1 
ATOM   3781 C C   . SER A 1 577 ? 47.411  5.355   35.224  1.00 44.19 ? 599 SER A C   1 
ATOM   3782 O O   . SER A 1 577 ? 47.542  4.518   34.325  1.00 38.19 ? 599 SER A O   1 
ATOM   3783 C CB  . SER A 1 577 ? 45.162  5.541   36.297  1.00 48.47 ? 599 SER A CB  1 
ATOM   3784 O OG  . SER A 1 577 ? 44.434  6.507   37.036  1.00 55.82 ? 599 SER A OG  1 
ATOM   3785 N N   . ARG A 1 578 ? 48.339  5.580   36.150  1.00 40.23 ? 600 ARG A N   1 
ATOM   3786 C CA  . ARG A 1 578 ? 49.458  4.667   36.299  1.00 35.99 ? 600 ARG A CA  1 
ATOM   3787 C C   . ARG A 1 578 ? 48.953  3.316   36.799  1.00 41.19 ? 600 ARG A C   1 
ATOM   3788 O O   . ARG A 1 578 ? 47.833  3.191   37.304  1.00 50.45 ? 600 ARG A O   1 
ATOM   3789 C CB  . ARG A 1 578 ? 50.496  5.239   37.265  1.00 38.83 ? 600 ARG A CB  1 
ATOM   3790 C CG  . ARG A 1 578 ? 50.868  6.685   36.982  1.00 37.99 ? 600 ARG A CG  1 
ATOM   3791 C CD  . ARG A 1 578 ? 51.914  7.197   37.958  1.00 30.32 ? 600 ARG A CD  1 
ATOM   3792 N NE  . ARG A 1 578 ? 51.327  7.641   39.219  1.00 41.18 ? 600 ARG A NE  1 
ATOM   3793 C CZ  . ARG A 1 578 ? 50.860  8.867   39.437  1.00 40.35 ? 600 ARG A CZ  1 
ATOM   3794 N NH1 . ARG A 1 578 ? 50.905  9.777   38.474  1.00 41.53 ? 600 ARG A NH1 1 
ATOM   3795 N NH2 . ARG A 1 578 ? 50.348  9.187   40.618  1.00 33.69 ? 600 ARG A NH2 1 
ATOM   3796 N N   . LYS A 1 579 ? 49.790  2.293   36.647  1.00 44.47 ? 601 LYS A N   1 
ATOM   3797 C CA  . LYS A 1 579 ? 49.391  0.949   37.043  1.00 46.85 ? 601 LYS A CA  1 
ATOM   3798 C C   . LYS A 1 579 ? 49.134  0.886   38.550  1.00 52.81 ? 601 LYS A C   1 
ATOM   3799 O O   . LYS A 1 579 ? 49.657  1.686   39.334  1.00 51.24 ? 601 LYS A O   1 
ATOM   3800 C CB  . LYS A 1 579 ? 50.452  -0.066  36.617  1.00 41.42 ? 601 LYS A CB  1 
ATOM   3801 C CG  . LYS A 1 579 ? 50.462  -0.328  35.117  1.00 29.64 ? 601 LYS A CG  1 
ATOM   3802 C CD  . LYS A 1 579 ? 51.715  -1.065  34.670  1.00 35.48 ? 601 LYS A CD  1 
ATOM   3803 C CE  . LYS A 1 579 ? 51.829  -1.077  33.147  1.00 39.05 ? 601 LYS A CE  1 
ATOM   3804 N NZ  . LYS A 1 579 ? 52.971  -1.901  32.647  1.00 36.72 ? 601 LYS A NZ  1 
ATOM   3805 N N   . GLU A 1 580 ? 48.309  -0.089  38.949  1.00 51.82 ? 602 GLU A N   1 
ATOM   3806 C CA  . GLU A 1 580 ? 47.717  -0.076  40.286  1.00 62.16 ? 602 GLU A CA  1 
ATOM   3807 C C   . GLU A 1 580 ? 48.764  -0.171  41.390  1.00 64.91 ? 602 GLU A C   1 
ATOM   3808 O O   . GLU A 1 580 ? 48.579  0.404   42.471  1.00 56.58 ? 602 GLU A O   1 
ATOM   3809 C CB  . GLU A 1 580 ? 46.700  -1.211  40.422  1.00 63.27 ? 602 GLU A CB  1 
ATOM   3810 C CG  . GLU A 1 580 ? 45.266  -0.817  40.069  1.00 78.40 ? 602 GLU A CG  1 
ATOM   3811 C CD  . GLU A 1 580 ? 44.516  -0.177  41.231  1.00 79.50 ? 602 GLU A CD  1 
ATOM   3812 O OE1 . GLU A 1 580 ? 43.342  -0.545  41.455  1.00 70.84 ? 602 GLU A OE1 1 
ATOM   3813 O OE2 . GLU A 1 580 ? 45.092  0.696   41.915  1.00 72.37 ? 602 GLU A OE2 1 
ATOM   3814 N N   . ASN A 1 581 ? 49.861  -0.885  41.150  1.00 57.85 ? 603 ASN A N   1 
ATOM   3815 C CA  . ASN A 1 581 ? 50.902  -1.037  42.155  1.00 57.66 ? 603 ASN A CA  1 
ATOM   3816 C C   . ASN A 1 581 ? 51.966  0.050   42.069  1.00 52.48 ? 603 ASN A C   1 
ATOM   3817 O O   . ASN A 1 581 ? 53.054  -0.113  42.634  1.00 45.05 ? 603 ASN A O   1 
ATOM   3818 C CB  . ASN A 1 581 ? 51.550  -2.418  42.043  1.00 59.76 ? 603 ASN A CB  1 
ATOM   3819 C CG  . ASN A 1 581 ? 51.837  -3.029  43.397  1.00 59.95 ? 603 ASN A CG  1 
ATOM   3820 O OD1 . ASN A 1 581 ? 52.116  -2.317  44.361  1.00 63.04 ? 603 ASN A OD1 1 
ATOM   3821 N ND2 . ASN A 1 581 ? 51.766  -4.352  43.481  1.00 62.38 ? 603 ASN A ND2 1 
ATOM   3822 N N   . GLY A 1 582 ? 51.677  1.152   41.382  1.00 59.49 ? 604 GLY A N   1 
ATOM   3823 C CA  . GLY A 1 582 ? 52.631  2.221   41.218  1.00 52.63 ? 604 GLY A CA  1 
ATOM   3824 C C   . GLY A 1 582 ? 53.004  2.866   42.536  1.00 48.00 ? 604 GLY A C   1 
ATOM   3825 O O   . GLY A 1 582 ? 52.325  2.699   43.553  1.00 48.69 ? 604 GLY A O   1 
ATOM   3826 N N   . PRO A 1 583 ? 54.107  3.611   42.541  1.00 40.05 ? 605 PRO A N   1 
ATOM   3827 C CA  . PRO A 1 583 ? 54.513  4.322   43.757  1.00 39.27 ? 605 PRO A CA  1 
ATOM   3828 C C   . PRO A 1 583 ? 53.473  5.345   44.194  1.00 44.62 ? 605 PRO A C   1 
ATOM   3829 O O   . PRO A 1 583 ? 52.623  5.790   43.417  1.00 39.86 ? 605 PRO A O   1 
ATOM   3830 C CB  . PRO A 1 583 ? 55.828  5.002   43.352  1.00 38.17 ? 605 PRO A CB  1 
ATOM   3831 C CG  . PRO A 1 583 ? 56.332  4.197   42.196  1.00 40.16 ? 605 PRO A CG  1 
ATOM   3832 C CD  . PRO A 1 583 ? 55.109  3.722   41.467  1.00 39.83 ? 605 PRO A CD  1 
ATOM   3833 N N   . VAL A 1 584 ? 53.547  5.709   45.475  1.00 46.25 ? 606 VAL A N   1 
ATOM   3834 C CA  . VAL A 1 584 ? 52.667  6.702   46.080  1.00 38.61 ? 606 VAL A CA  1 
ATOM   3835 C C   . VAL A 1 584 ? 53.525  7.702   46.841  1.00 38.81 ? 606 VAL A C   1 
ATOM   3836 O O   . VAL A 1 584 ? 54.562  7.340   47.409  1.00 41.31 ? 606 VAL A O   1 
ATOM   3837 C CB  . VAL A 1 584 ? 51.630  6.055   47.026  1.00 34.75 ? 606 VAL A CB  1 
ATOM   3838 C CG1 . VAL A 1 584 ? 50.584  7.077   47.460  1.00 36.84 ? 606 VAL A CG1 1 
ATOM   3839 C CG2 . VAL A 1 584 ? 50.970  4.857   46.368  1.00 41.27 ? 606 VAL A CG2 1 
ATOM   3840 N N   . VAL A 1 585 ? 53.098  8.964   46.844  1.00 37.84 ? 607 VAL A N   1 
ATOM   3841 C CA  . VAL A 1 585 ? 53.700  9.999   47.676  1.00 39.30 ? 607 VAL A CA  1 
ATOM   3842 C C   . VAL A 1 585 ? 52.585  10.688  48.449  1.00 42.15 ? 607 VAL A C   1 
ATOM   3843 O O   . VAL A 1 585 ? 51.548  11.037  47.873  1.00 43.90 ? 607 VAL A O   1 
ATOM   3844 C CB  . VAL A 1 585 ? 54.501  11.026  46.854  1.00 31.92 ? 607 VAL A CB  1 
ATOM   3845 C CG1 . VAL A 1 585 ? 55.049  12.115  47.764  1.00 30.70 ? 607 VAL A CG1 1 
ATOM   3846 C CG2 . VAL A 1 585 ? 55.635  10.347  46.116  1.00 34.05 ? 607 VAL A CG2 1 
ATOM   3847 N N   . GLU A 1 586 ? 52.794  10.871  49.750  1.00 41.43 ? 608 GLU A N   1 
ATOM   3848 C CA  . GLU A 1 586 ? 51.820  11.519  50.613  1.00 41.30 ? 608 GLU A CA  1 
ATOM   3849 C C   . GLU A 1 586 ? 52.555  12.437  51.579  1.00 38.49 ? 608 GLU A C   1 
ATOM   3850 O O   . GLU A 1 586 ? 53.757  12.288  51.816  1.00 42.28 ? 608 GLU A O   1 
ATOM   3851 C CB  . GLU A 1 586 ? 50.965  10.485  51.370  1.00 44.33 ? 608 GLU A CB  1 
ATOM   3852 C CG  . GLU A 1 586 ? 49.899  9.813   50.501  1.00 42.48 ? 608 GLU A CG  1 
ATOM   3853 C CD  . GLU A 1 586 ? 49.343  8.532   51.110  1.00 45.84 ? 608 GLU A CD  1 
ATOM   3854 O OE1 . GLU A 1 586 ? 48.730  7.737   50.362  1.00 38.97 ? 608 GLU A OE1 1 
ATOM   3855 O OE2 . GLU A 1 586 ? 49.511  8.321   52.331  1.00 47.21 ? 608 GLU A OE2 1 
ATOM   3856 N N   . THR A 1 587 ? 51.822  13.401  52.127  1.00 41.87 ? 609 THR A N   1 
ATOM   3857 C CA  . THR A 1 587 ? 52.373  14.363  53.070  1.00 45.96 ? 609 THR A CA  1 
ATOM   3858 C C   . THR A 1 587 ? 51.978  14.001  54.497  1.00 42.35 ? 609 THR A C   1 
ATOM   3859 O O   . THR A 1 587 ? 50.892  13.470  54.747  1.00 46.45 ? 609 THR A O   1 
ATOM   3860 C CB  . THR A 1 587 ? 51.897  15.782  52.749  1.00 45.77 ? 609 THR A CB  1 
ATOM   3861 O OG1 . THR A 1 587 ? 51.780  15.936  51.330  1.00 51.69 ? 609 THR A OG1 1 
ATOM   3862 C CG2 . THR A 1 587 ? 52.889  16.800  53.273  1.00 47.94 ? 609 THR A CG2 1 
ATOM   3863 N N   . VAL A 1 588 ? 52.874  14.304  55.435  1.00 38.70 ? 610 VAL A N   1 
ATOM   3864 C CA  . VAL A 1 588 ? 52.693  13.967  56.843  1.00 41.73 ? 610 VAL A CA  1 
ATOM   3865 C C   . VAL A 1 588 ? 53.165  15.141  57.690  1.00 45.24 ? 610 VAL A C   1 
ATOM   3866 O O   . VAL A 1 588 ? 54.280  15.639  57.504  1.00 48.47 ? 610 VAL A O   1 
ATOM   3867 C CB  . VAL A 1 588 ? 53.461  12.684  57.225  1.00 44.97 ? 610 VAL A CB  1 
ATOM   3868 C CG1 . VAL A 1 588 ? 53.645  12.593  58.733  1.00 44.85 ? 610 VAL A CG1 1 
ATOM   3869 C CG2 . VAL A 1 588 ? 52.746  11.449  56.686  1.00 38.72 ? 610 VAL A CG2 1 
ATOM   3870 N N   . GLN A 1 589 ? 52.321  15.579  58.620  1.00 45.71 ? 611 GLN A N   1 
ATOM   3871 C CA  . GLN A 1 589 ? 52.662  16.629  59.569  1.00 51.09 ? 611 GLN A CA  1 
ATOM   3872 C C   . GLN A 1 589 ? 53.094  15.996  60.884  1.00 52.62 ? 611 GLN A C   1 
ATOM   3873 O O   . GLN A 1 589 ? 52.430  15.088  61.392  1.00 53.59 ? 611 GLN A O   1 
ATOM   3874 C CB  . GLN A 1 589 ? 51.479  17.570  59.805  1.00 53.03 ? 611 GLN A CB  1 
ATOM   3875 C CG  . GLN A 1 589 ? 50.690  17.929  58.552  1.00 54.43 ? 611 GLN A CG  1 
ATOM   3876 C CD  . GLN A 1 589 ? 51.363  19.007  57.727  1.00 57.36 ? 611 GLN A CD  1 
ATOM   3877 O OE1 . GLN A 1 589 ? 52.027  19.889  58.271  1.00 50.06 ? 611 GLN A OE1 1 
ATOM   3878 N NE2 . GLN A 1 589 ? 51.194  18.943  56.406  1.00 54.89 ? 611 GLN A NE2 1 
ATOM   3879 N N   . VAL A 1 590 ? 54.207  16.463  61.433  1.00 50.78 ? 612 VAL A N   1 
ATOM   3880 C CA  . VAL A 1 590 ? 54.602  16.002  62.761  1.00 52.84 ? 612 VAL A CA  1 
ATOM   3881 C C   . VAL A 1 590 ? 54.833  17.225  63.649  1.00 63.57 ? 612 VAL A C   1 
ATOM   3882 O O   . VAL A 1 590 ? 55.698  18.067  63.346  1.00 60.40 ? 612 VAL A O   1 
ATOM   3883 C CB  . VAL A 1 590 ? 55.812  15.046  62.680  1.00 45.93 ? 612 VAL A CB  1 
ATOM   3884 C CG1 . VAL A 1 590 ? 55.566  13.957  61.638  1.00 49.44 ? 612 VAL A CG1 1 
ATOM   3885 C CG2 . VAL A 1 590 ? 57.100  15.780  62.355  1.00 57.22 ? 612 VAL A CG2 1 
ATOM   3886 N N   . PRO A 1 591 ? 54.013  17.414  64.689  1.00 62.57 ? 613 PRO A N   1 
ATOM   3887 C CA  . PRO A 1 591 ? 54.191  18.564  65.583  1.00 60.69 ? 613 PRO A CA  1 
ATOM   3888 C C   . PRO A 1 591 ? 55.558  18.550  66.250  1.00 66.35 ? 613 PRO A C   1 
ATOM   3889 O O   . PRO A 1 591 ? 56.193  17.506  66.394  1.00 72.48 ? 613 PRO A O   1 
ATOM   3890 C CB  . PRO A 1 591 ? 53.064  18.403  66.620  1.00 67.36 ? 613 PRO A CB  1 
ATOM   3891 C CG  . PRO A 1 591 ? 52.548  17.001  66.447  1.00 58.48 ? 613 PRO A CG  1 
ATOM   3892 C CD  . PRO A 1 591 ? 52.789  16.662  64.997  1.00 56.49 ? 613 PRO A CD  1 
ATOM   3893 N N   . LEU A 1 592 ? 56.005  19.741  66.673  1.00 65.56 ? 614 LEU A N   1 
ATOM   3894 C CA  . LEU A 1 592 ? 57.379  19.888  67.148  1.00 63.95 ? 614 LEU A CA  1 
ATOM   3895 C C   . LEU A 1 592 ? 57.662  19.016  68.363  1.00 67.30 ? 614 LEU A C   1 
ATOM   3896 O O   . LEU A 1 592 ? 58.799  18.566  68.545  1.00 77.28 ? 614 LEU A O   1 
ATOM   3897 C CB  . LEU A 1 592 ? 57.672  21.355  67.466  1.00 64.21 ? 614 LEU A CB  1 
ATOM   3898 C CG  . LEU A 1 592 ? 59.084  21.672  67.971  1.00 64.02 ? 614 LEU A CG  1 
ATOM   3899 C CD1 . LEU A 1 592 ? 60.132  21.369  66.906  1.00 55.14 ? 614 LEU A CD1 1 
ATOM   3900 C CD2 . LEU A 1 592 ? 59.182  23.119  68.436  1.00 62.54 ? 614 LEU A CD2 1 
ATOM   3901 N N   . SER A 1 593 ? 56.653  18.763  69.201  1.00 61.32 ? 615 SER A N   1 
ATOM   3902 C CA  . SER A 1 593 ? 56.865  17.897  70.358  1.00 67.85 ? 615 SER A CA  1 
ATOM   3903 C C   . SER A 1 593 ? 57.325  16.509  69.924  1.00 68.47 ? 615 SER A C   1 
ATOM   3904 O O   . SER A 1 593 ? 58.366  16.017  70.375  1.00 75.20 ? 615 SER A O   1 
ATOM   3905 C CB  . SER A 1 593 ? 55.586  17.812  71.195  1.00 69.69 ? 615 SER A CB  1 
ATOM   3906 O OG  . SER A 1 593 ? 54.433  17.704  70.378  1.00 70.56 ? 615 SER A OG  1 
ATOM   3907 N N   . LYS A 1 594 ? 56.572  15.871  69.029  1.00 60.78 ? 616 LYS A N   1 
ATOM   3908 C CA  . LYS A 1 594 ? 56.945  14.561  68.514  1.00 62.70 ? 616 LYS A CA  1 
ATOM   3909 C C   . LYS A 1 594 ? 58.020  14.628  67.433  1.00 66.20 ? 616 LYS A C   1 
ATOM   3910 O O   . LYS A 1 594 ? 58.443  13.574  66.943  1.00 61.97 ? 616 LYS A O   1 
ATOM   3911 C CB  . LYS A 1 594 ? 55.705  13.843  67.970  1.00 53.33 ? 616 LYS A CB  1 
ATOM   3912 C CG  . LYS A 1 594 ? 54.492  13.924  68.884  1.00 56.04 ? 616 LYS A CG  1 
ATOM   3913 C CD  . LYS A 1 594 ? 54.729  13.166  70.181  1.00 64.42 ? 616 LYS A CD  1 
ATOM   3914 C CE  . LYS A 1 594 ? 53.490  13.170  71.065  1.00 60.75 ? 616 LYS A CE  1 
ATOM   3915 N NZ  . LYS A 1 594 ? 53.551  14.229  72.113  1.00 53.06 ? 616 LYS A NZ  1 
ATOM   3916 N N   . ARG A 1 595 ? 58.483  15.830  67.069  1.00 62.92 ? 617 ARG A N   1 
ATOM   3917 C CA  . ARG A 1 595 ? 59.431  15.973  65.965  1.00 62.05 ? 617 ARG A CA  1 
ATOM   3918 C C   . ARG A 1 595 ? 60.817  15.460  66.342  1.00 59.58 ? 617 ARG A C   1 
ATOM   3919 O O   . ARG A 1 595 ? 61.470  14.777  65.543  1.00 51.18 ? 617 ARG A O   1 
ATOM   3920 C CB  . ARG A 1 595 ? 59.501  17.439  65.527  1.00 63.92 ? 617 ARG A CB  1 
ATOM   3921 C CG  . ARG A 1 595 ? 60.218  17.686  64.205  1.00 57.29 ? 617 ARG A CG  1 
ATOM   3922 C CD  . ARG A 1 595 ? 61.649  18.156  64.422  1.00 60.90 ? 617 ARG A CD  1 
ATOM   3923 N NE  . ARG A 1 595 ? 62.354  18.359  63.159  1.00 73.23 ? 617 ARG A NE  1 
ATOM   3924 C CZ  . ARG A 1 595 ? 63.671  18.245  63.008  1.00 68.76 ? 617 ARG A CZ  1 
ATOM   3925 N NH1 . ARG A 1 595 ? 64.436  17.926  64.045  1.00 56.43 ? 617 ARG A NH1 1 
ATOM   3926 N NH2 . ARG A 1 595 ? 64.224  18.450  61.819  1.00 58.28 ? 617 ARG A NH2 1 
ATOM   3927 N N   . ALA A 1 596 ? 61.289  15.787  67.548  1.00 63.36 ? 618 ALA A N   1 
ATOM   3928 C CA  . ALA A 1 596 ? 62.597  15.305  67.975  1.00 55.55 ? 618 ALA A CA  1 
ATOM   3929 C C   . ALA A 1 596 ? 62.617  13.787  68.101  1.00 52.88 ? 618 ALA A C   1 
ATOM   3930 O O   . ALA A 1 596 ? 63.643  13.154  67.827  1.00 44.59 ? 618 ALA A O   1 
ATOM   3931 C CB  . ALA A 1 596 ? 62.993  15.959  69.299  1.00 55.80 ? 618 ALA A CB  1 
ATOM   3932 N N   . LYS A 1 597 ? 61.493  13.189  68.505  1.00 62.41 ? 619 LYS A N   1 
ATOM   3933 C CA  . LYS A 1 597 ? 61.400  11.737  68.611  1.00 54.10 ? 619 LYS A CA  1 
ATOM   3934 C C   . LYS A 1 597 ? 61.196  11.075  67.252  1.00 57.49 ? 619 LYS A C   1 
ATOM   3935 O O   . LYS A 1 597 ? 61.651  9.945   67.044  1.00 54.47 ? 619 LYS A O   1 
ATOM   3936 C CB  . LYS A 1 597 ? 60.262  11.360  69.563  1.00 49.64 ? 619 LYS A CB  1 
ATOM   3937 C CG  . LYS A 1 597 ? 60.186  9.882   69.922  1.00 46.01 ? 619 LYS A CG  1 
ATOM   3938 C CD  . LYS A 1 597 ? 58.805  9.533   70.465  1.00 46.54 ? 619 LYS A CD  1 
ATOM   3939 C CE  . LYS A 1 597 ? 58.774  8.157   71.112  1.00 47.48 ? 619 LYS A CE  1 
ATOM   3940 N NZ  . LYS A 1 597 ? 57.402  7.799   71.573  1.00 41.62 ? 619 LYS A NZ  1 
ATOM   3941 N N   . PHE A 1 598 ? 60.523  11.758  66.321  1.00 56.55 ? 620 PHE A N   1 
ATOM   3942 C CA  . PHE A 1 598 ? 60.300  11.188  64.995  1.00 52.92 ? 620 PHE A CA  1 
ATOM   3943 C C   . PHE A 1 598 ? 61.613  11.028  64.238  1.00 53.45 ? 620 PHE A C   1 
ATOM   3944 O O   . PHE A 1 598 ? 61.932  9.936   63.753  1.00 50.29 ? 620 PHE A O   1 
ATOM   3945 C CB  . PHE A 1 598 ? 59.324  12.065  64.206  1.00 44.38 ? 620 PHE A CB  1 
ATOM   3946 C CG  . PHE A 1 598 ? 58.920  11.488  62.876  1.00 43.06 ? 620 PHE A CG  1 
ATOM   3947 C CD1 . PHE A 1 598 ? 58.480  10.178  62.776  1.00 52.07 ? 620 PHE A CD1 1 
ATOM   3948 C CD2 . PHE A 1 598 ? 58.968  12.260  61.726  1.00 42.72 ? 620 PHE A CD2 1 
ATOM   3949 C CE1 . PHE A 1 598 ? 58.100  9.648   61.553  1.00 46.69 ? 620 PHE A CE1 1 
ATOM   3950 C CE2 . PHE A 1 598 ? 58.593  11.736  60.503  1.00 42.04 ? 620 PHE A CE2 1 
ATOM   3951 C CZ  . PHE A 1 598 ? 58.158  10.428  60.417  1.00 43.24 ? 620 PHE A CZ  1 
ATOM   3952 N N   . VAL A 1 599 ? 62.391  12.108  64.131  1.00 53.88 ? 621 VAL A N   1 
ATOM   3953 C CA  . VAL A 1 599 ? 63.643  12.051  63.381  1.00 50.31 ? 621 VAL A CA  1 
ATOM   3954 C C   . VAL A 1 599 ? 64.701  11.285  64.161  1.00 52.57 ? 621 VAL A C   1 
ATOM   3955 O O   . VAL A 1 599 ? 65.488  10.524  63.584  1.00 51.24 ? 621 VAL A O   1 
ATOM   3956 C CB  . VAL A 1 599 ? 64.119  13.472  63.029  1.00 50.10 ? 621 VAL A CB  1 
ATOM   3957 C CG1 . VAL A 1 599 ? 65.358  13.418  62.157  1.00 48.68 ? 621 VAL A CG1 1 
ATOM   3958 C CG2 . VAL A 1 599 ? 63.024  14.235  62.323  1.00 52.96 ? 621 VAL A CG2 1 
ATOM   3959 N N   . GLY A 1 600 ? 64.740  11.467  65.478  1.00 54.07 ? 622 GLY A N   1 
ATOM   3960 C CA  . GLY A 1 600 ? 65.730  10.823  66.307  1.00 52.66 ? 622 GLY A CA  1 
ATOM   3961 C C   . GLY A 1 600 ? 67.077  11.510  66.213  1.00 53.02 ? 622 GLY A C   1 
ATOM   3962 O O   . GLY A 1 600 ? 67.263  12.454  65.438  1.00 56.82 ? 622 GLY A O   1 
ATOM   3963 N N   . PRO A 1 601 ? 68.052  11.042  67.003  1.00 52.62 ? 623 PRO A N   1 
ATOM   3964 C CA  . PRO A 1 601 ? 69.380  11.676  66.994  1.00 49.81 ? 623 PRO A CA  1 
ATOM   3965 C C   . PRO A 1 601 ? 70.092  11.533  65.656  1.00 50.31 ? 623 PRO A C   1 
ATOM   3966 O O   . PRO A 1 601 ? 70.458  10.427  65.246  1.00 49.47 ? 623 PRO A O   1 
ATOM   3967 C CB  . PRO A 1 601 ? 70.128  10.940  68.113  1.00 55.09 ? 623 PRO A CB  1 
ATOM   3968 C CG  . PRO A 1 601 ? 69.408  9.637   68.264  1.00 53.84 ? 623 PRO A CG  1 
ATOM   3969 C CD  . PRO A 1 601 ? 67.973  9.921   67.956  1.00 44.65 ? 623 PRO A CD  1 
ATOM   3970 N N   . GLY A 1 602 ? 70.288  12.656  64.966  1.00 46.82 ? 624 GLY A N   1 
ATOM   3971 C CA  . GLY A 1 602 ? 70.940  12.646  63.674  1.00 38.63 ? 624 GLY A CA  1 
ATOM   3972 C C   . GLY A 1 602 ? 70.142  12.023  62.556  1.00 45.86 ? 624 GLY A C   1 
ATOM   3973 O O   . GLY A 1 602 ? 70.689  11.815  61.469  1.00 45.14 ? 624 GLY A O   1 
ATOM   3974 N N   . GLY A 1 603 ? 68.867  11.719  62.783  1.00 55.68 ? 625 GLY A N   1 
ATOM   3975 C CA  . GLY A 1 603 ? 68.041  11.104  61.764  1.00 52.74 ? 625 GLY A CA  1 
ATOM   3976 C C   . GLY A 1 603 ? 68.005  9.596   61.791  1.00 43.65 ? 625 GLY A C   1 
ATOM   3977 O O   . GLY A 1 603 ? 67.599  8.985   60.796  1.00 41.92 ? 625 GLY A O   1 
ATOM   3978 N N   . TYR A 1 604 ? 68.407  8.974   62.903  1.00 43.47 ? 626 TYR A N   1 
ATOM   3979 C CA  . TYR A 1 604 ? 68.500  7.518   62.954  1.00 45.65 ? 626 TYR A CA  1 
ATOM   3980 C C   . TYR A 1 604 ? 67.135  6.867   62.769  1.00 46.64 ? 626 TYR A C   1 
ATOM   3981 O O   . TYR A 1 604 ? 66.991  5.911   61.999  1.00 45.77 ? 626 TYR A O   1 
ATOM   3982 C CB  . TYR A 1 604 ? 69.134  7.082   64.277  1.00 44.70 ? 626 TYR A CB  1 
ATOM   3983 C CG  . TYR A 1 604 ? 68.950  5.613   64.588  1.00 46.60 ? 626 TYR A CG  1 
ATOM   3984 C CD1 . TYR A 1 604 ? 69.824  4.663   64.075  1.00 45.80 ? 626 TYR A CD1 1 
ATOM   3985 C CD2 . TYR A 1 604 ? 67.907  5.174   65.397  1.00 48.06 ? 626 TYR A CD2 1 
ATOM   3986 C CE1 . TYR A 1 604 ? 69.663  3.317   64.356  1.00 44.97 ? 626 TYR A CE1 1 
ATOM   3987 C CE2 . TYR A 1 604 ? 67.737  3.830   65.679  1.00 50.40 ? 626 TYR A CE2 1 
ATOM   3988 C CZ  . TYR A 1 604 ? 68.619  2.907   65.156  1.00 44.89 ? 626 TYR A CZ  1 
ATOM   3989 O OH  . TYR A 1 604 ? 68.457  1.570   65.437  1.00 50.71 ? 626 TYR A OH  1 
ATOM   3990 N N   . ASN A 1 605 ? 66.117  7.372   63.472  1.00 48.84 ? 627 ASN A N   1 
ATOM   3991 C CA  . ASN A 1 605 ? 64.788  6.773   63.388  1.00 43.52 ? 627 ASN A CA  1 
ATOM   3992 C C   . ASN A 1 605 ? 64.183  6.926   61.999  1.00 40.10 ? 627 ASN A C   1 
ATOM   3993 O O   . ASN A 1 605 ? 63.452  6.040   61.544  1.00 37.66 ? 627 ASN A O   1 
ATOM   3994 C CB  . ASN A 1 605 ? 63.870  7.389   64.443  1.00 46.69 ? 627 ASN A CB  1 
ATOM   3995 C CG  . ASN A 1 605 ? 64.028  6.735   65.802  1.00 55.17 ? 627 ASN A CG  1 
ATOM   3996 O OD1 . ASN A 1 605 ? 64.814  7.188   66.638  1.00 50.93 ? 627 ASN A OD1 1 
ATOM   3997 N ND2 . ASN A 1 605 ? 63.285  5.656   66.027  1.00 52.70 ? 627 ASN A ND2 1 
ATOM   3998 N N   . LEU A 1 606 ? 64.473  8.031   61.310  1.00 41.31 ? 628 LEU A N   1 
ATOM   3999 C CA  . LEU A 1 606 ? 63.970  8.194   59.951  1.00 43.71 ? 628 LEU A CA  1 
ATOM   4000 C C   . LEU A 1 606 ? 64.603  7.185   59.006  1.00 47.09 ? 628 LEU A C   1 
ATOM   4001 O O   . LEU A 1 606 ? 63.917  6.610   58.152  1.00 48.02 ? 628 LEU A O   1 
ATOM   4002 C CB  . LEU A 1 606 ? 64.223  9.617   59.461  1.00 42.90 ? 628 LEU A CB  1 
ATOM   4003 C CG  . LEU A 1 606 ? 63.168  10.641  59.867  1.00 45.00 ? 628 LEU A CG  1 
ATOM   4004 C CD1 . LEU A 1 606 ? 63.470  11.986  59.233  1.00 35.01 ? 628 LEU A CD1 1 
ATOM   4005 C CD2 . LEU A 1 606 ? 61.784  10.148  59.474  1.00 50.10 ? 628 LEU A CD2 1 
ATOM   4006 N N   . LYS A 1 607 ? 65.910  6.954   59.145  1.00 49.87 ? 629 LYS A N   1 
ATOM   4007 C CA  . LYS A 1 607 ? 66.598  5.982   58.304  1.00 53.22 ? 629 LYS A CA  1 
ATOM   4008 C C   . LYS A 1 607 ? 66.304  4.545   58.713  1.00 44.43 ? 629 LYS A C   1 
ATOM   4009 O O   . LYS A 1 607 ? 66.400  3.642   57.875  1.00 41.19 ? 629 LYS A O   1 
ATOM   4010 C CB  . LYS A 1 607 ? 68.104  6.248   58.326  1.00 41.98 ? 629 LYS A CB  1 
ATOM   4011 C CG  . LYS A 1 607 ? 68.486  7.543   57.620  1.00 46.48 ? 629 LYS A CG  1 
ATOM   4012 C CD  . LYS A 1 607 ? 69.966  7.848   57.743  1.00 50.76 ? 629 LYS A CD  1 
ATOM   4013 C CE  . LYS A 1 607 ? 70.317  9.140   57.021  1.00 50.30 ? 629 LYS A CE  1 
ATOM   4014 N NZ  . LYS A 1 607 ? 70.944  8.886   55.691  1.00 57.19 ? 629 LYS A NZ  1 
ATOM   4015 N N   . LYS A 1 608 ? 65.939  4.313   59.975  1.00 44.19 ? 630 LYS A N   1 
ATOM   4016 C CA  . LYS A 1 608 ? 65.489  2.984   60.372  1.00 47.31 ? 630 LYS A CA  1 
ATOM   4017 C C   . LYS A 1 608 ? 64.139  2.651   59.747  1.00 48.97 ? 630 LYS A C   1 
ATOM   4018 O O   . LYS A 1 608 ? 63.890  1.493   59.392  1.00 44.25 ? 630 LYS A O   1 
ATOM   4019 C CB  . LYS A 1 608 ? 65.439  2.888   61.900  1.00 39.56 ? 630 LYS A CB  1 
ATOM   4020 C CG  . LYS A 1 608 ? 64.052  2.775   62.508  1.00 41.69 ? 630 LYS A CG  1 
ATOM   4021 C CD  . LYS A 1 608 ? 64.138  2.319   63.951  1.00 45.01 ? 630 LYS A CD  1 
ATOM   4022 C CE  . LYS A 1 608 ? 64.699  0.910   64.032  1.00 51.84 ? 630 LYS A CE  1 
ATOM   4023 N NZ  . LYS A 1 608 ? 64.749  0.409   65.430  1.00 58.55 ? 630 LYS A NZ  1 
ATOM   4024 N N   . LEU A 1 609 ? 63.269  3.653   59.585  1.00 46.98 ? 631 LEU A N   1 
ATOM   4025 C CA  . LEU A 1 609 ? 62.004  3.438   58.891  1.00 46.73 ? 631 LEU A CA  1 
ATOM   4026 C C   . LEU A 1 609 ? 62.221  3.205   57.402  1.00 47.00 ? 631 LEU A C   1 
ATOM   4027 O O   . LEU A 1 609 ? 61.480  2.437   56.778  1.00 42.74 ? 631 LEU A O   1 
ATOM   4028 C CB  . LEU A 1 609 ? 61.077  4.633   59.121  1.00 44.99 ? 631 LEU A CB  1 
ATOM   4029 C CG  . LEU A 1 609 ? 59.712  4.649   58.425  1.00 39.27 ? 631 LEU A CG  1 
ATOM   4030 C CD1 . LEU A 1 609 ? 58.975  3.336   58.633  1.00 46.21 ? 631 LEU A CD1 1 
ATOM   4031 C CD2 . LEU A 1 609 ? 58.881  5.807   58.940  1.00 36.14 ? 631 LEU A CD2 1 
ATOM   4032 N N   . GLN A 1 610 ? 63.232  3.852   56.821  1.00 47.38 ? 632 GLN A N   1 
ATOM   4033 C CA  . GLN A 1 610 ? 63.526  3.648   55.408  1.00 47.79 ? 632 GLN A CA  1 
ATOM   4034 C C   . GLN A 1 610 ? 63.986  2.224   55.128  1.00 46.93 ? 632 GLN A C   1 
ATOM   4035 O O   . GLN A 1 610 ? 63.746  1.701   54.034  1.00 50.03 ? 632 GLN A O   1 
ATOM   4036 C CB  . GLN A 1 610 ? 64.586  4.647   54.948  1.00 55.20 ? 632 GLN A CB  1 
ATOM   4037 C CG  . GLN A 1 610 ? 64.138  6.096   55.014  1.00 50.03 ? 632 GLN A CG  1 
ATOM   4038 C CD  . GLN A 1 610 ? 65.225  7.054   54.575  1.00 62.65 ? 632 GLN A CD  1 
ATOM   4039 O OE1 . GLN A 1 610 ? 66.324  6.637   54.205  1.00 76.45 ? 632 GLN A OE1 1 
ATOM   4040 N NE2 . GLN A 1 610 ? 64.923  8.348   54.611  1.00 63.61 ? 632 GLN A NE2 1 
ATOM   4041 N N   . ALA A 1 611 ? 64.641  1.583   56.096  1.00 47.53 ? 633 ALA A N   1 
ATOM   4042 C CA  . ALA A 1 611 ? 65.112  0.219   55.886  1.00 50.29 ? 633 ALA A CA  1 
ATOM   4043 C C   . ALA A 1 611 ? 64.004  -0.800  56.124  1.00 54.78 ? 633 ALA A C   1 
ATOM   4044 O O   . ALA A 1 611 ? 63.937  -1.819  55.427  1.00 52.89 ? 633 ALA A O   1 
ATOM   4045 C CB  . ALA A 1 611 ? 66.309  -0.068  56.791  1.00 46.02 ? 633 ALA A CB  1 
ATOM   4046 N N   . GLU A 1 612 ? 63.126  -0.540  57.097  1.00 54.41 ? 634 GLU A N   1 
ATOM   4047 C CA  . GLU A 1 612 ? 62.057  -1.485  57.408  1.00 51.95 ? 634 GLU A CA  1 
ATOM   4048 C C   . GLU A 1 612 ? 61.032  -1.548  56.282  1.00 52.98 ? 634 GLU A C   1 
ATOM   4049 O O   . GLU A 1 612 ? 60.712  -2.631  55.778  1.00 59.81 ? 634 GLU A O   1 
ATOM   4050 C CB  . GLU A 1 612 ? 61.374  -1.099  58.723  1.00 50.18 ? 634 GLU A CB  1 
ATOM   4051 C CG  . GLU A 1 612 ? 62.184  -1.383  59.982  1.00 55.15 ? 634 GLU A CG  1 
ATOM   4052 C CD  . GLU A 1 612 ? 61.536  -0.801  61.232  1.00 59.92 ? 634 GLU A CD  1 
ATOM   4053 O OE1 . GLU A 1 612 ? 62.005  -1.107  62.351  1.00 53.53 ? 634 GLU A OE1 1 
ATOM   4054 O OE2 . GLU A 1 612 ? 60.554  -0.038  61.094  1.00 51.49 ? 634 GLU A OE2 1 
ATOM   4055 N N   . THR A 1 613 ? 60.505  -0.395  55.875  1.00 45.42 ? 635 THR A N   1 
ATOM   4056 C CA  . THR A 1 613 ? 59.393  -0.324  54.938  1.00 38.93 ? 635 THR A CA  1 
ATOM   4057 C C   . THR A 1 613 ? 59.830  -0.085  53.500  1.00 44.93 ? 635 THR A C   1 
ATOM   4058 O O   . THR A 1 613 ? 58.979  -0.075  52.604  1.00 40.32 ? 635 THR A O   1 
ATOM   4059 C CB  . THR A 1 613 ? 58.426  0.783   55.363  1.00 41.56 ? 635 THR A CB  1 
ATOM   4060 O OG1 . THR A 1 613 ? 59.150  2.010   55.520  1.00 46.85 ? 635 THR A OG1 1 
ATOM   4061 C CG2 . THR A 1 613 ? 57.760  0.436   56.683  1.00 41.91 ? 635 THR A CG2 1 
ATOM   4062 N N   . GLY A 1 614 ? 61.126  0.103   53.255  1.00 50.14 ? 636 GLY A N   1 
ATOM   4063 C CA  . GLY A 1 614 ? 61.576  0.476   51.924  1.00 50.30 ? 636 GLY A CA  1 
ATOM   4064 C C   . GLY A 1 614 ? 61.091  1.842   51.497  1.00 42.86 ? 636 GLY A C   1 
ATOM   4065 O O   . GLY A 1 614 ? 60.913  2.092   50.302  1.00 45.87 ? 636 GLY A O   1 
ATOM   4066 N N   . VAL A 1 615 ? 60.876  2.735   52.453  1.00 48.89 ? 637 VAL A N   1 
ATOM   4067 C CA  . VAL A 1 615 ? 60.276  4.023   52.200  1.00 40.85 ? 637 VAL A CA  1 
ATOM   4068 C C   . VAL A 1 615 ? 61.378  5.075   52.153  1.00 43.13 ? 637 VAL A C   1 
ATOM   4069 O O   . VAL A 1 615 ? 62.513  4.835   52.557  1.00 49.18 ? 637 VAL A O   1 
ATOM   4070 C CB  . VAL A 1 615 ? 59.209  4.358   53.273  1.00 42.51 ? 637 VAL A CB  1 
ATOM   4071 C CG1 . VAL A 1 615 ? 59.859  4.977   54.510  1.00 41.88 ? 637 VAL A CG1 1 
ATOM   4072 C CG2 . VAL A 1 615 ? 58.124  5.241   52.710  1.00 39.55 ? 637 VAL A CG2 1 
ATOM   4073 N N   . THR A 1 616 ? 61.047  6.260   51.643  1.00 44.96 ? 638 THR A N   1 
ATOM   4074 C CA  . THR A 1 616 ? 61.982  7.381   51.592  1.00 41.07 ? 638 THR A CA  1 
ATOM   4075 C C   . THR A 1 616 ? 61.292  8.614   52.154  1.00 41.64 ? 638 THR A C   1 
ATOM   4076 O O   . THR A 1 616 ? 60.248  9.031   51.641  1.00 44.01 ? 638 THR A O   1 
ATOM   4077 C CB  . THR A 1 616 ? 62.471  7.644   50.163  1.00 43.71 ? 638 THR A CB  1 
ATOM   4078 O OG1 . THR A 1 616 ? 62.805  6.402   49.529  1.00 52.49 ? 638 THR A OG1 1 
ATOM   4079 C CG2 . THR A 1 616 ? 63.698  8.534   50.179  1.00 40.10 ? 638 THR A CG2 1 
ATOM   4080 N N   . ILE A 1 617 ? 61.875  9.198   53.200  1.00 38.08 ? 639 ILE A N   1 
ATOM   4081 C CA  . ILE A 1 617 ? 61.276  10.314  53.922  1.00 35.41 ? 639 ILE A CA  1 
ATOM   4082 C C   . ILE A 1 617 ? 62.218  11.506  53.857  1.00 44.81 ? 639 ILE A C   1 
ATOM   4083 O O   . ILE A 1 617 ? 63.403  11.385  54.189  1.00 50.96 ? 639 ILE A O   1 
ATOM   4084 C CB  . ILE A 1 617 ? 60.975  9.949   55.388  1.00 40.38 ? 639 ILE A CB  1 
ATOM   4085 C CG1 . ILE A 1 617 ? 59.879  8.888   55.473  1.00 40.81 ? 639 ILE A CG1 1 
ATOM   4086 C CG2 . ILE A 1 617 ? 60.566  11.188  56.172  1.00 45.19 ? 639 ILE A CG2 1 
ATOM   4087 C CD1 . ILE A 1 617 ? 59.311  8.725   56.863  1.00 35.02 ? 639 ILE A CD1 1 
ATOM   4088 N N   . SER A 1 618 ? 61.684  12.659  53.448  1.00 45.92 ? 640 SER A N   1 
ATOM   4089 C CA  . SER A 1 618 ? 62.407  13.922  53.460  1.00 40.54 ? 640 SER A CA  1 
ATOM   4090 C C   . SER A 1 618 ? 61.533  14.999  54.089  1.00 49.53 ? 640 SER A C   1 
ATOM   4091 O O   . SER A 1 618 ? 60.302  14.918  54.052  1.00 52.16 ? 640 SER A O   1 
ATOM   4092 C CB  . SER A 1 618 ? 62.817  14.348  52.050  1.00 44.69 ? 640 SER A CB  1 
ATOM   4093 O OG  . SER A 1 618 ? 61.692  14.387  51.194  1.00 50.75 ? 640 SER A OG  1 
ATOM   4094 N N   . GLN A 1 619 ? 62.178  16.009  54.665  1.00 55.49 ? 641 GLN A N   1 
ATOM   4095 C CA  . GLN A 1 619 ? 61.464  17.110  55.295  1.00 50.46 ? 641 GLN A CA  1 
ATOM   4096 C C   . GLN A 1 619 ? 61.132  18.195  54.271  1.00 51.32 ? 641 GLN A C   1 
ATOM   4097 O O   . GLN A 1 619 ? 61.752  18.298  53.211  1.00 55.16 ? 641 GLN A O   1 
ATOM   4098 C CB  . GLN A 1 619 ? 62.281  17.699  56.449  1.00 50.85 ? 641 GLN A CB  1 
ATOM   4099 C CG  . GLN A 1 619 ? 61.442  18.472  57.463  1.00 54.75 ? 641 GLN A CG  1 
ATOM   4100 C CD  . GLN A 1 619 ? 62.258  19.030  58.612  1.00 61.38 ? 641 GLN A CD  1 
ATOM   4101 O OE1 . GLN A 1 619 ? 63.379  18.588  58.868  1.00 64.17 ? 641 GLN A OE1 1 
ATOM   4102 N NE2 . GLN A 1 619 ? 61.696  20.010  59.315  1.00 62.90 ? 641 GLN A NE2 1 
ATOM   4103 N N   . VAL A 1 620 ? 60.131  19.004  54.603  1.00 59.19 ? 642 VAL A N   1 
ATOM   4104 C CA  . VAL A 1 620 ? 59.678  20.077  53.728  1.00 55.34 ? 642 VAL A CA  1 
ATOM   4105 C C   . VAL A 1 620 ? 59.931  21.439  54.370  1.00 62.83 ? 642 VAL A C   1 
ATOM   4106 O O   . VAL A 1 620 ? 60.747  21.568  55.285  1.00 64.14 ? 642 VAL A O   1 
ATOM   4107 C CB  . VAL A 1 620 ? 58.191  19.912  53.380  1.00 54.55 ? 642 VAL A CB  1 
ATOM   4108 C CG1 . VAL A 1 620 ? 57.646  21.188  52.760  1.00 59.62 ? 642 VAL A CG1 1 
ATOM   4109 C CG2 . VAL A 1 620 ? 57.995  18.724  52.451  1.00 47.30 ? 642 VAL A CG2 1 
ATOM   4110 N N   . GLU A 1 623 ? 57.737  21.587  60.090  1.00 48.11 ? 645 GLU A N   1 
ATOM   4111 C CA  . GLU A 1 623 ? 57.069  20.414  60.646  1.00 57.41 ? 645 GLU A CA  1 
ATOM   4112 C C   . GLU A 1 623 ? 56.192  19.719  59.601  1.00 61.59 ? 645 GLU A C   1 
ATOM   4113 O O   . GLU A 1 623 ? 55.015  19.440  59.843  1.00 54.60 ? 645 GLU A O   1 
ATOM   4114 C CB  . GLU A 1 623 ? 56.229  20.800  61.868  1.00 55.95 ? 645 GLU A CB  1 
ATOM   4115 C CG  . GLU A 1 623 ? 55.480  22.114  61.737  1.00 64.33 ? 645 GLU A CG  1 
ATOM   4116 C CD  . GLU A 1 623 ? 54.884  22.576  63.056  1.00 77.50 ? 645 GLU A CD  1 
ATOM   4117 O OE1 . GLU A 1 623 ? 55.278  22.034  64.112  1.00 73.28 ? 645 GLU A OE1 1 
ATOM   4118 O OE2 . GLU A 1 623 ? 54.020  23.479  63.036  1.00 82.20 ? 645 GLU A OE2 1 
ATOM   4119 N N   . THR A 1 624 ? 56.783  19.443  58.439  1.00 65.02 ? 646 THR A N   1 
ATOM   4120 C CA  . THR A 1 624 ? 56.107  18.752  57.347  1.00 54.34 ? 646 THR A CA  1 
ATOM   4121 C C   . THR A 1 624 ? 57.098  17.823  56.664  1.00 54.53 ? 646 THR A C   1 
ATOM   4122 O O   . THR A 1 624 ? 58.198  18.252  56.304  1.00 59.95 ? 646 THR A O   1 
ATOM   4123 C CB  . THR A 1 624 ? 55.536  19.738  56.325  1.00 51.75 ? 646 THR A CB  1 
ATOM   4124 O OG1 . THR A 1 624 ? 55.046  20.904  57.001  1.00 63.12 ? 646 THR A OG1 1 
ATOM   4125 C CG2 . THR A 1 624 ? 54.407  19.090  55.543  1.00 44.66 ? 646 THR A CG2 1 
ATOM   4126 N N   . PHE A 1 625 ? 56.709  16.562  56.481  1.00 48.02 ? 647 PHE A N   1 
ATOM   4127 C CA  . PHE A 1 625 ? 57.574  15.554  55.882  1.00 43.44 ? 647 PHE A CA  1 
ATOM   4128 C C   . PHE A 1 625 ? 56.867  14.883  54.715  1.00 43.96 ? 647 PHE A C   1 
ATOM   4129 O O   . PHE A 1 625 ? 55.695  14.508  54.820  1.00 47.54 ? 647 PHE A O   1 
ATOM   4130 C CB  . PHE A 1 625 ? 57.990  14.494  56.907  1.00 45.66 ? 647 PHE A CB  1 
ATOM   4131 C CG  . PHE A 1 625 ? 58.971  14.990  57.929  1.00 47.50 ? 647 PHE A CG  1 
ATOM   4132 C CD1 . PHE A 1 625 ? 58.541  15.714  59.026  1.00 44.87 ? 647 PHE A CD1 1 
ATOM   4133 C CD2 . PHE A 1 625 ? 60.323  14.726  57.795  1.00 54.77 ? 647 PHE A CD2 1 
ATOM   4134 C CE1 . PHE A 1 625 ? 59.441  16.170  59.964  1.00 45.62 ? 647 PHE A CE1 1 
ATOM   4135 C CE2 . PHE A 1 625 ? 61.228  15.179  58.737  1.00 51.38 ? 647 PHE A CE2 1 
ATOM   4136 C CZ  . PHE A 1 625 ? 60.784  15.901  59.823  1.00 51.07 ? 647 PHE A CZ  1 
ATOM   4137 N N   . SER A 1 626 ? 57.586  14.730  53.607  1.00 43.63 ? 648 SER A N   1 
ATOM   4138 C CA  . SER A 1 626 ? 57.079  14.045  52.428  1.00 42.38 ? 648 SER A CA  1 
ATOM   4139 C C   . SER A 1 626 ? 57.552  12.599  52.436  1.00 39.58 ? 648 SER A C   1 
ATOM   4140 O O   . SER A 1 626 ? 58.716  12.317  52.738  1.00 41.36 ? 648 SER A O   1 
ATOM   4141 C CB  . SER A 1 626 ? 57.542  14.738  51.146  1.00 35.34 ? 648 SER A CB  1 
ATOM   4142 O OG  . SER A 1 626 ? 56.831  14.238  50.028  1.00 41.53 ? 648 SER A OG  1 
ATOM   4143 N N   . VAL A 1 627 ? 56.648  11.684  52.100  1.00 32.36 ? 649 VAL A N   1 
ATOM   4144 C CA  . VAL A 1 627 ? 56.910  10.252  52.193  1.00 37.75 ? 649 VAL A CA  1 
ATOM   4145 C C   . VAL A 1 627 ? 56.658  9.627   50.828  1.00 36.37 ? 649 VAL A C   1 
ATOM   4146 O O   . VAL A 1 627 ? 55.544  9.713   50.295  1.00 32.11 ? 649 VAL A O   1 
ATOM   4147 C CB  . VAL A 1 627 ? 56.043  9.586   53.273  1.00 41.96 ? 649 VAL A CB  1 
ATOM   4148 C CG1 . VAL A 1 627 ? 56.146  8.079   53.190  1.00 31.27 ? 649 VAL A CG1 1 
ATOM   4149 C CG2 . VAL A 1 627 ? 56.454  10.074  54.661  1.00 36.70 ? 649 VAL A CG2 1 
ATOM   4150 N N   . PHE A 1 628 ? 57.692  9.006   50.263  1.00 39.40 ? 650 PHE A N   1 
ATOM   4151 C CA  . PHE A 1 628 ? 57.606  8.298   48.992  1.00 43.50 ? 650 PHE A CA  1 
ATOM   4152 C C   . PHE A 1 628 ? 57.686  6.800   49.250  1.00 40.28 ? 650 PHE A C   1 
ATOM   4153 O O   . PHE A 1 628 ? 58.623  6.332   49.906  1.00 41.68 ? 650 PHE A O   1 
ATOM   4154 C CB  . PHE A 1 628 ? 58.730  8.727   48.039  1.00 45.76 ? 650 PHE A CB  1 
ATOM   4155 C CG  . PHE A 1 628 ? 58.926  7.795   46.868  1.00 42.50 ? 650 PHE A CG  1 
ATOM   4156 C CD1 . PHE A 1 628 ? 58.130  7.905   45.740  1.00 42.16 ? 650 PHE A CD1 1 
ATOM   4157 C CD2 . PHE A 1 628 ? 59.901  6.807   46.898  1.00 44.88 ? 650 PHE A CD2 1 
ATOM   4158 C CE1 . PHE A 1 628 ? 58.299  7.050   44.663  1.00 41.19 ? 650 PHE A CE1 1 
ATOM   4159 C CE2 . PHE A 1 628 ? 60.072  5.947   45.824  1.00 45.90 ? 650 PHE A CE2 1 
ATOM   4160 C CZ  . PHE A 1 628 ? 59.270  6.071   44.706  1.00 43.49 ? 650 PHE A CZ  1 
ATOM   4161 N N   . ALA A 1 629 ? 56.718  6.052   48.721  1.00 31.89 ? 651 ALA A N   1 
ATOM   4162 C CA  . ALA A 1 629 ? 56.719  4.613   48.900  1.00 39.02 ? 651 ALA A CA  1 
ATOM   4163 C C   . ALA A 1 629 ? 56.654  3.896   47.555  1.00 42.63 ? 651 ALA A C   1 
ATOM   4164 O O   . ALA A 1 629 ? 55.900  4.310   46.668  1.00 37.46 ? 651 ALA A O   1 
ATOM   4165 C CB  . ALA A 1 629 ? 55.538  4.171   49.772  1.00 44.17 ? 651 ALA A CB  1 
ATOM   4166 N N   . PRO A 1 630 ? 57.428  2.820   47.374  1.00 43.20 ? 652 PRO A N   1 
ATOM   4167 C CA  . PRO A 1 630 ? 57.384  2.073   46.105  1.00 36.28 ? 652 PRO A CA  1 
ATOM   4168 C C   . PRO A 1 630 ? 56.101  1.292   45.900  1.00 46.74 ? 652 PRO A C   1 
ATOM   4169 O O   . PRO A 1 630 ? 55.874  0.792   44.789  1.00 44.83 ? 652 PRO A O   1 
ATOM   4170 C CB  . PRO A 1 630 ? 58.584  1.119   46.211  1.00 32.42 ? 652 PRO A CB  1 
ATOM   4171 C CG  . PRO A 1 630 ? 59.390  1.599   47.386  1.00 31.03 ? 652 PRO A CG  1 
ATOM   4172 C CD  . PRO A 1 630 ? 58.428  2.272   48.303  1.00 40.29 ? 652 PRO A CD  1 
ATOM   4173 N N   . THR A 1 631 ? 55.264  1.169   46.930  1.00 51.98 ? 653 THR A N   1 
ATOM   4174 C CA  . THR A 1 631 ? 54.066  0.353   46.915  1.00 45.28 ? 653 THR A CA  1 
ATOM   4175 C C   . THR A 1 631 ? 53.065  1.020   47.844  1.00 41.14 ? 653 THR A C   1 
ATOM   4176 O O   . THR A 1 631 ? 53.474  1.583   48.870  1.00 47.05 ? 653 THR A O   1 
ATOM   4177 C CB  . THR A 1 631 ? 54.355  -1.079  47.387  1.00 44.52 ? 653 THR A CB  1 
ATOM   4178 O OG1 . THR A 1 631 ? 55.375  -1.659  46.565  1.00 50.14 ? 653 THR A OG1 1 
ATOM   4179 C CG2 . THR A 1 631 ? 53.109  -1.945  47.325  1.00 44.30 ? 653 THR A CG2 1 
ATOM   4180 N N   . PRO A 1 632 ? 51.772  1.006   47.513  1.00 41.27 ? 654 PRO A N   1 
ATOM   4181 C CA  . PRO A 1 632 ? 50.771  1.440   48.501  1.00 41.71 ? 654 PRO A CA  1 
ATOM   4182 C C   . PRO A 1 632 ? 50.855  0.666   49.803  1.00 40.73 ? 654 PRO A C   1 
ATOM   4183 O O   . PRO A 1 632 ? 50.500  1.202   50.860  1.00 43.32 ? 654 PRO A O   1 
ATOM   4184 C CB  . PRO A 1 632 ? 49.439  1.195   47.782  1.00 44.54 ? 654 PRO A CB  1 
ATOM   4185 C CG  . PRO A 1 632 ? 49.776  1.261   46.333  1.00 51.73 ? 654 PRO A CG  1 
ATOM   4186 C CD  . PRO A 1 632 ? 51.170  0.719   46.199  1.00 53.56 ? 654 PRO A CD  1 
ATOM   4187 N N   . SER A 1 633 ? 51.315  -0.587  49.753  1.00 37.11 ? 655 SER A N   1 
ATOM   4188 C CA  . SER A 1 633 ? 51.526  -1.355  50.974  1.00 38.51 ? 655 SER A CA  1 
ATOM   4189 C C   . SER A 1 633 ? 52.670  -0.773  51.795  1.00 38.10 ? 655 SER A C   1 
ATOM   4190 O O   . SER A 1 633 ? 52.547  -0.601  53.014  1.00 42.58 ? 655 SER A O   1 
ATOM   4191 C CB  . SER A 1 633 ? 51.797  -2.820  50.625  1.00 39.22 ? 655 SER A CB  1 
ATOM   4192 O OG  . SER A 1 633 ? 52.628  -3.441  51.589  1.00 36.81 ? 655 SER A OG  1 
ATOM   4193 N N   . ALA A 1 634 ? 53.792  -0.461  51.141  1.00 38.90 ? 656 ALA A N   1 
ATOM   4194 C CA  . ALA A 1 634 ? 54.917  0.150   51.840  1.00 34.73 ? 656 ALA A CA  1 
ATOM   4195 C C   . ALA A 1 634 ? 54.512  1.465   52.489  1.00 37.29 ? 656 ALA A C   1 
ATOM   4196 O O   . ALA A 1 634 ? 54.977  1.793   53.588  1.00 39.26 ? 656 ALA A O   1 
ATOM   4197 C CB  . ALA A 1 634 ? 56.084  0.367   50.875  1.00 39.79 ? 656 ALA A CB  1 
ATOM   4198 N N   . MET A 1 635 ? 53.648  2.236   51.824  1.00 41.27 ? 657 MET A N   1 
ATOM   4199 C CA  . MET A 1 635 ? 53.129  3.451   52.441  1.00 38.66 ? 657 MET A CA  1 
ATOM   4200 C C   . MET A 1 635 ? 52.282  3.122   53.663  1.00 40.59 ? 657 MET A C   1 
ATOM   4201 O O   . MET A 1 635 ? 52.388  3.792   54.697  1.00 38.04 ? 657 MET A O   1 
ATOM   4202 C CB  . MET A 1 635 ? 52.318  4.255   51.425  1.00 32.96 ? 657 MET A CB  1 
ATOM   4203 C CG  . MET A 1 635 ? 51.667  5.498   52.008  1.00 34.00 ? 657 MET A CG  1 
ATOM   4204 S SD  . MET A 1 635 ? 52.880  6.735   52.514  1.00 34.60 ? 657 MET A SD  1 
ATOM   4205 C CE  . MET A 1 635 ? 53.463  7.293   50.915  1.00 40.81 ? 657 MET A CE  1 
ATOM   4206 N N   . HIS A 1 636 ? 51.447  2.082   53.565  1.00 43.25 ? 658 HIS A N   1 
ATOM   4207 C CA  . HIS A 1 636 ? 50.601  1.688   54.688  1.00 42.18 ? 658 HIS A CA  1 
ATOM   4208 C C   . HIS A 1 636 ? 51.440  1.340   55.911  1.00 43.13 ? 658 HIS A C   1 
ATOM   4209 O O   . HIS A 1 636 ? 51.161  1.803   57.024  1.00 35.18 ? 658 HIS A O   1 
ATOM   4210 C CB  . HIS A 1 636 ? 49.716  0.507   54.286  1.00 45.02 ? 658 HIS A CB  1 
ATOM   4211 C CG  . HIS A 1 636 ? 48.810  0.031   55.380  1.00 54.38 ? 658 HIS A CG  1 
ATOM   4212 N ND1 . HIS A 1 636 ? 47.660  0.702   55.738  1.00 61.77 ? 658 HIS A ND1 1 
ATOM   4213 C CD2 . HIS A 1 636 ? 48.886  -1.048  56.194  1.00 54.17 ? 658 HIS A CD2 1 
ATOM   4214 C CE1 . HIS A 1 636 ? 47.066  0.056   56.726  1.00 58.83 ? 658 HIS A CE1 1 
ATOM   4215 N NE2 . HIS A 1 636 ? 47.789  -1.010  57.021  1.00 62.35 ? 658 HIS A NE2 1 
ATOM   4216 N N   . GLU A 1 637 ? 52.482  0.525   55.718  1.00 45.34 ? 659 GLU A N   1 
ATOM   4217 C CA  . GLU A 1 637 ? 53.375  0.186   56.822  1.00 43.60 ? 659 GLU A CA  1 
ATOM   4218 C C   . GLU A 1 637 ? 54.129  1.407   57.330  1.00 39.77 ? 659 GLU A C   1 
ATOM   4219 O O   . GLU A 1 637 ? 54.381  1.520   58.536  1.00 35.33 ? 659 GLU A O   1 
ATOM   4220 C CB  . GLU A 1 637 ? 54.358  -0.903  56.389  1.00 38.37 ? 659 GLU A CB  1 
ATOM   4221 C CG  . GLU A 1 637 ? 53.702  -2.148  55.812  1.00 42.88 ? 659 GLU A CG  1 
ATOM   4222 C CD  . GLU A 1 637 ? 53.192  -3.094  56.885  1.00 59.14 ? 659 GLU A CD  1 
ATOM   4223 O OE1 . GLU A 1 637 ? 52.280  -2.702  57.648  1.00 60.48 ? 659 GLU A OE1 1 
ATOM   4224 O OE2 . GLU A 1 637 ? 53.706  -4.232  56.966  1.00 57.71 ? 659 GLU A OE2 1 
ATOM   4225 N N   . ALA A 1 638 ? 54.493  2.328   56.433  1.00 34.08 ? 660 ALA A N   1 
ATOM   4226 C CA  . ALA A 1 638 ? 55.194  3.533   56.859  1.00 34.92 ? 660 ALA A CA  1 
ATOM   4227 C C   . ALA A 1 638 ? 54.285  4.438   57.682  1.00 39.64 ? 660 ALA A C   1 
ATOM   4228 O O   . ALA A 1 638 ? 54.728  5.034   58.674  1.00 36.33 ? 660 ALA A O   1 
ATOM   4229 C CB  . ALA A 1 638 ? 55.745  4.279   55.645  1.00 33.44 ? 660 ALA A CB  1 
ATOM   4230 N N   . ARG A 1 639 ? 53.009  4.550   57.291  1.00 35.33 ? 661 ARG A N   1 
ATOM   4231 C CA  . ARG A 1 639 ? 52.075  5.382   58.044  1.00 36.71 ? 661 ARG A CA  1 
ATOM   4232 C C   . ARG A 1 639 ? 51.802  4.808   59.430  1.00 40.05 ? 661 ARG A C   1 
ATOM   4233 O O   . ARG A 1 639 ? 51.580  5.569   60.381  1.00 37.01 ? 661 ARG A O   1 
ATOM   4234 C CB  . ARG A 1 639 ? 50.764  5.547   57.271  1.00 40.84 ? 661 ARG A CB  1 
ATOM   4235 C CG  . ARG A 1 639 ? 50.877  6.330   55.960  1.00 38.81 ? 661 ARG A CG  1 
ATOM   4236 C CD  . ARG A 1 639 ? 51.360  7.755   56.184  1.00 41.74 ? 661 ARG A CD  1 
ATOM   4237 N NE  . ARG A 1 639 ? 50.306  8.622   56.704  1.00 47.64 ? 661 ARG A NE  1 
ATOM   4238 C CZ  . ARG A 1 639 ? 49.674  9.552   55.993  1.00 46.75 ? 661 ARG A CZ  1 
ATOM   4239 N NH1 . ARG A 1 639 ? 49.984  9.748   54.717  1.00 38.53 ? 661 ARG A NH1 1 
ATOM   4240 N NH2 . ARG A 1 639 ? 48.729  10.289  56.561  1.00 50.28 ? 661 ARG A NH2 1 
ATOM   4241 N N   . ASP A 1 640 ? 51.819  3.479   59.568  1.00 37.61 ? 662 ASP A N   1 
ATOM   4242 C CA  . ASP A 1 640 ? 51.637  2.871   60.883  1.00 35.03 ? 662 ASP A CA  1 
ATOM   4243 C C   . ASP A 1 640 ? 52.783  3.236   61.817  1.00 35.82 ? 662 ASP A C   1 
ATOM   4244 O O   . ASP A 1 640 ? 52.557  3.685   62.946  1.00 38.00 ? 662 ASP A O   1 
ATOM   4245 C CB  . ASP A 1 640 ? 51.517  1.353   60.750  1.00 35.82 ? 662 ASP A CB  1 
ATOM   4246 C CG  . ASP A 1 640 ? 50.195  0.923   60.145  1.00 44.71 ? 662 ASP A CG  1 
ATOM   4247 O OD1 . ASP A 1 640 ? 49.357  1.804   59.850  1.00 42.58 ? 662 ASP A OD1 1 
ATOM   4248 O OD2 . ASP A 1 640 ? 49.998  -0.299  59.961  1.00 51.95 ? 662 ASP A OD2 1 
ATOM   4249 N N   . PHE A 1 641 ? 54.024  3.048   61.363  1.00 37.09 ? 663 PHE A N   1 
ATOM   4250 C CA  . PHE A 1 641 ? 55.167  3.414   62.190  1.00 38.46 ? 663 PHE A CA  1 
ATOM   4251 C C   . PHE A 1 641 ? 55.162  4.899   62.515  1.00 41.12 ? 663 PHE A C   1 
ATOM   4252 O O   . PHE A 1 641 ? 55.640  5.304   63.583  1.00 42.94 ? 663 PHE A O   1 
ATOM   4253 C CB  . PHE A 1 641 ? 56.471  3.026   61.492  1.00 40.31 ? 663 PHE A CB  1 
ATOM   4254 C CG  . PHE A 1 641 ? 56.800  1.562   61.591  1.00 45.39 ? 663 PHE A CG  1 
ATOM   4255 C CD1 . PHE A 1 641 ? 57.108  0.989   62.816  1.00 47.89 ? 663 PHE A CD1 1 
ATOM   4256 C CD2 . PHE A 1 641 ? 56.806  0.760   60.459  1.00 45.56 ? 663 PHE A CD2 1 
ATOM   4257 C CE1 . PHE A 1 641 ? 57.414  -0.359  62.912  1.00 42.79 ? 663 PHE A CE1 1 
ATOM   4258 C CE2 . PHE A 1 641 ? 57.113  -0.588  60.547  1.00 47.86 ? 663 PHE A CE2 1 
ATOM   4259 C CZ  . PHE A 1 641 ? 57.417  -1.148  61.775  1.00 48.60 ? 663 PHE A CZ  1 
ATOM   4260 N N   . ILE A 1 642 ? 54.619  5.724   61.617  1.00 39.34 ? 664 ILE A N   1 
ATOM   4261 C CA  . ILE A 1 642 ? 54.548  7.158   61.879  1.00 41.76 ? 664 ILE A CA  1 
ATOM   4262 C C   . ILE A 1 642 ? 53.492  7.455   62.937  1.00 32.17 ? 664 ILE A C   1 
ATOM   4263 O O   . ILE A 1 642 ? 53.713  8.267   63.842  1.00 26.89 ? 664 ILE A O   1 
ATOM   4264 C CB  . ILE A 1 642 ? 54.284  7.923   60.570  1.00 40.85 ? 664 ILE A CB  1 
ATOM   4265 C CG1 . ILE A 1 642 ? 55.532  7.901   59.687  1.00 40.15 ? 664 ILE A CG1 1 
ATOM   4266 C CG2 . ILE A 1 642 ? 53.868  9.356   60.856  1.00 39.95 ? 664 ILE A CG2 1 
ATOM   4267 C CD1 . ILE A 1 642 ? 55.317  8.492   58.316  1.00 35.74 ? 664 ILE A CD1 1 
ATOM   4268 N N   . THR A 1 643 ? 52.334  6.794   62.850  1.00 35.93 ? 665 THR A N   1 
ATOM   4269 C CA  . THR A 1 643 ? 51.276  7.022   63.831  1.00 35.55 ? 665 THR A CA  1 
ATOM   4270 C C   . THR A 1 643 ? 51.700  6.560   65.220  1.00 33.75 ? 665 THR A C   1 
ATOM   4271 O O   . THR A 1 643 ? 51.360  7.199   66.222  1.00 43.41 ? 665 THR A O   1 
ATOM   4272 C CB  . THR A 1 643 ? 49.992  6.317   63.394  1.00 38.60 ? 665 THR A CB  1 
ATOM   4273 O OG1 . THR A 1 643 ? 49.578  6.827   62.119  1.00 34.63 ? 665 THR A OG1 1 
ATOM   4274 C CG2 . THR A 1 643 ? 48.885  6.557   64.405  1.00 39.91 ? 665 THR A CG2 1 
ATOM   4275 N N   . GLU A 1 644 ? 52.450  5.458   65.302  1.00 37.59 ? 666 GLU A N   1 
ATOM   4276 C CA  . GLU A 1 644 ? 53.059  5.064   66.567  1.00 35.47 ? 666 GLU A CA  1 
ATOM   4277 C C   . GLU A 1 644 ? 54.179  6.006   66.989  1.00 33.76 ? 666 GLU A C   1 
ATOM   4278 O O   . GLU A 1 644 ? 54.690  5.870   68.106  1.00 35.33 ? 666 GLU A O   1 
ATOM   4279 C CB  . GLU A 1 644 ? 53.588  3.632   66.473  1.00 33.40 ? 666 GLU A CB  1 
ATOM   4280 C CG  . GLU A 1 644 ? 53.811  2.955   67.818  1.00 37.01 ? 666 GLU A CG  1 
ATOM   4281 C CD  . GLU A 1 644 ? 52.520  2.469   68.448  1.00 47.06 ? 666 GLU A CD  1 
ATOM   4282 O OE1 . GLU A 1 644 ? 51.541  2.250   67.699  1.00 38.89 ? 666 GLU A OE1 1 
ATOM   4283 O OE2 . GLU A 1 644 ? 52.486  2.305   69.690  1.00 41.46 ? 666 GLU A OE2 1 
ATOM   4284 N N   . ILE A 1 645 ? 54.563  6.946   66.126  1.00 36.25 ? 667 ILE A N   1 
ATOM   4285 C CA  . ILE A 1 645 ? 55.565  7.968   66.424  1.00 36.63 ? 667 ILE A CA  1 
ATOM   4286 C C   . ILE A 1 645 ? 56.906  7.333   66.755  1.00 37.56 ? 667 ILE A C   1 
ATOM   4287 O O   . ILE A 1 645 ? 57.688  7.029   65.852  1.00 39.37 ? 667 ILE A O   1 
ATOM   4288 C CB  . ILE A 1 645 ? 55.098  8.901   67.558  1.00 39.65 ? 667 ILE A CB  1 
ATOM   4289 C CG1 . ILE A 1 645 ? 53.854  9.693   67.123  1.00 37.90 ? 667 ILE A CG1 1 
ATOM   4290 C CG2 . ILE A 1 645 ? 56.226  9.829   67.974  1.00 35.85 ? 667 ILE A CG2 1 
ATOM   4291 C CD1 . ILE A 1 645 ? 53.027  10.229  68.283  1.00 35.82 ? 667 ILE A CD1 1 
ATOM   4292 N N   . ALA B 1 24  ? 118.758 18.286  30.713  1.00 27.38 ? 46  ALA B N   1 
ATOM   4293 C CA  . ALA B 1 24  ? 118.064 17.260  31.485  1.00 41.33 ? 46  ALA B CA  1 
ATOM   4294 C C   . ALA B 1 24  ? 118.932 16.768  32.637  1.00 41.98 ? 46  ALA B C   1 
ATOM   4295 O O   . ALA B 1 24  ? 120.154 16.670  32.506  1.00 46.51 ? 46  ALA B O   1 
ATOM   4296 C CB  . ALA B 1 24  ? 117.658 16.094  30.589  1.00 40.82 ? 46  ALA B CB  1 
ATOM   4297 N N   . VAL B 1 25  ? 118.288 16.466  33.766  1.00 42.24 ? 47  VAL B N   1 
ATOM   4298 C CA  . VAL B 1 25  ? 118.962 15.999  34.970  1.00 42.24 ? 47  VAL B CA  1 
ATOM   4299 C C   . VAL B 1 25  ? 118.480 14.589  35.285  1.00 37.09 ? 47  VAL B C   1 
ATOM   4300 O O   . VAL B 1 25  ? 117.398 14.165  34.873  1.00 40.60 ? 47  VAL B O   1 
ATOM   4301 C CB  . VAL B 1 25  ? 118.729 16.932  36.180  1.00 44.25 ? 47  VAL B CB  1 
ATOM   4302 C CG1 . VAL B 1 25  ? 119.578 16.492  37.369  1.00 41.45 ? 47  VAL B CG1 1 
ATOM   4303 C CG2 . VAL B 1 25  ? 119.028 18.374  35.813  1.00 41.71 ? 47  VAL B CG2 1 
ATOM   4304 N N   . ALA B 1 26  ? 119.300 13.869  36.044  1.00 39.25 ? 48  ALA B N   1 
ATOM   4305 C CA  . ALA B 1 26  ? 119.080 12.464  36.350  1.00 43.05 ? 48  ALA B CA  1 
ATOM   4306 C C   . ALA B 1 26  ? 119.155 12.245  37.852  1.00 47.09 ? 48  ALA B C   1 
ATOM   4307 O O   . ALA B 1 26  ? 120.003 12.833  38.529  1.00 53.82 ? 48  ALA B O   1 
ATOM   4308 C CB  . ALA B 1 26  ? 120.124 11.590  35.657  1.00 45.88 ? 48  ALA B CB  1 
ATOM   4309 N N   . VAL B 1 27  ? 118.268 11.401  38.375  1.00 47.18 ? 49  VAL B N   1 
ATOM   4310 C CA  . VAL B 1 27  ? 118.347 10.954  39.760  1.00 48.77 ? 49  VAL B CA  1 
ATOM   4311 C C   . VAL B 1 27  ? 118.259 9.432   39.791  1.00 49.94 ? 49  VAL B C   1 
ATOM   4312 O O   . VAL B 1 27  ? 117.530 8.822   38.999  1.00 46.24 ? 49  VAL B O   1 
ATOM   4313 C CB  . VAL B 1 27  ? 117.255 11.595  40.647  1.00 44.85 ? 49  VAL B CB  1 
ATOM   4314 C CG1 . VAL B 1 27  ? 117.156 13.094  40.385  1.00 44.77 ? 49  VAL B CG1 1 
ATOM   4315 C CG2 . VAL B 1 27  ? 115.913 10.926  40.433  1.00 50.30 ? 49  VAL B CG2 1 
ATOM   4316 N N   . ASP B 1 28  ? 119.020 8.816   40.696  1.00 53.97 ? 50  ASP B N   1 
ATOM   4317 C CA  . ASP B 1 28  ? 119.072 7.361   40.826  1.00 63.18 ? 50  ASP B CA  1 
ATOM   4318 C C   . ASP B 1 28  ? 118.189 6.949   41.998  1.00 62.96 ? 50  ASP B C   1 
ATOM   4319 O O   . ASP B 1 28  ? 118.569 7.100   43.163  1.00 65.09 ? 50  ASP B O   1 
ATOM   4320 C CB  . ASP B 1 28  ? 120.505 6.873   41.013  1.00 70.30 ? 50  ASP B CB  1 
ATOM   4321 C CG  . ASP B 1 28  ? 120.570 5.409   41.421  1.00 81.14 ? 50  ASP B CG  1 
ATOM   4322 O OD1 . ASP B 1 28  ? 120.328 4.534   40.561  1.00 78.78 ? 50  ASP B OD1 1 
ATOM   4323 O OD2 . ASP B 1 28  ? 120.851 5.135   42.609  1.00 78.64 ? 50  ASP B OD2 1 
ATOM   4324 N N   . LEU B 1 29  ? 117.010 6.420   41.682  1.00 59.39 ? 51  LEU B N   1 
ATOM   4325 C CA  . LEU B 1 29  ? 116.076 5.958   42.705  1.00 63.06 ? 51  LEU B CA  1 
ATOM   4326 C C   . LEU B 1 29  ? 116.076 4.431   42.737  1.00 68.02 ? 51  LEU B C   1 
ATOM   4327 O O   . LEU B 1 29  ? 115.079 3.761   42.449  1.00 73.97 ? 51  LEU B O   1 
ATOM   4328 C CB  . LEU B 1 29  ? 114.680 6.526   42.444  1.00 55.63 ? 51  LEU B CB  1 
ATOM   4329 C CG  . LEU B 1 29  ? 114.540 8.052   42.451  1.00 46.20 ? 51  LEU B CG  1 
ATOM   4330 C CD1 . LEU B 1 29  ? 113.171 8.472   41.942  1.00 33.58 ? 51  LEU B CD1 1 
ATOM   4331 C CD2 . LEU B 1 29  ? 114.810 8.646   43.833  1.00 46.23 ? 51  LEU B CD2 1 
ATOM   4332 N N   . GLY B 1 30  ? 117.228 3.896   43.086  1.00 68.38 ? 52  GLY B N   1 
ATOM   4333 C CA  . GLY B 1 30  ? 117.418 2.446   43.172  1.00 71.87 ? 52  GLY B CA  1 
ATOM   4334 C C   . GLY B 1 30  ? 117.758 1.834   41.814  1.00 77.94 ? 52  GLY B C   1 
ATOM   4335 O O   . GLY B 1 30  ? 118.879 1.979   41.332  1.00 74.83 ? 52  GLY B O   1 
ATOM   4336 N N   . ASN B 1 31  ? 116.775 1.165   41.211  1.00 78.17 ? 53  ASN B N   1 
ATOM   4337 C CA  . ASN B 1 31  ? 117.013 0.448   39.962  1.00 77.99 ? 53  ASN B CA  1 
ATOM   4338 C C   . ASN B 1 31  ? 117.015 1.395   38.764  1.00 76.57 ? 53  ASN B C   1 
ATOM   4339 O O   . ASN B 1 31  ? 118.062 1.651   38.158  1.00 75.00 ? 53  ASN B O   1 
ATOM   4340 C CB  . ASN B 1 31  ? 115.967 -0.654  39.784  1.00 74.84 ? 53  ASN B CB  1 
ATOM   4341 C CG  . ASN B 1 31  ? 115.838 -1.534  41.011  1.00 85.81 ? 53  ASN B CG  1 
ATOM   4342 O OD1 . ASN B 1 31  ? 116.723 -1.560  41.868  1.00 87.72 ? 53  ASN B OD1 1 
ATOM   4343 N ND2 . ASN B 1 31  ? 114.737 -2.271  41.098  1.00 78.95 ? 53  ASN B ND2 1 
ATOM   4344 N N   . ARG B 1 32  ? 115.844 1.913   38.402  1.00 74.35 ? 54  ARG B N   1 
ATOM   4345 C CA  . ARG B 1 32  ? 115.724 2.782   37.244  1.00 69.87 ? 54  ARG B CA  1 
ATOM   4346 C C   . ARG B 1 32  ? 115.991 4.227   37.652  1.00 62.49 ? 54  ARG B C   1 
ATOM   4347 O O   . ARG B 1 32  ? 116.259 4.539   38.816  1.00 53.78 ? 54  ARG B O   1 
ATOM   4348 C CB  . ARG B 1 32  ? 114.349 2.638   36.596  1.00 65.12 ? 54  ARG B CB  1 
ATOM   4349 C CG  . ARG B 1 32  ? 114.079 1.268   36.002  1.00 72.11 ? 54  ARG B CG  1 
ATOM   4350 C CD  . ARG B 1 32  ? 112.643 0.837   36.268  1.00 77.88 ? 54  ARG B CD  1 
ATOM   4351 N NE  . ARG B 1 32  ? 112.496 0.099   37.524  1.00 88.97 ? 54  ARG B NE  1 
ATOM   4352 C CZ  . ARG B 1 32  ? 112.209 0.653   38.701  1.00 76.65 ? 54  ARG B CZ  1 
ATOM   4353 N NH1 . ARG B 1 32  ? 112.034 1.965   38.804  1.00 58.79 ? 54  ARG B NH1 1 
ATOM   4354 N NH2 . ARG B 1 32  ? 112.095 -0.109  39.782  1.00 59.90 ? 54  ARG B NH2 1 
ATOM   4355 N N   . LYS B 1 33  ? 115.911 5.120   36.676  1.00 55.28 ? 55  LYS B N   1 
ATOM   4356 C CA  . LYS B 1 33  ? 116.268 6.518   36.843  1.00 48.78 ? 55  LYS B CA  1 
ATOM   4357 C C   . LYS B 1 33  ? 115.026 7.391   36.723  1.00 44.95 ? 55  LYS B C   1 
ATOM   4358 O O   . LYS B 1 33  ? 113.898 6.904   36.609  1.00 44.98 ? 55  LYS B O   1 
ATOM   4359 C CB  . LYS B 1 33  ? 117.346 6.905   35.826  1.00 51.49 ? 55  LYS B CB  1 
ATOM   4360 C CG  . LYS B 1 33  ? 116.851 7.158   34.404  1.00 65.40 ? 55  LYS B CG  1 
ATOM   4361 C CD  . LYS B 1 33  ? 117.990 7.688   33.516  1.00 62.82 ? 55  LYS B CD  1 
ATOM   4362 C CE  . LYS B 1 33  ? 118.590 8.949   34.090  1.00 62.24 ? 55  LYS B CE  1 
ATOM   4363 N NZ  . LYS B 1 33  ? 119.031 9.935   33.064  1.00 59.08 ? 55  LYS B NZ  1 
ATOM   4364 N N   . LEU B 1 34  ? 115.247 8.701   36.758  1.00 47.62 ? 56  LEU B N   1 
ATOM   4365 C CA  . LEU B 1 34  ? 114.163 9.666   36.613  1.00 47.87 ? 56  LEU B CA  1 
ATOM   4366 C C   . LEU B 1 34  ? 114.762 10.926  36.005  1.00 47.68 ? 56  LEU B C   1 
ATOM   4367 O O   . LEU B 1 34  ? 115.614 11.569  36.631  1.00 50.77 ? 56  LEU B O   1 
ATOM   4368 C CB  . LEU B 1 34  ? 113.502 9.949   37.962  1.00 45.00 ? 56  LEU B CB  1 
ATOM   4369 C CG  . LEU B 1 34  ? 112.303 10.894  38.041  1.00 43.02 ? 56  LEU B CG  1 
ATOM   4370 C CD1 . LEU B 1 34  ? 111.015 10.101  37.972  1.00 39.89 ? 56  LEU B CD1 1 
ATOM   4371 C CD2 . LEU B 1 34  ? 112.358 11.705  39.325  1.00 30.55 ? 56  LEU B CD2 1 
ATOM   4372 N N   . GLU B 1 35  ? 114.335 11.263  34.788  1.00 43.01 ? 57  GLU B N   1 
ATOM   4373 C CA  . GLU B 1 35  ? 114.854 12.433  34.096  1.00 43.02 ? 57  GLU B CA  1 
ATOM   4374 C C   . GLU B 1 35  ? 113.884 13.602  34.190  1.00 42.26 ? 57  GLU B C   1 
ATOM   4375 O O   . GLU B 1 35  ? 112.661 13.434  34.148  1.00 43.05 ? 57  GLU B O   1 
ATOM   4376 C CB  . GLU B 1 35  ? 115.147 12.148  32.619  1.00 48.74 ? 57  GLU B CB  1 
ATOM   4377 C CG  . GLU B 1 35  ? 115.868 10.836  32.320  1.00 52.73 ? 57  GLU B CG  1 
ATOM   4378 C CD  . GLU B 1 35  ? 114.944 9.814   31.732  1.00 58.86 ? 57  GLU B CD  1 
ATOM   4379 O OE1 . GLU B 1 35  ? 114.962 8.667   32.212  1.00 46.70 ? 57  GLU B OE1 1 
ATOM   4380 O OE2 . GLU B 1 35  ? 114.242 10.141  30.750  1.00 62.82 ? 57  GLU B OE2 1 
ATOM   4381 N N   . ILE B 1 36  ? 114.454 14.798  34.300  1.00 40.96 ? 58  ILE B N   1 
ATOM   4382 C CA  . ILE B 1 36  ? 113.703 16.021  34.543  1.00 40.78 ? 58  ILE B CA  1 
ATOM   4383 C C   . ILE B 1 36  ? 114.217 17.105  33.605  1.00 35.63 ? 58  ILE B C   1 
ATOM   4384 O O   . ILE B 1 36  ? 115.425 17.356  33.545  1.00 42.14 ? 58  ILE B O   1 
ATOM   4385 C CB  . ILE B 1 36  ? 113.830 16.478  36.008  1.00 45.24 ? 58  ILE B CB  1 
ATOM   4386 C CG1 . ILE B 1 36  ? 113.310 15.395  36.958  1.00 35.62 ? 58  ILE B CG1 1 
ATOM   4387 C CG2 . ILE B 1 36  ? 113.087 17.760  36.208  1.00 39.49 ? 58  ILE B CG2 1 
ATOM   4388 C CD1 . ILE B 1 36  ? 114.405 14.686  37.724  1.00 40.47 ? 58  ILE B CD1 1 
ATOM   4389 N N   . SER B 1 37  ? 113.302 17.754  32.889  1.00 36.32 ? 59  SER B N   1 
ATOM   4390 C CA  . SER B 1 37  ? 113.654 18.828  31.967  1.00 40.63 ? 59  SER B CA  1 
ATOM   4391 C C   . SER B 1 37  ? 112.618 19.940  32.101  1.00 42.53 ? 59  SER B C   1 
ATOM   4392 O O   . SER B 1 37  ? 111.768 19.921  32.996  1.00 44.18 ? 59  SER B O   1 
ATOM   4393 C CB  . SER B 1 37  ? 113.762 18.294  30.533  1.00 31.74 ? 59  SER B CB  1 
ATOM   4394 O OG  . SER B 1 37  ? 112.787 17.292  30.294  1.00 41.17 ? 59  SER B OG  1 
ATOM   4395 N N   . SER B 1 38  ? 112.695 20.924  31.204  1.00 40.11 ? 60  SER B N   1 
ATOM   4396 C CA  . SER B 1 38  ? 111.753 22.029  31.154  1.00 40.19 ? 60  SER B CA  1 
ATOM   4397 C C   . SER B 1 38  ? 110.826 21.856  29.946  1.00 49.18 ? 60  SER B C   1 
ATOM   4398 O O   . SER B 1 38  ? 110.729 20.762  29.371  1.00 52.90 ? 60  SER B O   1 
ATOM   4399 C CB  . SER B 1 38  ? 112.529 23.350  31.128  1.00 43.04 ? 60  SER B CB  1 
ATOM   4400 O OG  . SER B 1 38  ? 111.674 24.454  31.386  1.00 43.15 ? 60  SER B OG  1 
ATOM   4401 N N   . GLY B 1 39  ? 110.142 22.932  29.565  1.00 51.23 ? 61  GLY B N   1 
ATOM   4402 C CA  . GLY B 1 39  ? 109.260 22.903  28.411  1.00 47.78 ? 61  GLY B CA  1 
ATOM   4403 C C   . GLY B 1 39  ? 109.816 23.656  27.218  1.00 51.23 ? 61  GLY B C   1 
ATOM   4404 O O   . GLY B 1 39  ? 109.444 23.392  26.073  1.00 49.82 ? 61  GLY B O   1 
ATOM   4405 N N   . ALA B 1 45  ? 101.664 29.400  30.244  1.00 47.33 ? 67  ALA B N   1 
ATOM   4406 C CA  . ALA B 1 45  ? 102.428 28.498  31.100  1.00 41.11 ? 67  ALA B CA  1 
ATOM   4407 C C   . ALA B 1 45  ? 103.605 29.216  31.758  1.00 42.77 ? 67  ALA B C   1 
ATOM   4408 O O   . ALA B 1 45  ? 104.652 29.400  31.136  1.00 48.77 ? 67  ALA B O   1 
ATOM   4409 C CB  . ALA B 1 45  ? 102.921 27.300  30.299  1.00 37.90 ? 67  ALA B CB  1 
ATOM   4410 N N   . ASP B 1 46  ? 103.426 29.616  33.021  1.00 44.66 ? 68  ASP B N   1 
ATOM   4411 C CA  . ASP B 1 46  ? 104.492 30.263  33.780  1.00 38.11 ? 68  ASP B CA  1 
ATOM   4412 C C   . ASP B 1 46  ? 105.678 29.344  34.030  1.00 39.67 ? 68  ASP B C   1 
ATOM   4413 O O   . ASP B 1 46  ? 106.741 29.830  34.430  1.00 41.37 ? 68  ASP B O   1 
ATOM   4414 C CB  . ASP B 1 46  ? 103.957 30.771  35.121  1.00 30.10 ? 68  ASP B CB  1 
ATOM   4415 C CG  . ASP B 1 46  ? 103.156 32.052  34.984  1.00 43.82 ? 68  ASP B CG  1 
ATOM   4416 O OD1 . ASP B 1 46  ? 103.476 32.864  34.087  1.00 50.21 ? 68  ASP B OD1 1 
ATOM   4417 O OD2 . ASP B 1 46  ? 102.208 32.253  35.777  1.00 39.32 ? 68  ASP B OD2 1 
ATOM   4418 N N   . GLY B 1 47  ? 105.522 28.041  33.812  1.00 35.22 ? 69  GLY B N   1 
ATOM   4419 C CA  . GLY B 1 47  ? 106.592 27.089  34.027  1.00 36.32 ? 69  GLY B CA  1 
ATOM   4420 C C   . GLY B 1 47  ? 106.186 25.692  33.613  1.00 37.82 ? 69  GLY B C   1 
ATOM   4421 O O   . GLY B 1 47  ? 105.086 25.232  33.941  1.00 35.09 ? 69  GLY B O   1 
ATOM   4422 N N   . SER B 1 48  ? 107.061 25.005  32.885  1.00 33.25 ? 70  SER B N   1 
ATOM   4423 C CA  . SER B 1 48  ? 106.756 23.690  32.350  1.00 29.44 ? 70  SER B CA  1 
ATOM   4424 C C   . SER B 1 48  ? 107.882 22.729  32.693  1.00 39.01 ? 70  SER B C   1 
ATOM   4425 O O   . SER B 1 48  ? 109.018 23.133  32.949  1.00 44.05 ? 70  SER B O   1 
ATOM   4426 C CB  . SER B 1 48  ? 106.547 23.735  30.832  1.00 37.49 ? 70  SER B CB  1 
ATOM   4427 O OG  . SER B 1 48  ? 107.411 24.686  30.231  1.00 57.04 ? 70  SER B OG  1 
ATOM   4428 N N   . ALA B 1 49  ? 107.549 21.443  32.694  1.00 37.21 ? 71  ALA B N   1 
ATOM   4429 C CA  . ALA B 1 49  ? 108.519 20.414  33.027  1.00 30.25 ? 71  ALA B CA  1 
ATOM   4430 C C   . ALA B 1 49  ? 108.047 19.089  32.455  1.00 31.41 ? 71  ALA B C   1 
ATOM   4431 O O   . ALA B 1 49  ? 106.852 18.876  32.232  1.00 30.51 ? 71  ALA B O   1 
ATOM   4432 C CB  . ALA B 1 49  ? 108.721 20.301  34.539  1.00 34.30 ? 71  ALA B CB  1 
ATOM   4433 N N   . VAL B 1 50  ? 109.008 18.202  32.220  1.00 27.41 ? 72  VAL B N   1 
ATOM   4434 C CA  . VAL B 1 50  ? 108.739 16.859  31.733  1.00 31.99 ? 72  VAL B CA  1 
ATOM   4435 C C   . VAL B 1 50  ? 109.504 15.883  32.614  1.00 36.91 ? 72  VAL B C   1 
ATOM   4436 O O   . VAL B 1 50  ? 110.714 16.039  32.820  1.00 36.58 ? 72  VAL B O   1 
ATOM   4437 C CB  . VAL B 1 50  ? 109.135 16.690  30.254  1.00 33.54 ? 72  VAL B CB  1 
ATOM   4438 C CG1 . VAL B 1 50  ? 109.223 15.210  29.887  1.00 28.08 ? 72  VAL B CG1 1 
ATOM   4439 C CG2 . VAL B 1 50  ? 108.131 17.406  29.363  1.00 29.31 ? 72  VAL B CG2 1 
ATOM   4440 N N   . VAL B 1 51  ? 108.796 14.890  33.146  1.00 32.35 ? 73  VAL B N   1 
ATOM   4441 C CA  . VAL B 1 51  ? 109.377 13.879  34.019  1.00 36.17 ? 73  VAL B CA  1 
ATOM   4442 C C   . VAL B 1 51  ? 109.174 12.526  33.354  1.00 35.51 ? 73  VAL B C   1 
ATOM   4443 O O   . VAL B 1 51  ? 108.036 12.135  33.064  1.00 38.62 ? 73  VAL B O   1 
ATOM   4444 C CB  . VAL B 1 51  ? 108.750 13.907  35.421  1.00 26.76 ? 73  VAL B CB  1 
ATOM   4445 C CG1 . VAL B 1 51  ? 109.235 12.725  36.242  1.00 28.41 ? 73  VAL B CG1 1 
ATOM   4446 C CG2 . VAL B 1 51  ? 109.082 15.211  36.117  1.00 27.18 ? 73  VAL B CG2 1 
ATOM   4447 N N   . GLN B 1 52  ? 110.271 11.818  33.110  1.00 32.45 ? 74  GLN B N   1 
ATOM   4448 C CA  . GLN B 1 52  ? 110.228 10.543  32.413  1.00 34.61 ? 74  GLN B CA  1 
ATOM   4449 C C   . GLN B 1 52  ? 110.956 9.484   33.221  1.00 34.72 ? 74  GLN B C   1 
ATOM   4450 O O   . GLN B 1 52  ? 112.036 9.732   33.765  1.00 40.61 ? 74  GLN B O   1 
ATOM   4451 C CB  . GLN B 1 52  ? 110.854 10.646  31.017  1.00 41.78 ? 74  GLN B CB  1 
ATOM   4452 C CG  . GLN B 1 52  ? 110.786 9.360   30.216  1.00 40.93 ? 74  GLN B CG  1 
ATOM   4453 C CD  . GLN B 1 52  ? 111.312 9.522   28.809  1.00 38.99 ? 74  GLN B CD  1 
ATOM   4454 O OE1 . GLN B 1 52  ? 111.610 10.634  28.369  1.00 35.07 ? 74  GLN B OE1 1 
ATOM   4455 N NE2 . GLN B 1 52  ? 111.431 8.411   28.091  1.00 41.02 ? 74  GLN B NE2 1 
ATOM   4456 N N   . SER B 1 53  ? 110.348 8.304   33.301  1.00 34.32 ? 75  SER B N   1 
ATOM   4457 C CA  . SER B 1 53  ? 110.979 7.128   33.882  1.00 36.37 ? 75  SER B CA  1 
ATOM   4458 C C   . SER B 1 53  ? 110.645 5.952   32.985  1.00 39.33 ? 75  SER B C   1 
ATOM   4459 O O   . SER B 1 53  ? 109.467 5.647   32.779  1.00 39.37 ? 75  SER B O   1 
ATOM   4460 C CB  . SER B 1 53  ? 110.498 6.875   35.313  1.00 47.03 ? 75  SER B CB  1 
ATOM   4461 O OG  . SER B 1 53  ? 111.140 5.737   35.866  1.00 53.60 ? 75  SER B OG  1 
ATOM   4462 N N   . GLY B 1 54  ? 111.672 5.301   32.451  1.00 47.36 ? 76  GLY B N   1 
