data_5ZJU
# 
_entry.id   5ZJU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZJU         
WWPDB D_1300007203 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZJU 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yuan, Y.A.' 1 0000-0002-3256-237X 
'Mo, X.'     2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'PLoS Pathog.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1553-7374 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            15 
_citation.language                  ? 
_citation.page_first                e1007562 
_citation.page_last                 e1007562 
_citation.title                     
;Structural roles of PCV2 capsid protein N-terminus in PCV2 particle assembly and identification of PCV2 type-specific neutralizing epitope.
;
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1371/journal.ppat.1007562 
_citation.pdbx_database_id_PubMed   30822338 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mo, X.'   1 ?                   
primary 'Li, X.'   2 ?                   
primary 'Yin, B.'  3 ?                   
primary 'Deng, J.' 4 ?                   
primary 'Tian, K.' 5 ?                   
primary 'Yuan, A.' 6 0000-0002-3256-237X 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.72 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ZJU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     194.116 
_cell.length_a_esd                 ? 
_cell.length_b                     201.877 
_cell.length_b_esd                 ? 
_cell.length_c                     231.281 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        120 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ZJU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Capsid protein' 24126.051 60   ? ? ? ? 
2 water   nat water            18.015    4846 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVE
FWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLW
LRLQTAGNVDHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPLNP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVE
FWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLW
LRLQTAGNVDHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPLNP
;
_entity_poly.pdbx_strand_id                 
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,1,2,3,4,5,6,7,8,9,a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  PHE n 
1 22  ASN n 
1 23  THR n 
1 24  ARG n 
1 25  LEU n 
1 26  SER n 
1 27  ARG n 
1 28  THR n 
1 29  PHE n 
1 30  GLY n 
1 31  TYR n 
1 32  THR n 
1 33  ILE n 
1 34  LYS n 
1 35  ARG n 
1 36  THR n 
1 37  THR n 
1 38  VAL n 
1 39  LYS n 
1 40  THR n 
1 41  PRO n 
1 42  SER n 
1 43  TRP n 
1 44  ALA n 
1 45  VAL n 
1 46  ASP n 
1 47  MET n 
1 48  MET n 
1 49  ARG n 
1 50  PHE n 
1 51  ASN n 
1 52  ILE n 
1 53  ASN n 
1 54  ASP n 
1 55  PHE n 
1 56  LEU n 
1 57  PRO n 
1 58  PRO n 
1 59  GLY n 
1 60  GLY n 
1 61  GLY n 
1 62  SER n 
1 63  ASN n 
1 64  PRO n 
1 65  ARG n 
1 66  SER n 
1 67  VAL n 
1 68  PRO n 
1 69  PHE n 
1 70  GLU n 
1 71  TYR n 
1 72  TYR n 
1 73  ARG n 
1 74  ILE n 
1 75  ARG n 
1 76  LYS n 
1 77  VAL n 
1 78  LYS n 
1 79  VAL n 
1 80  GLU n 
1 81  PHE n 
1 82  TRP n 
1 83  PRO n 
1 84  CYS n 
1 85  SER n 
1 86  PRO n 
1 87  ILE n 
1 88  THR n 
1 89  GLN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  GLY n 
1 94  VAL n 
1 95  GLY n 
1 96  SER n 
1 97  SER n 
1 98  ALA n 
1 99  VAL n 
1 100 ILE n 
1 101 LEU n 
1 102 ASP n 
1 103 ASP n 
1 104 ASN n 
1 105 PHE n 
1 106 VAL n 
1 107 THR n 
1 108 LYS n 
1 109 ALA n 
1 110 THR n 
1 111 ALA n 
1 112 LEU n 
1 113 THR n 
1 114 TYR n 
1 115 ASP n 
1 116 PRO n 
1 117 TYR n 
1 118 VAL n 
1 119 ASN n 
1 120 TYR n 
1 121 SER n 
1 122 SER n 
1 123 ARG n 
1 124 HIS n 
1 125 THR n 
1 126 ILE n 
1 127 THR n 
1 128 GLN n 
1 129 PRO n 
1 130 PHE n 
1 131 SER n 
1 132 TYR n 
1 133 HIS n 
1 134 SER n 
1 135 ARG n 
1 136 TYR n 
1 137 PHE n 
1 138 THR n 
1 139 PRO n 
1 140 LYS n 
1 141 PRO n 
1 142 VAL n 
1 143 LEU n 
1 144 ASP n 
1 145 SER n 
1 146 THR n 
1 147 ILE n 
1 148 ASP n 
1 149 TYR n 
1 150 PHE n 
1 151 GLN n 
1 152 PRO n 
1 153 ASN n 
1 154 ASN n 
1 155 LYS n 
1 156 ARG n 
1 157 ASN n 
1 158 GLN n 
1 159 LEU n 
1 160 TRP n 
1 161 LEU n 
1 162 ARG n 
1 163 LEU n 
1 164 GLN n 
1 165 THR n 
1 166 ALA n 
1 167 GLY n 
1 168 ASN n 
1 169 VAL n 
1 170 ASP n 
1 171 HIS n 
1 172 VAL n 
1 173 GLY n 
1 174 LEU n 
1 175 GLY n 
1 176 THR n 
1 177 ALA n 
1 178 PHE n 
1 179 GLU n 
1 180 ASN n 
1 181 SER n 
1 182 ILE n 
1 183 TYR n 
1 184 ASP n 
1 185 GLN n 
1 186 GLU n 
1 187 TYR n 
1 188 ASN n 
1 189 ILE n 
1 190 ARG n 
1 191 VAL n 
1 192 THR n 
1 193 MET n 
1 194 TYR n 
1 195 VAL n 
1 196 GLN n 
1 197 PHE n 
1 198 ARG n 
1 199 GLU n 
1 200 PHE n 
1 201 ASN n 
1 202 LEU n 
1 203 LYS n 
1 204 ASP n 
1 205 PRO n 
1 206 PRO n 
1 207 LEU n 
1 208 ASN n 
1 209 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   209 
_entity_src_gen.gene_src_common_name               PCV2 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 cap 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Porcine circovirus 2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     85708 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G0Y2B2_PCV2 
_struct_ref.pdbx_db_accession          G0Y2B2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPGGGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVI
LDDNFVTKATALTYDPYVNYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTAFEN
SIYDQEYNIRVTMYVQFREFNLKDPPLNP
;
_struct_ref.pdbx_align_begin           45 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5ZJU A 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
2  1 5ZJU B 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
3  1 5ZJU C 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
4  1 5ZJU D 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
5  1 5ZJU E 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
6  1 5ZJU F 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
7  1 5ZJU G 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
8  1 5ZJU H 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
9  1 5ZJU I 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
10 1 5ZJU J 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
11 1 5ZJU K 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
12 1 5ZJU L 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
13 1 5ZJU M 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
14 1 5ZJU N 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
15 1 5ZJU O 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
16 1 5ZJU P 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
17 1 5ZJU Q 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
18 1 5ZJU R 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
19 1 5ZJU S 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
20 1 5ZJU T 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
21 1 5ZJU U 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
22 1 5ZJU V 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
23 1 5ZJU W 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
24 1 5ZJU X 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
25 1 5ZJU Y 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
26 1 5ZJU Z 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
27 1 5ZJU 1 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
28 1 5ZJU 2 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
29 1 5ZJU 3 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
30 1 5ZJU 4 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
31 1 5ZJU 5 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
32 1 5ZJU 6 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
33 1 5ZJU 7 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
34 1 5ZJU 8 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
35 1 5ZJU 9 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
36 1 5ZJU a 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
37 1 5ZJU b 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
38 1 5ZJU c 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
39 1 5ZJU d 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
40 1 5ZJU e 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
41 1 5ZJU f 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
42 1 5ZJU g 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
43 1 5ZJU h 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
44 1 5ZJU i 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
45 1 5ZJU j 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
46 1 5ZJU k 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
47 1 5ZJU l 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
48 1 5ZJU m 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
49 1 5ZJU n 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
50 1 5ZJU o 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
51 1 5ZJU p 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
52 1 5ZJU q 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
53 1 5ZJU r 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
54 1 5ZJU s 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
55 1 5ZJU t 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
56 1 5ZJU u 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
57 1 5ZJU v 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
58 1 5ZJU w 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
59 1 5ZJU x 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
60 1 5ZJU y 21 ? 209 ? G0Y2B2 45 ? 233 ? 45 233 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5ZJU MET A 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1    
1  5ZJU GLY A 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 2    
1  5ZJU SER A 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 3    
1  5ZJU SER A 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 4    
1  5ZJU HIS A 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 5    
1  5ZJU HIS A 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 6    
1  5ZJU HIS A 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 7    
1  5ZJU HIS A 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 8    
1  5ZJU HIS A 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 9    
1  5ZJU HIS A 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 10   
1  5ZJU SER A 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 11   
1  5ZJU SER A 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 12   
1  5ZJU GLY A 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 13   
1  5ZJU LEU A 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 14   
1  5ZJU VAL A 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 15   
1  5ZJU PRO A 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 16   
1  5ZJU ARG A 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 17   
1  5ZJU GLY A 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 18   
1  5ZJU SER A 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 19   
1  5ZJU HIS A 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 20   
2  5ZJU MET B 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 21   
2  5ZJU GLY B 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 22   
2  5ZJU SER B 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 23   
2  5ZJU SER B 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 24   
2  5ZJU HIS B 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 25   
2  5ZJU HIS B 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 26   
2  5ZJU HIS B 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 27   
2  5ZJU HIS B 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 28   
2  5ZJU HIS B 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 29   
2  5ZJU HIS B 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 30   
2  5ZJU SER B 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 31   
2  5ZJU SER B 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 32   
2  5ZJU GLY B 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 33   
2  5ZJU LEU B 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 34   
2  5ZJU VAL B 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 35   
2  5ZJU PRO B 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 36   
2  5ZJU ARG B 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 37   
2  5ZJU GLY B 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 38   
2  5ZJU SER B 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 39   
2  5ZJU HIS B 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 40   
3  5ZJU MET C 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 41   
3  5ZJU GLY C 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 42   
3  5ZJU SER C 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 43   
3  5ZJU SER C 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 44   
3  5ZJU HIS C 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 45   
3  5ZJU HIS C 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 46   
3  5ZJU HIS C 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 47   
3  5ZJU HIS C 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 48   
3  5ZJU HIS C 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 49   
3  5ZJU HIS C 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 50   
3  5ZJU SER C 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 51   
3  5ZJU SER C 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 52   
3  5ZJU GLY C 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 53   
3  5ZJU LEU C 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 54   
3  5ZJU VAL C 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 55   
3  5ZJU PRO C 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 56   
3  5ZJU ARG C 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 57   
3  5ZJU GLY C 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 58   
3  5ZJU SER C 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 59   
3  5ZJU HIS C 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 60   
4  5ZJU MET D 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 61   
4  5ZJU GLY D 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 62   
4  5ZJU SER D 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 63   
4  5ZJU SER D 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 64   
4  5ZJU HIS D 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 65   
4  5ZJU HIS D 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 66   
4  5ZJU HIS D 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 67   
4  5ZJU HIS D 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 68   
4  5ZJU HIS D 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 69   
4  5ZJU HIS D 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 70   
4  5ZJU SER D 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 71   
4  5ZJU SER D 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 72   
4  5ZJU GLY D 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 73   
4  5ZJU LEU D 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 74   
4  5ZJU VAL D 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 75   
4  5ZJU PRO D 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 76   
4  5ZJU ARG D 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 77   
4  5ZJU GLY D 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 78   
4  5ZJU SER D 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 79   
4  5ZJU HIS D 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 80   
5  5ZJU MET E 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 81   
5  5ZJU GLY E 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 82   
5  5ZJU SER E 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 83   
5  5ZJU SER E 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 84   
5  5ZJU HIS E 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 85   
5  5ZJU HIS E 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 86   
5  5ZJU HIS E 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 87   
5  5ZJU HIS E 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 88   
5  5ZJU HIS E 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 89   
5  5ZJU HIS E 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 90   
5  5ZJU SER E 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 91   
5  5ZJU SER E 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 92   
5  5ZJU GLY E 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 93   
5  5ZJU LEU E 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 94   
5  5ZJU VAL E 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 95   
5  5ZJU PRO E 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 96   
5  5ZJU ARG E 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 97   
5  5ZJU GLY E 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 98   
5  5ZJU SER E 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 99   
5  5ZJU HIS E 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 100  
6  5ZJU MET F 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 101  
6  5ZJU GLY F 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 102  
6  5ZJU SER F 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 103  
6  5ZJU SER F 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 104  
6  5ZJU HIS F 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 105  
6  5ZJU HIS F 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 106  
6  5ZJU HIS F 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 107  
6  5ZJU HIS F 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 108  
6  5ZJU HIS F 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 109  
6  5ZJU HIS F 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 110  
6  5ZJU SER F 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 111  
6  5ZJU SER F 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 112  
6  5ZJU GLY F 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 113  
6  5ZJU LEU F 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 114  
6  5ZJU VAL F 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 115  
6  5ZJU PRO F 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 116  
6  5ZJU ARG F 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 117  
6  5ZJU GLY F 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 118  
6  5ZJU SER F 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 119  
6  5ZJU HIS F 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 120  
7  5ZJU MET G 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 121  
7  5ZJU GLY G 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 122  
7  5ZJU SER G 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 123  
7  5ZJU SER G 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 124  
7  5ZJU HIS G 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 125  
7  5ZJU HIS G 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 126  
7  5ZJU HIS G 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 127  
7  5ZJU HIS G 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 128  
7  5ZJU HIS G 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 129  
7  5ZJU HIS G 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 130  
7  5ZJU SER G 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 131  
7  5ZJU SER G 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 132  
7  5ZJU GLY G 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 133  
7  5ZJU LEU G 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 134  
7  5ZJU VAL G 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 135  
7  5ZJU PRO G 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 136  
7  5ZJU ARG G 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 137  
7  5ZJU GLY G 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 138  
7  5ZJU SER G 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 139  
7  5ZJU HIS G 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 140  
8  5ZJU MET H 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 141  
8  5ZJU GLY H 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 142  
8  5ZJU SER H 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 143  
8  5ZJU SER H 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 144  
8  5ZJU HIS H 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 145  
8  5ZJU HIS H 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 146  
8  5ZJU HIS H 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 147  
8  5ZJU HIS H 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 148  
8  5ZJU HIS H 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 149  
8  5ZJU HIS H 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 150  
8  5ZJU SER H 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 151  
8  5ZJU SER H 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 152  
8  5ZJU GLY H 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 153  
8  5ZJU LEU H 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 154  
8  5ZJU VAL H 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 155  
8  5ZJU PRO H 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 156  
8  5ZJU ARG H 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 157  
8  5ZJU GLY H 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 158  
8  5ZJU SER H 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 159  
8  5ZJU HIS H 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 160  
9  5ZJU MET I 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 161  
9  5ZJU GLY I 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 162  
9  5ZJU SER I 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 163  
9  5ZJU SER I 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 164  
9  5ZJU HIS I 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 165  
9  5ZJU HIS I 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 166  
9  5ZJU HIS I 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 167  
9  5ZJU HIS I 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 168  
9  5ZJU HIS I 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 169  
9  5ZJU HIS I 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 170  
9  5ZJU SER I 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 171  
9  5ZJU SER I 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 172  
9  5ZJU GLY I 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 173  
9  5ZJU LEU I 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 174  
9  5ZJU VAL I 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 175  
9  5ZJU PRO I 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 176  
9  5ZJU ARG I 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 177  
9  5ZJU GLY I 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 178  
9  5ZJU SER I 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 179  
9  5ZJU HIS I 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 180  
10 5ZJU MET J 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 181  
10 5ZJU GLY J 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 182  
10 5ZJU SER J 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 183  
10 5ZJU SER J 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 184  
10 5ZJU HIS J 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 185  
10 5ZJU HIS J 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 186  
10 5ZJU HIS J 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 187  
10 5ZJU HIS J 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 188  
10 5ZJU HIS J 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 189  
10 5ZJU HIS J 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 190  
10 5ZJU SER J 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 191  
10 5ZJU SER J 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 192  
10 5ZJU GLY J 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 193  
10 5ZJU LEU J 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 194  
10 5ZJU VAL J 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 195  
10 5ZJU PRO J 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 196  
10 5ZJU ARG J 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 197  
10 5ZJU GLY J 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 198  
10 5ZJU SER J 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 199  
10 5ZJU HIS J 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 200  
11 5ZJU MET K 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 201  
11 5ZJU GLY K 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 202  
11 5ZJU SER K 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 203  
11 5ZJU SER K 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 204  
11 5ZJU HIS K 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 205  
11 5ZJU HIS K 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 206  
11 5ZJU HIS K 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 207  
11 5ZJU HIS K 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 208  
11 5ZJU HIS K 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 209  
11 5ZJU HIS K 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 210  
11 5ZJU SER K 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 211  
11 5ZJU SER K 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 212  
11 5ZJU GLY K 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 213  
11 5ZJU LEU K 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 214  
11 5ZJU VAL K 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 215  
11 5ZJU PRO K 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 216  
11 5ZJU ARG K 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 217  
11 5ZJU GLY K 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 218  
11 5ZJU SER K 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 219  
11 5ZJU HIS K 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 220  
12 5ZJU MET L 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 221  
12 5ZJU GLY L 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 222  
12 5ZJU SER L 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 223  
12 5ZJU SER L 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 224  
12 5ZJU HIS L 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 225  
12 5ZJU HIS L 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 226  
12 5ZJU HIS L 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 227  
12 5ZJU HIS L 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 228  
12 5ZJU HIS L 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 229  
12 5ZJU HIS L 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 230  
12 5ZJU SER L 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 231  
12 5ZJU SER L 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 232  
12 5ZJU GLY L 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 233  
12 5ZJU LEU L 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 234  
12 5ZJU VAL L 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 235  
12 5ZJU PRO L 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 236  
12 5ZJU ARG L 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 237  
12 5ZJU GLY L 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 238  
12 5ZJU SER L 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 239  
12 5ZJU HIS L 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 240  
13 5ZJU MET M 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 241  
13 5ZJU GLY M 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 242  
13 5ZJU SER M 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 243  
13 5ZJU SER M 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 244  
13 5ZJU HIS M 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 245  
13 5ZJU HIS M 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 246  
13 5ZJU HIS M 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 247  
13 5ZJU HIS M 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 248  
13 5ZJU HIS M 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 249  
13 5ZJU HIS M 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 250  
13 5ZJU SER M 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 251  
13 5ZJU SER M 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 252  
13 5ZJU GLY M 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 253  
13 5ZJU LEU M 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 254  
13 5ZJU VAL M 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 255  
13 5ZJU PRO M 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 256  
13 5ZJU ARG M 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 257  
13 5ZJU GLY M 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 258  
13 5ZJU SER M 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 259  
13 5ZJU HIS M 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 260  
14 5ZJU MET N 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 261  
14 5ZJU GLY N 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 262  
14 5ZJU SER N 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 263  
14 5ZJU SER N 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 264  
14 5ZJU HIS N 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 265  
14 5ZJU HIS N 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 266  
14 5ZJU HIS N 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 267  
14 5ZJU HIS N 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 268  
14 5ZJU HIS N 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 269  
14 5ZJU HIS N 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 270  
14 5ZJU SER N 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 271  
14 5ZJU SER N 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 272  
14 5ZJU GLY N 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 273  
14 5ZJU LEU N 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 274  
14 5ZJU VAL N 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 275  
14 5ZJU PRO N 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 276  
14 5ZJU ARG N 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 277  
14 5ZJU GLY N 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 278  
14 5ZJU SER N 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 279  
14 5ZJU HIS N 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 280  
15 5ZJU MET O 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 281  
15 5ZJU GLY O 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 282  
15 5ZJU SER O 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 283  
15 5ZJU SER O 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 284  
15 5ZJU HIS O 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 285  
15 5ZJU HIS O 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 286  
15 5ZJU HIS O 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 287  
15 5ZJU HIS O 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 288  
15 5ZJU HIS O 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 289  
15 5ZJU HIS O 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 290  
15 5ZJU SER O 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 291  
15 5ZJU SER O 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 292  
15 5ZJU GLY O 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 293  
15 5ZJU LEU O 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 294  
15 5ZJU VAL O 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 295  
15 5ZJU PRO O 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 296  
15 5ZJU ARG O 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 297  
15 5ZJU GLY O 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 298  
15 5ZJU SER O 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 299  
15 5ZJU HIS O 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 300  
16 5ZJU MET P 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 301  
16 5ZJU GLY P 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 302  
16 5ZJU SER P 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 303  
16 5ZJU SER P 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 304  
16 5ZJU HIS P 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 305  
16 5ZJU HIS P 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 306  
16 5ZJU HIS P 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 307  
16 5ZJU HIS P 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 308  
16 5ZJU HIS P 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 309  
16 5ZJU HIS P 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 310  
16 5ZJU SER P 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 311  
16 5ZJU SER P 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 312  
16 5ZJU GLY P 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 313  
16 5ZJU LEU P 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 314  
16 5ZJU VAL P 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 315  
16 5ZJU PRO P 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 316  
16 5ZJU ARG P 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 317  
16 5ZJU GLY P 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 318  
16 5ZJU SER P 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 319  
16 5ZJU HIS P 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 320  
17 5ZJU MET Q 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 321  
17 5ZJU GLY Q 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 322  
17 5ZJU SER Q 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 323  
17 5ZJU SER Q 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 324  
17 5ZJU HIS Q 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 325  
17 5ZJU HIS Q 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 326  
17 5ZJU HIS Q 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 327  
17 5ZJU HIS Q 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 328  
17 5ZJU HIS Q 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 329  
17 5ZJU HIS Q 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 330  
17 5ZJU SER Q 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 331  
17 5ZJU SER Q 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 332  
17 5ZJU GLY Q 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 333  
17 5ZJU LEU Q 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 334  
17 5ZJU VAL Q 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 335  
17 5ZJU PRO Q 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 336  
17 5ZJU ARG Q 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 337  
17 5ZJU GLY Q 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 338  
17 5ZJU SER Q 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 339  
17 5ZJU HIS Q 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 340  
18 5ZJU MET R 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 341  
18 5ZJU GLY R 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 342  
18 5ZJU SER R 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 343  
18 5ZJU SER R 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 344  
18 5ZJU HIS R 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 345  
18 5ZJU HIS R 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 346  
18 5ZJU HIS R 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 347  
18 5ZJU HIS R 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 348  
18 5ZJU HIS R 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 349  
18 5ZJU HIS R 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 350  
18 5ZJU SER R 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 351  
18 5ZJU SER R 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 352  
18 5ZJU GLY R 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 353  
18 5ZJU LEU R 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 354  
18 5ZJU VAL R 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 355  
18 5ZJU PRO R 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 356  
18 5ZJU ARG R 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 357  
18 5ZJU GLY R 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 358  
18 5ZJU SER R 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 359  
18 5ZJU HIS R 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 360  
19 5ZJU MET S 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 361  
19 5ZJU GLY S 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 362  
19 5ZJU SER S 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 363  
19 5ZJU SER S 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 364  
19 5ZJU HIS S 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 365  
19 5ZJU HIS S 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 366  
19 5ZJU HIS S 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 367  
19 5ZJU HIS S 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 368  
19 5ZJU HIS S 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 369  
19 5ZJU HIS S 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 370  
19 5ZJU SER S 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 371  
19 5ZJU SER S 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 372  
19 5ZJU GLY S 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 373  
19 5ZJU LEU S 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 374  
19 5ZJU VAL S 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 375  
19 5ZJU PRO S 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 376  
19 5ZJU ARG S 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 377  
19 5ZJU GLY S 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 378  
19 5ZJU SER S 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 379  
19 5ZJU HIS S 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 380  
20 5ZJU MET T 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 381  
20 5ZJU GLY T 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 382  
20 5ZJU SER T 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 383  
20 5ZJU SER T 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 384  
20 5ZJU HIS T 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 385  
20 5ZJU HIS T 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 386  
20 5ZJU HIS T 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 387  
20 5ZJU HIS T 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 388  
20 5ZJU HIS T 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 389  
20 5ZJU HIS T 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 390  
20 5ZJU SER T 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 391  
20 5ZJU SER T 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 392  
20 5ZJU GLY T 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 393  
20 5ZJU LEU T 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 394  
20 5ZJU VAL T 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 395  
20 5ZJU PRO T 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 396  
20 5ZJU ARG T 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 397  
20 5ZJU GLY T 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 398  
20 5ZJU SER T 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 399  
20 5ZJU HIS T 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 400  
21 5ZJU MET U 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 401  
21 5ZJU GLY U 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 402  
21 5ZJU SER U 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 403  
21 5ZJU SER U 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 404  
21 5ZJU HIS U 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 405  
21 5ZJU HIS U 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 406  
21 5ZJU HIS U 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 407  
21 5ZJU HIS U 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 408  
21 5ZJU HIS U 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 409  
21 5ZJU HIS U 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 410  
21 5ZJU SER U 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 411  
21 5ZJU SER U 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 412  
21 5ZJU GLY U 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 413  
21 5ZJU LEU U 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 414  
21 5ZJU VAL U 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 415  
21 5ZJU PRO U 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 416  
21 5ZJU ARG U 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 417  
21 5ZJU GLY U 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 418  
21 5ZJU SER U 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 419  
21 5ZJU HIS U 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 420  
22 5ZJU MET V 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 421  
22 5ZJU GLY V 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 422  
22 5ZJU SER V 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 423  
22 5ZJU SER V 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 424  
22 5ZJU HIS V 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 425  
22 5ZJU HIS V 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 426  
22 5ZJU HIS V 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 427  
22 5ZJU HIS V 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 428  
22 5ZJU HIS V 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 429  
22 5ZJU HIS V 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 430  
22 5ZJU SER V 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 431  
22 5ZJU SER V 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 432  
22 5ZJU GLY V 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 433  
22 5ZJU LEU V 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 434  
22 5ZJU VAL V 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 435  
22 5ZJU PRO V 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 436  
22 5ZJU ARG V 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 437  
22 5ZJU GLY V 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 438  
22 5ZJU SER V 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 439  
22 5ZJU HIS V 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 440  
23 5ZJU MET W 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 441  
23 5ZJU GLY W 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 442  
23 5ZJU SER W 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 443  
23 5ZJU SER W 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 444  
23 5ZJU HIS W 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 445  
23 5ZJU HIS W 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 446  
23 5ZJU HIS W 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 447  
23 5ZJU HIS W 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 448  
23 5ZJU HIS W 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 449  
23 5ZJU HIS W 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 450  
23 5ZJU SER W 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 451  
23 5ZJU SER W 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 452  
23 5ZJU GLY W 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 453  
23 5ZJU LEU W 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 454  
23 5ZJU VAL W 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 455  
23 5ZJU PRO W 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 456  
23 5ZJU ARG W 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 457  
23 5ZJU GLY W 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 458  
23 5ZJU SER W 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 459  
23 5ZJU HIS W 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 460  
24 5ZJU MET X 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 461  
24 5ZJU GLY X 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 462  
24 5ZJU SER X 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 463  
24 5ZJU SER X 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 464  
24 5ZJU HIS X 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 465  
24 5ZJU HIS X 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 466  
24 5ZJU HIS X 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 467  
24 5ZJU HIS X 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 468  
24 5ZJU HIS X 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 469  
24 5ZJU HIS X 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 470  
24 5ZJU SER X 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 471  
24 5ZJU SER X 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 472  
24 5ZJU GLY X 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 473  
24 5ZJU LEU X 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 474  
24 5ZJU VAL X 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 475  
24 5ZJU PRO X 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 476  
24 5ZJU ARG X 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 477  
24 5ZJU GLY X 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 478  
24 5ZJU SER X 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 479  
24 5ZJU HIS X 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 480  
25 5ZJU MET Y 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 481  
25 5ZJU GLY Y 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 482  
25 5ZJU SER Y 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 483  
25 5ZJU SER Y 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 484  
25 5ZJU HIS Y 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 485  
25 5ZJU HIS Y 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 486  
25 5ZJU HIS Y 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 487  
25 5ZJU HIS Y 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 488  
25 5ZJU HIS Y 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 489  
25 5ZJU HIS Y 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 490  
25 5ZJU SER Y 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 491  
25 5ZJU SER Y 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 492  
25 5ZJU GLY Y 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 493  
25 5ZJU LEU Y 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 494  
25 5ZJU VAL Y 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 495  
25 5ZJU PRO Y 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 496  
25 5ZJU ARG Y 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 497  
25 5ZJU GLY Y 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 498  
25 5ZJU SER Y 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 499  
25 5ZJU HIS Y 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 500  
26 5ZJU MET Z 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 501  
26 5ZJU GLY Z 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 502  
26 5ZJU SER Z 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 503  
26 5ZJU SER Z 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 504  
26 5ZJU HIS Z 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 505  
26 5ZJU HIS Z 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 506  
26 5ZJU HIS Z 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 507  
26 5ZJU HIS Z 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 508  
26 5ZJU HIS Z 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 509  
26 5ZJU HIS Z 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 510  
26 5ZJU SER Z 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 511  
26 5ZJU SER Z 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 512  
26 5ZJU GLY Z 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 513  
26 5ZJU LEU Z 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 514  
26 5ZJU VAL Z 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 515  
26 5ZJU PRO Z 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 516  
26 5ZJU ARG Z 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 517  
26 5ZJU GLY Z 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 518  
26 5ZJU SER Z 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 519  
26 5ZJU HIS Z 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 520  
27 5ZJU MET 1 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 521  
27 5ZJU GLY 1 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 522  
27 5ZJU SER 1 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 523  
27 5ZJU SER 1 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 524  
27 5ZJU HIS 1 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 525  
27 5ZJU HIS 1 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 526  
27 5ZJU HIS 1 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 527  
27 5ZJU HIS 1 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 528  
27 5ZJU HIS 1 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 529  
27 5ZJU HIS 1 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 530  
27 5ZJU SER 1 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 531  
27 5ZJU SER 1 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 532  
27 5ZJU GLY 1 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 533  
27 5ZJU LEU 1 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 534  
27 5ZJU VAL 1 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 535  
27 5ZJU PRO 1 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 536  
27 5ZJU ARG 1 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 537  
27 5ZJU GLY 1 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 538  
27 5ZJU SER 1 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 539  
27 5ZJU HIS 1 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 540  
28 5ZJU MET 2 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 541  
28 5ZJU GLY 2 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 542  
28 5ZJU SER 2 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 543  
28 5ZJU SER 2 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 544  
28 5ZJU HIS 2 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 545  
28 5ZJU HIS 2 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 546  
28 5ZJU HIS 2 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 547  
28 5ZJU HIS 2 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 548  
28 5ZJU HIS 2 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 549  
28 5ZJU HIS 2 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 550  
28 5ZJU SER 2 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 551  
28 5ZJU SER 2 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 552  
28 5ZJU GLY 2 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 553  
28 5ZJU LEU 2 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 554  
28 5ZJU VAL 2 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 555  
28 5ZJU PRO 2 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 556  
28 5ZJU ARG 2 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 557  
28 5ZJU GLY 2 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 558  
28 5ZJU SER 2 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 559  
28 5ZJU HIS 2 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 560  
29 5ZJU MET 3 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 561  
29 5ZJU GLY 3 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 562  
29 5ZJU SER 3 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 563  
29 5ZJU SER 3 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 564  
29 5ZJU HIS 3 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 565  
29 5ZJU HIS 3 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 566  
29 5ZJU HIS 3 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 567  
29 5ZJU HIS 3 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 568  
29 5ZJU HIS 3 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 569  
29 5ZJU HIS 3 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 570  
29 5ZJU SER 3 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 571  
29 5ZJU SER 3 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 572  
29 5ZJU GLY 3 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 573  
29 5ZJU LEU 3 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 574  
29 5ZJU VAL 3 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 575  
29 5ZJU PRO 3 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 576  
29 5ZJU ARG 3 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 577  
29 5ZJU GLY 3 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 578  
29 5ZJU SER 3 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 579  
29 5ZJU HIS 3 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 580  
30 5ZJU MET 4 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 581  
30 5ZJU GLY 4 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 582  
30 5ZJU SER 4 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 583  
30 5ZJU SER 4 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 584  
30 5ZJU HIS 4 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 585  
30 5ZJU HIS 4 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 586  
30 5ZJU HIS 4 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 587  
30 5ZJU HIS 4 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 588  
30 5ZJU HIS 4 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 589  
30 5ZJU HIS 4 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 590  
30 5ZJU SER 4 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 591  
30 5ZJU SER 4 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 592  
30 5ZJU GLY 4 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 593  
30 5ZJU LEU 4 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 594  
30 5ZJU VAL 4 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 595  
30 5ZJU PRO 4 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 596  
30 5ZJU ARG 4 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 597  
30 5ZJU GLY 4 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 598  
30 5ZJU SER 4 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 599  
30 5ZJU HIS 4 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 600  
31 5ZJU MET 5 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 601  
31 5ZJU GLY 5 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 602  
31 5ZJU SER 5 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 603  
31 5ZJU SER 5 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 604  
31 5ZJU HIS 5 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 605  
31 5ZJU HIS 5 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 606  
31 5ZJU HIS 5 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 607  
31 5ZJU HIS 5 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 608  
31 5ZJU HIS 5 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 609  
31 5ZJU HIS 5 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 610  
31 5ZJU SER 5 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 611  
31 5ZJU SER 5 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 612  
31 5ZJU GLY 5 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 613  
31 5ZJU LEU 5 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 614  
31 5ZJU VAL 5 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 615  
31 5ZJU PRO 5 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 616  
31 5ZJU ARG 5 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 617  
31 5ZJU GLY 5 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 618  
31 5ZJU SER 5 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 619  
31 5ZJU HIS 5 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 620  
32 5ZJU MET 6 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 621  
32 5ZJU GLY 6 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 622  
32 5ZJU SER 6 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 623  
32 5ZJU SER 6 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 624  
32 5ZJU HIS 6 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 625  
32 5ZJU HIS 6 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 626  
32 5ZJU HIS 6 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 627  
32 5ZJU HIS 6 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 628  
32 5ZJU HIS 6 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 629  
32 5ZJU HIS 6 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 630  
32 5ZJU SER 6 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 631  
32 5ZJU SER 6 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 632  
32 5ZJU GLY 6 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 633  
32 5ZJU LEU 6 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 634  
32 5ZJU VAL 6 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 635  
32 5ZJU PRO 6 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 636  
32 5ZJU ARG 6 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 637  
32 5ZJU GLY 6 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 638  
32 5ZJU SER 6 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 639  
32 5ZJU HIS 6 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 640  
33 5ZJU MET 7 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 641  
33 5ZJU GLY 7 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 642  
33 5ZJU SER 7 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 643  
33 5ZJU SER 7 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 644  
33 5ZJU HIS 7 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 645  
33 5ZJU HIS 7 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 646  
33 5ZJU HIS 7 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 647  
33 5ZJU HIS 7 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 648  
33 5ZJU HIS 7 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 649  
33 5ZJU HIS 7 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 650  
33 5ZJU SER 7 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 651  
33 5ZJU SER 7 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 652  
33 5ZJU GLY 7 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 653  
33 5ZJU LEU 7 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 654  
33 5ZJU VAL 7 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 655  
33 5ZJU PRO 7 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 656  
33 5ZJU ARG 7 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 657  
33 5ZJU GLY 7 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 658  
33 5ZJU SER 7 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 659  
33 5ZJU HIS 7 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 660  
34 5ZJU MET 8 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 661  
34 5ZJU GLY 8 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 662  
34 5ZJU SER 8 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 663  
34 5ZJU SER 8 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 664  
34 5ZJU HIS 8 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 665  
34 5ZJU HIS 8 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 666  
34 5ZJU HIS 8 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 667  
34 5ZJU HIS 8 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 668  
34 5ZJU HIS 8 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 669  
34 5ZJU HIS 8 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 670  
34 5ZJU SER 8 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 671  
34 5ZJU SER 8 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 672  
34 5ZJU GLY 8 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 673  
34 5ZJU LEU 8 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 674  
34 5ZJU VAL 8 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 675  
34 5ZJU PRO 8 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 676  
34 5ZJU ARG 8 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 677  
34 5ZJU GLY 8 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 678  
34 5ZJU SER 8 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 679  
34 5ZJU HIS 8 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 680  
35 5ZJU MET 9 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 681  
35 5ZJU GLY 9 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 682  
35 5ZJU SER 9 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 683  
35 5ZJU SER 9 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 684  
35 5ZJU HIS 9 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 685  
35 5ZJU HIS 9 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 686  
35 5ZJU HIS 9 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 687  
35 5ZJU HIS 9 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 688  
35 5ZJU HIS 9 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 689  
35 5ZJU HIS 9 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 690  
35 5ZJU SER 9 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 691  
35 5ZJU SER 9 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 692  
35 5ZJU GLY 9 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 693  
35 5ZJU LEU 9 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 694  
35 5ZJU VAL 9 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 695  
35 5ZJU PRO 9 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 696  
35 5ZJU ARG 9 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 697  
35 5ZJU GLY 9 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 698  
35 5ZJU SER 9 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 699  
35 5ZJU HIS 9 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 700  
36 5ZJU MET a 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 701  
36 5ZJU GLY a 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 702  
36 5ZJU SER a 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 703  
36 5ZJU SER a 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 704  
36 5ZJU HIS a 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 705  
36 5ZJU HIS a 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 706  
36 5ZJU HIS a 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 707  
36 5ZJU HIS a 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 708  
36 5ZJU HIS a 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 709  
36 5ZJU HIS a 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 710  
36 5ZJU SER a 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 711  
36 5ZJU SER a 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 712  
36 5ZJU GLY a 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 713  
36 5ZJU LEU a 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 714  
36 5ZJU VAL a 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 715  
36 5ZJU PRO a 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 716  
36 5ZJU ARG a 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 717  
36 5ZJU GLY a 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 718  
36 5ZJU SER a 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 719  
36 5ZJU HIS a 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 720  
37 5ZJU MET b 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 721  
37 5ZJU GLY b 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 722  
37 5ZJU SER b 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 723  
37 5ZJU SER b 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 724  
37 5ZJU HIS b 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 725  
37 5ZJU HIS b 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 726  
37 5ZJU HIS b 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 727  
37 5ZJU HIS b 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 728  
37 5ZJU HIS b 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 729  
37 5ZJU HIS b 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 730  
37 5ZJU SER b 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 731  
37 5ZJU SER b 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 732  
37 5ZJU GLY b 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 733  
37 5ZJU LEU b 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 734  
37 5ZJU VAL b 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 735  
37 5ZJU PRO b 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 736  
37 5ZJU ARG b 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 737  
37 5ZJU GLY b 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 738  
37 5ZJU SER b 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 739  
37 5ZJU HIS b 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 740  
38 5ZJU MET c 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 741  
38 5ZJU GLY c 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 742  
38 5ZJU SER c 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 743  
38 5ZJU SER c 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 744  
38 5ZJU HIS c 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 745  
38 5ZJU HIS c 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 746  
38 5ZJU HIS c 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 747  
38 5ZJU HIS c 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 748  
38 5ZJU HIS c 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 749  
38 5ZJU HIS c 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 750  
38 5ZJU SER c 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 751  
38 5ZJU SER c 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 752  
38 5ZJU GLY c 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 753  
38 5ZJU LEU c 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 754  
38 5ZJU VAL c 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 755  
38 5ZJU PRO c 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 756  
38 5ZJU ARG c 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 757  
38 5ZJU GLY c 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 758  
38 5ZJU SER c 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 759  
38 5ZJU HIS c 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 760  
39 5ZJU MET d 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 761  
39 5ZJU GLY d 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 762  
39 5ZJU SER d 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 763  
39 5ZJU SER d 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 764  
39 5ZJU HIS d 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 765  
39 5ZJU HIS d 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 766  
39 5ZJU HIS d 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 767  
39 5ZJU HIS d 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 768  
39 5ZJU HIS d 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 769  
39 5ZJU HIS d 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 770  
39 5ZJU SER d 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 771  
39 5ZJU SER d 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 772  
39 5ZJU GLY d 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 773  
39 5ZJU LEU d 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 774  
39 5ZJU VAL d 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 775  
39 5ZJU PRO d 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 776  
39 5ZJU ARG d 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 777  
39 5ZJU GLY d 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 778  
39 5ZJU SER d 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 779  
39 5ZJU HIS d 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 780  
40 5ZJU MET e 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 781  
40 5ZJU GLY e 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 782  
40 5ZJU SER e 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 783  
40 5ZJU SER e 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 784  
40 5ZJU HIS e 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 785  
40 5ZJU HIS e 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 786  
40 5ZJU HIS e 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 787  
40 5ZJU HIS e 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 788  
40 5ZJU HIS e 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 789  
40 5ZJU HIS e 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 790  
40 5ZJU SER e 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 791  
40 5ZJU SER e 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 792  
40 5ZJU GLY e 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 793  
40 5ZJU LEU e 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 794  
40 5ZJU VAL e 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 795  
40 5ZJU PRO e 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 796  
40 5ZJU ARG e 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 797  
40 5ZJU GLY e 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 798  
40 5ZJU SER e 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 799  
40 5ZJU HIS e 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 800  
41 5ZJU MET f 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 801  
41 5ZJU GLY f 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 802  
41 5ZJU SER f 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 803  
41 5ZJU SER f 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 804  
41 5ZJU HIS f 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 805  
41 5ZJU HIS f 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 806  
41 5ZJU HIS f 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 807  
41 5ZJU HIS f 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 808  
41 5ZJU HIS f 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 809  
41 5ZJU HIS f 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 810  
41 5ZJU SER f 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 811  
41 5ZJU SER f 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 812  
41 5ZJU GLY f 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 813  
41 5ZJU LEU f 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 814  
41 5ZJU VAL f 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 815  
41 5ZJU PRO f 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 816  
41 5ZJU ARG f 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 817  
41 5ZJU GLY f 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 818  
41 5ZJU SER f 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 819  
41 5ZJU HIS f 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 820  
42 5ZJU MET g 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 821  
42 5ZJU GLY g 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 822  
42 5ZJU SER g 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 823  
42 5ZJU SER g 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 824  
42 5ZJU HIS g 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 825  
42 5ZJU HIS g 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 826  
42 5ZJU HIS g 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 827  
42 5ZJU HIS g 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 828  
42 5ZJU HIS g 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 829  
42 5ZJU HIS g 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 830  
42 5ZJU SER g 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 831  
42 5ZJU SER g 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 832  
42 5ZJU GLY g 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 833  
42 5ZJU LEU g 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 834  
42 5ZJU VAL g 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 835  
42 5ZJU PRO g 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 836  
42 5ZJU ARG g 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 837  
42 5ZJU GLY g 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 838  
42 5ZJU SER g 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 839  
42 5ZJU HIS g 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 840  
43 5ZJU MET h 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 841  
43 5ZJU GLY h 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 842  
43 5ZJU SER h 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 843  
43 5ZJU SER h 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 844  
43 5ZJU HIS h 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 845  
43 5ZJU HIS h 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 846  
43 5ZJU HIS h 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 847  
43 5ZJU HIS h 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 848  
43 5ZJU HIS h 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 849  
43 5ZJU HIS h 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 850  
43 5ZJU SER h 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 851  
43 5ZJU SER h 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 852  
43 5ZJU GLY h 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 853  
43 5ZJU LEU h 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 854  
43 5ZJU VAL h 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 855  
43 5ZJU PRO h 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 856  
43 5ZJU ARG h 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 857  
43 5ZJU GLY h 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 858  
43 5ZJU SER h 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 859  
43 5ZJU HIS h 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 860  
44 5ZJU MET i 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 861  
44 5ZJU GLY i 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 862  
44 5ZJU SER i 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 863  
44 5ZJU SER i 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 864  
44 5ZJU HIS i 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 865  
44 5ZJU HIS i 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 866  
44 5ZJU HIS i 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 867  
44 5ZJU HIS i 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 868  
44 5ZJU HIS i 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 869  
44 5ZJU HIS i 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 870  
44 5ZJU SER i 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 871  
44 5ZJU SER i 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 872  
44 5ZJU GLY i 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 873  
44 5ZJU LEU i 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 874  
44 5ZJU VAL i 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 875  
44 5ZJU PRO i 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 876  
44 5ZJU ARG i 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 877  
44 5ZJU GLY i 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 878  
44 5ZJU SER i 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 879  
44 5ZJU HIS i 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 880  
45 5ZJU MET j 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 881  
45 5ZJU GLY j 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 882  
45 5ZJU SER j 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 883  
45 5ZJU SER j 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 884  
45 5ZJU HIS j 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 885  
45 5ZJU HIS j 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 886  
45 5ZJU HIS j 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 887  
45 5ZJU HIS j 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 888  
45 5ZJU HIS j 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 889  
45 5ZJU HIS j 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 890  
45 5ZJU SER j 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 891  
45 5ZJU SER j 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 892  
45 5ZJU GLY j 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 893  
45 5ZJU LEU j 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 894  
45 5ZJU VAL j 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 895  
45 5ZJU PRO j 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 896  
45 5ZJU ARG j 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 897  
45 5ZJU GLY j 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 898  
45 5ZJU SER j 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 899  
45 5ZJU HIS j 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 900  
46 5ZJU MET k 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 901  
46 5ZJU GLY k 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 902  
46 5ZJU SER k 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 903  
46 5ZJU SER k 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 904  
46 5ZJU HIS k 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 905  
46 5ZJU HIS k 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 906  
46 5ZJU HIS k 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 907  
46 5ZJU HIS k 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 908  
46 5ZJU HIS k 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 909  
46 5ZJU HIS k 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 910  
46 5ZJU SER k 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 911  
46 5ZJU SER k 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 912  
46 5ZJU GLY k 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 913  
46 5ZJU LEU k 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 914  
46 5ZJU VAL k 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 915  
46 5ZJU PRO k 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 916  
46 5ZJU ARG k 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 917  
46 5ZJU GLY k 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 918  
46 5ZJU SER k 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 919  
46 5ZJU HIS k 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 920  
47 5ZJU MET l 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 921  
47 5ZJU GLY l 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 922  
47 5ZJU SER l 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 923  
47 5ZJU SER l 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 924  
47 5ZJU HIS l 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 925  
47 5ZJU HIS l 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 926  
47 5ZJU HIS l 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 927  
47 5ZJU HIS l 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 928  
47 5ZJU HIS l 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 929  
47 5ZJU HIS l 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 930  
47 5ZJU SER l 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 931  
47 5ZJU SER l 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 932  
47 5ZJU GLY l 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 933  
47 5ZJU LEU l 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 934  
47 5ZJU VAL l 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 935  
47 5ZJU PRO l 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 936  
47 5ZJU ARG l 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 937  
47 5ZJU GLY l 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 938  
47 5ZJU SER l 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 939  
47 5ZJU HIS l 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 940  
48 5ZJU MET m 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 941  
48 5ZJU GLY m 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 942  
48 5ZJU SER m 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 943  
48 5ZJU SER m 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 944  
48 5ZJU HIS m 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 945  
48 5ZJU HIS m 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 946  
48 5ZJU HIS m 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 947  
48 5ZJU HIS m 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 948  
48 5ZJU HIS m 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 949  
48 5ZJU HIS m 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 950  
48 5ZJU SER m 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 951  
48 5ZJU SER m 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 952  
48 5ZJU GLY m 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 953  
48 5ZJU LEU m 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 954  
48 5ZJU VAL m 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 955  
48 5ZJU PRO m 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 956  
48 5ZJU ARG m 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 957  
48 5ZJU GLY m 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 958  
48 5ZJU SER m 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 959  
48 5ZJU HIS m 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 960  
49 5ZJU MET n 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 961  
49 5ZJU GLY n 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 962  
49 5ZJU SER n 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 963  
49 5ZJU SER n 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 964  
49 5ZJU HIS n 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 965  
49 5ZJU HIS n 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 966  
49 5ZJU HIS n 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 967  
49 5ZJU HIS n 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 968  
49 5ZJU HIS n 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 969  
49 5ZJU HIS n 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 970  
49 5ZJU SER n 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 971  
49 5ZJU SER n 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 972  
49 5ZJU GLY n 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 973  
49 5ZJU LEU n 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 974  
49 5ZJU VAL n 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 975  
49 5ZJU PRO n 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 976  
49 5ZJU ARG n 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 977  
49 5ZJU GLY n 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 978  
49 5ZJU SER n 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 979  
49 5ZJU HIS n 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 980  
50 5ZJU MET o 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 981  
50 5ZJU GLY o 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 982  
50 5ZJU SER o 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 983  
50 5ZJU SER o 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 984  
50 5ZJU HIS o 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 985  
50 5ZJU HIS o 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 986  
50 5ZJU HIS o 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 987  
50 5ZJU HIS o 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 988  
50 5ZJU HIS o 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 989  
50 5ZJU HIS o 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 990  
50 5ZJU SER o 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 991  
50 5ZJU SER o 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 992  
50 5ZJU GLY o 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 993  
50 5ZJU LEU o 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 994  
50 5ZJU VAL o 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 995  
50 5ZJU PRO o 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 996  
50 5ZJU ARG o 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 997  
50 5ZJU GLY o 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 998  
50 5ZJU SER o 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 999  
50 5ZJU HIS o 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1000 
51 5ZJU MET p 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1001 
51 5ZJU GLY p 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1002 
51 5ZJU SER p 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1003 
51 5ZJU SER p 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1004 
51 5ZJU HIS p 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1005 
51 5ZJU HIS p 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1006 
51 5ZJU HIS p 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1007 
51 5ZJU HIS p 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1008 
51 5ZJU HIS p 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1009 
51 5ZJU HIS p 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1010 
51 5ZJU SER p 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1011 
51 5ZJU SER p 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1012 
51 5ZJU GLY p 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1013 
51 5ZJU LEU p 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1014 
51 5ZJU VAL p 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1015 
51 5ZJU PRO p 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1016 
51 5ZJU ARG p 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1017 
51 5ZJU GLY p 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1018 
51 5ZJU SER p 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1019 
51 5ZJU HIS p 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1020 
52 5ZJU MET q 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1021 
52 5ZJU GLY q 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1022 
52 5ZJU SER q 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1023 
52 5ZJU SER q 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1024 
52 5ZJU HIS q 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1025 
52 5ZJU HIS q 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1026 
52 5ZJU HIS q 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1027 
52 5ZJU HIS q 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1028 
52 5ZJU HIS q 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1029 
52 5ZJU HIS q 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1030 
52 5ZJU SER q 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1031 
52 5ZJU SER q 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1032 
52 5ZJU GLY q 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1033 
52 5ZJU LEU q 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1034 
52 5ZJU VAL q 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1035 
52 5ZJU PRO q 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1036 
52 5ZJU ARG q 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1037 
52 5ZJU GLY q 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1038 
52 5ZJU SER q 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1039 
52 5ZJU HIS q 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1040 
53 5ZJU MET r 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1041 
53 5ZJU GLY r 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1042 
53 5ZJU SER r 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1043 
53 5ZJU SER r 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1044 
53 5ZJU HIS r 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1045 
53 5ZJU HIS r 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1046 
53 5ZJU HIS r 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1047 
53 5ZJU HIS r 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1048 
53 5ZJU HIS r 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1049 
53 5ZJU HIS r 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1050 
53 5ZJU SER r 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1051 
53 5ZJU SER r 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1052 
53 5ZJU GLY r 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1053 
53 5ZJU LEU r 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1054 
53 5ZJU VAL r 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1055 
53 5ZJU PRO r 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1056 
53 5ZJU ARG r 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1057 
53 5ZJU GLY r 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1058 
53 5ZJU SER r 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1059 
53 5ZJU HIS r 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1060 
54 5ZJU MET s 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1061 
54 5ZJU GLY s 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1062 
54 5ZJU SER s 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1063 
54 5ZJU SER s 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1064 
54 5ZJU HIS s 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1065 
54 5ZJU HIS s 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1066 
54 5ZJU HIS s 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1067 
54 5ZJU HIS s 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1068 
54 5ZJU HIS s 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1069 
54 5ZJU HIS s 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1070 
54 5ZJU SER s 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1071 
54 5ZJU SER s 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1072 
54 5ZJU GLY s 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1073 
54 5ZJU LEU s 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1074 
54 5ZJU VAL s 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1075 
54 5ZJU PRO s 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1076 
54 5ZJU ARG s 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1077 
54 5ZJU GLY s 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1078 
54 5ZJU SER s 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1079 
54 5ZJU HIS s 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1080 
55 5ZJU MET t 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1081 
55 5ZJU GLY t 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1082 
55 5ZJU SER t 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1083 
55 5ZJU SER t 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1084 
55 5ZJU HIS t 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1085 
55 5ZJU HIS t 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1086 
55 5ZJU HIS t 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1087 
55 5ZJU HIS t 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1088 
55 5ZJU HIS t 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1089 
55 5ZJU HIS t 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1090 
55 5ZJU SER t 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1091 
55 5ZJU SER t 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1092 
55 5ZJU GLY t 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1093 
55 5ZJU LEU t 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1094 
55 5ZJU VAL t 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1095 
55 5ZJU PRO t 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1096 
55 5ZJU ARG t 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1097 
55 5ZJU GLY t 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1098 
55 5ZJU SER t 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1099 
55 5ZJU HIS t 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1100 
56 5ZJU MET u 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1101 
56 5ZJU GLY u 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1102 
56 5ZJU SER u 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1103 
56 5ZJU SER u 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1104 
56 5ZJU HIS u 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1105 
56 5ZJU HIS u 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1106 
56 5ZJU HIS u 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1107 
56 5ZJU HIS u 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1108 
56 5ZJU HIS u 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1109 
56 5ZJU HIS u 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1110 
56 5ZJU SER u 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1111 
56 5ZJU SER u 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1112 
56 5ZJU GLY u 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1113 
56 5ZJU LEU u 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1114 
56 5ZJU VAL u 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1115 
56 5ZJU PRO u 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1116 
56 5ZJU ARG u 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1117 
56 5ZJU GLY u 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1118 
56 5ZJU SER u 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1119 
56 5ZJU HIS u 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1120 
57 5ZJU MET v 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1121 
57 5ZJU GLY v 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1122 
57 5ZJU SER v 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1123 
57 5ZJU SER v 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1124 
57 5ZJU HIS v 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1125 
57 5ZJU HIS v 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1126 
57 5ZJU HIS v 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1127 
57 5ZJU HIS v 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1128 
57 5ZJU HIS v 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1129 
57 5ZJU HIS v 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1130 
57 5ZJU SER v 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1131 
57 5ZJU SER v 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1132 
57 5ZJU GLY v 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1133 
57 5ZJU LEU v 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1134 
57 5ZJU VAL v 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1135 
57 5ZJU PRO v 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1136 
57 5ZJU ARG v 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1137 
57 5ZJU GLY v 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1138 
57 5ZJU SER v 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1139 
57 5ZJU HIS v 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1140 
58 5ZJU MET w 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1141 
58 5ZJU GLY w 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1142 
58 5ZJU SER w 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1143 
58 5ZJU SER w 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1144 
58 5ZJU HIS w 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1145 
58 5ZJU HIS w 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1146 
58 5ZJU HIS w 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1147 
58 5ZJU HIS w 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1148 
58 5ZJU HIS w 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1149 
58 5ZJU HIS w 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1150 
58 5ZJU SER w 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1151 
58 5ZJU SER w 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1152 
58 5ZJU GLY w 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1153 
58 5ZJU LEU w 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1154 
58 5ZJU VAL w 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1155 
58 5ZJU PRO w 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1156 
58 5ZJU ARG w 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1157 
58 5ZJU GLY w 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1158 
58 5ZJU SER w 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1159 
58 5ZJU HIS w 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1160 
59 5ZJU MET x 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1161 
59 5ZJU GLY x 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1162 
59 5ZJU SER x 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1163 
59 5ZJU SER x 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1164 
59 5ZJU HIS x 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1165 
59 5ZJU HIS x 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1166 
59 5ZJU HIS x 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1167 
59 5ZJU HIS x 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1168 
59 5ZJU HIS x 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1169 
59 5ZJU HIS x 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1170 
59 5ZJU SER x 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1171 
59 5ZJU SER x 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1172 
59 5ZJU GLY x 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1173 
59 5ZJU LEU x 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1174 
59 5ZJU VAL x 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1175 
59 5ZJU PRO x 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1176 
59 5ZJU ARG x 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1177 
59 5ZJU GLY x 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1178 
59 5ZJU SER x 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1179 
59 5ZJU HIS x 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1180 
60 5ZJU MET y 1  ? UNP G0Y2B2 ? ? 'expression tag' 25 1181 
60 5ZJU GLY y 2  ? UNP G0Y2B2 ? ? 'expression tag' 26 1182 
60 5ZJU SER y 3  ? UNP G0Y2B2 ? ? 'expression tag' 27 1183 
60 5ZJU SER y 4  ? UNP G0Y2B2 ? ? 'expression tag' 28 1184 
60 5ZJU HIS y 5  ? UNP G0Y2B2 ? ? 'expression tag' 29 1185 
60 5ZJU HIS y 6  ? UNP G0Y2B2 ? ? 'expression tag' 30 1186 
60 5ZJU HIS y 7  ? UNP G0Y2B2 ? ? 'expression tag' 31 1187 
60 5ZJU HIS y 8  ? UNP G0Y2B2 ? ? 'expression tag' 32 1188 
60 5ZJU HIS y 9  ? UNP G0Y2B2 ? ? 'expression tag' 33 1189 
60 5ZJU HIS y 10 ? UNP G0Y2B2 ? ? 'expression tag' 34 1190 
60 5ZJU SER y 11 ? UNP G0Y2B2 ? ? 'expression tag' 35 1191 
60 5ZJU SER y 12 ? UNP G0Y2B2 ? ? 'expression tag' 36 1192 
60 5ZJU GLY y 13 ? UNP G0Y2B2 ? ? 'expression tag' 37 1193 
60 5ZJU LEU y 14 ? UNP G0Y2B2 ? ? 'expression tag' 38 1194 
60 5ZJU VAL y 15 ? UNP G0Y2B2 ? ? 'expression tag' 39 1195 
60 5ZJU PRO y 16 ? UNP G0Y2B2 ? ? 'expression tag' 40 1196 
60 5ZJU ARG y 17 ? UNP G0Y2B2 ? ? 'expression tag' 41 1197 
60 5ZJU GLY y 18 ? UNP G0Y2B2 ? ? 'expression tag' 42 1198 
60 5ZJU SER y 19 ? UNP G0Y2B2 ? ? 'expression tag' 43 1199 
60 5ZJU HIS y 20 ? UNP G0Y2B2 ? ? 'expression tag' 44 1200 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZJU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.13 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.71 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Ammonium sulfate, Citrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR CCD 165 mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-03-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL17A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17A 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ZJU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       432268 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.80 
_reflns_shell.d_res_low                   2.85 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.31 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            1.96 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.92 
_refine.aniso_B[2][2]                            -0.71 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -1.23 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               42.029 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ZJU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             50 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     410467 
_refine.ls_number_reflns_R_free                  21255 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.05 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.16570 
_refine.ls_R_factor_R_free                       0.22408 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.16267 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3r0r 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       1.035 
_refine.pdbx_overall_ESU_R_Free                  0.312 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             26.017 
_refine.overall_SU_ML                            0.223 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        92840 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             4846 
_refine_hist.number_atoms_total               97686 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.019  0.020  95720  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  84410  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 2.028  1.931  130310 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.130  3.000  195610 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 9.074  5.000  11230  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 36.052 22.683 4920   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 19.990 15.000 14840  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 13.991 15.000 840    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.113  0.200  13700  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.021  106510 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  22090  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.513  3.544  45100  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.513  3.544  45099  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 4.244  5.305  56270  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.244  5.305  56271  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.529  3.712  50620  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.529  3.712  50621  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.171  5.473  74041  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.996  38.971 104407 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 6.943  39.023 103445 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.802 
_refine_ls_shell.d_res_low                        2.875 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             1465 
_refine_ls_shell.number_reflns_R_work             29533 
_refine_ls_shell.percent_reflns_obs               96.50 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.246 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5ZJU 
_struct.title                        'Crystal structure of in vitro expressed and assembled PCV2 Virus-like Particle' 
_struct.pdbx_descriptor              'Capsid protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZJU 
_struct_keywords.text            'PCV2 capsid protein, VIRUS' 
_struct_keywords.pdbx_keywords   VIRUS 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 1 ? 
DA N N 1 ? 
EA N N 1 ? 
FA N N 1 ? 
GA N N 1 ? 
HA N N 1 ? 
IA N N 1 ? 
JA N N 1 ? 
KA N N 1 ? 
LA N N 1 ? 
MA N N 1 ? 
NA N N 1 ? 
OA N N 1 ? 
PA N N 1 ? 
QA N N 1 ? 
RA N N 1 ? 
SA N N 1 ? 
TA N N 1 ? 
UA N N 1 ? 
VA N N 1 ? 
WA N N 1 ? 
XA N N 1 ? 
YA N N 1 ? 
ZA N N 1 ? 
AB N N 1 ? 
BB N N 1 ? 
CB N N 1 ? 
DB N N 1 ? 
EB N N 1 ? 
FB N N 1 ? 
GB N N 1 ? 
HB N N 1 ? 
IB N N 2 ? 
JB N N 2 ? 
KB N N 2 ? 
LB N N 2 ? 
MB N N 2 ? 
NB N N 2 ? 
OB N N 2 ? 
PB N N 2 ? 
QB N N 2 ? 
RB N N 2 ? 
SB N N 2 ? 
TB N N 2 ? 
UB N N 2 ? 
VB N N 2 ? 
WB N N 2 ? 
XB N N 2 ? 
YB N N 2 ? 
ZB N N 2 ? 
AC N N 2 ? 
BC N N 2 ? 
CC N N 2 ? 
DC N N 2 ? 
EC N N 2 ? 
FC N N 2 ? 
GC N N 2 ? 
HC N N 2 ? 
IC N N 2 ? 
JC N N 2 ? 
KC N N 2 ? 
LC N N 2 ? 
MC N N 2 ? 
NC N N 2 ? 
OC N N 2 ? 
PC N N 2 ? 
QC N N 2 ? 
RC N N 2 ? 
SC N N 2 ? 
TC N N 2 ? 
UC N N 2 ? 
VC N N 2 ? 
WC N N 2 ? 
XC N N 2 ? 
YC N N 2 ? 
ZC N N 2 ? 
AD N N 2 ? 
BD N N 2 ? 
CD N N 2 ? 
DD N N 2 ? 
ED N N 2 ? 
FD N N 2 ? 
GD N N 2 ? 
HD N N 2 ? 
ID N N 2 ? 
JD N N 2 ? 
KD N N 2 ? 
LD N N 2 ? 
MD N N 2 ? 
ND N N 2 ? 
OD N N 2 ? 
