data_5ZJS
# 
_entry.id   5ZJS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZJS         
WWPDB D_1300007151 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZJS 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Baburajendran, N.' 1 ? 
'Zeiske, T.'        2 ? 
'Kaczynska, A.'     3 ? 
'Mann, R.'          4 ? 
'Honig, B.'         5 ? 
'Shapiro, L.'       6 ? 
'Palmer, A.G.'      7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                2221 
_citation.page_last                 2230 
_citation.title                     'Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2018.07.100 
_citation.pdbx_database_id_PubMed   30157419 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zeiske, T.'        1 ? 
primary 'Baburajendran, N.' 2 ? 
primary 'Kaczynska, A.'     3 ? 
primary 'Brasch, J.'        4 ? 
primary 'Palmer, A.G.'      5 ? 
primary 'Shapiro, L.'       6 ? 
primary 'Honig, B.'         7 ? 
primary 'Mann, R.S.'        8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   109.030 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ZJS 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     77.760 
_cell.length_a_esd                 ? 
_cell.length_b                     49.658 
_cell.length_b_esd                 ? 
_cell.length_c                     96.774 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ZJS 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Homeobox protein abdominal-B'                             10195.751 1 ? ? ? ? 
2 polymer man 'Homeobox protein extradenticle'                           8773.827  1 ? ? ? ? 
3 polymer syn 
;DNA (5'-D(*GP*TP*CP*AP*TP*TP*AP*AP*TP*CP*AP*TP*GP*C)-3')
;
4254.791  1 ? ? ? ? 
4 polymer syn 
;DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*TP*AP*AP*TP*GP*AP*C)-3')
;
4303.828  1 ? ? ? ? 
5 water   nat water                                                      18.015    3 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Infraabdominal 7,IAB-7,P3,PH189' 
2 Dpbx                              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;VGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR
QANQ
;
;VGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR
QANQ
;
A ? 
2 'polypeptide(L)'        no no DARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY              
DARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY              B ? 
3 polydeoxyribonucleotide no no '(DG)(DT)(DC)(DA)(DT)(DT)(DA)(DA)(DT)(DC)(DA)(DT)(DG)(DC)'                              
GTCATTAATCATGC                                                                          C ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DA)(DT)(DG)(DA)(DT)(DT)(DA)(DA)(DT)(DG)(DA)(DC)'                              
GCATGATTAATGAC                                                                          D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  VAL n 
1 2  GLY n 
1 3  PRO n 
1 4  CYS n 
1 5  THR n 
1 6  PRO n 
1 7  ASN n 
1 8  PRO n 
1 9  GLY n 
1 10 LEU n 
1 11 HIS n 
1 12 GLU n 
1 13 TRP n 
1 14 THR n 
1 15 GLY n 
1 16 GLN n 
1 17 VAL n 
1 18 SER n 
1 19 VAL n 
1 20 ARG n 
1 21 LYS n 
1 22 LYS n 
1 23 ARG n 
1 24 LYS n 
1 25 PRO n 
1 26 TYR n 
1 27 SER n 
1 28 LYS n 
1 29 PHE n 
1 30 GLN n 
1 31 THR n 
1 32 LEU n 
1 33 GLU n 
1 34 LEU n 
1 35 GLU n 
1 36 LYS n 
1 37 GLU n 
1 38 PHE n 
1 39 LEU n 
1 40 PHE n 
1 41 ASN n 
1 42 ALA n 
1 43 TYR n 
1 44 VAL n 
1 45 SER n 
1 46 LYS n 
1 47 GLN n 
1 48 LYS n 
1 49 ARG n 
1 50 TRP n 
1 51 GLU n 
1 52 LEU n 
1 53 ALA n 
1 54 ARG n 
1 55 ASN n 
1 56 LEU n 
1 57 GLN n 
1 58 LEU n 
1 59 THR n 
1 60 GLU n 
1 61 ARG n 
1 62 GLN n 
1 63 VAL n 
1 64 LYS n 
1 65 ILE n 
1 66 TRP n 
1 67 PHE n 
1 68 GLN n 
1 69 ASN n 
1 70 ARG n 
1 71 ARG n 
1 72 MET n 
1 73 LYS n 
1 74 ASN n 
1 75 LYS n 
1 76 LYS n 
1 77 ASN n 
1 78 SER n 
1 79 GLN n 
1 80 ARG n 
1 81 GLN n 
1 82 ALA n 
1 83 ASN n 
1 84 GLN n 
2 1  ASP n 
2 2  ALA n 
2 3  ARG n 
2 4  ARG n 
2 5  LYS n 
2 6  ARG n 
2 7  ARG n 
2 8  ASN n 
2 9  PHE n 
2 10 SER n 
2 11 LYS n 
2 12 GLN n 
2 13 ALA n 
2 14 SER n 
2 15 GLU n 
2 16 ILE n 
2 17 LEU n 
2 18 ASN n 
2 19 GLU n 
2 20 TYR n 
2 21 PHE n 
2 22 TYR n 
2 23 SER n 
2 24 HIS n 
2 25 LEU n 
2 26 SER n 
2 27 ASN n 
2 28 PRO n 
2 29 TYR n 
2 30 PRO n 
2 31 SER n 
2 32 GLU n 
2 33 GLU n 
2 34 ALA n 
2 35 LYS n 
2 36 GLU n 
2 37 GLU n 
2 38 LEU n 
2 39 ALA n 
2 40 ARG n 
2 41 LYS n 
2 42 CYS n 
2 43 GLY n 
2 44 ILE n 
2 45 THR n 
2 46 VAL n 
2 47 SER n 
2 48 GLN n 
2 49 VAL n 
2 50 SER n 
2 51 ASN n 
2 52 TRP n 
2 53 PHE n 
2 54 GLY n 
2 55 ASN n 
2 56 LYS n 
2 57 ARG n 
2 58 ILE n 
2 59 ARG n 
2 60 TYR n 
2 61 LYS n 
2 62 LYS n 
2 63 ASN n 
2 64 ILE n 
2 65 GLY n 
2 66 LYS n 
2 67 ALA n 
2 68 GLN n 
2 69 GLU n 
2 70 GLU n 
2 71 ALA n 
2 72 ASN n 
2 73 LEU n 
2 74 TYR n 
3 1  DG  n 
3 2  DT  n 
3 3  DC  n 
3 4  DA  n 
3 5  DT  n 
3 6  DT  n 
3 7  DA  n 
3 8  DA  n 
3 9  DT  n 
3 10 DC  n 
3 11 DA  n 
3 12 DT  n 
3 13 DG  n 
3 14 DC  n 
4 1  DG  n 
4 2  DC  n 
4 3  DA  n 
4 4  DT  n 
4 5  DG  n 
4 6  DA  n 
4 7  DT  n 
4 8  DT  n 
4 9  DA  n 
4 10 DA  n 
4 11 DT  n 
4 12 DG  n 
4 13 DA  n 
4 14 DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 84 'Fruit fly' ? 'Abd-B, CG10291' ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 74 'Fruit fly' ? 'exd, CG8933'    ? ? ? ? ? ? 'Drosophila melanogaster' 7227 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 14 'Drosophila melanogaster' ? 7227 ? 
4 1 sample 1 14 'Drosophila melanogaster' ? 7227 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ABDB_DROME P09087 ? 1 
;VGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR
QANQ
;
369 
2 UNP EXD_DROME  P40427 ? 2 DARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY              237 
3 PDB 5ZJS       5ZJS   ? 3 ?                                                                                       1   
4 PDB 5ZJS       5ZJS   ? 4 ?                                                                                       1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ZJS A 1 ? 84 ? P09087 369 ? 452 ? 1 84 
2 2 5ZJS B 1 ? 74 ? P40427 237 ? 310 ? 1 74 
3 3 5ZJS C 1 ? 14 ? 5ZJS   1   ? 14  ? 1 14 
4 4 5ZJS D 1 ? 14 ? 5ZJS   1   ? 14  ? 1 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZJS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.21 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.66 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '200mM MgCl2, 0.1M Tris pH 5.8, 17.5% PEG 3350, 2.5% glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979180 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979180 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            41.580 
_reflns.entry_id                         5ZJS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.896 
_reflns.d_resolution_low                 28.143 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       7524 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.74 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.16 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.896 
_reflns_shell.d_res_low                   2.999 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                149.300 
_refine.B_iso_mean                               62.7866 
_refine.B_iso_min                                25.650 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ZJS 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.8960 
_refine.ls_d_res_low                             28.1430 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7436 
_refine.ls_number_reflns_R_free                  343 
_refine.ls_number_reflns_R_work                  7093 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.7600 
_refine.ls_percent_reflns_R_free                 4.6100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2546 
_refine.ls_R_factor_R_free                       0.2813 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2532 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5ZJQ 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.5000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.8960 
_refine_hist.d_res_low                        28.1430 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               1586 
_refine_hist.pdbx_number_residues_total       158 
_refine_hist.pdbx_B_iso_mean_solvent          30.00 
_refine_hist.pdbx_number_atoms_protein        1015 
_refine_hist.pdbx_number_atoms_nucleic_acid   568 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1673 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.697  ? 2380 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.029  ? 257  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 210  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 25.139 ? 633  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8957 3.6471  3614 . 163 3451 92.0000 . . . 0.3099 0.0000 0.2690 . . . . . . 2 . . . 
'X-RAY DIFFRACTION' 3.6471 28.1447 3822 . 180 3642 95.0000 . . . 0.2692 0.0000 0.2460 . . . . . . 2 . . . 
# 
_struct.entry_id                     5ZJS 
_struct.title                        
;Structure of AbdB/Exd complex bound to a 'Blue14' DNA sequence
;
_struct.pdbx_descriptor              'Homeobox protein abdominal-B, Homeobox protein extradenticle/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZJS 
_struct_keywords.text            'AbdB, Exd, DNA, shape, specificity, Hox, Homeodomain, TRANSCRIPTION, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 27 ? LEU A 39 ? SER A 27 LEU A 39 1 ? 13 
HELX_P HELX_P2 AA2 GLN A 47 ? LEU A 56 ? GLN A 47 LEU A 56 1 ? 10 
HELX_P HELX_P3 AA3 THR A 59 ? ASN A 77 ? THR A 59 ASN A 77 1 ? 19 
HELX_P HELX_P4 AA4 SER B 10 ? TYR B 22 ? SER B 10 TYR B 22 1 ? 13 
HELX_P HELX_P5 AA5 GLU B 33 ? CYS B 42 ? GLU B 33 CYS B 42 1 ? 10 
HELX_P HELX_P6 AA6 THR B 45 ? LYS B 62 ? THR B 45 LYS B 62 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DG 1  N1 ? ? ? 1_555 D DC 14 N3 ? ? C DG 1  D DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 14 O2 ? ? C DG 1  D DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DC 14 N4 ? ? C DG 1  D DC 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DT 2  N3 ? ? ? 1_555 D DA 13 N1 ? ? C DT 2  D DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DT 2  O4 ? ? ? 1_555 D DA 13 N6 ? ? C DT 2  D DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DC 3  N3 ? ? ? 1_555 D DG 12 N1 ? ? C DC 3  D DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DC 3  N4 ? ? ? 1_555 D DG 12 O6 ? ? C DC 3  D DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DC 3  O2 ? ? ? 1_555 D DG 12 N2 ? ? C DC 3  D DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 4  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA 4  D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 10 N1 ? ? C DT 5  D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 10 N6 ? ? C DT 5  D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DT 6  N3 ? ? ? 1_555 D DA 9  N1 ? ? C DT 6  D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DT 6  O4 ? ? ? 1_555 D DA 9  N6 ? ? C DT 6  D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 8  N3 ? ? C DA 7  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 8  O4 ? ? C DA 7  D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 7  N3 ? ? C DA 8  D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 7  O4 ? ? C DA 8  D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DT 9  N3 ? ? ? 1_555 D DA 6  N1 ? ? C DT 9  D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DT 9  O4 ? ? ? 1_555 D DA 6  N6 ? ? C DT 9  D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DC 10 N3 ? ? ? 1_555 D DG 5  N1 ? ? C DC 10 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C DC 10 N4 ? ? ? 1_555 D DG 5  O6 ? ? C DC 10 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DC 10 O2 ? ? ? 1_555 D DG 5  N2 ? ? C DC 10 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 4  N3 ? ? C DA 11 D DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 4  O4 ? ? C DA 11 D DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 3  N1 ? ? C DT 12 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 3  N6 ? ? C DT 12 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC 2  N3 ? ? C DG 13 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DG 13 N2 ? ? ? 1_555 D DC 2  O2 ? ? C DG 13 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DG 13 O6 ? ? ? 1_555 D DC 2  N4 ? ? C DG 13 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DC 14 O2 ? ? ? 1_555 D DG 1  N2 ? ? C DC 14 D DG 1  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 4  B . ? ARG 4  B LYS 5  B ? LYS 5  B 1 7.66  
2 ILE 64 B . ? ILE 64 B GLY 65 B ? GLY 65 B 1 6.66  
3 LYS 66 B . ? LYS 66 B ALA 67 B ? ALA 67 B 1 -3.17 
# 
_atom_sites.entry_id                    5ZJS 
_atom_sites.fract_transf_matrix[1][1]   0.012860 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004437 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020138 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010931 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . TRP A 1 13 ? -24.227 4.651   103.581 1.00 106.54 ? 13  TRP A N     1 
ATOM   2    C CA    . TRP A 1 13 ? -24.402 4.788   105.023 1.00 104.44 ? 13  TRP A CA    1 
ATOM   3    C C     . TRP A 1 13 ? -24.090 6.207   105.494 1.00 105.41 ? 13  TRP A C     1 
ATOM   4    O O     . TRP A 1 13 ? -25.000 6.978   105.802 1.00 108.23 ? 13  TRP A O     1 
ATOM   5    C CB    . TRP A 1 13 ? -23.528 3.774   105.760 1.00 109.84 ? 13  TRP A CB    1 
ATOM   6    C CG    . TRP A 1 13 ? -22.083 4.133   105.846 1.00 113.73 ? 13  TRP A CG    1 
ATOM   7    C CD1   . TRP A 1 13 ? -21.475 4.875   106.815 1.00 109.81 ? 13  TRP A CD1   1 
ATOM   8    C CD2   . TRP A 1 13 ? -21.060 3.766   104.919 1.00 111.64 ? 13  TRP A CD2   1 
ATOM   9    N NE1   . TRP A 1 13 ? -20.130 4.985   106.552 1.00 110.54 ? 13  TRP A NE1   1 
ATOM   10   C CE2   . TRP A 1 13 ? -19.851 4.313   105.391 1.00 109.79 ? 13  TRP A CE2   1 
ATOM   11   C CE3   . TRP A 1 13 ? -21.049 3.025   103.735 1.00 103.05 ? 13  TRP A CE3   1 
ATOM   12   C CZ2   . TRP A 1 13 ? -18.643 4.142   104.717 1.00 105.06 ? 13  TRP A CZ2   1 
ATOM   13   C CZ3   . TRP A 1 13 ? -19.856 2.859   103.070 1.00 94.92  ? 13  TRP A CZ3   1 
ATOM   14   C CH2   . TRP A 1 13 ? -18.668 3.411   103.561 1.00 96.27  ? 13  TRP A CH2   1 
ATOM   15   N N     . LYS A 1 21 ? -30.612 11.546  119.578 1.00 91.09  ? 21  LYS A N     1 
ATOM   16   C CA    . LYS A 1 21 ? -30.417 12.039  120.936 1.00 84.11  ? 21  LYS A CA    1 
ATOM   17   C C     . LYS A 1 21 ? -28.931 12.130  121.274 1.00 76.75  ? 21  LYS A C     1 
ATOM   18   O O     . LYS A 1 21 ? -28.238 11.114  121.332 1.00 75.00  ? 21  LYS A O     1 
ATOM   19   C CB    . LYS A 1 21 ? -31.137 11.136  121.940 1.00 70.46  ? 21  LYS A CB    1 
ATOM   20   C CG    . LYS A 1 21 ? -31.634 11.857  123.183 1.00 79.58  ? 21  LYS A CG    1 
ATOM   21   C CD    . LYS A 1 21 ? -31.423 11.013  124.430 1.00 73.96  ? 21  LYS A CD    1 
ATOM   22   C CE    . LYS A 1 21 ? -32.622 11.091  125.364 1.00 70.94  ? 21  LYS A CE    1 
ATOM   23   N NZ    . LYS A 1 21 ? -32.382 10.342  126.629 1.00 65.03  ? 21  LYS A NZ    1 
ATOM   24   N N     . LYS A 1 22 ? -28.449 13.349  121.495 1.00 98.45  ? 22  LYS A N     1 
ATOM   25   C CA    . LYS A 1 22 ? -27.034 13.574  121.779 1.00 98.78  ? 22  LYS A CA    1 
ATOM   26   C C     . LYS A 1 22 ? -26.631 12.985  123.129 1.00 90.12  ? 22  LYS A C     1 
ATOM   27   O O     . LYS A 1 22 ? -27.362 13.097  124.113 1.00 94.67  ? 22  LYS A O     1 
ATOM   28   C CB    . LYS A 1 22 ? -26.708 15.068  121.738 1.00 85.32  ? 22  LYS A CB    1 
ATOM   29   C CG    . LYS A 1 22 ? -25.255 15.386  122.046 1.00 81.48  ? 22  LYS A CG    1 
ATOM   30   C CD    . LYS A 1 22 ? -24.979 16.877  121.996 1.00 85.69  ? 22  LYS A CD    1 
ATOM   31   C CE    . LYS A 1 22 ? -23.718 17.223  122.771 1.00 80.77  ? 22  LYS A CE    1 
ATOM   32   N NZ    . LYS A 1 22 ? -22.644 16.211  122.566 1.00 69.28  ? 22  LYS A NZ    1 
ATOM   33   N N     . ARG A 1 23 ? -25.457 12.361  123.162 1.00 60.65  ? 23  ARG A N     1 
ATOM   34   C CA    . ARG A 1 23 ? -24.979 11.657  124.348 1.00 61.44  ? 23  ARG A CA    1 
ATOM   35   C C     . ARG A 1 23 ? -24.396 12.597  125.403 1.00 54.04  ? 23  ARG A C     1 
ATOM   36   O O     . ARG A 1 23 ? -23.633 13.508  125.084 1.00 56.36  ? 23  ARG A O     1 
ATOM   37   C CB    . ARG A 1 23 ? -23.928 10.620  123.949 1.00 61.05  ? 23  ARG A CB    1 
ATOM   38   C CG    . ARG A 1 23 ? -23.235 9.974   125.130 1.00 55.79  ? 23  ARG A CG    1 
ATOM   39   C CD    . ARG A 1 23 ? -21.823 9.539   124.795 1.00 50.00  ? 23  ARG A CD    1 
ATOM   40   N NE    . ARG A 1 23 ? -21.121 9.082   125.990 1.00 41.20  ? 23  ARG A NE    1 
ATOM   41   C CZ    . ARG A 1 23 ? -19.828 9.281   126.217 1.00 45.95  ? 23  ARG A CZ    1 
ATOM   42   N NH1   . ARG A 1 23 ? -19.091 9.932   125.329 1.00 60.43  ? 23  ARG A NH1   1 
ATOM   43   N NH2   . ARG A 1 23 ? -19.273 8.835   127.335 1.00 57.13  ? 23  ARG A NH2   1 
ATOM   44   N N     . LYS A 1 24 ? -24.754 12.359  126.661 1.00 62.57  ? 24  LYS A N     1 
ATOM   45   C CA    . LYS A 1 24 ? -24.232 13.146  127.773 1.00 64.03  ? 24  LYS A CA    1 
ATOM   46   C C     . LYS A 1 24 ? -23.614 12.255  128.847 1.00 57.41  ? 24  LYS A C     1 
ATOM   47   O O     . LYS A 1 24 ? -24.307 11.437  129.454 1.00 59.21  ? 24  LYS A O     1 
ATOM   48   C CB    . LYS A 1 24 ? -25.338 14.008  128.384 1.00 57.53  ? 24  LYS A CB    1 
ATOM   49   N N     . PRO A 1 25 ? -22.300 12.407  129.078 1.00 43.19  ? 25  PRO A N     1 
ATOM   50   C CA    . PRO A 1 25 ? -21.588 11.691  130.143 1.00 46.36  ? 25  PRO A CA    1 
ATOM   51   C C     . PRO A 1 25 ? -22.191 11.972  131.515 1.00 41.25  ? 25  PRO A C     1 
ATOM   52   O O     . PRO A 1 25 ? -22.407 13.132  131.865 1.00 46.97  ? 25  PRO A O     1 
ATOM   53   C CB    . PRO A 1 25 ? -20.164 12.247  130.048 1.00 34.42  ? 25  PRO A CB    1 
ATOM   54   C CG    . PRO A 1 25 ? -20.033 12.698  128.637 1.00 44.14  ? 25  PRO A CG    1 
ATOM   55   C CD    . PRO A 1 25 ? -21.387 13.228  128.264 1.00 48.28  ? 25  PRO A CD    1 
ATOM   56   N N     . TYR A 1 26 ? -22.457 10.919  132.279 1.00 46.26  ? 26  TYR A N     1 
ATOM   57   C CA    . TYR A 1 26 ? -23.116 11.061  133.573 1.00 46.95  ? 26  TYR A CA    1 
ATOM   58   C C     . TYR A 1 26 ? -22.186 11.670  134.616 1.00 40.36  ? 26  TYR A C     1 
ATOM   59   O O     . TYR A 1 26 ? -20.984 11.807  134.390 1.00 51.72  ? 26  TYR A O     1 
ATOM   60   C CB    . TYR A 1 26 ? -23.635 9.706   134.062 1.00 42.39  ? 26  TYR A CB    1 
ATOM   61   C CG    . TYR A 1 26 ? -24.741 9.123   133.208 1.00 46.50  ? 26  TYR A CG    1 
ATOM   62   C CD1   . TYR A 1 26 ? -25.346 9.875   132.208 1.00 46.35  ? 26  TYR A CD1   1 
ATOM   63   C CD2   . TYR A 1 26 ? -25.184 7.821   133.404 1.00 43.39  ? 26  TYR A CD2   1 
ATOM   64   C CE1   . TYR A 1 26 ? -26.354 9.347   131.425 1.00 45.84  ? 26  TYR A CE1   1 
ATOM   65   C CE2   . TYR A 1 26 ? -26.194 7.285   132.627 1.00 46.73  ? 26  TYR A CE2   1 
ATOM   66   C CZ    . TYR A 1 26 ? -26.775 8.052   131.639 1.00 45.37  ? 26  TYR A CZ    1 
ATOM   67   O OH    . TYR A 1 26 ? -27.780 7.523   130.864 1.00 37.14  ? 26  TYR A OH    1 
ATOM   68   N N     . SER A 1 27 ? -22.755 12.038  135.758 1.00 46.95  ? 27  SER A N     1 
ATOM   69   C CA    . SER A 1 27 ? -21.972 12.573  136.862 1.00 43.32  ? 27  SER A CA    1 
ATOM   70   C C     . SER A 1 27 ? -21.134 11.475  137.501 1.00 47.04  ? 27  SER A C     1 
ATOM   71   O O     . SER A 1 27 ? -21.394 10.289  137.299 1.00 55.52  ? 27  SER A O     1 
ATOM   72   C CB    . SER A 1 27 ? -22.886 13.213  137.909 1.00 43.32  ? 27  SER A CB    1 
ATOM   73   O OG    . SER A 1 27 ? -22.139 13.699  139.011 1.00 54.53  ? 27  SER A OG    1 
ATOM   74   N N     . LYS A 1 28 ? -20.124 11.873  138.266 1.00 41.29  ? 28  LYS A N     1 
ATOM   75   C CA    . LYS A 1 28 ? -19.326 10.915  139.019 1.00 39.05  ? 28  LYS A CA    1 
ATOM   76   C C     . LYS A 1 28 ? -20.178 10.309  140.128 1.00 43.85  ? 28  LYS A C     1 
ATOM   77   O O     . LYS A 1 28 ? -20.048 9.128   140.462 1.00 57.31  ? 28  LYS A O     1 
ATOM   78   C CB    . LYS A 1 28 ? -18.079 11.584  139.601 1.00 37.86  ? 28  LYS A CB    1 
ATOM   79   N N     . PHE A 1 29 ? -21.063 11.132  140.682 1.00 48.05  ? 29  PHE A N     1 
ATOM   80   C CA    . PHE A 1 29 ? -21.963 10.706  141.747 1.00 40.08  ? 29  PHE A CA    1 
ATOM   81   C C     . PHE A 1 29 ? -22.933 9.630   141.273 1.00 39.94  ? 29  PHE A C     1 
ATOM   82   O O     . PHE A 1 29 ? -23.030 8.561   141.882 1.00 49.24  ? 29  PHE A O     1 
ATOM   83   C CB    . PHE A 1 29 ? -22.741 11.904  142.293 1.00 46.54  ? 29  PHE A CB    1 
ATOM   84   C CG    . PHE A 1 29 ? -23.774 11.538  143.318 1.00 37.22  ? 29  PHE A CG    1 
ATOM   85   C CD1   . PHE A 1 29 ? -23.405 11.267  144.624 1.00 33.47  ? 29  PHE A CD1   1 
ATOM   86   C CD2   . PHE A 1 29 ? -25.116 11.474  142.978 1.00 40.95  ? 29  PHE A CD2   1 
ATOM   87   C CE1   . PHE A 1 29 ? -24.353 10.934  145.572 1.00 38.33  ? 29  PHE A CE1   1 
ATOM   88   C CE2   . PHE A 1 29 ? -26.069 11.141  143.921 1.00 38.59  ? 29  PHE A CE2   1 
ATOM   89   C CZ    . PHE A 1 29 ? -25.687 10.870  145.220 1.00 33.34  ? 29  PHE A CZ    1 
ATOM   90   N N     . GLN A 1 30 ? -23.655 9.924   140.193 1.00 47.91  ? 30  GLN A N     1 
ATOM   91   C CA    . GLN A 1 30 ? -24.592 8.973   139.602 1.00 46.27  ? 30  GLN A CA    1 
ATOM   92   C C     . GLN A 1 30 ? -23.910 7.642   139.308 1.00 51.93  ? 30  GLN A C     1 
ATOM   93   O O     . GLN A 1 30 ? -24.427 6.578   139.650 1.00 52.79  ? 30  GLN A O     1 
ATOM   94   C CB    . GLN A 1 30 ? -25.197 9.536   138.313 1.00 41.12  ? 30  GLN A CB    1 
ATOM   95   C CG    . GLN A 1 30 ? -25.798 10.924  138.439 1.00 41.90  ? 30  GLN A CG    1 
ATOM   96   C CD    . GLN A 1 30 ? -26.198 11.503  137.094 1.00 44.32  ? 30  GLN A CD    1 
ATOM   97   O OE1   . GLN A 1 30 ? -25.453 11.406  136.119 1.00 41.98  ? 30  GLN A OE1   1 
ATOM   98   N NE2   . GLN A 1 30 ? -27.383 12.098  137.033 1.00 46.16  ? 30  GLN A NE2   1 
ATOM   99   N N     . THR A 1 31 ? -22.745 7.721   138.673 1.00 46.77  ? 31  THR A N     1 
ATOM   100  C CA    . THR A 1 31 ? -21.951 6.545   138.341 1.00 49.58  ? 31  THR A CA    1 
ATOM   101  C C     . THR A 1 31 ? -21.624 5.727   139.587 1.00 45.25  ? 31  THR A C     1 
ATOM   102  O O     . THR A 1 31 ? -21.811 4.506   139.610 1.00 42.66  ? 31  THR A O     1 
ATOM   103  C CB    . THR A 1 31 ? -20.639 6.943   137.636 1.00 44.31  ? 31  THR A CB    1 
ATOM   104  O OG1   . THR A 1 31 ? -20.936 7.460   136.333 1.00 46.19  ? 31  THR A OG1   1 
ATOM   105  C CG2   . THR A 1 31 ? -19.716 5.742   137.497 1.00 41.08  ? 31  THR A CG2   1 
ATOM   106  N N     . LEU A 1 32 ? -21.143 6.411   140.622 1.00 43.49  ? 32  LEU A N     1 
ATOM   107  C CA    . LEU A 1 32 ? -20.804 5.756   141.882 1.00 45.22  ? 32  LEU A CA    1 
ATOM   108  C C     . LEU A 1 32 ? -22.003 5.044   142.498 1.00 43.86  ? 32  LEU A C     1 
ATOM   109  O O     . LEU A 1 32 ? -21.887 3.909   142.960 1.00 50.69  ? 32  LEU A O     1 
ATOM   110  C CB    . LEU A 1 32 ? -20.237 6.768   142.878 1.00 46.37  ? 32  LEU A CB    1 
ATOM   111  C CG    . LEU A 1 32 ? -18.751 7.088   142.728 1.00 57.26  ? 32  LEU A CG    1 
ATOM   112  C CD1   . LEU A 1 32 ? -18.315 8.091   143.779 1.00 67.23  ? 32  LEU A CD1   1 
ATOM   113  C CD2   . LEU A 1 32 ? -17.924 5.816   142.823 1.00 60.37  ? 32  LEU A CD2   1 
ATOM   114  N N     . GLU A 1 33 ? -23.151 5.713   142.503 1.00 41.69  ? 33  GLU A N     1 
ATOM   115  C CA    . GLU A 1 33 ? -24.367 5.128   143.058 1.00 42.68  ? 33  GLU A CA    1 
ATOM   116  C C     . GLU A 1 33 ? -24.809 3.894   142.273 1.00 38.96  ? 33  GLU A C     1 
ATOM   117  O O     . GLU A 1 33 ? -25.166 2.866   142.858 1.00 37.91  ? 33  GLU A O     1 
ATOM   118  C CB    . GLU A 1 33 ? -25.490 6.163   143.084 1.00 44.24  ? 33  GLU A CB    1 
ATOM   119  C CG    . GLU A 1 33 ? -25.274 7.289   144.079 1.00 38.64  ? 33  GLU A CG    1 
ATOM   120  C CD    . GLU A 1 33 ? -25.435 6.835   145.518 1.00 44.66  ? 33  GLU A CD    1 
ATOM   121  O OE1   . GLU A 1 33 ? -24.420 6.462   146.144 1.00 45.37  ? 33  GLU A OE1   1 
ATOM   122  O OE2   . GLU A 1 33 ? -26.577 6.857   146.024 1.00 54.34  ? 33  GLU A OE2   1 
ATOM   123  N N     . LEU A 1 34 ? -24.781 4.004   140.948 1.00 43.27  ? 34  LEU A N     1 
ATOM   124  C CA    . LEU A 1 34 ? -25.165 2.899   140.073 1.00 37.01  ? 34  LEU A CA    1 
ATOM   125  C C     . LEU A 1 34 ? -24.262 1.684   140.268 1.00 42.27  ? 34  LEU A C     1 
ATOM   126  O O     . LEU A 1 34 ? -24.745 0.553   140.353 1.00 43.41  ? 34  LEU A O     1 
ATOM   127  C CB    . LEU A 1 34 ? -25.142 3.344   138.609 1.00 37.32  ? 34  LEU A CB    1 
ATOM   128  C CG    . LEU A 1 34 ? -26.210 4.364   138.207 1.00 47.82  ? 34  LEU A CG    1 
ATOM   129  C CD1   . LEU A 1 34 ? -25.985 4.865   136.790 1.00 51.29  ? 34  LEU A CD1   1 
ATOM   130  C CD2   . LEU A 1 34 ? -27.600 3.765   138.348 1.00 35.75  ? 34  LEU A CD2   1 
ATOM   131  N N     . GLU A 1 35 ? -22.955 1.918   140.339 1.00 45.02  ? 35  GLU A N     1 
ATOM   132  C CA    . GLU A 1 35 ? -22.008 0.840   140.608 1.00 41.84  ? 35  GLU A CA    1 
ATOM   133  C C     . GLU A 1 35 ? -22.256 0.230   141.983 1.00 41.18  ? 35  GLU A C     1 
ATOM   134  O O     . GLU A 1 35 ? -22.197 -0.987  142.154 1.00 46.58  ? 35  GLU A O     1 
ATOM   135  C CB    . GLU A 1 35 ? -20.567 1.346   140.511 1.00 48.79  ? 35  GLU A CB    1 
ATOM   136  C CG    . GLU A 1 35 ? -20.106 1.658   139.098 1.00 46.68  ? 35  GLU A CG    1 
ATOM   137  C CD    . GLU A 1 35 ? -19.619 0.425   138.360 1.00 52.75  ? 35  GLU A CD    1 
ATOM   138  O OE1   . GLU A 1 35 ? -19.719 -0.686  138.922 1.00 47.30  ? 35  GLU A OE1   1 
ATOM   139  O OE2   . GLU A 1 35 ? -19.132 0.568   137.218 1.00 45.40  ? 35  GLU A OE2   1 
ATOM   140  N N     . LYS A 1 36 ? -22.539 1.090   142.958 1.00 44.15  ? 36  LYS A N     1 
ATOM   141  C CA    . LYS A 1 36 ? -22.803 0.655   144.325 1.00 42.61  ? 36  LYS A CA    1 
ATOM   142  C C     . LYS A 1 36 ? -24.037 -0.238  144.388 1.00 48.93  ? 36  LYS A C     1 
ATOM   143  O O     . LYS A 1 36 ? -24.126 -1.129  145.234 1.00 56.54  ? 36  LYS A O     1 
ATOM   144  C CB    . LYS A 1 36 ? -22.981 1.862   145.248 1.00 34.58  ? 36  LYS A CB    1 
ATOM   145  N N     . GLU A 1 37 ? -24.987 0.009   143.492 1.00 62.99  ? 37  GLU A N     1 
ATOM   146  C CA    . GLU A 1 37 ? -26.178 -0.826  143.405 1.00 65.89  ? 37  GLU A CA    1 
ATOM   147  C C     . GLU A 1 37 ? -25.890 -2.091  142.603 1.00 65.82  ? 37  GLU A C     1 
ATOM   148  O O     . GLU A 1 37 ? -26.538 -3.121  142.791 1.00 69.79  ? 37  GLU A O     1 
ATOM   149  C CB    . GLU A 1 37 ? -27.337 -0.051  142.773 1.00 71.86  ? 37  GLU A CB    1 
ATOM   150  C CG    . GLU A 1 37 ? -28.694 -0.717  142.945 1.00 68.90  ? 37  GLU A CG    1 
ATOM   151  C CD    . GLU A 1 37 ? -29.097 -0.851  144.402 1.00 74.13  ? 37  GLU A CD    1 
ATOM   152  O OE1   . GLU A 1 37 ? -28.691 0.003   145.218 1.00 84.18  ? 37  GLU A OE1   1 
ATOM   153  O OE2   . GLU A 1 37 ? -29.817 -1.817  144.733 1.00 80.78  ? 37  GLU A OE2   1 
ATOM   154  N N     . PHE A 1 38 ? -24.906 -2.008  141.714 1.00 44.32  ? 38  PHE A N     1 
ATOM   155  C CA    . PHE A 1 38 ? -24.549 -3.131  140.854 1.00 39.33  ? 38  PHE A CA    1 
ATOM   156  C C     . PHE A 1 38 ? -23.876 -4.252  141.642 1.00 37.30  ? 38  PHE A C     1 
ATOM   157  O O     . PHE A 1 38 ? -23.806 -5.390  141.179 1.00 42.94  ? 38  PHE A O     1 
ATOM   158  C CB    . PHE A 1 38 ? -23.636 -2.661  139.721 1.00 41.58  ? 38  PHE A CB    1 
ATOM   159  C CG    . PHE A 1 38 ? -23.509 -3.646  138.593 1.00 36.63  ? 38  PHE A CG    1 
ATOM   160  C CD1   . PHE A 1 38 ? -24.527 -3.788  137.665 1.00 30.76  ? 38  PHE A CD1   1 
ATOM   161  C CD2   . PHE A 1 38 ? -22.368 -4.419  138.453 1.00 40.17  ? 38  PHE A CD2   1 
ATOM   162  C CE1   . PHE A 1 38 ? -24.414 -4.687  136.622 1.00 34.18  ? 38  PHE A CE1   1 
ATOM   163  C CE2   . PHE A 1 38 ? -22.248 -5.321  137.411 1.00 28.05  ? 38  PHE A CE2   1 
ATOM   164  C CZ    . PHE A 1 38 ? -23.274 -5.454  136.495 1.00 39.95  ? 38  PHE A CZ    1 
ATOM   165  N N     . LEU A 1 39 ? -23.374 -3.920  142.828 1.00 64.06  ? 39  LEU A N     1 
ATOM   166  C CA    . LEU A 1 39 ? -22.793 -4.911  143.727 1.00 68.77  ? 39  LEU A CA    1 
ATOM   167  C C     . LEU A 1 39 ? -23.863 -5.898  144.177 1.00 68.93  ? 39  LEU A C     1 
ATOM   168  O O     . LEU A 1 39 ? -23.627 -7.105  144.246 1.00 81.87  ? 39  LEU A O     1 
ATOM   169  C CB    . LEU A 1 39 ? -22.150 -4.226  144.938 1.00 80.34  ? 39  LEU A CB    1 
ATOM   170  C CG    . LEU A 1 39 ? -21.341 -5.067  145.931 1.00 87.48  ? 39  LEU A CG    1 
ATOM   171  C CD1   . LEU A 1 39 ? -20.210 -4.238  146.519 1.00 97.64  ? 39  LEU A CD1   1 
ATOM   172  C CD2   . LEU A 1 39 ? -22.222 -5.615  147.047 1.00 77.70  ? 39  LEU A CD2   1 
ATOM   173  N N     . PHE A 1 40 ? -25.042 -5.368  144.483 1.00 66.90  ? 40  PHE A N     1 
ATOM   174  C CA    . PHE A 1 40 ? -26.161 -6.181  144.943 1.00 77.26  ? 40  PHE A CA    1 
ATOM   175  C C     . PHE A 1 40 ? -26.881 -6.860  143.786 1.00 73.08  ? 40  PHE A C     1 
ATOM   176  O O     . PHE A 1 40 ? -27.131 -8.065  143.819 1.00 73.79  ? 40  PHE A O     1 
ATOM   177  C CB    . PHE A 1 40 ? -27.153 -5.323  145.731 1.00 73.51  ? 40  PHE A CB    1 
ATOM   178  C CG    . PHE A 1 40 ? -26.740 -5.062  147.150 1.00 77.87  ? 40  PHE A CG    1 
ATOM   179  C CD1   . PHE A 1 40 ? -25.633 -4.278  147.432 1.00 83.34  ? 40  PHE A CD1   1 
ATOM   180  C CD2   . PHE A 1 40 ? -27.467 -5.590  148.203 1.00 72.98  ? 40  PHE A CD2   1 
ATOM   181  C CE1   . PHE A 1 40 ? -25.254 -4.035  148.739 1.00 90.07  ? 40  PHE A CE1   1 
ATOM   182  C CE2   . PHE A 1 40 ? -27.094 -5.350  149.511 1.00 75.90  ? 40  PHE A CE2   1 
ATOM   183  C CZ    . PHE A 1 40 ? -25.986 -4.571  149.780 1.00 87.39  ? 40  PHE A CZ    1 
ATOM   184  N N     . ASN A 1 41 ? -27.217 -6.080  142.764 1.00 60.38  ? 41  ASN A N     1 
ATOM   185  C CA    . ASN A 1 41 ? -28.036 -6.582  141.670 1.00 57.70  ? 41  ASN A CA    1 
ATOM   186  C C     . ASN A 1 41 ? -27.506 -6.200  140.294 1.00 55.64  ? 41  ASN A C     1 
ATOM   187  O O     . ASN A 1 41 ? -27.558 -5.033  139.904 1.00 62.27  ? 41  ASN A O     1 
ATOM   188  C CB    . ASN A 1 41 ? -29.471 -6.069  141.812 1.00 74.41  ? 41  ASN A CB    1 
ATOM   189  C CG    . ASN A 1 41 ? -29.918 -5.977  143.256 1.00 73.94  ? 41  ASN A CG    1 
ATOM   190  O OD1   . ASN A 1 41 ? -30.296 -6.976  143.867 1.00 69.41  ? 41  ASN A OD1   1 
ATOM   191  N ND2   . ASN A 1 41 ? -29.876 -4.771  143.812 1.00 83.49  ? 41  ASN A ND2   1 
ATOM   192  N N     . ALA A 1 42 ? -26.998 -7.184  139.560 1.00 39.42  ? 42  ALA A N     1 
ATOM   193  C CA    . ALA A 1 42 ? -26.680 -6.980  138.154 1.00 42.00  ? 42  ALA A CA    1 
ATOM   194  C C     . ALA A 1 42 ? -27.983 -6.776  137.394 1.00 44.59  ? 42  ALA A C     1 
ATOM   195  O O     . ALA A 1 42 ? -28.045 -6.021  136.422 1.00 41.40  ? 42  ALA A O     1 
ATOM   196  C CB    . ALA A 1 42 ? -25.907 -8.156  137.598 1.00 43.71  ? 42  ALA A CB    1 
ATOM   197  N N     . TYR A 1 43 ? -29.023 -7.461  137.856 1.00 36.60  ? 43  TYR A N     1 
ATOM   198  C CA    . TYR A 1 43 ? -30.372 -7.277  137.342 1.00 33.77  ? 43  TYR A CA    1 
ATOM   199  C C     . TYR A 1 43 ? -31.240 -6.630  138.414 1.00 33.49  ? 43  TYR A C     1 
ATOM   200  O O     . TYR A 1 43 ? -31.412 -7.183  139.500 1.00 35.05  ? 43  TYR A O     1 
ATOM   201  C CB    . TYR A 1 43 ? -30.973 -8.611  136.902 1.00 29.65  ? 43  TYR A CB    1 
ATOM   202  C CG    . TYR A 1 43 ? -30.260 -9.249  135.732 1.00 30.86  ? 43  TYR A CG    1 
ATOM   203  C CD1   . TYR A 1 43 ? -30.709 -9.054  134.433 1.00 28.56  ? 43  TYR A CD1   1 
ATOM   204  C CD2   . TYR A 1 43 ? -29.138 -10.043 135.927 1.00 34.78  ? 43  TYR A CD2   1 
ATOM   205  C CE1   . TYR A 1 43 ? -30.061 -9.635  133.360 1.00 34.27  ? 43  TYR A CE1   1 
ATOM   206  C CE2   . TYR A 1 43 ? -28.484 -10.629 134.861 1.00 25.65  ? 43  TYR A CE2   1 
ATOM   207  C CZ    . TYR A 1 43 ? -28.950 -10.421 133.580 1.00 28.02  ? 43  TYR A CZ    1 
ATOM   208  O OH    . TYR A 1 43 ? -28.301 -11.001 132.514 1.00 28.29  ? 43  TYR A OH    1 
ATOM   209  N N     . VAL A 1 44 ? -31.784 -5.458  138.104 1.00 28.66  ? 44  VAL A N     1 
ATOM   210  C CA    . VAL A 1 44 ? -32.540 -4.686  139.082 1.00 37.05  ? 44  VAL A CA    1 
ATOM   211  C C     . VAL A 1 44 ? -34.036 -4.693  138.753 1.00 36.93  ? 44  VAL A C     1 
ATOM   212  O O     . VAL A 1 44 ? -34.426 -4.774  137.587 1.00 39.29  ? 44  VAL A O     1 
ATOM   213  C CB    . VAL A 1 44 ? -32.012 -3.229  139.159 1.00 43.28  ? 44  VAL A CB    1 
ATOM   214  C CG1   . VAL A 1 44 ? -32.251 -2.496  137.846 1.00 41.78  ? 44  VAL A CG1   1 
ATOM   215  C CG2   . VAL A 1 44 ? -32.634 -2.475  140.330 1.00 35.64  ? 44  VAL A CG2   1 
ATOM   216  N N     . SER A 1 45 ? -34.865 -4.630  139.790 1.00 56.65  ? 45  SER A N     1 
ATOM   217  C CA    . SER A 1 45 ? -36.315 -4.612  139.627 1.00 54.92  ? 45  SER A CA    1 
ATOM   218  C C     . SER A 1 45 ? -36.793 -3.363  138.895 1.00 58.43  ? 45  SER A C     1 
ATOM   219  O O     . SER A 1 45 ? -36.068 -2.373  138.789 1.00 62.55  ? 45  SER A O     1 
ATOM   220  C CB    . SER A 1 45 ? -37.003 -4.708  140.990 1.00 47.23  ? 45  SER A CB    1 
ATOM   221  O OG    . SER A 1 45 ? -38.352 -4.282  140.909 1.00 61.93  ? 45  SER A OG    1 
ATOM   222  N N     . LYS A 1 46 ? -38.025 -3.416  138.398 1.00 41.74  ? 46  LYS A N     1 
ATOM   223  C CA    . LYS A 1 46 ? -38.615 -2.290  137.685 1.00 42.56  ? 46  LYS A CA    1 
ATOM   224  C C     . LYS A 1 46 ? -38.983 -1.155  138.637 1.00 41.82  ? 46  LYS A C     1 
ATOM   225  O O     . LYS A 1 46 ? -39.197 -0.021  138.207 1.00 44.24  ? 46  LYS A O     1 
ATOM   226  C CB    . LYS A 1 46 ? -39.852 -2.742  136.906 1.00 46.58  ? 46  LYS A CB    1 
ATOM   227  N N     . GLN A 1 47 ? -39.053 -1.459  139.930 1.00 41.91  ? 47  GLN A N     1 
ATOM   228  C CA    . GLN A 1 47 ? -39.423 -0.454  140.922 1.00 53.18  ? 47  GLN A CA    1 
ATOM   229  C C     . GLN A 1 47 ? -38.208 0.168   141.606 1.00 49.93  ? 47  GLN A C     1 
ATOM   230  O O     . GLN A 1 47 ? -38.191 1.368   141.871 1.00 47.29  ? 47  GLN A O     1 
ATOM   231  C CB    . GLN A 1 47 ? -40.351 -1.050  141.979 1.00 49.63  ? 47  GLN A CB    1 
ATOM   232  C CG    . GLN A 1 47 ? -41.021 0.009   142.841 1.00 64.37  ? 47  GLN A CG    1 
ATOM   233  C CD    . GLN A 1 47 ? -41.164 -0.413  144.287 1.00 66.87  ? 47  GLN A CD    1 
ATOM   234  O OE1   . GLN A 1 47 ? -40.323 -1.137  144.820 1.00 67.22  ? 47  GLN A OE1   1 
ATOM   235  N NE2   . GLN A 1 47 ? -42.224 0.052   144.937 1.00 73.69  ? 47  GLN A NE2   1 
ATOM   236  N N     . LYS A 1 48 ? -37.200 -0.644  141.908 1.00 75.25  ? 48  LYS A N     1 
ATOM   237  C CA    . LYS A 1 48 ? -35.971 -0.115  142.490 1.00 78.33  ? 48  LYS A CA    1 
ATOM   238  C C     . LYS A 1 48 ? -35.298 0.785   141.459 1.00 76.47  ? 48  LYS A C     1 
ATOM   239  O O     . LYS A 1 48 ? -34.614 1.756   141.801 1.00 79.51  ? 48  LYS A O     1 
ATOM   240  C CB    . LYS A 1 48 ? -35.039 -1.244  142.934 1.00 71.37  ? 48  LYS A CB    1 
ATOM   241  C CG    . LYS A 1 48 ? -33.779 -0.768  143.641 1.00 75.51  ? 48  LYS A CG    1 
ATOM   242  C CD    . LYS A 1 48 ? -33.618 -1.447  144.994 1.00 94.07  ? 48  LYS A CD    1 
ATOM   243  C CE    . LYS A 1 48 ? -33.029 -0.497  146.026 1.00 100.68 ? 48  LYS A CE    1 
ATOM   244  N NZ    . LYS A 1 48 ? -32.885 -1.145  147.360 1.00 101.61 ? 48  LYS A NZ    1 
ATOM   245  N N     . ARG A 1 49 ? -35.519 0.455   140.191 1.00 55.13  ? 49  ARG A N     1 
ATOM   246  C CA    . ARG A 1 49 ? -35.099 1.300   139.082 1.00 52.41  ? 49  ARG A CA    1 
ATOM   247  C C     . ARG A 1 49 ? -35.742 2.679   139.170 1.00 52.57  ? 49  ARG A C     1 
ATOM   248  O O     . ARG A 1 49 ? -35.097 3.687   138.898 1.00 59.89  ? 49  ARG A O     1 
ATOM   249  C CB    . ARG A 1 49 ? -35.455 0.647   137.747 1.00 46.68  ? 49  ARG A CB    1 
ATOM   250  C CG    . ARG A 1 49 ? -35.340 1.584   136.558 1.00 54.67  ? 49  ARG A CG    1 
ATOM   251  C CD    . ARG A 1 49 ? -36.094 1.043   135.360 1.00 63.45  ? 49  ARG A CD    1 
ATOM   252  N NE    . ARG A 1 49 ? -35.621 -0.280  134.970 1.00 60.58  ? 49  ARG A NE    1 
ATOM   253  C CZ    . ARG A 1 49 ? -36.375 -1.189  134.361 1.00 71.80  ? 49  ARG A CZ    1 
ATOM   254  N NH1   . ARG A 1 49 ? -37.642 -0.918  134.076 1.00 58.19  ? 49  ARG A NH1   1 
ATOM   255  N NH2   . ARG A 1 49 ? -35.864 -2.370  134.040 1.00 70.89  ? 49  ARG A NH2   1 
ATOM   256  N N     . TRP A 1 50 ? -37.018 2.715   139.541 1.00 56.44  ? 50  TRP A N     1 
ATOM   257  C CA    . TRP A 1 50 ? -37.740 3.975   139.694 1.00 62.93  ? 50  TRP A CA    1 
ATOM   258  C C     . TRP A 1 50 ? -37.074 4.843   140.759 1.00 52.56  ? 50  TRP A C     1 
ATOM   259  O O     . TRP A 1 50 ? -36.811 6.033   140.537 1.00 52.31  ? 50  TRP A O     1 
ATOM   260  C CB    . TRP A 1 50 ? -39.205 3.712   140.053 1.00 59.17  ? 50  TRP A CB    1 
ATOM   261  C CG    . TRP A 1 50 ? -40.050 4.946   140.114 1.00 58.30  ? 50  TRP A CG    1 
ATOM   262  C CD1   . TRP A 1 50 ? -40.757 5.506   139.091 1.00 60.82  ? 50  TRP A CD1   1 
ATOM   263  C CD2   . TRP A 1 50 ? -40.282 5.773   141.262 1.00 56.67  ? 50  TRP A CD2   1 
ATOM   264  N NE1   . TRP A 1 50 ? -41.414 6.631   139.529 1.00 58.55  ? 50  TRP A NE1   1 
ATOM   265  C CE2   . TRP A 1 50 ? -41.138 6.817   140.858 1.00 58.34  ? 50  TRP A CE2   1 
ATOM   266  C CE3   . TRP A 1 50 ? -39.847 5.732   142.590 1.00 55.80  ? 50  TRP A CE3   1 
ATOM   267  C CZ2   . TRP A 1 50 ? -41.568 7.811   141.734 1.00 54.06  ? 50  TRP A CZ2   1 
ATOM   268  C CZ3   . TRP A 1 50 ? -40.276 6.720   143.459 1.00 55.72  ? 50  TRP A CZ3   1 
ATOM   269  C CH2   . TRP A 1 50 ? -41.127 7.746   143.027 1.00 53.07  ? 50  TRP A CH2   1 
ATOM   270  N N     . GLU A 1 51 ? -36.797 4.232   141.909 1.00 61.50  ? 51  GLU A N     1 
ATOM   271  C CA    . GLU A 1 51 ? -36.097 4.903   142.998 1.00 58.95  ? 51  GLU A CA    1 
ATOM   272  C C     . GLU A 1 51 ? -34.758 5.450   142.520 1.00 68.11  ? 51  GLU A C     1 
ATOM   273  O O     . GLU A 1 51 ? -34.407 6.592   142.813 1.00 68.58  ? 51  GLU A O     1 
ATOM   274  C CB    . GLU A 1 51 ? -35.876 3.950   144.176 1.00 63.59  ? 51  GLU A CB    1 
ATOM   275  C CG    . GLU A 1 51 ? -37.036 3.012   144.466 1.00 71.38  ? 51  GLU A CG    1 
ATOM   276  C CD    . GLU A 1 51 ? -36.782 2.137   145.680 1.00 80.03  ? 51  GLU A CD    1 
ATOM   277  O OE1   . GLU A 1 51 ? -36.318 2.670   146.710 1.00 77.90  ? 51  GLU A OE1   1 
ATOM   278  O OE2   . GLU A 1 51 ? -37.038 0.916   145.603 1.00 81.71  ? 51  GLU A OE2   1 
ATOM   279  N N     . LEU A 1 52 ? -34.018 4.626   141.783 1.00 56.85  ? 52  LEU A N     1 
ATOM   280  C CA    . LEU A 1 52 ? -32.733 5.035   141.220 1.00 48.81  ? 52  LEU A CA    1 
ATOM   281  C C     . LEU A 1 52 ? -32.866 6.271   140.339 1.00 46.37  ? 52  LEU A C     1 
ATOM   282  O O     . LEU A 1 52 ? -32.173 7.269   140.541 1.00 53.04  ? 52  LEU A O     1 
ATOM   283  C CB    . LEU A 1 52 ? -32.116 3.893   140.412 1.00 54.14  ? 52  LEU A CB    1 
ATOM   284  C CG    . LEU A 1 52 ? -30.912 3.184   141.030 1.00 50.90  ? 52  LEU A CG    1 
ATOM   285  C CD1   . LEU A 1 52 ? -31.187 2.814   142.477 1.00 56.16  ? 52  LEU A CD1   1 
ATOM   286  C CD2   . LEU A 1 52 ? -30.548 1.953   140.216 1.00 62.22  ? 52  LEU A CD2   1 
ATOM   287  N N     . ALA A 1 53 ? -33.764 6.188   139.362 1.00 40.16  ? 53  ALA A N     1 
ATOM   288  C CA    . ALA A 1 53 ? -33.997 7.263   138.406 1.00 37.37  ? 53  ALA A CA    1 