ATOM   4463 C CA  . GLY B 1 54  ? 111.434 4.292   31.433  1.00 36.75 ? 76  GLY B CA  1 
ATOM   4464 C C   . GLY B 1 54  ? 110.957 4.974   30.169  1.00 46.82 ? 76  GLY B C   1 
ATOM   4465 O O   . GLY B 1 54  ? 111.534 5.974   29.723  1.00 43.70 ? 76  GLY B O   1 
ATOM   4466 N N   . ASP B 1 55  ? 109.881 4.448   29.585  1.00 47.57 ? 77  ASP B N   1 
ATOM   4467 C CA  . ASP B 1 55  ? 109.251 5.075   28.431  1.00 49.45 ? 77  ASP B CA  1 
ATOM   4468 C C   . ASP B 1 55  ? 107.889 5.664   28.785  1.00 46.99 ? 77  ASP B C   1 
ATOM   4469 O O   . ASP B 1 55  ? 107.012 5.791   27.926  1.00 44.75 ? 77  ASP B O   1 
ATOM   4470 C CB  . ASP B 1 55  ? 109.139 4.088   27.271  1.00 45.36 ? 77  ASP B CB  1 
ATOM   4471 C CG  . ASP B 1 55  ? 110.274 4.244   26.272  1.00 56.54 ? 77  ASP B CG  1 
ATOM   4472 O OD1 . ASP B 1 55  ? 110.648 5.399   25.965  1.00 64.24 ? 77  ASP B OD1 1 
ATOM   4473 O OD2 . ASP B 1 55  ? 110.795 3.214   25.798  1.00 66.33 ? 77  ASP B OD2 1 
ATOM   4474 N N   . THR B 1 56  ? 107.706 6.021   30.052  1.00 41.93 ? 78  THR B N   1 
ATOM   4475 C CA  . THR B 1 56  ? 106.556 6.786   30.508  1.00 35.73 ? 78  THR B CA  1 
ATOM   4476 C C   . THR B 1 56  ? 107.039 8.190   30.832  1.00 36.92 ? 78  THR B C   1 
ATOM   4477 O O   . THR B 1 56  ? 107.963 8.358   31.635  1.00 38.84 ? 78  THR B O   1 
ATOM   4478 C CB  . THR B 1 56  ? 105.906 6.145   31.735  1.00 34.97 ? 78  THR B CB  1 
ATOM   4479 O OG1 . THR B 1 56  ? 105.347 4.877   31.373  1.00 34.91 ? 78  THR B OG1 1 
ATOM   4480 C CG2 . THR B 1 56  ? 104.802 7.038   32.278  1.00 31.46 ? 78  THR B CG2 1 
ATOM   4481 N N   . ALA B 1 57  ? 106.432 9.189   30.200  1.00 33.20 ? 79  ALA B N   1 
ATOM   4482 C CA  . ALA B 1 57  ? 106.810 10.576  30.414  1.00 34.13 ? 79  ALA B CA  1 
ATOM   4483 C C   . ALA B 1 57  ? 105.560 11.426  30.571  1.00 32.76 ? 79  ALA B C   1 
ATOM   4484 O O   . ALA B 1 57  ? 104.571 11.228  29.859  1.00 31.29 ? 79  ALA B O   1 
ATOM   4485 C CB  . ALA B 1 57  ? 107.667 11.106  29.261  1.00 35.59 ? 79  ALA B CB  1 
ATOM   4486 N N   . VAL B 1 58  ? 105.614 12.370  31.513  1.00 29.63 ? 80  VAL B N   1 
ATOM   4487 C CA  . VAL B 1 58  ? 104.507 13.266  31.821  1.00 28.56 ? 80  VAL B CA  1 
ATOM   4488 C C   . VAL B 1 58  ? 104.992 14.701  31.686  1.00 32.66 ? 80  VAL B C   1 
ATOM   4489 O O   . VAL B 1 58  ? 106.122 15.018  32.071  1.00 41.34 ? 80  VAL B O   1 
ATOM   4490 C CB  . VAL B 1 58  ? 103.953 13.018  33.238  1.00 24.16 ? 80  VAL B CB  1 
ATOM   4491 C CG1 . VAL B 1 58  ? 102.655 13.786  33.444  1.00 27.04 ? 80  VAL B CG1 1 
ATOM   4492 C CG2 . VAL B 1 58  ? 103.750 11.531  33.476  1.00 29.43 ? 80  VAL B CG2 1 
ATOM   4493 N N   . MET B 1 59  ? 104.141 15.565  31.137  1.00 28.53 ? 81  MET B N   1 
ATOM   4494 C CA  . MET B 1 59  ? 104.415 16.992  31.049  1.00 34.64 ? 81  MET B CA  1 
ATOM   4495 C C   . MET B 1 59  ? 103.449 17.749  31.951  1.00 37.15 ? 81  MET B C   1 
ATOM   4496 O O   . MET B 1 59  ? 102.231 17.549  31.871  1.00 36.95 ? 81  MET B O   1 
ATOM   4497 C CB  . MET B 1 59  ? 104.297 17.505  29.611  1.00 39.35 ? 81  MET B CB  1 
ATOM   4498 C CG  . MET B 1 59  ? 104.499 19.017  29.501  1.00 37.65 ? 81  MET B CG  1 
ATOM   4499 S SD  . MET B 1 59  ? 104.422 19.665  27.822  1.00 49.61 ? 81  MET B SD  1 
ATOM   4500 C CE  . MET B 1 59  ? 102.698 19.370  27.419  1.00 43.05 ? 81  MET B CE  1 
ATOM   4501 N N   . VAL B 1 60  ? 103.994 18.619  32.799  1.00 29.13 ? 82  VAL B N   1 
ATOM   4502 C CA  . VAL B 1 60  ? 103.210 19.390  33.754  1.00 30.40 ? 82  VAL B CA  1 
ATOM   4503 C C   . VAL B 1 60  ? 103.490 20.872  33.540  1.00 30.69 ? 82  VAL B C   1 
ATOM   4504 O O   . VAL B 1 60  ? 104.639 21.274  33.327  1.00 38.53 ? 82  VAL B O   1 
ATOM   4505 C CB  . VAL B 1 60  ? 103.525 18.975  35.206  1.00 30.51 ? 82  VAL B CB  1 
ATOM   4506 C CG1 . VAL B 1 60  ? 102.524 19.601  36.164  1.00 34.24 ? 82  VAL B CG1 1 
ATOM   4507 C CG2 . VAL B 1 60  ? 103.508 17.466  35.337  1.00 26.68 ? 82  VAL B CG2 1 
ATOM   4508 N N   . THR B 1 61  ? 102.434 21.681  33.595  1.00 24.88 ? 83  THR B N   1 
ATOM   4509 C CA  . THR B 1 61  ? 102.532 23.122  33.415  1.00 28.53 ? 83  THR B CA  1 
ATOM   4510 C C   . THR B 1 61  ? 101.827 23.819  34.568  1.00 32.51 ? 83  THR B C   1 
ATOM   4511 O O   . THR B 1 61  ? 100.749 23.395  34.997  1.00 28.30 ? 83  THR B O   1 
ATOM   4512 C CB  . THR B 1 61  ? 101.911 23.576  32.080  1.00 27.39 ? 83  THR B CB  1 
ATOM   4513 O OG1 . THR B 1 61  ? 100.523 23.221  32.049  1.00 30.19 ? 83  THR B OG1 1 
ATOM   4514 C CG2 . THR B 1 61  ? 102.619 22.923  30.904  1.00 25.11 ? 83  THR B CG2 1 
ATOM   4515 N N   . ALA B 1 62  ? 102.437 24.894  35.062  1.00 33.62 ? 84  ALA B N   1 
ATOM   4516 C CA  . ALA B 1 62  ? 101.902 25.666  36.174  1.00 32.67 ? 84  ALA B CA  1 
ATOM   4517 C C   . ALA B 1 62  ? 101.761 27.117  35.748  1.00 33.05 ? 84  ALA B C   1 
ATOM   4518 O O   . ALA B 1 62  ? 102.710 27.705  35.220  1.00 36.41 ? 84  ALA B O   1 
ATOM   4519 C CB  . ALA B 1 62  ? 102.803 25.559  37.408  1.00 27.28 ? 84  ALA B CB  1 
ATOM   4520 N N   . VAL B 1 63  ? 100.572 27.683  35.962  1.00 32.32 ? 85  VAL B N   1 
ATOM   4521 C CA  . VAL B 1 63  ? 100.286 29.082  35.673  1.00 36.43 ? 85  VAL B CA  1 
ATOM   4522 C C   . VAL B 1 63  ? 99.640  29.702  36.904  1.00 36.51 ? 85  VAL B C   1 
ATOM   4523 O O   . VAL B 1 63  ? 99.026  29.006  37.718  1.00 37.41 ? 85  VAL B O   1 
ATOM   4524 C CB  . VAL B 1 63  ? 99.362  29.250  34.443  1.00 30.09 ? 85  VAL B CB  1 
ATOM   4525 C CG1 . VAL B 1 63  ? 99.487  30.650  33.864  1.00 27.91 ? 85  VAL B CG1 1 
ATOM   4526 C CG2 . VAL B 1 63  ? 99.667  28.202  33.390  1.00 38.26 ? 85  VAL B CG2 1 
ATOM   4527 N N   . SER B 1 64  ? 99.776  31.023  37.036  1.00 34.83 ? 86  SER B N   1 
ATOM   4528 C CA  . SER B 1 64  ? 99.124  31.756  38.117  1.00 38.87 ? 86  SER B CA  1 
ATOM   4529 C C   . SER B 1 64  ? 98.965  33.214  37.709  1.00 38.68 ? 86  SER B C   1 
ATOM   4530 O O   . SER B 1 64  ? 99.954  33.885  37.398  1.00 36.49 ? 86  SER B O   1 
ATOM   4531 C CB  . SER B 1 64  ? 99.918  31.649  39.425  1.00 40.55 ? 86  SER B CB  1 
ATOM   4532 O OG  . SER B 1 64  ? 99.333  32.423  40.459  1.00 35.96 ? 86  SER B OG  1 
ATOM   4533 N N   . LYS B 1 65  ? 97.724  33.693  37.718  1.00 39.97 ? 87  LYS B N   1 
ATOM   4534 C CA  . LYS B 1 65  ? 97.432  35.061  37.319  1.00 40.35 ? 87  LYS B CA  1 
ATOM   4535 C C   . LYS B 1 65  ? 98.075  36.054  38.281  1.00 44.53 ? 87  LYS B C   1 
ATOM   4536 O O   . LYS B 1 65  ? 98.329  35.748  39.450  1.00 40.59 ? 87  LYS B O   1 
ATOM   4537 C CB  . LYS B 1 65  ? 95.919  35.282  37.265  1.00 38.97 ? 87  LYS B CB  1 
ATOM   4538 C CG  . LYS B 1 65  ? 95.182  34.330  36.331  1.00 38.02 ? 87  LYS B CG  1 
ATOM   4539 C CD  . LYS B 1 65  ? 93.680  34.564  36.373  1.00 48.91 ? 87  LYS B CD  1 
ATOM   4540 C CE  . LYS B 1 65  ? 92.984  34.010  35.135  1.00 52.60 ? 87  LYS B CE  1 
ATOM   4541 N NZ  . LYS B 1 65  ? 92.888  32.525  35.159  1.00 56.66 ? 87  LYS B NZ  1 
ATOM   4542 N N   . THR B 1 66  ? 98.343  37.260  37.772  1.00 55.26 ? 88  THR B N   1 
ATOM   4543 C CA  . THR B 1 66  ? 98.903  38.332  38.588  1.00 53.66 ? 88  THR B CA  1 
ATOM   4544 C C   . THR B 1 66  ? 97.837  39.202  39.243  1.00 50.14 ? 88  THR B C   1 
ATOM   4545 O O   . THR B 1 66  ? 98.135  39.884  40.233  1.00 47.22 ? 88  THR B O   1 
ATOM   4546 C CB  . THR B 1 66  ? 99.828  39.222  37.749  1.00 44.38 ? 88  THR B CB  1 
ATOM   4547 O OG1 . THR B 1 66  ? 99.242  39.438  36.461  1.00 62.14 ? 88  THR B OG1 1 
ATOM   4548 C CG2 . THR B 1 66  ? 101.191 38.565  37.579  1.00 39.77 ? 88  THR B CG2 1 
ATOM   4549 N N   . LYS B 1 67  ? 96.614  39.195  38.721  1.00 47.44 ? 89  LYS B N   1 
ATOM   4550 C CA  . LYS B 1 67  ? 95.520  39.917  39.360  1.00 51.78 ? 89  LYS B CA  1 
ATOM   4551 C C   . LYS B 1 67  ? 94.967  39.090  40.516  1.00 57.40 ? 89  LYS B C   1 
ATOM   4552 O O   . LYS B 1 67  ? 94.681  37.901  40.337  1.00 59.67 ? 89  LYS B O   1 
ATOM   4553 C CB  . LYS B 1 67  ? 94.412  40.222  38.354  1.00 48.86 ? 89  LYS B CB  1 
ATOM   4554 C CG  . LYS B 1 67  ? 94.875  40.993  37.122  1.00 59.59 ? 89  LYS B CG  1 
ATOM   4555 C CD  . LYS B 1 67  ? 95.009  42.483  37.407  1.00 64.41 ? 89  LYS B CD  1 
ATOM   4556 C CE  . LYS B 1 67  ? 96.205  43.088  36.686  1.00 63.37 ? 89  LYS B CE  1 
ATOM   4557 N NZ  . LYS B 1 67  ? 96.538  42.372  35.424  1.00 56.81 ? 89  LYS B NZ  1 
ATOM   4558 N N   . PRO B 1 68  ? 94.816  39.671  41.706  1.00 55.57 ? 90  PRO B N   1 
ATOM   4559 C CA  . PRO B 1 68  ? 94.340  38.889  42.852  1.00 52.75 ? 90  PRO B CA  1 
ATOM   4560 C C   . PRO B 1 68  ? 92.934  38.349  42.638  1.00 53.24 ? 90  PRO B C   1 
ATOM   4561 O O   . PRO B 1 68  ? 92.080  38.991  42.022  1.00 55.91 ? 90  PRO B O   1 
ATOM   4562 C CB  . PRO B 1 68  ? 94.377  39.896  44.007  1.00 53.19 ? 90  PRO B CB  1 
ATOM   4563 C CG  . PRO B 1 68  ? 95.374  40.922  43.584  1.00 53.35 ? 90  PRO B CG  1 
ATOM   4564 C CD  . PRO B 1 68  ? 95.223  41.031  42.096  1.00 58.48 ? 90  PRO B CD  1 
ATOM   4565 N N   . SER B 1 69  ? 92.705  37.147  43.162  1.00 53.33 ? 91  SER B N   1 
ATOM   4566 C CA  . SER B 1 69  ? 91.400  36.523  43.058  1.00 59.27 ? 91  SER B CA  1 
ATOM   4567 C C   . SER B 1 69  ? 90.383  37.276  43.914  1.00 61.51 ? 91  SER B C   1 
ATOM   4568 O O   . SER B 1 69  ? 90.724  37.816  44.970  1.00 67.05 ? 91  SER B O   1 
ATOM   4569 C CB  . SER B 1 69  ? 91.470  35.063  43.498  1.00 53.30 ? 91  SER B CB  1 
ATOM   4570 O OG  . SER B 1 69  ? 90.187  34.461  43.489  1.00 47.85 ? 91  SER B OG  1 
ATOM   4571 N N   . PRO B 1 70  ? 89.126  37.333  43.477  1.00 64.55 ? 92  PRO B N   1 
ATOM   4572 C CA  . PRO B 1 70  ? 88.102  38.026  44.269  1.00 68.90 ? 92  PRO B CA  1 
ATOM   4573 C C   . PRO B 1 70  ? 87.422  37.125  45.291  1.00 64.67 ? 92  PRO B C   1 
ATOM   4574 O O   . PRO B 1 70  ? 86.361  37.474  45.817  1.00 69.01 ? 92  PRO B O   1 
ATOM   4575 C CB  . PRO B 1 70  ? 87.111  38.499  43.201  1.00 67.29 ? 92  PRO B CB  1 
ATOM   4576 C CG  . PRO B 1 70  ? 87.188  37.427  42.153  1.00 60.57 ? 92  PRO B CG  1 
ATOM   4577 C CD  . PRO B 1 70  ? 88.616  36.919  42.157  1.00 59.19 ? 92  PRO B CD  1 
ATOM   4578 N N   . SER B 1 71  ? 88.021  35.972  45.588  1.00 56.05 ? 93  SER B N   1 
ATOM   4579 C CA  . SER B 1 71  ? 87.382  34.963  46.421  1.00 56.41 ? 93  SER B CA  1 
ATOM   4580 C C   . SER B 1 71  ? 87.971  34.863  47.823  1.00 66.05 ? 93  SER B C   1 
ATOM   4581 O O   . SER B 1 71  ? 87.444  34.103  48.642  1.00 75.52 ? 93  SER B O   1 
ATOM   4582 C CB  . SER B 1 71  ? 87.455  33.597  45.735  1.00 55.70 ? 93  SER B CB  1 
ATOM   4583 O OG  . SER B 1 71  ? 88.742  33.028  45.891  1.00 65.96 ? 93  SER B OG  1 
ATOM   4584 N N   . GLN B 1 72  ? 89.035  35.611  48.125  1.00 59.11 ? 94  GLN B N   1 
ATOM   4585 C CA  . GLN B 1 72  ? 89.654  35.629  49.455  1.00 63.17 ? 94  GLN B CA  1 
ATOM   4586 C C   . GLN B 1 72  ? 90.153  34.242  49.868  1.00 63.44 ? 94  GLN B C   1 
ATOM   4587 O O   . GLN B 1 72  ? 89.929  33.786  50.992  1.00 61.76 ? 94  GLN B O   1 
ATOM   4588 C CB  . GLN B 1 72  ? 88.703  36.197  50.517  1.00 68.00 ? 94  GLN B CB  1 
ATOM   4589 C CG  . GLN B 1 72  ? 87.701  37.242  50.027  1.00 76.06 ? 94  GLN B CG  1 
ATOM   4590 C CD  . GLN B 1 72  ? 88.348  38.553  49.614  1.00 79.09 ? 94  GLN B CD  1 
ATOM   4591 O OE1 . GLN B 1 72  ? 89.509  38.820  49.930  1.00 82.59 ? 94  GLN B OE1 1 
ATOM   4592 N NE2 . GLN B 1 72  ? 87.591  39.383  48.904  1.00 66.75 ? 94  GLN B NE2 1 
ATOM   4593 N N   . PHE B 1 73  ? 90.826  33.568  48.941  1.00 63.92 ? 95  PHE B N   1 
ATOM   4594 C CA  . PHE B 1 73  ? 91.610  32.367  49.226  1.00 55.58 ? 95  PHE B CA  1 
ATOM   4595 C C   . PHE B 1 73  ? 92.447  32.070  47.987  1.00 51.59 ? 95  PHE B C   1 
ATOM   4596 O O   . PHE B 1 73  ? 92.322  32.740  46.958  1.00 58.51 ? 95  PHE B O   1 
ATOM   4597 C CB  . PHE B 1 73  ? 90.740  31.167  49.627  1.00 56.61 ? 95  PHE B CB  1 
ATOM   4598 C CG  . PHE B 1 73  ? 89.608  30.864  48.678  1.00 55.03 ? 95  PHE B CG  1 
ATOM   4599 C CD1 . PHE B 1 73  ? 89.839  30.206  47.481  1.00 47.42 ? 95  PHE B CD1 1 
ATOM   4600 C CD2 . PHE B 1 73  ? 88.304  31.197  49.009  1.00 61.70 ? 95  PHE B CD2 1 
ATOM   4601 C CE1 . PHE B 1 73  ? 88.795  29.913  46.620  1.00 51.48 ? 95  PHE B CE1 1 
ATOM   4602 C CE2 . PHE B 1 73  ? 87.256  30.908  48.151  1.00 58.76 ? 95  PHE B CE2 1 
ATOM   4603 C CZ  . PHE B 1 73  ? 87.503  30.264  46.956  1.00 53.39 ? 95  PHE B CZ  1 
ATOM   4604 N N   . MET B 1 74  ? 93.317  31.062  48.095  1.00 45.95 ? 96  MET B N   1 
ATOM   4605 C CA  . MET B 1 74  ? 94.138  30.650  46.965  1.00 37.43 ? 96  MET B CA  1 
ATOM   4606 C C   . MET B 1 74  ? 93.394  29.600  46.155  1.00 38.29 ? 96  MET B C   1 
ATOM   4607 O O   . MET B 1 74  ? 93.149  28.496  46.669  1.00 34.87 ? 96  MET B O   1 
ATOM   4608 C CB  . MET B 1 74  ? 95.475  30.100  47.428  1.00 30.75 ? 96  MET B CB  1 
ATOM   4609 C CG  . MET B 1 74  ? 96.383  29.733  46.269  1.00 28.36 ? 96  MET B CG  1 
ATOM   4610 S SD  . MET B 1 74  ? 97.817  28.782  46.780  1.00 31.92 ? 96  MET B SD  1 
ATOM   4611 C CE  . MET B 1 74  ? 97.027  27.240  47.240  1.00 34.60 ? 96  MET B CE  1 
ATOM   4612 N N   . PRO B 1 75  ? 93.021  29.881  44.911  1.00 39.76 ? 97  PRO B N   1 
ATOM   4613 C CA  . PRO B 1 75  ? 92.359  28.860  44.094  1.00 36.16 ? 97  PRO B CA  1 
ATOM   4614 C C   . PRO B 1 75  ? 93.363  28.047  43.293  1.00 34.85 ? 97  PRO B C   1 
ATOM   4615 O O   . PRO B 1 75  ? 93.744  28.438  42.185  1.00 40.06 ? 97  PRO B O   1 
ATOM   4616 C CB  . PRO B 1 75  ? 91.437  29.684  43.182  1.00 35.34 ? 97  PRO B CB  1 
ATOM   4617 C CG  . PRO B 1 75  ? 91.812  31.155  43.419  1.00 42.57 ? 97  PRO B CG  1 
ATOM   4618 C CD  . PRO B 1 75  ? 93.076  31.173  44.216  1.00 37.73 ? 97  PRO B CD  1 
ATOM   4619 N N   . LEU B 1 76  ? 93.806  26.924  43.849  1.00 27.07 ? 98  LEU B N   1 
ATOM   4620 C CA  . LEU B 1 76  ? 94.724  26.019  43.171  1.00 28.44 ? 98  LEU B CA  1 
ATOM   4621 C C   . LEU B 1 76  ? 93.938  24.840  42.614  1.00 24.34 ? 98  LEU B C   1 
ATOM   4622 O O   . LEU B 1 76  ? 93.132  24.234  43.327  1.00 28.94 ? 98  LEU B O   1 
ATOM   4623 C CB  . LEU B 1 76  ? 95.816  25.533  44.126  1.00 30.64 ? 98  LEU B CB  1 
ATOM   4624 C CG  . LEU B 1 76  ? 96.719  24.402  43.631  1.00 31.02 ? 98  LEU B CG  1 
ATOM   4625 C CD1 . LEU B 1 76  ? 97.503  24.846  42.407  1.00 29.21 ? 98  LEU B CD1 1 
ATOM   4626 C CD2 . LEU B 1 76  ? 97.657  23.936  44.736  1.00 24.33 ? 98  LEU B CD2 1 
ATOM   4627 N N   . VAL B 1 77  ? 94.157  24.530  41.338  1.00 21.44 ? 99  VAL B N   1 
ATOM   4628 C CA  . VAL B 1 77  ? 93.479  23.426  40.669  1.00 25.76 ? 99  VAL B CA  1 
ATOM   4629 C C   . VAL B 1 77  ? 94.530  22.548  40.006  1.00 33.98 ? 99  VAL B C   1 
ATOM   4630 O O   . VAL B 1 77  ? 95.357  23.040  39.229  1.00 35.59 ? 99  VAL B O   1 
ATOM   4631 C CB  . VAL B 1 77  ? 92.456  23.919  39.627  1.00 25.69 ? 99  VAL B CB  1 
ATOM   4632 C CG1 . VAL B 1 77  ? 91.447  22.822  39.318  1.00 25.97 ? 99  VAL B CG1 1 
ATOM   4633 C CG2 . VAL B 1 77  ? 91.748  25.171  40.112  1.00 29.47 ? 99  VAL B CG2 1 
ATOM   4634 N N   . VAL B 1 78  ? 94.499  21.253  40.311  1.00 33.36 ? 100 VAL B N   1 
ATOM   4635 C CA  . VAL B 1 78  ? 95.389  20.274  39.700  1.00 23.90 ? 100 VAL B CA  1 
ATOM   4636 C C   . VAL B 1 78  ? 94.560  19.434  38.743  1.00 24.03 ? 100 VAL B C   1 
ATOM   4637 O O   . VAL B 1 78  ? 93.552  18.840  39.144  1.00 26.80 ? 100 VAL B O   1 
ATOM   4638 C CB  . VAL B 1 78  ? 96.080  19.392  40.748  1.00 25.89 ? 100 VAL B CB  1 
ATOM   4639 C CG1 . VAL B 1 78  ? 97.013  18.403  40.067  1.00 26.68 ? 100 VAL B CG1 1 
ATOM   4640 C CG2 . VAL B 1 78  ? 96.840  20.247  41.747  1.00 25.74 ? 100 VAL B CG2 1 
ATOM   4641 N N   . ASP B 1 79  ? 94.987  19.386  37.484  1.00 30.29 ? 101 ASP B N   1 
ATOM   4642 C CA  . ASP B 1 79  ? 94.297  18.673  36.412  1.00 32.29 ? 101 ASP B CA  1 
ATOM   4643 C C   . ASP B 1 79  ? 95.202  17.543  35.931  1.00 34.60 ? 101 ASP B C   1 
ATOM   4644 O O   . ASP B 1 79  ? 96.226  17.794  35.285  1.00 36.84 ? 101 ASP B O   1 
ATOM   4645 C CB  . ASP B 1 79  ? 93.953  19.634  35.273  1.00 33.11 ? 101 ASP B CB  1 
ATOM   4646 C CG  . ASP B 1 79  ? 92.905  19.078  34.326  1.00 42.48 ? 101 ASP B CG  1 
ATOM   4647 O OD1 . ASP B 1 79  ? 93.146  18.007  33.730  1.00 48.01 ? 101 ASP B OD1 1 
ATOM   4648 O OD2 . ASP B 1 79  ? 91.844  19.720  34.166  1.00 43.49 ? 101 ASP B OD2 1 
ATOM   4649 N N   . TYR B 1 80  ? 94.830  16.303  36.241  1.00 30.94 ? 102 TYR B N   1 
ATOM   4650 C CA  . TYR B 1 80  ? 95.624  15.136  35.878  1.00 38.14 ? 102 TYR B CA  1 
ATOM   4651 C C   . TYR B 1 80  ? 94.898  14.296  34.834  1.00 46.91 ? 102 TYR B C   1 
ATOM   4652 O O   . TYR B 1 80  ? 93.682  14.094  34.920  1.00 46.24 ? 102 TYR B O   1 
ATOM   4653 C CB  . TYR B 1 80  ? 95.938  14.273  37.105  1.00 33.32 ? 102 TYR B CB  1 
ATOM   4654 C CG  . TYR B 1 80  ? 96.689  13.003  36.772  1.00 36.92 ? 102 TYR B CG  1 
ATOM   4655 C CD1 . TYR B 1 80  ? 98.042  13.034  36.457  1.00 34.53 ? 102 TYR B CD1 1 
ATOM   4656 C CD2 . TYR B 1 80  ? 96.043  11.773  36.762  1.00 38.12 ? 102 TYR B CD2 1 
ATOM   4657 C CE1 . TYR B 1 80  ? 98.733  11.877  36.148  1.00 35.98 ? 102 TYR B CE1 1 
ATOM   4658 C CE2 . TYR B 1 80  ? 96.726  10.610  36.455  1.00 40.20 ? 102 TYR B CE2 1 
ATOM   4659 C CZ  . TYR B 1 80  ? 98.071  10.666  36.149  1.00 40.28 ? 102 TYR B CZ  1 
ATOM   4660 O OH  . TYR B 1 80  ? 98.753  9.508   35.842  1.00 37.19 ? 102 TYR B OH  1 
ATOM   4661 N N   . ARG B 1 81  ? 95.659  13.791  33.864  1.00 50.11 ? 103 ARG B N   1 
ATOM   4662 C CA  . ARG B 1 81  ? 95.138  13.005  32.752  1.00 48.46 ? 103 ARG B CA  1 
ATOM   4663 C C   . ARG B 1 81  ? 95.733  11.601  32.786  1.00 57.87 ? 103 ARG B C   1 
ATOM   4664 O O   . ARG B 1 81  ? 96.950  11.442  32.934  1.00 66.64 ? 103 ARG B O   1 
ATOM   4665 C CB  . ARG B 1 81  ? 95.465  13.688  31.413  1.00 52.08 ? 103 ARG B CB  1 
ATOM   4666 C CG  . ARG B 1 81  ? 95.806  12.745  30.247  1.00 61.03 ? 103 ARG B CG  1 
ATOM   4667 C CD  . ARG B 1 81  ? 94.595  11.927  29.796  1.00 71.09 ? 103 ARG B CD  1 
ATOM   4668 N NE  . ARG B 1 81  ? 94.890  11.025  28.687  1.00 74.71 ? 103 ARG B NE  1 
ATOM   4669 C CZ  . ARG B 1 81  ? 93.990  10.630  27.792  1.00 73.20 ? 103 ARG B CZ  1 
ATOM   4670 N NH1 . ARG B 1 81  ? 94.339  9.809   26.810  1.00 58.53 ? 103 ARG B NH1 1 
ATOM   4671 N NH2 . ARG B 1 81  ? 92.737  11.055  27.884  1.00 65.51 ? 103 ARG B NH2 1 
ATOM   4672 N N   . GLN B 1 82  ? 94.880  10.591  32.639  1.00 50.18 ? 104 GLN B N   1 
ATOM   4673 C CA  . GLN B 1 82  ? 95.357  9.236   32.372  1.00 55.94 ? 104 GLN B CA  1 
ATOM   4674 C C   . GLN B 1 82  ? 94.537  8.593   31.261  1.00 59.26 ? 104 GLN B C   1 
ATOM   4675 O O   . GLN B 1 82  ? 94.906  8.663   30.087  1.00 55.35 ? 104 GLN B O   1 
ATOM   4676 C CB  . GLN B 1 82  ? 95.314  8.365   33.630  1.00 50.48 ? 104 GLN B CB  1 
ATOM   4677 C CG  . GLN B 1 82  ? 96.138  7.088   33.500  1.00 54.96 ? 104 GLN B CG  1 
ATOM   4678 C CD  . GLN B 1 82  ? 96.961  6.776   34.741  1.00 56.56 ? 104 GLN B CD  1 
ATOM   4679 O OE1 . GLN B 1 82  ? 96.866  7.467   35.756  1.00 47.76 ? 104 GLN B OE1 1 
ATOM   4680 N NE2 . GLN B 1 82  ? 97.778  5.728   34.662  1.00 57.62 ? 104 GLN B NE2 1 
ATOM   4681 N N   . SER B 1 102 ? 86.449  8.536   35.930  1.00 66.90 ? 124 SER B N   1 
ATOM   4682 C CA  . SER B 1 102 ? 87.669  7.762   36.131  1.00 67.83 ? 124 SER B CA  1 
ATOM   4683 C C   . SER B 1 102 ? 88.309  8.073   37.480  1.00 58.13 ? 124 SER B C   1 
ATOM   4684 O O   . SER B 1 102 ? 89.190  8.927   37.563  1.00 59.24 ? 124 SER B O   1 
ATOM   4685 C CB  . SER B 1 102 ? 88.667  8.039   35.007  1.00 59.70 ? 124 SER B CB  1 
ATOM   4686 O OG  . SER B 1 102 ? 89.996  7.914   35.482  1.00 48.31 ? 124 SER B OG  1 
ATOM   4687 N N   . ASP B 1 103 ? 87.887  7.343   38.519  1.00 59.43 ? 125 ASP B N   1 
ATOM   4688 C CA  . ASP B 1 103 ? 88.291  7.649   39.892  1.00 52.59 ? 125 ASP B CA  1 
ATOM   4689 C C   . ASP B 1 103 ? 89.802  7.775   40.060  1.00 52.20 ? 125 ASP B C   1 
ATOM   4690 O O   . ASP B 1 103 ? 90.266  8.451   40.985  1.00 44.17 ? 125 ASP B O   1 
ATOM   4691 C CB  . ASP B 1 103 ? 87.760  6.575   40.842  1.00 54.63 ? 125 ASP B CB  1 
ATOM   4692 C CG  . ASP B 1 103 ? 86.254  6.579   40.940  1.00 68.36 ? 125 ASP B CG  1 
ATOM   4693 O OD1 . ASP B 1 103 ? 85.643  7.625   40.637  1.00 62.62 ? 125 ASP B OD1 1 
ATOM   4694 O OD2 . ASP B 1 103 ? 85.682  5.535   41.317  1.00 84.66 ? 125 ASP B OD2 1 
ATOM   4695 N N   . LYS B 1 104 ? 90.587  7.127   39.194  1.00 56.79 ? 126 LYS B N   1 
ATOM   4696 C CA  . LYS B 1 104 ? 92.039  7.230   39.300  1.00 51.47 ? 126 LYS B CA  1 
ATOM   4697 C C   . LYS B 1 104 ? 92.511  8.669   39.121  1.00 48.45 ? 126 LYS B C   1 
ATOM   4698 O O   . LYS B 1 104 ? 93.391  9.137   39.853  1.00 45.08 ? 126 LYS B O   1 
ATOM   4699 C CB  . LYS B 1 104 ? 92.705  6.319   38.269  1.00 51.61 ? 126 LYS B CB  1 
ATOM   4700 C CG  . LYS B 1 104 ? 94.220  6.258   38.383  1.00 47.05 ? 126 LYS B CG  1 
ATOM   4701 C CD  . LYS B 1 104 ? 94.655  5.089   39.252  1.00 57.82 ? 126 LYS B CD  1 
ATOM   4702 C CE  . LYS B 1 104 ? 95.985  5.366   39.936  1.00 48.95 ? 126 LYS B CE  1 
ATOM   4703 N NZ  . LYS B 1 104 ? 96.428  4.210   40.763  1.00 42.87 ? 126 LYS B NZ  1 
ATOM   4704 N N   . GLU B 1 105 ? 91.934  9.387   38.153  1.00 51.41 ? 127 GLU B N   1 
ATOM   4705 C CA  . GLU B 1 105 ? 92.367  10.754  37.879  1.00 44.10 ? 127 GLU B CA  1 
ATOM   4706 C C   . GLU B 1 105 ? 92.089  11.673  39.062  1.00 39.77 ? 127 GLU B C   1 
ATOM   4707 O O   . GLU B 1 105 ? 92.928  12.508  39.417  1.00 38.43 ? 127 GLU B O   1 
ATOM   4708 C CB  . GLU B 1 105 ? 91.673  11.280  36.623  1.00 38.85 ? 127 GLU B CB  1 
ATOM   4709 C CG  . GLU B 1 105 ? 92.128  10.599  35.348  1.00 50.10 ? 127 GLU B CG  1 
ATOM   4710 C CD  . GLU B 1 105 ? 91.484  11.179  34.104  1.00 56.76 ? 127 GLU B CD  1 
ATOM   4711 O OE1 . GLU B 1 105 ? 90.244  11.335  34.089  1.00 65.89 ? 127 GLU B OE1 1 
ATOM   4712 O OE2 . GLU B 1 105 ? 92.224  11.476  33.141  1.00 50.54 ? 127 GLU B OE2 1 
ATOM   4713 N N   . ILE B 1 106 ? 90.919  11.534  39.687  1.00 39.52 ? 128 ILE B N   1 
ATOM   4714 C CA  . ILE B 1 106 ? 90.553  12.429  40.780  1.00 40.85 ? 128 ILE B CA  1 
ATOM   4715 C C   . ILE B 1 106 ? 91.445  12.183  41.996  1.00 38.82 ? 128 ILE B C   1 
ATOM   4716 O O   . ILE B 1 106 ? 91.960  13.128  42.606  1.00 37.62 ? 128 ILE B O   1 
ATOM   4717 C CB  . ILE B 1 106 ? 89.056  12.287  41.127  1.00 41.87 ? 128 ILE B CB  1 
ATOM   4718 C CG1 . ILE B 1 106 ? 88.139  12.548  39.919  1.00 45.97 ? 128 ILE B CG1 1 
ATOM   4719 C CG2 . ILE B 1 106 ? 88.677  13.232  42.239  1.00 43.27 ? 128 ILE B CG2 1 
ATOM   4720 C CD1 . ILE B 1 106 ? 87.841  11.351  39.023  1.00 54.21 ? 128 ILE B CD1 1 
ATOM   4721 N N   . LEU B 1 107 ? 91.643  10.913  42.364  1.00 41.06 ? 129 LEU B N   1 
ATOM   4722 C CA  . LEU B 1 107 ? 92.509  10.594  43.497  1.00 30.69 ? 129 LEU B CA  1 
ATOM   4723 C C   . LEU B 1 107 ? 93.947  11.025  43.232  1.00 34.85 ? 129 LEU B C   1 
ATOM   4724 O O   . LEU B 1 107 ? 94.635  11.504  44.141  1.00 34.10 ? 129 LEU B O   1 
ATOM   4725 C CB  . LEU B 1 107 ? 92.444  9.098   43.805  1.00 30.49 ? 129 LEU B CB  1 
ATOM   4726 C CG  . LEU B 1 107 ? 91.068  8.527   44.163  1.00 33.80 ? 129 LEU B CG  1 
ATOM   4727 C CD1 . LEU B 1 107 ? 91.173  7.048   44.498  1.00 32.92 ? 129 LEU B CD1 1 
ATOM   4728 C CD2 . LEU B 1 107 ? 90.432  9.298   45.316  1.00 27.39 ? 129 LEU B CD2 1 
ATOM   4729 N N   . THR B 1 108 ? 94.419  10.868  41.992  1.00 37.20 ? 130 THR B N   1 
ATOM   4730 C CA  . THR B 1 108 ? 95.766  11.320  41.660  1.00 27.25 ? 130 THR B CA  1 
ATOM   4731 C C   . THR B 1 108 ? 95.861  12.838  41.705  1.00 29.94 ? 130 THR B C   1 
ATOM   4732 O O   . THR B 1 108 ? 96.842  13.388  42.220  1.00 28.97 ? 130 THR B O   1 
ATOM   4733 C CB  . THR B 1 108 ? 96.178  10.806  40.282  1.00 26.50 ? 130 THR B CB  1 
ATOM   4734 O OG1 . THR B 1 108 ? 96.067  9.380   40.247  1.00 35.04 ? 130 THR B OG1 1 
ATOM   4735 C CG2 . THR B 1 108 ? 97.615  11.203  39.973  1.00 22.58 ? 130 THR B CG2 1 
ATOM   4736 N N   . SER B 1 109 ? 94.850  13.532  41.170  1.00 31.83 ? 131 SER B N   1 
ATOM   4737 C CA  . SER B 1 109 ? 94.869  14.991  41.169  1.00 24.62 ? 131 SER B CA  1 
ATOM   4738 C C   . SER B 1 109 ? 94.961  15.536  42.583  1.00 27.07 ? 131 SER B C   1 
ATOM   4739 O O   . SER B 1 109 ? 95.678  16.509  42.840  1.00 27.66 ? 131 SER B O   1 
ATOM   4740 C CB  . SER B 1 109 ? 93.623  15.539  40.477  1.00 28.43 ? 131 SER B CB  1 
ATOM   4741 O OG  . SER B 1 109 ? 93.603  15.193  39.105  1.00 41.80 ? 131 SER B OG  1 
ATOM   4742 N N   . ARG B 1 110 ? 94.252  14.916  43.517  1.00 25.11 ? 132 ARG B N   1 
ATOM   4743 C CA  . ARG B 1 110 ? 94.305  15.407  44.881  1.00 24.76 ? 132 ARG B CA  1 
ATOM   4744 C C   . ARG B 1 110 ? 95.589  14.985  45.586  1.00 26.03 ? 132 ARG B C   1 
ATOM   4745 O O   . ARG B 1 110 ? 96.065  15.711  46.463  1.00 25.80 ? 132 ARG B O   1 
ATOM   4746 C CB  . ARG B 1 110 ? 93.060  14.949  45.640  1.00 27.27 ? 132 ARG B CB  1 
ATOM   4747 C CG  . ARG B 1 110 ? 91.772  15.589  45.099  1.00 45.54 ? 132 ARG B CG  1 
ATOM   4748 C CD  . ARG B 1 110 ? 91.931  17.109  44.861  1.00 56.88 ? 132 ARG B CD  1 
ATOM   4749 N NE  . ARG B 1 110 ? 91.602  17.524  43.492  1.00 50.95 ? 132 ARG B NE  1 
ATOM   4750 C CZ  . ARG B 1 110 ? 91.818  18.744  42.997  1.00 43.08 ? 132 ARG B CZ  1 
ATOM   4751 N NH1 . ARG B 1 110 ? 92.365  19.690  43.751  1.00 33.88 ? 132 ARG B NH1 1 
ATOM   4752 N NH2 . ARG B 1 110 ? 91.485  19.023  41.742  1.00 40.43 ? 132 ARG B NH2 1 
ATOM   4753 N N   . ILE B 1 111 ? 96.179  13.845  45.208  1.00 25.64 ? 133 ILE B N   1 
ATOM   4754 C CA  . ILE B 1 111 ? 97.485  13.473  45.753  1.00 22.63 ? 133 ILE B CA  1 
ATOM   4755 C C   . ILE B 1 111 ? 98.534  14.502  45.349  1.00 24.47 ? 133 ILE B C   1 
ATOM   4756 O O   . ILE B 1 111 ? 99.378  14.908  46.158  1.00 24.50 ? 133 ILE B O   1 
ATOM   4757 C CB  . ILE B 1 111 ? 97.883  12.055  45.299  1.00 23.55 ? 133 ILE B CB  1 
ATOM   4758 C CG1 . ILE B 1 111 ? 97.158  10.989  46.119  1.00 34.34 ? 133 ILE B CG1 1 
ATOM   4759 C CG2 . ILE B 1 111 ? 99.373  11.843  45.451  1.00 20.82 ? 133 ILE B CG2 1 
ATOM   4760 C CD1 . ILE B 1 111 ? 97.676  9.577   45.865  1.00 21.14 ? 133 ILE B CD1 1 
ATOM   4761 N N   . ILE B 1 112 ? 98.495  14.940  44.091  1.00 24.40 ? 134 ILE B N   1 
ATOM   4762 C CA  . ILE B 1 112 ? 99.383  16.006  43.644  1.00 19.41 ? 134 ILE B CA  1 
ATOM   4763 C C   . ILE B 1 112 ? 99.078  17.295  44.390  1.00 22.36 ? 134 ILE B C   1 
ATOM   4764 O O   . ILE B 1 112 ? 99.989  18.002  44.842  1.00 23.96 ? 134 ILE B O   1 
ATOM   4765 C CB  . ILE B 1 112 ? 99.256  16.194  42.123  1.00 22.83 ? 134 ILE B CB  1 
ATOM   4766 C CG1 . ILE B 1 112 ? 99.611  14.894  41.398  1.00 24.91 ? 134 ILE B CG1 1 
ATOM   4767 C CG2 . ILE B 1 112 ? 100.123 17.350  41.657  1.00 20.99 ? 134 ILE B CG2 1 
ATOM   4768 C CD1 . ILE B 1 112 ? 99.089  14.828  39.986  1.00 20.69 ? 134 ILE B CD1 1 
ATOM   4769 N N   . ASP B 1 113 ? 97.791  17.617  44.534  1.00 23.97 ? 135 ASP B N   1 
ATOM   4770 C CA  . ASP B 1 113 ? 97.392  18.841  45.223  1.00 25.42 ? 135 ASP B CA  1 
ATOM   4771 C C   . ASP B 1 113 ? 97.978  18.897  46.629  1.00 28.77 ? 135 ASP B C   1 
ATOM   4772 O O   . ASP B 1 113 ? 98.575  19.905  47.026  1.00 28.36 ? 135 ASP B O   1 
ATOM   4773 C CB  . ASP B 1 113 ? 95.866  18.933  45.268  1.00 24.34 ? 135 ASP B CB  1 
ATOM   4774 C CG  . ASP B 1 113 ? 95.376  20.315  45.638  1.00 26.22 ? 135 ASP B CG  1 
ATOM   4775 O OD1 . ASP B 1 113 ? 95.494  20.694  46.825  1.00 28.34 ? 135 ASP B OD1 1 
ATOM   4776 O OD2 . ASP B 1 113 ? 94.870  21.022  44.739  1.00 32.13 ? 135 ASP B OD2 1 
ATOM   4777 N N   . ARG B 1 114 ? 97.829  17.811  47.393  1.00 25.02 ? 136 ARG B N   1 
ATOM   4778 C CA  . ARG B 1 114 ? 98.332  17.778  48.760  1.00 19.96 ? 136 ARG B CA  1 
ATOM   4779 C C   . ARG B 1 114 ? 99.850  17.880  48.821  1.00 24.08 ? 136 ARG B C   1 
ATOM   4780 O O   . ARG B 1 114 ? 100.389 18.317  49.845  1.00 24.85 ? 136 ARG B O   1 
ATOM   4781 C CB  . ARG B 1 114 ? 97.862  16.500  49.459  1.00 19.18 ? 136 ARG B CB  1 
ATOM   4782 C CG  . ARG B 1 114 ? 96.353  16.308  49.435  1.00 20.42 ? 136 ARG B CG  1 
ATOM   4783 C CD  . ARG B 1 114 ? 95.814  15.722  50.732  1.00 26.83 ? 136 ARG B CD  1 
ATOM   4784 N NE  . ARG B 1 114 ? 96.599  14.583  51.201  1.00 33.50 ? 136 ARG B NE  1 
ATOM   4785 C CZ  . ARG B 1 114 ? 96.487  13.348  50.718  1.00 37.92 ? 136 ARG B CZ  1 
ATOM   4786 N NH1 . ARG B 1 114 ? 95.622  13.088  49.743  1.00 33.54 ? 136 ARG B NH1 1 
ATOM   4787 N NH2 . ARG B 1 114 ? 97.243  12.373  51.208  1.00 30.33 ? 136 ARG B NH2 1 
ATOM   4788 N N   . SER B 1 115 ? 100.550 17.505  47.747  1.00 21.88 ? 137 SER B N   1 
ATOM   4789 C CA  . SER B 1 115 ? 102.008 17.530  47.755  1.00 21.40 ? 137 SER B CA  1 
ATOM   4790 C C   . SER B 1 115 ? 102.583 18.916  47.501  1.00 20.03 ? 137 SER B C   1 
ATOM   4791 O O   . SER B 1 115 ? 103.733 19.165  47.873  1.00 22.47 ? 137 SER B O   1 
ATOM   4792 C CB  . SER B 1 115 ? 102.559 16.561  46.710  1.00 17.17 ? 137 SER B CB  1 
ATOM   4793 O OG  . SER B 1 115 ? 102.058 15.254  46.914  1.00 18.88 ? 137 SER B OG  1 
ATOM   4794 N N   . ILE B 1 116 ? 101.824 19.811  46.875  1.00 24.40 ? 138 ILE B N   1 
ATOM   4795 C CA  . ILE B 1 116 ? 102.327 21.134  46.530  1.00 21.93 ? 138 ILE B CA  1 
ATOM   4796 C C   . ILE B 1 116 ? 101.599 22.257  47.253  1.00 21.61 ? 138 ILE B C   1 
ATOM   4797 O O   . ILE B 1 116 ? 102.115 23.385  47.286  1.00 24.86 ? 138 ILE B O   1 
ATOM   4798 C CB  . ILE B 1 116 ? 102.270 21.367  45.004  1.00 26.12 ? 138 ILE B CB  1 
ATOM   4799 C CG1 . ILE B 1 116 ? 100.831 21.639  44.558  1.00 23.17 ? 138 ILE B CG1 1 
ATOM   4800 C CG2 . ILE B 1 116 ? 102.843 20.172  44.254  1.00 18.99 ? 138 ILE B CG2 1 
ATOM   4801 C CD1 . ILE B 1 116 ? 100.691 21.887  43.070  1.00 19.88 ? 138 ILE B CD1 1 
ATOM   4802 N N   . ARG B 1 117 ? 100.429 22.005  47.832  1.00 24.03 ? 139 ARG B N   1 
ATOM   4803 C CA  . ARG B 1 117 ? 99.653  23.085  48.440  1.00 24.10 ? 139 ARG B CA  1 
ATOM   4804 C C   . ARG B 1 117 ? 100.346 23.749  49.624  1.00 23.36 ? 139 ARG B C   1 
ATOM   4805 O O   . ARG B 1 117 ? 100.367 24.991  49.673  1.00 26.97 ? 139 ARG B O   1 
ATOM   4806 C CB  . ARG B 1 117 ? 98.269  22.561  48.836  1.00 22.70 ? 139 ARG B CB  1 
ATOM   4807 C CG  . ARG B 1 117 ? 97.316  23.637  49.325  1.00 21.64 ? 139 ARG B CG  1 
ATOM   4808 C CD  . ARG B 1 117 ? 95.903  23.098  49.440  1.00 23.06 ? 139 ARG B CD  1 
ATOM   4809 N NE  . ARG B 1 117 ? 95.305  22.874  48.130  1.00 20.49 ? 139 ARG B NE  1 
ATOM   4810 C CZ  . ARG B 1 117 ? 94.479  23.728  47.534  1.00 23.09 ? 139 ARG B CZ  1 
ATOM   4811 N NH1 . ARG B 1 117 ? 94.148  24.864  48.135  1.00 18.66 ? 139 ARG B NH1 1 
ATOM   4812 N NH2 . ARG B 1 117 ? 93.985  23.447  46.336  1.00 21.81 ? 139 ARG B NH2 1 
ATOM   4813 N N   . PRO B 1 118 ? 100.912 23.027  50.600  1.00 29.43 ? 140 PRO B N   1 
ATOM   4814 C CA  . PRO B 1 118 ? 101.431 23.707  51.798  1.00 24.17 ? 140 PRO B CA  1 
ATOM   4815 C C   . PRO B 1 118 ? 102.632 24.605  51.545  1.00 25.22 ? 140 PRO B C   1 
ATOM   4816 O O   . PRO B 1 118 ? 103.067 25.294  52.473  1.00 30.76 ? 140 PRO B O   1 
ATOM   4817 C CB  . PRO B 1 118 ? 101.815 22.543  52.730  1.00 21.68 ? 140 PRO B CB  1 
ATOM   4818 C CG  . PRO B 1 118 ? 101.154 21.334  52.161  1.00 22.93 ? 140 PRO B CG  1 
ATOM   4819 C CD  . PRO B 1 118 ? 101.108 21.567  50.693  1.00 26.42 ? 140 PRO B CD  1 
ATOM   4820 N N   . LEU B 1 119 ? 103.178 24.639  50.332  1.00 24.86 ? 141 LEU B N   1 
ATOM   4821 C CA  . LEU B 1 119 ? 104.402 25.382  50.065  1.00 27.28 ? 141 LEU B CA  1 
ATOM   4822 C C   . LEU B 1 119 ? 104.163 26.735  49.407  1.00 29.51 ? 141 LEU B C   1 
ATOM   4823 O O   . LEU B 1 119 ? 105.132 27.440  49.106  1.00 31.95 ? 141 LEU B O   1 
ATOM   4824 C CB  . LEU B 1 119 ? 105.340 24.541  49.199  1.00 21.88 ? 141 LEU B CB  1 
ATOM   4825 C CG  . LEU B 1 119 ? 105.756 23.237  49.876  1.00 22.30 ? 141 LEU B CG  1 
ATOM   4826 C CD1 . LEU B 1 119 ? 106.954 22.647  49.176  1.00 25.47 ? 141 LEU B CD1 1 
ATOM   4827 C CD2 . LEU B 1 119 ? 106.067 23.480  51.350  1.00 24.81 ? 141 LEU B CD2 1 
ATOM   4828 N N   . PHE B 1 120 ? 102.914 27.114  49.173  1.00 27.85 ? 142 PHE B N   1 
ATOM   4829 C CA  . PHE B 1 120 ? 102.652 28.461  48.699  1.00 27.52 ? 142 PHE B CA  1 
ATOM   4830 C C   . PHE B 1 120 ? 102.641 29.433  49.878  1.00 34.89 ? 142 PHE B C   1 
ATOM   4831 O O   . PHE B 1 120 ? 102.268 29.062  50.995  1.00 38.46 ? 142 PHE B O   1 
ATOM   4832 C CB  . PHE B 1 120 ? 101.316 28.519  47.964  1.00 30.86 ? 142 PHE B CB  1 
ATOM   4833 C CG  . PHE B 1 120 ? 101.296 27.751  46.669  1.00 34.79 ? 142 PHE B CG  1 
ATOM   4834 C CD1 . PHE B 1 120 ? 101.720 28.345  45.488  1.00 34.65 ? 142 PHE B CD1 1 
ATOM   4835 C CD2 . PHE B 1 120 ? 100.846 26.441  46.631  1.00 28.20 ? 142 PHE B CD2 1 
ATOM   4836 C CE1 . PHE B 1 120 ? 101.699 27.643  44.292  1.00 28.46 ? 142 PHE B CE1 1 
ATOM   4837 C CE2 . PHE B 1 120 ? 100.823 25.734  45.440  1.00 29.89 ? 142 PHE B CE2 1 
ATOM   4838 C CZ  . PHE B 1 120 ? 101.252 26.338  44.268  1.00 26.35 ? 142 PHE B CZ  1 
ATOM   4839 N N   . PRO B 1 121 ? 103.058 30.678  49.664  1.00 35.97 ? 143 PRO B N   1 
ATOM   4840 C CA  . PRO B 1 121 ? 103.041 31.650  50.761  1.00 34.00 ? 143 PRO B CA  1 
ATOM   4841 C C   . PRO B 1 121 ? 101.618 31.994  51.166  1.00 35.35 ? 143 PRO B C   1 
ATOM   4842 O O   . PRO B 1 121 ? 100.683 31.918  50.365  1.00 36.78 ? 143 PRO B O   1 
ATOM   4843 C CB  . PRO B 1 121 ? 103.762 32.867  50.171  1.00 33.54 ? 143 PRO B CB  1 
ATOM   4844 C CG  . PRO B 1 121 ? 103.569 32.738  48.700  1.00 37.44 ? 143 PRO B CG  1 
ATOM   4845 C CD  . PRO B 1 121 ? 103.577 31.261  48.416  1.00 38.09 ? 143 PRO B CD  1 
ATOM   4846 N N   . ALA B 1 122 ? 101.462 32.369  52.432  1.00 33.71 ? 144 ALA B N   1 
ATOM   4847 C CA  . ALA B 1 122 ? 100.151 32.741  52.943  1.00 28.70 ? 144 ALA B CA  1 
ATOM   4848 C C   . ALA B 1 122 ? 99.638  33.991  52.239  1.00 29.76 ? 144 ALA B C   1 
ATOM   4849 O O   . ALA B 1 122 ? 100.410 34.840  51.787  1.00 33.78 ? 144 ALA B O   1 
ATOM   4850 C CB  . ALA B 1 122 ? 100.210 32.976  54.451  1.00 36.75 ? 144 ALA B CB  1 
ATOM   4851 N N   . GLY B 1 123 ? 98.314  34.094  52.144  1.00 38.88 ? 145 GLY B N   1 
ATOM   4852 C CA  . GLY B 1 123 ? 97.699  35.226  51.481  1.00 48.00 ? 145 GLY B CA  1 
ATOM   4853 C C   . GLY B 1 123 ? 97.907  35.292  49.984  1.00 50.31 ? 145 GLY B C   1 
ATOM   4854 O O   . GLY B 1 123 ? 97.546  36.299  49.368  1.00 53.79 ? 145 GLY B O   1 
ATOM   4855 N N   . TYR B 1 124 ? 98.481  34.250  49.379  1.00 42.73 ? 146 TYR B N   1 
ATOM   4856 C CA  . TYR B 1 124 ? 98.721  34.208  47.937  1.00 45.39 ? 146 TYR B CA  1 
ATOM   4857 C C   . TYR B 1 124 ? 97.412  33.878  47.216  1.00 41.86 ? 146 TYR B C   1 
ATOM   4858 O O   . TYR B 1 124 ? 97.190  32.772  46.720  1.00 46.83 ? 146 TYR B O   1 
ATOM   4859 C CB  . TYR B 1 124 ? 99.811  33.194  47.615  1.00 44.27 ? 146 TYR B CB  1 
ATOM   4860 C CG  . TYR B 1 124 ? 100.280 33.229  46.183  1.00 43.15 ? 146 TYR B CG  1 
ATOM   4861 C CD1 . TYR B 1 124 ? 101.112 34.245  45.732  1.00 45.26 ? 146 TYR B CD1 1 
ATOM   4862 C CD2 . TYR B 1 124 ? 99.891  32.247  45.281  1.00 36.47 ? 146 TYR B CD2 1 
ATOM   4863 C CE1 . TYR B 1 124 ? 101.543 34.285  44.423  1.00 48.69 ? 146 TYR B CE1 1 
ATOM   4864 C CE2 . TYR B 1 124 ? 100.316 32.279  43.967  1.00 45.51 ? 146 TYR B CE2 1 
ATOM   4865 C CZ  . TYR B 1 124 ? 101.143 33.301  43.543  1.00 48.09 ? 146 TYR B CZ  1 
ATOM   4866 O OH  . TYR B 1 124 ? 101.573 33.340  42.236  1.00 45.07 ? 146 TYR B OH  1 
ATOM   4867 N N   . PHE B 1 125 ? 96.533  34.878  47.154  1.00 40.87 ? 147 PHE B N   1 
ATOM   4868 C CA  . PHE B 1 125 ? 95.186  34.687  46.609  1.00 46.17 ? 147 PHE B CA  1 
ATOM   4869 C C   . PHE B 1 125 ? 95.200  34.970  45.106  1.00 46.32 ? 147 PHE B C   1 
ATOM   4870 O O   . PHE B 1 125 ? 94.657  35.961  44.613  1.00 49.45 ? 147 PHE B O   1 
ATOM   4871 C CB  . PHE B 1 125 ? 94.179  35.572  47.337  1.00 49.62 ? 147 PHE B CB  1 
ATOM   4872 C CG  . PHE B 1 125 ? 94.053  35.284  48.814  1.00 56.57 ? 147 PHE B CG  1 
ATOM   4873 C CD1 . PHE B 1 125 ? 94.673  34.182  49.388  1.00 55.99 ? 147 PHE B CD1 1 
ATOM   4874 C CD2 . PHE B 1 125 ? 93.309  36.122  49.629  1.00 62.36 ? 147 PHE B CD2 1 
ATOM   4875 C CE1 . PHE B 1 125 ? 94.557  33.928  50.743  1.00 54.84 ? 147 PHE B CE1 1 
ATOM   4876 C CE2 . PHE B 1 125 ? 93.190  35.871  50.984  1.00 59.62 ? 147 PHE B CE2 1 
ATOM   4877 C CZ  . PHE B 1 125 ? 93.815  34.773  51.541  1.00 56.21 ? 147 PHE B CZ  1 
ATOM   4878 N N   . TYR B 1 126 ? 95.833  34.057  44.370  1.00 39.63 ? 148 TYR B N   1 
ATOM   4879 C CA  . TYR B 1 126 ? 96.009  34.196  42.931  1.00 41.52 ? 148 TYR B CA  1 
ATOM   4880 C C   . TYR B 1 126 ? 95.674  32.884  42.233  1.00 38.76 ? 148 TYR B C   1 
ATOM   4881 O O   . TYR B 1 126 ? 96.265  31.844  42.541  1.00 41.70 ? 148 TYR B O   1 
ATOM   4882 C CB  . TYR B 1 126 ? 97.439  34.630  42.599  1.00 43.55 ? 148 TYR B CB  1 
ATOM   4883 C CG  . TYR B 1 126 ? 97.823  35.954  43.224  1.00 49.84 ? 148 TYR B CG  1 
ATOM   4884 C CD1 . TYR B 1 126 ? 98.405  36.004  44.485  1.00 52.47 ? 148 TYR B CD1 1 
ATOM   4885 C CD2 . TYR B 1 126 ? 97.597  37.153  42.558  1.00 47.32 ? 148 TYR B CD2 1 
ATOM   4886 C CE1 . TYR B 1 126 ? 98.757  37.210  45.065  1.00 53.55 ? 148 TYR B CE1 1 
ATOM   4887 C CE2 . TYR B 1 126 ? 97.946  38.365  43.130  1.00 53.37 ? 148 TYR B CE2 1 
ATOM   4888 C CZ  . TYR B 1 126 ? 98.526  38.387  44.384  1.00 57.43 ? 148 TYR B CZ  1 
ATOM   4889 O OH  . TYR B 1 126 ? 98.877  39.587  44.962  1.00 56.16 ? 148 TYR B OH  1 
ATOM   4890 N N   . ASP B 1 127 ? 94.732  32.948  41.291  1.00 37.03 ? 149 ASP B N   1 
ATOM   4891 C CA  . ASP B 1 127 ? 94.282  31.791  40.520  1.00 40.18 ? 149 ASP B CA  1 
ATOM   4892 C C   . ASP B 1 127 ? 95.459  31.025  39.932  1.00 40.68 ? 149 ASP B C   1 
ATOM   4893 O O   . ASP B 1 127 ? 96.187  31.544  39.083  1.00 39.31 ? 149 ASP B O   1 
ATOM   4894 C CB  . ASP B 1 127 ? 93.347  32.263  39.401  1.00 46.09 ? 149 ASP B CB  1 
ATOM   4895 C CG  . ASP B 1 127 ? 92.272  31.247  39.060  1.00 46.53 ? 149 ASP B CG  1 
ATOM   4896 O OD1 . ASP B 1 127 ? 92.609  30.192  38.481  1.00 47.17 ? 149 ASP B OD1 1 
ATOM   4897 O OD2 . ASP B 1 127 ? 91.086  31.512  39.359  1.00 42.54 ? 149 ASP B OD2 1 
ATOM   4898 N N   . THR B 1 128 ? 95.631  29.779  40.373  1.00 38.81 ? 150 THR B N   1 
ATOM   4899 C CA  . THR B 1 128 ? 96.761  28.948  39.978  1.00 31.99 ? 150 THR B CA  1 
ATOM   4900 C C   . THR B 1 128 ? 96.252  27.628  39.421  1.00 31.08 ? 150 THR B C   1 
ATOM   4901 O O   . THR B 1 128 ? 95.392  26.984  40.031  1.00 31.47 ? 150 THR B O   1 
ATOM   4902 C CB  . THR B 1 128 ? 97.694  28.706  41.168  1.00 30.63 ? 150 THR B CB  1 
ATOM   4903 O OG1 . THR B 1 128 ? 97.955  29.955  41.821  1.00 27.19 ? 150 THR B OG1 1 
ATOM   4904 C CG2 . THR B 1 128 ? 99.015  28.087  40.714  1.00 25.31 ? 150 THR B CG2 1 
ATOM   4905 N N   . GLN B 1 129 ? 96.782  27.230  38.265  1.00 32.23 ? 151 GLN B N   1 
ATOM   4906 C CA  . GLN B 1 129 ? 96.370  26.005  37.589  1.00 34.79 ? 151 GLN B CA  1 
ATOM   4907 C C   . GLN B 1 129 ? 97.596  25.150  37.308  1.00 35.91 ? 151 GLN B C   1 
ATOM   4908 O O   . GLN B 1 129 ? 98.599  25.650  36.788  1.00 35.81 ? 151 GLN B O   1 
ATOM   4909 C CB  . GLN B 1 129 ? 95.630  26.308  36.280  1.00 33.81 ? 151 GLN B CB  1 
ATOM   4910 C CG  . GLN B 1 129 ? 94.181  26.736  36.460  1.00 41.54 ? 151 GLN B CG  1 
ATOM   4911 C CD  . GLN B 1 129 ? 93.927  28.157  35.980  1.00 58.15 ? 151 GLN B CD  1 
ATOM   4912 O OE1 . GLN B 1 129 ? 94.774  29.040  36.136  1.00 56.69 ? 151 GLN B OE1 1 
ATOM   4913 N NE2 . GLN B 1 129 ? 92.755  28.384  35.393  1.00 59.27 ? 151 GLN B NE2 1 
ATOM   4914 N N   . VAL B 1 130 ? 97.511  23.867  37.649  1.00 31.64 ? 152 VAL B N   1 
ATOM   4915 C CA  . VAL B 1 130 ? 98.588  22.910  37.424  1.00 29.79 ? 152 VAL B CA  1 
ATOM   4916 C C   . VAL B 1 130 ? 98.016  21.774  36.589  1.00 29.04 ? 152 VAL B C   1 
ATOM   4917 O O   . VAL B 1 130 ? 97.254  20.944  37.101  1.00 31.29 ? 152 VAL B O   1 
ATOM   4918 C CB  . VAL B 1 130 ? 99.180  22.385  38.738  1.00 28.77 ? 152 VAL B CB  1 
ATOM   4919 C CG1 . VAL B 1 130 ? 100.361 21.469  38.460  1.00 24.30 ? 152 VAL B CG1 1 
ATOM   4920 C CG2 . VAL B 1 130 ? 99.593  23.541  39.635  1.00 31.00 ? 152 VAL B CG2 1 
ATOM   4921 N N   . LEU B 1 131 ? 98.382  21.731  35.311  1.00 29.33 ? 153 LEU B N   1 
ATOM   4922 C CA  . LEU B 1 131 ? 97.851  20.759  34.366  1.00 28.42 ? 153 LEU B CA  1 
ATOM   4923 C C   . LEU B 1 131 ? 98.918  19.728  34.032  1.00 32.17 ? 153 LEU B C   1 
ATOM   4924 O O   . LEU B 1 131 ? 100.047 20.087  33.678  1.00 34.13 ? 153 LEU B O   1 
ATOM   4925 C CB  . LEU B 1 131 ? 97.371  21.442  33.083  1.00 32.25 ? 153 LEU B CB  1 
ATOM   4926 C CG  . LEU B 1 131 ? 96.595  20.548  32.110  1.00 36.59 ? 153 LEU B CG  1 
ATOM   4927 C CD1 . LEU B 1 131 ? 95.294  21.213  31.689  1.00 47.16 ? 153 LEU B CD1 1 
ATOM   4928 C CD2 . LEU B 1 131 ? 97.436  20.201  30.897  1.00 36.68 ? 153 LEU B CD2 1 
ATOM   4929 N N   . CYS B 1 132 ? 98.555  18.453  34.132  1.00 34.77 ? 154 CYS B N   1 
ATOM   4930 C CA  . CYS B 1 132 ? 99.442  17.349  33.795  1.00 32.08 ? 154 CYS B CA  1 
ATOM   4931 C C   . CYS B 1 132 ? 98.933  16.669  32.536  1.00 33.53 ? 154 CYS B C   1 
ATOM   4932 O O   . CYS B 1 132 ? 97.749  16.329  32.441  1.00 37.71 ? 154 CYS B O   1 
ATOM   4933 C CB  . CYS B 1 132 ? 99.528  16.343  34.942  1.00 30.68 ? 154 CYS B CB  1 
ATOM   4934 S SG  . CYS B 1 132 ? 99.692  17.124  36.545  1.00 28.62 ? 154 CYS B SG  1 
ATOM   4935 N N   . ASN B 1 133 ? 99.827  16.478  31.574  1.00 35.45 ? 155 ASN B N   1 
ATOM   4936 C CA  . ASN B 1 133 ? 99.502  15.857  30.299  1.00 31.53 ? 155 ASN B CA  1 
ATOM   4937 C C   . ASN B 1 133 ? 100.412 14.651  30.123  1.00 32.06 ? 155 ASN B C   1 
ATOM   4938 O O   . ASN B 1 133 ? 101.637 14.801  30.056  1.00 34.39 ? 155 ASN B O   1 
ATOM   4939 C CB  . ASN B 1 133 ? 99.668  16.863  29.154  1.00 35.30 ? 155 ASN B CB  1 
ATOM   4940 C CG  . ASN B 1 133 ? 99.424  16.252  27.784  1.00 36.35 ? 155 ASN B CG  1 
ATOM   4941 O OD1 . ASN B 1 133 ? 98.716  15.253  27.643  1.00 32.84 ? 155 ASN B OD1 1 
ATOM   4942 N ND2 . ASN B 1 133 ? 100.012 16.862  26.760  1.00 37.64 ? 155 ASN B ND2 1 
ATOM   4943 N N   . LEU B 1 134 ? 99.817  13.460  30.080  1.00 32.88 ? 156 LEU B N   1 
ATOM   4944 C CA  . LEU B 1 134 ? 100.581 12.236  29.863  1.00 35.12 ? 156 LEU B CA  1 
ATOM   4945 C C   . LEU B 1 134 ? 101.051 12.176  28.416  1.00 40.30 ? 156 LEU B C   1 
ATOM   4946 O O   . LEU B 1 134 ? 100.231 12.202  27.492  1.00 57.86 ? 156 LEU B O   1 
ATOM   4947 C CB  . LEU B 1 134 ? 99.726  11.017  30.193  1.00 42.80 ? 156 LEU B CB  1 
ATOM   4948 C CG  . LEU B 1 134 ? 100.069 10.239  31.464  1.00 46.82 ? 156 LEU B CG  1 
ATOM   4949 C CD1 . LEU B 1 134 ? 100.138 11.172  32.662  1.00 52.15 ? 156 LEU B CD1 1 
ATOM   4950 C CD2 . LEU B 1 134 ? 99.044  9.147   31.705  1.00 48.90 ? 156 LEU B CD2 1 
ATOM   4951 N N   . LEU B 1 135 ? 102.365 12.096  28.213  1.00 30.01 ? 157 LEU B N   1 
ATOM   4952 C CA  . LEU B 1 135 ? 102.907 12.041  26.861  1.00 35.84 ? 157 LEU B CA  1 
ATOM   4953 C C   . LEU B 1 135 ? 103.116 10.616  26.365  1.00 43.31 ? 157 LEU B C   1 
ATOM   4954 O O   . LEU B 1 135 ? 103.008 10.367  25.157  1.00 47.45 ? 157 LEU B O   1 
ATOM   4955 C CB  . LEU B 1 135 ? 104.226 12.814  26.788  1.00 31.35 ? 157 LEU B CB  1 
ATOM   4956 C CG  . LEU B 1 135 ? 104.146 14.289  27.190  1.00 32.79 ? 157 LEU B CG  1 
ATOM   4957 C CD1 . LEU B 1 135 ? 105.442 15.012  26.857  1.00 31.77 ? 157 LEU B CD1 1 
ATOM   4958 C CD2 . LEU B 1 135 ? 102.960 14.972  26.524  1.00 28.67 ? 157 LEU B CD2 1 
ATOM   4959 N N   . ALA B 1 136 ? 103.405 9.679   27.264  1.00 38.34 ? 158 ALA B N   1 
ATOM   4960 C CA  . ALA B 1 136 ? 103.597 8.285   26.893  1.00 30.29 ? 158 ALA B CA  1 
ATOM   4961 C C   . ALA B 1 136 ? 103.418 7.422   28.130  1.00 40.28 ? 158 ALA B C   1 
ATOM   4962 O O   . ALA B 1 136 ? 103.700 7.855   29.251  1.00 45.06 ? 158 ALA B O   1 
ATOM   4963 C CB  . ALA B 1 136 ? 104.980 8.046   26.275  1.00 30.62 ? 158 ALA B CB  1 
ATOM   4964 N N   . VAL B 1 137 ? 102.945 6.196   27.913  1.00 42.60 ? 159 VAL B N   1 
ATOM   4965 C CA  . VAL B 1 137 ? 102.776 5.215   28.979  1.00 37.45 ? 159 VAL B CA  1 
ATOM   4966 C C   . VAL B 1 137 ? 103.285 3.878   28.456  1.00 43.35 ? 159 VAL B C   1 
ATOM   4967 O O   . VAL B 1 137 ? 102.814 3.395   27.420  1.00 49.54 ? 159 VAL B O   1 
ATOM   4968 C CB  . VAL B 1 137 ? 101.311 5.097   29.438  1.00 37.07 ? 159 VAL B CB  1 
ATOM   4969 C CG1 . VAL B 1 137 ? 101.030 3.710   30.009  1.00 45.02 ? 159 VAL B CG1 1 
ATOM   4970 C CG2 . VAL B 1 137 ? 100.993 6.172   30.460  1.00 34.44 ? 159 VAL B CG2 1 
ATOM   4971 N N   . ASP B 1 138 ? 104.253 3.289   29.156  1.00 40.44 ? 160 ASP B N   1 
ATOM   4972 C CA  . ASP B 1 138 ? 104.823 2.013   28.751  1.00 33.97 ? 160 ASP B CA  1 
ATOM   4973 C C   . ASP B 1 138 ? 104.167 0.822   29.436  1.00 38.13 ? 160 ASP B C   1 
ATOM   4974 O O   . ASP B 1 138 ? 104.628 -0.310  29.252  1.00 47.26 ? 160 ASP B O   1 
ATOM   4975 C CB  . ASP B 1 138 ? 106.339 1.995   29.011  1.00 42.71 ? 160 ASP B CB  1 
ATOM   4976 C CG  . ASP B 1 138 ? 106.707 2.305   30.461  1.00 43.64 ? 160 ASP B CG  1 
ATOM   4977 O OD1 . ASP B 1 138 ? 105.876 2.088   31.369  1.00 42.84 ? 160 ASP B OD1 1 
ATOM   4978 O OD2 . ASP B 1 138 ? 107.848 2.765   30.692  1.00 39.05 ? 160 ASP B OD2 1 
ATOM   4979 N N   . GLY B 1 139 ? 103.110 1.044   30.216  1.00 41.18 ? 161 GLY B N   1 
ATOM   4980 C CA  . GLY B 1 139 ? 102.484 -0.025  30.966  1.00 48.31 ? 161 GLY B CA  1 
ATOM   4981 C C   . GLY B 1 139 ? 103.321 -0.609  32.083  1.00 49.12 ? 161 GLY B C   1 
ATOM   4982 O O   . GLY B 1 139 ? 102.838 -1.502  32.790  1.00 45.15 ? 161 GLY B O   1 
ATOM   4983 N N   . VAL B 1 140 ? 104.554 -0.139  32.268  1.00 38.41 ? 162 VAL B N   1 
ATOM   4984 C CA  . VAL B 1 140 ? 105.439 -0.608  33.325  1.00 40.99 ? 162 VAL B CA  1 
ATOM   4985 C C   . VAL B 1 140 ? 105.620 0.451   34.411  1.00 44.03 ? 162 VAL B C   1 
ATOM   4986 O O   . VAL B 1 140 ? 105.374 0.191   35.589  1.00 42.91 ? 162 VAL B O   1 
ATOM   4987 C CB  . VAL B 1 140 ? 106.802 -1.050  32.747  1.00 40.57 ? 162 VAL B CB  1 
ATOM   4988 C CG1 . VAL B 1 140 ? 107.866 -1.057  33.831  1.00 38.51 ? 162 VAL B CG1 1 
ATOM   4989 C CG2 . VAL B 1 140 ? 106.682 -2.426  32.107  1.00 44.69 ? 162 VAL B CG2 1 
ATOM   4990 N N   . ASN B 1 141 ? 106.042 1.654   34.028  1.00 42.21 ? 163 ASN B N   1 
ATOM   4991 C CA  . ASN B 1 141 ? 106.236 2.747   34.971  1.00 34.18 ? 163 ASN B CA  1 
ATOM   4992 C C   . ASN B 1 141 ? 104.941 3.536   35.122  1.00 31.86 ? 163 ASN B C   1 
ATOM   4993 O O   . ASN B 1 141 ? 104.367 3.993   34.128  1.00 31.64 ? 163 ASN B O   1 
ATOM   4994 C CB  . ASN B 1 141 ? 107.366 3.666   34.508  1.00 35.61 ? 163 ASN B CB  1 
ATOM   4995 C CG  . ASN B 1 141 ? 108.713 2.971   34.490  1.00 41.98 ? 163 ASN B CG  1 
ATOM   4996 O OD1 . ASN B 1 141 ? 109.537 3.159   35.387  1.00 51.81 ? 163 ASN B OD1 1 
ATOM   4997 N ND2 . ASN B 1 141 ? 108.946 2.160   33.466  1.00 42.66 ? 163 ASN B ND2 1 
ATOM   4998 N N   . GLU B 1 142 ? 104.490 3.696   36.363  1.00 29.45 ? 164 GLU B N   1 
ATOM   4999 C CA  . GLU B 1 142 ? 103.243 4.405   36.623  1.00 28.73 ? 164 GLU B CA  1 
ATOM   5000 C C   . GLU B 1 142 ? 103.478 5.910   36.566  1.00 30.50 ? 164 GLU B C   1 
ATOM   5001 O O   . GLU B 1 142 ? 104.449 6.403   37.150  1.00 27.50 ? 164 GLU B O   1 
ATOM   5002 C CB  . GLU B 1 142 ? 102.674 4.015   37.982  1.00 31.82 ? 164 GLU B CB  1 
ATOM   5003 C CG  . GLU B 1 142 ? 102.181 2.575   38.071  1.00 39.49 ? 164 GLU B CG  1 
ATOM   5004 C CD  . GLU B 1 142 ? 100.978 2.309   37.184  1.00 42.60 ? 164 GLU B CD  1 
ATOM   5005 O OE1 . GLU B 1 142 ? 101.073 1.447   36.284  1.00 39.54 ? 164 GLU B OE1 1 
ATOM   5006 O OE2 . GLU B 1 142 ? 99.939  2.973   37.382  1.00 46.59 ? 164 GLU B OE2 1 
ATOM   5007 N N   . PRO B 1 143 ? 102.616 6.669   35.884  1.00 31.14 ? 165 PRO B N   1 
ATOM   5008 C CA  . PRO B 1 143 ? 102.856 8.110   35.735  1.00 25.73 ? 165 PRO B CA  1 
ATOM   5009 C C   . PRO B 1 143 ? 102.415 8.957   36.918  1.00 25.44 ? 165 PRO B C   1 
ATOM   5010 O O   . PRO B 1 143 ? 102.807 10.130  36.985  1.00 26.71 ? 165 PRO B O   1 
ATOM   5011 C CB  . PRO B 1 143 ? 102.043 8.464   34.484  1.00 29.63 ? 165 PRO B CB  1 
ATOM   5012 C CG  . PRO B 1 143 ? 100.920 7.481   34.487  1.00 29.89 ? 165 PRO B CG  1 
ATOM   5013 C CD  . PRO B 1 143 ? 101.457 6.211   35.097  1.00 33.14 ? 165 PRO B CD  1 
ATOM   5014 N N   . ASP B 1 144 ? 101.622 8.415   37.848  1.00 25.87 ? 166 ASP B N   1 
ATOM   5015 C CA  . ASP B 1 144 ? 101.092 9.237   38.934  1.00 24.38 ? 166 ASP B CA  1 
ATOM   5016 C C   . ASP B 1 144 ? 102.210 9.823   39.788  1.00 28.26 ? 166 ASP B C   1 
ATOM   5017 O O   . ASP B 1 144 ? 102.148 10.992  40.190  1.00 23.91 ? 166 ASP B O   1 
ATOM   5018 C CB  . ASP B 1 144 ? 100.129 8.420   39.798  1.00 28.90 ? 166 ASP B CB  1 
ATOM   5019 C CG  . ASP B 1 144 ? 100.697 7.067   40.195  1.00 26.65 ? 166 ASP B CG  1 
ATOM   5020 O OD1 . ASP B 1 144 ? 101.792 6.711   39.712  1.00 28.85 ? 166 ASP B OD1 1 
ATOM   5021 O OD2 . ASP B 1 144 ? 100.043 6.358   40.990  1.00 20.41 ? 166 ASP B OD2 1 
ATOM   5022 N N   . VAL B 1 145 ? 103.245 9.030   40.071  1.00 27.36 ? 167 VAL B N   1 
ATOM   5023 C CA  . VAL B 1 145 ? 104.376 9.537   40.839  1.00 23.35 ? 167 VAL B CA  1 
ATOM   5024 C C   . VAL B 1 145 ? 105.156 10.565  40.025  1.00 22.99 ? 167 VAL B C   1 
ATOM   5025 O O   . VAL B 1 145 ? 105.592 11.596  40.556  1.00 20.91 ? 167 VAL B O   1 
ATOM   5026 C CB  . VAL B 1 145 ? 105.265 8.368   41.300  1.00 22.45 ? 167 VAL B CB  1 
ATOM   5027 C CG1 . VAL B 1 145 ? 106.572 8.880   41.876  1.00 25.47 ? 167 VAL B CG1 1 
ATOM   5028 C CG2 . VAL B 1 145 ? 104.528 7.527   42.325  1.00 18.53 ? 167 VAL B CG2 1 
ATOM   5029 N N   . LEU B 1 146 ? 105.328 10.313  38.723  1.00 26.62 ? 168 LEU B N   1 
ATOM   5030 C CA  . LEU B 1 146 ? 106.014 11.274  37.864  1.00 21.81 ? 168 LEU B CA  1 
ATOM   5031 C C   . LEU B 1 146 ? 105.265 12.598  37.807  1.00 21.78 ? 168 LEU B C   1 
ATOM   5032 O O   . LEU B 1 146 ? 105.885 13.666  37.728  1.00 20.47 ? 168 LEU B O   1 
ATOM   5033 C CB  . LEU B 1 146 ? 106.185 10.703  36.455  1.00 22.84 ? 168 LEU B CB  1 
ATOM   5034 C CG  . LEU B 1 146 ? 106.515 9.215   36.302  1.00 31.97 ? 168 LEU B CG  1 
ATOM   5035 C CD1 . LEU B 1 146 ? 106.636 8.849   34.833  1.00 30.61 ? 168 LEU B CD1 1 
ATOM   5036 C CD2 . LEU B 1 146 ? 107.792 8.852   37.047  1.00 26.29 ? 168 LEU B CD2 1 
ATOM   5037 N N   . ALA B 1 147 ? 103.930 12.548  37.848  1.00 22.79 ? 169 ALA B N   1 
ATOM   5038 C CA  . ALA B 1 147 ? 103.133 13.772  37.806  1.00 22.73 ? 169 ALA B CA  1 
ATOM   5039 C C   . ALA B 1 147 ? 103.390 14.641  39.031  1.00 23.23 ? 169 ALA B C   1 
ATOM   5040 O O   . ALA B 1 147 ? 103.595 15.855  38.909  1.00 21.33 ? 169 ALA B O   1 
ATOM   5041 C CB  . ALA B 1 147 ? 101.647 13.429  37.692  1.00 20.50 ? 169 ALA B CB  1 
ATOM   5042 N N   . ILE B 1 148 ? 103.372 14.038  40.225  1.00 20.38 ? 170 ILE B N   1 
ATOM   5043 C CA  . ILE B 1 148 ? 103.659 14.795  41.442  1.00 23.30 ? 170 ILE B CA  1 
ATOM   5044 C C   . ILE B 1 148 ? 104.993 15.512  41.311  1.00 21.41 ? 170 ILE B C   1 
ATOM   5045 O O   . ILE B 1 148 ? 105.104 16.713  41.581  1.00 19.96 ? 170 ILE B O   1 
ATOM   5046 C CB  . ILE B 1 148 ? 103.644 13.874  42.676  1.00 24.84 ? 170 ILE B CB  1 
ATOM   5047 C CG1 . ILE B 1 148 ? 102.395 12.994  42.700  1.00 22.34 ? 170 ILE B CG1 1 
ATOM   5048 C CG2 . ILE B 1 148 ? 103.715 14.699  43.943  1.00 18.06 ? 170 ILE B CG2 1 
ATOM   5049 C CD1 . ILE B 1 148 ? 102.474 11.879  43.714  1.00 16.65 ? 170 ILE B CD1 1 
ATOM   5050 N N   . ASN B 1 149 ? 106.027 14.780  40.889  1.00 18.73 ? 171 ASN B N   1 
ATOM   5051 C CA  . ASN B 1 149 ? 107.325 15.404  40.662  1.00 21.83 ? 171 ASN B CA  1 
ATOM   5052 C C   . ASN B 1 149 ? 107.241 16.454  39.565  1.00 25.12 ? 171 ASN B C   1 
ATOM   5053 O O   . ASN B 1 149 ? 107.793 17.552  39.703  1.00 26.29 ? 171 ASN B O   1 
ATOM   5054 C CB  . ASN B 1 149 ? 108.362 14.338  40.314  1.00 24.62 ? 171 ASN B CB  1 
ATOM   5055 C CG  . ASN B 1 149 ? 108.656 13.416  41.481  1.00 25.03 ? 171 ASN B CG  1 
ATOM   5056 O OD1 . ASN B 1 149 ? 109.263 13.830  42.473  1.00 18.56 ? 171 ASN B OD1 1 
ATOM   5057 N ND2 . ASN B 1 149 ? 108.226 12.160  41.372  1.00 19.92 ? 171 ASN B ND2 1 
ATOM   5058 N N   . GLY B 1 150 ? 106.549 16.136  38.468  1.00 23.58 ? 172 GLY B N   1 
ATOM   5059 C CA  . GLY B 1 150 ? 106.356 17.122  37.420  1.00 25.60 ? 172 GLY B CA  1 
ATOM   5060 C C   . GLY B 1 150 ? 105.723 18.400  37.934  1.00 29.27 ? 172 GLY B C   1 
ATOM   5061 O O   . GLY B 1 150 ? 106.124 19.502  37.548  1.00 32.98 ? 172 GLY B O   1 
ATOM   5062 N N   . ALA B 1 151 ? 104.734 18.272  38.822  1.00 27.08 ? 173 ALA B N   1 
ATOM   5063 C CA  . ALA B 1 151 ? 104.148 19.454  39.445  1.00 25.15 ? 173 ALA B CA  1 
ATOM   5064 C C   . ALA B 1 151 ? 105.172 20.210  40.283  1.00 28.38 ? 173 ALA B C   1 
ATOM   5065 O O   . ALA B 1 151 ? 105.102 21.441  40.386  1.00 31.51 ? 173 ALA B O   1 
ATOM   5066 C CB  . ALA B 1 151 ? 102.945 19.059  40.300  1.00 13.83 ? 173 ALA B CB  1 
ATOM   5067 N N   . SER B 1 152 ? 106.130 19.502  40.882  1.00 26.30 ? 174 SER B N   1 
ATOM   5068 C CA  . SER B 1 152 ? 107.156 20.181  41.665  1.00 27.92 ? 174 SER B CA  1 
ATOM   5069 C C   . SER B 1 152 ? 108.114 20.951  40.764  1.00 31.91 ? 174 SER B C   1 
ATOM   5070 O O   . SER B 1 152 ? 108.429 22.117  41.028  1.00 32.67 ? 174 SER B O   1 
ATOM   5071 C CB  . SER B 1 152 ? 107.919 19.177  42.524  1.00 24.16 ? 174 SER B CB  1 
ATOM   5072 O OG  . SER B 1 152 ? 108.885 19.837  43.324  1.00 25.42 ? 174 SER B OG  1 
ATOM   5073 N N   . VAL B 1 153 ? 108.584 20.314  39.688  1.00 33.35 ? 175 VAL B N   1 
ATOM   5074 C CA  . VAL B 1 153 ? 109.560 20.965  38.819  1.00 32.41 ? 175 VAL B CA  1 
ATOM   5075 C C   . VAL B 1 153 ? 108.944 22.172  38.130  1.00 28.11 ? 175 VAL B C   1 
ATOM   5076 O O   . VAL B 1 153 ? 109.577 23.229  38.026  1.00 29.83 ? 175 VAL B O   1 
ATOM   5077 C CB  . VAL B 1 153 ? 110.124 19.972  37.790  1.00 27.98 ? 175 VAL B CB  1 
ATOM   5078 C CG1 . VAL B 1 153 ? 111.272 20.617  37.042  1.00 20.56 ? 175 VAL B CG1 1 
ATOM   5079 C CG2 . VAL B 1 153 ? 110.562 18.684  38.470  1.00 26.85 ? 175 VAL B CG2 1 
ATOM   5080 N N   . ALA B 1 154 ? 107.711 22.032  37.640  1.00 28.45 ? 176 ALA B N   1 
ATOM   5081 C CA  . ALA B 1 154 ? 107.049 23.147  36.974  1.00 28.99 ? 176 ALA B CA  1 
ATOM   5082 C C   . ALA B 1 154 ? 107.033 24.380  37.868  1.00 31.91 ? 176 ALA B C   1 
ATOM   5083 O O   . ALA B 1 154 ? 107.486 25.457  37.467  1.00 26.35 ? 176 ALA B O   1 
ATOM   5084 C CB  . ALA B 1 154 ? 105.631 22.748  36.563  1.00 25.06 ? 176 ALA B CB  1 
ATOM   5085 N N   . LEU B 1 155 ? 106.554 24.226  39.106  1.00 34.30 ? 177 LEU B N   1 
ATOM   5086 C CA  . LEU B 1 155 ? 106.516 25.360  40.024  1.00 29.18 ? 177 LEU B CA  1 
ATOM   5087 C C   . LEU B 1 155 ? 107.921 25.825  40.383  1.00 26.54 ? 177 LEU B C   1 
ATOM   5088 O O   . LEU B 1 155 ? 108.164 27.029  40.516  1.00 31.75 ? 177 LEU B O   1 
ATOM   5089 C CB  . LEU B 1 155 ? 105.729 24.996  41.285  1.00 29.58 ? 177 LEU B CB  1 
ATOM   5090 C CG  . LEU B 1 155 ? 104.202 24.915  41.174  1.00 24.12 ? 177 LEU B CG  1 
ATOM   5091 C CD1 . LEU B 1 155 ? 103.634 23.976  42.229  1.00 20.74 ? 177 LEU B CD1 1 
ATOM   5092 C CD2 . LEU B 1 155 ? 103.568 26.295  41.288  1.00 21.44 ? 177 LEU B CD2 1 
ATOM   5093 N N   . SER B 1 156 ? 108.860 24.887  40.535  1.00 24.88 ? 178 SER B N   1 
ATOM   5094 C CA  . SER B 1 156 ? 110.227 25.258  40.891  1.00 26.26 ? 178 SER B CA  1 
ATOM   5095 C C   . SER B 1 156 ? 110.895 26.055  39.778  1.00 36.61 ? 178 SER B C   1 
ATOM   5096 O O   . SER B 1 156 ? 111.645 27.001  40.049  1.00 38.79 ? 178 SER B O   1 
ATOM   5097 C CB  . SER B 1 156 ? 111.042 24.008  41.217  1.00 28.42 ? 178 SER B CB  1 
ATOM   5098 O OG  . SER B 1 156 ? 110.836 23.608  42.560  1.00 34.00 ? 178 SER B OG  1 
ATOM   5099 N N   . LEU B 1 157 ? 110.644 25.683  38.520  1.00 35.65 ? 179 LEU B N   1 
ATOM   5100 C CA  . LEU B 1 157 ? 111.149 26.433  37.377  1.00 32.52 ? 179 LEU B CA  1 
ATOM   5101 C C   . LEU B 1 157 ? 110.284 27.637  37.032  1.00 34.73 ? 179 LEU B C   1 
ATOM   5102 O O   . LEU B 1 157 ? 110.715 28.481  36.240  1.00 40.26 ? 179 LEU B O   1 
ATOM   5103 C CB  . LEU B 1 157 ? 111.250 25.527  36.146  1.00 26.85 ? 179 LEU B CB  1 
ATOM   5104 C CG  . LEU B 1 157 ? 112.206 24.339  36.204  1.00 24.14 ? 179 LEU B CG  1 
ATOM   5105 C CD1 . LEU B 1 157 ? 112.314 23.686  34.843  1.00 24.78 ? 179 LEU B CD1 1 
ATOM   5106 C CD2 . LEU B 1 157 ? 113.564 24.787  36.687  1.00 41.82 ? 179 LEU B CD2 1 
ATOM   5107 N N   . SER B 1 158 ? 109.090 27.739  37.604  1.00 30.90 ? 180 SER B N   1 
ATOM   5108 C CA  . SER B 1 158 ? 108.139 28.757  37.197  1.00 36.06 ? 180 SER B CA  1 
ATOM   5109 C C   . SER B 1 158 ? 108.420 30.095  37.873  1.00 44.16 ? 180 SER B C   1 
ATOM   5110 O O   . SER B 1 158 ? 109.316 30.242  38.711  1.00 43.81 ? 180 SER B O   1 
ATOM   5111 C CB  . SER B 1 158 ? 106.714 28.323  37.522  1.00 38.93 ? 180 SER B CB  1 
ATOM   5112 O OG  . SER B 1 158 ? 106.335 28.778  38.812  1.00 36.31 ? 180 SER B OG  1 
ATOM   5113 N N   . ASP B 1 159 ? 107.617 31.082  37.476  1.00 50.11 ? 181 ASP B N   1 
ATOM   5114 C CA  . ASP B 1 159 ? 107.554 32.363  38.163  1.00 49.20 ? 181 ASP B CA  1 
ATOM   5115 C C   . ASP B 1 159 ? 106.975 32.211  39.569  1.00 50.18 ? 181 ASP B C   1 
ATOM   5116 O O   . ASP B 1 159 ? 107.427 32.890  40.497  1.00 47.71 ? 181 ASP B O   1 
ATOM   5117 C CB  . ASP B 1 159 ? 106.706 33.325  37.315  1.00 45.56 ? 181 ASP B CB  1 
ATOM   5118 C CG  . ASP B 1 159 ? 106.695 34.747  37.840  1.00 59.86 ? 181 ASP B CG  1 
ATOM   5119 O OD1 . ASP B 1 159 ? 107.185 34.988  38.959  1.00 63.73 ? 181 ASP B OD1 1 
ATOM   5120 O OD2 . ASP B 1 159 ? 106.178 35.630  37.122  1.00 60.18 ? 181 ASP B OD2 1 
ATOM   5121 N N   . ILE B 1 160 ? 106.026 31.294  39.750  1.00 44.06 ? 182 ILE B N   1 
ATOM   5122 C CA  . ILE B 1 160 ? 105.132 31.309  40.918  1.00 36.84 ? 182 ILE B CA  1 
ATOM   5123 C C   . ILE B 1 160 ? 105.936 31.185  42.207  1.00 39.97 ? 182 ILE B C   1 
ATOM   5124 O O   . ILE B 1 160 ? 106.822 30.312  42.309  1.00 40.86 ? 182 ILE B O   1 
ATOM   5125 C CB  . ILE B 1 160 ? 104.099 30.180  40.812  1.00 36.96 ? 182 ILE B CB  1 
ATOM   5126 C CG1 . ILE B 1 160 ? 103.120 30.485  39.686  1.00 35.78 ? 182 ILE B CG1 1 
ATOM   5127 C CG2 . ILE B 1 160 ? 103.347 30.008  42.122  1.00 38.23 ? 182 ILE B CG2 1 
ATOM   5128 C CD1 . ILE B 1 160 ? 103.088 29.428  38.607  1.00 46.40 ? 182 ILE B CD1 1 
ATOM   5129 N N   . PRO B 1 161 ? 105.676 32.023  43.216  1.00 36.19 ? 183 PRO B N   1 
ATOM   5130 C CA  . PRO B 1 161 ? 106.330 31.842  44.517  1.00 35.47 ? 183 PRO B CA  1 
ATOM   5131 C C   . PRO B 1 161 ? 105.931 30.522  45.149  1.00 34.00 ? 183 PRO B C   1 
ATOM   5132 O O   . PRO B 1 161 ? 104.802 30.372  45.623  1.00 36.29 ? 183 PRO B O   1 
ATOM   5133 C CB  . PRO B 1 161 ? 105.826 33.033  45.343  1.00 38.70 ? 183 PRO B CB  1 
ATOM   5134 C CG  . PRO B 1 161 ? 105.288 34.014  44.347  1.00 44.30 ? 183 PRO B CG  1 
ATOM   5135 C CD  . PRO B 1 161 ? 104.780 33.190  43.203  1.00 42.62 ? 183 PRO B CD  1 
ATOM   5136 N N   . TRP B 1 162 ? 106.844 29.556  45.151  1.00 35.94 ? 184 TRP B N   1 
ATOM   5137 C CA  . TRP B 1 162 ? 106.567 28.228  45.689  1.00 28.15 ? 184 TRP B CA  1 
ATOM   5138 C C   . TRP B 1 162 ? 107.824 27.735  46.389  1.00 31.10 ? 184 TRP B C   1 
ATOM   5139 O O   . TRP B 1 162 ? 108.822 27.424  45.730  1.00 36.79 ? 184 TRP B O   1 
ATOM   5140 C CB  . TRP B 1 162 ? 106.139 27.266  44.583  1.00 26.18 ? 184 TRP B CB  1 
ATOM   5141 C CG  . TRP B 1 162 ? 105.599 25.984  45.092  1.00 22.44 ? 184 TRP B CG  1 
ATOM   5142 C CD1 . TRP B 1 162 ? 104.427 25.797  45.766  1.00 24.08 ? 184 TRP B CD1 1 
ATOM   5143 C CD2 . TRP B 1 162 ? 106.205 24.695  44.972  1.00 20.60 ? 184 TRP B CD2 1 
ATOM   5144 N NE1 . TRP B 1 162 ? 104.266 24.468  46.071  1.00 25.27 ? 184 TRP B NE1 1 