PD N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A  51  ? PHE A  55  ? ASN A 75  PHE A 79  5 ? 5 
HELX_P HELX_P2  AA2 ASN B  51  ? PHE B  55  ? ASN B 75  PHE B 79  5 ? 5 
HELX_P HELX_P3  AA3 ASN C  51  ? PHE C  55  ? ASN C 75  PHE C 79  5 ? 5 
HELX_P HELX_P4  AA4 ASN D  51  ? PHE D  55  ? ASN D 75  PHE D 79  5 ? 5 
HELX_P HELX_P5  AA5 ASN E  51  ? PHE E  55  ? ASN E 75  PHE E 79  5 ? 5 
HELX_P HELX_P6  AA6 ASN F  51  ? PHE F  55  ? ASN F 75  PHE F 79  5 ? 5 
HELX_P HELX_P7  AA7 ASN F  154 ? GLN F  158 ? ASN F 178 GLN F 182 5 ? 5 
HELX_P HELX_P8  AA8 ASN G  53  ? PHE G  55  ? ASN G 77  PHE G 79  5 ? 3 
HELX_P HELX_P9  AA9 ASN H  51  ? PHE H  55  ? ASN H 75  PHE H 79  5 ? 5 
HELX_P HELX_P10 AB1 ASN I  51  ? PHE I  55  ? ASN I 75  PHE I 79  5 ? 5 
HELX_P HELX_P11 AB2 ASN J  51  ? PHE J  55  ? ASN J 75  PHE J 79  5 ? 5 
HELX_P HELX_P12 AB3 ASN K  51  ? PHE K  55  ? ASN K 75  PHE K 79  5 ? 5 
HELX_P HELX_P13 AB4 ASN L  51  ? PHE L  55  ? ASN L 75  PHE L 79  5 ? 5 
HELX_P HELX_P14 AB5 ASN M  51  ? PHE M  55  ? ASN M 75  PHE M 79  5 ? 5 
HELX_P HELX_P15 AB6 ASN N  51  ? PHE N  55  ? ASN N 75  PHE N 79  5 ? 5 
HELX_P HELX_P16 AB7 ASN O  51  ? PHE O  55  ? ASN O 75  PHE O 79  5 ? 5 
HELX_P HELX_P17 AB8 ASN P  51  ? PHE P  55  ? ASN P 75  PHE P 79  5 ? 5 
HELX_P HELX_P18 AB9 ASN Q  51  ? PHE Q  55  ? ASN Q 75  PHE Q 79  5 ? 5 
HELX_P HELX_P19 AC1 ASN R  51  ? PHE R  55  ? ASN R 75  PHE R 79  5 ? 5 
HELX_P HELX_P20 AC2 ASN S  51  ? PHE S  55  ? ASN S 75  PHE S 79  5 ? 5 
HELX_P HELX_P21 AC3 ASN T  51  ? PHE T  55  ? ASN T 75  PHE T 79  5 ? 5 
HELX_P HELX_P22 AC4 ASN U  51  ? PHE U  55  ? ASN U 75  PHE U 79  5 ? 5 
HELX_P HELX_P23 AC5 ASN V  51  ? PHE V  55  ? ASN V 75  PHE V 79  5 ? 5 
HELX_P HELX_P24 AC6 ASN W  51  ? PHE W  55  ? ASN W 75  PHE W 79  5 ? 5 
HELX_P HELX_P25 AC7 ASN X  51  ? PHE X  55  ? ASN X 75  PHE X 79  5 ? 5 
HELX_P HELX_P26 AC8 ASN Y  51  ? PHE Y  55  ? ASN Y 75  PHE Y 79  5 ? 5 
HELX_P HELX_P27 AC9 ASN Z  51  ? PHE Z  55  ? ASN Z 75  PHE Z 79  5 ? 5 
HELX_P HELX_P28 AD1 ASN AA 51  ? PHE AA 55  ? ASN 1 75  PHE 1 79  5 ? 5 
HELX_P HELX_P29 AD2 ASN BA 51  ? PHE BA 55  ? ASN 2 75  PHE 2 79  5 ? 5 
HELX_P HELX_P30 AD3 ASN CA 51  ? PHE CA 55  ? ASN 3 75  PHE 3 79  5 ? 5 
HELX_P HELX_P31 AD4 ASN DA 51  ? PHE DA 55  ? ASN 4 75  PHE 4 79  5 ? 5 
HELX_P HELX_P32 AD5 ASN EA 51  ? PHE EA 55  ? ASN 5 75  PHE 5 79  5 ? 5 
HELX_P HELX_P33 AD6 ASN FA 51  ? PHE FA 55  ? ASN 6 75  PHE 6 79  5 ? 5 
HELX_P HELX_P34 AD7 ASN GA 51  ? PHE GA 55  ? ASN 7 75  PHE 7 79  5 ? 5 
HELX_P HELX_P35 AD8 ASN HA 51  ? PHE HA 55  ? ASN 8 75  PHE 8 79  5 ? 5 
HELX_P HELX_P36 AD9 ASN IA 51  ? PHE IA 55  ? ASN 9 75  PHE 9 79  5 ? 5 
HELX_P HELX_P37 AE1 ASN JA 51  ? PHE JA 55  ? ASN a 75  PHE a 79  5 ? 5 
HELX_P HELX_P38 AE2 ASN KA 51  ? PHE KA 55  ? ASN b 75  PHE b 79  5 ? 5 
HELX_P HELX_P39 AE3 ASN LA 51  ? PHE LA 55  ? ASN c 75  PHE c 79  5 ? 5 
HELX_P HELX_P40 AE4 ASN MA 51  ? PHE MA 55  ? ASN d 75  PHE d 79  5 ? 5 
HELX_P HELX_P41 AE5 ASN NA 51  ? PHE NA 55  ? ASN e 75  PHE e 79  5 ? 5 
HELX_P HELX_P42 AE6 ASN OA 51  ? LEU OA 56  ? ASN f 75  LEU f 80  5 ? 6 
HELX_P HELX_P43 AE7 ASN PA 51  ? PHE PA 55  ? ASN g 75  PHE g 79  5 ? 5 
HELX_P HELX_P44 AE8 ASN QA 51  ? PHE QA 55  ? ASN h 75  PHE h 79  5 ? 5 
HELX_P HELX_P45 AE9 ASN RA 51  ? PHE RA 55  ? ASN i 75  PHE i 79  5 ? 5 
HELX_P HELX_P46 AF1 ASN SA 51  ? PHE SA 55  ? ASN j 75  PHE j 79  5 ? 5 
HELX_P HELX_P47 AF2 ASN TA 51  ? PHE TA 55  ? ASN k 75  PHE k 79  5 ? 5 
HELX_P HELX_P48 AF3 ASN UA 51  ? PHE UA 55  ? ASN l 75  PHE l 79  5 ? 5 
HELX_P HELX_P49 AF4 ASN VA 51  ? PHE VA 55  ? ASN m 75  PHE m 79  5 ? 5 
HELX_P HELX_P50 AF5 ASN WA 51  ? PHE WA 55  ? ASN n 75  PHE n 79  5 ? 5 
HELX_P HELX_P51 AF6 ASN XA 51  ? PHE XA 55  ? ASN o 75  PHE o 79  5 ? 5 
HELX_P HELX_P52 AF7 ASN YA 51  ? PHE YA 55  ? ASN p 75  PHE p 79  5 ? 5 
HELX_P HELX_P53 AF8 ASN ZA 51  ? PHE ZA 55  ? ASN q 75  PHE q 79  5 ? 5 
HELX_P HELX_P54 AF9 ASN AB 53  ? PHE AB 55  ? ASN r 77  PHE r 79  5 ? 3 
HELX_P HELX_P55 AG1 ASN BB 51  ? PHE BB 55  ? ASN s 75  PHE s 79  5 ? 5 
HELX_P HELX_P56 AG2 ASN CB 51  ? PHE CB 55  ? ASN t 75  PHE t 79  5 ? 5 
HELX_P HELX_P57 AG3 ASN DB 53  ? PHE DB 55  ? ASN u 77  PHE u 79  5 ? 3 
HELX_P HELX_P58 AG4 ASN EB 51  ? PHE EB 55  ? ASN v 75  PHE v 79  5 ? 5 
HELX_P HELX_P59 AG5 ASN FB 51  ? PHE FB 55  ? ASN w 75  PHE w 79  5 ? 5 
HELX_P HELX_P60 AG6 ASN GB 51  ? PHE GB 55  ? ASN x 75  PHE x 79  5 ? 5 
HELX_P HELX_P61 AG7 ASN HB 51  ? PHE HB 55  ? ASN y 75  PHE y 79  5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 128 A  . ? GLN 152 A PRO 129 A  ? PRO 153 A 1 -2.33 
2  GLN 128 B  . ? GLN 152 B PRO 129 B  ? PRO 153 B 1 3.44  
3  GLN 128 C  . ? GLN 152 C PRO 129 C  ? PRO 153 C 1 4.59  
4  GLN 128 D  . ? GLN 152 D PRO 129 D  ? PRO 153 D 1 2.83  
5  GLN 128 E  . ? GLN 152 E PRO 129 E  ? PRO 153 E 1 8.36  
6  GLN 128 F  . ? GLN 152 F PRO 129 F  ? PRO 153 F 1 1.04  
7  GLN 128 G  . ? GLN 152 G PRO 129 G  ? PRO 153 G 1 5.40  
8  GLN 128 H  . ? GLN 152 H PRO 129 H  ? PRO 153 H 1 4.37  
9  GLN 128 I  . ? GLN 152 I PRO 129 I  ? PRO 153 I 1 11.90 
10 GLN 128 J  . ? GLN 152 J PRO 129 J  ? PRO 153 J 1 5.62  
11 GLN 128 K  . ? GLN 152 K PRO 129 K  ? PRO 153 K 1 8.25  
12 GLN 128 L  . ? GLN 152 L PRO 129 L  ? PRO 153 L 1 1.03  
13 GLN 128 M  . ? GLN 152 M PRO 129 M  ? PRO 153 M 1 1.19  
14 GLN 128 N  . ? GLN 152 N PRO 129 N  ? PRO 153 N 1 6.27  
15 GLN 128 O  . ? GLN 152 O PRO 129 O  ? PRO 153 O 1 4.53  
16 GLN 128 P  . ? GLN 152 P PRO 129 P  ? PRO 153 P 1 5.79  
17 GLN 128 Q  . ? GLN 152 Q PRO 129 Q  ? PRO 153 Q 1 6.97  
18 GLN 128 R  . ? GLN 152 R PRO 129 R  ? PRO 153 R 1 7.75  
19 GLN 128 S  . ? GLN 152 S PRO 129 S  ? PRO 153 S 1 6.47  
20 GLN 128 T  . ? GLN 152 T PRO 129 T  ? PRO 153 T 1 2.28  
21 GLN 128 U  . ? GLN 152 U PRO 129 U  ? PRO 153 U 1 11.67 
22 GLN 128 V  . ? GLN 152 V PRO 129 V  ? PRO 153 V 1 -0.30 
23 GLN 128 W  . ? GLN 152 W PRO 129 W  ? PRO 153 W 1 13.63 
24 GLN 128 X  . ? GLN 152 X PRO 129 X  ? PRO 153 X 1 8.25  
25 GLN 128 Y  . ? GLN 152 Y PRO 129 Y  ? PRO 153 Y 1 5.42  
26 GLN 128 Z  . ? GLN 152 Z PRO 129 Z  ? PRO 153 Z 1 9.87  
27 GLN 128 AA . ? GLN 152 1 PRO 129 AA ? PRO 153 1 1 2.32  
28 GLN 128 BA . ? GLN 152 2 PRO 129 BA ? PRO 153 2 1 9.07  
29 GLN 128 CA . ? GLN 152 3 PRO 129 CA ? PRO 153 3 1 6.10  
30 GLN 128 DA . ? GLN 152 4 PRO 129 DA ? PRO 153 4 1 13.61 
31 GLN 128 EA . ? GLN 152 5 PRO 129 EA ? PRO 153 5 1 8.58  
32 GLN 128 FA . ? GLN 152 6 PRO 129 FA ? PRO 153 6 1 2.94  
33 GLN 128 GA . ? GLN 152 7 PRO 129 GA ? PRO 153 7 1 6.16  
34 GLN 128 HA . ? GLN 152 8 PRO 129 HA ? PRO 153 8 1 11.56 
35 GLN 128 IA . ? GLN 152 9 PRO 129 IA ? PRO 153 9 1 3.59  
36 GLN 128 JA . ? GLN 152 a PRO 129 JA ? PRO 153 a 1 6.85  
37 GLN 128 KA . ? GLN 152 b PRO 129 KA ? PRO 153 b 1 2.66  
38 GLN 128 LA . ? GLN 152 c PRO 129 LA ? PRO 153 c 1 6.93  
39 GLN 128 MA . ? GLN 152 d PRO 129 MA ? PRO 153 d 1 -1.53 
40 GLN 128 NA . ? GLN 152 e PRO 129 NA ? PRO 153 e 1 4.82  
41 GLN 128 OA . ? GLN 152 f PRO 129 OA ? PRO 153 f 1 16.95 
42 GLN 128 PA . ? GLN 152 g PRO 129 PA ? PRO 153 g 1 5.50  
43 GLN 128 QA . ? GLN 152 h PRO 129 QA ? PRO 153 h 1 7.91  
44 GLN 128 RA . ? GLN 152 i PRO 129 RA ? PRO 153 i 1 5.86  
45 GLN 128 SA . ? GLN 152 j PRO 129 SA ? PRO 153 j 1 8.21  
46 GLN 128 TA . ? GLN 152 k PRO 129 TA ? PRO 153 k 1 15.41 
47 GLN 128 UA . ? GLN 152 l PRO 129 UA ? PRO 153 l 1 5.37  
48 GLN 128 VA . ? GLN 152 m PRO 129 VA ? PRO 153 m 1 4.63  
49 GLN 128 WA . ? GLN 152 n PRO 129 WA ? PRO 153 n 1 8.76  
50 GLN 128 XA . ? GLN 152 o PRO 129 XA ? PRO 153 o 1 9.93  
51 GLN 128 YA . ? GLN 152 p PRO 129 YA ? PRO 153 p 1 1.68  
52 GLN 128 ZA . ? GLN 152 q PRO 129 ZA ? PRO 153 q 1 -1.78 
53 GLN 128 AB . ? GLN 152 r PRO 129 AB ? PRO 153 r 1 9.07  
54 GLN 128 BB . ? GLN 152 s PRO 129 BB ? PRO 153 s 1 6.97  
55 GLN 128 CB . ? GLN 152 t PRO 129 CB ? PRO 153 t 1 2.91  
56 GLN 128 DB . ? GLN 152 u PRO 129 DB ? PRO 153 u 1 0.11  
57 GLN 128 EB . ? GLN 152 v PRO 129 EB ? PRO 153 v 1 3.00  
58 GLN 128 FB . ? GLN 152 w PRO 129 FB ? PRO 153 w 1 4.55  
59 GLN 128 GB . ? GLN 152 x PRO 129 GB ? PRO 153 x 1 5.57  
60 GLN 128 HB . ? GLN 152 y PRO 129 HB ? PRO 153 y 1 16.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 5 ? 
AB1 ? 5 ? 
AB2 ? 4 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 5 ? 
AB6 ? 5 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 5 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 5 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 5 ? 
AC9 ? 5 ? 
AD1 ? 4 ? 
AD2 ? 2 ? 
AD3 ? 5 ? 
AD4 ? 4 ? 
AD5 ? 5 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 4 ? 
AD9 ? 5 ? 
AE1 ? 5 ? 
AE2 ? 4 ? 
AE3 ? 4 ? 
AE4 ? 4 ? 
AE5 ? 5 ? 
AE6 ? 3 ? 
AE7 ? 5 ? 
AE8 ? 4 ? 
AE9 ? 4 ? 
AF1 ? 4 ? 
AF2 ? 5 ? 
AF3 ? 4 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 5 ? 
AF7 ? 5 ? 
AF8 ? 4 ? 
AF9 ? 2 ? 
AG1 ? 5 ? 
AG2 ? 4 ? 
AG3 ? 4 ? 
AG4 ? 5 ? 
AG5 ? 5 ? 
AG6 ? 4 ? 
AG7 ? 4 ? 
AG8 ? 4 ? 
AG9 ? 5 ? 
AH1 ? 4 ? 
AH2 ? 2 ? 
AH3 ? 5 ? 
AH4 ? 4 ? 
AH5 ? 2 ? 
AH6 ? 4 ? 
AH7 ? 5 ? 
AH8 ? 5 ? 
AH9 ? 4 ? 
AI1 ? 2 ? 
AI2 ? 5 ? 
AI3 ? 4 ? 
AI4 ? 4 ? 
AI5 ? 4 ? 
AI6 ? 5 ? 
AI7 ? 4 ? 
AI8 ? 2 ? 
AI9 ? 4 ? 
AJ1 ? 4 ? 
AJ2 ? 5 ? 
AJ3 ? 4 ? 
AJ4 ? 5 ? 
AJ5 ? 4 ? 
AJ6 ? 4 ? 
AJ7 ? 5 ? 
AJ8 ? 5 ? 
AJ9 ? 4 ? 
AK1 ? 5 ? 
AK2 ? 4 ? 
AK3 ? 5 ? 
AK4 ? 4 ? 
AK5 ? 2 ? 
AK6 ? 4 ? 
AK7 ? 5 ? 
AK8 ? 5 ? 
AK9 ? 4 ? 
AL1 ? 2 ? 
AL2 ? 5 ? 
AL3 ? 4 ? 
AL4 ? 5 ? 
AL5 ? 3 ? 
AL6 ? 2 ? 
AL7 ? 4 ? 
AL8 ? 5 ? 
AL9 ? 5 ? 
AM1 ? 4 ? 
AM2 ? 2 ? 
AM3 ? 5 ? 
AM4 ? 4 ? 
AM5 ? 4 ? 
AM6 ? 5 ? 
AM7 ? 5 ? 
AM8 ? 4 ? 
AM9 ? 2 ? 
AN1 ? 4 ? 
AN2 ? 5 ? 
AN3 ? 5 ? 
AN4 ? 4 ? 
AN5 ? 2 ? 
AN6 ? 5 ? 
AN7 ? 4 ? 
AN8 ? 5 ? 
AN9 ? 4 ? 
AO1 ? 4 ? 
AO2 ? 5 ? 
AO3 ? 5 ? 
AO4 ? 4 ? 
AO5 ? 2 ? 
AO6 ? 4 ? 
AO7 ? 4 ? 
AO8 ? 5 ? 
AO9 ? 4 ? 
AP1 ? 2 ? 
AP2 ? 4 ? 
AP3 ? 5 ? 
AP4 ? 5 ? 
AP5 ? 3 ? 
AP6 ? 2 ? 
AP7 ? 5 ? 
AP8 ? 4 ? 
AP9 ? 4 ? 
AQ1 ? 5 ? 
AQ2 ? 5 ? 
AQ3 ? 4 ? 
AQ4 ? 2 ? 
AQ5 ? 5 ? 
AQ6 ? 4 ? 
AQ7 ? 2 ? 
AQ8 ? 5 ? 
AQ9 ? 4 ? 
AR1 ? 5 ? 
AR2 ? 4 ? 
AR3 ? 4 ? 
AR4 ? 5 ? 
AR5 ? 5 ? 
AR6 ? 4 ? 
AR7 ? 2 ? 
AR8 ? 5 ? 
AR9 ? 4 ? 
AS1 ? 4 ? 
AS2 ? 5 ? 
AS3 ? 5 ? 
AS4 ? 4 ? 
AS5 ? 2 ? 
AS6 ? 5 ? 
AS7 ? 4 ? 
AS8 ? 5 ? 
AS9 ? 4 ? 
AT1 ? 2 ? 
AT2 ? 4 ? 
AT3 ? 4 ? 
AT4 ? 5 ? 
AT5 ? 4 ? 
AT6 ? 2 ? 
AT7 ? 4 ? 
AT8 ? 5 ? 
AT9 ? 5 ? 
AU1 ? 4 ? 
AU2 ? 2 ? 
AU3 ? 5 ? 
AU4 ? 4 ? 
AU5 ? 4 ? 
AU6 ? 5 ? 
AU7 ? 5 ? 
AU8 ? 3 ? 
AU9 ? 2 ? 
AV1 ? 5 ? 
AV2 ? 4 ? 
AV3 ? 4 ? 
AV4 ? 4 ? 
AV5 ? 5 ? 
AV6 ? 4 ? 
AV7 ? 4 ? 
AV8 ? 4 ? 
AV9 ? 5 ? 
AW1 ? 4 ? 
AW2 ? 5 ? 
AW3 ? 4 ? 
AW4 ? 4 ? 
AW5 ? 5 ? 
AW6 ? 5 ? 
AW7 ? 4 ? 
AW8 ? 2 ? 
AW9 ? 5 ? 
AX1 ? 4 ? 
AX2 ? 5 ? 
AX3 ? 3 ? 
AX4 ? 2 ? 
AX5 ? 5 ? 
AX6 ? 4 ? 
AX7 ? 2 ? 
AX8 ? 5 ? 
AX9 ? 4 ? 
AY1 ? 4 ? 
AY2 ? 5 ? 
AY3 ? 5 ? 
AY4 ? 4 ? 
AY5 ? 2 ? 
AY6 ? 5 ? 
AY7 ? 4 ? 
AY8 ? 2 ? 
AY9 ? 5 ? 
AZ1 ? 4 ? 
AZ2 ? 2 ? 
AZ3 ? 5 ? 
AZ4 ? 4 ? 
AZ5 ? 5 ? 
AZ6 ? 4 ? 
AZ7 ? 2 ? 
AZ8 ? 4 ? 
AZ9 ? 5 ? 
BA1 ? 5 ? 
BA2 ? 4 ? 
BA3 ? 2 ? 
BA4 ? 5 ? 
BA5 ? 4 ? 
BA6 ? 5 ? 
BA7 ? 4 ? 
BA8 ? 2 ? 
BA9 ? 5 ? 
BB1 ? 4 ? 
BB2 ? 4 ? 
BB3 ? 5 ? 
BB4 ? 5 ? 
BB5 ? 4 ? 
BB6 ? 2 ? 
BB7 ? 4 ? 
BB8 ? 5 ? 
BB9 ? 5 ? 
BC1 ? 4 ? 
BC2 ? 2 ? 
BC3 ? 5 ? 
BC4 ? 4 ? 
BC5 ? 2 ? 
BC6 ? 4 ? 
BC7 ? 5 ? 
BC8 ? 5 ? 
BC9 ? 4 ? 
BD1 ? 5 ? 
BD2 ? 4 ? 
BD3 ? 2 ? 
BD4 ? 4 ? 
BD5 ? 5 ? 
BD6 ? 5 ? 
BD7 ? 4 ? 
BD8 ? 2 ? 
BD9 ? 5 ? 
BE1 ? 4 ? 
BE2 ? 5 ? 
BE3 ? 4 ? 
BE4 ? 2 ? 
BE5 ? 5 ? 
BE6 ? 4 ? 
BE7 ? 2 ? 
BE8 ? 5 ? 
BE9 ? 4 ? 
BF1 ? 2 ? 
BF2 ? 5 ? 
BF3 ? 4 ? 
BF4 ? 5 ? 
BF5 ? 4 ? 
BF6 ? 2 ? 
BF7 ? 5 ? 
BF8 ? 4 ? 
BF9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD5 4 5 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AD9 4 5 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE7 4 5 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF6 4 5 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF7 4 5 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG1 4 5 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG2 3 4 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG3 2 3 ? anti-parallel 
AG3 3 4 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG4 3 4 ? anti-parallel 
AG4 4 5 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG5 4 5 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG7 3 4 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? anti-parallel 
AG8 3 4 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AG9 2 3 ? anti-parallel 
AG9 3 4 ? anti-parallel 
AG9 4 5 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH1 2 3 ? anti-parallel 
AH1 3 4 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH3 3 4 ? anti-parallel 
AH3 4 5 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? anti-parallel 
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH6 2 3 ? anti-parallel 
AH6 3 4 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH7 3 4 ? anti-parallel 
AH7 4 5 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? anti-parallel 
AH8 4 5 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AH9 2 3 ? anti-parallel 
AH9 3 4 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI2 4 5 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI3 2 3 ? anti-parallel 
AI3 3 4 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI4 2 3 ? anti-parallel 
AI4 3 4 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI6 4 5 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI7 3 4 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AJ1 1 2 ? anti-parallel 
AJ1 2 3 ? anti-parallel 
AJ1 3 4 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ2 4 5 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ3 2 3 ? anti-parallel 
AJ3 3 4 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ4 3 4 ? anti-parallel 
AJ4 4 5 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ5 2 3 ? anti-parallel 
AJ5 3 4 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ7 4 5 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
AJ8 3 4 ? anti-parallel 
AJ8 4 5 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AJ9 3 4 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK1 3 4 ? anti-parallel 
AK1 4 5 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK3 3 4 ? anti-parallel 
AK3 4 5 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK6 1 2 ? anti-parallel 
AK6 2 3 ? anti-parallel 
AK6 3 4 ? anti-parallel 
AK7 1 2 ? anti-parallel 
AK7 2 3 ? anti-parallel 
AK7 3 4 ? anti-parallel 
AK7 4 5 ? anti-parallel 
AK8 1 2 ? anti-parallel 
AK8 2 3 ? anti-parallel 
AK8 3 4 ? anti-parallel 
AK8 4 5 ? anti-parallel 
AK9 1 2 ? anti-parallel 
AK9 2 3 ? anti-parallel 
AK9 3 4 ? anti-parallel 
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL2 2 3 ? anti-parallel 
AL2 3 4 ? anti-parallel 
AL2 4 5 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL3 2 3 ? anti-parallel 
AL3 3 4 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL4 3 4 ? anti-parallel 
AL4 4 5 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL6 1 2 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL7 2 3 ? anti-parallel 
AL7 3 4 ? anti-parallel 
AL8 1 2 ? anti-parallel 
AL8 2 3 ? anti-parallel 
AL8 3 4 ? anti-parallel 
AL8 4 5 ? anti-parallel 
AL9 1 2 ? anti-parallel 
AL9 2 3 ? anti-parallel 
AL9 3 4 ? anti-parallel 
AL9 4 5 ? anti-parallel 
AM1 1 2 ? anti-parallel 
AM1 2 3 ? anti-parallel 
AM1 3 4 ? anti-parallel 
AM2 1 2 ? anti-parallel 
AM3 1 2 ? anti-parallel 
AM3 2 3 ? anti-parallel 
AM3 3 4 ? anti-parallel 
AM3 4 5 ? anti-parallel 
AM4 1 2 ? anti-parallel 
AM4 2 3 ? anti-parallel 
AM4 3 4 ? anti-parallel 
AM5 1 2 ? anti-parallel 
AM5 2 3 ? anti-parallel 
AM5 3 4 ? anti-parallel 
AM6 1 2 ? anti-parallel 
AM6 2 3 ? anti-parallel 
AM6 3 4 ? anti-parallel 
AM6 4 5 ? anti-parallel 
AM7 1 2 ? anti-parallel 
AM7 2 3 ? anti-parallel 
AM7 3 4 ? anti-parallel 
AM7 4 5 ? anti-parallel 
AM8 1 2 ? anti-parallel 
AM8 2 3 ? anti-parallel 
AM8 3 4 ? anti-parallel 
AM9 1 2 ? anti-parallel 
AN1 1 2 ? anti-parallel 
AN1 2 3 ? anti-parallel 
AN1 3 4 ? anti-parallel 
AN2 1 2 ? anti-parallel 
AN2 2 3 ? anti-parallel 
AN2 3 4 ? anti-parallel 
AN2 4 5 ? anti-parallel 
AN3 1 2 ? anti-parallel 
AN3 2 3 ? anti-parallel 
AN3 3 4 ? anti-parallel 
AN3 4 5 ? anti-parallel 
AN4 1 2 ? anti-parallel 
AN4 2 3 ? anti-parallel 
AN4 3 4 ? anti-parallel 
AN5 1 2 ? anti-parallel 
AN6 1 2 ? anti-parallel 
AN6 2 3 ? anti-parallel 
AN6 3 4 ? anti-parallel 
AN6 4 5 ? anti-parallel 
AN7 1 2 ? anti-parallel 
AN7 2 3 ? anti-parallel 
AN7 3 4 ? anti-parallel 
AN8 1 2 ? anti-parallel 
AN8 2 3 ? anti-parallel 
AN8 3 4 ? anti-parallel 
AN8 4 5 ? anti-parallel 
AN9 1 2 ? anti-parallel 
AN9 2 3 ? anti-parallel 
AN9 3 4 ? anti-parallel 
AO1 1 2 ? anti-parallel 
AO1 2 3 ? anti-parallel 
AO1 3 4 ? anti-parallel 
AO2 1 2 ? anti-parallel 
AO2 2 3 ? anti-parallel 
AO2 3 4 ? anti-parallel 
AO2 4 5 ? anti-parallel 
AO3 1 2 ? anti-parallel 
AO3 2 3 ? anti-parallel 
AO3 3 4 ? anti-parallel 
AO3 4 5 ? anti-parallel 
AO4 1 2 ? anti-parallel 
AO4 2 3 ? anti-parallel 
AO4 3 4 ? anti-parallel 
AO5 1 2 ? anti-parallel 
AO6 1 2 ? anti-parallel 
AO6 2 3 ? anti-parallel 
AO6 3 4 ? anti-parallel 
AO7 1 2 ? anti-parallel 
AO7 2 3 ? anti-parallel 
AO7 3 4 ? anti-parallel 
AO8 1 2 ? anti-parallel 
AO8 2 3 ? anti-parallel 
AO8 3 4 ? anti-parallel 
AO8 4 5 ? anti-parallel 
AO9 1 2 ? anti-parallel 
AO9 2 3 ? anti-parallel 
AO9 3 4 ? anti-parallel 
AP1 1 2 ? anti-parallel 
AP2 1 2 ? anti-parallel 
AP2 2 3 ? anti-parallel 
AP2 3 4 ? anti-parallel 
AP3 1 2 ? anti-parallel 
AP3 2 3 ? anti-parallel 
AP3 3 4 ? anti-parallel 
AP3 4 5 ? anti-parallel 
AP4 1 2 ? anti-parallel 
AP4 2 3 ? anti-parallel 
AP4 3 4 ? anti-parallel 
AP4 4 5 ? anti-parallel 
AP5 1 2 ? anti-parallel 
AP5 2 3 ? anti-parallel 
AP6 1 2 ? anti-parallel 
AP7 1 2 ? anti-parallel 
AP7 2 3 ? anti-parallel 
AP7 3 4 ? anti-parallel 
AP7 4 5 ? anti-parallel 
AP8 1 2 ? anti-parallel 
AP8 2 3 ? anti-parallel 
AP8 3 4 ? anti-parallel 
AP9 1 2 ? anti-parallel 
AP9 2 3 ? anti-parallel 
AP9 3 4 ? anti-parallel 
AQ1 1 2 ? anti-parallel 
AQ1 2 3 ? anti-parallel 
AQ1 3 4 ? anti-parallel 
AQ1 4 5 ? anti-parallel 
AQ2 1 2 ? anti-parallel 
AQ2 2 3 ? anti-parallel 
AQ2 3 4 ? anti-parallel 
AQ2 4 5 ? anti-parallel 
AQ3 1 2 ? anti-parallel 
AQ3 2 3 ? anti-parallel 
AQ3 3 4 ? anti-parallel 
AQ4 1 2 ? anti-parallel 
AQ5 1 2 ? anti-parallel 
AQ5 2 3 ? anti-parallel 
AQ5 3 4 ? anti-parallel 
AQ5 4 5 ? anti-parallel 
AQ6 1 2 ? anti-parallel 
AQ6 2 3 ? anti-parallel 
AQ6 3 4 ? anti-parallel 
AQ7 1 2 ? anti-parallel 
AQ8 1 2 ? anti-parallel 
AQ8 2 3 ? anti-parallel 
AQ8 3 4 ? anti-parallel 
AQ8 4 5 ? anti-parallel 
AQ9 1 2 ? anti-parallel 
AQ9 2 3 ? anti-parallel 
AQ9 3 4 ? anti-parallel 
AR1 1 2 ? anti-parallel 
AR1 2 3 ? anti-parallel 
AR1 3 4 ? anti-parallel 
AR1 4 5 ? anti-parallel 
AR2 1 2 ? anti-parallel 
AR2 2 3 ? anti-parallel 
AR2 3 4 ? anti-parallel 
AR3 1 2 ? anti-parallel 
AR3 2 3 ? anti-parallel 
AR3 3 4 ? anti-parallel 
AR4 1 2 ? anti-parallel 
AR4 2 3 ? anti-parallel 
AR4 3 4 ? anti-parallel 
AR4 4 5 ? anti-parallel 
AR5 1 2 ? anti-parallel 
AR5 2 3 ? anti-parallel 
AR5 3 4 ? anti-parallel 
AR5 4 5 ? anti-parallel 
AR6 1 2 ? anti-parallel 
AR6 2 3 ? anti-parallel 
AR6 3 4 ? anti-parallel 
AR7 1 2 ? anti-parallel 
AR8 1 2 ? anti-parallel 
AR8 2 3 ? anti-parallel 
AR8 3 4 ? anti-parallel 
AR8 4 5 ? anti-parallel 
AR9 1 2 ? anti-parallel 
AR9 2 3 ? anti-parallel 
AR9 3 4 ? anti-parallel 
AS1 1 2 ? anti-parallel 
AS1 2 3 ? anti-parallel 
AS1 3 4 ? anti-parallel 
AS2 1 2 ? anti-parallel 
AS2 2 3 ? anti-parallel 
AS2 3 4 ? anti-parallel 
AS2 4 5 ? anti-parallel 
AS3 1 2 ? anti-parallel 
AS3 2 3 ? anti-parallel 
AS3 3 4 ? anti-parallel 
AS3 4 5 ? anti-parallel 
AS4 1 2 ? anti-parallel 
AS4 2 3 ? anti-parallel 
AS4 3 4 ? anti-parallel 
AS5 1 2 ? anti-parallel 
AS6 1 2 ? anti-parallel 
AS6 2 3 ? anti-parallel 
AS6 3 4 ? anti-parallel 
AS6 4 5 ? anti-parallel 
AS7 1 2 ? anti-parallel 
AS7 2 3 ? anti-parallel 
AS7 3 4 ? anti-parallel 
AS8 1 2 ? anti-parallel 
AS8 2 3 ? anti-parallel 
AS8 3 4 ? anti-parallel 
AS8 4 5 ? anti-parallel 
AS9 1 2 ? anti-parallel 
AS9 2 3 ? anti-parallel 
AS9 3 4 ? anti-parallel 
AT1 1 2 ? anti-parallel 
AT2 1 2 ? anti-parallel 
AT2 2 3 ? anti-parallel 
AT2 3 4 ? anti-parallel 
AT3 1 2 ? anti-parallel 
AT3 2 3 ? anti-parallel 
AT3 3 4 ? anti-parallel 
AT4 1 2 ? anti-parallel 
AT4 2 3 ? anti-parallel 
AT4 3 4 ? anti-parallel 
AT4 4 5 ? anti-parallel 
AT5 1 2 ? anti-parallel 
AT5 2 3 ? anti-parallel 
AT5 3 4 ? anti-parallel 
AT6 1 2 ? anti-parallel 
AT7 1 2 ? anti-parallel 
AT7 2 3 ? anti-parallel 
AT7 3 4 ? anti-parallel 
AT8 1 2 ? anti-parallel 
AT8 2 3 ? anti-parallel 
AT8 3 4 ? anti-parallel 
AT8 4 5 ? anti-parallel 
AT9 1 2 ? anti-parallel 
AT9 2 3 ? anti-parallel 
AT9 3 4 ? anti-parallel 
AT9 4 5 ? anti-parallel 
AU1 1 2 ? anti-parallel 
AU1 2 3 ? anti-parallel 
AU1 3 4 ? anti-parallel 
AU2 1 2 ? anti-parallel 
AU3 1 2 ? anti-parallel 
AU3 2 3 ? anti-parallel 
AU3 3 4 ? anti-parallel 
AU3 4 5 ? anti-parallel 
AU4 1 2 ? anti-parallel 
AU4 2 3 ? anti-parallel 
AU4 3 4 ? anti-parallel 
AU5 1 2 ? anti-parallel 
AU5 2 3 ? anti-parallel 
AU5 3 4 ? anti-parallel 
AU6 1 2 ? anti-parallel 
AU6 2 3 ? anti-parallel 
AU6 3 4 ? anti-parallel 
AU6 4 5 ? anti-parallel 
AU7 1 2 ? anti-parallel 
AU7 2 3 ? anti-parallel 
AU7 3 4 ? anti-parallel 
AU7 4 5 ? anti-parallel 
AU8 1 2 ? anti-parallel 
AU8 2 3 ? anti-parallel 
AU9 1 2 ? anti-parallel 
AV1 1 2 ? anti-parallel 
AV1 2 3 ? anti-parallel 
AV1 3 4 ? anti-parallel 
AV1 4 5 ? anti-parallel 
AV2 1 2 ? anti-parallel 
AV2 2 3 ? anti-parallel 
AV2 3 4 ? anti-parallel 
AV3 1 2 ? anti-parallel 
AV3 2 3 ? anti-parallel 
AV3 3 4 ? anti-parallel 
AV4 1 2 ? anti-parallel 
AV4 2 3 ? anti-parallel 
AV4 3 4 ? anti-parallel 
AV5 1 2 ? anti-parallel 
AV5 2 3 ? anti-parallel 
AV5 3 4 ? anti-parallel 
AV5 4 5 ? anti-parallel 
AV6 1 2 ? anti-parallel 
AV6 2 3 ? anti-parallel 
AV6 3 4 ? anti-parallel 
AV7 1 2 ? anti-parallel 
AV7 2 3 ? anti-parallel 
AV7 3 4 ? anti-parallel 
AV8 1 2 ? anti-parallel 
AV8 2 3 ? anti-parallel 
AV8 3 4 ? anti-parallel 
AV9 1 2 ? anti-parallel 
AV9 2 3 ? anti-parallel 
AV9 3 4 ? anti-parallel 
AV9 4 5 ? anti-parallel 
AW1 1 2 ? anti-parallel 
AW1 2 3 ? anti-parallel 
AW1 3 4 ? anti-parallel 
AW2 1 2 ? anti-parallel 
AW2 2 3 ? anti-parallel 
AW2 3 4 ? anti-parallel 
AW2 4 5 ? anti-parallel 
AW3 1 2 ? anti-parallel 
AW3 2 3 ? anti-parallel 
AW3 3 4 ? anti-parallel 
AW4 1 2 ? anti-parallel 
AW4 2 3 ? anti-parallel 
AW4 3 4 ? anti-parallel 
AW5 1 2 ? anti-parallel 
AW5 2 3 ? anti-parallel 
AW5 3 4 ? anti-parallel 
AW5 4 5 ? anti-parallel 
AW6 1 2 ? anti-parallel 
AW6 2 3 ? anti-parallel 
AW6 3 4 ? anti-parallel 
AW6 4 5 ? anti-parallel 
AW7 1 2 ? anti-parallel 
AW7 2 3 ? anti-parallel 
AW7 3 4 ? anti-parallel 
AW8 1 2 ? anti-parallel 
AW9 1 2 ? anti-parallel 
AW9 2 3 ? anti-parallel 
AW9 3 4 ? anti-parallel 
AW9 4 5 ? anti-parallel 
AX1 1 2 ? anti-parallel 
AX1 2 3 ? anti-parallel 
AX1 3 4 ? anti-parallel 
AX2 1 2 ? anti-parallel 
AX2 2 3 ? anti-parallel 
AX2 3 4 ? anti-parallel 
AX2 4 5 ? anti-parallel 
AX3 1 2 ? anti-parallel 
AX3 2 3 ? anti-parallel 
AX4 1 2 ? anti-parallel 
AX5 1 2 ? anti-parallel 
AX5 2 3 ? anti-parallel 
AX5 3 4 ? anti-parallel 
AX5 4 5 ? anti-parallel 
AX6 1 2 ? anti-parallel 
AX6 2 3 ? anti-parallel 
AX6 3 4 ? anti-parallel 
AX7 1 2 ? anti-parallel 
AX8 1 2 ? anti-parallel 
AX8 2 3 ? anti-parallel 
AX8 3 4 ? anti-parallel 
AX8 4 5 ? anti-parallel 
AX9 1 2 ? anti-parallel 
AX9 2 3 ? anti-parallel 
AX9 3 4 ? anti-parallel 
AY1 1 2 ? anti-parallel 
AY1 2 3 ? anti-parallel 
AY1 3 4 ? anti-parallel 
AY2 1 2 ? anti-parallel 
AY2 2 3 ? anti-parallel 
AY2 3 4 ? anti-parallel 
AY2 4 5 ? anti-parallel 
AY3 1 2 ? anti-parallel 
AY3 2 3 ? anti-parallel 
AY3 3 4 ? anti-parallel 
AY3 4 5 ? anti-parallel 
AY4 1 2 ? anti-parallel 
AY4 2 3 ? anti-parallel 
AY4 3 4 ? anti-parallel 
AY5 1 2 ? anti-parallel 
AY6 1 2 ? anti-parallel 
AY6 2 3 ? anti-parallel 
AY6 3 4 ? anti-parallel 
AY6 4 5 ? anti-parallel 
AY7 1 2 ? anti-parallel 
AY7 2 3 ? anti-parallel 
AY7 3 4 ? anti-parallel 
AY8 1 2 ? anti-parallel 
AY9 1 2 ? anti-parallel 
AY9 2 3 ? anti-parallel 
AY9 3 4 ? anti-parallel 
AY9 4 5 ? anti-parallel 
AZ1 1 2 ? anti-parallel 
AZ1 2 3 ? anti-parallel 
AZ1 3 4 ? anti-parallel 
AZ2 1 2 ? anti-parallel 
AZ3 1 2 ? anti-parallel 
AZ3 2 3 ? anti-parallel 
AZ3 3 4 ? anti-parallel 
AZ3 4 5 ? anti-parallel 
AZ4 1 2 ? anti-parallel 
AZ4 2 3 ? anti-parallel 
AZ4 3 4 ? anti-parallel 
AZ5 1 2 ? anti-parallel 
AZ5 2 3 ? anti-parallel 
AZ5 3 4 ? anti-parallel 
AZ5 4 5 ? anti-parallel 
AZ6 1 2 ? anti-parallel 
AZ6 2 3 ? anti-parallel 
AZ6 3 4 ? anti-parallel 
AZ7 1 2 ? anti-parallel 
AZ8 1 2 ? anti-parallel 
AZ8 2 3 ? anti-parallel 
AZ8 3 4 ? anti-parallel 
AZ9 1 2 ? anti-parallel 
AZ9 2 3 ? anti-parallel 
AZ9 3 4 ? anti-parallel 
AZ9 4 5 ? anti-parallel 
BA1 1 2 ? anti-parallel 
BA1 2 3 ? anti-parallel 
BA1 3 4 ? anti-parallel 
BA1 4 5 ? anti-parallel 
BA2 1 2 ? anti-parallel 
BA2 2 3 ? anti-parallel 
BA2 3 4 ? anti-parallel 
BA3 1 2 ? anti-parallel 
BA4 1 2 ? anti-parallel 
BA4 2 3 ? anti-parallel 
BA4 3 4 ? anti-parallel 
BA4 4 5 ? anti-parallel 
BA5 1 2 ? anti-parallel 
BA5 2 3 ? anti-parallel 
BA5 3 4 ? anti-parallel 
BA6 1 2 ? anti-parallel 
BA6 2 3 ? anti-parallel 
BA6 3 4 ? anti-parallel 
BA6 4 5 ? anti-parallel 
BA7 1 2 ? anti-parallel 
BA7 2 3 ? anti-parallel 
BA7 3 4 ? anti-parallel 
BA8 1 2 ? anti-parallel 
BA9 1 2 ? anti-parallel 
BA9 2 3 ? anti-parallel 
BA9 3 4 ? anti-parallel 
BA9 4 5 ? anti-parallel 
BB1 1 2 ? anti-parallel 
BB1 2 3 ? anti-parallel 
BB1 3 4 ? anti-parallel 
BB2 1 2 ? anti-parallel 
BB2 2 3 ? anti-parallel 
BB2 3 4 ? anti-parallel 
BB3 1 2 ? anti-parallel 
BB3 2 3 ? anti-parallel 
BB3 3 4 ? anti-parallel 
BB3 4 5 ? anti-parallel 
BB4 1 2 ? anti-parallel 
BB4 2 3 ? anti-parallel 
BB4 3 4 ? anti-parallel 
BB4 4 5 ? anti-parallel 
BB5 1 2 ? anti-parallel 
BB5 2 3 ? anti-parallel 
BB5 3 4 ? anti-parallel 
BB6 1 2 ? anti-parallel 
BB7 1 2 ? anti-parallel 
BB7 2 3 ? anti-parallel 
BB7 3 4 ? anti-parallel 
BB8 1 2 ? anti-parallel 
BB8 2 3 ? anti-parallel 
BB8 3 4 ? anti-parallel 
BB8 4 5 ? anti-parallel 
BB9 1 2 ? anti-parallel 
BB9 2 3 ? anti-parallel 
BB9 3 4 ? anti-parallel 
BB9 4 5 ? anti-parallel 
BC1 1 2 ? anti-parallel 
BC1 2 3 ? anti-parallel 
BC1 3 4 ? anti-parallel 
BC2 1 2 ? anti-parallel 
BC3 1 2 ? anti-parallel 
BC3 2 3 ? anti-parallel 
BC3 3 4 ? anti-parallel 
BC3 4 5 ? anti-parallel 
BC4 1 2 ? anti-parallel 
BC4 2 3 ? anti-parallel 
BC4 3 4 ? anti-parallel 
BC5 1 2 ? anti-parallel 
BC6 1 2 ? anti-parallel 
BC6 2 3 ? anti-parallel 
BC6 3 4 ? anti-parallel 
BC7 1 2 ? anti-parallel 
BC7 2 3 ? anti-parallel 
BC7 3 4 ? anti-parallel 
BC7 4 5 ? anti-parallel 
BC8 1 2 ? anti-parallel 
BC8 2 3 ? anti-parallel 
BC8 3 4 ? anti-parallel 
BC8 4 5 ? anti-parallel 
BC9 1 2 ? anti-parallel 
BC9 2 3 ? anti-parallel 
BC9 3 4 ? anti-parallel 
BD1 1 2 ? anti-parallel 
BD1 2 3 ? anti-parallel 
BD1 3 4 ? anti-parallel 
BD1 4 5 ? anti-parallel 
BD2 1 2 ? anti-parallel 
BD2 2 3 ? anti-parallel 
BD2 3 4 ? anti-parallel 
BD3 1 2 ? anti-parallel 
BD4 1 2 ? anti-parallel 
BD4 2 3 ? anti-parallel 
BD4 3 4 ? anti-parallel 
BD5 1 2 ? anti-parallel 
BD5 2 3 ? anti-parallel 
BD5 3 4 ? anti-parallel 
BD5 4 5 ? anti-parallel 
BD6 1 2 ? anti-parallel 
BD6 2 3 ? anti-parallel 
BD6 3 4 ? anti-parallel 
BD6 4 5 ? anti-parallel 
BD7 1 2 ? anti-parallel 
BD7 2 3 ? anti-parallel 
BD7 3 4 ? anti-parallel 
BD8 1 2 ? anti-parallel 
BD9 1 2 ? anti-parallel 
BD9 2 3 ? anti-parallel 
BD9 3 4 ? anti-parallel 
BD9 4 5 ? anti-parallel 
BE1 1 2 ? anti-parallel 
BE1 2 3 ? anti-parallel 
BE1 3 4 ? anti-parallel 
BE2 1 2 ? anti-parallel 
BE2 2 3 ? anti-parallel 
BE2 3 4 ? anti-parallel 
BE2 4 5 ? anti-parallel 
BE3 1 2 ? anti-parallel 
BE3 2 3 ? anti-parallel 
BE3 3 4 ? anti-parallel 
BE4 1 2 ? anti-parallel 
BE5 1 2 ? anti-parallel 
BE5 2 3 ? anti-parallel 
BE5 3 4 ? anti-parallel 
BE5 4 5 ? anti-parallel 
BE6 1 2 ? anti-parallel 
BE6 2 3 ? anti-parallel 
BE6 3 4 ? anti-parallel 
BE7 1 2 ? anti-parallel 
BE8 1 2 ? anti-parallel 
BE8 2 3 ? anti-parallel 
BE8 3 4 ? anti-parallel 
BE8 4 5 ? anti-parallel 
BE9 1 2 ? anti-parallel 
BE9 2 3 ? anti-parallel 
BE9 3 4 ? anti-parallel 
BF1 1 2 ? anti-parallel 
BF2 1 2 ? anti-parallel 
BF2 2 3 ? anti-parallel 
BF2 3 4 ? anti-parallel 
BF2 4 5 ? anti-parallel 
BF3 1 2 ? anti-parallel 
BF3 2 3 ? anti-parallel 
BF3 3 4 ? anti-parallel 
BF4 1 2 ? anti-parallel 
BF4 2 3 ? anti-parallel 
BF4 3 4 ? anti-parallel 
BF4 4 5 ? anti-parallel 
BF5 1 2 ? anti-parallel 
BF5 2 3 ? anti-parallel 
BF5 3 4 ? anti-parallel 
BF6 1 2 ? anti-parallel 
BF7 1 2 ? anti-parallel 
BF7 2 3 ? anti-parallel 
BF7 3 4 ? anti-parallel 
BF7 4 5 ? anti-parallel 
BF8 1 2 ? anti-parallel 
BF8 2 3 ? anti-parallel 
BF8 3 4 ? anti-parallel 
BF9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A  20  ? ILE A  33  ? HIS A 44  ILE A 57  
AA1 2 GLN A  185 ? PHE A  200 ? GLN A 209 PHE A 224 
AA1 3 PHE A  69  ? PRO A  83  ? PHE A 93  PRO A 107 
AA1 4 HIS A  133 ? PHE A  137 ? HIS A 157 PHE A 161 
AA2 1 HIS A  20  ? ILE A  33  ? HIS A 44  ILE A 57  
AA2 2 GLN A  185 ? PHE A  200 ? GLN A 209 PHE A 224 
AA2 3 PHE A  69  ? PRO A  83  ? PHE A 93  PRO A 107 
AA2 4 LEU A  161 ? ARG A  162 ? LEU A 185 ARG A 186 
AA3 1 ALA A  109 ? LEU A  112 ? ALA A 133 LEU A 136 
AA3 2 TRP A  43  ? PHE A  50  ? TRP A 67  PHE A 74  
AA3 3 HIS A  171 ? GLU A  179 ? HIS A 195 GLU A 203 
AA3 4 GLY A  93  ? VAL A  99  ? GLY A 117 VAL A 123 
AA3 5 HIS A  124 ? GLN A  128 ? HIS A 148 GLN A 152 
AA4 1 ALA A  109 ? LEU A  112 ? ALA A 133 LEU A 136 
AA4 2 TRP A  43  ? PHE A  50  ? TRP A 67  PHE A 74  
AA4 3 HIS A  171 ? GLU A  179 ? HIS A 195 GLU A 203 
AA4 4 LYS A  140 ? PRO A  141 ? LYS A 164 PRO A 165 
AA5 1 PRO A  58  ? GLY A  60  ? PRO A 82  GLY A 84  
AA5 2 ASN A  63  ? ARG A  65  ? ASN A 87  ARG A 89  
AA6 1 TYR A  149 ? PHE A  150 ? TYR A 173 PHE A 174 
AA6 2 TRP F  160 ? ARG F  162 ? TRP F 184 ARG F 186 
AA6 3 PHE F  69  ? PRO F  83  ? PHE F 93  PRO F 107 
AA6 4 GLN F  185 ? PHE F  200 ? GLN F 209 PHE F 224 
AA6 5 HIS F  20  ? ILE F  33  ? HIS F 44  ILE F 57  
AA7 1 TYR A  149 ? PHE A  150 ? TYR A 173 PHE A 174 
AA7 2 TRP F  160 ? ARG F  162 ? TRP F 184 ARG F 186 
AA7 3 PHE F  69  ? PRO F  83  ? PHE F 93  PRO F 107 
AA7 4 HIS F  133 ? PHE F  137 ? HIS F 157 PHE F 161 
AA8 1 HIS B  20  ? ILE B  33  ? HIS B 44  ILE B 57  
AA8 2 GLN B  185 ? PHE B  200 ? GLN B 209 PHE B 224 
AA8 3 PHE B  69  ? PRO B  83  ? PHE B 93  PRO B 107 
AA8 4 HIS B  133 ? PHE B  137 ? HIS B 157 PHE B 161 
AA9 1 HIS B  20  ? ILE B  33  ? HIS B 44  ILE B 57  
AA9 2 GLN B  185 ? PHE B  200 ? GLN B 209 PHE B 224 
AA9 3 PHE B  69  ? PRO B  83  ? PHE B 93  PRO B 107 
AA9 4 TRP B  160 ? ARG B  162 ? TRP B 184 ARG B 186 
AA9 5 TYR G  149 ? PHE G  150 ? TYR G 173 PHE G 174 
AB1 1 ALA B  109 ? LEU B  112 ? ALA B 133 LEU B 136 
AB1 2 TRP B  43  ? PHE B  50  ? TRP B 67  PHE B 74  
AB1 3 HIS B  171 ? GLU B  179 ? HIS B 195 GLU B 203 
AB1 4 GLY B  93  ? VAL B  99  ? GLY B 117 VAL B 123 
AB1 5 HIS B  124 ? GLN B  128 ? HIS B 148 GLN B 152 
AB2 1 ALA B  109 ? LEU B  112 ? ALA B 133 LEU B 136 
AB2 2 TRP B  43  ? PHE B  50  ? TRP B 67  PHE B 74  
AB2 3 HIS B  171 ? GLU B  179 ? HIS B 195 GLU B 203 
AB2 4 LYS B  140 ? PRO B  141 ? LYS B 164 PRO B 165 
AB3 1 PRO B  58  ? GLY B  60  ? PRO B 82  GLY B 84  
AB3 2 ASN B  63  ? ARG B  65  ? ASN B 87  ARG B 89  
AB4 1 HIS C  20  ? ILE C  33  ? HIS C 44  ILE C 57  
AB4 2 GLN C  185 ? PHE C  200 ? GLN C 209 PHE C 224 
AB4 3 PHE C  69  ? PRO C  83  ? PHE C 93  PRO C 107 
AB4 4 HIS C  133 ? PHE C  137 ? HIS C 157 PHE C 161 
AB5 1 HIS C  20  ? ILE C  33  ? HIS C 44  ILE C 57  
AB5 2 GLN C  185 ? PHE C  200 ? GLN C 209 PHE C 224 
AB5 3 PHE C  69  ? PRO C  83  ? PHE C 93  PRO C 107 
AB5 4 TRP C  160 ? ARG C  162 ? TRP C 184 ARG C 186 
AB5 5 TYR F  149 ? PHE F  150 ? TYR F 173 PHE F 174 
AB6 1 ALA C  109 ? LEU C  112 ? ALA C 133 LEU C 136 
AB6 2 TRP C  43  ? PHE C  50  ? TRP C 67  PHE C 74  
AB6 3 HIS C  171 ? GLU C  179 ? HIS C 195 GLU C 203 
AB6 4 GLY C  93  ? VAL C  99  ? GLY C 117 VAL C 123 
AB6 5 HIS C  124 ? GLN C  128 ? HIS C 148 GLN C 152 
AB7 1 ALA C  109 ? LEU C  112 ? ALA C 133 LEU C 136 
AB7 2 TRP C  43  ? PHE C  50  ? TRP C 67  PHE C 74  
AB7 3 HIS C  171 ? GLU C  179 ? HIS C 195 GLU C 203 
AB7 4 LYS C  140 ? PRO C  141 ? LYS C 164 PRO C 165 
AB8 1 PRO C  58  ? GLY C  60  ? PRO C 82  GLY C 84  
AB8 2 ASN C  63  ? ARG C  65  ? ASN C 87  ARG C 89  
AB9 1 HIS D  20  ? ILE D  33  ? HIS D 44  ILE D 57  
AB9 2 GLN D  185 ? PHE D  200 ? GLN D 209 PHE D 224 
AB9 3 PHE D  69  ? PRO D  83  ? PHE D 93  PRO D 107 
AB9 4 HIS D  133 ? PHE D  137 ? HIS D 157 PHE D 161 
AC1 1 HIS D  20  ? ILE D  33  ? HIS D 44  ILE D 57  
AC1 2 GLN D  185 ? PHE D  200 ? GLN D 209 PHE D 224 
AC1 3 PHE D  69  ? PRO D  83  ? PHE D 93  PRO D 107 
AC1 4 LEU D  161 ? ARG D  162 ? LEU D 185 ARG D 186 
AC2 1 ALA D  109 ? LEU D  112 ? ALA D 133 LEU D 136 
AC2 2 TRP D  43  ? PHE D  50  ? TRP D 67  PHE D 74  
AC2 3 HIS D  171 ? GLU D  179 ? HIS D 195 GLU D 203 
AC2 4 GLY D  93  ? VAL D  99  ? GLY D 117 VAL D 123 
AC2 5 HIS D  124 ? GLN D  128 ? HIS D 148 GLN D 152 
AC3 1 ALA D  109 ? LEU D  112 ? ALA D 133 LEU D 136 
AC3 2 TRP D  43  ? PHE D  50  ? TRP D 67  PHE D 74  
AC3 3 HIS D  171 ? GLU D  179 ? HIS D 195 GLU D 203 
AC3 4 LYS D  140 ? PRO D  141 ? LYS D 164 PRO D 165 
AC4 1 PRO D  58  ? GLY D  60  ? PRO D 82  GLY D 84  
AC4 2 ASN D  63  ? ARG D  65  ? ASN D 87  ARG D 89  
AC5 1 TYR D  149 ? PHE D  150 ? TYR D 173 PHE D 174 
AC5 2 TRP M  160 ? ARG M  162 ? TRP M 184 ARG M 186 
AC5 3 PHE M  69  ? PRO M  83  ? PHE M 93  PRO M 107 
AC5 4 GLN M  185 ? PHE M  200 ? GLN M 209 PHE M 224 
AC5 5 HIS M  20  ? ILE M  33  ? HIS M 44  ILE M 57  
AC6 1 TYR D  149 ? PHE D  150 ? TYR D 173 PHE D 174 
AC6 2 TRP M  160 ? ARG M  162 ? TRP M 184 ARG M 186 
AC6 3 PHE M  69  ? PRO M  83  ? PHE M 93  PRO M 107 
AC6 4 HIS M  133 ? PHE M  137 ? HIS M 157 PHE M 161 
AC7 1 HIS E  20  ? ILE E  33  ? HIS E 44  ILE E 57  
AC7 2 GLN E  185 ? PHE E  200 ? GLN E 209 PHE E 224 
AC7 3 PHE E  69  ? PRO E  83  ? PHE E 93  PRO E 107 
AC7 4 HIS E  133 ? PHE E  137 ? HIS E 157 PHE E 161 
AC8 1 HIS E  20  ? ILE E  33  ? HIS E 44  ILE E 57  
AC8 2 GLN E  185 ? PHE E  200 ? GLN E 209 PHE E 224 
AC8 3 PHE E  69  ? PRO E  83  ? PHE E 93  PRO E 107 
AC8 4 TRP E  160 ? ARG E  162 ? TRP E 184 ARG E 186 
AC8 5 TYR O  149 ? PHE O  150 ? TYR O 173 PHE O 174 
AC9 1 ALA E  109 ? LEU E  112 ? ALA E 133 LEU E 136 
AC9 2 TRP E  43  ? PHE E  50  ? TRP E 67  PHE E 74  
AC9 3 HIS E  171 ? GLU E  179 ? HIS E 195 GLU E 203 
AC9 4 GLY E  93  ? VAL E  99  ? GLY E 117 VAL E 123 
AC9 5 HIS E  124 ? GLN E  128 ? HIS E 148 GLN E 152 
AD1 1 ALA E  109 ? LEU E  112 ? ALA E 133 LEU E 136 
AD1 2 TRP E  43  ? PHE E  50  ? TRP E 67  PHE E 74  
AD1 3 HIS E  171 ? GLU E  179 ? HIS E 195 GLU E 203 
AD1 4 LYS E  140 ? PRO E  141 ? LYS E 164 PRO E 165 
AD2 1 PRO E  58  ? GLY E  60  ? PRO E 82  GLY E 84  
AD2 2 ASN E  63  ? ARG E  65  ? ASN E 87  ARG E 89  
AD3 1 TYR E  149 ? PHE E  150 ? TYR E 173 PHE E 174 
AD3 2 TRP R  160 ? ARG R  162 ? TRP R 184 ARG R 186 
AD3 3 PHE R  69  ? PRO R  83  ? PHE R 93  PRO R 107 
AD3 4 GLN R  185 ? PHE R  200 ? GLN R 209 PHE R 224 
AD3 5 HIS R  20  ? ILE R  33  ? HIS R 44  ILE R 57  
AD4 1 TYR E  149 ? PHE E  150 ? TYR E 173 PHE E 174 
AD4 2 TRP R  160 ? ARG R  162 ? TRP R 184 ARG R 186 
AD4 3 PHE R  69  ? PRO R  83  ? PHE R 93  PRO R 107 
AD4 4 HIS R  133 ? PHE R  137 ? HIS R 157 PHE R 161 
AD5 1 ALA F  109 ? LEU F  112 ? ALA F 133 LEU F 136 
AD5 2 TRP F  43  ? PHE F  50  ? TRP F 67  PHE F 74  
AD5 3 HIS F  171 ? GLU F  179 ? HIS F 195 GLU F 203 
AD5 4 VAL F  94  ? VAL F  99  ? VAL F 118 VAL F 123 
AD5 5 HIS F  124 ? THR F  127 ? HIS F 148 THR F 151 
AD6 1 ALA F  109 ? LEU F  112 ? ALA F 133 LEU F 136 
AD6 2 TRP F  43  ? PHE F  50  ? TRP F 67  PHE F 74  
AD6 3 HIS F  171 ? GLU F  179 ? HIS F 195 GLU F 203 
AD6 4 LYS F  140 ? PRO F  141 ? LYS F 164 PRO F 165 
AD7 1 PRO F  58  ? GLY F  60  ? PRO F 82  GLY F 84  
AD7 2 ASN F  63  ? ARG F  65  ? ASN F 87  ARG F 89  
AD8 1 HIS G  20  ? ILE G  33  ? HIS G 44  ILE G 57  
AD8 2 GLN G  185 ? PHE G  200 ? GLN G 209 PHE G 224 
AD8 3 PHE G  69  ? PRO G  83  ? PHE G 93  PRO G 107 
AD8 4 HIS G  133 ? PHE G  137 ? HIS G 157 PHE G 161 
AD9 1 HIS G  20  ? ILE G  33  ? HIS G 44  ILE G 57  
AD9 2 GLN G  185 ? PHE G  200 ? GLN G 209 PHE G 224 
AD9 3 PHE G  69  ? PRO G  83  ? PHE G 93  PRO G 107 
AD9 4 TRP G  160 ? ARG G  162 ? TRP G 184 ARG G 186 
AD9 5 TYR I  149 ? PHE I  150 ? TYR I 173 PHE I 174 
AE1 1 ALA G  109 ? LEU G  112 ? ALA G 133 LEU G 136 
AE1 2 TRP G  43  ? ASN G  51  ? TRP G 67  ASN G 75  
AE1 3 ASP G  170 ? GLU G  179 ? ASP G 194 GLU G 203 
AE1 4 GLY G  93  ? VAL G  99  ? GLY G 117 VAL G 123 
AE1 5 HIS G  124 ? GLN G  128 ? HIS G 148 GLN G 152 
AE2 1 ALA G  109 ? LEU G  112 ? ALA G 133 LEU G 136 
AE2 2 TRP G  43  ? ASN G  51  ? TRP G 67  ASN G 75  
AE2 3 ASP G  170 ? GLU G  179 ? ASP G 194 GLU G 203 
AE2 4 LYS G  140 ? PRO G  141 ? LYS G 164 PRO G 165 
AE3 1 HIS H  20  ? ILE H  33  ? HIS H 44  ILE H 57  
AE3 2 GLN H  185 ? PHE H  200 ? GLN H 209 PHE H 224 
AE3 3 PHE H  69  ? PRO H  83  ? PHE H 93  PRO H 107 
AE3 4 HIS H  133 ? PHE H  137 ? HIS H 157 PHE H 161 
AE4 1 HIS H  20  ? ILE H  33  ? HIS H 44  ILE H 57  
AE4 2 GLN H  185 ? PHE H  200 ? GLN H 209 PHE H 224 
AE4 3 PHE H  69  ? PRO H  83  ? PHE H 93  PRO H 107 
AE4 4 LEU H  161 ? ARG H  162 ? LEU H 185 ARG H 186 
AE5 1 ALA H  109 ? LEU H  112 ? ALA H 133 LEU H 136 
AE5 2 TRP H  43  ? ASP H  46  ? TRP H 67  ASP H 70  
AE5 3 LEU H  174 ? GLU H  179 ? LEU H 198 GLU H 203 
AE5 4 GLY H  93  ? VAL H  99  ? GLY H 117 VAL H 123 
AE5 5 HIS H  124 ? GLN H  128 ? HIS H 148 GLN H 152 
AE6 1 ARG H  49  ? PHE H  50  ? ARG H 73  PHE H 74  
AE6 2 HIS H  171 ? VAL H  172 ? HIS H 195 VAL H 196 
AE6 3 LYS H  140 ? PRO H  141 ? LYS H 164 PRO H 165 
AE7 1 TYR H  149 ? PHE H  150 ? TYR H 173 PHE H 174 
AE7 2 TRP U  160 ? ARG U  162 ? TRP U 184 ARG U 186 
AE7 3 PHE U  69  ? PRO U  83  ? PHE U 93  PRO U 107 
AE7 4 GLN U  185 ? PHE U  200 ? GLN U 209 PHE U 224 
AE7 5 HIS U  20  ? ILE U  33  ? HIS U 44  ILE U 57  
AE8 1 TYR H  149 ? PHE H  150 ? TYR H 173 PHE H 174 
AE8 2 TRP U  160 ? ARG U  162 ? TRP U 184 ARG U 186 
AE8 3 PHE U  69  ? PRO U  83  ? PHE U 93  PRO U 107 
AE8 4 HIS U  133 ? PHE U  137 ? HIS U 157 PHE U 161 
AE9 1 HIS I  20  ? ILE I  33  ? HIS I 44  ILE I 57  
AE9 2 GLN I  185 ? PHE I  200 ? GLN I 209 PHE I 224 
AE9 3 PHE I  69  ? PRO I  83  ? PHE I 93  PRO I 107 
AE9 4 HIS I  133 ? PHE I  137 ? HIS I 157 PHE I 161 
AF1 1 HIS I  20  ? ILE I  33  ? HIS I 44  ILE I 57  
AF1 2 GLN I  185 ? PHE I  200 ? GLN I 209 PHE I 224 
AF1 3 PHE I  69  ? PRO I  83  ? PHE I 93  PRO I 107 
AF1 4 LEU I  161 ? ARG I  162 ? LEU I 185 ARG I 186 
AF2 1 ALA I  109 ? LEU I  112 ? ALA I 133 LEU I 136 
AF2 2 TRP I  43  ? PHE I  50  ? TRP I 67  PHE I 74  
AF2 3 HIS I  171 ? GLU I  179 ? HIS I 195 GLU I 203 
AF2 4 GLY I  93  ? VAL I  99  ? GLY I 117 VAL I 123 
AF2 5 HIS I  124 ? GLN I  128 ? HIS I 148 GLN I 152 
AF3 1 ALA I  109 ? LEU I  112 ? ALA I 133 LEU I 136 
AF3 2 TRP I  43  ? PHE I  50  ? TRP I 67  PHE I 74  
AF3 3 HIS I  171 ? GLU I  179 ? HIS I 195 GLU I 203 
AF3 4 LYS I  140 ? PRO I  141 ? LYS I 164 PRO I 165 
AF4 1 PRO I  58  ? GLY I  60  ? PRO I 82  GLY I 84  