ATOM   289  C C     . ALA A 1 53 ? -34.367 8.564   139.103 1.00 42.26  ? 53  ALA A C     1 
ATOM   290  O O     . ALA A 1 53 ? -33.918 9.641   138.709 1.00 39.07  ? 53  ALA A O     1 
ATOM   291  C CB    . ALA A 1 53 ? -35.092 6.863   137.425 1.00 35.92  ? 53  ALA A CB    1 
ATOM   292  N N     . ARG A 1 54 ? -35.184 8.457   140.147 1.00 59.35  ? 54  ARG A N     1 
ATOM   293  C CA    . ARG A 1 54 ? -35.636 9.636   140.878 1.00 59.47  ? 54  ARG A CA    1 
ATOM   294  C C     . ARG A 1 54 ? -34.526 10.214  141.758 1.00 57.99  ? 54  ARG A C     1 
ATOM   295  O O     . ARG A 1 54 ? -34.444 11.428  141.952 1.00 60.97  ? 54  ARG A O     1 
ATOM   296  C CB    . ARG A 1 54 ? -36.869 9.290   141.718 1.00 59.18  ? 54  ARG A CB    1 
ATOM   297  C CG    . ARG A 1 54 ? -36.946 9.981   143.074 1.00 68.73  ? 54  ARG A CG    1 
ATOM   298  C CD    . ARG A 1 54 ? -38.090 9.420   143.908 1.00 68.17  ? 54  ARG A CD    1 
ATOM   299  N NE    . ARG A 1 54 ? -38.471 10.300  145.010 1.00 75.77  ? 54  ARG A NE    1 
ATOM   300  C CZ    . ARG A 1 54 ? -39.296 11.336  144.888 1.00 85.88  ? 54  ARG A CZ    1 
ATOM   301  N NH1   . ARG A 1 54 ? -39.591 12.083  145.945 1.00 82.19  ? 54  ARG A NH1   1 
ATOM   302  N NH2   . ARG A 1 54 ? -39.818 11.638  143.706 1.00 82.97  ? 54  ARG A NH2   1 
ATOM   303  N N     . ASN A 1 55 ? -33.667 9.342   142.275 1.00 45.81  ? 55  ASN A N     1 
ATOM   304  C CA    . ASN A 1 55 ? -32.585 9.766   143.159 1.00 46.43  ? 55  ASN A CA    1 
ATOM   305  C C     . ASN A 1 55 ? -31.354 10.281  142.417 1.00 50.02  ? 55  ASN A C     1 
ATOM   306  O O     . ASN A 1 55 ? -30.668 11.185  142.895 1.00 50.17  ? 55  ASN A O     1 
ATOM   307  C CB    . ASN A 1 55 ? -32.174 8.618   144.082 1.00 42.22  ? 55  ASN A CB    1 
ATOM   308  C CG    . ASN A 1 55 ? -33.256 8.252   145.076 1.00 46.28  ? 55  ASN A CG    1 
ATOM   309  O OD1   . ASN A 1 55 ? -34.431 8.560   144.876 1.00 60.71  ? 55  ASN A OD1   1 
ATOM   310  N ND2   . ASN A 1 55 ? -32.863 7.592   146.159 1.00 52.51  ? 55  ASN A ND2   1 
ATOM   311  N N     . LEU A 1 56 ? -31.070 9.700   141.257 1.00 43.37  ? 56  LEU A N     1 
ATOM   312  C CA    . LEU A 1 56 ? -29.886 10.080  140.494 1.00 37.92  ? 56  LEU A CA    1 
ATOM   313  C C     . LEU A 1 56 ? -30.238 11.022  139.350 1.00 38.22  ? 56  LEU A C     1 
ATOM   314  O O     . LEU A 1 56 ? -29.409 11.285  138.477 1.00 44.37  ? 56  LEU A O     1 
ATOM   315  C CB    . LEU A 1 56 ? -29.176 8.839   139.951 1.00 38.53  ? 56  LEU A CB    1 
ATOM   316  C CG    . LEU A 1 56 ? -28.832 7.738   140.956 1.00 38.37  ? 56  LEU A CG    1 
ATOM   317  C CD1   . LEU A 1 56 ? -27.806 6.795   140.359 1.00 33.24  ? 56  LEU A CD1   1 
ATOM   318  C CD2   . LEU A 1 56 ? -28.328 8.316   142.272 1.00 41.39  ? 56  LEU A CD2   1 
ATOM   319  N N     . GLN A 1 57 ? -31.471 11.522  139.368 1.00 30.95  ? 57  GLN A N     1 
ATOM   320  C CA    . GLN A 1 57 ? -31.962 12.456  138.357 1.00 37.42  ? 57  GLN A CA    1 
ATOM   321  C C     . GLN A 1 57 ? -31.808 11.891  136.947 1.00 37.33  ? 57  GLN A C     1 
ATOM   322  O O     . GLN A 1 57 ? -31.186 12.506  136.079 1.00 31.83  ? 57  GLN A O     1 
ATOM   323  C CB    . GLN A 1 57 ? -31.238 13.797  138.474 1.00 34.71  ? 57  GLN A CB    1 
ATOM   324  C CG    . GLN A 1 57 ? -31.205 14.355  139.888 1.00 35.85  ? 57  GLN A CG    1 
ATOM   325  C CD    . GLN A 1 57 ? -32.494 15.056  140.271 1.00 42.36  ? 57  GLN A CD    1 
ATOM   326  O OE1   . GLN A 1 57 ? -33.260 15.487  139.410 1.00 42.29  ? 57  GLN A OE1   1 
ATOM   327  N NE2   . GLN A 1 57 ? -32.739 15.173  141.571 1.00 42.09  ? 57  GLN A NE2   1 
ATOM   328  N N     . LEU A 1 58 ? -32.376 10.709  136.735 1.00 45.41  ? 58  LEU A N     1 
ATOM   329  C CA    . LEU A 1 58 ? -32.346 10.053  135.434 1.00 38.54  ? 58  LEU A CA    1 
ATOM   330  C C     . LEU A 1 58 ? -33.734 9.527   135.089 1.00 37.16  ? 58  LEU A C     1 
ATOM   331  O O     . LEU A 1 58 ? -34.651 9.601   135.905 1.00 40.72  ? 58  LEU A O     1 
ATOM   332  C CB    . LEU A 1 58 ? -31.328 8.910   135.427 1.00 39.01  ? 58  LEU A CB    1 
ATOM   333  C CG    . LEU A 1 58 ? -29.856 9.275   135.639 1.00 44.15  ? 58  LEU A CG    1 
ATOM   334  C CD1   . LEU A 1 58 ? -29.107 8.126   136.299 1.00 38.79  ? 58  LEU A CD1   1 
ATOM   335  C CD2   . LEU A 1 58 ? -29.199 9.653   134.319 1.00 33.62  ? 58  LEU A CD2   1 
ATOM   336  N N     . THR A 1 59 ? -33.890 9.001   133.880 1.00 35.55  ? 59  THR A N     1 
ATOM   337  C CA    . THR A 1 59 ? -35.141 8.358   133.499 1.00 32.93  ? 59  THR A CA    1 
ATOM   338  C C     . THR A 1 59 ? -35.078 6.881   133.871 1.00 34.65  ? 59  THR A C     1 
ATOM   339  O O     . THR A 1 59 ? -34.019 6.375   134.241 1.00 46.49  ? 59  THR A O     1 
ATOM   340  C CB    . THR A 1 59 ? -35.429 8.501   131.992 1.00 35.46  ? 59  THR A CB    1 
ATOM   341  O OG1   . THR A 1 59 ? -34.664 7.535   131.260 1.00 42.69  ? 59  THR A OG1   1 
ATOM   342  C CG2   . THR A 1 59 ? -35.081 9.899   131.509 1.00 28.31  ? 59  THR A CG2   1 
ATOM   343  N N     . GLU A 1 60 ? -36.208 6.191   133.782 1.00 44.13  ? 60  GLU A N     1 
ATOM   344  C CA    . GLU A 1 60 ? -36.224 4.756   134.031 1.00 47.05  ? 60  GLU A CA    1 
ATOM   345  C C     . GLU A 1 60 ? -35.522 4.041   132.879 1.00 46.11  ? 60  GLU A C     1 
ATOM   346  O O     . GLU A 1 60 ? -34.812 3.048   133.077 1.00 49.29  ? 60  GLU A O     1 
ATOM   347  C CB    . GLU A 1 60 ? -37.658 4.248   134.204 1.00 54.99  ? 60  GLU A CB    1 
ATOM   348  C CG    . GLU A 1 60 ? -38.357 4.795   135.443 1.00 49.30  ? 60  GLU A CG    1 
ATOM   349  C CD    . GLU A 1 60 ? -39.651 4.069   135.758 1.00 60.54  ? 60  GLU A CD    1 
ATOM   350  O OE1   . GLU A 1 60 ? -39.629 2.824   135.846 1.00 60.65  ? 60  GLU A OE1   1 
ATOM   351  O OE2   . GLU A 1 60 ? -40.689 4.744   135.921 1.00 68.11  ? 60  GLU A OE2   1 
ATOM   352  N N     . ARG A 1 61 ? -35.713 4.574   131.676 1.00 39.75  ? 61  ARG A N     1 
ATOM   353  C CA    . ARG A 1 61 ? -35.054 4.055   130.485 1.00 38.88  ? 61  ARG A CA    1 
ATOM   354  C C     . ARG A 1 61 ? -33.540 4.229   130.588 1.00 47.72  ? 61  ARG A C     1 
ATOM   355  O O     . ARG A 1 61 ? -32.783 3.339   130.207 1.00 49.87  ? 61  ARG A O     1 
ATOM   356  C CB    . ARG A 1 61 ? -35.590 4.752   129.231 1.00 31.82  ? 61  ARG A CB    1 
ATOM   357  C CG    . ARG A 1 61 ? -35.023 4.225   127.920 1.00 41.07  ? 61  ARG A CG    1 
ATOM   358  C CD    . ARG A 1 61 ? -35.635 4.949   126.727 1.00 42.19  ? 61  ARG A CD    1 
ATOM   359  N NE    . ARG A 1 61 ? -34.768 4.920   125.550 1.00 68.28  ? 61  ARG A NE    1 
ATOM   360  C CZ    . ARG A 1 61 ? -35.000 4.189   124.464 1.00 73.08  ? 61  ARG A CZ    1 
ATOM   361  N NH1   . ARG A 1 61 ? -36.077 3.418   124.397 1.00 72.15  ? 61  ARG A NH1   1 
ATOM   362  N NH2   . ARG A 1 61 ? -34.155 4.230   123.442 1.00 60.65  ? 61  ARG A NH2   1 
ATOM   363  N N     . GLN A 1 62 ? -33.108 5.373   131.114 1.00 36.32  ? 62  GLN A N     1 
ATOM   364  C CA    . GLN A 1 62 ? -31.684 5.652   131.292 1.00 31.72  ? 62  GLN A CA    1 
ATOM   365  C C     . GLN A 1 62 ? -31.020 4.629   132.213 1.00 37.98  ? 62  GLN A C     1 
ATOM   366  O O     . GLN A 1 62 ? -29.954 4.095   131.896 1.00 42.24  ? 62  GLN A O     1 
ATOM   367  C CB    . GLN A 1 62 ? -31.477 7.065   131.845 1.00 32.71  ? 62  GLN A CB    1 
ATOM   368  C CG    . GLN A 1 62 ? -31.553 8.167   130.797 1.00 33.73  ? 62  GLN A CG    1 
ATOM   369  C CD    . GLN A 1 62 ? -31.096 9.511   131.330 1.00 37.08  ? 62  GLN A CD    1 
ATOM   370  O OE1   . GLN A 1 62 ? -31.727 10.087  132.215 1.00 39.13  ? 62  GLN A OE1   1 
ATOM   371  N NE2   . GLN A 1 62 ? -29.990 10.016  130.794 1.00 47.69  ? 62  GLN A NE2   1 
ATOM   372  N N     . VAL A 1 63 ? -31.656 4.362   133.350 1.00 35.84  ? 63  VAL A N     1 
ATOM   373  C CA    . VAL A 1 63 ? -31.159 3.376   134.305 1.00 37.84  ? 63  VAL A CA    1 
ATOM   374  C C     . VAL A 1 63 ? -31.126 1.986   133.673 1.00 41.21  ? 63  VAL A C     1 
ATOM   375  O O     . VAL A 1 63 ? -30.121 1.266   133.767 1.00 45.56  ? 63  VAL A O     1 
ATOM   376  C CB    . VAL A 1 63 ? -32.023 3.344   135.583 1.00 35.23  ? 63  VAL A CB    1 
ATOM   377  C CG1   . VAL A 1 63 ? -31.595 2.205   136.492 1.00 40.37  ? 63  VAL A CG1   1 
ATOM   378  C CG2   . VAL A 1 63 ? -31.942 4.676   136.313 1.00 33.02  ? 63  VAL A CG2   1 
ATOM   379  N N     . LYS A 1 64 ? -32.235 1.625   133.031 1.00 35.59  ? 64  LYS A N     1 
ATOM   380  C CA    . LYS A 1 64 ? -32.345 0.379   132.271 1.00 38.39  ? 64  LYS A CA    1 
ATOM   381  C C     . LYS A 1 64 ? -31.139 0.164   131.348 1.00 43.10  ? 64  LYS A C     1 
ATOM   382  O O     . LYS A 1 64 ? -30.424 -0.854  131.435 1.00 41.33  ? 64  LYS A O     1 
ATOM   383  C CB    . LYS A 1 64 ? -33.649 0.396   131.465 1.00 41.67  ? 64  LYS A CB    1 
ATOM   384  C CG    . LYS A 1 64 ? -33.898 -0.810  130.576 1.00 46.23  ? 64  LYS A CG    1 
ATOM   385  C CD    . LYS A 1 64 ? -34.540 -0.368  129.265 1.00 41.63  ? 64  LYS A CD    1 
ATOM   386  C CE    . LYS A 1 64 ? -34.917 -1.548  128.385 1.00 47.25  ? 64  LYS A CE    1 
ATOM   387  N NZ    . LYS A 1 64 ? -35.907 -1.164  127.338 1.00 55.07  ? 64  LYS A NZ    1 
ATOM   388  N N     . ILE A 1 65 ? -30.909 1.145   130.480 1.00 33.93  ? 65  ILE A N     1 
ATOM   389  C CA    . ILE A 1 65 ? -29.781 1.119   129.560 1.00 30.13  ? 65  ILE A CA    1 
ATOM   390  C C     . ILE A 1 65 ? -28.453 0.981   130.294 1.00 26.00  ? 65  ILE A C     1 
ATOM   391  O O     . ILE A 1 65 ? -27.615 0.160   129.914 1.00 31.94  ? 65  ILE A O     1 
ATOM   392  C CB    . ILE A 1 65 ? -29.736 2.388   128.687 1.00 36.43  ? 65  ILE A CB    1 
ATOM   393  C CG1   . ILE A 1 65 ? -31.000 2.489   127.831 1.00 43.43  ? 65  ILE A CG1   1 
ATOM   394  C CG2   . ILE A 1 65 ? -28.493 2.395   127.812 1.00 37.58  ? 65  ILE A CG2   1 
ATOM   395  C CD1   . ILE A 1 65 ? -31.218 1.305   126.925 1.00 41.24  ? 65  ILE A CD1   1 
ATOM   396  N N     . TRP A 1 66 ? -28.269 1.779   131.344 1.00 30.78  ? 66  TRP A N     1 
ATOM   397  C CA    . TRP A 1 66 ? -27.011 1.769   132.085 1.00 36.41  ? 66  TRP A CA    1 
ATOM   398  C C     . TRP A 1 66 ? -26.693 0.374   132.591 1.00 34.35  ? 66  TRP A C     1 
ATOM   399  O O     . TRP A 1 66 ? -25.558 -0.085  132.481 1.00 38.02  ? 66  TRP A O     1 
ATOM   400  C CB    . TRP A 1 66 ? -27.043 2.744   133.264 1.00 37.82  ? 66  TRP A CB    1 
ATOM   401  C CG    . TRP A 1 66 ? -25.687 2.923   133.895 1.00 37.13  ? 66  TRP A CG    1 
ATOM   402  C CD1   . TRP A 1 66 ? -24.783 3.908   133.624 1.00 37.23  ? 66  TRP A CD1   1 
ATOM   403  C CD2   . TRP A 1 66 ? -25.076 2.080   134.883 1.00 38.38  ? 66  TRP A CD2   1 
ATOM   404  N NE1   . TRP A 1 66 ? -23.653 3.739   134.387 1.00 39.51  ? 66  TRP A NE1   1 
ATOM   405  C CE2   . TRP A 1 66 ? -23.806 2.623   135.167 1.00 41.57  ? 66  TRP A CE2   1 
ATOM   406  C CE3   . TRP A 1 66 ? -25.480 0.923   135.558 1.00 33.24  ? 66  TRP A CE3   1 
ATOM   407  C CZ2   . TRP A 1 66 ? -22.939 2.050   136.095 1.00 39.37  ? 66  TRP A CZ2   1 
ATOM   408  C CZ3   . TRP A 1 66 ? -24.617 0.355   136.478 1.00 36.35  ? 66  TRP A CZ3   1 
ATOM   409  C CH2   . TRP A 1 66 ? -23.361 0.919   136.738 1.00 39.45  ? 66  TRP A CH2   1 
ATOM   410  N N     . PHE A 1 67 ? -27.696 -0.300  133.146 1.00 41.41  ? 67  PHE A N     1 
ATOM   411  C CA    . PHE A 1 67 ? -27.473 -1.645  133.664 1.00 42.82  ? 67  PHE A CA    1 
ATOM   412  C C     . PHE A 1 67 ? -27.207 -2.645  132.541 1.00 42.55  ? 67  PHE A C     1 
ATOM   413  O O     . PHE A 1 67 ? -26.373 -3.543  132.695 1.00 46.52  ? 67  PHE A O     1 
ATOM   414  C CB    . PHE A 1 67 ? -28.657 -2.096  134.522 1.00 44.79  ? 67  PHE A CB    1 
ATOM   415  C CG    . PHE A 1 67 ? -28.519 -1.724  135.972 1.00 47.54  ? 67  PHE A CG    1 
ATOM   416  C CD1   . PHE A 1 67 ? -28.127 -2.667  136.909 1.00 47.72  ? 67  PHE A CD1   1 
ATOM   417  C CD2   . PHE A 1 67 ? -28.760 -0.427  136.396 1.00 49.65  ? 67  PHE A CD2   1 
ATOM   418  C CE1   . PHE A 1 67 ? -27.989 -2.327  138.243 1.00 45.61  ? 67  PHE A CE1   1 
ATOM   419  C CE2   . PHE A 1 67 ? -28.624 -0.080  137.729 1.00 43.48  ? 67  PHE A CE2   1 
ATOM   420  C CZ    . PHE A 1 67 ? -28.238 -1.031  138.653 1.00 48.30  ? 67  PHE A CZ    1 
ATOM   421  N N     . GLN A 1 68 ? -27.895 -2.485  131.412 1.00 31.69  ? 68  GLN A N     1 
ATOM   422  C CA    . GLN A 1 68 ? -27.625 -3.340  130.252 1.00 27.49  ? 68  GLN A CA    1 
ATOM   423  C C     . GLN A 1 68 ? -26.153 -3.244  129.807 1.00 30.42  ? 68  GLN A C     1 
ATOM   424  O O     . GLN A 1 68 ? -25.412 -4.253  129.762 1.00 41.05  ? 68  GLN A O     1 
ATOM   425  C CB    . GLN A 1 68 ? -28.558 -2.968  129.096 1.00 33.03  ? 68  GLN A CB    1 
ATOM   426  C CG    . GLN A 1 68 ? -30.013 -3.370  129.321 1.00 35.64  ? 68  GLN A CG    1 
ATOM   427  C CD    . GLN A 1 68 ? -30.915 -3.009  128.154 1.00 39.91  ? 68  GLN A CD    1 
ATOM   428  O OE1   . GLN A 1 68 ? -30.532 -2.235  127.276 1.00 42.61  ? 68  GLN A OE1   1 
ATOM   429  N NE2   . GLN A 1 68 ? -32.119 -3.572  128.137 1.00 42.07  ? 68  GLN A NE2   1 
ATOM   430  N N     . ASN A 1 69 ? -25.737 -2.019  129.492 1.00 45.22  ? 69  ASN A N     1 
ATOM   431  C CA    . ASN A 1 69 ? -24.362 -1.740  129.094 1.00 47.01  ? 69  ASN A CA    1 
ATOM   432  C C     . ASN A 1 69 ? -23.350 -2.225  130.125 1.00 44.62  ? 69  ASN A C     1 
ATOM   433  O O     . ASN A 1 69 ? -22.335 -2.825  129.772 1.00 43.20  ? 69  ASN A O     1 
ATOM   434  C CB    . ASN A 1 69 ? -24.166 -0.241  128.854 1.00 39.20  ? 69  ASN A CB    1 
ATOM   435  C CG    . ASN A 1 69 ? -24.752 0.223   127.535 1.00 43.96  ? 69  ASN A CG    1 
ATOM   436  O OD1   . ASN A 1 69 ? -24.910 -0.562  126.600 1.00 50.43  ? 69  ASN A OD1   1 
ATOM   437  N ND2   . ASN A 1 69 ? -25.069 1.509   127.451 1.00 47.24  ? 69  ASN A ND2   1 
ATOM   438  N N     . ARG A 1 70 ? -23.635 -1.960  131.397 1.00 36.73  ? 70  ARG A N     1 
ATOM   439  C CA    . ARG A 1 70 ? -22.757 -2.382  132.482 1.00 34.85  ? 70  ARG A CA    1 
ATOM   440  C C     . ARG A 1 70 ? -22.593 -3.896  132.487 1.00 42.56  ? 70  ARG A C     1 
ATOM   441  O O     . ARG A 1 70 ? -21.498 -4.409  132.734 1.00 45.22  ? 70  ARG A O     1 
ATOM   442  C CB    . ARG A 1 70 ? -23.296 -1.905  133.831 1.00 32.84  ? 70  ARG A CB    1 
ATOM   443  C CG    . ARG A 1 70 ? -22.360 -2.168  134.999 1.00 33.11  ? 70  ARG A CG    1 
ATOM   444  C CD    . ARG A 1 70 ? -21.025 -1.470  134.796 1.00 42.04  ? 70  ARG A CD    1 
ATOM   445  N NE    . ARG A 1 70 ? -20.147 -1.614  135.954 1.00 39.43  ? 70  ARG A NE    1 
ATOM   446  C CZ    . ARG A 1 70 ? -19.349 -2.655  136.165 1.00 37.30  ? 70  ARG A CZ    1 
ATOM   447  N NH1   . ARG A 1 70 ? -19.313 -3.653  135.292 1.00 43.39  ? 70  ARG A NH1   1 
ATOM   448  N NH2   . ARG A 1 70 ? -18.586 -2.698  137.248 1.00 42.91  ? 70  ARG A NH2   1 
ATOM   449  N N     . ARG A 1 71 ? -23.681 -4.609  132.206 1.00 44.89  ? 71  ARG A N     1 
ATOM   450  C CA    . ARG A 1 71 ? -23.620 -6.063  132.115 1.00 47.82  ? 71  ARG A CA    1 
ATOM   451  C C     . ARG A 1 71 ? -22.693 -6.508  130.990 1.00 50.97  ? 71  ARG A C     1 
ATOM   452  O O     . ARG A 1 71 ? -21.830 -7.369  131.198 1.00 47.98  ? 71  ARG A O     1 
ATOM   453  C CB    . ARG A 1 71 ? -25.014 -6.660  131.916 1.00 46.82  ? 71  ARG A CB    1 
ATOM   454  C CG    . ARG A 1 71 ? -25.874 -6.631  133.166 1.00 39.57  ? 71  ARG A CG    1 
ATOM   455  C CD    . ARG A 1 71 ? -27.027 -7.614  133.068 1.00 37.83  ? 71  ARG A CD    1 
ATOM   456  N NE    . ARG A 1 71 ? -28.012 -7.215  132.068 1.00 39.90  ? 71  ARG A NE    1 
ATOM   457  C CZ    . ARG A 1 71 ? -28.937 -6.280  132.261 1.00 38.04  ? 71  ARG A CZ    1 
ATOM   458  N NH1   . ARG A 1 71 ? -29.006 -5.640  133.422 1.00 38.47  ? 71  ARG A NH1   1 
ATOM   459  N NH2   . ARG A 1 71 ? -29.794 -5.984  131.294 1.00 34.37  ? 71  ARG A NH2   1 
ATOM   460  N N     . MET A 1 72 ? -22.860 -5.923  129.803 1.00 42.81  ? 72  MET A N     1 
ATOM   461  C CA    . MET A 1 72 ? -21.962 -6.272  128.695 1.00 46.04  ? 72  MET A CA    1 
ATOM   462  C C     . MET A 1 72 ? -20.494 -5.988  129.041 1.00 46.07  ? 72  MET A C     1 
ATOM   463  O O     . MET A 1 72 ? -19.595 -6.783  128.727 1.00 50.96  ? 72  MET A O     1 
ATOM   464  C CB    . MET A 1 72 ? -22.354 -5.523  127.420 1.00 40.28  ? 72  MET A CB    1 
ATOM   465  C CG    . MET A 1 72 ? -23.634 -6.025  126.764 1.00 50.81  ? 72  MET A CG    1 
ATOM   466  S SD    . MET A 1 72 ? -23.618 -7.796  126.404 1.00 50.96  ? 72  MET A SD    1 
ATOM   467  C CE    . MET A 1 72 ? -24.625 -8.436  127.741 1.00 46.20  ? 72  MET A CE    1 
ATOM   468  N N     . LYS A 1 73 ? -20.266 -4.855  129.699 1.00 47.80  ? 73  LYS A N     1 
ATOM   469  C CA    . LYS A 1 73 ? -18.931 -4.470  130.141 1.00 49.08  ? 73  LYS A CA    1 
ATOM   470  C C     . LYS A 1 73 ? -18.333 -5.515  131.074 1.00 49.91  ? 73  LYS A C     1 
ATOM   471  O O     . LYS A 1 73 ? -17.179 -5.918  130.910 1.00 47.92  ? 73  LYS A O     1 
ATOM   472  C CB    . LYS A 1 73 ? -18.968 -3.112  130.843 1.00 38.11  ? 73  LYS A CB    1 
ATOM   473  C CG    . LYS A 1 73 ? -17.746 -2.835  131.702 1.00 41.08  ? 73  LYS A CG    1 
ATOM   474  C CD    . LYS A 1 73 ? -17.671 -1.378  132.118 1.00 43.60  ? 73  LYS A CD    1 
ATOM   475  C CE    . LYS A 1 73 ? -16.447 -1.119  132.980 1.00 28.96  ? 73  LYS A CE    1 
ATOM   476  N NZ    . LYS A 1 73 ? -16.345 0.312   133.376 1.00 30.34  ? 73  LYS A NZ    1 
ATOM   477  N N     . ASN A 1 74 ? -19.123 -5.951  132.051 1.00 38.34  ? 74  ASN A N     1 
ATOM   478  C CA    . ASN A 1 74 ? -18.666 -6.969  132.987 1.00 36.63  ? 74  ASN A CA    1 
ATOM   479  C C     . ASN A 1 74 ? -18.416 -8.289  132.275 1.00 40.66  ? 74  ASN A C     1 
ATOM   480  O O     . ASN A 1 74 ? -17.597 -9.096  132.715 1.00 46.02  ? 74  ASN A O     1 
ATOM   481  C CB    . ASN A 1 74 ? -19.675 -7.166  134.119 1.00 36.16  ? 74  ASN A CB    1 
ATOM   482  C CG    . ASN A 1 74 ? -19.033 -7.715  135.380 1.00 32.95  ? 74  ASN A CG    1 
ATOM   483  O OD1   . ASN A 1 74 ? -17.816 -7.642  135.551 1.00 50.83  ? 74  ASN A OD1   1 
ATOM   484  N ND2   . ASN A 1 74 ? -19.848 -8.272  136.268 1.00 40.37  ? 74  ASN A ND2   1 
ATOM   485  N N     . LYS A 1 75 ? -19.123 -8.506  131.169 1.00 49.47  ? 75  LYS A N     1 
ATOM   486  C CA    . LYS A 1 75 ? -18.892 -9.696  130.360 1.00 45.78  ? 75  LYS A CA    1 
ATOM   487  C C     . LYS A 1 75 ? -17.534 -9.634  129.669 1.00 43.18  ? 75  LYS A C     1 
ATOM   488  O O     . LYS A 1 75 ? -16.810 -10.625 129.637 1.00 55.13  ? 75  LYS A O     1 
ATOM   489  C CB    . LYS A 1 75 ? -20.002 -9.877  129.325 1.00 47.74  ? 75  LYS A CB    1 
ATOM   490  C CG    . LYS A 1 75 ? -20.684 -11.231 129.402 1.00 48.53  ? 75  LYS A CG    1 
ATOM   491  C CD    . LYS A 1 75 ? -21.872 -11.318 128.463 1.00 46.87  ? 75  LYS A CD    1 
ATOM   492  C CE    . LYS A 1 75 ? -22.515 -12.694 128.526 1.00 47.27  ? 75  LYS A CE    1 
ATOM   493  N NZ    . LYS A 1 75 ? -23.776 -12.757 127.739 1.00 47.47  ? 75  LYS A NZ    1 
ATOM   494  N N     . LYS A 1 76 ? -17.189 -8.472  129.119 1.00 52.05  ? 76  LYS A N     1 
ATOM   495  C CA    . LYS A 1 76 ? -15.900 -8.317  128.442 1.00 58.11  ? 76  LYS A CA    1 
ATOM   496  C C     . LYS A 1 76 ? -14.723 -8.603  129.377 1.00 51.06  ? 76  LYS A C     1 
ATOM   497  O O     . LYS A 1 76 ? -13.981 -9.566  129.181 1.00 56.19  ? 76  LYS A O     1 
ATOM   498  C CB    . LYS A 1 76 ? -15.767 -6.910  127.855 1.00 61.01  ? 76  LYS A CB    1 
ATOM   499  N N     . ASN A 1 77 ? -14.564 -7.767  130.397 1.00 69.10  ? 77  ASN A N     1 
ATOM   500  C CA    . ASN A 1 77 ? -13.456 -7.902  131.337 1.00 67.53  ? 77  ASN A CA    1 
ATOM   501  C C     . ASN A 1 77 ? -13.603 -9.121  132.244 1.00 65.58  ? 77  ASN A C     1 
ATOM   502  O O     . ASN A 1 77 ? -13.739 -8.989  133.461 1.00 76.72  ? 77  ASN A O     1 
ATOM   503  C CB    . ASN A 1 77 ? -13.329 -6.637  132.185 1.00 74.95  ? 77  ASN A CB    1 
ATOM   504  C CG    . ASN A 1 77 ? -13.494 -5.371  131.369 1.00 78.35  ? 77  ASN A CG    1 
ATOM   505  O OD1   . ASN A 1 77 ? -13.278 -5.366  130.157 1.00 84.69  ? 77  ASN A OD1   1 
ATOM   506  N ND2   . ASN A 1 77 ? -13.883 -4.287  132.031 1.00 84.69  ? 77  ASN A ND2   1 
ATOM   507  N N     . ARG B 2 3  ? -9.338  1.783   130.925 1.00 92.45  ? 3   ARG B N     1 
ATOM   508  C CA    . ARG B 2 3  ? -8.085  1.139   131.299 1.00 87.29  ? 3   ARG B CA    1 
ATOM   509  C C     . ARG B 2 3  ? -6.946  1.565   130.372 1.00 98.71  ? 3   ARG B C     1 
ATOM   510  O O     . ARG B 2 3  ? -6.996  1.343   129.162 1.00 93.80  ? 3   ARG B O     1 
ATOM   511  C CB    . ARG B 2 3  ? -8.242  -0.383  131.288 1.00 92.14  ? 3   ARG B CB    1 
ATOM   512  N N     . ARG B 2 4  ? -5.923  2.176   130.961 1.00 113.67 ? 4   ARG B N     1 
ATOM   513  C CA    . ARG B 2 4  ? -4.789  2.734   130.228 1.00 115.57 ? 4   ARG B CA    1 
ATOM   514  C C     . ARG B 2 4  ? -3.498  2.054   130.717 1.00 125.48 ? 4   ARG B C     1 
ATOM   515  O O     . ARG B 2 4  ? -3.517  1.436   131.782 1.00 122.56 ? 4   ARG B O     1 
ATOM   516  C CB    . ARG B 2 4  ? -4.752  4.256   130.428 1.00 73.11  ? 4   ARG B CB    1 
ATOM   517  N N     . LYS B 2 5  ? -2.379  2.148   129.987 1.00 92.30  ? 5   LYS B N     1 
ATOM   518  C CA    . LYS B 2 5  ? -2.206  2.989   128.801 1.00 76.45  ? 5   LYS B CA    1 
ATOM   519  C C     . LYS B 2 5  ? -2.350  2.243   127.480 1.00 76.93  ? 5   LYS B C     1 
ATOM   520  O O     . LYS B 2 5  ? -2.521  1.025   127.446 1.00 75.28  ? 5   LYS B O     1 
ATOM   521  C CB    . LYS B 2 5  ? -0.837  3.671   128.841 1.00 81.07  ? 5   LYS B CB    1 
ATOM   522  N N     . ARG B 2 6  ? -2.253  3.002   126.393 1.00 99.26  ? 6   ARG B N     1 
ATOM   523  C CA    . ARG B 2 6  ? -2.506  2.502   125.048 1.00 99.19  ? 6   ARG B CA    1 
ATOM   524  C C     . ARG B 2 6  ? -1.234  2.482   124.196 1.00 95.07  ? 6   ARG B C     1 
ATOM   525  O O     . ARG B 2 6  ? -0.314  3.268   124.423 1.00 91.48  ? 6   ARG B O     1 
ATOM   526  C CB    . ARG B 2 6  ? -3.587  3.368   124.384 1.00 90.76  ? 6   ARG B CB    1 
ATOM   527  C CG    . ARG B 2 6  ? -3.443  3.551   122.881 1.00 83.15  ? 6   ARG B CG    1 
ATOM   528  C CD    . ARG B 2 6  ? -3.967  4.901   122.420 1.00 86.86  ? 6   ARG B CD    1 
ATOM   529  N NE    . ARG B 2 6  ? -3.481  5.237   121.084 1.00 90.29  ? 6   ARG B NE    1 
ATOM   530  C CZ    . ARG B 2 6  ? -3.148  6.463   120.696 1.00 87.88  ? 6   ARG B CZ    1 
ATOM   531  N NH1   . ARG B 2 6  ? -3.250  7.478   121.541 1.00 90.29  ? 6   ARG B NH1   1 
ATOM   532  N NH2   . ARG B 2 6  ? -2.712  6.677   119.461 1.00 92.96  ? 6   ARG B NH2   1 
ATOM   533  N N     . ARG B 2 7  ? -1.178  1.568   123.231 1.00 56.05  ? 7   ARG B N     1 
ATOM   534  C CA    . ARG B 2 7  ? -0.109  1.563   122.239 1.00 55.75  ? 7   ARG B CA    1 
ATOM   535  C C     . ARG B 2 7  ? -0.686  1.725   120.836 1.00 55.24  ? 7   ARG B C     1 
ATOM   536  O O     . ARG B 2 7  ? -1.866  1.458   120.608 1.00 61.38  ? 7   ARG B O     1 
ATOM   537  C CB    . ARG B 2 7  ? 0.708   0.272   122.330 1.00 46.54  ? 7   ARG B CB    1 
ATOM   538  N N     . ASN B 2 8  ? 0.144   2.175   119.901 1.00 95.01  ? 8   ASN B N     1 
ATOM   539  C CA    . ASN B 2 8  ? -0.261  2.242   118.502 1.00 101.33 ? 8   ASN B CA    1 
ATOM   540  C C     . ASN B 2 8  ? 0.116   0.958   117.778 1.00 106.03 ? 8   ASN B C     1 
ATOM   541  O O     . ASN B 2 8  ? 1.167   0.375   118.041 1.00 104.93 ? 8   ASN B O     1 
ATOM   542  C CB    . ASN B 2 8  ? 0.372   3.447   117.805 1.00 102.97 ? 8   ASN B CB    1 
ATOM   543  C CG    . ASN B 2 8  ? -0.657  4.350   117.151 1.00 101.41 ? 8   ASN B CG    1 
ATOM   544  O OD1   . ASN B 2 8  ? -1.724  4.604   117.712 1.00 100.82 ? 8   ASN B OD1   1 
ATOM   545  N ND2   . ASN B 2 8  ? -0.344  4.836   115.955 1.00 103.71 ? 8   ASN B ND2   1 
ATOM   546  N N     . PHE B 2 9  ? -0.746  0.520   116.867 1.00 97.54  ? 9   PHE B N     1 
ATOM   547  C CA    . PHE B 2 9  ? -0.527  -0.733  116.156 1.00 93.93  ? 9   PHE B CA    1 
ATOM   548  C C     . PHE B 2 9  ? 0.667   -0.617  115.220 1.00 90.87  ? 9   PHE B C     1 
ATOM   549  O O     . PHE B 2 9  ? 0.987   0.475   114.746 1.00 89.93  ? 9   PHE B O     1 
ATOM   550  C CB    . PHE B 2 9  ? -1.779  -1.134  115.373 1.00 95.86  ? 9   PHE B CB    1 
ATOM   551  C CG    . PHE B 2 9  ? -3.002  -1.304  116.230 1.00 91.97  ? 9   PHE B CG    1 
ATOM   552  C CD1   . PHE B 2 9  ? -2.886  -1.578  117.584 1.00 91.29  ? 9   PHE B CD1   1 
ATOM   553  C CD2   . PHE B 2 9  ? -4.268  -1.183  115.683 1.00 95.57  ? 9   PHE B CD2   1 
ATOM   554  C CE1   . PHE B 2 9  ? -4.008  -1.729  118.372 1.00 90.37  ? 9   PHE B CE1   1 
ATOM   555  C CE2   . PHE B 2 9  ? -5.394  -1.335  116.467 1.00 91.21  ? 9   PHE B CE2   1 
ATOM   556  C CZ    . PHE B 2 9  ? -5.264  -1.608  117.814 1.00 85.72  ? 9   PHE B CZ    1 
ATOM   557  N N     . SER B 2 10 ? 1.326   -1.744  114.967 1.00 86.24  ? 10  SER B N     1 
ATOM   558  C CA    . SER B 2 10 ? 2.478   -1.777  114.074 1.00 86.54  ? 10  SER B CA    1 
ATOM   559  C C     . SER B 2 10 ? 2.096   -1.248  112.698 1.00 87.25  ? 10  SER B C     1 
ATOM   560  O O     . SER B 2 10 ? 0.962   -1.426  112.249 1.00 85.80  ? 10  SER B O     1 
ATOM   561  C CB    . SER B 2 10 ? 3.034   -3.198  113.962 1.00 81.18  ? 10  SER B CB    1 
ATOM   562  O OG    . SER B 2 10 ? 2.039   -4.101  113.514 1.00 86.51  ? 10  SER B OG    1 
ATOM   563  N N     . LYS B 2 11 ? 3.046   -0.600  112.031 1.00 100.65 ? 11  LYS B N     1 
ATOM   564  C CA    . LYS B 2 11 ? 2.790   0.042   110.744 1.00 93.30  ? 11  LYS B CA    1 
ATOM   565  C C     . LYS B 2 11 ? 2.332   -0.947  109.676 1.00 100.00 ? 11  LYS B C     1 
ATOM   566  O O     . LYS B 2 11 ? 1.872   -0.547  108.607 1.00 103.78 ? 11  LYS B O     1 
ATOM   567  C CB    . LYS B 2 11 ? 4.044   0.786   110.270 1.00 98.88  ? 11  LYS B CB    1 
ATOM   568  N N     . GLN B 2 12 ? 2.460   -2.237  109.973 1.00 94.71  ? 12  GLN B N     1 
ATOM   569  C CA    . GLN B 2 12 ? 2.067   -3.297  109.049 1.00 99.08  ? 12  GLN B CA    1 
ATOM   570  C C     . GLN B 2 12 ? 0.591   -3.625  109.230 1.00 95.46  ? 12  GLN B C     1 
ATOM   571  O O     . GLN B 2 12 ? -0.097  -3.964  108.274 1.00 91.55  ? 12  GLN B O     1 
ATOM   572  C CB    . GLN B 2 12 ? 2.934   -4.547  109.269 1.00 95.24  ? 12  GLN B CB    1 
ATOM   573  C CG    . GLN B 2 12 ? 2.445   -5.805  108.548 1.00 98.45  ? 12  GLN B CG    1 
ATOM   574  C CD    . GLN B 2 12 ? 2.993   -7.121  109.116 1.00 100.24 ? 12  GLN B CD    1 
ATOM   575  O OE1   . GLN B 2 12 ? 3.467   -7.192  110.253 1.00 105.65 ? 12  GLN B OE1   1 
ATOM   576  N NE2   . GLN B 2 12 ? 2.924   -8.172  108.306 1.00 88.35  ? 12  GLN B NE2   1 
ATOM   577  N N     . ALA B 2 13 ? 0.119   -3.502  110.468 1.00 90.39  ? 13  ALA B N     1 
ATOM   578  C CA    . ALA B 2 13 ? -1.252  -3.851  110.832 1.00 92.51  ? 13  ALA B CA    1 
ATOM   579  C C     . ALA B 2 13 ? -2.269  -2.830  110.302 1.00 96.99  ? 13  ALA B C     1 
ATOM   580  O O     . ALA B 2 13 ? -3.392  -3.183  109.890 1.00 98.36  ? 13  ALA B O     1 
ATOM   581  C CB    . ALA B 2 13 ? -1.369  -3.978  112.340 1.00 93.64  ? 13  ALA B CB    1 
ATOM   582  N N     . SER B 2 14 ? -1.870  -1.561  110.334 1.00 94.00  ? 14  SER B N     1 
ATOM   583  C CA    . SER B 2 14 ? -2.687  -0.471  109.825 1.00 90.49  ? 14  SER B CA    1 
ATOM   584  C C     . SER B 2 14 ? -2.895  -0.613  108.317 1.00 92.95  ? 14  SER B C     1 
ATOM   585  O O     . SER B 2 14 ? -3.988  -0.377  107.808 1.00 94.87  ? 14  SER B O     1 
ATOM   586  C CB    . SER B 2 14 ? -2.043  0.886   110.167 1.00 92.42  ? 14  SER B CB    1 
ATOM   587  O OG    . SER B 2 14 ? -1.034  1.281   109.251 1.00 100.21 ? 14  SER B OG    1 
ATOM   588  N N     . GLU B 2 15 ? -1.844  -1.023  107.615 1.00 92.96  ? 15  GLU B N     1 
ATOM   589  C CA    . GLU B 2 15 ? -1.883  -1.112  106.163 1.00 94.71  ? 15  GLU B CA    1 
ATOM   590  C C     . GLU B 2 15 ? -2.795  -2.235  105.696 1.00 95.80  ? 15  GLU B C     1 
ATOM   591  O O     . GLU B 2 15 ? -3.373  -2.151  104.615 1.00 97.31  ? 15  GLU B O     1 
ATOM   592  C CB    . GLU B 2 15 ? -0.482  -1.319  105.594 1.00 98.56  ? 15  GLU B CB    1 
ATOM   593  C CG    . GLU B 2 15 ? 0.472   -0.162  105.847 1.00 97.89  ? 15  GLU B CG    1 
ATOM   594  C CD    . GLU B 2 15 ? 0.052   1.133   105.166 1.00 107.20 ? 15  GLU B CD    1 
ATOM   595  O OE1   . GLU B 2 15 ? -0.685  1.091   104.156 1.00 112.31 ? 15  GLU B OE1   1 
ATOM   596  O OE2   . GLU B 2 15 ? 0.466   2.206   105.646 1.00 109.67 ? 15  GLU B OE2   1 
ATOM   597  N N     . ILE B 2 16 ? -2.925  -3.292  106.489 1.00 110.44 ? 16  ILE B N     1 
ATOM   598  C CA    . ILE B 2 16 ? -3.819  -4.357  106.080 1.00 109.46 ? 16  ILE B CA    1 
ATOM   599  C C     . ILE B 2 16 ? -5.235  -4.030  106.548 1.00 103.23 ? 16  ILE B C     1 
ATOM   600  O O     . ILE B 2 16 ? -6.193  -4.350  105.840 1.00 99.34  ? 16  ILE B O     1 
ATOM   601  C CB    . ILE B 2 16 ? -3.336  -5.764  106.560 1.00 103.63 ? 16  ILE B CB    1 
ATOM   602  C CG1   . ILE B 2 16 ? -2.534  -5.646  107.857 1.00 102.20 ? 16  ILE B CG1   1 
ATOM   603  C CG2   . ILE B 2 16 ? -2.504  -6.408  105.452 1.00 101.68 ? 16  ILE B CG2   1 
ATOM   604  C CD1   . ILE B 2 16 ? -1.925  -6.922  108.394 1.00 97.81  ? 16  ILE B CD1   1 
ATOM   605  N N     . LEU B 2 17 ? -5.388  -3.327  107.671 1.00 69.92  ? 17  LEU B N     1 
ATOM   606  C CA    . LEU B 2 17 ? -6.724  -2.820  108.022 1.00 63.69  ? 17  LEU B CA    1 
ATOM   607  C C     . LEU B 2 17 ? -7.253  -1.827  106.971 1.00 63.64  ? 17  LEU B C     1 
ATOM   608  O O     . LEU B 2 17 ? -8.464  -1.728  106.746 1.00 69.56  ? 17  LEU B O     1 
ATOM   609  C CB    . LEU B 2 17 ? -6.709  -2.168  109.403 1.00 56.42  ? 17  LEU B CB    1 
ATOM   610  C CG    . LEU B 2 17 ? -6.518  -3.167  110.545 1.00 57.65  ? 17  LEU B CG    1 
ATOM   611  C CD1   . LEU B 2 17 ? -6.624  -2.474  111.890 1.00 54.47  ? 17  LEU B CD1   1 
ATOM   612  C CD2   . LEU B 2 17 ? -7.513  -4.317  110.439 1.00 53.97  ? 17  LEU B CD2   1 
ATOM   613  N N     . ASN B 2 18 ? -6.340  -1.110  106.321 1.00 90.70  ? 18  ASN B N     1 
ATOM   614  C CA    . ASN B 2 18 ? -6.704  -0.174  105.263 1.00 91.31  ? 18  ASN B CA    1 
ATOM   615  C C     . ASN B 2 18 ? -6.924  -0.881  103.932 1.00 94.03  ? 18  ASN B C     1 
ATOM   616  O O     . ASN B 2 18 ? -7.813  -0.510  103.163 1.00 96.25  ? 18  ASN B O     1 
ATOM   617  C CB    . ASN B 2 18 ? -5.630  0.903   105.107 1.00 92.27  ? 18  ASN B CB    1 
ATOM   618  C CG    . ASN B 2 18 ? -5.554  1.829   106.304 1.00 85.67  ? 18  ASN B CG    1 
ATOM   619  O OD1   . ASN B 2 18 ? -6.542  2.036   107.008 1.00 82.67  ? 18  ASN B OD1   1 
ATOM   620  N ND2   . ASN B 2 18 ? -4.372  2.384   106.548 1.00 93.66  ? 18  ASN B ND2   1 
ATOM   621  N N     . GLU B 2 19 ? -6.107  -1.897  103.662 1.00 88.86  ? 19  GLU B N     1 
ATOM   622  C CA    . GLU B 2 19 ? -6.268  -2.705  102.459 1.00 88.75  ? 19  GLU B CA    1 
ATOM   623  C C     . GLU B 2 19 ? -7.631  -3.382  102.488 1.00 98.87  ? 19  GLU B C     1 
ATOM   624  O O     . GLU B 2 19 ? -8.262  -3.578  101.448 1.00 103.67 ? 19  GLU B O     1 
ATOM   625  C CB    . GLU B 2 19 ? -5.143  -3.740  102.340 1.00 95.54  ? 19  GLU B CB    1 
ATOM   626  C CG    . GLU B 2 19 ? -5.562  -5.066  101.717 1.00 103.98 ? 19  GLU B CG    1 
ATOM   627  C CD    . GLU B 2 19 ? -4.420  -6.062  101.617 1.00 101.73 ? 19  GLU B CD    1 
ATOM   628  O OE1   . GLU B 2 19 ? -3.247  -5.642  101.710 1.00 98.86  ? 19  GLU B OE1   1 
ATOM   629  O OE2   . GLU B 2 19 ? -4.697  -7.267  101.437 1.00 101.97 ? 19  GLU B OE2   1 
ATOM   630  N N     . TYR B 2 20 ? -8.087  -3.723  103.689 1.00 86.02  ? 20  TYR B N     1 
ATOM   631  C CA    . TYR B 2 20 ? -9.419  -4.288  103.846 1.00 85.86  ? 20  TYR B CA    1 
ATOM   632  C C     . TYR B 2 20 ? -10.473 -3.194  103.709 1.00 89.20  ? 20  TYR B C     1 
ATOM   633  O O     . TYR B 2 20 ? -11.398 -3.317  102.904 1.00 91.78  ? 20  TYR B O     1 
ATOM   634  C CB    . TYR B 2 20 ? -9.566  -5.004  105.194 1.00 81.97  ? 20  TYR B CB    1 
ATOM   635  C CG    . TYR B 2 20 ? -10.937 -5.617  105.401 1.00 86.75  ? 20  TYR B CG    1 
ATOM   636  C CD1   . TYR B 2 20 ? -11.155 -6.967  105.164 1.00 85.97  ? 20  TYR B CD1   1 
ATOM   637  C CD2   . TYR B 2 20 ? -12.012 -4.849  105.834 1.00 88.35  ? 20  TYR B CD2   1 
ATOM   638  C CE1   . TYR B 2 20 ? -12.402 -7.531  105.343 1.00 87.28  ? 20  TYR B CE1   1 
ATOM   639  C CE2   . TYR B 2 20 ? -13.262 -5.403  106.014 1.00 85.26  ? 20  TYR B CE2   1 
ATOM   640  C CZ    . TYR B 2 20 ? -13.450 -6.747  105.768 1.00 78.85  ? 20  TYR B CZ    1 
ATOM   641  O OH    . TYR B 2 20 ? -14.689 -7.316  105.944 1.00 78.07  ? 20  TYR B OH    1 
ATOM   642  N N     . PHE B 2 21 ? -10.334 -2.132  104.502 1.00 83.00  ? 21  PHE B N     1 
ATOM   643  C CA    . PHE B 2 21 ? -11.347 -1.079  104.558 1.00 79.74  ? 21  PHE B CA    1 
ATOM   644  C C     . PHE B 2 21 ? -11.630 -0.441  103.199 1.00 81.33  ? 21  PHE B C     1 
ATOM   645  O O     . PHE B 2 21 ? -12.769 -0.446  102.731 1.00 86.13  ? 21  PHE B O     1 
ATOM   646  C CB    . PHE B 2 21 ? -10.934 0.008   105.554 1.00 73.44  ? 21  PHE B CB    1 
ATOM   647  C CG    . PHE B 2 21 ? -11.954 1.107   105.715 1.00 73.61  ? 21  PHE B CG    1 
ATOM   648  C CD1   . PHE B 2 21 ? -12.965 0.998   106.656 1.00 76.31  ? 21  PHE B CD1   1 
ATOM   649  C CD2   . PHE B 2 21 ? -11.895 2.253   104.936 1.00 76.36  ? 21  PHE B CD2   1 
ATOM   650  C CE1   . PHE B 2 21 ? -13.903 2.005   106.810 1.00 80.67  ? 21  PHE B CE1   1 
ATOM   651  C CE2   . PHE B 2 21 ? -12.829 3.262   105.084 1.00 67.91  ? 21  PHE B CE2   1 
ATOM   652  C CZ    . PHE B 2 21 ? -13.834 3.139   106.023 1.00 77.64  ? 21  PHE B CZ    1 
ATOM   653  N N     . TYR B 2 22 ? -10.595 0.110   102.571 1.00 96.97  ? 22  TYR B N     1 
ATOM   654  C CA    . TYR B 2 22 ? -10.766 0.861   101.329 1.00 97.06  ? 22  TYR B CA    1 
ATOM   655  C C     . TYR B 2 22 ? -11.086 -0.026  100.121 1.00 102.17 ? 22  TYR B C     1 
ATOM   656  O O     . TYR B 2 22 ? -11.406 0.478   99.044  1.00 106.47 ? 22  TYR B O     1 
ATOM   657  C CB    . TYR B 2 22 ? -9.517  1.701   101.046 1.00 96.88  ? 22  TYR B CB    1 
ATOM   658  C CG    . TYR B 2 22 ? -9.341  2.865   102.000 1.00 92.53  ? 22  TYR B CG    1 
ATOM   659  C CD1   . TYR B 2 22 ? -10.137 3.999   101.894 1.00 93.12  ? 22  TYR B CD1   1 
ATOM   660  C CD2   . TYR B 2 22 ? -8.381  2.830   103.004 1.00 91.28  ? 22  TYR B CD2   1 
ATOM   661  C CE1   . TYR B 2 22 ? -9.985  5.064   102.762 1.00 90.57  ? 22  TYR B CE1   1 
ATOM   662  C CE2   . TYR B 2 22 ? -8.221  3.892   103.876 1.00 89.03  ? 22  TYR B CE2   1 
ATOM   663  C CZ    . TYR B 2 22 ? -9.025  5.006   103.750 1.00 91.69  ? 22  TYR B CZ    1 
ATOM   664  O OH    . TYR B 2 22 ? -8.871  6.065   104.615 1.00 98.38  ? 22  TYR B OH    1 
ATOM   665  N N     . SER B 2 23 ? -11.003 -1.341  100.300 1.00 96.76  ? 23  SER B N     1 
ATOM   666  C CA    . SER B 2 23 ? -11.400 -2.272  99.249  1.00 95.70  ? 23  SER B CA    1 
ATOM   667  C C     . SER B 2 23 ? -12.868 -2.643  99.412  1.00 100.85 ? 23  SER B C     1 
ATOM   668  O O     . SER B 2 23 ? -13.466 -3.274  98.541  1.00 108.05 ? 23  SER B O     1 
ATOM   669  C CB    . SER B 2 23 ? -10.530 -3.530  99.274  1.00 94.80  ? 23  SER B CB    1 
ATOM   670  N N     . HIS B 2 24 ? -13.440 -2.235  100.538 1.00 110.65 ? 24  HIS B N     1 
ATOM   671  C CA    . HIS B 2 24 ? -14.815 -2.571  100.865 1.00 107.23 ? 24  HIS B CA    1 
ATOM   672  C C     . HIS B 2 24 ? -15.595 -1.329  101.253 1.00 107.38 ? 24  HIS B C     1 
ATOM   673  O O     . HIS B 2 24 ? -16.300 -1.322  102.260 1.00 106.09 ? 24  HIS B O     1 
ATOM   674  C CB    . HIS B 2 24 ? -14.853 -3.593  101.999 1.00 99.81  ? 24  HIS B CB    1 
ATOM   675  C CG    . HIS B 2 24 ? -14.006 -4.796  101.742 1.00 104.35 ? 24  HIS B CG    1 
ATOM   676  N ND1   . HIS B 2 24 ? -13.182 -5.349  102.706 1.00 102.84 ? 24  HIS B ND1   1 
ATOM   677  C CD2   . HIS B 2 24 ? -13.848 -5.556  100.637 1.00 107.59 ? 24  HIS B CD2   1 
ATOM   678  C CE1   . HIS B 2 24 ? -12.559 -6.391  102.198 1.00 105.18 ? 24  HIS B CE1   1 
ATOM   679  N NE2   . HIS B 2 24 ? -12.943 -6.544  100.943 1.00 113.82 ? 24  HIS B NE2   1 
ATOM   680  N N     . LEU B 2 25 ? -15.450 -0.275  100.458 1.00 102.19 ? 25  LEU B N     1 
ATOM   681  C CA    . LEU B 2 25 ? -16.218 0.938   100.677 1.00 103.37 ? 25  LEU B CA    1 
ATOM   682  C C     . LEU B 2 25 ? -17.702 0.592   100.667 1.00 107.28 ? 25  LEU B C     1 
ATOM   683  O O     . LEU B 2 25 ? -18.395 0.834   101.647 1.00 105.94 ? 25  LEU B O     1 
ATOM   684  C CB    . LEU B 2 25 ? -15.897 1.991   99.615  1.00 103.01 ? 25  LEU B CB    1 
ATOM   685  N N     . SER B 2 26 ? -18.162 -0.011  99.572  1.00 112.21 ? 26  SER B N     1 
ATOM   686  C CA    . SER B 2 26 ? -19.559 -0.424  99.414  1.00 108.96 ? 26  SER B CA    1 
ATOM   687  C C     . SER B 2 26 ? -20.127 -1.073  100.685 1.00 108.86 ? 26  SER B C     1 
ATOM   688  O O     . SER B 2 26 ? -21.161 -0.640  101.193 1.00 103.19 ? 26  SER B O     1 
ATOM   689  C CB    . SER B 2 26 ? -19.693 -1.381  98.229  1.00 107.03 ? 26  SER B CB    1 
ATOM   690  N N     . ASN B 2 27 ? -19.437 -2.085  101.209 1.00 95.05  ? 27  ASN B N     1 
ATOM   691  C CA    . ASN B 2 27 ? -19.820 -2.720  102.470 1.00 88.17  ? 27  ASN B CA    1 
ATOM   692  C C     . ASN B 2 27 ? -18.609 -2.957  103.385 1.00 92.43  ? 27  ASN B C     1 
ATOM   693  O O     . ASN B 2 27 ? -17.916 -3.970  103.264 1.00 97.65  ? 27  ASN B O     1 
ATOM   694  C CB    . ASN B 2 27 ? -20.551 -4.043  102.198 1.00 94.37  ? 27  ASN B CB    1 
ATOM   695  N N     . PRO B 2 28 ? -18.344 -2.011  104.302 1.00 87.43  ? 28  PRO B N     1 
ATOM   696  C CA    . PRO B 2 28 ? -17.172 -2.063  105.181 1.00 88.70  ? 28  PRO B CA    1 
ATOM   697  C C     . PRO B 2 28 ? -17.422 -2.768  106.513 1.00 90.10  ? 28  PRO B C     1 
ATOM   698  O O     . PRO B 2 28 ? -16.781 -2.431  107.513 1.00 91.12  ? 28  PRO B O     1 
ATOM   699  C CB    . PRO B 2 28 ? -16.859 -0.583  105.419 1.00 86.81  ? 28  PRO B CB    1 
ATOM   700  C CG    . PRO B 2 28 ? -18.200 0.075   105.367 1.00 91.62  ? 28  PRO B CG    1 
ATOM   701  C CD    . PRO B 2 28 ? -19.103 -0.762  104.491 1.00 93.14  ? 28  PRO B CD    1 
ATOM   702  N N     . TYR B 2 29 ? -18.336 -3.732  106.533 1.00 79.16  ? 29  TYR B N     1 
ATOM   703  C CA    . TYR B 2 29 ? -18.578 -4.508  107.748 1.00 73.33  ? 29  TYR B CA    1 
ATOM   704  C C     . TYR B 2 29 ? -17.996 -5.908  107.608 1.00 74.15  ? 29  TYR B C     1 
ATOM   705  O O     . TYR B 2 29 ? -18.318 -6.627  106.656 1.00 78.50  ? 29  TYR B O     1 
ATOM   706  C CB    . TYR B 2 29 ? -20.074 -4.586  108.060 1.00 61.40  ? 29  TYR B CB    1 
ATOM   707  C CG    . TYR B 2 29 ? -20.682 -3.258  108.449 1.00 56.87  ? 29  TYR B CG    1 
ATOM   708  C CD1   . TYR B 2 29 ? -20.852 -2.907  109.785 1.00 55.75  ? 29  TYR B CD1   1 
ATOM   709  C CD2   . TYR B 2 29 ? -21.083 -2.354  107.479 1.00 64.98  ? 29  TYR B CD2   1 
ATOM   710  C CE1   . TYR B 2 29 ? -21.409 -1.691  110.136 1.00 58.62  ? 29  TYR B CE1   1 
ATOM   711  C CE2   . TYR B 2 29 ? -21.637 -1.140  107.818 1.00 68.18  ? 29  TYR B CE2   1 
ATOM   712  C CZ    . TYR B 2 29 ? -21.799 -0.811  109.144 1.00 66.00  ? 29  TYR B CZ    1 
ATOM   713  O OH    . TYR B 2 29 ? -22.353 0.403   109.474 1.00 65.86  ? 29  TYR B OH    1 
ATOM   714  N N     . PRO B 2 30 ? -17.129 -6.298  108.553 1.00 118.74 ? 30  PRO B N     1 
ATOM   715  C CA    . PRO B 2 30 ? -16.510 -7.623  108.503 1.00 117.19 ? 30  PRO B CA    1 
ATOM   716  C C     . PRO B 2 30 ? -17.372 -8.707  109.139 1.00 113.83 ? 30  PRO B C     1 
ATOM   717  O O     . PRO B 2 30 ? -18.009 -8.468  110.166 1.00 115.68 ? 30  PRO B O     1 