ATOM   5145 C CE2 . TRP B 1 162 ? 105.345 23.769  45.596  1.00 22.03 ? 184 TRP B CE2 1 
ATOM   5146 C CE3 . TRP B 1 162 ? 107.393 24.233  44.401  1.00 22.42 ? 184 TRP B CE3 1 
ATOM   5147 C CZ2 . TRP B 1 162 ? 105.635 22.410  45.662  1.00 21.04 ? 184 TRP B CZ2 1 
ATOM   5148 C CZ3 . TRP B 1 162 ? 107.680 22.881  44.467  1.00 24.42 ? 184 TRP B CZ3 1 
ATOM   5149 C CH2 . TRP B 1 162 ? 106.805 21.986  45.093  1.00 24.07 ? 184 TRP B CH2 1 
ATOM   5150 N N   . ASN B 1 163 ? 107.769 27.657  47.721  1.00 29.00 ? 185 ASN B N   1 
ATOM   5151 C CA  . ASN B 1 163 ? 108.938 27.327  48.537  1.00 31.07 ? 185 ASN B CA  1 
ATOM   5152 C C   . ASN B 1 163 ? 109.158 25.815  48.540  1.00 26.83 ? 185 ASN B C   1 
ATOM   5153 O O   . ASN B 1 163 ? 108.970 25.119  49.539  1.00 33.98 ? 185 ASN B O   1 
ATOM   5154 C CB  . ASN B 1 163 ? 108.770 27.871  49.949  1.00 28.30 ? 185 ASN B CB  1 
ATOM   5155 C CG  . ASN B 1 163 ? 108.402 29.343  49.964  1.00 40.37 ? 185 ASN B CG  1 
ATOM   5156 O OD1 . ASN B 1 163 ? 109.146 30.184  49.458  1.00 51.70 ? 185 ASN B OD1 1 
ATOM   5157 N ND2 . ASN B 1 163 ? 107.251 29.663  50.544  1.00 34.63 ? 185 ASN B ND2 1 
ATOM   5158 N N   . GLY B 1 164 ? 109.577 25.309  47.385  1.00 24.83 ? 186 GLY B N   1 
ATOM   5159 C CA  . GLY B 1 164 ? 109.946 23.922  47.252  1.00 32.20 ? 186 GLY B CA  1 
ATOM   5160 C C   . GLY B 1 164 ? 111.451 23.756  47.196  1.00 33.99 ? 186 GLY B C   1 
ATOM   5161 O O   . GLY B 1 164 ? 112.202 24.506  47.828  1.00 31.20 ? 186 GLY B O   1 
ATOM   5162 N N   . PRO B 1 165 ? 111.930 22.770  46.421  1.00 32.23 ? 187 PRO B N   1 
ATOM   5163 C CA  . PRO B 1 165 ? 111.115 21.824  45.654  1.00 35.26 ? 187 PRO B CA  1 
ATOM   5164 C C   . PRO B 1 165 ? 110.644 20.627  46.474  1.00 34.21 ? 187 PRO B C   1 
ATOM   5165 O O   . PRO B 1 165 ? 111.066 20.449  47.617  1.00 26.08 ? 187 PRO B O   1 
ATOM   5166 C CB  . PRO B 1 165 ? 112.063 21.361  44.538  1.00 35.84 ? 187 PRO B CB  1 
ATOM   5167 C CG  . PRO B 1 165 ? 113.291 22.228  44.652  1.00 39.76 ? 187 PRO B CG  1 
ATOM   5168 C CD  . PRO B 1 165 ? 113.351 22.651  46.075  1.00 37.23 ? 187 PRO B CD  1 
ATOM   5169 N N   . VAL B 1 166 ? 109.782 19.813  45.867  1.00 32.35 ? 188 VAL B N   1 
ATOM   5170 C CA  . VAL B 1 166 ? 109.200 18.635  46.494  1.00 27.60 ? 188 VAL B CA  1 
ATOM   5171 C C   . VAL B 1 166 ? 109.645 17.406  45.715  1.00 25.71 ? 188 VAL B C   1 
ATOM   5172 O O   . VAL B 1 166 ? 109.662 17.413  44.481  1.00 34.33 ? 188 VAL B O   1 
ATOM   5173 C CB  . VAL B 1 166 ? 107.658 18.728  46.542  1.00 24.58 ? 188 VAL B CB  1 
ATOM   5174 C CG1 . VAL B 1 166 ? 107.015 17.348  46.540  1.00 23.58 ? 188 VAL B CG1 1 
ATOM   5175 C CG2 . VAL B 1 166 ? 107.221 19.493  47.758  1.00 21.54 ? 188 VAL B CG2 1 
ATOM   5176 N N   . GLY B 1 167 ? 110.019 16.355  46.435  1.00 25.62 ? 189 GLY B N   1 
ATOM   5177 C CA  . GLY B 1 167 ? 110.293 15.060  45.843  1.00 24.70 ? 189 GLY B CA  1 
ATOM   5178 C C   . GLY B 1 167 ? 109.210 14.082  46.251  1.00 26.53 ? 189 GLY B C   1 
ATOM   5179 O O   . GLY B 1 167 ? 108.672 14.164  47.357  1.00 29.35 ? 189 GLY B O   1 
ATOM   5180 N N   . ALA B 1 168 ? 108.886 13.156  45.352  1.00 21.15 ? 190 ALA B N   1 
ATOM   5181 C CA  . ALA B 1 168 ? 107.806 12.213  45.606  1.00 16.62 ? 190 ALA B CA  1 
ATOM   5182 C C   . ALA B 1 168 ? 108.133 10.870  44.974  1.00 22.11 ? 190 ALA B C   1 
ATOM   5183 O O   . ALA B 1 168 ? 108.510 10.803  43.799  1.00 27.02 ? 190 ALA B O   1 
ATOM   5184 C CB  . ALA B 1 168 ? 106.473 12.743  45.068  1.00 21.59 ? 190 ALA B CB  1 
ATOM   5185 N N   . VAL B 1 169 ? 107.986 9.803   45.759  1.00 24.14 ? 191 VAL B N   1 
ATOM   5186 C CA  . VAL B 1 169 ? 108.242 8.445   45.302  1.00 19.14 ? 191 VAL B CA  1 
ATOM   5187 C C   . VAL B 1 169 ? 107.143 7.537   45.832  1.00 22.64 ? 191 VAL B C   1 
ATOM   5188 O O   . VAL B 1 169 ? 106.400 7.888   46.754  1.00 20.19 ? 191 VAL B O   1 
ATOM   5189 C CB  . VAL B 1 169 ? 109.615 7.916   45.765  1.00 26.36 ? 191 VAL B CB  1 
ATOM   5190 C CG1 . VAL B 1 169 ? 110.744 8.772   45.208  1.00 25.12 ? 191 VAL B CG1 1 
ATOM   5191 C CG2 . VAL B 1 169 ? 109.671 7.854   47.291  1.00 19.66 ? 191 VAL B CG2 1 
ATOM   5192 N N   . ARG B 1 170 ? 107.044 6.359   45.231  1.00 23.32 ? 192 ARG B N   1 
ATOM   5193 C CA  . ARG B 1 170 ? 106.254 5.274   45.785  1.00 24.08 ? 192 ARG B CA  1 
ATOM   5194 C C   . ARG B 1 170 ? 107.185 4.290   46.481  1.00 24.83 ? 192 ARG B C   1 
ATOM   5195 O O   . ARG B 1 170 ? 108.369 4.185   46.148  1.00 26.98 ? 192 ARG B O   1 
ATOM   5196 C CB  . ARG B 1 170 ? 105.443 4.562   44.698  1.00 22.30 ? 192 ARG B CB  1 
ATOM   5197 C CG  . ARG B 1 170 ? 104.565 3.426   45.209  1.00 18.30 ? 192 ARG B CG  1 
ATOM   5198 C CD  . ARG B 1 170 ? 103.537 2.997   44.178  1.00 23.64 ? 192 ARG B CD  1 
ATOM   5199 N NE  . ARG B 1 170 ? 102.359 3.859   44.192  1.00 22.79 ? 192 ARG B NE  1 
ATOM   5200 C CZ  . ARG B 1 170 ? 102.013 4.666   43.195  1.00 24.26 ? 192 ARG B CZ  1 
ATOM   5201 N NH1 . ARG B 1 170 ? 102.753 4.725   42.097  1.00 25.54 ? 192 ARG B NH1 1 
ATOM   5202 N NH2 . ARG B 1 170 ? 100.925 5.417   43.297  1.00 30.47 ? 192 ARG B NH2 1 
ATOM   5203 N N   . ILE B 1 171 ? 106.652 3.594   47.478  1.00 21.79 ? 193 ILE B N   1 
ATOM   5204 C CA  . ILE B 1 171 ? 107.385 2.550   48.180  1.00 24.74 ? 193 ILE B CA  1 
ATOM   5205 C C   . ILE B 1 171 ? 106.506 1.313   48.228  1.00 19.76 ? 193 ILE B C   1 
ATOM   5206 O O   . ILE B 1 171 ? 105.345 1.386   48.646  1.00 26.02 ? 193 ILE B O   1 
ATOM   5207 C CB  . ILE B 1 171 ? 107.793 2.980   49.603  1.00 22.49 ? 193 ILE B CB  1 
ATOM   5208 C CG1 . ILE B 1 171 ? 108.752 4.171   49.556  1.00 20.66 ? 193 ILE B CG1 1 
ATOM   5209 C CG2 . ILE B 1 171 ? 108.435 1.820   50.340  1.00 26.61 ? 193 ILE B CG2 1 
ATOM   5210 C CD1 . ILE B 1 171 ? 110.100 3.844   48.997  1.00 19.69 ? 193 ILE B CD1 1 
ATOM   5211 N N   . GLY B 1 172 ? 107.053 0.180   47.786  1.00 20.08 ? 194 GLY B N   1 
ATOM   5212 C CA  . GLY B 1 172 ? 106.385 -1.094  47.892  1.00 26.15 ? 194 GLY B CA  1 
ATOM   5213 C C   . GLY B 1 172 ? 107.249 -2.076  48.667  1.00 33.57 ? 194 GLY B C   1 
ATOM   5214 O O   . GLY B 1 172 ? 108.403 -1.794  49.009  1.00 35.22 ? 194 GLY B O   1 
ATOM   5215 N N   . ILE B 1 173 ? 106.669 -3.238  48.948  1.00 35.73 ? 195 ILE B N   1 
ATOM   5216 C CA  . ILE B 1 173 ? 107.367 -4.321  49.631  1.00 34.10 ? 195 ILE B CA  1 
ATOM   5217 C C   . ILE B 1 173 ? 107.070 -5.594  48.850  1.00 42.78 ? 195 ILE B C   1 
ATOM   5218 O O   . ILE B 1 173 ? 105.972 -6.154  48.952  1.00 42.21 ? 195 ILE B O   1 
ATOM   5219 C CB  . ILE B 1 173 ? 106.955 -4.452  51.099  1.00 32.25 ? 195 ILE B CB  1 
ATOM   5220 C CG1 . ILE B 1 173 ? 107.488 -3.258  51.893  1.00 29.57 ? 195 ILE B CG1 1 
ATOM   5221 C CG2 . ILE B 1 173 ? 107.484 -5.749  51.687  1.00 35.86 ? 195 ILE B CG2 1 
ATOM   5222 C CD1 . ILE B 1 173 ? 106.702 -2.957  53.144  1.00 30.95 ? 195 ILE B CD1 1 
ATOM   5223 N N   . ILE B 1 174 ? 108.036 -6.042  48.054  1.00 44.12 ? 196 ILE B N   1 
ATOM   5224 C CA  . ILE B 1 174 ? 107.912 -7.247  47.244  1.00 50.21 ? 196 ILE B CA  1 
ATOM   5225 C C   . ILE B 1 174 ? 108.887 -8.268  47.806  1.00 51.85 ? 196 ILE B C   1 
ATOM   5226 O O   . ILE B 1 174 ? 110.107 -8.068  47.750  1.00 57.14 ? 196 ILE B O   1 
ATOM   5227 C CB  . ILE B 1 174 ? 108.187 -6.971  45.760  1.00 49.03 ? 196 ILE B CB  1 
ATOM   5228 C CG1 . ILE B 1 174 ? 106.985 -6.279  45.118  1.00 49.37 ? 196 ILE B CG1 1 
ATOM   5229 C CG2 . ILE B 1 174 ? 108.497 -8.262  45.023  1.00 42.98 ? 196 ILE B CG2 1 
ATOM   5230 C CD1 . ILE B 1 174 ? 107.018 -4.773  45.229  1.00 39.17 ? 196 ILE B CD1 1 
ATOM   5231 N N   . ASP B 1 175 ? 108.352 -9.358  48.355  1.00 46.43 ? 197 ASP B N   1 
ATOM   5232 C CA  . ASP B 1 175 ? 109.165 -10.408 48.966  1.00 62.09 ? 197 ASP B CA  1 
ATOM   5233 C C   . ASP B 1 175 ? 110.124 -9.822  50.003  1.00 64.98 ? 197 ASP B C   1 
ATOM   5234 O O   . ASP B 1 175 ? 111.332 -10.071 49.986  1.00 64.87 ? 197 ASP B O   1 
ATOM   5235 C CB  . ASP B 1 175 ? 109.926 -11.198 47.898  1.00 64.72 ? 197 ASP B CB  1 
ATOM   5236 C CG  . ASP B 1 175 ? 109.003 -11.955 46.961  1.00 66.13 ? 197 ASP B CG  1 
ATOM   5237 O OD1 . ASP B 1 175 ? 108.123 -12.689 47.458  1.00 60.09 ? 197 ASP B OD1 1 
ATOM   5238 O OD2 . ASP B 1 175 ? 109.159 -11.817 45.727  1.00 60.15 ? 197 ASP B OD2 1 
ATOM   5239 N N   . GLY B 1 176 ? 109.572 -9.014  50.909  1.00 57.40 ? 198 GLY B N   1 
ATOM   5240 C CA  . GLY B 1 176 ? 110.359 -8.368  51.937  1.00 39.37 ? 198 GLY B CA  1 
ATOM   5241 C C   . GLY B 1 176 ? 111.321 -7.305  51.453  1.00 48.73 ? 198 GLY B C   1 
ATOM   5242 O O   . GLY B 1 176 ? 112.059 -6.747  52.273  1.00 47.56 ? 198 GLY B O   1 
ATOM   5243 N N   . GLU B 1 177 ? 111.341 -7.002  50.158  1.00 47.78 ? 199 GLU B N   1 
ATOM   5244 C CA  . GLU B 1 177 ? 112.242 -6.000  49.608  1.00 46.54 ? 199 GLU B CA  1 
ATOM   5245 C C   . GLU B 1 177 ? 111.538 -4.652  49.538  1.00 44.79 ? 199 GLU B C   1 
ATOM   5246 O O   . GLU B 1 177 ? 110.415 -4.558  49.033  1.00 44.93 ? 199 GLU B O   1 
ATOM   5247 C CB  . GLU B 1 177 ? 112.720 -6.414  48.215  1.00 56.38 ? 199 GLU B CB  1 
ATOM   5248 C CG  . GLU B 1 177 ? 113.760 -7.516  48.211  1.00 58.25 ? 199 GLU B CG  1 
ATOM   5249 C CD  . GLU B 1 177 ? 115.101 -7.044  48.732  1.00 57.98 ? 199 GLU B CD  1 
ATOM   5250 O OE1 . GLU B 1 177 ? 115.743 -6.217  48.049  1.00 56.58 ? 199 GLU B OE1 1 
ATOM   5251 O OE2 . GLU B 1 177 ? 115.512 -7.497  49.823  1.00 51.09 ? 199 GLU B OE2 1 
ATOM   5252 N N   . TYR B 1 178 ? 112.198 -3.610  50.039  1.00 40.60 ? 200 TYR B N   1 
ATOM   5253 C CA  . TYR B 1 178 ? 111.649 -2.258  49.964  1.00 38.52 ? 200 TYR B CA  1 
ATOM   5254 C C   . TYR B 1 178 ? 111.928 -1.699  48.575  1.00 40.26 ? 200 TYR B C   1 
ATOM   5255 O O   . TYR B 1 178 ? 113.076 -1.386  48.241  1.00 46.64 ? 200 TYR B O   1 
ATOM   5256 C CB  . TYR B 1 178 ? 112.244 -1.370  51.055  1.00 41.01 ? 200 TYR B CB  1 
ATOM   5257 C CG  . TYR B 1 178 ? 111.784 -1.759  52.441  1.00 46.47 ? 200 TYR B CG  1 
ATOM   5258 C CD1 . TYR B 1 178 ? 110.550 -1.347  52.928  1.00 43.55 ? 200 TYR B CD1 1 
ATOM   5259 C CD2 . TYR B 1 178 ? 112.576 -2.557  53.255  1.00 52.70 ? 200 TYR B CD2 1 
ATOM   5260 C CE1 . TYR B 1 178 ? 110.123 -1.712  54.193  1.00 49.25 ? 200 TYR B CE1 1 
ATOM   5261 C CE2 . TYR B 1 178 ? 112.157 -2.928  54.518  1.00 47.38 ? 200 TYR B CE2 1 
ATOM   5262 C CZ  . TYR B 1 178 ? 110.933 -2.503  54.984  1.00 47.47 ? 200 TYR B CZ  1 
ATOM   5263 O OH  . TYR B 1 178 ? 110.523 -2.873  56.245  1.00 49.00 ? 200 TYR B OH  1 
ATOM   5264 N N   . VAL B 1 179 ? 110.879 -1.572  47.770  1.00 37.42 ? 201 VAL B N   1 
ATOM   5265 C CA  . VAL B 1 179 ? 110.995 -1.219  46.362  1.00 29.12 ? 201 VAL B CA  1 
ATOM   5266 C C   . VAL B 1 179 ? 110.702 0.263   46.182  1.00 29.47 ? 201 VAL B C   1 
ATOM   5267 O O   . VAL B 1 179 ? 109.712 0.781   46.713  1.00 33.95 ? 201 VAL B O   1 
ATOM   5268 C CB  . VAL B 1 179 ? 110.045 -2.076  45.514  1.00 35.98 ? 201 VAL B CB  1 
ATOM   5269 C CG1 . VAL B 1 179 ? 110.200 -1.723  44.050  1.00 45.12 ? 201 VAL B CG1 1 
ATOM   5270 C CG2 . VAL B 1 179 ? 110.334 -3.556  45.748  1.00 33.62 ? 201 VAL B CG2 1 
ATOM   5271 N N   . VAL B 1 180 ? 111.559 0.945   45.433  1.00 32.57 ? 202 VAL B N   1 
ATOM   5272 C CA  . VAL B 1 180 ? 111.391 2.361   45.139  1.00 31.14 ? 202 VAL B CA  1 
ATOM   5273 C C   . VAL B 1 180 ? 110.730 2.489   43.776  1.00 39.36 ? 202 VAL B C   1 
ATOM   5274 O O   . VAL B 1 180 ? 111.251 1.976   42.777  1.00 41.68 ? 202 VAL B O   1 
ATOM   5275 C CB  . VAL B 1 180 ? 112.732 3.104   45.171  1.00 37.03 ? 202 VAL B CB  1 
ATOM   5276 C CG1 . VAL B 1 180 ? 112.481 4.598   45.341  1.00 32.75 ? 202 VAL B CG1 1 
ATOM   5277 C CG2 . VAL B 1 180 ? 113.607 2.564   46.286  1.00 46.12 ? 202 VAL B CG2 1 
ATOM   5278 N N   . ASN B 1 181 ? 109.590 3.187   43.739  1.00 38.70 ? 203 ASN B N   1 
ATOM   5279 C CA  . ASN B 1 181 ? 108.761 3.344   42.548  1.00 24.20 ? 203 ASN B CA  1 
ATOM   5280 C C   . ASN B 1 181 ? 108.519 1.990   41.892  1.00 30.78 ? 203 ASN B C   1 
ATOM   5281 O O   . ASN B 1 181 ? 109.010 1.745   40.783  1.00 37.84 ? 203 ASN B O   1 
ATOM   5282 C CB  . ASN B 1 181 ? 109.416 4.309   41.560  1.00 16.35 ? 203 ASN B CB  1 
ATOM   5283 C CG  . ASN B 1 181 ? 109.370 5.748   42.035  1.00 24.27 ? 203 ASN B CG  1 
ATOM   5284 O OD1 . ASN B 1 181 ? 108.506 6.126   42.827  1.00 28.34 ? 203 ASN B OD1 1 
ATOM   5285 N ND2 . ASN B 1 181 ? 110.304 6.562   41.553  1.00 22.94 ? 203 ASN B ND2 1 
ATOM   5286 N N   . PRO B 1 182 ? 107.789 1.084   42.542  1.00 27.84 ? 204 PRO B N   1 
ATOM   5287 C CA  . PRO B 1 182 ? 107.567 -0.238  41.947  1.00 33.33 ? 204 PRO B CA  1 
ATOM   5288 C C   . PRO B 1 182 ? 106.830 -0.154  40.618  1.00 37.94 ? 204 PRO B C   1 
ATOM   5289 O O   . PRO B 1 182 ? 105.938 0.676   40.425  1.00 39.87 ? 204 PRO B O   1 
ATOM   5290 C CB  . PRO B 1 182 ? 106.733 -0.971  43.007  1.00 41.24 ? 204 PRO B CB  1 
ATOM   5291 C CG  . PRO B 1 182 ? 106.170 0.103   43.884  1.00 32.21 ? 204 PRO B CG  1 
ATOM   5292 C CD  . PRO B 1 182 ? 107.202 1.185   43.889  1.00 28.05 ? 204 PRO B CD  1 
ATOM   5293 N N   . THR B 1 183 ? 107.223 -1.030  39.697  1.00 44.16 ? 205 THR B N   1 
ATOM   5294 C CA  . THR B 1 183 ? 106.581 -1.126  38.398  1.00 40.98 ? 205 THR B CA  1 
ATOM   5295 C C   . THR B 1 183 ? 105.161 -1.666  38.548  1.00 37.90 ? 205 THR B C   1 
ATOM   5296 O O   . THR B 1 183 ? 104.773 -2.195  39.593  1.00 38.98 ? 205 THR B O   1 
ATOM   5297 C CB  . THR B 1 183 ? 107.388 -2.033  37.471  1.00 39.66 ? 205 THR B CB  1 
ATOM   5298 O OG1 . THR B 1 183 ? 107.361 -3.375  37.978  1.00 38.28 ? 205 THR B OG1 1 
ATOM   5299 C CG2 . THR B 1 183 ? 108.832 -1.556  37.389  1.00 40.15 ? 205 THR B CG2 1 
ATOM   5300 N N   . ARG B 1 184 ? 104.383 -1.536  37.470  1.00 37.79 ? 206 ARG B N   1 
ATOM   5301 C CA  . ARG B 1 184 ? 103.006 -2.017  37.494  1.00 40.63 ? 206 ARG B CA  1 
ATOM   5302 C C   . ARG B 1 184 ? 102.935 -3.496  37.849  1.00 44.36 ? 206 ARG B C   1 
ATOM   5303 O O   . ARG B 1 184 ? 101.972 -3.938  38.486  1.00 44.76 ? 206 ARG B O   1 
ATOM   5304 C CB  . ARG B 1 184 ? 102.335 -1.758  36.144  1.00 40.28 ? 206 ARG B CB  1 
ATOM   5305 C CG  . ARG B 1 184 ? 100.814 -1.776  36.198  1.00 47.60 ? 206 ARG B CG  1 
ATOM   5306 C CD  . ARG B 1 184 ? 100.205 -1.732  34.808  1.00 54.31 ? 206 ARG B CD  1 
ATOM   5307 N NE  . ARG B 1 184 ? 99.330  -2.875  34.565  1.00 68.12 ? 206 ARG B NE  1 
ATOM   5308 C CZ  . ARG B 1 184 ? 99.043  -3.351  33.358  1.00 70.36 ? 206 ARG B CZ  1 
ATOM   5309 N NH1 . ARG B 1 184 ? 99.563  -2.778  32.280  1.00 63.16 ? 206 ARG B NH1 1 
ATOM   5310 N NH2 . ARG B 1 184 ? 98.237  -4.398  33.226  1.00 67.26 ? 206 ARG B NH2 1 
ATOM   5311 N N   . LYS B 1 185 ? 103.947 -4.272  37.459  1.00 51.29 ? 207 LYS B N   1 
ATOM   5312 C CA  . LYS B 1 185 ? 103.968 -5.687  37.808  1.00 51.02 ? 207 LYS B CA  1 
ATOM   5313 C C   . LYS B 1 185 ? 104.361 -5.892  39.267  1.00 49.73 ? 207 LYS B C   1 
ATOM   5314 O O   . LYS B 1 185 ? 103.770 -6.730  39.959  1.00 47.05 ? 207 LYS B O   1 
ATOM   5315 C CB  . LYS B 1 185 ? 104.918 -6.439  36.873  1.00 48.99 ? 207 LYS B CB  1 
ATOM   5316 C CG  . LYS B 1 185 ? 105.522 -7.698  37.469  1.00 51.15 ? 207 LYS B CG  1 
ATOM   5317 C CD  . LYS B 1 185 ? 105.314 -8.895  36.561  1.00 60.56 ? 207 LYS B CD  1 
ATOM   5318 C CE  . LYS B 1 185 ? 105.861 -10.160 37.199  1.00 66.64 ? 207 LYS B CE  1 
ATOM   5319 N NZ  . LYS B 1 185 ? 105.247 -11.392 36.631  1.00 61.67 ? 207 LYS B NZ  1 
ATOM   5320 N N   . GLU B 1 186 ? 105.344 -5.128  39.753  1.00 44.76 ? 208 GLU B N   1 
ATOM   5321 C CA  . GLU B 1 186 ? 105.761 -5.261  41.146  1.00 41.20 ? 208 GLU B CA  1 
ATOM   5322 C C   . GLU B 1 186 ? 104.652 -4.846  42.106  1.00 43.69 ? 208 GLU B C   1 
ATOM   5323 O O   . GLU B 1 186 ? 104.511 -5.440  43.181  1.00 45.26 ? 208 GLU B O   1 
ATOM   5324 C CB  . GLU B 1 186 ? 107.026 -4.438  41.398  1.00 38.06 ? 208 GLU B CB  1 
ATOM   5325 C CG  . GLU B 1 186 ? 108.268 -4.970  40.690  1.00 38.22 ? 208 GLU B CG  1 
ATOM   5326 C CD  . GLU B 1 186 ? 109.414 -3.970  40.677  1.00 40.00 ? 208 GLU B CD  1 
ATOM   5327 O OE1 . GLU B 1 186 ? 109.223 -2.837  41.161  1.00 41.54 ? 208 GLU B OE1 1 
ATOM   5328 O OE2 . GLU B 1 186 ? 110.508 -4.313  40.181  1.00 42.00 ? 208 GLU B OE2 1 
ATOM   5329 N N   . MET B 1 187 ? 103.851 -3.843  41.737  1.00 45.63 ? 209 MET B N   1 
ATOM   5330 C CA  . MET B 1 187 ? 102.746 -3.417  42.589  1.00 39.06 ? 209 MET B CA  1 
ATOM   5331 C C   . MET B 1 187 ? 101.674 -4.489  42.731  1.00 42.79 ? 209 MET B C   1 
ATOM   5332 O O   . MET B 1 187 ? 100.906 -4.454  43.698  1.00 44.34 ? 209 MET B O   1 
ATOM   5333 C CB  . MET B 1 187 ? 102.117 -2.133  42.042  1.00 30.63 ? 209 MET B CB  1 
ATOM   5334 C CG  . MET B 1 187 ? 102.975 -0.892  42.204  1.00 34.52 ? 209 MET B CG  1 
ATOM   5335 S SD  . MET B 1 187 ? 102.265 0.563   41.405  1.00 37.70 ? 209 MET B SD  1 
ATOM   5336 C CE  . MET B 1 187 ? 100.749 0.787   42.334  1.00 24.02 ? 209 MET B CE  1 
ATOM   5337 N N   . SER B 1 188 ? 101.600 -5.435  41.793  1.00 38.20 ? 210 SER B N   1 
ATOM   5338 C CA  . SER B 1 188 ? 100.597 -6.489  41.854  1.00 38.76 ? 210 SER B CA  1 
ATOM   5339 C C   . SER B 1 188 ? 100.943 -7.578  42.859  1.00 45.15 ? 210 SER B C   1 
ATOM   5340 O O   . SER B 1 188 ? 100.089 -8.421  43.156  1.00 50.20 ? 210 SER B O   1 
ATOM   5341 C CB  . SER B 1 188 ? 100.406 -7.107  40.467  1.00 37.84 ? 210 SER B CB  1 
ATOM   5342 O OG  . SER B 1 188 ? 100.249 -6.097  39.486  1.00 44.77 ? 210 SER B OG  1 
ATOM   5343 N N   . SER B 1 189 ? 102.166 -7.580  43.387  1.00 40.94 ? 211 SER B N   1 
ATOM   5344 C CA  . SER B 1 189 ? 102.585 -8.545  44.394  1.00 40.83 ? 211 SER B CA  1 
ATOM   5345 C C   . SER B 1 189 ? 103.284 -7.846  45.554  1.00 43.79 ? 211 SER B C   1 
ATOM   5346 O O   . SER B 1 189 ? 104.199 -8.406  46.164  1.00 41.44 ? 211 SER B O   1 
ATOM   5347 C CB  . SER B 1 189 ? 103.492 -9.613  43.784  1.00 45.54 ? 211 SER B CB  1 
ATOM   5348 O OG  . SER B 1 189 ? 104.623 -9.024  43.166  1.00 49.40 ? 211 SER B OG  1 
ATOM   5349 N N   . SER B 1 190 ? 102.866 -6.622  45.864  1.00 44.92 ? 212 SER B N   1 
ATOM   5350 C CA  . SER B 1 190 ? 103.427 -5.843  46.959  1.00 41.70 ? 212 SER B CA  1 
ATOM   5351 C C   . SER B 1 190 ? 102.443 -5.788  48.120  1.00 38.36 ? 212 SER B C   1 
ATOM   5352 O O   . SER B 1 190 ? 101.229 -5.697  47.915  1.00 37.48 ? 212 SER B O   1 
ATOM   5353 C CB  . SER B 1 190 ? 103.766 -4.422  46.508  1.00 37.77 ? 212 SER B CB  1 
ATOM   5354 O OG  . SER B 1 190 ? 104.230 -3.641  47.597  1.00 29.19 ? 212 SER B OG  1 
ATOM   5355 N N   . THR B 1 191 ? 102.974 -5.837  49.339  1.00 36.45 ? 213 THR B N   1 
ATOM   5356 C CA  . THR B 1 191 ? 102.159 -5.732  50.542  1.00 36.76 ? 213 THR B CA  1 
ATOM   5357 C C   . THR B 1 191 ? 101.880 -4.290  50.944  1.00 30.93 ? 213 THR B C   1 
ATOM   5358 O O   . THR B 1 191 ? 101.139 -4.065  51.907  1.00 25.57 ? 213 THR B O   1 
ATOM   5359 C CB  . THR B 1 191 ? 102.834 -6.461  51.709  1.00 28.61 ? 213 THR B CB  1 
ATOM   5360 O OG1 . THR B 1 191 ? 104.225 -6.116  51.753  1.00 31.95 ? 213 THR B OG1 1 
ATOM   5361 C CG2 . THR B 1 191 ? 102.692 -7.960  51.553  1.00 29.37 ? 213 THR B CG2 1 
ATOM   5362 N N   . LEU B 1 192 ? 102.439 -3.315  50.228  1.00 27.95 ? 214 LEU B N   1 
ATOM   5363 C CA  . LEU B 1 192 ? 102.342 -1.919  50.624  1.00 25.07 ? 214 LEU B CA  1 
ATOM   5364 C C   . LEU B 1 192 ? 102.317 -1.030  49.389  1.00 24.68 ? 214 LEU B C   1 
ATOM   5365 O O   . LEU B 1 192 ? 103.052 -1.269  48.427  1.00 24.21 ? 214 LEU B O   1 
ATOM   5366 C CB  . LEU B 1 192 ? 103.514 -1.527  51.527  1.00 24.90 ? 214 LEU B CB  1 
ATOM   5367 C CG  . LEU B 1 192 ? 103.739 -0.031  51.736  1.00 20.44 ? 214 LEU B CG  1 
ATOM   5368 C CD1 . LEU B 1 192 ? 102.785 0.510   52.791  1.00 21.95 ? 214 LEU B CD1 1 
ATOM   5369 C CD2 . LEU B 1 192 ? 105.174 0.236   52.120  1.00 19.16 ? 214 LEU B CD2 1 
ATOM   5370 N N   . ASN B 1 193 ? 101.468 -0.002  49.431  1.00 21.06 ? 215 ASN B N   1 
ATOM   5371 C CA  . ASN B 1 193 ? 101.369 1.020   48.389  1.00 17.45 ? 215 ASN B CA  1 
ATOM   5372 C C   . ASN B 1 193 ? 101.437 2.372   49.091  1.00 18.83 ? 215 ASN B C   1 
ATOM   5373 O O   . ASN B 1 193 ? 100.408 2.910   49.506  1.00 20.28 ? 215 ASN B O   1 
ATOM   5374 C CB  . ASN B 1 193 ? 100.083 0.865   47.588  1.00 20.94 ? 215 ASN B CB  1 
ATOM   5375 C CG  . ASN B 1 193 ? 99.985  1.855   46.445  1.00 19.09 ? 215 ASN B CG  1 
ATOM   5376 O OD1 . ASN B 1 193 ? 100.890 2.660   46.219  1.00 16.67 ? 215 ASN B OD1 1 
ATOM   5377 N ND2 . ASN B 1 193 ? 98.881  1.796   45.711  1.00 31.23 ? 215 ASN B ND2 1 
ATOM   5378 N N   . LEU B 1 194 ? 102.643 2.918   49.219  1.00 18.07 ? 216 LEU B N   1 
ATOM   5379 C CA  . LEU B 1 194 ? 102.882 4.136   49.982  1.00 14.99 ? 216 LEU B CA  1 
ATOM   5380 C C   . LEU B 1 194 ? 103.498 5.190   49.077  1.00 18.76 ? 216 LEU B C   1 
ATOM   5381 O O   . LEU B 1 194 ? 104.473 4.913   48.371  1.00 20.37 ? 216 LEU B O   1 
ATOM   5382 C CB  . LEU B 1 194 ? 103.802 3.863   51.178  1.00 15.93 ? 216 LEU B CB  1 
ATOM   5383 C CG  . LEU B 1 194 ? 104.353 5.083   51.925  1.00 25.27 ? 216 LEU B CG  1 
ATOM   5384 C CD1 . LEU B 1 194 ? 103.352 5.620   52.938  1.00 25.69 ? 216 LEU B CD1 1 
ATOM   5385 C CD2 . LEU B 1 194 ? 105.673 4.744   52.607  1.00 21.42 ? 216 LEU B CD2 1 
ATOM   5386 N N   . VAL B 1 195 ? 102.928 6.393   49.098  1.00 16.80 ? 217 VAL B N   1 
ATOM   5387 C CA  . VAL B 1 195 ? 103.428 7.524   48.326  1.00 20.58 ? 217 VAL B CA  1 
ATOM   5388 C C   . VAL B 1 195 ? 103.802 8.627   49.301  1.00 19.60 ? 217 VAL B C   1 
ATOM   5389 O O   . VAL B 1 195 ? 102.990 9.013   50.149  1.00 25.19 ? 217 VAL B O   1 
ATOM   5390 C CB  . VAL B 1 195 ? 102.394 8.028   47.301  1.00 18.94 ? 217 VAL B CB  1 
ATOM   5391 C CG1 . VAL B 1 195 ? 102.898 9.287   46.612  1.00 15.02 ? 217 VAL B CG1 1 
ATOM   5392 C CG2 . VAL B 1 195 ? 102.091 6.947   46.276  1.00 15.54 ? 217 VAL B CG2 1 
ATOM   5393 N N   . VAL B 1 196 ? 105.027 9.130   49.180  1.00 22.20 ? 218 VAL B N   1 
ATOM   5394 C CA  . VAL B 1 196 ? 105.579 10.110  50.109  1.00 24.64 ? 218 VAL B CA  1 
ATOM   5395 C C   . VAL B 1 196 ? 106.013 11.336  49.319  1.00 21.26 ? 218 VAL B C   1 
ATOM   5396 O O   . VAL B 1 196 ? 106.712 11.213  48.308  1.00 22.30 ? 218 VAL B O   1 
ATOM   5397 C CB  . VAL B 1 196 ? 106.764 9.528   50.903  1.00 25.47 ? 218 VAL B CB  1 
ATOM   5398 C CG1 . VAL B 1 196 ? 107.383 10.593  51.793  1.00 26.39 ? 218 VAL B CG1 1 
ATOM   5399 C CG2 . VAL B 1 196 ? 106.319 8.327   51.726  1.00 29.13 ? 218 VAL B CG2 1 
ATOM   5400 N N   . ALA B 1 197 ? 105.599 12.510  49.776  1.00 19.12 ? 219 ALA B N   1 
ATOM   5401 C CA  . ALA B 1 197 ? 106.053 13.776  49.219  1.00 17.38 ? 219 ALA B CA  1 
ATOM   5402 C C   . ALA B 1 197 ? 106.961 14.441  50.243  1.00 24.33 ? 219 ALA B C   1 
ATOM   5403 O O   . ALA B 1 197 ? 106.511 14.792  51.340  1.00 22.44 ? 219 ALA B O   1 
ATOM   5404 C CB  . ALA B 1 197 ? 104.874 14.680  48.864  1.00 15.13 ? 219 ALA B CB  1 
ATOM   5405 N N   . GLY B 1 198 ? 108.231 14.605  49.887  1.00 24.10 ? 220 GLY B N   1 
ATOM   5406 C CA  . GLY B 1 198 ? 109.239 15.144  50.789  1.00 25.64 ? 220 GLY B CA  1 
ATOM   5407 C C   . GLY B 1 198 ? 109.609 16.573  50.434  1.00 26.99 ? 220 GLY B C   1 
ATOM   5408 O O   . GLY B 1 198 ? 109.771 16.910  49.257  1.00 31.14 ? 220 GLY B O   1 
ATOM   5409 N N   . ALA B 1 199 ? 109.731 17.401  51.459  1.00 28.30 ? 221 ALA B N   1 
ATOM   5410 C CA  . ALA B 1 199 ? 110.207 18.773  51.389  1.00 27.92 ? 221 ALA B CA  1 
ATOM   5411 C C   . ALA B 1 199 ? 111.695 18.818  51.699  1.00 32.66 ? 221 ALA B C   1 
ATOM   5412 O O   . ALA B 1 199 ? 112.295 17.801  52.063  1.00 32.97 ? 221 ALA B O   1 
ATOM   5413 C CB  . ALA B 1 199 ? 109.424 19.642  52.377  1.00 31.23 ? 221 ALA B CB  1 
ATOM   5414 N N   . PRO B 1 200 ? 112.342 19.980  51.539  1.00 35.44 ? 222 PRO B N   1 
ATOM   5415 C CA  . PRO B 1 200 ? 113.750 20.086  51.942  1.00 34.97 ? 222 PRO B CA  1 
ATOM   5416 C C   . PRO B 1 200 ? 113.939 19.766  53.419  1.00 34.16 ? 222 PRO B C   1 
ATOM   5417 O O   . PRO B 1 200 ? 113.027 19.914  54.234  1.00 32.29 ? 222 PRO B O   1 
ATOM   5418 C CB  . PRO B 1 200 ? 114.098 21.547  51.640  1.00 31.53 ? 222 PRO B CB  1 
ATOM   5419 C CG  . PRO B 1 200 ? 113.187 21.922  50.536  1.00 25.44 ? 222 PRO B CG  1 
ATOM   5420 C CD  . PRO B 1 200 ? 111.909 21.165  50.773  1.00 29.87 ? 222 PRO B CD  1 
ATOM   5421 N N   . LYS B 1 201 ? 115.147 19.306  53.748  1.00 34.15 ? 223 LYS B N   1 
ATOM   5422 C CA  . LYS B 1 201 ? 115.525 18.977  55.123  1.00 29.58 ? 223 LYS B CA  1 
ATOM   5423 C C   . LYS B 1 201 ? 114.651 17.860  55.689  1.00 24.99 ? 223 LYS B C   1 
ATOM   5424 O O   . LYS B 1 201 ? 114.277 17.875  56.864  1.00 26.88 ? 223 LYS B O   1 
ATOM   5425 C CB  . LYS B 1 201 ? 115.485 20.217  56.020  1.00 26.00 ? 223 LYS B CB  1 
ATOM   5426 C CG  . LYS B 1 201 ? 116.516 21.270  55.655  1.00 27.28 ? 223 LYS B CG  1 
ATOM   5427 C CD  . LYS B 1 201 ? 115.941 22.673  55.756  1.00 36.08 ? 223 LYS B CD  1 
ATOM   5428 C CE  . LYS B 1 201 ? 115.849 23.136  57.205  1.00 47.00 ? 223 LYS B CE  1 
ATOM   5429 N NZ  . LYS B 1 201 ? 117.153 23.626  57.735  1.00 39.97 ? 223 LYS B NZ  1 
ATOM   5430 N N   . SER B 1 202 ? 114.319 16.887  54.840  1.00 25.17 ? 224 SER B N   1 
ATOM   5431 C CA  . SER B 1 202 ? 113.635 15.659  55.259  1.00 29.34 ? 224 SER B CA  1 
ATOM   5432 C C   . SER B 1 202 ? 112.309 15.942  55.967  1.00 31.64 ? 224 SER B C   1 
ATOM   5433 O O   . SER B 1 202 ? 111.955 15.277  56.943  1.00 31.92 ? 224 SER B O   1 
ATOM   5434 C CB  . SER B 1 202 ? 114.542 14.803  56.145  1.00 23.31 ? 224 SER B CB  1 
ATOM   5435 O OG  . SER B 1 202 ? 115.578 14.212  55.386  1.00 28.67 ? 224 SER B OG  1 
ATOM   5436 N N   . GLN B 1 203 ? 111.569 16.935  55.478  1.00 30.92 ? 225 GLN B N   1 
ATOM   5437 C CA  . GLN B 1 203 ? 110.234 17.219  55.985  1.00 24.43 ? 225 GLN B CA  1 
ATOM   5438 C C   . GLN B 1 203 ? 109.195 16.499  55.132  1.00 31.55 ? 225 GLN B C   1 
ATOM   5439 O O   . GLN B 1 203 ? 109.347 16.380  53.912  1.00 31.20 ? 225 GLN B O   1 
ATOM   5440 C CB  . GLN B 1 203 ? 109.954 18.723  55.997  1.00 27.07 ? 225 GLN B CB  1 
ATOM   5441 C CG  . GLN B 1 203 ? 110.929 19.549  56.826  1.00 27.33 ? 225 GLN B CG  1 
ATOM   5442 C CD  . GLN B 1 203 ? 110.896 19.202  58.304  1.00 30.26 ? 225 GLN B CD  1 
ATOM   5443 O OE1 . GLN B 1 203 ? 110.075 19.726  59.062  1.00 25.92 ? 225 GLN B OE1 1 
ATOM   5444 N NE2 . GLN B 1 203 ? 111.798 18.318  58.722  1.00 31.45 ? 225 GLN B NE2 1 
ATOM   5445 N N   . ILE B 1 204 ? 108.141 16.019  55.783  1.00 30.92 ? 226 ILE B N   1 
ATOM   5446 C CA  . ILE B 1 204 ? 107.101 15.225  55.139  1.00 22.41 ? 226 ILE B CA  1 
ATOM   5447 C C   . ILE B 1 204 ? 105.946 16.148  54.772  1.00 23.23 ? 226 ILE B C   1 
ATOM   5448 O O   . ILE B 1 204 ? 105.400 16.846  55.634  1.00 21.35 ? 226 ILE B O   1 
ATOM   5449 C CB  . ILE B 1 204 ? 106.633 14.082  56.053  1.00 16.40 ? 226 ILE B CB  1 
ATOM   5450 C CG1 . ILE B 1 204 ? 107.747 13.049  56.214  1.00 19.99 ? 226 ILE B CG1 1 
ATOM   5451 C CG2 . ILE B 1 204 ? 105.374 13.446  55.506  1.00 16.49 ? 226 ILE B CG2 1 
ATOM   5452 C CD1 . ILE B 1 204 ? 107.308 11.776  56.902  1.00 21.49 ? 226 ILE B CD1 1 
ATOM   5453 N N   . VAL B 1 205 ? 105.570 16.153  53.497  1.00 20.98 ? 227 VAL B N   1 
ATOM   5454 C CA  . VAL B 1 205 ? 104.474 16.983  53.014  1.00 21.64 ? 227 VAL B CA  1 
ATOM   5455 C C   . VAL B 1 205 ? 103.189 16.182  52.851  1.00 18.90 ? 227 VAL B C   1 
ATOM   5456 O O   . VAL B 1 205 ? 102.114 16.644  53.236  1.00 19.77 ? 227 VAL B O   1 
ATOM   5457 C CB  . VAL B 1 205 ? 104.865 17.676  51.690  1.00 23.78 ? 227 VAL B CB  1 
ATOM   5458 C CG1 . VAL B 1 205 ? 103.686 18.454  51.130  1.00 23.90 ? 227 VAL B CG1 1 
ATOM   5459 C CG2 . VAL B 1 205 ? 106.046 18.596  51.904  1.00 26.71 ? 227 VAL B CG2 1 
ATOM   5460 N N   . MET B 1 206 ? 103.277 14.980  52.284  1.00 18.08 ? 228 MET B N   1 
ATOM   5461 C CA  . MET B 1 206 ? 102.098 14.183  51.985  1.00 19.88 ? 228 MET B CA  1 
ATOM   5462 C C   . MET B 1 206 ? 102.402 12.711  52.212  1.00 18.80 ? 228 MET B C   1 
ATOM   5463 O O   . MET B 1 206 ? 103.477 12.225  51.850  1.00 21.23 ? 228 MET B O   1 
ATOM   5464 C CB  . MET B 1 206 ? 101.629 14.411  50.539  1.00 17.48 ? 228 MET B CB  1 
ATOM   5465 C CG  . MET B 1 206 ? 100.302 13.753  50.199  1.00 24.13 ? 228 MET B CG  1 
ATOM   5466 S SD  . MET B 1 206 ? 100.506 12.062  49.602  1.00 22.32 ? 228 MET B SD  1 
ATOM   5467 C CE  . MET B 1 206 ? 101.814 12.303  48.400  1.00 16.21 ? 228 MET B CE  1 
ATOM   5468 N N   . LEU B 1 207 ? 101.445 12.004  52.808  1.00 18.33 ? 229 LEU B N   1 
ATOM   5469 C CA  . LEU B 1 207 ? 101.562 10.570  53.043  1.00 16.54 ? 229 LEU B CA  1 
ATOM   5470 C C   . LEU B 1 207 ? 100.237 9.921   52.687  1.00 18.57 ? 229 LEU B C   1 
ATOM   5471 O O   . LEU B 1 207 ? 99.206  10.238  53.290  1.00 25.24 ? 229 LEU B O   1 
ATOM   5472 C CB  . LEU B 1 207 ? 101.926 10.269  54.500  1.00 22.96 ? 229 LEU B CB  1 
ATOM   5473 C CG  . LEU B 1 207 ? 103.402 10.233  54.893  1.00 21.17 ? 229 LEU B CG  1 
ATOM   5474 C CD1 . LEU B 1 207 ? 103.546 10.462  56.385  1.00 21.22 ? 229 LEU B CD1 1 
ATOM   5475 C CD2 . LEU B 1 207 ? 104.021 8.908   54.496  1.00 23.85 ? 229 LEU B CD2 1 
ATOM   5476 N N   . GLU B 1 208 ? 100.263 9.024   51.710  1.00 15.52 ? 230 GLU B N   1 
ATOM   5477 C CA  . GLU B 1 208 ? 99.095  8.249   51.318  1.00 20.55 ? 230 GLU B CA  1 
ATOM   5478 C C   . GLU B 1 208 ? 99.524  6.795   51.215  1.00 20.91 ? 230 GLU B C   1 
ATOM   5479 O O   . GLU B 1 208 ? 100.540 6.493   50.580  1.00 23.12 ? 230 GLU B O   1 
ATOM   5480 C CB  . GLU B 1 208 ? 98.517  8.748   49.986  1.00 22.84 ? 230 GLU B CB  1 
ATOM   5481 C CG  . GLU B 1 208 ? 97.128  8.217   49.668  1.00 24.29 ? 230 GLU B CG  1 
ATOM   5482 C CD  . GLU B 1 208 ? 96.025  9.083   50.255  1.00 37.38 ? 230 GLU B CD  1 
ATOM   5483 O OE1 . GLU B 1 208 ? 96.152  10.327  50.209  1.00 34.17 ? 230 GLU B OE1 1 
ATOM   5484 O OE2 . GLU B 1 208 ? 95.031  8.516   50.762  1.00 43.37 ? 230 GLU B OE2 1 
ATOM   5485 N N   . ALA B 1 209 ? 98.770  5.898   51.848  1.00 15.05 ? 231 ALA B N   1 
ATOM   5486 C CA  . ALA B 1 209 ? 99.203  4.512   51.922  1.00 14.73 ? 231 ALA B CA  1 
ATOM   5487 C C   . ALA B 1 209 ? 98.013  3.569   51.971  1.00 21.39 ? 231 ALA B C   1 
ATOM   5488 O O   . ALA B 1 209 ? 96.971  3.877   52.561  1.00 15.71 ? 231 ALA B O   1 
ATOM   5489 C CB  . ALA B 1 209 ? 100.085 4.254   53.145  1.00 17.20 ? 231 ALA B CB  1 
ATOM   5490 N N   . SER B 1 210 ? 98.196  2.412   51.340  1.00 16.12 ? 232 SER B N   1 
ATOM   5491 C CA  . SER B 1 210 ? 97.377  1.233   51.571  1.00 16.14 ? 232 SER B CA  1 
ATOM   5492 C C   . SER B 1 210 ? 98.327  0.062   51.770  1.00 17.57 ? 232 SER B C   1 
ATOM   5493 O O   . SER B 1 210 ? 99.287  -0.097  51.010  1.00 20.81 ? 232 SER B O   1 
ATOM   5494 C CB  . SER B 1 210 ? 96.408  0.975   50.411  1.00 18.45 ? 232 SER B CB  1 
ATOM   5495 O OG  . SER B 1 210 ? 97.097  0.664   49.214  1.00 30.74 ? 232 SER B OG  1 
ATOM   5496 N N   . ALA B 1 211 ? 98.083  -0.732  52.808  1.00 17.58 ? 233 ALA B N   1 
ATOM   5497 C CA  . ALA B 1 211 ? 98.965  -1.833  53.161  1.00 21.92 ? 233 ALA B CA  1 
ATOM   5498 C C   . ALA B 1 211 ? 98.142  -3.072  53.466  1.00 24.18 ? 233 ALA B C   1 
ATOM   5499 O O   . ALA B 1 211 ? 97.030  -2.983  53.991  1.00 27.74 ? 233 ALA B O   1 
ATOM   5500 C CB  . ALA B 1 211 ? 99.843  -1.487  54.369  1.00 21.14 ? 233 ALA B CB  1 
ATOM   5501 N N   . GLU B 1 212 ? 98.697  -4.235  53.134  1.00 26.95 ? 234 GLU B N   1 
ATOM   5502 C CA  . GLU B 1 212 ? 98.032  -5.505  53.422  1.00 32.49 ? 234 GLU B CA  1 
ATOM   5503 C C   . GLU B 1 212 ? 98.349  -5.956  54.849  1.00 30.72 ? 234 GLU B C   1 
ATOM   5504 O O   . GLU B 1 212 ? 98.935  -7.010  55.089  1.00 41.14 ? 234 GLU B O   1 
ATOM   5505 C CB  . GLU B 1 212 ? 98.431  -6.559  52.398  1.00 30.36 ? 234 GLU B CB  1 
ATOM   5506 C CG  . GLU B 1 212 ? 97.675  -6.459  51.083  1.00 34.20 ? 234 GLU B CG  1 
ATOM   5507 C CD  . GLU B 1 212 ? 96.389  -7.264  51.084  1.00 49.30 ? 234 GLU B CD  1 
ATOM   5508 O OE1 . GLU B 1 212 ? 95.370  -6.755  50.568  1.00 59.06 ? 234 GLU B OE1 1 
ATOM   5509 O OE2 . GLU B 1 212 ? 96.395  -8.405  51.597  1.00 50.15 ? 234 GLU B OE2 1 
ATOM   5510 N N   . ASN B 1 213 ? 97.955  -5.107  55.803  1.00 26.76 ? 235 ASN B N   1 
ATOM   5511 C CA  . ASN B 1 213 ? 98.076  -5.386  57.237  1.00 31.26 ? 235 ASN B CA  1 
ATOM   5512 C C   . ASN B 1 213 ? 99.528  -5.592  57.671  1.00 28.49 ? 235 ASN B C   1 
ATOM   5513 O O   . ASN B 1 213 ? 99.806  -6.366  58.589  1.00 31.86 ? 235 ASN B O   1 
ATOM   5514 C CB  . ASN B 1 213 ? 97.220  -6.592  57.636  1.00 26.00 ? 235 ASN B CB  1 
ATOM   5515 C CG  . ASN B 1 213 ? 96.732  -6.512  59.069  1.00 31.57 ? 235 ASN B CG  1 
ATOM   5516 O OD1 . ASN B 1 213 ? 96.868  -5.479  59.725  1.00 36.28 ? 235 ASN B OD1 1 
ATOM   5517 N ND2 . ASN B 1 213 ? 96.159  -7.606  59.563  1.00 27.38 ? 235 ASN B ND2 1 
ATOM   5518 N N   . ILE B 1 214 ? 100.467 -4.890  57.032  1.00 23.76 ? 236 ILE B N   1 
ATOM   5519 C CA  . ILE B 1 214 ? 101.875 -5.041  57.395  1.00 27.72 ? 236 ILE B CA  1 
ATOM   5520 C C   . ILE B 1 214 ? 102.118 -4.520  58.810  1.00 31.94 ? 236 ILE B C   1 
ATOM   5521 O O   . ILE B 1 214 ? 101.338 -3.739  59.367  1.00 36.30 ? 236 ILE B O   1 
ATOM   5522 C CB  . ILE B 1 214 ? 102.786 -4.328  56.381  1.00 26.37 ? 236 ILE B CB  1 
ATOM   5523 C CG1 . ILE B 1 214 ? 102.710 -2.812  56.568  1.00 19.68 ? 236 ILE B CG1 1 
ATOM   5524 C CG2 . ILE B 1 214 ? 102.426 -4.717  54.959  1.00 24.43 ? 236 ILE B CG2 1 
ATOM   5525 C CD1 . ILE B 1 214 ? 103.747 -2.058  55.782  1.00 27.24 ? 236 ILE B CD1 1 
ATOM   5526 N N   . LEU B 1 215 ? 103.232 -4.953  59.397  1.00 28.04 ? 237 LEU B N   1 
ATOM   5527 C CA  . LEU B 1 215 ? 103.568 -4.521  60.745  1.00 32.65 ? 237 LEU B CA  1 
ATOM   5528 C C   . LEU B 1 215 ? 103.997 -3.064  60.764  1.00 33.10 ? 237 LEU B C   1 
ATOM   5529 O O   . LEU B 1 215 ? 104.550 -2.538  59.794  1.00 36.37 ? 237 LEU B O   1 
ATOM   5530 C CB  . LEU B 1 215 ? 104.681 -5.374  61.341  1.00 35.07 ? 237 LEU B CB  1 
ATOM   5531 C CG  . LEU B 1 215 ? 104.294 -6.796  61.712  1.00 47.40 ? 237 LEU B CG  1 
ATOM   5532 C CD1 . LEU B 1 215 ? 104.713 -7.786  60.639  1.00 46.55 ? 237 LEU B CD1 1 
ATOM   5533 C CD2 . LEU B 1 215 ? 104.931 -7.104  63.048  1.00 47.49 ? 237 LEU B CD2 1 
ATOM   5534 N N   . GLN B 1 216 ? 103.745 -2.423  61.905  1.00 32.43 ? 238 GLN B N   1 
ATOM   5535 C CA  . GLN B 1 216 ? 104.094 -1.020  62.084  1.00 27.70 ? 238 GLN B CA  1 
ATOM   5536 C C   . GLN B 1 216 ? 105.575 -0.777  61.827  1.00 37.98 ? 238 GLN B C   1 
ATOM   5537 O O   . GLN B 1 216 ? 105.958 0.272   61.295  1.00 35.32 ? 238 GLN B O   1 
ATOM   5538 C CB  . GLN B 1 216 ? 103.714 -0.587  63.501  1.00 23.41 ? 238 GLN B CB  1 
ATOM   5539 C CG  . GLN B 1 216 ? 103.828 0.894   63.796  1.00 25.30 ? 238 GLN B CG  1 
ATOM   5540 C CD  . GLN B 1 216 ? 102.991 1.286   64.999  1.00 31.11 ? 238 GLN B CD  1 
ATOM   5541 O OE1 . GLN B 1 216 ? 101.757 1.238   64.951  1.00 31.73 ? 238 GLN B OE1 1 
ATOM   5542 N NE2 . GLN B 1 216 ? 103.655 1.654   66.095  1.00 23.03 ? 238 GLN B NE2 1 
ATOM   5543 N N   . GLN B 1 217 ? 106.423 -1.742  62.191  1.00 40.08 ? 239 GLN B N   1 
ATOM   5544 C CA  . GLN B 1 217 ? 107.862 -1.541  62.070  1.00 35.93 ? 239 GLN B CA  1 
ATOM   5545 C C   . GLN B 1 217 ? 108.286 -1.441  60.610  1.00 33.95 ? 239 GLN B C   1 
ATOM   5546 O O   . GLN B 1 217 ? 109.095 -0.576  60.252  1.00 37.96 ? 239 GLN B O   1 
ATOM   5547 C CB  . GLN B 1 217 ? 108.604 -2.672  62.780  1.00 32.30 ? 239 GLN B CB  1 
ATOM   5548 C CG  . GLN B 1 217 ? 110.085 -2.419  62.944  1.00 41.46 ? 239 GLN B CG  1 
ATOM   5549 C CD  . GLN B 1 217 ? 110.901 -3.680  62.773  1.00 59.02 ? 239 GLN B CD  1 
ATOM   5550 O OE1 . GLN B 1 217 ? 111.870 -3.712  62.010  1.00 62.44 ? 239 GLN B OE1 1 
ATOM   5551 N NE2 . GLN B 1 217 ? 110.511 -4.733  63.482  1.00 60.75 ? 239 GLN B NE2 1 
ATOM   5552 N N   . ASP B 1 218 ? 107.755 -2.316  59.753  1.00 32.59 ? 240 ASP B N   1 
ATOM   5553 C CA  . ASP B 1 218 ? 108.035 -2.207  58.324  1.00 37.77 ? 240 ASP B CA  1 
ATOM   5554 C C   . ASP B 1 218 ? 107.425 -0.939  57.739  1.00 36.13 ? 240 ASP B C   1 
ATOM   5555 O O   . ASP B 1 218 ? 108.081 -0.227  56.970  1.00 42.00 ? 240 ASP B O   1 
ATOM   5556 C CB  . ASP B 1 218 ? 107.511 -3.437  57.580  1.00 38.09 ? 240 ASP B CB  1 
ATOM   5557 C CG  . ASP B 1 218 ? 107.925 -4.739  58.236  1.00 37.49 ? 240 ASP B CG  1 
ATOM   5558 O OD1 . ASP B 1 218 ? 109.018 -4.781  58.846  1.00 37.07 ? 240 ASP B OD1 1 
ATOM   5559 O OD2 . ASP B 1 218 ? 107.154 -5.722  58.134  1.00 34.09 ? 240 ASP B OD2 1 
ATOM   5560 N N   . PHE B 1 219 ? 106.170 -0.647  58.089  1.00 31.61 ? 241 PHE B N   1 
ATOM   5561 C CA  . PHE B 1 219 ? 105.515 0.563   57.603  1.00 28.24 ? 241 PHE B CA  1 
ATOM   5562 C C   . PHE B 1 219 ? 106.332 1.807   57.935  1.00 30.00 ? 241 PHE B C   1 
ATOM   5563 O O   . PHE B 1 219 ? 106.521 2.680   57.080  1.00 27.64 ? 241 PHE B O   1 
ATOM   5564 C CB  . PHE B 1 219 ? 104.108 0.659   58.198  1.00 29.31 ? 241 PHE B CB  1 
ATOM   5565 C CG  . PHE B 1 219 ? 103.228 1.679   57.528  1.00 31.77 ? 241 PHE B CG  1 
ATOM   5566 C CD1 . PHE B 1 219 ? 102.582 1.383   56.338  1.00 24.53 ? 241 PHE B CD1 1 
ATOM   5567 C CD2 . PHE B 1 219 ? 103.038 2.932   58.095  1.00 30.43 ? 241 PHE B CD2 1 
ATOM   5568 C CE1 . PHE B 1 219 ? 101.773 2.317   55.720  1.00 19.44 ? 241 PHE B CE1 1 
ATOM   5569 C CE2 . PHE B 1 219 ? 102.225 3.871   57.481  1.00 25.52 ? 241 PHE B CE2 1 
ATOM   5570 C CZ  . PHE B 1 219 ? 101.594 3.562   56.292  1.00 21.90 ? 241 PHE B CZ  1 
ATOM   5571 N N   . CYS B 1 220 ? 106.835 1.903   59.169  1.00 37.07 ? 242 CYS B N   1 
ATOM   5572 C CA  . CYS B 1 220 ? 107.641 3.061   59.547  1.00 34.45 ? 242 CYS B CA  1 
ATOM   5573 C C   . CYS B 1 220 ? 109.005 3.036   58.878  1.00 34.48 ? 242 CYS B C   1 
ATOM   5574 O O   . CYS B 1 220 ? 109.561 4.095   58.566  1.00 33.57 ? 242 CYS B O   1 
ATOM   5575 C CB  . CYS B 1 220 ? 107.809 3.119   61.061  1.00 31.49 ? 242 CYS B CB  1 
ATOM   5576 S SG  . CYS B 1 220 ? 106.275 3.353   61.945  1.00 29.92 ? 242 CYS B SG  1 
ATOM   5577 N N   . HIS B 1 221 ? 109.566 1.847   58.664  1.00 35.19 ? 243 HIS B N   1 
ATOM   5578 C CA  . HIS B 1 221 ? 110.816 1.770   57.921  1.00 40.73 ? 243 HIS B CA  1 
ATOM   5579 C C   . HIS B 1 221 ? 110.604 2.173   56.470  1.00 41.02 ? 243 HIS B C   1 
ATOM   5580 O O   . HIS B 1 221 ? 111.452 2.853   55.878  1.00 42.49 ? 243 HIS B O   1 
ATOM   5581 C CB  . HIS B 1 221 ? 111.407 0.364   58.009  1.00 44.19 ? 243 HIS B CB  1 
ATOM   5582 C CG  . HIS B 1 221 ? 112.763 0.247   57.387  1.00 49.47 ? 243 HIS B CG  1 
ATOM   5583 N ND1 . HIS B 1 221 ? 113.013 -0.544  56.286  1.00 46.47 ? 243 HIS B ND1 1 
ATOM   5584 C CD2 . HIS B 1 221 ? 113.939 0.840   57.699  1.00 47.02 ? 243 HIS B CD2 1 
ATOM   5585 C CE1 . HIS B 1 221 ? 114.287 -0.443  55.954  1.00 51.99 ? 243 HIS B CE1 1 
ATOM   5586 N NE2 . HIS B 1 221 ? 114.871 0.393   56.795  1.00 54.63 ? 243 HIS B NE2 1 
ATOM   5587 N N   . ALA B 1 222 ? 109.469 1.774   55.887  1.00 36.33 ? 244 ALA B N   1 
ATOM   5588 C CA  . ALA B 1 222 ? 109.178 2.141   54.506  1.00 32.38 ? 244 ALA B CA  1 
ATOM   5589 C C   . ALA B 1 222 ? 109.001 3.646   54.357  1.00 30.56 ? 244 ALA B C   1 
ATOM   5590 O O   . ALA B 1 222 ? 109.404 4.222   53.340  1.00 33.98 ? 244 ALA B O   1 
ATOM   5591 C CB  . ALA B 1 222 ? 107.935 1.403   54.019  1.00 25.50 ? 244 ALA B CB  1 
ATOM   5592 N N   . ILE B 1 223 ? 108.401 4.300   55.355  1.00 25.83 ? 245 ILE B N   1 
ATOM   5593 C CA  . ILE B 1 223 ? 108.262 5.754   55.309  1.00 30.33 ? 245 ILE B CA  1 
ATOM   5594 C C   . ILE B 1 223 ? 109.632 6.419   55.322  1.00 33.62 ? 245 ILE B C   1 
ATOM   5595 O O   . ILE B 1 223 ? 109.876 7.385   54.586  1.00 25.79 ? 245 ILE B O   1 
ATOM   5596 C CB  . ILE B 1 223 ? 107.384 6.249   56.474  1.00 22.74 ? 245 ILE B CB  1 
ATOM   5597 C CG1 . ILE B 1 223 ? 105.952 5.742   56.320  1.00 25.36 ? 245 ILE B CG1 1 
ATOM   5598 C CG2 . ILE B 1 223 ? 107.394 7.762   56.539  1.00 14.45 ? 245 ILE B CG2 1 
ATOM   5599 C CD1 . ILE B 1 223 ? 105.084 6.016   57.524  1.00 24.74 ? 245 ILE B CD1 1 
ATOM   5600 N N   . LYS B 1 224 ? 110.548 5.913   56.157  1.00 33.15 ? 246 LYS B N   1 
ATOM   5601 C CA  . LYS B 1 224 ? 111.886 6.491   56.238  1.00 32.52 ? 246 LYS B CA  1 
ATOM   5602 C C   . LYS B 1 224 ? 112.659 6.289   54.940  1.00 31.06 ? 246 LYS B C   1 
ATOM   5603 O O   . LYS B 1 224 ? 113.397 7.181   54.505  1.00 29.93 ? 246 LYS B O   1 
ATOM   5604 C CB  . LYS B 1 224 ? 112.649 5.887   57.418  1.00 39.94 ? 246 LYS B CB  1 
ATOM   5605 C CG  . LYS B 1 224 ? 112.618 6.735   58.683  1.00 40.52 ? 246 LYS B CG  1 
ATOM   5606 C CD  . LYS B 1 224 ? 113.121 5.957   59.889  1.00 37.42 ? 246 LYS B CD  1 
ATOM   5607 C CE  . LYS B 1 224 ? 113.074 6.805   61.156  1.00 36.21 ? 246 LYS B CE  1 
ATOM   5608 N NZ  . LYS B 1 224 ? 113.359 6.001   62.380  1.00 34.68 ? 246 LYS B NZ  1 
ATOM   5609 N N   . VAL B 1 225 ? 112.502 5.123   54.309  1.00 32.81 ? 247 VAL B N   1 
ATOM   5610 C CA  . VAL B 1 225 ? 113.134 4.884   53.013  1.00 37.96 ? 247 VAL B CA  1 
ATOM   5611 C C   . VAL B 1 225 ? 112.657 5.912   51.993  1.00 36.06 ? 247 VAL B C   1 
ATOM   5612 O O   . VAL B 1 225 ? 113.463 6.570   51.323  1.00 35.19 ? 247 VAL B O   1 
ATOM   5613 C CB  . VAL B 1 225 ? 112.853 3.446   52.534  1.00 36.46 ? 247 VAL B CB  1 
ATOM   5614 C CG1 . VAL B 1 225 ? 113.152 3.311   51.046  1.00 33.21 ? 247 VAL B CG1 1 
ATOM   5615 C CG2 . VAL B 1 225 ? 113.663 2.444   53.340  1.00 38.16 ? 247 VAL B CG2 1 
ATOM   5616 N N   . GLY B 1 226 ? 111.336 6.072   51.873  1.00 30.23 ? 248 GLY B N   1 
ATOM   5617 C CA  . GLY B 1 226 ? 110.795 6.979   50.875  1.00 28.48 ? 248 GLY B CA  1 
ATOM   5618 C C   . GLY B 1 226 ? 111.264 8.410   51.055  1.00 30.39 ? 248 GLY B C   1 
ATOM   5619 O O   . GLY B 1 226 ? 111.598 9.091   50.081  1.00 28.43 ? 248 GLY B O   1 
ATOM   5620 N N   . VAL B 1 227 ? 111.296 8.889   52.299  1.00 31.08 ? 249 VAL B N   1 
ATOM   5621 C CA  . VAL B 1 227 ? 111.715 10.267  52.531  1.00 28.73 ? 249 VAL B CA  1 
ATOM   5622 C C   . VAL B 1 227 ? 113.157 10.457  52.088  1.00 33.26 ? 249 VAL B C   1 
ATOM   5623 O O   . VAL B 1 227 ? 113.517 11.497  51.520  1.00 28.91 ? 249 VAL B O   1 
ATOM   5624 C CB  . VAL B 1 227 ? 111.516 10.651  54.009  1.00 21.94 ? 249 VAL B CB  1 
ATOM   5625 C CG1 . VAL B 1 227 ? 112.043 12.057  54.264  1.00 20.90 ? 249 VAL B CG1 1 
ATOM   5626 C CG2 . VAL B 1 227 ? 110.045 10.554  54.388  1.00 25.86 ? 249 VAL B CG2 1 
ATOM   5627 N N   . LYS B 1 228 ? 114.000 9.446   52.324  1.00 33.79 ? 250 LYS B N   1 
ATOM   5628 C CA  . LYS B 1 228 ? 115.393 9.527   51.899  1.00 32.10 ? 250 LYS B CA  1 
ATOM   5629 C C   . LYS B 1 228 ? 115.494 9.746   50.398  1.00 34.30 ? 250 LYS B C   1 
ATOM   5630 O O   . LYS B 1 228 ? 116.296 10.564  49.933  1.00 41.98 ? 250 LYS B O   1 
ATOM   5631 C CB  . LYS B 1 228 ? 116.143 8.260   52.308  1.00 37.77 ? 250 LYS B CB  1 
ATOM   5632 C CG  . LYS B 1 228 ? 117.511 8.109   51.659  1.00 46.90 ? 250 LYS B CG  1 
ATOM   5633 C CD  . LYS B 1 228 ? 117.723 6.697   51.126  1.00 52.09 ? 250 LYS B CD  1 
ATOM   5634 C CE  . LYS B 1 228 ? 117.679 5.665   52.246  1.00 55.81 ? 250 LYS B CE  1 
ATOM   5635 N NZ  . LYS B 1 228 ? 117.947 4.287   51.744  1.00 55.13 ? 250 LYS B NZ  1 
ATOM   5636 N N   . TYR B 1 229 ? 114.670 9.040   49.623  1.00 32.99 ? 251 TYR B N   1 
ATOM   5637 C CA  . TYR B 1 229 ? 114.714 9.202   48.176  1.00 33.95 ? 251 TYR B CA  1 
ATOM   5638 C C   . TYR B 1 229 ? 114.093 10.519  47.731  1.00 29.94 ? 251 TYR B C   1 
ATOM   5639 O O   . TYR B 1 229 ? 114.498 11.073  46.704  1.00 33.45 ? 251 TYR B O   1 
ATOM   5640 C CB  . TYR B 1 229 ? 114.024 8.020   47.500  1.00 29.10 ? 251 TYR B CB  1 
ATOM   5641 C CG  . TYR B 1 229 ? 114.857 6.762   47.540  1.00 38.30 ? 251 TYR B CG  1 
ATOM   5642 C CD1 . TYR B 1 229 ? 115.955 6.608   46.703  1.00 45.99 ? 251 TYR B CD1 1 
ATOM   5643 C CD2 . TYR B 1 229 ? 114.558 5.736   48.425  1.00 40.16 ? 251 TYR B CD2 1 
ATOM   5644 C CE1 . TYR B 1 229 ? 116.726 5.463   46.736  1.00 52.19 ? 251 TYR B CE1 1 
ATOM   5645 C CE2 . TYR B 1 229 ? 115.324 4.587   48.468  1.00 50.26 ? 251 TYR B CE2 1 
ATOM   5646 C CZ  . TYR B 1 229 ? 116.406 4.454   47.619  1.00 56.59 ? 251 TYR B CZ  1 
ATOM   5647 O OH  . TYR B 1 229 ? 117.173 3.312   47.656  1.00 65.69 ? 251 TYR B OH  1 
ATOM   5648 N N   . THR B 1 230 ? 113.119 11.042  48.478  1.00 29.61 ? 252 THR B N   1 
ATOM   5649 C CA  . THR B 1 230 ? 112.580 12.350  48.126  1.00 30.17 ? 252 THR B CA  1 
ATOM   5650 C C   . THR B 1 230 ? 113.640 13.433  48.257  1.00 36.39 ? 252 THR B C   1 
ATOM   5651 O O   . THR B 1 230 ? 113.595 14.433  47.532  1.00 38.46 ? 252 THR B O   1 
ATOM   5652 C CB  . THR B 1 230 ? 111.371 12.694  48.997  1.00 28.50 ? 252 THR B CB  1 
ATOM   5653 O OG1 . THR B 1 230 ? 111.770 12.758  50.372  1.00 31.76 ? 252 THR B OG1 1 
ATOM   5654 C CG2 . THR B 1 230 ? 110.285 11.649  48.832  1.00 23.06 ? 252 THR B CG2 1 
ATOM   5655 N N   . GLN B 1 231 ? 114.599 13.249  49.168  1.00 36.65 ? 253 GLN B N   1 
ATOM   5656 C CA  . GLN B 1 231 ? 115.675 14.222  49.308  1.00 36.91 ? 253 GLN B CA  1 
ATOM   5657 C C   . GLN B 1 231 ? 116.649 14.141  48.140  1.00 40.05 ? 253 GLN B C   1 
ATOM   5658 O O   . GLN B 1 231 ? 117.279 15.146  47.788  1.00 39.22 ? 253 GLN B O   1 
ATOM   5659 C CB  . GLN B 1 231 ? 116.399 14.013  50.637  1.00 28.71 ? 253 GLN B CB  1 
ATOM   5660 C CG  . GLN B 1 231 ? 115.490 14.127  51.857  1.00 27.35 ? 253 GLN B CG  1 
ATOM   5661 C CD  . GLN B 1 231 ? 114.774 15.470  51.941  1.00 32.70 ? 253 GLN B CD  1 
ATOM   5662 O OE1 . GLN B 1 231 ? 115.387 16.497  52.240  1.00 29.56 ? 253 GLN B OE1 1 
ATOM   5663 N NE2 . GLN B 1 231 ? 113.469 15.466  51.678  1.00 31.51 ? 253 GLN B NE2 1 
ATOM   5664 N N   . GLN B 1 232 ? 116.777 12.962  47.524  1.00 36.58 ? 254 GLN B N   1 
ATOM   5665 C CA  . GLN B 1 232 ? 117.598 12.836  46.324  1.00 37.91 ? 254 GLN B CA  1 
ATOM   5666 C C   . GLN B 1 232 ? 116.973 13.578  45.148  1.00 40.11 ? 254 GLN B C   1 
ATOM   5667 O O   . GLN B 1 232 ? 117.680 14.231  44.370  1.00 42.94 ? 254 GLN B O   1 
ATOM   5668 C CB  . GLN B 1 232 ? 117.803 11.361  45.979  1.00 30.13 ? 254 GLN B CB  1 
ATOM   5669 C CG  . GLN B 1 232 ? 118.655 10.596  46.981  1.00 38.57 ? 254 GLN B CG  1 
ATOM   5670 C CD  . GLN B 1 232 ? 118.910 9.162   46.550  1.00 52.16 ? 254 GLN B CD  1 
ATOM   5671 O OE1 . GLN B 1 232 ? 118.966 8.860   45.358  1.00 56.14 ? 254 GLN B OE1 1 
ATOM   5672 N NE2 . GLN B 1 232 ? 119.061 8.269   47.523  1.00 54.49 ? 254 GLN B NE2 1 
ATOM   5673 N N   . ILE B 1 233 ? 115.648 13.492  45.005  1.00 35.02 ? 255 ILE B N   1 
ATOM   5674 C CA  . ILE B 1 233 ? 114.974 14.163  43.898  1.00 31.71 ? 255 ILE B CA  1 
ATOM   5675 C C   . ILE B 1 233 ? 115.107 15.674  44.026  1.00 38.87 ? 255 ILE B C   1 
ATOM   5676 O O   . ILE B 1 233 ? 115.352 16.372  43.035  1.00 37.23 ? 255 ILE B O   1 
ATOM   5677 C CB  . ILE B 1 233 ? 113.500 13.731  43.831  1.00 26.88 ? 255 ILE B CB  1 
ATOM   5678 C CG1 . ILE B 1 233 ? 113.398 12.223  43.604  1.00 33.14 ? 255 ILE B CG1 1 
ATOM   5679 C CG2 . ILE B 1 233 ? 112.782 14.485  42.732  1.00 24.42 ? 255 ILE B CG2 1 
ATOM   5680 C CD1 . ILE B 1 233 ? 111.976 11.705  43.557  1.00 21.23 ? 255 ILE B CD1 1 
ATOM   5681 N N   . ILE B 1 234 ? 114.957 16.203  45.244  1.00 38.49 ? 256 ILE B N   1 
ATOM   5682 C CA  . ILE B 1 234 ? 115.078 17.644  45.456  1.00 39.26 ? 256 ILE B CA  1 
ATOM   5683 C C   . ILE B 1 234 ? 116.463 18.134  45.059  1.00 44.71 ? 256 ILE B C   1 
ATOM   5684 O O   . ILE B 1 234 ? 116.615 19.259  44.561  1.00 43.85 ? 256 ILE B O   1 
ATOM   5685 C CB  . ILE B 1 234 ? 114.744 17.993  46.920  1.00 41.93 ? 256 ILE B CB  1 
ATOM   5686 C CG1 . ILE B 1 234 ? 113.309 17.578  47.249  1.00 37.05 ? 256 ILE B CG1 1 
ATOM   5687 C CG2 . ILE B 1 234 ? 114.922 19.481  47.181  1.00 39.50 ? 256 ILE B CG2 1 
ATOM   5688 C CD1 . ILE B 1 234 ? 112.932 17.804  48.690  1.00 30.51 ? 256 ILE B CD1 1 
ATOM   5689 N N   . GLN B 1 235 ? 117.493 17.307  45.259  1.00 45.78 ? 257 GLN B N   1 
ATOM   5690 C CA  . GLN B 1 235 ? 118.818 17.662  44.764  1.00 47.54 ? 257 GLN B CA  1 
ATOM   5691 C C   . GLN B 1 235 ? 118.810 17.795  43.247  1.00 51.36 ? 257 GLN B C   1 
ATOM   5692 O O   . GLN B 1 235 ? 119.424 18.714  42.693  1.00 56.93 ? 257 GLN B O   1 
ATOM   5693 C CB  . GLN B 1 235 ? 119.847 16.623  45.212  1.00 50.34 ? 257 GLN B CB  1 
ATOM   5694 C CG  . GLN B 1 235 ? 120.508 16.938  46.550  1.00 59.73 ? 257 GLN B CG  1 
ATOM   5695 C CD  . GLN B 1 235 ? 121.647 17.942  46.431  1.00 72.26 ? 257 GLN B CD  1 
ATOM   5696 O OE1 . GLN B 1 235 ? 121.461 19.060  45.950  1.00 68.61 ? 257 GLN B OE1 1 
ATOM   5697 N NE2 . GLN B 1 235 ? 122.832 17.545  46.880  1.00 69.16 ? 257 GLN B NE2 1 
ATOM   5698 N N   . GLY B 1 236 ? 118.102 16.894  42.561  1.00 48.84 ? 258 GLY B N   1 
ATOM   5699 C CA  . GLY B 1 236 ? 117.970 17.013  41.118  1.00 42.89 ? 258 GLY B CA  1 
ATOM   5700 C C   . GLY B 1 236 ? 117.266 18.289  40.696  1.00 40.69 ? 258 GLY B C   1 
ATOM   5701 O O   . GLY B 1 236 ? 117.696 18.962  39.756  1.00 50.61 ? 258 GLY B O   1 
ATOM   5702 N N   . ILE B 1 237 ? 116.177 18.642  41.382  1.00 33.77 ? 259 ILE B N   1 
ATOM   5703 C CA  . ILE B 1 237 ? 115.443 19.853  41.027  1.00 38.49 ? 259 ILE B CA  1 
ATOM   5704 C C   . ILE B 1 237 ? 116.316 21.081  41.244  1.00 46.69 ? 259 ILE B C   1 
ATOM   5705 O O   . ILE B 1 237 ? 116.515 21.889  40.330  1.00 45.54 ? 259 ILE B O   1 
ATOM   5706 C CB  . ILE B 1 237 ? 114.132 19.962  41.827  1.00 40.92 ? 259 ILE B CB  1 
ATOM   5707 C CG1 . ILE B 1 237 ? 113.526 18.586  42.111  1.00 40.85 ? 259 ILE B CG1 1 
ATOM   5708 C CG2 . ILE B 1 237 ? 113.136 20.841  41.087  1.00 34.12 ? 259 ILE B CG2 1 
ATOM   5709 C CD1 . ILE B 1 237 ? 113.016 17.864  40.893  1.00 32.83 ? 259 ILE B CD1 1 
ATOM   5710 N N   . GLN B 1 238 ? 116.848 21.236  42.461  1.00 53.88 ? 260 GLN B N   1 
ATOM   5711 C CA  . GLN B 1 238 ? 117.660 22.406  42.782  1.00 55.03 ? 260 GLN B CA  1 
ATOM   5712 C C   . GLN B 1 238 ? 118.857 22.530  41.851  1.00 53.25 ? 260 GLN B C   1 
ATOM   5713 O O   . GLN B 1 238 ? 119.276 23.648  41.526  1.00 48.79 ? 260 GLN B O   1 
ATOM   5714 C CB  . GLN B 1 238 ? 118.122 22.341  44.238  1.00 57.21 ? 260 GLN B CB  1 
ATOM   5715 C CG  . GLN B 1 238 ? 117.054 22.732  45.249  1.00 55.01 ? 260 GLN B CG  1 
ATOM   5716 C CD  . GLN B 1 238 ? 117.463 22.424  46.678  1.00 59.39 ? 260 GLN B CD  1 
ATOM   5717 O OE1 . GLN B 1 238 ? 118.281 21.535  46.925  1.00 59.22 ? 260 GLN B OE1 1 
ATOM   5718 N NE2 . GLN B 1 238 ? 116.894 23.157  47.628  1.00 56.21 ? 260 GLN B NE2 1 
ATOM   5719 N N   . GLN B 1 239 ? 119.417 21.398  41.412  1.00 55.38 ? 261 GLN B N   1 
ATOM   5720 C CA  . GLN B 1 239 ? 120.481 21.435  40.415  1.00 56.97 ? 261 GLN B CA  1 
ATOM   5721 C C   . GLN B 1 239 ? 119.974 21.973  39.083  1.00 54.16 ? 261 GLN B C   1 
ATOM   5722 O O   . GLN B 1 239 ? 120.712 22.664  38.373  1.00 59.50 ? 261 GLN B O   1 
ATOM   5723 C CB  . GLN B 1 239 ? 121.080 20.039  40.234  1.00 53.60 ? 261 GLN B CB  1 
ATOM   5724 C CG  . GLN B 1 239 ? 122.132 19.942  39.139  1.00 56.30 ? 261 GLN B CG  1 
ATOM   5725 C CD  . GLN B 1 239 ? 122.595 18.518  38.904  1.00 62.38 ? 261 GLN B CD  1 
ATOM   5726 O OE1 . GLN B 1 239 ? 122.333 17.627  39.710  1.00 60.43 ? 261 GLN B OE1 1 
ATOM   5727 N NE2 . GLN B 1 239 ? 123.288 18.297  37.792  1.00 69.44 ? 261 GLN B NE2 1 
ATOM   5728 N N   . LEU B 1 240 ? 118.719 21.683  38.736  1.00 47.53 ? 262 LEU B N   1 
ATOM   5729 C CA  . LEU B 1 240 ? 118.181 22.157  37.469  1.00 47.14 ? 262 LEU B CA  1 
ATOM   5730 C C   . LEU B 1 240 ? 117.782 23.627  37.528  1.00 50.82 ? 262 LEU B C   1 
ATOM   5731 O O   . LEU B 1 240 ? 117.915 24.333  36.523  1.00 62.11 ? 262 LEU B O   1 
ATOM   5732 C CB  . LEU B 1 240 ? 116.992 21.293  37.046  1.00 45.72 ? 262 LEU B CB  1 
ATOM   5733 C CG  . LEU B 1 240 ? 116.150 21.791  35.870  1.00 46.16 ? 262 LEU B CG  1 
ATOM   5734 C CD1 . LEU B 1 240 ? 116.860 21.544  34.548  1.00 46.84 ? 262 LEU B CD1 1 
ATOM   5735 C CD2 . LEU B 1 240 ? 114.782 21.131  35.879  1.00 35.91 ? 262 LEU B CD2 1 
ATOM   5736 N N   . VAL B 1 241 ? 117.322 24.119  38.682  1.00 51.36 ? 263 VAL B N   1 
ATOM   5737 C CA  . VAL B 1 241 ? 116.917 25.523  38.758  1.00 57.26 ? 263 VAL B CA  1 
ATOM   5738 C C   . VAL B 1 241 ? 118.115 26.452  38.596  1.00 68.38 ? 263 VAL B C   1 
ATOM   5739 O O   . VAL B 1 241 ? 117.970 27.583  38.114  1.00 69.07 ? 263 VAL B O   1 
ATOM   5740 C CB  . VAL B 1 241 ? 116.153 25.812  40.066  1.00 46.94 ? 263 VAL B CB  1 
ATOM   5741 C CG1 . VAL B 1 241 ? 115.143 24.718  40.346  1.00 51.13 ? 263 VAL B CG1 1 
ATOM   5742 C CG2 . VAL B 1 241 ? 117.111 25.981  41.238  1.00 52.52 ? 263 VAL B CG2 1 
ATOM   5743 N N   . LYS B 1 242 ? 119.313 26.006  38.982  1.00 64.35 ? 264 LYS B N   1 
ATOM   5744 C CA  . LYS B 1 242 ? 120.485 26.846  38.772  1.00 65.15 ? 264 LYS B CA  1 
ATOM   5745 C C   . LYS B 1 242 ? 120.975 26.765  37.333  1.00 71.17 ? 264 LYS B C   1 
ATOM   5746 O O   . LYS B 1 242 ? 121.537 27.740  36.821  1.00 81.94 ? 264 LYS B O   1 
ATOM   5747 C CB  . LYS B 1 242 ? 121.599 26.472  39.755  1.00 59.29 ? 264 LYS B CB  1 
ATOM   5748 C CG  . LYS B 1 242 ? 122.298 25.149  39.487  1.00 63.14 ? 264 LYS B CG  1 
ATOM   5749 C CD  . LYS B 1 242 ? 123.573 25.030  40.317  1.00 68.18 ? 264 LYS B CD  1 
ATOM   5750 C CE  . LYS B 1 242 ? 124.346 23.759  39.989  1.00 72.26 ? 264 LYS B CE  1 
ATOM   5751 N NZ  . LYS B 1 242 ? 125.811 23.902  40.248  1.00 59.61 ? 264 LYS B NZ  1 
ATOM   5752 N N   . GLU B 1 243 ? 120.755 25.629  36.660  1.00 62.46 ? 265 GLU B N   1 
ATOM   5753 C CA  . GLU B 1 243 ? 121.101 25.533  35.245  1.00 63.83 ? 265 GLU B CA  1 
ATOM   5754 C C   . GLU B 1 243 ? 120.101 26.280  34.373  1.00 66.88 ? 265 GLU B C   1 
ATOM   5755 O O   . GLU B 1 243 ? 120.473 26.812  33.321  1.00 81.85 ? 265 GLU B O   1 
ATOM   5756 C CB  . GLU B 1 243 ? 121.182 24.069  34.813  1.00 49.14 ? 265 GLU B CB  1 
ATOM   5757 C CG  . GLU B 1 243 ? 122.387 23.321  35.351  1.00 51.04 ? 265 GLU B CG  1 
ATOM   5758 C CD  . GLU B 1 243 ? 122.335 21.838  35.041  1.00 60.28 ? 265 GLU B CD  1 
ATOM   5759 O OE1 . GLU B 1 243 ? 122.541 21.028  35.970  1.00 64.19 ? 265 GLU B OE1 1 
ATOM   5760 O OE2 . GLU B 1 243 ? 122.087 21.481  33.869  1.00 59.49 ? 265 GLU B OE2 1 
ATOM   5761 N N   . THR B 1 244 ? 118.836 26.336  34.790  1.00 62.07 ? 266 THR B N   1 
ATOM   5762 C CA  . THR B 1 244 ? 117.820 27.001  33.982  1.00 66.44 ? 266 THR B CA  1 
ATOM   5763 C C   . THR B 1 244 ? 117.767 28.498  34.262  1.00 72.66 ? 266 THR B C   1 
ATOM   5764 O O   . THR B 1 244 ? 117.509 29.293  33.351  1.00 71.50 ? 266 THR B O   1 
ATOM   5765 C CB  . THR B 1 244 ? 116.451 26.368  34.237  1.00 63.69 ? 266 THR B CB  1 
ATOM   5766 O OG1 . THR B 1 244 ? 116.278 26.160  35.643  1.00 66.36 ? 266 THR B OG1 1 
ATOM   5767 C CG2 . THR B 1 244 ? 116.336 25.033  33.514  1.00 51.84 ? 266 THR B CG2 1 
ATOM   5768 N N   . GLY B 1 245 ? 118.010 28.901  35.507  1.00 70.18 ? 267 GLY B N   1 
ATOM   5769 C CA  . GLY B 1 245 ? 117.881 30.295  35.885  1.00 64.25 ? 267 GLY B CA  1 
ATOM   5770 C C   . GLY B 1 245 ? 116.437 30.685  36.123  1.00 68.90 ? 267 GLY B C   1 
ATOM   5771 O O   . GLY B 1 245 ? 115.672 30.874  35.171  1.00 70.86 ? 267 GLY B O   1 
ATOM   5772 N N   . VAL B 1 246 ? 116.051 30.807  37.390  1.00 63.63 ? 268 VAL B N   1 
ATOM   5773 C CA  . VAL B 1 246 ? 114.667 31.049  37.781  1.00 63.24 ? 268 VAL B CA  1 
ATOM   5774 C C   . VAL B 1 246 ? 114.600 32.373  38.527  1.00 60.38 ? 268 VAL B C   1 
ATOM   5775 O O   . VAL B 1 246 ? 115.435 32.643  39.398  1.00 60.21 ? 268 VAL B O   1 
ATOM   5776 C CB  . VAL B 1 246 ? 114.118 29.898  38.647  1.00 55.99 ? 268 VAL B CB  1 
ATOM   5777 C CG1 . VAL B 1 246 ? 112.722 30.222  39.165  1.00 49.55 ? 268 VAL B CG1 1 
ATOM   5778 C CG2 . VAL B 1 246 ? 114.111 28.599  37.855  1.00 54.44 ? 268 VAL B CG2 1 
ATOM   5779 N N   . THR B 1 247 ? 113.611 33.197  38.183  1.00 60.85 ? 269 THR B N   1 
ATOM   5780 C CA  . THR B 1 247 ? 113.367 34.466  38.858  1.00 67.25 ? 269 THR B CA  1 
ATOM   5781 C C   . THR B 1 247 ? 111.888 34.554  39.205  1.00 61.92 ? 269 THR B C   1 
ATOM   5782 O O   . THR B 1 247 ? 111.035 34.466  38.316  1.00 60.94 ? 269 THR B O   1 
ATOM   5783 C CB  . THR B 1 247 ? 113.786 35.653  37.983  1.00 66.05 ? 269 THR B CB  1 
ATOM   5784 O OG1 . THR B 1 247 ? 115.138 35.473  37.541  1.00 64.85 ? 269 THR B OG1 1 
ATOM   5785 C CG2 . THR B 1 247 ? 113.679 36.958  38.767  1.00 48.94 ? 269 THR B CG2 1 
ATOM   5786 N N   . LYS B 1 248 ? 111.588 34.728  40.489  1.00 50.78 ? 270 LYS B N   1 
ATOM   5787 C CA  . LYS B 1 248 ? 110.214 34.781  40.964  1.00 51.33 ? 270 LYS B CA  1 
ATOM   5788 C C   . LYS B 1 248 ? 109.693 36.214  40.961  1.00 53.32 ? 270 LYS B C   1 
ATOM   5789 O O   . LYS B 1 248 ? 110.434 37.165  41.220  1.00 60.86 ? 270 LYS B O   1 
ATOM   5790 C CB  . LYS B 1 248 ? 110.109 34.189  42.372  1.00 50.89 ? 270 LYS B CB  1 
ATOM   5791 C CG  . LYS B 1 248 ? 110.777 32.824  42.525  1.00 51.80 ? 270 LYS B CG  1 
ATOM   5792 C CD  . LYS B 1 248 ? 109.799 31.685  42.250  1.00 43.32 ? 270 LYS B CD  1 
ATOM   5793 C CE  . LYS B 1 248 ? 110.484 30.327  42.300  1.00 45.15 ? 270 LYS B CE  1 
ATOM   5794 N NZ  . LYS B 1 248 ? 109.508 29.217  42.498  1.00 38.98 ? 270 LYS B NZ  1 
ATOM   5795 N N   . ARG B 1 249 ? 108.403 36.358  40.662  1.00 50.70 ? 271 ARG B N   1 
ATOM   5796 C CA  . ARG B 1 249 ? 107.774 37.669  40.676  1.00 49.57 ? 271 ARG B CA  1 
ATOM   5797 C C   . ARG B 1 249 ? 107.630 38.181  42.103  1.00 54.23 ? 271 ARG B C   1 
ATOM   5798 O O   . ARG B 1 249 ? 107.766 37.442  43.083  1.00 50.72 ? 271 ARG B O   1 
ATOM   5799 C CB  . ARG B 1 249 ? 106.390 37.623  40.025  1.00 51.63 ? 271 ARG B CB  1 
ATOM   5800 C CG  . ARG B 1 249 ? 105.308 37.034  40.933  1.00 55.21 ? 271 ARG B CG  1 
ATOM   5801 C CD  . ARG B 1 249 ? 103.983 36.822  40.206  1.00 50.19 ? 271 ARG B CD  1 
ATOM   5802 N NE  . ARG B 1 249 ? 104.012 35.641  39.346  1.00 56.39 ? 271 ARG B NE  1 
ATOM   5803 C CZ  . ARG B 1 249 ? 102.933 35.054  38.834  1.00 53.48 ? 271 ARG B CZ  1 
ATOM   5804 N NH1 . ARG B 1 249 ? 101.722 35.533  39.093  1.00 47.00 ? 271 ARG B NH1 1 
ATOM   5805 N NH2 . ARG B 1 249 ? 103.066 33.984  38.057  1.00 40.52 ? 271 ARG B NH2 1 
ATOM   5806 N N   . THR B 1 250 ? 107.342 39.477  42.207  1.00 54.81 ? 272 THR B N   1 
ATOM   5807 C CA  . THR B 1 250 ? 106.877 40.073  43.449  1.00 56.94 ? 272 THR B CA  1 
ATOM   5808 C C   . THR B 1 250 ? 105.373 40.266  43.328  1.00 56.35 ? 272 THR B C   1 
ATOM   5809 O O   . THR B 1 250 ? 104.926 41.182  42.619  1.00 61.84 ? 272 THR B O   1 
ATOM   5810 C CB  . THR B 1 250 ? 107.575 41.408  43.717  1.00 50.82 ? 272 THR B CB  1 
ATOM   5811 O OG1 . THR B 1 250 ? 108.993 41.213  43.723  1.00 55.57 ? 272 THR B OG1 1 
ATOM   5812 C CG2 . THR B 1 250 ? 107.144 41.971  45.060  1.00 48.74 ? 272 THR B CG2 1 
ATOM   5813 N N   . PRO B 1 251 ? 104.553 39.429  43.961  1.00 56.38 ? 273 PRO B N   1 
ATOM   5814 C CA  . PRO B 1 251 ? 103.101 39.591  43.839  1.00 56.95 ? 273 PRO B CA  1 
ATOM   5815 C C   . PRO B 1 251 ? 102.646 40.945  44.360  1.00 54.60 ? 273 PRO B C   1 
ATOM   5816 O O   . PRO B 1 251 ? 103.307 41.581  45.184  1.00 57.77 ? 273 PRO B O   1 
ATOM   5817 C CB  . PRO B 1 251 ? 102.538 38.443  44.689  1.00 52.32 ? 273 PRO B CB  1 
ATOM   5818 C CG  . PRO B 1 251 ? 103.668 38.024  45.577  1.00 50.13 ? 273 PRO B CG  1 
ATOM   5819 C CD  . PRO B 1 251 ? 104.914 38.268  44.789  1.00 54.31 ? 273 PRO B CD  1 
ATOM   5820 N N   . GLN B 1 252 ? 101.496 41.389  43.847  1.00 51.74 ? 274 GLN B N   1 
ATOM   5821 C CA  . GLN B 1 252 ? 100.968 42.699  44.215  1.00 52.74 ? 274 GLN B CA  1 
ATOM   5822 C C   . GLN B 1 252 ? 100.718 42.793  45.715  1.00 61.77 ? 274 GLN B C   1 
ATOM   5823 O O   . GLN B 1 252 ? 101.146 43.751  46.370  1.00 71.41 ? 274 GLN B O   1 
ATOM   5824 C CB  . GLN B 1 252 ? 99.680  42.980  43.439  1.00 48.40 ? 274 GLN B CB  1 
ATOM   5825 C CG  . GLN B 1 252 ? 99.887  43.250  41.959  1.00 59.80 ? 274 GLN B CG  1 
ATOM   5826 C CD  . GLN B 1 252 ? 98.587  43.563  41.241  1.00 70.22 ? 274 GLN B CD  1 