AF4 2 ASN I  63  ? ARG I  65  ? ASN I 87  ARG I 89  
AF5 1 HIS J  20  ? ILE J  33  ? HIS J 44  ILE J 57  
AF5 2 GLN J  185 ? PHE J  200 ? GLN J 209 PHE J 224 
AF5 3 PHE J  69  ? PRO J  83  ? PHE J 93  PRO J 107 
AF5 4 HIS J  133 ? PHE J  137 ? HIS J 157 PHE J 161 
AF6 1 HIS J  20  ? ILE J  33  ? HIS J 44  ILE J 57  
AF6 2 GLN J  185 ? PHE J  200 ? GLN J 209 PHE J 224 
AF6 3 PHE J  69  ? PRO J  83  ? PHE J 93  PRO J 107 
AF6 4 TRP J  160 ? ARG J  162 ? TRP J 184 ARG J 186 
AF6 5 TYR W  149 ? PHE W  150 ? TYR W 173 PHE W 174 
AF7 1 ALA J  109 ? LEU J  112 ? ALA J 133 LEU J 136 
AF7 2 TRP J  43  ? PHE J  50  ? TRP J 67  PHE J 74  
AF7 3 HIS J  171 ? GLU J  179 ? HIS J 195 GLU J 203 
AF7 4 GLY J  93  ? VAL J  99  ? GLY J 117 VAL J 123 
AF7 5 HIS J  124 ? GLN J  128 ? HIS J 148 GLN J 152 
AF8 1 ALA J  109 ? LEU J  112 ? ALA J 133 LEU J 136 
AF8 2 TRP J  43  ? PHE J  50  ? TRP J 67  PHE J 74  
AF8 3 HIS J  171 ? GLU J  179 ? HIS J 195 GLU J 203 
AF8 4 LYS J  140 ? PRO J  141 ? LYS J 164 PRO J 165 
AF9 1 PRO J  58  ? GLY J  60  ? PRO J 82  GLY J 84  
AF9 2 ASN J  63  ? ARG J  65  ? ASN J 87  ARG J 89  
AG1 1 TYR J  149 ? PHE J  150 ? TYR J 173 PHE J 174 
AG1 2 TRP Y  160 ? ARG Y  162 ? TRP Y 184 ARG Y 186 
AG1 3 PHE Y  69  ? PRO Y  83  ? PHE Y 93  PRO Y 107 
AG1 4 GLN Y  185 ? PHE Y  200 ? GLN Y 209 PHE Y 224 
AG1 5 HIS Y  20  ? ILE Y  33  ? HIS Y 44  ILE Y 57  
AG2 1 TYR J  149 ? PHE J  150 ? TYR J 173 PHE J 174 
AG2 2 TRP Y  160 ? ARG Y  162 ? TRP Y 184 ARG Y 186 
AG2 3 PHE Y  69  ? PRO Y  83  ? PHE Y 93  PRO Y 107 
AG2 4 HIS Y  133 ? PHE Y  137 ? HIS Y 157 PHE Y 161 
AG3 1 HIS K  20  ? ILE K  33  ? HIS K 44  ILE K 57  
AG3 2 GLN K  185 ? PHE K  200 ? GLN K 209 PHE K 224 
AG3 3 PHE K  69  ? PRO K  83  ? PHE K 93  PRO K 107 
AG3 4 HIS K  133 ? PHE K  137 ? HIS K 157 PHE K 161 
AG4 1 HIS K  20  ? ILE K  33  ? HIS K 44  ILE K 57  
AG4 2 GLN K  185 ? PHE K  200 ? GLN K 209 PHE K 224 
AG4 3 PHE K  69  ? PRO K  83  ? PHE K 93  PRO K 107 
AG4 4 TRP K  160 ? ARG K  162 ? TRP K 184 ARG K 186 
AG4 5 TYR M  149 ? PHE M  150 ? TYR M 173 PHE M 174 
AG5 1 ALA K  109 ? LEU K  112 ? ALA K 133 LEU K 136 
AG5 2 TRP K  43  ? PHE K  50  ? TRP K 67  PHE K 74  
AG5 3 HIS K  171 ? GLU K  179 ? HIS K 195 GLU K 203 
AG5 4 GLY K  93  ? VAL K  99  ? GLY K 117 VAL K 123 
AG5 5 HIS K  124 ? GLN K  128 ? HIS K 148 GLN K 152 
AG6 1 ALA K  109 ? LEU K  112 ? ALA K 133 LEU K 136 
AG6 2 TRP K  43  ? PHE K  50  ? TRP K 67  PHE K 74  
AG6 3 HIS K  171 ? GLU K  179 ? HIS K 195 GLU K 203 
AG6 4 LYS K  140 ? PRO K  141 ? LYS K 164 PRO K 165 
AG7 1 HIS L  20  ? ILE L  33  ? HIS L 44  ILE L 57  
AG7 2 GLN L  185 ? PHE L  200 ? GLN L 209 PHE L 224 
AG7 3 PHE L  69  ? PRO L  83  ? PHE L 93  PRO L 107 
AG7 4 HIS L  133 ? PHE L  137 ? HIS L 157 PHE L 161 
AG8 1 HIS L  20  ? ILE L  33  ? HIS L 44  ILE L 57  
AG8 2 GLN L  185 ? PHE L  200 ? GLN L 209 PHE L 224 
AG8 3 PHE L  69  ? PRO L  83  ? PHE L 93  PRO L 107 
AG8 4 LEU L  161 ? ARG L  162 ? LEU L 185 ARG L 186 
AG9 1 ALA L  109 ? LEU L  112 ? ALA L 133 LEU L 136 
AG9 2 TRP L  43  ? PHE L  50  ? TRP L 67  PHE L 74  
AG9 3 HIS L  171 ? GLU L  179 ? HIS L 195 GLU L 203 
AG9 4 VAL L  94  ? VAL L  99  ? VAL L 118 VAL L 123 
AG9 5 HIS L  124 ? THR L  127 ? HIS L 148 THR L 151 
AH1 1 ALA L  109 ? LEU L  112 ? ALA L 133 LEU L 136 
AH1 2 TRP L  43  ? PHE L  50  ? TRP L 67  PHE L 74  
AH1 3 HIS L  171 ? GLU L  179 ? HIS L 195 GLU L 203 
AH1 4 LYS L  140 ? PRO L  141 ? LYS L 164 PRO L 165 
AH2 1 PRO L  58  ? GLY L  60  ? PRO L 82  GLY L 84  
AH2 2 ASN L  63  ? ARG L  65  ? ASN L 87  ARG L 89  
AH3 1 ALA M  109 ? LEU M  112 ? ALA M 133 LEU M 136 
AH3 2 TRP M  43  ? PHE M  50  ? TRP M 67  PHE M 74  
AH3 3 HIS M  171 ? GLU M  179 ? HIS M 195 GLU M 203 
AH3 4 GLY M  93  ? VAL M  99  ? GLY M 117 VAL M 123 
AH3 5 HIS M  124 ? GLN M  128 ? HIS M 148 GLN M 152 
AH4 1 ALA M  109 ? LEU M  112 ? ALA M 133 LEU M 136 
AH4 2 TRP M  43  ? PHE M  50  ? TRP M 67  PHE M 74  
AH4 3 HIS M  171 ? GLU M  179 ? HIS M 195 GLU M 203 
AH4 4 LYS M  140 ? PRO M  141 ? LYS M 164 PRO M 165 
AH5 1 PRO M  58  ? GLY M  60  ? PRO M 82  GLY M 84  
AH5 2 ASN M  63  ? ARG M  65  ? ASN M 87  ARG M 89  
AH6 1 HIS N  20  ? ILE N  33  ? HIS N 44  ILE N 57  
AH6 2 GLN N  185 ? PHE N  200 ? GLN N 209 PHE N 224 
AH6 3 PHE N  69  ? PRO N  83  ? PHE N 93  PRO N 107 
AH6 4 HIS N  133 ? PHE N  137 ? HIS N 157 PHE N 161 
AH7 1 HIS N  20  ? ILE N  33  ? HIS N 44  ILE N 57  
AH7 2 GLN N  185 ? PHE N  200 ? GLN N 209 PHE N 224 
AH7 3 PHE N  69  ? PRO N  83  ? PHE N 93  PRO N 107 
AH7 4 TRP N  160 ? ARG N  162 ? TRP N 184 ARG N 186 
AH7 5 TYR EA 149 ? PHE EA 150 ? TYR 5 173 PHE 5 174 
AH8 1 ALA N  109 ? LEU N  112 ? ALA N 133 LEU N 136 
AH8 2 TRP N  43  ? PHE N  50  ? TRP N 67  PHE N 74  
AH8 3 HIS N  171 ? GLU N  179 ? HIS N 195 GLU N 203 
AH8 4 GLY N  93  ? VAL N  99  ? GLY N 117 VAL N 123 
AH8 5 HIS N  124 ? GLN N  128 ? HIS N 148 GLN N 152 
AH9 1 ALA N  109 ? LEU N  112 ? ALA N 133 LEU N 136 
AH9 2 TRP N  43  ? PHE N  50  ? TRP N 67  PHE N 74  
AH9 3 HIS N  171 ? GLU N  179 ? HIS N 195 GLU N 203 
AH9 4 LYS N  140 ? PRO N  141 ? LYS N 164 PRO N 165 
AI1 1 PRO N  58  ? GLY N  60  ? PRO N 82  GLY N 84  
AI1 2 ASN N  63  ? ARG N  65  ? ASN N 87  ARG N 89  
AI2 1 TYR N  149 ? PHE N  150 ? TYR N 173 PHE N 174 
AI2 2 TRP DA 160 ? ARG DA 162 ? TRP 4 184 ARG 4 186 
AI2 3 PHE DA 69  ? PRO DA 83  ? PHE 4 93  PRO 4 107 
AI2 4 GLN DA 185 ? PHE DA 200 ? GLN 4 209 PHE 4 224 
AI2 5 HIS DA 20  ? ILE DA 33  ? HIS 4 44  ILE 4 57  
AI3 1 TYR N  149 ? PHE N  150 ? TYR N 173 PHE N 174 
AI3 2 TRP DA 160 ? ARG DA 162 ? TRP 4 184 ARG 4 186 
AI3 3 PHE DA 69  ? PRO DA 83  ? PHE 4 93  PRO 4 107 
AI3 4 HIS DA 133 ? PHE DA 137 ? HIS 4 157 PHE 4 161 
AI4 1 HIS O  20  ? ILE O  33  ? HIS O 44  ILE O 57  
AI4 2 GLN O  185 ? PHE O  200 ? GLN O 209 PHE O 224 
AI4 3 PHE O  69  ? PRO O  83  ? PHE O 93  PRO O 107 
AI4 4 HIS O  133 ? PHE O  137 ? HIS O 157 PHE O 161 
AI5 1 HIS O  20  ? ILE O  33  ? HIS O 44  ILE O 57  
AI5 2 GLN O  185 ? PHE O  200 ? GLN O 209 PHE O 224 
AI5 3 PHE O  69  ? PRO O  83  ? PHE O 93  PRO O 107 
AI5 4 LEU O  161 ? ARG O  162 ? LEU O 185 ARG O 186 
AI6 1 ALA O  109 ? LEU O  112 ? ALA O 133 LEU O 136 
AI6 2 TRP O  43  ? PHE O  50  ? TRP O 67  PHE O 74  
AI6 3 HIS O  171 ? GLU O  179 ? HIS O 195 GLU O 203 
AI6 4 GLY O  93  ? VAL O  99  ? GLY O 117 VAL O 123 
AI6 5 HIS O  124 ? GLN O  128 ? HIS O 148 GLN O 152 
AI7 1 ALA O  109 ? LEU O  112 ? ALA O 133 LEU O 136 
AI7 2 TRP O  43  ? PHE O  50  ? TRP O 67  PHE O 74  
AI7 3 HIS O  171 ? GLU O  179 ? HIS O 195 GLU O 203 
AI7 4 LYS O  140 ? PRO O  141 ? LYS O 164 PRO O 165 
AI8 1 PRO O  58  ? GLY O  60  ? PRO O 82  GLY O 84  
AI8 2 ASN O  63  ? ARG O  65  ? ASN O 87  ARG O 89  
AI9 1 HIS P  20  ? ILE P  33  ? HIS P 44  ILE P 57  
AI9 2 GLN P  185 ? PHE P  200 ? GLN P 209 PHE P 224 
AI9 3 PHE P  69  ? PRO P  83  ? PHE P 93  PRO P 107 
AI9 4 HIS P  133 ? PHE P  137 ? HIS P 157 PHE P 161 
AJ1 1 HIS P  20  ? ILE P  33  ? HIS P 44  ILE P 57  
AJ1 2 GLN P  185 ? PHE P  200 ? GLN P 209 PHE P 224 
AJ1 3 PHE P  69  ? PRO P  83  ? PHE P 93  PRO P 107 
AJ1 4 LEU P  161 ? ARG P  162 ? LEU P 185 ARG P 186 
AJ2 1 ALA P  109 ? LEU P  112 ? ALA P 133 LEU P 136 
AJ2 2 TRP P  43  ? PHE P  50  ? TRP P 67  PHE P 74  
AJ2 3 HIS P  171 ? GLU P  179 ? HIS P 195 GLU P 203 
AJ2 4 GLY P  93  ? VAL P  99  ? GLY P 117 VAL P 123 
AJ2 5 HIS P  124 ? GLN P  128 ? HIS P 148 GLN P 152 
AJ3 1 ALA P  109 ? LEU P  112 ? ALA P 133 LEU P 136 
AJ3 2 TRP P  43  ? PHE P  50  ? TRP P 67  PHE P 74  
AJ3 3 HIS P  171 ? GLU P  179 ? HIS P 195 GLU P 203 
AJ3 4 LYS P  140 ? PRO P  141 ? LYS P 164 PRO P 165 
AJ4 1 TYR P  149 ? PHE P  150 ? TYR P 173 PHE P 174 
AJ4 2 TRP HA 160 ? ARG HA 162 ? TRP 8 184 ARG 8 186 
AJ4 3 PHE HA 69  ? PRO HA 83  ? PHE 8 93  PRO 8 107 
AJ4 4 GLN HA 185 ? PHE HA 200 ? GLN 8 209 PHE 8 224 
AJ4 5 HIS HA 20  ? ILE HA 33  ? HIS 8 44  ILE 8 57  
AJ5 1 TYR P  149 ? PHE P  150 ? TYR P 173 PHE P 174 
AJ5 2 TRP HA 160 ? ARG HA 162 ? TRP 8 184 ARG 8 186 
AJ5 3 PHE HA 69  ? PRO HA 83  ? PHE 8 93  PRO 8 107 
AJ5 4 HIS HA 133 ? PHE HA 137 ? HIS 8 157 PHE 8 161 
AJ6 1 HIS Q  20  ? ILE Q  33  ? HIS Q 44  ILE Q 57  
AJ6 2 GLN Q  185 ? PHE Q  200 ? GLN Q 209 PHE Q 224 
AJ6 3 PHE Q  69  ? PRO Q  83  ? PHE Q 93  PRO Q 107 
AJ6 4 HIS Q  133 ? PHE Q  137 ? HIS Q 157 PHE Q 161 
AJ7 1 HIS Q  20  ? ILE Q  33  ? HIS Q 44  ILE Q 57  
AJ7 2 GLN Q  185 ? PHE Q  200 ? GLN Q 209 PHE Q 224 
AJ7 3 PHE Q  69  ? PRO Q  83  ? PHE Q 93  PRO Q 107 
AJ7 4 TRP Q  160 ? ARG Q  162 ? TRP Q 184 ARG Q 186 
AJ7 5 TYR IA 149 ? PHE IA 150 ? TYR 9 173 PHE 9 174 
AJ8 1 ALA Q  109 ? LEU Q  112 ? ALA Q 133 LEU Q 136 
AJ8 2 TRP Q  43  ? PHE Q  50  ? TRP Q 67  PHE Q 74  
AJ8 3 HIS Q  171 ? GLU Q  179 ? HIS Q 195 GLU Q 203 
AJ8 4 GLY Q  93  ? VAL Q  99  ? GLY Q 117 VAL Q 123 
AJ8 5 HIS Q  124 ? GLN Q  128 ? HIS Q 148 GLN Q 152 
AJ9 1 ALA Q  109 ? LEU Q  112 ? ALA Q 133 LEU Q 136 
AJ9 2 TRP Q  43  ? PHE Q  50  ? TRP Q 67  PHE Q 74  
AJ9 3 HIS Q  171 ? GLU Q  179 ? HIS Q 195 GLU Q 203 
AJ9 4 LYS Q  140 ? PRO Q  141 ? LYS Q 164 PRO Q 165 
AK1 1 TYR Q  149 ? PHE Q  150 ? TYR Q 173 PHE Q 174 
AK1 2 TRP T  160 ? ARG T  162 ? TRP T 184 ARG T 186 
AK1 3 PHE T  69  ? PRO T  83  ? PHE T 93  PRO T 107 
AK1 4 GLN T  185 ? PHE T  200 ? GLN T 209 PHE T 224 
AK1 5 HIS T  20  ? ILE T  33  ? HIS T 44  ILE T 57  
AK2 1 TYR Q  149 ? PHE Q  150 ? TYR Q 173 PHE Q 174 
AK2 2 TRP T  160 ? ARG T  162 ? TRP T 184 ARG T 186 
AK2 3 PHE T  69  ? PRO T  83  ? PHE T 93  PRO T 107 
AK2 4 HIS T  133 ? PHE T  137 ? HIS T 157 PHE T 161 
AK3 1 ALA R  109 ? LEU R  112 ? ALA R 133 LEU R 136 
AK3 2 TRP R  43  ? PHE R  50  ? TRP R 67  PHE R 74  
AK3 3 HIS R  171 ? GLU R  179 ? HIS R 195 GLU R 203 
AK3 4 GLY R  93  ? VAL R  99  ? GLY R 117 VAL R 123 
AK3 5 HIS R  124 ? GLN R  128 ? HIS R 148 GLN R 152 
AK4 1 ALA R  109 ? LEU R  112 ? ALA R 133 LEU R 136 
AK4 2 TRP R  43  ? PHE R  50  ? TRP R 67  PHE R 74  
AK4 3 HIS R  171 ? GLU R  179 ? HIS R 195 GLU R 203 
AK4 4 LYS R  140 ? PRO R  141 ? LYS R 164 PRO R 165 
AK5 1 PRO R  58  ? GLY R  60  ? PRO R 82  GLY R 84  
AK5 2 ASN R  63  ? ARG R  65  ? ASN R 87  ARG R 89  
AK6 1 HIS S  20  ? ILE S  33  ? HIS S 44  ILE S 57  
AK6 2 GLN S  185 ? PHE S  200 ? GLN S 209 PHE S 224 
AK6 3 PHE S  69  ? PRO S  83  ? PHE S 93  PRO S 107 
AK6 4 HIS S  133 ? PHE S  137 ? HIS S 157 PHE S 161 
AK7 1 HIS S  20  ? ILE S  33  ? HIS S 44  ILE S 57  
AK7 2 GLN S  185 ? PHE S  200 ? GLN S 209 PHE S 224 
AK7 3 PHE S  69  ? PRO S  83  ? PHE S 93  PRO S 107 
AK7 4 TRP S  160 ? ARG S  162 ? TRP S 184 ARG S 186 
AK7 5 TYR U  149 ? PHE U  150 ? TYR U 173 PHE U 174 
AK8 1 ALA S  109 ? LEU S  112 ? ALA S 133 LEU S 136 
AK8 2 TRP S  43  ? PHE S  50  ? TRP S 67  PHE S 74  
AK8 3 HIS S  171 ? GLU S  179 ? HIS S 195 GLU S 203 
AK8 4 GLY S  93  ? VAL S  99  ? GLY S 117 VAL S 123 
AK8 5 HIS S  124 ? GLN S  128 ? HIS S 148 GLN S 152 
AK9 1 ALA S  109 ? LEU S  112 ? ALA S 133 LEU S 136 
AK9 2 TRP S  43  ? PHE S  50  ? TRP S 67  PHE S 74  
AK9 3 HIS S  171 ? GLU S  179 ? HIS S 195 GLU S 203 
AK9 4 LYS S  140 ? PRO S  141 ? LYS S 164 PRO S 165 
AL1 1 PRO S  58  ? GLY S  60  ? PRO S 82  GLY S 84  
AL1 2 ASN S  63  ? ARG S  65  ? ASN S 87  ARG S 89  
AL2 1 ALA T  109 ? LEU T  112 ? ALA T 133 LEU T 136 
AL2 2 TRP T  43  ? PHE T  50  ? TRP T 67  PHE T 74  
AL2 3 HIS T  171 ? GLU T  179 ? HIS T 195 GLU T 203 
AL2 4 GLY T  93  ? VAL T  99  ? GLY T 117 VAL T 123 
AL2 5 HIS T  124 ? GLN T  128 ? HIS T 148 GLN T 152 
AL3 1 ALA T  109 ? LEU T  112 ? ALA T 133 LEU T 136 
AL3 2 TRP T  43  ? PHE T  50  ? TRP T 67  PHE T 74  
AL3 3 HIS T  171 ? GLU T  179 ? HIS T 195 GLU T 203 
AL3 4 LYS T  140 ? PRO T  141 ? LYS T 164 PRO T 165 
AL4 1 ALA U  109 ? LEU U  112 ? ALA U 133 LEU U 136 
AL4 2 TRP U  43  ? ASP U  46  ? TRP U 67  ASP U 70  
AL4 3 LEU U  174 ? GLU U  179 ? LEU U 198 GLU U 203 
AL4 4 GLY U  93  ? VAL U  99  ? GLY U 117 VAL U 123 
AL4 5 HIS U  124 ? GLN U  128 ? HIS U 148 GLN U 152 
AL5 1 ARG U  49  ? PHE U  50  ? ARG U 73  PHE U 74  
AL5 2 HIS U  171 ? VAL U  172 ? HIS U 195 VAL U 196 
AL5 3 LYS U  140 ? PRO U  141 ? LYS U 164 PRO U 165 
AL6 1 PRO U  58  ? GLY U  60  ? PRO U 82  GLY U 84  
AL6 2 ASN U  63  ? ARG U  65  ? ASN U 87  ARG U 89  
AL7 1 HIS V  20  ? ILE V  33  ? HIS V 44  ILE V 57  
AL7 2 GLN V  185 ? PHE V  200 ? GLN V 209 PHE V 224 
AL7 3 PHE V  69  ? PRO V  83  ? PHE V 93  PRO V 107 
AL7 4 HIS V  133 ? PHE V  137 ? HIS V 157 PHE V 161 
AL8 1 HIS V  20  ? ILE V  33  ? HIS V 44  ILE V 57  
AL8 2 GLN V  185 ? PHE V  200 ? GLN V 209 PHE V 224 
AL8 3 PHE V  69  ? PRO V  83  ? PHE V 93  PRO V 107 
AL8 4 TRP V  160 ? ARG V  162 ? TRP V 184 ARG V 186 
AL8 5 TYR MA 149 ? PHE MA 150 ? TYR d 173 PHE d 174 
AL9 1 ALA V  109 ? LEU V  112 ? ALA V 133 LEU V 136 
AL9 2 TRP V  43  ? PHE V  50  ? TRP V 67  PHE V 74  
AL9 3 HIS V  171 ? GLU V  179 ? HIS V 195 GLU V 203 
AL9 4 VAL V  94  ? VAL V  99  ? VAL V 118 VAL V 123 
AL9 5 HIS V  124 ? THR V  127 ? HIS V 148 THR V 151 
AM1 1 ALA V  109 ? LEU V  112 ? ALA V 133 LEU V 136 
AM1 2 TRP V  43  ? PHE V  50  ? TRP V 67  PHE V 74  
AM1 3 HIS V  171 ? GLU V  179 ? HIS V 195 GLU V 203 
AM1 4 LYS V  140 ? PRO V  141 ? LYS V 164 PRO V 165 
AM2 1 PRO V  58  ? GLY V  60  ? PRO V 82  GLY V 84  
AM2 2 ASN V  63  ? ARG V  65  ? ASN V 87  ARG V 89  
AM3 1 TYR V  149 ? PHE V  150 ? TYR V 173 PHE V 174 
AM3 2 TRP LA 160 ? ARG LA 162 ? TRP c 184 ARG c 186 
AM3 3 PHE LA 69  ? PRO LA 83  ? PHE c 93  PRO c 107 
AM3 4 GLN LA 185 ? PHE LA 200 ? GLN c 209 PHE c 224 
AM3 5 HIS LA 20  ? ILE LA 33  ? HIS c 44  ILE c 57  
AM4 1 TYR V  149 ? PHE V  150 ? TYR V 173 PHE V 174 
AM4 2 TRP LA 160 ? ARG LA 162 ? TRP c 184 ARG c 186 
AM4 3 PHE LA 69  ? PRO LA 83  ? PHE c 93  PRO c 107 
AM4 4 HIS LA 133 ? PHE LA 137 ? HIS c 157 PHE c 161 
AM5 1 HIS W  20  ? ILE W  33  ? HIS W 44  ILE W 57  
AM5 2 GLN W  185 ? PHE W  200 ? GLN W 209 PHE W 224 
AM5 3 PHE W  69  ? PRO W  83  ? PHE W 93  PRO W 107 
AM5 4 HIS W  133 ? PHE W  137 ? HIS W 157 PHE W 161 
AM6 1 HIS W  20  ? ILE W  33  ? HIS W 44  ILE W 57  
AM6 2 GLN W  185 ? PHE W  200 ? GLN W 209 PHE W 224 
AM6 3 PHE W  69  ? PRO W  83  ? PHE W 93  PRO W 107 
AM6 4 TRP W  160 ? ARG W  162 ? TRP W 184 ARG W 186 
AM6 5 TYR Y  149 ? PHE Y  150 ? TYR Y 173 PHE Y 174 
AM7 1 ALA W  109 ? LEU W  112 ? ALA W 133 LEU W 136 
AM7 2 TRP W  43  ? PHE W  50  ? TRP W 67  PHE W 74  
AM7 3 HIS W  171 ? GLU W  179 ? HIS W 195 GLU W 203 
AM7 4 GLY W  93  ? VAL W  99  ? GLY W 117 VAL W 123 
AM7 5 HIS W  124 ? GLN W  128 ? HIS W 148 GLN W 152 
AM8 1 ALA W  109 ? LEU W  112 ? ALA W 133 LEU W 136 
AM8 2 TRP W  43  ? PHE W  50  ? TRP W 67  PHE W 74  
AM8 3 HIS W  171 ? GLU W  179 ? HIS W 195 GLU W 203 
AM8 4 LYS W  140 ? PRO W  141 ? LYS W 164 PRO W 165 
AM9 1 PRO W  58  ? GLY W  60  ? PRO W 82  GLY W 84  
AM9 2 ASN W  63  ? ARG W  65  ? ASN W 87  ARG W 89  
AN1 1 HIS X  20  ? ILE X  33  ? HIS X 44  ILE X 57  
AN1 2 GLN X  185 ? PHE X  200 ? GLN X 209 PHE X 224 
AN1 3 PHE X  69  ? PRO X  83  ? PHE X 93  PRO X 107 
AN1 4 HIS X  133 ? PHE X  137 ? HIS X 157 PHE X 161 
AN2 1 HIS X  20  ? ILE X  33  ? HIS X 44  ILE X 57  
AN2 2 GLN X  185 ? PHE X  200 ? GLN X 209 PHE X 224 
AN2 3 PHE X  69  ? PRO X  83  ? PHE X 93  PRO X 107 
AN2 4 TRP X  160 ? ARG X  162 ? TRP X 184 ARG X 186 
AN2 5 TYR KA 149 ? PHE KA 150 ? TYR b 173 PHE b 174 
AN3 1 ALA X  109 ? LEU X  112 ? ALA X 133 LEU X 136 
AN3 2 TRP X  43  ? PHE X  50  ? TRP X 67  PHE X 74  
AN3 3 HIS X  171 ? GLU X  179 ? HIS X 195 GLU X 203 
AN3 4 GLY X  93  ? VAL X  99  ? GLY X 117 VAL X 123 
AN3 5 HIS X  124 ? GLN X  128 ? HIS X 148 GLN X 152 
AN4 1 ALA X  109 ? LEU X  112 ? ALA X 133 LEU X 136 
AN4 2 TRP X  43  ? PHE X  50  ? TRP X 67  PHE X 74  
AN4 3 HIS X  171 ? GLU X  179 ? HIS X 195 GLU X 203 
AN4 4 LYS X  140 ? PRO X  141 ? LYS X 164 PRO X 165 
AN5 1 PRO X  58  ? GLY X  60  ? PRO X 82  GLY X 84  
AN5 2 ASN X  63  ? ARG X  65  ? ASN X 87  ARG X 89  
AN6 1 TYR X  149 ? PHE X  150 ? TYR X 173 PHE X 174 
AN6 2 TRP PA 160 ? ARG PA 162 ? TRP g 184 ARG g 186 
AN6 3 PHE PA 69  ? PRO PA 83  ? PHE g 93  PRO g 107 
AN6 4 GLN PA 185 ? PHE PA 200 ? GLN g 209 PHE g 224 
AN6 5 HIS PA 20  ? ILE PA 33  ? HIS g 44  ILE g 57  
AN7 1 TYR X  149 ? PHE X  150 ? TYR X 173 PHE X 174 
AN7 2 TRP PA 160 ? ARG PA 162 ? TRP g 184 ARG g 186 
AN7 3 PHE PA 69  ? PRO PA 83  ? PHE g 93  PRO g 107 
AN7 4 HIS PA 133 ? PHE PA 137 ? HIS g 157 PHE g 161 
AN8 1 ALA Y  109 ? LEU Y  112 ? ALA Y 133 LEU Y 136 
AN8 2 TRP Y  43  ? PHE Y  50  ? TRP Y 67  PHE Y 74  
AN8 3 HIS Y  171 ? GLU Y  179 ? HIS Y 195 GLU Y 203 
AN8 4 GLY Y  93  ? VAL Y  99  ? GLY Y 117 VAL Y 123 
AN8 5 HIS Y  124 ? GLN Y  128 ? HIS Y 148 GLN Y 152 
AN9 1 ALA Y  109 ? LEU Y  112 ? ALA Y 133 LEU Y 136 
AN9 2 TRP Y  43  ? PHE Y  50  ? TRP Y 67  PHE Y 74  
AN9 3 HIS Y  171 ? GLU Y  179 ? HIS Y 195 GLU Y 203 
AN9 4 LYS Y  140 ? PRO Y  141 ? LYS Y 164 PRO Y 165 
AO1 1 HIS Z  20  ? ILE Z  33  ? HIS Z 44  ILE Z 57  
AO1 2 GLN Z  185 ? PHE Z  200 ? GLN Z 209 PHE Z 224 
AO1 3 PHE Z  69  ? PRO Z  83  ? PHE Z 93  PRO Z 107 
AO1 4 HIS Z  133 ? PHE Z  137 ? HIS Z 157 PHE Z 161 
AO2 1 HIS Z  20  ? ILE Z  33  ? HIS Z 44  ILE Z 57  
AO2 2 GLN Z  185 ? PHE Z  200 ? GLN Z 209 PHE Z 224 
AO2 3 PHE Z  69  ? PRO Z  83  ? PHE Z 93  PRO Z 107 
AO2 4 TRP Z  160 ? ARG Z  162 ? TRP Z 184 ARG Z 186 
AO2 5 TYR AA 149 ? PHE AA 150 ? TYR 1 173 PHE 1 174 
AO3 1 ALA Z  109 ? LEU Z  112 ? ALA Z 133 LEU Z 136 
AO3 2 TRP Z  43  ? PHE Z  50  ? TRP Z 67  PHE Z 74  
AO3 3 HIS Z  171 ? GLU Z  179 ? HIS Z 195 GLU Z 203 
AO3 4 GLY Z  93  ? VAL Z  99  ? GLY Z 117 VAL Z 123 
AO3 5 HIS Z  124 ? GLN Z  128 ? HIS Z 148 GLN Z 152 
AO4 1 ALA Z  109 ? LEU Z  112 ? ALA Z 133 LEU Z 136 
AO4 2 TRP Z  43  ? PHE Z  50  ? TRP Z 67  PHE Z 74  
AO4 3 HIS Z  171 ? GLU Z  179 ? HIS Z 195 GLU Z 203 
AO4 4 LYS Z  140 ? PRO Z  141 ? LYS Z 164 PRO Z 165 
AO5 1 PRO Z  58  ? GLY Z  60  ? PRO Z 82  GLY Z 84  
AO5 2 ASN Z  63  ? ARG Z  65  ? ASN Z 87  ARG Z 89  
AO6 1 HIS AA 20  ? ILE AA 33  ? HIS 1 44  ILE 1 57  
AO6 2 GLN AA 185 ? PHE AA 200 ? GLN 1 209 PHE 1 224 
AO6 3 PHE AA 69  ? PRO AA 83  ? PHE 1 93  PRO 1 107 
AO6 4 HIS AA 133 ? PHE AA 137 ? HIS 1 157 PHE 1 161 
AO7 1 HIS AA 20  ? ILE AA 33  ? HIS 1 44  ILE 1 57  
AO7 2 GLN AA 185 ? PHE AA 200 ? GLN 1 209 PHE 1 224 
AO7 3 PHE AA 69  ? PRO AA 83  ? PHE 1 93  PRO 1 107 
AO7 4 LEU AA 161 ? ARG AA 162 ? LEU 1 185 ARG 1 186 
AO8 1 ALA AA 109 ? LEU AA 112 ? ALA 1 133 LEU 1 136 
AO8 2 TRP AA 43  ? PHE AA 50  ? TRP 1 67  PHE 1 74  
AO8 3 HIS AA 171 ? GLU AA 179 ? HIS 1 195 GLU 1 203 
AO8 4 GLY AA 93  ? VAL AA 99  ? GLY 1 117 VAL 1 123 
AO8 5 HIS AA 124 ? GLN AA 128 ? HIS 1 148 GLN 1 152 
AO9 1 ALA AA 109 ? LEU AA 112 ? ALA 1 133 LEU 1 136 
AO9 2 TRP AA 43  ? PHE AA 50  ? TRP 1 67  PHE 1 74  
AO9 3 HIS AA 171 ? GLU AA 179 ? HIS 1 195 GLU 1 203 
AO9 4 LYS AA 140 ? PRO AA 141 ? LYS 1 164 PRO 1 165 
AP1 1 PRO AA 58  ? GLY AA 60  ? PRO 1 82  GLY 1 84  
AP1 2 ASN AA 63  ? ARG AA 65  ? ASN 1 87  ARG 1 89  
AP2 1 HIS BA 20  ? ILE BA 33  ? HIS 2 44  ILE 2 57  
AP2 2 GLN BA 185 ? PHE BA 200 ? GLN 2 209 PHE 2 224 
AP2 3 PHE BA 69  ? PRO BA 83  ? PHE 2 93  PRO 2 107 
AP2 4 HIS BA 133 ? PHE BA 137 ? HIS 2 157 PHE 2 161 
AP3 1 HIS BA 20  ? ILE BA 33  ? HIS 2 44  ILE 2 57  
AP3 2 GLN BA 185 ? PHE BA 200 ? GLN 2 209 PHE 2 224 
AP3 3 PHE BA 69  ? PRO BA 83  ? PHE 2 93  PRO 2 107 
AP3 4 TRP BA 160 ? ARG BA 162 ? TRP 2 184 ARG 2 186 
AP3 5 TYR SA 149 ? PHE SA 150 ? TYR j 173 PHE j 174 
AP4 1 ALA BA 109 ? LEU BA 112 ? ALA 2 133 LEU 2 136 
AP4 2 TRP BA 43  ? ASP BA 46  ? TRP 2 67  ASP 2 70  
AP4 3 LEU BA 174 ? GLU BA 179 ? LEU 2 198 GLU 2 203 
AP4 4 GLY BA 93  ? VAL BA 99  ? GLY 2 117 VAL 2 123 
AP4 5 HIS BA 124 ? GLN BA 128 ? HIS 2 148 GLN 2 152 
AP5 1 ARG BA 49  ? PHE BA 50  ? ARG 2 73  PHE 2 74  
AP5 2 HIS BA 171 ? VAL BA 172 ? HIS 2 195 VAL 2 196 
AP5 3 LYS BA 140 ? PRO BA 141 ? LYS 2 164 PRO 2 165 
AP6 1 PRO BA 58  ? GLY BA 60  ? PRO 2 82  GLY 2 84  
AP6 2 ASN BA 63  ? ARG BA 65  ? ASN 2 87  ARG 2 89  
AP7 1 TYR BA 149 ? PHE BA 150 ? TYR 2 173 PHE 2 174 
AP7 2 TRP QA 160 ? ARG QA 162 ? TRP h 184 ARG h 186 
AP7 3 PHE QA 69  ? PRO QA 83  ? PHE h 93  PRO h 107 
AP7 4 GLN QA 185 ? PHE QA 200 ? GLN h 209 PHE h 224 
AP7 5 HIS QA 20  ? ILE QA 33  ? HIS h 44  ILE h 57  
AP8 1 TYR BA 149 ? PHE BA 150 ? TYR 2 173 PHE 2 174 
AP8 2 TRP QA 160 ? ARG QA 162 ? TRP h 184 ARG h 186 
AP8 3 PHE QA 69  ? PRO QA 83  ? PHE h 93  PRO h 107 
AP8 4 HIS QA 133 ? PHE QA 137 ? HIS h 157 PHE h 161 
AP9 1 HIS CA 20  ? ILE CA 33  ? HIS 3 44  ILE 3 57  
AP9 2 GLN CA 185 ? PHE CA 200 ? GLN 3 209 PHE 3 224 
AP9 3 PHE CA 69  ? PRO CA 83  ? PHE 3 93  PRO 3 107 
AP9 4 HIS CA 133 ? PHE CA 137 ? HIS 3 157 PHE 3 161 
AQ1 1 HIS CA 20  ? ILE CA 33  ? HIS 3 44  ILE 3 57  
AQ1 2 GLN CA 185 ? PHE CA 200 ? GLN 3 209 PHE 3 224 
AQ1 3 PHE CA 69  ? PRO CA 83  ? PHE 3 93  PRO 3 107 
AQ1 4 TRP CA 160 ? ARG CA 162 ? TRP 3 184 ARG 3 186 
AQ1 5 TYR HA 149 ? PHE HA 150 ? TYR 8 173 PHE 8 174 
AQ2 1 ALA CA 109 ? LEU CA 112 ? ALA 3 133 LEU 3 136 
AQ2 2 TRP CA 43  ? PHE CA 50  ? TRP 3 67  PHE 3 74  
AQ2 3 HIS CA 171 ? GLU CA 179 ? HIS 3 195 GLU 3 203 
AQ2 4 GLY CA 93  ? VAL CA 99  ? GLY 3 117 VAL 3 123 
AQ2 5 HIS CA 124 ? GLN CA 128 ? HIS 3 148 GLN 3 152 
AQ3 1 ALA CA 109 ? LEU CA 112 ? ALA 3 133 LEU 3 136 
AQ3 2 TRP CA 43  ? PHE CA 50  ? TRP 3 67  PHE 3 74  
AQ3 3 HIS CA 171 ? GLU CA 179 ? HIS 3 195 GLU 3 203 
AQ3 4 LYS CA 140 ? PRO CA 141 ? LYS 3 164 PRO 3 165 
AQ4 1 PRO CA 58  ? GLY CA 60  ? PRO 3 82  GLY 3 84  
AQ4 2 ASN CA 63  ? ARG CA 65  ? ASN 3 87  ARG 3 89  
AQ5 1 ALA DA 109 ? LEU DA 112 ? ALA 4 133 LEU 4 136 
AQ5 2 TRP DA 43  ? PHE DA 50  ? TRP 4 67  PHE 4 74  
AQ5 3 HIS DA 171 ? GLU DA 179 ? HIS 4 195 GLU 4 203 
AQ5 4 VAL DA 94  ? VAL DA 99  ? VAL 4 118 VAL 4 123 
AQ5 5 HIS DA 124 ? THR DA 127 ? HIS 4 148 THR 4 151 
AQ6 1 ALA DA 109 ? LEU DA 112 ? ALA 4 133 LEU 4 136 
AQ6 2 TRP DA 43  ? PHE DA 50  ? TRP 4 67  PHE 4 74  
AQ6 3 HIS DA 171 ? GLU DA 179 ? HIS 4 195 GLU 4 203 
AQ6 4 LYS DA 140 ? PRO DA 141 ? LYS 4 164 PRO 4 165 
AQ7 1 PRO DA 58  ? GLY DA 60  ? PRO 4 82  GLY 4 84  
AQ7 2 ASN DA 63  ? ARG DA 65  ? ASN 4 87  ARG 4 89  
AQ8 1 TYR DA 149 ? PHE DA 150 ? TYR 4 173 PHE 4 174 
AQ8 2 TRP EA 160 ? ARG EA 162 ? TRP 5 184 ARG 5 186 
AQ8 3 PHE EA 69  ? PRO EA 83  ? PHE 5 93  PRO 5 107 
AQ8 4 GLN EA 185 ? PHE EA 200 ? GLN 5 209 PHE 5 224 
AQ8 5 HIS EA 20  ? ILE EA 33  ? HIS 5 44  ILE 5 57  
AQ9 1 TYR DA 149 ? PHE DA 150 ? TYR 4 173 PHE 4 174 
AQ9 2 TRP EA 160 ? ARG EA 162 ? TRP 5 184 ARG 5 186 
AQ9 3 PHE EA 69  ? PRO EA 83  ? PHE 5 93  PRO 5 107 
AQ9 4 HIS EA 133 ? PHE EA 137 ? HIS 5 157 PHE 5 161 
AR1 1 ALA EA 109 ? LEU EA 112 ? ALA 5 133 LEU 5 136 
AR1 2 TRP EA 43  ? PHE EA 50  ? TRP 5 67  PHE 5 74  
AR1 3 HIS EA 171 ? GLU EA 179 ? HIS 5 195 GLU 5 203 
AR1 4 GLY EA 93  ? VAL EA 99  ? GLY 5 117 VAL 5 123 
AR1 5 HIS EA 124 ? GLN EA 128 ? HIS 5 148 GLN 5 152 
AR2 1 ALA EA 109 ? LEU EA 112 ? ALA 5 133 LEU 5 136 
AR2 2 TRP EA 43  ? PHE EA 50  ? TRP 5 67  PHE 5 74  
AR2 3 HIS EA 171 ? GLU EA 179 ? HIS 5 195 GLU 5 203 
AR2 4 LYS EA 140 ? PRO EA 141 ? LYS 5 164 PRO 5 165 
AR3 1 HIS FA 20  ? ILE FA 33  ? HIS 6 44  ILE 6 57  
AR3 2 GLN FA 185 ? PHE FA 200 ? GLN 6 209 PHE 6 224 
AR3 3 PHE FA 69  ? PRO FA 83  ? PHE 6 93  PRO 6 107 
AR3 4 HIS FA 133 ? PHE FA 137 ? HIS 6 157 PHE 6 161 
AR4 1 HIS FA 20  ? ILE FA 33  ? HIS 6 44  ILE 6 57  
AR4 2 GLN FA 185 ? PHE FA 200 ? GLN 6 209 PHE 6 224 
AR4 3 PHE FA 69  ? PRO FA 83  ? PHE 6 93  PRO 6 107 
AR4 4 TRP FA 160 ? ARG FA 162 ? TRP 6 184 ARG 6 186 
AR4 5 TYR RA 149 ? PHE RA 150 ? TYR i 173 PHE i 174 
AR5 1 ALA FA 109 ? LEU FA 112 ? ALA 6 133 LEU 6 136 
AR5 2 TRP FA 43  ? PHE FA 50  ? TRP 6 67  PHE 6 74  
AR5 3 HIS FA 171 ? GLU FA 179 ? HIS 6 195 GLU 6 203 
AR5 4 GLY FA 93  ? VAL FA 99  ? GLY 6 117 VAL 6 123 
AR5 5 HIS FA 124 ? GLN FA 128 ? HIS 6 148 GLN 6 152 
AR6 1 ALA FA 109 ? LEU FA 112 ? ALA 6 133 LEU 6 136 
AR6 2 TRP FA 43  ? PHE FA 50  ? TRP 6 67  PHE 6 74  
AR6 3 HIS FA 171 ? GLU FA 179 ? HIS 6 195 GLU 6 203 
AR6 4 LYS FA 140 ? PRO FA 141 ? LYS 6 164 PRO 6 165 
AR7 1 PRO FA 58  ? GLY FA 60  ? PRO 6 82  GLY 6 84  
AR7 2 ASN FA 63  ? ARG FA 65  ? ASN 6 87  ARG 6 89  
AR8 1 TYR FA 149 ? PHE FA 150 ? TYR 6 173 PHE 6 174 
AR8 2 TRP UA 160 ? ARG UA 162 ? TRP l 184 ARG l 186 
AR8 3 PHE UA 69  ? PRO UA 83  ? PHE l 93  PRO l 107 
AR8 4 GLN UA 185 ? PHE UA 200 ? GLN l 209 PHE l 224 
AR8 5 HIS UA 20  ? ILE UA 33  ? HIS l 44  ILE l 57  
AR9 1 TYR FA 149 ? PHE FA 150 ? TYR 6 173 PHE 6 174 
AR9 2 TRP UA 160 ? ARG UA 162 ? TRP l 184 ARG l 186 
AR9 3 PHE UA 69  ? PRO UA 83  ? PHE l 93  PRO l 107 
AR9 4 HIS UA 133 ? PHE UA 137 ? HIS l 157 PHE l 161 
AS1 1 HIS GA 20  ? ILE GA 33  ? HIS 7 44  ILE 7 57  
AS1 2 GLN GA 185 ? PHE GA 200 ? GLN 7 209 PHE 7 224 
AS1 3 PHE GA 69  ? PRO GA 83  ? PHE 7 93  PRO 7 107 
AS1 4 HIS GA 133 ? PHE GA 137 ? HIS 7 157 PHE 7 161 
AS2 1 HIS GA 20  ? ILE GA 33  ? HIS 7 44  ILE 7 57  
AS2 2 GLN GA 185 ? PHE GA 200 ? GLN 7 209 PHE 7 224 
AS2 3 PHE GA 69  ? PRO GA 83  ? PHE 7 93  PRO 7 107 
AS2 4 TRP GA 160 ? ARG GA 162 ? TRP 7 184 ARG 7 186 
AS2 5 TYR XA 149 ? PHE XA 150 ? TYR o 173 PHE o 174 
AS3 1 ALA GA 109 ? LEU GA 112 ? ALA 7 133 LEU 7 136 
AS3 2 TRP GA 43  ? PHE GA 50  ? TRP 7 67  PHE 7 74  
AS3 3 HIS GA 171 ? GLU GA 179 ? HIS 7 195 GLU 7 203 
AS3 4 GLY GA 93  ? VAL GA 99  ? GLY 7 117 VAL 7 123 
AS3 5 HIS GA 124 ? GLN GA 128 ? HIS 7 148 GLN 7 152 
AS4 1 ALA GA 109 ? LEU GA 112 ? ALA 7 133 LEU 7 136 
AS4 2 TRP GA 43  ? PHE GA 50  ? TRP 7 67  PHE 7 74  
AS4 3 HIS GA 171 ? GLU GA 179 ? HIS 7 195 GLU 7 203 
AS4 4 LYS GA 140 ? PRO GA 141 ? LYS 7 164 PRO 7 165 
AS5 1 PRO GA 58  ? GLY GA 60  ? PRO 7 82  GLY 7 84  
AS5 2 ASN GA 63  ? ARG GA 65  ? ASN 7 87  ARG 7 89  
AS6 1 TYR GA 149 ? PHE GA 150 ? TYR 7 173 PHE 7 174 
AS6 2 TRP ZA 160 ? ARG ZA 162 ? TRP q 184 ARG q 186 
AS6 3 PHE ZA 69  ? PRO ZA 83  ? PHE q 93  PRO q 107 
AS6 4 GLN ZA 185 ? PHE ZA 200 ? GLN q 209 PHE q 224 
AS6 5 HIS ZA 20  ? ILE ZA 33  ? HIS q 44  ILE q 57  
AS7 1 TYR GA 149 ? PHE GA 150 ? TYR 7 173 PHE 7 174 
AS7 2 TRP ZA 160 ? ARG ZA 162 ? TRP q 184 ARG q 186 
AS7 3 PHE ZA 69  ? PRO ZA 83  ? PHE q 93  PRO q 107 
AS7 4 HIS ZA 133 ? PHE ZA 137 ? HIS q 157 PHE q 161 
AS8 1 ALA HA 109 ? LEU HA 112 ? ALA 8 133 LEU 8 136 
AS8 2 TRP HA 43  ? PHE HA 50  ? TRP 8 67  PHE 8 74  
AS8 3 HIS HA 171 ? GLU HA 179 ? HIS 8 195 GLU 8 203 
AS8 4 GLY HA 93  ? VAL HA 99  ? GLY 8 117 VAL 8 123 
AS8 5 HIS HA 124 ? GLN HA 128 ? HIS 8 148 GLN 8 152 
AS9 1 ALA HA 109 ? LEU HA 112 ? ALA 8 133 LEU 8 136 
AS9 2 TRP HA 43  ? PHE HA 50  ? TRP 8 67  PHE 8 74  
AS9 3 HIS HA 171 ? GLU HA 179 ? HIS 8 195 GLU 8 203 
AS9 4 LYS HA 140 ? PRO HA 141 ? LYS 8 164 PRO 8 165 
AT1 1 PRO HA 58  ? GLY HA 60  ? PRO 8 82  GLY 8 84  
AT1 2 ASN HA 63  ? ARG HA 65  ? ASN 8 87  ARG 8 89  
AT2 1 HIS IA 20  ? ILE IA 33  ? HIS 9 44  ILE 9 57  
AT2 2 GLN IA 185 ? PHE IA 200 ? GLN 9 209 PHE 9 224 
AT2 3 PHE IA 69  ? PRO IA 83  ? PHE 9 93  PRO 9 107 
AT2 4 HIS IA 133 ? PHE IA 137 ? HIS 9 157 PHE 9 161 
AT3 1 HIS IA 20  ? ILE IA 33  ? HIS 9 44  ILE 9 57  
AT3 2 GLN IA 185 ? PHE IA 200 ? GLN 9 209 PHE 9 224 
AT3 3 PHE IA 69  ? PRO IA 83  ? PHE 9 93  PRO 9 107 
AT3 4 LEU IA 161 ? ARG IA 162 ? LEU 9 185 ARG 9 186 
AT4 1 ALA IA 109 ? LEU IA 112 ? ALA 9 133 LEU 9 136 
AT4 2 TRP IA 43  ? PHE IA 50  ? TRP 9 67  PHE 9 74  
AT4 3 HIS IA 171 ? GLU IA 179 ? HIS 9 195 GLU 9 203 
AT4 4 GLY IA 93  ? VAL IA 99  ? GLY 9 117 VAL 9 123 
AT4 5 HIS IA 124 ? GLN IA 128 ? HIS 9 148 GLN 9 152 
AT5 1 ALA IA 109 ? LEU IA 112 ? ALA 9 133 LEU 9 136 
AT5 2 TRP IA 43  ? PHE IA 50  ? TRP 9 67  PHE 9 74  
AT5 3 HIS IA 171 ? GLU IA 179 ? HIS 9 195 GLU 9 203 
AT5 4 LYS IA 140 ? PRO IA 141 ? LYS 9 164 PRO 9 165 
AT6 1 PRO IA 58  ? GLY IA 60  ? PRO 9 82  GLY 9 84  
AT6 2 ASN IA 63  ? ARG IA 65  ? ASN 9 87  ARG 9 89  
AT7 1 HIS JA 20  ? ILE JA 33  ? HIS a 44  ILE a 57  
AT7 2 GLN JA 185 ? PHE JA 200 ? GLN a 209 PHE a 224 
AT7 3 PHE JA 69  ? PRO JA 83  ? PHE a 93  PRO a 107 
AT7 4 HIS JA 133 ? PHE JA 137 ? HIS a 157 PHE a 161 
AT8 1 HIS JA 20  ? ILE JA 33  ? HIS a 44  ILE a 57  
AT8 2 GLN JA 185 ? PHE JA 200 ? GLN a 209 PHE a 224 
AT8 3 PHE JA 69  ? PRO JA 83  ? PHE a 93  PRO a 107 
AT8 4 TRP JA 160 ? ARG JA 162 ? TRP a 184 ARG a 186 
AT8 5 TYR YA 149 ? PHE YA 150 ? TYR p 173 PHE p 174 
AT9 1 ALA JA 109 ? LEU JA 112 ? ALA a 133 LEU a 136 
AT9 2 TRP JA 43  ? PHE JA 50  ? TRP a 67  PHE a 74  
AT9 3 HIS JA 171 ? GLU JA 179 ? HIS a 195 GLU a 203 
AT9 4 GLY JA 93  ? VAL JA 99  ? GLY a 117 VAL a 123 
AT9 5 HIS JA 124 ? GLN JA 128 ? HIS a 148 GLN a 152 
AU1 1 ALA JA 109 ? LEU JA 112 ? ALA a 133 LEU a 136 
AU1 2 TRP JA 43  ? PHE JA 50  ? TRP a 67  PHE a 74  
AU1 3 HIS JA 171 ? GLU JA 179 ? HIS a 195 GLU a 203 
AU1 4 LYS JA 140 ? PRO JA 141 ? LYS a 164 PRO a 165 
AU2 1 PRO JA 58  ? GLY JA 60  ? PRO a 82  GLY a 84  
AU2 2 ASN JA 63  ? ARG JA 65  ? ASN a 87  ARG a 89  
AU3 1 TYR JA 149 ? PHE JA 150 ? TYR a 173 PHE a 174 
AU3 2 TRP BB 160 ? ARG BB 162 ? TRP s 184 ARG s 186 
AU3 3 PHE BB 69  ? PRO BB 83  ? PHE s 93  PRO s 107 
AU3 4 GLN BB 185 ? PHE BB 200 ? GLN s 209 PHE s 224 
AU3 5 HIS BB 20  ? ILE BB 33  ? HIS s 44  ILE s 57  
AU4 1 TYR JA 149 ? PHE JA 150 ? TYR a 173 PHE a 174 
AU4 2 TRP BB 160 ? ARG BB 162 ? TRP s 184 ARG s 186 
AU4 3 PHE BB 69  ? PRO BB 83  ? PHE s 93  PRO s 107 
AU4 4 HIS BB 133 ? PHE BB 137 ? HIS s 157 PHE s 161 
AU5 1 HIS KA 20  ? ILE KA 33  ? HIS b 44  ILE b 57  
AU5 2 GLN KA 185 ? PHE KA 200 ? GLN b 209 PHE b 224 
AU5 3 PHE KA 69  ? PRO KA 83  ? PHE b 93  PRO b 107 
AU5 4 HIS KA 133 ? PHE KA 137 ? HIS b 157 PHE b 161 
AU6 1 HIS KA 20  ? ILE KA 33  ? HIS b 44  ILE b 57  
AU6 2 GLN KA 185 ? PHE KA 200 ? GLN b 209 PHE b 224 
AU6 3 PHE KA 69  ? PRO KA 83  ? PHE b 93  PRO b 107 
AU6 4 TRP KA 160 ? ARG KA 162 ? TRP b 184 ARG b 186 
AU6 5 TYR PA 149 ? PHE PA 150 ? TYR g 173 PHE g 174 
AU7 1 ALA KA 109 ? LEU KA 112 ? ALA b 133 LEU b 136 
AU7 2 TRP KA 43  ? ASP KA 46  ? TRP b 67  ASP b 70  
AU7 3 LEU KA 174 ? GLU KA 179 ? LEU b 198 GLU b 203 
AU7 4 GLY KA 93  ? VAL KA 99  ? GLY b 117 VAL b 123 
AU7 5 HIS KA 124 ? GLN KA 128 ? HIS b 148 GLN b 152 
AU8 1 ARG KA 49  ? PHE KA 50  ? ARG b 73  PHE b 74  
AU8 2 HIS KA 171 ? VAL KA 172 ? HIS b 195 VAL b 196 
AU8 3 LYS KA 140 ? PRO KA 141 ? LYS b 164 PRO b 165 
AU9 1 PRO KA 58  ? GLY KA 60  ? PRO b 82  GLY b 84  
AU9 2 ASN KA 63  ? ARG KA 65  ? ASN b 87  ARG b 89  
AV1 1 ALA LA 109 ? LEU LA 112 ? ALA c 133 LEU c 136 
AV1 2 TRP LA 43  ? PHE LA 50  ? TRP c 67  PHE c 74  
AV1 3 HIS LA 171 ? GLU LA 179 ? HIS c 195 GLU c 203 
AV1 4 GLY LA 93  ? VAL LA 99  ? GLY c 117 VAL c 123 
AV1 5 HIS LA 124 ? GLN LA 128 ? HIS c 148 GLN c 152 
AV2 1 ALA LA 109 ? LEU LA 112 ? ALA c 133 LEU c 136 
AV2 2 TRP LA 43  ? PHE LA 50  ? TRP c 67  PHE c 74  
AV2 3 HIS LA 171 ? GLU LA 179 ? HIS c 195 GLU c 203 
AV2 4 LYS LA 140 ? PRO LA 141 ? LYS c 164 PRO c 165 
AV3 1 HIS MA 20  ? ILE MA 33  ? HIS d 44  ILE d 57  
AV3 2 GLN MA 185 ? PHE MA 200 ? GLN d 209 PHE d 224 
AV3 3 PHE MA 69  ? PRO MA 83  ? PHE d 93  PRO d 107 
AV3 4 HIS MA 133 ? PHE MA 137 ? HIS d 157 PHE d 161 
AV4 1 HIS MA 20  ? ILE MA 33  ? HIS d 44  ILE d 57  
AV4 2 GLN MA 185 ? PHE MA 200 ? GLN d 209 PHE d 224 
AV4 3 PHE MA 69  ? PRO MA 83  ? PHE d 93  PRO d 107 
AV4 4 LEU MA 161 ? ARG MA 162 ? LEU d 185 ARG d 186 
AV5 1 ALA MA 109 ? LEU MA 112 ? ALA d 133 LEU d 136 
AV5 2 TRP MA 43  ? PHE MA 50  ? TRP d 67  PHE d 74  
AV5 3 HIS MA 171 ? GLU MA 179 ? HIS d 195 GLU d 203 
AV5 4 GLY MA 93  ? VAL MA 99  ? GLY d 117 VAL d 123 
AV5 5 HIS MA 124 ? GLN MA 128 ? HIS d 148 GLN d 152 
AV6 1 ALA MA 109 ? LEU MA 112 ? ALA d 133 LEU d 136 
AV6 2 TRP MA 43  ? PHE MA 50  ? TRP d 67  PHE d 74  
AV6 3 HIS MA 171 ? GLU MA 179 ? HIS d 195 GLU d 203 
AV6 4 LYS MA 140 ? PRO MA 141 ? LYS d 164 PRO d 165 
AV7 1 HIS NA 20  ? ILE NA 33  ? HIS e 44  ILE e 57  
AV7 2 GLN NA 185 ? PHE NA 200 ? GLN e 209 PHE e 224 
AV7 3 PHE NA 69  ? PRO NA 83  ? PHE e 93  PRO e 107 
AV7 4 HIS NA 133 ? PHE NA 137 ? HIS e 157 PHE e 161 
AV8 1 HIS NA 20  ? ILE NA 33  ? HIS e 44  ILE e 57  
AV8 2 GLN NA 185 ? PHE NA 200 ? GLN e 209 PHE e 224 
AV8 3 PHE NA 69  ? PRO NA 83  ? PHE e 93  PRO e 107 
AV8 4 LEU NA 161 ? ARG NA 162 ? LEU e 185 ARG e 186 
AV9 1 ALA NA 109 ? LEU NA 112 ? ALA e 133 LEU e 136 
AV9 2 TRP NA 43  ? PHE NA 50  ? TRP e 67  PHE e 74  
AV9 3 HIS NA 171 ? GLU NA 179 ? HIS e 195 GLU e 203 
AV9 4 VAL NA 94  ? VAL NA 99  ? VAL e 118 VAL e 123 
AV9 5 HIS NA 124 ? THR NA 127 ? HIS e 148 THR e 151 
AW1 1 ALA NA 109 ? LEU NA 112 ? ALA e 133 LEU e 136 
AW1 2 TRP NA 43  ? PHE NA 50  ? TRP e 67  PHE e 74  
AW1 3 HIS NA 171 ? GLU NA 179 ? HIS e 195 GLU e 203 
AW1 4 LYS NA 140 ? PRO NA 141 ? LYS e 164 PRO e 165 
AW2 1 TYR NA 149 ? PHE NA 150 ? TYR e 173 PHE e 174 
AW2 2 TRP DB 160 ? ARG DB 162 ? TRP u 184 ARG u 186 
AW2 3 PHE DB 69  ? PRO DB 83  ? PHE u 93  PRO u 107 
AW2 4 GLN DB 185 ? PHE DB 200 ? GLN u 209 PHE u 224 
AW2 5 HIS DB 20  ? ILE DB 33  ? HIS u 44  ILE u 57  
AW3 1 TYR NA 149 ? PHE NA 150 ? TYR e 173 PHE e 174 
AW3 2 TRP DB 160 ? ARG DB 162 ? TRP u 184 ARG u 186 
AW3 3 PHE DB 69  ? PRO DB 83  ? PHE u 93  PRO u 107 
AW3 4 HIS DB 133 ? PHE DB 137 ? HIS u 157 PHE u 161 
AW4 1 HIS OA 20  ? ILE OA 33  ? HIS f 44  ILE f 57  
AW4 2 GLN OA 185 ? PHE OA 200 ? GLN f 209 PHE f 224 
AW4 3 PHE OA 69  ? PRO OA 83  ? PHE f 93  PRO f 107 
AW4 4 HIS OA 133 ? PHE OA 137 ? HIS f 157 PHE f 161 
AW5 1 HIS OA 20  ? ILE OA 33  ? HIS f 44  ILE f 57  
AW5 2 GLN OA 185 ? PHE OA 200 ? GLN f 209 PHE f 224 
AW5 3 PHE OA 69  ? PRO OA 83  ? PHE f 93  PRO f 107 
AW5 4 TRP OA 160 ? ARG OA 162 ? TRP f 184 ARG f 186 
AW5 5 TYR EB 149 ? PHE EB 150 ? TYR v 173 PHE v 174 
AW6 1 ALA OA 109 ? LEU OA 112 ? ALA f 133 LEU f 136 
AW6 2 TRP OA 43  ? PHE OA 50  ? TRP f 67  PHE f 74  
AW6 3 HIS OA 171 ? GLU OA 179 ? HIS f 195 GLU f 203 
AW6 4 GLY OA 93  ? VAL OA 99  ? GLY f 117 VAL f 123 
AW6 5 HIS OA 124 ? GLN OA 128 ? HIS f 148 GLN f 152 
AW7 1 ALA OA 109 ? LEU OA 112 ? ALA f 133 LEU f 136 
AW7 2 TRP OA 43  ? PHE OA 50  ? TRP f 67  PHE f 74  
AW7 3 HIS OA 171 ? GLU OA 179 ? HIS f 195 GLU f 203 
AW7 4 LYS OA 140 ? PRO OA 141 ? LYS f 164 PRO f 165 
AW8 1 PRO OA 58  ? GLY OA 60  ? PRO f 82  GLY f 84  
AW8 2 ASN OA 63  ? ARG OA 65  ? ASN f 87  ARG f 89  
AW9 1 TYR OA 149 ? PHE OA 150 ? TYR f 173 PHE f 174 
AW9 2 TRP TA 160 ? ARG TA 162 ? TRP k 184 ARG k 186 
AW9 3 PHE TA 69  ? PRO TA 83  ? PHE k 93  PRO k 107 
AW9 4 GLN TA 185 ? PHE TA 200 ? GLN k 209 PHE k 224 
AW9 5 HIS TA 20  ? ILE TA 33  ? HIS k 44  ILE k 57  
AX1 1 TYR OA 149 ? PHE OA 150 ? TYR f 173 PHE f 174 
AX1 2 TRP TA 160 ? ARG TA 162 ? TRP k 184 ARG k 186 
AX1 3 PHE TA 69  ? PRO TA 83  ? PHE k 93  PRO k 107 
AX1 4 HIS TA 133 ? PHE TA 137 ? HIS k 157 PHE k 161 
AX2 1 ALA PA 109 ? LEU PA 112 ? ALA g 133 LEU g 136 
AX2 2 TRP PA 43  ? ASP PA 46  ? TRP g 67  ASP g 70  
AX2 3 LEU PA 174 ? GLU PA 179 ? LEU g 198 GLU g 203 
AX2 4 GLY PA 93  ? VAL PA 99  ? GLY g 117 VAL g 123 
AX2 5 HIS PA 124 ? GLN PA 128 ? HIS g 148 GLN g 152 
AX3 1 ARG PA 49  ? PHE PA 50  ? ARG g 73  PHE g 74  
AX3 2 HIS PA 171 ? VAL PA 172 ? HIS g 195 VAL g 196 
AX3 3 LYS PA 140 ? PRO PA 141 ? LYS g 164 PRO g 165 
AX4 1 PRO PA 58  ? GLY PA 60  ? PRO g 82  GLY g 84  
AX4 2 ASN PA 63  ? ARG PA 65  ? ASN g 87  ARG g 89  
AX5 1 ALA QA 109 ? LEU QA 112 ? ALA h 133 LEU h 136 
AX5 2 TRP QA 43  ? PHE QA 50  ? TRP h 67  PHE h 74  
AX5 3 HIS QA 171 ? GLU QA 179 ? HIS h 195 GLU h 203 
AX5 4 GLY QA 93  ? VAL QA 99  ? GLY h 117 VAL h 123 
AX5 5 HIS QA 124 ? GLN QA 128 ? HIS h 148 GLN h 152 
AX6 1 ALA QA 109 ? LEU QA 112 ? ALA h 133 LEU h 136 
AX6 2 TRP QA 43  ? PHE QA 50  ? TRP h 67  PHE h 74  
AX6 3 HIS QA 171 ? GLU QA 179 ? HIS h 195 GLU h 203 
AX6 4 LYS QA 140 ? PRO QA 141 ? LYS h 164 PRO h 165 
AX7 1 PRO QA 58  ? GLY QA 60  ? PRO h 82  GLY h 84  
AX7 2 ASN QA 63  ? ARG QA 65  ? ASN h 87  ARG h 89  
AX8 1 TYR QA 149 ? PHE QA 150 ? TYR h 173 PHE h 174 
AX8 2 TRP SA 160 ? ARG SA 162 ? TRP j 184 ARG j 186 
AX8 3 PHE SA 69  ? PRO SA 83  ? PHE j 93  PRO j 107 
AX8 4 GLN SA 185 ? PHE SA 200 ? GLN j 209 PHE j 224 
AX8 5 HIS SA 20  ? ILE SA 33  ? HIS j 44  ILE j 57  
AX9 1 TYR QA 149 ? PHE QA 150 ? TYR h 173 PHE h 174 
AX9 2 TRP SA 160 ? ARG SA 162 ? TRP j 184 ARG j 186 
AX9 3 PHE SA 69  ? PRO SA 83  ? PHE j 93  PRO j 107 
AX9 4 HIS SA 133 ? PHE SA 137 ? HIS j 157 PHE j 161 
AY1 1 HIS RA 20  ? ILE RA 33  ? HIS i 44  ILE i 57  
AY1 2 GLN RA 185 ? PHE RA 200 ? GLN i 209 PHE i 224 
AY1 3 PHE RA 69  ? PRO RA 83  ? PHE i 93  PRO i 107 
AY1 4 HIS RA 133 ? PHE RA 137 ? HIS i 157 PHE i 161 
AY2 1 HIS RA 20  ? ILE RA 33  ? HIS i 44  ILE i 57  
AY2 2 GLN RA 185 ? PHE RA 200 ? GLN i 209 PHE i 224 
AY2 3 PHE RA 69  ? PRO RA 83  ? PHE i 93  PRO i 107 
AY2 4 TRP RA 160 ? ARG RA 162 ? TRP i 184 ARG i 186 
AY2 5 TYR UA 149 ? PHE UA 150 ? TYR l 173 PHE l 174 
AY3 1 ALA RA 109 ? LEU RA 112 ? ALA i 133 LEU i 136 
AY3 2 TRP RA 43  ? PHE RA 50  ? TRP i 67  PHE i 74  
AY3 3 HIS RA 171 ? GLU RA 179 ? HIS i 195 GLU i 203 
AY3 4 GLY RA 93  ? VAL RA 99  ? GLY i 117 VAL i 123 
AY3 5 HIS RA 124 ? GLN RA 128 ? HIS i 148 GLN i 152 
AY4 1 ALA RA 109 ? LEU RA 112 ? ALA i 133 LEU i 136 
AY4 2 TRP RA 43  ? PHE RA 50  ? TRP i 67  PHE i 74  
AY4 3 HIS RA 171 ? GLU RA 179 ? HIS i 195 GLU i 203 
AY4 4 LYS RA 140 ? PRO RA 141 ? LYS i 164 PRO i 165 
AY5 1 PRO RA 58  ? GLY RA 60  ? PRO i 82  GLY i 84  
AY5 2 ASN RA 63  ? ARG RA 65  ? ASN i 87  ARG i 89  
AY6 1 ALA SA 109 ? LEU SA 112 ? ALA j 133 LEU j 136 
AY6 2 TRP SA 43  ? PHE SA 50  ? TRP j 67  PHE j 74  
AY6 3 HIS SA 171 ? GLU SA 179 ? HIS j 195 GLU j 203 
AY6 4 GLY SA 93  ? VAL SA 99  ? GLY j 117 VAL j 123 
AY6 5 HIS SA 124 ? GLN SA 128 ? HIS j 148 GLN j 152 
AY7 1 ALA SA 109 ? LEU SA 112 ? ALA j 133 LEU j 136 
AY7 2 TRP SA 43  ? PHE SA 50  ? TRP j 67  PHE j 74  
AY7 3 HIS SA 171 ? GLU SA 179 ? HIS j 195 GLU j 203 
AY7 4 LYS SA 140 ? PRO SA 141 ? LYS j 164 PRO j 165 
AY8 1 PRO SA 58  ? GLY SA 60  ? PRO j 82  GLY j 84  
AY8 2 ASN SA 63  ? ARG SA 65  ? ASN j 87  ARG j 89  
AY9 1 ALA TA 109 ? LEU TA 112 ? ALA k 133 LEU k 136 
AY9 2 TRP TA 43  ? PHE TA 50  ? TRP k 67  PHE k 74  
AY9 3 HIS TA 171 ? GLU TA 179 ? HIS k 195 GLU k 203 
AY9 4 GLY TA 93  ? VAL TA 99  ? GLY k 117 VAL k 123 
AY9 5 HIS TA 124 ? GLN TA 128 ? HIS k 148 GLN k 152 
AZ1 1 ALA TA 109 ? LEU TA 112 ? ALA k 133 LEU k 136 
AZ1 2 TRP TA 43  ? PHE TA 50  ? TRP k 67  PHE k 74  
AZ1 3 HIS TA 171 ? GLU TA 179 ? HIS k 195 GLU k 203 
AZ1 4 LYS TA 140 ? PRO TA 141 ? LYS k 164 PRO k 165 
AZ2 1 PRO TA 58  ? GLY TA 60  ? PRO k 82  GLY k 84  
AZ2 2 ASN TA 63  ? ARG TA 65  ? ASN k 87  ARG k 89  
AZ3 1 TYR TA 149 ? PHE TA 150 ? TYR k 173 PHE k 174 
AZ3 2 TRP EB 160 ? ARG EB 162 ? TRP v 184 ARG v 186 
AZ3 3 PHE EB 69  ? PRO EB 83  ? PHE v 93  PRO v 107 
AZ3 4 GLN EB 185 ? PHE EB 200 ? GLN v 209 PHE v 224 
AZ3 5 HIS EB 20  ? ILE EB 33  ? HIS v 44  ILE v 57  
AZ4 1 TYR TA 149 ? PHE TA 150 ? TYR k 173 PHE k 174 
AZ4 2 TRP EB 160 ? ARG EB 162 ? TRP v 184 ARG v 186 
AZ4 3 PHE EB 69  ? PRO EB 83  ? PHE v 93  PRO v 107 
AZ4 4 HIS EB 133 ? PHE EB 137 ? HIS v 157 PHE v 161 
AZ5 1 ALA UA 109 ? LEU UA 112 ? ALA l 133 LEU l 136 
AZ5 2 TRP UA 43  ? PHE UA 50  ? TRP l 67  PHE l 74  
AZ5 3 HIS UA 171 ? GLU UA 179 ? HIS l 195 GLU l 203 
AZ5 4 GLY UA 93  ? VAL UA 99  ? GLY l 117 VAL l 123 
AZ5 5 HIS UA 124 ? GLN UA 128 ? HIS l 148 GLN l 152 
AZ6 1 ALA UA 109 ? LEU UA 112 ? ALA l 133 LEU l 136 