ATOM   718  C CB    . PRO B 2 30 ? -15.217 -7.423  109.294 1.00 111.84 ? 30  PRO B CB    1 
ATOM   719  C CG    . PRO B 2 30 ? -15.578 -6.403  110.317 1.00 110.57 ? 30  PRO B CG    1 
ATOM   720  C CD    . PRO B 2 30 ? -16.610 -5.492  109.674 1.00 113.23 ? 30  PRO B CD    1 
ATOM   721  N N     . SER B 2 31 ? -17.389 -9.886  108.526 1.00 77.89  ? 31  SER B N     1 
ATOM   722  C CA    . SER B 2 31 ? -18.052 -11.037 109.119 1.00 72.14  ? 31  SER B CA    1 
ATOM   723  C C     . SER B 2 31 ? -17.386 -11.356 110.451 1.00 73.67  ? 31  SER B C     1 
ATOM   724  O O     . SER B 2 31 ? -16.218 -11.029 110.659 1.00 78.15  ? 31  SER B O     1 
ATOM   725  C CB    . SER B 2 31 ? -17.994 -12.247 108.185 1.00 73.26  ? 31  SER B CB    1 
ATOM   726  N N     . GLU B 2 32 ? -18.126 -11.996 111.350 1.00 80.78  ? 32  GLU B N     1 
ATOM   727  C CA    . GLU B 2 32 ? -17.595 -12.341 112.665 1.00 77.51  ? 32  GLU B CA    1 
ATOM   728  C C     . GLU B 2 32 ? -16.474 -13.375 112.573 1.00 78.81  ? 32  GLU B C     1 
ATOM   729  O O     . GLU B 2 32 ? -15.841 -13.707 113.575 1.00 80.61  ? 32  GLU B O     1 
ATOM   730  C CB    . GLU B 2 32 ? -18.713 -12.860 113.571 1.00 78.89  ? 32  GLU B CB    1 
ATOM   731  N N     . GLU B 2 33 ? -16.237 -13.882 111.366 1.00 100.27 ? 33  GLU B N     1 
ATOM   732  C CA    . GLU B 2 33 ? -15.170 -14.844 111.122 1.00 105.36 ? 33  GLU B CA    1 
ATOM   733  C C     . GLU B 2 33 ? -13.988 -14.189 110.412 1.00 104.28 ? 33  GLU B C     1 
ATOM   734  O O     . GLU B 2 33 ? -12.834 -14.537 110.663 1.00 101.46 ? 33  GLU B O     1 
ATOM   735  C CB    . GLU B 2 33 ? -15.692 -16.023 110.299 1.00 105.15 ? 33  GLU B CB    1 
ATOM   736  N N     . ALA B 2 34 ? -14.282 -13.243 109.525 1.00 97.34  ? 34  ALA B N     1 
ATOM   737  C CA    . ALA B 2 34 ? -13.239 -12.523 108.800 1.00 100.58 ? 34  ALA B CA    1 
ATOM   738  C C     . ALA B 2 34 ? -12.409 -11.672 109.756 1.00 95.35  ? 34  ALA B C     1 
ATOM   739  O O     . ALA B 2 34 ? -11.193 -11.543 109.598 1.00 99.07  ? 34  ALA B O     1 
ATOM   740  C CB    . ALA B 2 34 ? -13.850 -11.656 107.709 1.00 92.65  ? 34  ALA B CB    1 
ATOM   741  N N     . LYS B 2 35 ? -13.079 -11.100 110.752 1.00 65.89  ? 35  LYS B N     1 
ATOM   742  C CA    . LYS B 2 35 ? -12.421 -10.251 111.739 1.00 63.70  ? 35  LYS B CA    1 
ATOM   743  C C     . LYS B 2 35 ? -11.472 -11.054 112.622 1.00 64.49  ? 35  LYS B C     1 
ATOM   744  O O     . LYS B 2 35 ? -10.517 -10.509 113.174 1.00 64.43  ? 35  LYS B O     1 
ATOM   745  C CB    . LYS B 2 35 ? -13.460 -9.534  112.603 1.00 69.09  ? 35  LYS B CB    1 
ATOM   746  N N     . GLU B 2 36 ? -11.746 -12.347 112.759 1.00 95.51  ? 36  GLU B N     1 
ATOM   747  C CA    . GLU B 2 36 ? -10.882 -13.235 113.528 1.00 94.62  ? 36  GLU B CA    1 
ATOM   748  C C     . GLU B 2 36 ? -9.554  -13.407 112.802 1.00 95.06  ? 36  GLU B C     1 
ATOM   749  O O     . GLU B 2 36 ? -8.481  -13.313 113.405 1.00 101.81 ? 36  GLU B O     1 
ATOM   750  C CB    . GLU B 2 36 ? -11.561 -14.589 113.748 1.00 91.06  ? 36  GLU B CB    1 
ATOM   751  C CG    . GLU B 2 36 ? -10.965 -15.424 114.870 1.00 93.89  ? 36  GLU B CG    1 
ATOM   752  C CD    . GLU B 2 36 ? -11.604 -16.797 114.972 1.00 104.35 ? 36  GLU B CD    1 
ATOM   753  O OE1   . GLU B 2 36 ? -12.525 -17.087 114.178 1.00 105.33 ? 36  GLU B OE1   1 
ATOM   754  O OE2   . GLU B 2 36 ? -11.197 -17.581 115.854 1.00 103.42 ? 36  GLU B OE2   1 
ATOM   755  N N     . GLU B 2 37 ? -9.639  -13.647 111.497 1.00 111.13 ? 37  GLU B N     1 
ATOM   756  C CA    . GLU B 2 37 ? -8.455  -13.771 110.656 1.00 119.79 ? 37  GLU B CA    1 
ATOM   757  C C     . GLU B 2 37 ? -7.708  -12.444 110.570 1.00 113.46 ? 37  GLU B C     1 
ATOM   758  O O     . GLU B 2 37 ? -6.480  -12.420 110.480 1.00 114.01 ? 37  GLU B O     1 
ATOM   759  C CB    . GLU B 2 37 ? -8.838  -14.255 109.256 1.00 123.10 ? 37  GLU B CB    1 
ATOM   760  N N     . LEU B 2 38 ? -8.456  -11.343 110.588 1.00 80.83  ? 38  LEU B N     1 
ATOM   761  C CA    . LEU B 2 38 ? -7.853  -10.015 110.641 1.00 75.52  ? 38  LEU B CA    1 
ATOM   762  C C     . LEU B 2 38 ? -7.065  -9.845  111.933 1.00 72.22  ? 38  LEU B C     1 
ATOM   763  O O     . LEU B 2 38 ? -5.958  -9.312  111.932 1.00 71.63  ? 38  LEU B O     1 
ATOM   764  C CB    . LEU B 2 38 ? -8.917  -8.922  110.529 1.00 76.31  ? 38  LEU B CB    1 
ATOM   765  C CG    . LEU B 2 38 ? -9.437  -8.576  109.133 1.00 76.06  ? 38  LEU B CG    1 
ATOM   766  C CD1   . LEU B 2 38 ? -10.561 -7.557  109.225 1.00 79.51  ? 38  LEU B CD1   1 
ATOM   767  C CD2   . LEU B 2 38 ? -8.308  -8.052  108.259 1.00 75.95  ? 38  LEU B CD2   1 
ATOM   768  N N     . ALA B 2 39 ? -7.640  -10.314 113.035 1.00 72.56  ? 39  ALA B N     1 
ATOM   769  C CA    . ALA B 2 39 ? -6.992  -10.223 114.336 1.00 69.08  ? 39  ALA B CA    1 
ATOM   770  C C     . ALA B 2 39 ? -5.873  -11.253 114.470 1.00 74.81  ? 39  ALA B C     1 
ATOM   771  O O     . ALA B 2 39 ? -5.114  -11.234 115.440 1.00 76.81  ? 39  ALA B O     1 
ATOM   772  C CB    . ALA B 2 39 ? -8.011  -10.401 115.448 1.00 70.63  ? 39  ALA B CB    1 
ATOM   773  N N     . ARG B 2 40 ? -5.783  -12.156 113.499 1.00 88.56  ? 40  ARG B N     1 
ATOM   774  C CA    . ARG B 2 40 ? -4.694  -13.126 113.458 1.00 88.66  ? 40  ARG B CA    1 
ATOM   775  C C     . ARG B 2 40 ? -3.509  -12.574 112.665 1.00 89.89  ? 40  ARG B C     1 
ATOM   776  O O     . ARG B 2 40 ? -2.368  -12.620 113.125 1.00 88.25  ? 40  ARG B O     1 
ATOM   777  C CB    . ARG B 2 40 ? -5.171  -14.448 112.854 1.00 84.30  ? 40  ARG B CB    1 
ATOM   778  N N     . LYS B 2 41 ? -3.790  -12.048 111.476 1.00 71.50  ? 41  LYS B N     1 
ATOM   779  C CA    . LYS B 2 41 ? -2.760  -11.469 110.618 1.00 62.23  ? 41  LYS B CA    1 
ATOM   780  C C     . LYS B 2 41 ? -2.123  -10.247 111.277 1.00 71.88  ? 41  LYS B C     1 
ATOM   781  O O     . LYS B 2 41 ? -0.906  -10.066 111.237 1.00 80.03  ? 41  LYS B O     1 
ATOM   782  C CB    . LYS B 2 41 ? -3.350  -11.094 109.258 1.00 57.98  ? 41  LYS B CB    1 
ATOM   783  N N     . CYS B 2 42 ? -2.960  -9.404  111.871 1.00 97.88  ? 42  CYS B N     1 
ATOM   784  C CA    . CYS B 2 42 ? -2.484  -8.344  112.749 1.00 97.21  ? 42  CYS B CA    1 
ATOM   785  C C     . CYS B 2 42 ? -2.175  -8.967  114.109 1.00 94.87  ? 42  CYS B C     1 
ATOM   786  O O     . CYS B 2 42 ? -2.769  -9.980  114.468 1.00 93.27  ? 42  CYS B O     1 
ATOM   787  C CB    . CYS B 2 42 ? -3.530  -7.235  112.891 1.00 91.70  ? 42  CYS B CB    1 
ATOM   788  S SG    . CYS B 2 42 ? -4.328  -6.732  111.336 1.00 96.02  ? 42  CYS B SG    1 
ATOM   789  N N     . GLY B 2 43 ? -1.256  -8.379  114.867 1.00 74.22  ? 43  GLY B N     1 
ATOM   790  C CA    . GLY B 2 43 ? -1.033  -8.829  116.230 1.00 74.27  ? 43  GLY B CA    1 
ATOM   791  C C     . GLY B 2 43 ? -1.965  -8.117  117.197 1.00 82.60  ? 43  GLY B C     1 
ATOM   792  O O     . GLY B 2 43 ? -1.536  -7.234  117.940 1.00 92.64  ? 43  GLY B O     1 
ATOM   793  N N     . ILE B 2 44 ? -3.243  -8.489  117.185 1.00 89.39  ? 44  ILE B N     1 
ATOM   794  C CA    . ILE B 2 44 ? -4.230  -7.848  118.054 1.00 89.17  ? 44  ILE B CA    1 
ATOM   795  C C     . ILE B 2 44 ? -5.414  -8.756  118.389 1.00 88.49  ? 44  ILE B C     1 
ATOM   796  O O     . ILE B 2 44 ? -5.585  -9.820  117.796 1.00 82.71  ? 44  ILE B O     1 
ATOM   797  C CB    . ILE B 2 44 ? -4.779  -6.552  117.421 1.00 75.92  ? 44  ILE B CB    1 
ATOM   798  N N     . THR B 2 45 ? -6.227  -8.322  119.349 1.00 85.38  ? 45  THR B N     1 
ATOM   799  C CA    . THR B 2 45 ? -7.448  -9.032  119.711 1.00 80.49  ? 45  THR B CA    1 
ATOM   800  C C     . THR B 2 45 ? -8.520  -8.741  118.662 1.00 81.32  ? 45  THR B C     1 
ATOM   801  O O     . THR B 2 45 ? -8.355  -7.838  117.842 1.00 88.31  ? 45  THR B O     1 
ATOM   802  C CB    . THR B 2 45 ? -7.955  -8.614  121.111 1.00 80.16  ? 45  THR B CB    1 
ATOM   803  O OG1   . THR B 2 45 ? -6.841  -8.284  121.949 1.00 82.51  ? 45  THR B OG1   1 
ATOM   804  C CG2   . THR B 2 45 ? -8.759  -9.736  121.761 1.00 82.30  ? 45  THR B CG2   1 
ATOM   805  N N     . VAL B 2 46 ? -9.608  -9.506  118.675 1.00 72.37  ? 46  VAL B N     1 
ATOM   806  C CA    . VAL B 2 46 ? -10.738 -9.228  117.793 1.00 76.88  ? 46  VAL B CA    1 
ATOM   807  C C     . VAL B 2 46 ? -11.465 -7.982  118.299 1.00 77.00  ? 46  VAL B C     1 
ATOM   808  O O     . VAL B 2 46 ? -12.004 -7.176  117.516 1.00 76.32  ? 46  VAL B O     1 
ATOM   809  C CB    . VAL B 2 46 ? -11.709 -10.434 117.705 1.00 81.33  ? 46  VAL B CB    1 
ATOM   810  C CG1   . VAL B 2 46 ? -10.982 -11.662 117.181 1.00 73.54  ? 46  VAL B CG1   1 
ATOM   811  C CG2   . VAL B 2 46 ? -12.336 -10.738 119.061 1.00 71.36  ? 46  VAL B CG2   1 
ATOM   812  N N     . SER B 2 47 ? -11.427 -7.816  119.620 1.00 92.19  ? 47  SER B N     1 
ATOM   813  C CA    . SER B 2 47 ? -12.034 -6.682  120.304 1.00 97.09  ? 47  SER B CA    1 
ATOM   814  C C     . SER B 2 47 ? -11.336 -5.379  119.939 1.00 91.57  ? 47  SER B C     1 
ATOM   815  O O     . SER B 2 47 ? -11.809 -4.296  120.279 1.00 88.83  ? 47  SER B O     1 
ATOM   816  C CB    . SER B 2 47 ? -11.991 -6.894  121.820 1.00 91.64  ? 47  SER B CB    1 
ATOM   817  O OG    . SER B 2 47 ? -10.654 -6.937  122.290 1.00 97.80  ? 47  SER B OG    1 
ATOM   818  N N     . GLN B 2 48 ? -10.207 -5.493  119.248 1.00 64.71  ? 48  GLN B N     1 
ATOM   819  C CA    . GLN B 2 48 ? -9.461  -4.328  118.797 1.00 69.29  ? 48  GLN B CA    1 
ATOM   820  C C     . GLN B 2 48 ? -9.762  -4.014  117.337 1.00 70.81  ? 48  GLN B C     1 
ATOM   821  O O     . GLN B 2 48 ? -9.833  -2.849  116.951 1.00 74.76  ? 48  GLN B O     1 
ATOM   822  C CB    . GLN B 2 48 ? -7.961  -4.545  118.992 1.00 70.21  ? 48  GLN B CB    1 
ATOM   823  C CG    . GLN B 2 48 ? -7.583  -4.981  120.395 1.00 67.86  ? 48  GLN B CG    1 
ATOM   824  C CD    . GLN B 2 48 ? -6.162  -4.603  120.751 1.00 72.96  ? 48  GLN B CD    1 
ATOM   825  O OE1   . GLN B 2 48 ? -5.562  -3.739  120.114 1.00 81.95  ? 48  GLN B OE1   1 
ATOM   826  N NE2   . GLN B 2 48 ? -5.614  -5.250  121.772 1.00 68.57  ? 48  GLN B NE2   1 
ATOM   827  N N     . VAL B 2 49 ? -9.933  -5.054  116.527 1.00 59.35  ? 49  VAL B N     1 
ATOM   828  C CA    . VAL B 2 49 ? -10.288 -4.871  115.125 1.00 63.89  ? 49  VAL B CA    1 
ATOM   829  C C     . VAL B 2 49 ? -11.679 -4.252  115.018 1.00 69.06  ? 49  VAL B C     1 
ATOM   830  O O     . VAL B 2 49 ? -11.890 -3.289  114.263 1.00 74.87  ? 49  VAL B O     1 
ATOM   831  C CB    . VAL B 2 49 ? -10.248 -6.201  114.346 1.00 69.89  ? 49  VAL B CB    1 
ATOM   832  C CG1   . VAL B 2 49 ? -10.594 -5.972  112.882 1.00 69.73  ? 49  VAL B CG1   1 
ATOM   833  C CG2   . VAL B 2 49 ? -8.879  -6.849  114.474 1.00 72.90  ? 49  VAL B CG2   1 
ATOM   834  N N     . SER B 2 50 ? -12.622 -4.792  115.789 1.00 76.59  ? 50  SER B N     1 
ATOM   835  C CA    . SER B 2 50 ? -13.981 -4.251  115.788 1.00 73.18  ? 50  SER B CA    1 
ATOM   836  C C     . SER B 2 50 ? -13.996 -2.791  116.253 1.00 71.22  ? 50  SER B C     1 
ATOM   837  O O     . SER B 2 50 ? -14.792 -1.976  115.770 1.00 76.36  ? 50  SER B O     1 
ATOM   838  C CB    . SER B 2 50 ? -14.903 -5.105  116.662 1.00 83.31  ? 50  SER B CB    1 
ATOM   839  O OG    . SER B 2 50 ? -14.243 -5.538  117.838 1.00 82.06  ? 50  SER B OG    1 
ATOM   840  N N     . ASN B 2 51 ? -13.102 -2.465  117.183 1.00 63.73  ? 51  ASN B N     1 
ATOM   841  C CA    . ASN B 2 51 ? -12.920 -1.086  117.622 1.00 59.84  ? 51  ASN B CA    1 
ATOM   842  C C     . ASN B 2 51 ? -12.402 -0.210  116.485 1.00 55.93  ? 51  ASN B C     1 
ATOM   843  O O     . ASN B 2 51 ? -12.912 0.894   116.243 1.00 65.66  ? 51  ASN B O     1 
ATOM   844  C CB    . ASN B 2 51 ? -11.953 -1.021  118.807 1.00 57.65  ? 51  ASN B CB    1 
ATOM   845  C CG    . ASN B 2 51 ? -12.616 -1.368  120.126 1.00 58.34  ? 51  ASN B CG    1 
ATOM   846  O OD1   . ASN B 2 51 ? -13.805 -1.117  120.322 1.00 54.90  ? 51  ASN B OD1   1 
ATOM   847  N ND2   . ASN B 2 51 ? -11.847 -1.950  121.039 1.00 54.01  ? 51  ASN B ND2   1 
ATOM   848  N N     . TRP B 2 52 ? -11.389 -0.718  115.787 1.00 53.37  ? 52  TRP B N     1 
ATOM   849  C CA    . TRP B 2 52 ? -10.766 0.002   114.685 1.00 57.89  ? 52  TRP B CA    1 
ATOM   850  C C     . TRP B 2 52 ? -11.776 0.338   113.602 1.00 51.39  ? 52  TRP B C     1 
ATOM   851  O O     . TRP B 2 52 ? -11.731 1.421   113.030 1.00 51.18  ? 52  TRP B O     1 
ATOM   852  C CB    . TRP B 2 52 ? -9.616  -0.807  114.080 1.00 56.10  ? 52  TRP B CB    1 
ATOM   853  C CG    . TRP B 2 52 ? -8.777  -0.001  113.128 1.00 61.27  ? 52  TRP B CG    1 
ATOM   854  C CD1   . TRP B 2 52 ? -7.683  0.754   113.438 1.00 59.88  ? 52  TRP B CD1   1 
ATOM   855  C CD2   . TRP B 2 52 ? -8.974  0.142   111.714 1.00 63.28  ? 52  TRP B CD2   1 
ATOM   856  N NE1   . TRP B 2 52 ? -7.183  1.351   112.306 1.00 58.94  ? 52  TRP B NE1   1 
ATOM   857  C CE2   . TRP B 2 52 ? -7.957  0.992   111.235 1.00 56.01  ? 52  TRP B CE2   1 
ATOM   858  C CE3   . TRP B 2 52 ? -9.908  -0.370  110.807 1.00 63.99  ? 52  TRP B CE3   1 
ATOM   859  C CZ2   . TRP B 2 52 ? -7.849  1.342   109.890 1.00 59.79  ? 52  TRP B CZ2   1 
ATOM   860  C CZ3   . TRP B 2 52 ? -9.798  -0.020  109.472 1.00 62.37  ? 52  TRP B CZ3   1 
ATOM   861  C CH2   . TRP B 2 52 ? -8.775  0.826   109.027 1.00 61.05  ? 52  TRP B CH2   1 
ATOM   862  N N     . PHE B 2 53 ? -12.686 -0.588  113.317 1.00 61.83  ? 53  PHE B N     1 
ATOM   863  C CA    . PHE B 2 53 ? -13.725 -0.309  112.330 1.00 61.13  ? 53  PHE B CA    1 
ATOM   864  C C     . PHE B 2 53 ? -14.768 0.650   112.894 1.00 60.81  ? 53  PHE B C     1 
ATOM   865  O O     . PHE B 2 53 ? -15.284 1.519   112.175 1.00 66.34  ? 53  PHE B O     1 
ATOM   866  C CB    . PHE B 2 53 ? -14.374 -1.606  111.855 1.00 60.14  ? 53  PHE B CB    1 
ATOM   867  C CG    . PHE B 2 53 ? -13.566 -2.326  110.821 1.00 64.13  ? 53  PHE B CG    1 
ATOM   868  C CD1   . PHE B 2 53 ? -13.827 -2.146  109.474 1.00 68.21  ? 53  PHE B CD1   1 
ATOM   869  C CD2   . PHE B 2 53 ? -12.524 -3.157  111.193 1.00 66.24  ? 53  PHE B CD2   1 
ATOM   870  C CE1   . PHE B 2 53 ? -13.076 -2.798  108.519 1.00 76.37  ? 53  PHE B CE1   1 
ATOM   871  C CE2   . PHE B 2 53 ? -11.770 -3.811  110.243 1.00 68.48  ? 53  PHE B CE2   1 
ATOM   872  C CZ    . PHE B 2 53 ? -12.045 -3.631  108.905 1.00 75.99  ? 53  PHE B CZ    1 
ATOM   873  N N     . GLY B 2 54 ? -15.058 0.495   114.185 1.00 52.71  ? 54  GLY B N     1 
ATOM   874  C CA    . GLY B 2 54 ? -15.958 1.394   114.883 1.00 48.97  ? 54  GLY B CA    1 
ATOM   875  C C     . GLY B 2 54 ? -15.541 2.848   114.757 1.00 50.21  ? 54  GLY B C     1 
ATOM   876  O O     . GLY B 2 54 ? -16.387 3.736   114.641 1.00 52.72  ? 54  GLY B O     1 
ATOM   877  N N     . ASN B 2 55 ? -14.233 3.092   114.770 1.00 53.75  ? 55  ASN B N     1 
ATOM   878  C CA    . ASN B 2 55 ? -13.711 4.450   114.615 1.00 45.12  ? 55  ASN B CA    1 
ATOM   879  C C     . ASN B 2 55 ? -13.517 4.856   113.153 1.00 50.20  ? 55  ASN B C     1 
ATOM   880  O O     . ASN B 2 55 ? -13.887 5.965   112.742 1.00 60.39  ? 55  ASN B O     1 
ATOM   881  C CB    . ASN B 2 55 ? -12.386 4.592   115.364 1.00 35.29  ? 55  ASN B CB    1 
ATOM   882  C CG    . ASN B 2 55 ? -12.568 4.632   116.868 1.00 39.36  ? 55  ASN B CG    1 
ATOM   883  O OD1   . ASN B 2 55 ? -13.405 5.373   117.383 1.00 49.41  ? 55  ASN B OD1   1 
ATOM   884  N ND2   . ASN B 2 55 ? -11.786 3.830   117.581 1.00 33.72  ? 55  ASN B ND2   1 
ATOM   885  N N     . LYS B 2 56 ? -12.938 3.950   112.371 1.00 51.55  ? 56  LYS B N     1 
ATOM   886  C CA    . LYS B 2 56 ? -12.590 4.244   110.986 1.00 56.95  ? 56  LYS B CA    1 
ATOM   887  C C     . LYS B 2 56 ? -13.818 4.526   110.132 1.00 65.67  ? 56  LYS B C     1 
ATOM   888  O O     . LYS B 2 56 ? -13.737 5.285   109.167 1.00 69.67  ? 56  LYS B O     1 
ATOM   889  C CB    . LYS B 2 56 ? -11.790 3.095   110.372 1.00 57.64  ? 56  LYS B CB    1 
ATOM   890  C CG    . LYS B 2 56 ? -11.092 3.471   109.074 1.00 63.23  ? 56  LYS B CG    1 
ATOM   891  C CD    . LYS B 2 56 ? -10.058 4.562   109.313 1.00 68.23  ? 56  LYS B CD    1 
ATOM   892  C CE    . LYS B 2 56 ? -9.571  5.169   108.007 1.00 65.94  ? 56  LYS B CE    1 
ATOM   893  N NZ    . LYS B 2 56 ? -9.072  6.560   108.201 1.00 69.34  ? 56  LYS B NZ    1 
ATOM   894  N N     . ARG B 2 57 ? -14.949 3.919   110.482 1.00 78.78  ? 57  ARG B N     1 
ATOM   895  C CA    . ARG B 2 57 ? -16.190 4.173   109.754 1.00 82.46  ? 57  ARG B CA    1 
ATOM   896  C C     . ARG B 2 57 ? -16.571 5.656   109.794 1.00 81.40  ? 57  ARG B C     1 
ATOM   897  O O     . ARG B 2 57 ? -16.620 6.334   108.758 1.00 82.09  ? 57  ARG B O     1 
ATOM   898  C CB    . ARG B 2 57 ? -17.329 3.325   110.324 1.00 77.56  ? 57  ARG B CB    1 
ATOM   899  N N     . ILE B 2 58 ? -16.825 6.157   110.999 1.00 75.04  ? 58  ILE B N     1 
ATOM   900  C CA    . ILE B 2 58 ? -17.256 7.538   111.173 1.00 75.33  ? 58  ILE B CA    1 
ATOM   901  C C     . ILE B 2 58 ? -16.159 8.530   110.785 1.00 79.71  ? 58  ILE B C     1 
ATOM   902  O O     . ILE B 2 58 ? -16.440 9.547   110.147 1.00 78.41  ? 58  ILE B O     1 
ATOM   903  C CB    . ILE B 2 58 ? -17.716 7.808   112.630 1.00 69.57  ? 58  ILE B CB    1 
ATOM   904  C CG1   . ILE B 2 58 ? -18.056 9.288   112.825 1.00 73.93  ? 58  ILE B CG1   1 
ATOM   905  C CG2   . ILE B 2 58 ? -16.665 7.354   113.633 1.00 55.24  ? 58  ILE B CG2   1 
ATOM   906  C CD1   . ILE B 2 58 ? -19.197 9.772   111.954 1.00 67.62  ? 58  ILE B CD1   1 
ATOM   907  N N     . ARG B 2 59 ? -14.911 8.234   111.145 1.00 70.73  ? 59  ARG B N     1 
ATOM   908  C CA    . ARG B 2 59 ? -13.824 9.156   110.828 1.00 68.22  ? 59  ARG B CA    1 
ATOM   909  C C     . ARG B 2 59 ? -13.557 9.198   109.327 1.00 69.89  ? 59  ARG B C     1 
ATOM   910  O O     . ARG B 2 59 ? -12.997 10.169  108.816 1.00 77.70  ? 59  ARG B O     1 
ATOM   911  C CB    . ARG B 2 59 ? -12.561 8.785   111.604 1.00 58.54  ? 59  ARG B CB    1 
ATOM   912  C CG    . ARG B 2 59 ? -12.662 9.168   113.072 1.00 52.62  ? 59  ARG B CG    1 
ATOM   913  C CD    . ARG B 2 59 ? -11.537 8.603   113.915 1.00 45.28  ? 59  ARG B CD    1 
ATOM   914  N NE    . ARG B 2 59 ? -11.740 8.918   115.327 1.00 38.14  ? 59  ARG B NE    1 
ATOM   915  C CZ    . ARG B 2 59 ? -11.074 8.348   116.325 1.00 48.35  ? 59  ARG B CZ    1 
ATOM   916  N NH1   . ARG B 2 59 ? -10.156 7.426   116.070 1.00 42.08  ? 59  ARG B NH1   1 
ATOM   917  N NH2   . ARG B 2 59 ? -11.329 8.696   117.579 1.00 44.42  ? 59  ARG B NH2   1 
ATOM   918  N N     . TYR B 2 60 ? -13.969 8.148   108.623 1.00 66.13  ? 60  TYR B N     1 
ATOM   919  C CA    . TYR B 2 60 ? -14.037 8.200   107.169 1.00 68.57  ? 60  TYR B CA    1 
ATOM   920  C C     . TYR B 2 60 ? -15.147 9.156   106.762 1.00 71.45  ? 60  TYR B C     1 
ATOM   921  O O     . TYR B 2 60 ? -14.916 10.131  106.046 1.00 77.50  ? 60  TYR B O     1 
ATOM   922  C CB    . TYR B 2 60 ? -14.289 6.811   106.572 1.00 66.16  ? 60  TYR B CB    1 
ATOM   923  C CG    . TYR B 2 60 ? -14.570 6.805   105.083 1.00 67.68  ? 60  TYR B CG    1 
ATOM   924  C CD1   . TYR B 2 60 ? -13.545 6.625   104.164 1.00 74.53  ? 60  TYR B CD1   1 
ATOM   925  C CD2   . TYR B 2 60 ? -15.864 6.966   104.596 1.00 73.20  ? 60  TYR B CD2   1 
ATOM   926  C CE1   . TYR B 2 60 ? -13.796 6.616   102.805 1.00 82.74  ? 60  TYR B CE1   1 
ATOM   927  C CE2   . TYR B 2 60 ? -16.124 6.962   103.240 1.00 77.97  ? 60  TYR B CE2   1 
ATOM   928  C CZ    . TYR B 2 60 ? -15.087 6.785   102.349 1.00 84.12  ? 60  TYR B CZ    1 
ATOM   929  O OH    . TYR B 2 60 ? -15.342 6.776   100.997 1.00 86.17  ? 60  TYR B OH    1 
ATOM   930  N N     . LYS B 2 61 ? -16.356 8.865   107.237 1.00 79.70  ? 61  LYS B N     1 
ATOM   931  C CA    . LYS B 2 61 ? -17.546 9.606   106.825 1.00 80.36  ? 61  LYS B CA    1 
ATOM   932  C C     . LYS B 2 61 ? -17.522 11.087  107.208 1.00 82.19  ? 61  LYS B C     1 
ATOM   933  O O     . LYS B 2 61 ? -18.281 11.884  106.654 1.00 81.26  ? 61  LYS B O     1 
ATOM   934  C CB    . LYS B 2 61 ? -18.796 8.953   107.417 1.00 71.70  ? 61  LYS B CB    1 
ATOM   935  N N     . LYS B 2 62 ? -16.660 11.457  108.152 1.00 78.51  ? 62  LYS B N     1 
ATOM   936  C CA    . LYS B 2 62 ? -16.566 12.848  108.585 1.00 85.35  ? 62  LYS B CA    1 
ATOM   937  C C     . LYS B 2 62 ? -15.551 13.628  107.756 1.00 90.80  ? 62  LYS B C     1 
ATOM   938  O O     . LYS B 2 62 ? -15.110 14.708  108.150 1.00 86.59  ? 62  LYS B O     1 
ATOM   939  C CB    . LYS B 2 62 ? -16.206 12.931  110.069 1.00 78.84  ? 62  LYS B CB    1 
ATOM   940  C CG    . LYS B 2 62 ? -17.415 13.039  110.984 1.00 69.51  ? 62  LYS B CG    1 
ATOM   941  C CD    . LYS B 2 62 ? -17.004 13.187  112.438 1.00 65.13  ? 62  LYS B CD    1 
ATOM   942  C CE    . LYS B 2 62 ? -18.154 13.716  113.279 1.00 65.58  ? 62  LYS B CE    1 
ATOM   943  N NZ    . LYS B 2 62 ? -18.561 15.088  112.862 1.00 85.86  ? 62  LYS B NZ    1 
ATOM   944  N N     . ASN B 2 63 ? -15.186 13.072  106.606 1.00 91.51  ? 63  ASN B N     1 
ATOM   945  C CA    . ASN B 2 63 ? -14.329 13.766  105.654 1.00 87.61  ? 63  ASN B CA    1 
ATOM   946  C C     . ASN B 2 63 ? -15.103 14.142  104.392 1.00 100.72 ? 63  ASN B C     1 
ATOM   947  O O     . ASN B 2 63 ? -16.230 13.693  104.187 1.00 96.52  ? 63  ASN B O     1 
ATOM   948  C CB    . ASN B 2 63 ? -13.113 12.907  105.299 1.00 86.45  ? 63  ASN B CB    1 
ATOM   949  N N     . ILE B 2 64 ? -14.483 14.960  103.548 1.00 145.72 ? 64  ILE B N     1 
ATOM   950  C CA    . ILE B 2 64 ? -15.143 15.523  102.367 1.00 139.77 ? 64  ILE B CA    1 
ATOM   951  C C     . ILE B 2 64 ? -15.059 14.780  101.007 1.00 147.75 ? 64  ILE B C     1 
ATOM   952  O O     . ILE B 2 64 ? -15.998 14.899  100.218 1.00 149.30 ? 64  ILE B O     1 
ATOM   953  C CB    . ILE B 2 64 ? -14.629 16.960  102.119 1.00 112.57 ? 64  ILE B CB    1 
ATOM   954  C CG1   . ILE B 2 64 ? -14.166 17.597  103.431 1.00 111.63 ? 64  ILE B CG1   1 
ATOM   955  C CG2   . ILE B 2 64 ? -15.701 17.813  101.452 1.00 113.97 ? 64  ILE B CG2   1 
ATOM   956  C CD1   . ILE B 2 64 ? -13.476 18.929  103.246 1.00 112.74 ? 64  ILE B CD1   1 
ATOM   957  N N     . GLY B 2 65 ? -13.995 14.032  100.689 1.00 112.39 ? 65  GLY B N     1 
ATOM   958  C CA    . GLY B 2 65 ? -12.878 13.693  101.556 1.00 111.37 ? 65  GLY B CA    1 
ATOM   959  C C     . GLY B 2 65 ? -11.708 14.653  101.530 1.00 112.13 ? 65  GLY B C     1 
ATOM   960  O O     . GLY B 2 65 ? -11.396 15.253  100.501 1.00 113.29 ? 65  GLY B O     1 
ATOM   961  N N     . LYS B 2 66 ? -11.052 14.789  102.679 1.00 104.08 ? 66  LYS B N     1 
ATOM   962  C CA    . LYS B 2 66 ? -9.882  15.652  102.799 1.00 107.26 ? 66  LYS B CA    1 
ATOM   963  C C     . LYS B 2 66 ? -8.736  14.959  103.540 1.00 103.46 ? 66  LYS B C     1 
ATOM   964  O O     . LYS B 2 66 ? -8.531  15.197  104.729 1.00 103.92 ? 66  LYS B O     1 
ATOM   965  C CB    . LYS B 2 66 ? -10.251 16.950  103.517 1.00 89.49  ? 66  LYS B CB    1 
ATOM   966  N N     . ALA B 2 67 ? -7.998  14.097  102.845 1.00 93.97  ? 67  ALA B N     1 
ATOM   967  C CA    . ALA B 2 67 ? -8.283  13.751  101.457 1.00 87.32  ? 67  ALA B CA    1 
ATOM   968  C C     . ALA B 2 67 ? -8.506  12.251  101.335 1.00 97.41  ? 67  ALA B C     1 
ATOM   969  O O     . ALA B 2 67 ? -7.674  11.545  100.770 1.00 100.28 ? 67  ALA B O     1 
ATOM   970  C CB    . ALA B 2 67 ? -7.148  14.190  100.549 1.00 80.78  ? 67  ALA B CB    1 
ATOM   971  N N     . GLN B 2 68 ? -9.624  11.759  101.862 1.00 99.00  ? 68  GLN B N     1 
ATOM   972  C CA    . GLN B 2 68 ? -9.866  10.317  101.869 1.00 94.13  ? 68  GLN B CA    1 
ATOM   973  C C     . GLN B 2 68 ? -10.201 9.786   100.473 1.00 96.84  ? 68  GLN B C     1 
ATOM   974  O O     . GLN B 2 68 ? -10.274 8.575   100.267 1.00 96.69  ? 68  GLN B O     1 
ATOM   975  C CB    . GLN B 2 68 ? -10.985 9.960   102.857 1.00 94.88  ? 68  GLN B CB    1 
ATOM   976  C CG    . GLN B 2 68 ? -10.609 8.906   103.901 1.00 92.46  ? 68  GLN B CG    1 
ATOM   977  C CD    . GLN B 2 68 ? -9.764  9.461   105.035 1.00 91.28  ? 68  GLN B CD    1 
ATOM   978  O OE1   . GLN B 2 68 ? -9.841  10.644  105.361 1.00 85.03  ? 68  GLN B OE1   1 
ATOM   979  N NE2   . GLN B 2 68 ? -8.965  8.599   105.654 1.00 93.13  ? 68  GLN B NE2   1 
ATOM   980  N N     . GLU B 2 69 ? -10.406 10.689  99.519  1.00 86.51  ? 69  GLU B N     1 
ATOM   981  C CA    . GLU B 2 69 ? -10.679 10.294  98.139  1.00 87.82  ? 69  GLU B CA    1 
ATOM   982  C C     . GLU B 2 69 ? -9.403  9.878   97.429  1.00 91.73  ? 69  GLU B C     1 
ATOM   983  O O     . GLU B 2 69 ? -9.442  9.150   96.440  1.00 94.41  ? 69  GLU B O     1 
ATOM   984  C CB    . GLU B 2 69 ? -11.347 11.436  97.370  1.00 80.68  ? 69  GLU B CB    1 
ATOM   985  N N     . GLU B 2 70 ? -8.270  10.353  97.935  1.00 101.49 ? 70  GLU B N     1 
ATOM   986  C CA    . GLU B 2 70 ? -6.982  10.047  97.326  1.00 103.26 ? 70  GLU B CA    1 
ATOM   987  C C     . GLU B 2 70 ? -6.436  8.711   97.819  1.00 109.02 ? 70  GLU B C     1 
ATOM   988  O O     . GLU B 2 70 ? -5.660  8.059   97.122  1.00 113.17 ? 70  GLU B O     1 
ATOM   989  C CB    . GLU B 2 70 ? -5.973  11.157  97.612  1.00 95.28  ? 70  GLU B CB    1 
ATOM   990  N N     . ALA B 2 71 ? -6.846  8.310   99.021  1.00 78.83  ? 71  ALA B N     1 
ATOM   991  C CA    . ALA B 2 71 ? -6.402  7.049   99.606  1.00 70.63  ? 71  ALA B CA    1 
ATOM   992  C C     . ALA B 2 71 ? -7.221  5.871   99.085  1.00 77.60  ? 71  ALA B C     1 
ATOM   993  O O     . ALA B 2 71 ? -7.949  5.228   99.843  1.00 77.55  ? 71  ALA B O     1 
ATOM   994  C CB    . ALA B 2 71 ? -6.479  7.115   101.126 1.00 58.45  ? 71  ALA B CB    1 
ATOM   995  N N     . ASN B 2 72 ? -7.110  5.601   97.787  1.00 115.87 ? 72  ASN B N     1 
ATOM   996  C CA    . ASN B 2 72 ? -7.684  4.393   97.203  1.00 114.76 ? 72  ASN B CA    1 
ATOM   997  C C     . ASN B 2 72 ? -6.679  3.702   96.295  1.00 117.31 ? 72  ASN B C     1 
ATOM   998  O O     . ASN B 2 72 ? -6.636  3.945   95.087  1.00 115.75 ? 72  ASN B O     1 
ATOM   999  C CB    . ASN B 2 72 ? -8.967  4.705   96.434  1.00 113.04 ? 72  ASN B CB    1 
ATOM   1000 C CG    . ASN B 2 72 ? -10.211 4.483   97.270  1.00 108.68 ? 72  ASN B CG    1 
ATOM   1001 O OD1   . ASN B 2 72 ? -10.156 3.853   98.325  1.00 100.96 ? 72  ASN B OD1   1 
ATOM   1002 N ND2   . ASN B 2 72 ? -11.343 4.993   96.798  1.00 109.44 ? 72  ASN B ND2   1 
ATOM   1003 N N     . LEU B 2 73 ? -5.862  2.847   96.898  1.00 112.00 ? 73  LEU B N     1 
ATOM   1004 C CA    . LEU B 2 73 ? -4.886  2.059   96.165  1.00 103.90 ? 73  LEU B CA    1 
ATOM   1005 C C     . LEU B 2 73 ? -5.477  0.683   95.894  1.00 105.01 ? 73  LEU B C     1 
ATOM   1006 O O     . LEU B 2 73 ? -4.846  -0.172  95.271  1.00 107.32 ? 73  LEU B O     1 
ATOM   1007 C CB    . LEU B 2 73 ? -3.583  1.949   96.956  1.00 94.35  ? 73  LEU B CB    1 
ATOM   1008 C CG    . LEU B 2 73 ? -3.168  3.252   97.646  1.00 90.10  ? 73  LEU B CG    1 
ATOM   1009 C CD1   . LEU B 2 73 ? -2.058  3.015   98.660  1.00 93.52  ? 73  LEU B CD1   1 
ATOM   1010 C CD2   . LEU B 2 73 ? -2.756  4.301   96.622  1.00 89.57  ? 73  LEU B CD2   1 
ATOM   1011 N N     . TYR B 2 74 ? -6.701  0.486   96.373  1.00 75.59  ? 74  TYR B N     1 
ATOM   1012 C CA    . TYR B 2 74 ? -7.417  -0.769  96.192  1.00 65.85  ? 74  TYR B CA    1 
ATOM   1013 C C     . TYR B 2 74 ? -7.715  -1.030  94.719  1.00 70.07  ? 74  TYR B C     1 
ATOM   1014 O O     . TYR B 2 74 ? -8.332  -0.206  94.045  1.00 77.10  ? 74  TYR B O     1 
ATOM   1015 C CB    . TYR B 2 74 ? -8.719  -0.759  96.997  1.00 60.20  ? 74  TYR B CB    1 
ATOM   1016 O "O5'" . DG  C 3 1  ? -33.428 -8.641  132.056 1.00 50.68  ? 1   DG  C "O5'" 1 
ATOM   1017 C "C5'" . DG  C 3 1  ? -32.788 -8.145  130.885 1.00 34.13  ? 1   DG  C "C5'" 1 
ATOM   1018 C "C4'" . DG  C 3 1  ? -32.588 -9.253  129.866 1.00 38.16  ? 1   DG  C "C4'" 1 
ATOM   1019 O "O4'" . DG  C 3 1  ? -33.706 -9.271  128.954 1.00 45.58  ? 1   DG  C "O4'" 1 
ATOM   1020 C "C3'" . DG  C 3 1  ? -31.360 -9.094  128.990 1.00 47.36  ? 1   DG  C "C3'" 1 
ATOM   1021 O "O3'" . DG  C 3 1  ? -30.245 -9.717  129.620 1.00 49.60  ? 1   DG  C "O3'" 1 
ATOM   1022 C "C2'" . DG  C 3 1  ? -31.753 -9.823  127.703 1.00 41.38  ? 1   DG  C "C2'" 1 
ATOM   1023 C "C1'" . DG  C 3 1  ? -33.281 -9.692  127.672 1.00 39.70  ? 1   DG  C "C1'" 1 
ATOM   1024 N N9    . DG  C 3 1  ? -33.784 -8.736  126.685 1.00 42.29  ? 1   DG  C N9    1 
ATOM   1025 C C8    . DG  C 3 1  ? -34.482 -7.581  126.941 1.00 40.22  ? 1   DG  C C8    1 
ATOM   1026 N N7    . DG  C 3 1  ? -34.820 -6.927  125.867 1.00 39.57  ? 1   DG  C N7    1 
ATOM   1027 C C5    . DG  C 3 1  ? -34.319 -7.697  124.826 1.00 41.94  ? 1   DG  C C5    1 
ATOM   1028 C C6    . DG  C 3 1  ? -34.380 -7.487  123.428 1.00 42.45  ? 1   DG  C C6    1 
ATOM   1029 O O6    . DG  C 3 1  ? -34.907 -6.547  122.818 1.00 40.13  ? 1   DG  C O6    1 
ATOM   1030 N N1    . DG  C 3 1  ? -33.747 -8.509  122.722 1.00 39.72  ? 1   DG  C N1    1 
ATOM   1031 C C2    . DG  C 3 1  ? -33.132 -9.596  123.300 1.00 40.88  ? 1   DG  C C2    1 
ATOM   1032 N N2    . DG  C 3 1  ? -32.574 -10.478 122.460 1.00 46.47  ? 1   DG  C N2    1 
ATOM   1033 N N3    . DG  C 3 1  ? -33.068 -9.806  124.612 1.00 38.45  ? 1   DG  C N3    1 
ATOM   1034 C C4    . DG  C 3 1  ? -33.681 -8.818  125.311 1.00 42.26  ? 1   DG  C C4    1 
ATOM   1035 P P     . DT  C 3 2  ? -28.773 -9.083  129.491 1.00 43.21  ? 2   DT  C P     1 
ATOM   1036 O OP1   . DT  C 3 2  ? -27.952 -9.647  130.586 1.00 29.55  ? 2   DT  C OP1   1 
ATOM   1037 O OP2   . DT  C 3 2  ? -28.911 -7.615  129.364 1.00 31.46  ? 2   DT  C OP2   1 
ATOM   1038 O "O5'" . DT  C 3 2  ? -28.223 -9.682  128.115 1.00 32.52  ? 2   DT  C "O5'" 1 
ATOM   1039 C "C5'" . DT  C 3 2  ? -28.188 -11.088 127.924 1.00 27.52  ? 2   DT  C "C5'" 1 
ATOM   1040 C "C4'" . DT  C 3 2  ? -27.966 -11.431 126.463 1.00 32.69  ? 2   DT  C "C4'" 1 
ATOM   1041 O "O4'" . DT  C 3 2  ? -28.979 -10.778 125.653 1.00 36.41  ? 2   DT  C "O4'" 1 
ATOM   1042 C "C3'" . DT  C 3 2  ? -26.618 -10.991 125.891 1.00 31.77  ? 2   DT  C "C3'" 1 
ATOM   1043 O "O3'" . DT  C 3 2  ? -26.111 -11.997 125.026 1.00 43.42  ? 2   DT  C "O3'" 1 
ATOM   1044 C "C2'" . DT  C 3 2  ? -26.968 -9.718  125.125 1.00 34.14  ? 2   DT  C "C2'" 1 
ATOM   1045 C "C1'" . DT  C 3 2  ? -28.358 -10.055 124.615 1.00 34.30  ? 2   DT  C "C1'" 1 
ATOM   1046 N N1    . DT  C 3 2  ? -29.193 -8.859  124.306 1.00 29.56  ? 2   DT  C N1    1 
ATOM   1047 C C2    . DT  C 3 2  ? -29.428 -8.525  122.992 1.00 35.43  ? 2   DT  C C2    1 
ATOM   1048 O O2    . DT  C 3 2  ? -28.979 -9.158  122.052 1.00 41.08  ? 2   DT  C O2    1 
ATOM   1049 N N3    . DT  C 3 2  ? -30.210 -7.415  122.814 1.00 31.05  ? 2   DT  C N3    1 
ATOM   1050 C C4    . DT  C 3 2  ? -30.772 -6.623  123.798 1.00 34.55  ? 2   DT  C C4    1 
ATOM   1051 O O4    . DT  C 3 2  ? -31.462 -5.643  123.536 1.00 33.47  ? 2   DT  C O4    1 
ATOM   1052 C C5    . DT  C 3 2  ? -30.488 -7.030  125.155 1.00 31.26  ? 2   DT  C C5    1 
ATOM   1053 C C7    . DT  C 3 2  ? -31.043 -6.248  126.309 1.00 31.04  ? 2   DT  C C7    1 
ATOM   1054 C C6    . DT  C 3 2  ? -29.722 -8.116  125.341 1.00 27.62  ? 2   DT  C C6    1 
ATOM   1055 P P     . DC  C 3 3  ? -24.549 -12.035 124.653 1.00 54.48  ? 3   DC  C P     1 
ATOM   1056 O OP1   . DC  C 3 3  ? -24.229 -13.408 124.205 1.00 53.89  ? 3   DC  C OP1   1 
ATOM   1057 O OP2   . DC  C 3 3  ? -23.800 -11.428 125.776 1.00 42.37  ? 3   DC  C OP2   1 
ATOM   1058 O "O5'" . DC  C 3 3  ? -24.430 -11.050 123.401 1.00 43.46  ? 3   DC  C "O5'" 1 
ATOM   1059 C "C5'" . DC  C 3 3  ? -25.162 -11.322 122.215 1.00 45.76  ? 3   DC  C "C5'" 1 
ATOM   1060 C "C4'" . DC  C 3 3  ? -24.932 -10.237 121.182 1.00 52.67  ? 3   DC  C "C4'" 1 
ATOM   1061 O "O4'" . DC  C 3 3  ? -25.936 -9.196  121.327 1.00 54.11  ? 3   DC  C "O4'" 1 
ATOM   1062 C "C3'" . DC  C 3 3  ? -23.575 -9.529  121.275 1.00 49.82  ? 3   DC  C "C3'" 1 
ATOM   1063 O "O3'" . DC  C 3 3  ? -23.054 -9.336  119.972 1.00 54.76  ? 3   DC  C "O3'" 1 
ATOM   1064 C "C2'" . DC  C 3 3  ? -23.934 -8.196  121.928 1.00 43.29  ? 3   DC  C "C2'" 1 
ATOM   1065 C "C1'" . DC  C 3 3  ? -25.289 -7.947  121.298 1.00 46.66  ? 3   DC  C "C1'" 1 
ATOM   1066 N N1    . DC  C 3 3  ? -26.127 -6.947  122.014 1.00 36.66  ? 3   DC  C N1    1 
ATOM   1067 C C2    . DC  C 3 3  ? -26.999 -6.148  121.278 1.00 40.38  ? 3   DC  C C2    1 
ATOM   1068 O O2    . DC  C 3 3  ? -27.053 -6.302  120.055 1.00 39.65  ? 3   DC  C O2    1 
ATOM   1069 N N3    . DC  C 3 3  ? -27.763 -5.233  121.924 1.00 39.46  ? 3   DC  C N3    1 
ATOM   1070 C C4    . DC  C 3 3  ? -27.670 -5.106  123.249 1.00 32.92  ? 3   DC  C C4    1 
ATOM   1071 N N4    . DC  C 3 3  ? -28.442 -4.191  123.845 1.00 32.99  ? 3   DC  C N4    1 
ATOM   1072 C C5    . DC  C 3 3  ? -26.779 -5.914  124.021 1.00 28.86  ? 3   DC  C C5    1 
ATOM   1073 C C6    . DC  C 3 3  ? -26.032 -6.812  123.367 1.00 31.40  ? 3   DC  C C6    1 
ATOM   1074 P P     . DA  C 3 4  ? -21.472 -9.191  119.738 1.00 62.35  ? 4   DA  C P     1 
ATOM   1075 O OP1   . DA  C 3 4  ? -20.963 -10.528 119.357 1.00 57.71  ? 4   DA  C OP1   1 
ATOM   1076 O OP2   . DA  C 3 4  ? -20.894 -8.485  120.904 1.00 55.88  ? 4   DA  C OP2   1 
ATOM   1077 O "O5'" . DA  C 3 4  ? -21.371 -8.222  118.469 1.00 58.51  ? 4   DA  C "O5'" 1 
ATOM   1078 C "C5'" . DA  C 3 4  ? -22.000 -8.595  117.251 1.00 51.03  ? 4   DA  C "C5'" 1 
ATOM   1079 C "C4'" . DA  C 3 4  ? -22.666 -7.401  116.588 1.00 54.24  ? 4   DA  C "C4'" 1 
ATOM   1080 O "O4'" . DA  C 3 4  ? -23.540 -6.732  117.537 1.00 57.86  ? 4   DA  C "O4'" 1 
ATOM   1081 C "C3'" . DA  C 3 4  ? -21.709 -6.329  116.058 1.00 55.84  ? 4   DA  C "C3'" 1 
ATOM   1082 O "O3'" . DA  C 3 4  ? -22.081 -5.973  114.735 1.00 58.30  ? 4   DA  C "O3'" 1 
ATOM   1083 C "C2'" . DA  C 3 4  ? -21.901 -5.163  117.030 1.00 50.43  ? 4   DA  C "C2'" 1 
ATOM   1084 C "C1'" . DA  C 3 4  ? -23.356 -5.340  117.431 1.00 46.68  ? 4   DA  C "C1'" 1 
ATOM   1085 N N9    . DA  C 3 4  ? -23.687 -4.727  118.717 1.00 42.48  ? 4   DA  C N9    1 
ATOM   1086 C C8    . DA  C 3 4  ? -23.110 -4.995  119.926 1.00 41.77  ? 4   DA  C C8    1 
ATOM   1087 N N7    . DA  C 3 4  ? -23.606 -4.295  120.917 1.00 34.19  ? 4   DA  C N7    1 
ATOM   1088 C C5    . DA  C 3 4  ? -24.579 -3.511  120.319 1.00 38.31  ? 4   DA  C C5    1 
ATOM   1089 C C6    . DA  C 3 4  ? -25.468 -2.548  120.837 1.00 42.49  ? 4   DA  C C6    1 
ATOM   1090 N N6    . DA  C 3 4  ? -25.504 -2.212  122.129 1.00 41.04  ? 4   DA  C N6    1 
ATOM   1091 N N1    . DA  C 3 4  ? -26.317 -1.942  119.973 1.00 42.53  ? 4   DA  C N1    1 
ATOM   1092 C C2    . DA  C 3 4  ? -26.266 -2.290  118.679 1.00 40.99  ? 4   DA  C C2    1 
ATOM   1093 N N3    . DA  C 3 4  ? -25.473 -3.183  118.077 1.00 41.03  ? 4   DA  C N3    1 
ATOM   1094 C C4    . DA  C 3 4  ? -24.645 -3.762  118.963 1.00 39.26  ? 4   DA  C C4    1 
ATOM   1095 P P     . DT  C 3 5  ? -21.104 -5.076  113.830 1.00 58.64  ? 5   DT  C P     1 
ATOM   1096 O OP1   . DT  C 3 5  ? -21.337 -5.452  112.417 1.00 66.12  ? 5   DT  C OP1   1 
ATOM   1097 O OP2   . DT  C 3 5  ? -19.742 -5.167  114.401 1.00 59.34  ? 5   DT  C OP2   1 
ATOM   1098 O "O5'" . DT  C 3 5  ? -21.629 -3.586  114.072 1.00 61.76  ? 5   DT  C "O5'" 1 
ATOM   1099 C "C5'" . DT  C 3 5  ? -23.025 -3.332  114.154 1.00 63.73  ? 5   DT  C "C5'" 1 
ATOM   1100 C "C4'" . DT  C 3 5  ? -23.285 -1.868  114.449 1.00 60.37  ? 5   DT  C "C4'" 1 
ATOM   1101 O "O4'" . DT  C 3 5  ? -23.626 -1.699  115.851 1.00 63.90  ? 5   DT  C "O4'" 1 
ATOM   1102 C "C3'" . DT  C 3 5  ? -22.095 -0.938  114.182 1.00 62.39  ? 5   DT  C "C3'" 1 
ATOM   1103 O "O3'" . DT  C 3 5  ? -22.523 0.181   113.418 1.00 64.28  ? 5   DT  C "O3'" 1 
ATOM   1104 C "C2'" . DT  C 3 5  ? -21.646 -0.527  115.585 1.00 56.21  ? 5   DT  C "C2'" 1 
ATOM   1105 C "C1'" . DT  C 3 5  ? -22.958 -0.565  116.342 1.00 52.37  ? 5   DT  C "C1'" 1 
ATOM   1106 N N1    . DT  C 3 5  ? -22.794 -0.697  117.820 1.00 47.75  ? 5   DT  C N1    1 
ATOM   1107 C C2    . DT  C 3 5  ? -23.649 -0.016  118.654 1.00 47.32  ? 5   DT  C C2    1 
ATOM   1108 O O2    . DT  C 3 5  ? -24.554 0.692   118.248 1.00 54.30  ? 5   DT  C O2    1 
ATOM   1109 N N3    . DT  C 3 5  ? -23.412 -0.198  119.990 1.00 44.89  ? 5   DT  C N3    1 
ATOM   1110 C C4    . DT  C 3 5  ? -22.422 -0.973  120.566 1.00 45.78  ? 5   DT  C C4    1 
ATOM   1111 O O4    . DT  C 3 5  ? -22.289 -1.072  121.782 1.00 43.74  ? 5   DT  C O4    1 
ATOM   1112 C C5    . DT  C 3 5  ? -21.555 -1.657  119.635 1.00 41.70  ? 5   DT  C C5    1 
ATOM   1113 C C7    . DT  C 3 5  ? -20.444 -2.528  120.142 1.00 35.71  ? 5   DT  C C7    1 
ATOM   1114 C C6    . DT  C 3 5  ? -21.778 -1.486  118.322 1.00 43.02  ? 5   DT  C C6    1 
ATOM   1115 P P     . DT  C 3 6  ? -21.458 1.224   112.816 1.00 60.82  ? 6   DT  C P     1 
ATOM   1116 O OP1   . DT  C 3 6  ? -21.643 1.249   111.352 1.00 65.94  ? 6   DT  C OP1   1 
ATOM   1117 O OP2   . DT  C 3 6  ? -20.116 0.941   113.372 1.00 67.96  ? 6   DT  C OP2   1 
ATOM   1118 O "O5'" . DT  C 3 6  ? -21.955 2.626   113.392 1.00 47.53  ? 6   DT  C "O5'" 1 
ATOM   1119 C "C5'" . DT  C 3 6  ? -23.305 3.020   113.201 1.00 50.78  ? 6   DT  C "C5'" 1 
ATOM   1120 C "C4'" . DT  C 3 6  ? -23.708 4.067   114.218 1.00 51.36  ? 6   DT  C "C4'" 1 
ATOM   1121 O "O4'" . DT  C 3 6  ? -23.554 3.525   115.554 1.00 52.15  ? 6   DT  C "O4'" 1 
ATOM   1122 C "C3'" . DT  C 3 6  ? -22.882 5.353   114.172 1.00 51.65  ? 6   DT  C "C3'" 1 
ATOM   1123 O "O3'" . DT  C 3 6  ? -23.743 6.481   114.165 1.00 60.89  ? 6   DT  C "O3'" 1 
ATOM   1124 C "C2'" . DT  C 3 6  ? -22.032 5.291   115.443 1.00 49.68  ? 6   DT  C "C2'" 1 
ATOM   1125 C "C1'" . DT  C 3 6  ? -22.907 4.467   116.373 1.00 48.65  ? 6   DT  C "C1'" 1 
ATOM   1126 N N1    . DT  C 3 6  ? -22.137 3.730   117.421 1.00 51.16  ? 6   DT  C N1    1 
ATOM   1127 C C2    . DT  C 3 6  ? -22.462 3.909   118.746 1.00 49.17  ? 6   DT  C C2    1 
ATOM   1128 O O2    . DT  C 3 6  ? -23.357 4.646   119.121 1.00 45.83  ? 6   DT  C O2    1 
ATOM   1129 N N3    . DT  C 3 6  ? -21.699 3.187   119.625 1.00 44.51  ? 6   DT  C N3    1 
ATOM   1130 C C4    . DT  C 3 6  ? -20.665 2.322   119.319 1.00 50.40  ? 6   DT  C C4    1 
ATOM   1131 O O4    . DT  C 3 6  ? -20.036 1.720   120.184 1.00 52.13  ? 6   DT  C O4    1 
ATOM   1132 C C5    . DT  C 3 6  ? -20.373 2.181   117.913 1.00 46.63  ? 6   DT  C C5    1 
ATOM   1133 C C7    . DT  C 3 6  ? -19.268 1.272   117.462 1.00 49.42  ? 6   DT  C C7    1 
ATOM   1134 C C6    . DT  C 3 6  ? -21.115 2.883   117.041 1.00 43.64  ? 6   DT  C C6    1 
ATOM   1135 P P     . DA  C 3 7  ? -23.326 7.811   113.367 1.00 61.87  ? 7   DA  C P     1 
ATOM   1136 O OP1   . DA  C 3 7  ? -24.548 8.354   112.734 1.00 66.59  ? 7   DA  C OP1   1 
ATOM   1137 O OP2   . DA  C 3 7  ? -22.147 7.491   112.532 1.00 59.84  ? 7   DA  C OP2   1 
ATOM   1138 O "O5'" . DA  C 3 7  ? -22.860 8.810   114.523 1.00 52.07  ? 7   DA  C "O5'" 1 
ATOM   1139 C "C5'" . DA  C 3 7  ? -23.780 9.184   115.534 1.00 53.62  ? 7   DA  C "C5'" 1 
ATOM   1140 C "C4'" . DA  C 3 7  ? -23.063 9.723   116.757 1.00 54.09  ? 7   DA  C "C4'" 1 
ATOM   1141 O "O4'" . DA  C 3 7  ? -22.501 8.627   117.531 1.00 53.03  ? 7   DA  C "O4'" 1 
ATOM   1142 C "C3'" . DA  C 3 7  ? -21.896 10.677  116.473 1.00 55.92  ? 7   DA  C "C3'" 1 
ATOM   1143 O "O3'" . DA  C 3 7  ? -21.958 11.759  117.380 1.00 56.50  ? 7   DA  C "O3'" 1 
ATOM   1144 C "C2'" . DA  C 3 7  ? -20.674 9.802   116.748 1.00 57.47  ? 7   DA  C "C2'" 1 
ATOM   1145 C "C1'" . DA  C 3 7  ? -21.194 8.980   117.908 1.00 53.81  ? 7   DA  C "C1'" 1 
ATOM   1146 N N9    . DA  C 3 7  ? -20.428 7.768   118.178 1.00 48.32  ? 7   DA  C N9    1 