ATOM   5827 O OE1 . GLN B 1 252 ? 98.164  42.829  40.347  1.00 65.59 ? 274 GLN B OE1 1 
ATOM   5828 N NE2 . GLN B 1 252 ? 97.942  44.656  41.634  1.00 78.18 ? 274 GLN B NE2 1 
ATOM   5829 N N   . LYS B 1 253 ? 100.027 41.805  46.280  1.00 56.56 ? 275 LYS B N   1 
ATOM   5830 C CA  . LYS B 1 253 ? 99.680  41.851  47.694  1.00 56.34 ? 275 LYS B CA  1 
ATOM   5831 C C   . LYS B 1 253 ? 99.470  40.436  48.207  1.00 55.78 ? 275 LYS B C   1 
ATOM   5832 O O   . LYS B 1 253 ? 98.678  39.679  47.638  1.00 54.92 ? 275 LYS B O   1 
ATOM   5833 C CB  . LYS B 1 253 ? 98.416  42.696  47.921  1.00 51.24 ? 275 LYS B CB  1 
ATOM   5834 C CG  . LYS B 1 253 ? 98.202  43.136  49.367  1.00 52.20 ? 275 LYS B CG  1 
ATOM   5835 C CD  . LYS B 1 253 ? 96.944  43.982  49.515  1.00 47.03 ? 275 LYS B CD  1 
ATOM   5836 C CE  . LYS B 1 253 ? 97.037  44.924  50.712  1.00 49.49 ? 275 LYS B CE  1 
ATOM   5837 N NZ  . LYS B 1 253 ? 97.182  44.195  52.003  1.00 45.35 ? 275 LYS B NZ  1 
ATOM   5838 N N   . LEU B 1 254 ? 100.185 40.086  49.274  1.00 53.93 ? 276 LEU B N   1 
ATOM   5839 C CA  . LEU B 1 254 ? 99.914  38.869  50.032  1.00 45.79 ? 276 LEU B CA  1 
ATOM   5840 C C   . LEU B 1 254 ? 98.857  39.206  51.077  1.00 46.58 ? 276 LEU B C   1 
ATOM   5841 O O   . LEU B 1 254 ? 99.150  39.872  52.076  1.00 49.72 ? 276 LEU B O   1 
ATOM   5842 C CB  . LEU B 1 254 ? 101.191 38.334  50.675  1.00 40.87 ? 276 LEU B CB  1 
ATOM   5843 C CG  . LEU B 1 254 ? 102.261 37.866  49.688  1.00 37.79 ? 276 LEU B CG  1 
ATOM   5844 C CD1 . LEU B 1 254 ? 103.419 37.202  50.415  1.00 26.60 ? 276 LEU B CD1 1 
ATOM   5845 C CD2 . LEU B 1 254 ? 101.652 36.925  48.658  1.00 35.89 ? 276 LEU B CD2 1 
ATOM   5846 N N   . PHE B 1 255 ? 97.626  38.755  50.843  1.00 46.67 ? 277 PHE B N   1 
ATOM   5847 C CA  . PHE B 1 255 ? 96.484  39.181  51.643  1.00 47.11 ? 277 PHE B CA  1 
ATOM   5848 C C   . PHE B 1 255 ? 96.522  38.600  53.052  1.00 51.06 ? 277 PHE B C   1 
ATOM   5849 O O   . PHE B 1 255 ? 95.673  37.781  53.419  1.00 56.33 ? 277 PHE B O   1 
ATOM   5850 C CB  . PHE B 1 255 ? 95.179  38.798  50.943  1.00 52.17 ? 277 PHE B CB  1 
ATOM   5851 C CG  . PHE B 1 255 ? 94.940  39.545  49.659  1.00 57.31 ? 277 PHE B CG  1 
ATOM   5852 C CD1 . PHE B 1 255 ? 95.615  39.194  48.500  1.00 54.37 ? 277 PHE B CD1 1 
ATOM   5853 C CD2 . PHE B 1 255 ? 94.043  40.599  49.612  1.00 59.30 ? 277 PHE B CD2 1 
ATOM   5854 C CE1 . PHE B 1 255 ? 95.401  39.880  47.322  1.00 53.86 ? 277 PHE B CE1 1 
ATOM   5855 C CE2 . PHE B 1 255 ? 93.824  41.289  48.433  1.00 60.47 ? 277 PHE B CE2 1 
ATOM   5856 C CZ  . PHE B 1 255 ? 94.503  40.929  47.289  1.00 53.87 ? 277 PHE B CZ  1 
ATOM   5857 N N   . THR B 1 256 ? 97.503  39.024  53.849  1.00 51.34 ? 278 THR B N   1 
ATOM   5858 C CA  . THR B 1 256 ? 97.605  38.677  55.255  1.00 46.69 ? 278 THR B CA  1 
ATOM   5859 C C   . THR B 1 256 ? 97.259  39.889  56.114  1.00 46.98 ? 278 THR B C   1 
ATOM   5860 O O   . THR B 1 256 ? 97.606  41.020  55.754  1.00 45.99 ? 278 THR B O   1 
ATOM   5861 C CB  . THR B 1 256 ? 99.015  38.188  55.610  1.00 42.12 ? 278 THR B CB  1 
ATOM   5862 O OG1 . THR B 1 256 ? 99.853  39.309  55.917  1.00 52.60 ? 278 THR B OG1 1 
ATOM   5863 C CG2 . THR B 1 256 ? 99.618  37.425  54.444  1.00 42.77 ? 278 THR B CG2 1 
ATOM   5864 N N   . PRO B 1 257 ? 96.571  39.697  57.237  1.00 48.51 ? 279 PRO B N   1 
ATOM   5865 C CA  . PRO B 1 257 ? 96.164  40.849  58.046  1.00 48.06 ? 279 PRO B CA  1 
ATOM   5866 C C   . PRO B 1 257 ? 97.363  41.520  58.693  1.00 48.54 ? 279 PRO B C   1 
ATOM   5867 O O   . PRO B 1 257 ? 98.344  40.870  59.067  1.00 43.99 ? 279 PRO B O   1 
ATOM   5868 C CB  . PRO B 1 257 ? 95.227  40.236  59.093  1.00 38.75 ? 279 PRO B CB  1 
ATOM   5869 C CG  . PRO B 1 257 ? 95.663  38.825  59.200  1.00 39.65 ? 279 PRO B CG  1 
ATOM   5870 C CD  . PRO B 1 257 ? 96.142  38.421  57.834  1.00 45.87 ? 279 PRO B CD  1 
ATOM   5871 N N   . SER B 1 258 ? 97.276  42.845  58.808  1.00 45.70 ? 280 SER B N   1 
ATOM   5872 C CA  . SER B 1 258 ? 98.369  43.618  59.372  1.00 42.08 ? 280 SER B CA  1 
ATOM   5873 C C   . SER B 1 258 ? 98.501  43.338  60.869  1.00 43.41 ? 280 SER B C   1 
ATOM   5874 O O   . SER B 1 258 ? 97.513  43.034  61.544  1.00 41.99 ? 280 SER B O   1 
ATOM   5875 C CB  . SER B 1 258 ? 98.142  45.109  59.143  1.00 48.03 ? 280 SER B CB  1 
ATOM   5876 O OG  . SER B 1 258 ? 97.091  45.596  59.959  1.00 46.86 ? 280 SER B OG  1 
ATOM   5877 N N   . PRO B 1 259 ? 99.719  43.427  61.410  1.00 40.20 ? 281 PRO B N   1 
ATOM   5878 C CA  . PRO B 1 259 ? 99.896  43.187  62.853  1.00 39.58 ? 281 PRO B CA  1 
ATOM   5879 C C   . PRO B 1 259 ? 99.115  44.149  63.729  1.00 40.44 ? 281 PRO B C   1 
ATOM   5880 O O   . PRO B 1 259 ? 98.720  43.774  64.840  1.00 34.12 ? 281 PRO B O   1 
ATOM   5881 C CB  . PRO B 1 259 ? 101.409 43.351  63.051  1.00 37.15 ? 281 PRO B CB  1 
ATOM   5882 C CG  . PRO B 1 259 ? 102.001 43.127  61.694  1.00 42.09 ? 281 PRO B CG  1 
ATOM   5883 C CD  . PRO B 1 259 ? 100.997 43.655  60.718  1.00 40.57 ? 281 PRO B CD  1 
ATOM   5884 N N   . GLU B 1 260 ? 98.883  45.379  63.263  1.00 46.63 ? 282 GLU B N   1 
ATOM   5885 C CA  . GLU B 1 260 ? 98.154  46.359  64.063  1.00 41.22 ? 282 GLU B CA  1 
ATOM   5886 C C   . GLU B 1 260 ? 96.720  45.907  64.307  1.00 45.05 ? 282 GLU B C   1 
ATOM   5887 O O   . GLU B 1 260 ? 96.232  45.928  65.443  1.00 40.53 ? 282 GLU B O   1 
ATOM   5888 C CB  . GLU B 1 260 ? 98.180  47.721  63.369  1.00 42.96 ? 282 GLU B CB  1 
ATOM   5889 C CG  . GLU B 1 260 ? 99.579  48.306  63.190  1.00 63.42 ? 282 GLU B CG  1 
ATOM   5890 C CD  . GLU B 1 260 ? 100.282 47.805  61.933  1.00 65.40 ? 282 GLU B CD  1 
ATOM   5891 O OE1 . GLU B 1 260 ? 99.701  47.920  60.832  1.00 67.19 ? 282 GLU B OE1 1 
ATOM   5892 O OE2 . GLU B 1 260 ? 101.421 47.302  62.047  1.00 67.69 ? 282 GLU B OE2 1 
ATOM   5893 N N   . ILE B 1 261 ? 96.031  45.486  63.243  1.00 44.20 ? 283 ILE B N   1 
ATOM   5894 C CA  . ILE B 1 261 ? 94.669  44.986  63.390  1.00 39.32 ? 283 ILE B CA  1 
ATOM   5895 C C   . ILE B 1 261 ? 94.658  43.669  64.157  1.00 35.89 ? 283 ILE B C   1 
ATOM   5896 O O   . ILE B 1 261 ? 93.732  43.403  64.933  1.00 35.99 ? 283 ILE B O   1 
ATOM   5897 C CB  . ILE B 1 261 ? 94.008  44.855  62.006  1.00 38.40 ? 283 ILE B CB  1 
ATOM   5898 C CG1 . ILE B 1 261 ? 94.200  46.154  61.219  1.00 48.02 ? 283 ILE B CG1 1 
ATOM   5899 C CG2 . ILE B 1 261 ? 92.528  44.535  62.139  1.00 35.62 ? 283 ILE B CG2 1 
ATOM   5900 C CD1 . ILE B 1 261 ? 93.395  46.236  59.947  1.00 54.81 ? 283 ILE B CD1 1 
ATOM   5901 N N   . VAL B 1 262 ? 95.684  42.834  63.974  1.00 33.11 ? 284 VAL B N   1 
ATOM   5902 C CA  . VAL B 1 262 ? 95.739  41.576  64.710  1.00 30.73 ? 284 VAL B CA  1 
ATOM   5903 C C   . VAL B 1 262 ? 95.942  41.835  66.199  1.00 33.67 ? 284 VAL B C   1 
ATOM   5904 O O   . VAL B 1 262 ? 95.305  41.196  67.046  1.00 28.52 ? 284 VAL B O   1 
ATOM   5905 C CB  . VAL B 1 262 ? 96.836  40.665  64.128  1.00 30.18 ? 284 VAL B CB  1 
ATOM   5906 C CG1 . VAL B 1 262 ? 97.048  39.455  65.019  1.00 25.95 ? 284 VAL B CG1 1 
ATOM   5907 C CG2 . VAL B 1 262 ? 96.470  40.224  62.725  1.00 31.07 ? 284 VAL B CG2 1 
ATOM   5908 N N   . LYS B 1 263 ? 96.806  42.793  66.544  1.00 39.66 ? 285 LYS B N   1 
ATOM   5909 C CA  . LYS B 1 263 ? 97.063  43.090  67.952  1.00 32.80 ? 285 LYS B CA  1 
ATOM   5910 C C   . LYS B 1 263 ? 95.834  43.685  68.629  1.00 34.70 ? 285 LYS B C   1 
ATOM   5911 O O   . LYS B 1 263 ? 95.506  43.319  69.766  1.00 35.67 ? 285 LYS B O   1 
ATOM   5912 C CB  . LYS B 1 263 ? 98.259  44.037  68.085  1.00 33.98 ? 285 LYS B CB  1 
ATOM   5913 C CG  . LYS B 1 263 ? 98.764  44.217  69.511  1.00 32.12 ? 285 LYS B CG  1 
ATOM   5914 C CD  . LYS B 1 263 ? 99.959  43.317  69.803  1.00 34.97 ? 285 LYS B CD  1 
ATOM   5915 C CE  . LYS B 1 263 ? 100.570 43.634  71.157  1.00 29.92 ? 285 LYS B CE  1 
ATOM   5916 N NZ  . LYS B 1 263 ? 100.876 45.088  71.283  1.00 42.52 ? 285 LYS B NZ  1 
ATOM   5917 N N   . TYR B 1 264 ? 95.138  44.597  67.947  1.00 33.45 ? 286 TYR B N   1 
ATOM   5918 C CA  . TYR B 1 264 ? 93.925  45.173  68.518  1.00 38.72 ? 286 TYR B CA  1 
ATOM   5919 C C   . TYR B 1 264 ? 92.816  44.133  68.615  1.00 40.60 ? 286 TYR B C   1 
ATOM   5920 O O   . TYR B 1 264 ? 92.031  44.140  69.572  1.00 39.81 ? 286 TYR B O   1 
ATOM   5921 C CB  . TYR B 1 264 ? 93.470  46.375  67.689  1.00 43.90 ? 286 TYR B CB  1 
ATOM   5922 C CG  . TYR B 1 264 ? 92.393  47.204  68.356  1.00 50.02 ? 286 TYR B CG  1 
ATOM   5923 C CD1 . TYR B 1 264 ? 92.665  47.940  69.503  1.00 51.89 ? 286 TYR B CD1 1 
ATOM   5924 C CD2 . TYR B 1 264 ? 91.104  47.247  67.843  1.00 54.69 ? 286 TYR B CD2 1 
ATOM   5925 C CE1 . TYR B 1 264 ? 91.684  48.697  70.118  1.00 47.41 ? 286 TYR B CE1 1 
ATOM   5926 C CE2 . TYR B 1 264 ? 90.116  48.002  68.449  1.00 56.96 ? 286 TYR B CE2 1 
ATOM   5927 C CZ  . TYR B 1 264 ? 90.411  48.726  69.585  1.00 52.64 ? 286 TYR B CZ  1 
ATOM   5928 O OH  . TYR B 1 264 ? 89.429  49.477  70.190  1.00 64.69 ? 286 TYR B OH  1 
ATOM   5929 N N   . THR B 1 265 ? 92.732  43.233  67.630  1.00 33.93 ? 287 THR B N   1 
ATOM   5930 C CA  . THR B 1 265 ? 91.763  42.145  67.709  1.00 33.53 ? 287 THR B CA  1 
ATOM   5931 C C   . THR B 1 265 ? 92.069  41.215  68.872  1.00 33.02 ? 287 THR B C   1 
ATOM   5932 O O   . THR B 1 265 ? 91.147  40.663  69.485  1.00 35.05 ? 287 THR B O   1 
ATOM   5933 C CB  . THR B 1 265 ? 91.745  41.356  66.401  1.00 34.57 ? 287 THR B CB  1 
ATOM   5934 O OG1 . THR B 1 265 ? 91.780  42.263  65.294  1.00 40.17 ? 287 THR B OG1 1 
ATOM   5935 C CG2 . THR B 1 265 ? 90.489  40.502  66.311  1.00 35.03 ? 287 THR B CG2 1 
ATOM   5936 N N   . HIS B 1 266 ? 93.352  41.028  69.187  1.00 33.17 ? 288 HIS B N   1 
ATOM   5937 C CA  . HIS B 1 266 ? 93.724  40.187  70.319  1.00 35.25 ? 288 HIS B CA  1 
ATOM   5938 C C   . HIS B 1 266 ? 93.237  40.790  71.630  1.00 33.08 ? 288 HIS B C   1 
ATOM   5939 O O   . HIS B 1 266 ? 92.590  40.111  72.433  1.00 33.89 ? 288 HIS B O   1 
ATOM   5940 C CB  . HIS B 1 266 ? 95.240  39.984  70.346  1.00 35.64 ? 288 HIS B CB  1 
ATOM   5941 C CG  . HIS B 1 266 ? 95.706  39.056  71.424  1.00 34.47 ? 288 HIS B CG  1 
ATOM   5942 N ND1 . HIS B 1 266 ? 95.855  37.701  71.225  1.00 42.27 ? 288 HIS B ND1 1 
ATOM   5943 C CD2 . HIS B 1 266 ? 96.053  39.288  72.712  1.00 33.01 ? 288 HIS B CD2 1 
ATOM   5944 C CE1 . HIS B 1 266 ? 96.277  37.137  72.343  1.00 46.58 ? 288 HIS B CE1 1 
ATOM   5945 N NE2 . HIS B 1 266 ? 96.405  38.079  73.261  1.00 43.51 ? 288 HIS B NE2 1 
ATOM   5946 N N   . LYS B 1 267 ? 93.534  42.072  71.859  1.00 36.79 ? 289 LYS B N   1 
ATOM   5947 C CA  . LYS B 1 267 ? 93.085  42.737  73.078  1.00 35.26 ? 289 LYS B CA  1 
ATOM   5948 C C   . LYS B 1 267 ? 91.570  42.683  73.223  1.00 35.89 ? 289 LYS B C   1 
ATOM   5949 O O   . LYS B 1 267 ? 91.057  42.532  74.337  1.00 39.69 ? 289 LYS B O   1 
ATOM   5950 C CB  . LYS B 1 267 ? 93.579  44.187  73.082  1.00 39.29 ? 289 LYS B CB  1 
ATOM   5951 C CG  . LYS B 1 267 ? 92.853  45.118  74.040  1.00 47.71 ? 289 LYS B CG  1 
ATOM   5952 C CD  . LYS B 1 267 ? 93.216  46.574  73.765  1.00 50.09 ? 289 LYS B CD  1 
ATOM   5953 C CE  . LYS B 1 267 ? 92.570  47.512  74.774  1.00 60.14 ? 289 LYS B CE  1 
ATOM   5954 N NZ  . LYS B 1 267 ? 93.080  48.909  74.655  1.00 54.14 ? 289 LYS B NZ  1 
ATOM   5955 N N   . LEU B 1 268 ? 90.841  42.769  72.110  1.00 38.12 ? 290 LEU B N   1 
ATOM   5956 C CA  . LEU B 1 268 ? 89.386  42.819  72.165  1.00 36.00 ? 290 LEU B CA  1 
ATOM   5957 C C   . LEU B 1 268 ? 88.758  41.459  72.439  1.00 37.27 ? 290 LEU B C   1 
ATOM   5958 O O   . LEU B 1 268 ? 87.687  41.394  73.056  1.00 44.81 ? 290 LEU B O   1 
ATOM   5959 C CB  . LEU B 1 268 ? 88.833  43.382  70.853  1.00 38.89 ? 290 LEU B CB  1 
ATOM   5960 C CG  . LEU B 1 268 ? 88.377  44.841  70.866  1.00 47.07 ? 290 LEU B CG  1 
ATOM   5961 C CD1 . LEU B 1 268 ? 89.459  45.733  71.446  1.00 53.12 ? 290 LEU B CD1 1 
ATOM   5962 C CD2 . LEU B 1 268 ? 88.006  45.295  69.466  1.00 52.97 ? 290 LEU B CD2 1 
ATOM   5963 N N   . ALA B 1 269 ? 89.392  40.369  72.000  1.00 34.72 ? 291 ALA B N   1 
ATOM   5964 C CA  . ALA B 1 269 ? 88.740  39.069  71.983  1.00 36.77 ? 291 ALA B CA  1 
ATOM   5965 C C   . ALA B 1 269 ? 89.470  37.971  72.743  1.00 35.81 ? 291 ALA B C   1 
ATOM   5966 O O   . ALA B 1 269 ? 88.914  36.877  72.879  1.00 37.48 ? 291 ALA B O   1 
ATOM   5967 C CB  . ALA B 1 269 ? 88.529  38.599  70.533  1.00 34.15 ? 291 ALA B CB  1 
ATOM   5968 N N   . MET B 1 270 ? 90.680  38.221  73.247  1.00 38.36 ? 292 MET B N   1 
ATOM   5969 C CA  . MET B 1 270 ? 91.477  37.141  73.824  1.00 36.18 ? 292 MET B CA  1 
ATOM   5970 C C   . MET B 1 270 ? 90.772  36.502  75.014  1.00 40.86 ? 292 MET B C   1 
ATOM   5971 O O   . MET B 1 270 ? 90.538  35.288  75.033  1.00 44.28 ? 292 MET B O   1 
ATOM   5972 C CB  . MET B 1 270 ? 92.857  37.657  74.233  1.00 36.91 ? 292 MET B CB  1 
ATOM   5973 C CG  . MET B 1 270 ? 93.828  36.559  74.615  1.00 47.66 ? 292 MET B CG  1 
ATOM   5974 S SD  . MET B 1 270 ? 94.003  36.353  76.400  1.00 76.05 ? 292 MET B SD  1 
ATOM   5975 C CE  . MET B 1 270 ? 95.243  35.059  76.463  1.00 68.37 ? 292 MET B CE  1 
ATOM   5976 N N   . GLU B 1 271 ? 90.423  37.306  76.022  1.00 36.94 ? 293 GLU B N   1 
ATOM   5977 C CA  . GLU B 1 271 ? 89.858  36.738  77.242  1.00 42.89 ? 293 GLU B CA  1 
ATOM   5978 C C   . GLU B 1 271 ? 88.507  36.083  76.986  1.00 42.47 ? 293 GLU B C   1 
ATOM   5979 O O   . GLU B 1 271 ? 88.188  35.061  77.607  1.00 36.27 ? 293 GLU B O   1 
ATOM   5980 C CB  . GLU B 1 271 ? 89.741  37.814  78.322  1.00 54.28 ? 293 GLU B CB  1 
ATOM   5981 C CG  . GLU B 1 271 ? 90.947  37.893  79.261  1.00 67.11 ? 293 GLU B CG  1 
ATOM   5982 C CD  . GLU B 1 271 ? 91.088  36.672  80.165  1.00 78.38 ? 293 GLU B CD  1 
ATOM   5983 O OE1 . GLU B 1 271 ? 91.663  35.653  79.722  1.00 69.22 ? 293 GLU B OE1 1 
ATOM   5984 O OE2 . GLU B 1 271 ? 90.629  36.737  81.325  1.00 74.14 ? 293 GLU B OE2 1 
ATOM   5985 N N   . ARG B 1 272 ? 87.709  36.640  76.070  1.00 40.36 ? 294 ARG B N   1 
ATOM   5986 C CA  . ARG B 1 272 ? 86.426  36.024  75.744  1.00 40.45 ? 294 ARG B CA  1 
ATOM   5987 C C   . ARG B 1 272 ? 86.614  34.740  74.945  1.00 37.05 ? 294 ARG B C   1 
ATOM   5988 O O   . ARG B 1 272 ? 85.879  33.765  75.146  1.00 37.17 ? 294 ARG B O   1 
ATOM   5989 C CB  . ARG B 1 272 ? 85.544  37.013  74.983  1.00 43.99 ? 294 ARG B CB  1 
ATOM   5990 C CG  . ARG B 1 272 ? 85.042  38.162  75.842  1.00 45.17 ? 294 ARG B CG  1 
ATOM   5991 C CD  . ARG B 1 272 ? 84.326  39.202  75.007  1.00 49.92 ? 294 ARG B CD  1 
ATOM   5992 N NE  . ARG B 1 272 ? 83.101  38.671  74.419  1.00 55.66 ? 294 ARG B NE  1 
ATOM   5993 C CZ  . ARG B 1 272 ? 82.371  39.319  73.519  1.00 58.28 ? 294 ARG B CZ  1 
ATOM   5994 N NH1 . ARG B 1 272 ? 82.748  40.522  73.105  1.00 59.02 ? 294 ARG B NH1 1 
ATOM   5995 N NH2 . ARG B 1 272 ? 81.266  38.766  73.034  1.00 56.56 ? 294 ARG B NH2 1 
ATOM   5996 N N   . LEU B 1 273 ? 87.593  34.719  74.033  1.00 40.74 ? 295 LEU B N   1 
ATOM   5997 C CA  . LEU B 1 273 ? 87.910  33.482  73.325  1.00 35.40 ? 295 LEU B CA  1 
ATOM   5998 C C   . LEU B 1 273 ? 88.516  32.453  74.269  1.00 32.90 ? 295 LEU B C   1 
ATOM   5999 O O   . LEU B 1 273 ? 88.157  31.270  74.219  1.00 29.86 ? 295 LEU B O   1 
ATOM   6000 C CB  . LEU B 1 273 ? 88.861  33.763  72.163  1.00 26.91 ? 295 LEU B CB  1 
ATOM   6001 C CG  . LEU B 1 273 ? 88.246  34.439  70.936  1.00 29.53 ? 295 LEU B CG  1 
ATOM   6002 C CD1 . LEU B 1 273 ? 89.333  35.006  70.039  1.00 30.16 ? 295 LEU B CD1 1 
ATOM   6003 C CD2 . LEU B 1 273 ? 87.358  33.474  70.169  1.00 27.36 ? 295 LEU B CD2 1 
ATOM   6004 N N   . TYR B 1 274 ? 89.433  32.883  75.139  1.00 27.67 ? 296 TYR B N   1 
ATOM   6005 C CA  . TYR B 1 274 ? 89.980  31.971  76.135  1.00 27.82 ? 296 TYR B CA  1 
ATOM   6006 C C   . TYR B 1 274 ? 88.875  31.394  77.007  1.00 29.73 ? 296 TYR B C   1 
ATOM   6007 O O   . TYR B 1 274 ? 88.927  30.220  77.393  1.00 29.02 ? 296 TYR B O   1 
ATOM   6008 C CB  . TYR B 1 274 ? 91.022  32.690  76.994  1.00 33.79 ? 296 TYR B CB  1 
ATOM   6009 C CG  . TYR B 1 274 ? 91.690  31.801  78.026  1.00 33.32 ? 296 TYR B CG  1 
ATOM   6010 C CD1 . TYR B 1 274 ? 91.135  31.626  79.290  1.00 31.24 ? 296 TYR B CD1 1 
ATOM   6011 C CD2 . TYR B 1 274 ? 92.873  31.135  77.735  1.00 30.04 ? 296 TYR B CD2 1 
ATOM   6012 C CE1 . TYR B 1 274 ? 91.737  30.814  80.230  1.00 24.34 ? 296 TYR B CE1 1 
ATOM   6013 C CE2 . TYR B 1 274 ? 93.484  30.322  78.673  1.00 33.01 ? 296 TYR B CE2 1 
ATOM   6014 C CZ  . TYR B 1 274 ? 92.910  30.168  79.917  1.00 27.02 ? 296 TYR B CZ  1 
ATOM   6015 O OH  . TYR B 1 274 ? 93.510  29.361  80.851  1.00 35.24 ? 296 TYR B OH  1 
ATOM   6016 N N   . ALA B 1 275 ? 87.863  32.204  77.324  1.00 30.43 ? 297 ALA B N   1 
ATOM   6017 C CA  . ALA B 1 275 ? 86.749  31.715  78.127  1.00 26.03 ? 297 ALA B CA  1 
ATOM   6018 C C   . ALA B 1 275 ? 86.020  30.579  77.421  1.00 27.27 ? 297 ALA B C   1 
ATOM   6019 O O   . ALA B 1 275 ? 85.689  29.562  78.042  1.00 26.79 ? 297 ALA B O   1 
ATOM   6020 C CB  . ALA B 1 275 ? 85.790  32.861  78.438  1.00 26.81 ? 297 ALA B CB  1 
ATOM   6021 N N   . VAL B 1 276 ? 85.771  30.730  76.120  1.00 28.02 ? 298 VAL B N   1 
ATOM   6022 C CA  . VAL B 1 276 ? 85.029  29.714  75.380  1.00 31.93 ? 298 VAL B CA  1 
ATOM   6023 C C   . VAL B 1 276 ? 85.827  28.417  75.305  1.00 32.93 ? 298 VAL B C   1 
ATOM   6024 O O   . VAL B 1 276 ? 85.295  27.327  75.548  1.00 37.26 ? 298 VAL B O   1 
ATOM   6025 C CB  . VAL B 1 276 ? 84.660  30.238  73.980  1.00 28.24 ? 298 VAL B CB  1 
ATOM   6026 C CG1 . VAL B 1 276 ? 84.121  29.115  73.112  1.00 26.71 ? 298 VAL B CG1 1 
ATOM   6027 C CG2 . VAL B 1 276 ? 83.644  31.357  74.091  1.00 29.39 ? 298 VAL B CG2 1 
ATOM   6028 N N   . PHE B 1 277 ? 87.115  28.514  74.989  1.00 29.02 ? 299 PHE B N   1 
ATOM   6029 C CA  . PHE B 1 277 ? 87.963  27.342  74.816  1.00 24.21 ? 299 PHE B CA  1 
ATOM   6030 C C   . PHE B 1 277 ? 88.442  26.741  76.136  1.00 26.05 ? 299 PHE B C   1 
ATOM   6031 O O   . PHE B 1 277 ? 89.270  25.822  76.115  1.00 26.15 ? 299 PHE B O   1 
ATOM   6032 C CB  . PHE B 1 277 ? 89.161  27.695  73.932  1.00 24.79 ? 299 PHE B CB  1 
ATOM   6033 C CG  . PHE B 1 277 ? 88.781  28.141  72.551  1.00 23.72 ? 299 PHE B CG  1 
ATOM   6034 C CD1 . PHE B 1 277 ? 87.831  27.447  71.822  1.00 25.31 ? 299 PHE B CD1 1 
ATOM   6035 C CD2 . PHE B 1 277 ? 89.366  29.258  71.983  1.00 27.50 ? 299 PHE B CD2 1 
ATOM   6036 C CE1 . PHE B 1 277 ? 87.474  27.857  70.548  1.00 24.33 ? 299 PHE B CE1 1 
ATOM   6037 C CE2 . PHE B 1 277 ? 89.011  29.675  70.710  1.00 27.48 ? 299 PHE B CE2 1 
ATOM   6038 C CZ  . PHE B 1 277 ? 88.064  28.973  69.993  1.00 23.56 ? 299 PHE B CZ  1 
ATOM   6039 N N   . THR B 1 278 ? 87.958  27.230  77.279  1.00 27.33 ? 300 THR B N   1 
ATOM   6040 C CA  . THR B 1 278 ? 88.178  26.557  78.553  1.00 32.61 ? 300 THR B CA  1 
ATOM   6041 C C   . THR B 1 278 ? 86.884  26.051  79.173  1.00 36.08 ? 300 THR B C   1 
ATOM   6042 O O   . THR B 1 278 ? 86.928  25.426  80.239  1.00 29.19 ? 300 THR B O   1 
ATOM   6043 C CB  . THR B 1 278 ? 88.896  27.477  79.552  1.00 24.72 ? 300 THR B CB  1 
ATOM   6044 O OG1 . THR B 1 278 ? 88.199  28.726  79.652  1.00 34.86 ? 300 THR B OG1 1 
ATOM   6045 C CG2 . THR B 1 278 ? 90.332  27.728  79.111  1.00 21.49 ? 300 THR B CG2 1 
ATOM   6046 N N   . ASP B 1 279 ? 85.741  26.300  78.536  1.00 36.23 ? 301 ASP B N   1 
ATOM   6047 C CA  . ASP B 1 279 ? 84.445  25.829  79.013  1.00 40.18 ? 301 ASP B CA  1 
ATOM   6048 C C   . ASP B 1 279 ? 84.155  24.483  78.360  1.00 44.43 ? 301 ASP B C   1 
ATOM   6049 O O   . ASP B 1 279 ? 83.856  24.418  77.163  1.00 51.37 ? 301 ASP B O   1 
ATOM   6050 C CB  . ASP B 1 279 ? 83.355  26.846  78.689  1.00 37.99 ? 301 ASP B CB  1 
ATOM   6051 C CG  . ASP B 1 279 ? 82.003  26.440  79.227  1.00 43.41 ? 301 ASP B CG  1 
ATOM   6052 O OD1 . ASP B 1 279 ? 81.750  26.655  80.431  1.00 52.71 ? 301 ASP B OD1 1 
ATOM   6053 O OD2 . ASP B 1 279 ? 81.194  25.899  78.448  1.00 49.44 ? 301 ASP B OD2 1 
ATOM   6054 N N   . TYR B 1 280 ? 84.235  23.408  79.145  1.00 41.31 ? 302 TYR B N   1 
ATOM   6055 C CA  . TYR B 1 280 ? 84.157  22.061  78.591  1.00 42.10 ? 302 TYR B CA  1 
ATOM   6056 C C   . TYR B 1 280 ? 82.730  21.588  78.350  1.00 46.96 ? 302 TYR B C   1 
ATOM   6057 O O   . TYR B 1 280 ? 82.544  20.515  77.765  1.00 44.30 ? 302 TYR B O   1 
ATOM   6058 C CB  . TYR B 1 280 ? 84.874  21.074  79.513  1.00 39.62 ? 302 TYR B CB  1 
ATOM   6059 C CG  . TYR B 1 280 ? 86.258  21.518  79.923  1.00 35.12 ? 302 TYR B CG  1 
ATOM   6060 C CD1 . TYR B 1 280 ? 87.102  22.158  79.023  1.00 34.22 ? 302 TYR B CD1 1 
ATOM   6061 C CD2 . TYR B 1 280 ? 86.724  21.295  81.211  1.00 34.59 ? 302 TYR B CD2 1 
ATOM   6062 C CE1 . TYR B 1 280 ? 88.370  22.565  79.397  1.00 37.79 ? 302 TYR B CE1 1 
ATOM   6063 C CE2 . TYR B 1 280 ? 87.988  21.696  81.593  1.00 34.45 ? 302 TYR B CE2 1 
ATOM   6064 C CZ  . TYR B 1 280 ? 88.807  22.331  80.685  1.00 35.92 ? 302 TYR B CZ  1 
ATOM   6065 O OH  . TYR B 1 280 ? 90.065  22.731  81.071  1.00 36.28 ? 302 TYR B OH  1 
ATOM   6066 N N   . GLU B 1 281 ? 81.727  22.351  78.784  1.00 48.12 ? 303 GLU B N   1 
ATOM   6067 C CA  . GLU B 1 281 ? 80.339  21.985  78.537  1.00 50.17 ? 303 GLU B CA  1 
ATOM   6068 C C   . GLU B 1 281 ? 79.903  22.272  77.108  1.00 46.50 ? 303 GLU B C   1 
ATOM   6069 O O   . GLU B 1 281 ? 78.836  21.804  76.696  1.00 47.96 ? 303 GLU B O   1 
ATOM   6070 C CB  . GLU B 1 281 ? 79.415  22.720  79.514  1.00 53.18 ? 303 GLU B CB  1 
ATOM   6071 C CG  . GLU B 1 281 ? 79.849  22.627  80.968  1.00 55.26 ? 303 GLU B CG  1 
ATOM   6072 C CD  . GLU B 1 281 ? 80.064  21.194  81.418  1.00 67.38 ? 303 GLU B CD  1 
ATOM   6073 O OE1 . GLU B 1 281 ? 79.230  20.330  81.071  1.00 67.96 ? 303 GLU B OE1 1 
ATOM   6074 O OE2 . GLU B 1 281 ? 81.069  20.931  82.115  1.00 68.18 ? 303 GLU B OE2 1 
ATOM   6075 N N   . HIS B 1 282 ? 80.697  23.023  76.350  1.00 48.40 ? 304 HIS B N   1 
ATOM   6076 C CA  . HIS B 1 282 ? 80.337  23.345  74.977  1.00 45.38 ? 304 HIS B CA  1 
ATOM   6077 C C   . HIS B 1 282 ? 80.283  22.083  74.125  1.00 37.08 ? 304 HIS B C   1 
ATOM   6078 O O   . HIS B 1 282 ? 81.121  21.186  74.256  1.00 33.45 ? 304 HIS B O   1 
ATOM   6079 C CB  . HIS B 1 282 ? 81.346  24.326  74.381  1.00 42.08 ? 304 HIS B CB  1 
ATOM   6080 C CG  . HIS B 1 282 ? 81.044  25.763  74.670  1.00 38.32 ? 304 HIS B CG  1 
ATOM   6081 N ND1 . HIS B 1 282 ? 79.994  26.435  74.083  1.00 37.94 ? 304 HIS B ND1 1 
ATOM   6082 C CD2 . HIS B 1 282 ? 81.665  26.661  75.470  1.00 42.99 ? 304 HIS B CD2 1 
ATOM   6083 C CE1 . HIS B 1 282 ? 79.976  27.683  74.514  1.00 44.11 ? 304 HIS B CE1 1 
ATOM   6084 N NE2 . HIS B 1 282 ? 80.980  27.847  75.357  1.00 43.06 ? 304 HIS B NE2 1 
ATOM   6085 N N   . ASP B 1 283 ? 79.278  22.017  73.258  1.00 38.12 ? 305 ASP B N   1 
ATOM   6086 C CA  . ASP B 1 283 ? 79.205  21.003  72.220  1.00 37.58 ? 305 ASP B CA  1 
ATOM   6087 C C   . ASP B 1 283 ? 79.801  21.587  70.939  1.00 43.12 ? 305 ASP B C   1 
ATOM   6088 O O   . ASP B 1 283 ? 80.326  22.704  70.930  1.00 44.25 ? 305 ASP B O   1 
ATOM   6089 C CB  . ASP B 1 283 ? 77.763  20.533  72.032  1.00 38.76 ? 305 ASP B CB  1 
ATOM   6090 C CG  . ASP B 1 283 ? 76.804  21.680  71.753  1.00 53.89 ? 305 ASP B CG  1 
ATOM   6091 O OD1 . ASP B 1 283 ? 76.150  22.163  72.707  1.00 52.00 ? 305 ASP B OD1 1 
ATOM   6092 O OD2 . ASP B 1 283 ? 76.707  22.101  70.578  1.00 53.21 ? 305 ASP B OD2 1 
ATOM   6093 N N   . LYS B 1 284 ? 79.722  20.840  69.837  1.00 38.40 ? 306 LYS B N   1 
ATOM   6094 C CA  . LYS B 1 284 ? 80.317  21.311  68.590  1.00 33.72 ? 306 LYS B CA  1 
ATOM   6095 C C   . LYS B 1 284 ? 79.645  22.588  68.099  1.00 39.06 ? 306 LYS B C   1 
ATOM   6096 O O   . LYS B 1 284 ? 80.317  23.495  67.593  1.00 41.28 ? 306 LYS B O   1 
ATOM   6097 C CB  . LYS B 1 284 ? 80.237  20.215  67.527  1.00 34.65 ? 306 LYS B CB  1 
ATOM   6098 C CG  . LYS B 1 284 ? 80.520  20.685  66.110  1.00 27.20 ? 306 LYS B CG  1 
ATOM   6099 C CD  . LYS B 1 284 ? 79.847  19.781  65.093  1.00 32.04 ? 306 LYS B CD  1 
ATOM   6100 C CE  . LYS B 1 284 ? 79.803  20.427  63.719  1.00 39.07 ? 306 LYS B CE  1 
ATOM   6101 N NZ  . LYS B 1 284 ? 78.831  19.749  62.818  1.00 36.74 ? 306 LYS B NZ  1 
ATOM   6102 N N   . VAL B 1 285 ? 78.326  22.686  68.248  1.00 45.23 ? 307 VAL B N   1 
ATOM   6103 C CA  . VAL B 1 285 ? 77.593  23.827  67.705  1.00 44.11 ? 307 VAL B CA  1 
ATOM   6104 C C   . VAL B 1 285 ? 77.583  25.000  68.676  1.00 46.38 ? 307 VAL B C   1 
ATOM   6105 O O   . VAL B 1 285 ? 77.722  26.154  68.263  1.00 47.78 ? 307 VAL B O   1 
ATOM   6106 C CB  . VAL B 1 285 ? 76.163  23.403  67.323  1.00 37.67 ? 307 VAL B CB  1 
ATOM   6107 C CG1 . VAL B 1 285 ? 75.580  24.372  66.303  1.00 38.11 ? 307 VAL B CG1 1 
ATOM   6108 C CG2 . VAL B 1 285 ? 76.160  21.984  66.783  1.00 45.73 ? 307 VAL B CG2 1 
ATOM   6109 N N   . SER B 1 286 ? 77.417  24.735  69.972  1.00 43.07 ? 308 SER B N   1 
ATOM   6110 C CA  . SER B 1 286 ? 77.382  25.828  70.936  1.00 41.92 ? 308 SER B CA  1 
ATOM   6111 C C   . SER B 1 286 ? 78.731  26.527  71.044  1.00 43.71 ? 308 SER B C   1 
ATOM   6112 O O   . SER B 1 286 ? 78.782  27.719  71.369  1.00 46.25 ? 308 SER B O   1 
ATOM   6113 C CB  . SER B 1 286 ? 76.935  25.312  72.303  1.00 42.25 ? 308 SER B CB  1 
ATOM   6114 O OG  . SER B 1 286 ? 77.933  24.502  72.889  1.00 43.97 ? 308 SER B OG  1 
ATOM   6115 N N   . ARG B 1 287 ? 79.828  25.812  70.776  1.00 43.67 ? 309 ARG B N   1 
ATOM   6116 C CA  . ARG B 1 287 ? 81.147  26.436  70.803  1.00 34.72 ? 309 ARG B CA  1 
ATOM   6117 C C   . ARG B 1 287 ? 81.416  27.223  69.531  1.00 36.92 ? 309 ARG B C   1 
ATOM   6118 O O   . ARG B 1 287 ? 82.062  28.275  69.576  1.00 32.88 ? 309 ARG B O   1 
ATOM   6119 C CB  . ARG B 1 287 ? 82.235  25.383  71.001  1.00 37.04 ? 309 ARG B CB  1 
ATOM   6120 C CG  . ARG B 1 287 ? 83.627  25.972  71.177  1.00 33.73 ? 309 ARG B CG  1 
ATOM   6121 C CD  . ARG B 1 287 ? 84.709  24.976  70.799  1.00 28.97 ? 309 ARG B CD  1 
ATOM   6122 N NE  . ARG B 1 287 ? 84.618  23.751  71.587  1.00 32.91 ? 309 ARG B NE  1 
ATOM   6123 C CZ  . ARG B 1 287 ? 84.196  22.587  71.105  1.00 34.62 ? 309 ARG B CZ  1 
ATOM   6124 N NH1 . ARG B 1 287 ? 83.827  22.496  69.831  1.00 27.52 ? 309 ARG B NH1 1 
ATOM   6125 N NH2 . ARG B 1 287 ? 84.143  21.519  71.894  1.00 33.40 ? 309 ARG B NH2 1 
ATOM   6126 N N   . ASP B 1 288 ? 80.942  26.720  68.387  1.00 39.74 ? 310 ASP B N   1 
ATOM   6127 C CA  . ASP B 1 288 ? 81.097  27.461  67.140  1.00 36.62 ? 310 ASP B CA  1 
ATOM   6128 C C   . ASP B 1 288 ? 80.290  28.751  67.168  1.00 39.17 ? 310 ASP B C   1 
ATOM   6129 O O   . ASP B 1 288 ? 80.752  29.792  66.685  1.00 44.25 ? 310 ASP B O   1 
ATOM   6130 C CB  . ASP B 1 288 ? 80.683  26.590  65.957  1.00 36.15 ? 310 ASP B CB  1 
ATOM   6131 C CG  . ASP B 1 288 ? 81.802  25.680  65.486  1.00 40.58 ? 310 ASP B CG  1 
ATOM   6132 O OD1 . ASP B 1 288 ? 82.892  25.715  66.098  1.00 38.42 ? 310 ASP B OD1 1 
ATOM   6133 O OD2 . ASP B 1 288 ? 81.592  24.932  64.505  1.00 38.32 ? 310 ASP B OD2 1 
ATOM   6134 N N   . GLU B 1 289 ? 79.090  28.706  67.746  1.00 37.77 ? 311 GLU B N   1 
ATOM   6135 C CA  . GLU B 1 289 ? 78.270  29.906  67.843  1.00 41.43 ? 311 GLU B CA  1 
ATOM   6136 C C   . GLU B 1 289 ? 78.771  30.852  68.926  1.00 37.44 ? 311 GLU B C   1 
ATOM   6137 O O   . GLU B 1 289 ? 78.578  32.067  68.816  1.00 44.62 ? 311 GLU B O   1 
ATOM   6138 C CB  . GLU B 1 289 ? 76.811  29.520  68.094  1.00 45.84 ? 311 GLU B CB  1 
ATOM   6139 C CG  . GLU B 1 289 ? 76.174  28.782  66.919  1.00 47.12 ? 311 GLU B CG  1 
ATOM   6140 C CD  . GLU B 1 289 ? 74.812  28.200  67.251  1.00 56.48 ? 311 GLU B CD  1 
ATOM   6141 O OE1 . GLU B 1 289 ? 74.507  28.033  68.452  1.00 62.77 ? 311 GLU B OE1 1 
ATOM   6142 O OE2 . GLU B 1 289 ? 74.047  27.906  66.307  1.00 54.30 ? 311 GLU B OE2 1 
ATOM   6143 N N   . ALA B 1 290 ? 79.424  30.323  69.962  1.00 35.23 ? 312 ALA B N   1 
ATOM   6144 C CA  . ALA B 1 290 ? 79.964  31.183  71.010  1.00 36.00 ? 312 ALA B CA  1 
ATOM   6145 C C   . ALA B 1 290 ? 81.090  32.063  70.480  1.00 43.27 ? 312 ALA B C   1 
ATOM   6146 O O   . ALA B 1 290 ? 81.143  33.260  70.786  1.00 44.73 ? 312 ALA B O   1 
ATOM   6147 C CB  . ALA B 1 290 ? 80.451  30.342  72.189  1.00 30.76 ? 312 ALA B CB  1 
ATOM   6148 N N   . VAL B 1 291 ? 82.005  31.491  69.689  1.00 43.98 ? 313 VAL B N   1 
ATOM   6149 C CA  . VAL B 1 291 ? 83.068  32.311  69.118  1.00 44.59 ? 313 VAL B CA  1 
ATOM   6150 C C   . VAL B 1 291 ? 82.493  33.265  68.082  1.00 46.58 ? 313 VAL B C   1 
ATOM   6151 O O   . VAL B 1 291 ? 83.039  34.354  67.864  1.00 44.50 ? 313 VAL B O   1 
ATOM   6152 C CB  . VAL B 1 291 ? 84.197  31.442  68.522  1.00 35.73 ? 313 VAL B CB  1 
ATOM   6153 C CG1 . VAL B 1 291 ? 84.536  30.284  69.448  1.00 29.41 ? 313 VAL B CG1 1 
ATOM   6154 C CG2 . VAL B 1 291 ? 83.836  30.941  67.133  1.00 36.97 ? 313 VAL B CG2 1 
ATOM   6155 N N   . ASN B 1 292 ? 81.378  32.892  67.445  1.00 45.13 ? 314 ASN B N   1 
ATOM   6156 C CA  . ASN B 1 292 ? 80.776  33.775  66.454  1.00 46.47 ? 314 ASN B CA  1 
ATOM   6157 C C   . ASN B 1 292 ? 80.074  34.955  67.109  1.00 47.37 ? 314 ASN B C   1 
ATOM   6158 O O   . ASN B 1 292 ? 80.036  36.047  66.532  1.00 50.13 ? 314 ASN B O   1 
ATOM   6159 C CB  . ASN B 1 292 ? 79.803  33.004  65.565  1.00 47.69 ? 314 ASN B CB  1 
ATOM   6160 C CG  . ASN B 1 292 ? 79.419  33.782  64.320  1.00 48.39 ? 314 ASN B CG  1 
ATOM   6161 O OD1 . ASN B 1 292 ? 78.330  34.354  64.243  1.00 45.16 ? 314 ASN B OD1 1 
ATOM   6162 N ND2 . ASN B 1 292 ? 80.320  33.823  63.343  1.00 40.24 ? 314 ASN B ND2 1 
ATOM   6163 N N   . LYS B 1 293 ? 79.510  34.765  68.303  1.00 44.53 ? 315 LYS B N   1 
ATOM   6164 C CA  . LYS B 1 293 ? 78.988  35.911  69.037  1.00 49.33 ? 315 LYS B CA  1 
ATOM   6165 C C   . LYS B 1 293 ? 80.110  36.875  69.399  1.00 53.49 ? 315 LYS B C   1 
ATOM   6166 O O   . LYS B 1 293 ? 79.970  38.091  69.229  1.00 54.99 ? 315 LYS B O   1 
ATOM   6167 C CB  . LYS B 1 293 ? 78.238  35.453  70.288  1.00 47.26 ? 315 LYS B CB  1 
ATOM   6168 C CG  . LYS B 1 293 ? 77.094  36.382  70.688  1.00 54.39 ? 315 LYS B CG  1 
ATOM   6169 C CD  . LYS B 1 293 ? 76.313  35.838  71.875  1.00 66.97 ? 315 LYS B CD  1 
ATOM   6170 C CE  . LYS B 1 293 ? 77.126  35.929  73.157  1.00 74.39 ? 315 LYS B CE  1 
ATOM   6171 N NZ  . LYS B 1 293 ? 76.402  35.359  74.329  1.00 59.70 ? 315 LYS B NZ  1 
ATOM   6172 N N   . ILE B 1 294 ? 81.237  36.349  69.891  1.00 52.65 ? 316 ILE B N   1 
ATOM   6173 C CA  . ILE B 1 294 ? 82.416  37.185  70.106  1.00 51.22 ? 316 ILE B CA  1 
ATOM   6174 C C   . ILE B 1 294 ? 82.890  37.765  68.786  1.00 47.95 ? 316 ILE B C   1 
ATOM   6175 O O   . ILE B 1 294 ? 83.457  38.863  68.740  1.00 47.20 ? 316 ILE B O   1 
ATOM   6176 C CB  . ILE B 1 294 ? 83.540  36.382  70.790  1.00 44.82 ? 316 ILE B CB  1 
ATOM   6177 C CG1 . ILE B 1 294 ? 83.016  35.646  72.021  1.00 46.82 ? 316 ILE B CG1 1 
ATOM   6178 C CG2 . ILE B 1 294 ? 84.700  37.290  71.167  1.00 38.94 ? 316 ILE B CG2 1 
ATOM   6179 C CD1 . ILE B 1 294 ? 84.013  34.665  72.586  1.00 41.02 ? 316 ILE B CD1 1 
ATOM   6180 N N   . ARG B 1 295 ? 82.660  37.042  67.693  1.00 51.66 ? 317 ARG B N   1 
ATOM   6181 C CA  . ARG B 1 295 ? 83.099  37.506  66.386  1.00 53.04 ? 317 ARG B CA  1 
ATOM   6182 C C   . ARG B 1 295 ? 82.279  38.705  65.918  1.00 63.71 ? 317 ARG B C   1 
ATOM   6183 O O   . ARG B 1 295 ? 82.821  39.625  65.298  1.00 69.57 ? 317 ARG B O   1 
ATOM   6184 C CB  . ARG B 1 295 ? 83.024  36.345  65.395  1.00 50.37 ? 317 ARG B CB  1 
ATOM   6185 C CG  . ARG B 1 295 ? 82.861  36.716  63.954  1.00 51.82 ? 317 ARG B CG  1 
ATOM   6186 C CD  . ARG B 1 295 ? 83.590  35.716  63.066  1.00 53.67 ? 317 ARG B CD  1 
ATOM   6187 N NE  . ARG B 1 295 ? 83.329  34.335  63.468  1.00 57.05 ? 317 ARG B NE  1 
ATOM   6188 C CZ  . ARG B 1 295 ? 83.911  33.270  62.923  1.00 59.59 ? 317 ARG B CZ  1 
ATOM   6189 N NH1 . ARG B 1 295 ? 84.799  33.424  61.948  1.00 53.00 ? 317 ARG B NH1 1 
ATOM   6190 N NH2 . ARG B 1 295 ? 83.606  32.051  63.352  1.00 54.47 ? 317 ARG B NH2 1 
ATOM   6191 N N   . LEU B 1 296 ? 80.981  38.732  66.230  1.00 65.77 ? 318 LEU B N   1 
ATOM   6192 C CA  . LEU B 1 296 ? 80.146  39.848  65.793  1.00 58.68 ? 318 LEU B CA  1 
ATOM   6193 C C   . LEU B 1 296 ? 80.399  41.107  66.616  1.00 59.53 ? 318 LEU B C   1 
ATOM   6194 O O   . LEU B 1 296 ? 80.390  42.217  66.071  1.00 69.48 ? 318 LEU B O   1 
ATOM   6195 C CB  . LEU B 1 296 ? 78.669  39.457  65.862  1.00 58.04 ? 318 LEU B CB  1 
ATOM   6196 C CG  . LEU B 1 296 ? 78.256  38.284  64.970  1.00 57.67 ? 318 LEU B CG  1 
ATOM   6197 C CD1 . LEU B 1 296 ? 76.893  37.751  65.377  1.00 51.16 ? 318 LEU B CD1 1 
ATOM   6198 C CD2 . LEU B 1 296 ? 78.262  38.685  63.501  1.00 53.54 ? 318 LEU B CD2 1 
ATOM   6199 N N   . ASP B 1 297 ? 80.628  40.959  67.923  1.00 58.62 ? 319 ASP B N   1 
ATOM   6200 C CA  . ASP B 1 297 ? 80.808  42.130  68.777  1.00 61.83 ? 319 ASP B CA  1 
ATOM   6201 C C   . ASP B 1 297 ? 82.131  42.840  68.509  1.00 66.39 ? 319 ASP B C   1 
ATOM   6202 O O   . ASP B 1 297 ? 82.223  44.058  68.694  1.00 69.19 ? 319 ASP B O   1 
ATOM   6203 C CB  . ASP B 1 297 ? 80.728  41.728  70.252  1.00 53.36 ? 319 ASP B CB  1 
ATOM   6204 C CG  . ASP B 1 297 ? 79.408  41.066  70.609  1.00 68.33 ? 319 ASP B CG  1 
ATOM   6205 O OD1 . ASP B 1 297 ? 78.721  40.571  69.690  1.00 71.88 ? 319 ASP B OD1 1 
ATOM   6206 O OD2 . ASP B 1 297 ? 79.061  41.031  71.812  1.00 69.17 ? 319 ASP B OD2 1 
ATOM   6207 N N   . THR B 1 298 ? 83.158  42.109  68.073  1.00 67.74 ? 320 THR B N   1 
ATOM   6208 C CA  . THR B 1 298 ? 84.503  42.669  68.017  1.00 67.86 ? 320 THR B CA  1 
ATOM   6209 C C   . THR B 1 298 ? 84.790  43.436  66.736  1.00 71.83 ? 320 THR B C   1 
ATOM   6210 O O   . THR B 1 298 ? 85.556  44.411  66.771  1.00 74.62 ? 320 THR B O   1 
ATOM   6211 C CB  . THR B 1 298 ? 85.550  41.561  68.172  1.00 60.58 ? 320 THR B CB  1 
ATOM   6212 O OG1 . THR B 1 298 ? 85.152  40.415  67.409  1.00 60.19 ? 320 THR B OG1 1 
ATOM   6213 C CG2 . THR B 1 298 ? 85.708  41.174  69.640  1.00 51.14 ? 320 THR B CG2 1 
ATOM   6214 N N   . GLU B 1 299 ? 84.201  43.026  65.607  1.00 67.14 ? 321 GLU B N   1 
ATOM   6215 C CA  . GLU B 1 299 ? 84.568  43.638  64.331  1.00 73.56 ? 321 GLU B CA  1 
ATOM   6216 C C   . GLU B 1 299 ? 83.858  44.956  64.077  1.00 72.03 ? 321 GLU B C   1 
ATOM   6217 O O   . GLU B 1 299 ? 84.427  45.849  63.443  1.00 71.85 ? 321 GLU B O   1 
ATOM   6218 C CB  . GLU B 1 299 ? 84.289  42.674  63.180  1.00 63.58 ? 321 GLU B CB  1 
ATOM   6219 C CG  . GLU B 1 299 ? 84.595  41.263  63.498  1.00 65.98 ? 321 GLU B CG  1 
ATOM   6220 C CD  . GLU B 1 299 ? 84.131  40.361  62.406  1.00 71.84 ? 321 GLU B CD  1 
ATOM   6221 O OE1 . GLU B 1 299 ? 83.948  39.166  62.678  1.00 73.74 ? 321 GLU B OE1 1 
ATOM   6222 O OE2 . GLU B 1 299 ? 83.963  40.848  61.272  1.00 77.01 ? 321 GLU B OE2 1 
ATOM   6223 N N   . GLU B 1 300 ? 82.615  45.091  64.533  1.00 66.53 ? 322 GLU B N   1 
ATOM   6224 C CA  . GLU B 1 300 ? 82.007  46.414  64.550  1.00 74.15 ? 322 GLU B CA  1 
ATOM   6225 C C   . GLU B 1 300 ? 82.841  47.382  65.380  1.00 73.97 ? 322 GLU B C   1 
ATOM   6226 O O   . GLU B 1 300 ? 82.921  48.575  65.060  1.00 78.95 ? 322 GLU B O   1 
ATOM   6227 C CB  . GLU B 1 300 ? 80.576  46.328  65.080  1.00 80.17 ? 322 GLU B CB  1 
ATOM   6228 C CG  . GLU B 1 300 ? 79.650  45.493  64.207  1.00 80.65 ? 322 GLU B CG  1 
ATOM   6229 C CD  . GLU B 1 300 ? 78.434  44.994  64.960  1.00 86.69 ? 322 GLU B CD  1 
ATOM   6230 O OE1 . GLU B 1 300 ? 78.073  45.616  65.984  1.00 93.63 ? 322 GLU B OE1 1 
ATOM   6231 O OE2 . GLU B 1 300 ? 77.841  43.978  64.538  1.00 71.18 ? 322 GLU B OE2 1 
ATOM   6232 N N   . GLN B 1 301 ? 83.467  46.884  66.447  1.00 70.77 ? 323 GLN B N   1 
ATOM   6233 C CA  . GLN B 1 301 ? 84.466  47.670  67.158  1.00 69.74 ? 323 GLN B CA  1 
ATOM   6234 C C   . GLN B 1 301 ? 85.732  47.840  66.327  1.00 66.29 ? 323 GLN B C   1 
ATOM   6235 O O   . GLN B 1 301 ? 86.392  48.882  66.409  1.00 66.26 ? 323 GLN B O   1 
ATOM   6236 C CB  . GLN B 1 301 ? 84.791  47.001  68.494  1.00 64.59 ? 323 GLN B CB  1 
ATOM   6237 C CG  . GLN B 1 301 ? 84.831  47.941  69.679  1.00 63.61 ? 323 GLN B CG  1 
ATOM   6238 C CD  . GLN B 1 301 ? 84.692  47.203  70.994  1.00 65.22 ? 323 GLN B CD  1 
ATOM   6239 O OE1 . GLN B 1 301 ? 84.058  46.150  71.058  1.00 69.51 ? 323 GLN B OE1 1 
ATOM   6240 N NE2 . GLN B 1 301 ? 85.288  47.748  72.050  1.00 55.61 ? 323 GLN B NE2 1 
ATOM   6241 N N   . LEU B 1 302 ? 86.082  46.833  65.521  1.00 60.64 ? 324 LEU B N   1 
ATOM   6242 C CA  . LEU B 1 302 ? 87.267  46.936  64.674  1.00 64.73 ? 324 LEU B CA  1 
ATOM   6243 C C   . LEU B 1 302 ? 87.044  47.916  63.529  1.00 69.22 ? 324 LEU B C   1 
ATOM   6244 O O   . LEU B 1 302 ? 87.956  48.665  63.159  1.00 65.00 ? 324 LEU B O   1 
ATOM   6245 C CB  . LEU B 1 302 ? 87.651  45.560  64.129  1.00 55.30 ? 324 LEU B CB  1 
ATOM   6246 C CG  . LEU B 1 302 ? 88.436  44.629  65.054  1.00 54.98 ? 324 LEU B CG  1 
ATOM   6247 C CD1 . LEU B 1 302 ? 88.499  43.222  64.476  1.00 48.97 ? 324 LEU B CD1 1 
ATOM   6248 C CD2 . LEU B 1 302 ? 89.831  45.176  65.295  1.00 48.61 ? 324 LEU B CD2 1 
ATOM   6249 N N   . LYS B 1 303 ? 85.839  47.922  62.952  1.00 70.97 ? 325 LYS B N   1 
ATOM   6250 C CA  . LYS B 1 303 ? 85.548  48.847  61.863  1.00 68.07 ? 325 LYS B CA  1 
ATOM   6251 C C   . LYS B 1 303 ? 85.559  50.295  62.338  1.00 69.50 ? 325 LYS B C   1 
ATOM   6252 O O   . LYS B 1 303 ? 85.896  51.198  61.564  1.00 68.31 ? 325 LYS B O   1 
ATOM   6253 C CB  . LYS B 1 303 ? 84.200  48.502  61.228  1.00 61.49 ? 325 LYS B CB  1 
ATOM   6254 C CG  . LYS B 1 303 ? 83.978  49.129  59.861  1.00 61.83 ? 325 LYS B CG  1 
ATOM   6255 C CD  . LYS B 1 303 ? 83.128  48.233  58.975  1.00 63.18 ? 325 LYS B CD  1 
ATOM   6256 C CE  . LYS B 1 303 ? 83.902  47.003  58.525  1.00 66.24 ? 325 LYS B CE  1 
ATOM   6257 N NZ  . LYS B 1 303 ? 82.998  45.887  58.122  1.00 59.97 ? 325 LYS B NZ  1 
ATOM   6258 N N   . GLU B 1 304 ? 85.202  50.536  63.603  1.00 70.75 ? 326 GLU B N   1 
ATOM   6259 C CA  . GLU B 1 304 ? 85.260  51.893  64.133  1.00 70.87 ? 326 GLU B CA  1 
ATOM   6260 C C   . GLU B 1 304 ? 86.695  52.323  64.411  1.00 71.53 ? 326 GLU B C   1 
ATOM   6261 O O   . GLU B 1 304 ? 86.993  53.523  64.396  1.00 82.07 ? 326 GLU B O   1 
ATOM   6262 C CB  . GLU B 1 304 ? 84.413  52.003  65.403  1.00 76.18 ? 326 GLU B CB  1 
ATOM   6263 C CG  . GLU B 1 304 ? 82.975  52.458  65.157  1.00 84.99 ? 326 GLU B CG  1 
ATOM   6264 C CD  . GLU B 1 304 ? 82.736  53.915  65.535  1.00 92.86 ? 326 GLU B CD  1 
ATOM   6265 O OE1 . GLU B 1 304 ? 81.581  54.381  65.418  1.00 79.40 ? 326 GLU B OE1 1 
ATOM   6266 O OE2 . GLU B 1 304 ? 83.700  54.594  65.949  1.00 93.62 ? 326 GLU B OE2 1 
ATOM   6267 N N   . LYS B 1 305 ? 87.593  51.369  64.658  1.00 66.16 ? 327 LYS B N   1 
ATOM   6268 C CA  . LYS B 1 305 ? 88.994  51.688  64.912  1.00 62.49 ? 327 LYS B CA  1 
ATOM   6269 C C   . LYS B 1 305 ? 89.809  51.794  63.627  1.00 62.66 ? 327 LYS B C   1 
ATOM   6270 O O   . LYS B 1 305 ? 90.636  52.702  63.493  1.00 63.51 ? 327 LYS B O   1 
ATOM   6271 C CB  . LYS B 1 305 ? 89.613  50.642  65.841  1.00 55.67 ? 327 LYS B CB  1 
ATOM   6272 C CG  . LYS B 1 305 ? 91.128  50.719  65.949  1.00 50.91 ? 327 LYS B CG  1 
ATOM   6273 C CD  . LYS B 1 305 ? 91.580  51.694  67.023  1.00 51.72 ? 327 LYS B CD  1 
ATOM   6274 C CE  . LYS B 1 305 ? 93.091  51.632  67.214  1.00 50.65 ? 327 LYS B CE  1 
ATOM   6275 N NZ  . LYS B 1 305 ? 93.544  52.384  68.418  1.00 45.05 ? 327 LYS B NZ  1 
ATOM   6276 N N   . PHE B 1 306 ? 89.591  50.887  62.670  1.00 61.55 ? 328 PHE B N   1 
ATOM   6277 C CA  . PHE B 1 306 ? 90.303  50.884  61.393  1.00 59.55 ? 328 PHE B CA  1 
ATOM   6278 C C   . PHE B 1 306 ? 89.295  51.021  60.257  1.00 58.61 ? 328 PHE B C   1 
ATOM   6279 O O   . PHE B 1 306 ? 88.963  50.029  59.590  1.00 51.72 ? 328 PHE B O   1 
ATOM   6280 C CB  . PHE B 1 306 ? 91.136  49.615  61.218  1.00 56.62 ? 328 PHE B CB  1 
ATOM   6281 C CG  . PHE B 1 306 ? 92.017  49.295  62.390  1.00 49.69 ? 328 PHE B CG  1 
ATOM   6282 C CD1 . PHE B 1 306 ? 93.195  49.990  62.599  1.00 49.26 ? 328 PHE B CD1 1 
ATOM   6283 C CD2 . PHE B 1 306 ? 91.672  48.287  63.277  1.00 51.53 ? 328 PHE B CD2 1 
ATOM   6284 C CE1 . PHE B 1 306 ? 94.012  49.692  63.676  1.00 50.14 ? 328 PHE B CE1 1 
ATOM   6285 C CE2 . PHE B 1 306 ? 92.484  47.982  64.356  1.00 48.30 ? 328 PHE B CE2 1 
ATOM   6286 C CZ  . PHE B 1 306 ? 93.656  48.687  64.556  1.00 45.66 ? 328 PHE B CZ  1 
ATOM   6287 N N   . PRO B 1 307 ? 88.789  52.232  60.002  1.00 71.08 ? 329 PRO B N   1 
ATOM   6288 C CA  . PRO B 1 307 ? 87.893  52.420  58.847  1.00 65.63 ? 329 PRO B CA  1 
ATOM   6289 C C   . PRO B 1 307 ? 88.591  52.261  57.507  1.00 62.32 ? 329 PRO B C   1 
ATOM   6290 O O   . PRO B 1 307 ? 87.910  52.054  56.495  1.00 50.78 ? 329 PRO B O   1 
ATOM   6291 C CB  . PRO B 1 307 ? 87.364  53.851  59.033  1.00 56.27 ? 329 PRO B CB  1 
ATOM   6292 C CG  . PRO B 1 307 ? 87.674  54.206  60.461  1.00 66.84 ? 329 PRO B CG  1 
ATOM   6293 C CD  . PRO B 1 307 ? 88.929  53.466  60.791  1.00 71.46 ? 329 PRO B CD  1 
ATOM   6294 N N   . GLU B 1 308 ? 89.920  52.355  57.467  1.00 69.57 ? 330 GLU B N   1 
ATOM   6295 C CA  . GLU B 1 308 ? 90.688  52.152  56.245  1.00 71.85 ? 330 GLU B CA  1 
ATOM   6296 C C   . GLU B 1 308 ? 90.925  50.681  55.933  1.00 71.43 ? 330 GLU B C   1 
ATOM   6297 O O   . GLU B 1 308 ? 91.629  50.374  54.964  1.00 71.90 ? 330 GLU B O   1 
ATOM   6298 C CB  . GLU B 1 308 ? 92.041  52.868  56.346  1.00 74.11 ? 330 GLU B CB  1 
ATOM   6299 C CG  . GLU B 1 308 ? 91.954  54.386  56.446  1.00 74.34 ? 330 GLU B CG  1 
ATOM   6300 C CD  . GLU B 1 308 ? 92.842  54.955  57.542  1.00 76.81 ? 330 GLU B CD  1 
ATOM   6301 O OE1 . GLU B 1 308 ? 92.348  55.784  58.336  1.00 62.69 ? 330 GLU B OE1 1 
ATOM   6302 O OE2 . GLU B 1 308 ? 94.033  54.576  57.609  1.00 74.16 ? 330 GLU B OE2 1 
ATOM   6303 N N   . ALA B 1 309 ? 90.363  49.771  56.722  1.00 67.02 ? 331 ALA B N   1 
ATOM   6304 C CA  . ALA B 1 309 ? 90.671  48.355  56.609  1.00 63.46 ? 331 ALA B CA  1 
ATOM   6305 C C   . ALA B 1 309 ? 89.707  47.661  55.657  1.00 62.24 ? 331 ALA B C   1 
ATOM   6306 O O   . ALA B 1 309 ? 88.511  47.966  55.629  1.00 58.62 ? 331 ALA B O   1 
ATOM   6307 C CB  . ALA B 1 309 ? 90.618  47.686  57.983  1.00 59.81 ? 331 ALA B CB  1 
ATOM   6308 N N   . ASP B 1 310 ? 90.243  46.726  54.879  1.00 63.68 ? 332 ASP B N   1 
ATOM   6309 C CA  . ASP B 1 310 ? 89.411  45.899  54.019  1.00 69.05 ? 332 ASP B CA  1 
ATOM   6310 C C   . ASP B 1 310 ? 88.397  45.128  54.863  1.00 69.40 ? 332 ASP B C   1 
ATOM   6311 O O   . ASP B 1 310 ? 88.730  44.655  55.957  1.00 69.04 ? 332 ASP B O   1 
ATOM   6312 C CB  . ASP B 1 310 ? 90.285  44.926  53.222  1.00 67.94 ? 332 ASP B CB  1 
ATOM   6313 C CG  . ASP B 1 310 ? 89.520  44.204  52.127  1.00 72.93 ? 332 ASP B CG  1 
ATOM   6314 O OD1 . ASP B 1 310 ? 88.631  43.388  52.450  1.00 67.90 ? 332 ASP B OD1 1 
ATOM   6315 O OD2 . ASP B 1 310 ? 89.818  44.447  50.939  1.00 79.89 ? 332 ASP B OD2 1 
ATOM   6316 N N   . PRO B 1 311 ? 87.150  44.996  54.402  1.00 71.88 ? 333 PRO B N   1 
ATOM   6317 C CA  . PRO B 1 311 ? 86.181  44.185  55.160  1.00 72.32 ? 333 PRO B CA  1 
ATOM   6318 C C   . PRO B 1 311 ? 86.622  42.742  55.346  1.00 69.78 ? 333 PRO B C   1 
ATOM   6319 O O   . PRO B 1 311 ? 86.291  42.128  56.368  1.00 64.25 ? 333 PRO B O   1 
ATOM   6320 C CB  . PRO B 1 311 ? 84.898  44.287  54.318  1.00 65.66 ? 333 PRO B CB  1 
ATOM   6321 C CG  . PRO B 1 311 ? 85.342  44.785  52.969  1.00 64.90 ? 333 PRO B CG  1 
ATOM   6322 C CD  . PRO B 1 311 ? 86.540  45.640  53.227  1.00 65.60 ? 333 PRO B CD  1 
ATOM   6323 N N   . TYR B 1 312 ? 87.370  42.183  54.392  1.00 66.05 ? 334 TYR B N   1 
ATOM   6324 C CA  . TYR B 1 312 ? 87.881  40.828  54.564  1.00 63.35 ? 334 TYR B CA  1 
ATOM   6325 C C   . TYR B 1 312 ? 89.038  40.797  55.555  1.00 63.45 ? 334 TYR B C   1 
ATOM   6326 O O   . TYR B 1 312 ? 89.190  39.831  56.312  1.00 60.85 ? 334 TYR B O   1 
ATOM   6327 C CB  . TYR B 1 312 ? 88.319  40.252  53.220  1.00 69.43 ? 334 TYR B CB  1 
ATOM   6328 C CG  . TYR B 1 312 ? 89.204  39.037  53.362  1.00 77.97 ? 334 TYR B CG  1 
ATOM   6329 C CD1 . TYR B 1 312 ? 88.737  37.885  53.984  1.00 73.86 ? 334 TYR B CD1 1 
ATOM   6330 C CD2 . TYR B 1 312 ? 90.511  39.047  52.894  1.00 76.21 ? 334 TYR B CD2 1 
ATOM   6331 C CE1 . TYR B 1 312 ? 89.540  36.774  54.128  1.00 67.65 ? 334 TYR B CE1 1 
ATOM   6332 C CE2 . TYR B 1 312 ? 91.323  37.937  53.031  1.00 74.18 ? 334 TYR B CE2 1 
ATOM   6333 C CZ  . TYR B 1 312 ? 90.831  36.803  53.649  1.00 71.16 ? 334 TYR B CZ  1 
ATOM   6334 O OH  . TYR B 1 312 ? 91.631  35.692  53.793  1.00 76.54 ? 334 TYR B OH  1 
ATOM   6335 N N   . GLU B 1 313 ? 89.869  41.842  55.558  1.00 63.98 ? 335 GLU B N   1 
ATOM   6336 C CA  . GLU B 1 313 ? 90.958  41.925  56.525  1.00 60.81 ? 335 GLU B CA  1 
ATOM   6337 C C   . GLU B 1 313 ? 90.441  41.862  57.957  1.00 57.43 ? 335 GLU B C   1 
ATOM   6338 O O   . GLU B 1 313 ? 91.136  41.362  58.849  1.00 52.23 ? 335 GLU B O   1 
ATOM   6339 C CB  . GLU B 1 313 ? 91.754  43.212  56.295  1.00 59.94 ? 335 GLU B CB  1 
ATOM   6340 C CG  . GLU B 1 313 ? 92.867  43.460  57.298  1.00 55.29 ? 335 GLU B CG  1 
ATOM   6341 C CD  . GLU B 1 313 ? 93.777  44.602  56.888  1.00 60.32 ? 335 GLU B CD  1 
ATOM   6342 O OE1 . GLU B 1 313 ? 94.922  44.660  57.387  1.00 56.70 ? 335 GLU B OE1 1 
ATOM   6343 O OE2 . GLU B 1 313 ? 93.347  45.440  56.066  1.00 70.23 ? 335 GLU B OE2 1 
ATOM   6344 N N   . ILE B 1 314 ? 89.220  42.345  58.194  1.00 55.27 ? 336 ILE B N   1 
ATOM   6345 C CA  . ILE B 1 314 ? 88.658  42.303  59.538  1.00 54.29 ? 336 ILE B CA  1 
ATOM   6346 C C   . ILE B 1 314 ? 88.261  40.882  59.916  1.00 55.28 ? 336 ILE B C   1 
ATOM   6347 O O   . ILE B 1 314 ? 88.368  40.492  61.085  1.00 52.21 ? 336 ILE B O   1 
ATOM   6348 C CB  . ILE B 1 314 ? 87.464  43.267  59.644  1.00 62.98 ? 336 ILE B CB  1 
ATOM   6349 C CG1 . ILE B 1 314 ? 87.844  44.649  59.111  1.00 63.87 ? 336 ILE B CG1 1 
ATOM   6350 C CG2 . ILE B 1 314 ? 86.997  43.380  61.084  1.00 64.70 ? 336 ILE B CG2 1 
ATOM   6351 C CD1 . ILE B 1 314 ? 88.611  45.497  60.107  1.00 57.21 ? 336 ILE B CD1 1 
ATOM   6352 N N   . ILE B 1 315 ? 87.799  40.089  58.946  1.00 58.52 ? 337 ILE B N   1 
ATOM   6353 C CA  . ILE B 1 315 ? 87.370  38.723  59.236  1.00 54.68 ? 337 ILE B CA  1 
ATOM   6354 C C   . ILE B 1 315 ? 88.572  37.846  59.563  1.00 45.07 ? 337 ILE B C   1 
ATOM   6355 O O   . ILE B 1 315 ? 88.586  37.129  60.571  1.00 43.67 ? 337 ILE B O   1 
ATOM   6356 C CB  . ILE B 1 315 ? 86.564  38.152  58.056  1.00 49.69 ? 337 ILE B CB  1 
ATOM   6357 C CG1 . ILE B 1 315 ? 85.183  38.798  57.988  1.00 52.66 ? 337 ILE B CG1 1 
ATOM   6358 C CG2 . ILE B 1 315 ? 86.405  36.651  58.205  1.00 46.99 ? 337 ILE B CG2 1 
ATOM   6359 C CD1 . ILE B 1 315 ? 84.341  38.554  59.225  1.00 58.50 ? 337 ILE B CD1 1 
ATOM   6360 N N   . GLU B 1 316 ? 89.598  37.888  58.711  1.00 40.94 ? 338 GLU B N   1 
ATOM   6361 C CA  . GLU B 1 316 ? 90.776  37.060  58.939  1.00 45.54 ? 338 GLU B CA  1 
ATOM   6362 C C   . GLU B 1 316 ? 91.502  37.475  60.212  1.00 43.61 ? 338 GLU B C   1 
ATOM   6363 O O   . GLU B 1 316 ? 92.025  36.623  60.940  1.00 42.06 ? 338 GLU B O   1 
ATOM   6364 C CB  . GLU B 1 316 ? 91.710  37.127  57.732  1.00 43.73 ? 338 GLU B CB  1 
ATOM   6365 C CG  . GLU B 1 316 ? 93.090  36.547  57.993  1.00 54.43 ? 338 GLU B CG  1 
ATOM   6366 C CD  . GLU B 1 316 ? 93.175  35.065  57.686  1.00 52.01 ? 338 GLU B CD  1 
ATOM   6367 O OE1 . GLU B 1 316 ? 94.303  34.560  57.501  1.00 46.41 ? 338 GLU B OE1 1 
ATOM   6368 O OE2 . GLU B 1 316 ? 92.114  34.407  57.627  1.00 51.57 ? 338 GLU B OE2 1 
ATOM   6369 N N   . SER B 1 317 ? 91.533  38.779  60.505  1.00 42.44 ? 339 SER B N   1 
ATOM   6370 C CA  . SER B 1 317 ? 92.141  39.246  61.749  1.00 39.53 ? 339 SER B CA  1 
ATOM   6371 C C   . SER B 1 317 ? 91.552  38.531  62.956  1.00 35.99 ? 339 SER B C   1 
ATOM   6372 O O   . SER B 1 317 ? 92.286  38.091  63.848  1.00 34.83 ? 339 SER B O   1 
ATOM   6373 C CB  . SER B 1 317 ? 91.964  40.757  61.890  1.00 39.66 ? 339 SER B CB  1 
ATOM   6374 O OG  . SER B 1 317 ? 93.019  41.454  61.252  1.00 50.65 ? 339 SER B OG  1 
ATOM   6375 N N   . PHE B 1 318 ? 90.225  38.391  62.997  1.00 36.65 ? 340 PHE B N   1 
ATOM   6376 C CA  . PHE B 1 318 ? 89.613  37.619  64.071  1.00 33.34 ? 340 PHE B CA  1 
ATOM   6377 C C   . PHE B 1 318 ? 89.951  36.139  63.945  1.00 34.98 ? 340 PHE B C   1 
ATOM   6378 O O   . PHE B 1 318 ? 90.147  35.455  64.956  1.00 33.58 ? 340 PHE B O   1 
ATOM   6379 C CB  . PHE B 1 318 ? 88.101  37.824  64.080  1.00 35.96 ? 340 PHE B CB  1 
ATOM   6380 C CG  . PHE B 1 318 ? 87.401  37.058  65.160  1.00 39.74 ? 340 PHE B CG  1 
ATOM   6381 C CD1 . PHE B 1 318 ? 87.302  37.578  66.437  1.00 37.28 ? 340 PHE B CD1 1 
ATOM   6382 C CD2 . PHE B 1 318 ? 86.856  35.810  64.905  1.00 40.78 ? 340 PHE B CD2 1 
ATOM   6383 C CE1 . PHE B 1 318 ? 86.666  36.871  67.435  1.00 42.02 ? 340 PHE B CE1 1 
ATOM   6384 C CE2 . PHE B 1 318 ? 86.221  35.101  65.901  1.00 34.88 ? 340 PHE B CE2 1 
ATOM   6385 C CZ  . PHE B 1 318 ? 86.124  35.630  67.165  1.00 34.89 ? 340 PHE B CZ  1 
ATOM   6386 N N   . ASN B 1 319 ? 90.017  35.624  62.714  1.00 35.36 ? 341 ASN B N   1 
ATOM   6387 C CA  . ASN B 1 319 ? 90.418  34.234  62.516  1.00 29.86 ? 341 ASN B CA  1 
ATOM   6388 C C   . ASN B 1 319 ? 91.823  33.983  63.047  1.00 31.36 ? 341 ASN B C   1 
ATOM   6389 O O   . ASN B 1 319 ? 92.073  32.961  63.697  1.00 32.53 ? 341 ASN B O   1 
ATOM   6390 C CB  . ASN B 1 319 ? 90.336  33.864  61.036  1.00 37.33 ? 341 ASN B CB  1 
ATOM   6391 C CG  . ASN B 1 319 ? 88.912  33.789  60.531  1.00 38.11 ? 341 ASN B CG  1 
ATOM   6392 O OD1 . ASN B 1 319 ? 87.980  33.532  61.294  1.00 44.65 ? 341 ASN B OD1 1 
ATOM   6393 N ND2 . ASN B 1 319 ? 88.738  34.007  59.236  1.00 37.19 ? 341 ASN B ND2 1 
ATOM   6394 N N   . VAL B 1 320 ? 92.756  34.903  62.775  1.00 31.93 ? 342 VAL B N   1 
ATOM   6395 C CA  . VAL B 1 320 ? 94.119  34.759  63.286  1.00 35.35 ? 342 VAL B CA  1 
ATOM   6396 C C   . VAL B 1 320 ? 94.112  34.697  64.808  1.00 33.38 ? 342 VAL B C   1 
ATOM   6397 O O   . VAL B 1 320 ? 94.727  33.810  65.414  1.00 29.44 ? 342 VAL B O   1 
ATOM   6398 C CB  . VAL B 1 320 ? 95.013  35.904  62.776  1.00 33.96 ? 342 VAL B CB  1 
ATOM   6399 C CG1 . VAL B 1 320 ? 96.440  35.724  63.275  1.00 27.12 ? 342 VAL B CG1 1 
ATOM   6400 C CG2 . VAL B 1 320 ? 94.990  35.959  61.264  1.00 36.41 ? 342 VAL B CG2 1 
ATOM   6401 N N   . VAL B 1 321 ? 93.404  35.635  65.444  1.00 32.22 ? 343 VAL B N   1 
ATOM   6402 C CA  . VAL B 1 321 ? 93.383  35.704  66.902  1.00 28.16 ? 343 VAL B CA  1 
ATOM   6403 C C   . VAL B 1 321 ? 92.676  34.489  67.488  1.00 27.07 ? 343 VAL B C   1 
ATOM   6404 O O   . VAL B 1 321 ? 93.126  33.914  68.486  1.00 33.55 ? 343 VAL B O   1 
ATOM   6405 C CB  . VAL B 1 321 ? 92.730  37.021  67.363  1.00 25.81 ? 343 VAL B CB  1 
ATOM   6406 C CG1 . VAL B 1 321 ? 92.560  37.032  68.874  1.00 25.71 ? 343 VAL B CG1 1 
ATOM   6407 C CG2 . VAL B 1 321 ? 93.558  38.210  66.907  1.00 23.97 ? 343 VAL B CG2 1 
ATOM   6408 N N   . ALA B 1 322 ? 91.562  34.076  66.882  1.00 29.45 ? 344 ALA B N   1 
ATOM   6409 C CA  . ALA B 1 322 ? 90.857  32.899  67.376  1.00 29.15 ? 344 ALA B CA  1 
ATOM   6410 C C   . ALA B 1 322 ? 91.700  31.643  67.217  1.00 27.53 ? 344 ALA B C   1 
ATOM   6411 O O   . ALA B 1 322 ? 91.637  30.742  68.062  1.00 22.16 ? 344 ALA B O   1 
ATOM   6412 C CB  . ALA B 1 322 ? 89.519  32.743  66.653  1.00 23.42 ? 344 ALA B CB  1 
ATOM   6413 N N   . LYS B 1 323 ? 92.501  31.573  66.152  1.00 26.24 ? 345 LYS B N   1 
ATOM   6414 C CA  . LYS B 1 323 ? 93.364  30.416  65.948  1.00 28.31 ? 345 LYS B CA  1 
ATOM   6415 C C   . LYS B 1 323 ? 94.503  30.392  66.959  1.00 28.85 ? 345 LYS B C   1 
ATOM   6416 O O   . LYS B 1 323 ? 94.844  29.328  67.492  1.00 26.67 ? 345 LYS B O   1 
ATOM   6417 C CB  . LYS B 1 323 ? 93.908  30.420  64.521  1.00 26.54 ? 345 LYS B CB  1 
ATOM   6418 C CG  . LYS B 1 323 ? 94.556  29.122  64.093  1.00 17.62 ? 345 LYS B CG  1 
ATOM   6419 C CD  . LYS B 1 323 ? 95.072  29.225  62.669  1.00 24.81 ? 345 LYS B CD  1 
ATOM   6420 C CE  . LYS B 1 323 ? 95.918  28.018  62.297  1.00 31.72 ? 345 LYS B CE  1 
ATOM   6421 N NZ  . LYS B 1 323 ? 97.213  28.423  61.682  1.00 32.48 ? 345 LYS B NZ  1 
ATOM   6422 N N   . GLU B 1 324 ? 95.098  31.556  67.244  1.00 27.68 ? 346 GLU B N   1 
ATOM   6423 C CA  . GLU B 1 324 ? 96.232  31.602  68.164  1.00 28.91 ? 346 GLU B CA  1 
ATOM   6424 C C   . GLU B 1 324 ? 95.804  31.287  69.589  1.00 31.16 ? 346 GLU B C   1 
ATOM   6425 O O   . GLU B 1 324 ? 96.502  30.559  70.304  1.00 33.60 ? 346 GLU B O   1 
ATOM   6426 C CB  . GLU B 1 324 ? 96.915  32.968  68.104  1.00 34.29 ? 346 GLU B CB  1 
ATOM   6427 C CG  . GLU B 1 324 ? 98.384  32.934  68.513  1.00 44.36 ? 346 GLU B CG  1 
ATOM   6428 C CD  . GLU B 1 324 ? 98.628  33.507  69.902  1.00 62.49 ? 346 GLU B CD  1 
ATOM   6429 O OE1 . GLU B 1 324 ? 99.733  33.294  70.450  1.00 64.91 ? 346 GLU B OE1 1 
ATOM   6430 O OE2 . GLU B 1 324 ? 97.717  34.173  70.444  1.00 57.27 ? 346 GLU B OE2 1 
ATOM   6431 N N   . VAL B 1 325 ? 94.664  31.830  70.022  1.00 31.46 ? 347 VAL B N   1 
ATOM   6432 C CA  . VAL B 1 325 ? 94.164  31.539  71.362  1.00 27.03 ? 347 VAL B CA  1 
ATOM   6433 C C   . VAL B 1 325 ? 93.871  30.052  71.508  1.00 29.90 ? 347 VAL B C   1 
ATOM   6434 O O   . VAL B 1 325 ? 94.223  29.430  72.519  1.00 32.89 ? 347 VAL B O   1 
ATOM   6435 C CB  . VAL B 1 325 ? 92.922  32.398  71.663  1.00 29.61 ? 347 VAL B CB  1 
ATOM   6436 C CG1 . VAL B 1 325 ? 92.269  31.960  72.971  1.00 27.72 ? 347 VAL B CG1 1 
ATOM   6437 C CG2 . VAL B 1 325 ? 93.297  33.874  71.708  1.00 33.47 ? 347 VAL B CG2 1 
ATOM   6438 N N   . PHE B 1 326 ? 93.233  29.459  70.496  1.00 29.63 ? 348 PHE B N   1 
ATOM   6439 C CA  . PHE B 1 326 ? 92.919  28.034  70.531  1.00 26.52 ? 348 PHE B CA  1 
ATOM   6440 C C   . PHE B 1 326 ? 94.183  27.195  70.674  1.00 26.16 ? 348 PHE B C   1 
ATOM   6441 O O   . PHE B 1 326 ? 94.241  26.267  71.490  1.00 27.73 ? 348 PHE B O   1 
ATOM   6442 C CB  . PHE B 1 326 ? 92.155  27.647  69.263  1.00 24.92 ? 348 PHE B CB  1 
ATOM   6443 C CG  . PHE B 1 326 ? 91.613  26.245  69.276  1.00 20.41 ? 348 PHE B CG  1 
ATOM   6444 C CD1 . PHE B 1 326 ? 90.372  25.972  69.831  1.00 23.71 ? 348 PHE B CD1 1 
ATOM   6445 C CD2 . PHE B 1 326 ? 92.333  25.205  68.718  1.00 16.69 ? 348 PHE B CD2 1 
ATOM   6446 C CE1 . PHE B 1 326 ? 89.867  24.686  69.839  1.00 21.69 ? 348 PHE B CE1 1 
ATOM   6447 C CE2 . PHE B 1 326 ? 91.832  23.917  68.722  1.00 21.68 ? 348 PHE B CE2 1 
ATOM   6448 C CZ  . PHE B 1 326 ? 90.598  23.658  69.281  1.00 23.15 ? 348 PHE B CZ  1 
ATOM   6449 N N   . ARG B 1 327 ? 95.213  27.514  69.892  1.00 23.18 ? 349 ARG B N   1 
ATOM   6450 C CA  . ARG B 1 327 ? 96.420  26.700  69.898  1.00 20.84 ? 349 ARG B CA  1 
ATOM   6451 C C   . ARG B 1 327 ? 97.289  26.966  71.120  1.00 28.35 ? 349 ARG B C   1 
ATOM   6452 O O   . ARG B 1 327 ? 98.007  26.067  71.568  1.00 32.12 ? 349 ARG B O   1 
ATOM   6453 C CB  . ARG B 1 327 ? 97.218  26.943  68.619  1.00 21.09 ? 349 ARG B CB  1 
ATOM   6454 C CG  . ARG B 1 327 ? 96.504  26.500  67.354  1.00 17.76 ? 349 ARG B CG  1 
ATOM   6455 C CD  . ARG B 1 327 ? 97.153  27.109  66.127  1.00 21.26 ? 349 ARG B CD  1 
ATOM   6456 N NE  . ARG B 1 327 ? 98.507  26.605  65.924  1.00 20.96 ? 349 ARG B NE  1 
ATOM   6457 C CZ  . ARG B 1 327 ? 98.871  25.828  64.908  1.00 17.59 ? 349 ARG B CZ  1 
ATOM   6458 N NH1 . ARG B 1 327 ? 97.980  25.471  63.994  1.00 15.87 ? 349 ARG B NH1 1 
ATOM   6459 N NH2 . ARG B 1 327 ? 100.127 25.414  64.802  1.00 18.22 ? 349 ARG B NH2 1 
ATOM   6460 N N   . SER B 1 328 ? 97.237  28.179  71.674  1.00 30.45 ? 350 SER B N   1 
ATOM   6461 C CA  . SER B 1 328 ? 98.075  28.493  72.826  1.00 25.32 ? 350 SER B CA  1 
ATOM   6462 C C   . SER B 1 328 ? 97.642  27.726  74.067  1.00 31.05 ? 350 SER B C   1 
ATOM   6463 O O   . SER B 1 328 ? 98.464  27.473  74.954  1.00 32.23 ? 350 SER B O   1 
ATOM   6464 C CB  . SER B 1 328 ? 98.043  29.992  73.109  1.00 27.05 ? 350 SER B CB  1 
ATOM   6465 O OG  . SER B 1 328 ? 96.919  30.316  73.905  1.00 29.16 ? 350 SER B OG  1 
ATOM   6466 N N   . ILE B 1 329 ? 96.363  27.357  74.155  1.00 31.18 ? 351 ILE B N   1 
ATOM   6467 C CA  . ILE B 1 329 ? 95.881  26.635  75.327  1.00 26.57 ? 351 ILE B CA  1 
ATOM   6468 C C   . ILE B 1 329 ? 96.415  25.209  75.330  1.00 27.41 ? 351 ILE B C   1 
ATOM   6469 O O   . ILE B 1 329 ? 96.900  24.713  76.353  1.00 33.50 ? 351 ILE B O   1 
ATOM   6470 C CB  . ILE B 1 329 ? 94.344  26.674  75.381  1.00 32.59 ? 351 ILE B CB  1 
ATOM   6471 C CG1 . ILE B 1 329 ? 93.871  28.107  75.627  1.00 30.48 ? 351 ILE B CG1 1 
ATOM   6472 C CG2 . ILE B 1 329 ? 93.810  25.723  76.452  1.00 29.61 ? 351 ILE B CG2 1 
ATOM   6473 C CD1 . ILE B 1 329 ? 92.392  28.313  75.403  1.00 31.11 ? 351 ILE B CD1 1 
ATOM   6474 N N   . VAL B 1 330 ? 96.345  24.531  74.184  1.00 25.78 ? 352 VAL B N   1 
ATOM   6475 C CA  . VAL B 1 330 ? 96.881  23.176  74.091  1.00 28.96 ? 352 VAL B CA  1 
ATOM   6476 C C   . VAL B 1 330 ? 98.390  23.177  74.301  1.00 31.76 ? 352 VAL B C   1 
ATOM   6477 O O   . VAL B 1 330 ? 98.946  22.239  74.889  1.00 31.44 ? 352 VAL B O   1 
ATOM   6478 C CB  . VAL B 1 330 ? 96.496  22.548  72.735  1.00 25.56 ? 352 VAL B CB  1 
ATOM   6479 C CG1 . VAL B 1 330 ? 97.104  21.163  72.590  1.00 18.36 ? 352 VAL B CG1 1 
ATOM   6480 C CG2 . VAL B 1 330 ? 94.980  22.489  72.589  1.00 29.00 ? 352 VAL B CG2 1 
ATOM   6481 N N   . LEU B 1 331 ? 99.075  24.227  73.843  1.00 29.49 ? 353 LEU B N   1 
ATOM   6482 C CA  . LEU B 1 331 ? 100.527 24.282  73.974  1.00 30.02 ? 353 LEU B CA  1 
ATOM   6483 C C   . LEU B 1 331 ? 100.943 24.565  75.414  1.00 36.30 ? 353 LEU B C   1 
ATOM   6484 O O   . LEU B 1 331 ? 101.795 23.864  75.976  1.00 28.73 ? 353 LEU B O   1 
ATOM   6485 C CB  . LEU B 1 331 ? 101.097 25.346  73.035  1.00 24.15 ? 353 LEU B CB  1 
ATOM   6486 C CG  . LEU B 1 331 ? 101.209 25.026  71.546  1.00 23.66 ? 353 LEU B CG  1 
ATOM   6487 C CD1 . LEU B 1 331 ? 101.360 26.317  70.764  1.00 27.74 ? 353 LEU B CD1 1 
ATOM   6488 C CD2 . LEU B 1 331 ? 102.374 24.085  71.262  1.00 23.13 ? 353 LEU B CD2 1 
ATOM   6489 N N   . ASN B 1 332 ? 100.351 25.591  76.030  1.00 29.00 ? 354 ASN B N   1 
ATOM   6490 C CA  . ASN B 1 332 ? 100.803 26.025  77.347  1.00 30.94 ? 354 ASN B CA  1 
ATOM   6491 C C   . ASN B 1 332 ? 100.241 25.152  78.463  1.00 34.46 ? 354 ASN B C   1 
ATOM   6492 O O   . ASN B 1 332 ? 100.963 24.818  79.411  1.00 37.27 ? 354 ASN B O   1 
ATOM   6493 C CB  . ASN B 1 332 ? 100.424 27.488  77.579  1.00 29.91 ? 354 ASN B CB  1 
ATOM   6494 C CG  . ASN B 1 332 ? 101.095 28.428  76.592  1.00 35.46 ? 354 ASN B CG  1 
ATOM   6495 O OD1 . ASN B 1 332 ? 102.174 28.133  76.069  1.00 35.30 ? 354 ASN B OD1 1 
ATOM   6496 N ND2 . ASN B 1 332 ? 100.457 29.568  76.330  1.00 25.54 ? 354 ASN B ND2 1 
ATOM   6497 N N   . GLU B 1 333 ? 98.966  24.766  78.370  1.00 26.67 ? 355 GLU B N   1 
ATOM   6498 C CA  . GLU B 1 333 ? 98.278  24.092  79.464  1.00 27.43 ? 355 GLU B CA  1 
ATOM   6499 C C   . GLU B 1 333 ? 98.047  22.603  79.231  1.00 27.57 ? 355 GLU B C   1 
ATOM   6500 O O   . GLU B 1 333 ? 97.460  21.943  80.095  1.00 33.15 ? 355 GLU B O   1 
ATOM   6501 C CB  . GLU B 1 333 ? 96.940  24.785  79.743  1.00 28.18 ? 355 GLU B CB  1 
ATOM   6502 C CG  . GLU B 1 333 ? 97.059  26.288  79.928  1.00 26.79 ? 355 GLU B CG  1 
ATOM   6503 C CD  . GLU B 1 333 ? 95.739  26.942  80.292  1.00 34.94 ? 355 GLU B CD  1 
ATOM   6504 O OE1 . GLU B 1 333 ? 94.943  26.309  81.020  1.00 28.91 ? 355 GLU B OE1 1 
ATOM   6505 O OE2 . GLU B 1 333 ? 95.500  28.091  79.851  1.00 33.91 ? 355 GLU B OE2 1 
ATOM   6506 N N   . TYR B 1 334 ? 98.477  22.058  78.092  1.00 28.75 ? 356 TYR B N   1 
ATOM   6507 C CA  . TYR B 1 334 ? 98.399  20.626  77.796  1.00 24.66 ? 356 TYR B CA  1 