AZ6 2 TRP UA 43  ? PHE UA 50  ? TRP l 67  PHE l 74  
AZ6 3 HIS UA 171 ? GLU UA 179 ? HIS l 195 GLU l 203 
AZ6 4 LYS UA 140 ? PRO UA 141 ? LYS l 164 PRO l 165 
AZ7 1 PRO UA 58  ? GLY UA 60  ? PRO l 82  GLY l 84  
AZ7 2 ASN UA 63  ? ARG UA 65  ? ASN l 87  ARG l 89  
AZ8 1 HIS VA 20  ? ILE VA 33  ? HIS m 44  ILE m 57  
AZ8 2 GLN VA 185 ? PHE VA 200 ? GLN m 209 PHE m 224 
AZ8 3 PHE VA 69  ? PRO VA 83  ? PHE m 93  PRO m 107 
AZ8 4 HIS VA 133 ? PHE VA 137 ? HIS m 157 PHE m 161 
AZ9 1 HIS VA 20  ? ILE VA 33  ? HIS m 44  ILE m 57  
AZ9 2 GLN VA 185 ? PHE VA 200 ? GLN m 209 PHE m 224 
AZ9 3 PHE VA 69  ? PRO VA 83  ? PHE m 93  PRO m 107 
AZ9 4 TRP VA 160 ? ARG VA 162 ? TRP m 184 ARG m 186 
AZ9 5 TYR HB 149 ? PHE HB 150 ? TYR y 173 PHE y 174 
BA1 1 ALA VA 109 ? LEU VA 112 ? ALA m 133 LEU m 136 
BA1 2 TRP VA 43  ? PHE VA 50  ? TRP m 67  PHE m 74  
BA1 3 HIS VA 171 ? GLU VA 179 ? HIS m 195 GLU m 203 
BA1 4 GLY VA 93  ? VAL VA 99  ? GLY m 117 VAL m 123 
BA1 5 HIS VA 124 ? GLN VA 128 ? HIS m 148 GLN m 152 
BA2 1 ALA VA 109 ? LEU VA 112 ? ALA m 133 LEU m 136 
BA2 2 TRP VA 43  ? PHE VA 50  ? TRP m 67  PHE m 74  
BA2 3 HIS VA 171 ? GLU VA 179 ? HIS m 195 GLU m 203 
BA2 4 LYS VA 140 ? PRO VA 141 ? LYS m 164 PRO m 165 
BA3 1 PRO VA 58  ? GLY VA 60  ? PRO m 82  GLY m 84  
BA3 2 ASN VA 63  ? ARG VA 65  ? ASN m 87  ARG m 89  
BA4 1 TYR VA 149 ? PHE VA 150 ? TYR m 173 PHE m 174 
BA4 2 TRP WA 160 ? ARG WA 162 ? TRP n 184 ARG n 186 
BA4 3 PHE WA 69  ? PRO WA 83  ? PHE n 93  PRO n 107 
BA4 4 GLN WA 185 ? PHE WA 200 ? GLN n 209 PHE n 224 
BA4 5 HIS WA 20  ? ILE WA 33  ? HIS n 44  ILE n 57  
BA5 1 TYR VA 149 ? PHE VA 150 ? TYR m 173 PHE m 174 
BA5 2 TRP WA 160 ? ARG WA 162 ? TRP n 184 ARG n 186 
BA5 3 PHE WA 69  ? PRO WA 83  ? PHE n 93  PRO n 107 
BA5 4 HIS WA 133 ? PHE WA 137 ? HIS n 157 PHE n 161 
BA6 1 ALA WA 109 ? LEU WA 112 ? ALA n 133 LEU n 136 
BA6 2 TRP WA 43  ? PHE WA 50  ? TRP n 67  PHE n 74  
BA6 3 HIS WA 171 ? GLU WA 179 ? HIS n 195 GLU n 203 
BA6 4 GLY WA 93  ? VAL WA 99  ? GLY n 117 VAL n 123 
BA6 5 HIS WA 124 ? GLN WA 128 ? HIS n 148 GLN n 152 
BA7 1 ALA WA 109 ? LEU WA 112 ? ALA n 133 LEU n 136 
BA7 2 TRP WA 43  ? PHE WA 50  ? TRP n 67  PHE n 74  
BA7 3 HIS WA 171 ? GLU WA 179 ? HIS n 195 GLU n 203 
BA7 4 LYS WA 140 ? PRO WA 141 ? LYS n 164 PRO n 165 
BA8 1 PRO WA 58  ? GLY WA 60  ? PRO n 82  GLY n 84  
BA8 2 ASN WA 63  ? ARG WA 65  ? ASN n 87  ARG n 89  
BA9 1 TYR WA 149 ? PHE WA 150 ? TYR n 173 PHE n 174 
BA9 2 TRP HB 160 ? ARG HB 162 ? TRP y 184 ARG y 186 
BA9 3 PHE HB 69  ? PRO HB 83  ? PHE y 93  PRO y 107 
BA9 4 GLN HB 185 ? PHE HB 200 ? GLN y 209 PHE y 224 
BA9 5 HIS HB 20  ? ILE HB 33  ? HIS y 44  ILE y 57  
BB1 1 TYR WA 149 ? PHE WA 150 ? TYR n 173 PHE n 174 
BB1 2 TRP HB 160 ? ARG HB 162 ? TRP y 184 ARG y 186 
BB1 3 PHE HB 69  ? PRO HB 83  ? PHE y 93  PRO y 107 
BB1 4 HIS HB 133 ? PHE HB 137 ? HIS y 157 PHE y 161 
BB2 1 HIS XA 20  ? ILE XA 33  ? HIS o 44  ILE o 57  
BB2 2 GLN XA 185 ? PHE XA 200 ? GLN o 209 PHE o 224 
BB2 3 PHE XA 69  ? PRO XA 83  ? PHE o 93  PRO o 107 
BB2 4 HIS XA 133 ? PHE XA 137 ? HIS o 157 PHE o 161 
BB3 1 HIS XA 20  ? ILE XA 33  ? HIS o 44  ILE o 57  
BB3 2 GLN XA 185 ? PHE XA 200 ? GLN o 209 PHE o 224 
BB3 3 PHE XA 69  ? PRO XA 83  ? PHE o 93  PRO o 107 
BB3 4 TRP XA 160 ? ARG XA 162 ? TRP o 184 ARG o 186 
BB3 5 TYR ZA 149 ? PHE ZA 150 ? TYR q 173 PHE q 174 
BB4 1 ALA XA 109 ? LEU XA 112 ? ALA o 133 LEU o 136 
BB4 2 TRP XA 43  ? PHE XA 50  ? TRP o 67  PHE o 74  
BB4 3 HIS XA 171 ? GLU XA 179 ? HIS o 195 GLU o 203 
BB4 4 GLY XA 93  ? VAL XA 99  ? GLY o 117 VAL o 123 
BB4 5 HIS XA 124 ? GLN XA 128 ? HIS o 148 GLN o 152 
BB5 1 ALA XA 109 ? LEU XA 112 ? ALA o 133 LEU o 136 
BB5 2 TRP XA 43  ? PHE XA 50  ? TRP o 67  PHE o 74  
BB5 3 HIS XA 171 ? GLU XA 179 ? HIS o 195 GLU o 203 
BB5 4 LYS XA 140 ? PRO XA 141 ? LYS o 164 PRO o 165 
BB6 1 PRO XA 58  ? GLY XA 60  ? PRO o 82  GLY o 84  
BB6 2 ASN XA 63  ? ARG XA 65  ? ASN o 87  ARG o 89  
BB7 1 HIS YA 20  ? ILE YA 33  ? HIS p 44  ILE p 57  
BB7 2 GLN YA 185 ? PHE YA 200 ? GLN p 209 PHE p 224 
BB7 3 PHE YA 69  ? PRO YA 83  ? PHE p 93  PRO p 107 
BB7 4 HIS YA 133 ? PHE YA 137 ? HIS p 157 PHE p 161 
BB8 1 HIS YA 20  ? ILE YA 33  ? HIS p 44  ILE p 57  
BB8 2 GLN YA 185 ? PHE YA 200 ? GLN p 209 PHE p 224 
BB8 3 PHE YA 69  ? PRO YA 83  ? PHE p 93  PRO p 107 
BB8 4 TRP YA 160 ? ARG YA 162 ? TRP p 184 ARG p 186 
BB8 5 TYR BB 149 ? PHE BB 150 ? TYR s 173 PHE s 174 
BB9 1 ALA YA 109 ? LEU YA 112 ? ALA p 133 LEU p 136 
BB9 2 TRP YA 43  ? PHE YA 50  ? TRP p 67  PHE p 74  
BB9 3 HIS YA 171 ? GLU YA 179 ? HIS p 195 GLU p 203 
BB9 4 VAL YA 94  ? VAL YA 99  ? VAL p 118 VAL p 123 
BB9 5 HIS YA 124 ? THR YA 127 ? HIS p 148 THR p 151 
BC1 1 ALA YA 109 ? LEU YA 112 ? ALA p 133 LEU p 136 
BC1 2 TRP YA 43  ? PHE YA 50  ? TRP p 67  PHE p 74  
BC1 3 HIS YA 171 ? GLU YA 179 ? HIS p 195 GLU p 203 
BC1 4 LYS YA 140 ? PRO YA 141 ? LYS p 164 PRO p 165 
BC2 1 PRO YA 58  ? GLY YA 60  ? PRO p 82  GLY p 84  
BC2 2 ASN YA 63  ? ARG YA 65  ? ASN p 87  ARG p 89  
BC3 1 ALA ZA 109 ? LEU ZA 112 ? ALA q 133 LEU q 136 
BC3 2 TRP ZA 43  ? PHE ZA 50  ? TRP q 67  PHE q 74  
BC3 3 HIS ZA 171 ? GLU ZA 179 ? HIS q 195 GLU q 203 
BC3 4 GLY ZA 93  ? VAL ZA 99  ? GLY q 117 VAL q 123 
BC3 5 HIS ZA 124 ? GLN ZA 128 ? HIS q 148 GLN q 152 
BC4 1 ALA ZA 109 ? LEU ZA 112 ? ALA q 133 LEU q 136 
BC4 2 TRP ZA 43  ? PHE ZA 50  ? TRP q 67  PHE q 74  
BC4 3 HIS ZA 171 ? GLU ZA 179 ? HIS q 195 GLU q 203 
BC4 4 LYS ZA 140 ? PRO ZA 141 ? LYS q 164 PRO q 165 
BC5 1 PRO ZA 58  ? GLY ZA 60  ? PRO q 82  GLY q 84  
BC5 2 ASN ZA 63  ? ARG ZA 65  ? ASN q 87  ARG q 89  
BC6 1 HIS AB 20  ? ILE AB 33  ? HIS r 44  ILE r 57  
BC6 2 GLN AB 185 ? PHE AB 200 ? GLN r 209 PHE r 224 
BC6 3 PHE AB 69  ? PRO AB 83  ? PHE r 93  PRO r 107 
BC6 4 HIS AB 133 ? PHE AB 137 ? HIS r 157 PHE r 161 
BC7 1 HIS AB 20  ? ILE AB 33  ? HIS r 44  ILE r 57  
BC7 2 GLN AB 185 ? PHE AB 200 ? GLN r 209 PHE r 224 
BC7 3 PHE AB 69  ? PRO AB 83  ? PHE r 93  PRO r 107 
BC7 4 TRP AB 160 ? ARG AB 162 ? TRP r 184 ARG r 186 
BC7 5 TYR DB 149 ? PHE DB 150 ? TYR u 173 PHE u 174 
BC8 1 ALA AB 109 ? LEU AB 112 ? ALA r 133 LEU r 136 
BC8 2 TRP AB 43  ? ASN AB 51  ? TRP r 67  ASN r 75  
BC8 3 ASP AB 170 ? GLU AB 179 ? ASP r 194 GLU r 203 
BC8 4 GLY AB 93  ? VAL AB 99  ? GLY r 117 VAL r 123 
BC8 5 HIS AB 124 ? GLN AB 128 ? HIS r 148 GLN r 152 
BC9 1 ALA AB 109 ? LEU AB 112 ? ALA r 133 LEU r 136 
BC9 2 TRP AB 43  ? ASN AB 51  ? TRP r 67  ASN r 75  
BC9 3 ASP AB 170 ? GLU AB 179 ? ASP r 194 GLU r 203 
BC9 4 LYS AB 140 ? PRO AB 141 ? LYS r 164 PRO r 165 
BD1 1 ALA BB 109 ? LEU BB 112 ? ALA s 133 LEU s 136 
BD1 2 TRP BB 43  ? PHE BB 50  ? TRP s 67  PHE s 74  
BD1 3 HIS BB 171 ? GLU BB 179 ? HIS s 195 GLU s 203 
BD1 4 GLY BB 93  ? VAL BB 99  ? GLY s 117 VAL s 123 
BD1 5 HIS BB 124 ? GLN BB 128 ? HIS s 148 GLN s 152 
BD2 1 ALA BB 109 ? LEU BB 112 ? ALA s 133 LEU s 136 
BD2 2 TRP BB 43  ? PHE BB 50  ? TRP s 67  PHE s 74  
BD2 3 HIS BB 171 ? GLU BB 179 ? HIS s 195 GLU s 203 
BD2 4 LYS BB 140 ? PRO BB 141 ? LYS s 164 PRO s 165 
BD3 1 PRO BB 58  ? GLY BB 60  ? PRO s 82  GLY s 84  
BD3 2 ASN BB 63  ? ARG BB 65  ? ASN s 87  ARG s 89  
BD4 1 HIS CB 20  ? ILE CB 33  ? HIS t 44  ILE t 57  
BD4 2 GLN CB 185 ? PHE CB 200 ? GLN t 209 PHE t 224 
BD4 3 PHE CB 69  ? PRO CB 83  ? PHE t 93  PRO t 107 
BD4 4 HIS CB 133 ? PHE CB 137 ? HIS t 157 PHE t 161 
BD5 1 HIS CB 20  ? ILE CB 33  ? HIS t 44  ILE t 57  
BD5 2 GLN CB 185 ? PHE CB 200 ? GLN t 209 PHE t 224 
BD5 3 PHE CB 69  ? PRO CB 83  ? PHE t 93  PRO t 107 
BD5 4 TRP CB 160 ? ARG CB 162 ? TRP t 184 ARG t 186 
BD5 5 TYR GB 149 ? PHE GB 150 ? TYR x 173 PHE x 174 
BD6 1 ALA CB 109 ? LEU CB 112 ? ALA t 133 LEU t 136 
BD6 2 TRP CB 43  ? PHE CB 50  ? TRP t 67  PHE t 74  
BD6 3 HIS CB 171 ? GLU CB 179 ? HIS t 195 GLU t 203 
BD6 4 VAL CB 94  ? VAL CB 99  ? VAL t 118 VAL t 123 
BD6 5 HIS CB 124 ? THR CB 127 ? HIS t 148 THR t 151 
BD7 1 ALA CB 109 ? LEU CB 112 ? ALA t 133 LEU t 136 
BD7 2 TRP CB 43  ? PHE CB 50  ? TRP t 67  PHE t 74  
BD7 3 HIS CB 171 ? GLU CB 179 ? HIS t 195 GLU t 203 
BD7 4 LYS CB 140 ? PRO CB 141 ? LYS t 164 PRO t 165 
BD8 1 PRO CB 58  ? GLY CB 60  ? PRO t 82  GLY t 84  
BD8 2 ASN CB 63  ? ARG CB 65  ? ASN t 87  ARG t 89  
BD9 1 TYR CB 149 ? PHE CB 150 ? TYR t 173 PHE t 174 
BD9 2 TRP FB 160 ? ARG FB 162 ? TRP w 184 ARG w 186 
BD9 3 PHE FB 69  ? PRO FB 83  ? PHE w 93  PRO w 107 
BD9 4 GLN FB 185 ? PHE FB 200 ? GLN w 209 PHE w 224 
BD9 5 HIS FB 20  ? ILE FB 33  ? HIS w 44  ILE w 57  
BE1 1 TYR CB 149 ? PHE CB 150 ? TYR t 173 PHE t 174 
BE1 2 TRP FB 160 ? ARG FB 162 ? TRP w 184 ARG w 186 
BE1 3 PHE FB 69  ? PRO FB 83  ? PHE w 93  PRO w 107 
BE1 4 HIS FB 133 ? PHE FB 137 ? HIS w 157 PHE w 161 
BE2 1 ALA DB 109 ? LEU DB 112 ? ALA u 133 LEU u 136 
BE2 2 TRP DB 43  ? ASN DB 51  ? TRP u 67  ASN u 75  
BE2 3 ASP DB 170 ? GLU DB 179 ? ASP u 194 GLU u 203 
BE2 4 VAL DB 94  ? VAL DB 99  ? VAL u 118 VAL u 123 
BE2 5 HIS DB 124 ? THR DB 127 ? HIS u 148 THR u 151 
BE3 1 ALA DB 109 ? LEU DB 112 ? ALA u 133 LEU u 136 
BE3 2 TRP DB 43  ? ASN DB 51  ? TRP u 67  ASN u 75  
BE3 3 ASP DB 170 ? GLU DB 179 ? ASP u 194 GLU u 203 
BE3 4 LYS DB 140 ? PRO DB 141 ? LYS u 164 PRO u 165 
BE4 1 PRO DB 58  ? GLY DB 60  ? PRO u 82  GLY u 84  
BE4 2 ASN DB 63  ? ARG DB 65  ? ASN u 87  ARG u 89  
BE5 1 ALA EB 109 ? LEU EB 112 ? ALA v 133 LEU v 136 
BE5 2 TRP EB 43  ? PHE EB 50  ? TRP v 67  PHE v 74  
BE5 3 HIS EB 171 ? GLU EB 179 ? HIS v 195 GLU v 203 
BE5 4 GLY EB 93  ? VAL EB 99  ? GLY v 117 VAL v 123 
BE5 5 HIS EB 124 ? GLN EB 128 ? HIS v 148 GLN v 152 
BE6 1 ALA EB 109 ? LEU EB 112 ? ALA v 133 LEU v 136 
BE6 2 TRP EB 43  ? PHE EB 50  ? TRP v 67  PHE v 74  
BE6 3 HIS EB 171 ? GLU EB 179 ? HIS v 195 GLU v 203 
BE6 4 LYS EB 140 ? PRO EB 141 ? LYS v 164 PRO v 165 
BE7 1 PRO EB 58  ? GLY EB 60  ? PRO v 82  GLY v 84  
BE7 2 ASN EB 63  ? ARG EB 65  ? ASN v 87  ARG v 89  
BE8 1 ALA FB 109 ? LEU FB 112 ? ALA w 133 LEU w 136 
BE8 2 TRP FB 43  ? PHE FB 50  ? TRP w 67  PHE w 74  
BE8 3 HIS FB 171 ? GLU FB 179 ? HIS w 195 GLU w 203 
BE8 4 GLY FB 93  ? VAL FB 99  ? GLY w 117 VAL w 123 
BE8 5 HIS FB 124 ? GLN FB 128 ? HIS w 148 GLN w 152 
BE9 1 ALA FB 109 ? LEU FB 112 ? ALA w 133 LEU w 136 
BE9 2 TRP FB 43  ? PHE FB 50  ? TRP w 67  PHE w 74  
BE9 3 HIS FB 171 ? GLU FB 179 ? HIS w 195 GLU w 203 
BE9 4 LYS FB 140 ? PRO FB 141 ? LYS w 164 PRO w 165 
BF1 1 PRO FB 58  ? GLY FB 60  ? PRO w 82  GLY w 84  
BF1 2 ASN FB 63  ? ARG FB 65  ? ASN w 87  ARG w 89  
BF2 1 TYR FB 149 ? PHE FB 150 ? TYR w 173 PHE w 174 
BF2 2 TRP GB 160 ? ARG GB 162 ? TRP x 184 ARG x 186 
BF2 3 PHE GB 69  ? PRO GB 83  ? PHE x 93  PRO x 107 
BF2 4 GLN GB 185 ? PHE GB 200 ? GLN x 209 PHE x 224 
BF2 5 HIS GB 20  ? ILE GB 33  ? HIS x 44  ILE x 57  
BF3 1 TYR FB 149 ? PHE FB 150 ? TYR w 173 PHE w 174 
BF3 2 TRP GB 160 ? ARG GB 162 ? TRP x 184 ARG x 186 
BF3 3 PHE GB 69  ? PRO GB 83  ? PHE x 93  PRO x 107 
BF3 4 HIS GB 133 ? PHE GB 137 ? HIS x 157 PHE x 161 
BF4 1 ALA GB 109 ? LEU GB 112 ? ALA x 133 LEU x 136 
BF4 2 TRP GB 43  ? PHE GB 50  ? TRP x 67  PHE x 74  
BF4 3 HIS GB 171 ? GLU GB 179 ? HIS x 195 GLU x 203 
BF4 4 GLY GB 93  ? VAL GB 99  ? GLY x 117 VAL x 123 
BF4 5 HIS GB 124 ? GLN GB 128 ? HIS x 148 GLN x 152 
BF5 1 ALA GB 109 ? LEU GB 112 ? ALA x 133 LEU x 136 
BF5 2 TRP GB 43  ? PHE GB 50  ? TRP x 67  PHE x 74  
BF5 3 HIS GB 171 ? GLU GB 179 ? HIS x 195 GLU x 203 
BF5 4 LYS GB 140 ? PRO GB 141 ? LYS x 164 PRO x 165 
BF6 1 PRO GB 58  ? GLY GB 60  ? PRO x 82  GLY x 84  
BF6 2 ASN GB 63  ? ARG GB 65  ? ASN x 87  ARG x 89  
BF7 1 ALA HB 109 ? LEU HB 112 ? ALA y 133 LEU y 136 
BF7 2 TRP HB 43  ? PHE HB 50  ? TRP y 67  PHE y 74  
BF7 3 HIS HB 171 ? GLU HB 179 ? HIS y 195 GLU y 203 
BF7 4 GLY HB 93  ? VAL HB 99  ? GLY y 117 VAL y 123 
BF7 5 HIS HB 124 ? GLN HB 128 ? HIS y 148 GLN y 152 
BF8 1 ALA HB 109 ? LEU HB 112 ? ALA y 133 LEU y 136 
BF8 2 TRP HB 43  ? PHE HB 50  ? TRP y 67  PHE y 74  
BF8 3 HIS HB 171 ? GLU HB 179 ? HIS y 195 GLU y 203 
BF8 4 LYS HB 140 ? PRO HB 141 ? LYS y 164 PRO y 165 
BF9 1 PRO HB 58  ? GLY HB 60  ? PRO y 82  GLY y 84  
BF9 2 ASN HB 63  ? ARG HB 65  ? ASN y 87  ARG y 89  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A  29  ? N PHE A 53  O ILE A  189 ? O ILE A 213 
AA1 2 3 O ARG A  190 ? O ARG A 214 N GLU A  80  ? N GLU A 104 
AA1 3 4 N PHE A  81  ? N PHE A 105 O HIS A  133 ? O HIS A 157 
AA2 1 2 N PHE A  29  ? N PHE A 53  O ILE A  189 ? O ILE A 213 
AA2 2 3 O ARG A  190 ? O ARG A 214 N GLU A  80  ? N GLU A 104 
AA2 3 4 N TYR A  72  ? N TYR A 96  O LEU A  161 ? O LEU A 185 
AA3 1 2 O LEU A  112 ? O LEU A 136 N TRP A  43  ? N TRP A 67  
AA3 2 3 N ALA A  44  ? N ALA A 68  O PHE A  178 ? O PHE A 202 
AA3 3 4 O GLY A  175 ? O GLY A 199 N ALA A  98  ? N ALA A 122 
AA3 4 5 N GLY A  95  ? N GLY A 119 O ILE A  126 ? O ILE A 150 
AA4 1 2 O LEU A  112 ? O LEU A 136 N TRP A  43  ? N TRP A 67  
AA4 2 3 N ALA A  44  ? N ALA A 68  O PHE A  178 ? O PHE A 202 
AA4 3 4 O VAL A  172 ? O VAL A 196 N LYS A  140 ? N LYS A 164 
AA5 1 2 N GLY A  59  ? N GLY A 83  O PRO A  64  ? O PRO A 88  
AA6 1 2 N PHE A  150 ? N PHE A 174 O TRP F  160 ? O TRP F 184 
AA6 2 3 O LEU F  161 ? O LEU F 185 N TYR F  72  ? N TYR F 96  
AA6 3 4 N ARG F  73  ? N ARG F 97  O GLN F  196 ? O GLN F 220 
AA6 4 5 O ILE F  189 ? O ILE F 213 N PHE F  29  ? N PHE F 53  
AA7 1 2 N PHE A  150 ? N PHE A 174 O TRP F  160 ? O TRP F 184 
AA7 2 3 O LEU F  161 ? O LEU F 185 N TYR F  72  ? N TYR F 96  
AA7 3 4 N PHE F  81  ? N PHE F 105 O HIS F  133 ? O HIS F 157 
AA8 1 2 N LEU B  25  ? N LEU B 49  O MET B  193 ? O MET B 217 
AA8 2 3 O ASN B  188 ? O ASN B 212 N TRP B  82  ? N TRP B 106 
AA8 3 4 N PHE B  81  ? N PHE B 105 O HIS B  133 ? O HIS B 157 
AA9 1 2 N LEU B  25  ? N LEU B 49  O MET B  193 ? O MET B 217 
AA9 2 3 O ASN B  188 ? O ASN B 212 N TRP B  82  ? N TRP B 106 
AA9 3 4 N TYR B  72  ? N TYR B 96  O LEU B  161 ? O LEU B 185 
AA9 4 5 N TRP B  160 ? N TRP B 184 O PHE G  150 ? O PHE G 174 
AB1 1 2 O LEU B  112 ? O LEU B 136 N TRP B  43  ? N TRP B 67  
AB1 2 3 N PHE B  50  ? N PHE B 74  O HIS B  171 ? O HIS B 195 
AB1 3 4 O GLY B  175 ? O GLY B 199 N ALA B  98  ? N ALA B 122 
AB1 4 5 N SER B  97  ? N SER B 121 O HIS B  124 ? O HIS B 148 
AB2 1 2 O LEU B  112 ? O LEU B 136 N TRP B  43  ? N TRP B 67  
AB2 2 3 N PHE B  50  ? N PHE B 74  O HIS B  171 ? O HIS B 195 
AB2 3 4 O VAL B  172 ? O VAL B 196 N LYS B  140 ? N LYS B 164 
AB3 1 2 N GLY B  59  ? N GLY B 83  O PRO B  64  ? O PRO B 88  
AB4 1 2 N PHE C  29  ? N PHE C 53  O ILE C  189 ? O ILE C 213 
AB4 2 3 O ASN C  188 ? O ASN C 212 N TRP C  82  ? N TRP C 106 
AB4 3 4 N PHE C  81  ? N PHE C 105 O HIS C  133 ? O HIS C 157 
AB5 1 2 N PHE C  29  ? N PHE C 53  O ILE C  189 ? O ILE C 213 
AB5 2 3 O ASN C  188 ? O ASN C 212 N TRP C  82  ? N TRP C 106 
AB5 3 4 N TYR C  72  ? N TYR C 96  O LEU C  161 ? O LEU C 185 
AB5 4 5 N TRP C  160 ? N TRP C 184 O PHE F  150 ? O PHE F 174 
AB6 1 2 O LEU C  112 ? O LEU C 136 N TRP C  43  ? N TRP C 67  
AB6 2 3 N ALA C  44  ? N ALA C 68  O PHE C  178 ? O PHE C 202 
AB6 3 4 O GLY C  175 ? O GLY C 199 N ALA C  98  ? N ALA C 122 
AB6 4 5 N GLY C  95  ? N GLY C 119 O ILE C  126 ? O ILE C 150 
AB7 1 2 O LEU C  112 ? O LEU C 136 N TRP C  43  ? N TRP C 67  
AB7 2 3 N ALA C  44  ? N ALA C 68  O PHE C  178 ? O PHE C 202 
AB7 3 4 O VAL C  172 ? O VAL C 196 N LYS C  140 ? N LYS C 164 
AB8 1 2 N GLY C  59  ? N GLY C 83  O PRO C  64  ? O PRO C 88  
AB9 1 2 N PHE D  21  ? N PHE D 45  O PHE D  197 ? O PHE D 221 
AB9 2 3 O ASN D  188 ? O ASN D 212 N TRP D  82  ? N TRP D 106 
AB9 3 4 N PHE D  81  ? N PHE D 105 O HIS D  133 ? O HIS D 157 
AC1 1 2 N PHE D  21  ? N PHE D 45  O PHE D  197 ? O PHE D 221 
AC1 2 3 O ASN D  188 ? O ASN D 212 N TRP D  82  ? N TRP D 106 
AC1 3 4 N TYR D  72  ? N TYR D 96  O LEU D  161 ? O LEU D 185 
AC2 1 2 O ALA D  109 ? O ALA D 133 N VAL D  45  ? N VAL D 69  
AC2 2 3 N ALA D  44  ? N ALA D 68  O PHE D  178 ? O PHE D 202 
AC2 3 4 O GLY D  175 ? O GLY D 199 N ALA D  98  ? N ALA D 122 
AC2 4 5 N GLY D  95  ? N GLY D 119 O ILE D  126 ? O ILE D 150 
AC3 1 2 O ALA D  109 ? O ALA D 133 N VAL D  45  ? N VAL D 69  
AC3 2 3 N ALA D  44  ? N ALA D 68  O PHE D  178 ? O PHE D 202 
AC3 3 4 O VAL D  172 ? O VAL D 196 N LYS D  140 ? N LYS D 164 
AC4 1 2 N GLY D  59  ? N GLY D 83  O PRO D  64  ? O PRO D 88  
AC5 1 2 N PHE D  150 ? N PHE D 174 O TRP M  160 ? O TRP M 184 
AC5 2 3 O LEU M  161 ? O LEU M 185 N TYR M  72  ? N TYR M 96  
AC5 3 4 N TRP M  82  ? N TRP M 106 O ASN M  188 ? O ASN M 212 
AC5 4 5 O TYR M  187 ? O TYR M 211 N TYR M  31  ? N TYR M 55  
AC6 1 2 N PHE D  150 ? N PHE D 174 O TRP M  160 ? O TRP M 184 
AC6 2 3 O LEU M  161 ? O LEU M 185 N TYR M  72  ? N TYR M 96  
AC6 3 4 N PHE M  81  ? N PHE M 105 O HIS M  133 ? O HIS M 157 
AC7 1 2 N PHE E  29  ? N PHE E 53  O ILE E  189 ? O ILE E 213 
AC7 2 3 O ASN E  188 ? O ASN E 212 N TRP E  82  ? N TRP E 106 
AC7 3 4 N PHE E  81  ? N PHE E 105 O HIS E  133 ? O HIS E 157 
AC8 1 2 N PHE E  29  ? N PHE E 53  O ILE E  189 ? O ILE E 213 
AC8 2 3 O ASN E  188 ? O ASN E 212 N TRP E  82  ? N TRP E 106 
AC8 3 4 N TYR E  72  ? N TYR E 96  O LEU E  161 ? O LEU E 185 
AC8 4 5 N TRP E  160 ? N TRP E 184 O PHE O  150 ? O PHE O 174 
AC9 1 2 O ALA E  109 ? O ALA E 133 N VAL E  45  ? N VAL E 69  
AC9 2 3 N ALA E  44  ? N ALA E 68  O PHE E  178 ? O PHE E 202 
AC9 3 4 O GLY E  175 ? O GLY E 199 N ALA E  98  ? N ALA E 122 
AC9 4 5 N GLY E  93  ? N GLY E 117 O GLN E  128 ? O GLN E 152 
AD1 1 2 O ALA E  109 ? O ALA E 133 N VAL E  45  ? N VAL E 69  
AD1 2 3 N ALA E  44  ? N ALA E 68  O PHE E  178 ? O PHE E 202 
AD1 3 4 O VAL E  172 ? O VAL E 196 N LYS E  140 ? N LYS E 164 
AD2 1 2 N GLY E  59  ? N GLY E 83  O PRO E  64  ? O PRO E 88  
AD3 1 2 N PHE E  150 ? N PHE E 174 O TRP R  160 ? O TRP R 184 
AD3 2 3 O LEU R  161 ? O LEU R 185 N TYR R  72  ? N TYR R 96  
AD3 3 4 N GLU R  80  ? N GLU R 104 O ARG R  190 ? O ARG R 214 
AD3 4 5 O ILE R  189 ? O ILE R 213 N PHE R  29  ? N PHE R 53  
AD4 1 2 N PHE E  150 ? N PHE E 174 O TRP R  160 ? O TRP R 184 
AD4 2 3 O LEU R  161 ? O LEU R 185 N TYR R  72  ? N TYR R 96  
AD4 3 4 N PHE R  81  ? N PHE R 105 O HIS R  133 ? O HIS R 157 
AD5 1 2 O LEU F  112 ? O LEU F 136 N TRP F  43  ? N TRP F 67  
AD5 2 3 N ALA F  44  ? N ALA F 68  O PHE F  178 ? O PHE F 202 
AD5 3 4 O GLY F  175 ? O GLY F 199 N ALA F  98  ? N ALA F 122 
AD5 4 5 N GLY F  95  ? N GLY F 119 O ILE F  126 ? O ILE F 150 
AD6 1 2 O LEU F  112 ? O LEU F 136 N TRP F  43  ? N TRP F 67  
AD6 2 3 N ALA F  44  ? N ALA F 68  O PHE F  178 ? O PHE F 202 
AD6 3 4 O VAL F  172 ? O VAL F 196 N LYS F  140 ? N LYS F 164 
AD7 1 2 N GLY F  59  ? N GLY F 83  O PRO F  64  ? O PRO F 88  
AD8 1 2 N PHE G  29  ? N PHE G 53  O ILE G  189 ? O ILE G 213 
AD8 2 3 O THR G  192 ? O THR G 216 N LYS G  78  ? N LYS G 102 
AD8 3 4 N PHE G  81  ? N PHE G 105 O HIS G  133 ? O HIS G 157 
AD9 1 2 N PHE G  29  ? N PHE G 53  O ILE G  189 ? O ILE G 213 
AD9 2 3 O THR G  192 ? O THR G 216 N LYS G  78  ? N LYS G 102 
AD9 3 4 N TYR G  72  ? N TYR G 96  O LEU G  161 ? O LEU G 185 
AD9 4 5 N TRP G  160 ? N TRP G 184 O PHE I  150 ? O PHE I 174 
AE1 1 2 O ALA G  109 ? O ALA G 133 N VAL G  45  ? N VAL G 69  
AE1 2 3 N ALA G  44  ? N ALA G 68  O PHE G  178 ? O PHE G 202 
AE1 3 4 O GLY G  175 ? O GLY G 199 N ALA G  98  ? N ALA G 122 
AE1 4 5 N GLY G  95  ? N GLY G 119 O ILE G  126 ? O ILE G 150 
AE2 1 2 O ALA G  109 ? O ALA G 133 N VAL G  45  ? N VAL G 69  
AE2 2 3 N ALA G  44  ? N ALA G 68  O PHE G  178 ? O PHE G 202 
AE2 3 4 O VAL G  172 ? O VAL G 196 N LYS G  140 ? N LYS G 164 
AE3 1 2 N ILE H  33  ? N ILE H 57  O GLN H  185 ? O GLN H 209 
AE3 2 3 O ASN H  188 ? O ASN H 212 N TRP H  82  ? N TRP H 106 
AE3 3 4 N VAL H  77  ? N VAL H 101 O PHE H  137 ? O PHE H 161 
AE4 1 2 N ILE H  33  ? N ILE H 57  O GLN H  185 ? O GLN H 209 
AE4 2 3 O ASN H  188 ? O ASN H 212 N TRP H  82  ? N TRP H 106 
AE4 3 4 N TYR H  72  ? N TYR H 96  O LEU H  161 ? O LEU H 185 
AE5 1 2 O LEU H  112 ? O LEU H 136 N TRP H  43  ? N TRP H 67  
AE5 2 3 N ALA H  44  ? N ALA H 68  O PHE H  178 ? O PHE H 202 
AE5 3 4 O GLY H  175 ? O GLY H 199 N ALA H  98  ? N ALA H 122 
AE5 4 5 N GLY H  95  ? N GLY H 119 O ILE H  126 ? O ILE H 150 
AE6 1 2 N PHE H  50  ? N PHE H 74  O HIS H  171 ? O HIS H 195 
AE6 2 3 O VAL H  172 ? O VAL H 196 N LYS H  140 ? N LYS H 164 
AE7 1 2 N PHE H  150 ? N PHE H 174 O TRP U  160 ? O TRP U 184 
AE7 2 3 O LEU U  161 ? O LEU U 185 N TYR U  72  ? N TYR U 96  
AE7 3 4 N ARG U  73  ? N ARG U 97  O GLN U  196 ? O GLN U 220 
AE7 4 5 O MET U  193 ? O MET U 217 N LEU U  25  ? N LEU U 49  
AE8 1 2 N PHE H  150 ? N PHE H 174 O TRP U  160 ? O TRP U 184 
AE8 2 3 O LEU U  161 ? O LEU U 185 N TYR U  72  ? N TYR U 96  
AE8 3 4 N PHE U  81  ? N PHE U 105 O HIS U  133 ? O HIS U 157 
AE9 1 2 N ILE I  33  ? N ILE I 57  O GLN I  185 ? O GLN I 209 
AE9 2 3 O GLN I  196 ? O GLN I 220 N ARG I  73  ? N ARG I 97  
AE9 3 4 N PHE I  81  ? N PHE I 105 O HIS I  133 ? O HIS I 157 
AF1 1 2 N ILE I  33  ? N ILE I 57  O GLN I  185 ? O GLN I 209 
AF1 2 3 O GLN I  196 ? O GLN I 220 N ARG I  73  ? N ARG I 97  
AF1 3 4 N TYR I  72  ? N TYR I 96  O LEU I  161 ? O LEU I 185 
AF2 1 2 O ALA I  109 ? O ALA I 133 N VAL I  45  ? N VAL I 69  
AF2 2 3 N PHE I  50  ? N PHE I 74  O HIS I  171 ? O HIS I 195 
AF2 3 4 O GLY I  175 ? O GLY I 199 N ALA I  98  ? N ALA I 122 
AF2 4 5 N GLY I  93  ? N GLY I 117 O GLN I  128 ? O GLN I 152 
AF3 1 2 O ALA I  109 ? O ALA I 133 N VAL I  45  ? N VAL I 69  
AF3 2 3 N PHE I  50  ? N PHE I 74  O HIS I  171 ? O HIS I 195 
AF3 3 4 O VAL I  172 ? O VAL I 196 N LYS I  140 ? N LYS I 164 
AF4 1 2 N GLY I  59  ? N GLY I 83  O PRO I  64  ? O PRO I 88  
AF5 1 2 N LEU J  25  ? N LEU J 49  O MET J  193 ? O MET J 217 
AF5 2 3 O ARG J  190 ? O ARG J 214 N GLU J  80  ? N GLU J 104 
AF5 3 4 N PHE J  81  ? N PHE J 105 O HIS J  133 ? O HIS J 157 
AF6 1 2 N LEU J  25  ? N LEU J 49  O MET J  193 ? O MET J 217 
AF6 2 3 O ARG J  190 ? O ARG J 214 N GLU J  80  ? N GLU J 104 
AF6 3 4 N TYR J  72  ? N TYR J 96  O LEU J  161 ? O LEU J 185 
AF6 4 5 N TRP J  160 ? N TRP J 184 O PHE W  150 ? O PHE W 174 
AF7 1 2 O LEU J  112 ? O LEU J 136 N TRP J  43  ? N TRP J 67  
AF7 2 3 N ALA J  44  ? N ALA J 68  O PHE J  178 ? O PHE J 202 
AF7 3 4 O GLY J  175 ? O GLY J 199 N ALA J  98  ? N ALA J 122 
AF7 4 5 N GLY J  95  ? N GLY J 119 O ILE J  126 ? O ILE J 150 
AF8 1 2 O LEU J  112 ? O LEU J 136 N TRP J  43  ? N TRP J 67  
AF8 2 3 N ALA J  44  ? N ALA J 68  O PHE J  178 ? O PHE J 202 
AF8 3 4 O VAL J  172 ? O VAL J 196 N LYS J  140 ? N LYS J 164 
AF9 1 2 N GLY J  59  ? N GLY J 83  O PRO J  64  ? O PRO J 88  
AG1 1 2 N PHE J  150 ? N PHE J 174 O TRP Y  160 ? O TRP Y 184 
AG1 2 3 O LEU Y  161 ? O LEU Y 185 N TYR Y  72  ? N TYR Y 96  
AG1 3 4 N TRP Y  82  ? N TRP Y 106 O ASN Y  188 ? O ASN Y 212 
AG1 4 5 O ILE Y  189 ? O ILE Y 213 N PHE Y  29  ? N PHE Y 53  
AG2 1 2 N PHE J  150 ? N PHE J 174 O TRP Y  160 ? O TRP Y 184 
AG2 2 3 O LEU Y  161 ? O LEU Y 185 N TYR Y  72  ? N TYR Y 96  
AG2 3 4 N VAL Y  77  ? N VAL Y 101 O PHE Y  137 ? O PHE Y 161 
AG3 1 2 N PHE K  29  ? N PHE K 53  O ILE K  189 ? O ILE K 213 
AG3 2 3 O ARG K  190 ? O ARG K 214 N GLU K  80  ? N GLU K 104 
AG3 3 4 N PHE K  81  ? N PHE K 105 O HIS K  133 ? O HIS K 157 
AG4 1 2 N PHE K  29  ? N PHE K 53  O ILE K  189 ? O ILE K 213 
AG4 2 3 O ARG K  190 ? O ARG K 214 N GLU K  80  ? N GLU K 104 
AG4 3 4 N TYR K  72  ? N TYR K 96  O LEU K  161 ? O LEU K 185 
AG4 4 5 N TRP K  160 ? N TRP K 184 O PHE M  150 ? O PHE M 174 
AG5 1 2 O ALA K  109 ? O ALA K 133 N VAL K  45  ? N VAL K 69  
AG5 2 3 N ALA K  44  ? N ALA K 68  O PHE K  178 ? O PHE K 202 
AG5 3 4 O GLY K  175 ? O GLY K 199 N ALA K  98  ? N ALA K 122 
AG5 4 5 N SER K  97  ? N SER K 121 O HIS K  124 ? O HIS K 148 
AG6 1 2 O ALA K  109 ? O ALA K 133 N VAL K  45  ? N VAL K 69  
AG6 2 3 N ALA K  44  ? N ALA K 68  O PHE K  178 ? O PHE K 202 
AG6 3 4 O VAL K  172 ? O VAL K 196 N LYS K  140 ? N LYS K 164 
AG7 1 2 N PHE L  21  ? N PHE L 45  O PHE L  197 ? O PHE L 221 
AG7 2 3 O TYR L  194 ? O TYR L 218 N LYS L  76  ? N LYS L 100 
AG7 3 4 N VAL L  77  ? N VAL L 101 O PHE L  137 ? O PHE L 161 
AG8 1 2 N PHE L  21  ? N PHE L 45  O PHE L  197 ? O PHE L 221 
AG8 2 3 O TYR L  194 ? O TYR L 218 N LYS L  76  ? N LYS L 100 
AG8 3 4 N TYR L  72  ? N TYR L 96  O LEU L  161 ? O LEU L 185 
AG9 1 2 O LEU L  112 ? O LEU L 136 N TRP L  43  ? N TRP L 67  
AG9 2 3 N PHE L  50  ? N PHE L 74  O HIS L  171 ? O HIS L 195 
AG9 3 4 O GLY L  175 ? O GLY L 199 N ALA L  98  ? N ALA L 122 
AG9 4 5 N SER L  97  ? N SER L 121 O HIS L  124 ? O HIS L 148 
AH1 1 2 O LEU L  112 ? O LEU L 136 N TRP L  43  ? N TRP L 67  
AH1 2 3 N PHE L  50  ? N PHE L 74  O HIS L  171 ? O HIS L 195 
AH1 3 4 O VAL L  172 ? O VAL L 196 N LYS L  140 ? N LYS L 164 
AH2 1 2 N GLY L  59  ? N GLY L 83  O PRO L  64  ? O PRO L 88  
AH3 1 2 O LEU M  112 ? O LEU M 136 N TRP M  43  ? N TRP M 67  
AH3 2 3 N PHE M  50  ? N PHE M 74  O HIS M  171 ? O HIS M 195 
AH3 3 4 O GLY M  175 ? O GLY M 199 N ALA M  98  ? N ALA M 122 
AH3 4 5 N GLY M  93  ? N GLY M 117 O GLN M  128 ? O GLN M 152 
AH4 1 2 O LEU M  112 ? O LEU M 136 N TRP M  43  ? N TRP M 67  
AH4 2 3 N PHE M  50  ? N PHE M 74  O HIS M  171 ? O HIS M 195 
AH4 3 4 O VAL M  172 ? O VAL M 196 N LYS M  140 ? N LYS M 164 
AH5 1 2 N GLY M  59  ? N GLY M 83  O PRO M  64  ? O PRO M 88  
AH6 1 2 N PHE N  29  ? N PHE N 53  O ILE N  189 ? O ILE N 213 
AH6 2 3 O GLN N  196 ? O GLN N 220 N ARG N  73  ? N ARG N 97  
AH6 3 4 N PHE N  81  ? N PHE N 105 O HIS N  133 ? O HIS N 157 
AH7 1 2 N PHE N  29  ? N PHE N 53  O ILE N  189 ? O ILE N 213 
AH7 2 3 O GLN N  196 ? O GLN N 220 N ARG N  73  ? N ARG N 97  
AH7 3 4 N TYR N  72  ? N TYR N 96  O LEU N  161 ? O LEU N 185 
AH7 4 5 N TRP N  160 ? N TRP N 184 O PHE EA 150 ? O PHE 5 174 
AH8 1 2 O LEU N  112 ? O LEU N 136 N TRP N  43  ? N TRP N 67  
AH8 2 3 N ALA N  44  ? N ALA N 68  O PHE N  178 ? O PHE N 202 
AH8 3 4 O GLY N  175 ? O GLY N 199 N ALA N  98  ? N ALA N 122 
AH8 4 5 N GLY N  95  ? N GLY N 119 O ILE N  126 ? O ILE N 150 
AH9 1 2 O LEU N  112 ? O LEU N 136 N TRP N  43  ? N TRP N 67  
AH9 2 3 N ALA N  44  ? N ALA N 68  O PHE N  178 ? O PHE N 202 
AH9 3 4 O VAL N  172 ? O VAL N 196 N LYS N  140 ? N LYS N 164 
AI1 1 2 N GLY N  59  ? N GLY N 83  O PRO N  64  ? O PRO N 88  
AI2 1 2 N PHE N  150 ? N PHE N 174 O TRP DA 160 ? O TRP 4 184 
AI2 2 3 O LEU DA 161 ? O LEU 4 185 N TYR DA 72  ? N TYR 4 96  
AI2 3 4 N LYS DA 76  ? N LYS 4 100 O TYR DA 194 ? O TYR 4 218 
AI2 4 5 O ILE DA 189 ? O ILE 4 213 N PHE DA 29  ? N PHE 4 53  
AI3 1 2 N PHE N  150 ? N PHE N 174 O TRP DA 160 ? O TRP 4 184 
AI3 2 3 O LEU DA 161 ? O LEU 4 185 N TYR DA 72  ? N TYR 4 96  
AI3 3 4 N PHE DA 81  ? N PHE 4 105 O HIS DA 133 ? O HIS 4 157 
AI4 1 2 N PHE O  21  ? N PHE O 45  O PHE O  197 ? O PHE O 221 
AI4 2 3 O TYR O  194 ? O TYR O 218 N LYS O  76  ? N LYS O 100 
AI4 3 4 N PHE O  81  ? N PHE O 105 O HIS O  133 ? O HIS O 157 
AI5 1 2 N PHE O  21  ? N PHE O 45  O PHE O  197 ? O PHE O 221 
AI5 2 3 O TYR O  194 ? O TYR O 218 N LYS O  76  ? N LYS O 100 
AI5 3 4 N TYR O  72  ? N TYR O 96  O LEU O  161 ? O LEU O 185 
AI6 1 2 O LEU O  112 ? O LEU O 136 N TRP O  43  ? N TRP O 67  
AI6 2 3 N ALA O  44  ? N ALA O 68  O PHE O  178 ? O PHE O 202 
AI6 3 4 O GLY O  175 ? O GLY O 199 N ALA O  98  ? N ALA O 122 
AI6 4 5 N GLY O  95  ? N GLY O 119 O ILE O  126 ? O ILE O 150 
AI7 1 2 O LEU O  112 ? O LEU O 136 N TRP O  43  ? N TRP O 67  
AI7 2 3 N ALA O  44  ? N ALA O 68  O PHE O  178 ? O PHE O 202 
AI7 3 4 O VAL O  172 ? O VAL O 196 N LYS O  140 ? N LYS O 164 
AI8 1 2 N GLY O  59  ? N GLY O 83  O PRO O  64  ? O PRO O 88  
AI9 1 2 N PHE P  21  ? N PHE P 45  O PHE P  197 ? O PHE P 221 
AI9 2 3 O ARG P  198 ? O ARG P 222 N TYR P  71  ? N TYR P 95  
AI9 3 4 N VAL P  79  ? N VAL P 103 O ARG P  135 ? O ARG P 159 
AJ1 1 2 N PHE P  21  ? N PHE P 45  O PHE P  197 ? O PHE P 221 
AJ1 2 3 O ARG P  198 ? O ARG P 222 N TYR P  71  ? N TYR P 95  
AJ1 3 4 N TYR P  72  ? N TYR P 96  O LEU P  161 ? O LEU P 185 
AJ2 1 2 O LEU P  112 ? O LEU P 136 N TRP P  43  ? N TRP P 67  
AJ2 2 3 N ALA P  44  ? N ALA P 68  O PHE P  178 ? O PHE P 202 
AJ2 3 4 O GLY P  175 ? O GLY P 199 N ALA P  98  ? N ALA P 122 
AJ2 4 5 N GLY P  95  ? N GLY P 119 O ILE P  126 ? O ILE P 150 
AJ3 1 2 O LEU P  112 ? O LEU P 136 N TRP P  43  ? N TRP P 67  
AJ3 2 3 N ALA P  44  ? N ALA P 68  O PHE P  178 ? O PHE P 202 
AJ3 3 4 O VAL P  172 ? O VAL P 196 N LYS P  140 ? N LYS P 164 
AJ4 1 2 N PHE P  150 ? N PHE P 174 O TRP HA 160 ? O TRP 8 184 
AJ4 2 3 O LEU HA 161 ? O LEU 8 185 N TYR HA 72  ? N TYR 8 96  
AJ4 3 4 N TYR HA 71  ? N TYR 8 95  O ARG HA 198 ? O ARG 8 222 
AJ4 4 5 O ILE HA 189 ? O ILE 8 213 N PHE HA 29  ? N PHE 8 53  
AJ5 1 2 N PHE P  150 ? N PHE P 174 O TRP HA 160 ? O TRP 8 184 
AJ5 2 3 O LEU HA 161 ? O LEU 8 185 N TYR HA 72  ? N TYR 8 96  
AJ5 3 4 N PHE HA 81  ? N PHE 8 105 O HIS HA 133 ? O HIS 8 157 
AJ6 1 2 N LEU Q  25  ? N LEU Q 49  O MET Q  193 ? O MET Q 217 
AJ6 2 3 O GLN Q  196 ? O GLN Q 220 N ARG Q  73  ? N ARG Q 97  
AJ6 3 4 N PHE Q  81  ? N PHE Q 105 O HIS Q  133 ? O HIS Q 157 
AJ7 1 2 N LEU Q  25  ? N LEU Q 49  O MET Q  193 ? O MET Q 217 
AJ7 2 3 O GLN Q  196 ? O GLN Q 220 N ARG Q  73  ? N ARG Q 97  
AJ7 3 4 N TYR Q  72  ? N TYR Q 96  O LEU Q  161 ? O LEU Q 185 
AJ7 4 5 N TRP Q  160 ? N TRP Q 184 O PHE IA 150 ? O PHE 9 174 
AJ8 1 2 O ALA Q  109 ? O ALA Q 133 N VAL Q  45  ? N VAL Q 69  
AJ8 2 3 N ALA Q  44  ? N ALA Q 68  O PHE Q  178 ? O PHE Q 202 
AJ8 3 4 O GLY Q  175 ? O GLY Q 199 N ALA Q  98  ? N ALA Q 122 
AJ8 4 5 N GLY Q  95  ? N GLY Q 119 O ILE Q  126 ? O ILE Q 150 
AJ9 1 2 O ALA Q  109 ? O ALA Q 133 N VAL Q  45  ? N VAL Q 69  
AJ9 2 3 N ALA Q  44  ? N ALA Q 68  O PHE Q  178 ? O PHE Q 202 
AJ9 3 4 O VAL Q  172 ? O VAL Q 196 N LYS Q  140 ? N LYS Q 164 
AK1 1 2 N PHE Q  150 ? N PHE Q 174 O TRP T  160 ? O TRP T 184 
AK1 2 3 O LEU T  161 ? O LEU T 185 N TYR T  72  ? N TYR T 96  
AK1 3 4 N TRP T  82  ? N TRP T 106 O ASN T  188 ? O ASN T 212 
AK1 4 5 O MET T  193 ? O MET T 217 N LEU T  25  ? N LEU T 49  
AK2 1 2 N PHE Q  150 ? N PHE Q 174 O TRP T  160 ? O TRP T 184 
AK2 2 3 O LEU T  161 ? O LEU T 185 N TYR T  72  ? N TYR T 96  
AK2 3 4 N PHE T  81  ? N PHE T 105 O HIS T  133 ? O HIS T 157 
AK3 1 2 O ALA R  109 ? O ALA R 133 N VAL R  45  ? N VAL R 69  
AK3 2 3 N ALA R  44  ? N ALA R 68  O PHE R  178 ? O PHE R 202 
AK3 3 4 O GLY R  175 ? O GLY R 199 N ALA R  98  ? N ALA R 122 
AK3 4 5 N SER R  97  ? N SER R 121 O HIS R  124 ? O HIS R 148 
AK4 1 2 O ALA R  109 ? O ALA R 133 N VAL R  45  ? N VAL R 69  
AK4 2 3 N ALA R  44  ? N ALA R 68  O PHE R  178 ? O PHE R 202 
AK4 3 4 O VAL R  172 ? O VAL R 196 N LYS R  140 ? N LYS R 164 
AK5 1 2 N GLY R  59  ? N GLY R 83  O PRO R  64  ? O PRO R 88  
AK6 1 2 N PHE S  29  ? N PHE S 53  O ILE S  189 ? O ILE S 213 
AK6 2 3 O THR S  192 ? O THR S 216 N LYS S  78  ? N LYS S 102 
AK6 3 4 N PHE S  81  ? N PHE S 105 O HIS S  133 ? O HIS S 157 
AK7 1 2 N PHE S  29  ? N PHE S 53  O ILE S  189 ? O ILE S 213 
AK7 2 3 O THR S  192 ? O THR S 216 N LYS S  78  ? N LYS S 102 
AK7 3 4 N TYR S  72  ? N TYR S 96  O LEU S  161 ? O LEU S 185 
AK7 4 5 N TRP S  160 ? N TRP S 184 O PHE U  150 ? O PHE U 174 
AK8 1 2 O LEU S  112 ? O LEU S 136 N TRP S  43  ? N TRP S 67  
AK8 2 3 N PHE S  50  ? N PHE S 74  O HIS S  171 ? O HIS S 195 
AK8 3 4 O GLY S  175 ? O GLY S 199 N ALA S  98  ? N ALA S 122 
AK8 4 5 N GLY S  95  ? N GLY S 119 O ILE S  126 ? O ILE S 150 
AK9 1 2 O LEU S  112 ? O LEU S 136 N TRP S  43  ? N TRP S 67  
AK9 2 3 N PHE S  50  ? N PHE S 74  O HIS S  171 ? O HIS S 195 
AK9 3 4 O VAL S  172 ? O VAL S 196 N LYS S  140 ? N LYS S 164 
AL1 1 2 N GLY S  60  ? N GLY S 84  O ASN S  63  ? O ASN S 87  
AL2 1 2 O ALA T  109 ? O ALA T 133 N VAL T  45  ? N VAL T 69  
AL2 2 3 N PHE T  50  ? N PHE T 74  O HIS T  171 ? O HIS T 195 
AL2 3 4 O GLY T  175 ? O GLY T 199 N ALA T  98  ? N ALA T 122 
AL2 4 5 N GLY T  95  ? N GLY T 119 O ILE T  126 ? O ILE T 150 
AL3 1 2 O ALA T  109 ? O ALA T 133 N VAL T  45  ? N VAL T 69  
AL3 2 3 N PHE T  50  ? N PHE T 74  O HIS T  171 ? O HIS T 195 
AL3 3 4 O VAL T  172 ? O VAL T 196 N LYS T  140 ? N LYS T 164 
AL4 1 2 O ALA U  109 ? O ALA U 133 N VAL U  45  ? N VAL U 69  
AL4 2 3 N ALA U  44  ? N ALA U 68  O PHE U  178 ? O PHE U 202 
AL4 3 4 O GLY U  175 ? O GLY U 199 N ALA U  98  ? N ALA U 122 
AL4 4 5 N GLY U  93  ? N GLY U 117 O GLN U  128 ? O GLN U 152 
AL5 1 2 N PHE U  50  ? N PHE U 74  O HIS U  171 ? O HIS U 195 
AL5 2 3 O VAL U  172 ? O VAL U 196 N LYS U  140 ? N LYS U 164 
AL6 1 2 N GLY U  59  ? N GLY U 83  O PRO U  64  ? O PRO U 88  
AL7 1 2 N ILE V  33  ? N ILE V 57  O GLN V  185 ? O GLN V 209 
AL7 2 3 O GLU V  199 ? O GLU V 223 N GLU V  70  ? N GLU V 94  
AL7 3 4 N PHE V  81  ? N PHE V 105 O HIS V  133 ? O HIS V 157 
AL8 1 2 N ILE V  33  ? N ILE V 57  O GLN V  185 ? O GLN V 209 
AL8 2 3 O GLU V  199 ? O GLU V 223 N GLU V  70  ? N GLU V 94  
AL8 3 4 N TYR V  72  ? N TYR V 96  O LEU V  161 ? O LEU V 185 
AL8 4 5 N TRP V  160 ? N TRP V 184 O PHE MA 150 ? O PHE d 174 
AL9 1 2 O ALA V  109 ? O ALA V 133 N VAL V  45  ? N VAL V 69  
AL9 2 3 N ALA V  44  ? N ALA V 68  O PHE V  178 ? O PHE V 202 
AL9 3 4 O ALA V  177 ? O ALA V 201 N SER V  96  ? N SER V 120 
AL9 4 5 N GLY V  95  ? N GLY V 119 O ILE V  126 ? O ILE V 150 
AM1 1 2 O ALA V  109 ? O ALA V 133 N VAL V  45  ? N VAL V 69  
AM1 2 3 N ALA V  44  ? N ALA V 68  O PHE V  178 ? O PHE V 202 
AM1 3 4 O VAL V  172 ? O VAL V 196 N LYS V  140 ? N LYS V 164 
AM2 1 2 N GLY V  59  ? N GLY V 83  O PRO V  64  ? O PRO V 88  
AM3 1 2 N PHE V  150 ? N PHE V 174 O TRP LA 160 ? O TRP c 184 
AM3 2 3 O LEU LA 161 ? O LEU c 185 N TYR LA 72  ? N TYR c 96  
AM3 3 4 N GLU LA 80  ? N GLU c 104 O ARG LA 190 ? O ARG c 214 
AM3 4 5 O MET LA 193 ? O MET c 217 N LEU LA 25  ? N LEU c 49  
AM4 1 2 N PHE V  150 ? N PHE V 174 O TRP LA 160 ? O TRP c 184 
AM4 2 3 O LEU LA 161 ? O LEU c 185 N TYR LA 72  ? N TYR c 96  
AM4 3 4 N VAL LA 77  ? N VAL c 101 O PHE LA 137 ? O PHE c 161 
AM5 1 2 N PHE W  21  ? N PHE W 45  O PHE W  197 ? O PHE W 221 
AM5 2 3 O GLN W  196 ? O GLN W 220 N ARG W  73  ? N ARG W 97  
AM5 3 4 N PHE W  81  ? N PHE W 105 O HIS W  133 ? O HIS W 157 
AM6 1 2 N PHE W  21  ? N PHE W 45  O PHE W  197 ? O PHE W 221 
AM6 2 3 O GLN W  196 ? O GLN W 220 N ARG W  73  ? N ARG W 97  
AM6 3 4 N TYR W  72  ? N TYR W 96  O LEU W  161 ? O LEU W 185 
AM6 4 5 N TRP W  160 ? N TRP W 184 O PHE Y  150 ? O PHE Y 174 
AM7 1 2 O LEU W  112 ? O LEU W 136 N TRP W  43  ? N TRP W 67  
AM7 2 3 N PHE W  50  ? N PHE W 74  O HIS W  171 ? O HIS W 195 
AM7 3 4 O GLY W  175 ? O GLY W 199 N ALA W  98  ? N ALA W 122 
AM7 4 5 N GLY W  95  ? N GLY W 119 O ILE W  126 ? O ILE W 150 
AM8 1 2 O LEU W  112 ? O LEU W 136 N TRP W  43  ? N TRP W 67  
AM8 2 3 N PHE W  50  ? N PHE W 74  O HIS W  171 ? O HIS W 195 
AM8 3 4 O VAL W  172 ? O VAL W 196 N LYS W  140 ? N LYS W 164 
AM9 1 2 N GLY W  59  ? N GLY W 83  O PRO W  64  ? O PRO W 88  
AN1 1 2 N PHE X  21  ? N PHE X 45  O PHE X  197 ? O PHE X 221 
AN1 2 3 O ASN X  188 ? O ASN X 212 N TRP X  82  ? N TRP X 106 
AN1 3 4 N PHE X  81  ? N PHE X 105 O HIS X  133 ? O HIS X 157 
AN2 1 2 N PHE X  21  ? N PHE X 45  O PHE X  197 ? O PHE X 221 
AN2 2 3 O ASN X  188 ? O ASN X 212 N TRP X  82  ? N TRP X 106 
AN2 3 4 N TYR X  72  ? N TYR X 96  O LEU X  161 ? O LEU X 185 
AN2 4 5 N TRP X  160 ? N TRP X 184 O PHE KA 150 ? O PHE b 174 
AN3 1 2 O ALA X  109 ? O ALA X 133 N VAL X  45  ? N VAL X 69  
AN3 2 3 N PHE X  50  ? N PHE X 74  O HIS X  171 ? O HIS X 195 
AN3 3 4 O GLY X  175 ? O GLY X 199 N ALA X  98  ? N ALA X 122 
AN3 4 5 N GLY X  95  ? N GLY X 119 O ILE X  126 ? O ILE X 150 
AN4 1 2 O ALA X  109 ? O ALA X 133 N VAL X  45  ? N VAL X 69  
AN4 2 3 N PHE X  50  ? N PHE X 74  O HIS X  171 ? O HIS X 195 
AN4 3 4 O VAL X  172 ? O VAL X 196 N LYS X  140 ? N LYS X 164 
AN5 1 2 N GLY X  59  ? N GLY X 83  O PRO X  64  ? O PRO X 88  
AN6 1 2 N PHE X  150 ? N PHE X 174 O TRP PA 160 ? O TRP g 184 
AN6 2 3 O LEU PA 161 ? O LEU g 185 N TYR PA 72  ? N TYR g 96  
AN6 3 4 N LYS PA 76  ? N LYS g 100 O TYR PA 194 ? O TYR g 218 
AN6 4 5 O ILE PA 189 ? O ILE g 213 N PHE PA 29  ? N PHE g 53  
AN7 1 2 N PHE X  150 ? N PHE X 174 O TRP PA 160 ? O TRP g 184 
AN7 2 3 O LEU PA 161 ? O LEU g 185 N TYR PA 72  ? N TYR g 96  
AN7 3 4 N PHE PA 81  ? N PHE g 105 O HIS PA 133 ? O HIS g 157 
AN8 1 2 O LEU Y  112 ? O LEU Y 136 N TRP Y  43  ? N TRP Y 67  
AN8 2 3 N PHE Y  50  ? N PHE Y 74  O HIS Y  171 ? O HIS Y 195 
AN8 3 4 O GLY Y  175 ? O GLY Y 199 N ALA Y  98  ? N ALA Y 122 
AN8 4 5 N GLY Y  93  ? N GLY Y 117 O GLN Y  128 ? O GLN Y 152 
AN9 1 2 O LEU Y  112 ? O LEU Y 136 N TRP Y  43  ? N TRP Y 67  
AN9 2 3 N PHE Y  50  ? N PHE Y 74  O HIS Y  171 ? O HIS Y 195 
AN9 3 4 O VAL Y  172 ? O VAL Y 196 N LYS Y  140 ? N LYS Y 164 
AO1 1 2 N PHE Z  21  ? N PHE Z 45  O PHE Z  197 ? O PHE Z 221 
AO1 2 3 O TYR Z  194 ? O TYR Z 218 N LYS Z  76  ? N LYS Z 100 
AO1 3 4 N VAL Z  77  ? N VAL Z 101 O PHE Z  137 ? O PHE Z 161 
AO2 1 2 N PHE Z  21  ? N PHE Z 45  O PHE Z  197 ? O PHE Z 221 
AO2 2 3 O TYR Z  194 ? O TYR Z 218 N LYS Z  76  ? N LYS Z 100 
AO2 3 4 N TYR Z  72  ? N TYR Z 96  O LEU Z  161 ? O LEU Z 185 
AO2 4 5 N TRP Z  160 ? N TRP Z 184 O PHE AA 150 ? O PHE 1 174 
AO3 1 2 O LEU Z  112 ? O LEU Z 136 N TRP Z  43  ? N TRP Z 67  
AO3 2 3 N ALA Z  44  ? N ALA Z 68  O PHE Z  178 ? O PHE Z 202 
AO3 3 4 O GLY Z  175 ? O GLY Z 199 N ALA Z  98  ? N ALA Z 122 
AO3 4 5 N GLY Z  93  ? N GLY Z 117 O GLN Z  128 ? O GLN Z 152 
AO4 1 2 O LEU Z  112 ? O LEU Z 136 N TRP Z  43  ? N TRP Z 67  
AO4 2 3 N ALA Z  44  ? N ALA Z 68  O PHE Z  178 ? O PHE Z 202 
AO4 3 4 O VAL Z  172 ? O VAL Z 196 N LYS Z  140 ? N LYS Z 164 
AO5 1 2 N GLY Z  59  ? N GLY Z 83  O PRO Z  64  ? O PRO Z 88  
AO6 1 2 N ILE AA 33  ? N ILE 1 57  O GLN AA 185 ? O GLN 1 209 
AO6 2 3 O ARG AA 190 ? O ARG 1 214 N GLU AA 80  ? N GLU 1 104 
AO6 3 4 N PHE AA 81  ? N PHE 1 105 O HIS AA 133 ? O HIS 1 157 
AO7 1 2 N ILE AA 33  ? N ILE 1 57  O GLN AA 185 ? O GLN 1 209 
AO7 2 3 O ARG AA 190 ? O ARG 1 214 N GLU AA 80  ? N GLU 1 104 
AO7 3 4 N TYR AA 72  ? N TYR 1 96  O LEU AA 161 ? O LEU 1 185 
AO8 1 2 O LEU AA 112 ? O LEU 1 136 N TRP AA 43  ? N TRP 1 67  
AO8 2 3 N PHE AA 50  ? N PHE 1 74  O HIS AA 171 ? O HIS 1 195 
AO8 3 4 O GLY AA 175 ? O GLY 1 199 N ALA AA 98  ? N ALA 1 122 
AO8 4 5 N GLY AA 95  ? N GLY 1 119 O ILE AA 126 ? O ILE 1 150 
AO9 1 2 O LEU AA 112 ? O LEU 1 136 N TRP AA 43  ? N TRP 1 67  
AO9 2 3 N PHE AA 50  ? N PHE 1 74  O HIS AA 171 ? O HIS 1 195 
AO9 3 4 O VAL AA 172 ? O VAL 1 196 N LYS AA 140 ? N LYS 1 164 
AP1 1 2 N GLY AA 59  ? N GLY 1 83  O PRO AA 64  ? O PRO 1 88  
AP2 1 2 N PHE BA 29  ? N PHE 2 53  O ILE BA 189 ? O ILE 2 213 
AP2 2 3 O TYR BA 194 ? O TYR 2 218 N LYS BA 76  ? N LYS 2 100 
AP2 3 4 N PHE BA 81  ? N PHE 2 105 O HIS BA 133 ? O HIS 2 157 
AP3 1 2 N PHE BA 29  ? N PHE 2 53  O ILE BA 189 ? O ILE 2 213 
AP3 2 3 O TYR BA 194 ? O TYR 2 218 N LYS BA 76  ? N LYS 2 100 
AP3 3 4 N TYR BA 72  ? N TYR 2 96  O LEU BA 161 ? O LEU 2 185 
AP3 4 5 N TRP BA 160 ? N TRP 2 184 O PHE SA 150 ? O PHE j 174 
AP4 1 2 O LEU BA 112 ? O LEU 2 136 N TRP BA 43  ? N TRP 2 67  
AP4 2 3 N ALA BA 44  ? N ALA 2 68  O PHE BA 178 ? O PHE 2 202 
AP4 3 4 O GLY BA 175 ? O GLY 2 199 N ALA BA 98  ? N ALA 2 122 
AP4 4 5 N GLY BA 93  ? N GLY 2 117 O GLN BA 128 ? O GLN 2 152 