ATOM   1147 C C8    . DA  C 3 7  ? -19.743 7.000   117.279 1.00 50.06  ? 7   DA  C C8    1 
ATOM   1148 N N7    . DA  C 3 7  ? -19.144 5.963   117.818 1.00 48.41  ? 7   DA  C N7    1 
ATOM   1149 C C5    . DA  C 3 7  ? -19.456 6.061   119.164 1.00 49.52  ? 7   DA  C C5    1 
ATOM   1150 C C6    . DA  C 3 7  ? -19.124 5.265   120.280 1.00 49.04  ? 7   DA  C C6    1 
ATOM   1151 N N6    . DA  C 3 7  ? -18.367 4.166   120.202 1.00 45.81  ? 7   DA  C N6    1 
ATOM   1152 N N1    . DA  C 3 7  ? -19.600 5.646   121.484 1.00 45.91  ? 7   DA  C N1    1 
ATOM   1153 C C2    . DA  C 3 7  ? -20.356 6.747   121.560 1.00 44.43  ? 7   DA  C C2    1 
ATOM   1154 N N3    . DA  C 3 7  ? -20.734 7.573   120.586 1.00 50.01  ? 7   DA  C N3    1 
ATOM   1155 C C4    . DA  C 3 7  ? -20.246 7.169   119.402 1.00 49.07  ? 7   DA  C C4    1 
ATOM   1156 P P     . DA  C 3 8  ? -21.163 13.126  117.102 1.00 60.71  ? 8   DA  C P     1 
ATOM   1157 O OP1   . DA  C 3 8  ? -22.123 14.080  116.505 1.00 54.25  ? 8   DA  C OP1   1 
ATOM   1158 O OP2   . DA  C 3 8  ? -19.904 12.816  116.389 1.00 58.13  ? 8   DA  C OP2   1 
ATOM   1159 O "O5'" . DA  C 3 8  ? -20.778 13.621  118.571 1.00 55.86  ? 8   DA  C "O5'" 1 
ATOM   1160 C "C5'" . DA  C 3 8  ? -21.709 13.455  119.632 1.00 49.60  ? 8   DA  C "C5'" 1 
ATOM   1161 C "C4'" . DA  C 3 8  ? -21.017 12.995  120.904 1.00 51.92  ? 8   DA  C "C4'" 1 
ATOM   1162 O "O4'" . DA  C 3 8  ? -20.500 11.650  120.730 1.00 58.38  ? 8   DA  C "O4'" 1 
ATOM   1163 C "C3'" . DA  C 3 8  ? -19.824 13.854  121.346 1.00 55.59  ? 8   DA  C "C3'" 1 
ATOM   1164 O "O3'" . DA  C 3 8  ? -20.010 14.282  122.687 1.00 56.02  ? 8   DA  C "O3'" 1 
ATOM   1165 C "C2'" . DA  C 3 8  ? -18.623 12.910  121.223 1.00 55.30  ? 8   DA  C "C2'" 1 
ATOM   1166 C "C1'" . DA  C 3 8  ? -19.282 11.558  121.421 1.00 51.58  ? 8   DA  C "C1'" 1 
ATOM   1167 N N9    . DA  C 3 8  ? -18.508 10.436  120.890 1.00 49.33  ? 8   DA  C N9    1 
ATOM   1168 C C8    . DA  C 3 8  ? -18.105 10.245  119.598 1.00 50.63  ? 8   DA  C C8    1 
ATOM   1169 N N7    . DA  C 3 8  ? -17.416 9.141   119.415 1.00 53.51  ? 8   DA  C N7    1 
ATOM   1170 C C5    . DA  C 3 8  ? -17.364 8.569   120.676 1.00 52.40  ? 8   DA  C C5    1 
ATOM   1171 C C6    . DA  C 3 8  ? -16.774 7.380   121.160 1.00 47.48  ? 8   DA  C C6    1 
ATOM   1172 N N6    . DA  C 3 8  ? -16.099 6.521   120.388 1.00 50.05  ? 8   DA  C N6    1 
ATOM   1173 N N1    . DA  C 3 8  ? -16.909 7.107   122.474 1.00 41.78  ? 8   DA  C N1    1 
ATOM   1174 C C2    . DA  C 3 8  ? -17.585 7.965   123.246 1.00 45.86  ? 8   DA  C C2    1 
ATOM   1175 N N3    . DA  C 3 8  ? -18.180 9.108   122.908 1.00 44.94  ? 8   DA  C N3    1 
ATOM   1176 C C4    . DA  C 3 8  ? -18.030 9.355   121.597 1.00 51.20  ? 8   DA  C C4    1 
ATOM   1177 P P     . DT  C 3 9  ? -19.019 15.369  123.332 1.00 53.80  ? 9   DT  C P     1 
ATOM   1178 O OP1   . DT  C 3 9  ? -19.794 16.150  124.320 1.00 52.58  ? 9   DT  C OP1   1 
ATOM   1179 O OP2   . DT  C 3 9  ? -18.327 16.064  122.224 1.00 63.69  ? 9   DT  C OP2   1 
ATOM   1180 O "O5'" . DT  C 3 9  ? -17.935 14.489  124.113 1.00 58.56  ? 9   DT  C "O5'" 1 
ATOM   1181 C "C5'" . DT  C 3 9  ? -18.198 14.051  125.442 1.00 57.71  ? 9   DT  C "C5'" 1 
ATOM   1182 C "C4'" . DT  C 3 9  ? -17.054 13.202  125.965 1.00 50.50  ? 9   DT  C "C4'" 1 
ATOM   1183 O "O4'" . DT  C 3 9  ? -16.951 12.006  125.170 1.00 50.62  ? 9   DT  C "O4'" 1 
ATOM   1184 C "C3'" . DT  C 3 9  ? -15.680 13.843  125.856 1.00 49.28  ? 9   DT  C "C3'" 1 
ATOM   1185 O "O3'" . DT  C 3 9  ? -15.377 14.688  127.013 1.00 63.21  ? 9   DT  C "O3'" 1 
ATOM   1186 C "C2'" . DT  C 3 9  ? -14.733 12.648  125.736 1.00 48.48  ? 9   DT  C "C2'" 1 
ATOM   1187 C "C1'" . DT  C 3 9  ? -15.634 11.503  125.263 1.00 54.90  ? 9   DT  C "C1'" 1 
ATOM   1188 N N1    . DT  C 3 9  ? -15.231 10.948  123.940 1.00 50.38  ? 9   DT  C N1    1 
ATOM   1189 C C2    . DT  C 3 9  ? -14.801 9.644   123.862 1.00 51.01  ? 9   DT  C C2    1 
ATOM   1190 O O2    . DT  C 3 9  ? -14.744 8.901   124.827 1.00 48.75  ? 9   DT  C O2    1 
ATOM   1191 N N3    . DT  C 3 9  ? -14.448 9.232   122.605 1.00 46.35  ? 9   DT  C N3    1 
ATOM   1192 C C4    . DT  C 3 9  ? -14.472 9.981   121.443 1.00 50.60  ? 9   DT  C C4    1 
ATOM   1193 O O4    . DT  C 3 9  ? -14.133 9.520   120.358 1.00 59.23  ? 9   DT  C O4    1 
ATOM   1194 C C5    . DT  C 3 9  ? -14.926 11.343  121.596 1.00 38.31  ? 9   DT  C C5    1 
ATOM   1195 C C7    . DT  C 3 9  ? -14.996 12.253  120.405 1.00 39.57  ? 9   DT  C C7    1 
ATOM   1196 C C6    . DT  C 3 9  ? -15.276 11.757  122.823 1.00 42.33  ? 9   DT  C C6    1 
ATOM   1197 P P     . DC  C 3 10 ? -15.295 14.127  128.528 1.00 45.41  ? 10  DC  C P     1 
ATOM   1198 O OP1   . DC  C 3 10 ? -16.575 13.500  128.921 1.00 53.51  ? 10  DC  C OP1   1 
ATOM   1199 O OP2   . DC  C 3 10 ? -14.783 15.257  129.333 1.00 67.99  ? 10  DC  C OP2   1 
ATOM   1200 O "O5'" . DC  C 3 10 ? -14.130 13.027  128.525 1.00 46.66  ? 10  DC  C "O5'" 1 
ATOM   1201 C "C5'" . DC  C 3 10 ? -14.264 11.859  129.330 1.00 53.26  ? 10  DC  C "C5'" 1 
ATOM   1202 C "C4'" . DC  C 3 10 ? -13.109 10.893  129.112 1.00 38.49  ? 10  DC  C "C4'" 1 
ATOM   1203 O "O4'" . DC  C 3 10 ? -12.967 10.585  127.705 1.00 46.78  ? 10  DC  C "O4'" 1 
ATOM   1204 C "C3'" . DC  C 3 10 ? -11.730 11.390  129.577 1.00 55.63  ? 10  DC  C "C3'" 1 
ATOM   1205 O "O3'" . DC  C 3 10 ? -11.203 10.495  130.551 1.00 62.33  ? 10  DC  C "O3'" 1 
ATOM   1206 C "C2'" . DC  C 3 10 ? -10.884 11.388  128.293 1.00 48.66  ? 10  DC  C "C2'" 1 
ATOM   1207 C "C1'" . DC  C 3 10 ? -11.606 10.346  127.459 1.00 47.20  ? 10  DC  C "C1'" 1 
ATOM   1208 N N1    . DC  C 3 10 ? -11.349 10.440  125.988 1.00 45.31  ? 10  DC  C N1    1 
ATOM   1209 C C2    . DC  C 3 10 ? -10.804 9.343   125.314 1.00 46.47  ? 10  DC  C C2    1 
ATOM   1210 O O2    . DC  C 3 10 ? -10.541 8.315   125.949 1.00 45.33  ? 10  DC  C O2    1 
ATOM   1211 N N3    . DC  C 3 10 ? -10.581 9.437   123.981 1.00 43.48  ? 10  DC  C N3    1 
ATOM   1212 C C4    . DC  C 3 10 ? -10.879 10.561  123.329 1.00 48.16  ? 10  DC  C C4    1 
ATOM   1213 N N4    . DC  C 3 10 ? -10.639 10.604  122.013 1.00 49.66  ? 10  DC  C N4    1 
ATOM   1214 C C5    . DC  C 3 10 ? -11.435 11.690  123.999 1.00 45.67  ? 10  DC  C C5    1 
ATOM   1215 C C6    . DC  C 3 10 ? -11.646 11.586  125.316 1.00 45.73  ? 10  DC  C C6    1 
ATOM   1216 P P     . DA  C 3 11 ? -9.985  10.946  131.498 1.00 68.03  ? 11  DA  C P     1 
ATOM   1217 O OP1   . DA  C 3 11 ? -10.156 10.259  132.798 1.00 64.85  ? 11  DA  C OP1   1 
ATOM   1218 O OP2   . DA  C 3 11 ? -9.894  12.422  131.449 1.00 66.34  ? 11  DA  C OP2   1 
ATOM   1219 O "O5'" . DA  C 3 11 ? -8.692  10.346  130.773 1.00 57.61  ? 11  DA  C "O5'" 1 
ATOM   1220 C "C5'" . DA  C 3 11 ? -8.542  8.937   130.642 1.00 53.62  ? 11  DA  C "C5'" 1 
ATOM   1221 C "C4'" . DA  C 3 11 ? -7.486  8.602   129.606 1.00 50.18  ? 11  DA  C "C4'" 1 
ATOM   1222 O "O4'" . DA  C 3 11 ? -7.932  9.049   128.315 1.00 57.35  ? 11  DA  C "O4'" 1 
ATOM   1223 C "C3'" . DA  C 3 11 ? -6.134  9.270   129.835 1.00 63.29  ? 11  DA  C "C3'" 1 
ATOM   1224 O "O3'" . DA  C 3 11 ? -5.224  8.321   130.382 1.00 70.52  ? 11  DA  C "O3'" 1 
ATOM   1225 C "C2'" . DA  C 3 11 ? -5.688  9.755   128.440 1.00 62.41  ? 11  DA  C "C2'" 1 
ATOM   1226 C "C1'" . DA  C 3 11 ? -6.818  9.314   127.507 1.00 48.39  ? 11  DA  C "C1'" 1 
ATOM   1227 N N9    . DA  C 3 11 ? -7.208  10.331  126.532 1.00 49.07  ? 11  DA  C N9    1 
ATOM   1228 C C8    . DA  C 3 11 ? -7.761  11.552  126.798 1.00 47.76  ? 11  DA  C C8    1 
ATOM   1229 N N7    . DA  C 3 11 ? -8.025  12.259  125.725 1.00 45.88  ? 11  DA  C N7    1 
ATOM   1230 C C5    . DA  C 3 11 ? -7.623  11.443  124.681 1.00 43.63  ? 11  DA  C C5    1 
ATOM   1231 C C6    . DA  C 3 11 ? -7.639  11.614  123.283 1.00 47.48  ? 11  DA  C C6    1 
ATOM   1232 N N6    . DA  C 3 11 ? -8.097  12.718  122.682 1.00 52.84  ? 11  DA  C N6    1 
ATOM   1233 N N1    . DA  C 3 11 ? -7.164  10.605  122.524 1.00 43.76  ? 11  DA  C N1    1 
ATOM   1234 C C2    . DA  C 3 11 ? -6.706  9.502   123.130 1.00 46.51  ? 11  DA  C C2    1 
ATOM   1235 N N3    . DA  C 3 11 ? -6.640  9.227   124.433 1.00 44.76  ? 11  DA  C N3    1 
ATOM   1236 C C4    . DA  C 3 11 ? -7.119  10.248  125.161 1.00 46.24  ? 11  DA  C C4    1 
ATOM   1237 P P     . DT  C 3 12 ? -3.731  8.753   130.788 1.00 74.47  ? 12  DT  C P     1 
ATOM   1238 O OP1   . DT  C 3 12 ? -3.310  7.887   131.912 1.00 70.69  ? 12  DT  C OP1   1 
ATOM   1239 O OP2   . DT  C 3 12 ? -3.697  10.225  130.939 1.00 74.51  ? 12  DT  C OP2   1 
ATOM   1240 O "O5'" . DT  C 3 12 ? -2.872  8.370   129.498 1.00 56.65  ? 12  DT  C "O5'" 1 
ATOM   1241 C "C5'" . DT  C 3 12 ? -3.113  7.136   128.838 1.00 57.35  ? 12  DT  C "C5'" 1 
ATOM   1242 C "C4'" . DT  C 3 12 ? -2.380  7.080   127.513 1.00 57.76  ? 12  DT  C "C4'" 1 
ATOM   1243 O "O4'" . DT  C 3 12 ? -3.106  7.846   126.511 1.00 60.35  ? 12  DT  C "O4'" 1 
ATOM   1244 C "C3'" . DT  C 3 12 ? -0.959  7.653   127.536 1.00 61.35  ? 12  DT  C "C3'" 1 
ATOM   1245 O "O3'" . DT  C 3 12 ? -0.082  6.770   126.855 1.00 60.70  ? 12  DT  C "O3'" 1 
ATOM   1246 C "C2'" . DT  C 3 12 ? -1.111  8.977   126.789 1.00 64.99  ? 12  DT  C "C2'" 1 
ATOM   1247 C "C1'" . DT  C 3 12 ? -2.180  8.610   125.781 1.00 53.01  ? 12  DT  C "C1'" 1 
ATOM   1248 N N1    . DT  C 3 12 ? -2.875  9.786   125.175 1.00 48.48  ? 12  DT  C N1    1 
ATOM   1249 C C2    . DT  C 3 12 ? -2.974  9.870   123.806 1.00 50.94  ? 12  DT  C C2    1 
ATOM   1250 O O2    . DT  C 3 12 ? -2.527  9.024   123.053 1.00 49.83  ? 12  DT  C O2    1 
ATOM   1251 N N3    . DT  C 3 12 ? -3.623  10.983  123.344 1.00 46.37  ? 12  DT  C N3    1 
ATOM   1252 C C4    . DT  C 3 12 ? -4.169  12.004  124.098 1.00 47.21  ? 12  DT  C C4    1 
ATOM   1253 O O4    . DT  C 3 12 ? -4.735  12.967  123.586 1.00 40.54  ? 12  DT  C O4    1 
ATOM   1254 C C5    . DT  C 3 12 ? -4.027  11.859  125.529 1.00 48.26  ? 12  DT  C C5    1 
ATOM   1255 C C7    . DT  C 3 12 ? -4.579  12.905  126.451 1.00 47.14  ? 12  DT  C C7    1 
ATOM   1256 C C6    . DT  C 3 12 ? -3.392  10.770  125.993 1.00 42.51  ? 12  DT  C C6    1 
ATOM   1257 P P     . DG  C 3 13 ? 1.511   6.955   126.951 1.00 67.37  ? 13  DG  C P     1 
ATOM   1258 O OP1   . DG  C 3 13 ? 2.054   5.759   127.629 1.00 65.93  ? 13  DG  C OP1   1 
ATOM   1259 O OP2   . DG  C 3 13 ? 1.815   8.300   127.488 1.00 69.46  ? 13  DG  C OP2   1 
ATOM   1260 O "O5'" . DG  C 3 13 ? 1.976   6.938   125.424 1.00 55.96  ? 13  DG  C "O5'" 1 
ATOM   1261 C "C5'" . DG  C 3 13 ? 1.297   6.114   124.487 1.00 49.59  ? 13  DG  C "C5'" 1 
ATOM   1262 C "C4'" . DG  C 3 13 ? 1.500   6.626   123.073 1.00 59.34  ? 13  DG  C "C4'" 1 
ATOM   1263 O "O4'" . DG  C 3 13 ? 0.619   7.756   122.832 1.00 64.17  ? 13  DG  C "O4'" 1 
ATOM   1264 C "C3'" . DG  C 3 13 ? 2.911   7.117   122.764 1.00 65.91  ? 13  DG  C "C3'" 1 
ATOM   1265 O "O3'" . DG  C 3 13 ? 3.259   6.770   121.432 1.00 67.78  ? 13  DG  C "O3'" 1 
ATOM   1266 C "C2'" . DG  C 3 13 ? 2.793   8.630   122.942 1.00 62.24  ? 13  DG  C "C2'" 1 
ATOM   1267 C "C1'" . DG  C 3 13 ? 1.378   8.883   122.444 1.00 53.36  ? 13  DG  C "C1'" 1 
ATOM   1268 N N9    . DG  C 3 13 ? 0.757   10.072  123.021 1.00 53.01  ? 13  DG  C N9    1 
ATOM   1269 C C8    . DG  C 3 13 ? 0.612   10.365  124.354 1.00 54.01  ? 13  DG  C C8    1 
ATOM   1270 N N7    . DG  C 3 13 ? 0.006   11.499  124.575 1.00 48.91  ? 13  DG  C N7    1 
ATOM   1271 C C5    . DG  C 3 13 ? -0.270  11.991  123.306 1.00 42.35  ? 13  DG  C C5    1 
ATOM   1272 C C6    . DG  C 3 13 ? -0.914  13.189  122.911 1.00 44.61  ? 13  DG  C C6    1 
ATOM   1273 O O6    . DG  C 3 13 ? -1.384  14.081  123.631 1.00 52.49  ? 13  DG  C O6    1 
ATOM   1274 N N1    . DG  C 3 13 ? -0.988  13.300  121.522 1.00 43.21  ? 13  DG  C N1    1 
ATOM   1275 C C2    . DG  C 3 13 ? -0.497  12.370  120.635 1.00 45.91  ? 13  DG  C C2    1 
ATOM   1276 N N2    . DG  C 3 13 ? -0.657  12.645  119.336 1.00 41.06  ? 13  DG  C N2    1 
ATOM   1277 N N3    . DG  C 3 13 ? 0.107   11.246  120.994 1.00 51.74  ? 13  DG  C N3    1 
ATOM   1278 C C4    . DG  C 3 13 ? 0.186   11.123  122.338 1.00 53.71  ? 13  DG  C C4    1 
ATOM   1279 P P     . DC  C 3 14 ? 4.773   6.376   121.066 1.00 66.23  ? 14  DC  C P     1 
ATOM   1280 O OP1   . DC  C 3 14 ? 4.757   5.028   120.455 1.00 65.44  ? 14  DC  C OP1   1 
ATOM   1281 O OP2   . DC  C 3 14 ? 5.605   6.635   122.263 1.00 58.64  ? 14  DC  C OP2   1 
ATOM   1282 O "O5'" . DC  C 3 14 ? 5.179   7.448   119.954 1.00 66.40  ? 14  DC  C "O5'" 1 
ATOM   1283 C "C5'" . DC  C 3 14 ? 5.043   8.829   120.237 1.00 69.44  ? 14  DC  C "C5'" 1 
ATOM   1284 C "C4'" . DC  C 3 14 ? 4.922   9.640   118.965 1.00 70.75  ? 14  DC  C "C4'" 1 
ATOM   1285 O "O4'" . DC  C 3 14 ? 3.880   10.628  119.134 1.00 65.75  ? 14  DC  C "O4'" 1 
ATOM   1286 C "C3'" . DC  C 3 14 ? 6.157   10.443  118.611 1.00 67.45  ? 14  DC  C "C3'" 1 
ATOM   1287 O "O3'" . DC  C 3 14 ? 6.145   10.769  117.229 1.00 69.11  ? 14  DC  C "O3'" 1 
ATOM   1288 C "C2'" . DC  C 3 14 ? 5.978   11.683  119.479 1.00 66.93  ? 14  DC  C "C2'" 1 
ATOM   1289 C "C1'" . DC  C 3 14 ? 4.460   11.885  119.437 1.00 60.79  ? 14  DC  C "C1'" 1 
ATOM   1290 N N1    . DC  C 3 14 ? 3.888   12.371  120.727 1.00 54.83  ? 14  DC  C N1    1 
ATOM   1291 C C2    . DC  C 3 14 ? 2.885   13.345  120.714 1.00 52.26  ? 14  DC  C C2    1 
ATOM   1292 O O2    . DC  C 3 14 ? 2.488   13.786  119.629 1.00 50.77  ? 14  DC  C O2    1 
ATOM   1293 N N3    . DC  C 3 14 ? 2.374   13.779  121.893 1.00 46.46  ? 14  DC  C N3    1 
ATOM   1294 C C4    . DC  C 3 14 ? 2.829   13.278  123.043 1.00 53.75  ? 14  DC  C C4    1 
ATOM   1295 N N4    . DC  C 3 14 ? 2.295   13.736  124.180 1.00 46.82  ? 14  DC  C N4    1 
ATOM   1296 C C5    . DC  C 3 14 ? 3.852   12.284  123.077 1.00 52.08  ? 14  DC  C C5    1 
ATOM   1297 C C6    . DC  C 3 14 ? 4.348   11.865  121.907 1.00 50.64  ? 14  DC  C C6    1 
ATOM   1298 O "O5'" . DG  D 4 1  ? 1.020   22.456  115.559 1.00 96.97  ? 1   DG  D "O5'" 1 
ATOM   1299 C "C5'" . DG  D 4 1  ? 0.762   21.995  116.882 1.00 99.78  ? 1   DG  D "C5'" 1 
ATOM   1300 C "C4'" . DG  D 4 1  ? -0.420  21.041  116.899 1.00 106.74 ? 1   DG  D "C4'" 1 
ATOM   1301 O "O4'" . DG  D 4 1  ? -0.272  20.097  117.997 1.00 99.16  ? 1   DG  D "O4'" 1 
ATOM   1302 C "C3'" . DG  D 4 1  ? -1.787  21.698  117.105 1.00 103.30 ? 1   DG  D "C3'" 1 
ATOM   1303 O "O3'" . DG  D 4 1  ? -2.772  20.987  116.359 1.00 103.05 ? 1   DG  D "O3'" 1 
ATOM   1304 C "C2'" . DG  D 4 1  ? -2.001  21.521  118.602 1.00 98.09  ? 1   DG  D "C2'" 1 
ATOM   1305 C "C1'" . DG  D 4 1  ? -1.446  20.122  118.777 1.00 95.07  ? 1   DG  D "C1'" 1 
ATOM   1306 N N9    . DG  D 4 1  ? -1.112  19.776  120.154 1.00 87.60  ? 1   DG  D N9    1 
ATOM   1307 C C8    . DG  D 4 1  ? -1.370  20.513  121.284 1.00 93.31  ? 1   DG  D C8    1 
ATOM   1308 N N7    . DG  D 4 1  ? -0.960  19.939  122.382 1.00 85.87  ? 1   DG  D N7    1 
ATOM   1309 C C5    . DG  D 4 1  ? -0.399  18.743  121.950 1.00 70.92  ? 1   DG  D C5    1 
ATOM   1310 C C6    . DG  D 4 1  ? 0.210   17.700  122.688 1.00 73.96  ? 1   DG  D C6    1 
ATOM   1311 O O6    . DG  D 4 1  ? 0.381   17.624  123.913 1.00 80.64  ? 1   DG  D O6    1 
ATOM   1312 N N1    . DG  D 4 1  ? 0.644   16.668  121.859 1.00 65.83  ? 1   DG  D N1    1 
ATOM   1313 C C2    . DG  D 4 1  ? 0.506   16.649  120.491 1.00 69.09  ? 1   DG  D C2    1 
ATOM   1314 N N2    . DG  D 4 1  ? 0.985   15.571  119.859 1.00 62.49  ? 1   DG  D N2    1 
ATOM   1315 N N3    . DG  D 4 1  ? -0.062  17.618  119.790 1.00 72.55  ? 1   DG  D N3    1 
ATOM   1316 C C4    . DG  D 4 1  ? -0.489  18.629  120.582 1.00 69.15  ? 1   DG  D C4    1 
ATOM   1317 P P     . DC  D 4 2  ? -4.261  21.570  116.196 1.00 94.99  ? 2   DC  D P     1 
ATOM   1318 O OP1   . DC  D 4 2  ? -4.172  22.802  115.382 1.00 99.92  ? 2   DC  D OP1   1 
ATOM   1319 O OP2   . DC  D 4 2  ? -4.902  21.611  117.529 1.00 83.82  ? 2   DC  D OP2   1 
ATOM   1320 O "O5'" . DC  D 4 2  ? -5.009  20.459  115.323 1.00 77.55  ? 2   DC  D "O5'" 1 
ATOM   1321 C "C5'" . DC  D 4 2  ? -5.273  19.177  115.882 1.00 78.74  ? 2   DC  D "C5'" 1 
ATOM   1322 C "C4'" . DC  D 4 2  ? -4.476  18.098  115.171 1.00 71.78  ? 2   DC  D "C4'" 1 
ATOM   1323 O "O4'" . DC  D 4 2  ? -3.439  17.607  116.060 1.00 78.65  ? 2   DC  D "O4'" 1 
ATOM   1324 C "C3'" . DC  D 4 2  ? -5.280  16.866  114.787 1.00 74.87  ? 2   DC  D "C3'" 1 
ATOM   1325 O "O3'" . DC  D 4 2  ? -4.660  16.200  113.693 1.00 78.72  ? 2   DC  D "O3'" 1 
ATOM   1326 C "C2'" . DC  D 4 2  ? -5.197  16.038  116.058 1.00 72.17  ? 2   DC  D "C2'" 1 
ATOM   1327 C "C1'" . DC  D 4 2  ? -3.752  16.289  116.476 1.00 65.59  ? 2   DC  D "C1'" 1 
ATOM   1328 N N1    . DC  D 4 2  ? -3.533  16.191  117.946 1.00 59.27  ? 2   DC  D N1    1 
ATOM   1329 C C2    . DC  D 4 2  ? -2.637  15.244  118.448 1.00 63.24  ? 2   DC  D C2    1 
ATOM   1330 O O2    . DC  D 4 2  ? -2.042  14.507  117.654 1.00 61.96  ? 2   DC  D O2    1 
ATOM   1331 N N3    . DC  D 4 2  ? -2.445  15.162  119.791 1.00 58.89  ? 2   DC  D N3    1 
ATOM   1332 C C4    . DC  D 4 2  ? -3.112  15.983  120.608 1.00 60.85  ? 2   DC  D C4    1 
ATOM   1333 N N4    . DC  D 4 2  ? -2.895  15.872  121.923 1.00 54.70  ? 2   DC  D N4    1 
ATOM   1334 C C5    . DC  D 4 2  ? -4.032  16.955  120.112 1.00 56.36  ? 2   DC  D C5    1 
ATOM   1335 C C6    . DC  D 4 2  ? -4.209  17.022  118.788 1.00 57.36  ? 2   DC  D C6    1 
ATOM   1336 P P     . DA  D 4 3  ? -5.515  15.207  112.761 1.00 75.63  ? 3   DA  D P     1 
ATOM   1337 O OP1   . DA  D 4 3  ? -5.199  15.538  111.354 1.00 89.52  ? 3   DA  D OP1   1 
ATOM   1338 O OP2   . DA  D 4 3  ? -6.918  15.245  113.232 1.00 60.71  ? 3   DA  D OP2   1 
ATOM   1339 O "O5'" . DA  D 4 3  ? -4.927  13.757  113.096 1.00 68.92  ? 3   DA  D "O5'" 1 
ATOM   1340 C "C5'" . DA  D 4 3  ? -3.607  13.412  112.686 1.00 64.01  ? 3   DA  D "C5'" 1 
ATOM   1341 C "C4'" . DA  D 4 3  ? -3.161  12.104  113.319 1.00 73.03  ? 3   DA  D "C4'" 1 
ATOM   1342 O "O4'" . DA  D 4 3  ? -3.109  12.252  114.763 1.00 73.81  ? 3   DA  D "O4'" 1 
ATOM   1343 C "C3'" . DA  D 4 3  ? -4.068  10.904  113.051 1.00 70.64  ? 3   DA  D "C3'" 1 
ATOM   1344 O "O3'" . DA  D 4 3  ? -3.279  9.734   112.875 1.00 76.58  ? 3   DA  D "O3'" 1 
ATOM   1345 C "C2'" . DA  D 4 3  ? -4.914  10.825  114.319 1.00 64.83  ? 3   DA  D "C2'" 1 
ATOM   1346 C "C1'" . DA  D 4 3  ? -3.916  11.270  115.377 1.00 62.14  ? 3   DA  D "C1'" 1 
ATOM   1347 N N9    . DA  D 4 3  ? -4.541  11.864  116.555 1.00 54.23  ? 3   DA  D N9    1 
ATOM   1348 C C8    . DA  D 4 3  ? -5.549  12.785  116.574 1.00 58.80  ? 3   DA  D C8    1 
ATOM   1349 N N7    . DA  D 4 3  ? -5.913  13.150  117.780 1.00 59.51  ? 3   DA  D N7    1 
ATOM   1350 C C5    . DA  D 4 3  ? -5.085  12.416  118.613 1.00 52.32  ? 3   DA  D C5    1 
ATOM   1351 C C6    . DA  D 4 3  ? -4.969  12.347  120.016 1.00 47.05  ? 3   DA  D C6    1 
ATOM   1352 N N6    . DA  D 4 3  ? -5.726  13.061  120.855 1.00 55.79  ? 3   DA  D N6    1 
ATOM   1353 N N1    . DA  D 4 3  ? -4.040  11.511  120.525 1.00 47.31  ? 3   DA  D N1    1 
ATOM   1354 C C2    . DA  D 4 3  ? -3.284  10.797  119.682 1.00 53.49  ? 3   DA  D C2    1 
ATOM   1355 N N3    . DA  D 4 3  ? -3.300  10.779  118.350 1.00 56.57  ? 3   DA  D N3    1 
ATOM   1356 C C4    . DA  D 4 3  ? -4.232  11.618  117.874 1.00 54.64  ? 3   DA  D C4    1 
ATOM   1357 P P     . DT  D 4 4  ? -3.975  8.327   112.530 1.00 83.47  ? 4   DT  D P     1 
ATOM   1358 O OP1   . DT  D 4 4  ? -2.963  7.490   111.848 1.00 76.80  ? 4   DT  D OP1   1 
ATOM   1359 O OP2   . DT  D 4 4  ? -5.266  8.609   111.863 1.00 57.01  ? 4   DT  D OP2   1 
ATOM   1360 O "O5'" . DT  D 4 4  ? -4.288  7.693   113.965 1.00 57.16  ? 4   DT  D "O5'" 1 
ATOM   1361 C "C5'" . DT  D 4 4  ? -3.256  7.609   114.941 1.00 55.60  ? 4   DT  D "C5'" 1 
ATOM   1362 C "C4'" . DT  D 4 4  ? -3.745  6.894   116.188 1.00 60.11  ? 4   DT  D "C4'" 1 
ATOM   1363 O "O4'" . DT  D 4 4  ? -4.296  7.856   117.126 1.00 59.20  ? 4   DT  D "O4'" 1 
ATOM   1364 C "C3'" . DT  D 4 4  ? -4.844  5.851   115.952 1.00 64.21  ? 4   DT  D "C3'" 1 
ATOM   1365 O "O3'" . DT  D 4 4  ? -4.520  4.651   116.637 1.00 65.28  ? 4   DT  D "O3'" 1 
ATOM   1366 C "C2'" . DT  D 4 4  ? -6.090  6.511   116.546 1.00 51.54  ? 4   DT  D "C2'" 1 
ATOM   1367 C "C1'" . DT  D 4 4  ? -5.474  7.319   117.673 1.00 47.97  ? 4   DT  D "C1'" 1 
ATOM   1368 N N1    . DT  D 4 4  ? -6.333  8.435   118.165 1.00 44.72  ? 4   DT  D N1    1 
ATOM   1369 C C2    . DT  D 4 4  ? -6.385  8.692   119.516 1.00 46.85  ? 4   DT  D C2    1 
ATOM   1370 O O2    . DT  D 4 4  ? -5.756  8.054   120.341 1.00 44.69  ? 4   DT  D O2    1 
ATOM   1371 N N3    . DT  D 4 4  ? -7.200  9.732   119.870 1.00 41.68  ? 4   DT  D N3    1 
ATOM   1372 C C4    . DT  D 4 4  ? -7.957  10.524  119.028 1.00 41.22  ? 4   DT  D C4    1 
ATOM   1373 O O4    . DT  D 4 4  ? -8.661  11.438  119.445 1.00 45.32  ? 4   DT  D O4    1 
ATOM   1374 C C5    . DT  D 4 4  ? -7.861  10.200  117.624 1.00 41.07  ? 4   DT  D C5    1 
ATOM   1375 C C7    . DT  D 4 4  ? -8.637  10.990  116.613 1.00 44.32  ? 4   DT  D C7    1 
ATOM   1376 C C6    . DT  D 4 4  ? -7.063  9.182   117.264 1.00 42.72  ? 4   DT  D C6    1 
ATOM   1377 P P     . DG  D 4 5  ? -4.948  3.227   116.029 1.00 63.91  ? 5   DG  D P     1 
ATOM   1378 O OP1   . DG  D 4 5  ? -3.738  2.608   115.445 1.00 76.12  ? 5   DG  D OP1   1 
ATOM   1379 O OP2   . DG  D 4 5  ? -6.148  3.438   115.189 1.00 75.70  ? 5   DG  D OP2   1 
ATOM   1380 O "O5'" . DG  D 4 5  ? -5.391  2.385   117.314 1.00 61.32  ? 5   DG  D "O5'" 1 
ATOM   1381 C "C5'" . DG  D 4 5  ? -4.506  2.258   118.419 1.00 58.43  ? 5   DG  D "C5'" 1 
ATOM   1382 C "C4'" . DG  D 4 5  ? -5.275  2.283   119.727 1.00 52.87  ? 5   DG  D "C4'" 1 
ATOM   1383 O "O4'" . DG  D 4 5  ? -5.854  3.598   119.922 1.00 50.93  ? 5   DG  D "O4'" 1 
ATOM   1384 C "C3'" . DG  D 4 5  ? -6.430  1.280   119.817 1.00 49.61  ? 5   DG  D "C3'" 1 
ATOM   1385 O "O3'" . DG  D 4 5  ? -6.295  0.486   120.994 1.00 48.47  ? 5   DG  D "O3'" 1 
ATOM   1386 C "C2'" . DG  D 4 5  ? -7.687  2.158   119.858 1.00 46.58  ? 5   DG  D "C2'" 1 
ATOM   1387 C "C1'" . DG  D 4 5  ? -7.157  3.460   120.432 1.00 52.37  ? 5   DG  D "C1'" 1 
ATOM   1388 N N9    . DG  D 4 5  ? -7.936  4.628   120.029 1.00 44.90  ? 5   DG  D N9    1 
ATOM   1389 C C8    . DG  D 4 5  ? -8.311  4.972   118.752 1.00 45.95  ? 5   DG  D C8    1 
ATOM   1390 N N7    . DG  D 4 5  ? -9.006  6.075   118.694 1.00 41.43  ? 5   DG  D N7    1 
ATOM   1391 C C5    . DG  D 4 5  ? -9.100  6.488   120.016 1.00 38.37  ? 5   DG  D C5    1 
ATOM   1392 C C6    . DG  D 4 5  ? -9.738  7.621   120.576 1.00 38.70  ? 5   DG  D C6    1 
ATOM   1393 O O6    . DG  D 4 5  ? -10.369 8.517   119.995 1.00 37.70  ? 5   DG  D O6    1 
ATOM   1394 N N1    . DG  D 4 5  ? -9.591  7.662   121.958 1.00 32.90  ? 5   DG  D N1    1 
ATOM   1395 C C2    . DG  D 4 5  ? -8.916  6.729   122.707 1.00 41.07  ? 5   DG  D C2    1 
ATOM   1396 N N2    . DG  D 4 5  ? -8.882  6.941   124.030 1.00 36.51  ? 5   DG  D N2    1 
ATOM   1397 N N3    . DG  D 4 5  ? -8.314  5.663   122.197 1.00 35.98  ? 5   DG  D N3    1 
ATOM   1398 C C4    . DG  D 4 5  ? -8.446  5.607   120.851 1.00 37.23  ? 5   DG  D C4    1 
ATOM   1399 P P     . DA  D 4 6  ? -7.415  -0.600  121.385 1.00 54.24  ? 6   DA  D P     1 
ATOM   1400 O OP1   . DA  D 4 6  ? -6.714  -1.735  122.023 1.00 53.90  ? 6   DA  D OP1   1 
ATOM   1401 O OP2   . DA  D 4 6  ? -8.281  -0.853  120.210 1.00 46.38  ? 6   DA  D OP2   1 
ATOM   1402 O "O5'" . DA  D 4 6  ? -8.279  0.141   122.507 1.00 50.08  ? 6   DA  D "O5'" 1 
ATOM   1403 C "C5'" . DA  D 4 6  ? -7.640  0.598   123.692 1.00 45.02  ? 6   DA  D "C5'" 1 
ATOM   1404 C "C4'" . DA  D 4 6  ? -8.619  1.311   124.607 1.00 44.57  ? 6   DA  D "C4'" 1 
ATOM   1405 O "O4'" . DA  D 4 6  ? -9.118  2.509   123.954 1.00 49.41  ? 6   DA  D "O4'" 1 
ATOM   1406 C "C3'" . DA  D 4 6  ? -9.853  0.499   125.003 1.00 44.88  ? 6   DA  D "C3'" 1 
ATOM   1407 O "O3'" . DA  D 4 6  ? -10.161 0.749   126.363 1.00 39.85  ? 6   DA  D "O3'" 1 
ATOM   1408 C "C2'" . DA  D 4 6  ? -10.935 1.049   124.077 1.00 35.98  ? 6   DA  D "C2'" 1 
ATOM   1409 C "C1'" . DA  D 4 6  ? -10.527 2.511   123.986 1.00 37.69  ? 6   DA  D "C1'" 1 
ATOM   1410 N N9    . DA  D 4 6  ? -11.013 3.185   122.787 1.00 37.34  ? 6   DA  D N9    1 
ATOM   1411 C C8    . DA  D 4 6  ? -10.956 2.724   121.501 1.00 40.87  ? 6   DA  D C8    1 
ATOM   1412 N N7    . DA  D 4 6  ? -11.467 3.552   120.619 1.00 38.30  ? 6   DA  D N7    1 
ATOM   1413 C C5    . DA  D 4 6  ? -11.884 4.632   121.380 1.00 33.06  ? 6   DA  D C5    1 
ATOM   1414 C C6    . DA  D 4 6  ? -12.509 5.847   121.040 1.00 34.88  ? 6   DA  D C6    1 
ATOM   1415 N N6    . DA  D 4 6  ? -12.832 6.183   119.787 1.00 36.58  ? 6   DA  D N6    1 
ATOM   1416 N N1    . DA  D 4 6  ? -12.789 6.708   122.041 1.00 37.53  ? 6   DA  D N1    1 
ATOM   1417 C C2    . DA  D 4 6  ? -12.464 6.368   123.294 1.00 37.74  ? 6   DA  D C2    1 
ATOM   1418 N N3    . DA  D 4 6  ? -11.876 5.257   123.735 1.00 41.92  ? 6   DA  D N3    1 
ATOM   1419 C C4    . DA  D 4 6  ? -11.610 4.423   122.718 1.00 34.73  ? 6   DA  D C4    1 
ATOM   1420 P P     . DT  D 4 7  ? -10.980 -0.326  127.230 1.00 47.56  ? 7   DT  D P     1 
ATOM   1421 O OP1   . DT  D 4 7  ? -10.077 -0.804  128.302 1.00 52.35  ? 7   DT  D OP1   1 
ATOM   1422 O OP2   . DT  D 4 7  ? -11.603 -1.299  126.305 1.00 40.32  ? 7   DT  D OP2   1 
ATOM   1423 O "O5'" . DT  D 4 7  ? -12.119 0.556   127.921 1.00 58.21  ? 7   DT  D "O5'" 1 
ATOM   1424 C "C5'" . DT  D 4 7  ? -11.756 1.744   128.605 1.00 47.85  ? 7   DT  D "C5'" 1 
ATOM   1425 C "C4'" . DT  D 4 7  ? -12.844 2.797   128.497 1.00 43.83  ? 7   DT  D "C4'" 1 
ATOM   1426 O "O4'" . DT  D 4 7  ? -13.010 3.208   127.124 1.00 41.99  ? 7   DT  D "O4'" 1 
ATOM   1427 C "C3'" . DT  D 4 7  ? -14.235 2.358   128.972 1.00 40.57  ? 7   DT  D "C3'" 1 
ATOM   1428 O "O3'" . DT  D 4 7  ? -14.581 3.079   130.146 1.00 43.68  ? 7   DT  D "O3'" 1 
ATOM   1429 C "C2'" . DT  D 4 7  ? -15.167 2.704   127.795 1.00 33.46  ? 7   DT  D "C2'" 1 
ATOM   1430 C "C1'" . DT  D 4 7  ? -14.321 3.679   126.990 1.00 37.54  ? 7   DT  D "C1'" 1 
ATOM   1431 N N1    . DT  D 4 7  ? -14.674 3.752   125.537 1.00 40.57  ? 7   DT  D N1    1 
ATOM   1432 C C2    . DT  D 4 7  ? -15.224 4.912   125.043 1.00 46.31  ? 7   DT  D C2    1 
ATOM   1433 O O2    . DT  D 4 7  ? -15.444 5.893   125.732 1.00 53.11  ? 7   DT  D O2    1 
ATOM   1434 N N3    . DT  D 4 7  ? -15.512 4.887   123.705 1.00 40.54  ? 7   DT  D N3    1 
ATOM   1435 C C4    . DT  D 4 7  ? -15.310 3.842   122.825 1.00 44.97  ? 7   DT  D C4    1 
ATOM   1436 O O4    . DT  D 4 7  ? -15.603 3.920   121.634 1.00 46.37  ? 7   DT  D O4    1 
ATOM   1437 C C5    . DT  D 4 7  ? -14.730 2.652   123.405 1.00 35.09  ? 7   DT  D C5    1 
ATOM   1438 C C7    . DT  D 4 7  ? -14.464 1.450   122.549 1.00 29.02  ? 7   DT  D C7    1 
ATOM   1439 C C6    . DT  D 4 7  ? -14.443 2.664   124.719 1.00 36.33  ? 7   DT  D C6    1 
ATOM   1440 P P     . DT  D 4 8  ? -15.943 2.755   130.933 1.00 46.45  ? 8   DT  D P     1 
ATOM   1441 O OP1   . DT  D 4 8  ? -15.721 3.118   132.351 1.00 36.12  ? 8   DT  D OP1   1 
ATOM   1442 O OP2   . DT  D 4 8  ? -16.373 1.384   130.575 1.00 41.97  ? 8   DT  D OP2   1 
ATOM   1443 O "O5'" . DT  D 4 8  ? -16.992 3.785   130.309 1.00 38.88  ? 8   DT  D "O5'" 1 
ATOM   1444 C "C5'" . DT  D 4 8  ? -16.711 5.174   130.335 1.00 40.32  ? 8   DT  D "C5'" 1 
ATOM   1445 C "C4'" . DT  D 4 8  ? -17.678 5.934   129.450 1.00 35.68  ? 8   DT  D "C4'" 1 
ATOM   1446 O "O4'" . DT  D 4 8  ? -17.534 5.490   128.087 1.00 38.48  ? 8   DT  D "O4'" 1 
ATOM   1447 C "C3'" . DT  D 4 8  ? -19.155 5.748   129.805 1.00 34.38  ? 8   DT  D "C3'" 1 
ATOM   1448 O "O3'" . DT  D 4 8  ? -19.692 6.981   130.278 1.00 43.98  ? 8   DT  D "O3'" 1 
ATOM   1449 C "C2'" . DT  D 4 8  ? -19.820 5.292   128.492 1.00 38.40  ? 8   DT  D "C2'" 1 
ATOM   1450 C "C1'" . DT  D 4 8  ? -18.768 5.620   127.440 1.00 36.40  ? 8   DT  D "C1'" 1 
ATOM   1451 N N1    . DT  D 4 8  ? -18.777 4.700   126.265 1.00 40.37  ? 8   DT  D N1    1 
ATOM   1452 C C2    . DT  D 4 8  ? -19.255 5.153   125.057 1.00 43.97  ? 8   DT  D C2    1 
ATOM   1453 O O2    . DT  D 4 8  ? -19.690 6.278   124.889 1.00 46.96  ? 8   DT  D O2    1 
ATOM   1454 N N3    . DT  D 4 8  ? -19.210 4.233   124.042 1.00 35.40  ? 8   DT  D N3    1 
ATOM   1455 C C4    . DT  D 4 8  ? -18.741 2.934   124.113 1.00 42.93  ? 8   DT  D C4    1 
ATOM   1456 O O4    . DT  D 4 8  ? -18.742 2.181   123.144 1.00 46.24  ? 8   DT  D O4    1 
ATOM   1457 C C5    . DT  D 4 8  ? -18.251 2.525   125.408 1.00 37.46  ? 8   DT  D C5    1 
ATOM   1458 C C7    . DT  D 4 8  ? -17.718 1.137   125.608 1.00 28.95  ? 8   DT  D C7    1 
ATOM   1459 C C6    . DT  D 4 8  ? -18.291 3.418   126.408 1.00 37.91  ? 8   DT  D C6    1 
ATOM   1460 P P     . DA  D 4 9  ? -21.192 7.055   130.849 1.00 41.43  ? 9   DA  D P     1 
ATOM   1461 O OP1   . DA  D 4 9  ? -21.288 8.274   131.683 1.00 35.04  ? 9   DA  D OP1   1 
ATOM   1462 O OP2   . DA  D 4 9  ? -21.537 5.737   131.429 1.00 29.76  ? 9   DA  D OP2   1 
ATOM   1463 O "O5'" . DA  D 4 9  ? -22.075 7.262   129.536 1.00 39.47  ? 9   DA  D "O5'" 1 
ATOM   1464 C "C5'" . DA  D 4 9  ? -23.483 7.351   129.626 1.00 37.34  ? 9   DA  D "C5'" 1 
ATOM   1465 C "C4'" . DA  D 4 9  ? -24.044 8.004   128.379 1.00 39.39  ? 9   DA  D "C4'" 1 
ATOM   1466 O "O4'" . DA  D 4 9  ? -23.357 7.482   127.212 1.00 40.60  ? 9   DA  D "O4'" 1 
ATOM   1467 C "C3'" . DA  D 4 9  ? -25.524 7.763   128.133 1.00 39.37  ? 9   DA  D "C3'" 1 
ATOM   1468 O "O3'" . DA  D 4 9  ? -26.089 8.896   127.489 1.00 53.88  ? 9   DA  D "O3'" 1 
ATOM   1469 C "C2'" . DA  D 4 9  ? -25.516 6.539   127.220 1.00 39.33  ? 9   DA  D "C2'" 1 
ATOM   1470 C "C1'" . DA  D 4 9  ? -24.264 6.780   126.385 1.00 40.19  ? 9   DA  D "C1'" 1 
ATOM   1471 N N9    . DA  D 4 9  ? -23.614 5.552   125.933 1.00 43.14  ? 9   DA  D N9    1 
ATOM   1472 C C8    . DA  D 4 9  ? -23.061 4.577   126.716 1.00 39.38  ? 9   DA  D C8    1 
ATOM   1473 N N7    . DA  D 4 9  ? -22.539 3.583   126.035 1.00 40.90  ? 9   DA  D N7    1 
ATOM   1474 C C5    . DA  D 4 9  ? -22.763 3.931   124.713 1.00 44.14  ? 9   DA  D C5    1 
ATOM   1475 C C6    . DA  D 4 9  ? -22.448 3.293   123.496 1.00 46.08  ? 9   DA  D C6    1 
ATOM   1476 N N6    . DA  D 4 9  ? -21.812 2.119   123.422 1.00 33.02  ? 9   DA  D N6    1 
ATOM   1477 N N1    . DA  D 4 9  ? -22.814 3.911   122.353 1.00 45.57  ? 9   DA  D N1    1 
ATOM   1478 C C2    . DA  D 4 9  ? -23.449 5.087   122.430 1.00 43.90  ? 9   DA  D C2    1 
ATOM   1479 N N3    . DA  D 4 9  ? -23.799 5.782   123.513 1.00 45.33  ? 9   DA  D N3    1 
ATOM   1480 C C4    . DA  D 4 9  ? -23.423 5.143   124.632 1.00 43.09  ? 9   DA  D C4    1 
ATOM   1481 P P     . DA  D 4 10 ? -27.665 9.184   127.594 1.00 42.01  ? 10  DA  D P     1 
ATOM   1482 O OP1   . DA  D 4 10 ? -27.860 10.644  127.451 1.00 48.37  ? 10  DA  D OP1   1 
ATOM   1483 O OP2   . DA  D 4 10 ? -28.176 8.490   128.797 1.00 40.33  ? 10  DA  D OP2   1 
ATOM   1484 O "O5'" . DA  D 4 10 ? -28.264 8.460   126.301 1.00 43.69  ? 10  DA  D "O5'" 1 
ATOM   1485 C "C5'" . DA  D 4 10 ? -27.841 8.873   125.010 1.00 42.66  ? 10  DA  D "C5'" 1 
ATOM   1486 C "C4'" . DA  D 4 10 ? -28.258 7.874   123.945 1.00 62.52  ? 10  DA  D "C4'" 1 
ATOM   1487 O "O4'" . DA  D 4 10 ? -27.317 6.782   123.894 1.00 61.58  ? 10  DA  D "O4'" 1 
ATOM   1488 C "C3'" . DA  D 4 10 ? -29.635 7.227   124.145 1.00 60.35  ? 10  DA  D "C3'" 1 
ATOM   1489 O "O3'" . DA  D 4 10 ? -30.545 7.732   123.166 1.00 53.70  ? 10  DA  D "O3'" 1 
ATOM   1490 C "C2'" . DA  D 4 10 ? -29.377 5.715   123.969 1.00 46.11  ? 10  DA  D "C2'" 1 
ATOM   1491 C "C1'" . DA  D 4 10 ? -27.986 5.680   123.351 1.00 54.31  ? 10  DA  D "C1'" 1 
ATOM   1492 N N9    . DA  D 4 10 ? -27.233 4.467   123.658 1.00 51.08  ? 10  DA  D N9    1 
ATOM   1493 C C8    . DA  D 4 10 ? -27.028 3.908   124.890 1.00 45.95  ? 10  DA  D C8    1 
ATOM   1494 N N7    . DA  D 4 10 ? -26.308 2.810   124.859 1.00 44.02  ? 10  DA  D N7    1 
ATOM   1495 C C5    . DA  D 4 10 ? -26.022 2.638   123.514 1.00 42.93  ? 10  DA  D C5    1 
ATOM   1496 C C6    . DA  D 4 10 ? -25.292 1.656   122.815 1.00 45.49  ? 10  DA  D C6    1 
ATOM   1497 N N6    . DA  D 4 10 ? -24.693 0.620   123.412 1.00 43.96  ? 10  DA  D N6    1 
ATOM   1498 N N1    . DA  D 4 10 ? -25.200 1.781   121.475 1.00 49.52  ? 10  DA  D N1    1 
ATOM   1499 C C2    . DA  D 4 10 ? -25.800 2.818   120.881 1.00 51.42  ? 10  DA  D C2    1 
ATOM   1500 N N3    . DA  D 4 10 ? -26.512 3.801   121.429 1.00 54.95  ? 10  DA  D N3    1 
ATOM   1501 C C4    . DA  D 4 10 ? -26.585 3.650   122.761 1.00 49.22  ? 10  DA  D C4    1 
ATOM   1502 P P     . DT  D 4 11 ? -31.951 7.006   122.872 1.00 58.80  ? 11  DT  D P     1 
ATOM   1503 O OP1   . DT  D 4 11 ? -32.866 8.059   122.381 1.00 71.65  ? 11  DT  D OP1   1 
ATOM   1504 O OP2   . DT  D 4 11 ? -32.358 6.204   124.049 1.00 62.29  ? 11  DT  D OP2   1 
ATOM   1505 O "O5'" . DT  D 4 11 ? -31.616 6.019   121.656 1.00 53.60  ? 11  DT  D "O5'" 1 
ATOM   1506 C "C5'" . DT  D 4 11 ? -30.835 6.494   120.559 1.00 52.03  ? 11  DT  D "C5'" 1 
ATOM   1507 C "C4'" . DT  D 4 11 ? -30.733 5.454   119.452 1.00 57.60  ? 11  DT  D "C4'" 1 
ATOM   1508 O "O4'" . DT  D 4 11 ? -29.774 4.426   119.816 1.00 60.01  ? 11  DT  D "O4'" 1 
ATOM   1509 C "C3'" . DT  D 4 11 ? -32.037 4.721   119.111 1.00 62.93  ? 11  DT  D "C3'" 1 
ATOM   1510 O "O3'" . DT  D 4 11 ? -32.281 4.795   117.712 1.00 69.65  ? 11  DT  D "O3'" 1 
ATOM   1511 C "C2'" . DT  D 4 11 ? -31.768 3.280   119.554 1.00 56.58  ? 11  DT  D "C2'" 1 
ATOM   1512 C "C1'" . DT  D 4 11 ? -30.264 3.188   119.370 1.00 57.73  ? 11  DT  D "C1'" 1 
ATOM   1513 N N1    . DT  D 4 11 ? -29.631 2.098   120.168 1.00 53.01  ? 11  DT  D N1    1 
ATOM   1514 C C2    . DT  D 4 11 ? -28.926 1.106   119.520 1.00 51.92  ? 11  DT  D C2    1 
ATOM   1515 O O2    . DT  D 4 11 ? -28.781 1.070   118.311 1.00 57.34  ? 11  DT  D O2    1 
ATOM   1516 N N3    . DT  D 4 11 ? -28.386 0.151   120.347 1.00 52.43  ? 11  DT  D N3    1 
ATOM   1517 C C4    . DT  D 4 11 ? -28.491 0.096   121.727 1.00 44.87  ? 11  DT  D C4    1 
ATOM   1518 O O4    . DT  D 4 11 ? -27.980 -0.796  122.388 1.00 46.17  ? 11  DT  D O4    1 
ATOM   1519 C C5    . DT  D 4 11 ? -29.245 1.163   122.336 1.00 38.01  ? 11  DT  D C5    1 
ATOM   1520 C C7    . DT  D 4 11 ? -29.420 1.205   123.823 1.00 43.02  ? 11  DT  D C7    1 
ATOM   1521 C C6    . DT  D 4 11 ? -29.774 2.100   121.538 1.00 41.73  ? 11  DT  D C6    1 
ATOM   1522 P P     . DG  D 4 12 ? -33.584 4.099   117.077 1.00 69.83  ? 12  DG  D P     1 
ATOM   1523 O OP1   . DG  D 4 12 ? -33.898 4.815   115.821 1.00 77.40  ? 12  DG  D OP1   1 
ATOM   1524 O OP2   . DG  D 4 12 ? -34.610 3.994   118.138 1.00 55.20  ? 12  DG  D OP2   1 
ATOM   1525 O "O5'" . DG  D 4 12 ? -33.095 2.621   116.706 1.00 60.70  ? 12  DG  D "O5'" 1 
ATOM   1526 C "C5'" . DG  D 4 12 ? -32.210 2.423   115.611 1.00 62.70  ? 12  DG  D "C5'" 1 
ATOM   1527 C "C4'" . DG  D 4 12 ? -31.954 0.945   115.374 1.00 63.96  ? 12  DG  D "C4'" 1 
ATOM   1528 O "O4'" . DG  D 4 12 ? -31.328 0.360   116.548 1.00 70.50  ? 12  DG  D "O4'" 1 
ATOM   1529 C "C3'" . DG  D 4 12 ? -33.201 0.097   115.097 1.00 67.13  ? 12  DG  D "C3'" 1 
ATOM   1530 O "O3'" . DG  D 4 12 ? -32.905 -0.851  114.080 1.00 76.04  ? 12  DG  D "O3'" 1 
ATOM   1531 C "C2'" . DG  D 4 12 ? -33.444 -0.589  116.440 1.00 60.96  ? 12  DG  D "C2'" 1 
ATOM   1532 C "C1'" . DG  D 4 12 ? -32.014 -0.822  116.886 1.00 64.34  ? 12  DG  D "C1'" 1 
ATOM   1533 N N9    . DG  D 4 12 ? -31.859 -1.068  118.316 1.00 58.55  ? 12  DG  D N9    1 
ATOM   1534 C C8    . DG  D 4 12 ? -32.511 -0.440  119.351 1.00 52.15  ? 12  DG  D C8    1 
ATOM   1535 N N7    . DG  D 4 12 ? -32.153 -0.879  120.529 1.00 53.77  ? 12  DG  D N7    1 
ATOM   1536 C C5    . DG  D 4 12 ? -31.202 -1.856  120.253 1.00 51.95  ? 12  DG  D C5    1 
ATOM   1537 C C6    . DG  D 4 12 ? -30.454 -2.684  121.129 1.00 46.19  ? 12  DG  D C6    1 
ATOM   1538 O O6    . DG  D 4 12 ? -30.483 -2.719  122.368 1.00 45.43  ? 12  DG  D O6    1 
ATOM   1539 N N1    . DG  D 4 12 ? -29.602 -3.536  120.426 1.00 48.44  ? 12  DG  D N1    1 
ATOM   1540 C C2    . DG  D 4 12 ? -29.491 -3.578  119.054 1.00 51.06  ? 12  DG  D C2    1 
ATOM   1541 N N2    . DG  D 4 12 ? -28.622 -4.459  118.550 1.00 51.18  ? 12  DG  D N2    1 
ATOM   1542 N N3    . DG  D 4 12 ? -30.183 -2.811  118.232 1.00 48.15  ? 12  DG  D N3    1 
ATOM   1543 C C4    . DG  D 4 12 ? -31.014 -1.979  118.896 1.00 52.35  ? 12  DG  D C4    1 
ATOM   1544 P P     . DA  D 4 13 ? -34.080 -1.605  113.285 1.00 67.50  ? 13  DA  D P     1 
ATOM   1545 O OP1   . DA  D 4 13 ? -34.064 -1.095  111.896 1.00 58.20  ? 13  DA  D OP1   1 
ATOM   1546 O OP2   . DA  D 4 13 ? -35.324 -1.518  114.083 1.00 71.62  ? 13  DA  D OP2   1 
ATOM   1547 O "O5'" . DA  D 4 13 ? -33.605 -3.133  113.275 1.00 50.96  ? 13  DA  D "O5'" 1 
ATOM   1548 C "C5'" . DA  D 4 13 ? -32.337 -3.476  112.724 1.00 57.05  ? 13  DA  D "C5'" 1 
ATOM   1549 C "C4'" . DA  D 4 13 ? -31.840 -4.801  113.276 1.00 56.07  ? 13  DA  D "C4'" 1 
ATOM   1550 O "O4'" . DA  D 4 13 ? -31.592 -4.672  114.699 1.00 58.49  ? 13  DA  D "O4'" 1 
ATOM   1551 C "C3'" . DA  D 4 13 ? -32.806 -5.976  113.107 1.00 60.23  ? 13  DA  D "C3'" 1 
ATOM   1552 O "O3'" . DA  D 4 13 ? -32.120 -7.094  112.560 1.00 68.73  ? 13  DA  D "O3'" 1 
ATOM   1553 C "C2'" . DA  D 4 13 ? -33.303 -6.256  114.527 1.00 56.28  ? 13  DA  D "C2'" 1 
ATOM   1554 C "C1'" . DA  D 4 13 ? -32.138 -5.776  115.380 1.00 50.16  ? 13  DA  D "C1'" 1 
ATOM   1555 N N9    . DA  D 4 13 ? -32.542 -5.336  116.713 1.00 49.32  ? 13  DA  D N9    1 
ATOM   1556 C C8    . DA  D 4 13 ? -33.470 -4.379  117.016 1.00 51.14  ? 13  DA  D C8    1 
ATOM   1557 N N7    . DA  D 4 13 ? -33.632 -4.185  118.303 1.00 48.42  ? 13  DA  D N7    1 
ATOM   1558 C C5    . DA  D 4 13 ? -32.746 -5.074  118.887 1.00 42.54  ? 13  DA  D C5    1 
ATOM   1559 C C6    . DA  D 4 13 ? -32.436 -5.359  120.232 1.00 37.61  ? 13  DA  D C6    1 
ATOM   1560 N N6    . DA  D 4 13 ? -33.016 -4.743  121.267 1.00 34.40  ? 13  DA  D N6    1 
ATOM   1561 N N1    . DA  D 4 13 ? -31.504 -6.304  120.473 1.00 34.36  ? 13  DA  D N1    1 
ATOM   1562 C C2    . DA  D 4 13 ? -30.925 -6.919  119.434 1.00 35.80  ? 13  DA  D C2    1 
ATOM   1563 N N3    . DA  D 4 13 ? -31.134 -6.737  118.129 1.00 39.68  ? 13  DA  D N3    1 
ATOM   1564 C C4    . DA  D 4 13 ? -32.065 -5.792  117.922 1.00 42.66  ? 13  DA  D C4    1 
ATOM   1565 P P     . DC  D 4 14 ? -32.948 -8.313  111.920 1.00 87.37  ? 14  DC  D P     1 
ATOM   1566 O OP1   . DC  D 4 14 ? -32.103 -8.940  110.879 1.00 89.44  ? 14  DC  D OP1   1 
ATOM   1567 O OP2   . DC  D 4 14 ? -34.295 -7.807  111.572 1.00 77.68  ? 14  DC  D OP2   1 
ATOM   1568 O "O5'" . DC  D 4 14 ? -33.113 -9.338  113.134 1.00 80.63  ? 14  DC  D "O5'" 1 
ATOM   1569 C "C5'" . DC  D 4 14 ? -31.961 -9.875  113.770 1.00 71.06  ? 14  DC  D "C5'" 1 
ATOM   1570 C "C4'" . DC  D 4 14 ? -32.354 -10.688 114.988 1.00 74.72  ? 14  DC  D "C4'" 1 
ATOM   1571 O "O4'" . DC  D 4 14 ? -32.542 -9.808  116.114 1.00 69.44  ? 14  DC  D "O4'" 1 
ATOM   1572 C "C3'" . DC  D 4 14 ? -33.661 -11.472 114.838 1.00 80.36  ? 14  DC  D "C3'" 1 
ATOM   1573 O "O3'" . DC  D 4 14 ? -33.393 -12.869 114.811 1.00 77.69  ? 14  DC  D "O3'" 1 
ATOM   1574 C "C2'" . DC  D 4 14 ? -34.501 -11.078 116.066 1.00 72.34  ? 14  DC  D "C2'" 1 
ATOM   1575 C "C1'" . DC  D 4 14 ? -33.494 -10.375 116.971 1.00 60.46  ? 14  DC  D "C1'" 1 