ATOM   6508 C C   . TYR B 1 334 ? 96.975  20.078  77.869  1.00 27.70 ? 356 TYR B C   1 
ATOM   6509 O O   . TYR B 1 334 ? 96.782  18.871  78.050  1.00 33.33 ? 356 TYR B O   1 
ATOM   6510 C CB  . TYR B 1 334 ? 99.317  19.819  78.725  1.00 26.93 ? 356 TYR B CB  1 
ATOM   6511 C CG  . TYR B 1 334 ? 100.794 20.080  78.507  1.00 31.82 ? 356 TYR B CG  1 
ATOM   6512 C CD1 . TYR B 1 334 ? 101.519 19.346  77.571  1.00 25.15 ? 356 TYR B CD1 1 
ATOM   6513 C CD2 . TYR B 1 334 ? 101.462 21.062  79.233  1.00 21.31 ? 356 TYR B CD2 1 
ATOM   6514 C CE1 . TYR B 1 334 ? 102.865 19.580  77.368  1.00 18.07 ? 356 TYR B CE1 1 
ATOM   6515 C CE2 . TYR B 1 334 ? 102.807 21.302  79.036  1.00 23.07 ? 356 TYR B CE2 1 
ATOM   6516 C CZ  . TYR B 1 334 ? 103.504 20.559  78.100  1.00 28.07 ? 356 TYR B CZ  1 
ATOM   6517 O OH  . TYR B 1 334 ? 104.846 20.794  77.901  1.00 39.02 ? 356 TYR B OH  1 
ATOM   6518 N N   . LYS B 1 335 ? 95.969  20.937  77.737  1.00 30.42 ? 357 LYS B N   1 
ATOM   6519 C CA  . LYS B 1 335 ? 94.573  20.529  77.741  1.00 26.90 ? 357 LYS B CA  1 
ATOM   6520 C C   . LYS B 1 335 ? 93.898  21.018  76.465  1.00 28.07 ? 357 LYS B C   1 
ATOM   6521 O O   . LYS B 1 335 ? 94.338  21.982  75.833  1.00 32.18 ? 357 LYS B O   1 
ATOM   6522 C CB  . LYS B 1 335 ? 93.835  21.076  78.970  1.00 26.47 ? 357 LYS B CB  1 
ATOM   6523 C CG  . LYS B 1 335 ? 93.499  22.554  78.876  1.00 39.35 ? 357 LYS B CG  1 
ATOM   6524 C CD  . LYS B 1 335 ? 93.088  23.144  80.218  1.00 40.93 ? 357 LYS B CD  1 
ATOM   6525 C CE  . LYS B 1 335 ? 92.431  24.509  80.031  1.00 36.93 ? 357 LYS B CE  1 
ATOM   6526 N NZ  . LYS B 1 335 ? 92.695  25.442  81.164  1.00 36.78 ? 357 LYS B NZ  1 
ATOM   6527 N N   . ARG B 1 336 ? 92.820  20.342  76.090  1.00 26.37 ? 358 ARG B N   1 
ATOM   6528 C CA  . ARG B 1 336 ? 92.096  20.670  74.874  1.00 28.01 ? 358 ARG B CA  1 
ATOM   6529 C C   . ARG B 1 336 ? 90.818  21.442  75.211  1.00 27.35 ? 358 ARG B C   1 
ATOM   6530 O O   . ARG B 1 336 ? 90.493  21.690  76.375  1.00 34.20 ? 358 ARG B O   1 
ATOM   6531 C CB  . ARG B 1 336 ? 91.809  19.395  74.081  1.00 23.18 ? 358 ARG B CB  1 
ATOM   6532 C CG  . ARG B 1 336 ? 93.073  18.674  73.648  1.00 20.19 ? 358 ARG B CG  1 
ATOM   6533 C CD  . ARG B 1 336 ? 92.835  17.194  73.427  1.00 23.11 ? 358 ARG B CD  1 
ATOM   6534 N NE  . ARG B 1 336 ? 92.301  16.908  72.098  1.00 24.96 ? 358 ARG B NE  1 
ATOM   6535 C CZ  . ARG B 1 336 ? 92.261  15.695  71.555  1.00 21.44 ? 358 ARG B CZ  1 
ATOM   6536 N NH1 . ARG B 1 336 ? 92.730  14.655  72.229  1.00 23.96 ? 358 ARG B NH1 1 
ATOM   6537 N NH2 . ARG B 1 336 ? 91.753  15.520  70.344  1.00 16.35 ? 358 ARG B NH2 1 
ATOM   6538 N N   . CYS B 1 337 ? 90.080  21.827  74.168  1.00 22.52 ? 359 CYS B N   1 
ATOM   6539 C CA  . CYS B 1 337 ? 88.926  22.700  74.352  1.00 20.42 ? 359 CYS B CA  1 
ATOM   6540 C C   . CYS B 1 337 ? 87.717  21.986  74.942  1.00 29.69 ? 359 CYS B C   1 
ATOM   6541 O O   . CYS B 1 337 ? 86.742  22.658  75.296  1.00 33.71 ? 359 CYS B O   1 
ATOM   6542 C CB  . CYS B 1 337 ? 88.541  23.352  73.022  1.00 26.38 ? 359 CYS B CB  1 
ATOM   6543 S SG  . CYS B 1 337 ? 87.910  22.220  71.764  1.00 25.63 ? 359 CYS B SG  1 
ATOM   6544 N N   . ASP B 1 338 ? 87.747  20.657  75.061  1.00 25.18 ? 360 ASP B N   1 
ATOM   6545 C CA  . ASP B 1 338 ? 86.663  19.920  75.701  1.00 25.20 ? 360 ASP B CA  1 
ATOM   6546 C C   . ASP B 1 338 ? 87.122  19.212  76.973  1.00 32.45 ? 360 ASP B C   1 
ATOM   6547 O O   . ASP B 1 338 ? 86.432  18.309  77.459  1.00 31.25 ? 360 ASP B O   1 
ATOM   6548 C CB  . ASP B 1 338 ? 86.041  18.920  74.724  1.00 25.80 ? 360 ASP B CB  1 
ATOM   6549 C CG  . ASP B 1 338 ? 86.992  17.806  74.337  1.00 28.63 ? 360 ASP B CG  1 
ATOM   6550 O OD1 . ASP B 1 338 ? 88.223  18.000  74.432  1.00 31.52 ? 360 ASP B OD1 1 
ATOM   6551 O OD2 . ASP B 1 338 ? 86.502  16.733  73.923  1.00 25.29 ? 360 ASP B OD2 1 
ATOM   6552 N N   . GLY B 1 339 ? 88.268  19.610  77.529  1.00 29.66 ? 361 GLY B N   1 
ATOM   6553 C CA  . GLY B 1 339 ? 88.799  18.993  78.724  1.00 28.61 ? 361 GLY B CA  1 
ATOM   6554 C C   . GLY B 1 339 ? 89.661  17.773  78.484  1.00 33.65 ? 361 GLY B C   1 
ATOM   6555 O O   . GLY B 1 339 ? 90.379  17.348  79.401  1.00 38.08 ? 361 GLY B O   1 
ATOM   6556 N N   . ARG B 1 340 ? 89.617  17.197  77.286  1.00 33.60 ? 362 ARG B N   1 
ATOM   6557 C CA  . ARG B 1 340 ? 90.430  16.033  76.973  1.00 31.08 ? 362 ARG B CA  1 
ATOM   6558 C C   . ARG B 1 340 ? 91.910  16.394  76.993  1.00 26.88 ? 362 ARG B C   1 
ATOM   6559 O O   . ARG B 1 340 ? 92.295  17.542  76.753  1.00 28.29 ? 362 ARG B O   1 
ATOM   6560 C CB  . ARG B 1 340 ? 90.052  15.478  75.600  1.00 24.61 ? 362 ARG B CB  1 
ATOM   6561 C CG  . ARG B 1 340 ? 89.224  14.209  75.641  1.00 27.49 ? 362 ARG B CG  1 
ATOM   6562 C CD  . ARG B 1 340 ? 88.924  13.715  74.239  1.00 23.79 ? 362 ARG B CD  1 
ATOM   6563 N NE  . ARG B 1 340 ? 88.662  14.820  73.323  1.00 23.84 ? 362 ARG B NE  1 
ATOM   6564 C CZ  . ARG B 1 340 ? 88.805  14.743  72.004  1.00 29.60 ? 362 ARG B CZ  1 
ATOM   6565 N NH1 . ARG B 1 340 ? 89.216  13.613  71.446  1.00 29.03 ? 362 ARG B NH1 1 
ATOM   6566 N NH2 . ARG B 1 340 ? 88.541  15.796  71.241  1.00 32.63 ? 362 ARG B NH2 1 
ATOM   6567 N N   . ASP B 1 341 ? 92.745  15.404  77.292  1.00 22.16 ? 363 ASP B N   1 
ATOM   6568 C CA  . ASP B 1 341 ? 94.179  15.579  77.141  1.00 29.73 ? 363 ASP B CA  1 
ATOM   6569 C C   . ASP B 1 341 ? 94.615  15.020  75.786  1.00 28.08 ? 363 ASP B C   1 
ATOM   6570 O O   . ASP B 1 341 ? 93.805  14.531  74.992  1.00 27.11 ? 363 ASP B O   1 
ATOM   6571 C CB  . ASP B 1 341 ? 94.951  14.943  78.302  1.00 25.33 ? 363 ASP B CB  1 
ATOM   6572 C CG  . ASP B 1 341 ? 94.397  13.597  78.713  1.00 36.42 ? 363 ASP B CG  1 
ATOM   6573 O OD1 . ASP B 1 341 ? 93.925  13.476  79.865  1.00 39.06 ? 363 ASP B OD1 1 
ATOM   6574 O OD2 . ASP B 1 341 ? 94.445  12.659  77.889  1.00 41.28 ? 363 ASP B OD2 1 
ATOM   6575 N N   . LEU B 1 342 ? 95.921  15.097  75.524  1.00 22.49 ? 364 LEU B N   1 
ATOM   6576 C CA  . LEU B 1 342 ? 96.419  14.895  74.168  1.00 20.86 ? 364 LEU B CA  1 
ATOM   6577 C C   . LEU B 1 342 ? 96.161  13.482  73.659  1.00 22.46 ? 364 LEU B C   1 
ATOM   6578 O O   . LEU B 1 342 ? 95.959  13.288  72.454  1.00 24.39 ? 364 LEU B O   1 
ATOM   6579 C CB  . LEU B 1 342 ? 97.911  15.218  74.113  1.00 20.94 ? 364 LEU B CB  1 
ATOM   6580 C CG  . LEU B 1 342 ? 98.345  16.489  74.844  1.00 18.31 ? 364 LEU B CG  1 
ATOM   6581 C CD1 . LEU B 1 342 ? 99.826  16.744  74.634  1.00 18.38 ? 364 LEU B CD1 1 
ATOM   6582 C CD2 . LEU B 1 342 ? 97.519  17.681  74.380  1.00 22.47 ? 364 LEU B CD2 1 
ATOM   6583 N N   . THR B 1 343 ? 96.152  12.487  74.546  1.00 23.09 ? 365 THR B N   1 
ATOM   6584 C CA  . THR B 1 343 ? 96.058  11.092  74.133  1.00 23.69 ? 365 THR B CA  1 
ATOM   6585 C C   . THR B 1 343 ? 94.688  10.479  74.393  1.00 19.86 ? 365 THR B C   1 
ATOM   6586 O O   . THR B 1 343 ? 94.520  9.272   74.190  1.00 18.03 ? 365 THR B O   1 
ATOM   6587 C CB  . THR B 1 343 ? 97.139  10.254  74.827  1.00 24.50 ? 365 THR B CB  1 
ATOM   6588 O OG1 . THR B 1 343 ? 96.964  10.314  76.250  1.00 18.10 ? 365 THR B OG1 1 
ATOM   6589 C CG2 . THR B 1 343 ? 98.528  10.765  74.463  1.00 22.97 ? 365 THR B CG2 1 
ATOM   6590 N N   . SER B 1 344 ? 93.705  11.275  74.817  1.00 22.86 ? 366 SER B N   1 
ATOM   6591 C CA  . SER B 1 344 ? 92.413  10.750  75.246  1.00 23.36 ? 366 SER B CA  1 
ATOM   6592 C C   . SER B 1 344 ? 91.444  10.646  74.076  1.00 23.39 ? 366 SER B C   1 
ATOM   6593 O O   . SER B 1 344 ? 91.244  11.613  73.334  1.00 24.21 ? 366 SER B O   1 
ATOM   6594 C CB  . SER B 1 344 ? 91.805  11.625  76.342  1.00 24.44 ? 366 SER B CB  1 
ATOM   6595 O OG  . SER B 1 344 ? 92.456  11.422  77.583  1.00 27.06 ? 366 SER B OG  1 
ATOM   6596 N N   . LEU B 1 345 ? 90.836  9.473   73.928  1.00 25.67 ? 367 LEU B N   1 
ATOM   6597 C CA  . LEU B 1 345 ? 89.783  9.273   72.945  1.00 21.33 ? 367 LEU B CA  1 
ATOM   6598 C C   . LEU B 1 345 ? 88.500  9.971   73.382  1.00 27.36 ? 367 LEU B C   1 
ATOM   6599 O O   . LEU B 1 345 ? 88.304  10.302  74.554  1.00 35.09 ? 367 LEU B O   1 
ATOM   6600 C CB  . LEU B 1 345 ? 89.496  7.785   72.760  1.00 20.26 ? 367 LEU B CB  1 
ATOM   6601 C CG  . LEU B 1 345 ? 90.147  7.032   71.607  1.00 27.16 ? 367 LEU B CG  1 
ATOM   6602 C CD1 . LEU B 1 345 ? 90.040  5.542   71.867  1.00 24.98 ? 367 LEU B CD1 1 
ATOM   6603 C CD2 . LEU B 1 345 ? 89.495  7.404   70.279  1.00 29.25 ? 367 LEU B CD2 1 
ATOM   6604 N N   . ARG B 1 346 ? 87.614  10.190  72.420  1.00 28.15 ? 368 ARG B N   1 
ATOM   6605 C CA  . ARG B 1 346 ? 86.251  10.530  72.780  1.00 29.68 ? 368 ARG B CA  1 
ATOM   6606 C C   . ARG B 1 346 ? 85.491  9.254   73.122  1.00 33.49 ? 368 ARG B C   1 
ATOM   6607 O O   . ARG B 1 346 ? 85.919  8.143   72.795  1.00 35.21 ? 368 ARG B O   1 
ATOM   6608 C CB  . ARG B 1 346 ? 85.558  11.281  71.645  1.00 30.49 ? 368 ARG B CB  1 
ATOM   6609 C CG  . ARG B 1 346 ? 85.928  12.746  71.569  1.00 26.18 ? 368 ARG B CG  1 
ATOM   6610 C CD  . ARG B 1 346 ? 85.388  13.384  70.306  1.00 28.21 ? 368 ARG B CD  1 
ATOM   6611 N NE  . ARG B 1 346 ? 85.975  12.802  69.104  1.00 29.42 ? 368 ARG B NE  1 
ATOM   6612 C CZ  . ARG B 1 346 ? 85.640  13.152  67.867  1.00 29.21 ? 368 ARG B CZ  1 
ATOM   6613 N NH1 . ARG B 1 346 ? 84.717  14.086  67.665  1.00 24.81 ? 368 ARG B NH1 1 
ATOM   6614 N NH2 . ARG B 1 346 ? 86.228  12.568  66.831  1.00 26.91 ? 368 ARG B NH2 1 
ATOM   6615 N N   . ASN B 1 347 ? 84.353  9.419   73.789  1.00 34.77 ? 369 ASN B N   1 
ATOM   6616 C CA  . ASN B 1 347 ? 83.585  8.266   74.244  1.00 42.31 ? 369 ASN B CA  1 
ATOM   6617 C C   . ASN B 1 347 ? 83.066  7.477   73.046  1.00 33.82 ? 369 ASN B C   1 
ATOM   6618 O O   . ASN B 1 347 ? 82.277  7.987   72.246  1.00 37.56 ? 369 ASN B O   1 
ATOM   6619 C CB  . ASN B 1 347 ? 82.440  8.717   75.146  1.00 49.06 ? 369 ASN B CB  1 
ATOM   6620 C CG  . ASN B 1 347 ? 82.878  9.760   76.159  1.00 66.06 ? 369 ASN B CG  1 
ATOM   6621 O OD1 . ASN B 1 347 ? 83.247  10.879  75.795  1.00 65.90 ? 369 ASN B OD1 1 
ATOM   6622 N ND2 . ASN B 1 347 ? 82.856  9.392   77.438  1.00 58.99 ? 369 ASN B ND2 1 
ATOM   6623 N N   . VAL B 1 348 ? 83.519  6.235   72.921  1.00 26.83 ? 370 VAL B N   1 
ATOM   6624 C CA  . VAL B 1 348 ? 83.179  5.380   71.794  1.00 26.11 ? 370 VAL B CA  1 
ATOM   6625 C C   . VAL B 1 348 ? 82.124  4.377   72.237  1.00 28.74 ? 370 VAL B C   1 
ATOM   6626 O O   . VAL B 1 348 ? 82.290  3.694   73.256  1.00 31.30 ? 370 VAL B O   1 
ATOM   6627 C CB  . VAL B 1 348 ? 84.426  4.663   71.251  1.00 27.52 ? 370 VAL B CB  1 
ATOM   6628 C CG1 . VAL B 1 348 ? 84.040  3.667   70.172  1.00 20.99 ? 370 VAL B CG1 1 
ATOM   6629 C CG2 . VAL B 1 348 ? 85.431  5.678   70.721  1.00 31.24 ? 370 VAL B CG2 1 
ATOM   6630 N N   . SER B 1 349 ? 81.040  4.290   71.473  1.00 32.15 ? 371 SER B N   1 
ATOM   6631 C CA  . SER B 1 349 ? 80.015  3.279   71.677  1.00 32.16 ? 371 SER B CA  1 
ATOM   6632 C C   . SER B 1 349 ? 79.506  2.829   70.317  1.00 33.82 ? 371 SER B C   1 
ATOM   6633 O O   . SER B 1 349 ? 79.488  3.606   69.358  1.00 33.07 ? 371 SER B O   1 
ATOM   6634 C CB  . SER B 1 349 ? 78.857  3.808   72.533  1.00 35.63 ? 371 SER B CB  1 
ATOM   6635 O OG  . SER B 1 349 ? 78.143  4.820   71.847  1.00 31.90 ? 371 SER B OG  1 
ATOM   6636 N N   . CYS B 1 350 ? 79.099  1.564   70.233  1.00 32.41 ? 372 CYS B N   1 
ATOM   6637 C CA  . CYS B 1 350 ? 78.652  1.017   68.962  1.00 28.82 ? 372 CYS B CA  1 
ATOM   6638 C C   . CYS B 1 350 ? 77.676  -0.124  69.200  1.00 32.98 ? 372 CYS B C   1 
ATOM   6639 O O   . CYS B 1 350 ? 77.778  -0.860  70.186  1.00 33.17 ? 372 CYS B O   1 
ATOM   6640 C CB  . CYS B 1 350 ? 79.833  0.535   68.118  1.00 30.65 ? 372 CYS B CB  1 
ATOM   6641 S SG  . CYS B 1 350 ? 81.111  -0.315  69.063  1.00 32.73 ? 372 CYS B SG  1 
ATOM   6642 N N   . GLU B 1 351 ? 76.730  -0.259  68.276  1.00 35.22 ? 373 GLU B N   1 
ATOM   6643 C CA  . GLU B 1 351 ? 75.725  -1.308  68.288  1.00 32.17 ? 373 GLU B CA  1 
ATOM   6644 C C   . GLU B 1 351 ? 75.821  -2.113  67.000  1.00 35.61 ? 373 GLU B C   1 
ATOM   6645 O O   . GLU B 1 351 ? 76.474  -1.711  66.033  1.00 36.80 ? 373 GLU B O   1 
ATOM   6646 C CB  . GLU B 1 351 ? 74.316  -0.723  68.442  1.00 34.71 ? 373 GLU B CB  1 
ATOM   6647 C CG  . GLU B 1 351 ? 73.735  -0.853  69.835  1.00 45.99 ? 373 GLU B CG  1 
ATOM   6648 C CD  . GLU B 1 351 ? 72.220  -0.836  69.827  1.00 61.54 ? 373 GLU B CD  1 
ATOM   6649 O OE1 . GLU B 1 351 ? 71.638  -0.163  68.947  1.00 48.92 ? 373 GLU B OE1 1 
ATOM   6650 O OE2 . GLU B 1 351 ? 71.611  -1.495  70.698  1.00 69.23 ? 373 GLU B OE2 1 
ATOM   6651 N N   . VAL B 1 352 ? 75.146  -3.259  66.990  1.00 34.21 ? 374 VAL B N   1 
ATOM   6652 C CA  . VAL B 1 352 ? 75.163  -4.172  65.854  1.00 32.02 ? 374 VAL B CA  1 
ATOM   6653 C C   . VAL B 1 352 ? 73.775  -4.780  65.702  1.00 34.74 ? 374 VAL B C   1 
ATOM   6654 O O   . VAL B 1 352 ? 73.081  -5.020  66.696  1.00 39.35 ? 374 VAL B O   1 
ATOM   6655 C CB  . VAL B 1 352 ? 76.252  -5.255  66.030  1.00 33.91 ? 374 VAL B CB  1 
ATOM   6656 C CG1 . VAL B 1 352 ? 75.900  -6.530  65.282  1.00 31.66 ? 374 VAL B CG1 1 
ATOM   6657 C CG2 . VAL B 1 352 ? 77.604  -4.724  65.563  1.00 32.71 ? 374 VAL B CG2 1 
ATOM   6658 N N   . ASP B 1 353 ? 73.355  -4.987  64.450  1.00 32.96 ? 375 ASP B N   1 
ATOM   6659 C CA  . ASP B 1 353 ? 72.103  -5.676  64.125  1.00 35.74 ? 375 ASP B CA  1 
ATOM   6660 C C   . ASP B 1 353 ? 70.884  -4.905  64.633  1.00 44.05 ? 375 ASP B C   1 
ATOM   6661 O O   . ASP B 1 353 ? 70.016  -5.444  65.323  1.00 46.54 ? 375 ASP B O   1 
ATOM   6662 C CB  . ASP B 1 353 ? 72.107  -7.109  64.660  1.00 33.50 ? 375 ASP B CB  1 
ATOM   6663 C CG  . ASP B 1 353 ? 70.990  -7.949  64.080  1.00 39.41 ? 375 ASP B CG  1 
ATOM   6664 O OD1 . ASP B 1 353 ? 71.088  -8.323  62.893  1.00 42.84 ? 375 ASP B OD1 1 
ATOM   6665 O OD2 . ASP B 1 353 ? 70.012  -8.230  64.808  1.00 45.17 ? 375 ASP B OD2 1 
ATOM   6666 N N   . MET B 1 354 ? 70.818  -3.625  64.273  1.00 41.25 ? 376 MET B N   1 
ATOM   6667 C CA  . MET B 1 354 ? 69.669  -2.799  64.618  1.00 32.90 ? 376 MET B CA  1 
ATOM   6668 C C   . MET B 1 354 ? 68.592  -2.822  63.542  1.00 42.53 ? 376 MET B C   1 
ATOM   6669 O O   . MET B 1 354 ? 67.402  -2.740  63.866  1.00 54.83 ? 376 MET B O   1 
ATOM   6670 C CB  . MET B 1 354 ? 70.125  -1.361  64.866  1.00 29.64 ? 376 MET B CB  1 
ATOM   6671 C CG  . MET B 1 354 ? 70.771  -0.754  63.643  1.00 50.43 ? 376 MET B CG  1 
ATOM   6672 S SD  . MET B 1 354 ? 72.288  0.139   63.971  1.00 58.06 ? 376 MET B SD  1 
ATOM   6673 C CE  . MET B 1 354 ? 73.229  -1.118  64.814  1.00 31.07 ? 376 MET B CE  1 
ATOM   6674 N N   . PHE B 1 355 ? 68.978  -2.926  62.269  1.00 39.94 ? 377 PHE B N   1 
ATOM   6675 C CA  . PHE B 1 355 ? 68.035  -3.009  61.159  1.00 43.75 ? 377 PHE B CA  1 
ATOM   6676 C C   . PHE B 1 355 ? 67.867  -4.485  60.822  1.00 49.50 ? 377 PHE B C   1 
ATOM   6677 O O   . PHE B 1 355 ? 68.803  -5.129  60.336  1.00 48.99 ? 377 PHE B O   1 
ATOM   6678 C CB  . PHE B 1 355 ? 68.518  -2.218  59.943  1.00 41.97 ? 377 PHE B CB  1 
ATOM   6679 C CG  . PHE B 1 355 ? 68.696  -0.740  60.193  1.00 43.27 ? 377 PHE B CG  1 
ATOM   6680 C CD1 . PHE B 1 355 ? 68.256  -0.150  61.368  1.00 41.95 ? 377 PHE B CD1 1 
ATOM   6681 C CD2 . PHE B 1 355 ? 69.305  0.062   59.239  1.00 45.42 ? 377 PHE B CD2 1 
ATOM   6682 C CE1 . PHE B 1 355 ? 68.432  1.206   61.592  1.00 38.95 ? 377 PHE B CE1 1 
ATOM   6683 C CE2 . PHE B 1 355 ? 69.477  1.419   59.456  1.00 45.76 ? 377 PHE B CE2 1 
ATOM   6684 C CZ  . PHE B 1 355 ? 69.040  1.990   60.635  1.00 36.91 ? 377 PHE B CZ  1 
ATOM   6685 N N   . LYS B 1 356 ? 66.672  -5.017  61.079  1.00 54.49 ? 378 LYS B N   1 
ATOM   6686 C CA  . LYS B 1 356 ? 66.456  -6.457  61.026  1.00 51.23 ? 378 LYS B CA  1 
ATOM   6687 C C   . LYS B 1 356 ? 66.258  -6.986  59.612  1.00 52.71 ? 378 LYS B C   1 
ATOM   6688 O O   . LYS B 1 356 ? 66.432  -8.189  59.387  1.00 50.48 ? 378 LYS B O   1 
ATOM   6689 C CB  . LYS B 1 356 ? 65.250  -6.828  61.889  1.00 46.12 ? 378 LYS B CB  1 
ATOM   6690 C CG  . LYS B 1 356 ? 65.235  -6.146  63.249  1.00 48.20 ? 378 LYS B CG  1 
ATOM   6691 C CD  . LYS B 1 356 ? 66.445  -6.545  64.080  1.00 47.88 ? 378 LYS B CD  1 
ATOM   6692 C CE  . LYS B 1 356 ? 66.391  -5.934  65.474  1.00 44.16 ? 378 LYS B CE  1 
ATOM   6693 N NZ  . LYS B 1 356 ? 67.512  -6.427  66.322  1.00 45.38 ? 378 LYS B NZ  1 
ATOM   6694 N N   . THR B 1 357 ? 65.901  -6.127  58.659  1.00 51.71 ? 379 THR B N   1 
ATOM   6695 C CA  . THR B 1 357 ? 65.647  -6.576  57.296  1.00 50.07 ? 379 THR B CA  1 
ATOM   6696 C C   . THR B 1 357 ? 66.898  -6.607  56.431  1.00 44.87 ? 379 THR B C   1 
ATOM   6697 O O   . THR B 1 357 ? 66.930  -7.346  55.441  1.00 48.55 ? 379 THR B O   1 
ATOM   6698 C CB  . THR B 1 357 ? 64.599  -5.678  56.628  1.00 50.96 ? 379 THR B CB  1 
ATOM   6699 O OG1 . THR B 1 357 ? 65.096  -4.337  56.545  1.00 55.33 ? 379 THR B OG1 1 
ATOM   6700 C CG2 . THR B 1 357 ? 63.308  -5.684  57.430  1.00 57.48 ? 379 THR B CG2 1 
ATOM   6701 N N   . LEU B 1 358 ? 67.923  -5.836  56.777  1.00 48.56 ? 380 LEU B N   1 
ATOM   6702 C CA  . LEU B 1 358 ? 69.113  -5.747  55.947  1.00 49.58 ? 380 LEU B CA  1 
ATOM   6703 C C   . LEU B 1 358 ? 70.031  -6.944  56.190  1.00 47.97 ? 380 LEU B C   1 
ATOM   6704 O O   . LEU B 1 358 ? 69.859  -7.718  57.137  1.00 51.99 ? 380 LEU B O   1 
ATOM   6705 C CB  . LEU B 1 358 ? 69.851  -4.438  56.216  1.00 44.36 ? 380 LEU B CB  1 
ATOM   6706 C CG  . LEU B 1 358 ? 68.967  -3.190  56.199  1.00 42.50 ? 380 LEU B CG  1 
ATOM   6707 C CD1 . LEU B 1 358 ? 69.800  -1.948  56.442  1.00 42.68 ? 380 LEU B CD1 1 
ATOM   6708 C CD2 . LEU B 1 358 ? 68.210  -3.080  54.883  1.00 41.27 ? 380 LEU B CD2 1 
ATOM   6709 N N   . HIS B 1 359 ? 71.024  -7.092  55.307  1.00 32.56 ? 381 HIS B N   1 
ATOM   6710 C CA  . HIS B 1 359 ? 71.946  -8.218  55.395  1.00 33.34 ? 381 HIS B CA  1 
ATOM   6711 C C   . HIS B 1 359 ? 72.990  -8.033  56.485  1.00 36.90 ? 381 HIS B C   1 
ATOM   6712 O O   . HIS B 1 359 ? 73.613  -9.016  56.905  1.00 37.85 ? 381 HIS B O   1 
ATOM   6713 C CB  . HIS B 1 359 ? 72.645  -8.441  54.051  1.00 34.76 ? 381 HIS B CB  1 
ATOM   6714 C CG  . HIS B 1 359 ? 71.705  -8.603  52.896  1.00 40.43 ? 381 HIS B CG  1 
ATOM   6715 N ND1 . HIS B 1 359 ? 72.140  -8.687  51.591  1.00 37.90 ? 381 HIS B ND1 1 
ATOM   6716 C CD2 . HIS B 1 359 ? 70.354  -8.698  52.848  1.00 39.70 ? 381 HIS B CD2 1 
ATOM   6717 C CE1 . HIS B 1 359 ? 71.100  -8.824  50.788  1.00 40.18 ? 381 HIS B CE1 1 
ATOM   6718 N NE2 . HIS B 1 359 ? 70.004  -8.833  51.526  1.00 48.58 ? 381 HIS B NE2 1 
ATOM   6719 N N   . GLY B 1 360 ? 73.193  -6.804  56.948  1.00 35.06 ? 382 GLY B N   1 
ATOM   6720 C CA  . GLY B 1 360 ? 74.145  -6.517  58.000  1.00 33.60 ? 382 GLY B CA  1 
ATOM   6721 C C   . GLY B 1 360 ? 74.116  -5.045  58.354  1.00 33.13 ? 382 GLY B C   1 
ATOM   6722 O O   . GLY B 1 360 ? 74.021  -4.195  57.465  1.00 31.01 ? 382 GLY B O   1 
ATOM   6723 N N   . SER B 1 361 ? 74.187  -4.722  59.643  1.00 30.23 ? 383 SER B N   1 
ATOM   6724 C CA  . SER B 1 361 ? 74.082  -3.332  60.053  1.00 33.00 ? 383 SER B CA  1 
ATOM   6725 C C   . SER B 1 361 ? 74.933  -3.090  61.288  1.00 31.55 ? 383 SER B C   1 
ATOM   6726 O O   . SER B 1 361 ? 75.128  -3.984  62.116  1.00 38.30 ? 383 SER B O   1 
ATOM   6727 C CB  . SER B 1 361 ? 72.625  -2.939  60.329  1.00 38.82 ? 383 SER B CB  1 
ATOM   6728 O OG  . SER B 1 361 ? 72.005  -3.866  61.201  1.00 41.12 ? 383 SER B OG  1 
ATOM   6729 N N   . ALA B 1 362 ? 75.437  -1.864  61.396  1.00 26.66 ? 384 ALA B N   1 
ATOM   6730 C CA  . ALA B 1 362 ? 76.165  -1.413  62.570  1.00 27.26 ? 384 ALA B CA  1 
ATOM   6731 C C   . ALA B 1 362 ? 76.021  0.097   62.663  1.00 30.53 ? 384 ALA B C   1 
ATOM   6732 O O   . ALA B 1 362 ? 75.693  0.768   61.680  1.00 32.74 ? 384 ALA B O   1 
ATOM   6733 C CB  . ALA B 1 362 ? 77.642  -1.806  62.502  1.00 28.09 ? 384 ALA B CB  1 
ATOM   6734 N N   . LEU B 1 363 ? 76.257  0.633   63.859  1.00 23.98 ? 385 LEU B N   1 
ATOM   6735 C CA  . LEU B 1 363 ? 76.368  2.079   64.019  1.00 27.74 ? 385 LEU B CA  1 
ATOM   6736 C C   . LEU B 1 363 ? 77.483  2.365   65.014  1.00 29.86 ? 385 LEU B C   1 
ATOM   6737 O O   . LEU B 1 363 ? 77.411  1.956   66.177  1.00 35.11 ? 385 LEU B O   1 
ATOM   6738 C CB  . LEU B 1 363 ? 75.034  2.728   64.434  1.00 22.92 ? 385 LEU B CB  1 
ATOM   6739 C CG  . LEU B 1 363 ? 74.492  2.835   65.860  1.00 26.13 ? 385 LEU B CG  1 
ATOM   6740 C CD1 . LEU B 1 363 ? 74.981  4.131   66.483  1.00 36.72 ? 385 LEU B CD1 1 
ATOM   6741 C CD2 . LEU B 1 363 ? 72.970  2.795   65.876  1.00 37.41 ? 385 LEU B CD2 1 
ATOM   6742 N N   . PHE B 1 364 ? 78.529  3.034   64.533  1.00 26.41 ? 386 PHE B N   1 
ATOM   6743 C CA  . PHE B 1 364 ? 79.701  3.383   65.321  1.00 22.86 ? 386 PHE B CA  1 
ATOM   6744 C C   . PHE B 1 364 ? 79.617  4.853   65.705  1.00 25.30 ? 386 PHE B C   1 
ATOM   6745 O O   . PHE B 1 364 ? 79.407  5.711   64.842  1.00 28.61 ? 386 PHE B O   1 
ATOM   6746 C CB  . PHE B 1 364 ? 80.977  3.111   64.522  1.00 19.64 ? 386 PHE B CB  1 
ATOM   6747 C CG  . PHE B 1 364 ? 82.245  3.418   65.268  1.00 26.36 ? 386 PHE B CG  1 
ATOM   6748 C CD1 . PHE B 1 364 ? 82.851  2.451   66.055  1.00 28.51 ? 386 PHE B CD1 1 
ATOM   6749 C CD2 . PHE B 1 364 ? 82.839  4.666   65.172  1.00 27.23 ? 386 PHE B CD2 1 
ATOM   6750 C CE1 . PHE B 1 364 ? 84.020  2.728   66.742  1.00 23.02 ? 386 PHE B CE1 1 
ATOM   6751 C CE2 . PHE B 1 364 ? 84.009  4.949   65.856  1.00 29.02 ? 386 PHE B CE2 1 
ATOM   6752 C CZ  . PHE B 1 364 ? 84.598  3.979   66.642  1.00 24.81 ? 386 PHE B CZ  1 
ATOM   6753 N N   . GLN B 1 365 ? 79.766  5.142   66.994  1.00 29.44 ? 387 GLN B N   1 
ATOM   6754 C CA  . GLN B 1 365 ? 79.695  6.510   67.491  1.00 29.61 ? 387 GLN B CA  1 
ATOM   6755 C C   . GLN B 1 365 ? 80.946  6.804   68.297  1.00 28.57 ? 387 GLN B C   1 
ATOM   6756 O O   . GLN B 1 365 ? 81.241  6.101   69.268  1.00 30.73 ? 387 GLN B O   1 
ATOM   6757 C CB  . GLN B 1 365 ? 78.445  6.739   68.344  1.00 37.79 ? 387 GLN B CB  1 
ATOM   6758 C CG  . GLN B 1 365 ? 78.335  8.158   68.878  1.00 45.13 ? 387 GLN B CG  1 
ATOM   6759 C CD  . GLN B 1 365 ? 76.900  8.637   68.970  1.00 62.62 ? 387 GLN B CD  1 
ATOM   6760 O OE1 . GLN B 1 365 ? 75.959  7.842   68.888  1.00 59.41 ? 387 GLN B OE1 1 
ATOM   6761 N NE2 . GLN B 1 365 ? 76.725  9.946   69.134  1.00 59.69 ? 387 GLN B NE2 1 
ATOM   6762 N N   . ARG B 1 366 ? 81.677  7.837   67.892  1.00 33.29 ? 388 ARG B N   1 
ATOM   6763 C CA  . ARG B 1 366 ? 82.880  8.287   68.585  1.00 33.05 ? 388 ARG B CA  1 
ATOM   6764 C C   . ARG B 1 366 ? 82.722  9.783   68.820  1.00 36.09 ? 388 ARG B C   1 
ATOM   6765 O O   . ARG B 1 366 ? 82.837  10.578  67.882  1.00 31.95 ? 388 ARG B O   1 
ATOM   6766 C CB  . ARG B 1 366 ? 84.132  7.978   67.776  1.00 34.87 ? 388 ARG B CB  1 
ATOM   6767 C CG  . ARG B 1 366 ? 85.377  8.679   68.275  1.00 37.37 ? 388 ARG B CG  1 
ATOM   6768 C CD  . ARG B 1 366 ? 86.349  8.910   67.136  1.00 38.16 ? 388 ARG B CD  1 
ATOM   6769 N NE  . ARG B 1 366 ? 86.627  7.677   66.414  1.00 41.13 ? 388 ARG B NE  1 
ATOM   6770 C CZ  . ARG B 1 366 ? 86.554  7.563   65.096  1.00 43.14 ? 388 ARG B CZ  1 
ATOM   6771 N NH1 . ARG B 1 366 ? 86.222  8.621   64.363  1.00 30.15 ? 388 ARG B NH1 1 
ATOM   6772 N NH2 . ARG B 1 366 ? 86.819  6.394   64.519  1.00 35.36 ? 388 ARG B NH2 1 
ATOM   6773 N N   . GLY B 1 367 ? 82.457  10.160  70.069  1.00 35.14 ? 389 GLY B N   1 
ATOM   6774 C CA  . GLY B 1 367 ? 82.181  11.555  70.366  1.00 30.32 ? 389 GLY B CA  1 
ATOM   6775 C C   . GLY B 1 367 ? 80.952  12.009  69.609  1.00 38.47 ? 389 GLY B C   1 
ATOM   6776 O O   . GLY B 1 367 ? 79.903  11.354  69.632  1.00 44.46 ? 389 GLY B O   1 
ATOM   6777 N N   . GLN B 1 368 ? 81.084  13.136  68.907  1.00 40.06 ? 390 GLN B N   1 
ATOM   6778 C CA  . GLN B 1 368 ? 80.008  13.681  68.090  1.00 43.33 ? 390 GLN B CA  1 
ATOM   6779 C C   . GLN B 1 368 ? 80.096  13.245  66.628  1.00 42.44 ? 390 GLN B C   1 
ATOM   6780 O O   . GLN B 1 368 ? 79.437  13.843  65.770  1.00 41.48 ? 390 GLN B O   1 
ATOM   6781 C CB  . GLN B 1 368 ? 79.995  15.207  68.188  1.00 42.78 ? 390 GLN B CB  1 
ATOM   6782 C CG  . GLN B 1 368 ? 79.317  15.739  69.439  1.00 43.92 ? 390 GLN B CG  1 
ATOM   6783 C CD  . GLN B 1 368 ? 78.762  17.137  69.248  1.00 46.42 ? 390 GLN B CD  1 
ATOM   6784 O OE1 . GLN B 1 368 ? 79.051  18.047  70.029  1.00 44.36 ? 390 GLN B OE1 1 
ATOM   6785 N NE2 . GLN B 1 368 ? 77.957  17.316  68.205  1.00 45.48 ? 390 GLN B NE2 1 
ATOM   6786 N N   . THR B 1 369 ? 80.902  12.227  66.328  1.00 42.68 ? 391 THR B N   1 
ATOM   6787 C CA  . THR B 1 369 ? 80.995  11.637  64.996  1.00 39.41 ? 391 THR B CA  1 
ATOM   6788 C C   . THR B 1 369 ? 80.252  10.307  65.043  1.00 37.04 ? 391 THR B C   1 
ATOM   6789 O O   . THR B 1 369 ? 80.685  9.375   65.729  1.00 38.26 ? 391 THR B O   1 
ATOM   6790 C CB  . THR B 1 369 ? 82.454  11.442  64.573  1.00 39.11 ? 391 THR B CB  1 
ATOM   6791 O OG1 . THR B 1 369 ? 83.072  12.715  64.335  1.00 33.03 ? 391 THR B OG1 1 
ATOM   6792 C CG2 . THR B 1 369 ? 82.543  10.596  63.308  1.00 30.25 ? 391 THR B CG2 1 
ATOM   6793 N N   . GLN B 1 370 ? 79.133  10.219  64.326  1.00 35.16 ? 392 GLN B N   1 
ATOM   6794 C CA  . GLN B 1 370 ? 78.268  9.045   64.382  1.00 41.35 ? 392 GLN B CA  1 
ATOM   6795 C C   . GLN B 1 370 ? 77.931  8.589   62.970  1.00 35.21 ? 392 GLN B C   1 
ATOM   6796 O O   . GLN B 1 370 ? 77.314  9.337   62.205  1.00 35.76 ? 392 GLN B O   1 
ATOM   6797 C CB  . GLN B 1 370 ? 76.990  9.343   65.170  1.00 47.39 ? 392 GLN B CB  1 
ATOM   6798 C CG  . GLN B 1 370 ? 76.064  8.148   65.315  1.00 46.71 ? 392 GLN B CG  1 
ATOM   6799 C CD  . GLN B 1 370 ? 74.671  8.542   65.763  1.00 56.87 ? 392 GLN B CD  1 
ATOM   6800 O OE1 . GLN B 1 370 ? 73.754  7.721   65.765  1.00 62.42 ? 392 GLN B OE1 1 
ATOM   6801 N NE2 . GLN B 1 370 ? 74.506  9.803   66.148  1.00 59.81 ? 392 GLN B NE2 1 
ATOM   6802 N N   . VAL B 1 371 ? 78.322  7.361   62.634  1.00 28.04 ? 393 VAL B N   1 
ATOM   6803 C CA  . VAL B 1 371 ? 78.069  6.787   61.320  1.00 29.66 ? 393 VAL B CA  1 
ATOM   6804 C C   . VAL B 1 371 ? 77.183  5.563   61.482  1.00 27.12 ? 393 VAL B C   1 
ATOM   6805 O O   . VAL B 1 371 ? 77.218  4.875   62.506  1.00 24.54 ? 393 VAL B O   1 
ATOM   6806 C CB  . VAL B 1 371 ? 79.370  6.410   60.576  1.00 29.07 ? 393 VAL B CB  1 
ATOM   6807 C CG1 . VAL B 1 371 ? 80.215  7.648   60.306  1.00 30.66 ? 393 VAL B CG1 1 
ATOM   6808 C CG2 . VAL B 1 371 ? 80.155  5.379   61.365  1.00 27.20 ? 393 VAL B CG2 1 
ATOM   6809 N N   . LEU B 1 372 ? 76.380  5.300   60.457  1.00 34.38 ? 394 LEU B N   1 
ATOM   6810 C CA  . LEU B 1 372 ? 75.554  4.103   60.377  1.00 30.20 ? 394 LEU B CA  1 
ATOM   6811 C C   . LEU B 1 372 ? 75.949  3.358   59.111  1.00 31.65 ? 394 LEU B C   1 
ATOM   6812 O O   . LEU B 1 372 ? 75.823  3.895   58.005  1.00 34.87 ? 394 LEU B O   1 
ATOM   6813 C CB  . LEU B 1 372 ? 74.067  4.462   60.373  1.00 32.02 ? 394 LEU B CB  1 
ATOM   6814 C CG  . LEU B 1 372 ? 73.110  3.494   59.677  1.00 38.20 ? 394 LEU B CG  1 
ATOM   6815 C CD1 . LEU B 1 372 ? 72.966  2.202   60.471  1.00 35.26 ? 394 LEU B CD1 1 
ATOM   6816 C CD2 . LEU B 1 372 ? 71.758  4.159   59.459  1.00 46.55 ? 394 LEU B CD2 1 
ATOM   6817 N N   . CYS B 1 373 ? 76.445  2.137   59.274  1.00 27.41 ? 395 CYS B N   1 
ATOM   6818 C CA  . CYS B 1 373 ? 76.932  1.338   58.161  1.00 24.27 ? 395 CYS B CA  1 
ATOM   6819 C C   . CYS B 1 373 ? 76.004  0.156   57.925  1.00 27.62 ? 395 CYS B C   1 
ATOM   6820 O O   . CYS B 1 373 ? 75.572  -0.508  58.872  1.00 34.61 ? 395 CYS B O   1 
ATOM   6821 C CB  . CYS B 1 373 ? 78.353  0.838   58.424  1.00 22.80 ? 395 CYS B CB  1 
ATOM   6822 S SG  . CYS B 1 373 ? 79.563  2.154   58.635  1.00 30.92 ? 395 CYS B SG  1 
ATOM   6823 N N   . THR B 1 374 ? 75.694  -0.097  56.659  1.00 23.10 ? 396 THR B N   1 
ATOM   6824 C CA  . THR B 1 374 ? 74.906  -1.251  56.264  1.00 25.59 ? 396 THR B CA  1 
ATOM   6825 C C   . THR B 1 374 ? 75.694  -2.090  55.266  1.00 29.27 ? 396 THR B C   1 
ATOM   6826 O O   . THR B 1 374 ? 76.614  -1.605  54.602  1.00 33.30 ? 396 THR B O   1 
ATOM   6827 C CB  . THR B 1 374 ? 73.563  -0.831  55.654  1.00 24.11 ? 396 THR B CB  1 
ATOM   6828 O OG1 . THR B 1 374 ? 73.788  -0.151  54.413  1.00 29.32 ? 396 THR B OG1 1 
ATOM   6829 C CG2 . THR B 1 374 ? 72.823  0.090   56.600  1.00 28.51 ? 396 THR B CG2 1 
ATOM   6830 N N   . VAL B 1 375 ? 75.330  -3.366  55.177  1.00 23.68 ? 397 VAL B N   1 
ATOM   6831 C CA  . VAL B 1 375 ? 75.948  -4.306  54.252  1.00 20.35 ? 397 VAL B CA  1 
ATOM   6832 C C   . VAL B 1 375 ? 74.857  -4.863  53.355  1.00 24.71 ? 397 VAL B C   1 
ATOM   6833 O O   . VAL B 1 375 ? 73.806  -5.294  53.842  1.00 29.18 ? 397 VAL B O   1 
ATOM   6834 C CB  . VAL B 1 375 ? 76.680  -5.439  54.994  1.00 24.84 ? 397 VAL B CB  1 
ATOM   6835 C CG1 . VAL B 1 375 ? 77.087  -6.540  54.023  1.00 24.58 ? 397 VAL B CG1 1 
ATOM   6836 C CG2 . VAL B 1 375 ? 77.894  -4.896  55.723  1.00 30.56 ? 397 VAL B CG2 1 
ATOM   6837 N N   . THR B 1 376 ? 75.097  -4.846  52.049  1.00 28.28 ? 398 THR B N   1 
ATOM   6838 C CA  . THR B 1 376 ? 74.169  -5.421  51.087  1.00 24.37 ? 398 THR B CA  1 
ATOM   6839 C C   . THR B 1 376 ? 74.941  -6.352  50.171  1.00 27.41 ? 398 THR B C   1 
ATOM   6840 O O   . THR B 1 376 ? 75.918  -5.936  49.542  1.00 26.56 ? 398 THR B O   1 
ATOM   6841 C CB  . THR B 1 376 ? 73.459  -4.335  50.279  1.00 24.95 ? 398 THR B CB  1 
ATOM   6842 O OG1 . THR B 1 376 ? 72.683  -3.523  51.165  1.00 36.52 ? 398 THR B OG1 1 
ATOM   6843 C CG2 . THR B 1 376 ? 72.538  -4.963  49.244  1.00 24.99 ? 398 THR B CG2 1 
ATOM   6844 N N   . PHE B 1 377 ? 74.512  -7.610  50.113  1.00 35.39 ? 399 PHE B N   1 
ATOM   6845 C CA  . PHE B 1 377 ? 75.074  -8.583  49.189  1.00 30.45 ? 399 PHE B CA  1 
ATOM   6846 C C   . PHE B 1 377 ? 74.335  -8.497  47.863  1.00 29.04 ? 399 PHE B C   1 
ATOM   6847 O O   . PHE B 1 377 ? 73.101  -8.545  47.828  1.00 33.99 ? 399 PHE B O   1 
ATOM   6848 C CB  . PHE B 1 377 ? 74.968  -9.999  49.754  1.00 33.83 ? 399 PHE B CB  1 
ATOM   6849 C CG  . PHE B 1 377 ? 75.663  -10.183 51.072  1.00 31.78 ? 399 PHE B CG  1 
ATOM   6850 C CD1 . PHE B 1 377 ? 77.018  -9.932  51.198  1.00 26.38 ? 399 PHE B CD1 1 
ATOM   6851 C CD2 . PHE B 1 377 ? 74.960  -10.612 52.186  1.00 33.26 ? 399 PHE B CD2 1 
ATOM   6852 C CE1 . PHE B 1 377 ? 77.660  -10.106 52.409  1.00 30.22 ? 399 PHE B CE1 1 
ATOM   6853 C CE2 . PHE B 1 377 ? 75.597  -10.790 53.400  1.00 32.31 ? 399 PHE B CE2 1 
ATOM   6854 C CZ  . PHE B 1 377 ? 76.950  -10.535 53.511  1.00 31.64 ? 399 PHE B CZ  1 
ATOM   6855 N N   . ASP B 1 378 ? 75.089  -8.348  46.783  1.00 37.31 ? 400 ASP B N   1 
ATOM   6856 C CA  . ASP B 1 378 ? 74.561  -8.385  45.429  1.00 37.07 ? 400 ASP B CA  1 
ATOM   6857 C C   . ASP B 1 378 ? 75.298  -9.469  44.655  1.00 39.21 ? 400 ASP B C   1 
ATOM   6858 O O   . ASP B 1 378 ? 76.264  -10.061 45.143  1.00 43.51 ? 400 ASP B O   1 
ATOM   6859 C CB  . ASP B 1 378 ? 74.702  -7.019  44.738  1.00 41.11 ? 400 ASP B CB  1 
ATOM   6860 C CG  . ASP B 1 378 ? 73.646  -6.790  43.660  1.00 52.07 ? 400 ASP B CG  1 
ATOM   6861 O OD1 . ASP B 1 378 ? 72.847  -7.715  43.391  1.00 49.54 ? 400 ASP B OD1 1 
ATOM   6862 O OD2 . ASP B 1 378 ? 73.618  -5.682  43.078  1.00 44.86 ? 400 ASP B OD2 1 
ATOM   6863 N N   . SER B 1 379 ? 74.830  -9.734  43.438  1.00 41.53 ? 401 SER B N   1 
ATOM   6864 C CA  . SER B 1 379 ? 75.441  -10.769 42.614  1.00 42.08 ? 401 SER B CA  1 
ATOM   6865 C C   . SER B 1 379 ? 76.910  -10.458 42.351  1.00 44.30 ? 401 SER B C   1 
ATOM   6866 O O   . SER B 1 379 ? 77.327  -9.298  42.324  1.00 47.75 ? 401 SER B O   1 
ATOM   6867 C CB  . SER B 1 379 ? 74.694  -10.900 41.287  1.00 46.15 ? 401 SER B CB  1 
ATOM   6868 O OG  . SER B 1 379 ? 74.528  -9.632  40.672  1.00 50.13 ? 401 SER B OG  1 
ATOM   6869 N N   . LEU B 1 380 ? 77.702  -11.518 42.161  1.00 48.66 ? 402 LEU B N   1 
ATOM   6870 C CA  . LEU B 1 380 ? 79.089  -11.334 41.750  1.00 45.55 ? 402 LEU B CA  1 
ATOM   6871 C C   . LEU B 1 380 ? 79.190  -10.662 40.388  1.00 54.57 ? 402 LEU B C   1 
ATOM   6872 O O   . LEU B 1 380 ? 80.237  -10.091 40.065  1.00 61.19 ? 402 LEU B O   1 
ATOM   6873 C CB  . LEU B 1 380 ? 79.823  -12.677 41.725  1.00 46.32 ? 402 LEU B CB  1 
ATOM   6874 C CG  . LEU B 1 380 ? 80.564  -13.123 42.991  1.00 44.68 ? 402 LEU B CG  1 
ATOM   6875 C CD1 . LEU B 1 380 ? 81.508  -14.288 42.693  1.00 34.49 ? 402 LEU B CD1 1 
ATOM   6876 C CD2 . LEU B 1 380 ? 81.324  -11.967 43.614  1.00 48.96 ? 402 LEU B CD2 1 
ATOM   6877 N N   . GLU B 1 381 ? 78.126  -10.713 39.589  1.00 63.10 ? 403 GLU B N   1 
ATOM   6878 C CA  . GLU B 1 381 ? 78.079  -10.073 38.274  1.00 61.81 ? 403 GLU B CA  1 
ATOM   6879 C C   . GLU B 1 381 ? 77.585  -8.631  38.373  1.00 62.90 ? 403 GLU B C   1 
ATOM   6880 O O   . GLU B 1 381 ? 76.693  -8.206  37.636  1.00 56.52 ? 403 GLU B O   1 
ATOM   6881 C CB  . GLU B 1 381 ? 77.200  -10.890 37.334  1.00 63.79 ? 403 GLU B CB  1 
ATOM   6882 C CG  . GLU B 1 381 ? 77.098  -12.365 37.701  1.00 68.99 ? 403 GLU B CG  1 
ATOM   6883 C CD  . GLU B 1 381 ? 78.440  -13.076 37.652  1.00 77.64 ? 403 GLU B CD  1 
ATOM   6884 O OE1 . GLU B 1 381 ? 79.269  -12.730 36.783  1.00 79.98 ? 403 GLU B OE1 1 
ATOM   6885 O OE2 . GLU B 1 381 ? 78.666  -13.980 38.485  1.00 77.59 ? 403 GLU B OE2 1 
ATOM   6886 N N   . SER B 1 382 ? 78.173  -7.879  39.304  1.00 62.72 ? 404 SER B N   1 
ATOM   6887 C CA  . SER B 1 382 ? 77.845  -6.470  39.542  1.00 55.84 ? 404 SER B CA  1 
ATOM   6888 C C   . SER B 1 382 ? 76.345  -6.237  39.705  1.00 47.98 ? 404 SER B C   1 
ATOM   6889 O O   . SER B 1 382 ? 75.788  -6.456  40.781  1.00 47.53 ? 404 SER B O   1 
ATOM   6890 C CB  . SER B 1 382 ? 78.390  -5.597  38.409  1.00 59.04 ? 404 SER B CB  1 
ATOM   6891 O OG  . SER B 1 382 ? 79.808  -5.569  38.425  1.00 55.27 ? 404 SER B OG  1 
ATOM   6892 N N   . ASP B 1 398 ? 90.432  -5.683  42.673  1.00 58.42 ? 420 ASP B N   1 
ATOM   6893 C CA  . ASP B 1 398 ? 90.456  -7.138  42.558  1.00 68.08 ? 420 ASP B CA  1 
ATOM   6894 C C   . ASP B 1 398 ? 89.231  -7.759  43.224  1.00 58.91 ? 420 ASP B C   1 
ATOM   6895 O O   . ASP B 1 398 ? 88.287  -8.160  42.541  1.00 54.26 ? 420 ASP B O   1 
ATOM   6896 C CB  . ASP B 1 398 ? 91.741  -7.706  43.167  1.00 68.21 ? 420 ASP B CB  1 
ATOM   6897 C CG  . ASP B 1 398 ? 92.975  -7.358  42.350  1.00 76.58 ? 420 ASP B CG  1 
ATOM   6898 O OD1 . ASP B 1 398 ? 92.817  -6.839  41.224  1.00 77.30 ? 420 ASP B OD1 1 
ATOM   6899 O OD2 . ASP B 1 398 ? 94.101  -7.605  42.833  1.00 71.25 ? 420 ASP B OD2 1 
ATOM   6900 N N   . LYS B 1 399 ? 89.250  -7.836  44.555  1.00 52.05 ? 421 LYS B N   1 
ATOM   6901 C CA  . LYS B 1 399 ? 88.109  -8.373  45.287  1.00 50.50 ? 421 LYS B CA  1 
ATOM   6902 C C   . LYS B 1 399 ? 86.860  -7.546  45.010  1.00 47.60 ? 421 LYS B C   1 
ATOM   6903 O O   . LYS B 1 399 ? 86.928  -6.325  44.844  1.00 50.80 ? 421 LYS B O   1 
ATOM   6904 C CB  . LYS B 1 399 ? 88.394  -8.395  46.789  1.00 47.94 ? 421 LYS B CB  1 
ATOM   6905 C CG  . LYS B 1 399 ? 89.803  -8.823  47.160  1.00 49.83 ? 421 LYS B CG  1 
ATOM   6906 C CD  . LYS B 1 399 ? 89.929  -9.028  48.661  1.00 39.56 ? 421 LYS B CD  1 
ATOM   6907 C CE  . LYS B 1 399 ? 91.311  -8.645  49.155  1.00 41.13 ? 421 LYS B CE  1 
ATOM   6908 N NZ  . LYS B 1 399 ? 91.482  -8.949  50.601  1.00 37.79 ? 421 LYS B NZ  1 
ATOM   6909 N N   . ASN B 1 400 ? 85.711  -8.222  44.960  1.00 37.96 ? 422 ASN B N   1 
ATOM   6910 C CA  . ASN B 1 400 ? 84.440  -7.567  44.650  1.00 39.39 ? 422 ASN B CA  1 
ATOM   6911 C C   . ASN B 1 400 ? 83.851  -6.996  45.938  1.00 36.92 ? 422 ASN B C   1 
ATOM   6912 O O   . ASN B 1 400 ? 82.926  -7.543  46.545  1.00 34.55 ? 422 ASN B O   1 
ATOM   6913 C CB  . ASN B 1 400 ? 83.490  -8.538  43.963  1.00 36.61 ? 422 ASN B CB  1 
ATOM   6914 C CG  . ASN B 1 400 ? 83.940  -8.893  42.561  1.00 50.24 ? 422 ASN B CG  1 
ATOM   6915 O OD1 . ASN B 1 400 ? 83.850  -10.046 42.140  1.00 68.72 ? 422 ASN B OD1 1 
ATOM   6916 N ND2 . ASN B 1 400 ? 84.436  -7.900  41.831  1.00 65.61 ? 422 ASN B ND2 1 
ATOM   6917 N N   . PHE B 1 401 ? 84.402  -5.856  46.350  1.00 28.83 ? 423 PHE B N   1 
ATOM   6918 C CA  . PHE B 1 401 ? 84.024  -5.213  47.597  1.00 29.59 ? 423 PHE B CA  1 
ATOM   6919 C C   . PHE B 1 401 ? 84.038  -3.706  47.402  1.00 33.78 ? 423 PHE B C   1 
ATOM   6920 O O   . PHE B 1 401 ? 84.982  -3.159  46.824  1.00 32.21 ? 423 PHE B O   1 
ATOM   6921 C CB  . PHE B 1 401 ? 84.972  -5.615  48.732  1.00 27.47 ? 423 PHE B CB  1 
ATOM   6922 C CG  . PHE B 1 401 ? 84.937  -4.689  49.906  1.00 24.05 ? 423 PHE B CG  1 
ATOM   6923 C CD1 . PHE B 1 401 ? 83.844  -4.669  50.754  1.00 26.57 ? 423 PHE B CD1 1 
ATOM   6924 C CD2 . PHE B 1 401 ? 85.998  -3.842  50.165  1.00 25.42 ? 423 PHE B CD2 1 
ATOM   6925 C CE1 . PHE B 1 401 ? 83.808  -3.819  51.838  1.00 27.54 ? 423 PHE B CE1 1 
ATOM   6926 C CE2 . PHE B 1 401 ? 85.970  -2.989  51.248  1.00 28.10 ? 423 PHE B CE2 1 
ATOM   6927 C CZ  . PHE B 1 401 ? 84.872  -2.977  52.086  1.00 31.66 ? 423 PHE B CZ  1 
ATOM   6928 N N   . MET B 1 402 ? 82.992  -3.039  47.886  1.00 33.97 ? 424 MET B N   1 
ATOM   6929 C CA  . MET B 1 402 ? 82.838  -1.603  47.705  1.00 34.92 ? 424 MET B CA  1 
ATOM   6930 C C   . MET B 1 402 ? 82.297  -0.975  48.981  1.00 35.77 ? 424 MET B C   1 
ATOM   6931 O O   . MET B 1 402 ? 81.398  -1.527  49.621  1.00 35.30 ? 424 MET B O   1 
ATOM   6932 C CB  . MET B 1 402 ? 81.896  -1.284  46.533  1.00 42.16 ? 424 MET B CB  1 
ATOM   6933 C CG  . MET B 1 402 ? 82.471  -1.597  45.155  1.00 58.44 ? 424 MET B CG  1 
ATOM   6934 S SD  . MET B 1 402 ? 81.223  -1.626  43.844  1.00 91.80 ? 424 MET B SD  1 
ATOM   6935 C CE  . MET B 1 402 ? 82.257  -1.666  42.373  1.00 39.99 ? 424 MET B CE  1 
ATOM   6936 N N   . LEU B 1 403 ? 82.856  0.179   49.346  1.00 34.07 ? 425 LEU B N   1 
ATOM   6937 C CA  . LEU B 1 403 ? 82.333  1.015   50.420  1.00 34.66 ? 425 LEU B CA  1 
ATOM   6938 C C   . LEU B 1 403 ? 81.977  2.378   49.848  1.00 36.98 ? 425 LEU B C   1 
ATOM   6939 O O   . LEU B 1 403 ? 82.792  2.997   49.154  1.00 32.69 ? 425 LEU B O   1 
ATOM   6940 C CB  . LEU B 1 403 ? 83.337  1.175   51.566  1.00 33.12 ? 425 LEU B CB  1 
ATOM   6941 C CG  . LEU B 1 403 ? 82.771  1.811   52.841  1.00 25.38 ? 425 LEU B CG  1 
ATOM   6942 C CD1 . LEU B 1 403 ? 83.433  1.208   54.066  1.00 23.24 ? 425 LEU B CD1 1 
ATOM   6943 C CD2 . LEU B 1 403 ? 82.925  3.328   52.838  1.00 24.80 ? 425 LEU B CD2 1 
ATOM   6944 N N   . HIS B 1 404 ? 80.772  2.849   50.154  1.00 33.39 ? 426 HIS B N   1 
ATOM   6945 C CA  . HIS B 1 404 ? 80.250  4.081   49.585  1.00 35.12 ? 426 HIS B CA  1 
ATOM   6946 C C   . HIS B 1 404 ? 79.844  5.027   50.704  1.00 32.35 ? 426 HIS B C   1 
ATOM   6947 O O   . HIS B 1 404 ? 79.154  4.628   51.648  1.00 32.39 ? 426 HIS B O   1 
ATOM   6948 C CB  . HIS B 1 404 ? 79.074  3.787   48.645  1.00 47.61 ? 426 HIS B CB  1 
ATOM   6949 C CG  . HIS B 1 404 ? 79.482  3.075   47.389  1.00 65.90 ? 426 HIS B CG  1 
ATOM   6950 N ND1 . HIS B 1 404 ? 78.578  2.652   46.438  1.00 73.01 ? 426 HIS B ND1 1 
ATOM   6951 C CD2 . HIS B 1 404 ? 80.705  2.713   46.930  1.00 63.49 ? 426 HIS B CD2 1 
ATOM   6952 C CE1 . HIS B 1 404 ? 79.225  2.057   45.451  1.00 75.34 ? 426 HIS B CE1 1 
ATOM   6953 N NE2 . HIS B 1 404 ? 80.517  2.080   45.725  1.00 69.72 ? 426 HIS B NE2 1 
ATOM   6954 N N   . TYR B 1 405 ? 80.293  6.274   50.593  1.00 37.15 ? 427 TYR B N   1 
ATOM   6955 C CA  . TYR B 1 405 ? 80.066  7.319   51.581  1.00 33.14 ? 427 TYR B CA  1 
ATOM   6956 C C   . TYR B 1 405 ? 78.772  8.061   51.264  1.00 38.56 ? 427 TYR B C   1 
ATOM   6957 O O   . TYR B 1 405 ? 78.415  8.233   50.095  1.00 48.97 ? 427 TYR B O   1 
ATOM   6958 C CB  . TYR B 1 405 ? 81.251  8.288   51.562  1.00 38.43 ? 427 TYR B CB  1 
ATOM   6959 C CG  . TYR B 1 405 ? 81.561  9.000   52.854  1.00 44.68 ? 427 TYR B CG  1 
ATOM   6960 C CD1 . TYR B 1 405 ? 82.068  8.311   53.951  1.00 39.68 ? 427 TYR B CD1 1 
ATOM   6961 C CD2 . TYR B 1 405 ? 81.385  10.377  52.961  1.00 47.99 ? 427 TYR B CD2 1 
ATOM   6962 C CE1 . TYR B 1 405 ? 82.367  8.973   55.129  1.00 35.87 ? 427 TYR B CE1 1 
ATOM   6963 C CE2 . TYR B 1 405 ? 81.680  11.047  54.129  1.00 45.04 ? 427 TYR B CE2 1 
ATOM   6964 C CZ  . TYR B 1 405 ? 82.171  10.342  55.207  1.00 48.01 ? 427 TYR B CZ  1 
ATOM   6965 O OH  . TYR B 1 405 ? 82.463  11.013  56.367  1.00 43.58 ? 427 TYR B OH  1 
ATOM   6966 N N   . GLU B 1 406 ? 78.067  8.502   52.304  1.00 36.39 ? 428 GLU B N   1 
ATOM   6967 C CA  . GLU B 1 406 ? 76.826  9.250   52.094  1.00 41.17 ? 428 GLU B CA  1 
ATOM   6968 C C   . GLU B 1 406 ? 76.659  10.411  53.075  1.00 38.04 ? 428 GLU B C   1 
ATOM   6969 O O   . GLU B 1 406 ? 76.904  10.272  54.273  1.00 40.22 ? 428 GLU B O   1 
ATOM   6970 C CB  . GLU B 1 406 ? 75.617  8.313   52.181  1.00 41.40 ? 428 GLU B CB  1 
ATOM   6971 C CG  . GLU B 1 406 ? 75.473  7.391   50.975  1.00 43.84 ? 428 GLU B CG  1 
ATOM   6972 C CD  . GLU B 1 406 ? 74.081  6.808   50.827  1.00 58.42 ? 428 GLU B CD  1 
ATOM   6973 O OE1 . GLU B 1 406 ? 73.252  7.000   51.741  1.00 58.26 ? 428 GLU B OE1 1 
ATOM   6974 O OE2 . GLU B 1 406 ? 73.819  6.157   49.792  1.00 65.51 ? 428 GLU B OE2 1 
ATOM   6975 N N   . GLY B 1 427 ? 86.289  10.064  47.888  1.00 38.74 ? 449 GLY B N   1 
ATOM   6976 C CA  . GLY B 1 427 ? 87.144  10.740  48.849  1.00 42.20 ? 449 GLY B CA  1 
ATOM   6977 C C   . GLY B 1 427 ? 87.188  10.049  50.200  1.00 42.23 ? 449 GLY B C   1 
ATOM   6978 O O   . GLY B 1 427 ? 88.101  9.269   50.481  1.00 43.30 ? 449 GLY B O   1 
ATOM   6979 N N   . HIS B 1 428 ? 86.196  10.342  51.044  1.00 44.24 ? 450 HIS B N   1 
ATOM   6980 C CA  . HIS B 1 428 ? 86.104  9.671   52.337  1.00 34.23 ? 450 HIS B CA  1 
ATOM   6981 C C   . HIS B 1 428 ? 85.856  8.178   52.164  1.00 34.71 ? 450 HIS B C   1 
ATOM   6982 O O   . HIS B 1 428 ? 86.479  7.353   52.843  1.00 32.03 ? 450 HIS B O   1 
ATOM   6983 C CB  . HIS B 1 428 ? 84.993  10.302  53.182  1.00 34.43 ? 450 HIS B CB  1 
ATOM   6984 C CG  . HIS B 1 428 ? 85.320  11.671  53.698  1.00 45.20 ? 450 HIS B CG  1 
ATOM   6985 N ND1 . HIS B 1 428 ? 85.427  12.773  52.875  1.00 56.05 ? 450 HIS B ND1 1 
ATOM   6986 C CD2 . HIS B 1 428 ? 85.557  12.117  54.955  1.00 49.07 ? 450 HIS B CD2 1 
ATOM   6987 C CE1 . HIS B 1 428 ? 85.718  13.837  53.602  1.00 52.58 ? 450 HIS B CE1 1 
ATOM   6988 N NE2 . HIS B 1 428 ? 85.801  13.466  54.868  1.00 60.72 ? 450 HIS B NE2 1 
ATOM   6989 N N   . GLY B 1 429 ? 84.949  7.811   51.256  1.00 34.34 ? 451 GLY B N   1 
ATOM   6990 C CA  . GLY B 1 429 ? 84.668  6.403   51.033  1.00 27.06 ? 451 GLY B CA  1 
ATOM   6991 C C   . GLY B 1 429 ? 85.887  5.622   50.579  1.00 27.96 ? 451 GLY B C   1 
ATOM   6992 O O   . GLY B 1 429 ? 86.107  4.489   51.016  1.00 31.51 ? 451 GLY B O   1 
ATOM   6993 N N   . ALA B 1 430 ? 86.700  6.218   49.701  1.00 22.42 ? 452 ALA B N   1 
ATOM   6994 C CA  . ALA B 1 430 ? 87.892  5.529   49.214  1.00 23.20 ? 452 ALA B CA  1 
ATOM   6995 C C   . ALA B 1 430 ? 88.856  5.213   50.352  1.00 27.43 ? 452 ALA B C   1 
ATOM   6996 O O   . ALA B 1 430 ? 89.463  4.135   50.383  1.00 23.29 ? 452 ALA B O   1 
ATOM   6997 C CB  . ALA B 1 430 ? 88.585  6.369   48.141  1.00 21.88 ? 452 ALA B CB  1 
ATOM   6998 N N   . LEU B 1 431 ? 89.010  6.139   51.299  1.00 25.80 ? 453 LEU B N   1 
ATOM   6999 C CA  . LEU B 1 431 ? 89.910  5.898   52.422  1.00 19.44 ? 453 LEU B CA  1 
ATOM   7000 C C   . LEU B 1 431 ? 89.371  4.804   53.336  1.00 23.33 ? 453 LEU B C   1 
ATOM   7001 O O   . LEU B 1 431 ? 90.134  3.961   53.821  1.00 24.71 ? 453 LEU B O   1 
ATOM   7002 C CB  . LEU B 1 431 ? 90.129  7.191   53.202  1.00 19.88 ? 453 LEU B CB  1 
ATOM   7003 C CG  . LEU B 1 431 ? 90.941  7.075   54.489  1.00 17.39 ? 453 LEU B CG  1 
ATOM   7004 C CD1 . LEU B 1 431 ? 92.325  6.521   54.194  1.00 24.85 ? 453 LEU B CD1 1 
ATOM   7005 C CD2 . LEU B 1 431 ? 91.032  8.425   55.180  1.00 24.51 ? 453 LEU B CD2 1 
ATOM   7006 N N   . ALA B 1 432 ? 88.060  4.800   53.587  1.00 21.70 ? 454 ALA B N   1 
ATOM   7007 C CA  . ALA B 1 432 ? 87.488  3.749   54.420  1.00 21.78 ? 454 ALA B CA  1 
ATOM   7008 C C   . ALA B 1 432 ? 87.534  2.404   53.708  1.00 24.85 ? 454 ALA B C   1 
ATOM   7009 O O   . ALA B 1 432 ? 87.801  1.371   54.334  1.00 23.92 ? 454 ALA B O   1 
ATOM   7010 C CB  . ALA B 1 432 ? 86.056  4.109   54.812  1.00 23.65 ? 454 ALA B CB  1 
ATOM   7011 N N   . GLU B 1 433 ? 87.285  2.401   52.396  1.00 25.82 ? 455 GLU B N   1 
ATOM   7012 C CA  . GLU B 1 433 ? 87.346  1.163   51.628  1.00 23.70 ? 455 GLU B CA  1 
ATOM   7013 C C   . GLU B 1 433 ? 88.747  0.569   51.648  1.00 24.71 ? 455 GLU B C   1 
ATOM   7014 O O   . GLU B 1 433 ? 88.911  -0.653  51.750  1.00 26.51 ? 455 GLU B O   1 
ATOM   7015 C CB  . GLU B 1 433 ? 86.894  1.421   50.194  1.00 22.03 ? 455 GLU B CB  1 
ATOM   7016 C CG  . GLU B 1 433 ? 87.091  0.247   49.263  1.00 25.73 ? 455 GLU B CG  1 
ATOM   7017 C CD  . GLU B 1 433 ? 86.490  0.491   47.897  1.00 30.21 ? 455 GLU B CD  1 
ATOM   7018 O OE1 . GLU B 1 433 ? 87.193  0.259   46.888  1.00 30.76 ? 455 GLU B OE1 1 
ATOM   7019 O OE2 . GLU B 1 433 ? 85.316  0.921   47.835  1.00 27.51 ? 455 GLU B OE2 1 
ATOM   7020 N N   . LYS B 1 434 ? 89.773  1.419   51.550  1.00 28.35 ? 456 LYS B N   1 
ATOM   7021 C CA  . LYS B 1 434 ? 91.148  0.935   51.609  1.00 27.07 ? 456 LYS B CA  1 
ATOM   7022 C C   . LYS B 1 434 ? 91.487  0.380   52.985  1.00 26.71 ? 456 LYS B C   1 
ATOM   7023 O O   . LYS B 1 434 ? 92.348  -0.499  53.102  1.00 26.17 ? 456 LYS B O   1 
ATOM   7024 C CB  . LYS B 1 434 ? 92.120  2.059   51.245  1.00 23.42 ? 456 LYS B CB  1 
ATOM   7025 C CG  . LYS B 1 434 ? 92.177  2.378   49.765  1.00 31.00 ? 456 LYS B CG  1 
ATOM   7026 C CD  . LYS B 1 434 ? 92.857  3.717   49.509  1.00 37.04 ? 456 LYS B CD  1 
ATOM   7027 C CE  . LYS B 1 434 ? 94.219  3.788   50.179  1.00 28.59 ? 456 LYS B CE  1 
ATOM   7028 N NZ  . LYS B 1 434 ? 95.013  4.958   49.703  1.00 31.02 ? 456 LYS B NZ  1 
ATOM   7029 N N   . ALA B 1 435 ? 90.831  0.882   54.033  1.00 28.10 ? 457 ALA B N   1 
ATOM   7030 C CA  . ALA B 1 435 ? 91.124  0.414   55.382  1.00 24.57 ? 457 ALA B CA  1 
ATOM   7031 C C   . ALA B 1 435 ? 90.585  -0.989  55.617  1.00 27.60 ? 457 ALA B C   1 
ATOM   7032 O O   . ALA B 1 435 ? 91.186  -1.764  56.369  1.00 29.39 ? 457 ALA B O   1 
ATOM   7033 C CB  . ALA B 1 435 ? 90.545  1.381   56.414  1.00 25.59 ? 457 ALA B CB  1 
ATOM   7034 N N   . LEU B 1 436 ? 89.461  -1.331  54.989  1.00 26.04 ? 458 LEU B N   1 
ATOM   7035 C CA  . LEU B 1 436 ? 88.858  -2.645  55.148  1.00 25.39 ? 458 LEU B CA  1 
ATOM   7036 C C   . LEU B 1 436 ? 89.277  -3.629  54.069  1.00 28.68 ? 458 LEU B C   1 
ATOM   7037 O O   . LEU B 1 436 ? 89.052  -4.832  54.235  1.00 33.55 ? 458 LEU B O   1 
ATOM   7038 C CB  . LEU B 1 436 ? 87.331  -2.533  55.149  1.00 22.67 ? 458 LEU B CB  1 
ATOM   7039 C CG  . LEU B 1 436 ? 86.733  -1.548  56.147  1.00 27.52 ? 458 LEU B CG  1 
ATOM   7040 C CD1 . LEU B 1 436 ? 85.274  -1.309  55.826  1.00 26.24 ? 458 LEU B CD1 1 
ATOM   7041 C CD2 . LEU B 1 436 ? 86.901  -2.068  57.566  1.00 29.81 ? 458 LEU B CD2 1 
ATOM   7042 N N   . TYR B 1 437 ? 89.875  -3.150  52.979  1.00 30.25 ? 459 TYR B N   1 
ATOM   7043 C CA  . TYR B 1 437 ? 90.171  -4.021  51.842  1.00 32.97 ? 459 TYR B CA  1 
ATOM   7044 C C   . TYR B 1 437 ? 91.023  -5.231  52.211  1.00 32.45 ? 459 TYR B C   1 
ATOM   7045 O O   . TYR B 1 437 ? 90.673  -6.348  51.791  1.00 32.98 ? 459 TYR B O   1 
ATOM   7046 C CB  . TYR B 1 437 ? 90.820  -3.194  50.726  1.00 34.29 ? 459 TYR B CB  1 
ATOM   7047 C CG  . TYR B 1 437 ? 91.096  -3.970  49.458  1.00 39.89 ? 459 TYR B CG  1 
ATOM   7048 C CD1 . TYR B 1 437 ? 90.129  -4.084  48.464  1.00 45.91 ? 459 TYR B CD1 1 
ATOM   7049 C CD2 . TYR B 1 437 ? 92.325  -4.584  49.253  1.00 46.32 ? 459 TYR B CD2 1 
ATOM   7050 C CE1 . TYR B 1 437 ? 90.380  -4.795  47.300  1.00 48.62 ? 459 TYR B CE1 1 
ATOM   7051 C CE2 . TYR B 1 437 ? 92.586  -5.298  48.096  1.00 54.15 ? 459 TYR B CE2 1 
ATOM   7052 C CZ  . TYR B 1 437 ? 91.612  -5.400  47.122  1.00 57.09 ? 459 TYR B CZ  1 
ATOM   7053 O OH  . TYR B 1 437 ? 91.879  -6.111  45.972  1.00 67.15 ? 459 TYR B OH  1 
ATOM   7054 N N   . PRO B 1 438 ? 92.118  -5.108  52.973  1.00 29.87 ? 460 PRO B N   1 
ATOM   7055 C CA  . PRO B 1 438 ? 92.962  -6.294  53.209  1.00 34.87 ? 460 PRO B CA  1 
ATOM   7056 C C   . PRO B 1 438 ? 92.258  -7.427  53.938  1.00 34.62 ? 460 PRO B C   1 
ATOM   7057 O O   . PRO B 1 438 ? 92.577  -8.595  53.688  1.00 44.92 ? 460 PRO B O   1 
ATOM   7058 C CB  . PRO B 1 438 ? 94.130  -5.736  54.034  1.00 27.53 ? 460 PRO B CB  1 
ATOM   7059 C CG  . PRO B 1 438 ? 94.162  -4.293  53.711  1.00 25.76 ? 460 PRO B CG  1 
ATOM   7060 C CD  . PRO B 1 438 ? 92.731  -3.897  53.548  1.00 24.51 ? 460 PRO B CD  1 
ATOM   7061 N N   . VAL B 1 439 ? 91.303  -7.127  54.825  1.00 30.16 ? 461 VAL B N   1 
ATOM   7062 C CA  . VAL B 1 439 ? 90.654  -8.173  55.610  1.00 32.00 ? 461 VAL B CA  1 
ATOM   7063 C C   . VAL B 1 439 ? 89.455  -8.795  54.904  1.00 33.63 ? 461 VAL B C   1 
ATOM   7064 O O   . VAL B 1 439 ? 88.803  -9.673  55.482  1.00 32.88 ? 461 VAL B O   1 
ATOM   7065 C CB  . VAL B 1 439 ? 90.210  -7.638  56.989  1.00 32.50 ? 461 VAL B CB  1 
ATOM   7066 C CG1 . VAL B 1 439 ? 91.351  -6.888  57.661  1.00 27.72 ? 461 VAL B CG1 1 
ATOM   7067 C CG2 . VAL B 1 439 ? 88.975  -6.755  56.855  1.00 22.48 ? 461 VAL B CG2 1 
ATOM   7068 N N   . ILE B 1 440 ? 89.150  -8.383  53.680  1.00 35.11 ? 462 ILE B N   1 
ATOM   7069 C CA  . ILE B 1 440 ? 87.974  -8.904  52.975  1.00 34.33 ? 462 ILE B CA  1 
ATOM   7070 C C   . ILE B 1 440 ? 88.342  -10.234 52.321  1.00 34.37 ? 462 ILE B C   1 
ATOM   7071 O O   . ILE B 1 440 ? 89.417  -10.337 51.710  1.00 39.71 ? 462 ILE B O   1 
ATOM   7072 C CB  . ILE B 1 440 ? 87.478  -7.897  51.938  1.00 33.49 ? 462 ILE B CB  1 
ATOM   7073 C CG1 . ILE B 1 440 ? 86.672  -6.786  52.613  1.00 33.13 ? 462 ILE B CG1 1 
ATOM   7074 C CG2 . ILE B 1 440 ? 86.613  -8.572  50.894  1.00 27.08 ? 462 ILE B CG2 1 
ATOM   7075 C CD1 . ILE B 1 440 ? 85.316  -7.234  53.111  1.00 30.58 ? 462 ILE B CD1 1 
ATOM   7076 N N   . PRO B 1 441 ? 87.500  -11.261 52.430  1.00 36.30 ? 463 PRO B N   1 
ATOM   7077 C CA  . PRO B 1 441 ? 87.838  -12.563 51.842  1.00 35.72 ? 463 PRO B CA  1 
ATOM   7078 C C   . PRO B 1 441 ? 87.857  -12.508 50.323  1.00 43.42 ? 463 PRO B C   1 
ATOM   7079 O O   . PRO B 1 441 ? 87.308  -11.601 49.694  1.00 45.84 ? 463 PRO B O   1 
ATOM   7080 C CB  . PRO B 1 441 ? 86.720  -13.488 52.343  1.00 33.70 ? 463 PRO B CB  1 
ATOM   7081 C CG  . PRO B 1 441 ? 86.040  -12.740 53.449  1.00 36.11 ? 463 PRO B CG  1 
ATOM   7082 C CD  . PRO B 1 441 ? 86.210  -11.289 53.136  1.00 39.08 ? 463 PRO B CD  1 
ATOM   7083 N N   . ARG B 1 442 ? 88.497  -13.518 49.733  1.00 43.90 ? 464 ARG B N   1 
ATOM   7084 C CA  . ARG B 1 442 ? 88.668  -13.547 48.281  1.00 47.78 ? 464 ARG B CA  1 
ATOM   7085 C C   . ARG B 1 442 ? 87.414  -14.065 47.583  1.00 57.56 ? 464 ARG B C   1 
ATOM   7086 O O   . ARG B 1 442 ? 86.662  -13.295 46.978  1.00 61.33 ? 464 ARG B O   1 
ATOM   7087 C CB  . ARG B 1 442 ? 89.887  -14.398 47.916  1.00 46.71 ? 464 ARG B CB  1 
ATOM   7088 C CG  . ARG B 1 442 ? 91.214  -13.658 48.003  1.00 57.12 ? 464 ARG B CG  1 
ATOM   7089 C CD  . ARG B 1 442 ? 91.475  -12.836 46.748  1.00 70.16 ? 464 ARG B CD  1 
ATOM   7090 N NE  . ARG B 1 442 ? 92.446  -11.767 46.977  1.00 64.02 ? 464 ARG B NE  1 
ATOM   7091 C CZ  . ARG B 1 442 ? 92.684  -10.775 46.123  1.00 58.93 ? 464 ARG B CZ  1 
ATOM   7092 N NH1 . ARG B 1 442 ? 92.018  -10.707 44.977  1.00 58.88 ? 464 ARG B NH1 1 
ATOM   7093 N NH2 . ARG B 1 442 ? 93.584  -9.847  46.418  1.00 59.09 ? 464 ARG B NH2 1 
ATOM   7094 N N   . ASP B 1 443 ? 87.171  -15.372 47.664  1.00 53.90 ? 465 ASP B N   1 
ATOM   7095 C CA  . ASP B 1 443 ? 86.095  -16.004 46.899  1.00 61.45 ? 465 ASP B CA  1 
ATOM   7096 C C   . ASP B 1 443 ? 84.797  -16.056 47.711  1.00 50.64 ? 465 ASP B C   1 
ATOM   7097 O O   . ASP B 1 443 ? 84.261  -17.116 48.029  1.00 52.17 ? 465 ASP B O   1 
ATOM   7098 C CB  . ASP B 1 443 ? 86.521  -17.396 46.441  1.00 72.47 ? 465 ASP B CB  1 
ATOM   7099 C CG  . ASP B 1 443 ? 87.306  -17.370 45.137  1.00 74.07 ? 465 ASP B CG  1 
ATOM   7100 O OD1 . ASP B 1 443 ? 87.466  -16.274 44.558  1.00 74.77 ? 465 ASP B OD1 1 
ATOM   7101 O OD2 . ASP B 1 443 ? 87.763  -18.445 44.691  1.00 76.86 ? 465 ASP B OD2 1 
ATOM   7102 N N   . PHE B 1 444 ? 84.292  -14.869 48.041  1.00 49.53 ? 466 PHE B N   1 
ATOM   7103 C CA  . PHE B 1 444 ? 82.968  -14.766 48.638  1.00 40.49 ? 466 PHE B CA  1 
ATOM   7104 C C   . PHE B 1 444 ? 81.906  -14.915 47.549  1.00 43.99 ? 466 PHE B C   1 
ATOM   7105 O O   . PHE B 1 444 ? 82.066  -14.378 46.449  1.00 48.60 ? 466 PHE B O   1 
ATOM   7106 C CB  . PHE B 1 444 ? 82.803  -13.426 49.354  1.00 37.02 ? 466 PHE B CB  1 
ATOM   7107 C CG  . PHE B 1 444 ? 81.641  -13.377 50.312  1.00 33.24 ? 466 PHE B CG  1 
ATOM   7108 C CD1 . PHE B 1 444 ? 81.698  -14.034 51.530  1.00 36.42 ? 466 PHE B CD1 1 
ATOM   7109 C CD2 . PHE B 1 444 ? 80.497  -12.655 50.002  1.00 32.60 ? 466 PHE B CD2 1 
ATOM   7110 C CE1 . PHE B 1 444 ? 80.629  -13.980 52.419  1.00 35.02 ? 466 PHE B CE1 1 
ATOM   7111 C CE2 . PHE B 1 444 ? 79.428  -12.599 50.883  1.00 27.54 ? 466 PHE B CE2 1 
ATOM   7112 C CZ  . PHE B 1 444 ? 79.495  -13.260 52.092  1.00 28.75 ? 466 PHE B CZ  1 
ATOM   7113 N N   . PRO B 1 445 ? 80.818  -15.637 47.824  1.00 41.60 ? 467 PRO B N   1 
ATOM   7114 C CA  . PRO B 1 445 ? 79.846  -15.937 46.758  1.00 40.33 ? 467 PRO B CA  1 
ATOM   7115 C C   . PRO B 1 445 ? 79.136  -14.718 46.196  1.00 39.05 ? 467 PRO B C   1 
ATOM   7116 O O   . PRO B 1 445 ? 78.571  -14.810 45.098  1.00 41.42 ? 467 PRO B O   1 
ATOM   7117 C CB  . PRO B 1 445 ? 78.857  -16.888 47.445  1.00 49.11 ? 467 PRO B CB  1 
ATOM   7118 C CG  . PRO B 1 445 ? 79.004  -16.596 48.908  1.00 43.37 ? 467 PRO B CG  1 
ATOM   7119 C CD  . PRO B 1 445 ? 80.452  -16.270 49.102  1.00 42.25 ? 467 PRO B CD  1 
ATOM   7120 N N   . PHE B 1 446 ? 79.139  -13.589 46.898  1.00 35.65 ? 468 PHE B N   1 
ATOM   7121 C CA  . PHE B 1 446 ? 78.424  -12.400 46.460  1.00 39.70 ? 468 PHE B CA  1 
ATOM   7122 C C   . PHE B 1 446 ? 79.363  -11.202 46.430  1.00 38.10 ? 468 PHE B C   1 
ATOM   7123 O O   . PHE B 1 446 ? 80.505  -11.257 46.894  1.00 39.45 ? 468 PHE B O   1 
ATOM   7124 C CB  . PHE B 1 446 ? 77.226  -12.088 47.372  1.00 39.12 ? 468 PHE B CB  1 
ATOM   7125 C CG  . PHE B 1 446 ? 76.435  -13.295 47.773  1.00 41.19 ? 468 PHE B CG  1 
ATOM   7126 C CD1 . PHE B 1 446 ? 75.544  -13.880 46.891  1.00 39.59 ? 468 PHE B CD1 1 
ATOM   7127 C CD2 . PHE B 1 446 ? 76.577  -13.841 49.036  1.00 38.18 ? 468 PHE B CD2 1 
ATOM   7128 C CE1 . PHE B 1 446 ? 74.810  -14.987 47.262  1.00 40.28 ? 468 PHE B CE1 1 
ATOM   7129 C CE2 . PHE B 1 446 ? 75.847  -14.950 49.410  1.00 41.71 ? 468 PHE B CE2 1 
ATOM   7130 C CZ  . PHE B 1 446 ? 74.962  -15.524 48.521  1.00 41.78 ? 468 PHE B CZ  1 
ATOM   7131 N N   . THR B 1 447 ? 78.856  -10.109 45.868  1.00 39.22 ? 469 THR B N   1 
ATOM   7132 C CA  . THR B 1 447 ? 79.535  -8.824  45.933  1.00 39.68 ? 469 THR B CA  1 
ATOM   7133 C C   . THR B 1 447 ? 79.193  -8.147  47.254  1.00 36.64 ? 469 THR B C   1 
ATOM   7134 O O   . THR B 1 447 ? 78.017  -8.017  47.610  1.00 38.20 ? 469 THR B O   1 
ATOM   7135 C CB  . THR B 1 447 ? 79.120  -7.939  44.755  1.00 40.19 ? 469 THR B CB  1 
ATOM   7136 O OG1 . THR B 1 447 ? 79.802  -8.363  43.569  1.00 43.79 ? 469 THR B OG1 1 
ATOM   7137 C CG2 . THR B 1 447 ? 79.457  -6.480  45.027  1.00 40.27 ? 469 THR B CG2 1 
ATOM   7138 N N   . ILE B 1 448 ? 80.216  -7.731  47.988  1.00 33.13 ? 470 ILE B N   1 
ATOM   7139 C CA  . ILE B 1 448 ? 80.024  -7.089  49.282  1.00 32.33 ? 470 ILE B CA  1 
ATOM   7140 C C   . ILE B 1 448 ? 80.010  -5.582  49.075  1.00 36.27 ? 470 ILE B C   1 
ATOM   7141 O O   . ILE B 1 448 ? 80.979  -5.006  48.568  1.00 35.71 ? 470 ILE B O   1 
ATOM   7142 C CB  . ILE B 1 448 ? 81.122  -7.493  50.277  1.00 30.76 ? 470 ILE B CB  1 
ATOM   7143 C CG1 . ILE B 1 448 ? 81.374  -9.000  50.214  1.00 28.59 ? 470 ILE B CG1 1 
ATOM   7144 C CG2 . ILE B 1 448 ? 80.742  -7.063  51.684  1.00 21.40 ? 470 ILE B CG2 1 
ATOM   7145 C CD1 . ILE B 1 448 ? 82.667  -9.420  50.862  1.00 28.51 ? 470 ILE B CD1 1 
ATOM   7146 N N   . ARG B 1 449 ? 78.916  -4.941  49.475  1.00 37.14 ? 471 ARG B N   1 
ATOM   7147 C CA  . ARG B 1 449 ? 78.778  -3.493  49.391  1.00 37.30 ? 471 ARG B CA  1 
ATOM   7148 C C   . ARG B 1 449 ? 78.456  -2.943  50.771  1.00 34.43 ? 471 ARG B C   1 
ATOM   7149 O O   . ARG B 1 449 ? 77.375  -3.203  51.311  1.00 34.53 ? 471 ARG B O   1 
ATOM   7150 C CB  . ARG B 1 449 ? 77.689  -3.100  48.395  1.00 37.82 ? 471 ARG B CB  1 
ATOM   7151 C CG  . ARG B 1 449 ? 77.392  -1.601  48.357  1.00 54.93 ? 471 ARG B CG  1 
ATOM   7152 C CD  . ARG B 1 449 ? 76.003  -1.314  47.784  1.00 55.68 ? 471 ARG B CD  1 
ATOM   7153 N NE  . ARG B 1 449 ? 75.584  -2.317  46.804  1.00 60.33 ? 471 ARG B NE  1 
ATOM   7154 C CZ  . ARG B 1 449 ? 76.150  -2.500  45.612  1.00 61.38 ? 471 ARG B CZ  1 
ATOM   7155 N NH1 . ARG B 1 449 ? 77.170  -1.745  45.223  1.00 65.96 ? 471 ARG B NH1 1 
ATOM   7156 N NH2 . ARG B 1 449 ? 75.695  -3.450  44.806  1.00 56.05 ? 471 ARG B NH2 1 
ATOM   7157 N N   . VAL B 1 450 ? 79.386  -2.187  51.336  1.00 28.23 ? 472 VAL B N   1 
ATOM   7158 C CA  . VAL B 1 450 ? 79.157  -1.473  52.583  1.00 27.56 ? 472 VAL B CA  1 
ATOM   7159 C C   . VAL B 1 450 ? 78.684  -0.071  52.239  1.00 29.60 ? 472 VAL B C   1 
ATOM   7160 O O   . VAL B 1 450 ? 79.188  0.555   51.298  1.00 32.77 ? 472 VAL B O   1 
ATOM   7161 C CB  . VAL B 1 450 ? 80.427  -1.442  53.455  1.00 26.61 ? 472 VAL B CB  1 
ATOM   7162 C CG1 . VAL B 1 450 ? 80.188  -0.640  54.722  1.00 19.08 ? 472 VAL B CG1 1 
ATOM   7163 C CG2 . VAL B 1 450 ? 80.860  -2.854  53.797  1.00 27.66 ? 472 VAL B CG2 1 
ATOM   7164 N N   . THR B 1 451 ? 77.693  0.411   52.979  1.00 26.96 ? 473 THR B N   1 
ATOM   7165 C CA  . THR B 1 451 ? 77.172  1.763   52.819  1.00 26.61 ? 473 THR B CA  1 
ATOM   7166 C C   . THR B 1 451 ? 77.272  2.454   54.170  1.00 31.58 ? 473 THR B C   1 
ATOM   7167 O O   . THR B 1 451 ? 76.569  2.079   55.115  1.00 36.01 ? 473 THR B O   1 
ATOM   7168 C CB  . THR B 1 451 ? 75.731  1.742   52.311  1.00 27.61 ? 473 THR B CB  1 
ATOM   7169 O OG1 . THR B 1 451 ? 75.713  1.307   50.946  1.00 40.57 ? 473 THR B OG1 1 
ATOM   7170 C CG2 . THR B 1 451 ? 75.112  3.126   52.404  1.00 36.46 ? 473 THR B CG2 1 
ATOM   7171 N N   . SER B 1 452 ? 78.152  3.446   54.269  1.00 29.90 ? 474 SER B N   1 
ATOM   7172 C CA  . SER B 1 452 ? 78.334  4.206   55.499  1.00 31.89 ? 474 SER B CA  1 
ATOM   7173 C C   . SER B 1 452 ? 77.597  5.533   55.360  1.00 36.95 ? 474 SER B C   1 
ATOM   7174 O O   . SER B 1 452 ? 77.966  6.373   54.533  1.00 37.50 ? 474 SER B O   1 
ATOM   7175 C CB  . SER B 1 452 ? 79.814  4.429   55.798  1.00 30.12 ? 474 SER B CB  1 
ATOM   7176 O OG  . SER B 1 452 ? 79.985  5.031   57.072  1.00 31.13 ? 474 SER B OG  1 
ATOM   7177 N N   . GLU B 1 453 ? 76.550  5.710   56.161  1.00 35.84 ? 475 GLU B N   1 
ATOM   7178 C CA  . GLU B 1 453 ? 75.788  6.949   56.206  1.00 32.92 ? 475 GLU B CA  1 
ATOM   7179 C C   . GLU B 1 453 ? 76.216  7.732   57.437  1.00 32.49 ? 475 GLU B C   1 
ATOM   7180 O O   . GLU B 1 453 ? 76.049  7.257   58.565  1.00 37.77 ? 475 GLU B O   1 
ATOM   7181 C CB  . GLU B 1 453 ? 74.286  6.670   56.245  1.00 43.13 ? 475 GLU B CB  1 
ATOM   7182 C CG  . GLU B 1 453 ? 73.633  6.547   54.878  1.00 59.02 ? 475 GLU B CG  1 
ATOM   7183 C CD  . GLU B 1 453 ? 72.228  5.966   54.945  1.00 66.16 ? 475 GLU B CD  1 
ATOM   7184 O OE1 . GLU B 1 453 ? 71.896  5.318   55.962  1.00 60.44 ? 475 GLU B OE1 1 
ATOM   7185 O OE2 . GLU B 1 453 ? 71.457  6.155   53.979  1.00 67.27 ? 475 GLU B OE2 1 
ATOM   7186 N N   . VAL B 1 454 ? 76.768  8.922   57.224  1.00 31.41 ? 476 VAL B N   1 
ATOM   7187 C CA  . VAL B 1 454 ? 77.182  9.777   58.331  1.00 31.50 ? 476 VAL B CA  1 
ATOM   7188 C C   . VAL B 1 454 ? 75.958  10.514  58.859  1.00 37.17 ? 476 VAL B C   1 
ATOM   7189 O O   . VAL B 1 454 ? 75.300  11.253  58.119  1.00 34.08 ? 476 VAL B O   1 