AP5 1 2 N PHE BA 50  ? N PHE 2 74  O HIS BA 171 ? O HIS 2 195 
AP5 2 3 O VAL BA 172 ? O VAL 2 196 N LYS BA 140 ? N LYS 2 164 
AP6 1 2 N GLY BA 59  ? N GLY 2 83  O PRO BA 64  ? O PRO 2 88  
AP7 1 2 N PHE BA 150 ? N PHE 2 174 O TRP QA 160 ? O TRP h 184 
AP7 2 3 O LEU QA 161 ? O LEU h 185 N TYR QA 72  ? N TYR h 96  
AP7 3 4 N TRP QA 82  ? N TRP h 106 O ASN QA 188 ? O ASN h 212 
AP7 4 5 O GLN QA 185 ? O GLN h 209 N ILE QA 33  ? N ILE h 57  
AP8 1 2 N PHE BA 150 ? N PHE 2 174 O TRP QA 160 ? O TRP h 184 
AP8 2 3 O LEU QA 161 ? O LEU h 185 N TYR QA 72  ? N TYR h 96  
AP8 3 4 N PHE QA 81  ? N PHE h 105 O HIS QA 133 ? O HIS h 157 
AP9 1 2 N PHE CA 29  ? N PHE 3 53  O ILE CA 189 ? O ILE 3 213 
AP9 2 3 O ASN CA 188 ? O ASN 3 212 N TRP CA 82  ? N TRP 3 106 
AP9 3 4 N PHE CA 81  ? N PHE 3 105 O HIS CA 133 ? O HIS 3 157 
AQ1 1 2 N PHE CA 29  ? N PHE 3 53  O ILE CA 189 ? O ILE 3 213 
AQ1 2 3 O ASN CA 188 ? O ASN 3 212 N TRP CA 82  ? N TRP 3 106 
AQ1 3 4 N TYR CA 72  ? N TYR 3 96  O LEU CA 161 ? O LEU 3 185 
AQ1 4 5 N TRP CA 160 ? N TRP 3 184 O PHE HA 150 ? O PHE 8 174 
AQ2 1 2 O LEU CA 112 ? O LEU 3 136 N TRP CA 43  ? N TRP 3 67  
AQ2 2 3 N PHE CA 50  ? N PHE 3 74  O HIS CA 171 ? O HIS 3 195 
AQ2 3 4 O ALA CA 177 ? O ALA 3 201 N SER CA 96  ? N SER 3 120 
AQ2 4 5 N GLY CA 95  ? N GLY 3 119 O ILE CA 126 ? O ILE 3 150 
AQ3 1 2 O LEU CA 112 ? O LEU 3 136 N TRP CA 43  ? N TRP 3 67  
AQ3 2 3 N PHE CA 50  ? N PHE 3 74  O HIS CA 171 ? O HIS 3 195 
AQ3 3 4 O VAL CA 172 ? O VAL 3 196 N LYS CA 140 ? N LYS 3 164 
AQ4 1 2 N GLY CA 59  ? N GLY 3 83  O PRO CA 64  ? O PRO 3 88  
AQ5 1 2 O ALA DA 109 ? O ALA 4 133 N VAL DA 45  ? N VAL 4 69  
AQ5 2 3 N PHE DA 50  ? N PHE 4 74  O HIS DA 171 ? O HIS 4 195 
AQ5 3 4 O GLY DA 175 ? O GLY 4 199 N ALA DA 98  ? N ALA 4 122 
AQ5 4 5 N GLY DA 95  ? N GLY 4 119 O ILE DA 126 ? O ILE 4 150 
AQ6 1 2 O ALA DA 109 ? O ALA 4 133 N VAL DA 45  ? N VAL 4 69  
AQ6 2 3 N PHE DA 50  ? N PHE 4 74  O HIS DA 171 ? O HIS 4 195 
AQ6 3 4 O VAL DA 172 ? O VAL 4 196 N LYS DA 140 ? N LYS 4 164 
AQ7 1 2 N GLY DA 59  ? N GLY 4 83  O PRO DA 64  ? O PRO 4 88  
AQ8 1 2 N PHE DA 150 ? N PHE 4 174 O TRP EA 160 ? O TRP 5 184 
AQ8 2 3 O LEU EA 161 ? O LEU 5 185 N TYR EA 72  ? N TYR 5 96  
AQ8 3 4 N TRP EA 82  ? N TRP 5 106 O ASN EA 188 ? O ASN 5 212 
AQ8 4 5 O PHE EA 197 ? O PHE 5 221 N PHE EA 21  ? N PHE 5 45  
AQ9 1 2 N PHE DA 150 ? N PHE 4 174 O TRP EA 160 ? O TRP 5 184 
AQ9 2 3 O LEU EA 161 ? O LEU 5 185 N TYR EA 72  ? N TYR 5 96  
AQ9 3 4 N PHE EA 81  ? N PHE 5 105 O HIS EA 133 ? O HIS 5 157 
AR1 1 2 O LEU EA 112 ? O LEU 5 136 N TRP EA 43  ? N TRP 5 67  
AR1 2 3 N ALA EA 44  ? N ALA 5 68  O PHE EA 178 ? O PHE 5 202 
AR1 3 4 O GLY EA 175 ? O GLY 5 199 N ALA EA 98  ? N ALA 5 122 
AR1 4 5 N GLY EA 95  ? N GLY 5 119 O ILE EA 126 ? O ILE 5 150 
AR2 1 2 O LEU EA 112 ? O LEU 5 136 N TRP EA 43  ? N TRP 5 67  
AR2 2 3 N ALA EA 44  ? N ALA 5 68  O PHE EA 178 ? O PHE 5 202 
AR2 3 4 O VAL EA 172 ? O VAL 5 196 N LYS EA 140 ? N LYS 5 164 
AR3 1 2 N PHE FA 29  ? N PHE 6 53  O ILE FA 189 ? O ILE 6 213 
AR3 2 3 O GLN FA 196 ? O GLN 6 220 N ARG FA 73  ? N ARG 6 97  
AR3 3 4 N PHE FA 81  ? N PHE 6 105 O HIS FA 133 ? O HIS 6 157 
AR4 1 2 N PHE FA 29  ? N PHE 6 53  O ILE FA 189 ? O ILE 6 213 
AR4 2 3 O GLN FA 196 ? O GLN 6 220 N ARG FA 73  ? N ARG 6 97  
AR4 3 4 N TYR FA 72  ? N TYR 6 96  O LEU FA 161 ? O LEU 6 185 
AR4 4 5 N TRP FA 160 ? N TRP 6 184 O PHE RA 150 ? O PHE i 174 
AR5 1 2 O ALA FA 109 ? O ALA 6 133 N VAL FA 45  ? N VAL 6 69  
AR5 2 3 N ASP FA 46  ? N ASP 6 70  O THR FA 176 ? O THR 6 200 
AR5 3 4 O GLY FA 175 ? O GLY 6 199 N ALA FA 98  ? N ALA 6 122 
AR5 4 5 N GLY FA 95  ? N GLY 6 119 O ILE FA 126 ? O ILE 6 150 
AR6 1 2 O ALA FA 109 ? O ALA 6 133 N VAL FA 45  ? N VAL 6 69  
AR6 2 3 N ASP FA 46  ? N ASP 6 70  O THR FA 176 ? O THR 6 200 
AR6 3 4 O VAL FA 172 ? O VAL 6 196 N LYS FA 140 ? N LYS 6 164 
AR7 1 2 N GLY FA 59  ? N GLY 6 83  O PRO FA 64  ? O PRO 6 88  
AR8 1 2 N PHE FA 150 ? N PHE 6 174 O TRP UA 160 ? O TRP l 184 
AR8 2 3 O LEU UA 161 ? O LEU l 185 N TYR UA 72  ? N TYR l 96  
AR8 3 4 N TYR UA 71  ? N TYR l 95  O ARG UA 198 ? O ARG l 222 
AR8 4 5 O ILE UA 189 ? O ILE l 213 N PHE UA 29  ? N PHE l 53  
AR9 1 2 N PHE FA 150 ? N PHE 6 174 O TRP UA 160 ? O TRP l 184 
AR9 2 3 O LEU UA 161 ? O LEU l 185 N TYR UA 72  ? N TYR l 96  
AR9 3 4 N VAL UA 77  ? N VAL l 101 O PHE UA 137 ? O PHE l 161 
AS1 1 2 N PHE GA 29  ? N PHE 7 53  O ILE GA 189 ? O ILE 7 213 
AS1 2 3 O TYR GA 194 ? O TYR 7 218 N LYS GA 76  ? N LYS 7 100 
AS1 3 4 N PHE GA 81  ? N PHE 7 105 O HIS GA 133 ? O HIS 7 157 
AS2 1 2 N PHE GA 29  ? N PHE 7 53  O ILE GA 189 ? O ILE 7 213 
AS2 2 3 O TYR GA 194 ? O TYR 7 218 N LYS GA 76  ? N LYS 7 100 
AS2 3 4 N TYR GA 72  ? N TYR 7 96  O LEU GA 161 ? O LEU 7 185 
AS2 4 5 N TRP GA 160 ? N TRP 7 184 O PHE XA 150 ? O PHE o 174 
AS3 1 2 O LEU GA 112 ? O LEU 7 136 N TRP GA 43  ? N TRP 7 67  
AS3 2 3 N ALA GA 44  ? N ALA 7 68  O PHE GA 178 ? O PHE 7 202 
AS3 3 4 O GLY GA 175 ? O GLY 7 199 N ALA GA 98  ? N ALA 7 122 
AS3 4 5 N GLY GA 95  ? N GLY 7 119 O ILE GA 126 ? O ILE 7 150 
AS4 1 2 O LEU GA 112 ? O LEU 7 136 N TRP GA 43  ? N TRP 7 67  
AS4 2 3 N ALA GA 44  ? N ALA 7 68  O PHE GA 178 ? O PHE 7 202 
AS4 3 4 O VAL GA 172 ? O VAL 7 196 N LYS GA 140 ? N LYS 7 164 
AS5 1 2 N GLY GA 59  ? N GLY 7 83  O PRO GA 64  ? O PRO 7 88  
AS6 1 2 N PHE GA 150 ? N PHE 7 174 O TRP ZA 160 ? O TRP q 184 
AS6 2 3 O LEU ZA 161 ? O LEU q 185 N TYR ZA 72  ? N TYR q 96  
AS6 3 4 N GLU ZA 80  ? N GLU q 104 O ARG ZA 190 ? O ARG q 214 
AS6 4 5 O ILE ZA 189 ? O ILE q 213 N PHE ZA 29  ? N PHE q 53  
AS7 1 2 N PHE GA 150 ? N PHE 7 174 O TRP ZA 160 ? O TRP q 184 
AS7 2 3 O LEU ZA 161 ? O LEU q 185 N TYR ZA 72  ? N TYR q 96  
AS7 3 4 N PHE ZA 81  ? N PHE q 105 O HIS ZA 133 ? O HIS q 157 
AS8 1 2 O LEU HA 112 ? O LEU 8 136 N TRP HA 43  ? N TRP 8 67  
AS8 2 3 N ALA HA 44  ? N ALA 8 68  O PHE HA 178 ? O PHE 8 202 
AS8 3 4 O ALA HA 177 ? O ALA 8 201 N SER HA 96  ? N SER 8 120 
AS8 4 5 N GLY HA 95  ? N GLY 8 119 O ILE HA 126 ? O ILE 8 150 
AS9 1 2 O LEU HA 112 ? O LEU 8 136 N TRP HA 43  ? N TRP 8 67  
AS9 2 3 N ALA HA 44  ? N ALA 8 68  O PHE HA 178 ? O PHE 8 202 
AS9 3 4 O VAL HA 172 ? O VAL 8 196 N LYS HA 140 ? N LYS 8 164 
AT1 1 2 N GLY HA 59  ? N GLY 8 83  O PRO HA 64  ? O PRO 8 88  
AT2 1 2 N PHE IA 29  ? N PHE 9 53  O ILE IA 189 ? O ILE 9 213 
AT2 2 3 O THR IA 192 ? O THR 9 216 N LYS IA 78  ? N LYS 9 102 
AT2 3 4 N PHE IA 81  ? N PHE 9 105 O HIS IA 133 ? O HIS 9 157 
AT3 1 2 N PHE IA 29  ? N PHE 9 53  O ILE IA 189 ? O ILE 9 213 
AT3 2 3 O THR IA 192 ? O THR 9 216 N LYS IA 78  ? N LYS 9 102 
AT3 3 4 N TYR IA 72  ? N TYR 9 96  O LEU IA 161 ? O LEU 9 185 
AT4 1 2 O ALA IA 109 ? O ALA 9 133 N VAL IA 45  ? N VAL 9 69  
AT4 2 3 N ALA IA 44  ? N ALA 9 68  O PHE IA 178 ? O PHE 9 202 
AT4 3 4 O GLY IA 175 ? O GLY 9 199 N ALA IA 98  ? N ALA 9 122 
AT4 4 5 N SER IA 97  ? N SER 9 121 O HIS IA 124 ? O HIS 9 148 
AT5 1 2 O ALA IA 109 ? O ALA 9 133 N VAL IA 45  ? N VAL 9 69  
AT5 2 3 N ALA IA 44  ? N ALA 9 68  O PHE IA 178 ? O PHE 9 202 
AT5 3 4 O VAL IA 172 ? O VAL 9 196 N LYS IA 140 ? N LYS 9 164 
AT6 1 2 N GLY IA 59  ? N GLY 9 83  O PRO IA 64  ? O PRO 9 88  
AT7 1 2 N PHE JA 29  ? N PHE a 53  O ILE JA 189 ? O ILE a 213 
AT7 2 3 O ARG JA 198 ? O ARG a 222 N TYR JA 71  ? N TYR a 95  
AT7 3 4 N PHE JA 81  ? N PHE a 105 O HIS JA 133 ? O HIS a 157 
AT8 1 2 N PHE JA 29  ? N PHE a 53  O ILE JA 189 ? O ILE a 213 
AT8 2 3 O ARG JA 198 ? O ARG a 222 N TYR JA 71  ? N TYR a 95  
AT8 3 4 N TYR JA 72  ? N TYR a 96  O LEU JA 161 ? O LEU a 185 
AT8 4 5 N TRP JA 160 ? N TRP a 184 O PHE YA 150 ? O PHE p 174 
AT9 1 2 O ALA JA 109 ? O ALA a 133 N VAL JA 45  ? N VAL a 69  
AT9 2 3 N PHE JA 50  ? N PHE a 74  O HIS JA 171 ? O HIS a 195 
AT9 3 4 O GLY JA 175 ? O GLY a 199 N ALA JA 98  ? N ALA a 122 
AT9 4 5 N GLY JA 95  ? N GLY a 119 O ILE JA 126 ? O ILE a 150 
AU1 1 2 O ALA JA 109 ? O ALA a 133 N VAL JA 45  ? N VAL a 69  
AU1 2 3 N PHE JA 50  ? N PHE a 74  O HIS JA 171 ? O HIS a 195 
AU1 3 4 O VAL JA 172 ? O VAL a 196 N LYS JA 140 ? N LYS a 164 
AU2 1 2 N GLY JA 59  ? N GLY a 83  O PRO JA 64  ? O PRO a 88  
AU3 1 2 N PHE JA 150 ? N PHE a 174 O TRP BB 160 ? O TRP s 184 
AU3 2 3 O LEU BB 161 ? O LEU s 185 N TYR BB 72  ? N TYR s 96  
AU3 3 4 N ARG BB 73  ? N ARG s 97  O GLN BB 196 ? O GLN s 220 
AU3 4 5 O ILE BB 189 ? O ILE s 213 N PHE BB 29  ? N PHE s 53  
AU4 1 2 N PHE JA 150 ? N PHE a 174 O TRP BB 160 ? O TRP s 184 
AU4 2 3 O LEU BB 161 ? O LEU s 185 N TYR BB 72  ? N TYR s 96  
AU4 3 4 N PHE BB 81  ? N PHE s 105 O HIS BB 133 ? O HIS s 157 
AU5 1 2 N LEU KA 25  ? N LEU b 49  O MET KA 193 ? O MET b 217 
AU5 2 3 O TYR KA 194 ? O TYR b 218 N LYS KA 76  ? N LYS b 100 
AU5 3 4 N PHE KA 81  ? N PHE b 105 O HIS KA 133 ? O HIS b 157 
AU6 1 2 N LEU KA 25  ? N LEU b 49  O MET KA 193 ? O MET b 217 
AU6 2 3 O TYR KA 194 ? O TYR b 218 N LYS KA 76  ? N LYS b 100 
AU6 3 4 N TYR KA 72  ? N TYR b 96  O LEU KA 161 ? O LEU b 185 
AU6 4 5 N TRP KA 160 ? N TRP b 184 O PHE PA 150 ? O PHE g 174 
AU7 1 2 O LEU KA 112 ? O LEU b 136 N TRP KA 43  ? N TRP b 67  
AU7 2 3 N ALA KA 44  ? N ALA b 68  O PHE KA 178 ? O PHE b 202 
AU7 3 4 O GLY KA 175 ? O GLY b 199 N ALA KA 98  ? N ALA b 122 
AU7 4 5 N GLY KA 95  ? N GLY b 119 O ILE KA 126 ? O ILE b 150 
AU8 1 2 N PHE KA 50  ? N PHE b 74  O HIS KA 171 ? O HIS b 195 
AU8 2 3 O VAL KA 172 ? O VAL b 196 N LYS KA 140 ? N LYS b 164 
AU9 1 2 N GLY KA 60  ? N GLY b 84  O ASN KA 63  ? O ASN b 87  
AV1 1 2 O LEU LA 112 ? O LEU c 136 N TRP LA 43  ? N TRP c 67  
AV1 2 3 N PHE LA 50  ? N PHE c 74  O HIS LA 171 ? O HIS c 195 
AV1 3 4 O GLY LA 175 ? O GLY c 199 N ALA LA 98  ? N ALA c 122 
AV1 4 5 N SER LA 97  ? N SER c 121 O HIS LA 124 ? O HIS c 148 
AV2 1 2 O LEU LA 112 ? O LEU c 136 N TRP LA 43  ? N TRP c 67  
AV2 2 3 N PHE LA 50  ? N PHE c 74  O HIS LA 171 ? O HIS c 195 
AV2 3 4 O VAL LA 172 ? O VAL c 196 N LYS LA 140 ? N LYS c 164 
AV3 1 2 N PHE MA 29  ? N PHE d 53  O ILE MA 189 ? O ILE d 213 
AV3 2 3 O ASN MA 188 ? O ASN d 212 N TRP MA 82  ? N TRP d 106 
AV3 3 4 N PHE MA 81  ? N PHE d 105 O HIS MA 133 ? O HIS d 157 
AV4 1 2 N PHE MA 29  ? N PHE d 53  O ILE MA 189 ? O ILE d 213 
AV4 2 3 O ASN MA 188 ? O ASN d 212 N TRP MA 82  ? N TRP d 106 
AV4 3 4 N TYR MA 72  ? N TYR d 96  O LEU MA 161 ? O LEU d 185 
AV5 1 2 O LEU MA 112 ? O LEU d 136 N TRP MA 43  ? N TRP d 67  
AV5 2 3 N ALA MA 44  ? N ALA d 68  O PHE MA 178 ? O PHE d 202 
AV5 3 4 O GLY MA 175 ? O GLY d 199 N ALA MA 98  ? N ALA d 122 
AV5 4 5 N GLY MA 95  ? N GLY d 119 O ILE MA 126 ? O ILE d 150 
AV6 1 2 O LEU MA 112 ? O LEU d 136 N TRP MA 43  ? N TRP d 67  
AV6 2 3 N ALA MA 44  ? N ALA d 68  O PHE MA 178 ? O PHE d 202 
AV6 3 4 O VAL MA 172 ? O VAL d 196 N LYS MA 140 ? N LYS d 164 
AV7 1 2 N PHE NA 21  ? N PHE e 45  O PHE NA 197 ? O PHE e 221 
AV7 2 3 O ARG NA 190 ? O ARG e 214 N GLU NA 80  ? N GLU e 104 
AV7 3 4 N PHE NA 81  ? N PHE e 105 O HIS NA 133 ? O HIS e 157 
AV8 1 2 N PHE NA 21  ? N PHE e 45  O PHE NA 197 ? O PHE e 221 
AV8 2 3 O ARG NA 190 ? O ARG e 214 N GLU NA 80  ? N GLU e 104 
AV8 3 4 N TYR NA 72  ? N TYR e 96  O LEU NA 161 ? O LEU e 185 
AV9 1 2 O ALA NA 109 ? O ALA e 133 N VAL NA 45  ? N VAL e 69  
AV9 2 3 N ALA NA 44  ? N ALA e 68  O PHE NA 178 ? O PHE e 202 
AV9 3 4 O GLY NA 175 ? O GLY e 199 N ALA NA 98  ? N ALA e 122 
AV9 4 5 N GLY NA 95  ? N GLY e 119 O ILE NA 126 ? O ILE e 150 
AW1 1 2 O ALA NA 109 ? O ALA e 133 N VAL NA 45  ? N VAL e 69  
AW1 2 3 N ALA NA 44  ? N ALA e 68  O PHE NA 178 ? O PHE e 202 
AW1 3 4 O VAL NA 172 ? O VAL e 196 N LYS NA 140 ? N LYS e 164 
AW2 1 2 N PHE NA 150 ? N PHE e 174 O TRP DB 160 ? O TRP u 184 
AW2 2 3 O LEU DB 161 ? O LEU u 185 N TYR DB 72  ? N TYR u 96  
AW2 3 4 N LYS DB 76  ? N LYS u 100 O TYR DB 194 ? O TYR u 218 
AW2 4 5 O MET DB 193 ? O MET u 217 N LEU DB 25  ? N LEU u 49  
AW3 1 2 N PHE NA 150 ? N PHE e 174 O TRP DB 160 ? O TRP u 184 
AW3 2 3 O LEU DB 161 ? O LEU u 185 N TYR DB 72  ? N TYR u 96  
AW3 3 4 N PHE DB 81  ? N PHE u 105 O HIS DB 133 ? O HIS u 157 
AW4 1 2 N PHE OA 29  ? N PHE f 53  O ILE OA 189 ? O ILE f 213 
AW4 2 3 O TYR OA 194 ? O TYR f 218 N LYS OA 76  ? N LYS f 100 
AW4 3 4 N PHE OA 81  ? N PHE f 105 O HIS OA 133 ? O HIS f 157 
AW5 1 2 N PHE OA 29  ? N PHE f 53  O ILE OA 189 ? O ILE f 213 
AW5 2 3 O TYR OA 194 ? O TYR f 218 N LYS OA 76  ? N LYS f 100 
AW5 3 4 N TYR OA 72  ? N TYR f 96  O LEU OA 161 ? O LEU f 185 
AW5 4 5 N TRP OA 160 ? N TRP f 184 O PHE EB 150 ? O PHE v 174 
AW6 1 2 O LEU OA 112 ? O LEU f 136 N TRP OA 43  ? N TRP f 67  
AW6 2 3 N ALA OA 44  ? N ALA f 68  O PHE OA 178 ? O PHE f 202 
AW6 3 4 O ALA OA 177 ? O ALA f 201 N SER OA 96  ? N SER f 120 
AW6 4 5 N GLY OA 95  ? N GLY f 119 O ILE OA 126 ? O ILE f 150 
AW7 1 2 O LEU OA 112 ? O LEU f 136 N TRP OA 43  ? N TRP f 67  
AW7 2 3 N ALA OA 44  ? N ALA f 68  O PHE OA 178 ? O PHE f 202 
AW7 3 4 O VAL OA 172 ? O VAL f 196 N LYS OA 140 ? N LYS f 164 
AW8 1 2 N GLY OA 60  ? N GLY f 84  O ASN OA 63  ? O ASN f 87  
AW9 1 2 N PHE OA 150 ? N PHE f 174 O TRP TA 160 ? O TRP k 184 
AW9 2 3 O LEU TA 161 ? O LEU k 185 N TYR TA 72  ? N TYR k 96  
AW9 3 4 N LYS TA 78  ? N LYS k 102 O THR TA 192 ? O THR k 216 
AW9 4 5 O GLN TA 185 ? O GLN k 209 N ILE TA 33  ? N ILE k 57  
AX1 1 2 N PHE OA 150 ? N PHE f 174 O TRP TA 160 ? O TRP k 184 
AX1 2 3 O LEU TA 161 ? O LEU k 185 N TYR TA 72  ? N TYR k 96  
AX1 3 4 N PHE TA 81  ? N PHE k 105 O HIS TA 133 ? O HIS k 157 
AX2 1 2 O LEU PA 112 ? O LEU g 136 N TRP PA 43  ? N TRP g 67  
AX2 2 3 N ASP PA 46  ? N ASP g 70  O THR PA 176 ? O THR g 200 
AX2 3 4 O GLY PA 175 ? O GLY g 199 N ALA PA 98  ? N ALA g 122 
AX2 4 5 N SER PA 97  ? N SER g 121 O HIS PA 124 ? O HIS g 148 
AX3 1 2 N PHE PA 50  ? N PHE g 74  O HIS PA 171 ? O HIS g 195 
AX3 2 3 O VAL PA 172 ? O VAL g 196 N LYS PA 140 ? N LYS g 164 
AX4 1 2 N GLY PA 59  ? N GLY g 83  O PRO PA 64  ? O PRO g 88  
AX5 1 2 O LEU QA 112 ? O LEU h 136 N TRP QA 43  ? N TRP h 67  
AX5 2 3 N ALA QA 44  ? N ALA h 68  O PHE QA 178 ? O PHE h 202 
AX5 3 4 O GLY QA 175 ? O GLY h 199 N ALA QA 98  ? N ALA h 122 
AX5 4 5 N GLY QA 93  ? N GLY h 117 O GLN QA 128 ? O GLN h 152 
AX6 1 2 O LEU QA 112 ? O LEU h 136 N TRP QA 43  ? N TRP h 67  
AX6 2 3 N ALA QA 44  ? N ALA h 68  O PHE QA 178 ? O PHE h 202 
AX6 3 4 O VAL QA 172 ? O VAL h 196 N LYS QA 140 ? N LYS h 164 
AX7 1 2 N GLY QA 59  ? N GLY h 83  O PRO QA 64  ? O PRO h 88  
AX8 1 2 N PHE QA 150 ? N PHE h 174 O TRP SA 160 ? O TRP j 184 
AX8 2 3 O LEU SA 161 ? O LEU j 185 N TYR SA 72  ? N TYR j 96  
AX8 3 4 N TRP SA 82  ? N TRP j 106 O ASN SA 188 ? O ASN j 212 
AX8 4 5 O PHE SA 197 ? O PHE j 221 N PHE SA 21  ? N PHE j 45  
AX9 1 2 N PHE QA 150 ? N PHE h 174 O TRP SA 160 ? O TRP j 184 
AX9 2 3 O LEU SA 161 ? O LEU j 185 N TYR SA 72  ? N TYR j 96  
AX9 3 4 N PHE SA 81  ? N PHE j 105 O HIS SA 133 ? O HIS j 157 
AY1 1 2 N PHE RA 29  ? N PHE i 53  O ILE RA 189 ? O ILE i 213 
AY1 2 3 O TYR RA 194 ? O TYR i 218 N LYS RA 76  ? N LYS i 100 
AY1 3 4 N PHE RA 81  ? N PHE i 105 O HIS RA 133 ? O HIS i 157 
AY2 1 2 N PHE RA 29  ? N PHE i 53  O ILE RA 189 ? O ILE i 213 
AY2 2 3 O TYR RA 194 ? O TYR i 218 N LYS RA 76  ? N LYS i 100 
AY2 3 4 N TYR RA 72  ? N TYR i 96  O LEU RA 161 ? O LEU i 185 
AY2 4 5 N TRP RA 160 ? N TRP i 184 O PHE UA 150 ? O PHE l 174 
AY3 1 2 O ALA RA 109 ? O ALA i 133 N VAL RA 45  ? N VAL i 69  
AY3 2 3 N ALA RA 44  ? N ALA i 68  O PHE RA 178 ? O PHE i 202 
AY3 3 4 O GLY RA 175 ? O GLY i 199 N ALA RA 98  ? N ALA i 122 
AY3 4 5 N GLY RA 93  ? N GLY i 117 O GLN RA 128 ? O GLN i 152 
AY4 1 2 O ALA RA 109 ? O ALA i 133 N VAL RA 45  ? N VAL i 69  
AY4 2 3 N ALA RA 44  ? N ALA i 68  O PHE RA 178 ? O PHE i 202 
AY4 3 4 O VAL RA 172 ? O VAL i 196 N LYS RA 140 ? N LYS i 164 
AY5 1 2 N GLY RA 59  ? N GLY i 83  O PRO RA 64  ? O PRO i 88  
AY6 1 2 O ALA SA 109 ? O ALA j 133 N VAL SA 45  ? N VAL j 69  
AY6 2 3 N PHE SA 50  ? N PHE j 74  O HIS SA 171 ? O HIS j 195 
AY6 3 4 O GLY SA 175 ? O GLY j 199 N ALA SA 98  ? N ALA j 122 
AY6 4 5 N GLY SA 95  ? N GLY j 119 O ILE SA 126 ? O ILE j 150 
AY7 1 2 O ALA SA 109 ? O ALA j 133 N VAL SA 45  ? N VAL j 69  
AY7 2 3 N PHE SA 50  ? N PHE j 74  O HIS SA 171 ? O HIS j 195 
AY7 3 4 O VAL SA 172 ? O VAL j 196 N LYS SA 140 ? N LYS j 164 
AY8 1 2 N GLY SA 59  ? N GLY j 83  O PRO SA 64  ? O PRO j 88  
AY9 1 2 O LEU TA 112 ? O LEU k 136 N TRP TA 43  ? N TRP k 67  
AY9 2 3 N ALA TA 44  ? N ALA k 68  O PHE TA 178 ? O PHE k 202 
AY9 3 4 O GLY TA 175 ? O GLY k 199 N ALA TA 98  ? N ALA k 122 
AY9 4 5 N GLY TA 93  ? N GLY k 117 O GLN TA 128 ? O GLN k 152 
AZ1 1 2 O LEU TA 112 ? O LEU k 136 N TRP TA 43  ? N TRP k 67  
AZ1 2 3 N ALA TA 44  ? N ALA k 68  O PHE TA 178 ? O PHE k 202 
AZ1 3 4 O VAL TA 172 ? O VAL k 196 N LYS TA 140 ? N LYS k 164 
AZ2 1 2 N GLY TA 60  ? N GLY k 84  O ASN TA 63  ? O ASN k 87  
AZ3 1 2 N PHE TA 150 ? N PHE k 174 O TRP EB 160 ? O TRP v 184 
AZ3 2 3 O LEU EB 161 ? O LEU v 185 N TYR EB 72  ? N TYR v 96  
AZ3 3 4 N TRP EB 82  ? N TRP v 106 O ASN EB 188 ? O ASN v 212 
AZ3 4 5 O ILE EB 189 ? O ILE v 213 N PHE EB 29  ? N PHE v 53  
AZ4 1 2 N PHE TA 150 ? N PHE k 174 O TRP EB 160 ? O TRP v 184 
AZ4 2 3 O LEU EB 161 ? O LEU v 185 N TYR EB 72  ? N TYR v 96  
AZ4 3 4 N PHE EB 81  ? N PHE v 105 O HIS EB 133 ? O HIS v 157 
AZ5 1 2 O LEU UA 112 ? O LEU l 136 N TRP UA 43  ? N TRP l 67  
AZ5 2 3 N ALA UA 44  ? N ALA l 68  O PHE UA 178 ? O PHE l 202 
AZ5 3 4 O ALA UA 177 ? O ALA l 201 N SER UA 96  ? N SER l 120 
AZ5 4 5 N SER UA 97  ? N SER l 121 O HIS UA 124 ? O HIS l 148 
AZ6 1 2 O LEU UA 112 ? O LEU l 136 N TRP UA 43  ? N TRP l 67  
AZ6 2 3 N ALA UA 44  ? N ALA l 68  O PHE UA 178 ? O PHE l 202 
AZ6 3 4 O VAL UA 172 ? O VAL l 196 N LYS UA 140 ? N LYS l 164 
AZ7 1 2 N GLY UA 59  ? N GLY l 83  O PRO UA 64  ? O PRO l 88  
AZ8 1 2 N PHE VA 29  ? N PHE m 53  O ILE VA 189 ? O ILE m 213 
AZ8 2 3 O TYR VA 194 ? O TYR m 218 N ARG VA 75  ? N ARG m 99  
AZ8 3 4 N PHE VA 81  ? N PHE m 105 O HIS VA 133 ? O HIS m 157 
AZ9 1 2 N PHE VA 29  ? N PHE m 53  O ILE VA 189 ? O ILE m 213 
AZ9 2 3 O TYR VA 194 ? O TYR m 218 N ARG VA 75  ? N ARG m 99  
AZ9 3 4 N TYR VA 72  ? N TYR m 96  O LEU VA 161 ? O LEU m 185 
AZ9 4 5 N TRP VA 160 ? N TRP m 184 O PHE HB 150 ? O PHE y 174 
BA1 1 2 O LEU VA 112 ? O LEU m 136 N TRP VA 43  ? N TRP m 67  
BA1 2 3 N ALA VA 44  ? N ALA m 68  O PHE VA 178 ? O PHE m 202 
BA1 3 4 O GLY VA 175 ? O GLY m 199 N ALA VA 98  ? N ALA m 122 
BA1 4 5 N GLY VA 93  ? N GLY m 117 O GLN VA 128 ? O GLN m 152 
BA2 1 2 O LEU VA 112 ? O LEU m 136 N TRP VA 43  ? N TRP m 67  
BA2 2 3 N ALA VA 44  ? N ALA m 68  O PHE VA 178 ? O PHE m 202 
BA2 3 4 O VAL VA 172 ? O VAL m 196 N LYS VA 140 ? N LYS m 164 
BA3 1 2 N GLY VA 60  ? N GLY m 84  O ASN VA 63  ? O ASN m 87  
BA4 1 2 N PHE VA 150 ? N PHE m 174 O TRP WA 160 ? O TRP n 184 
BA4 2 3 O LEU WA 161 ? O LEU n 185 N TYR WA 72  ? N TYR n 96  
BA4 3 4 N LYS WA 78  ? N LYS n 102 O THR WA 192 ? O THR n 216 
BA4 4 5 O MET WA 193 ? O MET n 217 N LEU WA 25  ? N LEU n 49  
BA5 1 2 N PHE VA 150 ? N PHE m 174 O TRP WA 160 ? O TRP n 184 
BA5 2 3 O LEU WA 161 ? O LEU n 185 N TYR WA 72  ? N TYR n 96  
BA5 3 4 N PHE WA 81  ? N PHE n 105 O HIS WA 133 ? O HIS n 157 
BA6 1 2 O ALA WA 109 ? O ALA n 133 N VAL WA 45  ? N VAL n 69  
BA6 2 3 N ALA WA 44  ? N ALA n 68  O PHE WA 178 ? O PHE n 202 
BA6 3 4 O GLY WA 175 ? O GLY n 199 N ALA WA 98  ? N ALA n 122 
BA6 4 5 N GLY WA 95  ? N GLY n 119 O ILE WA 126 ? O ILE n 150 
BA7 1 2 O ALA WA 109 ? O ALA n 133 N VAL WA 45  ? N VAL n 69  
BA7 2 3 N ALA WA 44  ? N ALA n 68  O PHE WA 178 ? O PHE n 202 
BA7 3 4 O VAL WA 172 ? O VAL n 196 N LYS WA 140 ? N LYS n 164 
BA8 1 2 N GLY WA 59  ? N GLY n 83  O PRO WA 64  ? O PRO n 88  
BA9 1 2 N PHE WA 150 ? N PHE n 174 O TRP HB 160 ? O TRP y 184 
BA9 2 3 O LEU HB 161 ? O LEU y 185 N TYR HB 72  ? N TYR y 96  
BA9 3 4 N LYS HB 76  ? N LYS y 100 O TYR HB 194 ? O TYR y 218 
BA9 4 5 O PHE HB 197 ? O PHE y 221 N PHE HB 21  ? N PHE y 45  
BB1 1 2 N PHE WA 150 ? N PHE n 174 O TRP HB 160 ? O TRP y 184 
BB1 2 3 O LEU HB 161 ? O LEU y 185 N TYR HB 72  ? N TYR y 96  
BB1 3 4 N PHE HB 81  ? N PHE y 105 O HIS HB 133 ? O HIS y 157 
BB2 1 2 N PHE XA 21  ? N PHE o 45  O PHE XA 197 ? O PHE o 221 
BB2 2 3 O ASN XA 188 ? O ASN o 212 N TRP XA 82  ? N TRP o 106 
BB2 3 4 N PHE XA 81  ? N PHE o 105 O HIS XA 133 ? O HIS o 157 
BB3 1 2 N PHE XA 21  ? N PHE o 45  O PHE XA 197 ? O PHE o 221 
BB3 2 3 O ASN XA 188 ? O ASN o 212 N TRP XA 82  ? N TRP o 106 
BB3 3 4 N TYR XA 72  ? N TYR o 96  O LEU XA 161 ? O LEU o 185 
BB3 4 5 N TRP XA 160 ? N TRP o 184 O PHE ZA 150 ? O PHE q 174 
BB4 1 2 O LEU XA 112 ? O LEU o 136 N TRP XA 43  ? N TRP o 67  
BB4 2 3 N ALA XA 44  ? N ALA o 68  O PHE XA 178 ? O PHE o 202 
BB4 3 4 O GLY XA 175 ? O GLY o 199 N ALA XA 98  ? N ALA o 122 
BB4 4 5 N GLY XA 95  ? N GLY o 119 O ILE XA 126 ? O ILE o 150 
BB5 1 2 O LEU XA 112 ? O LEU o 136 N TRP XA 43  ? N TRP o 67  
BB5 2 3 N ALA XA 44  ? N ALA o 68  O PHE XA 178 ? O PHE o 202 
BB5 3 4 O VAL XA 172 ? O VAL o 196 N LYS XA 140 ? N LYS o 164 
BB6 1 2 N GLY XA 59  ? N GLY o 83  O PRO XA 64  ? O PRO o 88  
BB7 1 2 N PHE YA 29  ? N PHE p 53  O ILE YA 189 ? O ILE p 213 
BB7 2 3 O TYR YA 194 ? O TYR p 218 N LYS YA 76  ? N LYS p 100 
BB7 3 4 N PHE YA 81  ? N PHE p 105 O HIS YA 133 ? O HIS p 157 
BB8 1 2 N PHE YA 29  ? N PHE p 53  O ILE YA 189 ? O ILE p 213 
BB8 2 3 O TYR YA 194 ? O TYR p 218 N LYS YA 76  ? N LYS p 100 
BB8 3 4 N TYR YA 72  ? N TYR p 96  O LEU YA 161 ? O LEU p 185 
BB8 4 5 N TRP YA 160 ? N TRP p 184 O PHE BB 150 ? O PHE s 174 
BB9 1 2 O ALA YA 109 ? O ALA p 133 N VAL YA 45  ? N VAL p 69  
BB9 2 3 N ALA YA 44  ? N ALA p 68  O PHE YA 178 ? O PHE p 202 
BB9 3 4 O GLY YA 175 ? O GLY p 199 N ALA YA 98  ? N ALA p 122 
BB9 4 5 N GLY YA 95  ? N GLY p 119 O ILE YA 126 ? O ILE p 150 
BC1 1 2 O ALA YA 109 ? O ALA p 133 N VAL YA 45  ? N VAL p 69  
BC1 2 3 N ALA YA 44  ? N ALA p 68  O PHE YA 178 ? O PHE p 202 
BC1 3 4 O VAL YA 172 ? O VAL p 196 N LYS YA 140 ? N LYS p 164 
BC2 1 2 N GLY YA 60  ? N GLY p 84  O ASN YA 63  ? O ASN p 87  
BC3 1 2 O LEU ZA 112 ? O LEU q 136 N TRP ZA 43  ? N TRP q 67  
BC3 2 3 N ALA ZA 44  ? N ALA q 68  O PHE ZA 178 ? O PHE q 202 
BC3 3 4 O GLY ZA 175 ? O GLY q 199 N ALA ZA 98  ? N ALA q 122 
BC3 4 5 N GLY ZA 93  ? N GLY q 117 O GLN ZA 128 ? O GLN q 152 
BC4 1 2 O LEU ZA 112 ? O LEU q 136 N TRP ZA 43  ? N TRP q 67  
BC4 2 3 N ALA ZA 44  ? N ALA q 68  O PHE ZA 178 ? O PHE q 202 
BC4 3 4 O VAL ZA 172 ? O VAL q 196 N LYS ZA 140 ? N LYS q 164 
BC5 1 2 N GLY ZA 60  ? N GLY q 84  O ASN ZA 63  ? O ASN q 87  
BC6 1 2 N ILE AB 33  ? N ILE r 57  O GLN AB 185 ? O GLN r 209 
BC6 2 3 O ARG AB 190 ? O ARG r 214 N GLU AB 80  ? N GLU r 104 
BC6 3 4 N PHE AB 81  ? N PHE r 105 O HIS AB 133 ? O HIS r 157 
BC7 1 2 N ILE AB 33  ? N ILE r 57  O GLN AB 185 ? O GLN r 209 
BC7 2 3 O ARG AB 190 ? O ARG r 214 N GLU AB 80  ? N GLU r 104 
BC7 3 4 N TYR AB 72  ? N TYR r 96  O LEU AB 161 ? O LEU r 185 
BC7 4 5 N TRP AB 160 ? N TRP r 184 O PHE DB 150 ? O PHE u 174 
BC8 1 2 O LEU AB 112 ? O LEU r 136 N TRP AB 43  ? N TRP r 67  
BC8 2 3 N ALA AB 44  ? N ALA r 68  O PHE AB 178 ? O PHE r 202 
BC8 3 4 O GLY AB 175 ? O GLY r 199 N ALA AB 98  ? N ALA r 122 
BC8 4 5 N GLY AB 95  ? N GLY r 119 O ILE AB 126 ? O ILE r 150 
BC9 1 2 O LEU AB 112 ? O LEU r 136 N TRP AB 43  ? N TRP r 67  
BC9 2 3 N ALA AB 44  ? N ALA r 68  O PHE AB 178 ? O PHE r 202 
BC9 3 4 O VAL AB 172 ? O VAL r 196 N LYS AB 140 ? N LYS r 164 
BD1 1 2 O LEU BB 112 ? O LEU s 136 N TRP BB 43  ? N TRP s 67  
BD1 2 3 N PHE BB 50  ? N PHE s 74  O HIS BB 171 ? O HIS s 195 
BD1 3 4 O GLY BB 175 ? O GLY s 199 N ALA BB 98  ? N ALA s 122 
BD1 4 5 N GLY BB 95  ? N GLY s 119 O ILE BB 126 ? O ILE s 150 
BD2 1 2 O LEU BB 112 ? O LEU s 136 N TRP BB 43  ? N TRP s 67  
BD2 2 3 N PHE BB 50  ? N PHE s 74  O HIS BB 171 ? O HIS s 195 
BD2 3 4 O VAL BB 172 ? O VAL s 196 N LYS BB 140 ? N LYS s 164 
BD3 1 2 N GLY BB 60  ? N GLY s 84  O ASN BB 63  ? O ASN s 87  
BD4 1 2 N PHE CB 29  ? N PHE t 53  O ILE CB 189 ? O ILE t 213 
BD4 2 3 O ASN CB 188 ? O ASN t 212 N TRP CB 82  ? N TRP t 106 
BD4 3 4 N PHE CB 81  ? N PHE t 105 O HIS CB 133 ? O HIS t 157 
BD5 1 2 N PHE CB 29  ? N PHE t 53  O ILE CB 189 ? O ILE t 213 
BD5 2 3 O ASN CB 188 ? O ASN t 212 N TRP CB 82  ? N TRP t 106 
BD5 3 4 N TYR CB 72  ? N TYR t 96  O LEU CB 161 ? O LEU t 185 
BD5 4 5 N TRP CB 160 ? N TRP t 184 O PHE GB 150 ? O PHE x 174 
BD6 1 2 O ALA CB 109 ? O ALA t 133 N VAL CB 45  ? N VAL t 69  
BD6 2 3 N ALA CB 44  ? N ALA t 68  O PHE CB 178 ? O PHE t 202 
BD6 3 4 O GLY CB 175 ? O GLY t 199 N ALA CB 98  ? N ALA t 122 
BD6 4 5 N GLY CB 95  ? N GLY t 119 O ILE CB 126 ? O ILE t 150 
BD7 1 2 O ALA CB 109 ? O ALA t 133 N VAL CB 45  ? N VAL t 69  
BD7 2 3 N ALA CB 44  ? N ALA t 68  O PHE CB 178 ? O PHE t 202 
BD7 3 4 O VAL CB 172 ? O VAL t 196 N LYS CB 140 ? N LYS t 164 
BD8 1 2 N GLY CB 60  ? N GLY t 84  O ASN CB 63  ? O ASN t 87  
BD9 1 2 N PHE CB 150 ? N PHE t 174 O TRP FB 160 ? O TRP w 184 
BD9 2 3 O LEU FB 161 ? O LEU w 185 N TYR FB 72  ? N TYR w 96  
BD9 3 4 N TRP FB 82  ? N TRP w 106 O ASN FB 188 ? O ASN w 212 
BD9 4 5 O ILE FB 189 ? O ILE w 213 N PHE FB 29  ? N PHE w 53  
BE1 1 2 N PHE CB 150 ? N PHE t 174 O TRP FB 160 ? O TRP w 184 
BE1 2 3 O LEU FB 161 ? O LEU w 185 N TYR FB 72  ? N TYR w 96  
BE1 3 4 N PHE FB 81  ? N PHE w 105 O HIS FB 133 ? O HIS w 157 
BE2 1 2 O ALA DB 109 ? O ALA u 133 N VAL DB 45  ? N VAL u 69  
BE2 2 3 N ALA DB 44  ? N ALA u 68  O PHE DB 178 ? O PHE u 202 
BE2 3 4 O GLY DB 175 ? O GLY u 199 N ALA DB 98  ? N ALA u 122 
BE2 4 5 N GLY DB 95  ? N GLY u 119 O ILE DB 126 ? O ILE u 150 
BE3 1 2 O ALA DB 109 ? O ALA u 133 N VAL DB 45  ? N VAL u 69  
BE3 2 3 N ALA DB 44  ? N ALA u 68  O PHE DB 178 ? O PHE u 202 
BE3 3 4 O VAL DB 172 ? O VAL u 196 N LYS DB 140 ? N LYS u 164 
BE4 1 2 N GLY DB 59  ? N GLY u 83  O PRO DB 64  ? O PRO u 88  
BE5 1 2 O ALA EB 109 ? O ALA v 133 N VAL EB 45  ? N VAL v 69  
BE5 2 3 N PHE EB 50  ? N PHE v 74  O HIS EB 171 ? O HIS v 195 
BE5 3 4 O GLY EB 175 ? O GLY v 199 N ALA EB 98  ? N ALA v 122 
BE5 4 5 N GLY EB 95  ? N GLY v 119 O ILE EB 126 ? O ILE v 150 
BE6 1 2 O ALA EB 109 ? O ALA v 133 N VAL EB 45  ? N VAL v 69  
BE6 2 3 N PHE EB 50  ? N PHE v 74  O HIS EB 171 ? O HIS v 195 
BE6 3 4 O VAL EB 172 ? O VAL v 196 N LYS EB 140 ? N LYS v 164 
BE7 1 2 N GLY EB 59  ? N GLY v 83  O PRO EB 64  ? O PRO v 88  
BE8 1 2 O ALA FB 109 ? O ALA w 133 N VAL FB 45  ? N VAL w 69  
BE8 2 3 N ALA FB 44  ? N ALA w 68  O PHE FB 178 ? O PHE w 202 
BE8 3 4 O GLY FB 175 ? O GLY w 199 N ALA FB 98  ? N ALA w 122 
BE8 4 5 N GLY FB 95  ? N GLY w 119 O ILE FB 126 ? O ILE w 150 
BE9 1 2 O ALA FB 109 ? O ALA w 133 N VAL FB 45  ? N VAL w 69  
BE9 2 3 N ALA FB 44  ? N ALA w 68  O PHE FB 178 ? O PHE w 202 
BE9 3 4 O VAL FB 172 ? O VAL w 196 N LYS FB 140 ? N LYS w 164 
BF1 1 2 N GLY FB 59  ? N GLY w 83  O PRO FB 64  ? O PRO w 88  
BF2 1 2 N PHE FB 150 ? N PHE w 174 O TRP GB 160 ? O TRP x 184 
BF2 2 3 O LEU GB 161 ? O LEU x 185 N TYR GB 72  ? N TYR x 96  
BF2 3 4 N TRP GB 82  ? N TRP x 106 O ASN GB 188 ? O ASN x 212 
BF2 4 5 O PHE GB 197 ? O PHE x 221 N PHE GB 21  ? N PHE x 45  
BF3 1 2 N PHE FB 150 ? N PHE w 174 O TRP GB 160 ? O TRP x 184 
BF3 2 3 O LEU GB 161 ? O LEU x 185 N TYR GB 72  ? N TYR x 96  
BF3 3 4 N PHE GB 81  ? N PHE x 105 O HIS GB 133 ? O HIS x 157 
BF4 1 2 O LEU GB 112 ? O LEU x 136 N TRP GB 43  ? N TRP x 67  
BF4 2 3 N ALA GB 44  ? N ALA x 68  O PHE GB 178 ? O PHE x 202 
BF4 3 4 O GLY GB 175 ? O GLY x 199 N ALA GB 98  ? N ALA x 122 
BF4 4 5 N GLY GB 93  ? N GLY x 117 O GLN GB 128 ? O GLN x 152 
BF5 1 2 O LEU GB 112 ? O LEU x 136 N TRP GB 43  ? N TRP x 67  
BF5 2 3 N ALA GB 44  ? N ALA x 68  O PHE GB 178 ? O PHE x 202 
BF5 3 4 O VAL GB 172 ? O VAL x 196 N LYS GB 140 ? N LYS x 164 
BF6 1 2 N GLY GB 60  ? N GLY x 84  O ASN GB 63  ? O ASN x 87  
BF7 1 2 O LEU HB 112 ? O LEU y 136 N TRP HB 43  ? N TRP y 67  
BF7 2 3 N ALA HB 44  ? N ALA y 68  O PHE HB 178 ? O PHE y 202 
BF7 3 4 O GLY HB 175 ? O GLY y 199 N ALA HB 98  ? N ALA y 122 
BF7 4 5 N GLY HB 95  ? N GLY y 119 O ILE HB 126 ? O ILE y 150 
BF8 1 2 O LEU HB 112 ? O LEU y 136 N TRP HB 43  ? N TRP y 67  
BF8 2 3 N ALA HB 44  ? N ALA y 68  O PHE HB 178 ? O PHE y 202 
BF8 3 4 O VAL HB 172 ? O VAL y 196 N LYS HB 140 ? N LYS y 164 
BF9 1 2 N GLY HB 59  ? N GLY y 83  O PRO HB 64  ? O PRO y 88  
# 
_atom_sites.entry_id                    5ZJU 
_atom_sites.fract_transf_matrix[1][1]   0.005152 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000065 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004954 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004324 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A  1 19  ? 34.004  4.157   126.810 1.00 64.23  ? 43  SER A N   1 
ATOM   2     C CA  . SER A  1 19  ? 32.715  3.894   126.067 1.00 63.81  ? 43  SER A CA  1 
ATOM   3     C C   . SER A  1 19  ? 32.183  2.472   126.457 1.00 58.88  ? 43  SER A C   1 
ATOM   4     O O   . SER A  1 19  ? 31.526  2.389   127.493 1.00 50.35  ? 43  SER A O   1 
ATOM   5     C CB  . SER A  1 19  ? 32.875  4.193   124.514 1.00 68.48  ? 43  SER A CB  1 
ATOM   6     O OG  . SER A  1 19  ? 31.644  4.377   123.775 1.00 68.29  ? 43  SER A OG  1 
ATOM   7     N N   . HIS A  1 20  ? 32.499  1.406   125.671 1.00 59.07  ? 44  HIS A N   1 
ATOM   8     C CA  . HIS A  1 20  ? 31.951  0.018   125.815 1.00 59.80  ? 44  HIS A CA  1 
ATOM   9     C C   . HIS A  1 20  ? 33.032  -0.889  126.196 1.00 53.78  ? 44  HIS A C   1 
ATOM   10    O O   . HIS A  1 20  ? 34.104  -0.789  125.654 1.00 53.77  ? 44  HIS A O   1 
ATOM   11    C CB  . HIS A  1 20  ? 31.390  -0.608  124.540 1.00 63.01  ? 44  HIS A CB  1 
ATOM   12    C CG  . HIS A  1 20  ? 30.421  0.264   123.862 1.00 78.62  ? 44  HIS A CG  1 
ATOM   13    N ND1 . HIS A  1 20  ? 30.757  1.024   122.759 1.00 105.70 ? 44  HIS A ND1 1 
ATOM   14    C CD2 . HIS A  1 20  ? 29.143  0.584   124.165 1.00 91.07  ? 44  HIS A CD2 1 
ATOM   15    C CE1 . HIS A  1 20  ? 29.712  1.743   122.378 1.00 113.70 ? 44  HIS A CE1 1 
ATOM   16    N NE2 . HIS A  1 20  ? 28.717  1.493   123.215 1.00 110.34 ? 44  HIS A NE2 1 
ATOM   17    N N   . PHE A  1 21  ? 32.716  -1.823  127.085 1.00 49.24  ? 45  PHE A N   1 
ATOM   18    C CA  . PHE A  1 21  ? 33.637  -2.874  127.503 1.00 44.64  ? 45  PHE A CA  1 
ATOM   19    C C   . PHE A  1 21  ? 32.986  -4.243  127.284 1.00 39.67  ? 45  PHE A C   1 
ATOM   20    O O   . PHE A  1 21  ? 31.948  -4.522  127.820 1.00 38.54  ? 45  PHE A O   1 
ATOM   21    C CB  . PHE A  1 21  ? 34.045  -2.640  128.966 1.00 44.50  ? 45  PHE A CB  1 
ATOM   22    C CG  . PHE A  1 21  ? 34.984  -3.675  129.512 1.00 45.09  ? 45  PHE A CG  1 
ATOM   23    C CD1 . PHE A  1 21  ? 36.141  -4.055  128.802 1.00 45.07  ? 45  PHE A CD1 1 
ATOM   24    C CD2 . PHE A  1 21  ? 34.732  -4.256  130.743 1.00 45.06  ? 45  PHE A CD2 1 
ATOM   25    C CE1 . PHE A  1 21  ? 37.014  -5.013  129.309 1.00 46.53  ? 45  PHE A CE1 1 
ATOM   26    C CE2 . PHE A  1 21  ? 35.617  -5.208  131.269 1.00 47.38  ? 45  PHE A CE2 1 
ATOM   27    C CZ  . PHE A  1 21  ? 36.764  -5.586  130.550 1.00 46.88  ? 45  PHE A CZ  1 
ATOM   28    N N   . ASN A  1 22  ? 33.593  -5.081  126.467 1.00 37.64  ? 46  ASN A N   1 
ATOM   29    C CA  . ASN A  1 22  ? 33.055  -6.417  126.227 1.00 37.95  ? 46  ASN A CA  1 
ATOM   30    C C   . ASN A  1 22  ? 33.808  -7.367  127.142 1.00 36.38  ? 46  ASN A C   1 
ATOM   31    O O   . ASN A  1 22  ? 35.017  -7.325  127.187 1.00 36.59  ? 46  ASN A O   1 
ATOM   32    C CB  . ASN A  1 22  ? 33.185  -6.836  124.734 1.00 37.20  ? 46  ASN A CB  1 
ATOM   33    C CG  . ASN A  1 22  ? 32.448  -5.893  123.795 1.00 36.94  ? 46  ASN A CG  1 
ATOM   34    O OD1 . ASN A  1 22  ? 31.268  -5.708  123.900 1.00 38.80  ? 46  ASN A OD1 1 
ATOM   35    N ND2 . ASN A  1 22  ? 33.148  -5.298  122.897 1.00 36.51  ? 46  ASN A ND2 1 
ATOM   36    N N   . THR A  1 23  ? 33.110  -8.182  127.908 1.00 35.22  ? 47  THR A N   1 
ATOM   37    C CA  . THR A  1 23  ? 33.811  -9.160  128.689 1.00 36.10  ? 47  THR A CA  1 
ATOM   38    C C   . THR A  1 23  ? 33.013  -10.440 128.896 1.00 34.47  ? 47  THR A C   1 
ATOM   39    O O   . THR A  1 23  ? 31.930  -10.563 128.382 1.00 33.25  ? 47  THR A O   1 
ATOM   40    C CB  . THR A  1 23  ? 34.323  -8.524  129.993 1.00 38.78  ? 47  THR A CB  1 
ATOM   41    O OG1 . THR A  1 23  ? 35.276  -9.388  130.636 1.00 41.47  ? 47  THR A OG1 1 
ATOM   42    C CG2 . THR A  1 23  ? 33.204  -8.146  130.950 1.00 39.09  ? 47  THR A CG2 1 
ATOM   43    N N   . ARG A  1 24  ? 33.613  -11.399 129.595 1.00 33.73  ? 48  ARG A N   1 
ATOM   44    C CA  . ARG A  1 24  ? 33.114  -12.761 129.785 1.00 34.43  ? 48  ARG A CA  1 
ATOM   45    C C   . ARG A  1 24  ? 33.108  -13.057 131.281 1.00 34.27  ? 48  ARG A C   1 
ATOM   46    O O   . ARG A  1 24  ? 34.049  -12.711 131.941 1.00 36.64  ? 48  ARG A O   1 
ATOM   47    C CB  . ARG A  1 24  ? 34.032  -13.719 129.061 1.00 35.11  ? 48  ARG A CB  1 
ATOM   48    C CG  . ARG A  1 24  ? 33.660  -15.184 129.063 1.00 37.03  ? 48  ARG A CG  1 
ATOM   49    C CD  . ARG A  1 24  ? 34.858  -16.026 128.601 1.00 39.40  ? 48  ARG A CD  1 
ATOM   50    N NE  . ARG A  1 24  ? 35.874  -15.903 129.645 1.00 43.82  ? 48  ARG A NE  1 
ATOM   51    C CZ  . ARG A  1 24  ? 37.178  -16.172 129.556 1.00 45.53  ? 48  ARG A CZ  1 
ATOM   52    N NH1 . ARG A  1 24  ? 37.663  -16.663 128.442 1.00 46.87  ? 48  ARG A NH1 1 
ATOM   53    N NH2 . ARG A  1 24  ? 37.988  -16.000 130.627 1.00 45.35  ? 48  ARG A NH2 1 
ATOM   54    N N   . LEU A  1 25  ? 32.053  -13.684 131.804 1.00 33.29  ? 49  LEU A N   1 
ATOM   55    C CA  . LEU A  1 25  ? 31.874  -13.870 133.242 1.00 32.41  ? 49  LEU A CA  1 
ATOM   56    C C   . LEU A  1 25  ? 31.356  -15.267 133.491 1.00 30.73  ? 49  LEU A C   1 
ATOM   57    O O   . LEU A  1 25  ? 30.427  -15.704 132.847 1.00 29.63  ? 49  LEU A O   1 
ATOM   58    C CB  . LEU A  1 25  ? 30.863  -12.848 133.805 1.00 33.94  ? 49  LEU A CB  1 
ATOM   59    C CG  . LEU A  1 25  ? 31.063  -11.311 133.769 1.00 34.51  ? 49  LEU A CG  1 
ATOM   60    C CD1 . LEU A  1 25  ? 29.885  -10.646 134.441 1.00 35.68  ? 49  LEU A CD1 1 
ATOM   61    C CD2 . LEU A  1 25  ? 32.305  -10.845 134.467 1.00 34.44  ? 49  LEU A CD2 1 
ATOM   62    N N   . SER A  1 26  ? 31.930  -15.983 134.440 1.00 30.64  ? 50  SER A N   1 
ATOM   63    C CA  . SER A  1 26  ? 31.602  -17.383 134.544 1.00 30.84  ? 50  SER A CA  1 
ATOM   64    C C   . SER A  1 26  ? 31.323  -17.744 135.966 1.00 32.46  ? 50  SER A C   1 
ATOM   65    O O   . SER A  1 26  ? 31.873  -17.143 136.887 1.00 34.11  ? 50  SER A O   1 
ATOM   66    C CB  . SER A  1 26  ? 32.721  -18.235 133.953 1.00 30.52  ? 50  SER A CB  1 
ATOM   67    O OG  . SER A  1 26  ? 32.704  -18.173 132.534 1.00 29.56  ? 50  SER A OG  1 
ATOM   68    N N   . ARG A  1 27  ? 30.417  -18.703 136.131 1.00 33.49  ? 51  ARG A N   1 
ATOM   69    C CA  . ARG A  1 27  ? 30.211  -19.383 137.408 1.00 33.38  ? 51  ARG A CA  1 
ATOM   70    C C   . ARG A  1 27  ? 29.929  -20.839 137.106 1.00 32.40  ? 51  ARG A C   1 
ATOM   71    O O   . ARG A  1 27  ? 29.509  -21.144 136.043 1.00 29.49  ? 51  ARG A O   1 
ATOM   72    C CB  . ARG A  1 27  ? 29.081  -18.780 138.212 1.00 32.39  ? 51  ARG A CB  1 
ATOM   73    C CG  . ARG A  1 27  ? 27.742  -19.100 137.670 1.00 33.32  ? 51  ARG A CG  1 
ATOM   74    C CD  . ARG A  1 27  ? 26.738  -18.221 138.364 1.00 36.18  ? 51  ARG A CD  1 
ATOM   75    N NE  . ARG A  1 27  ? 26.249  -18.958 139.532 1.00 39.08  ? 51  ARG A NE  1 
ATOM   76    C CZ  . ARG A  1 27  ? 25.070  -19.590 139.594 1.00 37.95  ? 51  ARG A CZ  1 
ATOM   77    N NH1 . ARG A  1 27  ? 24.780  -20.278 140.676 1.00 37.90  ? 51  ARG A NH1 1 
ATOM   78    N NH2 . ARG A  1 27  ? 24.183  -19.544 138.594 1.00 37.18  ? 51  ARG A NH2 1 
ATOM   79    N N   . THR A  1 28  ? 30.205  -21.699 138.086 1.00 34.67  ? 52  THR A N   1 
ATOM   80    C CA  . THR A  1 28  ? 30.110  -23.151 137.996 1.00 34.86  ? 52  THR A CA  1 
ATOM   81    C C   . THR A  1 28  ? 29.377  -23.702 139.228 1.00 35.38  ? 52  THR A C   1 
ATOM   82    O O   . THR A  1 28  ? 29.744  -23.395 140.370 1.00 37.07  ? 52  THR A O   1 
ATOM   83    C CB  . THR A  1 28  ? 31.494  -23.804 137.847 1.00 34.49  ? 52  THR A CB  1 
ATOM   84    O OG1 . THR A  1 28  ? 31.992  -23.516 136.537 1.00 33.64  ? 52  THR A OG1 1 
ATOM   85    C CG2 . THR A  1 28  ? 31.383  -25.276 137.963 1.00 35.91  ? 52  THR A CG2 1 
ATOM   86    N N   . PHE A  1 29  ? 28.350  -24.517 138.980 1.00 34.09  ? 53  PHE A N   1 
ATOM   87    C CA  . PHE A  1 29  ? 27.596  -25.154 140.050 1.00 33.22  ? 53  PHE A CA  1 
ATOM   88    C C   . PHE A  1 29  ? 27.233  -26.610 139.718 1.00 32.84  ? 53  PHE A C   1 
ATOM   89    O O   . PHE A  1 29  ? 27.238  -27.044 138.562 1.00 32.99  ? 53  PHE A O   1 
ATOM   90    C CB  . PHE A  1 29  ? 26.378  -24.308 140.408 1.00 32.47  ? 53  PHE A CB  1 
ATOM   91    C CG  . PHE A  1 29  ? 25.420  -24.099 139.268 1.00 33.55  ? 53  PHE A CG  1 
ATOM   92    C CD1 . PHE A  1 29  ? 25.534  -22.981 138.440 1.00 33.62  ? 53  PHE A CD1 1 
ATOM   93    C CD2 . PHE A  1 29  ? 24.405  -25.025 139.004 1.00 33.66  ? 53  PHE A CD2 1 
ATOM   94    C CE1 . PHE A  1 29  ? 24.664  -22.792 137.372 1.00 34.12  ? 53  PHE A CE1 1 
ATOM   95    C CE2 . PHE A  1 29  ? 23.520  -24.824 137.962 1.00 34.79  ? 53  PHE A CE2 1 
ATOM   96    C CZ  . PHE A  1 29  ? 23.646  -23.704 137.137 1.00 34.87  ? 53  PHE A CZ  1 
ATOM   97    N N   . GLY A  1 30  ? 26.933  -27.360 140.763 1.00 32.89  ? 54  GLY A N   1 
ATOM   98    C CA  . GLY A  1 30  ? 26.609  -28.777 140.652 1.00 33.18  ? 54  GLY A CA  1 
ATOM   99    C C   . GLY A  1 30  ? 25.155  -28.994 140.305 1.00 32.75  ? 54  GLY A C   1 
ATOM   100   O O   . GLY A  1 30  ? 24.336  -28.160 140.600 1.00 32.53  ? 54  GLY A O   1 
ATOM   101   N N   . TYR A  1 31  ? 24.889  -30.082 139.588 1.00 33.93  ? 55  TYR A N   1 
ATOM   102   C CA  . TYR A  1 31  ? 23.563  -30.582 139.236 1.00 34.14  ? 55  TYR A CA  1 
ATOM   103   C C   . TYR A  1 31  ? 23.620  -32.117 139.264 1.00 34.20  ? 55  TYR A C   1 
ATOM   104   O O   . TYR A  1 31  ? 24.391  -32.707 138.545 1.00 32.46  ? 55  TYR A O   1 
ATOM   105   C CB  . TYR A  1 31  ? 23.139  -30.136 137.840 1.00 33.91  ? 55  TYR A CB  1 
ATOM   106   C CG  . TYR A  1 31  ? 21.746  -30.587 137.377 1.00 35.99  ? 55  TYR A CG  1 
ATOM   107   C CD1 . TYR A  1 31  ? 20.638  -30.460 138.204 1.00 38.60  ? 55  TYR A CD1 1 
ATOM   108   C CD2 . TYR A  1 31  ? 21.524  -31.070 136.084 1.00 37.68  ? 55  TYR A CD2 1 
ATOM   109   C CE1 . TYR A  1 31  ? 19.378  -30.829 137.787 1.00 40.25  ? 55  TYR A CE1 1 
ATOM   110   C CE2 . TYR A  1 31  ? 20.251  -31.439 135.652 1.00 38.90  ? 55  TYR A CE2 1 
ATOM   111   C CZ  . TYR A  1 31  ? 19.184  -31.310 136.527 1.00 41.15  ? 55  TYR A CZ  1 
ATOM   112   O OH  . TYR A  1 31  ? 17.887  -31.642 136.187 1.00 44.80  ? 55  TYR A OH  1 
ATOM   113   N N   . THR A  1 32  ? 22.796  -32.731 140.094 1.00 35.03  ? 56  THR A N   1 
ATOM   114   C CA  . THR A  1 32  ? 22.562  -34.125 140.013 1.00 35.95  ? 56  THR A CA  1 
ATOM   115   C C   . THR A  1 32  ? 21.168  -34.510 139.581 1.00 37.63  ? 56  THR A C   1 
ATOM   116   O O   . THR A  1 32  ? 20.190  -34.096 140.183 1.00 42.64  ? 56  THR A O   1 
ATOM   117   C CB  . THR A  1 32  ? 22.748  -34.675 141.379 1.00 36.62  ? 56  THR A CB  1 