ATOM   1576 N N1    . DC  D 4 14 ? -34.097 -9.284  117.790 1.00 59.79  ? 14  DC  D N1    1 
ATOM   1577 C C2    . DC  D 4 14 ? -33.745 -9.151  119.140 1.00 56.01  ? 14  DC  D C2    1 
ATOM   1578 O O2    . DC  D 4 14 ? -32.933 -9.942  119.633 1.00 49.57  ? 14  DC  D O2    1 
ATOM   1579 N N3    . DC  D 4 14 ? -34.307 -8.153  119.870 1.00 48.96  ? 14  DC  D N3    1 
ATOM   1580 C C4    . DC  D 4 14 ? -35.179 -7.319  119.296 1.00 53.83  ? 14  DC  D C4    1 
ATOM   1581 N N4    . DC  D 4 14 ? -35.707 -6.350  120.050 1.00 57.66  ? 14  DC  D N4    1 
ATOM   1582 C C5    . DC  D 4 14 ? -35.549 -7.442  117.924 1.00 60.11  ? 14  DC  D C5    1 
ATOM   1583 C C6    . DC  D 4 14 ? -34.990 -8.428  117.217 1.00 60.22  ? 14  DC  D C6    1 
HETATM 1584 O O     . HOH E 5 .  ? -27.971 5.289   130.557 1.00 30.00  ? 101 HOH A O     1 
HETATM 1585 O O     . HOH E 5 .  ? -33.218 -2.686  125.855 1.00 30.00  ? 102 HOH A O     1 
HETATM 1586 O O     . HOH E 5 .  ? -19.939 1.325   132.613 1.00 30.00  ? 103 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . TRP A 13 ? 1.3121 1.5577 1.1781 -0.2029 -0.0597 0.0692  13 TRP A N     
2    C CA    . TRP A 13 ? 1.2886 1.5089 1.1708 -0.1979 -0.0571 0.0591  13 TRP A CA    
3    C C     . TRP A 13 ? 1.2953 1.5058 1.2041 -0.1892 -0.0557 0.0739  13 TRP A C     
4    O O     . TRP A 13 ? 1.3286 1.5423 1.2414 -0.1858 -0.0511 0.0849  13 TRP A O     
5    C CB    . TRP A 13 ? 1.3670 1.5689 1.2376 -0.1960 -0.0469 0.0387  13 TRP A CB    
6    C CG    . TRP A 13 ? 1.4172 1.6197 1.2845 -0.1914 -0.0380 0.0422  13 TRP A CG    
7    C CD1   . TRP A 13 ? 1.3692 1.5868 1.2162 -0.1950 -0.0347 0.0425  13 TRP A CD1   
8    C CD2   . TRP A 13 ? 1.3893 1.5783 1.2744 -0.1829 -0.0313 0.0458  13 TRP A CD2   
9    N NE1   . TRP A 13 ? 1.3778 1.5922 1.2299 -0.1892 -0.0260 0.0467  13 TRP A NE1   
10   C CE2   . TRP A 13 ? 1.3661 1.5636 1.2418 -0.1821 -0.0241 0.0484  13 TRP A CE2   
11   C CE3   . TRP A 13 ? 1.2785 1.4503 1.1865 -0.1761 -0.0307 0.0467  13 TRP A CE3   
12   C CZ2   . TRP A 13 ? 1.3041 1.4943 1.1934 -0.1757 -0.0166 0.0518  13 TRP A CZ2   
13   C CZ3   . TRP A 13 ? 1.1739 1.3384 1.0941 -0.1697 -0.0236 0.0494  13 TRP A CZ3   
14   C CH2   . TRP A 13 ? 1.1907 1.3649 1.1021 -0.1699 -0.0168 0.0518  13 TRP A CH2   
15   N N     . LYS A 21 ? 1.0885 1.1138 1.2588 -0.0997 -0.0501 0.1283  21 LYS A N     
16   C CA    . LYS A 21 ? 1.0029 1.0081 1.1849 -0.0924 -0.0447 0.1236  21 LYS A CA    
17   C C     . LYS A 21 ? 0.9143 0.9104 1.0913 -0.0934 -0.0391 0.1120  21 LYS A C     
18   O O     . LYS A 21 ? 0.8956 0.8932 1.0609 -0.0954 -0.0387 0.0981  21 LYS A O     
19   C CB    . LYS A 21 ? 0.8314 0.8299 1.0159 -0.0878 -0.0457 0.1142  21 LYS A CB    
20   C CG    . LYS A 21 ? 0.9473 0.9293 1.1471 -0.0790 -0.0417 0.1161  21 LYS A CG    
21   C CD    . LYS A 21 ? 0.8808 0.8510 1.0782 -0.0744 -0.0390 0.1000  21 LYS A CD    
22   C CE    . LYS A 21 ? 0.8411 0.8027 1.0515 -0.0665 -0.0381 0.1037  21 LYS A CE    
23   N NZ    . LYS A 21 ? 0.7710 0.7217 0.9783 -0.0613 -0.0350 0.0890  21 LYS A NZ    
24   N N     . LYS A 22 ? 1.1891 1.1762 1.3755 -0.0922 -0.0344 0.1180  22 LYS A N     
25   C CA    . LYS A 22 ? 1.1960 1.1773 1.3797 -0.0945 -0.0293 0.1082  22 LYS A CA    
26   C C     . LYS A 22 ? 1.0900 1.0597 1.2745 -0.0895 -0.0268 0.0917  22 LYS A C     
27   O O     . LYS A 22 ? 1.1483 1.1072 1.3414 -0.0830 -0.0263 0.0910  22 LYS A O     
28   C CB    . LYS A 22 ? 1.0245 0.9981 1.2192 -0.0956 -0.0243 0.1188  22 LYS A CB    
29   C CG    . LYS A 22 ? 0.9777 0.9467 1.1716 -0.0994 -0.0190 0.1086  22 LYS A CG    
30   C CD    . LYS A 22 ? 1.0304 0.9891 1.2362 -0.1015 -0.0130 0.1183  22 LYS A CD    
31   C CE    . LYS A 22 ? 0.9698 0.9200 1.1790 -0.1040 -0.0078 0.1045  22 LYS A CE    
32   N NZ    . LYS A 22 ? 0.8241 0.7873 1.0210 -0.1070 -0.0093 0.0908  22 LYS A NZ    
33   N N     . ARG A 23 ? 0.7187 0.6918 0.8940 -0.0917 -0.0249 0.0791  23 ARG A N     
34   C CA    . ARG A 23 ? 0.7316 0.6981 0.9047 -0.0864 -0.0229 0.0635  23 ARG A CA    
35   C C     . ARG A 23 ? 0.6382 0.5936 0.8215 -0.0840 -0.0184 0.0584  23 ARG A C     
36   O O     . ARG A 23 ? 0.6661 0.6223 0.8532 -0.0891 -0.0154 0.0604  23 ARG A O     
37   C CB    . ARG A 23 ? 0.7280 0.7048 0.8868 -0.0889 -0.0224 0.0528  23 ARG A CB    
38   C CG    . ARG A 23 ? 0.6636 0.6358 0.8204 -0.0827 -0.0194 0.0381  23 ARG A CG    
39   C CD    . ARG A 23 ? 0.5899 0.5722 0.7377 -0.0852 -0.0167 0.0295  23 ARG A CD    
40   N NE    . ARG A 23 ? 0.4793 0.4592 0.6270 -0.0782 -0.0138 0.0169  23 ARG A NE    
41   C CZ    . ARG A 23 ? 0.5369 0.5241 0.6849 -0.0789 -0.0108 0.0098  23 ARG A CZ    
42   N NH1   . ARG A 23 ? 0.7171 0.7132 0.8659 -0.0867 -0.0097 0.0138  23 ARG A NH1   
43   N NH2   . ARG A 23 ? 0.6785 0.6657 0.8263 -0.0716 -0.0088 -0.0009 23 ARG A NH2   
44   N N     . LYS A 24 ? 0.7481 0.6936 0.9356 -0.0766 -0.0176 0.0513  24 LYS A N     
45   C CA    . LYS A 24 ? 0.7672 0.7025 0.9630 -0.0741 -0.0136 0.0445  24 LYS A CA    
46   C C     . LYS A 24 ? 0.6850 0.6213 0.8750 -0.0682 -0.0126 0.0290  24 LYS A C     
47   O O     . LYS A 24 ? 0.7099 0.6427 0.8973 -0.0611 -0.0137 0.0260  24 LYS A O     
48   C CB    . LYS A 24 ? 0.6857 0.6066 0.8935 -0.0696 -0.0125 0.0521  24 LYS A CB    
49   N N     . PRO A 25 ? 0.5033 0.4459 0.6917 -0.0710 -0.0104 0.0199  25 PRO A N     
50   C CA    . PRO A 25 ? 0.5438 0.4899 0.7279 -0.0648 -0.0091 0.0059  25 PRO A CA    
51   C C     . PRO A 25 ? 0.4810 0.4147 0.6715 -0.0574 -0.0080 0.0019  25 PRO A C     
52   O O     . PRO A 25 ? 0.5536 0.4773 0.7539 -0.0596 -0.0063 0.0044  25 PRO A O     
53   C CB    . PRO A 25 ? 0.3887 0.3444 0.5748 -0.0714 -0.0070 -0.0002 25 PRO A CB    
54   C CG    . PRO A 25 ? 0.5102 0.4709 0.6960 -0.0804 -0.0073 0.0101  25 PRO A CG    
55   C CD    . PRO A 25 ? 0.5648 0.5137 0.7558 -0.0803 -0.0087 0.0231  25 PRO A CD    
56   N N     . TYR A 26 ? 0.5465 0.4801 0.7310 -0.0483 -0.0082 -0.0042 26 TYR A N     
57   C CA    . TYR A 26 ? 0.5575 0.4801 0.7463 -0.0401 -0.0069 -0.0074 26 TYR A CA    
58   C C     . TYR A 26 ? 0.4725 0.3968 0.6642 -0.0392 -0.0048 -0.0185 26 TYR A C     
59   O O     . TYR A 26 ? 0.6130 0.5492 0.8030 -0.0443 -0.0046 -0.0246 26 TYR A O     
60   C CB    . TYR A 26 ? 0.5023 0.4248 0.6835 -0.0306 -0.0069 -0.0101 26 TYR A CB    
61   C CG    . TYR A 26 ? 0.5558 0.4756 0.7353 -0.0319 -0.0089 -0.0003 26 TYR A CG    
62   C CD1   . TYR A 26 ? 0.5524 0.4710 0.7376 -0.0395 -0.0112 0.0110  26 TYR A CD1   
63   C CD2   . TYR A 26 ? 0.5190 0.4381 0.6915 -0.0256 -0.0083 -0.0023 26 TYR A CD2   
64   C CE1   . TYR A 26 ? 0.5462 0.4657 0.7299 -0.0413 -0.0138 0.0195  26 TYR A CE1   
65   C CE2   . TYR A 26 ? 0.5621 0.4799 0.7335 -0.0283 -0.0104 0.0054  26 TYR A CE2   
66   C CZ    . TYR A 26 ? 0.5425 0.4619 0.7195 -0.0364 -0.0136 0.0159  26 TYR A CZ    
67   O OH    . TYR A 26 ? 0.4380 0.3594 0.6138 -0.0396 -0.0164 0.0231  26 TYR A OH    
68   N N     . SER A 27 ? 0.5581 0.4715 0.7542 -0.0331 -0.0032 -0.0214 27 SER A N     
69   C CA    . SER A 27 ? 0.5109 0.4263 0.7086 -0.0321 -0.0015 -0.0333 27 SER A CA    
70   C C     . SER A 27 ? 0.5561 0.4871 0.7442 -0.0253 -0.0020 -0.0435 27 SER A C     
71   O O     . SER A 27 ? 0.6646 0.5998 0.8450 -0.0192 -0.0025 -0.0412 27 SER A O     
72   C CB    . SER A 27 ? 0.5145 0.4140 0.7175 -0.0263 0.0008  -0.0340 27 SER A CB    
73   O OG    . SER A 27 ? 0.6555 0.5579 0.8585 -0.0257 0.0023  -0.0470 27 SER A OG    
74   N N     . LYS A 28 ? 0.4801 0.4199 0.6690 -0.0264 -0.0016 -0.0547 28 LYS A N     
75   C CA    . LYS A 28 ? 0.4487 0.4055 0.6295 -0.0186 -0.0019 -0.0641 28 LYS A CA    
76   C C     . LYS A 28 ? 0.5132 0.4633 0.6896 -0.0055 -0.0006 -0.0662 28 LYS A C     
77   O O     . LYS A 28 ? 0.6828 0.6438 0.8511 0.0044  -0.0000 -0.0702 28 LYS A O     
78   C CB    . LYS A 28 ? 0.4277 0.3992 0.6116 -0.0250 -0.0024 -0.0754 28 LYS A CB    
79   N N     . PHE A 29 ? 0.5705 0.5026 0.7526 -0.0050 0.0007  -0.0628 29 PHE A N     
80   C CA    . PHE A 29 ? 0.4733 0.3974 0.6521 0.0072  0.0027  -0.0635 29 PHE A CA    
81   C C     . PHE A 29 ? 0.4748 0.3926 0.6502 0.0137  0.0033  -0.0536 29 PHE A C     
82   O O     . PHE A 29 ? 0.5937 0.5157 0.7616 0.0244  0.0049  -0.0553 29 PHE A O     
83   C CB    . PHE A 29 ? 0.5583 0.4653 0.7448 0.0058  0.0047  -0.0635 29 PHE A CB    
84   C CG    . PHE A 29 ? 0.4443 0.3417 0.6282 0.0181  0.0073  -0.0624 29 PHE A CG    
85   C CD1   . PHE A 29 ? 0.3966 0.3016 0.5736 0.0270  0.0084  -0.0725 29 PHE A CD1   
86   C CD2   . PHE A 29 ? 0.4949 0.3774 0.6836 0.0209  0.0088  -0.0508 29 PHE A CD2   
87   C CE1   . PHE A 29 ? 0.4619 0.3583 0.6362 0.0387  0.0115  -0.0710 29 PHE A CE1   
88   C CE2   . PHE A 29 ? 0.4682 0.3427 0.6555 0.0322  0.0118  -0.0494 29 PHE A CE2   
89   C CZ    . PHE A 29 ? 0.4021 0.2828 0.5819 0.0412  0.0135  -0.0594 29 PHE A CZ    
90   N N     . GLN A 30 ? 0.5770 0.4851 0.7581 0.0071  0.0024  -0.0431 30 GLN A N     
91   C CA    . GLN A 30 ? 0.5585 0.4620 0.7374 0.0103  0.0024  -0.0341 30 GLN A CA    
92   C C     . GLN A 30 ? 0.6298 0.5450 0.7984 0.0138  0.0027  -0.0370 30 GLN A C     
93   O O     . GLN A 30 ? 0.6433 0.5557 0.8066 0.0224  0.0050  -0.0357 30 GLN A O     
94   C CB    . GLN A 30 ? 0.4929 0.3909 0.6786 0.0004  0.0002  -0.0232 30 GLN A CB    
95   C CG    . GLN A 30 ? 0.5030 0.3893 0.6997 -0.0037 0.0009  -0.0188 30 GLN A CG    
96   C CD    . GLN A 30 ? 0.5322 0.4167 0.7349 -0.0132 -0.0012 -0.0073 30 GLN A CD    
97   O OE1   . GLN A 30 ? 0.5006 0.3947 0.6998 -0.0206 -0.0033 -0.0067 30 GLN A OE1   
98   N NE2   . GLN A 30 ? 0.5564 0.4295 0.7680 -0.0123 -0.0004 0.0025  30 GLN A NE2   
99   N N     . THR A 31 ? 0.5612 0.4887 0.7272 0.0072  0.0011  -0.0406 31 THR A N     
100  C CA    . THR A 31 ? 0.5961 0.5353 0.7523 0.0104  0.0021  -0.0436 31 THR A CA    
101  C C     . THR A 31 ? 0.5417 0.4866 0.6910 0.0238  0.0053  -0.0501 31 THR A C     
102  O O     . THR A 31 ? 0.5117 0.4556 0.6534 0.0313  0.0083  -0.0487 31 THR A O     
103  C CB    . THR A 31 ? 0.5245 0.4783 0.6808 0.0016  0.0005  -0.0472 31 THR A CB    
104  O OG1   . THR A 31 ? 0.5485 0.4982 0.7082 -0.0095 -0.0016 -0.0394 31 THR A OG1   
105  C CG2   . THR A 31 ? 0.4821 0.4500 0.6286 0.0076  0.0026  -0.0518 31 THR A CG2   
106  N N     . LEU A 32 ? 0.5168 0.4675 0.6682 0.0269  0.0050  -0.0573 32 LEU A N     
107  C CA    . LEU A 32 ? 0.5385 0.4964 0.6831 0.0404  0.0076  -0.0630 32 LEU A CA    
108  C C     . LEU A 32 ? 0.5268 0.4702 0.6693 0.0504  0.0111  -0.0576 32 LEU A C     
109  O O     . LEU A 32 ? 0.6152 0.5608 0.7498 0.0611  0.0150  -0.0570 32 LEU A O     
110  C CB    . LEU A 32 ? 0.5493 0.5155 0.6970 0.0403  0.0060  -0.0720 32 LEU A CB    
111  C CG    . LEU A 32 ? 0.6800 0.6678 0.8277 0.0348  0.0036  -0.0801 32 LEU A CG    
112  C CD1   . LEU A 32 ? 0.8028 0.7980 0.9535 0.0335  0.0020  -0.0902 32 LEU A CD1   
113  C CD2   . LEU A 32 ? 0.7168 0.7215 0.8554 0.0447  0.0056  -0.0811 32 LEU A CD2   
114  N N     . GLU A 33 ? 0.5019 0.4302 0.6519 0.0470  0.0105  -0.0530 33 GLU A N     
115  C CA    . GLU A 33 ? 0.5190 0.4338 0.6690 0.0552  0.0139  -0.0473 33 GLU A CA    
116  C C     . GLU A 33 ? 0.4748 0.3843 0.6213 0.0557  0.0159  -0.0405 33 GLU A C     
117  O O     . GLU A 33 ? 0.4647 0.3683 0.6073 0.0654  0.0204  -0.0382 33 GLU A O     
118  C CB    . GLU A 33 ? 0.5398 0.4410 0.7001 0.0503  0.0127  -0.0426 33 GLU A CB    
119  C CG    . GLU A 33 ? 0.4679 0.3693 0.6308 0.0520  0.0128  -0.0499 33 GLU A CG    
120  C CD    . GLU A 33 ? 0.5460 0.4480 0.7028 0.0662  0.0166  -0.0537 33 GLU A CD    
121  O OE1   . GLU A 33 ? 0.5530 0.4693 0.7017 0.0722  0.0169  -0.0614 33 GLU A OE1   
122  O OE2   . GLU A 33 ? 0.6718 0.5611 0.8318 0.0717  0.0196  -0.0483 33 GLU A OE2   
123  N N     . LEU A 34 ? 0.5285 0.4396 0.6760 0.0449  0.0131  -0.0377 34 LEU A N     
124  C CA    . LEU A 34 ? 0.4522 0.3587 0.5955 0.0432  0.0149  -0.0329 34 LEU A CA    
125  C C     . LEU A 34 ? 0.5204 0.4332 0.6525 0.0519  0.0195  -0.0373 34 LEU A C     
126  O O     . LEU A 34 ? 0.5391 0.4437 0.6666 0.0578  0.0244  -0.0349 34 LEU A O     
127  C CB    . LEU A 34 ? 0.4545 0.3627 0.6006 0.0293  0.0104  -0.0291 34 LEU A CB    
128  C CG    . LEU A 34 ? 0.5863 0.4873 0.7435 0.0215  0.0067  -0.0218 34 LEU A CG    
129  C CD1   . LEU A 34 ? 0.6281 0.5338 0.7869 0.0088  0.0025  -0.0177 34 LEU A CD1   
130  C CD2   . LEU A 34 ? 0.4357 0.3259 0.5966 0.0246  0.0084  -0.0151 34 LEU A CD2   
131  N N     . GLU A 35 ? 0.5516 0.4791 0.6799 0.0526  0.0186  -0.0435 35 GLU A N     
132  C CA    . GLU A 35 ? 0.5118 0.4480 0.6301 0.0626  0.0234  -0.0472 35 GLU A CA    
133  C C     . GLU A 35 ? 0.5055 0.4391 0.6201 0.0780  0.0285  -0.0475 35 GLU A C     
134  O O     . GLU A 35 ? 0.5778 0.5072 0.6849 0.0873  0.0350  -0.0459 35 GLU A O     
135  C CB    . GLU A 35 ? 0.5935 0.5495 0.7108 0.0606  0.0208  -0.0534 35 GLU A CB    
136  C CG    . GLU A 35 ? 0.5648 0.5252 0.6836 0.0472  0.0176  -0.0527 35 GLU A CG    
137  C CD    . GLU A 35 ? 0.6440 0.6068 0.7533 0.0499  0.0222  -0.0526 35 GLU A CD    
138  O OE1   . GLU A 35 ? 0.5789 0.5371 0.6810 0.0619  0.0284  -0.0523 35 GLU A OE1   
139  O OE2   . GLU A 35 ? 0.5494 0.5178 0.6579 0.0404  0.0204  -0.0525 35 GLU A OE2   
140  N N     . LYS A 36 ? 0.5409 0.4762 0.6603 0.0807  0.0263  -0.0496 36 LYS A N     
141  C CA    . LYS A 36 ? 0.5230 0.4573 0.6388 0.0952  0.0307  -0.0499 36 LYS A CA    
142  C C     . LYS A 36 ? 0.6093 0.5253 0.7246 0.0999  0.0362  -0.0426 36 LYS A C     
143  O O     . LYS A 36 ? 0.7092 0.6248 0.8142 0.1116  0.0409  -0.0403 36 LYS A O     
144  C CB    . LYS A 36 ? 0.4187 0.3553 0.5400 0.0946  0.0270  -0.0538 36 LYS A CB    
145  N N     . GLU A 37 ? 0.7892 0.6931 0.9111 0.0886  0.0340  -0.0378 37 GLU A N     
146  C CA    . GLU A 37 ? 0.8313 0.7211 0.9512 0.0888  0.0376  -0.0308 37 GLU A CA    
147  C C     . GLU A 37 ? 0.8339 0.7193 0.9477 0.0888  0.0426  -0.0305 37 GLU A C     
148  O O     . GLU A 37 ? 0.8895 0.7681 0.9941 0.0907  0.0460  -0.0263 37 GLU A O     
149  C CB    . GLU A 37 ? 0.9059 0.7871 1.0374 0.0772  0.0332  -0.0257 37 GLU A CB    
150  C CG    . GLU A 37 ? 0.8725 0.7461 0.9991 0.0758  0.0349  -0.0183 37 GLU A CG    
151  C CD    . GLU A 37 ? 0.9414 0.8177 1.0574 0.0849  0.0362  -0.0170 37 GLU A CD    
152  O OE1   . GLU A 37 ? 1.0671 0.9493 1.1822 0.0898  0.0344  -0.0205 37 GLU A OE1   
153  O OE2   . GLU A 37 ? 1.0291 0.9015 1.1387 0.0869  0.0390  -0.0132 37 GLU A OE2   
154  N N     . PHE A 38 ? 0.5595 0.4533 0.6713 0.0830  0.0403  -0.0345 38 PHE A N     
155  C CA    . PHE A 38 ? 0.5001 0.3904 0.6039 0.0816  0.0449  -0.0350 38 PHE A CA    
156  C C     . PHE A 38 ? 0.4773 0.3685 0.5714 0.0975  0.0538  -0.0362 38 PHE A C     
157  O O     . PHE A 38 ? 0.5541 0.4365 0.6411 0.0994  0.0607  -0.0358 38 PHE A O     
158  C CB    . PHE A 38 ? 0.5253 0.4269 0.6276 0.0712  0.0398  -0.0384 38 PHE A CB    
159  C CG    . PHE A 38 ? 0.4670 0.3628 0.5619 0.0658  0.0434  -0.0389 38 PHE A CG    
160  C CD1   . PHE A 38 ? 0.3955 0.2804 0.4928 0.0540  0.0415  -0.0360 38 PHE A CD1   
161  C CD2   . PHE A 38 ? 0.5128 0.4153 0.5981 0.0722  0.0485  -0.0427 38 PHE A CD2   
162  C CE1   . PHE A 38 ? 0.4433 0.3230 0.5325 0.0480  0.0447  -0.0379 38 PHE A CE1   
163  C CE2   . PHE A 38 ? 0.3642 0.2598 0.4416 0.0672  0.0526  -0.0440 38 PHE A CE2   
164  C CZ    . PHE A 38 ? 0.5185 0.4022 0.5973 0.0546  0.0506  -0.0423 38 PHE A CZ    
165  N N     . LEU A 39 ? 0.8128 0.7155 0.9058 0.1086  0.0535  -0.0377 39 LEU A N     
166  C CA    . LEU A 39 ? 0.8738 0.7853 0.9539 0.1205  0.0563  -0.0371 39 LEU A CA    
167  C C     . LEU A 39 ? 0.8815 0.7816 0.9560 0.1195  0.0579  -0.0316 39 LEU A C     
168  O O     . LEU A 39 ? 1.0484 0.9464 1.1157 0.1232  0.0631  -0.0300 39 LEU A O     
169  C CB    . LEU A 39 ? 1.0139 0.9431 1.0956 0.1287  0.0528  -0.0404 39 LEU A CB    
170  C CG    . LEU A 39 ? 1.1013 1.0452 1.1773 0.1382  0.0556  -0.0401 39 LEU A CG    
171  C CD1   . LEU A 39 ? 1.2220 1.1872 1.3007 0.1441  0.0540  -0.0449 39 LEU A CD1   
172  C CD2   . LEU A 39 ? 0.9801 0.9184 1.0536 0.1394  0.0559  -0.0353 39 LEU A CD2   
173  N N     . PHE A 40 ? 0.8567 0.7496 0.9355 0.1144  0.0542  -0.0285 40 PHE A N     
174  C CA    . PHE A 40 ? 0.9920 0.8758 1.0679 0.1129  0.0561  -0.0232 40 PHE A CA    
175  C C     . PHE A 40 ? 0.9439 0.8120 1.0208 0.1038  0.0602  -0.0208 40 PHE A C     
176  O O     . PHE A 40 ? 0.9571 0.8180 1.0287 0.1046  0.0658  -0.0185 40 PHE A O     
177  C CB    . PHE A 40 ? 0.9430 0.8270 1.0232 0.1113  0.0513  -0.0209 40 PHE A CB    
178  C CG    . PHE A 40 ? 0.9945 0.8914 1.0727 0.1204  0.0492  -0.0230 40 PHE A CG    
179  C CD1   . PHE A 40 ? 1.0587 0.9689 1.1389 0.1255  0.0467  -0.0290 40 PHE A CD1   
180  C CD2   . PHE A 40 ? 0.9336 0.8297 1.0096 0.1231  0.0506  -0.0194 40 PHE A CD2   
181  C CE1   . PHE A 40 ? 1.1394 1.0623 1.2206 0.1325  0.0459  -0.0315 40 PHE A CE1   
182  C CE2   . PHE A 40 ? 0.9666 0.8745 1.0426 0.1303  0.0497  -0.0214 40 PHE A CE2   
183  C CZ    . PHE A 40 ? 1.1067 1.0280 1.1857 0.1347  0.0476  -0.0275 40 PHE A CZ    
184  N N     . ASN A 41 ? 0.7818 0.6446 0.8676 0.0942  0.0578  -0.0216 41 ASN A N     
185  C CA    . ASN A 41 ? 0.7511 0.6002 0.8412 0.0836  0.0605  -0.0202 41 ASN A CA    
186  C C     . ASN A 41 ? 0.7239 0.5697 0.8206 0.0755  0.0600  -0.0246 41 ASN A C     
187  O O     . ASN A 41 ? 0.8027 0.6525 0.9109 0.0690  0.0536  -0.0248 41 ASN A O     
188  C CB    . ASN A 41 ? 0.9606 0.8064 1.0601 0.0766  0.0567  -0.0150 41 ASN A CB    
189  C CG    . ASN A 41 ? 0.9541 0.8061 1.0493 0.0845  0.0555  -0.0117 41 ASN A CG    
190  O OD1   . ASN A 41 ? 0.8996 0.7487 0.9889 0.0884  0.0600  -0.0095 41 ASN A OD1   
191  N ND2   . ASN A 41 ? 1.0712 0.9311 1.1700 0.0863  0.0499  -0.0118 41 ASN A ND2   
192  N N     . ALA A 42 ? 0.5231 0.3622 0.6123 0.0752  0.0664  -0.0283 42 ALA A N     
193  C CA    . ALA A 42 ? 0.5556 0.3958 0.6445 0.0622  0.0628  -0.0321 42 ALA A CA    
194  C C     . ALA A 42 ? 0.5877 0.4222 0.6845 0.0474  0.0578  -0.0291 42 ALA A C     
195  O O     . ALA A 42 ? 0.5432 0.3863 0.6434 0.0350  0.0492  -0.0288 42 ALA A O     
196  C CB    . ALA A 42 ? 0.5835 0.4173 0.6598 0.0645  0.0712  -0.0367 42 ALA A CB    
197  N N     . TYR A 43 ? 0.4898 0.3108 0.5900 0.0492  0.0635  -0.0262 43 TYR A N     
198  C CA    . TYR A 43 ? 0.4518 0.2697 0.5615 0.0364  0.0590  -0.0225 43 TYR A CA    
199  C C     . TYR A 43 ? 0.4440 0.2634 0.5652 0.0421  0.0571  -0.0158 43 TYR A C     
200  O O     . TYR A 43 ? 0.4658 0.2868 0.5793 0.0515  0.0611  -0.0134 43 TYR A O     
201  C CB    . TYR A 43 ? 0.4063 0.2088 0.5115 0.0308  0.0669  -0.0250 43 TYR A CB    
202  C CG    . TYR A 43 ? 0.4263 0.2271 0.5192 0.0229  0.0685  -0.0322 43 TYR A CG    
203  C CD1   . TYR A 43 ? 0.3952 0.2015 0.4885 0.0057  0.0613  -0.0340 43 TYR A CD1   
204  C CD2   . TYR A 43 ? 0.4821 0.2768 0.5625 0.0334  0.0775  -0.0368 43 TYR A CD2   
205  C CE1   . TYR A 43 ? 0.4723 0.2770 0.5529 -0.0015 0.0631  -0.0412 43 TYR A CE1   
206  C CE2   . TYR A 43 ? 0.3712 0.1635 0.4398 0.0269  0.0800  -0.0436 43 TYR A CE2   
207  C CZ    . TYR A 43 ? 0.3999 0.1967 0.4682 0.0092  0.0728  -0.0462 43 TYR A CZ    
208  O OH    . TYR A 43 ? 0.4084 0.2029 0.4637 0.0027  0.0756  -0.0535 43 TYR A OH    
209  N N     . VAL A 44 ? 0.3763 0.2041 0.5087 0.0344  0.0480  -0.0117 44 VAL A N     
210  C CA    . VAL A 44 ? 0.4780 0.3109 0.6187 0.0396  0.0453  -0.0055 44 VAL A CA    
211  C C     . VAL A 44 ? 0.4730 0.3041 0.6259 0.0304  0.0431  0.0007  44 VAL A C     
212  O O     . VAL A 44 ? 0.5013 0.3330 0.6586 0.0172  0.0391  0.0008  44 VAL A O     
213  C CB    . VAL A 44 ? 0.5520 0.3940 0.6986 0.0409  0.0382  -0.0051 44 VAL A CB    
214  C CG1   . VAL A 44 ? 0.5285 0.3781 0.6807 0.0264  0.0295  -0.0029 44 VAL A CG1   
215  C CG2   . VAL A 44 ? 0.4525 0.3016 0.6000 0.0470  0.0363  -0.0005 44 VAL A CG2   
216  N N     . SER A 45 ? 0.7211 0.5563 0.8750 0.0360  0.0443  0.0056  45 SER A N     
217  C CA    . SER A 45 ? 0.6947 0.5304 0.8617 0.0292  0.0432  0.0120  45 SER A CA    
218  C C     . SER A 45 ? 0.7316 0.5744 0.9140 0.0214  0.0343  0.0176  45 SER A C     
219  O O     . SER A 45 ? 0.7822 0.6299 0.9645 0.0234  0.0297  0.0172  45 SER A O     
220  C CB    . SER A 45 ? 0.5969 0.4364 0.7611 0.0381  0.0470  0.0157  45 SER A CB    
221  O OG    . SER A 45 ? 0.7764 0.6207 0.9561 0.0332  0.0444  0.0229  45 SER A OG    
222  N N     . LYS A 46 ? 0.5151 0.3592 0.7115 0.0121  0.0321  0.0235  46 LYS A N     
223  C CA    . LYS A 46 ? 0.5174 0.3717 0.7279 0.0048  0.0233  0.0313  46 LYS A CA    
224  C C     . LYS A 46 ? 0.5044 0.3655 0.7189 0.0149  0.0227  0.0366  46 LYS A C     
225  O O     . LYS A 46 ? 0.5300 0.3978 0.7532 0.0126  0.0166  0.0423  46 LYS A O     
226  C CB    . LYS A 46 ? 0.5627 0.4244 0.7829 -0.0076 0.0206  0.0361  46 LYS A CB    
227  N N     . GLN A 47 ? 0.5088 0.3692 0.7142 0.0252  0.0292  0.0343  47 GLN A N     
228  C CA    . GLN A 47 ? 0.6496 0.5167 0.8543 0.0331  0.0292  0.0372  47 GLN A CA    
229  C C     . GLN A 47 ? 0.6137 0.4801 0.8034 0.0405  0.0292  0.0306  47 GLN A C     
230  O O     . GLN A 47 ? 0.5785 0.4487 0.7697 0.0424  0.0264  0.0319  47 GLN A O     
231  C CB    . GLN A 47 ? 0.6048 0.4725 0.8085 0.0385  0.0353  0.0395  47 GLN A CB    
232  C CG    . GLN A 47 ? 0.7886 0.6628 0.9943 0.0440  0.0350  0.0434  47 GLN A CG    
233  C CD    . GLN A 47 ? 0.8249 0.6977 1.0183 0.0528  0.0408  0.0411  47 GLN A CD    
234  O OE1   . GLN A 47 ? 0.8360 0.7041 1.0140 0.0576  0.0434  0.0351  47 GLN A OE1   
235  N NE2   . GLN A 47 ? 0.9075 0.7848 1.1076 0.0552  0.0424  0.0465  47 GLN A NE2   
236  N N     . LYS A 48 ? 0.9406 0.8021 1.1163 0.0447  0.0326  0.0235  48 LYS A N     
237  C CA    . LYS A 48 ? 0.9833 0.8457 1.1472 0.0512  0.0319  0.0174  48 LYS A CA    
238  C C     . LYS A 48 ? 0.9569 0.8202 1.1283 0.0449  0.0264  0.0165  48 LYS A C     
239  O O     . LYS A 48 ? 0.9958 0.8610 1.1642 0.0478  0.0245  0.0131  48 LYS A O     
240  C CB    . LYS A 48 ? 0.9013 0.7604 1.0502 0.0578  0.0365  0.0114  48 LYS A CB    
241  C CG    . LYS A 48 ? 0.9560 0.8181 1.0948 0.0648  0.0353  0.0052  48 LYS A CG    
242  C CD    . LYS A 48 ? 1.1952 1.0591 1.3198 0.0755  0.0385  0.0027  48 LYS A CD    
243  C CE    . LYS A 48 ? 1.2789 1.1478 1.3987 0.0818  0.0358  -0.0013 48 LYS A CE    
244  N NZ    . LYS A 48 ? 1.2934 1.1653 1.4020 0.0918  0.0374  -0.0030 48 LYS A NZ    
245  N N     . ARG A 49 ? 0.6839 0.5453 0.8656 0.0355  0.0236  0.0196  49 ARG A N     
246  C CA    . ARG A 49 ? 0.6460 0.5087 0.8365 0.0278  0.0173  0.0212  49 ARG A CA    
247  C C     . ARG A 49 ? 0.6432 0.5113 0.8430 0.0273  0.0137  0.0281  49 ARG A C     
248  O O     . ARG A 49 ? 0.7349 0.6038 0.9370 0.0256  0.0104  0.0278  49 ARG A O     
249  C CB    . ARG A 49 ? 0.5718 0.4336 0.7681 0.0160  0.0140  0.0237  49 ARG A CB    
250  C CG    . ARG A 49 ? 0.6687 0.5405 0.8682 0.0059  0.0060  0.0278  49 ARG A CG    
251  C CD    . ARG A 49 ? 0.7767 0.6563 0.9779 -0.0066 0.0017  0.0318  49 ARG A CD    
252  N NE    . ARG A 49 ? 0.7455 0.6219 0.9342 -0.0107 0.0048  0.0235  49 ARG A NE    
253  C CZ    . ARG A 49 ? 0.8871 0.7649 1.0760 -0.0191 0.0048  0.0237  49 ARG A CZ    
254  N NH1   . ARG A 49 ? 0.7079 0.5932 0.9098 -0.0245 0.0010  0.0323  49 ARG A NH1   
255  N NH2   . ARG A 49 ? 0.8818 0.7537 1.0581 -0.0223 0.0090  0.0151  49 ARG A NH2   
256  N N     . TRP A 50 ? 0.6892 0.5605 0.8949 0.0286  0.0151  0.0344  50 TRP A N     
257  C CA    . TRP A 50 ? 0.7667 0.6430 0.9812 0.0292  0.0131  0.0414  50 TRP A CA    
258  C C     . TRP A 50 ? 0.6393 0.5137 0.8441 0.0362  0.0153  0.0358  50 TRP A C     
259  O O     . TRP A 50 ? 0.6345 0.5091 0.8440 0.0347  0.0130  0.0378  50 TRP A O     
260  C CB    . TRP A 50 ? 0.7151 0.5957 0.9375 0.0308  0.0155  0.0483  50 TRP A CB    
261  C CG    . TRP A 50 ? 0.6991 0.5850 0.9312 0.0317  0.0141  0.0561  50 TRP A CG    
262  C CD1   . TRP A 50 ? 0.7236 0.6158 0.9716 0.0258  0.0092  0.0666  50 TRP A CD1   
263  C CD2   . TRP A 50 ? 0.6807 0.5657 0.9069 0.0391  0.0178  0.0545  50 TRP A CD2   
264  N NE1   . TRP A 50 ? 0.6922 0.5875 0.9448 0.0300  0.0106  0.0717  50 TRP A NE1   
265  C CE2   . TRP A 50 ? 0.6959 0.5858 0.9349 0.0377  0.0160  0.0638  50 TRP A CE2   
266  C CE3   . TRP A 50 ? 0.6763 0.5566 0.8871 0.0467  0.0222  0.0466  50 TRP A CE3   
267  C CZ2   . TRP A 50 ? 0.6430 0.5313 0.8797 0.0435  0.0195  0.0643  50 TRP A CZ2   
268  C CZ3   . TRP A 50 ? 0.6765 0.5554 0.8851 0.0518  0.0245  0.0471  50 TRP A CZ3   
269  C CH2   . TRP A 50 ? 0.6377 0.5197 0.8589 0.0501  0.0236  0.0555  50 TRP A CH2   
270  N N     . GLU A 51 ? 0.7577 0.6298 0.9491 0.0436  0.0197  0.0290  51 GLU A N     
271  C CA    . GLU A 51 ? 0.7294 0.5995 0.9110 0.0502  0.0213  0.0229  51 GLU A CA    
272  C C     . GLU A 51 ? 0.8459 0.7142 1.0279 0.0475  0.0185  0.0175  51 GLU A C     
273  O O     . GLU A 51 ? 0.8518 0.7183 1.0356 0.0479  0.0179  0.0159  51 GLU A O     
274  C CB    . GLU A 51 ? 0.7934 0.6625 0.9601 0.0586  0.0254  0.0174  51 GLU A CB    
275  C CG    . GLU A 51 ? 0.8917 0.7618 1.0585 0.0597  0.0286  0.0220  51 GLU A CG    
276  C CD    . GLU A 51 ? 1.0067 0.8756 1.1584 0.0683  0.0324  0.0175  51 GLU A CD    
277  O OE1   . GLU A 51 ? 0.9827 0.8515 1.1255 0.0750  0.0324  0.0133  51 GLU A OE1   
278  O OE2   . GLU A 51 ? 1.0292 0.8970 1.1783 0.0685  0.0352  0.0182  51 GLU A OE2   
279  N N     . LEU A 52 ? 0.7036 0.5717 0.8848 0.0445  0.0173  0.0145  52 LEU A N     
280  C CA    . LEU A 52 ? 0.6013 0.4685 0.7846 0.0413  0.0147  0.0090  52 LEU A CA    
281  C C     . LEU A 52 ? 0.5667 0.4332 0.7620 0.0335  0.0106  0.0145  52 LEU A C     
282  O O     . LEU A 52 ? 0.6514 0.5158 0.8481 0.0335  0.0103  0.0110  52 LEU A O     
283  C CB    . LEU A 52 ? 0.6697 0.5361 0.8514 0.0383  0.0143  0.0062  52 LEU A CB    
284  C CG    . LEU A 52 ? 0.6318 0.4993 0.8028 0.0457  0.0178  -0.0031 52 LEU A CG    
285  C CD1   . LEU A 52 ? 0.7019 0.5711 0.8609 0.0559  0.0222  -0.0045 52 LEU A CD1   
286  C CD2   . LEU A 52 ? 0.7769 0.6426 0.9446 0.0429  0.0191  -0.0044 52 LEU A CD2   
287  N N     . ALA A 53 ? 0.4847 0.3527 0.6885 0.0268  0.0076  0.0235  53 ALA A N     
288  C CA    . ALA A 53 ? 0.4454 0.3142 0.6601 0.0196  0.0035  0.0317  53 ALA A CA    
289  C C     . ALA A 53 ? 0.5073 0.3745 0.7238 0.0235  0.0058  0.0332  53 ALA A C     
290  O O     . ALA A 53 ? 0.4663 0.3308 0.6873 0.0196  0.0047  0.0345  53 ALA A O     
291  C CB    . ALA A 53 ? 0.4227 0.2960 0.6462 0.0140  0.0003  0.0424  53 ALA A CB    
292  N N     . ARG A 54 ? 0.7251 0.5928 0.9372 0.0306  0.0097  0.0329  54 ARG A N     
293  C CA    . ARG A 54 ? 0.7275 0.5922 0.9399 0.0346  0.0127  0.0340  54 ARG A CA    
294  C C     . ARG A 54 ? 0.7133 0.5717 0.9182 0.0378  0.0148  0.0233  54 ARG A C     
295  O O     . ARG A 54 ? 0.7521 0.6050 0.9595 0.0377  0.0165  0.0229  54 ARG A O     
296  C CB    . ARG A 54 ? 0.7238 0.5910 0.9337 0.0407  0.0159  0.0371  54 ARG A CB    
297  C CG    . ARG A 54 ? 0.8495 0.7116 1.0505 0.0480  0.0203  0.0315  54 ARG A CG    
298  C CD    . ARG A 54 ? 0.8423 0.7071 1.0408 0.0533  0.0233  0.0351  54 ARG A CD    
299  N NE    . ARG A 54 ? 0.9425 0.8018 1.1348 0.0597  0.0269  0.0320  54 ARG A NE    
300  C CZ    . ARG A 54 ? 1.0690 0.9263 1.2679 0.0605  0.0288  0.0377  54 ARG A CZ    
301  N NH1   . ARG A 54 ? 1.0266 0.8773 1.2188 0.0665  0.0324  0.0336  54 ARG A NH1   
302  N NH2   . ARG A 54 ? 1.0261 0.8878 1.2386 0.0559  0.0272  0.0475  54 ARG A NH2   
303  N N     . ASN A 55 ? 0.5616 0.4209 0.7582 0.0407  0.0152  0.0146  55 ASN A N     
304  C CA    . ASN A 55 ? 0.5724 0.4282 0.7635 0.0442  0.0168  0.0037  55 ASN A CA    
305  C C     . ASN A 55 ? 0.6162 0.4702 0.8141 0.0373  0.0142  -0.0012 55 ASN A C     
306  O O     . ASN A 55 ? 0.6191 0.4686 0.8184 0.0367  0.0153  -0.0086 55 ASN A O     
307  C CB    . ASN A 55 ? 0.5219 0.3814 0.7010 0.0522  0.0188  -0.0032 55 ASN A CB    
308  C CG    . ASN A 55 ? 0.5759 0.4358 0.7467 0.0592  0.0219  0.0003  55 ASN A CG    
309  O OD1   . ASN A 55 ? 0.7572 0.6167 0.9329 0.0574  0.0221  0.0085  55 ASN A OD1   
310  N ND2   . ASN A 55 ? 0.6583 0.5200 0.8169 0.0675  0.0241  -0.0057 55 ASN A ND2   
311  N N     . LEU A 56 ? 0.5294 0.3864 0.7319 0.0313  0.0107  0.0023  56 LEU A N     
312  C CA    . LEU A 56 ? 0.4588 0.3151 0.6668 0.0236  0.0080  -0.0021 56 LEU A CA    
313  C C     . LEU A 56 ? 0.4604 0.3142 0.6775 0.0143  0.0057  0.0081  56 LEU A C     
314  O O     . LEU A 56 ? 0.5368 0.3969 0.7521 0.0055  0.0030  0.0075  56 LEU A O     
315  C CB    . LEU A 56 ? 0.4661 0.3338 0.6640 0.0218  0.0059  -0.0056 56 LEU A CB    
316  C CG    . LEU A 56 ? 0.4662 0.3371 0.6545 0.0320  0.0089  -0.0131 56 LEU A CG    
317  C CD1   . LEU A 56 ? 0.4007 0.2830 0.5791 0.0292  0.0076  -0.0182 56 LEU A CD1   
318  C CD2   . LEU A 56 ? 0.5057 0.3748 0.6923 0.0399  0.0118  -0.0219 56 LEU A CD2   
319  N N     . GLN A 57 ? 0.3678 0.2206 0.5875 0.0163  0.0069  0.0176  57 GLN A N     
320  C CA    . GLN A 57 ? 0.4472 0.2992 0.6752 0.0100  0.0055  0.0290  57 GLN A CA    
321  C C     . GLN A 57 ? 0.4430 0.3004 0.6750 0.0017  0.0003  0.0358  57 GLN A C     
322  O O     . GLN A 57 ? 0.3723 0.2313 0.6058 -0.0065 -0.0014 0.0378  57 GLN A O     
323  C CB    . GLN A 57 ? 0.4145 0.2588 0.6456 0.0062  0.0079  0.0257  57 GLN A CB    
324  C CG    . GLN A 57 ? 0.4327 0.2702 0.6591 0.0129  0.0127  0.0165  57 GLN A CG    
325  C CD    . GLN A 57 ? 0.5161 0.3501 0.7432 0.0181  0.0163  0.0240  57 GLN A CD    
326  O OE1   . GLN A 57 ? 0.5125 0.3481 0.7462 0.0160  0.0158  0.0361  57 GLN A OE1   
327  N NE2   . GLN A 57 ? 0.5162 0.3461 0.7368 0.0253  0.0201  0.0171  57 GLN A NE2   
328  N N     . LEU A 58 ? 0.5442 0.4068 0.7744 0.0030  -0.0017 0.0385  58 LEU A N     
329  C CA    . LEU A 58 ? 0.4548 0.3289 0.6808 -0.0054 -0.0065 0.0429  58 LEU A CA    
330  C C     . LEU A 58 ? 0.4339 0.3119 0.6660 -0.0049 -0.0085 0.0530  58 LEU A C     
331  O O     . LEU A 58 ? 0.4785 0.3523 0.7162 0.0026  -0.0056 0.0557  58 LEU A O     
332  C CB    . LEU A 58 ? 0.4632 0.3432 0.6757 -0.0063 -0.0068 0.0313  58 LEU A CB    
333  C CG    . LEU A 58 ? 0.5299 0.4115 0.7360 -0.0079 -0.0057 0.0212  58 LEU A CG    
334  C CD1   . LEU A 58 ? 0.4647 0.3490 0.6600 -0.0018 -0.0035 0.0096  58 LEU A CD1   
335  C CD2   . LEU A 58 ? 0.3945 0.2850 0.5978 -0.0186 -0.0091 0.0242  58 LEU A CD2   
336  N N     . THR A 59 ? 0.4108 0.3001 0.6399 -0.0132 -0.0132 0.0578  59 THR A N     
337  C CA    . THR A 59 ? 0.3737 0.2697 0.6079 -0.0144 -0.0156 0.0658  59 THR A CA    
338  C C     . THR A 59 ? 0.3986 0.2940 0.6241 -0.0130 -0.0140 0.0566  59 THR A C     
339  O O     . THR A 59 ? 0.5534 0.4446 0.7683 -0.0106 -0.0112 0.0454  59 THR A O     
340  C CB    . THR A 59 ? 0.4008 0.3110 0.6355 -0.0246 -0.0218 0.0753  59 THR A CB    
341  O OG1   . THR A 59 ? 0.4946 0.4117 0.7156 -0.0319 -0.0241 0.0672  59 THR A OG1   
342  C CG2   . THR A 59 ? 0.3087 0.2186 0.5483 -0.0266 -0.0224 0.0828  59 THR A CG2   
343  N N     . GLU A 60 ? 0.5155 0.4154 0.7460 -0.0142 -0.0150 0.0617  60 GLU A N     
344  C CA    . GLU A 60 ? 0.5558 0.4537 0.7783 -0.0142 -0.0126 0.0537  60 GLU A CA    
345  C C     . GLU A 60 ? 0.5456 0.4509 0.7555 -0.0242 -0.0157 0.0482  60 GLU A C     
346  O O     . GLU A 60 ? 0.5913 0.4916 0.7899 -0.0232 -0.0121 0.0382  60 GLU A O     
347  C CB    . GLU A 60 ? 0.6519 0.5526 0.8847 -0.0139 -0.0123 0.0605  60 GLU A CB    
348  C CG    . GLU A 60 ? 0.5790 0.4712 0.8228 -0.0024 -0.0074 0.0644  60 GLU A CG    
349  C CD    . GLU A 60 ? 0.7176 0.6123 0.9704 -0.0016 -0.0057 0.0692  60 GLU A CD    
350  O OE1   . GLU A 60 ? 0.7222 0.6144 0.9679 -0.0039 -0.0031 0.0624  60 GLU A OE1   
351  O OE2   . GLU A 60 ? 0.8072 0.7062 1.0744 0.0012  -0.0062 0.0801  60 GLU A OE2   
352  N N     . ARG A 61 ? 0.4607 0.3777 0.6720 -0.0331 -0.0217 0.0553  61 ARG A N     
353  C CA    . ARG A 61 ? 0.4512 0.3761 0.6498 -0.0428 -0.0248 0.0506  61 ARG A CA    
354  C C     . ARG A 61 ? 0.5683 0.4884 0.7566 -0.0405 -0.0221 0.0420  61 ARG A C     
355  O O     . ARG A 61 ? 0.5998 0.5197 0.7752 -0.0431 -0.0203 0.0328  61 ARG A O     
356  C CB    . ARG A 61 ? 0.3552 0.2956 0.5582 -0.0518 -0.0319 0.0618  61 ARG A CB    
357  C CG    . ARG A 61 ? 0.4735 0.4242 0.6629 -0.0625 -0.0354 0.0577  61 ARG A CG    
358  C CD    . ARG A 61 ? 0.4802 0.4483 0.6744 -0.0702 -0.0426 0.0705  61 ARG A CD    
359  N NE    . ARG A 61 ? 0.8119 0.7890 0.9933 -0.0782 -0.0454 0.0685  61 ARG A NE    
360  C CZ    . ARG A 61 ? 0.8715 0.8618 1.0435 -0.0885 -0.0497 0.0670  61 ARG A CZ    
361  N NH1   . ARG A 61 ? 0.8568 0.8530 1.0316 -0.0931 -0.0522 0.0668  61 ARG A NH1   
362  N NH2   . ARG A 61 ? 0.7156 0.7136 0.8754 -0.0947 -0.0515 0.0655  61 ARG A NH2   
363  N N     . GLN A 62 ? 0.4230 0.3394 0.6175 -0.0357 -0.0213 0.0448  62 GLN A N     
364  C CA    . GLN A 62 ? 0.3681 0.2818 0.5554 -0.0339 -0.0189 0.0368  62 GLN A CA    
365  C C     . GLN A 62 ? 0.4526 0.3593 0.6311 -0.0266 -0.0136 0.0249  62 GLN A C     
366  O O     . GLN A 62 ? 0.5095 0.4189 0.6767 -0.0280 -0.0122 0.0170  62 GLN A O     
367  C CB    . GLN A 62 ? 0.3791 0.2876 0.5761 -0.0299 -0.0180 0.0408  62 GLN A CB    
368  C CG    . GLN A 62 ? 0.3880 0.3030 0.5905 -0.0370 -0.0216 0.0514  62 GLN A CG    
369  C CD    . GLN A 62 ? 0.4306 0.3378 0.6403 -0.0342 -0.0189 0.0523  62 GLN A CD    
370  O OE1   . GLN A 62 ? 0.4567 0.3544 0.6758 -0.0275 -0.0163 0.0548  62 GLN A OE1   
371  N NE2   . GLN A 62 ? 0.5653 0.4761 0.7705 -0.0398 -0.0190 0.0497  62 GLN A NE2   
372  N N     . VAL A 63 ? 0.4266 0.3248 0.6104 -0.0179 -0.0101 0.0244  63 VAL A N     
373  C CA    . VAL A 63 ? 0.4567 0.3483 0.6328 -0.0095 -0.0044 0.0151  63 VAL A CA    
374  C C     . VAL A 63 ? 0.5024 0.3947 0.6686 -0.0137 -0.0030 0.0111  63 VAL A C     
375  O O     . VAL A 63 ? 0.5617 0.4523 0.7169 -0.0103 0.0010  0.0028  63 VAL A O     
376  C CB    . VAL A 63 ? 0.4239 0.3067 0.6079 0.0004  -0.0007 0.0170  63 VAL A CB    
377  C CG1   . VAL A 63 ? 0.4939 0.3706 0.6693 0.0094  0.0057  0.0091  63 VAL A CG1   
378  C CG2   . VAL A 63 ? 0.3944 0.2742 0.5860 0.0054  -0.0006 0.0183  63 VAL A CG2   
379  N N     . LYS A 64 ? 0.4289 0.3241 0.5993 -0.0212 -0.0061 0.0171  64 LYS A N     
380  C CA    . LYS A 64 ? 0.4673 0.3628 0.6287 -0.0278 -0.0051 0.0130  64 LYS A CA    
381  C C     . LYS A 64 ? 0.5296 0.4303 0.6776 -0.0333 -0.0056 0.0067  64 LYS A C     
382  O O     . LYS A 64 ? 0.5128 0.4083 0.6494 -0.0321 -0.0005 -0.0015 64 LYS A O     
383  C CB    . LYS A 64 ? 0.5037 0.4067 0.6728 -0.0375 -0.0103 0.0209  64 LYS A CB    
384  C CG    . LYS A 64 ? 0.5641 0.4680 0.7244 -0.0467 -0.0097 0.0157  64 LYS A CG    
385  C CD    . LYS A 64 ? 0.5005 0.4201 0.6612 -0.0598 -0.0179 0.0214  64 LYS A CD    
386  C CE    . LYS A 64 ? 0.5740 0.4957 0.7254 -0.0708 -0.0179 0.0152  64 LYS A CE    
387  N NZ    . LYS A 64 ? 0.6653 0.6048 0.8222 -0.0826 -0.0266 0.0231  64 LYS A NZ    
388  N N     . ILE A 65 ? 0.4098 0.3201 0.5594 -0.0387 -0.0109 0.0110  65 ILE A N     
389  C CA    . ILE A 65 ? 0.3634 0.2802 0.5012 -0.0440 -0.0113 0.0061  65 ILE A CA    
390  C C     . ILE A 65 ? 0.3145 0.2276 0.4457 -0.0351 -0.0058 -0.0023 65 ILE A C     
391  O O     . ILE A 65 ? 0.3939 0.3069 0.5129 -0.0351 -0.0021 -0.0097 65 ILE A O     
392  C CB    . ILE A 65 ? 0.4380 0.3660 0.5802 -0.0513 -0.0175 0.0142  65 ILE A CB    
393  C CG1   . ILE A 65 ? 0.5224 0.4584 0.6695 -0.0601 -0.0235 0.0232  65 ILE A CG1   
394  C CG2   . ILE A 65 ? 0.4541 0.3891 0.5845 -0.0556 -0.0170 0.0091  65 ILE A CG2   
395  C CD1   . ILE A 65 ? 0.4972 0.4370 0.6326 -0.0685 -0.0239 0.0180  65 ILE A CD1   
396  N N     . TRP A 66 ? 0.3731 0.2840 0.5123 -0.0275 -0.0052 -0.0013 66 TRP A N     
397  C CA    . TRP A 66 ? 0.4457 0.3575 0.5802 -0.0197 -0.0013 -0.0088 66 TRP A CA    
398  C C     . TRP A 66 ? 0.4249 0.3308 0.5493 -0.0118 0.0055  -0.0163 66 TRP A C     
399  O O     . TRP A 66 ? 0.4731 0.3833 0.5883 -0.0091 0.0088  -0.0225 66 TRP A O     
400  C CB    . TRP A 66 ? 0.4611 0.3702 0.6056 -0.0126 -0.0013 -0.0077 66 TRP A CB    
401  C CG    . TRP A 66 ? 0.4519 0.3663 0.5926 -0.0067 0.0012  -0.0152 66 TRP A CG    
402  C CD1   . TRP A 66 ? 0.4495 0.3723 0.5928 -0.0113 -0.0012 -0.0162 66 TRP A CD1   
403  C CD2   . TRP A 66 ? 0.4702 0.3837 0.6043 0.0045  0.0066  -0.0224 66 TRP A CD2   
404  N NE1   . TRP A 66 ? 0.4777 0.4066 0.6170 -0.0043 0.0017  -0.0242 66 TRP A NE1   
405  C CE2   . TRP A 66 ? 0.5073 0.4314 0.6406 0.0061  0.0064  -0.0278 66 TRP A CE2   
406  C CE3   . TRP A 66 ? 0.4094 0.3148 0.5386 0.0136  0.0120  -0.0243 66 TRP A CE3   
407  C CZ2   . TRP A 66 ? 0.4797 0.4088 0.6072 0.0170  0.0106  -0.0346 66 TRP A CZ2   
408  C CZ3   . TRP A 66 ? 0.4499 0.3582 0.5729 0.0251  0.0170  -0.0304 66 TRP A CZ3   
409  C CH2   . TRP A 66 ? 0.4852 0.4065 0.6074 0.0270  0.0159  -0.0353 66 TRP A CH2   
410  N N     . PHE A 67 ? 0.5170 0.4128 0.6436 -0.0077 0.0084  -0.0151 67 PHE A N     
411  C CA    . PHE A 67 ? 0.5406 0.4280 0.6583 0.0002  0.0162  -0.0208 67 PHE A CA    
412  C C     . PHE A 67 ? 0.5413 0.4277 0.6476 -0.0073 0.0183  -0.0248 67 PHE A C     
413  O O     . PHE A 67 ? 0.5964 0.4788 0.6922 -0.0012 0.0252  -0.0309 67 PHE A O     
414  C CB    . PHE A 67 ? 0.5671 0.4436 0.6911 0.0054  0.0194  -0.0176 67 PHE A CB    
415  C CG    . PHE A 67 ? 0.6010 0.4754 0.7298 0.0183  0.0220  -0.0175 67 PHE A CG    
416  C CD1   . PHE A 67 ? 0.6076 0.4755 0.7299 0.0307  0.0301  -0.0213 67 PHE A CD1   
417  C CD2   . PHE A 67 ? 0.6229 0.5015 0.7619 0.0184  0.0170  -0.0136 67 PHE A CD2   
418  C CE1   . PHE A 67 ? 0.5798 0.4479 0.7053 0.0427  0.0322  -0.0213 67 PHE A CE1   
419  C CE2   . PHE A 67 ? 0.5444 0.4213 0.6864 0.0296  0.0195  -0.0148 67 PHE A CE2   
420  C CZ    . PHE A 67 ? 0.6091 0.4819 0.7440 0.0418  0.0267  -0.0187 67 PHE A CZ    
421  N N     . GLN A 68 ? 0.4020 0.2924 0.5098 -0.0202 0.0126  -0.0211 68 GLN A N     
422  C CA    . GLN A 68 ? 0.3527 0.2433 0.4485 -0.0289 0.0138  -0.0257 68 GLN A CA    
423  C C     . GLN A 68 ? 0.3904 0.2890 0.4765 -0.0280 0.0153  -0.0305 68 GLN A C     
424  O O     . GLN A 68 ? 0.5306 0.4245 0.6045 -0.0257 0.0219  -0.0374 68 GLN A O     
425  C CB    . GLN A 68 ? 0.4192 0.3172 0.5187 -0.0430 0.0061  -0.0203 68 GLN A CB    
426  C CG    . GLN A 68 ? 0.4520 0.3436 0.5584 -0.0465 0.0058  -0.0174 68 GLN A CG    
427  C CD    . GLN A 68 ? 0.5017 0.4044 0.6104 -0.0608 -0.0021 -0.0126 68 GLN A CD    
428  O OE1   . GLN A 68 ? 0.5323 0.4475 0.6393 -0.0669 -0.0080 -0.0091 68 GLN A OE1   
429  N NE2   . GLN A 68 ? 0.5286 0.4282 0.6415 -0.0663 -0.0022 -0.0119 68 GLN A NE2   
430  N N     . ASN A 69 ? 0.5720 0.4821 0.6641 -0.0297 0.0097  -0.0265 69 ASN A N     
431  C CA    . ASN A 69 ? 0.5936 0.5135 0.6790 -0.0293 0.0108  -0.0301 69 ASN A CA    
432  C C     . ASN A 69 ? 0.5651 0.4834 0.6468 -0.0159 0.0179  -0.0360 69 ASN A C     
433  O O     . ASN A 69 ? 0.5495 0.4711 0.6208 -0.0134 0.0228  -0.0413 69 ASN A O     
434  C CB    . ASN A 69 ? 0.4878 0.4191 0.5824 -0.0345 0.0040  -0.0240 69 ASN A CB    
435  C CG    . ASN A 69 ? 0.5460 0.4839 0.6403 -0.0475 -0.0020 -0.0179 69 ASN A CG    
436  O OD1   . ASN A 69 ? 0.6316 0.5693 0.7154 -0.0537 -0.0013 -0.0205 69 ASN A OD1   
437  N ND2   . ASN A 69 ? 0.5821 0.5257 0.6871 -0.0515 -0.0076 -0.0099 69 ASN A ND2   
438  N N     . ARG A 70 ? 0.4638 0.3782 0.5536 -0.0068 0.0186  -0.0348 70 ARG A N     
439  C CA    . ARG A 70 ? 0.4405 0.3562 0.5275 0.0069  0.0245  -0.0394 70 ARG A CA    
440  C C     . ARG A 70 ? 0.5453 0.4515 0.6203 0.0136  0.0337  -0.0440 70 ARG A C     
441  O O     . ARG A 70 ? 0.5795 0.4910 0.6478 0.0225  0.0392  -0.0481 70 ARG A O     
442  C CB    . ARG A 70 ? 0.4131 0.3250 0.5096 0.0151  0.0239  -0.0371 70 ARG A CB    