ATOM   7190 C CB  . VAL B 1 454 ? 78.272  10.762  57.892  1.00 33.72 ? 476 VAL B CB  1 
ATOM   7191 C CG1 . VAL B 1 454 ? 78.864  11.469  59.103  1.00 33.03 ? 476 VAL B CG1 1 
ATOM   7192 C CG2 . VAL B 1 454 ? 79.344  10.038  57.107  1.00 33.27 ? 476 VAL B CG2 1 
ATOM   7193 N N   . LEU B 1 455 ? 75.647  10.308  60.139  1.00 39.61 ? 477 LEU B N   1 
ATOM   7194 C CA  . LEU B 1 455 ? 74.515  10.979  60.766  1.00 37.35 ? 477 LEU B CA  1 
ATOM   7195 C C   . LEU B 1 455 ? 74.916  12.283  61.440  1.00 40.38 ? 477 LEU B C   1 
ATOM   7196 O O   . LEU B 1 455 ? 74.104  13.213  61.502  1.00 42.53 ? 477 LEU B O   1 
ATOM   7197 C CB  . LEU B 1 455 ? 73.846  10.047  61.784  1.00 42.03 ? 477 LEU B CB  1 
ATOM   7198 C CG  . LEU B 1 455 ? 73.362  8.690   61.250  1.00 44.44 ? 477 LEU B CG  1 
ATOM   7199 C CD1 . LEU B 1 455 ? 73.354  7.646   62.354  1.00 49.94 ? 477 LEU B CD1 1 
ATOM   7200 C CD2 . LEU B 1 455 ? 71.982  8.788   60.611  1.00 39.11 ? 477 LEU B CD2 1 
ATOM   7201 N N   . GLU B 1 456 ? 76.149  12.372  61.938  1.00 46.78 ? 478 GLU B N   1 
ATOM   7202 C CA  . GLU B 1 456 ? 76.677  13.608  62.503  1.00 45.88 ? 478 GLU B CA  1 
ATOM   7203 C C   . GLU B 1 456 ? 78.185  13.638  62.298  1.00 48.37 ? 478 GLU B C   1 
ATOM   7204 O O   . GLU B 1 456 ? 78.864  12.635  62.537  1.00 47.19 ? 478 GLU B O   1 
ATOM   7205 C CB  . GLU B 1 456 ? 76.338  13.731  63.992  1.00 42.72 ? 478 GLU B CB  1 
ATOM   7206 C CG  . GLU B 1 456 ? 76.716  15.076  64.591  1.00 50.99 ? 478 GLU B CG  1 
ATOM   7207 C CD  . GLU B 1 456 ? 76.415  15.165  66.074  1.00 62.56 ? 478 GLU B CD  1 
ATOM   7208 O OE1 . GLU B 1 456 ? 76.053  14.127  66.673  1.00 63.40 ? 478 GLU B OE1 1 
ATOM   7209 O OE2 . GLU B 1 456 ? 76.547  16.272  66.640  1.00 61.45 ? 478 GLU B OE2 1 
ATOM   7210 N N   . SER B 1 457 ? 78.703  14.786  61.863  1.00 49.54 ? 479 SER B N   1 
ATOM   7211 C CA  . SER B 1 457 ? 80.119  14.961  61.564  1.00 39.85 ? 479 SER B CA  1 
ATOM   7212 C C   . SER B 1 457 ? 80.769  15.858  62.608  1.00 39.55 ? 479 SER B C   1 
ATOM   7213 O O   . SER B 1 457 ? 80.240  16.929  62.925  1.00 46.02 ? 479 SER B O   1 
ATOM   7214 C CB  . SER B 1 457 ? 80.312  15.570  60.174  1.00 37.38 ? 479 SER B CB  1 
ATOM   7215 O OG  . SER B 1 457 ? 80.305  14.572  59.170  1.00 52.17 ? 479 SER B OG  1 
ATOM   7216 N N   . ASN B 1 458 ? 81.918  15.425  63.133  1.00 35.49 ? 480 ASN B N   1 
ATOM   7217 C CA  . ASN B 1 458 ? 82.725  16.270  64.009  1.00 35.50 ? 480 ASN B CA  1 
ATOM   7218 C C   . ASN B 1 458 ? 84.167  15.781  64.073  1.00 31.28 ? 480 ASN B C   1 
ATOM   7219 O O   . ASN B 1 458 ? 84.800  15.831  65.132  1.00 34.72 ? 480 ASN B O   1 
ATOM   7220 C CB  . ASN B 1 458 ? 82.129  16.336  65.418  1.00 32.74 ? 480 ASN B CB  1 
ATOM   7221 C CG  . ASN B 1 458 ? 82.693  17.495  66.240  1.00 30.57 ? 480 ASN B CG  1 
ATOM   7222 O OD1 . ASN B 1 458 ? 82.680  17.463  67.471  1.00 31.02 ? 480 ASN B OD1 1 
ATOM   7223 N ND2 . ASN B 1 458 ? 83.200  18.515  65.557  1.00 28.56 ? 480 ASN B ND2 1 
ATOM   7224 N N   . GLY B 1 459 ? 84.699  15.310  62.951  1.00 32.99 ? 481 GLY B N   1 
ATOM   7225 C CA  . GLY B 1 459 ? 86.092  14.919  62.912  1.00 29.62 ? 481 GLY B CA  1 
ATOM   7226 C C   . GLY B 1 459 ? 86.337  13.520  62.388  1.00 32.15 ? 481 GLY B C   1 
ATOM   7227 O O   . GLY B 1 459 ? 86.169  12.539  63.117  1.00 34.34 ? 481 GLY B O   1 
ATOM   7228 N N   . SER B 1 460 ? 86.731  13.429  61.119  1.00 36.74 ? 482 SER B N   1 
ATOM   7229 C CA  . SER B 1 460 ? 87.163  12.186  60.480  1.00 38.51 ? 482 SER B CA  1 
ATOM   7230 C C   . SER B 1 460 ? 86.128  11.070  60.651  1.00 35.37 ? 482 SER B C   1 
ATOM   7231 O O   . SER B 1 460 ? 86.319  10.095  61.379  1.00 29.40 ? 482 SER B O   1 
ATOM   7232 C CB  . SER B 1 460 ? 88.524  11.743  61.017  1.00 33.87 ? 482 SER B CB  1 
ATOM   7233 O OG  . SER B 1 460 ? 89.015  10.649  60.264  1.00 32.57 ? 482 SER B OG  1 
ATOM   7234 N N   . SER B 1 461 ? 85.019  11.245  59.938  1.00 38.67 ? 483 SER B N   1 
ATOM   7235 C CA  . SER B 1 461 ? 84.000  10.210  59.876  1.00 32.49 ? 483 SER B CA  1 
ATOM   7236 C C   . SER B 1 461 ? 84.381  9.071   58.942  1.00 29.21 ? 483 SER B C   1 
ATOM   7237 O O   . SER B 1 461 ? 83.698  8.041   58.938  1.00 29.46 ? 483 SER B O   1 
ATOM   7238 C CB  . SER B 1 461 ? 82.667  10.818  59.440  1.00 34.03 ? 483 SER B CB  1 
ATOM   7239 O OG  . SER B 1 461 ? 82.881  11.856  58.503  1.00 33.25 ? 483 SER B OG  1 
ATOM   7240 N N   . SER B 1 462 ? 85.448  9.230   58.154  1.00 24.95 ? 484 SER B N   1 
ATOM   7241 C CA  . SER B 1 462 ? 85.904  8.130   57.314  1.00 23.92 ? 484 SER B CA  1 
ATOM   7242 C C   . SER B 1 462 ? 86.547  7.031   58.152  1.00 24.96 ? 484 SER B C   1 
ATOM   7243 O O   . SER B 1 462 ? 86.336  5.841   57.890  1.00 23.60 ? 484 SER B O   1 
ATOM   7244 C CB  . SER B 1 462 ? 86.875  8.644   56.253  1.00 17.27 ? 484 SER B CB  1 
ATOM   7245 O OG  . SER B 1 462 ? 87.914  9.391   56.848  1.00 28.79 ? 484 SER B OG  1 
ATOM   7246 N N   . MET B 1 463 ? 87.334  7.403   59.164  1.00 22.91 ? 485 MET B N   1 
ATOM   7247 C CA  . MET B 1 463 ? 87.856  6.392   60.076  1.00 20.48 ? 485 MET B CA  1 
ATOM   7248 C C   . MET B 1 463 ? 86.728  5.745   60.865  1.00 22.80 ? 485 MET B C   1 
ATOM   7249 O O   . MET B 1 463 ? 86.741  4.530   61.094  1.00 21.04 ? 485 MET B O   1 
ATOM   7250 C CB  . MET B 1 463 ? 88.902  7.004   61.009  1.00 20.67 ? 485 MET B CB  1 
ATOM   7251 C CG  . MET B 1 463 ? 90.109  7.599   60.282  1.00 20.72 ? 485 MET B CG  1 
ATOM   7252 S SD  . MET B 1 463 ? 91.252  6.357   59.642  1.00 29.79 ? 485 MET B SD  1 
ATOM   7253 C CE  . MET B 1 463 ? 90.625  6.087   57.981  1.00 17.74 ? 485 MET B CE  1 
ATOM   7254 N N   . ALA B 1 464 ? 85.732  6.540   61.269  1.00 25.28 ? 486 ALA B N   1 
ATOM   7255 C CA  . ALA B 1 464 ? 84.530  5.964   61.862  1.00 28.17 ? 486 ALA B CA  1 
ATOM   7256 C C   . ALA B 1 464 ? 83.849  4.994   60.906  1.00 22.72 ? 486 ALA B C   1 
ATOM   7257 O O   . ALA B 1 464 ? 83.294  3.980   61.340  1.00 22.77 ? 486 ALA B O   1 
ATOM   7258 C CB  . ALA B 1 464 ? 83.561  7.073   62.273  1.00 28.78 ? 486 ALA B CB  1 
ATOM   7259 N N   . SER B 1 465 ? 83.894  5.277   59.604  1.00 21.46 ? 487 SER B N   1 
ATOM   7260 C CA  . SER B 1 465 ? 83.280  4.380   58.632  1.00 24.83 ? 487 SER B CA  1 
ATOM   7261 C C   . SER B 1 465 ? 84.010  3.044   58.567  1.00 22.34 ? 487 SER B C   1 
ATOM   7262 O O   . SER B 1 465 ? 83.379  1.995   58.396  1.00 23.80 ? 487 SER B O   1 
ATOM   7263 C CB  . SER B 1 465 ? 83.244  5.045   57.257  1.00 26.30 ? 487 SER B CB  1 
ATOM   7264 O OG  . SER B 1 465 ? 82.389  6.177   57.278  1.00 34.69 ? 487 SER B OG  1 
ATOM   7265 N N   . ALA B 1 466 ? 85.339  3.058   58.695  1.00 24.19 ? 488 ALA B N   1 
ATOM   7266 C CA  . ALA B 1 466 ? 86.081  1.802   58.711  1.00 19.35 ? 488 ALA B CA  1 
ATOM   7267 C C   . ALA B 1 466 ? 85.767  1.003   59.966  1.00 22.57 ? 488 ALA B C   1 
ATOM   7268 O O   . ALA B 1 466 ? 85.649  -0.227  59.912  1.00 22.28 ? 488 ALA B O   1 
ATOM   7269 C CB  . ALA B 1 466 ? 87.581  2.072   58.603  1.00 22.04 ? 488 ALA B CB  1 
ATOM   7270 N N   . CYS B 1 467 ? 85.620  1.686   61.104  1.00 21.51 ? 489 CYS B N   1 
ATOM   7271 C CA  . CYS B 1 467 ? 85.194  1.016   62.329  1.00 22.07 ? 489 CYS B CA  1 
ATOM   7272 C C   . CYS B 1 467 ? 83.809  0.402   62.156  1.00 26.22 ? 489 CYS B C   1 
ATOM   7273 O O   . CYS B 1 467 ? 83.624  -0.810  62.318  1.00 30.64 ? 489 CYS B O   1 
ATOM   7274 C CB  . CYS B 1 467 ? 85.205  2.005   63.497  1.00 21.83 ? 489 CYS B CB  1 
ATOM   7275 S SG  . CYS B 1 467 ? 86.849  2.636   63.969  1.00 27.98 ? 489 CYS B SG  1 
ATOM   7276 N N   . GLY B 1 468 ? 82.819  1.232   61.817  1.00 21.61 ? 490 GLY B N   1 
ATOM   7277 C CA  . GLY B 1 468 ? 81.474  0.725   61.610  1.00 22.53 ? 490 GLY B CA  1 
ATOM   7278 C C   . GLY B 1 468 ? 81.386  -0.284  60.483  1.00 27.19 ? 490 GLY B C   1 
ATOM   7279 O O   . GLY B 1 468 ? 80.565  -1.205  60.531  1.00 28.35 ? 490 GLY B O   1 
ATOM   7280 N N   . GLY B 1 469 ? 82.223  -0.128  59.457  1.00 23.96 ? 491 GLY B N   1 
ATOM   7281 C CA  . GLY B 1 469 ? 82.245  -1.105  58.384  1.00 23.38 ? 491 GLY B CA  1 
ATOM   7282 C C   . GLY B 1 469 ? 82.710  -2.469  58.857  1.00 32.73 ? 491 GLY B C   1 
ATOM   7283 O O   . GLY B 1 469 ? 82.149  -3.496  58.465  1.00 31.81 ? 491 GLY B O   1 
ATOM   7284 N N   . SER B 1 470 ? 83.739  -2.499  59.710  1.00 28.85 ? 492 SER B N   1 
ATOM   7285 C CA  . SER B 1 470 ? 84.192  -3.769  60.267  1.00 24.90 ? 492 SER B CA  1 
ATOM   7286 C C   . SER B 1 470 ? 83.082  -4.444  61.061  1.00 30.16 ? 492 SER B C   1 
ATOM   7287 O O   . SER B 1 470 ? 82.918  -5.668  60.995  1.00 29.80 ? 492 SER B O   1 
ATOM   7288 C CB  . SER B 1 470 ? 85.422  -3.553  61.148  1.00 25.77 ? 492 SER B CB  1 
ATOM   7289 O OG  . SER B 1 470 ? 85.488  -4.534  62.172  1.00 26.95 ? 492 SER B OG  1 
ATOM   7290 N N   . LEU B 1 471 ? 82.302  -3.660  61.809  1.00 27.52 ? 493 LEU B N   1 
ATOM   7291 C CA  . LEU B 1 471 ? 81.228  -4.234  62.613  1.00 29.81 ? 493 LEU B CA  1 
ATOM   7292 C C   . LEU B 1 471 ? 80.121  -4.793  61.732  1.00 31.47 ? 493 LEU B C   1 
ATOM   7293 O O   . LEU B 1 471 ? 79.641  -5.912  61.954  1.00 32.84 ? 493 LEU B O   1 
ATOM   7294 C CB  . LEU B 1 471 ? 80.665  -3.186  63.572  1.00 27.11 ? 493 LEU B CB  1 
ATOM   7295 C CG  . LEU B 1 471 ? 81.599  -2.591  64.619  1.00 27.66 ? 493 LEU B CG  1 
ATOM   7296 C CD1 . LEU B 1 471 ? 80.922  -1.412  65.288  1.00 24.72 ? 493 LEU B CD1 1 
ATOM   7297 C CD2 . LEU B 1 471 ? 81.997  -3.643  65.642  1.00 30.62 ? 493 LEU B CD2 1 
ATOM   7298 N N   . ALA B 1 472 ? 79.695  -4.022  60.728  1.00 29.56 ? 494 ALA B N   1 
ATOM   7299 C CA  . ALA B 1 472 ? 78.609  -4.472  59.865  1.00 23.71 ? 494 ALA B CA  1 
ATOM   7300 C C   . ALA B 1 472 ? 79.036  -5.645  58.997  1.00 23.00 ? 494 ALA B C   1 
ATOM   7301 O O   . ALA B 1 472 ? 78.197  -6.467  58.615  1.00 28.07 ? 494 ALA B O   1 
ATOM   7302 C CB  . ALA B 1 472 ? 78.111  -3.316  58.998  1.00 25.32 ? 494 ALA B CB  1 
ATOM   7303 N N   . LEU B 1 473 ? 80.327  -5.744  58.679  1.00 27.14 ? 495 LEU B N   1 
ATOM   7304 C CA  . LEU B 1 473 ? 80.812  -6.894  57.924  1.00 29.64 ? 495 LEU B CA  1 
ATOM   7305 C C   . LEU B 1 473 ? 80.718  -8.174  58.747  1.00 26.44 ? 495 LEU B C   1 
ATOM   7306 O O   . LEU B 1 473 ? 80.265  -9.210  58.245  1.00 27.05 ? 495 LEU B O   1 
ATOM   7307 C CB  . LEU B 1 473 ? 82.247  -6.645  57.463  1.00 24.80 ? 495 LEU B CB  1 
ATOM   7308 C CG  . LEU B 1 473 ? 82.373  -5.767  56.219  1.00 20.70 ? 495 LEU B CG  1 
ATOM   7309 C CD1 . LEU B 1 473 ? 83.755  -5.140  56.117  1.00 22.32 ? 495 LEU B CD1 1 
ATOM   7310 C CD2 . LEU B 1 473 ? 82.062  -6.584  54.986  1.00 27.18 ? 495 LEU B CD2 1 
ATOM   7311 N N   . MET B 1 474 ? 81.137  -8.122  60.016  1.00 30.06 ? 496 MET B N   1 
ATOM   7312 C CA  . MET B 1 474 ? 81.015  -9.288  60.887  1.00 35.39 ? 496 MET B CA  1 
ATOM   7313 C C   . MET B 1 474 ? 79.552  -9.649  61.125  1.00 37.01 ? 496 MET B C   1 
ATOM   7314 O O   . MET B 1 474 ? 79.178  -10.827 61.071  1.00 36.54 ? 496 MET B O   1 
ATOM   7315 C CB  . MET B 1 474 ? 81.724  -9.029  62.219  1.00 30.02 ? 496 MET B CB  1 
ATOM   7316 C CG  . MET B 1 474 ? 83.240  -9.131  62.162  1.00 26.98 ? 496 MET B CG  1 
ATOM   7317 S SD  . MET B 1 474 ? 84.015  -8.621  63.711  1.00 38.11 ? 496 MET B SD  1 
ATOM   7318 C CE  . MET B 1 474 ? 85.708  -9.123  63.414  1.00 29.22 ? 496 MET B CE  1 
ATOM   7319 N N   . ASP B 1 475 ? 78.710  -8.646  61.383  1.00 31.02 ? 497 ASP B N   1 
ATOM   7320 C CA  . ASP B 1 475 ? 77.292  -8.890  61.626  1.00 30.60 ? 497 ASP B CA  1 
ATOM   7321 C C   . ASP B 1 475 ? 76.611  -9.564  60.444  1.00 30.47 ? 497 ASP B C   1 
ATOM   7322 O O   . ASP B 1 475 ? 75.596  -10.244 60.632  1.00 33.53 ? 497 ASP B O   1 
ATOM   7323 C CB  . ASP B 1 475 ? 76.586  -7.573  61.955  1.00 33.82 ? 497 ASP B CB  1 
ATOM   7324 C CG  . ASP B 1 475 ? 75.099  -7.749  62.172  1.00 36.26 ? 497 ASP B CG  1 
ATOM   7325 O OD1 . ASP B 1 475 ? 74.721  -8.692  62.898  1.00 42.39 ? 497 ASP B OD1 1 
ATOM   7326 O OD2 . ASP B 1 475 ? 74.308  -6.951  61.622  1.00 40.07 ? 497 ASP B OD2 1 
ATOM   7327 N N   . SER B 1 476 ? 77.145  -9.393  59.235  1.00 33.59 ? 498 SER B N   1 
ATOM   7328 C CA  . SER B 1 476 ? 76.549  -9.947  58.028  1.00 34.93 ? 498 SER B CA  1 
ATOM   7329 C C   . SER B 1 476 ? 77.003  -11.368 57.738  1.00 37.57 ? 498 SER B C   1 
ATOM   7330 O O   . SER B 1 476 ? 76.377  -12.047 56.918  1.00 43.59 ? 498 SER B O   1 
ATOM   7331 C CB  . SER B 1 476 ? 76.876  -9.060  56.825  1.00 27.76 ? 498 SER B CB  1 
ATOM   7332 O OG  . SER B 1 476 ? 78.277  -8.910  56.685  1.00 32.67 ? 498 SER B OG  1 
ATOM   7333 N N   . GLY B 1 477 ? 78.065  -11.833 58.385  1.00 32.35 ? 499 GLY B N   1 
ATOM   7334 C CA  . GLY B 1 477 ? 78.579  -13.160 58.145  1.00 32.59 ? 499 GLY B CA  1 
ATOM   7335 C C   . GLY B 1 477 ? 79.800  -13.215 57.261  1.00 31.22 ? 499 GLY B C   1 
ATOM   7336 O O   . GLY B 1 477 ? 80.291  -14.316 56.985  1.00 41.92 ? 499 GLY B O   1 
ATOM   7337 N N   . VAL B 1 478 ? 80.304  -12.071 56.810  1.00 30.19 ? 500 VAL B N   1 
ATOM   7338 C CA  . VAL B 1 478 ? 81.502  -12.027 55.975  1.00 34.25 ? 500 VAL B CA  1 
ATOM   7339 C C   . VAL B 1 478 ? 82.698  -12.467 56.813  1.00 31.91 ? 500 VAL B C   1 
ATOM   7340 O O   . VAL B 1 478 ? 83.000  -11.846 57.843  1.00 33.30 ? 500 VAL B O   1 
ATOM   7341 C CB  . VAL B 1 478 ? 81.717  -10.627 55.378  1.00 32.52 ? 500 VAL B CB  1 
ATOM   7342 C CG1 . VAL B 1 478 ? 83.014  -10.579 54.586  1.00 31.33 ? 500 VAL B CG1 1 
ATOM   7343 C CG2 . VAL B 1 478 ? 80.541  -10.238 54.496  1.00 26.76 ? 500 VAL B CG2 1 
ATOM   7344 N N   . PRO B 1 479 ? 83.400  -13.524 56.422  1.00 29.17 ? 501 PRO B N   1 
ATOM   7345 C CA  . PRO B 1 479 ? 84.549  -14.006 57.221  1.00 32.36 ? 501 PRO B CA  1 
ATOM   7346 C C   . PRO B 1 479 ? 85.793  -13.140 57.054  1.00 33.10 ? 501 PRO B C   1 
ATOM   7347 O O   . PRO B 1 479 ? 86.799  -13.536 56.455  1.00 34.77 ? 501 PRO B O   1 
ATOM   7348 C CB  . PRO B 1 479 ? 84.746  -15.427 56.685  1.00 36.05 ? 501 PRO B CB  1 
ATOM   7349 C CG  . PRO B 1 479 ? 84.275  -15.362 55.272  1.00 36.59 ? 501 PRO B CG  1 
ATOM   7350 C CD  . PRO B 1 479 ? 83.135  -14.376 55.249  1.00 32.45 ? 501 PRO B CD  1 
ATOM   7351 N N   . ILE B 1 480 ? 85.744  -11.923 57.601  1.00 30.00 ? 502 ILE B N   1 
ATOM   7352 C CA  . ILE B 1 480 ? 86.908  -11.047 57.531  1.00 30.28 ? 502 ILE B CA  1 
ATOM   7353 C C   . ILE B 1 480 ? 87.999  -11.574 58.457  1.00 34.21 ? 502 ILE B C   1 
ATOM   7354 O O   . ILE B 1 480 ? 87.725  -12.160 59.515  1.00 41.21 ? 502 ILE B O   1 
ATOM   7355 C CB  . ILE B 1 480 ? 86.542  -9.589  57.871  1.00 34.58 ? 502 ILE B CB  1 
ATOM   7356 C CG1 . ILE B 1 480 ? 86.012  -9.466  59.300  1.00 27.41 ? 502 ILE B CG1 1 
ATOM   7357 C CG2 . ILE B 1 480 ? 85.531  -9.042  56.872  1.00 33.06 ? 502 ILE B CG2 1 
ATOM   7358 C CD1 . ILE B 1 480 ? 85.849  -8.034  59.753  1.00 23.57 ? 502 ILE B CD1 1 
ATOM   7359 N N   . SER B 1 481 ? 89.256  -11.374 58.051  1.00 30.58 ? 503 SER B N   1 
ATOM   7360 C CA  . SER B 1 481 ? 90.365  -11.965 58.794  1.00 29.08 ? 503 SER B CA  1 
ATOM   7361 C C   . SER B 1 481 ? 90.529  -11.333 60.171  1.00 33.06 ? 503 SER B C   1 
ATOM   7362 O O   . SER B 1 481 ? 90.951  -12.011 61.114  1.00 36.99 ? 503 SER B O   1 
ATOM   7363 C CB  . SER B 1 481 ? 91.661  -11.839 57.995  1.00 27.55 ? 503 SER B CB  1 
ATOM   7364 O OG  . SER B 1 481 ? 92.162  -10.517 58.043  1.00 32.11 ? 503 SER B OG  1 
ATOM   7365 N N   . SER B 1 482 ? 90.199  -10.052 60.311  1.00 35.72 ? 504 SER B N   1 
ATOM   7366 C CA  . SER B 1 482 ? 90.343  -9.362  61.586  1.00 34.70 ? 504 SER B CA  1 
ATOM   7367 C C   . SER B 1 482 ? 89.499  -8.094  61.563  1.00 33.02 ? 504 SER B C   1 
ATOM   7368 O O   . SER B 1 482 ? 89.111  -7.603  60.501  1.00 40.49 ? 504 SER B O   1 
ATOM   7369 C CB  . SER B 1 482 ? 91.812  -9.032  61.878  1.00 30.47 ? 504 SER B CB  1 
ATOM   7370 O OG  . SER B 1 482 ? 91.965  -8.495  63.180  1.00 40.06 ? 504 SER B OG  1 
ATOM   7371 N N   . ALA B 1 483 ? 89.216  -7.574  62.753  1.00 23.63 ? 505 ALA B N   1 
ATOM   7372 C CA  . ALA B 1 483 ? 88.493  -6.316  62.871  1.00 24.98 ? 505 ALA B CA  1 
ATOM   7373 C C   . ALA B 1 483 ? 89.436  -5.149  62.615  1.00 29.57 ? 505 ALA B C   1 
ATOM   7374 O O   . ALA B 1 483 ? 90.607  -5.180  63.006  1.00 38.06 ? 505 ALA B O   1 
ATOM   7375 C CB  . ALA B 1 483 ? 87.856  -6.184  64.254  1.00 23.67 ? 505 ALA B CB  1 
ATOM   7376 N N   . VAL B 1 484 ? 88.922  -4.118  61.951  1.00 27.88 ? 506 VAL B N   1 
ATOM   7377 C CA  . VAL B 1 484 ? 89.707  -2.940  61.606  1.00 26.06 ? 506 VAL B CA  1 
ATOM   7378 C C   . VAL B 1 484 ? 89.142  -1.733  62.342  1.00 27.51 ? 506 VAL B C   1 
ATOM   7379 O O   . VAL B 1 484 ? 87.933  -1.632  62.586  1.00 30.80 ? 506 VAL B O   1 
ATOM   7380 C CB  . VAL B 1 484 ? 89.725  -2.692  60.082  1.00 26.98 ? 506 VAL B CB  1 
ATOM   7381 C CG1 . VAL B 1 484 ? 90.826  -1.712  59.716  1.00 30.82 ? 506 VAL B CG1 1 
ATOM   7382 C CG2 . VAL B 1 484 ? 89.913  -4.002  59.333  1.00 23.25 ? 506 VAL B CG2 1 
ATOM   7383 N N   . ALA B 1 485 ? 90.033  -0.812  62.702  1.00 20.43 ? 507 ALA B N   1 
ATOM   7384 C CA  . ALA B 1 485 ? 89.639  0.434   63.337  1.00 17.50 ? 507 ALA B CA  1 
ATOM   7385 C C   . ALA B 1 485 ? 90.557  1.546   62.852  1.00 25.25 ? 507 ALA B C   1 
ATOM   7386 O O   . ALA B 1 485 ? 91.705  1.301   62.468  1.00 25.39 ? 507 ALA B O   1 
ATOM   7387 C CB  . ALA B 1 485 ? 89.690  0.331   64.865  1.00 20.40 ? 507 ALA B CB  1 
ATOM   7388 N N   . GLY B 1 486 ? 90.041  2.774   62.875  1.00 21.11 ? 508 GLY B N   1 
ATOM   7389 C CA  . GLY B 1 486 ? 90.818  3.923   62.459  1.00 19.86 ? 508 GLY B CA  1 
ATOM   7390 C C   . GLY B 1 486 ? 90.619  5.095   63.400  1.00 22.91 ? 508 GLY B C   1 
ATOM   7391 O O   . GLY B 1 486 ? 89.646  5.166   64.156  1.00 28.99 ? 508 GLY B O   1 
ATOM   7392 N N   . VAL B 1 487 ? 91.567  6.027   63.332  1.00 14.96 ? 509 VAL B N   1 
ATOM   7393 C CA  . VAL B 1 487 ? 91.551  7.225   64.161  1.00 16.07 ? 509 VAL B CA  1 
ATOM   7394 C C   . VAL B 1 487 ? 92.326  8.303   63.420  1.00 20.16 ? 509 VAL B C   1 
ATOM   7395 O O   . VAL B 1 487 ? 93.174  8.013   62.572  1.00 22.65 ? 509 VAL B O   1 
ATOM   7396 C CB  . VAL B 1 487 ? 92.157  6.964   65.562  1.00 17.58 ? 509 VAL B CB  1 
ATOM   7397 C CG1 . VAL B 1 487 ? 93.667  6.796   65.469  1.00 16.52 ? 509 VAL B CG1 1 
ATOM   7398 C CG2 . VAL B 1 487 ? 91.791  8.081   66.538  1.00 17.55 ? 509 VAL B CG2 1 
ATOM   7399 N N   . ALA B 1 488 ? 92.017  9.559   63.725  1.00 13.93 ? 510 ALA B N   1 
ATOM   7400 C CA  . ALA B 1 488 ? 92.730  10.692  63.157  1.00 14.54 ? 510 ALA B CA  1 
ATOM   7401 C C   . ALA B 1 488 ? 93.517  11.390  64.259  1.00 22.72 ? 510 ALA B C   1 
ATOM   7402 O O   . ALA B 1 488 ? 92.973  11.686  65.329  1.00 23.26 ? 510 ALA B O   1 
ATOM   7403 C CB  . ALA B 1 488 ? 91.765  11.667  62.480  1.00 14.57 ? 510 ALA B CB  1 
ATOM   7404 N N   . ILE B 1 489 ? 94.796  11.644  63.998  1.00 19.08 ? 511 ILE B N   1 
ATOM   7405 C CA  . ILE B 1 489 ? 95.683  12.309  64.944  1.00 17.39 ? 511 ILE B CA  1 
ATOM   7406 C C   . ILE B 1 489 ? 95.934  13.728  64.452  1.00 22.11 ? 511 ILE B C   1 
ATOM   7407 O O   . ILE B 1 489 ? 96.246  13.939  63.273  1.00 20.92 ? 511 ILE B O   1 
ATOM   7408 C CB  . ILE B 1 489 ? 97.003  11.538  65.108  1.00 18.90 ? 511 ILE B CB  1 
ATOM   7409 C CG1 . ILE B 1 489 ? 96.724  10.079  65.464  1.00 22.56 ? 511 ILE B CG1 1 
ATOM   7410 C CG2 . ILE B 1 489 ? 97.872  12.188  66.169  1.00 17.03 ? 511 ILE B CG2 1 
ATOM   7411 C CD1 . ILE B 1 489 ? 96.189  9.889   66.865  1.00 23.46 ? 511 ILE B CD1 1 
ATOM   7412 N N   . GLY B 1 490 ? 95.786  14.702  65.352  1.00 20.99 ? 512 GLY B N   1 
ATOM   7413 C CA  . GLY B 1 490 ? 96.034  16.089  65.033  1.00 15.73 ? 512 GLY B CA  1 
ATOM   7414 C C   . GLY B 1 490 ? 97.387  16.562  65.542  1.00 17.79 ? 512 GLY B C   1 
ATOM   7415 O O   . GLY B 1 490 ? 98.149  15.831  66.170  1.00 21.52 ? 512 GLY B O   1 
ATOM   7416 N N   . LEU B 1 491 ? 97.672  17.832  65.265  1.00 15.54 ? 513 LEU B N   1 
ATOM   7417 C CA  . LEU B 1 491 ? 98.974  18.398  65.582  1.00 17.47 ? 513 LEU B CA  1 
ATOM   7418 C C   . LEU B 1 491 ? 98.827  19.893  65.807  1.00 19.31 ? 513 LEU B C   1 
ATOM   7419 O O   . LEU B 1 491 ? 98.175  20.577  65.014  1.00 20.14 ? 513 LEU B O   1 
ATOM   7420 C CB  . LEU B 1 491 ? 99.974  18.117  64.454  1.00 20.79 ? 513 LEU B CB  1 
ATOM   7421 C CG  . LEU B 1 491 ? 101.382 18.690  64.596  1.00 18.96 ? 513 LEU B CG  1 
ATOM   7422 C CD1 . LEU B 1 491 ? 101.999 18.253  65.910  1.00 23.27 ? 513 LEU B CD1 1 
ATOM   7423 C CD2 . LEU B 1 491 ? 102.234 18.242  63.427  1.00 24.65 ? 513 LEU B CD2 1 
ATOM   7424 N N   . VAL B 1 492 ? 99.429  20.391  66.886  1.00 17.93 ? 514 VAL B N   1 
ATOM   7425 C CA  . VAL B 1 492 ? 99.453  21.816  67.199  1.00 19.74 ? 514 VAL B CA  1 
ATOM   7426 C C   . VAL B 1 492 ? 100.895 22.182  67.511  1.00 22.66 ? 514 VAL B C   1 
ATOM   7427 O O   . VAL B 1 492 ? 101.431 21.772  68.549  1.00 28.36 ? 514 VAL B O   1 
ATOM   7428 C CB  . VAL B 1 492 ? 98.537  22.177  68.375  1.00 18.54 ? 514 VAL B CB  1 
ATOM   7429 C CG1 . VAL B 1 492 ? 98.698  23.649  68.728  1.00 17.70 ? 514 VAL B CG1 1 
ATOM   7430 C CG2 . VAL B 1 492 ? 97.091  21.847  68.049  1.00 14.49 ? 514 VAL B CG2 1 
ATOM   7431 N N   . THR B 1 493 ? 101.521 22.954  66.631  1.00 20.92 ? 515 THR B N   1 
ATOM   7432 C CA  . THR B 1 493 ? 102.932 23.288  66.748  1.00 20.89 ? 515 THR B CA  1 
ATOM   7433 C C   . THR B 1 493 ? 103.106 24.738  67.172  1.00 22.85 ? 515 THR B C   1 
ATOM   7434 O O   . THR B 1 493 ? 102.179 25.551  67.121  1.00 24.59 ? 515 THR B O   1 
ATOM   7435 C CB  . THR B 1 493 ? 103.669 23.045  65.426  1.00 24.34 ? 515 THR B CB  1 
ATOM   7436 O OG1 . THR B 1 493 ? 103.016 23.768  64.373  1.00 22.95 ? 515 THR B OG1 1 
ATOM   7437 C CG2 . THR B 1 493 ? 103.698 21.560  65.086  1.00 24.17 ? 515 THR B CG2 1 
ATOM   7438 N N   . LYS B 1 494 ? 104.330 25.049  67.591  1.00 30.17 ? 516 LYS B N   1 
ATOM   7439 C CA  . LYS B 1 494 ? 104.743 26.406  67.935  1.00 36.20 ? 516 LYS B CA  1 
ATOM   7440 C C   . LYS B 1 494 ? 105.986 26.721  67.113  1.00 35.19 ? 516 LYS B C   1 
ATOM   7441 O O   . LYS B 1 494 ? 107.060 26.173  67.375  1.00 39.50 ? 516 LYS B O   1 
ATOM   7442 C CB  . LYS B 1 494 ? 105.016 26.537  69.435  1.00 33.40 ? 516 LYS B CB  1 
ATOM   7443 C CG  . LYS B 1 494 ? 105.685 27.836  69.851  1.00 36.97 ? 516 LYS B CG  1 
ATOM   7444 C CD  . LYS B 1 494 ? 106.750 27.589  70.910  1.00 47.78 ? 516 LYS B CD  1 
ATOM   7445 C CE  . LYS B 1 494 ? 107.607 28.828  71.138  1.00 61.84 ? 516 LYS B CE  1 
ATOM   7446 N NZ  . LYS B 1 494 ? 108.888 28.514  71.837  1.00 53.22 ? 516 LYS B NZ  1 
ATOM   7447 N N   . THR B 1 495 ? 105.840 27.580  66.111  1.00 38.51 ? 517 THR B N   1 
ATOM   7448 C CA  . THR B 1 495 ? 106.952 27.911  65.226  1.00 44.57 ? 517 THR B CA  1 
ATOM   7449 C C   . THR B 1 495 ? 107.349 29.377  65.354  1.00 47.42 ? 517 THR B C   1 
ATOM   7450 O O   . THR B 1 495 ? 106.852 30.229  64.617  1.00 55.13 ? 517 THR B O   1 
ATOM   7451 C CB  . THR B 1 495 ? 106.608 27.613  63.756  1.00 49.24 ? 517 THR B CB  1 
ATOM   7452 O OG1 . THR B 1 495 ? 105.691 28.603  63.269  1.00 48.46 ? 517 THR B OG1 1 
ATOM   7453 C CG2 . THR B 1 495 ? 105.985 26.230  63.624  1.00 37.30 ? 517 THR B CG2 1 
ATOM   7454 N N   . ILE B 1 502 ? 110.128 24.529  64.397  1.00 23.68 ? 524 ILE B N   1 
ATOM   7455 C CA  . ILE B 1 502 ? 109.230 23.940  65.389  1.00 37.64 ? 524 ILE B CA  1 
ATOM   7456 C C   . ILE B 1 502 ? 109.887 23.837  66.764  1.00 41.54 ? 524 ILE B C   1 
ATOM   7457 O O   . ILE B 1 502 ? 110.690 22.936  67.020  1.00 34.91 ? 524 ILE B O   1 
ATOM   7458 C CB  . ILE B 1 502 ? 108.735 22.548  64.954  1.00 32.67 ? 524 ILE B CB  1 
ATOM   7459 C CG1 . ILE B 1 502 ? 108.237 22.567  63.513  1.00 35.29 ? 524 ILE B CG1 1 
ATOM   7460 C CG2 . ILE B 1 502 ? 107.626 22.070  65.879  1.00 33.46 ? 524 ILE B CG2 1 
ATOM   7461 C CD1 . ILE B 1 502 ? 107.503 21.297  63.124  1.00 30.21 ? 524 ILE B CD1 1 
ATOM   7462 N N   . GLU B 1 503 ? 109.519 24.756  67.658  1.00 38.62 ? 525 GLU B N   1 
ATOM   7463 C CA  . GLU B 1 503 ? 110.075 24.770  69.004  1.00 30.25 ? 525 GLU B CA  1 
ATOM   7464 C C   . GLU B 1 503 ? 109.340 23.840  69.960  1.00 35.14 ? 525 GLU B C   1 
ATOM   7465 O O   . GLU B 1 503 ? 109.879 23.524  71.026  1.00 38.44 ? 525 GLU B O   1 
ATOM   7466 C CB  . GLU B 1 503 ? 110.057 26.196  69.566  1.00 45.39 ? 525 GLU B CB  1 
ATOM   7467 C CG  . GLU B 1 503 ? 111.092 27.132  68.948  1.00 54.88 ? 525 GLU B CG  1 
ATOM   7468 C CD  . GLU B 1 503 ? 110.470 28.180  68.041  1.00 58.78 ? 525 GLU B CD  1 
ATOM   7469 O OE1 . GLU B 1 503 ? 109.412 28.733  68.409  1.00 58.07 ? 525 GLU B OE1 1 
ATOM   7470 O OE2 . GLU B 1 503 ? 111.040 28.450  66.961  1.00 66.38 ? 525 GLU B OE2 1 
ATOM   7471 N N   . ASP B 1 504 ? 108.136 23.395  69.607  1.00 41.39 ? 526 ASP B N   1 
ATOM   7472 C CA  . ASP B 1 504 ? 107.320 22.549  70.470  1.00 34.28 ? 526 ASP B CA  1 
ATOM   7473 C C   . ASP B 1 504 ? 106.093 22.111  69.683  1.00 31.24 ? 526 ASP B C   1 
ATOM   7474 O O   . ASP B 1 504 ? 105.702 22.762  68.708  1.00 29.49 ? 526 ASP B O   1 
ATOM   7475 C CB  . ASP B 1 504 ? 106.905 23.283  71.750  1.00 26.45 ? 526 ASP B CB  1 
ATOM   7476 C CG  . ASP B 1 504 ? 106.534 22.339  72.870  1.00 29.28 ? 526 ASP B CG  1 
ATOM   7477 O OD1 . ASP B 1 504 ? 106.799 21.123  72.741  1.00 35.42 ? 526 ASP B OD1 1 
ATOM   7478 O OD2 . ASP B 1 504 ? 105.977 22.814  73.882  1.00 28.76 ? 526 ASP B OD2 1 
ATOM   7479 N N   . TYR B 1 505 ? 105.485 21.007  70.116  1.00 30.06 ? 527 TYR B N   1 
ATOM   7480 C CA  . TYR B 1 505 ? 104.305 20.508  69.420  1.00 29.15 ? 527 TYR B CA  1 
ATOM   7481 C C   . TYR B 1 505 ? 103.478 19.624  70.342  1.00 28.82 ? 527 TYR B C   1 
ATOM   7482 O O   . TYR B 1 505 ? 103.982 19.055  71.313  1.00 34.99 ? 527 TYR B O   1 
ATOM   7483 C CB  . TYR B 1 505 ? 104.682 19.742  68.150  1.00 22.64 ? 527 TYR B CB  1 
ATOM   7484 C CG  . TYR B 1 505 ? 105.520 18.499  68.366  1.00 24.69 ? 527 TYR B CG  1 
ATOM   7485 C CD1 . TYR B 1 505 ? 104.920 17.262  68.574  1.00 28.14 ? 527 TYR B CD1 1 
ATOM   7486 C CD2 . TYR B 1 505 ? 106.910 18.552  68.322  1.00 22.18 ? 527 TYR B CD2 1 
ATOM   7487 C CE1 . TYR B 1 505 ? 105.678 16.117  68.753  1.00 29.06 ? 527 TYR B CE1 1 
ATOM   7488 C CE2 . TYR B 1 505 ? 107.677 17.411  68.498  1.00 23.36 ? 527 TYR B CE2 1 
ATOM   7489 C CZ  . TYR B 1 505 ? 107.053 16.196  68.714  1.00 28.81 ? 527 TYR B CZ  1 
ATOM   7490 O OH  . TYR B 1 505 ? 107.797 15.053  68.893  1.00 26.58 ? 527 TYR B OH  1 
ATOM   7491 N N   . ARG B 1 506 ? 102.192 19.516  70.009  1.00 29.62 ? 528 ARG B N   1 
ATOM   7492 C CA  . ARG B 1 506 ? 101.250 18.664  70.722  1.00 26.77 ? 528 ARG B CA  1 
ATOM   7493 C C   . ARG B 1 506 ? 100.541 17.771  69.719  1.00 19.47 ? 528 ARG B C   1 
ATOM   7494 O O   . ARG B 1 506 ? 99.960  18.265  68.747  1.00 19.74 ? 528 ARG B O   1 
ATOM   7495 C CB  . ARG B 1 506 ? 100.221 19.490  71.499  1.00 22.49 ? 528 ARG B CB  1 
ATOM   7496 C CG  . ARG B 1 506 ? 100.821 20.583  72.352  1.00 23.75 ? 528 ARG B CG  1 
ATOM   7497 C CD  . ARG B 1 506 ? 101.243 20.050  73.706  1.00 23.62 ? 528 ARG B CD  1 
ATOM   7498 N NE  . ARG B 1 506 ? 101.913 21.079  74.493  1.00 28.79 ? 528 ARG B NE  1 
ATOM   7499 C CZ  . ARG B 1 506 ? 103.232 21.219  74.569  1.00 28.00 ? 528 ARG B CZ  1 
ATOM   7500 N NH1 . ARG B 1 506 ? 104.029 20.385  73.912  1.00 25.07 ? 528 ARG B NH1 1 
ATOM   7501 N NH2 . ARG B 1 506 ? 103.754 22.187  75.310  1.00 25.43 ? 528 ARG B NH2 1 
ATOM   7502 N N   . LEU B 1 507 ? 100.590 16.464  69.957  1.00 17.28 ? 529 LEU B N   1 
ATOM   7503 C CA  . LEU B 1 507 ? 99.875  15.490  69.144  1.00 16.40 ? 529 LEU B CA  1 
ATOM   7504 C C   . LEU B 1 507 ? 98.535  15.186  69.802  1.00 16.86 ? 529 LEU B C   1 
ATOM   7505 O O   . LEU B 1 507 ? 98.488  14.783  70.967  1.00 19.67 ? 529 LEU B O   1 
ATOM   7506 C CB  . LEU B 1 507 ? 100.696 14.214  68.984  1.00 16.15 ? 529 LEU B CB  1 
ATOM   7507 C CG  . LEU B 1 507 ? 101.812 14.265  67.945  1.00 16.20 ? 529 LEU B CG  1 
ATOM   7508 C CD1 . LEU B 1 507 ? 102.632 12.997  68.010  1.00 23.43 ? 529 LEU B CD1 1 
ATOM   7509 C CD2 . LEU B 1 507 ? 101.220 14.449  66.558  1.00 20.42 ? 529 LEU B CD2 1 
ATOM   7510 N N   . LEU B 1 508 ? 97.450  15.377  69.061  1.00 19.47 ? 530 LEU B N   1 
ATOM   7511 C CA  . LEU B 1 508 ? 96.105  15.229  69.598  1.00 18.67 ? 530 LEU B CA  1 
ATOM   7512 C C   . LEU B 1 508 ? 95.490  13.934  69.087  1.00 17.94 ? 530 LEU B C   1 
ATOM   7513 O O   . LEU B 1 508 ? 95.441  13.701  67.874  1.00 17.24 ? 530 LEU B O   1 
ATOM   7514 C CB  . LEU B 1 508 ? 95.233  16.426  69.218  1.00 16.96 ? 530 LEU B CB  1 
ATOM   7515 C CG  . LEU B 1 508 ? 95.919  17.794  69.293  1.00 16.95 ? 530 LEU B CG  1 
ATOM   7516 C CD1 . LEU B 1 508 ? 95.008  18.898  68.772  1.00 15.05 ? 530 LEU B CD1 1 
ATOM   7517 C CD2 . LEU B 1 508 ? 96.369  18.092  70.714  1.00 16.84 ? 530 LEU B CD2 1 
ATOM   7518 N N   . THR B 1 509 ? 95.030  13.097  70.016  1.00 21.29 ? 531 THR B N   1 
ATOM   7519 C CA  . THR B 1 509 ? 94.351  11.851  69.681  1.00 23.28 ? 531 THR B CA  1 
ATOM   7520 C C   . THR B 1 509 ? 92.863  12.110  69.470  1.00 21.92 ? 531 THR B C   1 
ATOM   7521 O O   . THR B 1 509 ? 92.199  12.698  70.333  1.00 17.87 ? 531 THR B O   1 
ATOM   7522 C CB  . THR B 1 509 ? 94.551  10.811  70.786  1.00 21.10 ? 531 THR B CB  1 
ATOM   7523 O OG1 . THR B 1 509 ? 95.915  10.374  70.798  1.00 23.98 ? 531 THR B OG1 1 
ATOM   7524 C CG2 . THR B 1 509 ? 93.657  9.609   70.561  1.00 15.63 ? 531 THR B CG2 1 
ATOM   7525 N N   . ASP B 1 510 ? 92.350  11.675  68.316  1.00 22.38 ? 532 ASP B N   1 
ATOM   7526 C CA  . ASP B 1 510 ? 90.927  11.750  68.008  1.00 19.71 ? 532 ASP B CA  1 
ATOM   7527 C C   . ASP B 1 510 ? 90.453  13.198  68.008  1.00 24.59 ? 532 ASP B C   1 
ATOM   7528 O O   . ASP B 1 510 ? 89.759  13.637  68.933  1.00 30.12 ? 532 ASP B O   1 
ATOM   7529 C CB  . ASP B 1 510 ? 90.131  10.906  69.004  1.00 23.13 ? 532 ASP B CB  1 
ATOM   7530 C CG  . ASP B 1 510 ? 88.665  10.841  68.673  1.00 26.57 ? 532 ASP B CG  1 
ATOM   7531 O OD1 . ASP B 1 510 ? 88.278  11.264  67.562  1.00 25.39 ? 532 ASP B OD1 1 
ATOM   7532 O OD2 . ASP B 1 510 ? 87.898  10.365  69.535  1.00 30.49 ? 532 ASP B OD2 1 
ATOM   7533 N N   . ILE B 1 511 ? 90.810  13.937  66.967  1.00 21.82 ? 533 ILE B N   1 
ATOM   7534 C CA  . ILE B 1 511 ? 90.582  15.376  66.940  1.00 25.30 ? 533 ILE B CA  1 
ATOM   7535 C C   . ILE B 1 511 ? 89.125  15.683  66.628  1.00 28.68 ? 533 ILE B C   1 
ATOM   7536 O O   . ILE B 1 511 ? 88.440  14.939  65.913  1.00 26.71 ? 533 ILE B O   1 
ATOM   7537 C CB  . ILE B 1 511 ? 91.512  16.056  65.917  1.00 25.19 ? 533 ILE B CB  1 
ATOM   7538 C CG1 . ILE B 1 511 ? 91.654  15.190  64.661  1.00 19.37 ? 533 ILE B CG1 1 
ATOM   7539 C CG2 . ILE B 1 511 ? 92.857  16.369  66.551  1.00 21.18 ? 533 ILE B CG2 1 
ATOM   7540 C CD1 . ILE B 1 511 ? 92.236  15.934  63.481  1.00 16.88 ? 533 ILE B CD1 1 
ATOM   7541 N N   . LEU B 1 512 ? 88.655  16.805  67.169  1.00 21.86 ? 534 LEU B N   1 
ATOM   7542 C CA  . LEU B 1 512 ? 87.396  17.387  66.744  1.00 19.30 ? 534 LEU B CA  1 
ATOM   7543 C C   . LEU B 1 512 ? 87.568  18.002  65.359  1.00 25.24 ? 534 LEU B C   1 
ATOM   7544 O O   . LEU B 1 512 ? 88.665  18.037  64.796  1.00 26.18 ? 534 LEU B O   1 
ATOM   7545 C CB  . LEU B 1 512 ? 86.928  18.438  67.747  1.00 19.97 ? 534 LEU B CB  1 
ATOM   7546 C CG  . LEU B 1 512 ? 86.914  18.046  69.223  1.00 24.73 ? 534 LEU B CG  1 
ATOM   7547 C CD1 . LEU B 1 512 ? 86.491  19.226  70.092  1.00 19.15 ? 534 LEU B CD1 1 
ATOM   7548 C CD2 . LEU B 1 512 ? 86.005  16.848  69.447  1.00 24.66 ? 534 LEU B CD2 1 
ATOM   7549 N N   . GLY B 1 513 ? 86.466  18.498  64.796  1.00 23.75 ? 535 GLY B N   1 
ATOM   7550 C CA  . GLY B 1 513 ? 86.579  19.290  63.586  1.00 16.60 ? 535 GLY B CA  1 
ATOM   7551 C C   . GLY B 1 513 ? 87.364  20.567  63.815  1.00 18.17 ? 535 GLY B C   1 
ATOM   7552 O O   . GLY B 1 513 ? 88.196  20.955  62.991  1.00 17.52 ? 535 GLY B O   1 
ATOM   7553 N N   . ILE B 1 514 ? 87.130  21.224  64.953  1.00 19.14 ? 536 ILE B N   1 
ATOM   7554 C CA  . ILE B 1 514 ? 87.784  22.499  65.217  1.00 18.98 ? 536 ILE B CA  1 
ATOM   7555 C C   . ILE B 1 514 ? 89.282  22.310  65.396  1.00 21.05 ? 536 ILE B C   1 
ATOM   7556 O O   . ILE B 1 514 ? 90.067  23.225  65.120  1.00 23.66 ? 536 ILE B O   1 
ATOM   7557 C CB  . ILE B 1 514 ? 87.143  23.185  66.442  1.00 23.89 ? 536 ILE B CB  1 
ATOM   7558 C CG1 . ILE B 1 514 ? 87.625  24.631  66.566  1.00 21.84 ? 536 ILE B CG1 1 
ATOM   7559 C CG2 . ILE B 1 514 ? 87.431  22.407  67.725  1.00 20.13 ? 536 ILE B CG2 1 
ATOM   7560 C CD1 . ILE B 1 514 ? 87.086  25.348  67.780  1.00 21.16 ? 536 ILE B CD1 1 
ATOM   7561 N N   . GLU B 1 515 ? 89.710  21.131  65.854  1.00 24.66 ? 537 GLU B N   1 
ATOM   7562 C CA  . GLU B 1 515 ? 91.137  20.877  66.004  1.00 19.54 ? 537 GLU B CA  1 
ATOM   7563 C C   . GLU B 1 515 ? 91.795  20.595  64.663  1.00 23.22 ? 537 GLU B C   1 
ATOM   7564 O O   . GLU B 1 515 ? 92.965  20.939  64.470  1.00 27.33 ? 537 GLU B O   1 
ATOM   7565 C CB  . GLU B 1 515 ? 91.371  19.713  66.968  1.00 22.56 ? 537 GLU B CB  1 
ATOM   7566 C CG  . GLU B 1 515 ? 91.308  20.102  68.436  1.00 20.66 ? 537 GLU B CG  1 
ATOM   7567 C CD  . GLU B 1 515 ? 91.274  18.897  69.358  1.00 22.93 ? 537 GLU B CD  1 
ATOM   7568 O OE1 . GLU B 1 515 ? 90.643  17.883  68.991  1.00 23.30 ? 537 GLU B OE1 1 
ATOM   7569 O OE2 . GLU B 1 515 ? 91.877  18.964  70.451  1.00 23.85 ? 537 GLU B OE2 1 
ATOM   7570 N N   . ASP B 1 516 ? 91.068  19.970  63.733  1.00 22.65 ? 538 ASP B N   1 
ATOM   7571 C CA  . ASP B 1 516 ? 91.556  19.862  62.362  1.00 17.69 ? 538 ASP B CA  1 
ATOM   7572 C C   . ASP B 1 516 ? 91.609  21.232  61.697  1.00 21.28 ? 538 ASP B C   1 
ATOM   7573 O O   . ASP B 1 516 ? 92.583  21.560  61.010  1.00 31.01 ? 538 ASP B O   1 
ATOM   7574 C CB  . ASP B 1 516 ? 90.667  18.902  61.571  1.00 18.52 ? 538 ASP B CB  1 
ATOM   7575 C CG  . ASP B 1 516 ? 90.987  18.885  60.084  1.00 33.51 ? 538 ASP B CG  1 
ATOM   7576 O OD1 . ASP B 1 516 ? 92.161  19.103  59.709  1.00 33.76 ? 538 ASP B OD1 1 
ATOM   7577 O OD2 . ASP B 1 516 ? 90.056  18.641  59.286  1.00 35.99 ? 538 ASP B OD2 1 
ATOM   7578 N N   . TYR B 1 517 ? 90.576  22.049  61.905  1.00 23.66 ? 539 TYR B N   1 
ATOM   7579 C CA  . TYR B 1 517 ? 90.529  23.377  61.300  1.00 25.75 ? 539 TYR B CA  1 
ATOM   7580 C C   . TYR B 1 517 ? 91.658  24.258  61.823  1.00 21.02 ? 539 TYR B C   1 
ATOM   7581 O O   . TYR B 1 517 ? 92.397  24.867  61.043  1.00 28.27 ? 539 TYR B O   1 
ATOM   7582 C CB  . TYR B 1 517 ? 89.161  24.011  61.573  1.00 25.95 ? 539 TYR B CB  1 
ATOM   7583 C CG  . TYR B 1 517 ? 88.930  25.370  60.955  1.00 29.54 ? 539 TYR B CG  1 
ATOM   7584 C CD1 . TYR B 1 517 ? 88.608  25.499  59.609  1.00 39.66 ? 539 TYR B CD1 1 
ATOM   7585 C CD2 . TYR B 1 517 ? 88.999  26.527  61.726  1.00 32.65 ? 539 TYR B CD2 1 
ATOM   7586 C CE1 . TYR B 1 517 ? 88.379  26.747  59.040  1.00 41.65 ? 539 TYR B CE1 1 
ATOM   7587 C CE2 . TYR B 1 517 ? 88.774  27.780  61.167  1.00 39.75 ? 539 TYR B CE2 1 
ATOM   7588 C CZ  . TYR B 1 517 ? 88.464  27.883  59.822  1.00 46.81 ? 539 TYR B CZ  1 
ATOM   7589 O OH  . TYR B 1 517 ? 88.239  29.121  59.259  1.00 47.04 ? 539 TYR B OH  1 
ATOM   7590 N N   . ASN B 1 518 ? 91.816  24.328  63.143  1.00 23.13 ? 540 ASN B N   1 
ATOM   7591 C CA  . ASN B 1 518 ? 92.823  25.174  63.771  1.00 24.87 ? 540 ASN B CA  1 
ATOM   7592 C C   . ASN B 1 518 ? 94.156  24.467  63.978  1.00 23.75 ? 540 ASN B C   1 
ATOM   7593 O O   . ASN B 1 518 ? 95.058  25.044  64.592  1.00 21.03 ? 540 ASN B O   1 
ATOM   7594 C CB  . ASN B 1 518 ? 92.313  25.695  65.115  1.00 19.34 ? 540 ASN B CB  1 
ATOM   7595 C CG  . ASN B 1 518 ? 91.257  26.757  64.957  1.00 21.74 ? 540 ASN B CG  1 
ATOM   7596 O OD1 . ASN B 1 518 ? 91.114  27.344  63.887  1.00 29.41 ? 540 ASN B OD1 1 
ATOM   7597 N ND2 . ASN B 1 518 ? 90.513  27.020  66.024  1.00 23.83 ? 540 ASN B ND2 1 
ATOM   7598 N N   . GLY B 1 519 ? 94.300  23.239  63.491  1.00 26.38 ? 541 GLY B N   1 
ATOM   7599 C CA  . GLY B 1 519 ? 95.512  22.474  63.655  1.00 21.85 ? 541 GLY B CA  1 
ATOM   7600 C C   . GLY B 1 519 ? 96.394  22.501  62.425  1.00 23.10 ? 541 GLY B C   1 
ATOM   7601 O O   . GLY B 1 519 ? 96.247  23.343  61.531  1.00 25.20 ? 541 GLY B O   1 
ATOM   7602 N N   . ASP B 1 520 ? 97.323  21.546  62.373  1.00 23.20 ? 542 ASP B N   1 
ATOM   7603 C CA  . ASP B 1 520 ? 98.332  21.510  61.330  1.00 22.68 ? 542 ASP B CA  1 
ATOM   7604 C C   . ASP B 1 520 ? 98.342  20.226  60.508  1.00 24.91 ? 542 ASP B C   1 
ATOM   7605 O O   . ASP B 1 520 ? 99.099  20.149  59.533  1.00 20.90 ? 542 ASP B O   1 
ATOM   7606 C CB  . ASP B 1 520 ? 99.723  21.729  61.945  1.00 18.76 ? 542 ASP B CB  1 
ATOM   7607 C CG  . ASP B 1 520 ? 99.873  23.109  62.580  1.00 21.40 ? 542 ASP B CG  1 
ATOM   7608 O OD1 . ASP B 1 520 ? 99.317  24.090  62.039  1.00 23.49 ? 542 ASP B OD1 1 
ATOM   7609 O OD2 . ASP B 1 520 ? 100.553 23.218  63.623  1.00 19.48 ? 542 ASP B OD2 1 
ATOM   7610 N N   . MET B 1 521 ? 97.534  19.225  60.856  1.00 24.23 ? 543 MET B N   1 
ATOM   7611 C CA  . MET B 1 521 ? 97.522  17.982  60.096  1.00 22.83 ? 543 MET B CA  1 
ATOM   7612 C C   . MET B 1 521 ? 96.266  17.190  60.431  1.00 22.77 ? 543 MET B C   1 
ATOM   7613 O O   . MET B 1 521 ? 95.669  17.351  61.497  1.00 20.29 ? 543 MET B O   1 
ATOM   7614 C CB  . MET B 1 521 ? 98.770  17.137  60.373  1.00 23.56 ? 543 MET B CB  1 
ATOM   7615 C CG  . MET B 1 521 ? 98.617  16.173  61.542  1.00 27.70 ? 543 MET B CG  1 
ATOM   7616 S SD  . MET B 1 521 ? 100.047 15.100  61.780  1.00 24.74 ? 543 MET B SD  1 
ATOM   7617 C CE  . MET B 1 521 ? 99.618  14.304  63.330  1.00 16.08 ? 543 MET B CE  1 
ATOM   7618 N N   . ASP B 1 522 ? 95.880  16.325  59.492  1.00 25.81 ? 544 ASP B N   1 
ATOM   7619 C CA  . ASP B 1 522 ? 94.760  15.394  59.642  1.00 21.74 ? 544 ASP B CA  1 
ATOM   7620 C C   . ASP B 1 522 ? 95.326  14.006  59.345  1.00 27.55 ? 544 ASP B C   1 
ATOM   7621 O O   . ASP B 1 522 ? 95.333  13.558  58.194  1.00 24.98 ? 544 ASP B O   1 
ATOM   7622 C CB  . ASP B 1 522 ? 93.614  15.760  58.708  1.00 25.69 ? 544 ASP B CB  1 
ATOM   7623 C CG  . ASP B 1 522 ? 92.284  15.203  59.165  1.00 31.09 ? 544 ASP B CG  1 
ATOM   7624 O OD1 . ASP B 1 522 ? 92.199  14.732  60.320  1.00 33.11 ? 544 ASP B OD1 1 
ATOM   7625 O OD2 . ASP B 1 522 ? 91.321  15.239  58.367  1.00 37.43 ? 544 ASP B OD2 1 
ATOM   7626 N N   . PHE B 1 523 ? 95.814  13.332  60.388  1.00 23.62 ? 545 PHE B N   1 
ATOM   7627 C CA  . PHE B 1 523 ? 96.577  12.092  60.242  1.00 20.38 ? 545 PHE B CA  1 
ATOM   7628 C C   . PHE B 1 523 ? 95.635  10.905  60.406  1.00 20.59 ? 545 PHE B C   1 
ATOM   7629 O O   . PHE B 1 523 ? 95.497  10.337  61.492  1.00 18.90 ? 545 PHE B O   1 
ATOM   7630 C CB  . PHE B 1 523 ? 97.711  12.054  61.256  1.00 16.37 ? 545 PHE B CB  1 
ATOM   7631 C CG  . PHE B 1 523 ? 98.834  11.139  60.884  1.00 17.41 ? 545 PHE B CG  1 
ATOM   7632 C CD1 . PHE B 1 523 ? 99.863  11.580  60.071  1.00 19.94 ? 545 PHE B CD1 1 
ATOM   7633 C CD2 . PHE B 1 523 ? 98.871  9.839   61.363  1.00 20.87 ? 545 PHE B CD2 1 
ATOM   7634 C CE1 . PHE B 1 523 ? 100.908 10.736  59.732  1.00 20.45 ? 545 PHE B CE1 1 
ATOM   7635 C CE2 . PHE B 1 523 ? 99.914  8.990   61.029  1.00 22.60 ? 545 PHE B CE2 1 
ATOM   7636 C CZ  . PHE B 1 523 ? 100.934 9.440   60.213  1.00 16.62 ? 545 PHE B CZ  1 
ATOM   7637 N N   . LYS B 1 524 ? 94.987  10.516  59.312  1.00 14.88 ? 546 LYS B N   1 
ATOM   7638 C CA  . LYS B 1 524 ? 94.025  9.423   59.331  1.00 15.13 ? 546 LYS B CA  1 
ATOM   7639 C C   . LYS B 1 524 ? 94.741  8.115   59.024  1.00 16.25 ? 546 LYS B C   1 
ATOM   7640 O O   . LYS B 1 524 ? 95.298  7.951   57.934  1.00 22.06 ? 546 LYS B O   1 
ATOM   7641 C CB  . LYS B 1 524 ? 92.905  9.674   58.323  1.00 20.09 ? 546 LYS B CB  1 
ATOM   7642 C CG  . LYS B 1 524 ? 91.993  10.832  58.691  1.00 21.90 ? 546 LYS B CG  1 
ATOM   7643 C CD  . LYS B 1 524 ? 91.313  11.415  57.467  1.00 19.89 ? 546 LYS B CD  1 
ATOM   7644 C CE  . LYS B 1 524 ? 92.192  12.445  56.793  1.00 20.00 ? 546 LYS B CE  1 
ATOM   7645 N NZ  . LYS B 1 524 ? 91.401  13.343  55.913  1.00 33.93 ? 546 LYS B NZ  1 
ATOM   7646 N N   . ILE B 1 525 ? 94.729  7.188   59.979  1.00 15.60 ? 547 ILE B N   1 
ATOM   7647 C CA  . ILE B 1 525 ? 95.378  5.892   59.810  1.00 20.47 ? 547 ILE B CA  1 
ATOM   7648 C C   . ILE B 1 525 ? 94.498  4.816   60.429  1.00 20.29 ? 547 ILE B C   1 
ATOM   7649 O O   . ILE B 1 525 ? 93.864  5.032   61.468  1.00 25.96 ? 547 ILE B O   1 
ATOM   7650 C CB  . ILE B 1 525 ? 96.792  5.878   60.428  1.00 21.84 ? 547 ILE B CB  1 
ATOM   7651 C CG1 . ILE B 1 525 ? 97.483  4.536   60.161  1.00 21.06 ? 547 ILE B CG1 1 
ATOM   7652 C CG2 . ILE B 1 525 ? 96.724  6.179   61.906  1.00 12.48 ? 547 ILE B CG2 1 
ATOM   7653 C CD1 . ILE B 1 525 ? 98.896  4.458   60.700  1.00 21.10 ? 547 ILE B CD1 1 
ATOM   7654 N N   . ALA B 1 526 ? 94.451  3.656   59.780  1.00 17.43 ? 548 ALA B N   1 
ATOM   7655 C CA  . ALA B 1 526 ? 93.606  2.559   60.218  1.00 22.06 ? 548 ALA B CA  1 
ATOM   7656 C C   . ALA B 1 526 ? 94.368  1.249   60.090  1.00 22.91 ? 548 ALA B C   1 
ATOM   7657 O O   . ALA B 1 526 ? 95.448  1.178   59.496  1.00 20.51 ? 548 ALA B O   1 
ATOM   7658 C CB  . ALA B 1 526 ? 92.301  2.499   59.415  1.00 24.73 ? 548 ALA B CB  1 
ATOM   7659 N N   . GLY B 1 527 ? 93.792  0.204   60.659  1.00 22.15 ? 549 GLY B N   1 
ATOM   7660 C CA  . GLY B 1 527 ? 94.376  -1.113  60.542  1.00 23.06 ? 549 GLY B CA  1 
ATOM   7661 C C   . GLY B 1 527 ? 93.789  -2.050  61.573  1.00 21.62 ? 549 GLY B C   1 
ATOM   7662 O O   . GLY B 1 527 ? 92.857  -1.708  62.296  1.00 21.67 ? 549 GLY B O   1 
ATOM   7663 N N   . THR B 1 528 ? 94.352  -3.252  61.602  1.00 29.54 ? 550 THR B N   1 
ATOM   7664 C CA  . THR B 1 528 ? 94.036  -4.205  62.648  1.00 25.89 ? 550 THR B CA  1 
ATOM   7665 C C   . THR B 1 528 ? 94.852  -3.887  63.897  1.00 26.49 ? 550 THR B C   1 
ATOM   7666 O O   . THR B 1 528 ? 95.751  -3.033  63.890  1.00 26.43 ? 550 THR B O   1 
ATOM   7667 C CB  . THR B 1 528 ? 94.312  -5.629  62.181  1.00 25.64 ? 550 THR B CB  1 
ATOM   7668 O OG1 . THR B 1 528 ? 95.717  -5.789  61.950  1.00 28.90 ? 550 THR B OG1 1 
ATOM   7669 C CG2 . THR B 1 528 ? 93.554  -5.929  60.894  1.00 19.92 ? 550 THR B CG2 1 
ATOM   7670 N N   . ASN B 1 529 ? 94.521  -4.589  64.986  1.00 33.30 ? 551 ASN B N   1 
ATOM   7671 C CA  . ASN B 1 529 ? 95.268  -4.536  66.232  1.00 38.34 ? 551 ASN B CA  1 
ATOM   7672 C C   . ASN B 1 529 ? 96.665  -5.154  66.103  1.00 37.13 ? 551 ASN B C   1 
ATOM   7673 O O   . ASN B 1 529 ? 97.456  -5.062  67.049  1.00 45.68 ? 551 ASN B O   1 
ATOM   7674 C CB  . ASN B 1 529 ? 94.470  -5.225  67.377  1.00 40.91 ? 551 ASN B CB  1 
ATOM   7675 C CG  . ASN B 1 529 ? 94.907  -4.731  68.752  1.00 56.21 ? 551 ASN B CG  1 
ATOM   7676 O OD1 . ASN B 1 529 ? 94.295  -3.820  69.284  1.00 62.63 ? 551 ASN B OD1 1 
ATOM   7677 N ND2 . ASN B 1 529 ? 96.023  -5.264  69.286  1.00 54.33 ? 551 ASN B ND2 1 
ATOM   7678 N N   . LYS B 1 530 ? 97.020  -5.695  64.928  1.00 37.95 ? 552 LYS B N   1 
ATOM   7679 C CA  . LYS B 1 530 ? 98.381  -6.156  64.640  1.00 33.79 ? 552 LYS B CA  1 
ATOM   7680 C C   . LYS B 1 530 ? 99.128  -5.365  63.571  1.00 36.91 ? 552 LYS B C   1 
ATOM   7681 O O   . LYS B 1 530 ? 100.361 -5.467  63.511  1.00 37.66 ? 552 LYS B O   1 
ATOM   7682 C CB  . LYS B 1 530 ? 98.430  -7.622  64.159  1.00 33.69 ? 552 LYS B CB  1 
ATOM   7683 C CG  . LYS B 1 530 ? 97.804  -8.755  65.002  1.00 46.46 ? 552 LYS B CG  1 
ATOM   7684 C CD  . LYS B 1 530 ? 98.271  -8.909  66.457  1.00 63.42 ? 552 LYS B CD  1 
ATOM   7685 C CE  . LYS B 1 530 ? 97.122  -8.885  67.431  1.00 70.42 ? 552 LYS B CE  1 
ATOM   7686 N NZ  . LYS B 1 530 ? 97.676  -8.595  68.807  1.00 56.68 ? 552 LYS B NZ  1 
ATOM   7687 N N   . GLY B 1 531 ? 98.434  -4.648  62.692  1.00 36.45 ? 553 GLY B N   1 
ATOM   7688 C CA  . GLY B 1 531 ? 99.110  -4.014  61.575  1.00 35.44 ? 553 GLY B CA  1 
ATOM   7689 C C   . GLY B 1 531 ? 98.316  -2.864  60.992  1.00 28.26 ? 553 GLY B C   1 
ATOM   7690 O O   . GLY B 1 531 ? 97.192  -2.577  61.411  1.00 23.83 ? 553 GLY B O   1 
ATOM   7691 N N   . ILE B 1 532 ? 98.928  -2.206  59.996  1.00 28.66 ? 554 ILE B N   1 
ATOM   7692 C CA  . ILE B 1 532 ? 98.383  -1.014  59.345  1.00 23.37 ? 554 ILE B CA  1 
ATOM   7693 C C   . ILE B 1 532 ? 97.815  -1.394  57.987  1.00 24.37 ? 554 ILE B C   1 
ATOM   7694 O O   . ILE B 1 532 ? 98.418  -2.187  57.252  1.00 26.21 ? 554 ILE B O   1 
ATOM   7695 C CB  . ILE B 1 532 ? 99.462  0.074   59.184  1.00 27.64 ? 554 ILE B CB  1 
ATOM   7696 C CG1 . ILE B 1 532 ? 100.190 0.312   60.510  1.00 25.34 ? 554 ILE B CG1 1 
ATOM   7697 C CG2 . ILE B 1 532 ? 98.858  1.359   58.612  1.00 18.77 ? 554 ILE B CG2 1 
ATOM   7698 C CD1 . ILE B 1 532 ? 99.279  0.683   61.645  1.00 22.25 ? 554 ILE B CD1 1 
ATOM   7699 N N   . THR B 1 533 ? 96.665  -0.809  57.637  1.00 20.71 ? 555 THR B N   1 
ATOM   7700 C CA  . THR B 1 533 ? 96.025  -1.076  56.354  1.00 18.58 ? 555 THR B CA  1 
ATOM   7701 C C   . THR B 1 533 ? 95.842  0.156   55.483  1.00 17.03 ? 555 THR B C   1 
ATOM   7702 O O   . THR B 1 533 ? 95.818  0.024   54.257  1.00 14.18 ? 555 THR B O   1 
ATOM   7703 C CB  . THR B 1 533 ? 94.652  -1.742  56.555  1.00 20.01 ? 555 THR B CB  1 
ATOM   7704 O OG1 . THR B 1 533 ? 93.830  -0.916  57.388  1.00 30.32 ? 555 THR B OG1 1 
ATOM   7705 C CG2 . THR B 1 533 ? 94.811  -3.104  57.205  1.00 22.95 ? 555 THR B CG2 1 
ATOM   7706 N N   . ALA B 1 534 ? 95.714  1.344   56.069  1.00 18.01 ? 556 ALA B N   1 
ATOM   7707 C CA  . ALA B 1 534 ? 95.537  2.549   55.270  1.00 21.78 ? 556 ALA B CA  1 
ATOM   7708 C C   . ALA B 1 534 ? 96.029  3.752   56.061  1.00 19.03 ? 556 ALA B C   1 
ATOM   7709 O O   . ALA B 1 534 ? 95.955  3.775   57.293  1.00 16.77 ? 556 ALA B O   1 
ATOM   7710 C CB  . ALA B 1 534 ? 94.074  2.743   54.855  1.00 22.67 ? 556 ALA B CB  1 
ATOM   7711 N N   . LEU B 1 535 ? 96.531  4.749   55.335  1.00 19.61 ? 557 LEU B N   1 
ATOM   7712 C CA  . LEU B 1 535 ? 97.014  5.981   55.941  1.00 17.58 ? 557 LEU B CA  1 
ATOM   7713 C C   . LEU B 1 535 ? 96.843  7.125   54.954  1.00 22.84 ? 557 LEU B C   1 
ATOM   7714 O O   . LEU B 1 535 ? 97.158  6.987   53.769  1.00 23.26 ? 557 LEU B O   1 
ATOM   7715 C CB  . LEU B 1 535 ? 98.486  5.868   56.352  1.00 19.64 ? 557 LEU B CB  1 
ATOM   7716 C CG  . LEU B 1 535 ? 99.230  7.197   56.475  1.00 20.26 ? 557 LEU B CG  1 
ATOM   7717 C CD1 . LEU B 1 535 ? 98.771  7.950   57.719  1.00 21.17 ? 557 LEU B CD1 1 
ATOM   7718 C CD2 . LEU B 1 535 ? 100.739 6.982   56.487  1.00 23.20 ? 557 LEU B CD2 1 
ATOM   7719 N N   . GLN B 1 536 ? 96.340  8.252   55.453  1.00 24.48 ? 558 GLN B N   1 
ATOM   7720 C CA  . GLN B 1 536 ? 96.232  9.477   54.668  1.00 21.76 ? 558 GLN B CA  1 
ATOM   7721 C C   . GLN B 1 536 ? 96.569  10.644  55.585  1.00 25.25 ? 558 GLN B C   1 
ATOM   7722 O O   . GLN B 1 536 ? 95.765  11.007  56.450  1.00 24.98 ? 558 GLN B O   1 
ATOM   7723 C CB  . GLN B 1 536 ? 94.839  9.636   54.069  1.00 18.65 ? 558 GLN B CB  1 
ATOM   7724 C CG  . GLN B 1 536 ? 94.668  10.913  53.279  1.00 26.84 ? 558 GLN B CG  1 
ATOM   7725 C CD  . GLN B 1 536 ? 93.275  11.060  52.704  1.00 30.94 ? 558 GLN B CD  1 
ATOM   7726 O OE1 . GLN B 1 536 ? 92.505  11.925  53.125  1.00 33.23 ? 558 GLN B OE1 1 
ATOM   7727 N NE2 . GLN B 1 536 ? 92.944  10.216  51.733  1.00 25.64 ? 558 GLN B NE2 1 
ATOM   7728 N N   . ALA B 1 537 ? 97.755  11.222  55.408  1.00 22.64 ? 559 ALA B N   1 
ATOM   7729 C CA  . ALA B 1 537 ? 98.192  12.370  56.190  1.00 19.60 ? 559 ALA B CA  1 
ATOM   7730 C C   . ALA B 1 537 ? 97.928  13.639  55.394  1.00 29.45 ? 559 ALA B C   1 
ATOM   7731 O O   . ALA B 1 537 ? 98.509  13.836  54.319  1.00 27.81 ? 559 ALA B O   1 
ATOM   7732 C CB  . ALA B 1 537 ? 99.672  12.261  56.550  1.00 19.13 ? 559 ALA B CB  1 
ATOM   7733 N N   . ASP B 1 538 ? 97.040  14.488  55.916  1.00 26.03 ? 560 ASP B N   1 
ATOM   7734 C CA  . ASP B 1 538 ? 96.737  15.781  55.304  1.00 26.81 ? 560 ASP B CA  1 
ATOM   7735 C C   . ASP B 1 538 ? 97.469  16.848  56.109  1.00 28.85 ? 560 ASP B C   1 
ATOM   7736 O O   . ASP B 1 538 ? 96.912  17.490  57.000  1.00 31.10 ? 560 ASP B O   1 
ATOM   7737 C CB  . ASP B 1 538 ? 95.233  16.031  55.264  1.00 25.48 ? 560 ASP B CB  1 
ATOM   7738 C CG  . ASP B 1 538 ? 94.502  15.047  54.375  1.00 37.01 ? 560 ASP B CG  1 
ATOM   7739 O OD1 . ASP B 1 538 ? 95.162  14.424  53.517  1.00 39.18 ? 560 ASP B OD1 1 
ATOM   7740 O OD2 . ASP B 1 538 ? 93.270  14.895  54.535  1.00 42.00 ? 560 ASP B OD2 1 
ATOM   7741 N N   . ILE B 1 539 ? 98.745  17.031  55.781  1.00 20.83 ? 561 ILE B N   1 
ATOM   7742 C CA  . ILE B 1 539 ? 99.591  17.967  56.513  1.00 21.42 ? 561 ILE B CA  1 
ATOM   7743 C C   . ILE B 1 539 ? 99.407  19.365  55.938  1.00 21.71 ? 561 ILE B C   1 
ATOM   7744 O O   . ILE B 1 539 ? 99.520  19.573  54.723  1.00 20.97 ? 561 ILE B O   1 
ATOM   7745 C CB  . ILE B 1 539 ? 101.060 17.523  56.458  1.00 18.18 ? 561 ILE B CB  1 
ATOM   7746 C CG1 . ILE B 1 539 ? 101.213 16.152  57.121  1.00 16.02 ? 561 ILE B CG1 1 
ATOM   7747 C CG2 . ILE B 1 539 ? 101.956 18.556  57.132  1.00 16.68 ? 561 ILE B CG2 1 
ATOM   7748 C CD1 . ILE B 1 539 ? 102.320 15.306  56.533  1.00 18.03 ? 561 ILE B CD1 1 
ATOM   7749 N N   . LYS B 1 540 ? 99.108  20.328  56.815  1.00 22.88 ? 562 LYS B N   1 
ATOM   7750 C CA  . LYS B 1 540 ? 98.926  21.717  56.412  1.00 21.64 ? 562 LYS B CA  1 
ATOM   7751 C C   . LYS B 1 540 ? 100.195 22.544  56.560  1.00 20.07 ? 562 LYS B C   1 
ATOM   7752 O O   . LYS B 1 540 ? 100.352 23.555  55.864  1.00 25.46 ? 562 LYS B O   1 
ATOM   7753 C CB  . LYS B 1 540 ? 97.799  22.367  57.229  1.00 19.32 ? 562 LYS B CB  1 
ATOM   7754 C CG  . LYS B 1 540 ? 96.443  21.712  57.037  1.00 23.24 ? 562 LYS B CG  1 
ATOM   7755 C CD  . LYS B 1 540 ? 95.497  22.022  58.184  1.00 28.58 ? 562 LYS B CD  1 
ATOM   7756 C CE  . LYS B 1 540 ? 94.815  20.748  58.687  1.00 35.73 ? 562 LYS B CE  1 
ATOM   7757 N NZ  . LYS B 1 540 ? 94.459  19.805  57.575  1.00 30.83 ? 562 LYS B NZ  1 
ATOM   7758 N N   . LEU B 1 541 ? 101.098 22.142  57.450  1.00 19.82 ? 563 LEU B N   1 
ATOM   7759 C CA  . LEU B 1 541 ? 102.345 22.863  57.623  1.00 18.84 ? 563 LEU B CA  1 
ATOM   7760 C C   . LEU B 1 541 ? 103.243 22.652  56.406  1.00 26.38 ? 563 LEU B C   1 
ATOM   7761 O O   . LEU B 1 541 ? 103.054 21.702  55.640  1.00 18.12 ? 563 LEU B O   1 
ATOM   7762 C CB  . LEU B 1 541 ? 103.054 22.393  58.891  1.00 17.55 ? 563 LEU B CB  1 
ATOM   7763 C CG  . LEU B 1 541 ? 102.607 22.984  60.227  1.00 17.21 ? 563 LEU B CG  1 
ATOM   7764 C CD1 . LEU B 1 541 ? 103.273 22.239  61.371  1.00 15.99 ? 563 LEU B CD1 1 
ATOM   7765 C CD2 . LEU B 1 541 ? 102.924 24.468  60.300  1.00 22.42 ? 563 LEU B CD2 1 
ATOM   7766 N N   . PRO B 1 542 ? 104.236 23.534  56.202  1.00 27.01 ? 564 PRO B N   1 
ATOM   7767 C CA  . PRO B 1 542 ? 105.181 23.333  55.091  1.00 17.19 ? 564 PRO B CA  1 
ATOM   7768 C C   . PRO B 1 542 ? 106.111 22.151  55.311  1.00 19.59 ? 564 PRO B C   1 
ATOM   7769 O O   . PRO B 1 542 ? 107.319 22.258  55.072  1.00 21.81 ? 564 PRO B O   1 
ATOM   7770 C CB  . PRO B 1 542 ? 105.964 24.652  55.051  1.00 14.42 ? 564 PRO B CB  1 
ATOM   7771 C CG  . PRO B 1 542 ? 105.119 25.633  55.802  1.00 17.99 ? 564 PRO B CG  1 
ATOM   7772 C CD  . PRO B 1 542 ? 104.424 24.839  56.855  1.00 18.52 ? 564 PRO B CD  1 
ATOM   7773 N N   . GLY B 1 543 ? 105.562 21.026  55.746  1.00 17.05 ? 565 GLY B N   1 
ATOM   7774 C CA  . GLY B 1 543 ? 106.327 19.842  56.078  1.00 18.42 ? 565 GLY B CA  1 
ATOM   7775 C C   . GLY B 1 543 ? 106.468 19.664  57.579  1.00 24.92 ? 565 GLY B C   1 
ATOM   7776 O O   . GLY B 1 543 ? 106.506 20.632  58.349  1.00 24.82 ? 565 GLY B O   1 
ATOM   7777 N N   . ILE B 1 544 ? 106.533 18.407  58.009  1.00 23.28 ? 566 ILE B N   1 
ATOM   7778 C CA  . ILE B 1 544 ? 106.757 18.088  59.418  1.00 24.91 ? 566 ILE B CA  1 
ATOM   7779 C C   . ILE B 1 544 ? 107.879 17.060  59.514  1.00 29.03 ? 566 ILE B C   1 
ATOM   7780 O O   . ILE B 1 544 ? 108.046 16.244  58.594  1.00 27.42 ? 566 ILE B O   1 
ATOM   7781 C CB  . ILE B 1 544 ? 105.470 17.587  60.095  1.00 20.56 ? 566 ILE B CB  1 
ATOM   7782 C CG1 . ILE B 1 544 ? 104.878 16.406  59.332  1.00 19.63 ? 566 ILE B CG1 1 
ATOM   7783 C CG2 . ILE B 1 544 ? 104.451 18.708  60.206  1.00 19.33 ? 566 ILE B CG2 1 
ATOM   7784 C CD1 . ILE B 1 544 ? 103.674 15.801  60.012  1.00 18.12 ? 566 ILE B CD1 1 
ATOM   7785 N N   . PRO B 1 545 ? 108.674 17.067  60.587  1.00 27.26 ? 567 PRO B N   1 
ATOM   7786 C CA  . PRO B 1 545 ? 109.781 16.109  60.699  1.00 17.16 ? 567 PRO B CA  1 
ATOM   7787 C C   . PRO B 1 545 ? 109.290 14.672  60.773  1.00 19.28 ? 567 PRO B C   1 
ATOM   7788 O O   . PRO B 1 545 ? 108.140 14.391  61.118  1.00 22.43 ? 567 PRO B O   1 
ATOM   7789 C CB  . PRO B 1 545 ? 110.478 16.517  62.003  1.00 15.39 ? 567 PRO B CB  1 
ATOM   7790 C CG  . PRO B 1 545 ? 110.049 17.917  62.252  1.00 20.40 ? 567 PRO B CG  1 
ATOM   7791 C CD  . PRO B 1 545 ? 108.660 18.027  61.704  1.00 25.53 ? 567 PRO B CD  1 
ATOM   7792 N N   . ILE B 1 546 ? 110.198 13.749  60.447  1.00 23.49 ? 568 ILE B N   1 
ATOM   7793 C CA  . ILE B 1 546 ? 109.888 12.324  60.511  1.00 19.04 ? 568 ILE B CA  1 
ATOM   7794 C C   . ILE B 1 546 ? 109.491 11.915  61.923  1.00 24.68 ? 568 ILE B C   1 
ATOM   7795 O O   . ILE B 1 546 ? 108.623 11.050  62.106  1.00 21.82 ? 568 ILE B O   1 
ATOM   7796 C CB  . ILE B 1 546 ? 111.088 11.498  60.004  1.00 18.15 ? 568 ILE B CB  1 
ATOM   7797 C CG1 . ILE B 1 546 ? 111.629 12.086  58.697  1.00 24.27 ? 568 ILE B CG1 1 
ATOM   7798 C CG2 . ILE B 1 546 ? 110.705 10.036  59.820  1.00 19.05 ? 568 ILE B CG2 1 
ATOM   7799 C CD1 . ILE B 1 546 ? 112.899 11.418  58.206  1.00 25.94 ? 568 ILE B CD1 1 
ATOM   7800 N N   . LYS B 1 547 ? 110.108 12.526  62.940  1.00 27.48 ? 569 LYS B N   1 
ATOM   7801 C CA  . LYS B 1 547 ? 109.836 12.131  64.318  1.00 24.34 ? 569 LYS B CA  1 
ATOM   7802 C C   . LYS B 1 547 ? 108.362 12.302  64.663  1.00 25.00 ? 569 LYS B C   1 
ATOM   7803 O O   . LYS B 1 547 ? 107.770 11.445  65.331  1.00 25.77 ? 569 LYS B O   1 
ATOM   7804 C CB  . LYS B 1 547 ? 110.712 12.933  65.284  1.00 23.22 ? 569 LYS B CB  1 
ATOM   7805 C CG  . LYS B 1 547 ? 110.910 12.258  66.644  1.00 31.30 ? 569 LYS B CG  1 
ATOM   7806 C CD  . LYS B 1 547 ? 111.550 13.200  67.662  1.00 40.34 ? 569 LYS B CD  1 
ATOM   7807 C CE  . LYS B 1 547 ? 110.847 14.557  67.686  1.00 38.54 ? 569 LYS B CE  1 
ATOM   7808 N NZ  . LYS B 1 547 ? 111.298 15.426  68.816  1.00 31.17 ? 569 LYS B NZ  1 
ATOM   7809 N N   . ILE B 1 548 ? 107.745 13.395  64.206  1.00 22.43 ? 570 ILE B N   1 
ATOM   7810 C CA  . ILE B 1 548 ? 106.338 13.621  64.517  1.00 17.66 ? 570 ILE B CA  1 
ATOM   7811 C C   . ILE B 1 548 ? 105.464 12.592  63.814  1.00 21.20 ? 570 ILE B C   1 
ATOM   7812 O O   . ILE B 1 548 ? 104.471 12.114  64.379  1.00 21.70 ? 570 ILE B O   1 
ATOM   7813 C CB  . ILE B 1 548 ? 105.924 15.056  64.154  1.00 17.37 ? 570 ILE B CB  1 
ATOM   7814 C CG1 . ILE B 1 548 ? 106.837 16.065  64.851  1.00 20.21 ? 570 ILE B CG1 1 
ATOM   7815 C CG2 . ILE B 1 548 ? 104.479 15.298  64.550  1.00 20.82 ? 570 ILE B CG2 1 
ATOM   7816 C CD1 . ILE B 1 548 ? 106.310 17.488  64.834  1.00 19.34 ? 570 ILE B CD1 1 
ATOM   7817 N N   . VAL B 1 549 ? 105.819 12.222  62.580  1.00 16.30 ? 571 VAL B N   1 
ATOM   7818 C CA  . VAL B 1 549 ? 105.050 11.201  61.875  1.00 14.68 ? 571 VAL B CA  1 
ATOM   7819 C C   . VAL B 1 549 ? 105.146 9.868   62.604  1.00 16.84 ? 571 VAL B C   1 
ATOM   7820 O O   . VAL B 1 549 ? 104.155 9.142   62.736  1.00 18.92 ? 571 VAL B O   1 
ATOM   7821 C CB  . VAL B 1 549 ? 105.519 11.091  60.413  1.00 15.48 ? 571 VAL B CB  1 
ATOM   7822 C CG1 . VAL B 1 549 ? 105.031 9.790   59.782  1.00 12.04 ? 571 VAL B CG1 1 
ATOM   7823 C CG2 . VAL B 1 549 ? 105.018 12.283  59.624  1.00 21.14 ? 571 VAL B CG2 1 
ATOM   7824 N N   . MET B 1 550 ? 106.333 9.534   63.107  1.00 25.09 ? 572 MET B N   1 
ATOM   7825 C CA  . MET B 1 550 ? 106.496 8.278   63.830  1.00 20.93 ? 572 MET B CA  1 
ATOM   7826 C C   . MET B 1 550 ? 105.648 8.262   65.096  1.00 24.71 ? 572 MET B C   1 
ATOM   7827 O O   . MET B 1 550 ? 104.881 7.320   65.331  1.00 19.59 ? 572 MET B O   1 
ATOM   7828 C CB  . MET B 1 550 ? 107.971 8.058   64.158  1.00 24.70 ? 572 MET B CB  1 
ATOM   7829 C CG  . MET B 1 550 ? 108.842 7.869   62.929  1.00 31.59 ? 572 MET B CG  1 
ATOM   7830 S SD  . MET B 1 550 ? 108.324 6.452   61.941  1.00 44.35 ? 572 MET B SD  1 
ATOM   7831 C CE  . MET B 1 550 ? 109.359 6.673   60.498  1.00 43.39 ? 572 MET B CE  1 
ATOM   7832 N N   . GLU B 1 551 ? 105.764 9.311   65.919  1.00 22.83 ? 573 GLU B N   1 
ATOM   7833 C CA  . GLU B 1 551 ? 104.977 9.381   67.147  1.00 22.57 ? 573 GLU B CA  1 
ATOM   7834 C C   . GLU B 1 551 ? 103.481 9.397   66.862  1.00 23.73 ? 573 GLU B C   1 
ATOM   7835 O O   . GLU B 1 551 ? 102.697 8.855   67.650  1.00 24.60 ? 573 GLU B O   1 
ATOM   7836 C CB  . GLU B 1 551 ? 105.362 10.618  67.954  1.00 20.47 ? 573 GLU B CB  1 
ATOM   7837 C CG  . GLU B 1 551 ? 106.820 10.679  68.348  1.00 23.75 ? 573 GLU B CG  1 
ATOM   7838 C CD  . GLU B 1 551 ? 107.241 12.078  68.745  1.00 30.73 ? 573 GLU B CD  1 
ATOM   7839 O OE1 . GLU B 1 551 ? 106.403 12.820  69.308  1.00 31.62 ? 573 GLU B OE1 1 
ATOM   7840 O OE2 . GLU B 1 551 ? 108.406 12.441  68.485  1.00 29.49 ? 573 GLU B OE2 1 
ATOM   7841 N N   . ALA B 1 552 ? 103.065 10.014  65.751  1.00 21.79 ? 574 ALA B N   1 
ATOM   7842 C CA  . ALA B 1 552 ? 101.649 10.005  65.400  1.00 19.05 ? 574 ALA B CA  1 
ATOM   7843 C C   . ALA B 1 552 ? 101.159 8.595   65.107  1.00 20.29 ? 574 ALA B C   1 
ATOM   7844 O O   . ALA B 1 552 ? 100.013 8.259   65.428  1.00 19.81 ? 574 ALA B O   1 
ATOM   7845 C CB  . ALA B 1 552 ? 101.394 10.921  64.206  1.00 14.01 ? 574 ALA B CB  1 
ATOM   7846 N N   . ILE B 1 553 ? 102.011 7.756   64.513  1.00 16.71 ? 575 ILE B N   1 
ATOM   7847 C CA  . ILE B 1 553 ? 101.633 6.371   64.266  1.00 17.97 ? 575 ILE B CA  1 
ATOM   7848 C C   . ILE B 1 553 ? 101.573 5.594   65.575  1.00 24.36 ? 575 ILE B C   1 
ATOM   7849 O O   . ILE B 1 553 ? 100.624 4.835   65.816  1.00 24.28 ? 575 ILE B O   1 
ATOM   7850 C CB  . ILE B 1 553 ? 102.601 5.724   63.259  1.00 20.60 ? 575 ILE B CB  1 
ATOM   7851 C CG1 . ILE B 1 553 ? 102.458 6.384   61.884  1.00 14.21 ? 575 ILE B CG1 1 
ATOM   7852 C CG2 . ILE B 1 553 ? 102.361 4.222   63.170  1.00 16.04 ? 575 ILE B CG2 1 
ATOM   7853 C CD1 . ILE B 1 553 ? 103.347 5.790   60.823  1.00 9.68  ? 575 ILE B CD1 1 
ATOM   7854 N N   . GLN B 1 554 ? 102.573 5.780   66.446  1.00 25.67 ? 576 GLN B N   1 
ATOM   7855 C CA  . GLN B 1 554 ? 102.565 5.106   67.744  1.00 23.19 ? 576 GLN B CA  1 
ATOM   7856 C C   . GLN B 1 554 ? 101.358 5.527   68.573  1.00 21.57 ? 576 GLN B C   1 
ATOM   7857 O O   . GLN B 1 554 ? 100.663 4.683   69.151  1.00 21.71 ? 576 GLN B O   1 
ATOM   7858 C CB  . GLN B 1 554 ? 103.864 5.390   68.506  1.00 26.26 ? 576 GLN B CB  1 
ATOM   7859 C CG  . GLN B 1 554 ? 105.131 5.335   67.653  1.00 39.96 ? 576 GLN B CG  1 
ATOM   7860 C CD  . GLN B 1 554 ? 106.415 5.408   68.475  1.00 41.14 ? 576 GLN B CD  1 
ATOM   7861 O OE1 . GLN B 1 554 ? 107.172 6.378   68.377  1.00 38.56 ? 576 GLN B OE1 1 
ATOM   7862 N NE2 . GLN B 1 554 ? 106.675 4.373   69.275  1.00 33.63 ? 576 GLN B NE2 1 
ATOM   7863 N N   . GLN B 1 555 ? 101.088 6.834   68.636  1.00 16.13 ? 577 GLN B N   1 
ATOM   7864 C CA  . GLN B 1 555 ? 99.916  7.308   69.363  1.00 16.26 ? 577 GLN B CA  1 
ATOM   7865 C C   . GLN B 1 555 ? 98.627  6.768   68.758  1.00 25.18 ? 577 GLN B C   1 
ATOM   7866 O O   . GLN B 1 555 ? 97.652  6.532   69.482  1.00 26.11 ? 577 GLN B O   1 
ATOM   7867 C CB  . GLN B 1 555 ? 99.892  8.835   69.381  1.00 15.92 ? 577 GLN B CB  1 
ATOM   7868 C CG  . GLN B 1 555 ? 98.922  9.432   70.381  1.00 18.53 ? 577 GLN B CG  1 
ATOM   7869 C CD  . GLN B 1 555 ? 99.279  10.862  70.752  1.00 27.46 ? 577 GLN B CD  1 
ATOM   7870 O OE1 . GLN B 1 555 ? 100.456 11.230  70.804  1.00 24.65 ? 577 GLN B OE1 1 
ATOM   7871 N NE2 . GLN B 1 555 ? 98.261  11.678  71.012  1.00 24.10 ? 577 GLN B NE2 1 