ATOM   118   O OG1 . THR A  1 32  ? 24.091  -34.402 141.749 1.00 36.17  ? 56  THR A OG1 1 
ATOM   119   C CG2 . THR A  1 32  ? 22.509  -36.169 141.384 1.00 37.17  ? 56  THR A CG2 1 
ATOM   120   N N   . ILE A  1 33  ? 21.080  -35.344 138.560 1.00 37.56  ? 57  ILE A N   1 
ATOM   121   C CA  . ILE A  1 33  ? 19.874  -36.097 138.310 1.00 37.57  ? 57  ILE A CA  1 
ATOM   122   C C   . ILE A  1 33  ? 19.963  -37.332 139.117 1.00 40.33  ? 57  ILE A C   1 
ATOM   123   O O   . ILE A  1 33  ? 20.895  -38.091 138.927 1.00 43.09  ? 57  ILE A O   1 
ATOM   124   C CB  . ILE A  1 33  ? 19.724  -36.525 136.843 1.00 35.59  ? 57  ILE A CB  1 
ATOM   125   C CG1 . ILE A  1 33  ? 19.609  -35.295 135.946 1.00 33.91  ? 57  ILE A CG1 1 
ATOM   126   C CG2 . ILE A  1 33  ? 18.464  -37.389 136.705 1.00 36.04  ? 57  ILE A CG2 1 
ATOM   127   C CD1 . ILE A  1 33  ? 20.780  -35.089 135.075 1.00 33.24  ? 57  ILE A CD1 1 
ATOM   128   N N   . LYS A  1 34  ? 18.989  -37.568 139.986 1.00 45.79  ? 58  LYS A N   1 
ATOM   129   C CA  . LYS A  1 34  ? 19.078  -38.695 140.933 1.00 47.57  ? 58  LYS A CA  1 
ATOM   130   C C   . LYS A  1 34  ? 18.679  -39.991 140.294 1.00 44.32  ? 58  LYS A C   1 
ATOM   131   O O   . LYS A  1 34  ? 18.013  -39.993 139.267 1.00 42.42  ? 58  LYS A O   1 
ATOM   132   C CB  . LYS A  1 34  ? 18.282  -38.425 142.220 1.00 53.99  ? 58  LYS A CB  1 
ATOM   133   C CG  . LYS A  1 34  ? 19.162  -37.740 143.231 1.00 63.02  ? 58  LYS A CG  1 
ATOM   134   C CD  . LYS A  1 34  ? 18.562  -37.516 144.614 1.00 74.77  ? 58  LYS A CD  1 
ATOM   135   C CE  . LYS A  1 34  ? 19.671  -36.925 145.531 1.00 80.82  ? 58  LYS A CE  1 
ATOM   136   N NZ  . LYS A  1 34  ? 19.241  -36.450 146.887 1.00 82.24  ? 58  LYS A NZ  1 
ATOM   137   N N   . ARG A  1 35  ? 19.116  -41.090 140.912 1.00 42.99  ? 59  ARG A N   1 
ATOM   138   C CA  . ARG A  1 35  ? 18.857  -42.395 140.395 1.00 43.19  ? 59  ARG A CA  1 
ATOM   139   C C   . ARG A  1 35  ? 17.360  -42.670 140.460 1.00 40.29  ? 59  ARG A C   1 
ATOM   140   O O   . ARG A  1 35  ? 16.729  -42.255 141.349 1.00 38.78  ? 59  ARG A O   1 
ATOM   141   C CB  . ARG A  1 35  ? 19.752  -43.438 141.085 1.00 48.20  ? 59  ARG A CB  1 
ATOM   142   C CG  . ARG A  1 35  ? 19.284  -44.114 142.376 1.00 54.51  ? 59  ARG A CG  1 
ATOM   143   C CD  . ARG A  1 35  ? 19.968  -43.712 143.687 1.00 61.29  ? 59  ARG A CD  1 
ATOM   144   N NE  . ARG A  1 35  ? 21.387  -44.105 143.779 1.00 66.80  ? 59  ARG A NE  1 
ATOM   145   C CZ  . ARG A  1 35  ? 22.278  -43.614 144.660 1.00 70.13  ? 59  ARG A CZ  1 
ATOM   146   N NH1 . ARG A  1 35  ? 21.928  -42.715 145.596 1.00 69.17  ? 59  ARG A NH1 1 
ATOM   147   N NH2 . ARG A  1 35  ? 23.547  -44.031 144.609 1.00 72.00  ? 59  ARG A NH2 1 
ATOM   148   N N   . THR A  1 36  ? 16.777  -43.313 139.474 1.00 41.06  ? 60  THR A N   1 
ATOM   149   C CA  . THR A  1 36  ? 15.394  -43.740 139.595 1.00 44.46  ? 60  THR A CA  1 
ATOM   150   C C   . THR A  1 36  ? 15.203  -45.203 139.762 1.00 46.73  ? 60  THR A C   1 
ATOM   151   O O   . THR A  1 36  ? 16.044  -46.052 139.398 1.00 43.98  ? 60  THR A O   1 
ATOM   152   C CB  . THR A  1 36  ? 14.467  -43.383 138.369 1.00 46.24  ? 60  THR A CB  1 
ATOM   153   O OG1 . THR A  1 36  ? 15.214  -43.429 137.139 1.00 41.58  ? 60  THR A OG1 1 
ATOM   154   C CG2 . THR A  1 36  ? 13.718  -41.982 138.630 1.00 48.74  ? 60  THR A CG2 1 
ATOM   155   N N   . THR A  1 37  ? 13.994  -45.447 140.265 1.00 53.22  ? 61  THR A N   1 
ATOM   156   C CA  . THR A  1 37  ? 13.363  -46.753 140.337 1.00 57.41  ? 61  THR A CA  1 
ATOM   157   C C   . THR A  1 37  ? 12.367  -46.940 139.188 1.00 57.55  ? 61  THR A C   1 
ATOM   158   O O   . THR A  1 37  ? 12.083  -48.067 138.837 1.00 61.92  ? 61  THR A O   1 
ATOM   159   C CB  . THR A  1 37  ? 12.706  -46.978 141.728 1.00 56.50  ? 61  THR A CB  1 
ATOM   160   O OG1 . THR A  1 37  ? 11.857  -45.857 142.116 1.00 51.58  ? 61  THR A OG1 1 
ATOM   161   C CG2 . THR A  1 37  ? 13.834  -47.185 142.764 1.00 54.48  ? 61  THR A CG2 1 
ATOM   162   N N   . VAL A  1 38  ? 11.887  -45.854 138.581 1.00 55.18  ? 62  VAL A N   1 
ATOM   163   C CA  . VAL A  1 38  ? 11.006  -45.956 137.391 1.00 53.93  ? 62  VAL A CA  1 
ATOM   164   C C   . VAL A  1 38  ? 11.590  -46.877 136.279 1.00 52.63  ? 62  VAL A C   1 
ATOM   165   O O   . VAL A  1 38  ? 12.776  -46.879 135.966 1.00 46.28  ? 62  VAL A O   1 
ATOM   166   C CB  . VAL A  1 38  ? 10.559  -44.554 136.843 1.00 50.71  ? 62  VAL A CB  1 
ATOM   167   C CG1 . VAL A  1 38  ? 9.492   -44.722 135.766 1.00 48.89  ? 62  VAL A CG1 1 
ATOM   168   C CG2 . VAL A  1 38  ? 10.026  -43.663 137.972 1.00 47.97  ? 62  VAL A CG2 1 
ATOM   169   N N   . LYS A  1 39  ? 10.731  -47.676 135.682 1.00 57.43  ? 63  LYS A N   1 
ATOM   170   C CA  . LYS A  1 39  ? 11.237  -48.818 134.923 1.00 64.04  ? 63  LYS A CA  1 
ATOM   171   C C   . LYS A  1 39  ? 11.376  -48.590 133.432 1.00 61.00  ? 63  LYS A C   1 
ATOM   172   O O   . LYS A  1 39  ? 12.393  -48.958 132.855 1.00 59.10  ? 63  LYS A O   1 
ATOM   173   C CB  . LYS A  1 39  ? 10.393  -50.059 135.269 1.00 71.03  ? 63  LYS A CB  1 
ATOM   174   C CG  . LYS A  1 39  ? 10.534  -50.443 136.755 1.00 72.28  ? 63  LYS A CG  1 
ATOM   175   C CD  . LYS A  1 39  ? 12.000  -50.770 137.101 1.00 71.27  ? 63  LYS A CD  1 
ATOM   176   C CE  . LYS A  1 39  ? 12.228  -51.281 138.518 1.00 73.40  ? 63  LYS A CE  1 
ATOM   177   N NZ  . LYS A  1 39  ? 13.682  -51.376 138.830 1.00 73.02  ? 63  LYS A NZ  1 
ATOM   178   N N   . THR A  1 40  ? 10.357  -47.986 132.834 1.00 59.68  ? 64  THR A N   1 
ATOM   179   C CA  . THR A  1 40  ? 10.391  -47.537 131.439 1.00 59.38  ? 64  THR A CA  1 
ATOM   180   C C   . THR A  1 40  ? 11.076  -46.175 131.308 1.00 55.12  ? 64  THR A C   1 
ATOM   181   O O   . THR A  1 40  ? 11.078  -45.398 132.286 1.00 58.17  ? 64  THR A O   1 
ATOM   182   C CB  . THR A  1 40  ? 8.967   -47.350 130.899 1.00 58.97  ? 64  THR A CB  1 
ATOM   183   O OG1 . THR A  1 40  ? 8.176   -46.714 131.939 1.00 57.57  ? 64  THR A OG1 1 
ATOM   184   C CG2 . THR A  1 40  ? 8.417   -48.727 130.414 1.00 58.14  ? 64  THR A CG2 1 
ATOM   185   N N   . PRO A  1 41  ? 11.583  -45.850 130.094 1.00 47.77  ? 65  PRO A N   1 
ATOM   186   C CA  . PRO A  1 41  ? 12.289  -44.569 129.932 1.00 45.61  ? 65  PRO A CA  1 
ATOM   187   C C   . PRO A  1 41  ? 11.452  -43.391 130.519 1.00 43.76  ? 65  PRO A C   1 
ATOM   188   O O   . PRO A  1 41  ? 10.218  -43.341 130.280 1.00 45.59  ? 65  PRO A O   1 
ATOM   189   C CB  . PRO A  1 41  ? 12.445  -44.433 128.405 1.00 44.99  ? 65  PRO A CB  1 
ATOM   190   C CG  . PRO A  1 41  ? 12.214  -45.820 127.855 1.00 46.20  ? 65  PRO A CG  1 
ATOM   191   C CD  . PRO A  1 41  ? 11.228  -46.444 128.791 1.00 46.36  ? 65  PRO A CD  1 
ATOM   192   N N   . SER A  1 42  ? 12.092  -42.524 131.317 1.00 38.18  ? 66  SER A N   1 
ATOM   193   C CA  . SER A  1 42  ? 11.489  -41.284 131.821 1.00 34.77  ? 66  SER A CA  1 
ATOM   194   C C   . SER A  1 42  ? 12.552  -40.162 131.818 1.00 33.18  ? 66  SER A C   1 
ATOM   195   O O   . SER A  1 42  ? 13.771  -40.405 131.638 1.00 30.01  ? 66  SER A O   1 
ATOM   196   C CB  . SER A  1 42  ? 10.955  -41.470 133.239 1.00 35.04  ? 66  SER A CB  1 
ATOM   197   O OG  . SER A  1 42  ? 12.010  -41.936 134.105 1.00 36.10  ? 66  SER A OG  1 
ATOM   198   N N   . TRP A  1 43  ? 12.090  -38.935 132.059 1.00 31.59  ? 67  TRP A N   1 
ATOM   199   C CA  . TRP A  1 43  ? 12.942  -37.765 131.907 1.00 31.28  ? 67  TRP A CA  1 
ATOM   200   C C   . TRP A  1 43  ? 12.806  -36.800 133.078 1.00 30.69  ? 67  TRP A C   1 
ATOM   201   O O   . TRP A  1 43  ? 11.698  -36.505 133.563 1.00 30.76  ? 67  TRP A O   1 
ATOM   202   C CB  . TRP A  1 43  ? 12.615  -37.051 130.557 1.00 31.93  ? 67  TRP A CB  1 
ATOM   203   C CG  . TRP A  1 43  ? 13.244  -37.741 129.383 1.00 31.65  ? 67  TRP A CG  1 
ATOM   204   C CD1 . TRP A  1 43  ? 14.446  -37.470 128.851 1.00 31.46  ? 67  TRP A CD1 1 
ATOM   205   C CD2 . TRP A  1 43  ? 12.717  -38.843 128.655 1.00 31.88  ? 67  TRP A CD2 1 
ATOM   206   N NE1 . TRP A  1 43  ? 14.742  -38.363 127.869 1.00 32.38  ? 67  TRP A NE1 1 
ATOM   207   C CE2 . TRP A  1 43  ? 13.691  -39.214 127.711 1.00 31.99  ? 67  TRP A CE2 1 
ATOM   208   C CE3 . TRP A  1 43  ? 11.519  -39.568 128.724 1.00 32.31  ? 67  TRP A CE3 1 
ATOM   209   C CZ2 . TRP A  1 43  ? 13.494  -40.227 126.770 1.00 32.25  ? 67  TRP A CZ2 1 
ATOM   210   C CZ3 . TRP A  1 43  ? 11.334  -40.612 127.846 1.00 32.51  ? 67  TRP A CZ3 1 
ATOM   211   C CH2 . TRP A  1 43  ? 12.325  -40.921 126.842 1.00 32.87  ? 67  TRP A CH2 1 
ATOM   212   N N   . ALA A  1 44  ? 13.946  -36.310 133.525 1.00 29.79  ? 68  ALA A N   1 
ATOM   213   C CA  . ALA A  1 44  ? 13.985  -35.246 134.505 1.00 29.93  ? 68  ALA A CA  1 
ATOM   214   C C   . ALA A  1 44  ? 13.939  -33.922 133.770 1.00 29.47  ? 68  ALA A C   1 
ATOM   215   O O   . ALA A  1 44  ? 14.883  -33.559 133.046 1.00 29.24  ? 68  ALA A O   1 
ATOM   216   C CB  . ALA A  1 44  ? 15.255  -35.327 135.351 1.00 30.42  ? 68  ALA A CB  1 
ATOM   217   N N   . VAL A  1 45  ? 12.870  -33.183 133.992 1.00 29.84  ? 69  VAL A N   1 
ATOM   218   C CA  . VAL A  1 45  ? 12.686  -31.932 133.323 1.00 30.84  ? 69  VAL A CA  1 
ATOM   219   C C   . VAL A  1 45  ? 12.937  -30.768 134.241 1.00 32.24  ? 69  VAL A C   1 
ATOM   220   O O   . VAL A  1 45  ? 12.339  -30.684 135.279 1.00 31.45  ? 69  VAL A O   1 
ATOM   221   C CB  . VAL A  1 45  ? 11.279  -31.802 132.863 1.00 30.88  ? 69  VAL A CB  1 
ATOM   222   C CG1 . VAL A  1 45  ? 11.138  -30.520 132.052 1.00 30.88  ? 69  VAL A CG1 1 
ATOM   223   C CG2 . VAL A  1 45  ? 10.886  -33.074 132.113 1.00 31.46  ? 69  VAL A CG2 1 
ATOM   224   N N   . ASP A  1 46  ? 13.797  -29.852 133.796 1.00 35.52  ? 70  ASP A N   1 
ATOM   225   C CA  . ASP A  1 46  ? 14.170  -28.645 134.529 1.00 36.88  ? 70  ASP A CA  1 
ATOM   226   C C   . ASP A  1 46  ? 14.471  -27.436 133.581 1.00 35.70  ? 70  ASP A C   1 
ATOM   227   O O   . ASP A  1 46  ? 14.264  -27.473 132.372 1.00 33.36  ? 70  ASP A O   1 
ATOM   228   C CB  . ASP A  1 46  ? 15.363  -29.016 135.419 1.00 39.87  ? 70  ASP A CB  1 
ATOM   229   C CG  . ASP A  1 46  ? 15.263  -28.426 136.845 1.00 42.18  ? 70  ASP A CG  1 
ATOM   230   O OD1 . ASP A  1 46  ? 14.636  -27.364 136.982 1.00 39.99  ? 70  ASP A OD1 1 
ATOM   231   O OD2 . ASP A  1 46  ? 15.835  -29.035 137.805 1.00 45.91  ? 70  ASP A OD2 1 
ATOM   232   N N   . MET A  1 47  ? 14.979  -26.377 134.150 1.00 37.46  ? 71  MET A N   1 
ATOM   233   C CA  . MET A  1 47  ? 15.067  -25.099 133.494 1.00 39.73  ? 71  MET A CA  1 
ATOM   234   C C   . MET A  1 47  ? 16.186  -24.270 134.102 1.00 39.28  ? 71  MET A C   1 
ATOM   235   O O   . MET A  1 47  ? 16.724  -24.599 135.187 1.00 39.23  ? 71  MET A O   1 
ATOM   236   C CB  . MET A  1 47  ? 13.812  -24.370 133.764 1.00 43.60  ? 71  MET A CB  1 
ATOM   237   C CG  . MET A  1 47  ? 13.653  -24.190 135.240 1.00 47.19  ? 71  MET A CG  1 
ATOM   238   S SD  . MET A  1 47  ? 12.208  -23.268 135.518 1.00 58.74  ? 71  MET A SD  1 
ATOM   239   C CE  . MET A  1 47  ? 10.977  -24.612 135.704 1.00 57.58  ? 71  MET A CE  1 
ATOM   240   N N   . MET A  1 48  ? 16.526  -23.202 133.396 1.00 38.90  ? 72  MET A N   1 
ATOM   241   C CA  . MET A  1 48  ? 17.724  -22.426 133.687 1.00 39.76  ? 72  MET A CA  1 
ATOM   242   C C   . MET A  1 48  ? 17.405  -21.023 133.351 1.00 37.39  ? 72  MET A C   1 
ATOM   243   O O   . MET A  1 48  ? 16.947  -20.745 132.215 1.00 36.99  ? 72  MET A O   1 
ATOM   244   C CB  . MET A  1 48  ? 18.911  -22.874 132.806 1.00 43.02  ? 72  MET A CB  1 
ATOM   245   C CG  . MET A  1 48  ? 20.158  -23.151 133.639 1.00 47.31  ? 72  MET A CG  1 
ATOM   246   S SD  . MET A  1 48  ? 21.572  -23.975 132.885 1.00 47.11  ? 72  MET A SD  1 
ATOM   247   C CE  . MET A  1 48  ? 20.728  -25.507 132.642 1.00 47.36  ? 72  MET A CE  1 
ATOM   248   N N   . ARG A  1 49  ? 17.590  -20.161 134.340 1.00 34.59  ? 73  ARG A N   1 
ATOM   249   C CA  . ARG A  1 49  ? 17.644  -18.755 134.087 1.00 34.76  ? 73  ARG A CA  1 
ATOM   250   C C   . ARG A  1 49  ? 19.001  -18.193 134.455 1.00 34.13  ? 73  ARG A C   1 
ATOM   251   O O   . ARG A  1 49  ? 19.790  -18.811 135.145 1.00 36.98  ? 73  ARG A O   1 
ATOM   252   C CB  . ARG A  1 49  ? 16.569  -18.055 134.870 1.00 35.02  ? 73  ARG A CB  1 
ATOM   253   C CG  . ARG A  1 49  ? 15.169  -18.457 134.523 1.00 35.68  ? 73  ARG A CG  1 
ATOM   254   C CD  . ARG A  1 49  ? 14.231  -17.572 135.330 1.00 37.71  ? 73  ARG A CD  1 
ATOM   255   N NE  . ARG A  1 49  ? 12.836  -17.989 135.272 1.00 39.57  ? 73  ARG A NE  1 
ATOM   256   C CZ  . ARG A  1 49  ? 12.279  -18.973 135.985 1.00 40.69  ? 73  ARG A CZ  1 
ATOM   257   N NH1 . ARG A  1 49  ? 11.009  -19.259 135.817 1.00 45.18  ? 73  ARG A NH1 1 
ATOM   258   N NH2 . ARG A  1 49  ? 12.949  -19.683 136.838 1.00 40.58  ? 73  ARG A NH2 1 
ATOM   259   N N   . PHE A  1 50  ? 19.246  -16.978 134.040 1.00 34.01  ? 74  PHE A N   1 
ATOM   260   C CA  . PHE A  1 50  ? 20.540  -16.348 134.243 1.00 34.95  ? 74  PHE A CA  1 
ATOM   261   C C   . PHE A  1 50  ? 20.376  -14.947 134.744 1.00 34.77  ? 74  PHE A C   1 
ATOM   262   O O   . PHE A  1 50  ? 19.685  -14.155 134.144 1.00 38.08  ? 74  PHE A O   1 
ATOM   263   C CB  . PHE A  1 50  ? 21.290  -16.290 132.935 1.00 35.18  ? 74  PHE A CB  1 
ATOM   264   C CG  . PHE A  1 50  ? 21.079  -17.498 132.078 1.00 34.27  ? 74  PHE A CG  1 
ATOM   265   C CD1 . PHE A  1 50  ? 21.654  -18.680 132.414 1.00 34.42  ? 74  PHE A CD1 1 
ATOM   266   C CD2 . PHE A  1 50  ? 20.292  -17.424 130.939 1.00 33.61  ? 74  PHE A CD2 1 
ATOM   267   C CE1 . PHE A  1 50  ? 21.470  -19.780 131.603 1.00 36.07  ? 74  PHE A CE1 1 
ATOM   268   C CE2 . PHE A  1 50  ? 20.113  -18.506 130.120 1.00 33.48  ? 74  PHE A CE2 1 
ATOM   269   C CZ  . PHE A  1 50  ? 20.717  -19.679 130.430 1.00 34.77  ? 74  PHE A CZ  1 
ATOM   270   N N   . ASN A  1 51  ? 21.035  -14.635 135.835 1.00 34.42  ? 75  ASN A N   1 
ATOM   271   C CA  . ASN A  1 51  ? 20.917  -13.333 136.428 1.00 34.26  ? 75  ASN A CA  1 
ATOM   272   C C   . ASN A  1 51  ? 22.322  -12.859 136.787 1.00 33.81  ? 75  ASN A C   1 
ATOM   273   O O   . ASN A  1 51  ? 23.022  -13.544 137.507 1.00 33.53  ? 75  ASN A O   1 
ATOM   274   C CB  . ASN A  1 51  ? 20.005  -13.440 137.640 1.00 33.66  ? 75  ASN A CB  1 
ATOM   275   C CG  . ASN A  1 51  ? 19.587  -12.105 138.151 1.00 33.16  ? 75  ASN A CG  1 
ATOM   276   O OD1 . ASN A  1 51  ? 20.418  -11.326 138.531 1.00 32.47  ? 75  ASN A OD1 1 
ATOM   277   N ND2 . ASN A  1 51  ? 18.307  -11.831 138.134 1.00 33.11  ? 75  ASN A ND2 1 
ATOM   278   N N   . ILE A  1 52  ? 22.696  -11.687 136.294 1.00 33.43  ? 76  ILE A N   1 
ATOM   279   C CA  . ILE A  1 52  ? 24.029  -11.117 136.499 1.00 34.54  ? 76  ILE A CA  1 
ATOM   280   C C   . ILE A  1 52  ? 24.371  -10.920 137.982 1.00 36.54  ? 76  ILE A C   1 
ATOM   281   O O   . ILE A  1 52  ? 25.555  -10.821 138.321 1.00 38.14  ? 76  ILE A O   1 
ATOM   282   C CB  . ILE A  1 52  ? 24.202  -9.801  135.687 1.00 34.62  ? 76  ILE A CB  1 
ATOM   283   C CG1 . ILE A  1 52  ? 25.631  -9.513  135.313 1.00 35.54  ? 76  ILE A CG1 1 
ATOM   284   C CG2 . ILE A  1 52  ? 23.688  -8.586  136.423 1.00 35.47  ? 76  ILE A CG2 1 
ATOM   285   C CD1 . ILE A  1 52  ? 25.692  -8.538  134.145 1.00 36.37  ? 76  ILE A CD1 1 
ATOM   286   N N   . ASN A  1 53  ? 23.377  -10.901 138.884 1.00 37.29  ? 77  ASN A N   1 
ATOM   287   C CA  . ASN A  1 53  ? 23.671  -10.922 140.337 1.00 37.06  ? 77  ASN A CA  1 
ATOM   288   C C   . ASN A  1 53  ? 24.559  -12.065 140.695 1.00 34.79  ? 77  ASN A C   1 
ATOM   289   O O   . ASN A  1 53  ? 25.345  -11.905 141.553 1.00 34.72  ? 77  ASN A O   1 
ATOM   290   C CB  . ASN A  1 53  ? 22.448  -11.181 141.192 1.00 40.63  ? 77  ASN A CB  1 
ATOM   291   C CG  . ASN A  1 53  ? 21.380  -10.109 141.082 1.00 43.11  ? 77  ASN A CG  1 
ATOM   292   O OD1 . ASN A  1 53  ? 21.689  -8.905  140.808 1.00 46.52  ? 77  ASN A OD1 1 
ATOM   293   N ND2 . ASN A  1 53  ? 20.089  -10.538 141.288 1.00 39.56  ? 77  ASN A ND2 1 
ATOM   294   N N   . ASP A  1 54  ? 24.413  -13.228 140.077 1.00 33.93  ? 78  ASP A N   1 
ATOM   295   C CA  . ASP A  1 54  ? 25.256  -14.375 140.430 1.00 34.61  ? 78  ASP A CA  1 
ATOM   296   C C   . ASP A  1 54  ? 26.632  -14.381 139.768 1.00 34.73  ? 78  ASP A C   1 
ATOM   297   O O   . ASP A  1 54  ? 27.375  -15.339 139.988 1.00 35.12  ? 78  ASP A O   1 
ATOM   298   C CB  . ASP A  1 54  ? 24.608  -15.717 140.066 1.00 35.60  ? 78  ASP A CB  1 
ATOM   299   C CG  . ASP A  1 54  ? 23.223  -15.904 140.638 1.00 36.29  ? 78  ASP A CG  1 
ATOM   300   O OD1 . ASP A  1 54  ? 23.082  -15.749 141.854 1.00 38.55  ? 78  ASP A OD1 1 
ATOM   301   O OD2 . ASP A  1 54  ? 22.293  -16.266 139.878 1.00 35.38  ? 78  ASP A OD2 1 
ATOM   302   N N   . PHE A  1 55  ? 26.959  -13.385 138.941 1.00 34.45  ? 79  PHE A N   1 
ATOM   303   C CA  . PHE A  1 55  ? 28.244  -13.324 138.204 1.00 34.93  ? 79  PHE A CA  1 
ATOM   304   C C   . PHE A  1 55  ? 29.137  -12.128 138.579 1.00 37.17  ? 79  PHE A C   1 
ATOM   305   O O   . PHE A  1 55  ? 30.310  -12.082 138.226 1.00 38.59  ? 79  PHE A O   1 
ATOM   306   C CB  . PHE A  1 55  ? 27.976  -13.249 136.697 1.00 33.61  ? 79  PHE A CB  1 
ATOM   307   C CG  . PHE A  1 55  ? 27.349  -14.480 136.117 1.00 32.93  ? 79  PHE A CG  1 
ATOM   308   C CD1 . PHE A  1 55  ? 25.985  -14.723 136.258 1.00 33.29  ? 79  PHE A CD1 1 
ATOM   309   C CD2 . PHE A  1 55  ? 28.096  -15.392 135.392 1.00 33.33  ? 79  PHE A CD2 1 
ATOM   310   C CE1 . PHE A  1 55  ? 25.386  -15.867 135.710 1.00 32.85  ? 79  PHE A CE1 1 
ATOM   311   C CE2 . PHE A  1 55  ? 27.505  -16.542 134.825 1.00 33.33  ? 79  PHE A CE2 1 
ATOM   312   C CZ  . PHE A  1 55  ? 26.150  -16.770 134.971 1.00 32.61  ? 79  PHE A CZ  1 
ATOM   313   N N   . LEU A  1 56  ? 28.570  -11.164 139.291 1.00 41.01  ? 80  LEU A N   1 
ATOM   314   C CA  . LEU A  1 56  ? 29.218  -9.885  139.578 1.00 42.38  ? 80  LEU A CA  1 
ATOM   315   C C   . LEU A  1 56  ? 29.014  -9.597  141.023 1.00 41.80  ? 80  LEU A C   1 
ATOM   316   O O   . LEU A  1 56  ? 27.933  -9.189  141.381 1.00 41.51  ? 80  LEU A O   1 
ATOM   317   C CB  . LEU A  1 56  ? 28.526  -8.789  138.775 1.00 43.68  ? 80  LEU A CB  1 
ATOM   318   C CG  . LEU A  1 56  ? 29.348  -7.675  138.208 1.00 46.30  ? 80  LEU A CG  1 
ATOM   319   C CD1 . LEU A  1 56  ? 30.429  -8.270  137.334 1.00 50.20  ? 80  LEU A CD1 1 
ATOM   320   C CD2 . LEU A  1 56  ? 28.454  -6.800  137.377 1.00 48.50  ? 80  LEU A CD2 1 
ATOM   321   N N   . PRO A  1 57  ? 30.036  -9.791  141.870 1.00 43.80  ? 81  PRO A N   1 
ATOM   322   C CA  . PRO A  1 57  ? 29.775  -9.501  143.277 1.00 46.17  ? 81  PRO A CA  1 
ATOM   323   C C   . PRO A  1 57  ? 29.630  -7.987  143.570 1.00 49.13  ? 81  PRO A C   1 
ATOM   324   O O   . PRO A  1 57  ? 29.952  -7.111  142.710 1.00 45.35  ? 81  PRO A O   1 
ATOM   325   C CB  . PRO A  1 57  ? 31.016  -10.046 143.974 1.00 44.80  ? 81  PRO A CB  1 
ATOM   326   C CG  . PRO A  1 57  ? 32.073  -9.722  142.993 1.00 45.87  ? 81  PRO A CG  1 
ATOM   327   C CD  . PRO A  1 57  ? 31.468  -10.020 141.644 1.00 44.54  ? 81  PRO A CD  1 
ATOM   328   N N   . PRO A  1 58  ? 29.156  -7.664  144.789 1.00 51.51  ? 82  PRO A N   1 
ATOM   329   C CA  . PRO A  1 58  ? 29.165  -6.205  145.068 1.00 52.12  ? 82  PRO A CA  1 
ATOM   330   C C   . PRO A  1 58  ? 30.572  -5.584  145.177 1.00 52.38  ? 82  PRO A C   1 
ATOM   331   O O   . PRO A  1 58  ? 31.590  -6.267  145.446 1.00 53.30  ? 82  PRO A O   1 
ATOM   332   C CB  . PRO A  1 58  ? 28.345  -6.085  146.360 1.00 51.09  ? 82  PRO A CB  1 
ATOM   333   C CG  . PRO A  1 58  ? 27.470  -7.337  146.351 1.00 50.87  ? 82  PRO A CG  1 
ATOM   334   C CD  . PRO A  1 58  ? 28.302  -8.414  145.731 1.00 49.34  ? 82  PRO A CD  1 
ATOM   335   N N   . GLY A  1 59  ? 30.606  -4.291  144.919 1.00 52.36  ? 83  GLY A N   1 
ATOM   336   C CA  . GLY A  1 59  ? 31.801  -3.502  145.120 1.00 54.69  ? 83  GLY A CA  1 
ATOM   337   C C   . GLY A  1 59  ? 31.905  -2.990  146.547 1.00 53.97  ? 83  GLY A C   1 
ATOM   338   O O   . GLY A  1 59  ? 31.291  -3.522  147.452 1.00 55.02  ? 83  GLY A O   1 
ATOM   339   N N   . GLY A  1 60  ? 32.701  -1.939  146.717 1.00 57.32  ? 84  GLY A N   1 
ATOM   340   C CA  . GLY A  1 60  ? 32.951  -1.295  148.010 1.00 56.44  ? 84  GLY A CA  1 
ATOM   341   C C   . GLY A  1 60  ? 33.030  0.214   147.886 1.00 53.82  ? 84  GLY A C   1 
ATOM   342   O O   . GLY A  1 60  ? 33.505  0.731   146.877 1.00 57.38  ? 84  GLY A O   1 
ATOM   343   N N   . GLY A  1 61  ? 32.576  0.904   148.926 1.00 50.12  ? 85  GLY A N   1 
ATOM   344   C CA  . GLY A  1 61  ? 32.531  2.351   148.976 1.00 49.18  ? 85  GLY A CA  1 
ATOM   345   C C   . GLY A  1 61  ? 31.519  2.964   148.012 1.00 49.63  ? 85  GLY A C   1 
ATOM   346   O O   . GLY A  1 61  ? 30.347  2.578   147.941 1.00 46.99  ? 85  GLY A O   1 
ATOM   347   N N   . SER A  1 62  ? 32.014  3.905   147.230 1.00 51.07  ? 86  SER A N   1 
ATOM   348   C CA  . SER A  1 62  ? 31.219  4.669   146.320 1.00 51.89  ? 86  SER A CA  1 
ATOM   349   C C   . SER A  1 62  ? 30.960  3.971   145.002 1.00 52.35  ? 86  SER A C   1 
ATOM   350   O O   . SER A  1 62  ? 30.155  4.436   144.194 1.00 49.54  ? 86  SER A O   1 
ATOM   351   C CB  . SER A  1 62  ? 31.955  5.950   146.057 1.00 55.22  ? 86  SER A CB  1 
ATOM   352   O OG  . SER A  1 62  ? 32.181  6.626   147.277 1.00 59.93  ? 86  SER A OG  1 
ATOM   353   N N   . ASN A  1 63  ? 31.668  2.869   144.773 1.00 55.78  ? 87  ASN A N   1 
ATOM   354   C CA  . ASN A  1 63  ? 31.487  2.026   143.568 1.00 55.11  ? 87  ASN A CA  1 
ATOM   355   C C   . ASN A  1 63  ? 30.739  0.725   143.977 1.00 52.99  ? 87  ASN A C   1 
ATOM   356   O O   . ASN A  1 63  ? 31.344  -0.240  144.403 1.00 50.74  ? 87  ASN A O   1 
ATOM   357   C CB  . ASN A  1 63  ? 32.849  1.770   142.887 1.00 52.87  ? 87  ASN A CB  1 
ATOM   358   C CG  . ASN A  1 63  ? 33.554  3.062   142.510 1.00 50.21  ? 87  ASN A CG  1 
ATOM   359   O OD1 . ASN A  1 63  ? 33.009  3.879   141.737 1.00 48.22  ? 87  ASN A OD1 1 
ATOM   360   N ND2 . ASN A  1 63  ? 34.755  3.269   143.068 1.00 46.90  ? 87  ASN A ND2 1 
ATOM   361   N N   . PRO A  1 64  ? 29.408  0.729   143.876 1.00 50.96  ? 88  PRO A N   1 
ATOM   362   C CA  . PRO A  1 64  ? 28.645  -0.347  144.472 1.00 49.77  ? 88  PRO A CA  1 
ATOM   363   C C   . PRO A  1 64  ? 28.803  -1.701  143.788 1.00 49.67  ? 88  PRO A C   1 
ATOM   364   O O   . PRO A  1 64  ? 28.444  -2.724  144.371 1.00 46.45  ? 88  PRO A O   1 
ATOM   365   C CB  . PRO A  1 64  ? 27.203  0.134   144.322 1.00 51.03  ? 88  PRO A CB  1 
ATOM   366   C CG  . PRO A  1 64  ? 27.311  1.605   144.139 1.00 52.36  ? 88  PRO A CG  1 
ATOM   367   C CD  . PRO A  1 64  ? 28.522  1.741   143.286 1.00 51.56  ? 88  PRO A CD  1 
ATOM   368   N N   . ARG A  1 65  ? 29.317  -1.724  142.563 1.00 50.15  ? 89  ARG A N   1 
ATOM   369   C CA  . ARG A  1 65  ? 29.397  -2.952  141.791 1.00 49.37  ? 89  ARG A CA  1 
ATOM   370   C C   . ARG A  1 65  ? 30.853  -3.155  141.377 1.00 46.97  ? 89  ARG A C   1 
ATOM   371   O O   . ARG A  1 65  ? 31.617  -2.203  141.229 1.00 47.36  ? 89  ARG A O   1 
ATOM   372   C CB  . ARG A  1 65  ? 28.438  -2.828  140.637 1.00 49.88  ? 89  ARG A CB  1 
ATOM   373   C CG  . ARG A  1 65  ? 27.071  -2.448  141.159 1.00 53.39  ? 89  ARG A CG  1 
ATOM   374   C CD  . ARG A  1 65  ? 26.204  -1.725  140.162 1.00 57.26  ? 89  ARG A CD  1 
ATOM   375   N NE  . ARG A  1 65  ? 26.185  -0.248  140.128 1.00 58.08  ? 89  ARG A NE  1 
ATOM   376   C CZ  . ARG A  1 65  ? 25.280  0.552   140.730 1.00 58.05  ? 89  ARG A CZ  1 
ATOM   377   N NH1 . ARG A  1 65  ? 25.340  1.860   140.527 1.00 61.78  ? 89  ARG A NH1 1 
ATOM   378   N NH2 . ARG A  1 65  ? 24.332  0.106   141.544 1.00 56.71  ? 89  ARG A NH2 1 
ATOM   379   N N   . SER A  1 66  ? 31.246  -4.405  141.242 1.00 45.07  ? 90  SER A N   1 
ATOM   380   C CA  . SER A  1 66  ? 32.656  -4.717  141.109 1.00 46.02  ? 90  SER A CA  1 
ATOM   381   C C   . SER A  1 66  ? 33.193  -4.355  139.723 1.00 44.44  ? 90  SER A C   1 
ATOM   382   O O   . SER A  1 66  ? 34.424  -4.183  139.576 1.00 41.07  ? 90  SER A O   1 
ATOM   383   C CB  . SER A  1 66  ? 32.962  -6.162  141.484 1.00 47.59  ? 90  SER A CB  1 
ATOM   384   O OG  . SER A  1 66  ? 32.192  -7.078  140.723 1.00 48.91  ? 90  SER A OG  1 
ATOM   385   N N   . VAL A  1 67  ? 32.293  -4.205  138.730 1.00 42.37  ? 91  VAL A N   1 
ATOM   386   C CA  . VAL A  1 67  ? 32.686  -3.529  137.510 1.00 40.82  ? 91  VAL A CA  1 
ATOM   387   C C   . VAL A  1 67  ? 31.967  -2.206  137.500 1.00 39.43  ? 91  VAL A C   1 
ATOM   388   O O   . VAL A  1 67  ? 30.799  -2.162  137.733 1.00 37.20  ? 91  VAL A O   1 
ATOM   389   C CB  . VAL A  1 67  ? 32.563  -4.340  136.208 1.00 41.67  ? 91  VAL A CB  1 
ATOM   390   C CG1 . VAL A  1 67  ? 32.799  -5.815  136.457 1.00 42.75  ? 91  VAL A CG1 1 
ATOM   391   C CG2 . VAL A  1 67  ? 31.279  -4.087  135.478 1.00 43.25  ? 91  VAL A CG2 1 
ATOM   392   N N   . PRO A  1 68  ? 32.708  -1.106  137.306 1.00 39.93  ? 92  PRO A N   1 
ATOM   393   C CA  . PRO A  1 68  ? 32.199  0.284   137.395 1.00 38.54  ? 92  PRO A CA  1 
ATOM   394   C C   . PRO A  1 68  ? 31.602  0.849   136.083 1.00 36.51  ? 92  PRO A C   1 
ATOM   395   O O   . PRO A  1 68  ? 32.137  1.823   135.497 1.00 34.64  ? 92  PRO A O   1 
ATOM   396   C CB  . PRO A  1 68  ? 33.456  1.032   137.769 1.00 38.59  ? 92  PRO A CB  1 
ATOM   397   C CG  . PRO A  1 68  ? 34.497  0.329   136.987 1.00 39.09  ? 92  PRO A CG  1 
ATOM   398   C CD  . PRO A  1 68  ? 34.175  -1.114  137.154 1.00 38.95  ? 92  PRO A CD  1 
ATOM   399   N N   . PHE A  1 69  ? 30.520  0.202   135.624 1.00 34.73  ? 93  PHE A N   1 
ATOM   400   C CA  . PHE A  1 69  ? 29.763  0.638   134.455 1.00 32.71  ? 93  PHE A CA  1 
ATOM   401   C C   . PHE A  1 69  ? 28.286  0.834   134.779 1.00 31.02  ? 93  PHE A C   1 
ATOM   402   O O   . PHE A  1 69  ? 27.724  0.115   135.599 1.00 29.20  ? 93  PHE A O   1 
ATOM   403   C CB  . PHE A  1 69  ? 29.962  -0.365  133.318 1.00 33.25  ? 93  PHE A CB  1 
ATOM   404   C CG  . PHE A  1 69  ? 31.324  -0.297  132.673 1.00 33.52  ? 93  PHE A CG  1 
ATOM   405   C CD1 . PHE A  1 69  ? 31.568  0.570   131.626 1.00 33.14  ? 93  PHE A CD1 1 
ATOM   406   C CD2 . PHE A  1 69  ? 32.356  -1.104  133.097 1.00 34.86  ? 93  PHE A CD2 1 
ATOM   407   C CE1 . PHE A  1 69  ? 32.812  0.651   131.031 1.00 33.15  ? 93  PHE A CE1 1 
ATOM   408   C CE2 . PHE A  1 69  ? 33.621  -1.003  132.512 1.00 35.02  ? 93  PHE A CE2 1 
ATOM   409   C CZ  . PHE A  1 69  ? 33.838  -0.134  131.472 1.00 33.48  ? 93  PHE A CZ  1 
ATOM   410   N N   . GLU A  1 70  ? 27.667  1.821   134.133 1.00 31.29  ? 94  GLU A N   1 
ATOM   411   C CA  . GLU A  1 70  ? 26.234  2.153   134.342 1.00 32.00  ? 94  GLU A CA  1 
ATOM   412   C C   . GLU A  1 70  ? 25.228  1.179   133.675 1.00 31.22  ? 94  GLU A C   1 
ATOM   413   O O   . GLU A  1 70  ? 24.203  0.767   134.281 1.00 29.15  ? 94  GLU A O   1 
ATOM   414   C CB  . GLU A  1 70  ? 25.925  3.583   133.884 1.00 33.38  ? 94  GLU A CB  1 
ATOM   415   C CG  . GLU A  1 70  ? 24.535  4.054   134.300 1.00 36.16  ? 94  GLU A CG  1 
ATOM   416   C CD  . GLU A  1 70  ? 24.348  4.026   135.816 1.00 37.45  ? 94  GLU A CD  1 
ATOM   417   O OE1 . GLU A  1 70  ? 23.274  3.551   136.298 1.00 34.40  ? 94  GLU A OE1 1 
ATOM   418   O OE2 . GLU A  1 70  ? 25.338  4.472   136.488 1.00 40.13  ? 94  GLU A OE2 1 
ATOM   419   N N   . TYR A  1 71  ? 25.507  0.835   132.420 1.00 31.84  ? 95  TYR A N   1 
ATOM   420   C CA  . TYR A  1 71  ? 24.588  -0.026  131.637 1.00 32.40  ? 95  TYR A CA  1 
ATOM   421   C C   . TYR A  1 71  ? 25.286  -1.283  131.187 1.00 30.82  ? 95  TYR A C   1 
ATOM   422   O O   . TYR A  1 71  ? 26.549  -1.334  131.120 1.00 30.52  ? 95  TYR A O   1 
ATOM   423   C CB  . TYR A  1 71  ? 23.946  0.670   130.413 1.00 32.70  ? 95  TYR A CB  1 
ATOM   424   C CG  . TYR A  1 71  ? 23.840  2.184   130.492 1.00 33.86  ? 95  TYR A CG  1 
ATOM   425   C CD1 . TYR A  1 71  ? 22.997  2.808   131.399 1.00 32.53  ? 95  TYR A CD1 1 
ATOM   426   C CD2 . TYR A  1 71  ? 24.595  2.974   129.622 1.00 34.96  ? 95  TYR A CD2 1 
ATOM   427   C CE1 . TYR A  1 71  ? 22.915  4.163   131.446 1.00 34.10  ? 95  TYR A CE1 1 
ATOM   428   C CE2 . TYR A  1 71  ? 24.527  4.341   129.657 1.00 36.81  ? 95  TYR A CE2 1 
ATOM   429   C CZ  . TYR A  1 71  ? 23.679  4.953   130.574 1.00 37.18  ? 95  TYR A CZ  1 
ATOM   430   O OH  . TYR A  1 71  ? 23.636  6.364   130.575 1.00 38.56  ? 95  TYR A OH  1 
ATOM   431   N N   . TYR A  1 72  ? 24.436  -2.282  130.927 1.00 29.12  ? 96  TYR A N   1 
ATOM   432   C CA  . TYR A  1 72  ? 24.846  -3.540  130.358 1.00 29.04  ? 96  TYR A CA  1 
ATOM   433   C C   . TYR A  1 72  ? 23.793  -4.116  129.437 1.00 29.09  ? 96  TYR A C   1 
ATOM   434   O O   . TYR A  1 72  ? 22.640  -3.731  129.509 1.00 28.84  ? 96  TYR A O   1 
ATOM   435   C CB  . TYR A  1 72  ? 25.225  -4.555  131.448 1.00 28.33  ? 96  TYR A CB  1 
ATOM   436   C CG  . TYR A  1 72  ? 24.091  -5.326  132.014 1.00 28.59  ? 96  TYR A CG  1 
ATOM   437   C CD1 . TYR A  1 72  ? 23.239  -4.767  132.995 1.00 29.41  ? 96  TYR A CD1 1 
ATOM   438   C CD2 . TYR A  1 72  ? 23.843  -6.631  131.645 1.00 28.57  ? 96  TYR A CD2 1 
ATOM   439   C CE1 . TYR A  1 72  ? 22.166  -5.509  133.582 1.00 28.07  ? 96  TYR A CE1 1 
ATOM   440   C CE2 . TYR A  1 72  ? 22.751  -7.361  132.237 1.00 28.63  ? 96  TYR A CE2 1 
ATOM   441   C CZ  . TYR A  1 72  ? 21.916  -6.782  133.189 1.00 27.10  ? 96  TYR A CZ  1 
ATOM   442   O OH  . TYR A  1 72  ? 20.884  -7.465  133.730 1.00 25.13  ? 96  TYR A OH  1 
ATOM   443   N N   . ARG A  1 73  ? 24.233  -5.002  128.548 1.00 29.41  ? 97  ARG A N   1 
ATOM   444   C CA  . ARG A  1 73  ? 23.356  -5.965  127.937 1.00 30.60  ? 97  ARG A CA  1 
ATOM   445   C C   . ARG A  1 73  ? 24.017  -7.304  127.693 1.00 31.19  ? 97  ARG A C   1 
ATOM   446   O O   . ARG A  1 73  ? 25.236  -7.313  127.440 1.00 33.42  ? 97  ARG A O   1 
ATOM   447   C CB  . ARG A  1 73  ? 22.849  -5.422  126.628 1.00 31.84  ? 97  ARG A CB  1 
ATOM   448   C CG  . ARG A  1 73  ? 23.897  -5.084  125.577 1.00 31.62  ? 97  ARG A CG  1 
ATOM   449   C CD  . ARG A  1 73  ? 23.278  -4.224  124.457 1.00 30.53  ? 97  ARG A CD  1 
ATOM   450   N NE  . ARG A  1 73  ? 24.305  -3.951  123.508 1.00 29.94  ? 97  ARG A NE  1 
ATOM   451   C CZ  . ARG A  1 73  ? 24.205  -3.228  122.404 1.00 29.61  ? 97  ARG A CZ  1 
ATOM   452   N NH1 . ARG A  1 73  ? 25.316  -3.108  121.671 1.00 27.83  ? 97  ARG A NH1 1 
ATOM   453   N NH2 . ARG A  1 73  ? 23.053  -2.640  122.024 1.00 29.76  ? 97  ARG A NH2 1 
ATOM   454   N N   . ILE A  1 74  ? 23.249  -8.420  127.758 1.00 30.56  ? 98  ILE A N   1 
ATOM   455   C CA  . ILE A  1 74  ? 23.851  -9.752  127.608 1.00 30.42  ? 98  ILE A CA  1 
ATOM   456   C C   . ILE A  1 74  ? 23.846  -10.183 126.187 1.00 29.68  ? 98  ILE A C   1 
ATOM   457   O O   . ILE A  1 74  ? 22.861  -10.531 125.653 1.00 28.63  ? 98  ILE A O   1 
ATOM   458   C CB  . ILE A  1 74  ? 23.227  -10.826 128.510 1.00 31.72  ? 98  ILE A CB  1 
ATOM   459   C CG1 . ILE A  1 74  ? 23.391  -10.411 129.991 1.00 31.41  ? 98  ILE A CG1 1 
ATOM   460   C CG2 . ILE A  1 74  ? 23.916  -12.208 128.296 1.00 31.16  ? 98  ILE A CG2 1 
ATOM   461   C CD1 . ILE A  1 74  ? 22.653  -11.315 130.963 1.00 31.26  ? 98  ILE A CD1 1 
ATOM   462   N N   . ARG A  1 75  ? 24.995  -10.144 125.590 1.00 32.20  ? 99  ARG A N   1 
ATOM   463   C CA  . ARG A  1 75  ? 25.161  -10.481 124.189 1.00 35.22  ? 99  ARG A CA  1 
ATOM   464   C C   . ARG A  1 75  ? 24.881  -12.002 123.898 1.00 34.38  ? 99  ARG A C   1 
ATOM   465   O O   . ARG A  1 75  ? 24.186  -12.371 122.926 1.00 31.67  ? 99  ARG A O   1 
ATOM   466   C CB  . ARG A  1 75  ? 26.589  -10.078 123.750 1.00 37.42  ? 99  ARG A CB  1 
ATOM   467   C CG  . ARG A  1 75  ? 26.632  -9.100  122.622 1.00 41.89  ? 99  ARG A CG  1 
ATOM   468   C CD  . ARG A  1 75  ? 26.162  -7.724  123.048 1.00 46.90  ? 99  ARG A CD  1 
ATOM   469   N NE  . ARG A  1 75  ? 25.327  -7.029  122.018 1.00 54.36  ? 99  ARG A NE  1 
ATOM   470   C CZ  . ARG A  1 75  ? 25.757  -6.508  120.852 1.00 60.34  ? 99  ARG A CZ  1 
ATOM   471   N NH1 . ARG A  1 75  ? 24.900  -5.871  120.050 1.00 62.48  ? 99  ARG A NH1 1 
ATOM   472   N NH2 . ARG A  1 75  ? 27.034  -6.616  120.457 1.00 64.51  ? 99  ARG A NH2 1 
ATOM   473   N N   . LYS A  1 76  ? 25.412  -12.856 124.772 1.00 35.08  ? 100 LYS A N   1 
ATOM   474   C CA  . LYS A  1 76  ? 25.379  -14.294 124.592 1.00 35.53  ? 100 LYS A CA  1 
ATOM   475   C C   . LYS A  1 76  ? 25.569  -15.005 125.937 1.00 35.47  ? 100 LYS A C   1 
ATOM   476   O O   . LYS A  1 76  ? 26.267  -14.499 126.812 1.00 36.19  ? 100 LYS A O   1 
ATOM   477   C CB  . LYS A  1 76  ? 26.511  -14.641 123.662 1.00 37.22  ? 100 LYS A CB  1 
ATOM   478   C CG  . LYS A  1 76  ? 26.104  -15.464 122.478 1.00 40.99  ? 100 LYS A CG  1 
ATOM   479   C CD  . LYS A  1 76  ? 25.869  -14.678 121.182 1.00 43.67  ? 100 LYS A CD  1 
ATOM   480   C CE  . LYS A  1 76  ? 25.044  -15.488 120.184 1.00 44.38  ? 100 LYS A CE  1 
ATOM   481   N NZ  . LYS A  1 76  ? 24.340  -14.619 119.237 1.00 46.20  ? 100 LYS A NZ  1 
ATOM   482   N N   . VAL A  1 77  ? 24.923  -16.151 126.125 1.00 36.15  ? 101 VAL A N   1 
ATOM   483   C CA  . VAL A  1 77  ? 25.266  -17.097 127.220 1.00 36.02  ? 101 VAL A CA  1 
ATOM   484   C C   . VAL A  1 77  ? 25.729  -18.432 126.613 1.00 34.46  ? 101 VAL A C   1 
ATOM   485   O O   . VAL A  1 77  ? 25.187  -18.900 125.617 1.00 32.90  ? 101 VAL A O   1 
ATOM   486   C CB  . VAL A  1 77  ? 24.074  -17.451 128.119 1.00 38.24  ? 101 VAL A CB  1 
ATOM   487   C CG1 . VAL A  1 77  ? 24.498  -18.136 129.400 1.00 40.67  ? 101 VAL A CG1 1 
ATOM   488   C CG2 . VAL A  1 77  ? 23.318  -16.236 128.475 1.00 39.77  ? 101 VAL A CG2 1 
ATOM   489   N N   . LYS A  1 78  ? 26.714  -19.031 127.241 1.00 33.58  ? 102 LYS A N   1 
ATOM   490   C CA  . LYS A  1 78  ? 27.098  -20.378 126.967 1.00 35.28  ? 102 LYS A CA  1 
ATOM   491   C C   . LYS A  1 78  ? 26.811  -21.127 128.235 1.00 32.96  ? 102 LYS A C   1 
ATOM   492   O O   . LYS A  1 78  ? 27.259  -20.747 129.309 1.00 33.92  ? 102 LYS A O   1 
ATOM   493   C CB  . LYS A  1 78  ? 28.603  -20.438 126.654 1.00 39.86  ? 102 LYS A CB  1 
ATOM   494   C CG  . LYS A  1 78  ? 29.201  -21.773 126.187 1.00 42.88  ? 102 LYS A CG  1 
ATOM   495   C CD  . LYS A  1 78  ? 30.739  -21.649 126.118 1.00 48.52  ? 102 LYS A CD  1 
ATOM   496   C CE  . LYS A  1 78  ? 31.292  -21.721 124.685 1.00 52.92  ? 102 LYS A CE  1 
ATOM   497   N NZ  . LYS A  1 78  ? 31.322  -23.135 124.175 1.00 53.93  ? 102 LYS A NZ  1 
ATOM   498   N N   . VAL A  1 79  ? 26.069  -22.191 128.107 1.00 30.99  ? 103 VAL A N   1 
ATOM   499   C CA  . VAL A  1 79  ? 25.783  -23.089 129.187 1.00 30.50  ? 103 VAL A CA  1 
ATOM   500   C C   . VAL A  1 79  ? 26.589  -24.326 128.843 1.00 30.11  ? 103 VAL A C   1 
ATOM   501   O O   . VAL A  1 79  ? 26.366  -24.895 127.787 1.00 29.38  ? 103 VAL A O   1 
ATOM   502   C CB  . VAL A  1 79  ? 24.264  -23.461 129.229 1.00 30.33  ? 103 VAL A CB  1 
ATOM   503   C CG1 . VAL A  1 79  ? 24.023  -24.474 130.324 1.00 31.98  ? 103 VAL A CG1 1 
ATOM   504   C CG2 . VAL A  1 79  ? 23.376  -22.256 129.504 1.00 29.65  ? 103 VAL A CG2 1 
ATOM   505   N N   . GLU A  1 80  ? 27.492  -24.762 129.724 1.00 30.71  ? 104 GLU A N   1 
ATOM   506   C CA  . GLU A  1 80  ? 28.214  -26.034 129.544 1.00 30.63  ? 104 GLU A CA  1 
ATOM   507   C C   . GLU A  1 80  ? 27.864  -27.052 130.625 1.00 31.10  ? 104 GLU A C   1 
ATOM   508   O O   . GLU A  1 80  ? 28.038  -26.807 131.809 1.00 32.16  ? 104 GLU A O   1 
ATOM   509   C CB  . GLU A  1 80  ? 29.715  -25.804 129.523 1.00 30.44  ? 104 GLU A CB  1 
ATOM   510   C CG  . GLU A  1 80  ? 30.189  -24.823 128.440 1.00 30.22  ? 104 GLU A CG  1 
ATOM   511   C CD  . GLU A  1 80  ? 31.680  -24.477 128.568 1.00 30.10  ? 104 GLU A CD  1 
ATOM   512   O OE1 . GLU A  1 80  ? 32.077  -23.744 129.528 1.00 27.89  ? 104 GLU A OE1 1 
ATOM   513   O OE2 . GLU A  1 80  ? 32.463  -25.028 127.731 1.00 30.37  ? 104 GLU A OE2 1 
ATOM   514   N N   . PHE A  1 81  ? 27.361  -28.196 130.208 1.00 31.77  ? 105 PHE A N   1 
ATOM   515   C CA  . PHE A  1 81  ? 27.314  -29.369 131.086 1.00 33.35  ? 105 PHE A CA  1 
ATOM   516   C C   . PHE A  1 81  ? 28.617  -30.233 131.022 1.00 33.90  ? 105 PHE A C   1 
ATOM   517   O O   . PHE A  1 81  ? 28.916  -30.865 129.992 1.00 33.02  ? 105 PHE A O   1 
ATOM   518   C CB  . PHE A  1 81  ? 26.106  -30.219 130.757 1.00 32.60  ? 105 PHE A CB  1 
ATOM   519   C CG  . PHE A  1 81  ? 24.830  -29.480 130.837 1.00 32.90  ? 105 PHE A CG  1 
ATOM   520   C CD1 . PHE A  1 81  ? 24.339  -28.803 129.747 1.00 33.63  ? 105 PHE A CD1 1 
ATOM   521   C CD2 . PHE A  1 81  ? 24.106  -29.458 132.000 1.00 33.55  ? 105 PHE A CD2 1 
ATOM   522   C CE1 . PHE A  1 81  ? 23.130  -28.127 129.820 1.00 33.39  ? 105 PHE A CE1 1 
ATOM   523   C CE2 . PHE A  1 81  ? 22.889  -28.794 132.068 1.00 33.16  ? 105 PHE A CE2 1 
ATOM   524   C CZ  . PHE A  1 81  ? 22.402  -28.127 130.981 1.00 32.37  ? 105 PHE A CZ  1 
ATOM   525   N N   . TRP A  1 82  ? 29.376  -30.264 132.121 1.00 33.94  ? 106 TRP A N   1 
ATOM   526   C CA  . TRP A  1 82  ? 30.585  -31.059 132.181 1.00 34.65  ? 106 TRP A CA  1 
ATOM   527   C C   . TRP A  1 82  ? 30.292  -32.237 133.051 1.00 36.26  ? 106 TRP A C   1 
ATOM   528   O O   . TRP A  1 82  ? 30.154  -32.125 134.264 1.00 38.21  ? 106 TRP A O   1 
ATOM   529   C CB  . TRP A  1 82  ? 31.752  -30.307 132.758 1.00 34.78  ? 106 TRP A CB  1 
ATOM   530   C CG  . TRP A  1 82  ? 32.163  -29.044 132.048 1.00 34.80  ? 106 TRP A CG  1 
ATOM   531   C CD1 . TRP A  1 82  ? 31.674  -27.785 132.269 1.00 36.32  ? 106 TRP A CD1 1 
ATOM   532   C CD2 . TRP A  1 82  ? 33.206  -28.897 131.089 1.00 33.72  ? 106 TRP A CD2 1 
ATOM   533   N NE1 . TRP A  1 82  ? 32.332  -26.861 131.479 1.00 35.33  ? 106 TRP A NE1 1 
ATOM   534   C CE2 . TRP A  1 82  ? 33.277  -27.514 130.748 1.00 33.71  ? 106 TRP A CE2 1 
ATOM   535   C CE3 . TRP A  1 82  ? 34.094  -29.789 130.492 1.00 33.74  ? 106 TRP A CE3 1 
ATOM   536   C CZ2 . TRP A  1 82  ? 34.178  -27.007 129.826 1.00 33.41  ? 106 TRP A CZ2 1 
ATOM   537   C CZ3 . TRP A  1 82  ? 35.038  -29.283 129.578 1.00 34.79  ? 106 TRP A CZ3 1 
ATOM   538   C CH2 . TRP A  1 82  ? 35.064  -27.886 129.259 1.00 34.97  ? 106 TRP A CH2 1 
ATOM   539   N N   . PRO A  1 83  ? 30.176  -33.399 132.437 1.00 38.36  ? 107 PRO A N   1 
ATOM   540   C CA  . PRO A  1 83  ? 29.761  -34.528 133.245 1.00 37.00  ? 107 PRO A CA  1 
ATOM   541   C C   . PRO A  1 83  ? 30.817  -34.917 134.240 1.00 36.04  ? 107 PRO A C   1 
ATOM   542   O O   . PRO A  1 83  ? 32.003  -34.845 133.979 1.00 33.19  ? 107 PRO A O   1 
ATOM   543   C CB  . PRO A  1 83  ? 29.630  -35.640 132.221 1.00 38.59  ? 107 PRO A CB  1 
ATOM   544   C CG  . PRO A  1 83  ? 30.680  -35.298 131.184 1.00 38.33  ? 107 PRO A CG  1 
ATOM   545   C CD  . PRO A  1 83  ? 30.617  -33.805 131.084 1.00 38.30  ? 107 PRO A CD  1 
ATOM   546   N N   . CYS A  1 84  ? 30.324  -35.361 135.375 1.00 38.35  ? 108 CYS A N   1 