443  C CG    . ARG A 70 ? 0.4155 0.3330 0.5097 0.0293  0.0286  -0.0412 70 ARG A CG    
444  C CD    . ARG A 70 ? 0.5225 0.4576 0.6172 0.0278  0.0259  -0.0443 70 ARG A CD    
445  N NE    . ARG A 70 ? 0.4867 0.4310 0.5803 0.0409  0.0291  -0.0481 70 ARG A NE    
446  C CZ    . ARG A 70 ? 0.4616 0.4094 0.5462 0.0516  0.0362  -0.0510 70 ARG A CZ    
447  N NH1   . ARG A 70 ? 0.5443 0.4844 0.6198 0.0502  0.0414  -0.0514 70 ARG A NH1   
448  N NH2   . ARG A 70 ? 0.5288 0.4883 0.6133 0.0638  0.0383  -0.0534 70 ARG A NH2   
449  N N     . ARG A 71 ? 0.5801 0.4727 0.6528 0.0090  0.0356  -0.0434 71 ARG A N     
450  C CA    . ARG A 71 ? 0.6253 0.5048 0.6868 0.0140  0.0455  -0.0480 71 ARG A CA    
451  C C     . ARG A 71 ? 0.6679 0.5516 0.7170 0.0102  0.0487  -0.0532 71 ARG A C     
452  O O     . ARG A 71 ? 0.6338 0.5150 0.6744 0.0206  0.0575  -0.0571 71 ARG A O     
453  C CB    . ARG A 71 ? 0.6171 0.4819 0.6799 0.0068  0.0463  -0.0469 71 ARG A CB    
454  C CG    . ARG A 71 ? 0.5244 0.3818 0.5974 0.0140  0.0471  -0.0423 71 ARG A CG    
455  C CD    . ARG A 71 ? 0.5080 0.3490 0.5803 0.0098  0.0521  -0.0427 71 ARG A CD    
456  N NE    . ARG A 71 ? 0.5316 0.3756 0.6087 -0.0065 0.0443  -0.0406 71 ARG A NE    
457  C CZ    . ARG A 71 ? 0.5015 0.3519 0.5918 -0.0108 0.0364  -0.0336 71 ARG A CZ    
458  N NH1   . ARG A 71 ? 0.5033 0.3557 0.6025 -0.0006 0.0354  -0.0291 71 ARG A NH1   
459  N NH2   . ARG A 71 ? 0.4521 0.3076 0.5462 -0.0249 0.0296  -0.0310 71 ARG A NH2   
460  N N     . MET A 72 ? 0.5625 0.4533 0.6106 -0.0039 0.0420  -0.0525 72 MET A N     
461  C CA    . MET A 72 ? 0.6056 0.5021 0.6418 -0.0084 0.0444  -0.0571 72 MET A CA    
462  C C     . MET A 72 ? 0.6015 0.5119 0.6371 0.0010  0.0467  -0.0582 72 MET A C     
463  O O     . MET A 72 ? 0.6666 0.5781 0.6915 0.0052  0.0538  -0.0629 72 MET A O     
464  C CB    . MET A 72 ? 0.5292 0.4350 0.5661 -0.0244 0.0355  -0.0543 72 MET A CB    
465  C CG    . MET A 72 ? 0.6666 0.5628 0.7010 -0.0356 0.0334  -0.0547 72 MET A CG    
466  S SD    . MET A 72 ? 0.6803 0.5579 0.6979 -0.0351 0.0453  -0.0649 72 MET A SD    
467  C CE    . MET A 72 ? 0.6234 0.4829 0.6492 -0.0270 0.0504  -0.0636 72 MET A CE    
468  N N     . LYS A 73 ? 0.6157 0.5371 0.6633 0.0041  0.0409  -0.0542 73 LYS A N     
469  C CA    . LYS A 73 ? 0.6260 0.5634 0.6754 0.0118  0.0418  -0.0554 73 LYS A CA    
470  C C     . LYS A 73 ? 0.6395 0.5734 0.6834 0.0284  0.0515  -0.0585 73 LYS A C     
471  O O     . LYS A 73 ? 0.6128 0.5570 0.6510 0.0350  0.0566  -0.0613 73 LYS A O     
472  C CB    . LYS A 73 ? 0.4790 0.4264 0.5425 0.0105  0.0339  -0.0515 73 LYS A CB    
473  C CG    . LYS A 73 ? 0.5103 0.4730 0.5774 0.0208  0.0353  -0.0538 73 LYS A CG    
474  C CD    . LYS A 73 ? 0.5343 0.5082 0.6141 0.0149  0.0274  -0.0516 73 LYS A CD    
475  C CE    . LYS A 73 ? 0.3420 0.3331 0.4253 0.0240  0.0285  -0.0552 73 LYS A CE    
476  N NZ    . LYS A 73 ? 0.3523 0.3530 0.4476 0.0168  0.0215  -0.0547 73 LYS A NZ    
477  N N     . ASN A 74 ? 0.4968 0.4170 0.5428 0.0357  0.0545  -0.0573 74 ASN A N     
478  C CA    . ASN A 74 ? 0.4784 0.3941 0.5194 0.0527  0.0643  -0.0586 74 ASN A CA    
479  C C     . ASN A 74 ? 0.5379 0.4417 0.5652 0.0551  0.0748  -0.0624 74 ASN A C     
480  O O     . ASN A 74 ? 0.6078 0.5118 0.6289 0.0694  0.0842  -0.0635 74 ASN A O     
481  C CB    . ASN A 74 ? 0.4751 0.3775 0.5213 0.0591  0.0656  -0.0555 74 ASN A CB    
482  C CG    . ASN A 74 ? 0.4331 0.3403 0.4786 0.0779  0.0720  -0.0547 74 ASN A CG    
483  O OD1   . ASN A 74 ? 0.6540 0.5790 0.6982 0.0854  0.0728  -0.0560 74 ASN A OD1   
484  N ND2   . ASN A 74 ? 0.5314 0.4243 0.5780 0.0858  0.0766  -0.0519 74 ASN A ND2   
485  N N     . LYS A 75 ? 0.6546 0.5484 0.6767 0.0412  0.0734  -0.0645 75 LYS A N     
486  C CA    . LYS A 75 ? 0.6170 0.4975 0.6250 0.0412  0.0834  -0.0697 75 LYS A CA    
487  C C     . LYS A 75 ? 0.5815 0.4769 0.5824 0.0436  0.0862  -0.0724 75 LYS A C     
488  O O     . LYS A 75 ? 0.7381 0.6273 0.7291 0.0540  0.0977  -0.0754 75 LYS A O     
489  C CB    . LYS A 75 ? 0.6473 0.5152 0.6515 0.0243  0.0803  -0.0721 75 LYS A CB    
490  C CG    . LYS A 75 ? 0.6682 0.5106 0.6652 0.0260  0.0905  -0.0757 75 LYS A CG    
491  C CD    . LYS A 75 ? 0.6507 0.4843 0.6458 0.0078  0.0856  -0.0784 75 LYS A CD    
492  C CE    . LYS A 75 ? 0.6668 0.4746 0.6545 0.0078  0.0968  -0.0834 75 LYS A CE    
493  N NZ    . LYS A 75 ? 0.6713 0.4732 0.6592 -0.0108 0.0912  -0.0862 75 LYS A NZ    
494  N N     . LYS A 76 ? 0.6854 0.6002 0.6919 0.0345  0.0767  -0.0708 76 LYS A N     
495  C CA    . LYS A 76 ? 0.7585 0.6898 0.7598 0.0360  0.0790  -0.0727 76 LYS A CA    
496  C C     . LYS A 76 ? 0.6639 0.6082 0.6681 0.0536  0.0846  -0.0717 76 LYS A C     
497  O O     . LYS A 76 ? 0.7326 0.6749 0.7274 0.0644  0.0954  -0.0740 76 LYS A O     
498  C CB    . LYS A 76 ? 0.7867 0.7361 0.7953 0.0223  0.0678  -0.0700 76 LYS A CB    
499  N N     . ASN A 77 ? 0.8836 0.8414 0.9006 0.0566  0.0774  -0.0682 77 ASN A N     
500  C CA    . ASN A 77 ? 0.8568 0.8313 0.8777 0.0724  0.0806  -0.0671 77 ASN A CA    
501  C C     . ASN A 77 ? 0.8389 0.7995 0.8532 0.0898  0.0921  -0.0666 77 ASN A C     
502  O O     . ASN A 77 ? 0.9784 0.9386 0.9982 0.0990  0.0914  -0.0639 77 ASN A O     
503  C CB    . ASN A 77 ? 0.9414 0.9299 0.9763 0.0705  0.0704  -0.0648 77 ASN A CB    
504  C CG    . ASN A 77 ? 0.9789 0.9765 1.0214 0.0531  0.0600  -0.0642 77 ASN A CG    
505  O OD1   . ASN A 77 ? 1.0617 1.0574 1.0988 0.0426  0.0597  -0.0649 77 ASN A OD1   
506  N ND2   . ASN A 77 ? 1.0521 1.0593 1.1066 0.0502  0.0519  -0.0629 77 ASN A ND2   
507  N N     . ARG B 3  ? 1.0970 1.2133 1.2024 0.0014  0.0258  -0.0659 3  ARG B N     
508  C CA    . ARG B 3  ? 1.0247 1.1637 1.1283 0.0126  0.0307  -0.0693 3  ARG B CA    
509  C C     . ARG B 3  ? 1.1615 1.3210 1.2680 0.0049  0.0323  -0.0687 3  ARG B C     
510  O O     . ARG B 3  ? 1.1041 1.2567 1.2031 -0.0002 0.0353  -0.0656 3  ARG B O     
511  C CB    . ARG B 3  ? 1.0943 1.2224 1.1842 0.0276  0.0381  -0.0688 3  ARG B CB    
512  N N     . ARG B 4  ? 1.3385 1.5245 1.4558 0.0039  0.0305  -0.0721 4  ARG B N     
513  C CA    . ARG B 4  ? 1.3530 1.5613 1.4770 -0.0054 0.0314  -0.0717 4  ARG B CA    
514  C C     . ARG B 4  ? 1.4673 1.7067 1.5936 0.0065  0.0352  -0.0749 4  ARG B C     
515  O O     . ARG B 4  ? 1.4299 1.6727 1.5541 0.0202  0.0356  -0.0774 4  ARG B O     
516  C CB    . ARG B 4  ? 0.8097 1.0203 0.9480 -0.0219 0.0249  -0.0725 4  ARG B CB    
517  N N     . LYS B 5  ? 1.0376 1.3010 1.1683 0.0024  0.0382  -0.0743 5  LYS B N     
518  C CA    . LYS B 5  ? 0.8356 1.0991 0.9702 -0.0140 0.0379  -0.0710 5  LYS B CA    
519  C C     . LYS B 5  ? 0.8516 1.0998 0.9717 -0.0131 0.0438  -0.0662 5  LYS B C     
520  O O     . LYS B 5  ? 0.8409 1.0718 0.9475 -0.0019 0.0477  -0.0660 5  LYS B O     
521  C CB    . LYS B 5  ? 0.8777 1.1771 1.0255 -0.0194 0.0385  -0.0728 5  LYS B CB    
522  N N     . ARG B 6  ? 1.1313 1.3860 1.2540 -0.0256 0.0449  -0.0627 6  ARG B N     
523  C CA    . ARG B 6  ? 1.1398 1.3803 1.2486 -0.0281 0.0494  -0.0583 6  ARG B CA    
524  C C     . ARG B 6  ? 1.0791 1.3444 1.1888 -0.0297 0.0557  -0.0566 6  ARG B C     
525  O O     . ARG B 6  ? 1.0200 1.3117 1.1442 -0.0342 0.0549  -0.0575 6  ARG B O     
526  C CB    . ARG B 6  ? 1.0399 1.2591 1.1495 -0.0431 0.0440  -0.0536 6  ARG B CB    
527  C CG    . ARG B 6  ? 0.9453 1.1652 1.0487 -0.0527 0.0471  -0.0478 6  ARG B CG    
528  C CD    . ARG B 6  ? 0.9924 1.2040 1.1039 -0.0689 0.0419  -0.0419 6  ARG B CD    
529  N NE    . ARG B 6  ? 1.0339 1.2546 1.1422 -0.0776 0.0458  -0.0360 6  ARG B NE    
530  C CZ    . ARG B 6  ? 0.9969 1.2251 1.1171 -0.0910 0.0447  -0.0306 6  ARG B CZ    
531  N NH1   . ARG B 6  ? 1.0227 1.2491 1.1588 -0.0977 0.0399  -0.0314 6  ARG B NH1   
532  N NH2   . ARG B 6  ? 1.0599 1.2966 1.1756 -0.0976 0.0491  -0.0246 6  ARG B NH2   
533  N N     . ARG B 7  ? 0.5925 0.8503 0.6867 -0.0262 0.0624  -0.0546 7  ARG B N     
534  C CA    . ARG B 7  ? 0.5820 0.8608 0.6756 -0.0287 0.0689  -0.0521 7  ARG B CA    
535  C C     . ARG B 7  ? 0.5841 0.8483 0.6664 -0.0395 0.0701  -0.0472 7  ARG B C     
536  O O     . ARG B 7  ? 0.6743 0.9122 0.7455 -0.0414 0.0674  -0.0466 7  ARG B O     
537  C CB    . ARG B 7  ? 0.4645 0.7546 0.5491 -0.0112 0.0783  -0.0548 7  ARG B CB    
538  N N     . ASN B 8  ? 1.0804 1.3637 1.1658 -0.0466 0.0741  -0.0434 8  ASN B N     
539  C CA    . ASN B 8  ? 1.1677 1.4422 1.2402 -0.0546 0.0769  -0.0385 8  ASN B CA    
540  C C     . ASN B 8  ? 1.2348 1.5062 1.2876 -0.0428 0.0863  -0.0416 8  ASN B C     
541  O O     . ASN B 8  ? 1.2152 1.5027 1.2690 -0.0304 0.0930  -0.0448 8  ASN B O     
542  C CB    . ASN B 8  ? 1.1776 1.4734 1.2614 -0.0672 0.0782  -0.0324 8  ASN B CB    
543  C CG    . ASN B 8  ? 1.1603 1.4430 1.2498 -0.0830 0.0714  -0.0257 8  ASN B CG    
544  O OD1   . ASN B 8  ? 1.1585 1.4218 1.2505 -0.0849 0.0643  -0.0263 8  ASN B OD1   
545  N ND2   . ASN B 8  ? 1.1853 1.4786 1.2767 -0.0936 0.0744  -0.0186 8  ASN B ND2   
546  N N     . PHE B 9  ? 1.1400 1.3910 1.1749 -0.0464 0.0871  -0.0407 9  PHE B N     
547  C CA    . PHE B 9  ? 1.1031 1.3482 1.1176 -0.0369 0.0966  -0.0447 9  PHE B CA    
548  C C     . PHE B 9  ? 1.0569 1.3256 1.0700 -0.0381 0.1048  -0.0417 9  PHE B C     
549  O O     . PHE B 9  ? 1.0370 1.3199 1.0600 -0.0503 0.1021  -0.0352 9  PHE B O     
550  C CB    . PHE B 9  ? 1.1428 1.3609 1.1384 -0.0424 0.0945  -0.0457 9  PHE B CB    
551  C CG    . PHE B 9  ? 1.1011 1.2959 1.0976 -0.0410 0.0874  -0.0485 9  PHE B CG    
552  C CD1   . PHE B 9  ? 1.0887 1.2839 1.0960 -0.0305 0.0865  -0.0518 9  PHE B CD1   
553  C CD2   . PHE B 9  ? 1.1566 1.3313 1.1435 -0.0499 0.0816  -0.0472 9  PHE B CD2   
554  C CE1   . PHE B 9  ? 1.0837 1.2579 1.0919 -0.0290 0.0806  -0.0539 9  PHE B CE1   
555  C CE2   . PHE B 9  ? 1.1073 1.2620 1.0961 -0.0487 0.0755  -0.0493 9  PHE B CE2   
556  C CZ    . PHE B 9  ? 1.0346 1.1883 1.0340 -0.0382 0.0753  -0.0526 9  PHE B CZ    
557  N N     . SER B 10 ? 1.0011 1.2736 1.0021 -0.0252 0.1156  -0.0461 10 SER B N     
558  C CA    . SER B 10 ? 0.9982 1.2932 0.9966 -0.0243 0.1249  -0.0435 10 SER B CA    
559  C C     . SER B 10 ? 1.0127 1.3030 0.9995 -0.0381 0.1241  -0.0389 10 SER B C     
560  O O     . SER B 10 ? 1.0074 1.2737 0.9788 -0.0431 0.1206  -0.0406 10 SER B O     
561  C CB    . SER B 10 ? 0.9359 1.2290 0.9194 -0.0070 0.1377  -0.0494 10 SER B CB    
562  O OG    . SER B 10 ? 1.0214 1.2832 0.9825 -0.0049 0.1398  -0.0552 10 SER B OG    
563  N N     . LYS B 11 ? 1.1717 1.4865 1.1660 -0.0443 0.1276  -0.0327 11 LYS B N     
564  C CA    . LYS B 11 ? 1.0818 1.3964 1.0668 -0.0573 0.1273  -0.0264 11 LYS B CA    
565  C C     . LYS B 11 ? 1.1814 1.4806 1.1376 -0.0535 0.1343  -0.0311 11 LYS B C     
566  O O     . LYS B 11 ? 1.2350 1.5295 1.1787 -0.0636 0.1328  -0.0271 11 LYS B O     
567  C CB    . LYS B 11 ? 1.1377 1.4831 1.1362 -0.0627 0.1323  -0.0190 11 LYS B CB    
568  N N     . GLN B 12 ? 1.1206 1.4120 1.0659 -0.0387 0.1423  -0.0398 12 GLN B N     
569  C CA    . GLN B 12 ? 1.1916 1.4639 1.1089 -0.0350 0.1494  -0.0468 12 GLN B CA    
570  C C     . GLN B 12 ? 1.1592 1.4013 1.0667 -0.0391 0.1411  -0.0516 12 GLN B C     
571  O O     . GLN B 12 ? 1.1211 1.3490 1.0083 -0.0459 0.1407  -0.0542 12 GLN B O     
572  C CB    . GLN B 12 ? 1.1451 1.4190 1.0547 -0.0170 0.1631  -0.0539 12 GLN B CB    
573  C CG    . GLN B 12 ? 1.2025 1.4556 1.0824 -0.0132 0.1724  -0.0624 12 GLN B CG    
574  C CD    . GLN B 12 ? 1.2321 1.4720 1.1047 0.0051  0.1835  -0.0710 12 GLN B CD    
575  O OE1   . GLN B 12 ? 1.2952 1.5359 1.1833 0.0143  0.1814  -0.0708 12 GLN B OE1   
576  N NE2   . GLN B 12 ? 1.0937 1.3211 0.9420 0.0108  0.1959  -0.0785 12 GLN B NE2   
577  N N     . ALA B 13 ? 1.0928 1.3267 1.0149 -0.0353 0.1344  -0.0528 13 ALA B N     
578  C CA    . ALA B 13 ? 1.1311 1.3373 1.0464 -0.0382 0.1270  -0.0572 13 ALA B CA    
579  C C     . ALA B 13 ? 1.1896 1.3913 1.1043 -0.0548 0.1159  -0.0509 13 ALA B C     
580  O O     . ALA B 13 ? 1.2186 1.4012 1.1176 -0.0600 0.1127  -0.0546 13 ALA B O     
581  C CB    . ALA B 13 ? 1.1411 1.3430 1.0739 -0.0305 0.1224  -0.0583 13 ALA B CB    
582  N N     . SER B 14 ? 1.1397 1.3596 1.0721 -0.0632 0.1103  -0.0411 14 SER B N     
583  C CA    . SER B 14 ? 1.0955 1.3124 1.0303 -0.0776 0.1003  -0.0328 14 SER B CA    
584  C C     . SER B 14 ? 1.1334 1.3515 1.0467 -0.0849 0.1030  -0.0309 14 SER B C     
585  O O     . SER B 14 ? 1.1644 1.3715 1.0689 -0.0935 0.0957  -0.0286 14 SER B O     
586  C CB    . SER B 14 ? 1.1058 1.3411 1.0647 -0.0843 0.0961  -0.0229 14 SER B CB    
587  O OG    . SER B 14 ? 1.1983 1.4540 1.1553 -0.0887 0.1024  -0.0168 14 SER B OG    
588  N N     . GLU B 15 ? 1.1316 1.3645 1.0361 -0.0811 0.1135  -0.0318 15 GLU B N     
589  C CA    . GLU B 15 ? 1.1590 1.3968 1.0429 -0.0879 0.1168  -0.0295 15 GLU B CA    
590  C C     . GLU B 15 ? 1.1884 1.4055 1.0460 -0.0881 0.1173  -0.0394 15 GLU B C     
591  O O     . GLU B 15 ? 1.2127 1.4310 1.0536 -0.0968 0.1154  -0.0371 15 GLU B O     
592  C CB    . GLU B 15 ? 1.2021 1.4604 1.0824 -0.0824 0.1293  -0.0290 15 GLU B CB    
593  C CG    . GLU B 15 ? 1.1773 1.4600 1.0821 -0.0857 0.1293  -0.0182 15 GLU B CG    
594  C CD    . GLU B 15 ? 1.2913 1.5806 1.2013 -0.1000 0.1223  -0.0052 15 GLU B CD    
595  O OE1   . GLU B 15 ? 1.3647 1.6473 1.2554 -0.1064 0.1200  -0.0034 15 GLU B OE1   
596  O OE2   . GLU B 15 ? 1.3106 1.6122 1.2442 -0.1050 0.1193  0.0032  15 GLU B OE2   
597  N N     . ILE B 16 ? 1.3812 1.5800 1.2349 -0.0788 0.1201  -0.0505 16 ILE B N     
598  C CA    . ILE B 16 ? 1.3839 1.5612 1.2140 -0.0802 0.1210  -0.0612 16 ILE B CA    
599  C C     . ILE B 16 ? 1.3085 1.4697 1.1441 -0.0872 0.1084  -0.0606 16 ILE B C     
600  O O     . ILE B 16 ? 1.2695 1.4174 1.0875 -0.0935 0.1056  -0.0666 16 ILE B O     
601  C CB    . ILE B 16 ? 1.3182 1.4814 1.1377 -0.0664 0.1334  -0.0742 16 ILE B CB    
602  C CG1   . ILE B 16 ? 1.2904 1.4607 1.1322 -0.0538 0.1367  -0.0721 16 ILE B CG1   
603  C CG2   . ILE B 16 ? 1.2986 1.4682 1.0964 -0.0634 0.1463  -0.0793 16 ILE B CG2   
604  C CD1   . ILE B 16 ? 1.2424 1.3989 1.0752 -0.0383 0.1494  -0.0828 16 ILE B CD1   
605  N N     . LEU B 17 ? 0.8777 1.0410 0.7378 -0.0865 0.1009  -0.0537 17 LEU B N     
606  C CA    . LEU B 17 ? 0.8003 0.9519 0.6678 -0.0939 0.0885  -0.0504 17 LEU B CA    
607  C C     . LEU B 17 ? 0.7961 0.9598 0.6620 -0.1069 0.0808  -0.0391 17 LEU B C     
608  O O     . LEU B 17 ? 0.8740 1.0302 0.7389 -0.1145 0.0713  -0.0361 17 LEU B O     
609  C CB    . LEU B 17 ? 0.7001 0.8503 0.5934 -0.0891 0.0836  -0.0466 17 LEU B CB    
610  C CG    . LEU B 17 ? 0.7188 0.8565 0.6152 -0.0757 0.0894  -0.0561 17 LEU B CG    
611  C CD1   . LEU B 17 ? 0.6702 0.8084 0.5910 -0.0727 0.0827  -0.0516 17 LEU B CD1   
612  C CD2   . LEU B 17 ? 0.6860 0.7997 0.5651 -0.0750 0.0906  -0.0664 17 LEU B CD2   
613  N N     . ASN B 18 ? 1.1324 1.3156 0.9982 -0.1088 0.0854  -0.0320 18 ASN B N     
614  C CA    . ASN B 18 ? 1.1371 1.3331 0.9990 -0.1199 0.0803  -0.0202 18 ASN B CA    
615  C C     . ASN B 18 ? 1.1807 1.3784 1.0135 -0.1237 0.0842  -0.0257 18 ASN B C     
616  O O     . ASN B 18 ? 1.2110 1.4119 1.0342 -0.1330 0.0771  -0.0200 18 ASN B O     
617  C CB    . ASN B 18 ? 1.1373 1.3536 1.0149 -0.1210 0.0836  -0.0088 18 ASN B CB    
618  C CG    . ASN B 18 ? 1.0444 1.2600 0.9506 -0.1206 0.0781  -0.0026 18 ASN B CG    
619  O OD1   . ASN B 18 ? 1.0084 1.2103 0.9224 -0.1221 0.0696  -0.0023 18 ASN B OD1   
620  N ND2   . ASN B 18 ? 1.1352 1.3662 1.0571 -0.1189 0.0833  0.0018  18 ASN B ND2   
621  N N     . GLU B 19 ? 1.1205 1.3167 0.9389 -0.1162 0.0958  -0.0367 19 GLU B N     
622  C CA    . GLU B 19 ? 1.1296 1.3243 0.9182 -0.1192 0.1009  -0.0450 19 GLU B CA    
623  C C     . GLU B 19 ? 1.2680 1.4440 1.0447 -0.1246 0.0936  -0.0536 19 GLU B C     
624  O O     . GLU B 19 ? 1.3350 1.5133 1.0907 -0.1330 0.0910  -0.0561 19 GLU B O     
625  C CB    . GLU B 19 ? 1.2203 1.4128 0.9968 -0.1084 0.1159  -0.0563 19 GLU B CB    
626  C CG    . GLU B 19 ? 1.3425 1.5183 1.0899 -0.1086 0.1217  -0.0722 19 GLU B CG    
627  C CD    . GLU B 19 ? 1.3191 1.4911 1.0551 -0.0966 0.1381  -0.0827 19 GLU B CD    
628  O OE1   . GLU B 19 ? 1.2734 1.4623 1.0206 -0.0896 0.1449  -0.0761 19 GLU B OE1   
629  O OE2   . GLU B 19 ? 1.3353 1.4875 1.0515 -0.0942 0.1447  -0.0976 19 GLU B OE2   
630  N N     . TYR B 20 ? 1.1061 1.2654 0.8967 -0.1202 0.0901  -0.0579 20 TYR B N     
631  C CA    . TYR B 20 ? 1.1122 1.2541 0.8959 -0.1256 0.0828  -0.0651 20 TYR B CA    
632  C C     . TYR B 20 ? 1.1486 1.2988 0.9418 -0.1362 0.0685  -0.0524 20 TYR B C     
633  O O     . TYR B 20 ? 1.1855 1.3390 0.9627 -0.1457 0.0629  -0.0531 20 TYR B O     
634  C CB    . TYR B 20 ? 1.0656 1.1871 0.8616 -0.1166 0.0848  -0.0728 20 TYR B CB    
635  C CG    . TYR B 20 ? 1.1355 1.2376 0.9230 -0.1217 0.0799  -0.0821 20 TYR B CG    
636  C CD1   . TYR B 20 ? 1.1384 1.2234 0.9045 -0.1203 0.0889  -0.0982 20 TYR B CD1   
637  C CD2   . TYR B 20 ? 1.1517 1.2522 0.9529 -0.1284 0.0671  -0.0749 20 TYR B CD2   
638  C CE1   . TYR B 20 ? 1.1632 1.2306 0.9223 -0.1264 0.0850  -0.1073 20 TYR B CE1   
639  C CE2   . TYR B 20 ? 1.1201 1.2048 0.9147 -0.1337 0.0627  -0.0832 20 TYR B CE2   
640  C CZ    . TYR B 20 ? 1.0513 1.1196 0.8251 -0.1333 0.0716  -0.0996 20 TYR B CZ    
641  O OH    . TYR B 20 ? 1.0486 1.1012 0.8166 -0.1400 0.0678  -0.1084 20 TYR B OH    
642  N N     . PHE B 21 ? 1.0602 1.2141 0.8793 -0.1341 0.0630  -0.0409 21 PHE B N     
643  C CA    . PHE B 21 ? 1.0130 1.1721 0.8448 -0.1419 0.0505  -0.0278 21 PHE B CA    
644  C C     . PHE B 21 ? 1.0314 1.2087 0.8502 -0.1513 0.0466  -0.0179 21 PHE B C     
645  O O     . PHE B 21 ? 1.0951 1.2734 0.9042 -0.1590 0.0386  -0.0172 21 PHE B O     
646  C CB    . PHE B 21 ? 0.9227 1.0850 0.7827 -0.1379 0.0483  -0.0168 21 PHE B CB    
647  C CG    . PHE B 21 ? 0.9192 1.0839 0.7939 -0.1443 0.0370  -0.0032 21 PHE B CG    
648  C CD1   . PHE B 21 ? 0.9543 1.1045 0.8407 -0.1432 0.0301  -0.0049 21 PHE B CD1   
649  C CD2   . PHE B 21 ? 0.9477 1.1286 0.8249 -0.1505 0.0342  0.0121  21 PHE B CD2   
650  C CE1   . PHE B 21 ? 1.0043 1.1564 0.9043 -0.1480 0.0206  0.0079  21 PHE B CE1   
651  C CE2   . PHE B 21 ? 0.8358 1.0179 0.7267 -0.1550 0.0249  0.0255  21 PHE B CE2   
652  C CZ    . PHE B 21 ? 0.9600 1.1277 0.8624 -0.1536 0.0181  0.0233  21 PHE B CZ    
653  N N     . TYR B 22 ? 1.2241 1.4174 1.0431 -0.1505 0.0524  -0.0099 22 TYR B N     
654  C CA    . TYR B 22 ? 1.2223 1.4346 1.0309 -0.1583 0.0497  0.0021  22 TYR B CA    
655  C C     . TYR B 22 ? 1.2962 1.5124 1.0733 -0.1630 0.0517  -0.0077 22 TYR B C     
656  O O     . TYR B 22 ? 1.3491 1.5825 1.1136 -0.1693 0.0495  0.0011  22 TYR B O     
657  C CB    . TYR B 22 ? 1.2120 1.4396 1.0295 -0.1561 0.0569  0.0128  22 TYR B CB    
658  C CG    . TYR B 22 ? 1.1469 1.3743 0.9945 -0.1550 0.0536  0.0251  22 TYR B CG    
659  C CD1   . TYR B 22 ? 1.1495 1.3808 1.0080 -0.1609 0.0448  0.0408  22 TYR B CD1   
660  C CD2   . TYR B 22 ? 1.1266 1.3503 0.9914 -0.1480 0.0597  0.0210  22 TYR B CD2   
661  C CE1   . TYR B 22 ? 1.1091 1.3377 0.9944 -0.1603 0.0428  0.0510  22 TYR B CE1   
662  C CE2   . TYR B 22 ? 1.0893 1.3127 0.9807 -0.1482 0.0567  0.0307  22 TYR B CE2   
663  C CZ    . TYR B 22 ? 1.1193 1.3438 1.0207 -0.1546 0.0487  0.0452  22 TYR B CZ    
664  O OH    . TYR B 22 ? 1.1963 1.4182 1.1235 -0.1551 0.0468  0.0539  22 TYR B OH    
665  N N     . SER B 23 ? 1.2374 1.4375 1.0014 -0.1600 0.0565  -0.0261 23 SER B N     
666  C CA    . SER B 23 ? 1.2340 1.4342 0.9679 -0.1657 0.0582  -0.0382 23 SER B CA    
667  C C     . SER B 23 ? 1.3041 1.4927 1.0350 -0.1723 0.0485  -0.0453 23 SER B C     
668  O O     . SER B 23 ? 1.4040 1.5902 1.1113 -0.1787 0.0486  -0.0577 23 SER B O     
669  C CB    . SER B 23 ? 1.2314 1.4209 0.9498 -0.1584 0.0726  -0.0548 23 SER B CB    
670  N N     . HIS B 24 ? 1.4224 1.6042 1.1776 -0.1711 0.0405  -0.0379 24 HIS B N     
671  C CA    . HIS B 24 ? 1.3816 1.5544 1.1381 -0.1771 0.0308  -0.0422 24 HIS B CA    
672  C C     . HIS B 24 ? 1.3732 1.5547 1.1520 -0.1795 0.0190  -0.0241 24 HIS B C     
673  O O     . HIS B 24 ? 1.3558 1.5249 1.1503 -0.1783 0.0136  -0.0246 24 HIS B O     
674  C CB    . HIS B 24 ? 1.2944 1.4413 1.0568 -0.1708 0.0357  -0.0569 24 HIS B CB    
675  C CG    . HIS B 24 ? 1.3625 1.4973 1.1052 -0.1663 0.0491  -0.0741 24 HIS B CG    
676  N ND1   . HIS B 24 ? 1.3435 1.4698 1.0940 -0.1541 0.0603  -0.0772 24 HIS B ND1   
677  C CD2   . HIS B 24 ? 1.4140 1.5441 1.1297 -0.1719 0.0539  -0.0891 24 HIS B CD2   
678  C CE1   . HIS B 24 ? 1.3835 1.4997 1.1130 -0.1514 0.0717  -0.0924 24 HIS B CE1   
679  N NE2   . HIS B 24 ? 1.5001 1.6169 1.2075 -0.1624 0.0684  -0.1006 24 HIS B NE2   
680  N N     . LEU B 25 ? 1.3003 1.5023 1.0803 -0.1822 0.0159  -0.0077 25 LEU B N     
681  C CA    . LEU B 25 ? 1.3057 1.5159 1.1060 -0.1840 0.0060  0.0110  25 LEU B CA    
682  C C     . LEU B 25 ? 1.3558 1.5670 1.1533 -0.1910 -0.0053 0.0098  25 LEU B C     
683  O O     . LEU B 25 ? 1.3334 1.5404 1.1513 -0.1900 -0.0124 0.0184  25 LEU B O     
684  C CB    . LEU B 25 ? 1.2945 1.5268 1.0925 -0.1863 0.0058  0.0289  25 LEU B CB    
685  N N     . SER B 26 ? 1.4246 1.6421 1.1969 -0.1984 -0.0064 -0.0014 26 SER B N     
686  C CA    . SER B 26 ? 1.3838 1.6051 1.1512 -0.2068 -0.0168 -0.0050 26 SER B CA    
687  C C     . SER B 26 ? 1.3850 1.5834 1.1677 -0.2043 -0.0179 -0.0145 26 SER B C     
688  O O     . SER B 26 ? 1.3073 1.5077 1.1059 -0.2060 -0.0273 -0.0062 26 SER B O     
689  C CB    . SER B 26 ? 1.3674 1.5963 1.1031 -0.2157 -0.0155 -0.0202 26 SER B CB    
690  N N     . ASN B 27 ? 1.2188 1.3958 0.9969 -0.1993 -0.0078 -0.0312 27 ASN B N     
691  C CA    . ASN B 27 ? 1.1348 1.2888 0.9265 -0.1955 -0.0070 -0.0403 27 ASN B CA    
692  C C     . ASN B 27 ? 1.1915 1.3279 0.9927 -0.1834 0.0041  -0.0448 27 ASN B C     
693  O O     . ASN B 27 ? 1.2667 1.3882 1.0552 -0.1803 0.0140  -0.0607 27 ASN B O     
694  C CB    . ASN B 27 ? 1.2228 1.3668 0.9962 -0.2035 -0.0064 -0.0593 27 ASN B CB    
695  N N     . PRO B 28 ? 1.1199 1.2585 0.9437 -0.1764 0.0029  -0.0308 28 PRO B N     
696  C CA    . PRO B 28 ? 1.1361 1.2634 0.9708 -0.1652 0.0123  -0.0334 28 PRO B CA    
697  C C     . PRO B 28 ? 1.1579 1.2626 1.0028 -0.1588 0.0149  -0.0434 28 PRO B C     
698  O O     . PRO B 28 ? 1.1670 1.2652 1.0300 -0.1500 0.0174  -0.0398 28 PRO B O     
699  C CB    . PRO B 28 ? 1.1014 1.2397 0.9574 -0.1628 0.0082  -0.0149 28 PRO B CB    
700  C CG    . PRO B 28 ? 1.1573 1.3040 1.0197 -0.1698 -0.0036 -0.0037 28 PRO B CG    
701  C CD    . PRO B 28 ? 1.1818 1.3361 1.0209 -0.1791 -0.0068 -0.0112 28 PRO B CD    
702  N N     . TYR B 29 ? 1.0271 1.1202 0.8603 -0.1634 0.0145  -0.0558 29 TYR B N     
703  C CA    . TYR B 29 ? 0.9585 1.0288 0.7990 -0.1573 0.0184  -0.0657 29 TYR B CA    
704  C C     . TYR B 29 ? 0.9805 1.0357 0.8013 -0.1543 0.0308  -0.0832 29 TYR B C     
705  O O     . TYR B 29 ? 1.0425 1.0978 0.8424 -0.1631 0.0318  -0.0929 29 TYR B O     
706  C CB    . TYR B 29 ? 0.8067 0.8729 0.6532 -0.1647 0.0091  -0.0655 29 TYR B CB    
707  C CG    . TYR B 29 ? 0.7384 0.8155 0.6069 -0.1651 -0.0016 -0.0484 29 TYR B CG    
708  C CD1   . TYR B 29 ? 0.7211 0.7862 0.6109 -0.1573 -0.0025 -0.0446 29 TYR B CD1   
709  C CD2   . TYR B 29 ? 0.8341 0.9332 0.7016 -0.1725 -0.0102 -0.0355 29 TYR B CD2   
710  C CE1   . TYR B 29 ? 0.7482 0.8214 0.6577 -0.1572 -0.0112 -0.0295 29 TYR B CE1   
711  C CE2   . TYR B 29 ? 0.8652 0.9725 0.7528 -0.1719 -0.0186 -0.0191 29 TYR B CE2   
712  C CZ    . TYR B 29 ? 0.8352 0.9287 0.7438 -0.1644 -0.0189 -0.0167 29 TYR B CZ    
713  O OH    . TYR B 29 ? 0.8247 0.9248 0.7528 -0.1634 -0.0263 -0.0009 29 TYR B OH    
714  N N     . PRO B 30 ? 1.5473 1.5898 1.3745 -0.1417 0.0406  -0.0873 30 PRO B N     
715  C CA    . PRO B 30 ? 1.5390 1.5644 1.3492 -0.1363 0.0540  -0.1029 30 PRO B CA    
716  C C     . PRO B 30 ? 1.5047 1.5065 1.3140 -0.1371 0.0560  -0.1137 30 PRO B C     
717  O O     . PRO B 30 ? 1.5237 1.5199 1.3516 -0.1346 0.0504  -0.1082 30 PRO B O     
718  C CB    . PRO B 30 ? 1.4676 1.4930 1.2890 -0.1214 0.0623  -0.0996 30 PRO B CB    
719  C CG    . PRO B 30 ? 1.4410 1.4718 1.2882 -0.1187 0.0531  -0.0870 30 PRO B CG    
720  C CD    . PRO B 30 ? 1.4690 1.5143 1.3191 -0.1314 0.0401  -0.0771 30 PRO B CD    
721  N N     . SER B 31 ? 1.0613 1.0488 0.8492 -0.1408 0.0646  -0.1290 31 SER B N     
722  C CA    . SER B 31 ? 0.9976 0.9596 0.7839 -0.1410 0.0695  -0.1402 31 SER B CA    
723  C C     . SER B 31 ? 1.0176 0.9640 0.8174 -0.1238 0.0786  -0.1391 31 SER B C     
724  O O     . SER B 31 ? 1.0702 1.0245 0.8745 -0.1124 0.0836  -0.1340 31 SER B O     
725  C CB    . SER B 31 ? 1.0254 0.9733 0.7849 -0.1480 0.0792  -0.1579 31 SER B CB    
726  N N     . GLU B 32 ? 1.1123 1.0381 0.9188 -0.1221 0.0807  -0.1437 32 GLU B N     
727  C CA    . GLU B 32 ? 1.0715 0.9829 0.8905 -0.1054 0.0890  -0.1420 32 GLU B CA    
728  C C     . GLU B 32 ? 1.0980 0.9945 0.9021 -0.0939 0.1065  -0.1519 32 GLU B C     
729  O O     . GLU B 32 ? 1.1213 1.0079 0.9335 -0.0782 0.1150  -0.1503 32 GLU B O     
730  C CB    . GLU B 32 ? 1.0919 0.9847 0.9207 -0.1067 0.0876  -0.1440 32 GLU B CB    
731  N N     . GLU B 33 ? 1.3775 1.2731 1.1593 -0.1013 0.1120  -0.1617 33 GLU B N     
732  C CA    . GLU B 33 ? 1.4517 1.3341 1.2174 -0.0907 0.1293  -0.1710 33 GLU B CA    
733  C C     . GLU B 33 ? 1.4316 1.3378 1.1928 -0.0871 0.1300  -0.1656 33 GLU B C     
734  O O     . GLU B 33 ? 1.3968 1.3018 1.1566 -0.0723 0.1418  -0.1656 33 GLU B O     
735  C CB    . GLU B 33 ? 1.4643 1.3247 1.2062 -0.1010 0.1379  -0.1883 33 GLU B CB    
736  N N     . ALA B 34 ? 1.3368 1.2655 1.0962 -0.1002 0.1176  -0.1601 34 ALA B N     
737  C CA    . ALA B 34 ? 1.3710 1.3237 1.1268 -0.0985 0.1175  -0.1536 34 ALA B CA    
738  C C     . ALA B 34 ? 1.2923 1.2595 1.0709 -0.0856 0.1158  -0.1404 34 ALA B C     
739  O O     . ALA B 34 ? 1.3360 1.3149 1.1134 -0.0766 0.1231  -0.1378 34 ALA B O     
740  C CB    . ALA B 34 ? 1.2653 1.2390 1.0160 -0.1152 0.1040  -0.1486 34 ALA B CB    
741  N N     . LYS B 35 ? 0.9124 0.8794 0.7118 -0.0849 0.1062  -0.1325 35 LYS B N     
742  C CA    . LYS B 35 ? 0.8729 0.8527 0.6946 -0.0740 0.1037  -0.1212 35 LYS B CA    
743  C C     . LYS B 35 ? 0.8860 0.8550 0.7092 -0.0559 0.1176  -0.1252 35 LYS B C     
744  O O     . LYS B 35 ? 0.8759 0.8605 0.7117 -0.0457 0.1192  -0.1182 35 LYS B O     
745  C CB    . LYS B 35 ? 0.9348 0.9139 0.7764 -0.0777 0.0911  -0.1134 35 LYS B CB    
746  N N     . GLU B 36 ? 1.2917 1.2348 1.1024 -0.0521 0.1280  -0.1363 36 GLU B N     
747  C CA    . GLU B 36 ? 1.2845 1.2151 1.0957 -0.0337 0.1424  -0.1394 36 GLU B CA    
748  C C     . GLU B 36 ? 1.2904 1.2311 1.0903 -0.0254 0.1541  -0.1416 36 GLU B C     
749  O O     . GLU B 36 ? 1.3718 1.3176 1.1789 -0.0089 0.1627  -0.1383 36 GLU B O     
750  C CB    . GLU B 36 ? 1.2540 1.1515 1.0542 -0.0324 0.1518  -0.1504 36 GLU B CB    
751  C CG    . GLU B 36 ? 1.2933 1.1765 1.0977 -0.0120 0.1657  -0.1508 36 GLU B CG    
752  C CD    . GLU B 36 ? 1.4411 1.2891 1.2345 -0.0111 0.1765  -0.1613 36 GLU B CD    
753  O OE1   . GLU B 36 ? 1.4631 1.2978 1.2412 -0.0262 0.1763  -0.1714 36 GLU B OE1   
754  O OE2   . GLU B 36 ? 1.4316 1.2660 1.2318 0.0045  0.1854  -0.1594 36 GLU B OE2   
755  N N     . GLU B 37 ? 1.4984 1.4437 1.2805 -0.0366 0.1545  -0.1467 37 GLU B N     
756  C CA    . GLU B 37 ? 1.6080 1.5647 1.3786 -0.0301 0.1654  -0.1484 37 GLU B CA    
757  C C     . GLU B 37 ? 1.5115 1.5018 1.2975 -0.0304 0.1571  -0.1355 37 GLU B C     
758  O O     . GLU B 37 ? 1.5131 1.5177 1.3011 -0.0192 0.1656  -0.1326 37 GLU B O     
759  C CB    . GLU B 37 ? 1.6617 1.6101 1.4056 -0.0420 0.1698  -0.1597 37 GLU B CB    
760  N N     . LEU B 38 ? 1.0904 1.0932 0.8876 -0.0433 0.1411  -0.1276 38 LEU B N     
761  C CA    . LEU B 38 ? 1.0077 1.0392 0.8224 -0.0448 0.1326  -0.1148 38 LEU B CA    
762  C C     . LEU B 38 ? 0.9566 0.9954 0.7919 -0.0300 0.1349  -0.1091 38 LEU B C     
763  O O     . LEU B 38 ? 0.9389 0.9999 0.7830 -0.0242 0.1375  -0.1032 38 LEU B O     
764  C CB    . LEU B 38 ? 1.0122 1.0505 0.8366 -0.0598 0.1159  -0.1071 38 LEU B CB    
765  C CG    . LEU B 38 ? 1.0119 1.0570 0.8209 -0.0755 0.1101  -0.1071 38 LEU B CG    
766  C CD1   . LEU B 38 ? 1.0499 1.0996 0.8716 -0.0871 0.0943  -0.0984 38 LEU B CD1   
767  C CD2   . LEU B 38 ? 1.0042 1.0725 0.8089 -0.0759 0.1139  -0.1018 38 LEU B CD2   
768  N N     . ALA B 39 ? 0.9642 0.9855 0.8071 -0.0241 0.1340  -0.1111 39 ALA B N     
769  C CA    . ALA B 39 ? 0.9119 0.9396 0.7732 -0.0097 0.1356  -0.1062 39 ALA B CA    
770  C C     . ALA B 39 ? 0.9874 1.0135 0.8416 0.0078  0.1520  -0.1105 39 ALA B C     
771  O O     . ALA B 39 ? 1.0053 1.0401 0.8730 0.0218  0.1550  -0.1065 39 ALA B O     
772  C CB    . ALA B 39 ? 0.9348 0.9440 0.8048 -0.0085 0.1302  -0.1067 39 ALA B CB    
773  N N     . ARG B 40 ? 1.1723 1.1879 1.0048 0.0074  0.1629  -0.1186 40 ARG B N     
774  C CA    . ARG B 40 ? 1.1772 1.1904 1.0012 0.0243  0.1801  -0.1225 40 ARG B CA    
775  C C     . ARG B 40 ? 1.1842 1.2246 1.0066 0.0247  0.1838  -0.1188 40 ARG B C     
776  O O     . ARG B 40 ? 1.1549 1.2123 0.9859 0.0392  0.1914  -0.1146 40 ARG B O     
777  C CB    . ARG B 40 ? 1.1408 1.1210 0.9411 0.0250  0.1924  -0.1351 40 ARG B CB    
778  N N     . LYS B 41 ? 0.9530 0.9991 0.7646 0.0090  0.1784  -0.1197 41 LYS B N     
779  C CA    . LYS B 41 ? 0.8278 0.8995 0.6370 0.0075  0.1817  -0.1156 41 LYS B CA    
780  C C     . LYS B 41 ? 0.9311 1.0337 0.7662 0.0079  0.1727  -0.1034 41 LYS B C     
781  O O     . LYS B 41 ? 1.0245 1.1501 0.8660 0.0160  0.1794  -0.0991 41 LYS B O     
782  C CB    . LYS B 41 ? 0.7801 0.8509 0.5719 -0.0101 0.1767  -0.1184 41 LYS B CB    
783  N N     . CYS B 42 ? 1.2552 1.3583 1.1055 -0.0012 0.1581  -0.0981 42 CYS B N     
784  C CA    . CYS B 42 ? 1.2303 1.3569 1.1063 0.0002  0.1501  -0.0884 42 CYS B CA    
785  C C     . CYS B 42 ? 1.1994 1.3192 1.0862 0.0156  0.1531  -0.0897 42 CYS B C     
786  O O     . CYS B 42 ? 1.1912 1.2845 1.0683 0.0205  0.1569  -0.0961 42 CYS B O     
787  C CB    . CYS B 42 ? 1.1560 1.2853 1.0430 -0.0161 0.1340  -0.0820 42 CYS B CB    
788  S SG    . CYS B 42 ? 1.2165 1.3455 1.0865 -0.0345 0.1291  -0.0809 42 CYS B SG    
789  N N     . GLY B 43 ? 0.9231 1.0674 0.8296 0.0230  0.1518  -0.0835 43 GLY B N     
790  C CA    . GLY B 43 ? 0.9208 1.0632 0.8378 0.0384  0.1542  -0.0836 43 GLY B CA    
791  C C     . GLY B 43 ? 1.0231 1.1604 0.9550 0.0321  0.1405  -0.0807 43 GLY B C     
792  O O     . GLY B 43 ? 1.1365 1.2954 1.0880 0.0320  0.1336  -0.0754 43 GLY B O     
793  N N     . ILE B 44 ? 1.1216 1.2305 1.0443 0.0264  0.1370  -0.0847 44 ILE B N     
794  C CA    . ILE B 44 ? 1.1168 1.2187 1.0524 0.0202  0.1246  -0.0820 44 ILE B CA    
795  C C     . ILE B 44 ? 1.1222 1.1921 1.0478 0.0227  0.1264  -0.0875 44 ILE B C     
796  O O     . ILE B 44 ? 1.0614 1.1125 0.9688 0.0255  0.1362  -0.0941 44 ILE B O     
797  C CB    . ILE B 44 ? 0.9451 1.0536 0.8860 0.0011  0.1122  -0.0772 44 ILE B CB    
798  N N     . THR B 45 ? 1.0808 1.1445 1.0186 0.0214  0.1175  -0.0850 45 THR B N     
799  C CA    . THR B 45 ? 1.0307 1.0656 0.9619 0.0215  0.1176  -0.0890 45 THR B CA    
800  C C     . THR B 45 ? 1.0486 1.0714 0.9697 0.0039  0.1114  -0.0911 45 THR B C     
801  O O     . THR B 45 ? 1.1320 1.1699 1.0536 -0.0075 0.1057  -0.0877 45 THR B O     
802  C CB    . THR B 45 ? 1.0211 1.0555 0.9691 0.0249  0.1095  -0.0850 45 THR B CB    
803  O OG1   . THR B 45 ? 1.0386 1.0964 0.9999 0.0363  0.1104  -0.0813 45 THR B OG1   
804  C CG2   . THR B 45 ? 1.0595 1.0664 1.0013 0.0328  0.1150  -0.0889 45 THR B CG2   
805  N N     . VAL B 46 ? 0.9469 0.9439 0.8589 0.0015  0.1128  -0.0963 46 VAL B N     
806  C CA    . VAL B 46 ? 1.0092 0.9975 0.9142 -0.0156 0.1049  -0.0976 46 VAL B CA    
807  C C     . VAL B 46 ? 1.0023 0.9981 0.9252 -0.0235 0.0905  -0.0896 46 VAL B C     
808  O O     . VAL B 46 ? 0.9921 0.9928 0.9149 -0.0377 0.0814  -0.0862 46 VAL B O     
809  C CB    . VAL B 46 ? 1.0801 1.0392 0.9708 -0.0172 0.1109  -0.1064 46 VAL B CB    
810  C CG1   . VAL B 46 ? 0.9912 0.9392 0.8639 -0.0081 0.1271  -0.1150 46 VAL B CG1   
811  C CG2   . VAL B 46 ? 0.9550 0.8994 0.8568 -0.0102 0.1097  -0.1051 46 VAL B CG2   
812  N N     . SER B 47 ? 1.1891 1.1868 1.1270 -0.0136 0.0891  -0.0862 47 SER B N     
813  C CA    . SER B 47 ? 1.2435 1.2467 1.1986 -0.0190 0.0770  -0.0793 47 SER B CA    
814  C C     . SER B 47 ? 1.1624 1.1894 1.1276 -0.0264 0.0700  -0.0725 47 SER B C     
815  O O     . SER B 47 ? 1.1214 1.1535 1.1004 -0.0326 0.0604  -0.0664 47 SER B O     
816  C CB    . SER B 47 ? 1.1717 1.1718 1.1385 -0.0055 0.0785  -0.0784 47 SER B CB    
817  O OG    . SER B 47 ? 1.2418 1.2602 1.2138 0.0056  0.0833  -0.0775 47 SER B OG    
818  N N     . GLN B 48 ? 0.8199 0.8607 0.7782 -0.0255 0.0759  -0.0735 48 GLN B N     
819  C CA    . GLN B 48 ? 0.8672 0.9309 0.8346 -0.0325 0.0712  -0.0671 48 GLN B CA    
820  C C     . GLN B 48 ? 0.8894 0.9555 0.8456 -0.0462 0.0685  -0.0650 48 GLN B C     
821  O O     . GLN B 48 ? 0.9330 1.0097 0.8980 -0.0563 0.0607  -0.0574 48 GLN B O     
822  C CB    . GLN B 48 ? 0.8718 0.9541 0.8416 -0.0222 0.0793  -0.0681 48 GLN B CB    
823  C CG    . GLN B 48 ? 0.8391 0.9217 0.8175 -0.0069 0.0829  -0.0702 48 GLN B CG    
824  C CD    . GLN B 48 ? 0.8909 1.0007 0.8806 -0.0004 0.0854  -0.0680 48 GLN B CD    
825  O OE1   . GLN B 48 ? 0.9967 1.1247 0.9924 -0.0094 0.0824  -0.0640 48 GLN B OE1   
826  N NE2   . GLN B 48 ? 0.8327 0.9468 0.8259 0.0152  0.0910  -0.0701 48 GLN B NE2   
827  N N     . VAL B 49 ? 0.7541 0.8104 0.6907 -0.0462 0.0756  -0.0717 49 VAL B N     
828  C CA    . VAL B 49 ? 0.8150 0.8744 0.7383 -0.0588 0.0734  -0.0707 49 VAL B CA    
829  C C     . VAL B 49 ? 0.8813 0.9340 0.8087 -0.0705 0.0618  -0.0659 49 VAL B C     
830  O O     . VAL B 49 ? 0.9505 1.0148 0.8793 -0.0810 0.0552  -0.0583 49 VAL B O     
831  C CB    . VAL B 49 ? 0.9030 0.9498 0.8028 -0.0569 0.0835  -0.0810 49 VAL B CB    
832  C CG1   . VAL B 49 ? 0.9038 0.9568 0.7887 -0.0702 0.0808  -0.0803 49 VAL B CG1   
833  C CG2   . VAL B 49 ? 0.9403 0.9932 0.8365 -0.0434 0.0961  -0.0850 49 VAL B CG2   
834  N N     . SER B 50 ? 0.9817 1.0166 0.9118 -0.0679 0.0599  -0.0693 50 SER B N     
835  C CA    . SER B 50 ? 0.9385 0.9677 0.8744 -0.0775 0.0493  -0.0644 50 SER B CA    
836  C C     . SER B 50 ? 0.9032 0.9422 0.8605 -0.0785 0.0411  -0.0541 50 SER B C     
837  O O     . SER B 50 ? 0.9663 1.0046 0.9305 -0.0865 0.0321  -0.0473 50 SER B O     
838  C CB    . SER B 50 ? 1.0749 1.0823 1.0081 -0.0742 0.0509  -0.0713 50 SER B CB    
839  O OG    . SER B 50 ? 1.0595 1.0597 0.9987 -0.0600 0.0579  -0.0748 50 SER B OG    
840  N N     . ASN B 51 ? 0.8017 0.8501 0.7697 -0.0704 0.0444  -0.0530 51 ASN B N     
841  C CA    . ASN B 51 ? 0.7425 0.8015 0.7297 -0.0728 0.0378  -0.0444 51 ASN B CA    
842  C C     . ASN B 51 ? 0.6873 0.7633 0.6744 -0.0820 0.0362  -0.0371 51 ASN B C     
843  O O     . ASN B 51 ? 0.8053 0.8857 0.8036 -0.0893 0.0293  -0.0280 51 ASN B O     
844  C CB    . ASN B 51 ? 0.7089 0.7735 0.7081 -0.0616 0.0415  -0.0469 51 ASN B CB    
845  C CG    . ASN B 51 ? 0.7197 0.7702 0.7269 -0.0545 0.0393  -0.0492 51 ASN B CG    
846  O OD1   . ASN B 51 ? 0.6785 0.7181 0.6893 -0.0596 0.0329  -0.0459 51 ASN B OD1   
847  N ND2   . ASN B 51 ? 0.6633 0.7155 0.6735 -0.0420 0.0449  -0.0540 51 ASN B ND2   
848  N N     . TRP B 52 ? 0.6564 0.7409 0.6304 -0.0810 0.0434  -0.0407 52 TRP B N     
849  C CA    . TRP B 52 ? 0.7086 0.8100 0.6808 -0.0889 0.0435  -0.0338 52 TRP B CA    
850  C C     . TRP B 52 ? 0.6295 0.7294 0.5938 -0.1004 0.0369  -0.0274 52 TRP B C     
851  O O     . TRP B 52 ? 0.6209 0.7317 0.5919 -0.1080 0.0330  -0.0170 52 TRP B O     
852  C CB    . TRP B 52 ? 0.6878 0.7979 0.6458 -0.0842 0.0537  -0.0398 52 TRP B CB    
853  C CG    . TRP B 52 ? 0.7464 0.8763 0.7053 -0.0905 0.0554  -0.0326 52 TRP B CG    
854  C CD1   . TRP B 52 ? 0.7184 0.8648 0.6921 -0.0891 0.0577  -0.0286 52 TRP B CD1   
855  C CD2   . TRP B 52 ? 0.7747 0.9109 0.7189 -0.0995 0.0552  -0.0284 52 TRP B CD2   
856  N NE1   . TRP B 52 ? 0.7026 0.8641 0.6726 -0.0967 0.0595  -0.0216 52 TRP B NE1   
857  C CE2   . TRP B 52 ? 0.6737 0.8294 0.6252 -0.1025 0.0581  -0.0211 52 TRP B CE2   
858  C CE3   . TRP B 52 ? 0.7923 0.9209 0.7181 -0.1056 0.0529  -0.0303 52 TRP B CE3   
859  C CZ2   . TRP B 52 ? 0.7216 0.8885 0.6618 -0.1105 0.0593  -0.0147 52 TRP B CZ2   
860  C CZ3   . TRP B 52 ? 0.7715 0.9128 0.6855 -0.1136 0.0533  -0.0246 52 TRP B CZ3   
861  C CH2   . TRP B 52 ? 0.7463 0.9061 0.6673 -0.1155 0.0567  -0.0164 52 TRP B CH2   
862  N N     . PHE B 53 ? 0.7705 0.8576 0.7210 -0.1017 0.0360  -0.0333 53 PHE B N     
863  C CA    . PHE B 53 ? 0.7642 0.8525 0.7061 -0.1125 0.0292  -0.0281 53 PHE B CA    
864  C C     . PHE B 53 ? 0.7560 0.8404 0.7140 -0.1163 0.0194  -0.0188 53 PHE B C     
865  O O     . PHE B 53 ? 0.8236 0.9156 0.7815 -0.1246 0.0131  -0.0090 53 PHE B O     
866  C CB    . PHE B 53 ? 0.7622 0.8391 0.6839 -0.1139 0.0316  -0.0390 53 PHE B CB    
867  C CG    . PHE B 53 ? 0.8174 0.9003 0.7189 -0.1142 0.0400  -0.0457 53 PHE B CG    
868  C CD1   . PHE B 53 ? 0.8706 0.9641 0.7571 -0.1240 0.0375  -0.0427 53 PHE B CD1   
869  C CD2   . PHE B 53 ? 0.8470 0.9258 0.7441 -0.1039 0.0508  -0.0546 53 PHE B CD2   
870  C CE1   . PHE B 53 ? 0.9787 1.0776 0.8455 -0.1240 0.0459  -0.0494 53 PHE B CE1   
871  C CE2   . PHE B 53 ? 0.8800 0.9637 0.7584 -0.1033 0.0596  -0.0607 53 PHE B CE2   
872  C CZ    . PHE B 53 ? 0.9771 1.0703 0.8399 -0.1136 0.0572  -0.0586 53 PHE B CZ    
873  N N     . GLY B 54 ? 0.6527 0.7258 0.6242 -0.1094 0.0186  -0.0214 54 GLY B N     
874  C CA    . GLY B 54 ? 0.6013 0.6700 0.5895 -0.1114 0.0106  -0.0130 54 GLY B CA    
875  C C     . GLY B 54 ? 0.6087 0.6890 0.6102 -0.1153 0.0083  -0.0011 54 GLY B C     
876  O O     . GLY B 54 ? 0.6374 0.7184 0.6472 -0.1206 0.0019  0.0095  54 GLY B O     
877  N N     . ASN B 55 ? 0.6495 0.7393 0.6535 -0.1127 0.0143  -0.0027 55 ASN B N     
878  C CA    . ASN B 55 ? 0.5323 0.6329 0.5492 -0.1172 0.0138  0.0074  55 ASN B CA    
879  C C     . ASN B 55 ? 0.5956 0.7096 0.6020 -0.1251 0.0147  0.0154  55 ASN B C     
880  O O     . ASN B 55 ? 0.7208 0.8390 0.7347 -0.1313 0.0111  0.0280  55 ASN B O     
881  C CB    . ASN B 55 ? 0.4024 0.5094 0.4289 -0.1116 0.0196  0.0020  55 ASN B CB    
882  C CG    . ASN B 55 ? 0.4526 0.5495 0.4933 -0.1050 0.0176  -0.0025 55 ASN B CG    
883  O OD1   . ASN B 55 ? 0.5789 0.6675 0.6311 -0.1074 0.0122  0.0034  55 ASN B OD1   
884  N ND2   . ASN B 55 ? 0.3814 0.4791 0.4208 -0.0959 0.0225  -0.0126 55 ASN B ND2   
885  N N     . LYS B 56 ? 0.6166 0.7368 0.6052 -0.1242 0.0201  0.0085  56 LYS B N     
886  C CA    . LYS B 56 ? 0.6842 0.8186 0.6609 -0.1309 0.0220  0.0152  56 LYS B CA    
887  C C     . LYS B 56 ? 0.7972 0.9320 0.7658 -0.1381 0.0147  0.0234  56 LYS B C     
888  O O     . LYS B 56 ? 0.8455 0.9929 0.8087 -0.1441 0.0143  0.0336  56 LYS B O     
889  C CB    . LYS B 56 ? 0.6977 0.8371 0.6554 -0.1275 0.0300  0.0046  56 LYS B CB    
890  C CG    . LYS B 56 ? 0.7660 0.9226 0.7138 -0.1329 0.0341  0.0113  56 LYS B CG    
891  C CD    . LYS B 56 ? 0.8195 0.9875 0.7853 -0.1339 0.0372  0.0197  56 LYS B CD    
892  C CE    . LYS B 56 ? 0.7876 0.9717 0.7463 -0.1409 0.0399  0.0306  56 LYS B CE    
893  N NZ    . LYS B 56 ? 0.8216 1.0119 0.8011 -0.1455 0.0396  0.0433  56 LYS B NZ    
894  N N     . ARG B 57 ? 0.9675 1.0901 0.9355 -0.1372 0.0091  0.0195  57 ARG B N     
895  C CA    . ARG B 57 ? 1.0153 1.1406 0.9772 -0.1438 0.0014  0.0270  57 ARG B CA    