ATOM   7872 N N   . ALA B 1 556 ? 98.606  6.551   67.440  1.00 24.18 ? 578 ALA B N   1 
ATOM   7873 C CA  . ALA B 1 556 ? 97.392  6.073   66.790  1.00 20.68 ? 578 ALA B CA  1 
ATOM   7874 C C   . ALA B 1 556 ? 97.145  4.592   67.054  1.00 21.30 ? 578 ALA B C   1 
ATOM   7875 O O   . ALA B 1 556 ? 95.989  4.153   67.049  1.00 20.86 ? 578 ALA B O   1 
ATOM   7876 C CB  . ALA B 1 556 ? 97.469  6.337   65.289  1.00 23.21 ? 578 ALA B CB  1 
ATOM   7877 N N   . SER B 1 557 ? 98.203  3.804   67.270  1.00 23.98 ? 579 SER B N   1 
ATOM   7878 C CA  . SER B 1 557 ? 98.000  2.401   67.619  1.00 24.27 ? 579 SER B CA  1 
ATOM   7879 C C   . SER B 1 557 ? 97.478  2.248   69.043  1.00 24.09 ? 579 SER B C   1 
ATOM   7880 O O   . SER B 1 557 ? 96.692  1.332   69.316  1.00 18.69 ? 579 SER B O   1 
ATOM   7881 C CB  . SER B 1 557 ? 99.296  1.613   67.438  1.00 21.45 ? 579 SER B CB  1 
ATOM   7882 O OG  . SER B 1 557 ? 100.397 2.322   67.971  1.00 25.63 ? 579 SER B OG  1 
ATOM   7883 N N   . VAL B 1 558 ? 97.900  3.127   69.958  1.00 18.48 ? 580 VAL B N   1 
ATOM   7884 C CA  . VAL B 1 558 ? 97.338  3.121   71.308  1.00 21.63 ? 580 VAL B CA  1 
ATOM   7885 C C   . VAL B 1 558 ? 95.836  3.372   71.253  1.00 21.71 ? 580 VAL B C   1 
ATOM   7886 O O   . VAL B 1 558 ? 95.043  2.639   71.856  1.00 27.99 ? 580 VAL B O   1 
ATOM   7887 C CB  . VAL B 1 558 ? 98.051  4.156   72.198  1.00 20.26 ? 580 VAL B CB  1 
ATOM   7888 C CG1 . VAL B 1 558 ? 97.407  4.202   73.567  1.00 15.77 ? 580 VAL B CG1 1 
ATOM   7889 C CG2 . VAL B 1 558 ? 99.528  3.831   72.324  1.00 17.40 ? 580 VAL B CG2 1 
ATOM   7890 N N   . ALA B 1 559 ? 95.422  4.410   70.521  1.00 20.88 ? 581 ALA B N   1 
ATOM   7891 C CA  . ALA B 1 559 ? 93.996  4.668   70.343  1.00 24.01 ? 581 ALA B CA  1 
ATOM   7892 C C   . ALA B 1 559 ? 93.309  3.535   69.591  1.00 25.71 ? 581 ALA B C   1 
ATOM   7893 O O   . ALA B 1 559 ? 92.143  3.226   69.866  1.00 27.76 ? 581 ALA B O   1 
ATOM   7894 C CB  . ALA B 1 559 ? 93.785  5.989   69.606  1.00 18.15 ? 581 ALA B CB  1 
ATOM   7895 N N   . LYS B 1 560 ? 94.008  2.907   68.643  1.00 23.61 ? 582 LYS B N   1 
ATOM   7896 C CA  . LYS B 1 560 ? 93.405  1.820   67.879  1.00 23.06 ? 582 LYS B CA  1 
ATOM   7897 C C   . LYS B 1 560 ? 93.088  0.626   68.771  1.00 28.67 ? 582 LYS B C   1 
ATOM   7898 O O   . LYS B 1 560 ? 92.029  0.002   68.629  1.00 31.50 ? 582 LYS B O   1 
ATOM   7899 C CB  . LYS B 1 560 ? 94.331  1.406   66.736  1.00 20.57 ? 582 LYS B CB  1 
ATOM   7900 C CG  . LYS B 1 560 ? 93.841  0.184   65.969  1.00 22.74 ? 582 LYS B CG  1 
ATOM   7901 C CD  . LYS B 1 560 ? 94.604  0.008   64.670  1.00 29.38 ? 582 LYS B CD  1 
ATOM   7902 C CE  . LYS B 1 560 ? 96.097  -0.113  64.915  1.00 23.05 ? 582 LYS B CE  1 
ATOM   7903 N NZ  . LYS B 1 560 ? 96.831  -0.194  63.628  1.00 18.40 ? 582 LYS B NZ  1 
ATOM   7904 N N   . LYS B 1 561 ? 93.995  0.290   69.691  1.00 30.89 ? 583 LYS B N   1 
ATOM   7905 C CA  . LYS B 1 561 ? 93.747  -0.828  70.594  1.00 26.07 ? 583 LYS B CA  1 
ATOM   7906 C C   . LYS B 1 561 ? 92.517  -0.571  71.456  1.00 32.19 ? 583 LYS B C   1 
ATOM   7907 O O   . LYS B 1 561 ? 91.683  -1.465  71.642  1.00 31.82 ? 583 LYS B O   1 
ATOM   7908 C CB  . LYS B 1 561 ? 94.984  -1.078  71.458  1.00 33.55 ? 583 LYS B CB  1 
ATOM   7909 C CG  . LYS B 1 561 ? 94.835  -2.188  72.494  1.00 47.31 ? 583 LYS B CG  1 
ATOM   7910 C CD  . LYS B 1 561 ? 94.664  -1.618  73.900  1.00 45.83 ? 583 LYS B CD  1 
ATOM   7911 C CE  . LYS B 1 561 ? 95.689  -0.529  74.186  1.00 42.07 ? 583 LYS B CE  1 
ATOM   7912 N NZ  . LYS B 1 561 ? 95.276  0.332   75.328  1.00 50.63 ? 583 LYS B NZ  1 
ATOM   7913 N N   . GLU B 1 562 ? 92.378  0.654   71.975  1.00 31.72 ? 584 GLU B N   1 
ATOM   7914 C CA  . GLU B 1 562 ? 91.218  0.983   72.800  1.00 28.11 ? 584 GLU B CA  1 
ATOM   7915 C C   . GLU B 1 562 ? 89.923  0.894   72.001  1.00 27.77 ? 584 GLU B C   1 
ATOM   7916 O O   . GLU B 1 562 ? 88.913  0.380   72.498  1.00 33.28 ? 584 GLU B O   1 
ATOM   7917 C CB  . GLU B 1 562 ? 91.370  2.382   73.395  1.00 30.72 ? 584 GLU B CB  1 
ATOM   7918 C CG  . GLU B 1 562 ? 92.688  2.649   74.097  1.00 34.80 ? 584 GLU B CG  1 
ATOM   7919 C CD  . GLU B 1 562 ? 92.804  4.093   74.563  1.00 46.55 ? 584 GLU B CD  1 
ATOM   7920 O OE1 . GLU B 1 562 ? 91.790  4.643   75.054  1.00 42.08 ? 584 GLU B OE1 1 
ATOM   7921 O OE2 . GLU B 1 562 ? 93.904  4.680   74.429  1.00 41.59 ? 584 GLU B OE2 1 
ATOM   7922 N N   . ILE B 1 563 ? 89.928  1.400   70.766  1.00 24.36 ? 585 ILE B N   1 
ATOM   7923 C CA  . ILE B 1 563 ? 88.726  1.346   69.939  1.00 26.12 ? 585 ILE B CA  1 
ATOM   7924 C C   . ILE B 1 563 ? 88.356  -0.099  69.635  1.00 26.83 ? 585 ILE B C   1 
ATOM   7925 O O   . ILE B 1 563 ? 87.179  -0.477  69.685  1.00 33.82 ? 585 ILE B O   1 
ATOM   7926 C CB  . ILE B 1 563 ? 88.926  2.163   68.648  1.00 30.37 ? 585 ILE B CB  1 
ATOM   7927 C CG1 . ILE B 1 563 ? 89.059  3.651   68.978  1.00 20.18 ? 585 ILE B CG1 1 
ATOM   7928 C CG2 . ILE B 1 563 ? 87.784  1.912   67.655  1.00 13.94 ? 585 ILE B CG2 1 
ATOM   7929 C CD1 . ILE B 1 563 ? 89.606  4.473   67.845  1.00 18.36 ? 585 ILE B CD1 1 
ATOM   7930 N N   . LEU B 1 564 ? 89.352  -0.932  69.327  1.00 24.06 ? 586 LEU B N   1 
ATOM   7931 C CA  . LEU B 1 564 ? 89.063  -2.320  68.987  1.00 24.26 ? 586 LEU B CA  1 
ATOM   7932 C C   . LEU B 1 564 ? 88.531  -3.094  70.185  1.00 28.12 ? 586 LEU B C   1 
ATOM   7933 O O   . LEU B 1 564 ? 87.729  -4.020  70.015  1.00 24.76 ? 586 LEU B O   1 
ATOM   7934 C CB  . LEU B 1 564 ? 90.313  -2.987  68.426  1.00 23.19 ? 586 LEU B CB  1 
ATOM   7935 C CG  . LEU B 1 564 ? 90.553  -2.636  66.962  1.00 20.80 ? 586 LEU B CG  1 
ATOM   7936 C CD1 . LEU B 1 564 ? 91.829  -3.249  66.473  1.00 21.35 ? 586 LEU B CD1 1 
ATOM   7937 C CD2 . LEU B 1 564 ? 89.390  -3.098  66.108  1.00 22.60 ? 586 LEU B CD2 1 
ATOM   7938 N N   . GLN B 1 565 ? 88.952  -2.728  71.398  1.00 29.89 ? 587 GLN B N   1 
ATOM   7939 C CA  . GLN B 1 565 ? 88.423  -3.385  72.586  1.00 27.06 ? 587 GLN B CA  1 
ATOM   7940 C C   . GLN B 1 565 ? 86.945  -3.072  72.769  1.00 35.41 ? 587 GLN B C   1 
ATOM   7941 O O   . GLN B 1 565 ? 86.147  -3.969  73.069  1.00 42.98 ? 587 GLN B O   1 
ATOM   7942 C CB  . GLN B 1 565 ? 89.226  -2.972  73.818  1.00 26.77 ? 587 GLN B CB  1 
ATOM   7943 C CG  . GLN B 1 565 ? 90.599  -3.630  73.892  1.00 37.27 ? 587 GLN B CG  1 
ATOM   7944 C CD  . GLN B 1 565 ? 91.444  -3.128  75.050  1.00 46.98 ? 587 GLN B CD  1 
ATOM   7945 O OE1 . GLN B 1 565 ? 91.159  -2.084  75.643  1.00 45.45 ? 587 GLN B OE1 1 
ATOM   7946 N NE2 . GLN B 1 565 ? 92.496  -3.872  75.375  1.00 50.86 ? 587 GLN B NE2 1 
ATOM   7947 N N   . ILE B 1 566 ? 86.560  -1.808  72.581  1.00 30.53 ? 588 ILE B N   1 
ATOM   7948 C CA  . ILE B 1 566 ? 85.149  -1.448  72.663  1.00 27.95 ? 588 ILE B CA  1 
ATOM   7949 C C   . ILE B 1 566 ? 84.361  -2.141  71.560  1.00 31.46 ? 588 ILE B C   1 
ATOM   7950 O O   . ILE B 1 566 ? 83.268  -2.670  71.797  1.00 34.38 ? 588 ILE B O   1 
ATOM   7951 C CB  . ILE B 1 566 ? 84.987  0.083   72.605  1.00 26.33 ? 588 ILE B CB  1 
ATOM   7952 C CG1 . ILE B 1 566 ? 85.689  0.737   73.798  1.00 19.45 ? 588 ILE B CG1 1 
ATOM   7953 C CG2 . ILE B 1 566 ? 83.515  0.470   72.559  1.00 20.74 ? 588 ILE B CG2 1 
ATOM   7954 C CD1 . ILE B 1 566 ? 85.964  2.203   73.615  1.00 20.85 ? 588 ILE B CD1 1 
ATOM   7955 N N   . MET B 1 567 ? 84.910  -2.163  70.341  1.00 28.24 ? 589 MET B N   1 
ATOM   7956 C CA  . MET B 1 567 ? 84.243  -2.839  69.232  1.00 34.17 ? 589 MET B CA  1 
ATOM   7957 C C   . MET B 1 567 ? 84.067  -4.322  69.524  1.00 33.65 ? 589 MET B C   1 
ATOM   7958 O O   . MET B 1 567 ? 82.978  -4.880  69.336  1.00 28.51 ? 589 MET B O   1 
ATOM   7959 C CB  . MET B 1 567 ? 85.037  -2.648  67.938  1.00 35.06 ? 589 MET B CB  1 
ATOM   7960 C CG  . MET B 1 567 ? 84.974  -1.254  67.342  1.00 31.38 ? 589 MET B CG  1 
ATOM   7961 S SD  . MET B 1 567 ? 86.098  -1.069  65.940  1.00 32.14 ? 589 MET B SD  1 
ATOM   7962 C CE  . MET B 1 567 ? 85.371  -2.190  64.747  1.00 24.86 ? 589 MET B CE  1 
ATOM   7963 N N   . ASN B 1 568 ? 85.135  -4.979  69.984  1.00 33.44 ? 590 ASN B N   1 
ATOM   7964 C CA  . ASN B 1 568 ? 85.084  -6.421  70.193  1.00 36.68 ? 590 ASN B CA  1 
ATOM   7965 C C   . ASN B 1 568 ? 84.107  -6.810  71.295  1.00 39.75 ? 590 ASN B C   1 
ATOM   7966 O O   . ASN B 1 568 ? 83.616  -7.945  71.294  1.00 37.43 ? 590 ASN B O   1 
ATOM   7967 C CB  . ASN B 1 568 ? 86.484  -6.958  70.492  1.00 30.91 ? 590 ASN B CB  1 
ATOM   7968 C CG  . ASN B 1 568 ? 87.327  -7.109  69.233  1.00 35.67 ? 590 ASN B CG  1 
ATOM   7969 O OD1 . ASN B 1 568 ? 86.803  -7.368  68.147  1.00 33.56 ? 590 ASN B OD1 1 
ATOM   7970 N ND2 . ASN B 1 568 ? 88.639  -6.942  69.372  1.00 31.90 ? 590 ASN B ND2 1 
ATOM   7971 N N   . LYS B 1 569 ? 83.804  -5.894  72.221  1.00 34.28 ? 591 LYS B N   1 
ATOM   7972 C CA  . LYS B 1 569 ? 82.736  -6.149  73.182  1.00 29.20 ? 591 LYS B CA  1 
ATOM   7973 C C   . LYS B 1 569 ? 81.395  -6.309  72.477  1.00 31.16 ? 591 LYS B C   1 
ATOM   7974 O O   . LYS B 1 569 ? 80.602  -7.191  72.826  1.00 35.05 ? 591 LYS B O   1 
ATOM   7975 C CB  . LYS B 1 569 ? 82.671  -5.017  74.209  1.00 33.41 ? 591 LYS B CB  1 
ATOM   7976 C CG  . LYS B 1 569 ? 83.682  -5.128  75.338  1.00 30.34 ? 591 LYS B CG  1 
ATOM   7977 C CD  . LYS B 1 569 ? 83.526  -3.979  76.320  1.00 34.51 ? 591 LYS B CD  1 
ATOM   7978 C CE  . LYS B 1 569 ? 84.618  -3.999  77.377  1.00 45.67 ? 591 LYS B CE  1 
ATOM   7979 N NZ  . LYS B 1 569 ? 84.553  -2.799  78.256  1.00 50.53 ? 591 LYS B NZ  1 
ATOM   7980 N N   . THR B 1 570 ? 81.124  -5.468  71.478  1.00 36.06 ? 592 THR B N   1 
ATOM   7981 C CA  . THR B 1 570 ? 79.886  -5.595  70.715  1.00 37.23 ? 592 THR B CA  1 
ATOM   7982 C C   . THR B 1 570 ? 79.902  -6.849  69.849  1.00 34.23 ? 592 THR B C   1 
ATOM   7983 O O   . THR B 1 570 ? 78.960  -7.650  69.880  1.00 36.13 ? 592 THR B O   1 
ATOM   7984 C CB  . THR B 1 570 ? 79.666  -4.348  69.856  1.00 41.52 ? 592 THR B CB  1 
ATOM   7985 O OG1 . THR B 1 570 ? 79.524  -3.200  70.705  1.00 44.66 ? 592 THR B OG1 1 
ATOM   7986 C CG2 . THR B 1 570 ? 78.416  -4.504  68.999  1.00 27.50 ? 592 THR B CG2 1 
ATOM   7987 N N   . ILE B 1 571 ? 80.961  -7.032  69.066  1.00 35.44 ? 593 ILE B N   1 
ATOM   7988 C CA  . ILE B 1 571 ? 81.158  -8.256  68.296  1.00 28.37 ? 593 ILE B CA  1 
ATOM   7989 C C   . ILE B 1 571 ? 82.646  -8.384  68.009  1.00 37.90 ? 593 ILE B C   1 
ATOM   7990 O O   . ILE B 1 571 ? 83.314  -7.403  67.671  1.00 38.21 ? 593 ILE B O   1 
ATOM   7991 C CB  . ILE B 1 571 ? 80.308  -8.258  67.002  1.00 29.23 ? 593 ILE B CB  1 
ATOM   7992 C CG1 . ILE B 1 571 ? 80.395  -9.613  66.298  1.00 32.35 ? 593 ILE B CG1 1 
ATOM   7993 C CG2 . ILE B 1 571 ? 80.726  -7.131  66.064  1.00 30.94 ? 593 ILE B CG2 1 
ATOM   7994 C CD1 . ILE B 1 571 ? 79.376  -9.782  65.184  1.00 25.86 ? 593 ILE B CD1 1 
ATOM   7995 N N   . SER B 1 572 ? 83.170  -9.601  68.174  1.00 43.00 ? 594 SER B N   1 
ATOM   7996 C CA  . SER B 1 572 ? 84.586  -9.861  67.955  1.00 40.17 ? 594 SER B CA  1 
ATOM   7997 C C   . SER B 1 572 ? 84.857  -10.921 66.900  1.00 39.32 ? 594 SER B C   1 
ATOM   7998 O O   . SER B 1 572 ? 86.010  -11.060 66.475  1.00 40.22 ? 594 SER B O   1 
ATOM   7999 C CB  . SER B 1 572 ? 85.266  -10.280 69.268  1.00 32.04 ? 594 SER B CB  1 
ATOM   8000 O OG  . SER B 1 572 ? 84.692  -11.468 69.777  1.00 38.37 ? 594 SER B OG  1 
ATOM   8001 N N   . LYS B 1 573 ? 83.845  -11.666 66.469  1.00 36.26 ? 595 LYS B N   1 
ATOM   8002 C CA  . LYS B 1 573 ? 84.006  -12.666 65.428  1.00 32.96 ? 595 LYS B CA  1 
ATOM   8003 C C   . LYS B 1 573 ? 82.872  -12.542 64.421  1.00 36.91 ? 595 LYS B C   1 
ATOM   8004 O O   . LYS B 1 573 ? 81.746  -12.169 64.779  1.00 34.87 ? 595 LYS B O   1 
ATOM   8005 C CB  . LYS B 1 573 ? 84.040  -14.089 66.019  1.00 34.83 ? 595 LYS B CB  1 
ATOM   8006 C CG  . LYS B 1 573 ? 82.680  -14.742 66.256  1.00 46.04 ? 595 LYS B CG  1 
ATOM   8007 C CD  . LYS B 1 573 ? 82.485  -15.962 65.362  1.00 52.64 ? 595 LYS B CD  1 
ATOM   8008 C CE  . LYS B 1 573 ? 81.189  -16.701 65.687  1.00 52.61 ? 595 LYS B CE  1 
ATOM   8009 N NZ  . LYS B 1 573 ? 81.119  -18.033 65.013  1.00 40.97 ? 595 LYS B NZ  1 
ATOM   8010 N N   . PRO B 1 574 ? 83.150  -12.809 63.146  1.00 34.90 ? 596 PRO B N   1 
ATOM   8011 C CA  . PRO B 1 574 ? 82.087  -12.750 62.135  1.00 37.91 ? 596 PRO B CA  1 
ATOM   8012 C C   . PRO B 1 574 ? 81.046  -13.824 62.402  1.00 36.75 ? 596 PRO B C   1 
ATOM   8013 O O   . PRO B 1 574 ? 81.388  -14.973 62.684  1.00 37.16 ? 596 PRO B O   1 
ATOM   8014 C CB  . PRO B 1 574 ? 82.833  -12.996 60.816  1.00 38.09 ? 596 PRO B CB  1 
ATOM   8015 C CG  . PRO B 1 574 ? 84.280  -12.730 61.122  1.00 33.85 ? 596 PRO B CG  1 
ATOM   8016 C CD  . PRO B 1 574 ? 84.464  -13.107 62.556  1.00 40.34 ? 596 PRO B CD  1 
ATOM   8017 N N   . ARG B 1 575 ? 79.772  -13.436 62.328  1.00 36.64 ? 597 ARG B N   1 
ATOM   8018 C CA  . ARG B 1 575 ? 78.677  -14.381 62.511  1.00 38.10 ? 597 ARG B CA  1 
ATOM   8019 C C   . ARG B 1 575 ? 78.884  -15.610 61.637  1.00 42.74 ? 597 ARG B C   1 
ATOM   8020 O O   . ARG B 1 575 ? 79.139  -15.497 60.436  1.00 47.12 ? 597 ARG B O   1 
ATOM   8021 C CB  . ARG B 1 575 ? 77.343  -13.714 62.172  1.00 36.71 ? 597 ARG B CB  1 
ATOM   8022 C CG  . ARG B 1 575 ? 76.993  -12.528 63.059  1.00 38.59 ? 597 ARG B CG  1 
ATOM   8023 C CD  . ARG B 1 575 ? 75.489  -12.419 63.269  1.00 35.81 ? 597 ARG B CD  1 
ATOM   8024 N NE  . ARG B 1 575 ? 75.100  -11.140 63.861  1.00 37.91 ? 597 ARG B NE  1 
ATOM   8025 C CZ  . ARG B 1 575 ? 75.257  -10.826 65.145  1.00 38.24 ? 597 ARG B CZ  1 
ATOM   8026 N NH1 . ARG B 1 575 ? 75.806  -11.694 65.988  1.00 31.61 ? 597 ARG B NH1 1 
ATOM   8027 N NH2 . ARG B 1 575 ? 74.866  -9.640  65.590  1.00 34.84 ? 597 ARG B NH2 1 
ATOM   8028 N N   . ALA B 1 576 ? 78.790  -16.790 62.257  1.00 50.96 ? 598 ALA B N   1 
ATOM   8029 C CA  . ALA B 1 576 ? 79.065  -18.038 61.552  1.00 43.34 ? 598 ALA B CA  1 
ATOM   8030 C C   . ALA B 1 576 ? 78.104  -18.282 60.396  1.00 49.26 ? 598 ALA B C   1 
ATOM   8031 O O   . ALA B 1 576 ? 78.457  -19.000 59.454  1.00 54.42 ? 598 ALA B O   1 
ATOM   8032 C CB  . ALA B 1 576 ? 79.013  -19.213 62.526  1.00 45.23 ? 598 ALA B CB  1 
ATOM   8033 N N   . SER B 1 577 ? 76.909  -17.700 60.439  1.00 51.77 ? 599 SER B N   1 
ATOM   8034 C CA  . SER B 1 577 ? 75.928  -17.852 59.375  1.00 56.22 ? 599 SER B CA  1 
ATOM   8035 C C   . SER B 1 577 ? 75.368  -16.490 58.994  1.00 56.10 ? 599 SER B C   1 
ATOM   8036 O O   . SER B 1 577 ? 75.241  -15.595 59.836  1.00 57.56 ? 599 SER B O   1 
ATOM   8037 C CB  . SER B 1 577 ? 74.781  -18.782 59.798  1.00 64.28 ? 599 SER B CB  1 
ATOM   8038 O OG  . SER B 1 577 ? 74.330  -18.473 61.108  1.00 70.86 ? 599 SER B OG  1 
ATOM   8039 N N   . ARG B 1 578 ? 75.037  -16.340 57.715  1.00 46.45 ? 600 ARG B N   1 
ATOM   8040 C CA  . ARG B 1 578 ? 74.351  -15.142 57.261  1.00 48.58 ? 600 ARG B CA  1 
ATOM   8041 C C   . ARG B 1 578 ? 72.870  -15.221 57.626  1.00 55.49 ? 600 ARG B C   1 
ATOM   8042 O O   . ARG B 1 578 ? 72.356  -16.268 58.031  1.00 61.22 ? 600 ARG B O   1 
ATOM   8043 C CB  . ARG B 1 578 ? 74.528  -14.959 55.754  1.00 45.76 ? 600 ARG B CB  1 
ATOM   8044 C CG  . ARG B 1 578 ? 75.976  -14.869 55.306  1.00 33.61 ? 600 ARG B CG  1 
ATOM   8045 C CD  . ARG B 1 578 ? 76.094  -14.406 53.860  1.00 29.01 ? 600 ARG B CD  1 
ATOM   8046 N NE  . ARG B 1 578 ? 75.627  -15.414 52.913  1.00 29.25 ? 600 ARG B NE  1 
ATOM   8047 C CZ  . ARG B 1 578 ? 76.381  -16.406 52.448  1.00 31.95 ? 600 ARG B CZ  1 
ATOM   8048 N NH1 . ARG B 1 578 ? 77.643  -16.522 52.850  1.00 31.75 ? 600 ARG B NH1 1 
ATOM   8049 N NH2 . ARG B 1 578 ? 75.875  -17.282 51.586  1.00 20.74 ? 600 ARG B NH2 1 
ATOM   8050 N N   . LYS B 1 579 ? 72.179  -14.094 57.482  1.00 47.54 ? 601 LYS B N   1 
ATOM   8051 C CA  . LYS B 1 579 ? 70.770  -14.043 57.844  1.00 57.20 ? 601 LYS B CA  1 
ATOM   8052 C C   . LYS B 1 579 ? 69.937  -14.890 56.885  1.00 56.98 ? 601 LYS B C   1 
ATOM   8053 O O   . LYS B 1 579 ? 70.281  -15.060 55.712  1.00 59.46 ? 601 LYS B O   1 
ATOM   8054 C CB  . LYS B 1 579 ? 70.283  -12.595 57.862  1.00 54.68 ? 601 LYS B CB  1 
ATOM   8055 C CG  . LYS B 1 579 ? 71.359  -11.618 58.319  1.00 43.72 ? 601 LYS B CG  1 
ATOM   8056 C CD  . LYS B 1 579 ? 70.837  -10.611 59.329  1.00 38.46 ? 601 LYS B CD  1 
ATOM   8057 C CE  . LYS B 1 579 ? 71.981  -9.792  59.917  1.00 40.24 ? 601 LYS B CE  1 
ATOM   8058 N NZ  . LYS B 1 579 ? 71.510  -8.526  60.552  1.00 47.18 ? 601 LYS B NZ  1 
ATOM   8059 N N   . GLU B 1 580 ? 68.834  -15.440 57.408  1.00 62.41 ? 602 GLU B N   1 
ATOM   8060 C CA  . GLU B 1 580 ? 68.047  -16.414 56.656  1.00 71.19 ? 602 GLU B CA  1 
ATOM   8061 C C   . GLU B 1 580 ? 67.345  -15.797 55.453  1.00 75.30 ? 602 GLU B C   1 
ATOM   8062 O O   . GLU B 1 580 ? 67.016  -16.519 54.504  1.00 70.37 ? 602 GLU B O   1 
ATOM   8063 C CB  . GLU B 1 580 ? 67.026  -17.093 57.574  1.00 72.06 ? 602 GLU B CB  1 
ATOM   8064 C CG  . GLU B 1 580 ? 67.499  -18.434 58.135  1.00 76.90 ? 602 GLU B CG  1 
ATOM   8065 C CD  . GLU B 1 580 ? 66.364  -19.424 58.346  1.00 75.41 ? 602 GLU B CD  1 
ATOM   8066 O OE1 . GLU B 1 580 ? 65.716  -19.819 57.352  1.00 69.12 ? 602 GLU B OE1 1 
ATOM   8067 O OE2 . GLU B 1 580 ? 66.123  -19.813 59.508  1.00 70.00 ? 602 GLU B OE2 1 
ATOM   8068 N N   . ASN B 1 581 ? 67.106  -14.488 55.471  1.00 69.09 ? 603 ASN B N   1 
ATOM   8069 C CA  . ASN B 1 581 ? 66.643  -13.774 54.288  1.00 73.89 ? 603 ASN B CA  1 
ATOM   8070 C C   . ASN B 1 581 ? 67.766  -13.515 53.288  1.00 71.37 ? 603 ASN B C   1 
ATOM   8071 O O   . ASN B 1 581 ? 67.514  -12.918 52.235  1.00 61.61 ? 603 ASN B O   1 
ATOM   8072 C CB  . ASN B 1 581 ? 65.996  -12.446 54.702  1.00 84.91 ? 603 ASN B CB  1 
ATOM   8073 C CG  . ASN B 1 581 ? 65.075  -11.880 53.632  1.00 78.84 ? 603 ASN B CG  1 
ATOM   8074 O OD1 . ASN B 1 581 ? 64.500  -12.621 52.834  1.00 81.05 ? 603 ASN B OD1 1 
ATOM   8075 N ND2 . ASN B 1 581 ? 64.932  -10.560 53.613  1.00 71.02 ? 603 ASN B ND2 1 
ATOM   8076 N N   . GLY B 1 582 ? 68.988  -13.952 53.590  1.00 75.25 ? 604 GLY B N   1 
ATOM   8077 C CA  . GLY B 1 582 ? 70.133  -13.693 52.753  1.00 62.97 ? 604 GLY B CA  1 
ATOM   8078 C C   . GLY B 1 582 ? 69.986  -14.265 51.361  1.00 53.25 ? 604 GLY B C   1 
ATOM   8079 O O   . GLY B 1 582 ? 69.278  -15.252 51.137  1.00 52.16 ? 604 GLY B O   1 
ATOM   8080 N N   . PRO B 1 583 ? 70.659  -13.645 50.394  1.00 50.67 ? 605 PRO B N   1 
ATOM   8081 C CA  . PRO B 1 583 ? 70.576  -14.114 49.006  1.00 45.42 ? 605 PRO B CA  1 
ATOM   8082 C C   . PRO B 1 583 ? 71.091  -15.537 48.857  1.00 40.32 ? 605 PRO B C   1 
ATOM   8083 O O   . PRO B 1 583 ? 71.703  -16.117 49.756  1.00 49.16 ? 605 PRO B O   1 
ATOM   8084 C CB  . PRO B 1 583 ? 71.456  -13.118 48.242  1.00 43.10 ? 605 PRO B CB  1 
ATOM   8085 C CG  . PRO B 1 583 ? 71.496  -11.898 49.111  1.00 38.47 ? 605 PRO B CG  1 
ATOM   8086 C CD  . PRO B 1 583 ? 71.456  -12.413 50.517  1.00 42.32 ? 605 PRO B CD  1 
ATOM   8087 N N   . VAL B 1 584 ? 70.834  -16.105 47.684  1.00 42.11 ? 606 VAL B N   1 
ATOM   8088 C CA  . VAL B 1 584 ? 71.249  -17.469 47.380  1.00 48.83 ? 606 VAL B CA  1 
ATOM   8089 C C   . VAL B 1 584 ? 71.563  -17.555 45.891  1.00 42.58 ? 606 VAL B C   1 
ATOM   8090 O O   . VAL B 1 584 ? 70.893  -16.927 45.066  1.00 39.39 ? 606 VAL B O   1 
ATOM   8091 C CB  . VAL B 1 584 ? 70.164  -18.485 47.808  1.00 37.92 ? 606 VAL B CB  1 
ATOM   8092 C CG1 . VAL B 1 584 ? 68.811  -18.118 47.206  1.00 36.94 ? 606 VAL B CG1 1 
ATOM   8093 C CG2 . VAL B 1 584 ? 70.568  -19.906 47.437  1.00 51.84 ? 606 VAL B CG2 1 
ATOM   8094 N N   . VAL B 1 585 ? 72.606  -18.314 45.551  1.00 42.52 ? 607 VAL B N   1 
ATOM   8095 C CA  . VAL B 1 585 ? 72.960  -18.575 44.161  1.00 49.45 ? 607 VAL B CA  1 
ATOM   8096 C C   . VAL B 1 585 ? 72.832  -20.067 43.893  1.00 49.48 ? 607 VAL B C   1 
ATOM   8097 O O   . VAL B 1 585 ? 73.049  -20.902 44.778  1.00 49.25 ? 607 VAL B O   1 
ATOM   8098 C CB  . VAL B 1 585 ? 74.379  -18.076 43.794  1.00 44.46 ? 607 VAL B CB  1 
ATOM   8099 C CG1 . VAL B 1 585 ? 74.597  -16.666 44.302  1.00 42.26 ? 607 VAL B CG1 1 
ATOM   8100 C CG2 . VAL B 1 585 ? 75.451  -19.020 44.330  1.00 45.09 ? 607 VAL B CG2 1 
ATOM   8101 N N   . GLU B 1 586 ? 72.461  -20.394 42.655  1.00 54.53 ? 608 GLU B N   1 
ATOM   8102 C CA  . GLU B 1 586 ? 72.314  -21.769 42.201  1.00 57.41 ? 608 GLU B CA  1 
ATOM   8103 C C   . GLU B 1 586 ? 72.739  -21.851 40.743  1.00 54.94 ? 608 GLU B C   1 
ATOM   8104 O O   . GLU B 1 586 ? 72.625  -20.877 39.995  1.00 60.81 ? 608 GLU B O   1 
ATOM   8105 C CB  . GLU B 1 586 ? 70.869  -22.270 42.356  1.00 53.68 ? 608 GLU B CB  1 
ATOM   8106 C CG  . GLU B 1 586 ? 70.538  -22.823 43.736  1.00 58.40 ? 608 GLU B CG  1 
ATOM   8107 C CD  . GLU B 1 586 ? 69.045  -22.862 44.004  1.00 64.64 ? 608 GLU B CD  1 
ATOM   8108 O OE1 . GLU B 1 586 ? 68.313  -22.063 43.385  1.00 59.10 ? 608 GLU B OE1 1 
ATOM   8109 O OE2 . GLU B 1 586 ? 68.602  -23.688 44.830  1.00 69.85 ? 608 GLU B OE2 1 
ATOM   8110 N N   . THR B 1 587 ? 73.233  -23.021 40.345  1.00 52.41 ? 609 THR B N   1 
ATOM   8111 C CA  . THR B 1 587 ? 73.700  -23.258 38.986  1.00 57.08 ? 609 THR B CA  1 
ATOM   8112 C C   . THR B 1 587 ? 72.690  -24.105 38.225  1.00 60.32 ? 609 THR B C   1 
ATOM   8113 O O   . THR B 1 587 ? 72.138  -25.068 38.767  1.00 59.10 ? 609 THR B O   1 
ATOM   8114 C CB  . THR B 1 587 ? 75.063  -23.956 38.978  1.00 61.63 ? 609 THR B CB  1 
ATOM   8115 O OG1 . THR B 1 587 ? 74.979  -25.179 39.720  1.00 74.17 ? 609 THR B OG1 1 
ATOM   8116 C CG2 . THR B 1 587 ? 76.123  -23.057 39.600  1.00 59.22 ? 609 THR B CG2 1 
ATOM   8117 N N   . VAL B 1 588 ? 72.458  -23.744 36.965  1.00 66.93 ? 610 VAL B N   1 
ATOM   8118 C CA  . VAL B 1 588 ? 71.500  -24.432 36.108  1.00 63.99 ? 610 VAL B CA  1 
ATOM   8119 C C   . VAL B 1 588 ? 72.198  -24.795 34.807  1.00 71.35 ? 610 VAL B C   1 
ATOM   8120 O O   . VAL B 1 588 ? 72.732  -23.917 34.117  1.00 77.30 ? 610 VAL B O   1 
ATOM   8121 C CB  . VAL B 1 588 ? 70.253  -23.576 35.833  1.00 53.00 ? 610 VAL B CB  1 
ATOM   8122 C CG1 . VAL B 1 588 ? 69.527  -24.081 34.598  1.00 57.39 ? 610 VAL B CG1 1 
ATOM   8123 C CG2 . VAL B 1 588 ? 69.331  -23.580 37.045  1.00 50.70 ? 610 VAL B CG2 1 
ATOM   8124 N N   . GLN B 1 589 ? 72.202  -26.085 34.481  1.00 76.28 ? 611 GLN B N   1 
ATOM   8125 C CA  . GLN B 1 589 ? 72.722  -26.592 33.218  1.00 76.06 ? 611 GLN B CA  1 
ATOM   8126 C C   . GLN B 1 589 ? 71.555  -26.780 32.259  1.00 81.33 ? 611 GLN B C   1 
ATOM   8127 O O   . GLN B 1 589 ? 70.610  -27.512 32.569  1.00 79.63 ? 611 GLN B O   1 
ATOM   8128 C CB  . GLN B 1 589 ? 73.468  -27.907 33.433  1.00 69.94 ? 611 GLN B CB  1 
ATOM   8129 C CG  . GLN B 1 589 ? 74.769  -27.726 34.186  1.00 74.06 ? 611 GLN B CG  1 
ATOM   8130 C CD  . GLN B 1 589 ? 75.946  -27.501 33.257  1.00 87.46 ? 611 GLN B CD  1 
ATOM   8131 O OE1 . GLN B 1 589 ? 75.848  -26.770 32.276  1.00 96.76 ? 611 GLN B OE1 1 
ATOM   8132 N NE2 . GLN B 1 589 ? 77.077  -28.100 33.586  1.00 85.55 ? 611 GLN B NE2 1 
ATOM   8133 N N   . VAL B 1 590 ? 71.616  -26.119 31.106  1.00 85.96 ? 612 VAL B N   1 
ATOM   8134 C CA  . VAL B 1 590 ? 70.497  -26.123 30.165  1.00 81.71 ? 612 VAL B CA  1 
ATOM   8135 C C   . VAL B 1 590 ? 70.767  -27.101 29.028  1.00 84.00 ? 612 VAL B C   1 
ATOM   8136 O O   . VAL B 1 590 ? 71.882  -27.134 28.488  1.00 84.44 ? 612 VAL B O   1 
ATOM   8137 C CB  . VAL B 1 590 ? 70.229  -24.714 29.612  1.00 76.28 ? 612 VAL B CB  1 
ATOM   8138 C CG1 . VAL B 1 590 ? 68.803  -24.612 29.083  1.00 74.14 ? 612 VAL B CG1 1 
ATOM   8139 C CG2 . VAL B 1 590 ? 70.484  -23.664 30.678  1.00 79.78 ? 612 VAL B CG2 1 
ATOM   8140 N N   . PRO B 1 591 ? 69.783  -27.918 28.633  1.00 89.64 ? 613 PRO B N   1 
ATOM   8141 C CA  . PRO B 1 591 ? 69.943  -28.731 27.420  1.00 89.12 ? 613 PRO B CA  1 
ATOM   8142 C C   . PRO B 1 591 ? 69.514  -27.973 26.172  1.00 88.20 ? 613 PRO B C   1 
ATOM   8143 O O   . PRO B 1 591 ? 68.400  -27.441 26.112  1.00 91.14 ? 613 PRO B O   1 
ATOM   8144 C CB  . PRO B 1 591 ? 69.044  -29.946 27.685  1.00 96.66 ? 613 PRO B CB  1 
ATOM   8145 C CG  . PRO B 1 591 ? 68.080  -29.516 28.772  1.00 94.47 ? 613 PRO B CG  1 
ATOM   8146 C CD  . PRO B 1 591 ? 68.505  -28.179 29.317  1.00 92.21 ? 613 PRO B CD  1 
ATOM   8147 N N   . LEU B 1 592 ? 70.394  -27.920 25.174  1.00 83.19 ? 614 LEU B N   1 
ATOM   8148 C CA  . LEU B 1 592 ? 70.152  -27.175 23.939  1.00 71.55 ? 614 LEU B CA  1 
ATOM   8149 C C   . LEU B 1 592 ? 68.873  -27.617 23.231  1.00 61.73 ? 614 LEU B C   1 
ATOM   8150 O O   . LEU B 1 592 ? 68.122  -26.790 22.712  1.00 48.57 ? 614 LEU B O   1 
ATOM   8151 C CB  . LEU B 1 592 ? 71.342  -27.326 22.988  1.00 65.40 ? 614 LEU B CB  1 
ATOM   8152 C CG  . LEU B 1 592 ? 72.631  -26.569 23.325  1.00 69.42 ? 614 LEU B CG  1 
ATOM   8153 C CD1 . LEU B 1 592 ? 72.323  -25.147 23.768  1.00 72.35 ? 614 LEU B CD1 1 
ATOM   8154 C CD2 . LEU B 1 592 ? 73.457  -27.300 24.382  1.00 64.55 ? 614 LEU B CD2 1 
ATOM   8155 N N   . PHE B 1 598 ? 65.382  -21.284 25.785  1.00 73.24 ? 620 PHE B N   1 
ATOM   8156 C CA  . PHE B 1 598 ? 65.491  -20.846 27.177  1.00 65.52 ? 620 PHE B CA  1 
ATOM   8157 C C   . PHE B 1 598 ? 66.117  -19.457 27.305  1.00 61.10 ? 620 PHE B C   1 
ATOM   8158 O O   . PHE B 1 598 ? 65.849  -18.729 28.264  1.00 62.02 ? 620 PHE B O   1 
ATOM   8159 C CB  . PHE B 1 598 ? 66.297  -21.859 27.989  1.00 75.32 ? 620 PHE B CB  1 
ATOM   8160 C CG  . PHE B 1 598 ? 66.572  -21.418 29.395  1.00 71.93 ? 620 PHE B CG  1 
ATOM   8161 C CD1 . PHE B 1 598 ? 65.535  -21.104 30.259  1.00 70.91 ? 620 PHE B CD1 1 
ATOM   8162 C CD2 . PHE B 1 598 ? 67.875  -21.292 29.844  1.00 65.55 ? 620 PHE B CD2 1 
ATOM   8163 C CE1 . PHE B 1 598 ? 65.797  -20.691 31.547  1.00 62.68 ? 620 PHE B CE1 1 
ATOM   8164 C CE2 . PHE B 1 598 ? 68.142  -20.879 31.132  1.00 68.07 ? 620 PHE B CE2 1 
ATOM   8165 C CZ  . PHE B 1 598 ? 67.103  -20.578 31.984  1.00 63.10 ? 620 PHE B CZ  1 
ATOM   8166 N N   . VAL B 1 599 ? 66.946  -19.080 26.337  1.00 65.49 ? 621 VAL B N   1 
ATOM   8167 C CA  . VAL B 1 599 ? 67.419  -17.701 26.286  1.00 68.23 ? 621 VAL B CA  1 
ATOM   8168 C C   . VAL B 1 599 ? 66.518  -16.858 25.387  1.00 69.12 ? 621 VAL B C   1 
ATOM   8169 O O   . VAL B 1 599 ? 66.374  -15.652 25.609  1.00 63.54 ? 621 VAL B O   1 
ATOM   8170 C CB  . VAL B 1 599 ? 68.893  -17.643 25.838  1.00 57.16 ? 621 VAL B CB  1 
ATOM   8171 C CG1 . VAL B 1 599 ? 69.366  -16.201 25.707  1.00 64.14 ? 621 VAL B CG1 1 
ATOM   8172 C CG2 . VAL B 1 599 ? 69.774  -18.380 26.832  1.00 46.96 ? 621 VAL B CG2 1 
ATOM   8173 N N   . GLY B 1 600 ? 65.869  -17.479 24.405  1.00 69.91 ? 622 GLY B N   1 
ATOM   8174 C CA  . GLY B 1 600 ? 64.924  -16.792 23.561  1.00 67.63 ? 622 GLY B CA  1 
ATOM   8175 C C   . GLY B 1 600 ? 65.584  -15.822 22.604  1.00 65.39 ? 622 GLY B C   1 
ATOM   8176 O O   . GLY B 1 600 ? 66.814  -15.735 22.515  1.00 68.19 ? 622 GLY B O   1 
ATOM   8177 N N   . PRO B 1 601 ? 64.770  -15.073 21.857  1.00 64.70 ? 623 PRO B N   1 
ATOM   8178 C CA  . PRO B 1 601 ? 65.325  -14.103 20.902  1.00 61.57 ? 623 PRO B CA  1 
ATOM   8179 C C   . PRO B 1 601 ? 66.043  -12.943 21.577  1.00 59.28 ? 623 PRO B C   1 
ATOM   8180 O O   . PRO B 1 601 ? 65.405  -12.034 22.120  1.00 55.86 ? 623 PRO B O   1 
ATOM   8181 C CB  . PRO B 1 601 ? 64.089  -13.624 20.129  1.00 64.31 ? 623 PRO B CB  1 
ATOM   8182 C CG  . PRO B 1 601 ? 62.930  -13.920 21.027  1.00 54.85 ? 623 PRO B CG  1 
ATOM   8183 C CD  . PRO B 1 601 ? 63.302  -15.162 21.776  1.00 59.20 ? 623 PRO B CD  1 
ATOM   8184 N N   . GLY B 1 602 ? 67.375  -12.971 21.549  1.00 64.91 ? 624 GLY B N   1 
ATOM   8185 C CA  . GLY B 1 602 ? 68.182  -11.897 22.092  1.00 61.97 ? 624 GLY B CA  1 
ATOM   8186 C C   . GLY B 1 602 ? 68.258  -11.826 23.600  1.00 61.67 ? 624 GLY B C   1 
ATOM   8187 O O   . GLY B 1 602 ? 68.844  -10.876 24.130  1.00 57.28 ? 624 GLY B O   1 
ATOM   8188 N N   . GLY B 1 603 ? 67.700  -12.798 24.311  1.00 63.99 ? 625 GLY B N   1 
ATOM   8189 C CA  . GLY B 1 603 ? 67.653  -12.749 25.755  1.00 59.13 ? 625 GLY B CA  1 
ATOM   8190 C C   . GLY B 1 603 ? 66.373  -12.199 26.339  1.00 61.10 ? 625 GLY B C   1 
ATOM   8191 O O   . GLY B 1 603 ? 66.330  -11.937 27.546  1.00 61.09 ? 625 GLY B O   1 
ATOM   8192 N N   . TYR B 1 604 ? 65.333  -12.002 25.518  1.00 65.71 ? 626 TYR B N   1 
ATOM   8193 C CA  . TYR B 1 604 ? 64.042  -11.555 26.031  1.00 58.62 ? 626 TYR B CA  1 
ATOM   8194 C C   . TYR B 1 604 ? 63.517  -12.497 27.105  1.00 57.66 ? 626 TYR B C   1 
ATOM   8195 O O   . TYR B 1 604 ? 62.797  -12.065 28.013  1.00 58.35 ? 626 TYR B O   1 
ATOM   8196 C CB  . TYR B 1 604 ? 63.038  -11.433 24.882  1.00 46.91 ? 626 TYR B CB  1 
ATOM   8197 C CG  . TYR B 1 604 ? 61.600  -11.267 25.320  1.00 41.31 ? 626 TYR B CG  1 
ATOM   8198 C CD1 . TYR B 1 604 ? 61.116  -10.029 25.719  1.00 47.49 ? 626 TYR B CD1 1 
ATOM   8199 C CD2 . TYR B 1 604 ? 60.725  -12.346 25.326  1.00 48.56 ? 626 TYR B CD2 1 
ATOM   8200 C CE1 . TYR B 1 604 ? 59.798  -9.868  26.118  1.00 50.43 ? 626 TYR B CE1 1 
ATOM   8201 C CE2 . TYR B 1 604 ? 59.406  -12.196 25.723  1.00 53.10 ? 626 TYR B CE2 1 
ATOM   8202 C CZ  . TYR B 1 604 ? 58.948  -10.954 26.119  1.00 52.59 ? 626 TYR B CZ  1 
ATOM   8203 O OH  . TYR B 1 604 ? 57.638  -10.796 26.517  1.00 52.47 ? 626 TYR B OH  1 
ATOM   8204 N N   . ASN B 1 605 ? 63.870  -13.780 27.013  1.00 63.38 ? 627 ASN B N   1 
ATOM   8205 C CA  . ASN B 1 605 ? 63.468  -14.745 28.026  1.00 60.81 ? 627 ASN B CA  1 
ATOM   8206 C C   . ASN B 1 605 ? 63.933  -14.305 29.409  1.00 53.20 ? 627 ASN B C   1 
ATOM   8207 O O   . ASN B 1 605 ? 63.143  -14.247 30.360  1.00 53.66 ? 627 ASN B O   1 
ATOM   8208 C CB  . ASN B 1 605 ? 64.037  -16.122 27.673  1.00 67.65 ? 627 ASN B CB  1 
ATOM   8209 C CG  . ASN B 1 605 ? 62.968  -17.186 27.609  1.00 76.21 ? 627 ASN B CG  1 
ATOM   8210 O OD1 . ASN B 1 605 ? 61.824  -16.940 27.978  1.00 72.60 ? 627 ASN B OD1 1 
ATOM   8211 N ND2 . ASN B 1 605 ? 63.318  -18.357 27.104  1.00 82.19 ? 627 ASN B ND2 1 
ATOM   8212 N N   . LEU B 1 606 ? 65.218  -13.977 29.538  1.00 45.21 ? 628 LEU B N   1 
ATOM   8213 C CA  . LEU B 1 606 ? 65.814  -13.750 30.846  1.00 44.61 ? 628 LEU B CA  1 
ATOM   8214 C C   . LEU B 1 606 ? 65.682  -12.313 31.323  1.00 55.93 ? 628 LEU B C   1 
ATOM   8215 O O   . LEU B 1 606 ? 65.680  -12.077 32.535  1.00 56.32 ? 628 LEU B O   1 
ATOM   8216 C CB  . LEU B 1 606 ? 67.284  -14.165 30.813  1.00 47.87 ? 628 LEU B CB  1 
ATOM   8217 C CG  . LEU B 1 606 ? 67.442  -15.545 30.179  1.00 54.32 ? 628 LEU B CG  1 
ATOM   8218 C CD1 . LEU B 1 606 ? 68.831  -15.742 29.592  1.00 45.07 ? 628 LEU B CD1 1 
ATOM   8219 C CD2 . LEU B 1 606 ? 67.109  -16.636 31.188  1.00 56.96 ? 628 LEU B CD2 1 
ATOM   8220 N N   . LYS B 1 607 ? 65.579  -11.348 30.405  1.00 59.81 ? 629 LYS B N   1 
ATOM   8221 C CA  . LYS B 1 607 ? 65.176  -10.007 30.812  1.00 54.59 ? 629 LYS B CA  1 
ATOM   8222 C C   . LYS B 1 607 ? 63.808  -10.045 31.482  1.00 51.42 ? 629 LYS B C   1 
ATOM   8223 O O   . LYS B 1 607 ? 63.588  -9.384  32.504  1.00 49.45 ? 629 LYS B O   1 
ATOM   8224 C CB  . LYS B 1 607 ? 65.173  -9.065  29.607  1.00 53.81 ? 629 LYS B CB  1 
ATOM   8225 C CG  . LYS B 1 607 ? 66.492  -9.020  28.848  1.00 50.05 ? 629 LYS B CG  1 
ATOM   8226 C CD  . LYS B 1 607 ? 67.346  -7.838  29.287  1.00 57.88 ? 629 LYS B CD  1 
ATOM   8227 C CE  . LYS B 1 607 ? 68.802  -8.015  28.880  1.00 49.04 ? 629 LYS B CE  1 
ATOM   8228 N NZ  . LYS B 1 607 ? 68.948  -8.227  27.413  1.00 49.44 ? 629 LYS B NZ  1 
ATOM   8229 N N   . LYS B 1 608 ? 62.886  -10.845 30.934  1.00 49.22 ? 630 LYS B N   1 
ATOM   8230 C CA  . LYS B 1 608 ? 61.575  -11.023 31.551  1.00 50.81 ? 630 LYS B CA  1 
ATOM   8231 C C   . LYS B 1 608 ? 61.675  -11.706 32.908  1.00 49.69 ? 630 LYS B C   1 
ATOM   8232 O O   . LYS B 1 608 ? 60.877  -11.412 33.805  1.00 56.00 ? 630 LYS B O   1 
ATOM   8233 C CB  . LYS B 1 608 ? 60.666  -11.830 30.625  1.00 52.70 ? 630 LYS B CB  1 
ATOM   8234 C CG  . LYS B 1 608 ? 59.222  -11.934 31.099  1.00 52.04 ? 630 LYS B CG  1 
ATOM   8235 C CD  . LYS B 1 608 ? 58.325  -12.529 30.020  1.00 55.54 ? 630 LYS B CD  1 
ATOM   8236 C CE  . LYS B 1 608 ? 56.848  -12.328 30.340  1.00 58.16 ? 630 LYS B CE  1 
ATOM   8237 N NZ  . LYS B 1 608 ? 56.411  -13.090 31.548  1.00 47.18 ? 630 LYS B NZ  1 
ATOM   8238 N N   . LEU B 1 609 ? 62.635  -12.615 33.079  1.00 50.91 ? 631 LEU B N   1 
ATOM   8239 C CA  . LEU B 1 609 ? 62.768  -13.324 34.346  1.00 49.79 ? 631 LEU B CA  1 
ATOM   8240 C C   . LEU B 1 609 ? 63.205  -12.380 35.460  1.00 52.92 ? 631 LEU B C   1 
ATOM   8241 O O   . LEU B 1 609 ? 62.585  -12.341 36.533  1.00 56.42 ? 631 LEU B O   1 
ATOM   8242 C CB  . LEU B 1 609 ? 63.757  -14.481 34.196  1.00 43.07 ? 631 LEU B CB  1 
ATOM   8243 C CG  . LEU B 1 609 ? 64.358  -15.014 35.494  1.00 45.70 ? 631 LEU B CG  1 
ATOM   8244 C CD1 . LEU B 1 609 ? 63.278  -15.618 36.382  1.00 49.30 ? 631 LEU B CD1 1 
ATOM   8245 C CD2 . LEU B 1 609 ? 65.451  -16.030 35.198  1.00 46.69 ? 631 LEU B CD2 1 
ATOM   8246 N N   . GLN B 1 610 ? 64.277  -11.612 35.223  1.00 52.98 ? 632 GLN B N   1 
ATOM   8247 C CA  . GLN B 1 610 ? 64.772  -10.676 36.229  1.00 51.95 ? 632 GLN B CA  1 
ATOM   8248 C C   . GLN B 1 610 ? 63.820  -9.513  36.452  1.00 56.20 ? 632 GLN B C   1 
ATOM   8249 O O   . GLN B 1 610 ? 63.802  -8.930  37.541  1.00 61.11 ? 632 GLN B O   1 
ATOM   8250 C CB  . GLN B 1 610 ? 66.152  -10.138 35.817  1.00 53.14 ? 632 GLN B CB  1 
ATOM   8251 C CG  . GLN B 1 610 ? 67.024  -11.131 35.088  1.00 54.50 ? 632 GLN B CG  1 
ATOM   8252 C CD  . GLN B 1 610 ? 68.348  -10.530 34.682  1.00 51.73 ? 632 GLN B CD  1 
ATOM   8253 O OE1 . GLN B 1 610 ? 68.579  -9.333  34.842  1.00 55.57 ? 632 GLN B OE1 1 
ATOM   8254 N NE2 . GLN B 1 610 ? 69.226  -11.358 34.141  1.00 46.35 ? 632 GLN B NE2 1 
ATOM   8255 N N   . ALA B 1 611 ? 63.035  -9.160  35.439  1.00 53.13 ? 633 ALA B N   1 
ATOM   8256 C CA  . ALA B 1 611 ? 62.094  -8.059  35.589  1.00 46.44 ? 633 ALA B CA  1 
ATOM   8257 C C   . ALA B 1 611 ? 60.962  -8.427  36.538  1.00 46.96 ? 633 ALA B C   1 
ATOM   8258 O O   . ALA B 1 611 ? 60.517  -7.597  37.344  1.00 49.30 ? 633 ALA B O   1 
ATOM   8259 C CB  . ALA B 1 611 ? 61.541  -7.664  34.221  1.00 48.49 ? 633 ALA B CB  1 
ATOM   8260 N N   . GLU B 1 612 ? 60.490  -9.668  36.463  1.00 47.98 ? 634 GLU B N   1 
ATOM   8261 C CA  . GLU B 1 612 ? 59.323  -10.093 37.222  1.00 54.22 ? 634 GLU B CA  1 
ATOM   8262 C C   . GLU B 1 612 ? 59.686  -10.571 38.624  1.00 54.03 ? 634 GLU B C   1 
ATOM   8263 O O   . GLU B 1 612 ? 59.096  -10.115 39.609  1.00 50.13 ? 634 GLU B O   1 
ATOM   8264 C CB  . GLU B 1 612 ? 58.579  -11.189 36.452  1.00 50.93 ? 634 GLU B CB  1 
ATOM   8265 C CG  . GLU B 1 612 ? 57.952  -10.699 35.153  1.00 55.45 ? 634 GLU B CG  1 
ATOM   8266 C CD  . GLU B 1 612 ? 57.042  -11.728 34.507  1.00 61.95 ? 634 GLU B CD  1 
ATOM   8267 O OE1 . GLU B 1 612 ? 57.119  -12.919 34.884  1.00 57.65 ? 634 GLU B OE1 1 
ATOM   8268 O OE2 . GLU B 1 612 ? 56.250  -11.342 33.619  1.00 58.00 ? 634 GLU B OE2 1 
ATOM   8269 N N   . THR B 1 613 ? 60.654  -11.481 38.733  1.00 50.64 ? 635 THR B N   1 
ATOM   8270 C CA  . THR B 1 613 ? 61.022  -12.048 40.024  1.00 49.53 ? 635 THR B CA  1 
ATOM   8271 C C   . THR B 1 613 ? 62.085  -11.241 40.754  1.00 45.68 ? 635 THR B C   1 
ATOM   8272 O O   . THR B 1 613 ? 62.169  -11.329 41.985  1.00 41.22 ? 635 THR B O   1 
ATOM   8273 C CB  . THR B 1 613 ? 61.525  -13.483 39.852  1.00 42.98 ? 635 THR B CB  1 
ATOM   8274 O OG1 . THR B 1 613 ? 62.862  -13.460 39.338  1.00 44.75 ? 635 THR B OG1 1 
ATOM   8275 C CG2 . THR B 1 613 ? 60.635  -14.242 38.890  1.00 46.25 ? 635 THR B CG2 1 
ATOM   8276 N N   . GLY B 1 614 ? 62.895  -10.471 40.033  1.00 46.07 ? 636 GLY B N   1 
ATOM   8277 C CA  . GLY B 1 614 ? 63.958  -9.697  40.638  1.00 44.53 ? 636 GLY B CA  1 
ATOM   8278 C C   . GLY B 1 614 ? 65.275  -10.422 40.812  1.00 49.68 ? 636 GLY B C   1 
ATOM   8279 O O   . GLY B 1 614 ? 66.155  -9.910  41.516  1.00 51.06 ? 636 GLY B O   1 
ATOM   8280 N N   . VAL B 1 615 ? 65.441  -11.595 40.203  1.00 46.28 ? 637 VAL B N   1 
ATOM   8281 C CA  . VAL B 1 615 ? 66.686  -12.346 40.317  1.00 42.31 ? 637 VAL B CA  1 
ATOM   8282 C C   . VAL B 1 615 ? 67.653  -11.843 39.253  1.00 42.85 ? 637 VAL B C   1 
ATOM   8283 O O   . VAL B 1 615 ? 67.315  -10.951 38.470  1.00 47.33 ? 637 VAL B O   1 
ATOM   8284 C CB  . VAL B 1 615 ? 66.438  -13.862 40.190  1.00 44.39 ? 637 VAL B CB  1 
ATOM   8285 C CG1 . VAL B 1 615 ? 65.373  -14.309 41.179  1.00 43.35 ? 637 VAL B CG1 1 
ATOM   8286 C CG2 . VAL B 1 615 ? 66.034  -14.222 38.773  1.00 48.56 ? 637 VAL B CG2 1 
ATOM   8287 N N   . THR B 1 616 ? 68.866  -12.394 39.221  1.00 43.23 ? 638 THR B N   1 
ATOM   8288 C CA  . THR B 1 616 ? 69.884  -11.991 38.255  1.00 46.08 ? 638 THR B CA  1 
ATOM   8289 C C   . THR B 1 616 ? 70.535  -13.243 37.684  1.00 45.95 ? 638 THR B C   1 
ATOM   8290 O O   . THR B 1 616 ? 71.105  -14.043 38.434  1.00 43.81 ? 638 THR B O   1 
ATOM   8291 C CB  . THR B 1 616 ? 70.940  -11.080 38.900  1.00 42.69 ? 638 THR B CB  1 
ATOM   8292 O OG1 . THR B 1 616 ? 70.323  -9.874  39.370  1.00 31.18 ? 638 THR B OG1 1 
ATOM   8293 C CG2 . THR B 1 616 ? 72.023  -10.724 37.897  1.00 39.54 ? 638 THR B CG2 1 
ATOM   8294 N N   . ILE B 1 617 ? 70.454  -13.410 36.364  1.00 45.56 ? 639 ILE B N   1 
ATOM   8295 C CA  . ILE B 1 617 ? 70.960  -14.604 35.697  1.00 46.70 ? 639 ILE B CA  1 
ATOM   8296 C C   . ILE B 1 617 ? 72.141  -14.232 34.807  1.00 58.94 ? 639 ILE B C   1 
ATOM   8297 O O   . ILE B 1 617 ? 72.250  -13.106 34.305  1.00 62.84 ? 639 ILE B O   1 
ATOM   8298 C CB  . ILE B 1 617 ? 69.854  -15.319 34.886  1.00 47.76 ? 639 ILE B CB  1 
ATOM   8299 C CG1 . ILE B 1 617 ? 70.331  -16.678 34.378  1.00 47.43 ? 639 ILE B CG1 1 
ATOM   8300 C CG2 . ILE B 1 617 ? 69.404  -14.481 33.715  1.00 56.00 ? 639 ILE B CG2 1 
ATOM   8301 C CD1 . ILE B 1 617 ? 69.210  -17.563 33.904  1.00 54.14 ? 639 ILE B CD1 1 
ATOM   8302 N N   . SER B 1 618 ? 73.040  -15.201 34.633  1.00 60.18 ? 640 SER B N   1 
ATOM   8303 C CA  . SER B 1 618 ? 74.220  -15.111 33.780  1.00 55.41 ? 640 SER B CA  1 
ATOM   8304 C C   . SER B 1 618 ? 74.840  -16.500 33.709  1.00 62.62 ? 640 SER B C   1 
ATOM   8305 O O   . SER B 1 618 ? 74.394  -17.432 34.385  1.00 70.48 ? 640 SER B O   1 
ATOM   8306 C CB  . SER B 1 618 ? 75.231  -14.089 34.311  1.00 63.02 ? 640 SER B CB  1 
ATOM   8307 O OG  . SER B 1 618 ? 75.696  -14.453 35.601  1.00 58.84 ? 640 SER B OG  1 
ATOM   8308 N N   . GLN B 1 619 ? 75.873  -16.628 32.878  1.00 73.28 ? 641 GLN B N   1 
ATOM   8309 C CA  . GLN B 1 619 ? 76.710  -17.830 32.880  1.00 74.72 ? 641 GLN B CA  1 
ATOM   8310 C C   . GLN B 1 619 ? 78.117  -17.464 33.331  1.00 70.55 ? 641 GLN B C   1 
ATOM   8311 O O   . GLN B 1 619 ? 78.941  -17.033 32.524  1.00 69.03 ? 641 GLN B O   1 
ATOM   8312 C CB  . GLN B 1 619 ? 76.770  -18.483 31.492  1.00 73.06 ? 641 GLN B CB  1 
ATOM   8313 C CG  . GLN B 1 619 ? 77.033  -19.996 31.547  1.00 83.64 ? 641 GLN B CG  1 
ATOM   8314 C CD  . GLN B 1 619 ? 78.507  -20.381 31.427  1.00 88.86 ? 641 GLN B CD  1 
ATOM   8315 O OE1 . GLN B 1 619 ? 79.370  -19.804 32.090  1.00 84.01 ? 641 GLN B OE1 1 
ATOM   8316 N NE2 . GLN B 1 619 ? 78.792  -21.393 30.609  1.00 74.31 ? 641 GLN B NE2 1 
ATOM   8317 N N   . THR B 1 624 ? 75.442  -23.822 31.634  1.00 79.97 ? 646 THR B N   1 
ATOM   8318 C CA  . THR B 1 624 ? 75.925  -23.710 33.004  1.00 80.52 ? 646 THR B CA  1 
ATOM   8319 C C   . THR B 1 624 ? 75.556  -22.345 33.582  1.00 82.89 ? 646 THR B C   1 
ATOM   8320 O O   . THR B 1 624 ? 76.400  -21.638 34.131  1.00 89.40 ? 646 THR B O   1 
ATOM   8321 C CB  . THR B 1 624 ? 77.445  -23.916 33.078  1.00 86.71 ? 646 THR B CB  1 
ATOM   8322 O OG1 . THR B 1 624 ? 77.841  -24.883 32.094  1.00 83.88 ? 646 THR B OG1 1 
ATOM   8323 C CG2 . THR B 1 624 ? 77.846  -24.409 34.464  1.00 80.84 ? 646 THR B CG2 1 
ATOM   8324 N N   . PHE B 1 625 ? 74.281  -21.994 33.454  1.00 79.11 ? 647 PHE B N   1 
ATOM   8325 C CA  . PHE B 1 625 ? 73.813  -20.688 33.888  1.00 72.47 ? 647 PHE B CA  1 
ATOM   8326 C C   . PHE B 1 625 ? 73.832  -20.589 35.408  1.00 64.51 ? 647 PHE B C   1 
ATOM   8327 O O   . PHE B 1 625 ? 73.570  -21.566 36.115  1.00 63.76 ? 647 PHE B O   1 
ATOM   8328 C CB  . PHE B 1 625 ? 72.403  -20.436 33.357  1.00 72.04 ? 647 PHE B CB  1 
ATOM   8329 C CG  . PHE B 1 625 ? 72.354  -20.111 31.888  1.00 82.99 ? 647 PHE B CG  1 
ATOM   8330 C CD1 . PHE B 1 625 ? 72.917  -20.963 30.951  1.00 83.78 ? 647 PHE B CD1 1 
ATOM   8331 C CD2 . PHE B 1 625 ? 71.731  -18.956 31.444  1.00 78.21 ? 647 PHE B CD2 1 
ATOM   8332 C CE1 . PHE B 1 625 ? 72.869  -20.666 29.602  1.00 79.19 ? 647 PHE B CE1 1 
ATOM   8333 C CE2 . PHE B 1 625 ? 71.678  -18.654 30.095  1.00 71.04 ? 647 PHE B CE2 1 
ATOM   8334 C CZ  . PHE B 1 625 ? 72.249  -19.511 29.174  1.00 69.63 ? 647 PHE B CZ  1 
ATOM   8335 N N   . SER B 1 626 ? 74.149  -19.396 35.904  1.00 60.85 ? 648 SER B N   1 
ATOM   8336 C CA  . SER B 1 626 ? 74.130  -19.084 37.327  1.00 58.05 ? 648 SER B CA  1 
ATOM   8337 C C   . SER B 1 626 ? 73.083  -18.010 37.578  1.00 52.30 ? 648 SER B C   1 
ATOM   8338 O O   . SER B 1 626 ? 73.022  -17.019 36.843  1.00 58.01 ? 648 SER B O   1 
ATOM   8339 C CB  . SER B 1 626 ? 75.505  -18.609 37.806  1.00 51.22 ? 648 SER B CB  1 
ATOM   8340 O OG  . SER B 1 626 ? 75.392  -17.852 38.999  1.00 38.68 ? 648 SER B OG  1 
ATOM   8341 N N   . VAL B 1 627 ? 72.260  -18.201 38.607  1.00 45.40 ? 649 VAL B N   1 
ATOM   8342 C CA  . VAL B 1 627 ? 71.176  -17.278 38.924  1.00 40.36 ? 649 VAL B CA  1 
ATOM   8343 C C   . VAL B 1 627 ? 71.341  -16.803 40.361  1.00 38.61 ? 649 VAL B C   1 
ATOM   8344 O O   . VAL B 1 627 ? 71.468  -17.617 41.282  1.00 39.93 ? 649 VAL B O   1 
ATOM   8345 C CB  . VAL B 1 627 ? 69.791  -17.919 38.701  1.00 41.66 ? 649 VAL B CB  1 
ATOM   8346 C CG1 . VAL B 1 627 ? 69.721  -19.299 39.337  1.00 47.92 ? 649 VAL B CG1 1 
ATOM   8347 C CG2 . VAL B 1 627 ? 68.685  -17.015 39.232  1.00 38.30 ? 649 VAL B CG2 1 
ATOM   8348 N N   . PHE B 1 628 ? 71.355  -15.487 40.542  1.00 41.13 ? 650 PHE B N   1 
ATOM   8349 C CA  . PHE B 1 628 ? 71.420  -14.857 41.851  1.00 35.53 ? 650 PHE B CA  1 
ATOM   8350 C C   . PHE B 1 628 ? 70.036  -14.344 42.227  1.00 36.44 ? 650 PHE B C   1 
ATOM   8351 O O   . PHE B 1 628 ? 69.337  -13.761 41.395  1.00 41.86 ? 650 PHE B O   1 
ATOM   8352 C CB  . PHE B 1 628 ? 72.431  -13.704 41.842  1.00 33.23 ? 650 PHE B CB  1 
ATOM   8353 C CG  . PHE B 1 628 ? 72.345  -12.800 43.042  1.00 35.15 ? 650 PHE B CG  1 
ATOM   8354 C CD1 . PHE B 1 628 ? 71.518  -11.685 43.034  1.00 31.21 ? 650 PHE B CD1 1 
ATOM   8355 C CD2 . PHE B 1 628 ? 73.104  -13.053 44.170  1.00 34.99 ? 650 PHE B CD2 1 
ATOM   8356 C CE1 . PHE B 1 628 ? 71.441  -10.856 44.129  1.00 29.38 ? 650 PHE B CE1 1 
ATOM   8357 C CE2 . PHE B 1 628 ? 73.031  -12.222 45.269  1.00 33.16 ? 650 PHE B CE2 1 
ATOM   8358 C CZ  . PHE B 1 628 ? 72.199  -11.123 45.247  1.00 34.52 ? 650 PHE B CZ  1 
ATOM   8359 N N   . ALA B 1 629 ? 69.646  -14.552 43.484  1.00 30.79 ? 651 ALA B N   1 
ATOM   8360 C CA  . ALA B 1 629 ? 68.338  -14.125 43.958  1.00 33.68 ? 651 ALA B CA  1 
ATOM   8361 C C   . ALA B 1 629 ? 68.490  -13.382 45.280  1.00 33.72 ? 651 ALA B C   1 
ATOM   8362 O O   . ALA B 1 629 ? 69.078  -13.925 46.230  1.00 30.97 ? 651 ALA B O   1 
ATOM   8363 C CB  . ALA B 1 629 ? 67.397  -15.322 44.123  1.00 39.17 ? 651 ALA B CB  1 
ATOM   8364 N N   . PRO B 1 630 ? 67.961  -12.160 45.393  1.00 35.35 ? 652 PRO B N   1 
ATOM   8365 C CA  . PRO B 1 630 ? 68.144  -11.398 46.639  1.00 37.05 ? 652 PRO B CA  1 
ATOM   8366 C C   . PRO B 1 630 ? 67.563  -12.092 47.856  1.00 42.37 ? 652 PRO B C   1 
ATOM   8367 O O   . PRO B 1 630 ? 68.064  -11.899 48.972  1.00 40.11 ? 652 PRO B O   1 
ATOM   8368 C CB  . PRO B 1 630 ? 67.421  -10.071 46.352  1.00 30.23 ? 652 PRO B CB  1 
ATOM   8369 C CG  . PRO B 1 630 ? 67.233  -10.027 44.865  1.00 33.74 ? 652 PRO B CG  1 
ATOM   8370 C CD  . PRO B 1 630 ? 67.108  -11.448 44.427  1.00 35.87 ? 652 PRO B CD  1 
ATOM   8371 N N   . THR B 1 631 ? 66.515  -12.886 47.673  1.00 44.69 ? 653 THR B N   1 
ATOM   8372 C CA  . THR B 1 631 ? 65.848  -13.615 48.737  1.00 46.87 ? 653 THR B CA  1 
ATOM   8373 C C   . THR B 1 631 ? 65.600  -15.046 48.289  1.00 45.69 ? 653 THR B C   1 
ATOM   8374 O O   . THR B 1 631 ? 65.491  -15.313 47.087  1.00 43.24 ? 653 THR B O   1 
ATOM   8375 C CB  . THR B 1 631 ? 64.506  -12.964 49.113  1.00 42.28 ? 653 THR B CB  1 
ATOM   8376 O OG1 . THR B 1 631 ? 63.624  -12.997 47.984  1.00 49.99 ? 653 THR B OG1 1 
ATOM   8377 C CG2 . THR B 1 631 ? 64.705  -11.524 49.546  1.00 36.62 ? 653 THR B CG2 1 
ATOM   8378 N N   . PRO B 1 632 ? 65.519  -15.990 49.229  1.00 50.36 ? 654 PRO B N   1 
ATOM   8379 C CA  . PRO B 1 632 ? 65.114  -17.351 48.846  1.00 52.06 ? 654 PRO B CA  1 
ATOM   8380 C C   . PRO B 1 632 ? 63.723  -17.402 48.242  1.00 54.84 ? 654 PRO B C   1 
ATOM   8381 O O   . PRO B 1 632 ? 63.453  -18.275 47.406  1.00 55.44 ? 654 PRO B O   1 
ATOM   8382 C CB  . PRO B 1 632 ? 65.192  -18.127 50.169  1.00 44.90 ? 654 PRO B CB  1 
ATOM   8383 C CG  . PRO B 1 632 ? 66.128  -17.338 51.021  1.00 49.44 ? 654 PRO B CG  1 
ATOM   8384 C CD  . PRO B 1 632 ? 65.897  -15.904 50.650  1.00 53.78 ? 654 PRO B CD  1 
ATOM   8385 N N   . SER B 1 633 ? 62.833  -16.484 48.634  1.00 53.38 ? 655 SER B N   1 
ATOM   8386 C CA  . SER B 1 633 ? 61.500  -16.434 48.041  1.00 51.55 ? 655 SER B CA  1 
ATOM   8387 C C   . SER B 1 633 ? 61.566  -16.077 46.561  1.00 54.44 ? 655 SER B C   1 
ATOM   8388 O O   . SER B 1 633 ? 60.881  -16.696 45.737  1.00 56.25 ? 655 SER B O   1 
ATOM   8389 C CB  . SER B 1 633 ? 60.625  -15.432 48.793  1.00 55.96 ? 655 SER B CB  1 
ATOM   8390 O OG  . SER B 1 633 ? 59.474  -15.091 48.038  1.00 59.79 ? 655 SER B OG  1 
ATOM   8391 N N   . ALA B 1 634 ? 62.376  -15.077 46.206  1.00 56.72 ? 656 ALA B N   1 
ATOM   8392 C CA  . ALA B 1 634 ? 62.561  -14.744 44.798  1.00 56.27 ? 656 ALA B CA  1 
ATOM   8393 C C   . ALA B 1 634 ? 63.204  -15.896 44.038  1.00 56.36 ? 656 ALA B C   1 
ATOM   8394 O O   . ALA B 1 634 ? 62.923  -16.091 42.849  1.00 56.08 ? 656 ALA B O   1 
ATOM   8395 C CB  . ALA B 1 634 ? 63.403  -13.476 44.660  1.00 49.24 ? 656 ALA B CB  1 
ATOM   8396 N N   . MET B 1 635 ? 64.061  -16.671 44.706  1.00 53.77 ? 657 MET B N   1 
ATOM   8397 C CA  . MET B 1 635 ? 64.652  -17.841 44.068  1.00 48.34 ? 657 MET B CA  1 
ATOM   8398 C C   . MET B 1 635 ? 63.593  -18.877 43.719  1.00 53.53 ? 657 MET B C   1 
ATOM   8399 O O   . MET B 1 635 ? 63.740  -19.610 42.735  1.00 57.56 ? 657 MET B O   1 
ATOM   8400 C CB  . MET B 1 635 ? 65.715  -18.449 44.984  1.00 46.59 ? 657 MET B CB  1 
ATOM   8401 C CG  . MET B 1 635 ? 66.455  -19.619 44.377  1.00 41.69 ? 657 MET B CG  1 
ATOM   8402 S SD  . MET B 1 635 ? 67.004  -19.273 42.697  1.00 47.64 ? 657 MET B SD  1 
ATOM   8403 C CE  . MET B 1 635 ? 68.653  -18.633 42.994  1.00 42.45 ? 657 MET B CE  1 
ATOM   8404 N N   . HIS B 1 636 ? 62.517  -18.943 44.505  1.00 55.38 ? 658 HIS B N   1 
ATOM   8405 C CA  . HIS B 1 636 ? 61.456  -19.905 44.228  1.00 54.09 ? 658 HIS B CA  1 
ATOM   8406 C C   . HIS B 1 636 ? 60.679  -19.524 42.976  1.00 58.91 ? 658 HIS B C   1 
ATOM   8407 O O   . HIS B 1 636 ? 60.385  -20.381 42.135  1.00 58.17 ? 658 HIS B O   1 
ATOM   8408 C CB  . HIS B 1 636 ? 60.528  -20.015 45.435  1.00 53.43 ? 658 HIS B CB  1 
ATOM   8409 C CG  . HIS B 1 636 ? 61.216  -20.494 46.673  1.00 47.58 ? 658 HIS B CG  1 
ATOM   8410 N ND1 . HIS B 1 636 ? 62.294  -21.353 46.638  1.00 50.09 ? 658 HIS B ND1 1 
ATOM   8411 C CD2 . HIS B 1 636 ? 60.988  -20.228 47.981  1.00 42.23 ? 658 HIS B CD2 1 
ATOM   8412 C CE1 . HIS B 1 636 ? 62.696  -21.601 47.871  1.00 51.46 ? 658 HIS B CE1 1 
ATOM   8413 N NE2 . HIS B 1 636 ? 61.919  -20.932 48.705  1.00 51.10 ? 658 HIS B NE2 1 
ATOM   8414 N N   . GLU B 1 637 ? 60.336  -18.243 42.832  1.00 62.33 ? 659 GLU B N   1 
ATOM   8415 C CA  . GLU B 1 637 ? 59.725  -17.791 41.590  1.00 59.89 ? 659 GLU B CA  1 
ATOM   8416 C C   . GLU B 1 637 ? 60.677  -17.920 40.410  1.00 58.71 ? 659 GLU B C   1 
ATOM   8417 O O   . GLU B 1 637 ? 60.217  -18.014 39.267  1.00 62.98 ? 659 GLU B O   1 
ATOM   8418 C CB  . GLU B 1 637 ? 59.250  -16.346 41.730  1.00 52.30 ? 659 GLU B CB  1 
ATOM   8419 C CG  . GLU B 1 637 ? 58.101  -16.172 42.704  1.00 58.34 ? 659 GLU B CG  1 
ATOM   8420 C CD  . GLU B 1 637 ? 58.360  -15.073 43.713  1.00 73.91 ? 659 GLU B CD  1 
ATOM   8421 O OE1 . GLU B 1 637 ? 59.256  -14.237 43.464  1.00 73.67 ? 659 GLU B OE1 1 
ATOM   8422 O OE2 . GLU B 1 637 ? 57.672  -15.045 44.756  1.00 78.42 ? 659 GLU B OE2 1 
ATOM   8423 N N   . ALA B 1 638 ? 61.989  -17.938 40.661  1.00 54.25 ? 660 ALA B N   1 
ATOM   8424 C CA  . ALA B 1 638 ? 62.948  -18.132 39.579  1.00 51.91 ? 660 ALA B CA  1 
ATOM   8425 C C   . ALA B 1 638 ? 62.878  -19.553 39.034  1.00 58.77 ? 660 ALA B C   1 
ATOM   8426 O O   . ALA B 1 638 ? 62.799  -19.757 37.817  1.00 60.00 ? 660 ALA B O   1 
ATOM   8427 C CB  . ALA B 1 638 ? 64.361  -17.803 40.061  1.00 53.11 ? 660 ALA B CB  1 
ATOM   8428 N N   . ARG B 1 639 ? 62.901  -20.554 39.919  1.00 58.38 ? 661 ARG B N   1 
ATOM   8429 C CA  . ARG B 1 639 ? 62.767  -21.931 39.455  1.00 63.92 ? 661 ARG B CA  1 
ATOM   8430 C C   . ARG B 1 639 ? 61.366  -22.219 38.925  1.00 63.90 ? 661 ARG B C   1 
ATOM   8431 O O   . ARG B 1 639 ? 61.201  -23.138 38.114  1.00 55.48 ? 661 ARG B O   1 
ATOM   8432 C CB  . ARG B 1 639 ? 63.140  -22.911 40.572  1.00 65.03 ? 661 ARG B CB  1 
ATOM   8433 C CG  . ARG B 1 639 ? 62.483  -22.641 41.917  1.00 68.62 ? 661 ARG B CG  1 
ATOM   8434 C CD  . ARG B 1 639 ? 61.800  -23.890 42.467  1.00 68.90 ? 661 ARG B CD  1 
ATOM   8435 N NE  . ARG B 1 639 ? 61.083  -23.628 43.713  1.00 61.70 ? 661 ARG B NE  1 
ATOM   8436 C CZ  . ARG B 1 639 ? 59.824  -23.204 43.772  1.00 61.58 ? 661 ARG B CZ  1 
ATOM   8437 N NH1 . ARG B 1 639 ? 59.142  -22.994 42.653  1.00 66.57 ? 661 ARG B NH1 1 
ATOM   8438 N NH2 . ARG B 1 639 ? 59.245  -22.988 44.946  1.00 50.51 ? 661 ARG B NH2 1 
ATOM   8439 N N   . ASP B 1 640 ? 60.361  -21.449 39.355  1.00 63.82 ? 662 ASP B N   1 
ATOM   8440 C CA  . ASP B 1 640 ? 59.048  -21.510 38.718  1.00 64.95 ? 662 ASP B CA  1 
ATOM   8441 C C   . ASP B 1 640 ? 59.119  -21.044 37.269  1.00 71.13 ? 662 ASP B C   1 
ATOM   8442 O O   . ASP B 1 640 ? 58.448  -21.600 36.392  1.00 76.43 ? 662 ASP B O   1 
ATOM   8443 C CB  . ASP B 1 640 ? 58.045  -20.651 39.488  1.00 59.87 ? 662 ASP B CB  1 
ATOM   8444 C CG  . ASP B 1 640 ? 57.278  -21.432 40.528  1.00 64.16 ? 662 ASP B CG  1 
ATOM   8445 O OD1 . ASP B 1 640 ? 57.545  -22.644 40.684  1.00 61.71 ? 662 ASP B OD1 1 
ATOM   8446 O OD2 . ASP B 1 640 ? 56.404  -20.829 41.188  1.00 65.83 ? 662 ASP B OD2 1 
ATOM   8447 N N   . PHE B 1 641 ? 59.925  -20.014 37.005  1.00 71.38 ? 663 PHE B N   1 
ATOM   8448 C CA  . PHE B 1 641 ? 59.995  -19.437 35.668  1.00 70.13 ? 663 PHE B CA  1 
ATOM   8449 C C   . PHE B 1 641 ? 60.680  -20.381 34.688  1.00 71.07 ? 663 PHE B C   1 
ATOM   8450 O O   . PHE B 1 641 ? 60.274  -20.478 33.524  1.00 77.57 ? 663 PHE B O   1 
ATOM   8451 C CB  . PHE B 1 641 ? 60.728  -18.097 35.730  1.00 67.56 ? 663 PHE B CB  1 
ATOM   8452 C CG  . PHE B 1 641 ? 60.539  -17.241 34.512  1.00 68.86 ? 663 PHE B CG  1 
ATOM   8453 C CD1 . PHE B 1 641 ? 61.351  -17.403 33.401  1.00 65.27 ? 663 PHE B CD1 1 
ATOM   8454 C CD2 . PHE B 1 641 ? 59.556  -16.266 34.483  1.00 66.66 ? 663 PHE B CD2 1 
ATOM   8455 C CE1 . PHE B 1 641 ? 61.182  -16.615 32.280  1.00 64.03 ? 663 PHE B CE1 1 
ATOM   8456 C CE2 . PHE B 1 641 ? 59.382  -15.474 33.365  1.00 71.40 ? 663 PHE B CE2 1 
ATOM   8457 C CZ  . PHE B 1 641 ? 60.196  -15.648 32.261  1.00 67.26 ? 663 PHE B CZ  1 
ATOM   8458 N N   . ILE B 1 642 ? 61.719  -21.086 35.140  1.00 65.48 ? 664 ILE B N   1 
ATOM   8459 C CA  . ILE B 1 642 ? 62.496  -21.923 34.232  1.00 69.02 ? 664 ILE B CA  1 
ATOM   8460 C C   . ILE B 1 642 ? 61.744  -23.203 33.872  1.00 74.13 ? 664 ILE B C   1 
ATOM   8461 O O   . ILE B 1 642 ? 61.890  -23.718 32.755  1.00 75.20 ? 664 ILE B O   1 
ATOM   8462 C CB  . ILE B 1 642 ? 63.875  -22.217 34.851  1.00 70.73 ? 664 ILE B CB  1 
ATOM   8463 C CG1 . ILE B 1 642 ? 64.739  -20.953 34.837  1.00 68.51 ? 664 ILE B CG1 1 
ATOM   8464 C CG2 . ILE B 1 642 ? 64.590  -23.338 34.107  1.00 61.39 ? 664 ILE B CG2 1 
ATOM   8465 C CD1 . ILE B 1 642 ? 65.348  -20.596 36.174  1.00 51.87 ? 664 ILE B CD1 1 
ATOM   8466 N N   . THR B 1 643 ? 60.917  -23.725 34.783  1.00 78.98 ? 665 THR B N   1 
ATOM   8467 C CA  . THR B 1 643 ? 60.188  -24.958 34.493  1.00 80.84 ? 665 THR B CA  1 
ATOM   8468 C C   . THR B 1 643 ? 59.175  -24.757 33.369  1.00 78.29 ? 665 THR B C   1 
ATOM   8469 O O   . THR B 1 643 ? 58.990  -25.647 32.529  1.00 74.45 ? 665 THR B O   1 
ATOM   8470 C CB  . THR B 1 643 ? 59.497  -25.481 35.756  1.00 77.42 ? 665 THR B CB  1 
ATOM   8471 O OG1 . THR B 1 643 ? 58.802  -24.412 36.410  1.00 74.73 ? 665 THR B OG1 1 
ATOM   8472 C CG2 . THR B 1 643 ? 60.519  -26.082 36.716  1.00 61.31 ? 665 THR B CG2 1 
ATOM   8473 N N   . GLU B 1 644 ? 58.514  -23.595 33.329  1.00 75.30 ? 666 GLU B N   1 
ATOM   8474 C CA  . GLU B 1 644 ? 57.628  -23.277 32.213  1.00 73.68 ? 666 GLU B CA  1 
ATOM   8475 C C   . GLU B 1 644 ? 58.379  -23.154 30.894  1.00 76.87 ? 666 GLU B C   1 
ATOM   8476 O O   . GLU B 1 644 ? 57.739  -23.100 29.838  1.00 78.98 ? 666 GLU B O   1 
ATOM   8477 C CB  . GLU B 1 644 ? 56.864  -21.979 32.489  1.00 67.56 ? 666 GLU B CB  1 
ATOM   8478 C CG  . GLU B 1 644 ? 55.590  -22.155 33.302  1.00 73.61 ? 666 GLU B CG  1 
ATOM   8479 C CD  . GLU B 1 644 ? 54.409  -22.609 32.462  1.00 82.84 ? 666 GLU B CD  1 
ATOM   8480 O OE1 . GLU B 1 644 ? 54.574  -22.773 31.235  1.00 80.93 ? 666 GLU B OE1 1 
ATOM   8481 O OE2 . GLU B 1 644 ? 53.314  -22.804 33.033  1.00 76.63 ? 666 GLU B OE2 1 
ATOM   8482 N N   . ILE B 1 645 ? 59.707  -23.105 30.931  1.00 75.95 ? 667 ILE B N   1 
ATOM   8483 C CA  . ILE B 1 645 ? 60.530  -23.058 29.732  1.00 68.36 ? 667 ILE B CA  1 
ATOM   8484 C C   . ILE B 1 645 ? 61.277  -24.379 29.561  1.00 57.36 ? 667 ILE B C   1 
ATOM   8485 O O   . ILE B 1 645 ? 60.835  -25.272 28.840  1.00 58.40 ? 667 ILE B O   1 
ATOM   8486 C CB  . ILE B 1 645 ? 61.516  -21.879 29.786  1.00 66.69 ? 667 ILE B CB  1 
ATOM   8487 C CG1 . ILE B 1 645 ? 60.787  -20.590 30.184  1.00 63.61 ? 667 ILE B CG1 1 
ATOM   8488 C CG2 . ILE B 1 645 ? 62.240  -21.727 28.459  1.00 67.36 ? 667 ILE B CG2 1 
ATOM   8489 C CD1 . ILE B 1 645 ? 59.696  -20.174 29.222  1.00 61.28 ? 667 ILE B CD1 1 
HETATM 8490 O O   . HOH C 2 .   ? 62.052  4.496   48.576  1.00 35.31 ? 701 HOH A O   1 
HETATM 8491 O O   . HOH C 2 .   ? 80.320  21.928  -4.101  1.00 44.01 ? 702 HOH A O   1 
HETATM 8492 O O   . HOH C 2 .   ? 102.542 31.304  23.754  1.00 34.36 ? 703 HOH A O   1 
HETATM 8493 O O   . HOH C 2 .   ? 76.582  23.015  0.536   1.00 19.65 ? 704 HOH A O   1 
HETATM 8494 O O   . HOH C 2 .   ? 85.948  1.130   -1.934  1.00 17.33 ? 705 HOH A O   1 
HETATM 8495 O O   . HOH C 2 .   ? 58.579  22.579  58.061  1.00 46.79 ? 706 HOH A O   1 
HETATM 8496 O O   . HOH C 2 .   ? 82.737  6.710   1.703   1.00 19.45 ? 707 HOH A O   1 
HETATM 8497 O O   . HOH C 2 .   ? 105.968 19.753  22.267  1.00 25.80 ? 708 HOH A O   1 
HETATM 8498 O O   . HOH C 2 .   ? 62.233  14.619  9.569   1.00 15.58 ? 709 HOH A O   1 
HETATM 8499 O O   . HOH C 2 .   ? 53.989  12.280  17.479  1.00 21.89 ? 710 HOH A O   1 
HETATM 8500 O O   . HOH C 2 .   ? 101.973 7.125   15.369  1.00 26.45 ? 711 HOH A O   1 
HETATM 8501 O O   . HOH C 2 .   ? 77.903  31.212  23.673  1.00 27.95 ? 712 HOH A O   1 
HETATM 8502 O O   . HOH C 2 .   ? 93.647  2.624   4.112   1.00 30.74 ? 713 HOH A O   1 
HETATM 8503 O O   . HOH C 2 .   ? 72.887  -9.433  0.274   1.00 29.93 ? 714 HOH A O   1 
HETATM 8504 O O   . HOH C 2 .   ? 97.322  7.483   -0.300  1.00 28.69 ? 715 HOH A O   1 
HETATM 8505 O O   . HOH C 2 .   ? 69.075  2.107   11.007  1.00 24.47 ? 716 HOH A O   1 
HETATM 8506 O O   . HOH C 2 .   ? 74.900  -7.632  6.500   1.00 28.18 ? 717 HOH A O   1 
HETATM 8507 O O   . HOH C 2 .   ? 77.219  6.329   27.298  1.00 21.91 ? 718 HOH A O   1 
HETATM 8508 O O   . HOH C 2 .   ? 60.662  27.864  18.187  1.00 19.04 ? 719 HOH A O   1 
HETATM 8509 O O   . HOH C 2 .   ? 75.186  5.395   4.899   1.00 16.46 ? 720 HOH A O   1 
HETATM 8510 O O   . HOH C 2 .   ? 74.891  -5.530  8.534   1.00 13.78 ? 721 HOH A O   1 
HETATM 8511 O O   . HOH C 2 .   ? 66.884  3.508   11.597  1.00 24.46 ? 722 HOH A O   1 
HETATM 8512 O O   . HOH C 2 .   ? 80.682  17.848  -2.925  1.00 29.71 ? 723 HOH A O   1 
HETATM 8513 O O   . HOH C 2 .   ? 104.457 33.214  12.337  1.00 34.62 ? 724 HOH A O   1 
HETATM 8514 O O   . HOH C 2 .   ? 58.546  16.749  10.766  1.00 21.16 ? 725 HOH A O   1 
HETATM 8515 O O   . HOH C 2 .   ? 88.135  11.247  20.513  1.00 19.43 ? 726 HOH A O   1 
HETATM 8516 O O   . HOH C 2 .   ? 62.069  14.242  12.389  1.00 21.24 ? 727 HOH A O   1 
HETATM 8517 O O   . HOH C 2 .   ? 82.867  15.040  0.143   1.00 18.30 ? 728 HOH A O   1 
HETATM 8518 O O   . HOH C 2 .   ? 75.841  5.005   25.940  1.00 24.46 ? 729 HOH A O   1 
HETATM 8519 O O   . HOH C 2 .   ? 60.075  14.873  62.815  1.00 78.55 ? 730 HOH A O   1 
HETATM 8520 O O   . HOH C 2 .   ? 51.094  4.823   70.907  1.00 9.92  ? 731 HOH A O   1 
HETATM 8521 O O   . HOH C 2 .   ? 77.568  28.835  22.022  1.00 23.17 ? 732 HOH A O   1 
HETATM 8522 O O   . HOH C 2 .   ? 73.411  -2.736  -2.438  1.00 26.62 ? 733 HOH A O   1 
HETATM 8523 O O   . HOH C 2 .   ? 94.349  25.842  6.152   1.00 24.11 ? 734 HOH A O   1 
HETATM 8524 O O   . HOH C 2 .   ? 79.954  -7.113  11.984  1.00 19.55 ? 735 HOH A O   1 
HETATM 8525 O O   . HOH C 2 .   ? 51.508  7.568   70.391  1.00 16.72 ? 736 HOH A O   1 
HETATM 8526 O O   . HOH C 2 .   ? 52.163  19.665  73.657  1.00 21.42 ? 737 HOH A O   1 
HETATM 8527 O O   . HOH D 2 .   ? 98.824  4.478   41.257  1.00 25.30 ? 701 HOH B O   1 
HETATM 8528 O O   . HOH D 2 .   ? 111.047 22.647  24.574  1.00 37.37 ? 702 HOH B O   1 
HETATM 8529 O O   . HOH D 2 .   ? 89.614  3.938   75.742  1.00 19.81 ? 703 HOH B O   1 
HETATM 8530 O O   . HOH D 2 .   ? 95.846  36.012  69.496  1.00 34.07 ? 704 HOH B O   1 
HETATM 8531 O O   . HOH D 2 .   ? 99.645  29.600  28.786  1.00 30.97 ? 705 HOH B O   1 
HETATM 8532 O O   . HOH D 2 .   ? 110.016 26.082  32.373  1.00 32.98 ? 706 HOH B O   1 
HETATM 8533 O O   . HOH D 2 .   ? 99.146  42.716  52.806  1.00 30.61 ? 707 HOH B O   1 
HETATM 8534 O O   . HOH D 2 .   ? 93.596  -10.476 50.931  1.00 31.06 ? 708 HOH B O   1 
HETATM 8535 O O   . HOH D 2 .   ? 84.264  16.413  72.561  1.00 25.10 ? 709 HOH B O   1 
HETATM 8536 O O   . HOH D 2 .   ? 85.661  25.104  74.015  1.00 29.87 ? 710 HOH B O   1 
HETATM 8537 O O   . HOH D 2 .   ? 95.996  51.956  69.586  1.00 33.92 ? 711 HOH B O   1 
HETATM 8538 O O   . HOH D 2 .   ? 91.706  21.550  71.407  1.00 21.32 ? 712 HOH B O   1 
HETATM 8539 O O   . HOH D 2 .   ? 106.224 19.136  76.154  1.00 13.99 ? 713 HOH B O   1 
HETATM 8540 O O   . HOH D 2 .   ? 91.720  7.377   75.832  1.00 26.22 ? 714 HOH B O   1 
HETATM 8541 O O   . HOH D 2 .   ? 111.924 22.484  54.978  1.00 25.67 ? 715 HOH B O   1 
HETATM 8542 O O   . HOH D 2 .   ? 90.693  13.173  79.070  1.00 22.43 ? 716 HOH B O   1 
HETATM 8543 O O   . HOH D 2 .   ? 105.036 14.173  71.503  1.00 25.07 ? 717 HOH B O   1 
HETATM 8544 O O   . HOH D 2 .   ? 99.182  2.500   64.328  1.00 19.72 ? 718 HOH B O   1 
HETATM 8545 O O   . HOH D 2 .   ? 76.775  -24.503 29.020  1.00 43.23 ? 719 HOH B O   1 
HETATM 8546 O O   . HOH D 2 .   ? 103.325 29.912  27.770  1.00 21.55 ? 720 HOH B O   1 
HETATM 8547 O O   . HOH D 2 .   ? 96.222  7.541   72.304  1.00 23.67 ? 721 HOH B O   1 
HETATM 8548 O O   . HOH D 2 .   ? 80.111  -1.092  72.995  1.00 24.29 ? 722 HOH B O   1 
HETATM 8549 O O   . HOH D 2 .   ? 106.531 17.409  72.319  1.00 26.45 ? 723 HOH B O   1 
HETATM 8550 O O   . HOH D 2 .   ? 63.915  -25.126 30.665  1.00 34.12 ? 724 HOH B O   1 
HETATM 8551 O O   . HOH D 2 .   ? 100.700 28.776  67.432  1.00 19.94 ? 725 HOH B O   1 
HETATM 8552 O O   . HOH D 2 .   ? 102.922 43.664  40.630  1.00 31.66 ? 726 HOH B O   1 
HETATM 8553 O O   . HOH D 2 .   ? 105.741 16.963  74.894  1.00 19.20 ? 727 HOH B O   1 