ATOM   547   C CA  . CYS A  1 84  ? 31.119  -36.038 136.380 1.00 37.91  ? 108 CYS A CA  1 
ATOM   548   C C   . CYS A  1 84  ? 31.253  -37.566 136.151 1.00 36.35  ? 108 CYS A C   1 
ATOM   549   O O   . CYS A  1 84  ? 32.238  -38.169 136.589 1.00 36.57  ? 108 CYS A O   1 
ATOM   550   C CB  . CYS A  1 84  ? 30.524  -35.739 137.765 1.00 39.06  ? 108 CYS A CB  1 
ATOM   551   S SG  . CYS A  1 84  ? 30.482  -33.990 138.276 1.00 40.68  ? 108 CYS A SG  1 
ATOM   552   N N   . SER A  1 85  ? 30.284  -38.195 135.489 1.00 35.46  ? 109 SER A N   1 
ATOM   553   C CA  . SER A  1 85  ? 30.257  -39.668 135.388 1.00 35.67  ? 109 SER A CA  1 
ATOM   554   C C   . SER A  1 85  ? 31.432  -40.171 134.534 1.00 35.56  ? 109 SER A C   1 
ATOM   555   O O   . SER A  1 85  ? 31.849  -39.538 133.579 1.00 35.19  ? 109 SER A O   1 
ATOM   556   C CB  . SER A  1 85  ? 28.901  -40.186 134.838 1.00 35.27  ? 109 SER A CB  1 
ATOM   557   O OG  . SER A  1 85  ? 27.792  -39.934 135.717 1.00 33.68  ? 109 SER A OG  1 
ATOM   558   N N   . PRO A  1 86  ? 32.008  -41.307 134.899 1.00 37.05  ? 110 PRO A N   1 
ATOM   559   C CA  . PRO A  1 86  ? 33.163  -41.765 134.128 1.00 37.91  ? 110 PRO A CA  1 
ATOM   560   C C   . PRO A  1 86  ? 32.761  -42.291 132.774 1.00 37.33  ? 110 PRO A C   1 
ATOM   561   O O   . PRO A  1 86  ? 31.657  -42.762 132.631 1.00 35.85  ? 110 PRO A O   1 
ATOM   562   C CB  . PRO A  1 86  ? 33.708  -42.908 134.999 1.00 37.16  ? 110 PRO A CB  1 
ATOM   563   C CG  . PRO A  1 86  ? 32.532  -43.449 135.618 1.00 36.42  ? 110 PRO A CG  1 
ATOM   564   C CD  . PRO A  1 86  ? 31.729  -42.227 136.009 1.00 37.12  ? 110 PRO A CD  1 
ATOM   565   N N   . ILE A  1 87  ? 33.677  -42.302 131.816 1.00 38.78  ? 111 ILE A N   1 
ATOM   566   C CA  . ILE A  1 87  ? 33.307  -42.818 130.489 1.00 39.31  ? 111 ILE A CA  1 
ATOM   567   C C   . ILE A  1 87  ? 32.967  -44.289 130.445 1.00 40.05  ? 111 ILE A C   1 
ATOM   568   O O   . ILE A  1 87  ? 32.672  -44.801 129.384 1.00 42.97  ? 111 ILE A O   1 
ATOM   569   C CB  . ILE A  1 87  ? 34.388  -42.527 129.424 1.00 40.53  ? 111 ILE A CB  1 
ATOM   570   C CG1 . ILE A  1 87  ? 35.625  -43.436 129.635 1.00 40.17  ? 111 ILE A CG1 1 
ATOM   571   C CG2 . ILE A  1 87  ? 34.692  -41.004 129.337 1.00 39.66  ? 111 ILE A CG2 1 
ATOM   572   C CD1 . ILE A  1 87  ? 36.709  -43.170 128.623 1.00 39.75  ? 111 ILE A CD1 1 
ATOM   573   N N   . THR A  1 88  ? 33.014  -44.966 131.583 1.00 41.13  ? 112 THR A N   1 
ATOM   574   C CA  . THR A  1 88  ? 32.616  -46.354 131.700 1.00 42.02  ? 112 THR A CA  1 
ATOM   575   C C   . THR A  1 88  ? 31.226  -46.565 132.260 1.00 39.98  ? 112 THR A C   1 
ATOM   576   O O   . THR A  1 88  ? 30.817  -47.685 132.391 1.00 43.53  ? 112 THR A O   1 
ATOM   577   C CB  . THR A  1 88  ? 33.587  -47.121 132.664 1.00 45.36  ? 112 THR A CB  1 
ATOM   578   O OG1 . THR A  1 88  ? 33.261  -46.876 134.060 1.00 47.15  ? 112 THR A OG1 1 
ATOM   579   C CG2 . THR A  1 88  ? 35.075  -46.790 132.338 1.00 45.47  ? 112 THR A CG2 1 
ATOM   580   N N   . GLN A  1 89  ? 30.530  -45.538 132.699 1.00 38.62  ? 113 GLN A N   1 
ATOM   581   C CA  . GLN A  1 89  ? 29.179  -45.744 133.244 1.00 38.61  ? 113 GLN A CA  1 
ATOM   582   C C   . GLN A  1 89  ? 28.230  -46.190 132.113 1.00 37.99  ? 113 GLN A C   1 
ATOM   583   O O   . GLN A  1 89  ? 28.412  -45.788 130.964 1.00 38.47  ? 113 GLN A O   1 
ATOM   584   C CB  . GLN A  1 89  ? 28.685  -44.482 133.954 1.00 37.27  ? 113 GLN A CB  1 
ATOM   585   C CG  . GLN A  1 89  ? 27.280  -44.546 134.556 1.00 37.20  ? 113 GLN A CG  1 
ATOM   586   C CD  . GLN A  1 89  ? 27.042  -43.368 135.523 1.00 38.15  ? 113 GLN A CD  1 
ATOM   587   O OE1 . GLN A  1 89  ? 27.936  -42.979 136.318 1.00 41.22  ? 113 GLN A OE1 1 
ATOM   588   N NE2 . GLN A  1 89  ? 25.891  -42.755 135.413 1.00 35.99  ? 113 GLN A NE2 1 
ATOM   589   N N   . GLY A  1 90  ? 27.296  -47.075 132.458 1.00 36.64  ? 114 GLY A N   1 
ATOM   590   C CA  . GLY A  1 90  ? 26.282  -47.632 131.559 1.00 36.22  ? 114 GLY A CA  1 
ATOM   591   C C   . GLY A  1 90  ? 24.952  -47.000 131.946 1.00 36.91  ? 114 GLY A C   1 
ATOM   592   O O   . GLY A  1 90  ? 24.917  -45.882 132.514 1.00 37.63  ? 114 GLY A O   1 
ATOM   593   N N   . ASP A  1 91  ? 23.868  -47.724 131.698 1.00 37.00  ? 115 ASP A N   1 
ATOM   594   C CA  . ASP A  1 91  ? 22.500  -47.166 131.637 1.00 37.70  ? 115 ASP A CA  1 
ATOM   595   C C   . ASP A  1 91  ? 22.483  -45.785 131.010 1.00 38.13  ? 115 ASP A C   1 
ATOM   596   O O   . ASP A  1 91  ? 21.940  -44.816 131.560 1.00 39.23  ? 115 ASP A O   1 
ATOM   597   C CB  . ASP A  1 91  ? 21.732  -47.153 132.970 1.00 37.92  ? 115 ASP A CB  1 
ATOM   598   C CG  . ASP A  1 91  ? 20.200  -47.077 132.753 1.00 39.44  ? 115 ASP A CG  1 
ATOM   599   O OD1 . ASP A  1 91  ? 19.760  -47.627 131.738 1.00 43.79  ? 115 ASP A OD1 1 
ATOM   600   O OD2 . ASP A  1 91  ? 19.411  -46.460 133.514 1.00 39.11  ? 115 ASP A OD2 1 
ATOM   601   N N   . ARG A  1 92  ? 23.073  -45.741 129.827 1.00 36.78  ? 116 ARG A N   1 
ATOM   602   C CA  . ARG A  1 92  ? 23.191  -44.524 129.040 1.00 36.14  ? 116 ARG A CA  1 
ATOM   603   C C   . ARG A  1 92  ? 21.868  -44.107 128.422 1.00 34.42  ? 116 ARG A C   1 
ATOM   604   O O   . ARG A  1 92  ? 21.007  -44.934 128.209 1.00 35.09  ? 116 ARG A O   1 
ATOM   605   C CB  . ARG A  1 92  ? 24.162  -44.748 127.883 1.00 36.63  ? 116 ARG A CB  1 
ATOM   606   C CG  . ARG A  1 92  ? 25.568  -45.175 128.252 1.00 35.10  ? 116 ARG A CG  1 
ATOM   607   C CD  . ARG A  1 92  ? 26.469  -44.624 127.209 1.00 35.07  ? 116 ARG A CD  1 
ATOM   608   N NE  . ARG A  1 92  ? 26.889  -45.610 126.288 1.00 34.59  ? 116 ARG A NE  1 
ATOM   609   C CZ  . ARG A  1 92  ? 27.289  -45.340 125.068 1.00 33.97  ? 116 ARG A CZ  1 
ATOM   610   N NH1 . ARG A  1 92  ? 27.622  -46.372 124.314 1.00 35.89  ? 116 ARG A NH1 1 
ATOM   611   N NH2 . ARG A  1 92  ? 27.311  -44.096 124.574 1.00 32.30  ? 116 ARG A NH2 1 
ATOM   612   N N   . GLY A  1 93  ? 21.739  -42.826 128.110 1.00 32.97  ? 117 GLY A N   1 
ATOM   613   C CA  . GLY A  1 93  ? 20.472  -42.274 127.685 1.00 32.57  ? 117 GLY A CA  1 
ATOM   614   C C   . GLY A  1 93  ? 20.632  -41.035 126.832 1.00 32.94  ? 117 GLY A C   1 
ATOM   615   O O   . GLY A  1 93  ? 21.777  -40.563 126.510 1.00 31.73  ? 117 GLY A O   1 
ATOM   616   N N   . VAL A  1 94  ? 19.475  -40.468 126.503 1.00 32.32  ? 118 VAL A N   1 
ATOM   617   C CA  . VAL A  1 94  ? 19.415  -39.422 125.504 1.00 32.93  ? 118 VAL A CA  1 
ATOM   618   C C   . VAL A  1 94  ? 18.330  -38.418 125.894 1.00 32.40  ? 118 VAL A C   1 
ATOM   619   O O   . VAL A  1 94  ? 17.159  -38.782 126.127 1.00 33.74  ? 118 VAL A O   1 
ATOM   620   C CB  . VAL A  1 94  ? 19.226  -40.089 124.111 1.00 34.10  ? 118 VAL A CB  1 
ATOM   621   C CG1 . VAL A  1 94  ? 17.847  -40.707 123.967 1.00 36.79  ? 118 VAL A CG1 1 
ATOM   622   C CG2 . VAL A  1 94  ? 19.411  -39.130 122.990 1.00 34.17  ? 118 VAL A CG2 1 
ATOM   623   N N   . GLY A  1 95  ? 18.720  -37.159 126.005 1.00 31.36  ? 119 GLY A N   1 
ATOM   624   C CA  . GLY A  1 95  ? 17.751  -36.119 126.303 1.00 32.04  ? 119 GLY A CA  1 
ATOM   625   C C   . GLY A  1 95  ? 17.775  -34.926 125.378 1.00 32.12  ? 119 GLY A C   1 
ATOM   626   O O   . GLY A  1 95  ? 18.227  -35.010 124.220 1.00 33.46  ? 119 GLY A O   1 
ATOM   627   N N   . SER A  1 96  ? 17.295  -33.797 125.887 1.00 31.04  ? 120 SER A N   1 
ATOM   628   C CA  . SER A  1 96  ? 17.178  -32.595 125.093 1.00 30.32  ? 120 SER A CA  1 
ATOM   629   C C   . SER A  1 96  ? 17.455  -31.313 125.872 1.00 29.32  ? 120 SER A C   1 
ATOM   630   O O   . SER A  1 96  ? 17.119  -31.217 127.082 1.00 29.33  ? 120 SER A O   1 
ATOM   631   C CB  . SER A  1 96  ? 15.762  -32.541 124.553 1.00 31.06  ? 120 SER A CB  1 
ATOM   632   O OG  . SER A  1 96  ? 15.555  -33.511 123.550 1.00 32.50  ? 120 SER A OG  1 
ATOM   633   N N   . SER A  1 97  ? 18.067  -30.341 125.199 1.00 27.36  ? 121 SER A N   1 
ATOM   634   C CA  . SER A  1 97  ? 18.015  -28.958 125.669 1.00 27.30  ? 121 SER A CA  1 
ATOM   635   C C   . SER A  1 97  ? 17.303  -28.074 124.672 1.00 28.13  ? 121 SER A C   1 
ATOM   636   O O   . SER A  1 97  ? 17.391  -28.258 123.462 1.00 26.91  ? 121 SER A O   1 
ATOM   637   C CB  . SER A  1 97  ? 19.401  -28.375 125.876 1.00 26.74  ? 121 SER A CB  1 
ATOM   638   O OG  . SER A  1 97  ? 20.043  -28.345 124.616 1.00 26.68  ? 121 SER A OG  1 
ATOM   639   N N   . ALA A  1 98  ? 16.638  -27.061 125.204 1.00 29.52  ? 122 ALA A N   1 
ATOM   640   C CA  . ALA A  1 98  ? 15.889  -26.117 124.376 1.00 30.81  ? 122 ALA A CA  1 
ATOM   641   C C   . ALA A  1 98  ? 16.080  -24.656 124.842 1.00 31.06  ? 122 ALA A C   1 
ATOM   642   O O   . ALA A  1 98  ? 16.269  -24.390 126.069 1.00 31.27  ? 122 ALA A O   1 
ATOM   643   C CB  . ALA A  1 98  ? 14.406  -26.486 124.371 1.00 30.98  ? 122 ALA A CB  1 
ATOM   644   N N   . VAL A  1 99  ? 16.038  -23.738 123.870 1.00 29.30  ? 123 VAL A N   1 
ATOM   645   C CA  . VAL A  1 99  ? 16.194  -22.355 124.167 1.00 29.09  ? 123 VAL A CA  1 
ATOM   646   C C   . VAL A  1 99  ? 14.812  -21.808 124.234 1.00 28.33  ? 123 VAL A C   1 
ATOM   647   O O   . VAL A  1 99  ? 14.100  -21.828 123.250 1.00 30.56  ? 123 VAL A O   1 
ATOM   648   C CB  . VAL A  1 99  ? 17.034  -21.595 123.129 1.00 29.49  ? 123 VAL A CB  1 
ATOM   649   C CG1 . VAL A  1 99  ? 17.124  -20.115 123.519 1.00 29.00  ? 123 VAL A CG1 1 
ATOM   650   C CG2 . VAL A  1 99  ? 18.427  -22.183 123.049 1.00 29.58  ? 123 VAL A CG2 1 
ATOM   651   N N   . ILE A  1 100 ? 14.493  -21.288 125.394 1.00 27.67  ? 124 ILE A N   1 
ATOM   652   C CA  . ILE A  1 100 ? 13.229  -20.774 125.778 1.00 29.27  ? 124 ILE A CA  1 
ATOM   653   C C   . ILE A  1 100 ? 13.439  -19.288 126.063 1.00 29.71  ? 124 ILE A C   1 
ATOM   654   O O   . ILE A  1 100 ? 14.029  -18.918 127.081 1.00 30.08  ? 124 ILE A O   1 
ATOM   655   C CB  . ILE A  1 100 ? 12.773  -21.499 127.056 1.00 30.33  ? 124 ILE A CB  1 
ATOM   656   C CG1 . ILE A  1 100 ? 12.724  -23.018 126.815 1.00 31.19  ? 124 ILE A CG1 1 
ATOM   657   C CG2 . ILE A  1 100 ? 11.418  -20.994 127.517 1.00 30.95  ? 124 ILE A CG2 1 
ATOM   658   C CD1 . ILE A  1 100 ? 11.775  -23.439 125.714 1.00 32.20  ? 124 ILE A CD1 1 
ATOM   659   N N   . LEU A  1 101 ? 12.981  -18.441 125.147 1.00 29.79  ? 125 LEU A N   1 
ATOM   660   C CA  . LEU A  1 101 ? 13.237  -16.999 125.234 1.00 30.26  ? 125 LEU A CA  1 
ATOM   661   C C   . LEU A  1 101 ? 12.118  -16.171 125.885 1.00 30.09  ? 125 LEU A C   1 
ATOM   662   O O   . LEU A  1 101 ? 12.284  -15.000 126.066 1.00 29.37  ? 125 LEU A O   1 
ATOM   663   C CB  . LEU A  1 101 ? 13.579  -16.458 123.825 1.00 31.01  ? 125 LEU A CB  1 
ATOM   664   C CG  . LEU A  1 101 ? 14.739  -17.203 123.077 1.00 30.39  ? 125 LEU A CG  1 
ATOM   665   C CD1 . LEU A  1 101 ? 14.861  -16.775 121.607 1.00 30.19  ? 125 LEU A CD1 1 
ATOM   666   C CD2 . LEU A  1 101 ? 16.079  -17.070 123.806 1.00 29.81  ? 125 LEU A CD2 1 
ATOM   667   N N   . ASP A  1 102 ? 11.040  -16.809 126.321 1.00 31.40  ? 126 ASP A N   1 
ATOM   668   C CA  . ASP A  1 102 ? 9.854   -16.156 126.842 1.00 31.77  ? 126 ASP A CA  1 
ATOM   669   C C   . ASP A  1 102 ? 9.503   -16.621 128.228 1.00 33.04  ? 126 ASP A C   1 
ATOM   670   O O   . ASP A  1 102 ? 8.354   -16.510 128.625 1.00 33.19  ? 126 ASP A O   1 
ATOM   671   C CB  . ASP A  1 102 ? 8.650   -16.444 125.925 1.00 32.83  ? 126 ASP A CB  1 
ATOM   672   C CG  . ASP A  1 102 ? 8.170   -17.959 125.924 1.00 33.86  ? 126 ASP A CG  1 
ATOM   673   O OD1 . ASP A  1 102 ? 8.826   -18.881 126.454 1.00 34.69  ? 126 ASP A OD1 1 
ATOM   674   O OD2 . ASP A  1 102 ? 7.116   -18.241 125.324 1.00 35.58  ? 126 ASP A OD2 1 
ATOM   675   N N   . ASP A  1 103 ? 10.445  -17.209 128.959 1.00 34.90  ? 127 ASP A N   1 
ATOM   676   C CA  . ASP A  1 103 ? 10.207  -17.561 130.381 1.00 36.63  ? 127 ASP A CA  1 
ATOM   677   C C   . ASP A  1 103 ? 9.051   -18.562 130.632 1.00 36.69  ? 127 ASP A C   1 
ATOM   678   O O   . ASP A  1 103 ? 8.628   -18.732 131.747 1.00 40.32  ? 127 ASP A O   1 
ATOM   679   C CB  . ASP A  1 103 ? 10.047  -16.272 131.246 1.00 36.91  ? 127 ASP A CB  1 
ATOM   680   C CG  . ASP A  1 103 ? 10.265  -16.509 132.792 1.00 38.54  ? 127 ASP A CG  1 
ATOM   681   O OD1 . ASP A  1 103 ? 11.011  -17.430 133.185 1.00 37.07  ? 127 ASP A OD1 1 
ATOM   682   O OD2 . ASP A  1 103 ? 9.676   -15.760 133.639 1.00 41.30  ? 127 ASP A OD2 1 
ATOM   683   N N   . ASN A  1 104 ? 8.610   -19.277 129.616 1.00 37.36  ? 128 ASN A N   1 
ATOM   684   C CA  . ASN A  1 104 ? 7.586   -20.342 129.733 1.00 39.76  ? 128 ASN A CA  1 
ATOM   685   C C   . ASN A  1 104 ? 8.208   -21.734 129.528 1.00 37.79  ? 128 ASN A C   1 
ATOM   686   O O   . ASN A  1 104 ? 8.324   -22.235 128.420 1.00 34.93  ? 128 ASN A O   1 
ATOM   687   C CB  . ASN A  1 104 ? 6.520   -20.125 128.639 1.00 43.78  ? 128 ASN A CB  1 
ATOM   688   C CG  . ASN A  1 104 ? 5.231   -20.975 128.821 1.00 44.77  ? 128 ASN A CG  1 
ATOM   689   O OD1 . ASN A  1 104 ? 4.694   -21.065 129.944 1.00 45.19  ? 128 ASN A OD1 1 
ATOM   690   N ND2 . ASN A  1 104 ? 4.673   -21.505 127.686 1.00 43.62  ? 128 ASN A ND2 1 
ATOM   691   N N   . PHE A  1 105 ? 8.623   -22.326 130.623 1.00 36.46  ? 129 PHE A N   1 
ATOM   692   C CA  . PHE A  1 105 ? 9.274   -23.592 130.592 1.00 33.62  ? 129 PHE A CA  1 
ATOM   693   C C   . PHE A  1 105 ? 8.264   -24.680 130.851 1.00 30.73  ? 129 PHE A C   1 
ATOM   694   O O   . PHE A  1 105 ? 7.299   -24.481 131.551 1.00 30.72  ? 129 PHE A O   1 
ATOM   695   C CB  . PHE A  1 105 ? 10.321  -23.624 131.699 1.00 34.12  ? 129 PHE A CB  1 
ATOM   696   C CG  . PHE A  1 105 ? 11.411  -22.635 131.534 1.00 35.30  ? 129 PHE A CG  1 
ATOM   697   C CD1 . PHE A  1 105 ? 12.558  -22.950 130.770 1.00 35.96  ? 129 PHE A CD1 1 
ATOM   698   C CD2 . PHE A  1 105 ? 11.337  -21.390 132.141 1.00 35.08  ? 129 PHE A CD2 1 
ATOM   699   C CE1 . PHE A  1 105 ? 13.611  -22.038 130.655 1.00 34.50  ? 129 PHE A CE1 1 
ATOM   700   C CE2 . PHE A  1 105 ? 12.387  -20.488 132.018 1.00 34.17  ? 129 PHE A CE2 1 
ATOM   701   C CZ  . PHE A  1 105 ? 13.528  -20.826 131.297 1.00 34.02  ? 129 PHE A CZ  1 
ATOM   702   N N   . VAL A  1 106 ? 8.574   -25.871 130.391 1.00 29.20  ? 130 VAL A N   1 
ATOM   703   C CA  . VAL A  1 106 ? 7.843   -27.062 130.786 1.00 28.68  ? 130 VAL A CA  1 
ATOM   704   C C   . VAL A  1 106 ? 7.979   -27.211 132.254 1.00 28.75  ? 130 VAL A C   1 
ATOM   705   O O   . VAL A  1 106 ? 9.047   -27.011 132.802 1.00 28.88  ? 130 VAL A O   1 
ATOM   706   C CB  . VAL A  1 106 ? 8.392   -28.307 130.094 1.00 27.61  ? 130 VAL A CB  1 
ATOM   707   C CG1 . VAL A  1 106 ? 7.764   -29.595 130.594 1.00 26.94  ? 130 VAL A CG1 1 
ATOM   708   C CG2 . VAL A  1 106 ? 8.149   -28.174 128.610 1.00 27.57  ? 130 VAL A CG2 1 
ATOM   709   N N   . THR A  1 107 ? 6.886   -27.564 132.890 1.00 30.17  ? 131 THR A N   1 
ATOM   710   C CA  . THR A  1 107 ? 6.904   -27.807 134.334 1.00 32.98  ? 131 THR A CA  1 
ATOM   711   C C   . THR A  1 107 ? 7.918   -28.875 134.805 1.00 33.12  ? 131 THR A C   1 
ATOM   712   O O   . THR A  1 107 ? 7.981   -30.019 134.275 1.00 33.07  ? 131 THR A O   1 
ATOM   713   C CB  . THR A  1 107 ? 5.526   -28.276 134.842 1.00 33.79  ? 131 THR A CB  1 
ATOM   714   O OG1 . THR A  1 107 ? 4.527   -27.308 134.493 1.00 37.09  ? 131 THR A OG1 1 
ATOM   715   C CG2 . THR A  1 107 ? 5.531   -28.435 136.314 1.00 33.34  ? 131 THR A CG2 1 
ATOM   716   N N   . LYS A  1 108 ? 8.651   -28.474 135.835 1.00 33.71  ? 132 LYS A N   1 
ATOM   717   C CA  . LYS A  1 108 ? 9.631   -29.299 136.521 1.00 34.45  ? 132 LYS A CA  1 
ATOM   718   C C   . LYS A  1 108 ? 9.043   -30.697 136.906 1.00 32.66  ? 132 LYS A C   1 
ATOM   719   O O   . LYS A  1 108 ? 7.891   -30.849 137.333 1.00 30.02  ? 132 LYS A O   1 
ATOM   720   C CB  . LYS A  1 108 ? 10.187  -28.534 137.720 1.00 36.54  ? 132 LYS A CB  1 
ATOM   721   C CG  . LYS A  1 108 ? 11.536  -28.995 138.128 1.00 40.08  ? 132 LYS A CG  1 
ATOM   722   C CD  . LYS A  1 108 ? 11.906  -28.729 139.575 1.00 43.21  ? 132 LYS A CD  1 
ATOM   723   C CE  . LYS A  1 108 ? 12.948  -29.773 139.981 1.00 46.86  ? 132 LYS A CE  1 
ATOM   724   N NZ  . LYS A  1 108 ? 13.705  -29.205 141.131 1.00 51.35  ? 132 LYS A NZ  1 
ATOM   725   N N   . ALA A  1 109 ? 9.812   -31.726 136.595 1.00 32.13  ? 133 ALA A N   1 
ATOM   726   C CA  . ALA A  1 109 ? 9.311   -33.068 136.676 1.00 33.64  ? 133 ALA A CA  1 
ATOM   727   C C   . ALA A  1 109 ? 10.447  -33.991 136.966 1.00 34.70  ? 133 ALA A C   1 
ATOM   728   O O   . ALA A  1 109 ? 11.490  -33.906 136.323 1.00 35.70  ? 133 ALA A O   1 
ATOM   729   C CB  . ALA A  1 109 ? 8.595   -33.494 135.404 1.00 33.19  ? 133 ALA A CB  1 
ATOM   730   N N   . THR A  1 110 ? 10.241  -34.869 137.946 1.00 35.21  ? 134 THR A N   1 
ATOM   731   C CA  . THR A  1 110 ? 11.267  -35.822 138.295 1.00 35.97  ? 134 THR A CA  1 
ATOM   732   C C   . THR A  1 110 ? 11.388  -36.946 137.246 1.00 36.17  ? 134 THR A C   1 
ATOM   733   O O   . THR A  1 110 ? 12.560  -37.312 136.873 1.00 38.00  ? 134 THR A O   1 
ATOM   734   C CB  . THR A  1 110 ? 11.017  -36.356 139.713 1.00 34.90  ? 134 THR A CB  1 
ATOM   735   O OG1 . THR A  1 110 ? 10.935  -35.236 140.565 1.00 35.48  ? 134 THR A OG1 1 
ATOM   736   C CG2 . THR A  1 110 ? 12.151  -37.133 140.203 1.00 34.35  ? 134 THR A CG2 1 
ATOM   737   N N   . ALA A  1 111 ? 10.220  -37.486 136.831 1.00 34.11  ? 135 ALA A N   1 
ATOM   738   C CA  . ALA A  1 111 ? 10.166  -38.573 135.878 1.00 34.06  ? 135 ALA A CA  1 
ATOM   739   C C   . ALA A  1 111 ? 8.994   -38.521 134.928 1.00 33.36  ? 135 ALA A C   1 
ATOM   740   O O   . ALA A  1 111 ? 8.132   -39.352 134.943 1.00 31.91  ? 135 ALA A O   1 
ATOM   741   C CB  . ALA A  1 111 ? 10.210  -39.903 136.604 1.00 34.67  ? 135 ALA A CB  1 
ATOM   742   N N   . LEU A  1 112 ? 9.049   -37.568 134.015 1.00 34.32  ? 136 LEU A N   1 
ATOM   743   C CA  . LEU A  1 112 ? 8.065   -37.438 132.964 1.00 33.11  ? 136 LEU A CA  1 
ATOM   744   C C   . LEU A  1 112 ? 8.254   -38.606 131.971 1.00 33.44  ? 136 LEU A C   1 
ATOM   745   O O   . LEU A  1 112 ? 9.388   -39.001 131.622 1.00 32.61  ? 136 LEU A O   1 
ATOM   746   C CB  . LEU A  1 112 ? 8.208   -36.065 132.323 1.00 33.49  ? 136 LEU A CB  1 
ATOM   747   C CG  . LEU A  1 112 ? 7.003   -35.617 131.477 1.00 34.92  ? 136 LEU A CG  1 
ATOM   748   C CD1 . LEU A  1 112 ? 5.834   -35.322 132.384 1.00 34.12  ? 136 LEU A CD1 1 
ATOM   749   C CD2 . LEU A  1 112 ? 7.254   -34.423 130.559 1.00 34.33  ? 136 LEU A CD2 1 
ATOM   750   N N   . THR A  1 113 ? 7.139   -39.212 131.577 1.00 33.90  ? 137 THR A N   1 
ATOM   751   C CA  . THR A  1 113 ? 7.153   -40.427 130.738 1.00 33.87  ? 137 THR A CA  1 
ATOM   752   C C   . THR A  1 113 ? 7.510   -40.135 129.261 1.00 34.22  ? 137 THR A C   1 
ATOM   753   O O   . THR A  1 113 ? 7.347   -41.020 128.425 1.00 35.14  ? 137 THR A O   1 
ATOM   754   C CB  . THR A  1 113 ? 5.756   -41.139 130.678 1.00 33.91  ? 137 THR A CB  1 
ATOM   755   O OG1 . THR A  1 113 ? 4.814   -40.274 130.023 1.00 34.11  ? 137 THR A OG1 1 
ATOM   756   C CG2 . THR A  1 113 ? 5.220   -41.540 132.001 1.00 33.03  ? 137 THR A CG2 1 
ATOM   757   N N   . TYR A  1 114 ? 7.899   -38.904 128.917 1.00 33.44  ? 138 TYR A N   1 
ATOM   758   C CA  . TYR A  1 114 ? 8.372   -38.569 127.550 1.00 33.69  ? 138 TYR A CA  1 
ATOM   759   C C   . TYR A  1 114 ? 9.321   -37.370 127.652 1.00 32.59  ? 138 TYR A C   1 
ATOM   760   O O   . TYR A  1 114 ? 9.347   -36.680 128.682 1.00 31.90  ? 138 TYR A O   1 
ATOM   761   C CB  . TYR A  1 114 ? 7.201   -38.244 126.534 1.00 34.82  ? 138 TYR A CB  1 
ATOM   762   C CG  . TYR A  1 114 ? 6.375   -37.024 126.894 1.00 36.22  ? 138 TYR A CG  1 
ATOM   763   C CD1 . TYR A  1 114 ? 5.507   -37.045 128.047 1.00 37.74  ? 138 TYR A CD1 1 
ATOM   764   C CD2 . TYR A  1 114 ? 6.502   -35.837 126.176 1.00 35.86  ? 138 TYR A CD2 1 
ATOM   765   C CE1 . TYR A  1 114 ? 4.810   -35.934 128.441 1.00 37.50  ? 138 TYR A CE1 1 
ATOM   766   C CE2 . TYR A  1 114 ? 5.796   -34.715 126.565 1.00 37.39  ? 138 TYR A CE2 1 
ATOM   767   C CZ  . TYR A  1 114 ? 4.966   -34.776 127.699 1.00 39.27  ? 138 TYR A CZ  1 
ATOM   768   O OH  . TYR A  1 114 ? 4.278   -33.667 128.077 1.00 41.51  ? 138 TYR A OH  1 
ATOM   769   N N   . ASP A  1 115 ? 10.089  -37.136 126.586 1.00 31.15  ? 139 ASP A N   1 
ATOM   770   C CA  . ASP A  1 115 ? 10.992  -36.013 126.539 1.00 30.47  ? 139 ASP A CA  1 
ATOM   771   C C   . ASP A  1 115 ? 10.162  -34.869 125.975 1.00 29.63  ? 139 ASP A C   1 
ATOM   772   O O   . ASP A  1 115 ? 9.893   -34.838 124.769 1.00 30.57  ? 139 ASP A O   1 
ATOM   773   C CB  . ASP A  1 115 ? 12.224  -36.323 125.700 1.00 30.46  ? 139 ASP A CB  1 
ATOM   774   C CG  . ASP A  1 115 ? 13.116  -35.101 125.481 1.00 31.16  ? 139 ASP A CG  1 
ATOM   775   O OD1 . ASP A  1 115 ? 12.778  -34.001 125.960 1.00 32.03  ? 139 ASP A OD1 1 
ATOM   776   O OD2 . ASP A  1 115 ? 14.191  -35.249 124.859 1.00 32.62  ? 139 ASP A OD2 1 
ATOM   777   N N   . PRO A  1 116 ? 9.750   -33.933 126.832 1.00 28.46  ? 140 PRO A N   1 
ATOM   778   C CA  . PRO A  1 116 ? 8.846   -32.932 126.351 1.00 29.33  ? 140 PRO A CA  1 
ATOM   779   C C   . PRO A  1 116 ? 9.529   -31.846 125.503 1.00 30.73  ? 140 PRO A C   1 
ATOM   780   O O   . PRO A  1 116 ? 8.801   -31.050 124.914 1.00 32.09  ? 140 PRO A O   1 
ATOM   781   C CB  . PRO A  1 116 ? 8.353   -32.300 127.636 1.00 29.34  ? 140 PRO A CB  1 
ATOM   782   C CG  . PRO A  1 116 ? 9.592   -32.244 128.483 1.00 28.98  ? 140 PRO A CG  1 
ATOM   783   C CD  . PRO A  1 116 ? 10.370  -33.507 128.095 1.00 28.71  ? 140 PRO A CD  1 
ATOM   784   N N   . TYR A  1 117 ? 10.879  -31.780 125.470 1.00 30.82  ? 141 TYR A N   1 
ATOM   785   C CA  . TYR A  1 117 ? 11.632  -30.871 124.569 1.00 30.53  ? 141 TYR A CA  1 
ATOM   786   C C   . TYR A  1 117 ? 12.140  -31.439 123.206 1.00 30.66  ? 141 TYR A C   1 
ATOM   787   O O   . TYR A  1 117 ? 12.730  -30.701 122.406 1.00 32.20  ? 141 TYR A O   1 
ATOM   788   C CB  . TYR A  1 117 ? 12.815  -30.239 125.331 1.00 30.03  ? 141 TYR A CB  1 
ATOM   789   C CG  . TYR A  1 117 ? 12.348  -29.207 126.360 1.00 30.26  ? 141 TYR A CG  1 
ATOM   790   C CD1 . TYR A  1 117 ? 11.561  -28.085 125.955 1.00 28.98  ? 141 TYR A CD1 1 
ATOM   791   C CD2 . TYR A  1 117 ? 12.691  -29.359 127.749 1.00 28.73  ? 141 TYR A CD2 1 
ATOM   792   C CE1 . TYR A  1 117 ? 11.123  -27.172 126.908 1.00 29.61  ? 141 TYR A CE1 1 
ATOM   793   C CE2 . TYR A  1 117 ? 12.257  -28.467 128.684 1.00 28.77  ? 141 TYR A CE2 1 
ATOM   794   C CZ  . TYR A  1 117 ? 11.468  -27.370 128.279 1.00 29.25  ? 141 TYR A CZ  1 
ATOM   795   O OH  . TYR A  1 117 ? 11.035  -26.470 129.230 1.00 28.05  ? 141 TYR A OH  1 
ATOM   796   N N   . VAL A  1 118 ? 11.892  -32.692 122.899 1.00 29.85  ? 142 VAL A N   1 
ATOM   797   C CA  . VAL A  1 118 ? 12.527  -33.272 121.734 1.00 30.55  ? 142 VAL A CA  1 
ATOM   798   C C   . VAL A  1 118 ? 12.050  -32.625 120.428 1.00 31.08  ? 142 VAL A C   1 
ATOM   799   O O   . VAL A  1 118 ? 12.835  -32.498 119.484 1.00 32.59  ? 142 VAL A O   1 
ATOM   800   C CB  . VAL A  1 118 ? 12.298  -34.820 121.671 1.00 30.81  ? 142 VAL A CB  1 
ATOM   801   C CG1 . VAL A  1 118 ? 10.813  -35.185 121.295 1.00 29.36  ? 142 VAL A CG1 1 
ATOM   802   C CG2 . VAL A  1 118 ? 13.386  -35.476 120.804 1.00 29.27  ? 142 VAL A CG2 1 
ATOM   803   N N   . ASN A  1 119 ? 10.777  -32.231 120.356 1.00 30.73  ? 143 ASN A N   1 
ATOM   804   C CA  . ASN A  1 119 ? 10.236  -31.643 119.118 1.00 30.51  ? 143 ASN A CA  1 
ATOM   805   C C   . ASN A  1 119 ? 10.463  -30.141 118.957 1.00 29.73  ? 143 ASN A C   1 
ATOM   806   O O   . ASN A  1 119 ? 10.129  -29.577 117.902 1.00 31.25  ? 143 ASN A O   1 
ATOM   807   C CB  . ASN A  1 119 ? 8.744   -31.956 118.946 1.00 30.30  ? 143 ASN A CB  1 
ATOM   808   C CG  . ASN A  1 119 ? 8.492   -33.424 118.639 1.00 29.85  ? 143 ASN A CG  1 
ATOM   809   O OD1 . ASN A  1 119 ? 9.321   -34.069 117.939 1.00 27.74  ? 143 ASN A OD1 1 
ATOM   810   N ND2 . ASN A  1 119 ? 7.330   -33.982 119.167 1.00 29.30  ? 143 ASN A ND2 1 
ATOM   811   N N   . TYR A  1 120 ? 11.071  -29.516 119.946 1.00 27.58  ? 144 TYR A N   1 
ATOM   812   C CA  . TYR A  1 120 ? 11.275  -28.074 119.876 1.00 27.56  ? 144 TYR A CA  1 
ATOM   813   C C   . TYR A  1 120 ? 12.199  -27.702 118.746 1.00 24.98  ? 144 TYR A C   1 
ATOM   814   O O   . TYR A  1 120 ? 13.180  -28.321 118.567 1.00 23.75  ? 144 TYR A O   1 
ATOM   815   C CB  . TYR A  1 120 ? 11.825  -27.496 121.221 1.00 27.58  ? 144 TYR A CB  1 
ATOM   816   C CG  . TYR A  1 120 ? 10.786  -27.183 122.252 1.00 27.19  ? 144 TYR A CG  1 
ATOM   817   C CD1 . TYR A  1 120 ? 9.848   -28.143 122.664 1.00 27.37  ? 144 TYR A CD1 1 
ATOM   818   C CD2 . TYR A  1 120 ? 10.794  -25.956 122.879 1.00 27.76  ? 144 TYR A CD2 1 
ATOM   819   C CE1 . TYR A  1 120 ? 8.906   -27.853 123.653 1.00 27.73  ? 144 TYR A CE1 1 
ATOM   820   C CE2 . TYR A  1 120 ? 9.877   -25.654 123.864 1.00 28.47  ? 144 TYR A CE2 1 
ATOM   821   C CZ  . TYR A  1 120 ? 8.921   -26.581 124.246 1.00 28.19  ? 144 TYR A CZ  1 
ATOM   822   O OH  . TYR A  1 120 ? 8.034   -26.153 125.199 1.00 27.22  ? 144 TYR A OH  1 
ATOM   823   N N   . SER A  1 121 ? 11.901  -26.650 118.048 1.00 24.95  ? 145 SER A N   1 
ATOM   824   C CA  . SER A  1 121 ? 12.799  -26.172 117.011 1.00 26.93  ? 145 SER A CA  1 
ATOM   825   C C   . SER A  1 121 ? 14.244  -25.994 117.475 1.00 26.66  ? 145 SER A C   1 
ATOM   826   O O   . SER A  1 121 ? 15.168  -26.375 116.793 1.00 25.14  ? 145 SER A O   1 
ATOM   827   C CB  . SER A  1 121 ? 12.251  -24.875 116.390 1.00 28.18  ? 145 SER A CB  1 
ATOM   828   O OG  . SER A  1 121 ? 10.900  -25.113 115.895 1.00 29.78  ? 145 SER A OG  1 
ATOM   829   N N   . SER A  1 122 ? 14.415  -25.467 118.676 1.00 28.17  ? 146 SER A N   1 
ATOM   830   C CA  . SER A  1 122 ? 15.740  -25.159 119.221 1.00 28.34  ? 146 SER A CA  1 
ATOM   831   C C   . SER A  1 122 ? 16.398  -26.324 119.916 1.00 28.04  ? 146 SER A C   1 
ATOM   832   O O   . SER A  1 122 ? 17.422  -26.133 120.604 1.00 27.47  ? 146 SER A O   1 
ATOM   833   C CB  . SER A  1 122 ? 15.672  -23.975 120.220 1.00 29.84  ? 146 SER A CB  1 
ATOM   834   O OG  . SER A  1 122 ? 14.783  -24.148 121.341 1.00 31.20  ? 146 SER A OG  1 
ATOM   835   N N   . ARG A  1 123 ? 15.850  -27.521 119.753 1.00 28.27  ? 147 ARG A N   1 
ATOM   836   C CA  . ARG A  1 123 ? 16.344  -28.661 120.525 1.00 29.32  ? 147 ARG A CA  1 
ATOM   837   C C   . ARG A  1 123 ? 17.718  -29.078 120.040 1.00 29.91  ? 147 ARG A C   1 
ATOM   838   O O   . ARG A  1 123 ? 17.950  -29.106 118.862 1.00 31.43  ? 147 ARG A O   1 
ATOM   839   C CB  . ARG A  1 123 ? 15.375  -29.834 120.426 1.00 29.43  ? 147 ARG A CB  1 
ATOM   840   C CG  . ARG A  1 123 ? 15.852  -31.068 121.136 1.00 29.50  ? 147 ARG A CG  1 
ATOM   841   C CD  . ARG A  1 123 ? 16.534  -31.978 120.162 1.00 30.15  ? 147 ARG A CD  1 
ATOM   842   N NE  . ARG A  1 123 ? 15.589  -32.584 119.225 1.00 30.95  ? 147 ARG A NE  1 
ATOM   843   C CZ  . ARG A  1 123 ? 15.923  -33.393 118.215 1.00 30.33  ? 147 ARG A CZ  1 
ATOM   844   N NH1 . ARG A  1 123 ? 14.992  -33.944 117.426 1.00 30.89  ? 147 ARG A NH1 1 
ATOM   845   N NH2 . ARG A  1 123 ? 17.187  -33.682 118.014 1.00 30.60  ? 147 ARG A NH2 1 
ATOM   846   N N   . HIS A  1 124 ? 18.632  -29.357 120.956 1.00 31.20  ? 148 HIS A N   1 
ATOM   847   C CA  . HIS A  1 124 ? 19.840  -30.166 120.669 1.00 31.46  ? 148 HIS A CA  1 
ATOM   848   C C   . HIS A  1 124 ? 19.744  -31.447 121.522 1.00 30.17  ? 148 HIS A C   1 
ATOM   849   O O   . HIS A  1 124 ? 19.152  -31.463 122.591 1.00 30.48  ? 148 HIS A O   1 
ATOM   850   C CB  . HIS A  1 124 ? 21.171  -29.423 120.972 1.00 31.68  ? 148 HIS A CB  1 
ATOM   851   C CG  . HIS A  1 124 ? 21.483  -28.299 120.028 1.00 31.78  ? 148 HIS A CG  1 
ATOM   852   N ND1 . HIS A  1 124 ? 22.678  -27.615 120.075 1.00 32.88  ? 148 HIS A ND1 1 
ATOM   853   C CD2 . HIS A  1 124 ? 20.747  -27.701 119.057 1.00 31.93  ? 148 HIS A CD2 1 
ATOM   854   C CE1 . HIS A  1 124 ? 22.672  -26.654 119.156 1.00 33.56  ? 148 HIS A CE1 1 
ATOM   855   N NE2 . HIS A  1 124 ? 21.513  -26.688 118.523 1.00 32.67  ? 148 HIS A NE2 1 
ATOM   856   N N   . THR A  1 125 ? 20.331  -32.518 121.018 1.00 29.49  ? 149 THR A N   1 
ATOM   857   C CA  . THR A  1 125 ? 20.395  -33.783 121.705 1.00 28.34  ? 149 THR A CA  1 
ATOM   858   C C   . THR A  1 125 ? 21.463  -33.775 122.815 1.00 28.02  ? 149 THR A C   1 
ATOM   859   O O   . THR A  1 125 ? 22.509  -33.243 122.659 1.00 25.28  ? 149 THR A O   1 
ATOM   860   C CB  . THR A  1 125 ? 20.693  -34.833 120.669 1.00 28.16  ? 149 THR A CB  1 
ATOM   861   O OG1 . THR A  1 125 ? 19.829  -34.620 119.535 1.00 27.60  ? 149 THR A OG1 1 
ATOM   862   C CG2 . THR A  1 125 ? 20.514  -36.222 121.247 1.00 28.00  ? 149 THR A CG2 1 
ATOM   863   N N   . ILE A  1 126 ? 21.117  -34.276 123.983 1.00 29.56  ? 150 ILE A N   1 
ATOM   864   C CA  . ILE A  1 126 ? 22.084  -34.466 125.024 1.00 31.10  ? 150 ILE A CA  1 
ATOM   865   C C   . ILE A  1 126 ? 22.344  -35.981 125.079 1.00 31.35  ? 150 ILE A C   1 
ATOM   866   O O   . ILE A  1 126 ? 21.418  -36.790 125.088 1.00 32.46  ? 150 ILE A O   1 
ATOM   867   C CB  . ILE A  1 126 ? 21.625  -34.015 126.412 1.00 32.48  ? 150 ILE A CB  1 
ATOM   868   C CG1 . ILE A  1 126 ? 21.194  -32.543 126.460 1.00 33.48  ? 150 ILE A CG1 1 
ATOM   869   C CG2 . ILE A  1 126 ? 22.718  -34.290 127.442 1.00 32.11  ? 150 ILE A CG2 1 
ATOM   870   C CD1 . ILE A  1 126 ? 20.398  -32.246 127.756 1.00 33.79  ? 150 ILE A CD1 1 
ATOM   871   N N   . THR A  1 127 ? 23.617  -36.319 125.193 1.00 30.01  ? 151 THR A N   1 
ATOM   872   C CA  . THR A  1 127 ? 24.102  -37.632 125.161 1.00 28.53  ? 151 THR A CA  1 
ATOM   873   C C   . THR A  1 127 ? 24.543  -37.898 126.612 1.00 28.53  ? 151 THR A C   1 
ATOM   874   O O   . THR A  1 127 ? 25.134  -37.054 127.204 1.00 28.14  ? 151 THR A O   1 
ATOM   875   C CB  . THR A  1 127 ? 25.096  -37.646 124.002 1.00 28.13  ? 151 THR A CB  1 
ATOM   876   O OG1 . THR A  1 127 ? 24.557  -38.500 122.992 1.00 28.42  ? 151 THR A OG1 1 
ATOM   877   C CG2 . THR A  1 127 ? 26.400  -38.145 124.369 1.00 28.40  ? 151 THR A CG2 1 
ATOM   878   N N   . GLN A  1 128 ? 24.140  -39.013 127.221 1.00 29.56  ? 152 GLN A N   1 
ATOM   879   C CA  . GLN A  1 128 ? 24.268  -39.195 128.688 1.00 30.83  ? 152 GLN A CA  1 
ATOM   880   C C   . GLN A  1 128 ? 24.912  -40.537 129.069 1.00 32.18  ? 152 GLN A C   1 
ATOM   881   O O   . GLN A  1 128 ? 24.812  -41.516 128.322 1.00 32.49  ? 152 GLN A O   1 
ATOM   882   C CB  . GLN A  1 128 ? 22.897  -39.141 129.379 1.00 30.46  ? 152 GLN A CB  1 
ATOM   883   C CG  . GLN A  1 128 ? 22.168  -37.819 129.269 1.00 30.61  ? 152 GLN A CG  1 
ATOM   884   C CD  . GLN A  1 128 ? 20.758  -37.891 129.827 1.00 30.41  ? 152 GLN A CD  1 
ATOM   885   O OE1 . GLN A  1 128 ? 19.782  -37.534 129.145 1.00 31.47  ? 152 GLN A OE1 1 
ATOM   886   N NE2 . GLN A  1 128 ? 20.635  -38.343 131.053 1.00 28.40  ? 152 GLN A NE2 1 
ATOM   887   N N   . PRO A  1 129 ? 25.566  -40.617 130.224 1.00 33.51  ? 153 PRO A N   1 
ATOM   888   C CA  . PRO A  1 129 ? 25.809  -39.547 131.209 1.00 33.48  ? 153 PRO A CA  1 
ATOM   889   C C   . PRO A  1 129 ? 27.246  -38.950 131.186 1.00 33.01  ? 153 PRO A C   1 
ATOM   890   O O   . PRO A  1 129 ? 27.593  -38.108 132.033 1.00 31.17  ? 153 PRO A O   1 
ATOM   891   C CB  . PRO A  1 129 ? 25.690  -40.323 132.504 1.00 33.93  ? 153 PRO A CB  1 
ATOM   892   C CG  . PRO A  1 129 ? 26.393  -41.578 132.192 1.00 34.37  ? 153 PRO A CG  1 
ATOM   893   C CD  . PRO A  1 129 ? 26.031  -41.906 130.744 1.00 34.51  ? 153 PRO A CD  1 
ATOM   894   N N   . PHE A  1 130 ? 28.078  -39.432 130.265 1.00 32.50  ? 154 PHE A N   1 
ATOM   895   C CA  . PHE A  1 130 ? 29.488  -39.073 130.272 1.00 33.17  ? 154 PHE A CA  1 
ATOM   896   C C   . PHE A  1 130 ? 29.894  -38.099 129.142 1.00 32.89  ? 154 PHE A C   1 
ATOM   897   O O   . PHE A  1 130 ? 31.072  -37.905 128.905 1.00 33.13  ? 154 PHE A O   1 
ATOM   898   C CB  . PHE A  1 130 ? 30.405  -40.335 130.316 1.00 33.87  ? 154 PHE A CB  1 
ATOM   899   C CG  . PHE A  1 130 ? 30.196  -41.322 129.167 1.00 33.53  ? 154 PHE A CG  1 
ATOM   900   C CD1 . PHE A  1 130 ? 30.628  -41.029 127.864 1.00 33.11  ? 154 PHE A CD1 1 
ATOM   901   C CD2 . PHE A  1 130 ? 29.588  -42.550 129.406 1.00 32.94  ? 154 PHE A CD2 1 
ATOM   902   C CE1 . PHE A  1 130 ? 30.401  -41.924 126.830 1.00 33.16  ? 154 PHE A CE1 1 
ATOM   903   C CE2 . PHE A  1 130 ? 29.393  -43.454 128.379 1.00 33.38  ? 154 PHE A CE2 1 
ATOM   904   C CZ  . PHE A  1 130 ? 29.776  -43.140 127.083 1.00 33.50  ? 154 PHE A CZ  1 
ATOM   905   N N   . SER A  1 131 ? 28.949  -37.437 128.487 1.00 32.84  ? 155 SER A N   1 
ATOM   906   C CA  . SER A  1 131 ? 29.323  -36.447 127.454 1.00 32.13  ? 155 SER A CA  1 
ATOM   907   C C   . SER A  1 131 ? 29.104  -35.037 127.887 1.00 31.27  ? 155 SER A C   1 
ATOM   908   O O   . SER A  1 131 ? 28.267  -34.746 128.749 1.00 30.02  ? 155 SER A O   1 
ATOM   909   C CB  . SER A  1 131 ? 28.559  -36.669 126.174 1.00 32.05  ? 155 SER A CB  1 
ATOM   910   O OG  . SER A  1 131 ? 28.836  -37.982 125.712 1.00 33.97  ? 155 SER A OG  1 
ATOM   911   N N   . TYR A  1 132 ? 29.876  -34.179 127.230 1.00 31.18  ? 156 TYR A N   1 
ATOM   912   C CA  . TYR A  1 132 ? 29.780  -32.740 127.320 1.00 31.07  ? 156 TYR A CA  1 
ATOM   913   C C   . TYR A  1 132 ? 28.540  -32.370 126.569 1.00 30.88  ? 156 TYR A C   1 
ATOM   914   O O   . TYR A  1 132 ? 28.161  -33.050 125.681 1.00 30.43  ? 156 TYR A O   1 
ATOM   915   C CB  . TYR A  1 132 ? 30.991  -32.142 126.622 1.00 31.14  ? 156 TYR A CB  1 
ATOM   916   C CG  . TYR A  1 132 ? 31.098  -30.641 126.450 1.00 32.04  ? 156 TYR A CG  1 
ATOM   917   C CD1 . TYR A  1 132 ? 31.666  -29.808 127.443 1.00 33.02  ? 156 TYR A CD1 1 
ATOM   918   C CD2 . TYR A  1 132 ? 30.738  -30.058 125.262 1.00 31.62  ? 156 TYR A CD2 1 
ATOM   919   C CE1 . TYR A  1 132 ? 31.792  -28.413 127.241 1.00 33.39  ? 156 TYR A CE1 1 
ATOM   920   C CE2 . TYR A  1 132 ? 30.882  -28.703 125.053 1.00 32.30  ? 156 TYR A CE2 1 
ATOM   921   C CZ  . TYR A  1 132 ? 31.399  -27.888 126.028 1.00 32.73  ? 156 TYR A CZ  1 
ATOM   922   O OH  . TYR A  1 132 ? 31.489  -26.579 125.713 1.00 32.95  ? 156 TYR A OH  1 
ATOM   923   N N   . HIS A  1 133 ? 27.881  -31.315 126.991 1.00 32.47  ? 157 HIS A N   1 
ATOM   924   C CA  . HIS A  1 133 ? 26.864  -30.668 126.203 1.00 33.27  ? 157 HIS A CA  1 
ATOM   925   C C   . HIS A  1 133 ? 27.013  -29.146 126.415 1.00 32.40  ? 157 HIS A C   1 
ATOM   926   O O   . HIS A  1 133 ? 27.258  -28.673 127.523 1.00 30.39  ? 157 HIS A O   1 
ATOM   927   C CB  . HIS A  1 133 ? 25.480  -31.160 126.651 1.00 33.86  ? 157 HIS A CB  1 
ATOM   928   C CG  . HIS A  1 133 ? 24.343  -30.659 125.802 1.00 34.05  ? 157 HIS A CG  1 
ATOM   929   N ND1 . HIS A  1 133 ? 24.066  -31.154 124.547 1.00 34.30  ? 157 HIS A ND1 1 
ATOM   930   C CD2 . HIS A  1 133 ? 23.408  -29.713 126.044 1.00 33.32  ? 157 HIS A CD2 1 
ATOM   931   C CE1 . HIS A  1 133 ? 22.993  -30.549 124.068 1.00 33.11  ? 157 HIS A CE1 1 
ATOM   932   N NE2 . HIS A  1 133 ? 22.591  -29.655 124.946 1.00 32.02  ? 157 HIS A NE2 1 
ATOM   933   N N   . SER A  1 134 ? 26.876  -28.391 125.331 1.00 31.44  ? 158 SER A N   1 
ATOM   934   C CA  . SER A  1 134 ? 26.825  -26.947 125.451 1.00 29.67  ? 158 SER A CA  1 
ATOM   935   C C   . SER A  1 134 ? 25.828  -26.301 124.483 1.00 28.05  ? 158 SER A C   1 
ATOM   936   O O   . SER A  1 134 ? 25.614  -26.776 123.386 1.00 28.88  ? 158 SER A O   1 
ATOM   937   C CB  . SER A  1 134 ? 28.217  -26.361 125.273 1.00 29.58  ? 158 SER A CB  1 
ATOM   938   O OG  . SER A  1 134 ? 28.687  -26.655 123.986 1.00 28.75  ? 158 SER A OG  1 
ATOM   939   N N   . ARG A  1 135 ? 25.200  -25.241 124.950 1.00 26.60  ? 159 ARG A N   1 
ATOM   940   C CA  . ARG A  1 135 ? 24.378  -24.398 124.146 1.00 26.71  ? 159 ARG A CA  1 
ATOM   941   C C   . ARG A  1 135 ? 24.943  -22.989 124.179 1.00 27.68  ? 159 ARG A C   1 
ATOM   942   O O   . ARG A  1 135 ? 25.621  -22.604 125.139 1.00 27.36  ? 159 ARG A O   1 
ATOM   943   C CB  . ARG A  1 135 ? 22.958  -24.396 124.694 1.00 26.58  ? 159 ARG A CB  1 
ATOM   944   C CG  . ARG A  1 135 ? 22.336  -25.745 124.655 1.00 26.17  ? 159 ARG A CG  1 
ATOM   945   C CD  . ARG A  1 135 ? 22.378  -26.293 123.237 1.00 26.29  ? 159 ARG A CD  1 
ATOM   946   N NE  . ARG A  1 135 ? 21.673  -25.536 122.214 1.00 25.49  ? 159 ARG A NE  1 
ATOM   947   C CZ  . ARG A  1 135 ? 20.377  -25.668 121.912 1.00 26.40  ? 159 ARG A CZ  1 
ATOM   948   N NH1 . ARG A  1 135 ? 19.907  -24.931 120.939 1.00 26.46  ? 159 ARG A NH1 1 
ATOM   949   N NH2 . ARG A  1 135 ? 19.504  -26.474 122.581 1.00 27.05  ? 159 ARG A NH2 1 
ATOM   950   N N   . TYR A  1 136 ? 24.671  -22.215 123.129 1.00 28.54  ? 160 TYR A N   1 
ATOM   951   C CA  . TYR A  1 136 ? 25.241  -20.888 123.028 1.00 29.01  ? 160 TYR A CA  1 
ATOM   952   C C   . TYR A  1 136 ? 24.387  -20.001 122.200 1.00 28.66  ? 160 TYR A C   1 
ATOM   953   O O   . TYR A  1 136 ? 24.331  -20.171 121.029 1.00 29.06  ? 160 TYR A O   1 
ATOM   954   C CB  . TYR A  1 136 ? 26.612  -20.999 122.406 1.00 29.75  ? 160 TYR A CB  1 
ATOM   955   C CG  . TYR A  1 136 ? 27.288  -19.687 122.018 1.00 30.44  ? 160 TYR A CG  1 
ATOM   956   C CD1 . TYR A  1 136 ? 28.112  -18.975 122.945 1.00 29.96  ? 160 TYR A CD1 1 
ATOM   957   C CD2 . TYR A  1 136 ? 27.187  -19.199 120.714 1.00 29.44  ? 160 TYR A CD2 1 
ATOM   958   C CE1 . TYR A  1 136 ? 28.777  -17.816 122.568 1.00 29.57  ? 160 TYR A CE1 1 
ATOM   959   C CE2 . TYR A  1 136 ? 27.857  -18.054 120.337 1.00 29.59  ? 160 TYR A CE2 1 
ATOM   960   C CZ  . TYR A  1 136 ? 28.658  -17.381 121.256 1.00 29.58  ? 160 TYR A CZ  1 
ATOM   961   O OH  . TYR A  1 136 ? 29.259  -16.249 120.817 1.00 29.01  ? 160 TYR A OH  1 
ATOM   962   N N   . PHE A  1 137 ? 23.762  -19.015 122.815 1.00 28.95  ? 161 PHE A N   1 
ATOM   963   C CA  . PHE A  1 137 ? 22.666  -18.267 122.163 1.00 28.01  ? 161 PHE A CA  1 
ATOM   964   C C   . PHE A  1 137 ? 22.489  -16.978 122.882 1.00 27.25  ? 161 PHE A C   1 
ATOM   965   O O   . PHE A  1 137 ? 23.007  -16.822 123.961 1.00 25.93  ? 161 PHE A O   1 
ATOM   966   C CB  . PHE A  1 137 ? 21.355  -19.082 122.291 1.00 27.46  ? 161 PHE A CB  1 
ATOM   967   C CG  . PHE A  1 137 ? 20.994  -19.430 123.715 1.00 26.03  ? 161 PHE A CG  1 
ATOM   968   C CD1 . PHE A  1 137 ? 21.642  -20.513 124.372 1.00 25.30  ? 161 PHE A CD1 1 
ATOM   969   C CD2 . PHE A  1 137 ? 20.085  -18.622 124.435 1.00 24.89  ? 161 PHE A CD2 1 
ATOM   970   C CE1 . PHE A  1 137 ? 21.332  -20.806 125.710 1.00 25.47  ? 161 PHE A CE1 1 
ATOM   971   C CE2 . PHE A  1 137 ? 19.771  -18.931 125.767 1.00 25.17  ? 161 PHE A CE2 1 
ATOM   972   C CZ  . PHE A  1 137 ? 20.378  -20.030 126.408 1.00 24.89  ? 161 PHE A CZ  1 
ATOM   973   N N   . THR A  1 138 ? 21.736  -16.075 122.291 1.00 29.06  ? 162 THR A N   1 
ATOM   974   C CA  . THR A  1 138 ? 21.415  -14.786 122.938 1.00 30.40  ? 162 THR A CA  1 