896  C C     . ARG B 57 ? 0.9949 1.1247 0.9733 -0.1470 -0.0036 0.0443  57 ARG B C     
897  O O     . ARG B 57 ? 1.0013 1.1437 0.9740 -0.1527 -0.0059 0.0558  57 ARG B O     
898  C CB    . ARG B 57 ? 0.9583 1.0699 0.9187 -0.1422 -0.0030 0.0186  57 ARG B CB    
899  N N     . ILE B 58 ? 0.9111 1.0303 0.9096 -0.1429 -0.0045 0.0461  58 ILE B N     
900  C CA    . ILE B 58 ? 0.9093 1.0284 0.9245 -0.1451 -0.0082 0.0616  58 ILE B CA    
901  C C     . ILE B 58 ? 0.9596 1.0877 0.9812 -0.1479 -0.0029 0.0707  58 ILE B C     
902  O O     . ILE B 58 ? 0.9399 1.0746 0.9649 -0.1522 -0.0044 0.0861  58 ILE B O     
903  C CB    . ILE B 58 ? 0.8355 0.9387 0.8693 -0.1398 -0.0103 0.0594  58 ILE B CB    
904  C CG1   . ILE B 58 ? 0.8856 0.9864 0.9371 -0.1415 -0.0120 0.0748  58 ILE B CG1   
905  C CG2   . ILE B 58 ? 0.6543 0.7516 0.6929 -0.1340 -0.0046 0.0464  58 ILE B CG2   
906  C CD1   . ILE B 58 ? 0.8043 0.9118 0.8531 -0.1452 -0.0179 0.0894  58 ILE B CD1   
907  N N     . ARG B 59 ? 0.8447 0.9742 0.8684 -0.1455 0.0038  0.0619  59 ARG B N     
908  C CA    . ARG B 59 ? 0.8073 0.9458 0.8390 -0.1490 0.0095  0.0692  59 ARG B CA    
909  C C     . ARG B 59 ? 0.8284 0.9826 0.8444 -0.1541 0.0117  0.0772  59 ARG B C     
910  O O     . ARG B 59 ? 0.9226 1.0846 0.9450 -0.1585 0.0152  0.0892  59 ARG B O     
911  C CB    . ARG B 59 ? 0.6823 0.8222 0.7196 -0.1450 0.0157  0.0569  59 ARG B CB    
912  C CG    . ARG B 59 ? 0.6057 0.7327 0.6611 -0.1410 0.0139  0.0519  59 ARG B CG    
913  C CD    . ARG B 59 ? 0.5103 0.6407 0.5693 -0.1356 0.0188  0.0386  59 ARG B CD    
914  N NE    . ARG B 59 ? 0.4185 0.5375 0.4931 -0.1316 0.0163  0.0337  59 ARG B NE    
915  C CZ    . ARG B 59 ? 0.5463 0.6661 0.6245 -0.1249 0.0185  0.0218  59 ARG B CZ    
916  N NH1   . ARG B 59 ? 0.4666 0.5976 0.5347 -0.1208 0.0237  0.0141  59 ARG B NH1   
917  N NH2   . ARG B 59 ? 0.4954 0.6055 0.5867 -0.1217 0.0159  0.0181  59 ARG B NH2   
918  N N     . TYR B 60 ? 0.7863 0.9449 0.7816 -0.1538 0.0100  0.0706  60 TYR B N     
919  C CA    . TYR B 60 ? 0.8180 0.9915 0.7960 -0.1589 0.0102  0.0787  60 TYR B CA    
920  C C     . TYR B 60 ? 0.8517 1.0275 0.8357 -0.1626 0.0040  0.0965  60 TYR B C     
921  O O     . TYR B 60 ? 0.9240 1.1086 0.9121 -0.1659 0.0067  0.1112  60 TYR B O     
922  C CB    . TYR B 60 ? 0.7946 0.9701 0.7489 -0.1587 0.0088  0.0663  60 TYR B CB    
923  C CG    . TYR B 60 ? 0.8152 1.0069 0.7496 -0.1644 0.0075  0.0737  60 TYR B CG    
924  C CD1   . TYR B 60 ? 0.9027 1.1068 0.8222 -0.1656 0.0149  0.0715  60 TYR B CD1   
925  C CD2   . TYR B 60 ? 0.8849 1.0813 0.8152 -0.1682 -0.0011 0.0829  60 TYR B CD2   
926  C CE1   . TYR B 60 ? 1.0080 1.2279 0.9080 -0.1706 0.0138  0.0779  60 TYR B CE1   
927  C CE2   . TYR B 60 ? 0.9458 1.1596 0.8571 -0.1733 -0.0028 0.0897  60 TYR B CE2   
928  C CZ    . TYR B 60 ? 1.0252 1.2502 0.9207 -0.1745 0.0047  0.0869  60 TYR B CZ    
929  O OH    . TYR B 60 ? 1.0519 1.2951 0.9271 -0.1794 0.0031  0.0933  60 TYR B OH    
930  N N     . LYS B 61 ? 0.9584 1.1267 0.9432 -0.1615 -0.0038 0.0955  61 LYS B N     
931  C CA    . LYS B 61 ? 0.9640 1.1363 0.9532 -0.1637 -0.0105 0.1118  61 LYS B CA    
932  C C     . LYS B 61 ? 0.9817 1.1490 0.9922 -0.1633 -0.0080 0.1275  61 LYS B C     
933  O O     . LYS B 61 ? 0.9667 1.1426 0.9783 -0.1655 -0.0092 0.1453  61 LYS B O     
934  C CB    . LYS B 61 ? 0.8566 1.0199 0.8479 -0.1617 -0.0184 0.1063  61 LYS B CB    
935  N N     . LYS B 62 ? 0.9341 1.0876 0.9612 -0.1606 -0.0041 0.1210  62 LYS B N     
936  C CA    . LYS B 62 ? 1.0165 1.1622 1.0643 -0.1611 -0.0007 0.1333  62 LYS B CA    
937  C C     . LYS B 62 ? 1.0820 1.2382 1.1297 -0.1657 0.0070  0.1428  62 LYS B C     
938  O O     . LYS B 62 ? 1.0255 1.1744 1.0902 -0.1674 0.0126  0.1471  62 LYS B O     
939  C CB    . LYS B 62 ? 0.9340 1.0633 0.9983 -0.1577 0.0010  0.1215  62 LYS B CB    
940  C CG    . LYS B 62 ? 0.8172 0.9323 0.8914 -0.1534 -0.0051 0.1217  62 LYS B CG    
941  C CD    . LYS B 62 ? 0.7617 0.8615 0.8516 -0.1500 -0.0029 0.1108  62 LYS B CD    
942  C CE    . LYS B 62 ? 0.7675 0.8525 0.8716 -0.1465 -0.0066 0.1168  62 LYS B CE    
943  N NZ    . LYS B 62 ? 1.0216 1.1042 1.1365 -0.1491 -0.0043 0.1358  62 LYS B NZ    
944  N N     . ASN B 63 ? 1.0918 1.2650 1.1202 -0.1683 0.0077  0.1457  63 ASN B N     
945  C CA    . ASN B 63 ? 1.0391 1.2242 1.0655 -0.1725 0.0152  0.1563  63 ASN B CA    
946  C C     . ASN B 63 ? 1.2047 1.4043 1.2179 -0.1743 0.0125  0.1736  63 ASN B C     
947  O O     . ASN B 63 ? 1.1536 1.3570 1.1568 -0.1729 0.0044  0.1745  63 ASN B O     
948  C CB    . ASN B 63 ? 1.0252 1.2197 1.0399 -0.1731 0.0210  0.1422  63 ASN B CB    
949  N N     . ILE B 64 ? 1.7714 1.9806 1.7848 -0.1776 0.0195  0.1875  64 ILE B N     
950  C CA    . ILE B 64 ? 1.6945 1.9167 1.6996 -0.1785 0.0181  0.2083  64 ILE B CA    
951  C C     . ILE B 64 ? 1.7974 2.0422 1.7744 -0.1800 0.0160  0.2083  64 ILE B C     
952  O O     . ILE B 64 ? 1.8166 2.0721 1.7841 -0.1793 0.0094  0.2196  64 ILE B O     
953  C CB    . ILE B 64 ? 1.3457 1.5659 1.3654 -0.1810 0.0276  0.2262  64 ILE B CB    
954  C CG1   . ILE B 64 ? 1.3325 1.5304 1.3784 -0.1813 0.0314  0.2218  64 ILE B CG1   
955  C CG2   . ILE B 64 ? 1.3616 1.5889 1.3799 -0.1795 0.0257  0.2508  64 ILE B CG2   
956  C CD1   . ILE B 64 ? 1.3429 1.5353 1.4053 -0.1852 0.0417  0.2372  64 ILE B CD1   
957  N N     . GLY B 65 ? 1.3513 1.6046 1.3144 -0.1818 0.0211  0.1957  65 GLY B N     
958  C CA    . GLY B 65 ? 1.3385 1.5830 1.3102 -0.1817 0.0276  0.1797  65 GLY B CA    
959  C C     . GLY B 65 ? 1.3430 1.5877 1.3299 -0.1846 0.0382  0.1878  65 GLY B C     
960  O O     . GLY B 65 ? 1.3551 1.6126 1.3367 -0.1874 0.0437  0.2027  65 GLY B O     
961  N N     . LYS B 66 ? 1.2391 1.4706 1.2448 -0.1844 0.0411  0.1773  66 LYS B N     
962  C CA    . LYS B 66 ? 1.2737 1.5050 1.2966 -0.1885 0.0509  0.1820  66 LYS B CA    
963  C C     . LYS B 66 ? 1.2238 1.4568 1.2504 -0.1879 0.0550  0.1628  66 LYS B C     
964  O O     . LYS B 66 ? 1.2275 1.4485 1.2725 -0.1877 0.0548  0.1544  66 LYS B O     
965  C CB    . LYS B 66 ? 1.0463 1.2599 1.0941 -0.1902 0.0512  0.1919  66 LYS B CB    
966  N N     . ALA B 67 ? 1.1042 1.3530 1.1132 -0.1870 0.0590  0.1559  67 ALA B N     
967  C CA    . ALA B 67 ? 1.0232 1.2865 1.0082 -0.1872 0.0589  0.1640  67 ALA B CA    
968  C C     . ALA B 67 ? 1.1569 1.4247 1.1196 -0.1828 0.0563  0.1460  67 ALA B C     
969  O O     . ALA B 67 ? 1.1933 1.4739 1.1431 -0.1823 0.0631  0.1402  67 ALA B O     
970  C CB    . ALA B 67 ? 0.9353 1.2142 0.9196 -0.1916 0.0692  0.1761  67 ALA B CB    
971  N N     . GLN B 68 ? 1.1822 1.4383 1.1409 -0.1796 0.0473  0.1372  68 GLN B N     
972  C CA    . GLN B 68 ? 1.1272 1.3834 1.0659 -0.1758 0.0453  0.1194  68 GLN B CA    
973  C C     . GLN B 68 ? 1.1665 1.4346 1.0785 -0.1778 0.0422  0.1232  68 GLN B C     
974  O O     . GLN B 68 ? 1.1711 1.4384 1.0641 -0.1761 0.0400  0.1089  68 GLN B O     
975  C CB    . GLN B 68 ? 1.1401 1.3782 1.0866 -0.1720 0.0380  0.1075  68 GLN B CB    
976  C CG    . GLN B 68 ? 1.1055 1.3339 1.0736 -0.1689 0.0413  0.0992  68 GLN B CG    
977  C CD    . GLN B 68 ? 1.0955 1.3092 1.0637 -0.1633 0.0365  0.0832  68 GLN B CD    
978  O OE1   . GLN B 68 ? 1.0138 1.2209 0.9960 -0.1595 0.0387  0.0744  68 GLN B OE1   
979  N NE2   . GLN B 68 ? 1.1255 1.3351 1.0779 -0.1629 0.0302  0.0792  68 GLN B NE2   
980  N N     . GLU B 69 ? 1.0323 1.3116 0.9429 -0.1816 0.0423  0.1424  69 GLU B N     
981  C CA    . GLU B 69 ? 1.0522 1.3482 0.9364 -0.1837 0.0407  0.1473  69 GLU B CA    
982  C C     . GLU B 69 ? 1.1023 1.4112 0.9717 -0.1836 0.0511  0.1416  69 GLU B C     
983  O O     . GLU B 69 ? 1.1414 1.4613 0.9844 -0.1842 0.0515  0.1357  69 GLU B O     
984  C CB    . GLU B 69 ? 0.9574 1.2627 0.8452 -0.1865 0.0382  0.1716  69 GLU B CB    
985  N N     . GLU B 70 ? 1.2204 1.5284 1.1073 -0.1830 0.0599  0.1427  70 GLU B N     
986  C CA    . GLU B 70 ? 1.2416 1.5629 1.1190 -0.1824 0.0709  0.1387  70 GLU B CA    
987  C C     . GLU B 70 ? 1.3202 1.6370 1.1850 -0.1773 0.0734  0.1158  70 GLU B C     
988  O O     . GLU B 70 ? 1.3772 1.7042 1.2184 -0.1762 0.0785  0.1091  70 GLU B O     
989  C CB    . GLU B 70 ? 1.1314 1.4544 1.0344 -0.1841 0.0792  0.1470  70 GLU B CB    
990  N N     . ALA B 71 ? 0.9381 1.2389 0.8183 -0.1738 0.0703  0.1042  71 ALA B N     
991  C CA    . ALA B 71 ? 0.8395 1.1336 0.7106 -0.1676 0.0735  0.0836  71 ALA B CA    
992  C C     . ALA B 71 ? 0.9382 1.2269 0.7833 -0.1674 0.0682  0.0728  71 ALA B C     
993  O O     . ALA B 71 ? 0.9417 1.2151 0.7897 -0.1662 0.0607  0.0649  71 ALA B O     
994  C CB    . ALA B 71 ? 0.6824 0.9617 0.5769 -0.1637 0.0712  0.0758  71 ALA B CB    
995  N N     . ASN B 72 ? 1.4271 1.7288 1.2468 -0.1690 0.0725  0.0722  72 ASN B N     
996  C CA    . ASN B 72 ? 1.4234 1.7209 1.2159 -0.1696 0.0695  0.0586  72 ASN B CA    
997  C C     . ASN B 72 ? 1.4604 1.7680 1.2288 -0.1674 0.0805  0.0500  72 ASN B C     
998  O O     . ASN B 72 ? 1.4447 1.7642 1.1889 -0.1715 0.0804  0.0519  72 ASN B O     
999  C CB    . ASN B 72 ? 1.4030 1.7067 1.1853 -0.1765 0.0588  0.0687  72 ASN B CB    
1000 C CG    . ASN B 72 ? 1.3499 1.6376 1.1418 -0.1773 0.0477  0.0641  72 ASN B CG    
1001 O OD1   . ASN B 72 ? 1.2548 1.5254 1.0558 -0.1728 0.0484  0.0509  72 ASN B OD1   
1002 N ND2   . ASN B 72 ? 1.3580 1.6524 1.1479 -0.1825 0.0377  0.0758  72 ASN B ND2   
1003 N N     . LEU B 73 ? 1.3922 1.6960 1.1674 -0.1603 0.0903  0.0405  73 LEU B N     
1004 C CA    . LEU B 73 ? 1.2942 1.6051 1.0486 -0.1560 0.1024  0.0306  73 LEU B CA    
1005 C C     . LEU B 73 ? 1.3215 1.6185 1.0500 -0.1551 0.1020  0.0115  73 LEU B C     
1006 O O     . LEU B 73 ? 1.3574 1.6565 1.0637 -0.1519 0.1119  0.0007  73 LEU B O     
1007 C CB    . LEU B 73 ? 1.1669 1.4787 0.9393 -0.1478 0.1125  0.0270  73 LEU B CB    
1008 C CG    . LEU B 73 ? 1.1003 1.4176 0.9055 -0.1499 0.1095  0.0418  73 LEU B CG    
1009 C CD1   . LEU B 73 ? 1.1373 1.4537 0.9624 -0.1420 0.1163  0.0353  73 LEU B CD1   
1010 C CD2   . LEU B 73 ? 1.0865 1.4241 0.8925 -0.1558 0.1129  0.0599  73 LEU B CD2   
1011 N N     . TYR B 74 ? 0.9525 1.2348 0.6846 -0.1582 0.0911  0.0074  74 TYR B N     
1012 C CA    . TYR B 74 ? 0.8413 1.1097 0.5509 -0.1600 0.0889  -0.0098 74 TYR B CA    
1013 C C     . TYR B 74 ? 0.9011 1.1826 0.5788 -0.1665 0.0900  -0.0119 74 TYR B C     
1014 O O     . TYR B 74 ? 0.9865 1.2828 0.6603 -0.1740 0.0815  0.0011  74 TYR B O     
1015 C CB    . TYR B 74 ? 0.7700 1.0262 0.4913 -0.1645 0.0754  -0.0090 74 TYR B CB    
1016 O "O5'" . DG  C 1  ? 0.6655 0.4869 0.7731 -0.0364 0.0432  -0.0310 1  DG  C "O5'" 
1017 C "C5'" . DG  C 1  ? 0.4539 0.2883 0.5544 -0.0456 0.0356  -0.0333 1  DG  C "C5'" 
1018 C "C4'" . DG  C 1  ? 0.5123 0.3393 0.5984 -0.0559 0.0403  -0.0433 1  DG  C "C4'" 
1019 O "O4'" . DG  C 1  ? 0.6020 0.4377 0.6923 -0.0730 0.0332  -0.0429 1  DG  C "O4'" 
1020 C "C3'" . DG  C 1  ? 0.6314 0.4646 0.7036 -0.0570 0.0390  -0.0484 1  DG  C "C3'" 
1021 O "O3'" . DG  C 1  ? 0.6669 0.4877 0.7298 -0.0430 0.0496  -0.0531 1  DG  C "O3'" 
1022 C "C2'" . DG  C 1  ? 0.5591 0.3918 0.6212 -0.0736 0.0384  -0.0561 1  DG  C "C2'" 
1023 C "C1'" . DG  C 1  ? 0.5314 0.3701 0.6070 -0.0844 0.0322  -0.0512 1  DG  C "C1'" 
1024 N N9    . DG  C 1  ? 0.5550 0.4164 0.6354 -0.0962 0.0190  -0.0456 1  DG  C N9    
1025 C C8    . DG  C 1  ? 0.5183 0.3949 0.6148 -0.0953 0.0097  -0.0337 1  DG  C C8    
1026 N N7    . DG  C 1  ? 0.5034 0.3994 0.6005 -0.1064 -0.0006 -0.0297 1  DG  C N7    
1027 C C5    . DG  C 1  ? 0.5398 0.4341 0.6195 -0.1160 0.0016  -0.0404 1  DG  C C5    
1028 C C6    . DG  C 1  ? 0.5435 0.4549 0.6146 -0.1296 -0.0062 -0.0418 1  DG  C C6    
1029 O O6    . DG  C 1  ? 0.5046 0.4374 0.5827 -0.1357 -0.0170 -0.0325 1  DG  C O6    
1030 N N1    . DG  C 1  ? 0.5184 0.4202 0.5704 -0.1357 0.0002  -0.0552 1  DG  C N1    
1031 C C2    . DG  C 1  ? 0.5442 0.4217 0.5873 -0.1286 0.0133  -0.0651 1  DG  C C2    
1032 N N2    . DG  C 1  ? 0.6239 0.4936 0.6482 -0.1354 0.0190  -0.0775 1  DG  C N2    
1033 N N3    . DG  C 1  ? 0.5158 0.3778 0.5672 -0.1152 0.0207  -0.0627 1  DG  C N3    
1034 C C4    . DG  C 1  ? 0.5547 0.4269 0.6241 -0.1098 0.0139  -0.0506 1  DG  C C4    
1035 P P     . DT  C 2  ? 0.5847 0.4159 0.6410 -0.0349 0.0482  -0.0535 2  DT  C P     
1036 O OP1   . DT  C 2  ? 0.4165 0.2370 0.4691 -0.0176 0.0587  -0.0550 2  DT  C OP1   
1037 O OP2   . DT  C 2  ? 0.4262 0.2757 0.4935 -0.0377 0.0363  -0.0455 2  DT  C OP2   
1038 O "O5'" . DT  C 2  ? 0.4547 0.2863 0.4948 -0.0452 0.0499  -0.0620 2  DT  C "O5'" 
1039 C "C5'" . DT  C 2  ? 0.4017 0.2144 0.4296 -0.0460 0.0613  -0.0710 2  DT  C "C5'" 
1040 C "C4'" . DT  C 2  ? 0.4708 0.2867 0.4846 -0.0596 0.0602  -0.0789 2  DT  C "C4'" 
1041 O "O4'" . DT  C 2  ? 0.5111 0.3415 0.5310 -0.0758 0.0480  -0.0757 2  DT  C "O4'" 
1042 C "C3'" . DT  C 2  ? 0.4582 0.2859 0.4629 -0.0556 0.0593  -0.0801 2  DT  C "C3'" 
1043 O "O3'" . DT  C 2  ? 0.6149 0.4329 0.6018 -0.0600 0.0675  -0.0905 2  DT  C "O3'" 
1044 C "C2'" . DT  C 2  ? 0.4785 0.3285 0.4900 -0.0667 0.0448  -0.0736 2  DT  C "C2'" 
1045 C "C1'" . DT  C 2  ? 0.4807 0.3285 0.4942 -0.0817 0.0408  -0.0751 2  DT  C "C1'" 
1046 N N1    . DT  C 2  ? 0.4097 0.2773 0.4360 -0.0904 0.0270  -0.0654 2  DT  C N1    
1047 C C2    . DT  C 2  ? 0.4813 0.3639 0.5011 -0.1045 0.0191  -0.0659 2  DT  C C2    
1048 O O2    . DT  C 2  ? 0.5589 0.4395 0.5624 -0.1110 0.0227  -0.0749 2  DT  C O2    
1049 N N3    . DT  C 2  ? 0.4155 0.3161 0.4483 -0.1102 0.0073  -0.0551 2  DT  C N3    
1050 C C4    . DT  C 2  ? 0.4528 0.3560 0.5038 -0.1033 0.0033  -0.0448 2  DT  C C4    
1051 O O4    . DT  C 2  ? 0.4303 0.3493 0.4922 -0.1081 -0.0065 -0.0348 2  DT  C O4    
1052 C C5    . DT  C 2  ? 0.4151 0.3014 0.4711 -0.0891 0.0119  -0.0461 2  DT  C C5    
1053 C C7    . DT  C 2  ? 0.4061 0.2933 0.4800 -0.0806 0.0091  -0.0364 2  DT  C C7    
1054 C C6    . DT  C 2  ? 0.3785 0.2488 0.4220 -0.0833 0.0229  -0.0558 2  DT  C C6    
1055 P P     . DC  C 3  ? 0.7575 0.5802 0.7323 -0.0512 0.0732  -0.0939 3  DC  C P     
1056 O OP1   . DC  C 3  ? 0.7624 0.5647 0.7206 -0.0512 0.0867  -0.1049 3  DC  C OP1   
1057 O OP2   . DC  C 3  ? 0.5984 0.4286 0.5830 -0.0349 0.0732  -0.0866 3  DC  C OP2   
1058 O "O5'" . DC  C 3  ? 0.6117 0.4564 0.5832 -0.0643 0.0618  -0.0924 3  DC  C "O5'" 
1059 C "C5'" . DC  C 3  ? 0.6431 0.4892 0.6064 -0.0816 0.0576  -0.0976 3  DC  C "C5'" 
1060 C "C4'" . DC  C 3  ? 0.7233 0.5930 0.6851 -0.0907 0.0466  -0.0931 3  DC  C "C4'" 
1061 O "O4'" . DC  C 3  ? 0.7316 0.6152 0.7093 -0.0969 0.0339  -0.0827 3  DC  C "O4'" 
1062 C "C3'" . DC  C 3  ? 0.6832 0.5648 0.6450 -0.0803 0.0473  -0.0890 3  DC  C "C3'" 
1063 O "O3'" . DC  C 3  ? 0.7462 0.6397 0.6948 -0.0886 0.0456  -0.0919 3  DC  C "O3'" 
1064 C "C2'" . DC  C 3  ? 0.5894 0.4850 0.5703 -0.0783 0.0367  -0.0767 3  DC  C "C2'" 
1065 C "C1'" . DC  C 3  ? 0.6290 0.5302 0.6138 -0.0930 0.0273  -0.0737 3  DC  C "C1'" 
1066 N N1    . DC  C 3  ? 0.4938 0.4013 0.4980 -0.0914 0.0188  -0.0627 3  DC  C N1    
1067 C C2    . DC  C 3  ? 0.5334 0.4566 0.5441 -0.1027 0.0076  -0.0549 3  DC  C C2    
1068 O O2    . DC  C 3  ? 0.5248 0.4575 0.5243 -0.1140 0.0043  -0.0574 3  DC  C O2    
1069 N N3    . DC  C 3  ? 0.5143 0.4422 0.5428 -0.1002 0.0010  -0.0446 3  DC  C N3    
1070 C C4    . DC  C 3  ? 0.4314 0.3492 0.4702 -0.0879 0.0051  -0.0429 3  DC  C C4    
1071 N N4    . DC  C 3  ? 0.4253 0.3473 0.4807 -0.0858 -0.0009 -0.0332 3  DC  C N4    
1072 C C5    . DC  C 3  ? 0.3870 0.2905 0.4189 -0.0766 0.0158  -0.0508 3  DC  C C5    
1073 C C6    . DC  C 3  ? 0.4264 0.3252 0.4416 -0.0785 0.0225  -0.0600 3  DC  C C6    
1074 P P     . DA  C 4  ? 0.8419 0.7437 0.7836 -0.0793 0.0512  -0.0925 4  DA  C P     
1075 O OP1   . DA  C 4  ? 0.7943 0.6805 0.7179 -0.0766 0.0643  -0.1043 4  DA  C OP1   
1076 O OP2   . DA  C 4  ? 0.7528 0.6600 0.7102 -0.0663 0.0502  -0.0848 4  DA  C OP2   
1077 O "O5'" . DA  C 4  ? 0.7869 0.7109 0.7252 -0.0912 0.0416  -0.0875 4  DA  C "O5'" 
1078 C "C5'" . DA  C 4  ? 0.6961 0.6223 0.6204 -0.1055 0.0390  -0.0929 4  DA  C "C5'" 
1079 C "C4'" . DA  C 4  ? 0.7275 0.6745 0.6589 -0.1166 0.0254  -0.0825 4  DA  C "C4'" 
1080 O "O4'" . DA  C 4  ? 0.7666 0.7139 0.7181 -0.1145 0.0182  -0.0733 4  DA  C "O4'" 
1081 C "C3'" . DA  C 4  ? 0.7410 0.7074 0.6734 -0.1154 0.0221  -0.0745 4  DA  C "C3'" 
1082 O "O3'" . DA  C 4  ? 0.7697 0.7519 0.6936 -0.1285 0.0147  -0.0715 4  DA  C "O3'" 
1083 C "C2'" . DA  C 4  ? 0.6633 0.6349 0.6180 -0.1090 0.0160  -0.0627 4  DA  C "C2'" 
1084 C "C1'" . DA  C 4  ? 0.6152 0.5802 0.5782 -0.1143 0.0102  -0.0610 4  DA  C "C1'" 
1085 N N9    . DA  C 4  ? 0.5569 0.5177 0.5395 -0.1062 0.0076  -0.0537 4  DA  C N9    
1086 C C8    . DA  C 4  ? 0.5496 0.4990 0.5386 -0.0931 0.0143  -0.0561 4  DA  C C8    
1087 N N7    . DA  C 4  ? 0.4481 0.3966 0.4542 -0.0885 0.0099  -0.0487 4  DA  C N7    
1088 C C5    . DA  C 4  ? 0.4948 0.4540 0.5068 -0.0988 0.0001  -0.0404 4  DA  C C5    
1089 C C6    . DA  C 4  ? 0.5407 0.5039 0.5697 -0.0994 -0.0074 -0.0299 4  DA  C C6    
1090 N N6    . DA  C 4  ? 0.5204 0.4760 0.5631 -0.0897 -0.0063 -0.0270 4  DA  C N6    
1091 N N1    . DA  C 4  ? 0.5364 0.5124 0.5673 -0.1098 -0.0159 -0.0221 4  DA  C N1    
1092 C C2    . DA  C 4  ? 0.5188 0.5039 0.5348 -0.1195 -0.0172 -0.0252 4  DA  C C2    
1093 N N3    . DA  C 4  ? 0.5262 0.5080 0.5246 -0.1207 -0.0107 -0.0359 4  DA  C N3    
1094 C C4    . DA  C 4  ? 0.5087 0.4766 0.5064 -0.1097 -0.0018 -0.0429 4  DA  C C4    
1095 P P     . DT  C 5  ? 0.7693 0.7712 0.6877 -0.1301 0.0133  -0.0651 5  DT  C P     
1096 O OP1   . DT  C 5  ? 0.8683 0.8778 0.7663 -0.1418 0.0124  -0.0709 5  DT  C OP1   
1097 O OP2   . DT  C 5  ? 0.7786 0.7769 0.6990 -0.1177 0.0222  -0.0672 5  DT  C OP2   
1098 O "O5'" . DT  C 5  ? 0.7975 0.8140 0.7350 -0.1323 0.0021  -0.0487 5  DT  C "O5'" 
1099 C "C5'" . DT  C 5  ? 0.8191 0.8356 0.7667 -0.1377 -0.0063 -0.0434 5  DT  C "C5'" 
1100 C "C4'" . DT  C 5  ? 0.7665 0.7949 0.7324 -0.1368 -0.0143 -0.0273 5  DT  C "C4'" 
1101 O "O4'" . DT  C 5  ? 0.8091 0.8255 0.7932 -0.1285 -0.0144 -0.0249 5  DT  C "O4'" 
1102 C "C3'" . DT  C 5  ? 0.7879 0.8268 0.7557 -0.1335 -0.0123 -0.0206 5  DT  C "C3'" 
1103 O "O3'" . DT  C 5  ? 0.8047 0.8600 0.7777 -0.1399 -0.0202 -0.0065 5  DT  C "O3'" 
1104 C "C2'" . DT  C 5  ? 0.7075 0.7363 0.6920 -0.1224 -0.0090 -0.0196 5  DT  C "C2'" 
1105 C "C1'" . DT  C 5  ? 0.6574 0.6781 0.6542 -0.1223 -0.0144 -0.0165 5  DT  C "C1'" 
1106 N N1    . DT  C 5  ? 0.5997 0.6060 0.6087 -0.1114 -0.0104 -0.0197 5  DT  C N1    
1107 C C2    . DT  C 5  ? 0.5896 0.5925 0.6157 -0.1092 -0.0155 -0.0120 5  DT  C C2    
1108 O O2    . DT  C 5  ? 0.6733 0.6842 0.7058 -0.1152 -0.0227 -0.0021 5  DT  C O2    
1109 N N3    . DT  C 5  ? 0.5600 0.5507 0.5950 -0.0989 -0.0113 -0.0158 5  DT  C N3    
1110 C C4    . DT  C 5  ? 0.5757 0.5588 0.6049 -0.0903 -0.0030 -0.0256 5  DT  C C4    
1111 O O4    . DT  C 5  ? 0.5501 0.5244 0.5876 -0.0808 -0.0000 -0.0277 5  DT  C O4    
1112 C C5    . DT  C 5  ? 0.5283 0.5156 0.5406 -0.0926 0.0022  -0.0325 5  DT  C C5    
1113 C C7    . DT  C 5  ? 0.4568 0.4377 0.4622 -0.0825 0.0120  -0.0421 5  DT  C C7    
1114 C C6    . DT  C 5  ? 0.5446 0.5425 0.5475 -0.1031 -0.0016 -0.0297 5  DT  C C6    
1115 P P     . DT  C 6  ? 0.7562 0.8253 0.7294 -0.1401 -0.0188 0.0025  6  DT  C P     
1116 O OP1   . DT  C 6  ? 0.8209 0.9062 0.7783 -0.1495 -0.0221 0.0059  6  DT  C OP1   
1117 O OP2   . DT  C 6  ? 0.8490 0.9120 0.8213 -0.1323 -0.0098 -0.0053 6  DT  C OP2   
1118 O "O5'" . DT  C 6  ? 0.5798 0.6512 0.5751 -0.1382 -0.0244 0.0179  6  DT  C "O5'" 
1119 C "C5'" . DT  C 6  ? 0.6170 0.6936 0.6187 -0.1427 -0.0328 0.0277  6  DT  C "C5'" 
1120 C "C4'" . DT  C 6  ? 0.6192 0.6890 0.6433 -0.1372 -0.0350 0.0376  6  DT  C "C4'" 
1121 O "O4'" . DT  C 6  ? 0.6326 0.6853 0.6636 -0.1294 -0.0308 0.0273  6  DT  C "O4'" 
1122 C "C3'" . DT  C 6  ? 0.6181 0.6921 0.6522 -0.1355 -0.0329 0.0482  6  DT  C "C3'" 
1123 O "O3'" . DT  C 6  ? 0.7293 0.8069 0.7773 -0.1362 -0.0381 0.0640  6  DT  C "O3'" 
1124 C "C2'" . DT  C 6  ? 0.5947 0.6549 0.6379 -0.1275 -0.0269 0.0395  6  DT  C "C2'" 
1125 C "C1'" . DT  C 6  ? 0.5850 0.6325 0.6308 -0.1235 -0.0283 0.0316  6  DT  C "C1'" 
1126 N N1    . DT  C 6  ? 0.6208 0.6565 0.6664 -0.1156 -0.0218 0.0185  6  DT  C N1    
1127 C C2    . DT  C 6  ? 0.5950 0.6187 0.6545 -0.1084 -0.0215 0.0174  6  DT  C C2    
1128 O O2    . DT  C 6  ? 0.5492 0.5703 0.6218 -0.1082 -0.0258 0.0262  6  DT  C O2    
1129 N N3    . DT  C 6  ? 0.5392 0.5550 0.5968 -0.1008 -0.0155 0.0060  6  DT  C N3    
1130 C C4    . DT  C 6  ? 0.6177 0.6356 0.6617 -0.0990 -0.0095 -0.0037 6  DT  C C4    
1131 O O4    . DT  C 6  ? 0.6418 0.6534 0.6855 -0.0907 -0.0040 -0.0123 6  DT  C O4    
1132 C C5    . DT  C 6  ? 0.5709 0.5999 0.6008 -0.1069 -0.0096 -0.0026 6  DT  C C5    
1133 C C7    . DT  C 6  ? 0.6106 0.6422 0.6249 -0.1050 -0.0023 -0.0126 6  DT  C C7    
1134 C C6    . DT  C 6  ? 0.5299 0.5674 0.5608 -0.1149 -0.0159 0.0081  6  DT  C C6    
1135 P P     . DA  C 7  ? 0.7366 0.8252 0.7888 -0.1390 -0.0377 0.0800  7  DA  C P     
1136 O OP1   . DA  C 7  ? 0.7919 0.8909 0.8475 -0.1418 -0.0447 0.0950  7  DA  C OP1   
1137 O OP2   . DA  C 7  ? 0.7130 0.8106 0.7501 -0.1425 -0.0331 0.0751  7  DA  C OP2   
1138 O "O5'" . DA  C 7  ? 0.6106 0.6855 0.6824 -0.1333 -0.0336 0.0829  7  DA  C "O5'" 
1139 C "C5'" . DA  C 7  ? 0.6290 0.6921 0.7162 -0.1284 -0.0359 0.0858  7  DA  C "C5'" 
1140 C "C4'" . DA  C 7  ? 0.6352 0.6842 0.7358 -0.1232 -0.0307 0.0810  7  DA  C "C4'" 
1141 O "O4'" . DA  C 7  ? 0.6259 0.6680 0.7209 -0.1192 -0.0279 0.0640  7  DA  C "O4'" 
1142 C "C3'" . DA  C 7  ? 0.6561 0.7081 0.7605 -0.1260 -0.0255 0.0855  7  DA  C "C3'" 
1143 O "O3'" . DA  C 7  ? 0.6618 0.7013 0.7838 -0.1230 -0.0232 0.0893  7  DA  C "O3'" 
1144 C "C2'" . DA  C 7  ? 0.6784 0.7321 0.7732 -0.1251 -0.0211 0.0698  7  DA  C "C2'" 
1145 C "C1'" . DA  C 7  ? 0.6350 0.6766 0.7328 -0.1184 -0.0222 0.0588  7  DA  C "C1'" 
1146 N N9    . DA  C 7  ? 0.5692 0.6110 0.6559 -0.1153 -0.0189 0.0437  7  DA  C N9    
1147 C C8    . DA  C 7  ? 0.5933 0.6447 0.6639 -0.1181 -0.0166 0.0383  7  DA  C C8    
1148 N N7    . DA  C 7  ? 0.5759 0.6236 0.6399 -0.1128 -0.0126 0.0249  7  DA  C N7    
1149 C C5    . DA  C 7  ? 0.5898 0.6257 0.6661 -0.1062 -0.0129 0.0216  7  DA  C C5    
1150 C C6    . DA  C 7  ? 0.5862 0.6141 0.6629 -0.0978 -0.0096 0.0102  7  DA  C C6    
1151 N N6    . DA  C 7  ? 0.5487 0.5785 0.6133 -0.0939 -0.0047 -0.0002 7  DA  C N6    
1152 N N1    . DA  C 7  ? 0.5456 0.5636 0.6353 -0.0927 -0.0110 0.0103  7  DA  C N1    
1153 C C2    . DA  C 7  ? 0.5239 0.5386 0.6257 -0.0957 -0.0148 0.0207  7  DA  C C2    
1154 N N3    . DA  C 7  ? 0.5920 0.6126 0.6955 -0.1029 -0.0176 0.0325  7  DA  C N3    
1155 C C4    . DA  C 7  ? 0.5808 0.6126 0.6709 -0.1080 -0.0168 0.0325  7  DA  C C4    
1156 P P     . DA  C 8  ? 0.7119 0.7509 0.8440 -0.1269 -0.0182 0.0997  8  DA  C P     
1157 O OP1   . DA  C 8  ? 0.6278 0.6674 0.7660 -0.1276 -0.0204 0.1182  8  DA  C OP1   
1158 O OP2   . DA  C 8  ? 0.6785 0.7293 0.8008 -0.1316 -0.0144 0.0953  8  DA  C OP2   
1159 O "O5'" . DA  C 8  ? 0.6508 0.6738 0.7978 -0.1230 -0.0146 0.0915  8  DA  C "O5'" 
1160 C "C5'" . DA  C 8  ? 0.5733 0.5842 0.7270 -0.1165 -0.0172 0.0880  8  DA  C "C5'" 
1161 C "C4'" . DA  C 8  ? 0.6042 0.6080 0.7605 -0.1124 -0.0148 0.0717  8  DA  C "C4'" 
1162 O "O4'" . DA  C 8  ? 0.6878 0.7005 0.8299 -0.1111 -0.0155 0.0599  8  DA  C "O4'" 
1163 C "C3'" . DA  C 8  ? 0.6484 0.6500 0.8136 -0.1159 -0.0093 0.0678  8  DA  C "C3'" 
1164 O "O3'" . DA  C 8  ? 0.6548 0.6426 0.8312 -0.1116 -0.0080 0.0616  8  DA  C "O3'" 
1165 C "C2'" . DA  C 8  ? 0.6441 0.6585 0.7987 -0.1166 -0.0077 0.0556  8  DA  C "C2'" 
1166 C "C1'" . DA  C 8  ? 0.6006 0.6148 0.7444 -0.1102 -0.0114 0.0485  8  DA  C "C1'" 
1167 N N9    . DA  C 8  ? 0.5729 0.5991 0.7022 -0.1103 -0.0102 0.0404  8  DA  C N9    
1168 C C8    . DA  C 8  ? 0.5887 0.6273 0.7077 -0.1159 -0.0094 0.0450  8  DA  C C8    
1169 N N7    . DA  C 8  ? 0.6267 0.6731 0.7333 -0.1139 -0.0073 0.0352  8  DA  C N7    
1170 C C5    . DA  C 8  ? 0.6143 0.6532 0.7236 -0.1062 -0.0067 0.0242  8  DA  C C5    
1171 C C6    . DA  C 8  ? 0.5541 0.5953 0.6548 -0.0996 -0.0038 0.0118  8  DA  C C6    
1172 N N6    . DA  C 8  ? 0.5880 0.6388 0.6750 -0.0999 -0.0006 0.0075  8  DA  C N6    
1173 N N1    . DA  C 8  ? 0.4827 0.5156 0.5890 -0.0917 -0.0037 0.0044  8  DA  C N1    
1174 C C2    . DA  C 8  ? 0.5335 0.5562 0.6526 -0.0911 -0.0063 0.0082  8  DA  C C2    
1175 N N3    . DA  C 8  ? 0.5202 0.5387 0.6485 -0.0968 -0.0086 0.0190  8  DA  C N3    
1176 C C4    . DA  C 8  ? 0.5984 0.6255 0.7214 -0.1041 -0.0087 0.0271  8  DA  C C4    
1177 P P     . DT  C 9  ? 0.6244 0.6074 0.8124 -0.1159 -0.0026 0.0563  9  DT  C P     
1178 O OP1   . DT  C 9  ? 0.6109 0.5760 0.8110 -0.1124 -0.0016 0.0576  9  DT  C OP1   
1179 O OP2   . DT  C 9  ? 0.7467 0.7376 0.9357 -0.1246 0.0009  0.0644  9  DT  C OP2   
1180 O "O5'" . DT  C 9  ? 0.6834 0.6756 0.8659 -0.1129 -0.0024 0.0387  9  DT  C "O5'" 
1181 C "C5'" . DT  C 9  ? 0.6743 0.6590 0.8596 -0.1055 -0.0033 0.0280  9  DT  C "C5'" 
1182 C "C4'" . DT  C 9  ? 0.5805 0.5782 0.7600 -0.1028 -0.0025 0.0138  9  DT  C "C4'" 
1183 O "O4'" . DT  C 9  ? 0.5832 0.5915 0.7488 -0.1005 -0.0038 0.0136  9  DT  C "O4'" 
1184 C "C3'" . DT  C 9  ? 0.5594 0.5684 0.7446 -0.1107 0.0011  0.0097  9  DT  C "C3'" 
1185 O "O3'" . DT  C 9  ? 0.7340 0.7368 0.9309 -0.1122 0.0028  0.0020  9  DT  C "O3'" 
1186 C "C2'" . DT  C 9  ? 0.5469 0.5737 0.7215 -0.1070 0.0014  0.0011  9  DT  C "C2'" 
1187 C "C1'" . DT  C 9  ? 0.6336 0.6572 0.7953 -0.1004 -0.0013 0.0041  9  DT  C "C1'" 
1188 N N1    . DT  C 9  ? 0.5761 0.6114 0.7266 -0.1038 -0.0004 0.0082  9  DT  C N1    
1189 C C2    . DT  C 9  ? 0.5854 0.6292 0.7235 -0.0977 0.0006  0.0008  9  DT  C C2    
1190 O O2    . DT  C 9  ? 0.5580 0.6002 0.6941 -0.0891 0.0007  -0.0081 9  DT  C O2    
1191 N N3    . DT  C 9  ? 0.5267 0.5802 0.6542 -0.1016 0.0021  0.0045  9  DT  C N3    
1192 C C4    . DT  C 9  ? 0.5792 0.6364 0.7070 -0.1105 0.0023  0.0153  9  DT  C C4    
1193 O O4    . DT  C 9  ? 0.6889 0.7558 0.8056 -0.1132 0.0038  0.0176  9  DT  C O4    
1194 C C5    . DT  C 9  ? 0.4219 0.4702 0.5636 -0.1160 0.0014  0.0238  9  DT  C C5    
1195 C C7    . DT  C 9  ? 0.4363 0.4873 0.5798 -0.1248 0.0024  0.0374  9  DT  C C7    
1196 C C6    . DT  C 9  ? 0.4729 0.5100 0.6253 -0.1125 0.0003  0.0196  9  DT  C C6    
1197 P P     . DC  C 10 ? 0.5085 0.5120 0.7050 -0.1034 0.0014  -0.0122 10 DC  C P     
1198 O OP1   . DC  C 10 ? 0.6170 0.6075 0.8088 -0.0938 -0.0013 -0.0097 10 DC  C OP1   
1199 O OP2   . DC  C 10 ? 0.7913 0.7920 0.9999 -0.1098 0.0038  -0.0188 10 DC  C OP2   
1200 O "O5'" . DC  C 10 ? 0.5198 0.5455 0.7075 -0.0997 0.0014  -0.0211 10 DC  C "O5'" 
1201 C "C5'" . DC  C 10 ? 0.6052 0.6337 0.7847 -0.0878 -0.0001 -0.0286 10 DC  C "C5'" 
1202 C "C4'" . DC  C 10 ? 0.4137 0.4632 0.5854 -0.0844 0.0014  -0.0345 10 DC  C "C4'" 
1203 O "O4'" . DC  C 10 ? 0.5196 0.5738 0.6842 -0.0888 0.0026  -0.0269 10 DC  C "O4'" 
1204 C "C3'" . DC  C 10 ? 0.6219 0.6904 0.8014 -0.0890 0.0029  -0.0430 10 DC  C "C3'" 
1205 O "O3'" . DC  C 10 ? 0.7041 0.7847 0.8796 -0.0782 0.0027  -0.0527 10 DC  C "O3'" 
1206 C "C2'" . DC  C 10 ? 0.5295 0.6126 0.7066 -0.0959 0.0056  -0.0383 10 DC  C "C2'" 
1207 C "C1'" . DC  C 10 ? 0.5183 0.5936 0.6816 -0.0901 0.0053  -0.0318 10 DC  C "C1'" 
1208 N N1    . DC  C 10 ? 0.4940 0.5745 0.6531 -0.0979 0.0072  -0.0234 10 DC  C N1    
1209 C C2    . DC  C 10 ? 0.5082 0.6018 0.6556 -0.0939 0.0099  -0.0248 10 DC  C C2    
1210 O O2    . DC  C 10 ? 0.4938 0.5935 0.6351 -0.0836 0.0109  -0.0325 10 DC  C O2    
1211 N N3    . DC  C 10 ? 0.4703 0.5689 0.6127 -0.1008 0.0118  -0.0174 10 DC  C N3    
1212 C C4    . DC  C 10 ? 0.5296 0.6216 0.6787 -0.1109 0.0112  -0.0079 10 DC  C C4    
1213 N N4    . DC  C 10 ? 0.5484 0.6469 0.6914 -0.1170 0.0133  -0.0000 10 DC  C N4    
1214 C C5    . DC  C 10 ? 0.4986 0.5764 0.6602 -0.1146 0.0090  -0.0056 10 DC  C C5    
1215 C C6    . DC  C 10 ? 0.4997 0.5721 0.6658 -0.1081 0.0072  -0.0140 10 DC  C C6    
1216 P P     . DA  C 11 ? 0.7665 0.8674 0.9509 -0.0804 0.0026  -0.0637 11 DA  C P     
1217 O OP1   . DA  C 11 ? 0.7266 0.8308 0.9065 -0.0671 0.0012  -0.0714 11 DA  C OP1   
1218 O OP2   . DA  C 11 ? 0.7431 0.8370 0.9404 -0.0941 0.0027  -0.0635 11 DA  C OP2   
1219 O "O5'" . DA  C 11 ? 0.6269 0.7534 0.8087 -0.0812 0.0053  -0.0644 11 DA  C "O5'" 
1220 C "C5'" . DA  C 11 ? 0.5776 0.7124 0.7474 -0.0684 0.0070  -0.0650 11 DA  C "C5'" 
1221 C "C4'" . DA  C 11 ? 0.5286 0.6823 0.6958 -0.0714 0.0107  -0.0627 11 DA  C "C4'" 
1222 O "O4'" . DA  C 11 ? 0.6240 0.7656 0.7896 -0.0811 0.0115  -0.0534 11 DA  C "O4'" 
1223 C "C3'" . DA  C 11 ? 0.6818 0.8620 0.8610 -0.0788 0.0113  -0.0682 11 DA  C "C3'" 
1224 O "O3'" . DA  C 11 ? 0.7668 0.9701 0.9424 -0.0669 0.0128  -0.0741 11 DA  C "O3'" 
1225 C "C2'" . DA  C 11 ? 0.6685 0.8532 0.8496 -0.0903 0.0144  -0.0609 11 DA  C "C2'" 
1226 C "C1'" . DA  C 11 ? 0.5029 0.6639 0.6719 -0.0885 0.0147  -0.0519 11 DA  C "C1'" 
1227 N N9    . DA  C 11 ? 0.5138 0.6634 0.6873 -0.1017 0.0149  -0.0431 11 DA  C N9    
1228 C C8    . DA  C 11 ? 0.4985 0.6335 0.6828 -0.1108 0.0130  -0.0408 11 DA  C C8    
1229 N N7    . DA  C 11 ? 0.4768 0.6037 0.6626 -0.1205 0.0146  -0.0308 11 DA  C N7    
1230 C C5    . DA  C 11 ? 0.4484 0.5861 0.6232 -0.1180 0.0171  -0.0269 11 DA  C C5    
1231 C C6    . DA  C 11 ? 0.4989 0.6366 0.6685 -0.1245 0.0197  -0.0166 11 DA  C C6    
1232 N N6    . DA  C 11 ? 0.5684 0.6949 0.7444 -0.1346 0.0201  -0.0068 11 DA  C N6    
1233 N N1    . DA  C 11 ? 0.4519 0.6017 0.6089 -0.1196 0.0224  -0.0165 11 DA  C N1    
1234 C C2    . DA  C 11 ? 0.4854 0.6454 0.6363 -0.1085 0.0231  -0.0253 11 DA  C C2    
1235 N N3    . DA  C 11 ? 0.4612 0.6228 0.6165 -0.1009 0.0211  -0.0342 11 DA  C N3    
1236 C C4    . DA  C 11 ? 0.4797 0.6304 0.6469 -0.1065 0.0177  -0.0347 11 DA  C C4    
1237 P P     . DT  C 12 ? 0.8013 1.0394 0.9889 -0.0711 0.0130  -0.0811 12 DT  C P     
1238 O OP1   . DT  C 12 ? 0.7493 1.0036 0.9331 -0.0556 0.0124  -0.0874 12 DT  C OP1   
1239 O OP2   . DT  C 12 ? 0.7978 1.0336 0.9998 -0.0878 0.0106  -0.0838 12 DT  C OP2   
1240 O "O5'" . DT  C 12 ? 0.5712 0.8251 0.7561 -0.0733 0.0183  -0.0757 12 DT  C "O5'" 
1241 C "C5'" . DT  C 12 ? 0.5876 0.8343 0.7572 -0.0620 0.0223  -0.0709 12 DT  C "C5'" 
1242 C "C4'" . DT  C 12 ? 0.5895 0.8478 0.7575 -0.0679 0.0273  -0.0655 12 DT  C "C4'" 
1243 O "O4'" . DT  C 12 ? 0.6292 0.8671 0.7968 -0.0807 0.0267  -0.0582 12 DT  C "O4'" 
1244 C "C3'" . DT  C 12 ? 0.6192 0.9108 0.8012 -0.0752 0.0287  -0.0686 12 DT  C "C3'" 
1245 O "O3'" . DT  C 12 ? 0.6066 0.9173 0.7823 -0.0676 0.0349  -0.0665 12 DT  C "O3'" 
1246 C "C2'" . DT  C 12 ? 0.6651 0.9479 0.8563 -0.0941 0.0281  -0.0638 12 DT  C "C2'" 
1247 C "C1'" . DT  C 12 ? 0.5274 0.7827 0.7042 -0.0928 0.0294  -0.0555 12 DT  C "C1'" 
1248 N N1    . DT  C 12 ? 0.4745 0.7108 0.6568 -0.1074 0.0279  -0.0488 12 DT  C N1    
1249 C C2    . DT  C 12 ? 0.5093 0.7411 0.6852 -0.1133 0.0313  -0.0397 12 DT  C C2    
1250 O O2    . DT  C 12 ? 0.4954 0.7372 0.6608 -0.1077 0.0356  -0.0379 12 DT  C O2    
1251 N N3    . DT  C 12 ? 0.4550 0.6700 0.6367 -0.1256 0.0301  -0.0325 12 DT  C N3    
1252 C C4    . DT  C 12 ? 0.4666 0.6672 0.6598 -0.1323 0.0266  -0.0339 12 DT  C C4    
1253 O O4    . DT  C 12 ? 0.3858 0.5707 0.5837 -0.1422 0.0269  -0.0260 12 DT  C O4    
1254 C C5    . DT  C 12 ? 0.4764 0.6820 0.6752 -0.1262 0.0232  -0.0450 12 DT  C C5    
1255 C C7    . DT  C 12 ? 0.4636 0.6540 0.6735 -0.1326 0.0199  -0.0487 12 DT  C C7    
1256 C C6    . DT  C 12 ? 0.3994 0.6234 0.5924 -0.1143 0.0237  -0.0516 12 DT  C C6    
1257 P P     . DG  C 13 ? 0.6731 1.0247 0.8620 -0.0702 0.0375  -0.0695 13 DG  C P     
1258 O OP1   . DG  C 13 ? 0.6505 1.0205 0.8340 -0.0514 0.0399  -0.0729 13 DG  C OP1   
1259 O OP2   . DG  C 13 ? 0.6903 1.0515 0.8975 -0.0859 0.0329  -0.0738 13 DG  C OP2   
1260 O "O5'" . DG  C 13 ? 0.5286 0.8841 0.7134 -0.0763 0.0441  -0.0619 13 DG  C "O5'" 
1261 C "C5'" . DG  C 13 ? 0.4616 0.7946 0.6279 -0.0701 0.0478  -0.0565 13 DG  C "C5'" 
1262 C "C4'" . DG  C 13 ? 0.5853 0.9190 0.7502 -0.0816 0.0521  -0.0491 13 DG  C "C4'" 
1263 O "O4'" . DG  C 13 ? 0.6523 0.9643 0.8217 -0.0962 0.0478  -0.0446 13 DG  C "O4'" 
1264 C "C3'" . DG  C 13 ? 0.6524 1.0206 0.8312 -0.0884 0.0561  -0.0487 13 DG  C "C3'" 
1265 O "O3'" . DG  C 13 ? 0.6781 1.0499 0.8474 -0.0890 0.0632  -0.0423 13 DG  C "O3'" 
1266 C "C2'" . DG  C 13 ? 0.6013 0.9665 0.7970 -0.1070 0.0517  -0.0480 13 DG  C "C2'" 
1267 C "C1'" . DG  C 13 ? 0.5046 0.8330 0.6897 -0.1112 0.0491  -0.0422 13 DG  C "C1'" 
1268 N N9    . DG  C 13 ? 0.5014 0.8143 0.6983 -0.1226 0.0435  -0.0431 13 DG  C N9    
1269 C C8    . DG  C 13 ? 0.5110 0.8243 0.7168 -0.1212 0.0382  -0.0516 13 DG  C C8    
1270 N N7    . DG  C 13 ? 0.4493 0.7450 0.6641 -0.1330 0.0350  -0.0509 13 DG  C N7    
1271 C C5    . DG  C 13 ? 0.3711 0.6546 0.5833 -0.1422 0.0384  -0.0403 13 DG  C C5    
1272 C C6    . DG  C 13 ? 0.4045 0.6671 0.6235 -0.1554 0.0381  -0.0337 13 DG  C C6    
1273 O O6    . DG  C 13 ? 0.5056 0.7543 0.7345 -0.1619 0.0350  -0.0368 13 DG  C O6    
1274 N N1    . DG  C 13 ? 0.3903 0.6485 0.6029 -0.1603 0.0424  -0.0222 13 DG  C N1    
1275 C C2    . DG  C 13 ? 0.4240 0.6959 0.6244 -0.1539 0.0466  -0.0187 13 DG  C C2    
1276 N N2    . DG  C 13 ? 0.3665 0.6327 0.5609 -0.1601 0.0504  -0.0074 13 DG  C N2    
1277 N N3    . DG  C 13 ? 0.4940 0.7838 0.6879 -0.1418 0.0475  -0.0255 13 DG  C N3    
1278 C C4    . DG  C 13 ? 0.5150 0.8099 0.7158 -0.1363 0.0433  -0.0356 13 DG  C C4    
1279 P P     . DC  C 14 ? 0.6443 1.0533 0.8190 -0.0850 0.0709  -0.0420 14 DC  C P     
1280 O OP1   . DC  C 14 ? 0.6425 1.0467 0.7974 -0.0694 0.0778  -0.0411 14 DC  C OP1   
1281 O OP2   . DC  C 14 ? 0.5324 0.9699 0.7256 -0.0846 0.0677  -0.0485 14 DC  C OP2   
1282 O "O5'" . DC  C 14 ? 0.6420 1.0568 0.8242 -0.1026 0.0741  -0.0345 14 DC  C "O5'" 
1283 C "C5'" . DC  C 14 ? 0.6759 1.0876 0.8749 -0.1197 0.0694  -0.0337 14 DC  C "C5'" 
1284 C "C4'" . DC  C 14 ? 0.6954 1.0989 0.8940 -0.1336 0.0731  -0.0238 14 DC  C "C4'" 
1285 O "O4'" . DC  C 14 ? 0.6397 1.0160 0.8426 -0.1446 0.0675  -0.0213 14 DC  C "O4'" 
1286 C "C3'" . DC  C 14 ? 0.6378 1.0707 0.8544 -0.1460 0.0781  -0.0213 14 DC  C "C3'" 
1287 O "O3'" . DC  C 14 ? 0.6627 1.0898 0.8732 -0.1540 0.0839  -0.0106 14 DC  C "O3'" 
1288 C "C2'" . DC  C 14 ? 0.6262 1.0547 0.8621 -0.1596 0.0723  -0.0254 14 DC  C "C2'" 
1289 C "C1'" . DC  C 14 ? 0.5655 0.9540 0.7903 -0.1602 0.0673  -0.0220 14 DC  C "C1'" 
1290 N N1    . DC  C 14 ? 0.4914 0.8669 0.7250 -0.1624 0.0599  -0.0298 14 DC  C N1    
1291 C C2    . DC  C 14 ? 0.4679 0.8139 0.7040 -0.1722 0.0569  -0.0256 14 DC  C C2    
1292 O O2    . DC  C 14 ? 0.4552 0.7875 0.6864 -0.1787 0.0603  -0.0147 14 DC  C O2    
1293 N N3    . DC  C 14 ? 0.3959 0.7297 0.6395 -0.1737 0.0509  -0.0332 14 DC  C N3    
1294 C C4    . DC  C 14 ? 0.4811 0.8324 0.7289 -0.1661 0.0473  -0.0445 14 DC  C C4    
1295 N N4    . DC  C 14 ? 0.3954 0.7342 0.6493 -0.1677 0.0416  -0.0520 14 DC  C N4    
1296 C C5    . DC  C 14 ? 0.4501 0.8329 0.6957 -0.1556 0.0498  -0.0480 14 DC  C C5    
1297 C C6    . DC  C 14 ? 0.4307 0.8239 0.6695 -0.1540 0.0563  -0.0405 14 DC  C C6    
1298 O "O5'" . DG  D 1  ? 1.0535 1.2836 1.3474 -0.2715 0.0957  0.0622  1  DG  D "O5'" 
1299 C "C5'" . DG  D 1  ? 1.0899 1.3153 1.3859 -0.2663 0.0876  0.0461  1  DG  D "C5'" 
1300 C "C4'" . DG  D 1  ? 1.1891 1.4013 1.4652 -0.2498 0.0794  0.0468  1  DG  D "C4'" 
1301 O "O4'" . DG  D 1  ? 1.0902 1.3135 1.3638 -0.2409 0.0720  0.0300  1  DG  D "O4'" 
1302 C "C3'" . DG  D 1  ? 1.1574 1.3351 1.4323 -0.2484 0.0772  0.0538  1  DG  D "C3'" 
1303 O "O3'" . DG  D 1  ? 1.1634 1.3336 1.4186 -0.2366 0.0732  0.0634  1  DG  D "O3'" 
1304 C "C2'" . DG  D 1  ? 1.0915 1.2635 1.3720 -0.2451 0.0706  0.0369  1  DG  D "C2'" 
1305 C "C1'" . DG  D 1  ? 1.0483 1.2462 1.3179 -0.2343 0.0658  0.0270  1  DG  D "C1'" 
1306 N N9    . DG  D 1  ? 0.9488 1.1552 1.2243 -0.2313 0.0605  0.0095  1  DG  D N9    
1307 C C8    . DG  D 1  ? 1.0219 1.2141 1.3093 -0.2365 0.0586  0.0005  1  DG  D C8    
1308 N N7    . DG  D 1  ? 0.9223 1.1293 1.2111 -0.2314 0.0535  -0.0147 1  DG  D N7    
1309 C C5    . DG  D 1  ? 0.7284 0.9600 1.0063 -0.2216 0.0524  -0.0151 1  DG  D C5    
1310 C C6    . DG  D 1  ? 0.7600 1.0157 1.0343 -0.2115 0.0483  -0.0270 1  DG  D C6    
1311 O O6    . DG  D 1  ? 0.8406 1.1029 1.1204 -0.2092 0.0438  -0.0399 1  DG  D O6    
1312 N N1    . DG  D 1  ? 0.6551 0.9286 0.9175 -0.2029 0.0502  -0.0223 1  DG  D N1    
1313 C C2    . DG  D 1  ? 0.7005 0.9699 0.9547 -0.2045 0.0550  -0.0089 1  DG  D C2    
1314 N N2    . DG  D 1  ? 0.6149 0.9024 0.8569 -0.1953 0.0569  -0.0074 1  DG  D N2    
1315 N N3    . DG  D 1  ? 0.7501 0.9991 1.0072 -0.2139 0.0582  0.0025  1  DG  D N3    
1316 C C4    . DG  D 1  ? 0.7091 0.9397 0.9786 -0.2218 0.0569  -0.0009 1  DG  D C4    
1317 P P     . DC  D 2  ? 1.0729 1.2120 1.3243 -0.2331 0.0712  0.0753  2  DC  D P     
1318 O OP1   . DC  D 2  ? 1.1355 1.2652 1.3957 -0.2435 0.0801  0.0915  2  DC  D OP1   
1319 O OP2   . DC  D 2  ? 0.9350 1.0578 1.1920 -0.2295 0.0657  0.0636  2  DC  D OP2   
1320 O "O5'" . DC  D 2  ? 0.8584 1.0015 1.0866 -0.2205 0.0659  0.0819  2  DC  D "O5'" 
1321 C "C5'" . DC  D 2  ? 0.8751 1.0253 1.0915 -0.2092 0.0585  0.0693  2  DC  D "C5'" 
1322 C "C4'" . DC  D 2  ? 0.7833 0.9579 0.9860 -0.2052 0.0598  0.0677  2  DC  D "C4'" 
1323 O "O4'" . DC  D 2  ? 0.8622 1.0553 1.0710 -0.2040 0.0597  0.0521  2  DC  D "O4'" 
1324 C "C3'" . DC  D 2  ? 0.8302 1.0031 1.0114 -0.1933 0.0541  0.0676  2  DC  D "C3'" 
1325 O "O3'" . DC  D 2  ? 0.8772 1.0688 1.0449 -0.1919 0.0577  0.0710  2  DC  D "O3'" 
1326 C "C2'" . DC  D 2  ? 0.7954 0.9697 0.9771 -0.1852 0.0490  0.0508  2  DC  D "C2'" 
1327 C "C1'" . DC  D 2  ? 0.7007 0.8955 0.8959 -0.1910 0.0537  0.0424  2  DC  D "C1'" 
1328 N N1    . DC  D 2  ? 0.6172 0.8115 0.8233 -0.1889 0.0500  0.0280  2  DC  D N1    
1329 C C2    . DC  D 2  ? 0.6609 0.8764 0.8656 -0.1823 0.0495  0.0157  2  DC  D C2    
1330 O O2    . DC  D 2  ? 0.6423 0.8750 0.8369 -0.1783 0.0528  0.0168  2  DC  D O2    
1331 N N3    . DC  D 2  ? 0.6022 0.8193 0.8162 -0.1800 0.0459  0.0033  2  DC  D N3    
1332 C C4    . DC  D 2  ? 0.6304 0.8277 0.8541 -0.1844 0.0431  0.0020  2  DC  D C4    
1333 N N4    . DC  D 2  ? 0.5488 0.7494 0.7801 -0.1819 0.0396  -0.0109 2  DC  D N4    
1334 C C5    . DC  D 2  ? 0.5807 0.7545 0.8063 -0.1909 0.0443  0.0142  2  DC  D C5    
1335 C C6    . DC  D 2  ? 0.5962 0.7700 0.8132 -0.1927 0.0476  0.0273  2  DC  D C6    
1336 P P     . DA  D 3  ? 0.8469 1.0363 0.9904 -0.1838 0.0539  0.0756  3  DA  D P     
1337 O OP1   . DA  D 3  ? 1.0219 1.2218 1.1576 -0.1889 0.0595  0.0890  3  DA  D OP1   
1338 O OP2   . DA  D 3  ? 0.6655 0.8333 0.8078 -0.1796 0.0468  0.0772  3  DA  D OP2   
1339 O "O5'" . DA  D 3  ? 0.7613 0.9641 0.8934 -0.1743 0.0532  0.0606  3  DA  D "O5'" 
1340 C "C5'" . DA  D 3  ? 0.6916 0.9172 0.8232 -0.1753 0.0599  0.0571  3  DA  D "C5'" 
1341 C "C4'" . DA  D 3  ? 0.8054 1.0397 0.9298 -0.1645 0.0591  0.0423  3  DA  D "C4'" 
1342 O "O4'" . DA  D 3  ? 0.8119 1.0416 0.9511 -0.1625 0.0553  0.0325  3  DA  D "O4'" 
1343 C "C3'" . DA  D 3  ? 0.7857 1.0098 0.8884 -0.1547 0.0553  0.0386  3  DA  D "C3'" 
1344 O "O3'" . DA  D 3  ? 0.8600 1.0985 0.9511 -0.1468 0.0599  0.0302  3  DA  D "O3'" 
1345 C "C2'" . DA  D 3  ? 0.7158 0.9225 0.8250 -0.1499 0.0483  0.0316  3  DA  D "C2'" 
1346 C "C1'" . DA  D 3  ? 0.6716 0.8892 0.8003 -0.1518 0.0500  0.0245  3  DA  D "C1'" 
1347 N N9    . DA  D 3  ? 0.5722 0.7744 0.7140 -0.1527 0.0445  0.0214  3  DA  D N9    
1348 C C8    . DA  D 3  ? 0.6346 0.8176 0.7819 -0.1582 0.0412  0.0297  3  DA  D C8    
1349 N N7    . DA  D 3  ? 0.6435 0.8153 0.8023 -0.1573 0.0374  0.0239  3  DA  D N7    