HETATM 8554 O O   . HOH D 2 .   ? 88.259  11.741  79.282  1.00 19.76 ? 728 HOH B O   1 
HETATM 8555 O O   . HOH D 2 .   ? 97.759  -3.755  74.383  1.00 29.36 ? 729 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   23  ?   ?   ?   A . n 
A 1 2   GLY 2   24  ?   ?   ?   A . n 
A 1 3   SER 3   25  ?   ?   ?   A . n 
A 1 4   SER 4   26  ?   ?   ?   A . n 
A 1 5   HIS 5   27  ?   ?   ?   A . n 
A 1 6   HIS 6   28  ?   ?   ?   A . n 
A 1 7   HIS 7   29  ?   ?   ?   A . n 
A 1 8   HIS 8   30  ?   ?   ?   A . n 
A 1 9   HIS 9   31  ?   ?   ?   A . n 
A 1 10  HIS 10  32  ?   ?   ?   A . n 
A 1 11  SER 11  33  ?   ?   ?   A . n 
A 1 12  SER 12  34  ?   ?   ?   A . n 
A 1 13  GLY 13  35  ?   ?   ?   A . n 
A 1 14  LEU 14  36  ?   ?   ?   A . n 
A 1 15  VAL 15  37  ?   ?   ?   A . n 
A 1 16  PRO 16  38  ?   ?   ?   A . n 
A 1 17  ARG 17  39  ?   ?   ?   A . n 
A 1 18  GLY 18  40  ?   ?   ?   A . n 
A 1 19  SER 19  41  ?   ?   ?   A . n 
A 1 20  HIS 20  42  ?   ?   ?   A . n 
A 1 21  MET 21  43  ?   ?   ?   A . n 
A 1 22  ALA 22  44  ?   ?   ?   A . n 
A 1 23  SER 23  45  ?   ?   ?   A . n 
A 1 24  ALA 24  46  46  ALA ALA A . n 
A 1 25  VAL 25  47  47  VAL VAL A . n 
A 1 26  ALA 26  48  48  ALA ALA A . n 
A 1 27  VAL 27  49  49  VAL VAL A . n 
A 1 28  ASP 28  50  50  ASP ASP A . n 
A 1 29  LEU 29  51  51  LEU LEU A . n 
A 1 30  GLY 30  52  52  GLY GLY A . n 
A 1 31  ASN 31  53  53  ASN ASN A . n 
A 1 32  ARG 32  54  54  ARG ARG A . n 
A 1 33  LYS 33  55  55  LYS LYS A . n 
A 1 34  LEU 34  56  56  LEU LEU A . n 
A 1 35  GLU 35  57  57  GLU GLU A . n 
A 1 36  ILE 36  58  58  ILE ILE A . n 
A 1 37  SER 37  59  59  SER SER A . n 
A 1 38  SER 38  60  60  SER SER A . n 
A 1 39  GLY 39  61  61  GLY GLY A . n 
A 1 40  LYS 40  62  ?   ?   ?   A . n 
A 1 41  LEU 41  63  ?   ?   ?   A . n 
A 1 42  ALA 42  64  ?   ?   ?   A . n 
A 1 43  ARG 43  65  ?   ?   ?   A . n 
A 1 44  PHE 44  66  ?   ?   ?   A . n 
A 1 45  ALA 45  67  67  ALA ALA A . n 
A 1 46  ASP 46  68  68  ASP ASP A . n 
A 1 47  GLY 47  69  69  GLY GLY A . n 
A 1 48  SER 48  70  70  SER SER A . n 
A 1 49  ALA 49  71  71  ALA ALA A . n 
A 1 50  VAL 50  72  72  VAL VAL A . n 
A 1 51  VAL 51  73  73  VAL VAL A . n 
A 1 52  GLN 52  74  74  GLN GLN A . n 
A 1 53  SER 53  75  75  SER SER A . n 
A 1 54  GLY 54  76  76  GLY GLY A . n 
A 1 55  ASP 55  77  77  ASP ASP A . n 
A 1 56  THR 56  78  78  THR THR A . n 
A 1 57  ALA 57  79  79  ALA ALA A . n 
A 1 58  VAL 58  80  80  VAL VAL A . n 
A 1 59  MET 59  81  81  MET MET A . n 
A 1 60  VAL 60  82  82  VAL VAL A . n 
A 1 61  THR 61  83  83  THR THR A . n 
A 1 62  ALA 62  84  84  ALA ALA A . n 
A 1 63  VAL 63  85  85  VAL VAL A . n 
A 1 64  SER 64  86  86  SER SER A . n 
A 1 65  LYS 65  87  87  LYS LYS A . n 
A 1 66  THR 66  88  88  THR THR A . n 
A 1 67  LYS 67  89  89  LYS LYS A . n 
A 1 68  PRO 68  90  90  PRO PRO A . n 
A 1 69  SER 69  91  91  SER SER A . n 
A 1 70  PRO 70  92  92  PRO PRO A . n 
A 1 71  SER 71  93  93  SER SER A . n 
A 1 72  GLN 72  94  94  GLN GLN A . n 
A 1 73  PHE 73  95  95  PHE PHE A . n 
A 1 74  MET 74  96  96  MET MET A . n 
A 1 75  PRO 75  97  97  PRO PRO A . n 
A 1 76  LEU 76  98  98  LEU LEU A . n 
A 1 77  VAL 77  99  99  VAL VAL A . n 
A 1 78  VAL 78  100 100 VAL VAL A . n 
A 1 79  ASP 79  101 101 ASP ASP A . n 
A 1 80  TYR 80  102 102 TYR TYR A . n 
A 1 81  ARG 81  103 103 ARG ARG A . n 
A 1 82  GLN 82  104 104 GLN GLN A . n 
A 1 83  LYS 83  105 ?   ?   ?   A . n 
A 1 84  ALA 84  106 ?   ?   ?   A . n 
A 1 85  ALA 85  107 ?   ?   ?   A . n 
A 1 86  ALA 86  108 ?   ?   ?   A . n 
A 1 87  ALA 87  109 ?   ?   ?   A . n 
A 1 88  GLY 88  110 ?   ?   ?   A . n 
A 1 89  ARG 89  111 ?   ?   ?   A . n 
A 1 90  ILE 90  112 ?   ?   ?   A . n 
A 1 91  PRO 91  113 ?   ?   ?   A . n 
A 1 92  THR 92  114 ?   ?   ?   A . n 
A 1 93  ASN 93  115 ?   ?   ?   A . n 
A 1 94  TYR 94  116 ?   ?   ?   A . n 
A 1 95  LEU 95  117 ?   ?   ?   A . n 
A 1 96  ARG 96  118 ?   ?   ?   A . n 
A 1 97  ARG 97  119 ?   ?   ?   A . n 
A 1 98  GLU 98  120 ?   ?   ?   A . n 
A 1 99  ILE 99  121 ?   ?   ?   A . n 
A 1 100 GLY 100 122 ?   ?   ?   A . n 
A 1 101 THR 101 123 ?   ?   ?   A . n 
A 1 102 SER 102 124 124 SER SER A . n 
A 1 103 ASP 103 125 125 ASP ASP A . n 
A 1 104 LYS 104 126 126 LYS LYS A . n 
A 1 105 GLU 105 127 127 GLU GLU A . n 
A 1 106 ILE 106 128 128 ILE ILE A . n 
A 1 107 LEU 107 129 129 LEU LEU A . n 
A 1 108 THR 108 130 130 THR THR A . n 
A 1 109 SER 109 131 131 SER SER A . n 
A 1 110 ARG 110 132 132 ARG ARG A . n 
A 1 111 ILE 111 133 133 ILE ILE A . n 
A 1 112 ILE 112 134 134 ILE ILE A . n 
A 1 113 ASP 113 135 135 ASP ASP A . n 
A 1 114 ARG 114 136 136 ARG ARG A . n 
A 1 115 SER 115 137 137 SER SER A . n 
A 1 116 ILE 116 138 138 ILE ILE A . n 
A 1 117 ARG 117 139 139 ARG ARG A . n 
A 1 118 PRO 118 140 140 PRO PRO A . n 
A 1 119 LEU 119 141 141 LEU LEU A . n 
A 1 120 PHE 120 142 142 PHE PHE A . n 
A 1 121 PRO 121 143 143 PRO PRO A . n 
A 1 122 ALA 122 144 144 ALA ALA A . n 
A 1 123 GLY 123 145 145 GLY GLY A . n 
A 1 124 TYR 124 146 146 TYR TYR A . n 
A 1 125 PHE 125 147 147 PHE PHE A . n 
A 1 126 TYR 126 148 148 TYR TYR A . n 
A 1 127 ASP 127 149 149 ASP ASP A . n 
A 1 128 THR 128 150 150 THR THR A . n 
A 1 129 GLN 129 151 151 GLN GLN A . n 
A 1 130 VAL 130 152 152 VAL VAL A . n 
A 1 131 LEU 131 153 153 LEU LEU A . n 
A 1 132 CYS 132 154 154 CYS CYS A . n 
A 1 133 ASN 133 155 155 ASN ASN A . n 
A 1 134 LEU 134 156 156 LEU LEU A . n 
A 1 135 LEU 135 157 157 LEU LEU A . n 
A 1 136 ALA 136 158 158 ALA ALA A . n 
A 1 137 VAL 137 159 159 VAL VAL A . n 
A 1 138 ASP 138 160 160 ASP ASP A . n 
A 1 139 GLY 139 161 161 GLY GLY A . n 
A 1 140 VAL 140 162 162 VAL VAL A . n 
A 1 141 ASN 141 163 163 ASN ASN A . n 
A 1 142 GLU 142 164 164 GLU GLU A . n 
A 1 143 PRO 143 165 165 PRO PRO A . n 
A 1 144 ASP 144 166 166 ASP ASP A . n 
A 1 145 VAL 145 167 167 VAL VAL A . n 
A 1 146 LEU 146 168 168 LEU LEU A . n 
A 1 147 ALA 147 169 169 ALA ALA A . n 
A 1 148 ILE 148 170 170 ILE ILE A . n 
A 1 149 ASN 149 171 171 ASN ASN A . n 
A 1 150 GLY 150 172 172 GLY GLY A . n 
A 1 151 ALA 151 173 173 ALA ALA A . n 
A 1 152 SER 152 174 174 SER SER A . n 
A 1 153 VAL 153 175 175 VAL VAL A . n 
A 1 154 ALA 154 176 176 ALA ALA A . n 
A 1 155 LEU 155 177 177 LEU LEU A . n 
A 1 156 SER 156 178 178 SER SER A . n 
A 1 157 LEU 157 179 179 LEU LEU A . n 
A 1 158 SER 158 180 180 SER SER A . n 
A 1 159 ASP 159 181 181 ASP ASP A . n 
A 1 160 ILE 160 182 182 ILE ILE A . n 
A 1 161 PRO 161 183 183 PRO PRO A . n 
A 1 162 TRP 162 184 184 TRP TRP A . n 
A 1 163 ASN 163 185 185 ASN ASN A . n 
A 1 164 GLY 164 186 186 GLY GLY A . n 
A 1 165 PRO 165 187 187 PRO PRO A . n 
A 1 166 VAL 166 188 188 VAL VAL A . n 
A 1 167 GLY 167 189 189 GLY GLY A . n 
A 1 168 ALA 168 190 190 ALA ALA A . n 
A 1 169 VAL 169 191 191 VAL VAL A . n 
A 1 170 ARG 170 192 192 ARG ARG A . n 
A 1 171 ILE 171 193 193 ILE ILE A . n 
A 1 172 GLY 172 194 194 GLY GLY A . n 
A 1 173 ILE 173 195 195 ILE ILE A . n 
A 1 174 ILE 174 196 196 ILE ILE A . n 
A 1 175 ASP 175 197 197 ASP ASP A . n 
A 1 176 GLY 176 198 198 GLY GLY A . n 
A 1 177 GLU 177 199 199 GLU GLU A . n 
A 1 178 TYR 178 200 200 TYR TYR A . n 
A 1 179 VAL 179 201 201 VAL VAL A . n 
A 1 180 VAL 180 202 202 VAL VAL A . n 
A 1 181 ASN 181 203 203 ASN ASN A . n 
A 1 182 PRO 182 204 204 PRO PRO A . n 
A 1 183 THR 183 205 205 THR THR A . n 
A 1 184 ARG 184 206 206 ARG ARG A . n 
A 1 185 LYS 185 207 207 LYS LYS A . n 
A 1 186 GLU 186 208 208 GLU GLU A . n 
A 1 187 MET 187 209 209 MET MET A . n 
A 1 188 SER 188 210 210 SER SER A . n 
A 1 189 SER 189 211 211 SER SER A . n 
A 1 190 SER 190 212 212 SER SER A . n 
A 1 191 THR 191 213 213 THR THR A . n 
A 1 192 LEU 192 214 214 LEU LEU A . n 
A 1 193 ASN 193 215 215 ASN ASN A . n 
A 1 194 LEU 194 216 216 LEU LEU A . n 
A 1 195 VAL 195 217 217 VAL VAL A . n 
A 1 196 VAL 196 218 218 VAL VAL A . n 
A 1 197 ALA 197 219 219 ALA ALA A . n 
A 1 198 GLY 198 220 220 GLY GLY A . n 
A 1 199 ALA 199 221 221 ALA ALA A . n 
A 1 200 PRO 200 222 222 PRO PRO A . n 
A 1 201 LYS 201 223 223 LYS LYS A . n 
A 1 202 SER 202 224 224 SER SER A . n 
A 1 203 GLN 203 225 225 GLN GLN A . n 
A 1 204 ILE 204 226 226 ILE ILE A . n 
A 1 205 VAL 205 227 227 VAL VAL A . n 
A 1 206 MET 206 228 228 MET MET A . n 
A 1 207 LEU 207 229 229 LEU LEU A . n 
A 1 208 GLU 208 230 230 GLU GLU A . n 
A 1 209 ALA 209 231 231 ALA ALA A . n 
A 1 210 SER 210 232 232 SER SER A . n 
A 1 211 ALA 211 233 233 ALA ALA A . n 
A 1 212 GLU 212 234 234 GLU GLU A . n 
A 1 213 ASN 213 235 235 ASN ASN A . n 
A 1 214 ILE 214 236 236 ILE ILE A . n 
A 1 215 LEU 215 237 237 LEU LEU A . n 
A 1 216 GLN 216 238 238 GLN GLN A . n 
A 1 217 GLN 217 239 239 GLN GLN A . n 
A 1 218 ASP 218 240 240 ASP ASP A . n 
A 1 219 PHE 219 241 241 PHE PHE A . n 
A 1 220 CYS 220 242 242 CYS CYS A . n 
A 1 221 HIS 221 243 243 HIS HIS A . n 
A 1 222 ALA 222 244 244 ALA ALA A . n 
A 1 223 ILE 223 245 245 ILE ILE A . n 
A 1 224 LYS 224 246 246 LYS LYS A . n 
A 1 225 VAL 225 247 247 VAL VAL A . n 
A 1 226 GLY 226 248 248 GLY GLY A . n 
A 1 227 VAL 227 249 249 VAL VAL A . n 
A 1 228 LYS 228 250 250 LYS LYS A . n 
A 1 229 TYR 229 251 251 TYR TYR A . n 
A 1 230 THR 230 252 252 THR THR A . n 
A 1 231 GLN 231 253 253 GLN GLN A . n 
A 1 232 GLN 232 254 254 GLN GLN A . n 
A 1 233 ILE 233 255 255 ILE ILE A . n 
A 1 234 ILE 234 256 256 ILE ILE A . n 
A 1 235 GLN 235 257 257 GLN GLN A . n 
A 1 236 GLY 236 258 258 GLY GLY A . n 
A 1 237 ILE 237 259 259 ILE ILE A . n 
A 1 238 GLN 238 260 260 GLN GLN A . n 
A 1 239 GLN 239 261 261 GLN GLN A . n 
A 1 240 LEU 240 262 262 LEU LEU A . n 
A 1 241 VAL 241 263 263 VAL VAL A . n 
A 1 242 LYS 242 264 264 LYS LYS A . n 
A 1 243 GLU 243 265 265 GLU GLU A . n 
A 1 244 THR 244 266 266 THR THR A . n 
A 1 245 GLY 245 267 267 GLY GLY A . n 
A 1 246 VAL 246 268 268 VAL VAL A . n 
A 1 247 THR 247 269 269 THR THR A . n 
A 1 248 LYS 248 270 270 LYS LYS A . n 
A 1 249 ARG 249 271 271 ARG ARG A . n 
A 1 250 THR 250 272 272 THR THR A . n 
A 1 251 PRO 251 273 273 PRO PRO A . n 
A 1 252 GLN 252 274 274 GLN GLN A . n 
A 1 253 LYS 253 275 275 LYS LYS A . n 
A 1 254 LEU 254 276 276 LEU LEU A . n 
A 1 255 PHE 255 277 277 PHE PHE A . n 
A 1 256 THR 256 278 278 THR THR A . n 
A 1 257 PRO 257 279 279 PRO PRO A . n 
A 1 258 SER 258 280 280 SER SER A . n 
A 1 259 PRO 259 281 281 PRO PRO A . n 
A 1 260 GLU 260 282 282 GLU GLU A . n 
A 1 261 ILE 261 283 283 ILE ILE A . n 
A 1 262 VAL 262 284 284 VAL VAL A . n 
A 1 263 LYS 263 285 285 LYS LYS A . n 
A 1 264 TYR 264 286 286 TYR TYR A . n 
A 1 265 THR 265 287 287 THR THR A . n 
A 1 266 HIS 266 288 288 HIS HIS A . n 
A 1 267 LYS 267 289 289 LYS LYS A . n 
A 1 268 LEU 268 290 290 LEU LEU A . n 
A 1 269 ALA 269 291 291 ALA ALA A . n 
A 1 270 MET 270 292 292 MET MET A . n 
A 1 271 GLU 271 293 293 GLU GLU A . n 
A 1 272 ARG 272 294 294 ARG ARG A . n 
A 1 273 LEU 273 295 295 LEU LEU A . n 
A 1 274 TYR 274 296 296 TYR TYR A . n 
A 1 275 ALA 275 297 297 ALA ALA A . n 
A 1 276 VAL 276 298 298 VAL VAL A . n 
A 1 277 PHE 277 299 299 PHE PHE A . n 
A 1 278 THR 278 300 300 THR THR A . n 
A 1 279 ASP 279 301 301 ASP ASP A . n 
A 1 280 TYR 280 302 302 TYR TYR A . n 
A 1 281 GLU 281 303 303 GLU GLU A . n 
A 1 282 HIS 282 304 304 HIS HIS A . n 
A 1 283 ASP 283 305 305 ASP ASP A . n 
A 1 284 LYS 284 306 306 LYS LYS A . n 
A 1 285 VAL 285 307 307 VAL VAL A . n 
A 1 286 SER 286 308 308 SER SER A . n 
A 1 287 ARG 287 309 309 ARG ARG A . n 
A 1 288 ASP 288 310 310 ASP ASP A . n 
A 1 289 GLU 289 311 311 GLU GLU A . n 
A 1 290 ALA 290 312 312 ALA ALA A . n 
A 1 291 VAL 291 313 313 VAL VAL A . n 
A 1 292 ASN 292 314 314 ASN ASN A . n 
A 1 293 LYS 293 315 315 LYS LYS A . n 
A 1 294 ILE 294 316 316 ILE ILE A . n 
A 1 295 ARG 295 317 317 ARG ARG A . n 
A 1 296 LEU 296 318 318 LEU LEU A . n 
A 1 297 ASP 297 319 319 ASP ASP A . n 
A 1 298 THR 298 320 320 THR THR A . n 
A 1 299 GLU 299 321 321 GLU GLU A . n 
A 1 300 GLU 300 322 322 GLU GLU A . n 
A 1 301 GLN 301 323 323 GLN GLN A . n 
A 1 302 LEU 302 324 324 LEU LEU A . n 
A 1 303 LYS 303 325 325 LYS LYS A . n 
A 1 304 GLU 304 326 326 GLU GLU A . n 
A 1 305 LYS 305 327 327 LYS LYS A . n 
A 1 306 PHE 306 328 328 PHE PHE A . n 
A 1 307 PRO 307 329 329 PRO PRO A . n 
A 1 308 GLU 308 330 330 GLU GLU A . n 
A 1 309 ALA 309 331 331 ALA ALA A . n 
A 1 310 ASP 310 332 332 ASP ASP A . n 
A 1 311 PRO 311 333 333 PRO PRO A . n 
A 1 312 TYR 312 334 334 TYR TYR A . n 
A 1 313 GLU 313 335 335 GLU GLU A . n 
A 1 314 ILE 314 336 336 ILE ILE A . n 
A 1 315 ILE 315 337 337 ILE ILE A . n 
A 1 316 GLU 316 338 338 GLU GLU A . n 
A 1 317 SER 317 339 339 SER SER A . n 
A 1 318 PHE 318 340 340 PHE PHE A . n 
A 1 319 ASN 319 341 341 ASN ASN A . n 
A 1 320 VAL 320 342 342 VAL VAL A . n 
A 1 321 VAL 321 343 343 VAL VAL A . n 
A 1 322 ALA 322 344 344 ALA ALA A . n 
A 1 323 LYS 323 345 345 LYS LYS A . n 
A 1 324 GLU 324 346 346 GLU GLU A . n 
A 1 325 VAL 325 347 347 VAL VAL A . n 
A 1 326 PHE 326 348 348 PHE PHE A . n 
A 1 327 ARG 327 349 349 ARG ARG A . n 
A 1 328 SER 328 350 350 SER SER A . n 
A 1 329 ILE 329 351 351 ILE ILE A . n 
A 1 330 VAL 330 352 352 VAL VAL A . n 
A 1 331 LEU 331 353 353 LEU LEU A . n 
A 1 332 ASN 332 354 354 ASN ASN A . n 
A 1 333 GLU 333 355 355 GLU GLU A . n 
A 1 334 TYR 334 356 356 TYR TYR A . n 
A 1 335 LYS 335 357 357 LYS LYS A . n 
A 1 336 ARG 336 358 358 ARG ARG A . n 
A 1 337 CYS 337 359 359 CYS CYS A . n 
A 1 338 ASP 338 360 360 ASP ASP A . n 
A 1 339 GLY 339 361 361 GLY GLY A . n 
A 1 340 ARG 340 362 362 ARG ARG A . n 
A 1 341 ASP 341 363 363 ASP ASP A . n 
A 1 342 LEU 342 364 364 LEU LEU A . n 
A 1 343 THR 343 365 365 THR THR A . n 
A 1 344 SER 344 366 366 SER SER A . n 
A 1 345 LEU 345 367 367 LEU LEU A . n 
A 1 346 ARG 346 368 368 ARG ARG A . n 
A 1 347 ASN 347 369 369 ASN ASN A . n 
A 1 348 VAL 348 370 370 VAL VAL A . n 
A 1 349 SER 349 371 371 SER SER A . n 
A 1 350 CYS 350 372 372 CYS CYS A . n 
A 1 351 GLU 351 373 373 GLU GLU A . n 
A 1 352 VAL 352 374 374 VAL VAL A . n 
A 1 353 ASP 353 375 375 ASP ASP A . n 
A 1 354 MET 354 376 376 MET MET A . n 
A 1 355 PHE 355 377 377 PHE PHE A . n 
A 1 356 LYS 356 378 378 LYS LYS A . n 
A 1 357 THR 357 379 379 THR THR A . n 
A 1 358 LEU 358 380 380 LEU LEU A . n 
A 1 359 HIS 359 381 381 HIS HIS A . n 
A 1 360 GLY 360 382 382 GLY GLY A . n 
A 1 361 SER 361 383 383 SER SER A . n 
A 1 362 ALA 362 384 384 ALA ALA A . n 
A 1 363 LEU 363 385 385 LEU LEU A . n 
A 1 364 PHE 364 386 386 PHE PHE A . n 
A 1 365 GLN 365 387 387 GLN GLN A . n 
A 1 366 ARG 366 388 388 ARG ARG A . n 
A 1 367 GLY 367 389 389 GLY GLY A . n 
A 1 368 GLN 368 390 390 GLN GLN A . n 
A 1 369 THR 369 391 391 THR THR A . n 
A 1 370 GLN 370 392 392 GLN GLN A . n 
A 1 371 VAL 371 393 393 VAL VAL A . n 
A 1 372 LEU 372 394 394 LEU LEU A . n 
A 1 373 CYS 373 395 395 CYS CYS A . n 
A 1 374 THR 374 396 396 THR THR A . n 
A 1 375 VAL 375 397 397 VAL VAL A . n 
A 1 376 THR 376 398 398 THR THR A . n 
A 1 377 PHE 377 399 399 PHE PHE A . n 
A 1 378 ASP 378 400 400 ASP ASP A . n 
A 1 379 SER 379 401 401 SER SER A . n 
A 1 380 LEU 380 402 402 LEU LEU A . n 
A 1 381 GLU 381 403 403 GLU GLU A . n 
A 1 382 SER 382 404 404 SER SER A . n 
A 1 383 GLY 383 405 ?   ?   ?   A . n 
A 1 384 ILE 384 406 ?   ?   ?   A . n 
A 1 385 LYS 385 407 ?   ?   ?   A . n 
A 1 386 SER 386 408 ?   ?   ?   A . n 
A 1 387 ASP 387 409 ?   ?   ?   A . n 
A 1 388 GLN 388 410 ?   ?   ?   A . n 
A 1 389 VAL 389 411 ?   ?   ?   A . n 
A 1 390 ILE 390 412 ?   ?   ?   A . n 
A 1 391 THR 391 413 ?   ?   ?   A . n 
A 1 392 ALA 392 414 ?   ?   ?   A . n 
A 1 393 ILE 393 415 ?   ?   ?   A . n 
A 1 394 ASN 394 416 ?   ?   ?   A . n 
A 1 395 GLY 395 417 ?   ?   ?   A . n 
A 1 396 ILE 396 418 ?   ?   ?   A . n 
A 1 397 LYS 397 419 ?   ?   ?   A . n 
A 1 398 ASP 398 420 420 ASP ASP A . n 
A 1 399 LYS 399 421 421 LYS LYS A . n 
A 1 400 ASN 400 422 422 ASN ASN A . n 
A 1 401 PHE 401 423 423 PHE PHE A . n 
A 1 402 MET 402 424 424 MET MET A . n 
A 1 403 LEU 403 425 425 LEU LEU A . n 
A 1 404 HIS 404 426 426 HIS HIS A . n 
A 1 405 TYR 405 427 427 TYR TYR A . n 
A 1 406 GLU 406 428 ?   ?   ?   A . n 
A 1 407 PHE 407 429 ?   ?   ?   A . n 
A 1 408 PRO 408 430 ?   ?   ?   A . n 
A 1 409 PRO 409 431 ?   ?   ?   A . n 
A 1 410 TYR 410 432 ?   ?   ?   A . n 
A 1 411 ALA 411 433 ?   ?   ?   A . n 
A 1 412 THR 412 434 ?   ?   ?   A . n 
A 1 413 ASN 413 435 ?   ?   ?   A . n 
A 1 414 GLU 414 436 ?   ?   ?   A . n 
A 1 415 ILE 415 437 ?   ?   ?   A . n 
A 1 416 GLY 416 438 ?   ?   ?   A . n 
A 1 417 LYS 417 439 ?   ?   ?   A . n 
A 1 418 VAL 418 440 ?   ?   ?   A . n 
A 1 419 THR 419 441 ?   ?   ?   A . n 
A 1 420 GLY 420 442 ?   ?   ?   A . n 
A 1 421 LEU 421 443 ?   ?   ?   A . n 
A 1 422 ASN 422 444 ?   ?   ?   A . n 
A 1 423 ARG 423 445 ?   ?   ?   A . n 
A 1 424 ARG 424 446 ?   ?   ?   A . n 
A 1 425 GLU 425 447 ?   ?   ?   A . n 
A 1 426 LEU 426 448 ?   ?   ?   A . n 
A 1 427 GLY 427 449 449 GLY GLY A . n 
A 1 428 HIS 428 450 450 HIS HIS A . n 
A 1 429 GLY 429 451 451 GLY GLY A . n 
A 1 430 ALA 430 452 452 ALA ALA A . n 
A 1 431 LEU 431 453 453 LEU LEU A . n 
A 1 432 ALA 432 454 454 ALA ALA A . n 
A 1 433 GLU 433 455 455 GLU GLU A . n 
A 1 434 LYS 434 456 456 LYS LYS A . n 
A 1 435 ALA 435 457 457 ALA ALA A . n 
A 1 436 LEU 436 458 458 LEU LEU A . n 
A 1 437 TYR 437 459 459 TYR TYR A . n 
A 1 438 PRO 438 460 460 PRO PRO A . n 
A 1 439 VAL 439 461 461 VAL VAL A . n 
A 1 440 ILE 440 462 462 ILE ILE A . n 
A 1 441 PRO 441 463 463 PRO PRO A . n 
A 1 442 ARG 442 464 464 ARG ARG A . n 
A 1 443 ASP 443 465 465 ASP ASP A . n 
A 1 444 PHE 444 466 466 PHE PHE A . n 
A 1 445 PRO 445 467 467 PRO PRO A . n 
A 1 446 PHE 446 468 468 PHE PHE A . n 
A 1 447 THR 447 469 469 THR THR A . n 
A 1 448 ILE 448 470 470 ILE ILE A . n 
A 1 449 ARG 449 471 471 ARG ARG A . n 
A 1 450 VAL 450 472 472 VAL VAL A . n 
A 1 451 THR 451 473 473 THR THR A . n 
A 1 452 SER 452 474 474 SER SER A . n 
A 1 453 GLU 453 475 475 GLU GLU A . n 
A 1 454 VAL 454 476 476 VAL VAL A . n 
A 1 455 LEU 455 477 477 LEU LEU A . n 
A 1 456 GLU 456 478 478 GLU GLU A . n 
A 1 457 SER 457 479 479 SER SER A . n 
A 1 458 ASN 458 480 480 ASN ASN A . n 
A 1 459 GLY 459 481 481 GLY GLY A . n 
A 1 460 SER 460 482 482 SER SER A . n 
A 1 461 SER 461 483 483 SER SER A . n 
A 1 462 SER 462 484 484 SER SER A . n 
A 1 463 MET 463 485 485 MET MET A . n 
A 1 464 ALA 464 486 486 ALA ALA A . n 
A 1 465 SER 465 487 487 SER SER A . n 
A 1 466 ALA 466 488 488 ALA ALA A . n 
A 1 467 CYS 467 489 489 CYS CYS A . n 
A 1 468 GLY 468 490 490 GLY GLY A . n 
A 1 469 GLY 469 491 491 GLY GLY A . n 
A 1 470 SER 470 492 492 SER SER A . n 
A 1 471 LEU 471 493 493 LEU LEU A . n 
A 1 472 ALA 472 494 494 ALA ALA A . n 
A 1 473 LEU 473 495 495 LEU LEU A . n 
A 1 474 MET 474 496 496 MET MET A . n 
A 1 475 ASP 475 497 497 ASP ASP A . n 
A 1 476 SER 476 498 498 SER SER A . n 
A 1 477 GLY 477 499 499 GLY GLY A . n 
A 1 478 VAL 478 500 500 VAL VAL A . n 
A 1 479 PRO 479 501 501 PRO PRO A . n 
A 1 480 ILE 480 502 502 ILE ILE A . n 
A 1 481 SER 481 503 503 SER SER A . n 
A 1 482 SER 482 504 504 SER SER A . n 
A 1 483 ALA 483 505 505 ALA ALA A . n 
A 1 484 VAL 484 506 506 VAL VAL A . n 
A 1 485 ALA 485 507 507 ALA ALA A . n 
A 1 486 GLY 486 508 508 GLY GLY A . n 
A 1 487 VAL 487 509 509 VAL VAL A . n 
A 1 488 ALA 488 510 510 ALA ALA A . n 
A 1 489 ILE 489 511 511 ILE ILE A . n 
A 1 490 GLY 490 512 512 GLY GLY A . n 
A 1 491 LEU 491 513 513 LEU LEU A . n 
A 1 492 VAL 492 514 514 VAL VAL A . n 
A 1 493 THR 493 515 515 THR THR A . n 
A 1 494 LYS 494 516 516 LYS LYS A . n 
A 1 495 THR 495 517 517 THR THR A . n 
A 1 496 ASP 496 518 518 ASP ASP A . n 
A 1 497 PRO 497 519 519 PRO PRO A . n 
A 1 498 GLU 498 520 520 GLU GLU A . n 
A 1 499 LYS 499 521 521 LYS LYS A . n 
A 1 500 GLY 500 522 522 GLY GLY A . n 
A 1 501 GLU 501 523 523 GLU GLU A . n 
A 1 502 ILE 502 524 524 ILE ILE A . n 
A 1 503 GLU 503 525 525 GLU GLU A . n 
A 1 504 ASP 504 526 526 ASP ASP A . n 
A 1 505 TYR 505 527 527 TYR TYR A . n 
A 1 506 ARG 506 528 528 ARG ARG A . n 
A 1 507 LEU 507 529 529 LEU LEU A . n 
A 1 508 LEU 508 530 530 LEU LEU A . n 
A 1 509 THR 509 531 531 THR THR A . n 
A 1 510 ASP 510 532 532 ASP ASP A . n 
A 1 511 ILE 511 533 533 ILE ILE A . n 
A 1 512 LEU 512 534 534 LEU LEU A . n 
A 1 513 GLY 513 535 535 GLY GLY A . n 
A 1 514 ILE 514 536 536 ILE ILE A . n 
A 1 515 GLU 515 537 537 GLU GLU A . n 
A 1 516 ASP 516 538 538 ASP ASP A . n 
A 1 517 TYR 517 539 539 TYR TYR A . n 
A 1 518 ASN 518 540 540 ASN ASN A . n 
A 1 519 GLY 519 541 541 GLY GLY A . n 
A 1 520 ASP 520 542 542 ASP ASP A . n 
A 1 521 MET 521 543 543 MET MET A . n 
A 1 522 ASP 522 544 544 ASP ASP A . n 
A 1 523 PHE 523 545 545 PHE PHE A . n 
A 1 524 LYS 524 546 546 LYS LYS A . n 
A 1 525 ILE 525 547 547 ILE ILE A . n 
A 1 526 ALA 526 548 548 ALA ALA A . n 
A 1 527 GLY 527 549 549 GLY GLY A . n 
A 1 528 THR 528 550 550 THR THR A . n 
A 1 529 ASN 529 551 551 ASN ASN A . n 
A 1 530 LYS 530 552 552 LYS LYS A . n 
A 1 531 GLY 531 553 553 GLY GLY A . n 
A 1 532 ILE 532 554 554 ILE ILE A . n 
A 1 533 THR 533 555 555 THR THR A . n 
A 1 534 ALA 534 556 556 ALA ALA A . n 
A 1 535 LEU 535 557 557 LEU LEU A . n 
A 1 536 GLN 536 558 558 GLN GLN A . n 
A 1 537 ALA 537 559 559 ALA ALA A . n 
A 1 538 ASP 538 560 560 ASP ASP A . n 
A 1 539 ILE 539 561 561 ILE ILE A . n 
A 1 540 LYS 540 562 562 LYS LYS A . n 
A 1 541 LEU 541 563 563 LEU LEU A . n 
A 1 542 PRO 542 564 564 PRO PRO A . n 
A 1 543 GLY 543 565 565 GLY GLY A . n 
A 1 544 ILE 544 566 566 ILE ILE A . n 
A 1 545 PRO 545 567 567 PRO PRO A . n 
A 1 546 ILE 546 568 568 ILE ILE A . n 
A 1 547 LYS 547 569 569 LYS LYS A . n 
A 1 548 ILE 548 570 570 ILE ILE A . n 
A 1 549 VAL 549 571 571 VAL VAL A . n 
A 1 550 MET 550 572 572 MET MET A . n 
A 1 551 GLU 551 573 573 GLU GLU A . n 
A 1 552 ALA 552 574 574 ALA ALA A . n 
A 1 553 ILE 553 575 575 ILE ILE A . n 
A 1 554 GLN 554 576 576 GLN GLN A . n 
A 1 555 GLN 555 577 577 GLN GLN A . n 
A 1 556 ALA 556 578 578 ALA ALA A . n 
A 1 557 SER 557 579 579 SER SER A . n 
A 1 558 VAL 558 580 580 VAL VAL A . n 
A 1 559 ALA 559 581 581 ALA ALA A . n 
A 1 560 LYS 560 582 582 LYS LYS A . n 
A 1 561 LYS 561 583 583 LYS LYS A . n 
A 1 562 GLU 562 584 584 GLU GLU A . n 
A 1 563 ILE 563 585 585 ILE ILE A . n 
A 1 564 LEU 564 586 586 LEU LEU A . n 
A 1 565 GLN 565 587 587 GLN GLN A . n 
A 1 566 ILE 566 588 588 ILE ILE A . n 
A 1 567 MET 567 589 589 MET MET A . n 
A 1 568 ASN 568 590 590 ASN ASN A . n 
A 1 569 LYS 569 591 591 LYS LYS A . n 
A 1 570 THR 570 592 592 THR THR A . n 
A 1 571 ILE 571 593 593 ILE ILE A . n 
A 1 572 SER 572 594 594 SER SER A . n 
A 1 573 LYS 573 595 595 LYS LYS A . n 
A 1 574 PRO 574 596 596 PRO PRO A . n 
A 1 575 ARG 575 597 597 ARG ARG A . n 
A 1 576 ALA 576 598 598 ALA ALA A . n 
A 1 577 SER 577 599 599 SER SER A . n 
A 1 578 ARG 578 600 600 ARG ARG A . n 
A 1 579 LYS 579 601 601 LYS LYS A . n 
A 1 580 GLU 580 602 602 GLU GLU A . n 
A 1 581 ASN 581 603 603 ASN ASN A . n 
A 1 582 GLY 582 604 604 GLY GLY A . n 
A 1 583 PRO 583 605 605 PRO PRO A . n 
A 1 584 VAL 584 606 606 VAL VAL A . n 
A 1 585 VAL 585 607 607 VAL VAL A . n 
A 1 586 GLU 586 608 608 GLU GLU A . n 
A 1 587 THR 587 609 609 THR THR A . n 
A 1 588 VAL 588 610 610 VAL VAL A . n 
A 1 589 GLN 589 611 611 GLN GLN A . n 
A 1 590 VAL 590 612 612 VAL VAL A . n 
A 1 591 PRO 591 613 613 PRO PRO A . n 
A 1 592 LEU 592 614 614 LEU LEU A . n 
A 1 593 SER 593 615 615 SER SER A . n 
A 1 594 LYS 594 616 616 LYS LYS A . n 
A 1 595 ARG 595 617 617 ARG ARG A . n 
A 1 596 ALA 596 618 618 ALA ALA A . n 
A 1 597 LYS 597 619 619 LYS LYS A . n 
A 1 598 PHE 598 620 620 PHE PHE A . n 
A 1 599 VAL 599 621 621 VAL VAL A . n 
A 1 600 GLY 600 622 622 GLY GLY A . n 
A 1 601 PRO 601 623 623 PRO PRO A . n 
A 1 602 GLY 602 624 624 GLY GLY A . n 
A 1 603 GLY 603 625 625 GLY GLY A . n 
A 1 604 TYR 604 626 626 TYR TYR A . n 
A 1 605 ASN 605 627 627 ASN ASN A . n 
A 1 606 LEU 606 628 628 LEU LEU A . n 
A 1 607 LYS 607 629 629 LYS LYS A . n 
A 1 608 LYS 608 630 630 LYS LYS A . n 
A 1 609 LEU 609 631 631 LEU LEU A . n 
A 1 610 GLN 610 632 632 GLN GLN A . n 
A 1 611 ALA 611 633 633 ALA ALA A . n 
A 1 612 GLU 612 634 634 GLU GLU A . n 
A 1 613 THR 613 635 635 THR THR A . n 
A 1 614 GLY 614 636 636 GLY GLY A . n 
A 1 615 VAL 615 637 637 VAL VAL A . n 
A 1 616 THR 616 638 638 THR THR A . n 
A 1 617 ILE 617 639 639 ILE ILE A . n 
A 1 618 SER 618 640 640 SER SER A . n 
A 1 619 GLN 619 641 641 GLN GLN A . n 
A 1 620 VAL 620 642 642 VAL VAL A . n 
A 1 621 ASP 621 643 ?   ?   ?   A . n 
A 1 622 GLU 622 644 ?   ?   ?   A . n 
A 1 623 GLU 623 645 645 GLU GLU A . n 
A 1 624 THR 624 646 646 THR THR A . n 
A 1 625 PHE 625 647 647 PHE PHE A . n 
A 1 626 SER 626 648 648 SER SER A . n 
A 1 627 VAL 627 649 649 VAL VAL A . n 
A 1 628 PHE 628 650 650 PHE PHE A . n 
A 1 629 ALA 629 651 651 ALA ALA A . n 
A 1 630 PRO 630 652 652 PRO PRO A . n 
A 1 631 THR 631 653 653 THR THR A . n 
A 1 632 PRO 632 654 654 PRO PRO A . n 
A 1 633 SER 633 655 655 SER SER A . n 
A 1 634 ALA 634 656 656 ALA ALA A . n 
A 1 635 MET 635 657 657 MET MET A . n 
A 1 636 HIS 636 658 658 HIS HIS A . n 
A 1 637 GLU 637 659 659 GLU GLU A . n 
A 1 638 ALA 638 660 660 ALA ALA A . n 
A 1 639 ARG 639 661 661 ARG ARG A . n 
A 1 640 ASP 640 662 662 ASP ASP A . n 
A 1 641 PHE 641 663 663 PHE PHE A . n 
A 1 642 ILE 642 664 664 ILE ILE A . n 
A 1 643 THR 643 665 665 THR THR A . n 
A 1 644 GLU 644 666 666 GLU GLU A . n 
A 1 645 ILE 645 667 667 ILE ILE A . n 
A 1 646 CYS 646 668 ?   ?   ?   A . n 
A 1 647 LYS 647 669 ?   ?   ?   A . n 
B 1 1   MET 1   23  ?   ?   ?   B . n 
B 1 2   GLY 2   24  ?   ?   ?   B . n 
B 1 3   SER 3   25  ?   ?   ?   B . n 
B 1 4   SER 4   26  ?   ?   ?   B . n 
B 1 5   HIS 5   27  ?   ?   ?   B . n 
B 1 6   HIS 6   28  ?   ?   ?   B . n 
B 1 7   HIS 7   29  ?   ?   ?   B . n 
B 1 8   HIS 8   30  ?   ?   ?   B . n 
B 1 9   HIS 9   31  ?   ?   ?   B . n 
B 1 10  HIS 10  32  ?   ?   ?   B . n 
B 1 11  SER 11  33  ?   ?   ?   B . n 
B 1 12  SER 12  34  ?   ?   ?   B . n 
B 1 13  GLY 13  35  ?   ?   ?   B . n 
B 1 14  LEU 14  36  ?   ?   ?   B . n 
B 1 15  VAL 15  37  ?   ?   ?   B . n 
B 1 16  PRO 16  38  ?   ?   ?   B . n 
B 1 17  ARG 17  39  ?   ?   ?   B . n 
B 1 18  GLY 18  40  ?   ?   ?   B . n 
B 1 19  SER 19  41  ?   ?   ?   B . n 
B 1 20  HIS 20  42  ?   ?   ?   B . n 
B 1 21  MET 21  43  ?   ?   ?   B . n 
B 1 22  ALA 22  44  ?   ?   ?   B . n 
B 1 23  SER 23  45  ?   ?   ?   B . n 
B 1 24  ALA 24  46  46  ALA ALA B . n 
B 1 25  VAL 25  47  47  VAL VAL B . n 
B 1 26  ALA 26  48  48  ALA ALA B . n 
B 1 27  VAL 27  49  49  VAL VAL B . n 
B 1 28  ASP 28  50  50  ASP ASP B . n 
B 1 29  LEU 29  51  51  LEU LEU B . n 
B 1 30  GLY 30  52  52  GLY GLY B . n 
B 1 31  ASN 31  53  53  ASN ASN B . n 
B 1 32  ARG 32  54  54  ARG ARG B . n 
B 1 33  LYS 33  55  55  LYS LYS B . n 
B 1 34  LEU 34  56  56  LEU LEU B . n 
B 1 35  GLU 35  57  57  GLU GLU B . n 
B 1 36  ILE 36  58  58  ILE ILE B . n 
B 1 37  SER 37  59  59  SER SER B . n 
B 1 38  SER 38  60  60  SER SER B . n 
B 1 39  GLY 39  61  61  GLY GLY B . n 
B 1 40  LYS 40  62  ?   ?   ?   B . n 
B 1 41  LEU 41  63  ?   ?   ?   B . n 
B 1 42  ALA 42  64  ?   ?   ?   B . n 
B 1 43  ARG 43  65  ?   ?   ?   B . n 
B 1 44  PHE 44  66  ?   ?   ?   B . n 
B 1 45  ALA 45  67  67  ALA ALA B . n 
B 1 46  ASP 46  68  68  ASP ASP B . n 
B 1 47  GLY 47  69  69  GLY GLY B . n 
B 1 48  SER 48  70  70  SER SER B . n 
B 1 49  ALA 49  71  71  ALA ALA B . n 
B 1 50  VAL 50  72  72  VAL VAL B . n 
B 1 51  VAL 51  73  73  VAL VAL B . n 
B 1 52  GLN 52  74  74  GLN GLN B . n 
B 1 53  SER 53  75  75  SER SER B . n 
B 1 54  GLY 54  76  76  GLY GLY B . n 
B 1 55  ASP 55  77  77  ASP ASP B . n 
B 1 56  THR 56  78  78  THR THR B . n 
B 1 57  ALA 57  79  79  ALA ALA B . n 
B 1 58  VAL 58  80  80  VAL VAL B . n 
B 1 59  MET 59  81  81  MET MET B . n 
B 1 60  VAL 60  82  82  VAL VAL B . n 
B 1 61  THR 61  83  83  THR THR B . n 
B 1 62  ALA 62  84  84  ALA ALA B . n 
B 1 63  VAL 63  85  85  VAL VAL B . n 
B 1 64  SER 64  86  86  SER SER B . n 
B 1 65  LYS 65  87  87  LYS LYS B . n 
B 1 66  THR 66  88  88  THR THR B . n 
B 1 67  LYS 67  89  89  LYS LYS B . n 
B 1 68  PRO 68  90  90  PRO PRO B . n 
B 1 69  SER 69  91  91  SER SER B . n 
B 1 70  PRO 70  92  92  PRO PRO B . n 
B 1 71  SER 71  93  93  SER SER B . n 
B 1 72  GLN 72  94  94  GLN GLN B . n 
B 1 73  PHE 73  95  95  PHE PHE B . n 
B 1 74  MET 74  96  96  MET MET B . n 
B 1 75  PRO 75  97  97  PRO PRO B . n 
B 1 76  LEU 76  98  98  LEU LEU B . n 
B 1 77  VAL 77  99  99  VAL VAL B . n 
B 1 78  VAL 78  100 100 VAL VAL B . n 
B 1 79  ASP 79  101 101 ASP ASP B . n 
B 1 80  TYR 80  102 102 TYR TYR B . n 
B 1 81  ARG 81  103 103 ARG ARG B . n 
B 1 82  GLN 82  104 104 GLN GLN B . n 
B 1 83  LYS 83  105 ?   ?   ?   B . n 
B 1 84  ALA 84  106 ?   ?   ?   B . n 
B 1 85  ALA 85  107 ?   ?   ?   B . n 
B 1 86  ALA 86  108 ?   ?   ?   B . n 
B 1 87  ALA 87  109 ?   ?   ?   B . n 
B 1 88  GLY 88  110 ?   ?   ?   B . n 
B 1 89  ARG 89  111 ?   ?   ?   B . n 
B 1 90  ILE 90  112 ?   ?   ?   B . n 
B 1 91  PRO 91  113 ?   ?   ?   B . n 
B 1 92  THR 92  114 ?   ?   ?   B . n 
B 1 93  ASN 93  115 ?   ?   ?   B . n 
B 1 94  TYR 94  116 ?   ?   ?   B . n 
B 1 95  LEU 95  117 ?   ?   ?   B . n 
B 1 96  ARG 96  118 ?   ?   ?   B . n 
B 1 97  ARG 97  119 ?   ?   ?   B . n 
B 1 98  GLU 98  120 ?   ?   ?   B . n 
B 1 99  ILE 99  121 ?   ?   ?   B . n 
B 1 100 GLY 100 122 ?   ?   ?   B . n 
B 1 101 THR 101 123 ?   ?   ?   B . n 
B 1 102 SER 102 124 124 SER SER B . n 
B 1 103 ASP 103 125 125 ASP ASP B . n 
B 1 104 LYS 104 126 126 LYS LYS B . n 
B 1 105 GLU 105 127 127 GLU GLU B . n 
B 1 106 ILE 106 128 128 ILE ILE B . n 
B 1 107 LEU 107 129 129 LEU LEU B . n 
B 1 108 THR 108 130 130 THR THR B . n 
B 1 109 SER 109 131 131 SER SER B . n 
B 1 110 ARG 110 132 132 ARG ARG B . n 
B 1 111 ILE 111 133 133 ILE ILE B . n 
B 1 112 ILE 112 134 134 ILE ILE B . n 
B 1 113 ASP 113 135 135 ASP ASP B . n 
B 1 114 ARG 114 136 136 ARG ARG B . n 
B 1 115 SER 115 137 137 SER SER B . n 
B 1 116 ILE 116 138 138 ILE ILE B . n 
B 1 117 ARG 117 139 139 ARG ARG B . n 
B 1 118 PRO 118 140 140 PRO PRO B . n 
B 1 119 LEU 119 141 141 LEU LEU B . n 
B 1 120 PHE 120 142 142 PHE PHE B . n 
B 1 121 PRO 121 143 143 PRO PRO B . n 
B 1 122 ALA 122 144 144 ALA ALA B . n 
B 1 123 GLY 123 145 145 GLY GLY B . n 
B 1 124 TYR 124 146 146 TYR TYR B . n 
B 1 125 PHE 125 147 147 PHE PHE B . n 
B 1 126 TYR 126 148 148 TYR TYR B . n 
B 1 127 ASP 127 149 149 ASP ASP B . n 
B 1 128 THR 128 150 150 THR THR B . n 
B 1 129 GLN 129 151 151 GLN GLN B . n 
B 1 130 VAL 130 152 152 VAL VAL B . n 
B 1 131 LEU 131 153 153 LEU LEU B . n 
B 1 132 CYS 132 154 154 CYS CYS B . n 
B 1 133 ASN 133 155 155 ASN ASN B . n 
B 1 134 LEU 134 156 156 LEU LEU B . n 
B 1 135 LEU 135 157 157 LEU LEU B . n 
B 1 136 ALA 136 158 158 ALA ALA B . n 
B 1 137 VAL 137 159 159 VAL VAL B . n 
B 1 138 ASP 138 160 160 ASP ASP B . n 
B 1 139 GLY 139 161 161 GLY GLY B . n 
B 1 140 VAL 140 162 162 VAL VAL B . n 
B 1 141 ASN 141 163 163 ASN ASN B . n 
B 1 142 GLU 142 164 164 GLU GLU B . n 
B 1 143 PRO 143 165 165 PRO PRO B . n 
B 1 144 ASP 144 166 166 ASP ASP B . n 
B 1 145 VAL 145 167 167 VAL VAL B . n 
B 1 146 LEU 146 168 168 LEU LEU B . n 
B 1 147 ALA 147 169 169 ALA ALA B . n 
B 1 148 ILE 148 170 170 ILE ILE B . n 
B 1 149 ASN 149 171 171 ASN ASN B . n 
B 1 150 GLY 150 172 172 GLY GLY B . n 
B 1 151 ALA 151 173 173 ALA ALA B . n 
B 1 152 SER 152 174 174 SER SER B . n 
B 1 153 VAL 153 175 175 VAL VAL B . n 
B 1 154 ALA 154 176 176 ALA ALA B . n 
B 1 155 LEU 155 177 177 LEU LEU B . n 
B 1 156 SER 156 178 178 SER SER B . n 
B 1 157 LEU 157 179 179 LEU LEU B . n 
B 1 158 SER 158 180 180 SER SER B . n 
B 1 159 ASP 159 181 181 ASP ASP B . n 
B 1 160 ILE 160 182 182 ILE ILE B . n 
B 1 161 PRO 161 183 183 PRO PRO B . n 
B 1 162 TRP 162 184 184 TRP TRP B . n 
B 1 163 ASN 163 185 185 ASN ASN B . n 
B 1 164 GLY 164 186 186 GLY GLY B . n 
B 1 165 PRO 165 187 187 PRO PRO B . n 
B 1 166 VAL 166 188 188 VAL VAL B . n 
B 1 167 GLY 167 189 189 GLY GLY B . n 
B 1 168 ALA 168 190 190 ALA ALA B . n 
B 1 169 VAL 169 191 191 VAL VAL B . n 
B 1 170 ARG 170 192 192 ARG ARG B . n 
B 1 171 ILE 171 193 193 ILE ILE B . n 
B 1 172 GLY 172 194 194 GLY GLY B . n 
B 1 173 ILE 173 195 195 ILE ILE B . n 
B 1 174 ILE 174 196 196 ILE ILE B . n 
B 1 175 ASP 175 197 197 ASP ASP B . n 
B 1 176 GLY 176 198 198 GLY GLY B . n 
B 1 177 GLU 177 199 199 GLU GLU B . n 
B 1 178 TYR 178 200 200 TYR TYR B . n 
B 1 179 VAL 179 201 201 VAL VAL B . n 
B 1 180 VAL 180 202 202 VAL VAL B . n 
B 1 181 ASN 181 203 203 ASN ASN B . n 
B 1 182 PRO 182 204 204 PRO PRO B . n 
B 1 183 THR 183 205 205 THR THR B . n 
B 1 184 ARG 184 206 206 ARG ARG B . n 
B 1 185 LYS 185 207 207 LYS LYS B . n 
B 1 186 GLU 186 208 208 GLU GLU B . n 
B 1 187 MET 187 209 209 MET MET B . n 
B 1 188 SER 188 210 210 SER SER B . n 
B 1 189 SER 189 211 211 SER SER B . n 
B 1 190 SER 190 212 212 SER SER B . n 
B 1 191 THR 191 213 213 THR THR B . n 
B 1 192 LEU 192 214 214 LEU LEU B . n 
B 1 193 ASN 193 215 215 ASN ASN B . n 
B 1 194 LEU 194 216 216 LEU LEU B . n 
B 1 195 VAL 195 217 217 VAL VAL B . n 
B 1 196 VAL 196 218 218 VAL VAL B . n 
B 1 197 ALA 197 219 219 ALA ALA B . n 
B 1 198 GLY 198 220 220 GLY GLY B . n 
B 1 199 ALA 199 221 221 ALA ALA B . n 
B 1 200 PRO 200 222 222 PRO PRO B . n 
B 1 201 LYS 201 223 223 LYS LYS B . n 
B 1 202 SER 202 224 224 SER SER B . n 
B 1 203 GLN 203 225 225 GLN GLN B . n 
B 1 204 ILE 204 226 226 ILE ILE B . n 
B 1 205 VAL 205 227 227 VAL VAL B . n 
B 1 206 MET 206 228 228 MET MET B . n 
B 1 207 LEU 207 229 229 LEU LEU B . n 
B 1 208 GLU 208 230 230 GLU GLU B . n 
B 1 209 ALA 209 231 231 ALA ALA B . n 
B 1 210 SER 210 232 232 SER SER B . n 
B 1 211 ALA 211 233 233 ALA ALA B . n 
B 1 212 GLU 212 234 234 GLU GLU B . n 
B 1 213 ASN 213 235 235 ASN ASN B . n 
B 1 214 ILE 214 236 236 ILE ILE B . n 
B 1 215 LEU 215 237 237 LEU LEU B . n 
B 1 216 GLN 216 238 238 GLN GLN B . n 
B 1 217 GLN 217 239 239 GLN GLN B . n 
B 1 218 ASP 218 240 240 ASP ASP B . n 
B 1 219 PHE 219 241 241 PHE PHE B . n 
B 1 220 CYS 220 242 242 CYS CYS B . n 
B 1 221 HIS 221 243 243 HIS HIS B . n 
B 1 222 ALA 222 244 244 ALA ALA B . n 
B 1 223 ILE 223 245 245 ILE ILE B . n 
B 1 224 LYS 224 246 246 LYS LYS B . n 
B 1 225 VAL 225 247 247 VAL VAL B . n 
B 1 226 GLY 226 248 248 GLY GLY B . n 
B 1 227 VAL 227 249 249 VAL VAL B . n 
B 1 228 LYS 228 250 250 LYS LYS B . n 
B 1 229 TYR 229 251 251 TYR TYR B . n 
B 1 230 THR 230 252 252 THR THR B . n 
B 1 231 GLN 231 253 253 GLN GLN B . n 
B 1 232 GLN 232 254 254 GLN GLN B . n 
B 1 233 ILE 233 255 255 ILE ILE B . n 
B 1 234 ILE 234 256 256 ILE ILE B . n 
B 1 235 GLN 235 257 257 GLN GLN B . n 
B 1 236 GLY 236 258 258 GLY GLY B . n 
B 1 237 ILE 237 259 259 ILE ILE B . n 
B 1 238 GLN 238 260 260 GLN GLN B . n 
B 1 239 GLN 239 261 261 GLN GLN B . n 
B 1 240 LEU 240 262 262 LEU LEU B . n 
B 1 241 VAL 241 263 263 VAL VAL B . n 
B 1 242 LYS 242 264 264 LYS LYS B . n 
B 1 243 GLU 243 265 265 GLU GLU B . n 
B 1 244 THR 244 266 266 THR THR B . n 
B 1 245 GLY 245 267 267 GLY GLY B . n 
B 1 246 VAL 246 268 268 VAL VAL B . n 
B 1 247 THR 247 269 269 THR THR B . n 
B 1 248 LYS 248 270 270 LYS LYS B . n 
B 1 249 ARG 249 271 271 ARG ARG B . n 
B 1 250 THR 250 272 272 THR THR B . n 
B 1 251 PRO 251 273 273 PRO PRO B . n 
B 1 252 GLN 252 274 274 GLN GLN B . n 
B 1 253 LYS 253 275 275 LYS LYS B . n 
B 1 254 LEU 254 276 276 LEU LEU B . n 
B 1 255 PHE 255 277 277 PHE PHE B . n 
B 1 256 THR 256 278 278 THR THR B . n 
B 1 257 PRO 257 279 279 PRO PRO B . n 
B 1 258 SER 258 280 280 SER SER B . n 
B 1 259 PRO 259 281 281 PRO PRO B . n 
B 1 260 GLU 260 282 282 GLU GLU B . n 
B 1 261 ILE 261 283 283 ILE ILE B . n 
B 1 262 VAL 262 284 284 VAL VAL B . n 
B 1 263 LYS 263 285 285 LYS LYS B . n 
B 1 264 TYR 264 286 286 TYR TYR B . n 
B 1 265 THR 265 287 287 THR THR B . n 
B 1 266 HIS 266 288 288 HIS HIS B . n 
B 1 267 LYS 267 289 289 LYS LYS B . n 
B 1 268 LEU 268 290 290 LEU LEU B . n 
B 1 269 ALA 269 291 291 ALA ALA B . n 
B 1 270 MET 270 292 292 MET MET B . n 
B 1 271 GLU 271 293 293 GLU GLU B . n 
B 1 272 ARG 272 294 294 ARG ARG B . n 
B 1 273 LEU 273 295 295 LEU LEU B . n 
B 1 274 TYR 274 296 296 TYR TYR B . n 
B 1 275 ALA 275 297 297 ALA ALA B . n 
B 1 276 VAL 276 298 298 VAL VAL B . n 
B 1 277 PHE 277 299 299 PHE PHE B . n 
B 1 278 THR 278 300 300 THR THR B . n 
B 1 279 ASP 279 301 301 ASP ASP B . n 
B 1 280 TYR 280 302 302 TYR TYR B . n 
B 1 281 GLU 281 303 303 GLU GLU B . n 
B 1 282 HIS 282 304 304 HIS HIS B . n 
B 1 283 ASP 283 305 305 ASP ASP B . n 
B 1 284 LYS 284 306 306 LYS LYS B . n 
B 1 285 VAL 285 307 307 VAL VAL B . n 
B 1 286 SER 286 308 308 SER SER B . n 
B 1 287 ARG 287 309 309 ARG ARG B . n 
B 1 288 ASP 288 310 310 ASP ASP B . n 
B 1 289 GLU 289 311 311 GLU GLU B . n 
B 1 290 ALA 290 312 312 ALA ALA B . n 
B 1 291 VAL 291 313 313 VAL VAL B . n 
B 1 292 ASN 292 314 314 ASN ASN B . n 
B 1 293 LYS 293 315 315 LYS LYS B . n 
B 1 294 ILE 294 316 316 ILE ILE B . n 
B 1 295 ARG 295 317 317 ARG ARG B . n 
B 1 296 LEU 296 318 318 LEU LEU B . n 
B 1 297 ASP 297 319 319 ASP ASP B . n 
B 1 298 THR 298 320 320 THR THR B . n 
B 1 299 GLU 299 321 321 GLU GLU B . n 
B 1 300 GLU 300 322 322 GLU GLU B . n 
B 1 301 GLN 301 323 323 GLN GLN B . n 
B 1 302 LEU 302 324 324 LEU LEU B . n 
B 1 303 LYS 303 325 325 LYS LYS B . n 
B 1 304 GLU 304 326 326 GLU GLU B . n 
B 1 305 LYS 305 327 327 LYS LYS B . n 
B 1 306 PHE 306 328 328 PHE PHE B . n 
B 1 307 PRO 307 329 329 PRO PRO B . n 
B 1 308 GLU 308 330 330 GLU GLU B . n 
B 1 309 ALA 309 331 331 ALA ALA B . n 
B 1 310 ASP 310 332 332 ASP ASP B . n 
B 1 311 PRO 311 333 333 PRO PRO B . n 
B 1 312 TYR 312 334 334 TYR TYR B . n 
B 1 313 GLU 313 335 335 GLU GLU B . n 
B 1 314 ILE 314 336 336 ILE ILE B . n 
B 1 315 ILE 315 337 337 ILE ILE B . n 
B 1 316 GLU 316 338 338 GLU GLU B . n 
B 1 317 SER 317 339 339 SER SER B . n 
B 1 318 PHE 318 340 340 PHE PHE B . n 
B 1 319 ASN 319 341 341 ASN ASN B . n 
B 1 320 VAL 320 342 342 VAL VAL B . n 
B 1 321 VAL 321 343 343 VAL VAL B . n 
B 1 322 ALA 322 344 344 ALA ALA B . n 
B 1 323 LYS 323 345 345 LYS LYS B . n 
B 1 324 GLU 324 346 346 GLU GLU B . n 
B 1 325 VAL 325 347 347 VAL VAL B . n 
B 1 326 PHE 326 348 348 PHE PHE B . n 
B 1 327 ARG 327 349 349 ARG ARG B . n 
B 1 328 SER 328 350 350 SER SER B . n 
B 1 329 ILE 329 351 351 ILE ILE B . n 
B 1 330 VAL 330 352 352 VAL VAL B . n 
B 1 331 LEU 331 353 353 LEU LEU B . n 
B 1 332 ASN 332 354 354 ASN ASN B . n 
B 1 333 GLU 333 355 355 GLU GLU B . n 
B 1 334 TYR 334 356 356 TYR TYR B . n 
B 1 335 LYS 335 357 357 LYS LYS B . n 
B 1 336 ARG 336 358 358 ARG ARG B . n 
B 1 337 CYS 337 359 359 CYS CYS B . n 
B 1 338 ASP 338 360 360 ASP ASP B . n 
B 1 339 GLY 339 361 361 GLY GLY B . n 
B 1 340 ARG 340 362 362 ARG ARG B . n 
B 1 341 ASP 341 363 363 ASP ASP B . n 
B 1 342 LEU 342 364 364 LEU LEU B . n 
B 1 343 THR 343 365 365 THR THR B . n 
B 1 344 SER 344 366 366 SER SER B . n 
B 1 345 LEU 345 367 367 LEU LEU B . n 
B 1 346 ARG 346 368 368 ARG ARG B . n 
B 1 347 ASN 347 369 369 ASN ASN B . n 
B 1 348 VAL 348 370 370 VAL VAL B . n 
B 1 349 SER 349 371 371 SER SER B . n 
B 1 350 CYS 350 372 372 CYS CYS B . n 
B 1 351 GLU 351 373 373 GLU GLU B . n 
B 1 352 VAL 352 374 374 VAL VAL B . n 
B 1 353 ASP 353 375 375 ASP ASP B . n 
B 1 354 MET 354 376 376 MET MET B . n 
B 1 355 PHE 355 377 377 PHE PHE B . n 
B 1 356 LYS 356 378 378 LYS LYS B . n 
B 1 357 THR 357 379 379 THR THR B . n 
B 1 358 LEU 358 380 380 LEU LEU B . n 
B 1 359 HIS 359 381 381 HIS HIS B . n 
B 1 360 GLY 360 382 382 GLY GLY B . n 
B 1 361 SER 361 383 383 SER SER B . n 
B 1 362 ALA 362 384 384 ALA ALA B . n 
B 1 363 LEU 363 385 385 LEU LEU B . n 
B 1 364 PHE 364 386 386 PHE PHE B . n 
B 1 365 GLN 365 387 387 GLN GLN B . n 
B 1 366 ARG 366 388 388 ARG ARG B . n 
B 1 367 GLY 367 389 389 GLY GLY B . n 
B 1 368 GLN 368 390 390 GLN GLN B . n 
B 1 369 THR 369 391 391 THR THR B . n 
B 1 370 GLN 370 392 392 GLN GLN B . n 
B 1 371 VAL 371 393 393 VAL VAL B . n 
B 1 372 LEU 372 394 394 LEU LEU B . n 
B 1 373 CYS 373 395 395 CYS CYS B . n 
B 1 374 THR 374 396 396 THR THR B . n 
B 1 375 VAL 375 397 397 VAL VAL B . n 
B 1 376 THR 376 398 398 THR THR B . n 
B 1 377 PHE 377 399 399 PHE PHE B . n 
B 1 378 ASP 378 400 400 ASP ASP B . n 
B 1 379 SER 379 401 401 SER SER B . n 
B 1 380 LEU 380 402 402 LEU LEU B . n 
B 1 381 GLU 381 403 403 GLU GLU B . n 
B 1 382 SER 382 404 404 SER SER B . n 
B 1 383 GLY 383 405 ?   ?   ?   B . n 
B 1 384 ILE 384 406 ?   ?   ?   B . n 
B 1 385 LYS 385 407 ?   ?   ?   B . n 
B 1 386 SER 386 408 ?   ?   ?   B . n 
B 1 387 ASP 387 409 ?   ?   ?   B . n 
B 1 388 GLN 388 410 ?   ?   ?   B . n 
B 1 389 VAL 389 411 ?   ?   ?   B . n 
B 1 390 ILE 390 412 ?   ?   ?   B . n 
B 1 391 THR 391 413 ?   ?   ?   B . n 
B 1 392 ALA 392 414 ?   ?   ?   B . n 
B 1 393 ILE 393 415 ?   ?   ?   B . n 
B 1 394 ASN 394 416 ?   ?   ?   B . n 
B 1 395 GLY 395 417 ?   ?   ?   B . n 
B 1 396 ILE 396 418 ?   ?   ?   B . n 
B 1 397 LYS 397 419 ?   ?   ?   B . n 
B 1 398 ASP 398 420 420 ASP ASP B . n 
B 1 399 LYS 399 421 421 LYS LYS B . n 
B 1 400 ASN 400 422 422 ASN ASN B . n 
B 1 401 PHE 401 423 423 PHE PHE B . n 
B 1 402 MET 402 424 424 MET MET B . n 
B 1 403 LEU 403 425 425 LEU LEU B . n 
B 1 404 HIS 404 426 426 HIS HIS B . n 
B 1 405 TYR 405 427 427 TYR TYR B . n 
B 1 406 GLU 406 428 428 GLU GLU B . n 
B 1 407 PHE 407 429 ?   ?   ?   B . n 
B 1 408 PRO 408 430 ?   ?   ?   B . n 
B 1 409 PRO 409 431 ?   ?   ?   B . n 
B 1 410 TYR 410 432 ?   ?   ?   B . n 
B 1 411 ALA 411 433 ?   ?   ?   B . n 
B 1 412 THR 412 434 ?   ?   ?   B . n 
B 1 413 ASN 413 435 ?   ?   ?   B . n 
B 1 414 GLU 414 436 ?   ?   ?   B . n 
B 1 415 ILE 415 437 ?   ?   ?   B . n 
B 1 416 GLY 416 438 ?   ?   ?   B . n 
B 1 417 LYS 417 439 ?   ?   ?   B . n 
B 1 418 VAL 418 440 ?   ?   ?   B . n 
B 1 419 THR 419 441 ?   ?   ?   B . n 
B 1 420 GLY 420 442 ?   ?   ?   B . n 
B 1 421 LEU 421 443 ?   ?   ?   B . n 
B 1 422 ASN 422 444 ?   ?   ?   B . n 
B 1 423 ARG 423 445 ?   ?   ?   B . n 
B 1 424 ARG 424 446 ?   ?   ?   B . n 
B 1 425 GLU 425 447 ?   ?   ?   B . n 
B 1 426 LEU 426 448 ?   ?   ?   B . n 
B 1 427 GLY 427 449 449 GLY GLY B . n 
B 1 428 HIS 428 450 450 HIS HIS B . n 
B 1 429 GLY 429 451 451 GLY GLY B . n 
B 1 430 ALA 430 452 452 ALA ALA B . n 
B 1 431 LEU 431 453 453 LEU LEU B . n 
B 1 432 ALA 432 454 454 ALA ALA B . n 
B 1 433 GLU 433 455 455 GLU GLU B . n 
B 1 434 LYS 434 456 456 LYS LYS B . n 
B 1 435 ALA 435 457 457 ALA ALA B . n 
B 1 436 LEU 436 458 458 LEU LEU B . n 
B 1 437 TYR 437 459 459 TYR TYR B . n 
B 1 438 PRO 438 460 460 PRO PRO B . n 
B 1 439 VAL 439 461 461 VAL VAL B . n 
B 1 440 ILE 440 462 462 ILE ILE B . n 
B 1 441 PRO 441 463 463 PRO PRO B . n 
B 1 442 ARG 442 464 464 ARG ARG B . n 
B 1 443 ASP 443 465 465 ASP ASP B . n 
B 1 444 PHE 444 466 466 PHE PHE B . n 
B 1 445 PRO 445 467 467 PRO PRO B . n 
B 1 446 PHE 446 468 468 PHE PHE B . n 
B 1 447 THR 447 469 469 THR THR B . n 
B 1 448 ILE 448 470 470 ILE ILE B . n 
B 1 449 ARG 449 471 471 ARG ARG B . n 
B 1 450 VAL 450 472 472 VAL VAL B . n 
B 1 451 THR 451 473 473 THR THR B . n 
B 1 452 SER 452 474 474 SER SER B . n 
B 1 453 GLU 453 475 475 GLU GLU B . n 
B 1 454 VAL 454 476 476 VAL VAL B . n 
B 1 455 LEU 455 477 477 LEU LEU B . n 
B 1 456 GLU 456 478 478 GLU GLU B . n 
B 1 457 SER 457 479 479 SER SER B . n 
B 1 458 ASN 458 480 480 ASN ASN B . n 
B 1 459 GLY 459 481 481 GLY GLY B . n 
B 1 460 SER 460 482 482 SER SER B . n 
B 1 461 SER 461 483 483 SER SER B . n 
B 1 462 SER 462 484 484 SER SER B . n 
B 1 463 MET 463 485 485 MET MET B . n 
B 1 464 ALA 464 486 486 ALA ALA B . n 
B 1 465 SER 465 487 487 SER SER B . n 
B 1 466 ALA 466 488 488 ALA ALA B . n 
B 1 467 CYS 467 489 489 CYS CYS B . n 
B 1 468 GLY 468 490 490 GLY GLY B . n 
B 1 469 GLY 469 491 491 GLY GLY B . n 
B 1 470 SER 470 492 492 SER SER B . n 
B 1 471 LEU 471 493 493 LEU LEU B . n 
B 1 472 ALA 472 494 494 ALA ALA B . n 
B 1 473 LEU 473 495 495 LEU LEU B . n 
B 1 474 MET 474 496 496 MET MET B . n 
B 1 475 ASP 475 497 497 ASP ASP B . n 
B 1 476 SER 476 498 498 SER SER B . n 
B 1 477 GLY 477 499 499 GLY GLY B . n 
B 1 478 VAL 478 500 500 VAL VAL B . n 
B 1 479 PRO 479 501 501 PRO PRO B . n 
B 1 480 ILE 480 502 502 ILE ILE B . n 
B 1 481 SER 481 503 503 SER SER B . n 
B 1 482 SER 482 504 504 SER SER B . n 
B 1 483 ALA 483 505 505 ALA ALA B . n 
B 1 484 VAL 484 506 506 VAL VAL B . n 
B 1 485 ALA 485 507 507 ALA ALA B . n 
B 1 486 GLY 486 508 508 GLY GLY B . n 
B 1 487 VAL 487 509 509 VAL VAL B . n 
B 1 488 ALA 488 510 510 ALA ALA B . n 
B 1 489 ILE 489 511 511 ILE ILE B . n 
B 1 490 GLY 490 512 512 GLY GLY B . n 
B 1 491 LEU 491 513 513 LEU LEU B . n 
B 1 492 VAL 492 514 514 VAL VAL B . n 
B 1 493 THR 493 515 515 THR THR B . n 
B 1 494 LYS 494 516 516 LYS LYS B . n 
B 1 495 THR 495 517 517 THR THR B . n 
B 1 496 ASP 496 518 ?   ?   ?   B . n 
B 1 497 PRO 497 519 ?   ?   ?   B . n 
B 1 498 GLU 498 520 ?   ?   ?   B . n 
B 1 499 LYS 499 521 ?   ?   ?   B . n 
B 1 500 GLY 500 522 ?   ?   ?   B . n 
B 1 501 GLU 501 523 ?   ?   ?   B . n 
B 1 502 ILE 502 524 524 ILE ILE B . n 
B 1 503 GLU 503 525 525 GLU GLU B . n 
B 1 504 ASP 504 526 526 ASP ASP B . n 
B 1 505 TYR 505 527 527 TYR TYR B . n 
B 1 506 ARG 506 528 528 ARG ARG B . n 
B 1 507 LEU 507 529 529 LEU LEU B . n 
B 1 508 LEU 508 530 530 LEU LEU B . n 
B 1 509 THR 509 531 531 THR THR B . n 
B 1 510 ASP 510 532 532 ASP ASP B . n 
B 1 511 ILE 511 533 533 ILE ILE B . n 
B 1 512 LEU 512 534 534 LEU LEU B . n 
B 1 513 GLY 513 535 535 GLY GLY B . n 
B 1 514 ILE 514 536 536 ILE ILE B . n 
B 1 515 GLU 515 537 537 GLU GLU B . n 
B 1 516 ASP 516 538 538 ASP ASP B . n 
B 1 517 TYR 517 539 539 TYR TYR B . n 
B 1 518 ASN 518 540 540 ASN ASN B . n 
B 1 519 GLY 519 541 541 GLY GLY B . n 
B 1 520 ASP 520 542 542 ASP ASP B . n 
B 1 521 MET 521 543 543 MET MET B . n 
B 1 522 ASP 522 544 544 ASP ASP B . n 
B 1 523 PHE 523 545 545 PHE PHE B . n 
B 1 524 LYS 524 546 546 LYS LYS B . n 
B 1 525 ILE 525 547 547 ILE ILE B . n 
B 1 526 ALA 526 548 548 ALA ALA B . n 
B 1 527 GLY 527 549 549 GLY GLY B . n 
B 1 528 THR 528 550 550 THR THR B . n 
B 1 529 ASN 529 551 551 ASN ASN B . n 
B 1 530 LYS 530 552 552 LYS LYS B . n 
B 1 531 GLY 531 553 553 GLY GLY B . n 
B 1 532 ILE 532 554 554 ILE ILE B . n 
B 1 533 THR 533 555 555 THR THR B . n 
B 1 534 ALA 534 556 556 ALA ALA B . n 
B 1 535 LEU 535 557 557 LEU LEU B . n 
B 1 536 GLN 536 558 558 GLN GLN B . n 
B 1 537 ALA 537 559 559 ALA ALA B . n 
B 1 538 ASP 538 560 560 ASP ASP B . n 
B 1 539 ILE 539 561 561 ILE ILE B . n 
B 1 540 LYS 540 562 562 LYS LYS B . n 
B 1 541 LEU 541 563 563 LEU LEU B . n 
B 1 542 PRO 542 564 564 PRO PRO B . n 
B 1 543 GLY 543 565 565 GLY GLY B . n 
B 1 544 ILE 544 566 566 ILE ILE B . n 
B 1 545 PRO 545 567 567 PRO PRO B . n 
B 1 546 ILE 546 568 568 ILE ILE B . n 
B 1 547 LYS 547 569 569 LYS LYS B . n 
B 1 548 ILE 548 570 570 ILE ILE B . n 
B 1 549 VAL 549 571 571 VAL VAL B . n 
B 1 550 MET 550 572 572 MET MET B . n 
B 1 551 GLU 551 573 573 GLU GLU B . n 
B 1 552 ALA 552 574 574 ALA ALA B . n 
B 1 553 ILE 553 575 575 ILE ILE B . n 
B 1 554 GLN 554 576 576 GLN GLN B . n 
B 1 555 GLN 555 577 577 GLN GLN B . n 
B 1 556 ALA 556 578 578 ALA ALA B . n 
B 1 557 SER 557 579 579 SER SER B . n 
B 1 558 VAL 558 580 580 VAL VAL B . n 
B 1 559 ALA 559 581 581 ALA ALA B . n 
B 1 560 LYS 560 582 582 LYS LYS B . n 
B 1 561 LYS 561 583 583 LYS LYS B . n 
B 1 562 GLU 562 584 584 GLU GLU B . n 
B 1 563 ILE 563 585 585 ILE ILE B . n 
B 1 564 LEU 564 586 586 LEU LEU B . n 
B 1 565 GLN 565 587 587 GLN GLN B . n 
B 1 566 ILE 566 588 588 ILE ILE B . n 
B 1 567 MET 567 589 589 MET MET B . n 
B 1 568 ASN 568 590 590 ASN ASN B . n 
B 1 569 LYS 569 591 591 LYS LYS B . n 
B 1 570 THR 570 592 592 THR THR B . n 
B 1 571 ILE 571 593 593 ILE ILE B . n 
B 1 572 SER 572 594 594 SER SER B . n 
B 1 573 LYS 573 595 595 LYS LYS B . n 
B 1 574 PRO 574 596 596 PRO PRO B . n 
B 1 575 ARG 575 597 597 ARG ARG B . n 
B 1 576 ALA 576 598 598 ALA ALA B . n 
B 1 577 SER 577 599 599 SER SER B . n 
B 1 578 ARG 578 600 600 ARG ARG B . n 
B 1 579 LYS 579 601 601 LYS LYS B . n 
B 1 580 GLU 580 602 602 GLU GLU B . n 
B 1 581 ASN 581 603 603 ASN ASN B . n 
B 1 582 GLY 582 604 604 GLY GLY B . n 
B 1 583 PRO 583 605 605 PRO PRO B . n 
B 1 584 VAL 584 606 606 VAL VAL B . n 
B 1 585 VAL 585 607 607 VAL VAL B . n 
B 1 586 GLU 586 608 608 GLU GLU B . n 
B 1 587 THR 587 609 609 THR THR B . n 
B 1 588 VAL 588 610 610 VAL VAL B . n 
B 1 589 GLN 589 611 611 GLN GLN B . n 
B 1 590 VAL 590 612 612 VAL VAL B . n 
B 1 591 PRO 591 613 613 PRO PRO B . n 
B 1 592 LEU 592 614 614 LEU LEU B . n 
B 1 593 SER 593 615 ?   ?   ?   B . n 
B 1 594 LYS 594 616 ?   ?   ?   B . n 
B 1 595 ARG 595 617 ?   ?   ?   B . n 
B 1 596 ALA 596 618 ?   ?   ?   B . n 
B 1 597 LYS 597 619 ?   ?   ?   B . n 
B 1 598 PHE 598 620 620 PHE PHE B . n 
B 1 599 VAL 599 621 621 VAL VAL B . n 
B 1 600 GLY 600 622 622 GLY GLY B . n 
B 1 601 PRO 601 623 623 PRO PRO B . n 
B 1 602 GLY 602 624 624 GLY GLY B . n 
B 1 603 GLY 603 625 625 GLY GLY B . n 
B 1 604 TYR 604 626 626 TYR TYR B . n 
B 1 605 ASN 605 627 627 ASN ASN B . n 
B 1 606 LEU 606 628 628 LEU LEU B . n 
B 1 607 LYS 607 629 629 LYS LYS B . n 
B 1 608 LYS 608 630 630 LYS LYS B . n 
B 1 609 LEU 609 631 631 LEU LEU B . n 
B 1 610 GLN 610 632 632 GLN GLN B . n 
B 1 611 ALA 611 633 633 ALA ALA B . n 
B 1 612 GLU 612 634 634 GLU GLU B . n 
B 1 613 THR 613 635 635 THR THR B . n 
B 1 614 GLY 614 636 636 GLY GLY B . n 
B 1 615 VAL 615 637 637 VAL VAL B . n 
B 1 616 THR 616 638 638 THR THR B . n 
B 1 617 ILE 617 639 639 ILE ILE B . n 
B 1 618 SER 618 640 640 SER SER B . n 
B 1 619 GLN 619 641 641 GLN GLN B . n 
B 1 620 VAL 620 642 ?   ?   ?   B . n 
B 1 621 ASP 621 643 ?   ?   ?   B . n 
B 1 622 GLU 622 644 ?   ?   ?   B . n 
B 1 623 GLU 623 645 ?   ?   ?   B . n 
B 1 624 THR 624 646 646 THR THR B . n 
B 1 625 PHE 625 647 647 PHE PHE B . n 
B 1 626 SER 626 648 648 SER SER B . n 
B 1 627 VAL 627 649 649 VAL VAL B . n 
B 1 628 PHE 628 650 650 PHE PHE B . n 
B 1 629 ALA 629 651 651 ALA ALA B . n 
B 1 630 PRO 630 652 652 PRO PRO B . n 
B 1 631 THR 631 653 653 THR THR B . n 
B 1 632 PRO 632 654 654 PRO PRO B . n 
B 1 633 SER 633 655 655 SER SER B . n 
B 1 634 ALA 634 656 656 ALA ALA B . n 
B 1 635 MET 635 657 657 MET MET B . n 
B 1 636 HIS 636 658 658 HIS HIS B . n 
B 1 637 GLU 637 659 659 GLU GLU B . n 
B 1 638 ALA 638 660 660 ALA ALA B . n 
B 1 639 ARG 639 661 661 ARG ARG B . n 
B 1 640 ASP 640 662 662 ASP ASP B . n 
B 1 641 PHE 641 663 663 PHE PHE B . n 
B 1 642 ILE 642 664 664 ILE ILE B . n 
B 1 643 THR 643 665 665 THR THR B . n 
B 1 644 GLU 644 666 666 GLU GLU B . n 
B 1 645 ILE 645 667 667 ILE ILE B . n 
B 1 646 CYS 646 668 ?   ?   ?   B . n 
B 1 647 LYS 647 669 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  701 82  HOH HOH A . 
C 2 HOH 2  702 111 HOH HOH A . 
C 2 HOH 3  703 25  HOH HOH A . 
C 2 HOH 4  704 22  HOH HOH A . 
C 2 HOH 5  705 13  HOH HOH A . 
C 2 HOH 6  706 81  HOH HOH A . 
C 2 HOH 7  707 9   HOH HOH A . 
C 2 HOH 8  708 79  HOH HOH A . 
C 2 HOH 9  709 1   HOH HOH A . 
C 2 HOH 10 710 8   HOH HOH A . 
C 2 HOH 11 711 15  HOH HOH A . 
C 2 HOH 12 712 51  HOH HOH A . 
C 2 HOH 13 713 30  HOH HOH A . 
C 2 HOH 14 714 110 HOH HOH A . 
C 2 HOH 15 715 24  HOH HOH A . 
C 2 HOH 16 716 26  HOH HOH A . 
C 2 HOH 17 717 85  HOH HOH A . 
C 2 HOH 18 718 32  HOH HOH A . 
C 2 HOH 19 719 95  HOH HOH A . 
C 2 HOH 20 720 57  HOH HOH A . 
C 2 HOH 21 721 7   HOH HOH A . 
C 2 HOH 22 722 29  HOH HOH A . 
C 2 HOH 23 723 43  HOH HOH A . 
C 2 HOH 24 724 44  HOH HOH A . 
C 2 HOH 25 725 84  HOH HOH A . 
C 2 HOH 26 726 18  HOH HOH A . 
C 2 HOH 27 727 88  HOH HOH A . 
C 2 HOH 28 728 71  HOH HOH A . 
C 2 HOH 29 729 27  HOH HOH A . 
C 2 HOH 30 730 77  HOH HOH A . 
C 2 HOH 31 731 3   HOH HOH A . 
C 2 HOH 32 732 60  HOH HOH A . 
C 2 HOH 33 733 106 HOH HOH A . 
C 2 HOH 34 734 65  HOH HOH A . 
C 2 HOH 35 735 46  HOH HOH A . 
C 2 HOH 36 736 86  HOH HOH A . 
C 2 HOH 37 737 68  HOH HOH A . 
D 2 HOH 1  701 89  HOH HOH B . 
D 2 HOH 2  702 19  HOH HOH B . 
D 2 HOH 3  703 36  HOH HOH B . 
D 2 HOH 4  704 102 HOH HOH B . 
D 2 HOH 5  705 54  HOH HOH B . 
D 2 HOH 6  706 109 HOH HOH B . 
D 2 HOH 7  707 23  HOH HOH B . 
D 2 HOH 8  708 52  HOH HOH B . 
D 2 HOH 9  709 59  HOH HOH B . 
D 2 HOH 10 710 16  HOH HOH B . 
D 2 HOH 11 711 70  HOH HOH B . 
D 2 HOH 12 712 11  HOH HOH B . 
D 2 HOH 13 713 42  HOH HOH B . 
D 2 HOH 14 714 48  HOH HOH B . 
D 2 HOH 15 715 47  HOH HOH B . 
D 2 HOH 16 716 107 HOH HOH B . 
D 2 HOH 17 717 21  HOH HOH B . 
D 2 HOH 18 718 14  HOH HOH B . 
D 2 HOH 19 719 33  HOH HOH B . 
D 2 HOH 20 720 10  HOH HOH B . 
D 2 HOH 21 721 5   HOH HOH B . 
D 2 HOH 22 722 6   HOH HOH B . 
D 2 HOH 23 723 103 HOH HOH B . 
D 2 HOH 24 724 93  HOH HOH B . 
D 2 HOH 25 725 12  HOH HOH B . 
D 2 HOH 26 726 73  HOH HOH B . 
D 2 HOH 27 727 91  HOH HOH B . 
D 2 HOH 28 728 113 HOH HOH B . 
D 2 HOH 29 729 96  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2050  ? 
1 MORE         -8    ? 
1 'SSA (A^2)'  46800 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-08-22 
2 'Structure model' 1 1 2018-10-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.13_2998: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .                  4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 51  ? ? -82.02  -149.97 
2  1 PHE A 95  ? ? -122.24 -163.63 
3  1 ASN A 480 ? ? -142.37 52.91   
4  1 LYS A 521 ? ? -105.82 -166.15 
5  1 ASP A 532 ? ? 57.11   76.38   
6  1 PRO A 564 ? ? -75.77  45.56   
7  1 LEU B 51  ? ? -105.79 63.66   
8  1 ASN B 53  ? ? -79.49  -71.11  
9  1 SER B 60  ? ? -106.91 -163.56 
10 1 GLU B 403 ? ? -88.77  48.65   
11 1 ARG B 464 ? ? -81.29  -74.01  
12 1 ASN B 480 ? ? -159.74 37.64   
13 1 SER B 482 ? ? 52.79   71.07   
14 1 ASP B 532 ? ? 61.09   74.38   
15 1 PRO B 564 ? ? -69.86  45.54   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 23  ? A MET 1   
2   1 Y 1 A GLY 24  ? A GLY 2   
3   1 Y 1 A SER 25  ? A SER 3   
4   1 Y 1 A SER 26  ? A SER 4   
5   1 Y 1 A HIS 27  ? A HIS 5   
6   1 Y 1 A HIS 28  ? A HIS 6   
7   1 Y 1 A HIS 29  ? A HIS 7   
8   1 Y 1 A HIS 30  ? A HIS 8   
9   1 Y 1 A HIS 31  ? A HIS 9   
10  1 Y 1 A HIS 32  ? A HIS 10  
11  1 Y 1 A SER 33  ? A SER 11  
12  1 Y 1 A SER 34  ? A SER 12  
13  1 Y 1 A GLY 35  ? A GLY 13  
14  1 Y 1 A LEU 36  ? A LEU 14  
15  1 Y 1 A VAL 37  ? A VAL 15  
16  1 Y 1 A PRO 38  ? A PRO 16  
17  1 Y 1 A ARG 39  ? A ARG 17  
18  1 Y 1 A GLY 40  ? A GLY 18  
19  1 Y 1 A SER 41  ? A SER 19  
20  1 Y 1 A HIS 42  ? A HIS 20  
21  1 Y 1 A MET 43  ? A MET 21  
22  1 Y 1 A ALA 44  ? A ALA 22  
23  1 Y 1 A SER 45  ? A SER 23  
24  1 Y 1 A LYS 62  ? A LYS 40  
25  1 Y 1 A LEU 63  ? A LEU 41  
26  1 Y 1 A ALA 64  ? A ALA 42  
27  1 Y 1 A ARG 65  ? A ARG 43  
28  1 Y 1 A PHE 66  ? A PHE 44  
29  1 Y 1 A LYS 105 ? A LYS 83  
30  1 Y 1 A ALA 106 ? A ALA 84  
31  1 Y 1 A ALA 107 ? A ALA 85  
32  1 Y 1 A ALA 108 ? A ALA 86  
33  1 Y 1 A ALA 109 ? A ALA 87  
34  1 Y 1 A GLY 110 ? A GLY 88  
35  1 Y 1 A ARG 111 ? A ARG 89  
36  1 Y 1 A ILE 112 ? A ILE 90  
37  1 Y 1 A PRO 113 ? A PRO 91  
38  1 Y 1 A THR 114 ? A THR 92  
39  1 Y 1 A ASN 115 ? A ASN 93  
40  1 Y 1 A TYR 116 ? A TYR 94  
41  1 Y 1 A LEU 117 ? A LEU 95  
42  1 Y 1 A ARG 118 ? A ARG 96  
43  1 Y 1 A ARG 119 ? A ARG 97  
44  1 Y 1 A GLU 120 ? A GLU 98  
45  1 Y 1 A ILE 121 ? A ILE 99  
46  1 Y 1 A GLY 122 ? A GLY 100 
47  1 Y 1 A THR 123 ? A THR 101 
48  1 Y 1 A GLY 405 ? A GLY 383 
49  1 Y 1 A ILE 406 ? A ILE 384 
50  1 Y 1 A LYS 407 ? A LYS 385 
51  1 Y 1 A SER 408 ? A SER 386 
52  1 Y 1 A ASP 409 ? A ASP 387 
53  1 Y 1 A GLN 410 ? A GLN 388 
54  1 Y 1 A VAL 411 ? A VAL 389 
55  1 Y 1 A ILE 412 ? A ILE 390 
56  1 Y 1 A THR 413 ? A THR 391 
57  1 Y 1 A ALA 414 ? A ALA 392 
58  1 Y 1 A ILE 415 ? A ILE 393 
59  1 Y 1 A ASN 416 ? A ASN 394 
60  1 Y 1 A GLY 417 ? A GLY 395 
61  1 Y 1 A ILE 418 ? A ILE 396 
62  1 Y 1 A LYS 419 ? A LYS 397 
63  1 Y 1 A GLU 428 ? A GLU 406 
64  1 Y 1 A PHE 429 ? A PHE 407 
65  1 Y 1 A PRO 430 ? A PRO 408 
66  1 Y 1 A PRO 431 ? A PRO 409 
67  1 Y 1 A TYR 432 ? A TYR 410 
68  1 Y 1 A ALA 433 ? A ALA 411 
69  1 Y 1 A THR 434 ? A THR 412 
70  1 Y 1 A ASN 435 ? A ASN 413 
71  1 Y 1 A GLU 436 ? A GLU 414 
72  1 Y 1 A ILE 437 ? A ILE 415 
73  1 Y 1 A GLY 438 ? A GLY 416 
74  1 Y 1 A LYS 439 ? A LYS 417 
75  1 Y 1 A VAL 440 ? A VAL 418 
76  1 Y 1 A THR 441 ? A THR 419 
77  1 Y 1 A GLY 442 ? A GLY 420 
78  1 Y 1 A LEU 443 ? A LEU 421 
79  1 Y 1 A ASN 444 ? A ASN 422 
80  1 Y 1 A ARG 445 ? A ARG 423 
81  1 Y 1 A ARG 446 ? A ARG 424 
82  1 Y 1 A GLU 447 ? A GLU 425 
83  1 Y 1 A LEU 448 ? A LEU 426 
84  1 Y 1 A ASP 643 ? A ASP 621 
85  1 Y 1 A GLU 644 ? A GLU 622 
86  1 Y 1 A CYS 668 ? A CYS 646 
87  1 Y 1 A LYS 669 ? A LYS 647 
88  1 Y 1 B MET 23  ? B MET 1   
89  1 Y 1 B GLY 24  ? B GLY 2   
90  1 Y 1 B SER 25  ? B SER 3   
91  1 Y 1 B SER 26  ? B SER 4   
92  1 Y 1 B HIS 27  ? B HIS 5   
93  1 Y 1 B HIS 28  ? B HIS 6   
94  1 Y 1 B HIS 29  ? B HIS 7   
95  1 Y 1 B HIS 30  ? B HIS 8   
96  1 Y 1 B HIS 31  ? B HIS 9   
97  1 Y 1 B HIS 32  ? B HIS 10  
98  1 Y 1 B SER 33  ? B SER 11  
99  1 Y 1 B SER 34  ? B SER 12  
100 1 Y 1 B GLY 35  ? B GLY 13  
101 1 Y 1 B LEU 36  ? B LEU 14  
102 1 Y 1 B VAL 37  ? B VAL 15  
103 1 Y 1 B PRO 38  ? B PRO 16  
104 1 Y 1 B ARG 39  ? B ARG 17  
105 1 Y 1 B GLY 40  ? B GLY 18  
106 1 Y 1 B SER 41  ? B SER 19  
107 1 Y 1 B HIS 42  ? B HIS 20  
108 1 Y 1 B MET 43  ? B MET 21  
109 1 Y 1 B ALA 44  ? B ALA 22  
110 1 Y 1 B SER 45  ? B SER 23  
111 1 Y 1 B LYS 62  ? B LYS 40  
112 1 Y 1 B LEU 63  ? B LEU 41  
113 1 Y 1 B ALA 64  ? B ALA 42  
114 1 Y 1 B ARG 65  ? B ARG 43  
115 1 Y 1 B PHE 66  ? B PHE 44  
116 1 Y 1 B LYS 105 ? B LYS 83  
117 1 Y 1 B ALA 106 ? B ALA 84  
118 1 Y 1 B ALA 107 ? B ALA 85  
119 1 Y 1 B ALA 108 ? B ALA 86  
120 1 Y 1 B ALA 109 ? B ALA 87  
121 1 Y 1 B GLY 110 ? B GLY 88  
122 1 Y 1 B ARG 111 ? B ARG 89  
123 1 Y 1 B ILE 112 ? B ILE 90  
124 1 Y 1 B PRO 113 ? B PRO 91  
125 1 Y 1 B THR 114 ? B THR 92  
126 1 Y 1 B ASN 115 ? B ASN 93  
127 1 Y 1 B TYR 116 ? B TYR 94  
128 1 Y 1 B LEU 117 ? B LEU 95  
129 1 Y 1 B ARG 118 ? B ARG 96  
130 1 Y 1 B ARG 119 ? B ARG 97  
131 1 Y 1 B GLU 120 ? B GLU 98  
132 1 Y 1 B ILE 121 ? B ILE 99  
133 1 Y 1 B GLY 122 ? B GLY 100 
134 1 Y 1 B THR 123 ? B THR 101 
135 1 Y 1 B GLY 405 ? B GLY 383 
136 1 Y 1 B ILE 406 ? B ILE 384 
137 1 Y 1 B LYS 407 ? B LYS 385 
138 1 Y 1 B SER 408 ? B SER 386 
139 1 Y 1 B ASP 409 ? B ASP 387 
140 1 Y 1 B GLN 410 ? B GLN 388 
141 1 Y 1 B VAL 411 ? B VAL 389 
142 1 Y 1 B ILE 412 ? B ILE 390 
143 1 Y 1 B THR 413 ? B THR 391 
144 1 Y 1 B ALA 414 ? B ALA 392 
145 1 Y 1 B ILE 415 ? B ILE 393 
146 1 Y 1 B ASN 416 ? B ASN 394 
147 1 Y 1 B GLY 417 ? B GLY 395 
148 1 Y 1 B ILE 418 ? B ILE 396 
149 1 Y 1 B LYS 419 ? B LYS 397 
150 1 Y 1 B PHE 429 ? B PHE 407 
151 1 Y 1 B PRO 430 ? B PRO 408 
152 1 Y 1 B PRO 431 ? B PRO 409 
153 1 Y 1 B TYR 432 ? B TYR 410 
154 1 Y 1 B ALA 433 ? B ALA 411 
155 1 Y 1 B THR 434 ? B THR 412 
156 1 Y 1 B ASN 435 ? B ASN 413 
157 1 Y 1 B GLU 436 ? B GLU 414 
158 1 Y 1 B ILE 437 ? B ILE 415 
159 1 Y 1 B GLY 438 ? B GLY 416 
160 1 Y 1 B LYS 439 ? B LYS 417 
161 1 Y 1 B VAL 440 ? B VAL 418 
162 1 Y 1 B THR 441 ? B THR 419 
163 1 Y 1 B GLY 442 ? B GLY 420 
164 1 Y 1 B LEU 443 ? B LEU 421 
165 1 Y 1 B ASN 444 ? B ASN 422 
166 1 Y 1 B ARG 445 ? B ARG 423 
167 1 Y 1 B ARG 446 ? B ARG 424 
168 1 Y 1 B GLU 447 ? B GLU 425 
169 1 Y 1 B LEU 448 ? B LEU 426 
170 1 Y 1 B ASP 518 ? B ASP 496 
171 1 Y 1 B PRO 519 ? B PRO 497 
172 1 Y 1 B GLU 520 ? B GLU 498 
173 1 Y 1 B LYS 521 ? B LYS 499 
174 1 Y 1 B GLY 522 ? B GLY 500 
175 1 Y 1 B GLU 523 ? B GLU 501 
176 1 Y 1 B SER 615 ? B SER 593 
177 1 Y 1 B LYS 616 ? B LYS 594 
178 1 Y 1 B ARG 617 ? B ARG 595 
179 1 Y 1 B ALA 618 ? B ALA 596 
180 1 Y 1 B LYS 619 ? B LYS 597 
181 1 Y 1 B VAL 642 ? B VAL 620 
182 1 Y 1 B ASP 643 ? B ASP 621 
183 1 Y 1 B GLU 644 ? B GLU 622 
184 1 Y 1 B GLU 645 ? B GLU 623 
185 1 Y 1 B CYS 668 ? B CYS 646 
186 1 Y 1 B LYS 669 ? B LYS 647 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'light scattering' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#