1350 C C5    . DA  D 3  ? 0.5471 0.7329 0.7078 -0.1509 0.0377  0.0111  3  DA  D C5    
1351 C C6    . DA  D 3  ? 0.4776 0.6627 0.6475 -0.1467 0.0347  0.0001  3  DA  D C6    
1352 N N6    . DA  D 3  ? 0.5910 0.7585 0.7702 -0.1489 0.0308  -0.0006 3  DA  D N6    
1353 N N1    . DA  D 3  ? 0.4748 0.6790 0.6437 -0.1394 0.0361  -0.0097 3  DA  D N1    
1354 C C2    . DA  D 3  ? 0.5506 0.7717 0.7102 -0.1363 0.0409  -0.0088 3  DA  D C2    
1355 N N3    . DA  D 3  ? 0.5923 0.8148 0.7423 -0.1401 0.0445  0.0001  3  DA  D N3    
1356 C C4    . DA  D 3  ? 0.5735 0.7782 0.7244 -0.1476 0.0423  0.0099  3  DA  D C4    
1357 P P     . DT  D 4  ? 0.9583 1.1875 1.0257 -0.1370 0.0585  0.0241  4  DT  D P     
1358 O OP1   . DT  D 4  ? 0.8720 1.1183 0.9276 -0.1321 0.0665  0.0201  4  DT  D OP1   
1359 O OP2   . DT  D 4  ? 0.6315 0.8456 0.6892 -0.1414 0.0533  0.0327  4  DT  D OP2   
1360 O "O5'" . DT  D 4  ? 0.6269 0.8455 0.6995 -0.1278 0.0542  0.0126  4  DT  D "O5'" 
1361 C "C5'" . DT  D 4  ? 0.5981 0.8302 0.6842 -0.1235 0.0566  0.0050  4  DT  D "C5'" 
1362 C "C4'" . DT  D 4  ? 0.6590 0.8797 0.7453 -0.1133 0.0526  -0.0047 4  DT  D "C4'" 
1363 O "O4'" . DT  D 4  ? 0.6456 0.8558 0.7480 -0.1179 0.0463  -0.0038 4  DT  D "O4'" 
1364 C "C3'" . DT  D 4  ? 0.7236 0.9253 0.7907 -0.1066 0.0506  -0.0074 4  DT  D "C3'" 
1365 O "O3'" . DT  D 4  ? 0.7390 0.9409 0.8005 -0.0938 0.0534  -0.0175 4  DT  D "O3'" 
1366 C "C2'" . DT  D 4  ? 0.5672 0.7494 0.6416 -0.1108 0.0424  -0.0038 4  DT  D "C2'" 
1367 C "C1'" . DT  D 4  ? 0.5126 0.7021 0.6078 -0.1119 0.0412  -0.0067 4  DT  D "C1'" 
1368 N N1    . DT  D 4  ? 0.4720 0.6471 0.5799 -0.1187 0.0352  -0.0018 4  DT  D N1    
1369 C C2    . DT  D 4  ? 0.4961 0.6675 0.6165 -0.1155 0.0321  -0.0082 4  DT  D C2    
1370 O O2    . DT  D 4  ? 0.4651 0.6462 0.5869 -0.1072 0.0336  -0.0172 4  DT  D O2    
1371 N N3    . DT  D 4  ? 0.4320 0.5885 0.5630 -0.1218 0.0277  -0.0034 4  DT  D N3    
1372 C C4    . DT  D 4  ? 0.4299 0.5755 0.5609 -0.1300 0.0263  0.0081  4  DT  D C4    
1373 O O4    . DT  D 4  ? 0.4830 0.6148 0.6243 -0.1340 0.0232  0.0122  4  DT  D O4    
1374 C C5    . DT  D 4  ? 0.4303 0.5824 0.5478 -0.1327 0.0291  0.0151  4  DT  D C5    
1375 C C7    . DT  D 4  ? 0.4747 0.6188 0.5906 -0.1404 0.0277  0.0289  4  DT  D C7    
1376 C C6    . DT  D 4  ? 0.4502 0.6162 0.5566 -0.1273 0.0333  0.0094  4  DT  D C6    
1377 P P     . DG  D 5  ? 0.7330 0.9240 0.7712 -0.0857 0.0574  -0.0227 5  DG  D P     
1378 O OP1   . DG  D 5  ? 0.8841 1.0930 0.9153 -0.0804 0.0666  -0.0254 5  DG  D OP1   
1379 O OP2   . DG  D 5  ? 0.8909 1.0669 0.9186 -0.0936 0.0527  -0.0171 5  DG  D OP2   
1380 O "O5'" . DG  D 5  ? 0.7043 0.8822 0.7435 -0.0740 0.0558  -0.0309 5  DG  D "O5'" 
1381 C "C5'" . DG  D 5  ? 0.6593 0.8501 0.7105 -0.0655 0.0578  -0.0357 5  DG  D "C5'" 
1382 C "C4'" . DG  D 5  ? 0.5910 0.7680 0.6499 -0.0608 0.0520  -0.0389 5  DG  D "C4'" 
1383 O "O4'" . DG  D 5  ? 0.5633 0.7359 0.6358 -0.0720 0.0444  -0.0334 5  DG  D "O4'" 
1384 C "C3'" . DG  D 5  ? 0.5625 0.7152 0.6071 -0.0550 0.0514  -0.0421 5  DG  D "C3'" 
1385 O "O3'" . DG  D 5  ? 0.5489 0.6989 0.5939 -0.0412 0.0542  -0.0485 5  DG  D "O3'" 
1386 C "C2'" . DG  D 5  ? 0.5272 0.6646 0.5781 -0.0644 0.0426  -0.0369 5  DG  D "C2'" 
1387 C "C1'" . DG  D 5  ? 0.5896 0.7401 0.6602 -0.0705 0.0391  -0.0338 5  DG  D "C1'" 
1388 N N9    . DG  D 5  ? 0.4955 0.6379 0.5727 -0.0827 0.0332  -0.0256 5  DG  D N9    
1389 C C8    . DG  D 5  ? 0.5116 0.6526 0.5816 -0.0918 0.0327  -0.0180 5  DG  D C8    
1390 N N7    . DG  D 5  ? 0.4539 0.5874 0.5330 -0.1004 0.0275  -0.0102 5  DG  D N7    
1391 C C5    . DG  D 5  ? 0.4121 0.5407 0.5051 -0.0973 0.0245  -0.0139 5  DG  D C5    
1392 C C6    . DG  D 5  ? 0.4151 0.5336 0.5218 -0.1028 0.0197  -0.0093 5  DG  D C6    
1393 O O6    . DG  D 5  ? 0.4035 0.5151 0.5137 -0.1111 0.0172  0.0004  5  DG  D O6    
1394 N N1    . DG  D 5  ? 0.3390 0.4556 0.4555 -0.0970 0.0182  -0.0166 5  DG  D N1    
1395 C C2    . DG  D 5  ? 0.4406 0.5658 0.5542 -0.0866 0.0208  -0.0261 5  DG  D C2    
1396 N N2    . DG  D 5  ? 0.3800 0.5038 0.5034 -0.0819 0.0186  -0.0318 5  DG  D N2    
1397 N N3    . DG  D 5  ? 0.3769 0.5115 0.4785 -0.0805 0.0258  -0.0294 5  DG  D N3    
1398 C C4    . DG  D 5  ? 0.3960 0.5309 0.4876 -0.0866 0.0275  -0.0234 5  DG  D C4    
1399 P P     . DA  D 6  ? 0.6343 0.7587 0.6679 -0.0338 0.0546  -0.0525 6  DA  D P     
1400 O OP1   . DA  D 6  ? 0.6306 0.7579 0.6595 -0.0179 0.0625  -0.0582 6  DA  D OP1   
1401 O OP2   . DA  D 6  ? 0.5443 0.6543 0.5635 -0.0421 0.0540  -0.0509 6  DA  D OP2   
1402 O "O5'" . DA  D 6  ? 0.5799 0.6954 0.6274 -0.0359 0.0460  -0.0508 6  DA  D "O5'" 
1403 C "C5'" . DA  D 6  ? 0.5069 0.6352 0.5684 -0.0301 0.0446  -0.0527 6  DA  D "C5'" 
1404 C "C4'" . DA  D 6  ? 0.5019 0.6179 0.5736 -0.0328 0.0371  -0.0515 6  DA  D "C4'" 
1405 O "O4'" . DA  D 6  ? 0.5620 0.6749 0.6403 -0.0474 0.0312  -0.0452 6  DA  D "O4'" 
1406 C "C3'" . DA  D 6  ? 0.5164 0.6087 0.5800 -0.0269 0.0367  -0.0528 6  DA  D "C3'" 
1407 O "O3'" . DA  D 6  ? 0.4505 0.5397 0.5240 -0.0213 0.0333  -0.0544 6  DA  D "O3'" 
1408 C "C2'" . DA  D 6  ? 0.4088 0.4882 0.4699 -0.0397 0.0317  -0.0472 6  DA  D "C2'" 
1409 C "C1'" . DA  D 6  ? 0.4217 0.5132 0.4971 -0.0498 0.0269  -0.0425 6  DA  D "C1'" 
1410 N N9    . DA  D 6  ? 0.4187 0.5077 0.4923 -0.0624 0.0240  -0.0352 6  DA  D N9    
1411 C C8    . DA  D 6  ? 0.4672 0.5580 0.5275 -0.0665 0.0268  -0.0334 6  DA  D C8    
1412 N N7    . DA  D 6  ? 0.4345 0.5245 0.4961 -0.0776 0.0229  -0.0254 6  DA  D N7    
1413 C C5    . DA  D 6  ? 0.3644 0.4502 0.4417 -0.0808 0.0178  -0.0216 6  DA  D C5    
1414 C C6    . DA  D 6  ? 0.3857 0.4677 0.4720 -0.0904 0.0131  -0.0122 6  DA  D C6    
1415 N N6    . DA  D 6  ? 0.4084 0.4925 0.4890 -0.0987 0.0121  -0.0039 6  DA  D N6    
1416 N N1    . DA  D 6  ? 0.4162 0.4923 0.5174 -0.0905 0.0100  -0.0115 6  DA  D N1    
1417 C C2    . DA  D 6  ? 0.4174 0.4933 0.5233 -0.0820 0.0108  -0.0198 6  DA  D C2    
1418 N N3    . DA  D 6  ? 0.4711 0.5520 0.5695 -0.0721 0.0146  -0.0280 6  DA  D N3    
1419 C C4    . DA  D 6  ? 0.3833 0.4684 0.4678 -0.0719 0.0183  -0.0283 6  DA  D C4    
1420 P P     . DT  D 7  ? 0.5561 0.6278 0.6232 -0.0088 0.0359  -0.0574 7  DT  D P     
1421 O OP1   . DT  D 7  ? 0.6111 0.6970 0.6808 0.0049  0.0399  -0.0614 7  DT  D OP1   
1422 O OP2   . DT  D 7  ? 0.4748 0.5303 0.5270 -0.0095 0.0400  -0.0576 7  DT  D OP2   
1423 O "O5'" . DT  D 7  ? 0.6917 0.7511 0.7691 -0.0135 0.0284  -0.0547 7  DT  D "O5'" 
1424 C "C5'" . DT  D 7  ? 0.5520 0.6226 0.6436 -0.0177 0.0234  -0.0545 7  DT  D "C5'" 
1425 C "C4'" . DT  D 7  ? 0.5030 0.5603 0.6021 -0.0282 0.0170  -0.0494 7  DT  D "C4'" 
1426 O "O4'" . DT  D 7  ? 0.4810 0.5375 0.5771 -0.0399 0.0158  -0.0438 7  DT  D "O4'" 
1427 C "C3'" . DT  D 7  ? 0.4696 0.5058 0.5662 -0.0241 0.0156  -0.0479 7  DT  D "C3'" 
1428 O "O3'" . DT  D 7  ? 0.5064 0.5395 0.6138 -0.0221 0.0121  -0.0486 7  DT  D "O3'" 
1429 C "C2'" . DT  D 7  ? 0.3838 0.4098 0.4778 -0.0354 0.0124  -0.0411 7  DT  D "C2'" 
1430 C "C1'" . DT  D 7  ? 0.4291 0.4694 0.5280 -0.0455 0.0111  -0.0382 7  DT  D "C1'" 
1431 N N1    . DT  D 7  ? 0.4702 0.5091 0.5622 -0.0551 0.0102  -0.0323 7  DT  D N1    
1432 C C2    . DT  D 7  ? 0.5411 0.5777 0.6407 -0.0653 0.0057  -0.0242 7  DT  D C2    
1433 O O2    . DT  D 7  ? 0.6240 0.6576 0.7362 -0.0672 0.0029  -0.0220 7  DT  D O2    
1434 N N3    . DT  D 7  ? 0.4703 0.5082 0.5620 -0.0730 0.0049  -0.0185 7  DT  D N3    
1435 C C4    . DT  D 7  ? 0.5307 0.5711 0.6070 -0.0724 0.0082  -0.0214 7  DT  D C4    
1436 O O4    . DT  D 7  ? 0.5502 0.5928 0.6190 -0.0800 0.0070  -0.0164 7  DT  D O4    
1437 C C5    . DT  D 7  ? 0.4081 0.4482 0.4771 -0.0616 0.0138  -0.0307 7  DT  D C5    
1438 C C7    . DT  D 7  ? 0.3370 0.3769 0.3888 -0.0597 0.0192  -0.0352 7  DT  D C7    
1439 C C6    . DT  D 7  ? 0.4210 0.4608 0.4984 -0.0532 0.0145  -0.0349 7  DT  D C6    
1440 P P     . DT  D 8  ? 0.5478 0.5615 0.6556 -0.0166 0.0109  -0.0471 8  DT  D P     
1441 O OP1   . DT  D 8  ? 0.4132 0.4304 0.5287 -0.0098 0.0099  -0.0511 8  DT  D OP1   
1442 O OP2   . DT  D 8  ? 0.4983 0.5024 0.5939 -0.0102 0.0155  -0.0478 8  DT  D OP2   
1443 O "O5'" . DT  D 8  ? 0.4532 0.4566 0.5676 -0.0285 0.0056  -0.0394 8  DT  D "O5'" 
1444 C "C5'" . DT  D 8  ? 0.4660 0.4740 0.5920 -0.0363 0.0023  -0.0374 8  DT  D "C5'" 
1445 C "C4'" . DT  D 8  ? 0.4089 0.4076 0.5390 -0.0464 -0.0013 -0.0281 8  DT  D "C4'" 
1446 O "O4'" . DT  D 8  ? 0.4458 0.4494 0.5670 -0.0523 -0.0007 -0.0246 8  DT  D "O4'" 
1447 C "C3'" . DT  D 8  ? 0.3974 0.3799 0.5290 -0.0433 -0.0032 -0.0238 8  DT  D "C3'" 
1448 O "O3'" . DT  D 8  ? 0.5172 0.4927 0.6612 -0.0460 -0.0056 -0.0199 8  DT  D "O3'" 
1449 C "C2'" . DT  D 8  ? 0.4515 0.4317 0.5760 -0.0498 -0.0047 -0.0172 8  DT  D "C2'" 
1450 C "C1'" . DT  D 8  ? 0.4228 0.4165 0.5438 -0.0573 -0.0039 -0.0166 8  DT  D "C1'" 
1451 N N1    . DT  D 8  ? 0.4764 0.4734 0.5839 -0.0604 -0.0028 -0.0161 8  DT  D N1    
1452 C C2    . DT  D 8  ? 0.5218 0.5212 0.6277 -0.0700 -0.0059 -0.0078 8  DT  D C2    
1453 O O2    . DT  D 8  ? 0.5569 0.5550 0.6724 -0.0754 -0.0091 0.0005  8  DT  D O2    
1454 N N3    . DT  D 8  ? 0.4167 0.4197 0.5085 -0.0726 -0.0046 -0.0094 8  DT  D N3    
1455 C C4    . DT  D 8  ? 0.5163 0.5185 0.5962 -0.0666 0.0003  -0.0184 8  DT  D C4    
1456 O O4    . DT  D 8  ? 0.5620 0.5660 0.6290 -0.0700 0.0020  -0.0201 8  DT  D O4    
1457 C C5    . DT  D 8  ? 0.4470 0.4461 0.5302 -0.0557 0.0040  -0.0255 8  DT  D C5    
1458 C C7    . DT  D 8  ? 0.3438 0.3410 0.4152 -0.0469 0.0106  -0.0340 8  DT  D C7    
1459 C C6    . DT  D 8  ? 0.4487 0.4466 0.5451 -0.0532 0.0018  -0.0240 8  DT  D C6    
1460 P P     . DA  D 9  ? 0.4884 0.4483 0.6375 -0.0421 -0.0072 -0.0149 9  DA  D P     
1461 O OP1   . DA  D 9  ? 0.4054 0.3599 0.5662 -0.0423 -0.0076 -0.0148 9  DA  D OP1   
1462 O OP2   . DA  D 9  ? 0.3447 0.3002 0.4860 -0.0327 -0.0050 -0.0193 9  DA  D OP2   
1463 O "O5'" . DA  D 9  ? 0.4642 0.4221 0.6134 -0.0507 -0.0104 -0.0039 9  DA  D "O5'" 
1464 C "C5'" . DA  D 9  ? 0.4390 0.3870 0.5927 -0.0496 -0.0126 0.0034  9  DA  D "C5'" 
1465 C "C4'" . DA  D 9  ? 0.4631 0.4141 0.6194 -0.0588 -0.0160 0.0149  9  DA  D "C4'" 
1466 O "O4'" . DA  D 9  ? 0.4784 0.4405 0.6239 -0.0648 -0.0162 0.0139  9  DA  D "O4'" 
1467 C "C3'" . DA  D 9  ? 0.4635 0.4099 0.6225 -0.0589 -0.0190 0.0232  9  DA  D "C3'" 
1468 O "O3'" . DA  D 9  ? 0.6441 0.5911 0.8120 -0.0640 -0.0215 0.0355  9  DA  D "O3'" 
1469 C "C2'" . DA  D 9  ? 0.4649 0.4186 0.6107 -0.0628 -0.0201 0.0208  9  DA  D "C2'" 
1470 C "C1'" . DA  D 9  ? 0.4747 0.4385 0.6140 -0.0682 -0.0190 0.0187  9  DA  D "C1'" 
1471 N N9    . DA  D 9  ? 0.5151 0.4840 0.6399 -0.0683 -0.0167 0.0102  9  DA  D N9    
1472 C C8    . DA  D 9  ? 0.4707 0.4362 0.5894 -0.0606 -0.0124 -0.0003 9  DA  D C8    
1473 N N7    . DA  D 9  ? 0.4930 0.4627 0.5983 -0.0619 -0.0099 -0.0058 9  DA  D N7    
1474 C C5    . DA  D 9  ? 0.5327 0.5101 0.6344 -0.0718 -0.0134 0.0010  9  DA  D C5    
1475 C C6    . DA  D 9  ? 0.5593 0.5442 0.6472 -0.0779 -0.0129 -0.0008 9  DA  D C6    
1476 N N6    . DA  D 9  ? 0.3986 0.3823 0.4737 -0.0747 -0.0077 -0.0106 9  DA  D N6    
1477 N N1    . DA  D 9  ? 0.5503 0.5437 0.6374 -0.0870 -0.0173 0.0081  9  DA  D N1    
1478 C C2    . DA  D 9  ? 0.5248 0.5184 0.6249 -0.0891 -0.0215 0.0189  9  DA  D C2    
1479 N N3    . DA  D 9  ? 0.5409 0.5263 0.6550 -0.0838 -0.0217 0.0215  9  DA  D N3    
1480 C C4    . DA  D 9  ? 0.5152 0.4929 0.6290 -0.0755 -0.0178 0.0115  9  DA  D C4    
1481 P P     . DA  D 10 ? 0.4922 0.4341 0.6697 -0.0621 -0.0242 0.0465  10 DA  D P     
1482 O OP1   . DA  D 10 ? 0.5699 0.5091 0.7587 -0.0642 -0.0240 0.0574  10 DA  D OP1   
1483 O OP2   . DA  D 10 ? 0.4732 0.4060 0.6530 -0.0535 -0.0223 0.0403  10 DA  D OP2   
1484 O "O5'" . DA  D 10 ? 0.5124 0.4659 0.6819 -0.0687 -0.0287 0.0517  10 DA  D "O5'" 
1485 C "C5'" . DA  D 10 ? 0.4971 0.4618 0.6619 -0.0768 -0.0309 0.0581  10 DA  D "C5'" 
1486 C "C4'" . DA  D 10 ? 0.7486 0.7247 0.9020 -0.0828 -0.0347 0.0584  10 DA  D "C4'" 
1487 O "O4'" . DA  D 10 ? 0.7412 0.7180 0.8806 -0.0833 -0.0319 0.0451  10 DA  D "O4'" 
1488 C "C3'" . DA  D 10 ? 0.7202 0.6960 0.8770 -0.0816 -0.0378 0.0608  10 DA  D "C3'" 
1489 O "O3'" . DA  D 10 ? 0.6307 0.6191 0.7907 -0.0872 -0.0433 0.0742  10 DA  D "O3'" 
1490 C "C2'" . DA  D 10 ? 0.5446 0.5204 0.6871 -0.0834 -0.0365 0.0479  10 DA  D "C2'" 
1491 C "C1'" . DA  D 10 ? 0.6506 0.6315 0.7813 -0.0869 -0.0343 0.0424  10 DA  D "C1'" 
1492 N N9    . DA  D 10 ? 0.6154 0.5913 0.7340 -0.0845 -0.0297 0.0283  10 DA  D N9    
1493 C C8    . DA  D 10 ? 0.5539 0.5182 0.6739 -0.0758 -0.0250 0.0196  10 DA  D C8    
1494 N N7    . DA  D 10 ? 0.5344 0.4966 0.6416 -0.0744 -0.0206 0.0089  10 DA  D N7    
1495 C C5    . DA  D 10 ? 0.5206 0.4935 0.6171 -0.0832 -0.0225 0.0097  10 DA  D C5    
1496 C C6    . DA  D 10 ? 0.5575 0.5330 0.6378 -0.0860 -0.0190 0.0010  10 DA  D C6    
1497 N N6    . DA  D 10 ? 0.5436 0.5103 0.6162 -0.0793 -0.0122 -0.0099 10 DA  D N6    
1498 N N1    . DA  D 10 ? 0.6075 0.5949 0.6792 -0.0952 -0.0220 0.0044  10 DA  D N1    
1499 C C2    . DA  D 10 ? 0.6258 0.6227 0.7052 -0.1007 -0.0283 0.0167  10 DA  D C2    
1500 N N3    . DA  D 10 ? 0.6659 0.6608 0.7611 -0.0982 -0.0317 0.0265  10 DA  D N3    
1501 C C4    . DA  D 10 ? 0.5950 0.5772 0.6981 -0.0896 -0.0284 0.0218  10 DA  D C4    
1502 P P     . DT  D 11 ? 0.6919 0.6881 0.8540 -0.0898 -0.0483 0.0781  11 DT  D P     
1503 O OP1   . DT  D 11 ? 0.8476 0.8527 1.0220 -0.0897 -0.0522 0.0955  11 DT  D OP1   
1504 O OP2   . DT  D 11 ? 0.7393 0.7234 0.9041 -0.0841 -0.0453 0.0689  11 DT  D OP2   
1505 O "O5'" . DT  D 11 ? 0.6274 0.6370 0.7722 -0.0998 -0.0514 0.0727  11 DT  D "O5'" 
1506 C "C5'" . DT  D 11 ? 0.6072 0.6264 0.7433 -0.1049 -0.0521 0.0760  11 DT  D "C5'" 
1507 C "C4'" . DT  D 11 ? 0.6795 0.7108 0.7982 -0.1141 -0.0548 0.0696  11 DT  D "C4'" 
1508 O "O4'" . DT  D 11 ? 0.7176 0.7383 0.8241 -0.1130 -0.0491 0.0531  11 DT  D "O4'" 
1509 C "C3'" . DT  D 11 ? 0.7437 0.7848 0.8624 -0.1197 -0.0604 0.0706  11 DT  D "C3'" 
1510 O "O3'" . DT  D 11 ? 0.8256 0.8869 0.9339 -0.1291 -0.0660 0.0756  11 DT  D "O3'" 
1511 C "C2'" . DT  D 11 ? 0.6706 0.6989 0.7801 -0.1197 -0.0558 0.0533  11 DT  D "C2'" 
1512 C "C1'" . DT  D 11 ? 0.6912 0.7148 0.7874 -0.1190 -0.0506 0.0448  11 DT  D "C1'" 
1513 N N1    . DT  D 11 ? 0.6393 0.6467 0.7282 -0.1145 -0.0433 0.0294  11 DT  D N1    
1514 C C2    . DT  D 11 ? 0.6314 0.6390 0.7022 -0.1191 -0.0401 0.0181  11 DT  D C2    
1515 O O2    . DT  D 11 ? 0.6993 0.7202 0.7590 -0.1275 -0.0432 0.0193  11 DT  D O2    
1516 N N3    . DT  D 11 ? 0.6449 0.6367 0.7105 -0.1131 -0.0325 0.0056  11 DT  D N3    
1517 C C4    . DT  D 11 ? 0.5505 0.5280 0.6265 -0.1031 -0.0284 0.0035  11 DT  D C4    
1518 O O4    . DT  D 11 ? 0.5732 0.5381 0.6431 -0.0972 -0.0213 -0.0068 11 DT  D O4    
1519 C C5    . DT  D 11 ? 0.4572 0.4358 0.5511 -0.0993 -0.0325 0.0149  11 DT  D C5    
1520 C C7    . DT  D 11 ? 0.5218 0.4862 0.6267 -0.0884 -0.0285 0.0133  11 DT  D C7    
1521 C C6    . DT  D 11 ? 0.4977 0.4902 0.5975 -0.1050 -0.0394 0.0271  11 DT  D C6    
1522 P P     . DG  D 12 ? 0.8231 0.9010 0.9291 -0.1379 -0.0732 0.0764  12 DG  D P     
1523 O OP1   . DG  D 12 ? 0.9119 1.0137 1.0151 -0.1435 -0.0800 0.0901  12 DG  D OP1   
1524 O OP2   . DG  D 12 ? 0.6348 0.7056 0.7571 -0.1331 -0.0735 0.0785  12 DG  D OP2   
1525 O "O5'" . DG  D 12 ? 0.7157 0.7887 0.8018 -0.1453 -0.0703 0.0572  12 DG  D "O5'" 
1526 C "C5'" . DG  D 12 ? 0.7446 0.8256 0.8120 -0.1514 -0.0698 0.0525  12 DG  D "C5'" 
1527 C "C4'" . DG  D 12 ? 0.7685 0.8433 0.8182 -0.1583 -0.0665 0.0340  12 DG  D "C4'" 
1528 O "O4'" . DG  D 12 ? 0.8593 0.9096 0.9098 -0.1503 -0.0575 0.0224  12 DG  D "O4'" 
1529 C "C3'" . DG  D 12 ? 0.8061 0.8898 0.8549 -0.1681 -0.0717 0.0299  12 DG  D "C3'" 
1530 O "O3'" . DG  D 12 ? 0.9243 1.0134 0.9516 -0.1787 -0.0713 0.0173  12 DG  D "O3'" 
1531 C "C2'" . DG  D 12 ? 0.7322 0.7936 0.7904 -0.1620 -0.0657 0.0217  12 DG  D "C2'" 
1532 C "C1'" . DG  D 12 ? 0.7845 0.8266 0.8335 -0.1542 -0.0561 0.0120  12 DG  D "C1'" 
1533 N N9    . DG  D 12 ? 0.7148 0.7356 0.7742 -0.1434 -0.0494 0.0082  12 DG  D N9    
1534 C C8    . DG  D 12 ? 0.6285 0.6455 0.7074 -0.1361 -0.0508 0.0173  12 DG  D C8    
1535 N N7    . DG  D 12 ? 0.6542 0.6517 0.7370 -0.1267 -0.0434 0.0108  12 DG  D N7    
1536 C C5    . DG  D 12 ? 0.6401 0.6279 0.7057 -0.1274 -0.0366 -0.0028 12 DG  D C5    
1537 C C6    . DG  D 12 ? 0.5753 0.5433 0.6365 -0.1186 -0.0269 -0.0133 12 DG  D C6    
1538 O O6    . DG  D 12 ? 0.5665 0.5219 0.6377 -0.1085 -0.0228 -0.0130 12 DG  D O6    
1539 N N1    . DG  D 12 ? 0.6114 0.5754 0.6538 -0.1217 -0.0214 -0.0246 12 DG  D N1    
1540 C C2    . DG  D 12 ? 0.6447 0.6219 0.6735 -0.1324 -0.0250 -0.0265 12 DG  D C2    
1541 N N2    . DG  D 12 ? 0.6545 0.6245 0.6655 -0.1333 -0.0177 -0.0384 12 DG  D N2    
1542 N N3    . DG  D 12 ? 0.6002 0.5971 0.6323 -0.1411 -0.0345 -0.0169 12 DG  D N3    
1543 C C4    . DG  D 12 ? 0.6456 0.6468 0.6967 -0.1377 -0.0399 -0.0049 12 DG  D C4    
1544 P P     . DA  D 13 ? 0.8126 0.9184 0.8338 -0.1933 -0.0783 0.0122  13 DA  D P     
1545 O OP1   . DA  D 13 ? 0.6899 0.8222 0.6991 -0.2012 -0.0855 0.0188  13 DA  D OP1   
1546 O OP2   . DA  D 13 ? 0.8573 0.9651 0.8990 -0.1921 -0.0822 0.0191  13 DA  D OP2   
1547 O "O5'" . DA  D 13 ? 0.6157 0.7016 0.6191 -0.1986 -0.0696 -0.0102 13 DA  D "O5'" 
1548 C "C5'" . DA  D 13 ? 0.7018 0.7801 0.6857 -0.1978 -0.0629 -0.0196 13 DA  D "C5'" 
1549 C "C4'" . DA  D 13 ? 0.7017 0.7528 0.6759 -0.1963 -0.0516 -0.0381 13 DA  D "C4'" 
1550 O "O4'" . DA  D 13 ? 0.7340 0.7648 0.7237 -0.1827 -0.0454 -0.0356 13 DA  D "O4'" 
1551 C "C3'" . DA  D 13 ? 0.7574 0.8050 0.7262 -0.2088 -0.0516 -0.0509 13 DA  D "C3'" 
1552 O "O3'" . DA  D 13 ? 0.8766 0.9123 0.8225 -0.2144 -0.0435 -0.0684 13 DA  D "O3'" 
1553 C "C2'" . DA  D 13 ? 0.7084 0.7355 0.6946 -0.2008 -0.0465 -0.0513 13 DA  D "C2'" 
1554 C "C1'" . DA  D 13 ? 0.6343 0.6466 0.6251 -0.1842 -0.0395 -0.0469 13 DA  D "C1'" 
1555 N N9    . DA  D 13 ? 0.6196 0.6227 0.6317 -0.1735 -0.0388 -0.0384 13 DA  D N9    
1556 C C8    . DA  D 13 ? 0.6316 0.6486 0.6627 -0.1724 -0.0473 -0.0237 13 DA  D C8    
1557 N N7    . DA  D 13 ? 0.5966 0.6000 0.6433 -0.1615 -0.0437 -0.0196 13 DA  D N7    
1558 C C5    . DA  D 13 ? 0.5329 0.5132 0.5704 -0.1548 -0.0326 -0.0318 13 DA  D C5    
1559 C C6    . DA  D 13 ? 0.4749 0.4343 0.5198 -0.1420 -0.0242 -0.0340 13 DA  D C6    
1560 N N6    . DA  D 13 ? 0.4286 0.3863 0.4922 -0.1341 -0.0259 -0.0245 13 DA  D N6    
1561 N N1    . DA  D 13 ? 0.4442 0.3852 0.4761 -0.1370 -0.0136 -0.0460 13 DA  D N1    
1562 C C2    . DA  D 13 ? 0.4686 0.4104 0.4814 -0.1444 -0.0110 -0.0557 13 DA  D C2    
1563 N N3    . DA  D 13 ? 0.5149 0.4747 0.5182 -0.1570 -0.0181 -0.0559 13 DA  D N3    
1564 C C4    . DA  D 13 ? 0.5417 0.5210 0.5583 -0.1617 -0.0291 -0.0433 13 DA  D C4    
1565 P P     . DC  D 14 ? 1.1170 1.1522 1.0504 -0.2316 -0.0436 -0.0844 14 DC  D P     
1566 O OP1   . DC  D 14 ? 1.1532 1.1851 1.0601 -0.2376 -0.0379 -0.0985 14 DC  D OP1   
1567 O OP2   . DC  D 14 ? 0.9811 1.0437 0.9265 -0.2418 -0.0570 -0.0747 14 DC  D OP2   
1568 O "O5'" . DC  D 14 ? 1.0397 1.0434 0.9805 -0.2265 -0.0325 -0.0941 14 DC  D "O5'" 
1569 C "C5'" . DC  D 14 ? 0.9297 0.9062 0.8639 -0.2137 -0.0191 -0.1012 14 DC  D "C5'" 
1570 C "C4'" . DC  D 14 ? 0.9816 0.9319 0.9254 -0.2090 -0.0100 -0.1070 14 DC  D "C4'" 
1571 O "O4'" . DC  D 14 ? 0.9072 0.8577 0.8734 -0.1960 -0.0126 -0.0924 14 DC  D "O4'" 
1572 C "C3'" . DC  D 14 ? 1.0522 1.0030 0.9982 -0.2250 -0.0123 -0.1151 14 DC  D "C3'" 
1573 O "O3'" . DC  D 14 ? 1.0324 0.9561 0.9634 -0.2291 0.0010  -0.1333 14 DC  D "O3'" 
1574 C "C2'" . DC  D 14 ? 0.9424 0.8921 0.9140 -0.2184 -0.0151 -0.1034 14 DC  D "C2'" 
1575 C "C1'" . DC  D 14 ? 0.7931 0.7323 0.7719 -0.1980 -0.0103 -0.0941 14 DC  D "C1'" 
1576 N N1    . DC  D 14 ? 0.7730 0.7235 0.7751 -0.1901 -0.0179 -0.0773 14 DC  D N1    
1577 C C2    . DC  D 14 ? 0.7270 0.6602 0.7409 -0.1739 -0.0111 -0.0725 14 DC  D C2    
1578 O O2    . DC  D 14 ? 0.6561 0.5661 0.6612 -0.1657 0.0009  -0.0814 14 DC  D O2    
1579 N N3    . DC  D 14 ? 0.6278 0.5705 0.6619 -0.1670 -0.0175 -0.0580 14 DC  D N3    
1580 C C4    . DC  D 14 ? 0.6780 0.6459 0.7213 -0.1749 -0.0297 -0.0476 14 DC  D C4    
1581 N N4    . DC  D 14 ? 0.7177 0.6925 0.7808 -0.1669 -0.0345 -0.0334 14 DC  D N4    
1582 C C5    . DC  D 14 ? 0.7548 0.7423 0.7869 -0.1908 -0.0371 -0.0511 14 DC  D C5    
1583 C C6    . DC  D 14 ? 0.7661 0.7444 0.7775 -0.1983 -0.0312 -0.0665 14 DC  D C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  VAL 1  1  ?  ?   ?   A . n 
A 1 2  GLY 2  2  ?  ?   ?   A . n 
A 1 3  PRO 3  3  ?  ?   ?   A . n 
A 1 4  CYS 4  4  ?  ?   ?   A . n 
A 1 5  THR 5  5  ?  ?   ?   A . n 
A 1 6  PRO 6  6  ?  ?   ?   A . n 
A 1 7  ASN 7  7  ?  ?   ?   A . n 
A 1 8  PRO 8  8  ?  ?   ?   A . n 
A 1 9  GLY 9  9  ?  ?   ?   A . n 
A 1 10 LEU 10 10 ?  ?   ?   A . n 
A 1 11 HIS 11 11 ?  ?   ?   A . n 
A 1 12 GLU 12 12 ?  ?   ?   A . n 
A 1 13 TRP 13 13 13 TRP TRP A . n 
A 1 14 THR 14 14 ?  ?   ?   A . n 
A 1 15 GLY 15 15 ?  ?   ?   A . n 
A 1 16 GLN 16 16 ?  ?   ?   A . n 
A 1 17 VAL 17 17 ?  ?   ?   A . n 
A 1 18 SER 18 18 ?  ?   ?   A . n 
A 1 19 VAL 19 19 ?  ?   ?   A . n 
A 1 20 ARG 20 20 ?  ?   ?   A . n 
A 1 21 LYS 21 21 21 LYS LYS A . n 
A 1 22 LYS 22 22 22 LYS LYS A . n 
A 1 23 ARG 23 23 23 ARG ARG A . n 
A 1 24 LYS 24 24 24 LYS LYS A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 TYR 26 26 26 TYR TYR A . n 
A 1 27 SER 27 27 27 SER SER A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 PHE 29 29 29 PHE PHE A . n 
A 1 30 GLN 30 30 30 GLN GLN A . n 
A 1 31 THR 31 31 31 THR THR A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 GLU 33 33 33 GLU GLU A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 LYS 36 36 36 LYS LYS A . n 
A 1 37 GLU 37 37 37 GLU GLU A . n 
A 1 38 PHE 38 38 38 PHE PHE A . n 
A 1 39 LEU 39 39 39 LEU LEU A . n 
A 1 40 PHE 40 40 40 PHE PHE A . n 
A 1 41 ASN 41 41 41 ASN ASN A . n 
A 1 42 ALA 42 42 42 ALA ALA A . n 
A 1 43 TYR 43 43 43 TYR TYR A . n 
A 1 44 VAL 44 44 44 VAL VAL A . n 
A 1 45 SER 45 45 45 SER SER A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 GLN 47 47 47 GLN GLN A . n 
A 1 48 LYS 48 48 48 LYS LYS A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 TRP 50 50 50 TRP TRP A . n 
A 1 51 GLU 51 51 51 GLU GLU A . n 
A 1 52 LEU 52 52 52 LEU LEU A . n 
A 1 53 ALA 53 53 53 ALA ALA A . n 
A 1 54 ARG 54 54 54 ARG ARG A . n 
A 1 55 ASN 55 55 55 ASN ASN A . n 
A 1 56 LEU 56 56 56 LEU LEU A . n 
A 1 57 GLN 57 57 57 GLN GLN A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 THR 59 59 59 THR THR A . n 
A 1 60 GLU 60 60 60 GLU GLU A . n 
A 1 61 ARG 61 61 61 ARG ARG A . n 
A 1 62 GLN 62 62 62 GLN GLN A . n 
A 1 63 VAL 63 63 63 VAL VAL A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 ILE 65 65 65 ILE ILE A . n 
A 1 66 TRP 66 66 66 TRP TRP A . n 
A 1 67 PHE 67 67 67 PHE PHE A . n 
A 1 68 GLN 68 68 68 GLN GLN A . n 
A 1 69 ASN 69 69 69 ASN ASN A . n 
A 1 70 ARG 70 70 70 ARG ARG A . n 
A 1 71 ARG 71 71 71 ARG ARG A . n 
A 1 72 MET 72 72 72 MET MET A . n 
A 1 73 LYS 73 73 73 LYS LYS A . n 
A 1 74 ASN 74 74 74 ASN ASN A . n 
A 1 75 LYS 75 75 75 LYS LYS A . n 
A 1 76 LYS 76 76 76 LYS LYS A . n 
A 1 77 ASN 77 77 77 ASN ASN A . n 
A 1 78 SER 78 78 ?  ?   ?   A . n 
A 1 79 GLN 79 79 ?  ?   ?   A . n 
A 1 80 ARG 80 80 ?  ?   ?   A . n 
A 1 81 GLN 81 81 ?  ?   ?   A . n 
A 1 82 ALA 82 82 ?  ?   ?   A . n 
A 1 83 ASN 83 83 ?  ?   ?   A . n 
A 1 84 GLN 84 84 ?  ?   ?   A . n 
B 2 1  ASP 1  1  ?  ?   ?   B . n 
B 2 2  ALA 2  2  ?  ?   ?   B . n 
B 2 3  ARG 3  3  3  ARG ARG B . n 
B 2 4  ARG 4  4  4  ARG ARG B . n 
B 2 5  LYS 5  5  5  LYS LYS B . n 
B 2 6  ARG 6  6  6  ARG ARG B . n 
B 2 7  ARG 7  7  7  ARG ARG B . n 
B 2 8  ASN 8  8  8  ASN ASN B . n 
B 2 9  PHE 9  9  9  PHE PHE B . n 
B 2 10 SER 10 10 10 SER SER B . n 
B 2 11 LYS 11 11 11 LYS LYS B . n 
B 2 12 GLN 12 12 12 GLN GLN B . n 
B 2 13 ALA 13 13 13 ALA ALA B . n 
B 2 14 SER 14 14 14 SER SER B . n 
B 2 15 GLU 15 15 15 GLU GLU B . n 
B 2 16 ILE 16 16 16 ILE ILE B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 ASN 18 18 18 ASN ASN B . n 
B 2 19 GLU 19 19 19 GLU GLU B . n 
B 2 20 TYR 20 20 20 TYR TYR B . n 
B 2 21 PHE 21 21 21 PHE PHE B . n 
B 2 22 TYR 22 22 22 TYR TYR B . n 
B 2 23 SER 23 23 23 SER SER B . n 
B 2 24 HIS 24 24 24 HIS HIS B . n 
B 2 25 LEU 25 25 25 LEU LEU B . n 
B 2 26 SER 26 26 26 SER SER B . n 
B 2 27 ASN 27 27 27 ASN ASN B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 TYR 29 29 29 TYR TYR B . n 
B 2 30 PRO 30 30 30 PRO PRO B . n 
B 2 31 SER 31 31 31 SER SER B . n 
B 2 32 GLU 32 32 32 GLU GLU B . n 
B 2 33 GLU 33 33 33 GLU GLU B . n 
B 2 34 ALA 34 34 34 ALA ALA B . n 
B 2 35 LYS 35 35 35 LYS LYS B . n 
B 2 36 GLU 36 36 36 GLU GLU B . n 
B 2 37 GLU 37 37 37 GLU GLU B . n 
B 2 38 LEU 38 38 38 LEU LEU B . n 
B 2 39 ALA 39 39 39 ALA ALA B . n 
B 2 40 ARG 40 40 40 ARG ARG B . n 
B 2 41 LYS 41 41 41 LYS LYS B . n 
B 2 42 CYS 42 42 42 CYS CYS B . n 
B 2 43 GLY 43 43 43 GLY GLY B . n 
B 2 44 ILE 44 44 44 ILE ILE B . n 
B 2 45 THR 45 45 45 THR THR B . n 
B 2 46 VAL 46 46 46 VAL VAL B . n 
B 2 47 SER 47 47 47 SER SER B . n 
B 2 48 GLN 48 48 48 GLN GLN B . n 
B 2 49 VAL 49 49 49 VAL VAL B . n 
B 2 50 SER 50 50 50 SER SER B . n 
B 2 51 ASN 51 51 51 ASN ASN B . n 
B 2 52 TRP 52 52 52 TRP TRP B . n 
B 2 53 PHE 53 53 53 PHE PHE B . n 
B 2 54 GLY 54 54 54 GLY GLY B . n 
B 2 55 ASN 55 55 55 ASN ASN B . n 
B 2 56 LYS 56 56 56 LYS LYS B . n 
B 2 57 ARG 57 57 57 ARG ARG B . n 
B 2 58 ILE 58 58 58 ILE ILE B . n 
B 2 59 ARG 59 59 59 ARG ARG B . n 
B 2 60 TYR 60 60 60 TYR TYR B . n 
B 2 61 LYS 61 61 61 LYS LYS B . n 
B 2 62 LYS 62 62 62 LYS LYS B . n 
B 2 63 ASN 63 63 63 ASN ASN B . n 
B 2 64 ILE 64 64 64 ILE ILE B . n 
B 2 65 GLY 65 65 65 GLY GLY B . n 
B 2 66 LYS 66 66 66 LYS LYS B . n 
B 2 67 ALA 67 67 67 ALA ALA B . n 
B 2 68 GLN 68 68 68 GLN GLN B . n 
B 2 69 GLU 69 69 69 GLU GLU B . n 
B 2 70 GLU 70 70 70 GLU GLU B . n 
B 2 71 ALA 71 71 71 ALA ALA B . n 
B 2 72 ASN 72 72 72 ASN ASN B . n 
B 2 73 LEU 73 73 73 LEU LEU B . n 
B 2 74 TYR 74 74 74 TYR TYR B . n 
C 3 1  DG  1  1  1  DG  DG  C . n 
C 3 2  DT  2  2  2  DT  DT  C . n 
C 3 3  DC  3  3  3  DC  DC  C . n 
C 3 4  DA  4  4  4  DA  DA  C . n 
C 3 5  DT  5  5  5  DT  DT  C . n 
C 3 6  DT  6  6  6  DT  DT  C . n 
C 3 7  DA  7  7  7  DA  DA  C . n 
C 3 8  DA  8  8  8  DA  DA  C . n 
C 3 9  DT  9  9  9  DT  DT  C . n 
C 3 10 DC  10 10 10 DC  DC  C . n 
C 3 11 DA  11 11 11 DA  DA  C . n 
C 3 12 DT  12 12 12 DT  DT  C . n 
C 3 13 DG  13 13 13 DG  DG  C . n 
C 3 14 DC  14 14 14 DC  DC  C . n 
D 4 1  DG  1  1  1  DG  DG  D . n 
D 4 2  DC  2  2  2  DC  DC  D . n 
D 4 3  DA  3  3  3  DA  DA  D . n 
D 4 4  DT  4  4  4  DT  DT  D . n 
D 4 5  DG  5  5  5  DG  DG  D . n 
D 4 6  DA  6  6  6  DA  DA  D . n 
D 4 7  DT  7  7  7  DT  DT  D . n 
D 4 8  DT  8  8  8  DT  DT  D . n 
D 4 9  DA  9  9  9  DA  DA  D . n 
D 4 10 DA  10 10 10 DA  DA  D . n 
D 4 11 DT  11 11 11 DT  DT  D . n 
D 4 12 DG  12 12 12 DG  DG  D . n 
D 4 13 DA  13 13 13 DA  DA  D . n 
D 4 14 DC  14 14 14 DC  DC  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 HOH 1 101 1 HOH HOH A . 
E 5 HOH 2 102 2 HOH HOH A . 
E 5 HOH 3 103 3 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4970  ? 
1 MORE         -24   ? 
1 'SSA (A^2)'  11950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-08-29 
2 'Structure model' 1 1 2018-09-12 
3 'Structure model' 1 2 2018-09-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
5 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' audit_author    
4 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_DOI'    
9  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 2 'Structure model' '_citation.title'                   
11 2 'Structure model' '_citation.year'                    
12 3 'Structure model' '_audit_author.name'                
13 3 'Structure model' '_citation_author.name'             
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -17.9431 
_pdbx_refine_tls.origin_y         2.2398 
_pdbx_refine_tls.origin_z         122.0441 
_pdbx_refine_tls.T[1][1]          0.3138 
_pdbx_refine_tls.T[2][2]          0.3293 
_pdbx_refine_tls.T[3][3]          0.3727 
_pdbx_refine_tls.T[1][2]          -0.0756 
_pdbx_refine_tls.T[1][3]          0.0036 
_pdbx_refine_tls.T[2][3]          -0.0194 
_pdbx_refine_tls.L[1][1]          1.4030 
_pdbx_refine_tls.L[2][2]          0.6740 
_pdbx_refine_tls.L[3][3]          1.3968 
_pdbx_refine_tls.L[1][2]          -0.1435 
_pdbx_refine_tls.L[1][3]          -0.7476 
_pdbx_refine_tls.L[2][3]          -0.2397 
_pdbx_refine_tls.S[1][1]          -0.1831 
_pdbx_refine_tls.S[2][2]          0.1786 
_pdbx_refine_tls.S[3][3]          0.0366 
_pdbx_refine_tls.S[1][2]          0.3474 
_pdbx_refine_tls.S[1][3]          0.1425 
_pdbx_refine_tls.S[2][3]          0.0386 
_pdbx_refine_tls.S[2][1]          -0.2013 
_pdbx_refine_tls.S[3][1]          0.1249 
_pdbx_refine_tls.S[3][2]          0.2114 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 13 A 77 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 B 3  B 74 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 1 C 1  C 14 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 1 D 1  D 14 all ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 1 E 1  E 3  all ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OH 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   TYR 
_pdbx_validate_close_contact.auth_seq_id_1    29 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OP1 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   DT 
_pdbx_validate_close_contact.auth_seq_id_2    6 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 24 ? CG  ? A LYS 24 CG  
2   1 Y 1 A LYS 24 ? CD  ? A LYS 24 CD  
3   1 Y 1 A LYS 24 ? CE  ? A LYS 24 CE  
4   1 Y 1 A LYS 24 ? NZ  ? A LYS 24 NZ  
5   1 Y 1 A LYS 28 ? CG  ? A LYS 28 CG  
6   1 Y 1 A LYS 28 ? CD  ? A LYS 28 CD  
7   1 Y 1 A LYS 28 ? CE  ? A LYS 28 CE  
8   1 Y 1 A LYS 28 ? NZ  ? A LYS 28 NZ  
9   1 Y 1 A LYS 36 ? CG  ? A LYS 36 CG  
10  1 Y 1 A LYS 36 ? CD  ? A LYS 36 CD  
11  1 Y 1 A LYS 36 ? CE  ? A LYS 36 CE  
12  1 Y 1 A LYS 36 ? NZ  ? A LYS 36 NZ  
13  1 Y 1 A LYS 46 ? CG  ? A LYS 46 CG  
14  1 Y 1 A LYS 46 ? CD  ? A LYS 46 CD  
15  1 Y 1 A LYS 46 ? CE  ? A LYS 46 CE  
16  1 Y 1 A LYS 46 ? NZ  ? A LYS 46 NZ  
17  1 Y 1 A LYS 76 ? CG  ? A LYS 76 CG  
18  1 Y 1 A LYS 76 ? CD  ? A LYS 76 CD  
19  1 Y 1 A LYS 76 ? CE  ? A LYS 76 CE  
20  1 Y 1 A LYS 76 ? NZ  ? A LYS 76 NZ  
21  1 Y 1 B ARG 3  ? CG  ? B ARG 3  CG  
22  1 Y 1 B ARG 3  ? CD  ? B ARG 3  CD  
23  1 Y 1 B ARG 3  ? NE  ? B ARG 3  NE  
24  1 Y 1 B ARG 3  ? CZ  ? B ARG 3  CZ  
25  1 Y 1 B ARG 3  ? NH1 ? B ARG 3  NH1 
26  1 Y 1 B ARG 3  ? NH2 ? B ARG 3  NH2 
27  1 Y 1 B ARG 4  ? CG  ? B ARG 4  CG  
28  1 Y 1 B ARG 4  ? CD  ? B ARG 4  CD  
29  1 Y 1 B ARG 4  ? NE  ? B ARG 4  NE  
30  1 Y 1 B ARG 4  ? CZ  ? B ARG 4  CZ  
31  1 Y 1 B ARG 4  ? NH1 ? B ARG 4  NH1 
32  1 Y 1 B ARG 4  ? NH2 ? B ARG 4  NH2 
33  1 Y 1 B LYS 5  ? CG  ? B LYS 5  CG  
34  1 Y 1 B LYS 5  ? CD  ? B LYS 5  CD  
35  1 Y 1 B LYS 5  ? CE  ? B LYS 5  CE  
36  1 Y 1 B LYS 5  ? NZ  ? B LYS 5  NZ  
37  1 Y 1 B ARG 7  ? CG  ? B ARG 7  CG  
38  1 Y 1 B ARG 7  ? CD  ? B ARG 7  CD  
39  1 Y 1 B ARG 7  ? NE  ? B ARG 7  NE  
40  1 Y 1 B ARG 7  ? CZ  ? B ARG 7  CZ  
41  1 Y 1 B ARG 7  ? NH1 ? B ARG 7  NH1 
42  1 Y 1 B ARG 7  ? NH2 ? B ARG 7  NH2 
43  1 Y 1 B LYS 11 ? CG  ? B LYS 11 CG  
44  1 Y 1 B LYS 11 ? CD  ? B LYS 11 CD  
45  1 Y 1 B LYS 11 ? CE  ? B LYS 11 CE  
46  1 Y 1 B LYS 11 ? NZ  ? B LYS 11 NZ  
47  1 Y 1 B SER 23 ? OG  ? B SER 23 OG  
48  1 Y 1 B LEU 25 ? CG  ? B LEU 25 CG  
49  1 Y 1 B LEU 25 ? CD1 ? B LEU 25 CD1 
50  1 Y 1 B LEU 25 ? CD2 ? B LEU 25 CD2 
51  1 Y 1 B SER 26 ? OG  ? B SER 26 OG  
52  1 Y 1 B ASN 27 ? CG  ? B ASN 27 CG  
53  1 Y 1 B ASN 27 ? OD1 ? B ASN 27 OD1 
54  1 Y 1 B ASN 27 ? ND2 ? B ASN 27 ND2 
55  1 Y 1 B SER 31 ? OG  ? B SER 31 OG  
56  1 Y 1 B GLU 32 ? CG  ? B GLU 32 CG  
57  1 Y 1 B GLU 32 ? CD  ? B GLU 32 CD  
58  1 Y 1 B GLU 32 ? OE1 ? B GLU 32 OE1 
59  1 Y 1 B GLU 32 ? OE2 ? B GLU 32 OE2 
60  1 Y 1 B GLU 33 ? CG  ? B GLU 33 CG  
61  1 Y 1 B GLU 33 ? CD  ? B GLU 33 CD  
62  1 Y 1 B GLU 33 ? OE1 ? B GLU 33 OE1 
63  1 Y 1 B GLU 33 ? OE2 ? B GLU 33 OE2 
64  1 Y 1 B LYS 35 ? CG  ? B LYS 35 CG  
65  1 Y 1 B LYS 35 ? CD  ? B LYS 35 CD  
66  1 Y 1 B LYS 35 ? CE  ? B LYS 35 CE  
67  1 Y 1 B LYS 35 ? NZ  ? B LYS 35 NZ  
68  1 Y 1 B GLU 37 ? CG  ? B GLU 37 CG  
69  1 Y 1 B GLU 37 ? CD  ? B GLU 37 CD  
70  1 Y 1 B GLU 37 ? OE1 ? B GLU 37 OE1 
71  1 Y 1 B GLU 37 ? OE2 ? B GLU 37 OE2 
72  1 Y 1 B ARG 40 ? CG  ? B ARG 40 CG  
73  1 Y 1 B ARG 40 ? CD  ? B ARG 40 CD  
74  1 Y 1 B ARG 40 ? NE  ? B ARG 40 NE  
75  1 Y 1 B ARG 40 ? CZ  ? B ARG 40 CZ  
76  1 Y 1 B ARG 40 ? NH1 ? B ARG 40 NH1 
77  1 Y 1 B ARG 40 ? NH2 ? B ARG 40 NH2 
78  1 Y 1 B LYS 41 ? CG  ? B LYS 41 CG  
79  1 Y 1 B LYS 41 ? CD  ? B LYS 41 CD  
80  1 Y 1 B LYS 41 ? CE  ? B LYS 41 CE  
81  1 Y 1 B LYS 41 ? NZ  ? B LYS 41 NZ  
82  1 Y 1 B ILE 44 ? CG1 ? B ILE 44 CG1 
83  1 Y 1 B ILE 44 ? CG2 ? B ILE 44 CG2 
84  1 Y 1 B ILE 44 ? CD1 ? B ILE 44 CD1 
85  1 Y 1 B ARG 57 ? CG  ? B ARG 57 CG  
86  1 Y 1 B ARG 57 ? CD  ? B ARG 57 CD  
87  1 Y 1 B ARG 57 ? NE  ? B ARG 57 NE  
88  1 Y 1 B ARG 57 ? CZ  ? B ARG 57 CZ  
89  1 Y 1 B ARG 57 ? NH1 ? B ARG 57 NH1 
90  1 Y 1 B ARG 57 ? NH2 ? B ARG 57 NH2 
91  1 Y 1 B LYS 61 ? CG  ? B LYS 61 CG  
92  1 Y 1 B LYS 61 ? CD  ? B LYS 61 CD  
93  1 Y 1 B LYS 61 ? CE  ? B LYS 61 CE  
94  1 Y 1 B LYS 61 ? NZ  ? B LYS 61 NZ  
95  1 Y 1 B ASN 63 ? CG  ? B ASN 63 CG  
96  1 Y 1 B ASN 63 ? OD1 ? B ASN 63 OD1 
97  1 Y 1 B ASN 63 ? ND2 ? B ASN 63 ND2 
98  1 Y 1 B LYS 66 ? CG  ? B LYS 66 CG  
99  1 Y 1 B LYS 66 ? CD  ? B LYS 66 CD  
100 1 Y 1 B LYS 66 ? CE  ? B LYS 66 CE  
101 1 Y 1 B LYS 66 ? NZ  ? B LYS 66 NZ  
102 1 Y 1 B GLU 69 ? CG  ? B GLU 69 CG  
103 1 Y 1 B GLU 69 ? CD  ? B GLU 69 CD  
104 1 Y 1 B GLU 69 ? OE1 ? B GLU 69 OE1 
105 1 Y 1 B GLU 69 ? OE2 ? B GLU 69 OE2 
106 1 Y 1 B GLU 70 ? CG  ? B GLU 70 CG  
107 1 Y 1 B GLU 70 ? CD  ? B GLU 70 CD  
108 1 Y 1 B GLU 70 ? OE1 ? B GLU 70 OE1 
109 1 Y 1 B GLU 70 ? OE2 ? B GLU 70 OE2 
110 1 Y 1 B TYR 74 ? CG  ? B TYR 74 CG  
111 1 Y 1 B TYR 74 ? CD1 ? B TYR 74 CD1 
112 1 Y 1 B TYR 74 ? CD2 ? B TYR 74 CD2 
113 1 Y 1 B TYR 74 ? CE1 ? B TYR 74 CE1 
114 1 Y 1 B TYR 74 ? CE2 ? B TYR 74 CE2 
115 1 Y 1 B TYR 74 ? CZ  ? B TYR 74 CZ  
116 1 Y 1 B TYR 74 ? OH  ? B TYR 74 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1  ? A VAL 1  
2  1 Y 1 A GLY 2  ? A GLY 2  
3  1 Y 1 A PRO 3  ? A PRO 3  
4  1 Y 1 A CYS 4  ? A CYS 4  
5  1 Y 1 A THR 5  ? A THR 5  
6  1 Y 1 A PRO 6  ? A PRO 6  
7  1 Y 1 A ASN 7  ? A ASN 7  
8  1 Y 1 A PRO 8  ? A PRO 8  
9  1 Y 1 A GLY 9  ? A GLY 9  
10 1 Y 1 A LEU 10 ? A LEU 10 
11 1 Y 1 A HIS 11 ? A HIS 11 
12 1 Y 1 A GLU 12 ? A GLU 12 
13 1 Y 1 A THR 14 ? A THR 14 
14 1 Y 1 A GLY 15 ? A GLY 15 
15 1 Y 1 A GLN 16 ? A GLN 16 
16 1 Y 1 A VAL 17 ? A VAL 17 
17 1 Y 1 A SER 18 ? A SER 18 
18 1 Y 1 A VAL 19 ? A VAL 19 
19 1 Y 1 A ARG 20 ? A ARG 20 
20 1 Y 1 A SER 78 ? A SER 78 
21 1 Y 1 A GLN 79 ? A GLN 79 
22 1 Y 1 A ARG 80 ? A ARG 80 
23 1 Y 1 A GLN 81 ? A GLN 81 
24 1 Y 1 A ALA 82 ? A ALA 82 
25 1 Y 1 A ASN 83 ? A ASN 83 
26 1 Y 1 A GLN 84 ? A GLN 84 
27 1 Y 1 B ASP 1  ? B ASP 1  
28 1 Y 1 B ALA 2  ? B ALA 2  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5ZJS 'double helix'        
5ZJS 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1  1_555 D DC 14 1_555 -0.540 -0.162 -0.212 -16.254 -9.890  -1.927  1  C_DG1:DC14_D C 1  ? D 14 ? 19 1 
1 C DT 2  1_555 D DA 13 1_555 -0.882 -0.123 0.404  -5.134  -7.700  -4.874  2  C_DT2:DA13_D C 2  ? D 13 ? 20 1 
1 C DC 3  1_555 D DG 12 1_555 0.045  -0.092 0.129  3.293   -8.197  -0.558  3  C_DC3:DG12_D C 3  ? D 12 ? 19 1 
1 C DA 4  1_555 D DT 11 1_555 0.960  -0.074 0.519  9.350   -17.347 -11.623 4  C_DA4:DT11_D C 4  ? D 11 ? 20 1 
1 C DT 5  1_555 D DA 10 1_555 0.451  0.063  -0.088 9.290   -17.476 3.601   5  C_DT5:DA10_D C 5  ? D 10 ? 20 1 
1 C DT 6  1_555 D DA 9  1_555 0.451  0.120  0.417  9.160   -19.294 10.501  6  C_DT6:DA9_D  C 6  ? D 9  ? 20 1 
1 C DA 7  1_555 D DT 8  1_555 -0.080 0.036  0.884  15.757  -22.156 6.235   7  C_DA7:DT8_D  C 7  ? D 8  ? 20 1 
1 C DA 8  1_555 D DT 7  1_555 0.189  -0.098 -0.057 3.194   -24.393 -3.864  8  C_DA8:DT7_D  C 8  ? D 7  ? 20 1 
1 C DT 9  1_555 D DA 6  1_555 -0.518 0.177  -0.527 6.846   -17.041 12.368  9  C_DT9:DA6_D  C 9  ? D 6  ? 20 1 
1 C DC 10 1_555 D DG 5  1_555 -0.708 -0.157 0.169  -0.871  -19.806 -1.144  10 C_DC10:DG5_D C 10 ? D 5  ? 19 1 
1 C DA 11 1_555 D DT 4  1_555 0.338  -0.064 0.531  -4.240  -17.037 11.864  11 C_DA11:DT4_D C 11 ? D 4  ? 20 1 
1 C DT 12 1_555 D DA 3  1_555 -0.368 -0.080 0.110  -3.788  -17.773 -4.726  12 C_DT12:DA3_D C 12 ? D 3  ? 20 1 
1 C DG 13 1_555 D DC 2  1_555 0.640  -0.055 -0.106 -13.600 -4.103  -1.240  13 C_DG13:DC2_D C 13 ? D 2  ? 19 1 
1 C DC 14 1_555 D DG 1  1_555 -0.208 0.684  -0.731 18.293  9.105   23.859  14 C_DC14:DG1_D C 14 ? D 1  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 14 1_555 C DT 2  1_555 D DA 13 1_555 -0.689 -0.751 3.144 -4.841 6.132  31.669 -2.359 0.423  3.019 11.028 
8.706   32.595 1  CC_DG1DT2:DA13DC14_DD C 1  ? D 14 ? C 2  ? D 13 ? 
1 C DT 2  1_555 D DA 13 1_555 C DC 3  1_555 D DG 12 1_555 0.697  -0.170 3.108 4.023  1.257  38.906 -0.398 -0.577 3.155 1.881  
-6.019  39.125 2  CC_DT2DC3:DG12DA13_DD C 2  ? D 13 ? C 3  ? D 12 ? 
1 C DC 3  1_555 D DG 12 1_555 C DA 4  1_555 D DT 11 1_555 -0.960 0.155  3.327 -3.872 -0.401 38.786 0.282  0.956  3.401 -0.601 
5.812   38.974 3  CC_DC3DA4:DT11DG12_DD C 3  ? D 12 ? C 4  ? D 11 ? 
1 C DA 4  1_555 D DT 11 1_555 C DT 5  1_555 D DA 10 1_555 1.040  -1.202 3.310 5.049  3.356  28.425 -3.148 -0.942 3.281 6.738  
-10.137 29.051 4  CC_DA4DT5:DA10DT11_DD C 4  ? D 11 ? C 5  ? D 10 ? 
1 C DT 5  1_555 D DA 10 1_555 C DT 6  1_555 D DA 9  1_555 0.044  -0.178 3.406 -3.506 2.112  33.951 -0.649 -0.651 3.368 3.601  
5.977   34.190 5  CC_DT5DT6:DA9DA10_DD  C 5  ? D 10 ? C 6  ? D 9  ? 
1 C DT 6  1_555 D DA 9  1_555 C DA 7  1_555 D DT 8  1_555 0.126  0.286  3.023 -2.844 12.584 35.029 -1.122 -0.552 2.932 20.084 
4.540   37.260 6  CC_DT6DA7:DT8DA9_DD   C 6  ? D 9  ? C 7  ? D 8  ? 
1 C DA 7  1_555 D DT 8  1_555 C DA 8  1_555 D DT 7  1_555 -0.645 -0.300 3.543 2.513  -0.826 37.862 -0.348 1.338  3.500 -1.271 
-3.867  37.951 7  CC_DA7DA8:DT7DT8_DD   C 7  ? D 8  ? C 8  ? D 7  ? 
1 C DA 8  1_555 D DT 7  1_555 C DT 9  1_555 D DA 6  1_555 0.817  -0.550 3.071 4.459  -0.982 34.231 -0.780 -0.716 3.163 -1.659 
-7.534  34.525 8  CC_DA8DT9:DA6DT7_DD   C 8  ? D 7  ? C 9  ? D 6  ? 
1 C DT 9  1_555 D DA 6  1_555 C DC 10 1_555 D DG 5  1_555 -0.415 -0.231 3.623 -4.738 1.196  33.241 -0.618 -0.146 3.636 2.077  
8.227   33.589 9  CC_DT9DC10:DG5DA6_DD  C 9  ? D 6  ? C 10 ? D 5  ? 
1 C DC 10 1_555 D DG 5  1_555 C DA 11 1_555 D DT 4  1_555 1.028  0.584  3.374 0.323  6.470  41.298 0.109  -1.406 3.430 9.105  
-0.454  41.781 10 CC_DC10DA11:DT4DG5_DD C 10 ? D 5  ? C 11 ? D 4  ? 
1 C DA 11 1_555 D DT 4  1_555 C DT 12 1_555 D DA 3  1_555 -1.225 -0.731 3.204 0.214  6.866  26.350 -3.189 2.655  2.913 14.745 
-0.460  27.216 11 CC_DA11DT12:DA3DT4_DD C 11 ? D 4  ? C 12 ? D 3  ? 
1 C DT 12 1_555 D DA 3  1_555 C DG 13 1_555 D DC 2  1_555 0.314  0.395  3.695 -1.668 -3.034 45.075 0.819  -0.576 3.649 -3.951 
2.172   45.201 12 CC_DT12DG13:DC2DA3_DD C 12 ? D 3  ? C 13 ? D 2  ? 
1 C DG 13 1_555 D DC 2  1_555 C DC 14 1_555 D DG 1  1_555 1.241  0.072  2.745 1.128  0.816  25.446 -0.036 -2.540 2.797 1.850  
-2.558  25.484 13 CC_DG13DC14:DG1DC2_DD C 13 ? D 2  ? C 14 ? D 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#