ATOM   975   C C   . THR A  1 138 ? 20.178  -14.946 123.794 1.00 29.80  ? 162 THR A C   1 
ATOM   976   O O   . THR A  1 138 ? 19.122  -15.242 123.261 1.00 30.72  ? 162 THR A O   1 
ATOM   977   C CB  . THR A  1 138 ? 21.084  -13.719 121.885 1.00 32.27  ? 162 THR A CB  1 
ATOM   978   O OG1 . THR A  1 138 ? 22.175  -13.562 120.933 1.00 33.63  ? 162 THR A OG1 1 
ATOM   979   C CG2 . THR A  1 138 ? 20.710  -12.410 122.572 1.00 33.16  ? 162 THR A CG2 1 
ATOM   980   N N   . PRO A  1 139 ? 20.285  -14.731 125.105 1.00 29.55  ? 163 PRO A N   1 
ATOM   981   C CA  . PRO A  1 139 ? 19.120  -14.855 126.025 1.00 29.71  ? 163 PRO A CA  1 
ATOM   982   C C   . PRO A  1 139 ? 18.340  -13.573 126.025 1.00 30.53  ? 163 PRO A C   1 
ATOM   983   O O   . PRO A  1 139 ? 18.757  -12.610 125.344 1.00 30.89  ? 163 PRO A O   1 
ATOM   984   C CB  . PRO A  1 139 ? 19.777  -14.985 127.388 1.00 30.18  ? 163 PRO A CB  1 
ATOM   985   C CG  . PRO A  1 139 ? 21.006  -14.049 127.235 1.00 30.40  ? 163 PRO A CG  1 
ATOM   986   C CD  . PRO A  1 139 ? 21.492  -14.233 125.805 1.00 29.38  ? 163 PRO A CD  1 
ATOM   987   N N   . LYS A  1 140 ? 17.243  -13.538 126.783 1.00 31.08  ? 164 LYS A N   1 
ATOM   988   C CA  . LYS A  1 140 ? 16.372  -12.353 126.813 1.00 31.77  ? 164 LYS A CA  1 
ATOM   989   C C   . LYS A  1 140 ? 15.955  -11.972 128.180 1.00 32.42  ? 164 LYS A C   1 
ATOM   990   O O   . LYS A  1 140 ? 15.560  -12.829 128.984 1.00 35.30  ? 164 LYS A O   1 
ATOM   991   C CB  . LYS A  1 140 ? 15.085  -12.564 126.016 1.00 32.28  ? 164 LYS A CB  1 
ATOM   992   C CG  . LYS A  1 140 ? 15.292  -13.054 124.592 1.00 33.45  ? 164 LYS A CG  1 
ATOM   993   C CD  . LYS A  1 140 ? 15.952  -12.023 123.708 1.00 33.89  ? 164 LYS A CD  1 
ATOM   994   C CE  . LYS A  1 140 ? 16.606  -12.700 122.516 1.00 34.63  ? 164 LYS A CE  1 
ATOM   995   N NZ  . LYS A  1 140 ? 16.971  -11.729 121.413 1.00 34.33  ? 164 LYS A NZ  1 
ATOM   996   N N   . PRO A  1 141 ? 15.950  -10.674 128.456 1.00 32.09  ? 165 PRO A N   1 
ATOM   997   C CA  . PRO A  1 141 ? 15.521  -10.284 129.782 1.00 31.06  ? 165 PRO A CA  1 
ATOM   998   C C   . PRO A  1 141 ? 14.055  -10.541 129.925 1.00 30.34  ? 165 PRO A C   1 
ATOM   999   O O   . PRO A  1 141 ? 13.330  -10.538 128.944 1.00 29.81  ? 165 PRO A O   1 
ATOM   1000  C CB  . PRO A  1 141 ? 15.854  -8.806  129.819 1.00 32.45  ? 165 PRO A CB  1 
ATOM   1001  C CG  . PRO A  1 141 ? 15.783  -8.342  128.381 1.00 33.11  ? 165 PRO A CG  1 
ATOM   1002  C CD  . PRO A  1 141 ? 16.276  -9.524  127.594 1.00 32.98  ? 165 PRO A CD  1 
ATOM   1003  N N   . VAL A  1 142 ? 13.635  -10.845 131.132 1.00 30.31  ? 166 VAL A N   1 
ATOM   1004  C CA  . VAL A  1 142 ? 12.223  -11.001 131.437 1.00 30.85  ? 166 VAL A CA  1 
ATOM   1005  C C   . VAL A  1 142 ? 11.734  -9.614  131.811 1.00 33.06  ? 166 VAL A C   1 
ATOM   1006  O O   . VAL A  1 142 ? 11.826  -9.215  132.987 1.00 35.55  ? 166 VAL A O   1 
ATOM   1007  C CB  . VAL A  1 142 ? 11.918  -11.963 132.612 1.00 29.25  ? 166 VAL A CB  1 
ATOM   1008  C CG1 . VAL A  1 142 ? 10.425  -12.204 132.719 1.00 28.86  ? 166 VAL A CG1 1 
ATOM   1009  C CG2 . VAL A  1 142 ? 12.587  -13.304 132.403 1.00 30.20  ? 166 VAL A CG2 1 
ATOM   1010  N N   . LEU A  1 143 ? 11.168  -8.928  130.826 1.00 34.11  ? 167 LEU A N   1 
ATOM   1011  C CA  . LEU A  1 143 ? 10.791  -7.529  130.937 1.00 35.30  ? 167 LEU A CA  1 
ATOM   1012  C C   . LEU A  1 143 ? 9.376   -7.349  131.492 1.00 35.78  ? 167 LEU A C   1 
ATOM   1013  O O   . LEU A  1 143 ? 9.068   -6.353  132.133 1.00 33.93  ? 167 LEU A O   1 
ATOM   1014  C CB  . LEU A  1 143 ? 10.895  -6.859  129.541 1.00 36.85  ? 167 LEU A CB  1 
ATOM   1015  C CG  . LEU A  1 143 ? 12.079  -5.949  129.166 1.00 36.43  ? 167 LEU A CG  1 
ATOM   1016  C CD1 . LEU A  1 143 ? 13.307  -6.240  129.996 1.00 36.22  ? 167 LEU A CD1 1 
ATOM   1017  C CD2 . LEU A  1 143 ? 12.376  -6.001  127.682 1.00 35.12  ? 167 LEU A CD2 1 
ATOM   1018  N N   . ASP A  1 144 ? 8.503   -8.303  131.222 1.00 38.65  ? 168 ASP A N   1 
ATOM   1019  C CA  . ASP A  1 144 ? 7.125   -8.225  131.745 1.00 40.34  ? 168 ASP A CA  1 
ATOM   1020  C C   . ASP A  1 144 ? 6.602   -9.634  131.813 1.00 38.69  ? 168 ASP A C   1 
ATOM   1021  O O   . ASP A  1 144 ? 6.188   -10.122 130.835 1.00 39.68  ? 168 ASP A O   1 
ATOM   1022  C CB  . ASP A  1 144 ? 6.276   -7.337  130.814 1.00 41.04  ? 168 ASP A CB  1 
ATOM   1023  C CG  . ASP A  1 144 ? 4.784   -7.217  131.239 1.00 43.50  ? 168 ASP A CG  1 
ATOM   1024  O OD1 . ASP A  1 144 ? 4.235   -8.035  132.001 1.00 43.55  ? 168 ASP A OD1 1 
ATOM   1025  O OD2 . ASP A  1 144 ? 4.122   -6.264  130.745 1.00 46.85  ? 168 ASP A OD2 1 
ATOM   1026  N N   . SER A  1 145 ? 6.595   -10.298 132.948 1.00 39.17  ? 169 SER A N   1 
ATOM   1027  C CA  . SER A  1 145 ? 6.273   -11.719 132.891 1.00 41.54  ? 169 SER A CA  1 
ATOM   1028  C C   . SER A  1 145 ? 4.807   -12.091 132.623 1.00 43.05  ? 169 SER A C   1 
ATOM   1029  O O   . SER A  1 145 ? 4.534   -13.233 132.397 1.00 44.93  ? 169 SER A O   1 
ATOM   1030  C CB  . SER A  1 145 ? 6.748   -12.412 134.126 1.00 41.40  ? 169 SER A CB  1 
ATOM   1031  O OG  . SER A  1 145 ? 5.808   -12.101 135.080 1.00 42.92  ? 169 SER A OG  1 
ATOM   1032  N N   . THR A  1 146 ? 3.888   -11.138 132.620 1.00 45.98  ? 170 THR A N   1 
ATOM   1033  C CA  . THR A  1 146 ? 2.513   -11.322 132.101 1.00 47.26  ? 170 THR A CA  1 
ATOM   1034  C C   . THR A  1 146 ? 2.365   -11.491 130.536 1.00 47.10  ? 170 THR A C   1 
ATOM   1035  O O   . THR A  1 146 ? 1.524   -12.249 130.064 1.00 45.27  ? 170 THR A O   1 
ATOM   1036  C CB  . THR A  1 146 ? 1.666   -10.093 132.531 1.00 51.10  ? 170 THR A CB  1 
ATOM   1037  O OG1 . THR A  1 146 ? 2.026   -9.686  133.869 1.00 50.84  ? 170 THR A OG1 1 
ATOM   1038  C CG2 . THR A  1 146 ? 0.147   -10.378 132.451 1.00 52.21  ? 170 THR A CG2 1 
ATOM   1039  N N   . ILE A  1 147 ? 3.115   -10.721 129.741 1.00 45.67  ? 171 ILE A N   1 
ATOM   1040  C CA  . ILE A  1 147 ? 3.026   -10.760 128.260 1.00 43.40  ? 171 ILE A CA  1 
ATOM   1041  C C   . ILE A  1 147 ? 4.160   -11.553 127.602 1.00 39.84  ? 171 ILE A C   1 
ATOM   1042  O O   . ILE A  1 147 ? 4.036   -12.067 126.513 1.00 36.49  ? 171 ILE A O   1 
ATOM   1043  C CB  . ILE A  1 147 ? 3.015   -9.324  127.711 1.00 44.29  ? 171 ILE A CB  1 
ATOM   1044  C CG1 . ILE A  1 147 ? 1.810   -8.581  128.252 1.00 45.87  ? 171 ILE A CG1 1 
ATOM   1045  C CG2 . ILE A  1 147 ? 2.905   -9.289  126.193 1.00 43.77  ? 171 ILE A CG2 1 
ATOM   1046  C CD1 . ILE A  1 147 ? 1.983   -7.071  128.160 1.00 48.75  ? 171 ILE A CD1 1 
ATOM   1047  N N   . ASP A  1 148 ? 5.264   -11.625 128.296 1.00 40.21  ? 172 ASP A N   1 
ATOM   1048  C CA  . ASP A  1 148 ? 6.444   -12.404 127.912 1.00 42.48  ? 172 ASP A CA  1 
ATOM   1049  C C   . ASP A  1 148 ? 6.879   -12.072 126.519 1.00 40.89  ? 172 ASP A C   1 
ATOM   1050  O O   . ASP A  1 148 ? 6.739   -12.865 125.622 1.00 40.32  ? 172 ASP A O   1 
ATOM   1051  C CB  . ASP A  1 148 ? 6.278   -13.935 128.140 1.00 43.52  ? 172 ASP A CB  1 
ATOM   1052  C CG  . ASP A  1 148 ? 6.539   -14.363 129.604 1.00 45.09  ? 172 ASP A CG  1 
ATOM   1053  O OD1 . ASP A  1 148 ? 7.569   -13.956 130.241 1.00 44.37  ? 172 ASP A OD1 1 
ATOM   1054  O OD2 . ASP A  1 148 ? 5.710   -15.166 130.088 1.00 48.71  ? 172 ASP A OD2 1 
ATOM   1055  N N   . TYR A  1 149 ? 7.423   -10.877 126.364 1.00 42.14  ? 173 TYR A N   1 
ATOM   1056  C CA  . TYR A  1 149 ? 7.840   -10.393 125.062 1.00 40.01  ? 173 TYR A CA  1 
ATOM   1057  C C   . TYR A  1 149 ? 9.293   -10.109 125.021 1.00 39.11  ? 173 TYR A C   1 
ATOM   1058  O O   . TYR A  1 149 ? 9.863   -9.717  126.028 1.00 41.83  ? 173 TYR A O   1 
ATOM   1059  C CB  . TYR A  1 149 ? 7.078   -9.157  124.689 1.00 38.98  ? 173 TYR A CB  1 
ATOM   1060  C CG  . TYR A  1 149 ? 7.225   -7.986  125.589 1.00 38.99  ? 173 TYR A CG  1 
ATOM   1061  C CD1 . TYR A  1 149 ? 8.377   -7.172  125.589 1.00 38.02  ? 173 TYR A CD1 1 
ATOM   1062  C CD2 . TYR A  1 149 ? 6.158   -7.622  126.407 1.00 39.71  ? 173 TYR A CD2 1 
ATOM   1063  C CE1 . TYR A  1 149 ? 8.449   -6.068  126.427 1.00 38.67  ? 173 TYR A CE1 1 
ATOM   1064  C CE2 . TYR A  1 149 ? 6.230   -6.515  127.228 1.00 39.63  ? 173 TYR A CE2 1 
ATOM   1065  C CZ  . TYR A  1 149 ? 7.350   -5.743  127.237 1.00 39.52  ? 173 TYR A CZ  1 
ATOM   1066  O OH  . TYR A  1 149 ? 7.296   -4.690  128.132 1.00 45.15  ? 173 TYR A OH  1 
ATOM   1067  N N   . PHE A  1 150 ? 9.871   -10.251 123.840 1.00 37.47  ? 174 PHE A N   1 
ATOM   1068  C CA  . PHE A  1 150 ? 11.319  -10.149 123.695 1.00 36.66  ? 174 PHE A CA  1 
ATOM   1069  C C   . PHE A  1 150 ? 11.694  -9.755  122.281 1.00 36.60  ? 174 PHE A C   1 
ATOM   1070  O O   . PHE A  1 150 ? 10.890  -9.959  121.369 1.00 36.05  ? 174 PHE A O   1 
ATOM   1071  C CB  . PHE A  1 150 ? 11.973  -11.511 124.048 1.00 35.52  ? 174 PHE A CB  1 
ATOM   1072  C CG  . PHE A  1 150 ? 11.545  -12.681 123.168 1.00 32.71  ? 174 PHE A CG  1 
ATOM   1073  C CD1 . PHE A  1 150 ? 12.262  -13.002 122.016 1.00 31.47  ? 174 PHE A CD1 1 
ATOM   1074  C CD2 . PHE A  1 150 ? 10.459  -13.478 123.520 1.00 32.12  ? 174 PHE A CD2 1 
ATOM   1075  C CE1 . PHE A  1 150 ? 11.913  -14.070 121.217 1.00 31.46  ? 174 PHE A CE1 1 
ATOM   1076  C CE2 . PHE A  1 150 ? 10.112  -14.582 122.734 1.00 32.28  ? 174 PHE A CE2 1 
ATOM   1077  C CZ  . PHE A  1 150 ? 10.840  -14.867 121.567 1.00 31.79  ? 174 PHE A CZ  1 
ATOM   1078  N N   . GLN A  1 151 ? 12.917  -9.252  122.102 1.00 36.26  ? 175 GLN A N   1 
ATOM   1079  C CA  . GLN A  1 151 ? 13.358  -8.725  120.806 1.00 37.08  ? 175 GLN A CA  1 
ATOM   1080  C C   . GLN A  1 151 ? 13.934  -9.806  119.892 1.00 37.92  ? 175 GLN A C   1 
ATOM   1081  O O   . GLN A  1 151 ? 14.577  -10.709 120.375 1.00 39.66  ? 175 GLN A O   1 
ATOM   1082  C CB  . GLN A  1 151 ? 14.510  -7.770  120.987 1.00 37.65  ? 175 GLN A CB  1 
ATOM   1083  C CG  . GLN A  1 151 ? 14.241  -6.479  121.693 1.00 38.00  ? 175 GLN A CG  1 
ATOM   1084  C CD  . GLN A  1 151 ? 15.552  -5.808  122.017 1.00 37.60  ? 175 GLN A CD  1 
ATOM   1085  O OE1 . GLN A  1 151 ? 16.322  -6.281  122.859 1.00 39.50  ? 175 GLN A OE1 1 
ATOM   1086  N NE2 . GLN A  1 151 ? 15.829  -4.739  121.346 1.00 36.49  ? 175 GLN A NE2 1 
ATOM   1087  N N   . PRO A  1 152 ? 13.791  -9.672  118.577 1.00 38.53  ? 176 PRO A N   1 
ATOM   1088  C CA  . PRO A  1 152 ? 14.444  -10.510 117.618 1.00 40.70  ? 176 PRO A CA  1 
ATOM   1089  C C   . PRO A  1 152 ? 15.912  -10.397 117.779 1.00 45.19  ? 176 PRO A C   1 
ATOM   1090  O O   . PRO A  1 152 ? 16.363  -9.397  118.269 1.00 43.55  ? 176 PRO A O   1 
ATOM   1091  C CB  . PRO A  1 152 ? 14.069  -9.882  116.322 1.00 40.17  ? 176 PRO A CB  1 
ATOM   1092  C CG  . PRO A  1 152 ? 12.723  -9.401  116.593 1.00 40.05  ? 176 PRO A CG  1 
ATOM   1093  C CD  . PRO A  1 152 ? 12.783  -8.828  117.944 1.00 39.45  ? 176 PRO A CD  1 
ATOM   1094  N N   . ASN A  1 153 ? 16.651  -11.421 117.364 1.00 57.32  ? 177 ASN A N   1 
ATOM   1095  C CA  . ASN A  1 153 ? 17.950  -11.734 118.018 1.00 64.76  ? 177 ASN A CA  1 
ATOM   1096  C C   . ASN A  1 153 ? 19.015  -10.728 117.503 1.00 68.64  ? 177 ASN A C   1 
ATOM   1097  O O   . ASN A  1 153 ? 18.878  -10.212 116.373 1.00 58.05  ? 177 ASN A O   1 
ATOM   1098  C CB  . ASN A  1 153 ? 18.375  -13.292 117.976 1.00 64.17  ? 177 ASN A CB  1 
ATOM   1099  C CG  . ASN A  1 153 ? 17.325  -14.291 118.649 1.00 61.32  ? 177 ASN A CG  1 
ATOM   1100  O OD1 . ASN A  1 153 ? 16.204  -14.471 118.196 1.00 54.84  ? 177 ASN A OD1 1 
ATOM   1101  N ND2 . ASN A  1 153 ? 17.754  -14.974 119.698 1.00 62.87  ? 177 ASN A ND2 1 
ATOM   1102  N N   . ASN A  1 154 ? 19.877  -10.321 118.467 1.00 83.15  ? 178 ASN A N   1 
ATOM   1103  C CA  . ASN A  1 154 ? 21.335  -9.983  118.346 1.00 95.58  ? 178 ASN A CA  1 
ATOM   1104  C C   . ASN A  1 154 ? 21.708  -8.804  117.391 1.00 104.54 ? 178 ASN A C   1 
ATOM   1105  O O   . ASN A  1 154 ? 21.642  -8.953  116.150 1.00 115.75 ? 178 ASN A O   1 
ATOM   1106  C CB  . ASN A  1 154 ? 22.125  -11.292 117.996 1.00 94.86  ? 178 ASN A CB  1 
ATOM   1107  C CG  . ASN A  1 154 ? 23.580  -11.293 118.496 1.00 93.56  ? 178 ASN A CG  1 
ATOM   1108  O OD1 . ASN A  1 154 ? 24.435  -11.972 117.874 1.00 85.82  ? 178 ASN A OD1 1 
ATOM   1109  N ND2 . ASN A  1 154 ? 23.876  -10.553 119.619 1.00 80.36  ? 178 ASN A ND2 1 
ATOM   1110  N N   . LYS A  1 155 ? 22.105  -7.646  117.943 1.00 95.90  ? 179 LYS A N   1 
ATOM   1111  C CA  . LYS A  1 155 ? 22.108  -6.436  117.126 1.00 88.79  ? 179 LYS A CA  1 
ATOM   1112  C C   . LYS A  1 155 ? 22.621  -5.103  117.747 1.00 84.15  ? 179 LYS A C   1 
ATOM   1113  O O   . LYS A  1 155 ? 22.782  -4.932  118.935 1.00 68.09  ? 179 LYS A O   1 
ATOM   1114  C CB  . LYS A  1 155 ? 20.657  -6.217  116.602 1.00 91.41  ? 179 LYS A CB  1 
ATOM   1115  C CG  . LYS A  1 155 ? 20.562  -5.925  115.102 1.00 94.55  ? 179 LYS A CG  1 
ATOM   1116  C CD  . LYS A  1 155 ? 19.154  -6.122  114.571 1.00 95.30  ? 179 LYS A CD  1 
ATOM   1117  C CE  . LYS A  1 155 ? 18.886  -7.601  114.323 1.00 100.65 ? 179 LYS A CE  1 
ATOM   1118  N NZ  . LYS A  1 155 ? 17.543  -7.892  113.747 1.00 104.01 ? 179 LYS A NZ  1 
ATOM   1119  N N   . ARG A  1 156 ? 22.824  -4.134  116.863 1.00 90.19  ? 180 ARG A N   1 
ATOM   1120  C CA  . ARG A  1 156 ? 22.915  -2.707  117.218 1.00 89.60  ? 180 ARG A CA  1 
ATOM   1121  C C   . ARG A  1 156 ? 21.703  -2.133  117.929 1.00 78.36  ? 180 ARG A C   1 
ATOM   1122  O O   . ARG A  1 156 ? 21.861  -1.089  118.566 1.00 72.04  ? 180 ARG A O   1 
ATOM   1123  C CB  . ARG A  1 156 ? 23.149  -1.841  115.955 1.00 101.01 ? 180 ARG A CB  1 
ATOM   1124  C CG  . ARG A  1 156 ? 21.998  -1.742  114.945 1.00 105.76 ? 180 ARG A CG  1 
ATOM   1125  C CD  . ARG A  1 156 ? 22.395  -0.916  113.707 1.00 112.91 ? 180 ARG A CD  1 
ATOM   1126  N NE  . ARG A  1 156 ? 22.882  -1.744  112.575 1.00 116.97 ? 180 ARG A NE  1 
ATOM   1127  C CZ  . ARG A  1 156 ? 24.041  -1.608  111.899 1.00 110.75 ? 180 ARG A CZ  1 
ATOM   1128  N NH1 . ARG A  1 156 ? 24.310  -2.460  110.912 1.00 110.33 ? 180 ARG A NH1 1 
ATOM   1129  N NH2 . ARG A  1 156 ? 24.935  -0.652  112.171 1.00 104.77 ? 180 ARG A NH2 1 
ATOM   1130  N N   . ASN A  1 157 ? 20.528  -2.766  117.691 1.00 67.58  ? 181 ASN A N   1 
ATOM   1131  C CA  . ASN A  1 157 ? 19.188  -2.548  118.349 1.00 58.53  ? 181 ASN A CA  1 
ATOM   1132  C C   . ASN A  1 157 ? 18.785  -3.172  119.718 1.00 50.03  ? 181 ASN A C   1 
ATOM   1133  O O   . ASN A  1 157 ? 17.655  -2.968  120.164 1.00 41.33  ? 181 ASN A O   1 
ATOM   1134  C CB  . ASN A  1 157 ? 18.105  -2.993  117.370 1.00 60.72  ? 181 ASN A CB  1 
ATOM   1135  C CG  . ASN A  1 157 ? 17.801  -1.943  116.352 1.00 66.63  ? 181 ASN A CG  1 
ATOM   1136  O OD1 . ASN A  1 157 ? 18.528  -0.960  116.218 1.00 70.52  ? 181 ASN A OD1 1 
ATOM   1137  N ND2 . ASN A  1 157 ? 16.711  -2.132  115.629 1.00 72.42  ? 181 ASN A ND2 1 
ATOM   1138  N N   . GLN A  1 158 ? 19.697  -3.892  120.384 1.00 46.88  ? 182 GLN A N   1 
ATOM   1139  C CA  . GLN A  1 158 ? 19.393  -4.615  121.653 1.00 42.74  ? 182 GLN A CA  1 
ATOM   1140  C C   . GLN A  1 158 ? 19.292  -3.680  122.830 1.00 40.05  ? 182 GLN A C   1 
ATOM   1141  O O   . GLN A  1 158 ? 20.184  -2.891  123.075 1.00 42.28  ? 182 GLN A O   1 
ATOM   1142  C CB  . GLN A  1 158 ? 20.469  -5.644  121.967 1.00 41.69  ? 182 GLN A CB  1 
ATOM   1143  C CG  . GLN A  1 158 ? 20.160  -6.574  123.117 1.00 42.05  ? 182 GLN A CG  1 
ATOM   1144  C CD  . GLN A  1 158 ? 21.315  -7.501  123.450 1.00 43.00  ? 182 GLN A CD  1 
ATOM   1145  O OE1 . GLN A  1 158 ? 22.439  -7.318  122.990 1.00 43.31  ? 182 GLN A OE1 1 
ATOM   1146  N NE2 . GLN A  1 158 ? 21.039  -8.487  124.277 1.00 44.87  ? 182 GLN A NE2 1 
ATOM   1147  N N   . LEU A  1 159 ? 18.217  -3.808  123.585 1.00 37.49  ? 183 LEU A N   1 
ATOM   1148  C CA  . LEU A  1 159 ? 17.988  -2.988  124.748 1.00 35.45  ? 183 LEU A CA  1 
ATOM   1149  C C   . LEU A  1 159 ? 19.245  -2.930  125.647 1.00 33.42  ? 183 LEU A C   1 
ATOM   1150  O O   . LEU A  1 159 ? 19.934  -3.951  125.847 1.00 33.19  ? 183 LEU A O   1 
ATOM   1151  C CB  . LEU A  1 159 ? 16.809  -3.576  125.528 1.00 35.70  ? 183 LEU A CB  1 
ATOM   1152  C CG  . LEU A  1 159 ? 15.401  -3.026  125.396 1.00 36.96  ? 183 LEU A CG  1 
ATOM   1153  C CD1 . LEU A  1 159 ? 15.182  -2.038  124.277 1.00 37.40  ? 183 LEU A CD1 1 
ATOM   1154  C CD2 . LEU A  1 159 ? 14.408  -4.165  125.246 1.00 37.79  ? 183 LEU A CD2 1 
ATOM   1155  N N   . TRP A  1 160 ? 19.546  -1.749  126.171 1.00 30.35  ? 184 TRP A N   1 
ATOM   1156  C CA  . TRP A  1 160 ? 20.451  -1.646  127.300 1.00 29.28  ? 184 TRP A CA  1 
ATOM   1157  C C   . TRP A  1 160 ? 19.634  -1.683  128.587 1.00 27.97  ? 184 TRP A C   1 
ATOM   1158  O O   . TRP A  1 160 ? 18.578  -1.101  128.656 1.00 26.38  ? 184 TRP A O   1 
ATOM   1159  C CB  . TRP A  1 160 ? 21.247  -0.335  127.269 1.00 28.73  ? 184 TRP A CB  1 
ATOM   1160  C CG  . TRP A  1 160 ? 22.164  -0.198  126.174 1.00 28.36  ? 184 TRP A CG  1 
ATOM   1161  C CD1 . TRP A  1 160 ? 21.961  0.509   125.066 1.00 28.70  ? 184 TRP A CD1 1 
ATOM   1162  C CD2 . TRP A  1 160 ? 23.483  -0.756  126.071 1.00 28.12  ? 184 TRP A CD2 1 
ATOM   1163  N NE1 . TRP A  1 160 ? 23.068  0.431   124.240 1.00 29.14  ? 184 TRP A NE1 1 
ATOM   1164  C CE2 . TRP A  1 160 ? 24.024  -0.326  124.848 1.00 27.94  ? 184 TRP A CE2 1 
ATOM   1165  C CE3 . TRP A  1 160 ? 24.237  -1.597  126.875 1.00 28.25  ? 184 TRP A CE3 1 
ATOM   1166  C CZ2 . TRP A  1 160 ? 25.262  -0.719  124.392 1.00 27.30  ? 184 TRP A CZ2 1 
ATOM   1167  C CZ3 . TRP A  1 160 ? 25.501  -1.969  126.440 1.00 28.23  ? 184 TRP A CZ3 1 
ATOM   1168  C CH2 . TRP A  1 160 ? 25.986  -1.543  125.188 1.00 27.88  ? 184 TRP A CH2 1 
ATOM   1169  N N   . LEU A  1 161 ? 20.208  -2.312  129.610 1.00 29.01  ? 185 LEU A N   1 
ATOM   1170  C CA  . LEU A  1 161 ? 19.667  -2.367  130.996 1.00 29.91  ? 185 LEU A CA  1 
ATOM   1171  C C   . LEU A  1 161 ? 20.606  -1.680  132.012 1.00 29.96  ? 185 LEU A C   1 
ATOM   1172  O O   . LEU A  1 161 ? 21.817  -1.569  131.815 1.00 28.48  ? 185 LEU A O   1 
ATOM   1173  C CB  . LEU A  1 161 ? 19.400  -3.833  131.429 1.00 29.30  ? 185 LEU A CB  1 
ATOM   1174  C CG  . LEU A  1 161 ? 18.834  -4.697  130.325 1.00 29.51  ? 185 LEU A CG  1 
ATOM   1175  C CD1 . LEU A  1 161 ? 18.863  -6.139  130.657 1.00 30.75  ? 185 LEU A CD1 1 
ATOM   1176  C CD2 . LEU A  1 161 ? 17.422  -4.301  130.028 1.00 30.55  ? 185 LEU A CD2 1 
ATOM   1177  N N   . ARG A  1 162 ? 20.021  -1.249  133.125 1.00 30.96  ? 186 ARG A N   1 
ATOM   1178  C CA  . ARG A  1 162 ? 20.812  -0.679  134.203 1.00 31.36  ? 186 ARG A CA  1 
ATOM   1179  C C   . ARG A  1 162 ? 21.579  -1.771  134.897 1.00 29.51  ? 186 ARG A C   1 
ATOM   1180  O O   . ARG A  1 162 ? 21.042  -2.799  135.122 1.00 27.94  ? 186 ARG A O   1 
ATOM   1181  C CB  . ARG A  1 162 ? 19.928  0.048   135.212 1.00 32.45  ? 186 ARG A CB  1 
ATOM   1182  C CG  . ARG A  1 162 ? 20.784  0.674   136.302 1.00 34.90  ? 186 ARG A CG  1 
ATOM   1183  C CD  . ARG A  1 162 ? 20.116  1.866   136.944 1.00 37.67  ? 186 ARG A CD  1 
ATOM   1184  N NE  . ARG A  1 162 ? 19.075  1.475   137.891 1.00 39.57  ? 186 ARG A NE  1 
ATOM   1185  C CZ  . ARG A  1 162 ? 19.296  1.067   139.136 1.00 41.92  ? 186 ARG A CZ  1 
ATOM   1186  N NH1 . ARG A  1 162 ? 18.266  0.698   139.874 1.00 42.85  ? 186 ARG A NH1 1 
ATOM   1187  N NH2 . ARG A  1 162 ? 20.539  0.965   139.632 1.00 44.64  ? 186 ARG A NH2 1 
ATOM   1188  N N   . LEU A  1 163 ? 22.834  -1.547  135.223 1.00 30.29  ? 187 LEU A N   1 
ATOM   1189  C CA  . LEU A  1 163 ? 23.562  -2.472  136.094 1.00 31.13  ? 187 LEU A CA  1 
ATOM   1190  C C   . LEU A  1 163 ? 23.204  -2.153  137.519 1.00 34.05  ? 187 LEU A C   1 
ATOM   1191  O O   . LEU A  1 163 ? 23.717  -1.209  138.094 1.00 33.41  ? 187 LEU A O   1 
ATOM   1192  C CB  . LEU A  1 163 ? 25.050  -2.314  135.978 1.00 30.35  ? 187 LEU A CB  1 
ATOM   1193  C CG  . LEU A  1 163 ? 25.847  -3.586  136.122 1.00 30.99  ? 187 LEU A CG  1 
ATOM   1194  C CD1 . LEU A  1 163 ? 27.285  -3.199  136.430 1.00 31.36  ? 187 LEU A CD1 1 
ATOM   1195  C CD2 . LEU A  1 163 ? 25.364  -4.610  137.120 1.00 31.12  ? 187 LEU A CD2 1 
ATOM   1196  N N   . GLN A  1 164 ? 22.333  -2.967  138.104 1.00 38.76  ? 188 GLN A N   1 
ATOM   1197  C CA  . GLN A  1 164 ? 21.908  -2.801  139.476 1.00 39.79  ? 188 GLN A CA  1 
ATOM   1198  C C   . GLN A  1 164 ? 22.879  -3.441  140.452 1.00 41.58  ? 188 GLN A C   1 
ATOM   1199  O O   . GLN A  1 164 ? 23.610  -4.390  140.115 1.00 36.12  ? 188 GLN A O   1 
ATOM   1200  C CB  . GLN A  1 164 ? 20.485  -3.320  139.632 1.00 41.62  ? 188 GLN A CB  1 
ATOM   1201  C CG  . GLN A  1 164 ? 19.508  -2.526  138.761 1.00 41.55  ? 188 GLN A CG  1 
ATOM   1202  C CD  . GLN A  1 164 ? 18.074  -3.018  138.790 1.00 41.99  ? 188 GLN A CD  1 
ATOM   1203  O OE1 . GLN A  1 164 ? 17.539  -3.259  137.733 1.00 42.17  ? 188 GLN A OE1 1 
ATOM   1204  N NE2 . GLN A  1 164 ? 17.444  -3.163  139.994 1.00 41.38  ? 188 GLN A NE2 1 
ATOM   1205  N N   . THR A  1 165 ? 22.886  -2.897  141.677 1.00 47.07  ? 189 THR A N   1 
ATOM   1206  C CA  . THR A  1 165 ? 23.686  -3.495  142.739 1.00 49.25  ? 189 THR A CA  1 
ATOM   1207  C C   . THR A  1 165 ? 23.049  -4.793  143.122 1.00 47.17  ? 189 THR A C   1 
ATOM   1208  O O   . THR A  1 165 ? 23.677  -5.806  143.119 1.00 43.42  ? 189 THR A O   1 
ATOM   1209  C CB  . THR A  1 165 ? 23.743  -2.651  144.002 1.00 53.53  ? 189 THR A CB  1 
ATOM   1210  O OG1 . THR A  1 165 ? 23.556  -1.258  143.694 1.00 61.15  ? 189 THR A OG1 1 
ATOM   1211  C CG2 . THR A  1 165 ? 25.076  -2.905  144.695 1.00 53.44  ? 189 THR A CG2 1 
ATOM   1212  N N   . ALA A  1 166 ? 21.750  -4.738  143.318 1.00 49.46  ? 190 ALA A N   1 
ATOM   1213  C CA  . ALA A  1 166 ? 21.015  -5.798  143.943 1.00 53.35  ? 190 ALA A CA  1 
ATOM   1214  C C   . ALA A  1 166 ? 19.959  -6.529  143.080 1.00 51.41  ? 190 ALA A C   1 
ATOM   1215  O O   . ALA A  1 166 ? 19.897  -7.747  143.078 1.00 55.76  ? 190 ALA A O   1 
ATOM   1216  C CB  . ALA A  1 166 ? 20.323  -5.206  145.183 1.00 58.86  ? 190 ALA A CB  1 
ATOM   1217  N N   . GLY A  1 167 ? 19.044  -5.849  142.434 1.00 46.86  ? 191 GLY A N   1 
ATOM   1218  C CA  . GLY A  1 167 ? 17.847  -6.605  142.038 1.00 43.79  ? 191 GLY A CA  1 
ATOM   1219  C C   . GLY A  1 167 ? 17.799  -6.757  140.568 1.00 41.90  ? 191 GLY A C   1 
ATOM   1220  O O   . GLY A  1 167 ? 16.898  -6.236  139.925 1.00 40.55  ? 191 GLY A O   1 
ATOM   1221  N N   . ASN A  1 168 ? 18.814  -7.398  140.010 1.00 39.97  ? 192 ASN A N   1 
ATOM   1222  C CA  . ASN A  1 168 ? 18.930  -7.403  138.563 1.00 36.76  ? 192 ASN A CA  1 
ATOM   1223  C C   . ASN A  1 168 ? 17.907  -8.313  137.976 1.00 35.67  ? 192 ASN A C   1 
ATOM   1224  O O   . ASN A  1 168 ? 17.476  -9.237  138.637 1.00 34.08  ? 192 ASN A O   1 
ATOM   1225  C CB  . ASN A  1 168 ? 20.315  -7.777  138.153 1.00 35.02  ? 192 ASN A CB  1 
ATOM   1226  C CG  . ASN A  1 168 ? 21.230  -6.619  138.283 1.00 35.27  ? 192 ASN A CG  1 
ATOM   1227  O OD1 . ASN A  1 168 ? 21.134  -5.645  137.491 1.00 35.08  ? 192 ASN A OD1 1 
ATOM   1228  N ND2 . ASN A  1 168 ? 22.048  -6.636  139.314 1.00 33.30  ? 192 ASN A ND2 1 
ATOM   1229  N N   . VAL A  1 169 ? 17.508  -8.020  136.748 1.00 35.31  ? 193 VAL A N   1 
ATOM   1230  C CA  . VAL A  1 169 ? 16.485  -8.800  136.024 1.00 36.19  ? 193 VAL A CA  1 
ATOM   1231  C C   . VAL A  1 169 ? 16.948  -10.222 135.536 1.00 35.92  ? 193 VAL A C   1 
ATOM   1232  O O   . VAL A  1 169 ? 18.074  -10.413 135.099 1.00 36.15  ? 193 VAL A O   1 
ATOM   1233  C CB  . VAL A  1 169 ? 15.966  -7.977  134.828 1.00 36.03  ? 193 VAL A CB  1 
ATOM   1234  C CG1 . VAL A  1 169 ? 16.942  -8.088  133.630 1.00 36.01  ? 193 VAL A CG1 1 
ATOM   1235  C CG2 . VAL A  1 169 ? 14.543  -8.380  134.471 1.00 35.66  ? 193 VAL A CG2 1 
ATOM   1236  N N   . ASP A  1 170 ? 16.072  -11.214 135.633 1.00 36.62  ? 194 ASP A N   1 
ATOM   1237  C CA  . ASP A  1 170 ? 16.359  -12.546 135.103 1.00 37.06  ? 194 ASP A CA  1 
ATOM   1238  C C   . ASP A  1 170 ? 16.459  -12.441 133.570 1.00 37.46  ? 194 ASP A C   1 
ATOM   1239  O O   . ASP A  1 170 ? 15.655  -11.780 132.923 1.00 40.03  ? 194 ASP A O   1 
ATOM   1240  C CB  . ASP A  1 170 ? 15.272  -13.583 135.476 1.00 37.04  ? 194 ASP A CB  1 
ATOM   1241  C CG  . ASP A  1 170 ? 15.345  -14.044 136.934 1.00 38.24  ? 194 ASP A CG  1 
ATOM   1242  O OD1 . ASP A  1 170 ? 16.380  -13.810 137.606 1.00 39.88  ? 194 ASP A OD1 1 
ATOM   1243  O OD2 . ASP A  1 170 ? 14.352  -14.647 137.410 1.00 36.72  ? 194 ASP A OD2 1 
ATOM   1244  N N   . HIS A  1 171 ? 17.497  -13.028 132.995 1.00 34.84  ? 195 HIS A N   1 
ATOM   1245  C CA  . HIS A  1 171 ? 17.478  -13.305 131.599 1.00 32.66  ? 195 HIS A CA  1 
ATOM   1246  C C   . HIS A  1 171 ? 17.112  -14.743 131.437 1.00 32.41  ? 195 HIS A C   1 
ATOM   1247  O O   . HIS A  1 171 ? 17.160  -15.490 132.402 1.00 31.09  ? 195 HIS A O   1 
ATOM   1248  C CB  . HIS A  1 171 ? 18.825  -13.056 131.018 1.00 32.05  ? 195 HIS A CB  1 
ATOM   1249  C CG  . HIS A  1 171 ? 19.109  -11.629 130.829 1.00 29.60  ? 195 HIS A CG  1 
ATOM   1250  N ND1 . HIS A  1 171 ? 19.281  -10.783 131.891 1.00 29.09  ? 195 HIS A ND1 1 
ATOM   1251  C CD2 . HIS A  1 171 ? 19.232  -10.894 129.708 1.00 29.10  ? 195 HIS A CD2 1 
ATOM   1252  C CE1 . HIS A  1 171 ? 19.512  -9.568  131.428 1.00 30.40  ? 195 HIS A CE1 1 
ATOM   1253  N NE2 . HIS A  1 171 ? 19.489  -9.609  130.104 1.00 30.20  ? 195 HIS A NE2 1 
ATOM   1254  N N   . VAL A  1 172 ? 16.773  -15.142 130.207 1.00 32.33  ? 196 VAL A N   1 
ATOM   1255  C CA  . VAL A  1 172 ? 16.025  -16.352 130.048 1.00 31.74  ? 196 VAL A CA  1 
ATOM   1256  C C   . VAL A  1 172 ? 16.273  -17.080 128.754 1.00 32.70  ? 196 VAL A C   1 
ATOM   1257  O O   . VAL A  1 172 ? 16.711  -16.507 127.731 1.00 30.65  ? 196 VAL A O   1 
ATOM   1258  C CB  . VAL A  1 172 ? 14.573  -16.065 130.350 1.00 31.72  ? 196 VAL A CB  1 
ATOM   1259  C CG1 . VAL A  1 172 ? 13.726  -15.995 129.100 1.00 32.44  ? 196 VAL A CG1 1 
ATOM   1260  C CG2 . VAL A  1 172 ? 14.071  -17.035 131.371 1.00 31.37  ? 196 VAL A CG2 1 
ATOM   1261  N N   . GLY A  1 173 ? 15.984  -18.381 128.858 1.00 33.38  ? 197 GLY A N   1 
ATOM   1262  C CA  . GLY A  1 173 ? 17.018  -19.293 128.509 1.00 33.56  ? 197 GLY A CA  1 
ATOM   1263  C C   . GLY A  1 173 ? 16.825  -20.746 128.296 1.00 32.24  ? 197 GLY A C   1 
ATOM   1264  O O   . GLY A  1 173 ? 16.607  -21.105 127.180 1.00 37.04  ? 197 GLY A O   1 
ATOM   1265  N N   . LEU A  1 174 ? 17.064  -21.610 129.262 1.00 29.94  ? 198 LEU A N   1 
ATOM   1266  C CA  . LEU A  1 174 ? 17.274  -23.030 128.871 1.00 29.36  ? 198 LEU A CA  1 
ATOM   1267  C C   . LEU A  1 174 ? 16.374  -24.071 129.516 1.00 29.28  ? 198 LEU A C   1 
ATOM   1268  O O   . LEU A  1 174 ? 16.345  -24.206 130.730 1.00 29.09  ? 198 LEU A O   1 
ATOM   1269  C CB  . LEU A  1 174 ? 18.733  -23.448 129.063 1.00 28.68  ? 198 LEU A CB  1 
ATOM   1270  C CG  . LEU A  1 174 ? 19.149  -24.591 128.132 1.00 28.64  ? 198 LEU A CG  1 
ATOM   1271  C CD1 . LEU A  1 174 ? 19.117  -24.180 126.676 1.00 28.73  ? 198 LEU A CD1 1 
ATOM   1272  C CD2 . LEU A  1 174 ? 20.537  -25.152 128.445 1.00 29.15  ? 198 LEU A CD2 1 
ATOM   1273  N N   . GLY A  1 175 ? 15.628  -24.790 128.693 1.00 29.31  ? 199 GLY A N   1 
ATOM   1274  C CA  . GLY A  1 175 ? 14.902  -25.968 129.147 1.00 30.64  ? 199 GLY A CA  1 
ATOM   1275  C C   . GLY A  1 175 ? 15.814  -27.195 129.054 1.00 31.14  ? 199 GLY A C   1 
ATOM   1276  O O   . GLY A  1 175 ? 16.529  -27.324 128.079 1.00 32.93  ? 199 GLY A O   1 
ATOM   1277  N N   . THR A  1 176 ? 15.788  -28.084 130.043 1.00 30.74  ? 200 THR A N   1 
ATOM   1278  C CA  . THR A  1 176 ? 16.530  -29.328 130.003 1.00 31.76  ? 200 THR A CA  1 
ATOM   1279  C C   . THR A  1 176 ? 15.620  -30.529 130.299 1.00 31.11  ? 200 THR A C   1 
ATOM   1280  O O   . THR A  1 176 ? 14.779  -30.478 131.200 1.00 29.79  ? 200 THR A O   1 
ATOM   1281  C CB  . THR A  1 176 ? 17.702  -29.342 131.027 1.00 35.68  ? 200 THR A CB  1 
ATOM   1282  O OG1 . THR A  1 176 ? 17.288  -28.886 132.366 1.00 37.60  ? 200 THR A OG1 1 
ATOM   1283  C CG2 . THR A  1 176 ? 18.846  -28.466 130.486 1.00 35.91  ? 200 THR A CG2 1 
ATOM   1284  N N   . ALA A  1 177 ? 15.803  -31.612 129.530 1.00 29.58  ? 201 ALA A N   1 
ATOM   1285  C CA  . ALA A  1 177 ? 15.207  -32.873 129.863 1.00 28.53  ? 201 ALA A CA  1 
ATOM   1286  C C   . ALA A  1 177 ? 16.297  -33.958 129.768 1.00 28.14  ? 201 ALA A C   1 
ATOM   1287  O O   . ALA A  1 177 ? 16.748  -34.248 128.700 1.00 28.32  ? 201 ALA A O   1 
ATOM   1288  C CB  . ALA A  1 177 ? 14.054  -33.144 128.931 1.00 28.58  ? 201 ALA A CB  1 
ATOM   1289  N N   . PHE A  1 178 ? 16.737  -34.513 130.895 1.00 27.73  ? 202 PHE A N   1 
ATOM   1290  C CA  . PHE A  1 178 ? 17.726  -35.572 130.903 1.00 28.23  ? 202 PHE A CA  1 
ATOM   1291  C C   . PHE A  1 178 ? 17.016  -36.857 131.198 1.00 28.93  ? 202 PHE A C   1 
ATOM   1292  O O   . PHE A  1 178 ? 16.110  -36.890 132.036 1.00 28.00  ? 202 PHE A O   1 
ATOM   1293  C CB  . PHE A  1 178 ? 18.716  -35.402 132.044 1.00 28.74  ? 202 PHE A CB  1 
ATOM   1294  C CG  . PHE A  1 178 ? 19.757  -34.382 131.805 1.00 29.36  ? 202 PHE A CG  1 
ATOM   1295  C CD1 . PHE A  1 178 ? 19.427  -33.023 131.872 1.00 29.58  ? 202 PHE A CD1 1 
ATOM   1296  C CD2 . PHE A  1 178 ? 21.090  -34.768 131.545 1.00 29.81  ? 202 PHE A CD2 1 
ATOM   1297  C CE1 . PHE A  1 178 ? 20.397  -32.063 131.666 1.00 30.62  ? 202 PHE A CE1 1 
ATOM   1298  C CE2 . PHE A  1 178 ? 22.075  -33.807 131.347 1.00 30.69  ? 202 PHE A CE2 1 
ATOM   1299  C CZ  . PHE A  1 178 ? 21.733  -32.452 131.390 1.00 31.09  ? 202 PHE A CZ  1 
ATOM   1300  N N   . GLU A  1 179 ? 17.458  -37.937 130.570 1.00 30.00  ? 203 GLU A N   1 
ATOM   1301  C CA  . GLU A  1 179 ? 16.810  -39.199 130.772 1.00 31.49  ? 203 GLU A CA  1 
ATOM   1302  C C   . GLU A  1 179 ? 17.346  -39.731 132.067 1.00 32.43  ? 203 GLU A C   1 
ATOM   1303  O O   . GLU A  1 179 ? 18.581  -39.703 132.288 1.00 33.16  ? 203 GLU A O   1 
ATOM   1304  C CB  . GLU A  1 179 ? 17.098  -40.132 129.611 1.00 33.56  ? 203 GLU A CB  1 
ATOM   1305  C CG  . GLU A  1 179 ? 16.406  -41.475 129.685 1.00 35.11  ? 203 GLU A CG  1 
ATOM   1306  C CD  . GLU A  1 179 ? 16.495  -42.262 128.394 1.00 37.29  ? 203 GLU A CD  1 
ATOM   1307  O OE1 . GLU A  1 179 ? 15.690  -43.208 128.212 1.00 37.11  ? 203 GLU A OE1 1 
ATOM   1308  O OE2 . GLU A  1 179 ? 17.371  -41.949 127.541 1.00 43.15  ? 203 GLU A OE2 1 
ATOM   1309  N N   . ASN A  1 180 ? 16.428  -40.194 132.934 1.00 32.11  ? 204 ASN A N   1 
ATOM   1310  C CA  . ASN A  1 180 ? 16.813  -40.774 134.207 1.00 31.42  ? 204 ASN A CA  1 
ATOM   1311  C C   . ASN A  1 180 ? 17.537  -42.074 133.963 1.00 31.42  ? 204 ASN A C   1 
ATOM   1312  O O   . ASN A  1 180 ? 17.535  -42.578 132.836 1.00 28.97  ? 204 ASN A O   1 
ATOM   1313  C CB  . ASN A  1 180 ? 15.628  -41.002 135.106 1.00 31.31  ? 204 ASN A CB  1 
ATOM   1314  C CG  . ASN A  1 180 ? 15.027  -39.714 135.608 1.00 31.31  ? 204 ASN A CG  1 
ATOM   1315  O OD1 . ASN A  1 180 ? 15.682  -38.914 136.259 1.00 32.66  ? 204 ASN A OD1 1 
ATOM   1316  N ND2 . ASN A  1 180 ? 13.769  -39.520 135.332 1.00 30.60  ? 204 ASN A ND2 1 
ATOM   1317  N N   . SER A  1 181 ? 18.177  -42.567 135.028 1.00 32.22  ? 205 SER A N   1 
ATOM   1318  C CA  . SER A  1 181 ? 18.996  -43.738 134.972 1.00 33.18  ? 205 SER A CA  1 
ATOM   1319  C C   . SER A  1 181 ? 18.908  -44.522 136.280 1.00 35.53  ? 205 SER A C   1 
ATOM   1320  O O   . SER A  1 181 ? 18.552  -44.017 137.338 1.00 35.16  ? 205 SER A O   1 
ATOM   1321  C CB  . SER A  1 181 ? 20.439  -43.294 134.721 1.00 34.06  ? 205 SER A CB  1 
ATOM   1322  O OG  . SER A  1 181 ? 21.460  -44.320 134.778 1.00 33.78  ? 205 SER A OG  1 
ATOM   1323  N N   . ILE A  1 182 ? 19.270  -45.789 136.157 1.00 37.72  ? 206 ILE A N   1 
ATOM   1324  C CA  . ILE A  1 182 ? 19.633  -46.731 137.237 1.00 38.25  ? 206 ILE A CA  1 
ATOM   1325  C C   . ILE A  1 182 ? 20.683  -46.097 138.149 1.00 38.60  ? 206 ILE A C   1 
ATOM   1326  O O   . ILE A  1 182 ? 20.646  -46.280 139.328 1.00 36.80  ? 206 ILE A O   1 
ATOM   1327  C CB  . ILE A  1 182 ? 19.992  -48.135 136.551 1.00 40.38  ? 206 ILE A CB  1 
ATOM   1328  C CG1 . ILE A  1 182 ? 18.837  -49.117 136.776 1.00 44.83  ? 206 ILE A CG1 1 
ATOM   1329  C CG2 . ILE A  1 182 ? 21.353  -48.759 136.825 1.00 37.77  ? 206 ILE A CG2 1 
ATOM   1330  C CD1 . ILE A  1 182 ? 17.532  -48.743 136.035 1.00 46.44  ? 206 ILE A CD1 1 
ATOM   1331  N N   . TYR A  1 183 ? 21.582  -45.285 137.595 1.00 42.65  ? 207 TYR A N   1 
ATOM   1332  C CA  . TYR A  1 183 ? 22.640  -44.556 138.366 1.00 42.33  ? 207 TYR A CA  1 
ATOM   1333  C C   . TYR A  1 183 ? 22.425  -43.047 138.514 1.00 41.72  ? 207 TYR A C   1 
ATOM   1334  O O   . TYR A  1 183 ? 21.649  -42.407 137.751 1.00 41.39  ? 207 TYR A O   1 
ATOM   1335  C CB  . TYR A  1 183 ? 23.977  -44.749 137.685 1.00 41.53  ? 207 TYR A CB  1 
ATOM   1336  C CG  . TYR A  1 183 ? 24.270  -46.156 137.252 1.00 42.54  ? 207 TYR A CG  1 
ATOM   1337  C CD1 . TYR A  1 183 ? 24.599  -47.144 138.186 1.00 42.98  ? 207 TYR A CD1 1 
ATOM   1338  C CD2 . TYR A  1 183 ? 24.268  -46.498 135.904 1.00 43.96  ? 207 TYR A CD2 1 
ATOM   1339  C CE1 . TYR A  1 183 ? 24.946  -48.438 137.782 1.00 45.20  ? 207 TYR A CE1 1 
ATOM   1340  C CE2 . TYR A  1 183 ? 24.612  -47.789 135.475 1.00 46.68  ? 207 TYR A CE2 1 
ATOM   1341  C CZ  . TYR A  1 183 ? 24.950  -48.776 136.415 1.00 47.52  ? 207 TYR A CZ  1 
ATOM   1342  O OH  . TYR A  1 183 ? 25.269  -50.071 135.981 1.00 46.75  ? 207 TYR A OH  1 
ATOM   1343  N N   . ASP A  1 184 ? 23.152  -42.475 139.469 1.00 40.60  ? 208 ASP A N   1 
ATOM   1344  C CA  . ASP A  1 184 ? 23.199  -41.018 139.592 1.00 40.58  ? 208 ASP A CA  1 
ATOM   1345  C C   . ASP A  1 184 ? 24.012  -40.369 138.482 1.00 38.32  ? 208 ASP A C   1 
ATOM   1346  O O   . ASP A  1 184 ? 25.098  -40.845 138.188 1.00 39.09  ? 208 ASP A O   1 
ATOM   1347  C CB  . ASP A  1 184 ? 23.802  -40.641 140.920 1.00 42.82  ? 208 ASP A CB  1 
ATOM   1348  C CG  . ASP A  1 184 ? 22.800  -40.663 142.039 1.00 46.10  ? 208 ASP A CG  1 
ATOM   1349  O OD1 . ASP A  1 184 ? 21.588  -40.854 141.803 1.00 47.70  ? 208 ASP A OD1 1 
ATOM   1350  O OD2 . ASP A  1 184 ? 23.236  -40.458 143.182 1.00 50.92  ? 208 ASP A OD2 1 
ATOM   1351  N N   . GLN A  1 185 ? 23.498  -39.289 137.884 1.00 36.07  ? 209 GLN A N   1 
ATOM   1352  C CA  . GLN A  1 185 ? 24.205  -38.568 136.814 1.00 35.52  ? 209 GLN A CA  1 
ATOM   1353  C C   . GLN A  1 185 ? 24.467  -37.152 137.272 1.00 35.73  ? 209 GLN A C   1 
ATOM   1354  O O   . GLN A  1 185 ? 23.613  -36.329 137.294 1.00 35.64  ? 209 GLN A O   1 
ATOM   1355  C CB  . GLN A  1 185 ? 23.381  -38.539 135.537 1.00 33.86  ? 209 GLN A CB  1 
ATOM   1356  C CG  . GLN A  1 185 ? 22.931  -39.894 135.071 1.00 33.44  ? 209 GLN A CG  1 
ATOM   1357  C CD  . GLN A  1 185 ? 21.914  -39.791 133.964 1.00 32.49  ? 209 GLN A CD  1 
ATOM   1358  O OE1 . GLN A  1 185 ? 22.305  -39.796 132.785 1.00 31.26  ? 209 GLN A OE1 1 
ATOM   1359  N NE2 . GLN A  1 185 ? 20.599  -39.681 134.323 1.00 29.41  ? 209 GLN A NE2 1 
ATOM   1360  N N   . GLU A  1 186 ? 25.679  -36.870 137.618 1.00 38.16  ? 210 GLU A N   1 
ATOM   1361  C CA  . GLU A  1 186 ? 26.052  -35.632 138.247 1.00 39.60  ? 210 GLU A CA  1 
ATOM   1362  C C   . GLU A  1 186 ? 26.856  -34.828 137.178 1.00 36.00  ? 210 GLU A C   1 
ATOM   1363  O O   . GLU A  1 186 ? 27.591  -35.395 136.353 1.00 33.83  ? 210 GLU A O   1 
ATOM   1364  C CB  . GLU A  1 186 ? 26.883  -36.096 139.409 1.00 46.17  ? 210 GLU A CB  1 
ATOM   1365  C CG  . GLU A  1 186 ? 27.342  -35.211 140.531 1.00 53.38  ? 210 GLU A CG  1 
ATOM   1366  C CD  . GLU A  1 186 ? 28.085  -36.115 141.548 1.00 61.01  ? 210 GLU A CD  1 
ATOM   1367  O OE1 . GLU A  1 186 ? 29.365  -36.214 141.464 1.00 63.62  ? 210 GLU A OE1 1 
ATOM   1368  O OE2 . GLU A  1 186 ? 27.357  -36.804 142.341 1.00 61.22  ? 210 GLU A OE2 1 
ATOM   1369  N N   . TYR A  1 187 ? 26.675  -33.516 137.171 1.00 32.97  ? 211 TYR A N   1 
ATOM   1370  C CA  . TYR A  1 187 ? 27.375  -32.646 136.271 1.00 31.64  ? 211 TYR A CA  1 
ATOM   1371  C C   . TYR A  1 187 ? 27.932  -31.410 136.991 1.00 32.17  ? 211 TYR A C   1 
ATOM   1372  O O   . TYR A  1 187 ? 27.355  -30.914 138.011 1.00 30.51  ? 211 TYR A O   1 
ATOM   1373  C CB  . TYR A  1 187 ? 26.400  -32.189 135.209 1.00 30.85  ? 211 TYR A CB  1 
ATOM   1374  C CG  . TYR A  1 187 ? 25.979  -33.227 134.201 1.00 30.12  ? 211 TYR A CG  1 
ATOM   1375  C CD1 . TYR A  1 187 ? 24.949  -34.147 134.475 1.00 30.53  ? 211 TYR A CD1 1 
ATOM   1376  C CD2 . TYR A  1 187 ? 26.556  -33.283 132.981 1.00 29.26  ? 211 TYR A CD2 1 
ATOM   1377  C CE1 . TYR A  1 187 ? 24.514  -35.091 133.549 1.00 28.68  ? 211 TYR A CE1 1 
ATOM   1378  C CE2 . TYR A  1 187 ? 26.139  -34.227 132.060 1.00 29.36  ? 211 TYR A CE2 1 
ATOM   1379  C CZ  . TYR A  1 187 ? 25.118  -35.127 132.341 1.00 28.67  ? 211 TYR A CZ  1 
ATOM   1380  O OH  . TYR A  1 187 ? 24.748  -36.050 131.372 1.00 28.06  ? 211 TYR A OH  1 
ATOM   1381  N N   . ASN A  1 188 ? 29.044  -30.877 136.472 1.00 32.21  ? 212 ASN A N   1 
ATOM   1382  C CA  . ASN A  1 188 ? 29.405  -29.499 136.822 1.00 32.04  ? 212 ASN A CA  1 
ATOM   1383  C C   . ASN A  1 188 ? 28.862  -28.629 135.733 1.00 31.97  ? 212 ASN A C   1 
ATOM   1384  O O   . ASN A  1 188 ? 29.097  -28.893 134.579 1.00 32.71  ? 212 ASN A O   1 
ATOM   1385  C CB  . ASN A  1 188 ? 30.889  -29.341 137.015 1.00 32.38  ? 212 ASN A CB  1 
ATOM   1386  C CG  . ASN A  1 188 ? 31.330  -29.806 138.396 1.00 34.47  ? 212 ASN A CG  1 
ATOM   1387  O OD1 . ASN A  1 188 ? 31.860  -30.904 138.558 1.00 37.15  ? 212 ASN A OD1 1 
ATOM   1388  N ND2 . ASN A  1 188 ? 31.057  -28.984 139.420 1.00 34.68  ? 212 ASN A ND2 1 
ATOM   1389  N N   . ILE A  1 189 ? 28.066  -27.629 136.071 1.00 33.11  ? 213 ILE A N   1 
ATOM   1390  C CA  . ILE A  1 189 ? 27.524  -26.735 135.053 1.00 34.16  ? 213 ILE A CA  1 
ATOM   1391  C C   . ILE A  1 189 ? 28.242  -25.416 135.128 1.00 34.24  ? 213 ILE A C   1 
ATOM   1392  O O   . ILE A  1 189 ? 28.180  -24.752 136.119 1.00 33.32  ? 213 ILE A O   1 
ATOM   1393  C CB  . ILE A  1 189 ? 26.017  -26.487 135.227 1.00 35.97  ? 213 ILE A CB  1 
ATOM   1394  C CG1 . ILE A  1 189 ? 25.239  -27.827 135.034 1.00 37.13  ? 213 ILE A CG1 1 
ATOM   1395  C CG2 . ILE A  1 189 ? 25.558  -25.458 134.203 1.00 36.06  ? 213 ILE A CG2 1 
ATOM   1396  C CD1 . ILE A  1 189 ? 23.740  -27.749 135.248 1.00 36.38  ? 213 ILE A CD1 1 
ATOM   1397  N N   . ARG A  1 190 ? 28.946  -25.069 134.069 1.00 35.54  ? 214 ARG A N   1 
ATOM   1398  C CA  . ARG A  1 190 ? 29.494  -23.743 133.903 1.00 35.50  ? 214 ARG A CA  1 
ATOM   1399  C C   . ARG A  1 190 ? 28.626  -22.924 132.959 1.00 33.56  ? 214 ARG A C   1 
ATOM   1400  O O   . ARG A  1 190 ? 28.380  -23.320 131.850 1.00 32.66  ? 214 ARG A O   1 
ATOM   1401  C CB  . ARG A  1 190 ? 30.876  -23.835 133.315 1.00 38.10  ? 214 ARG A CB  1 
ATOM   1402  C CG  . ARG A  1 190 ? 31.646  -22.520 133.337 1.00 38.72  ? 214 ARG A CG  1 
ATOM   1403  C CD  . ARG A  1 190 ? 32.943  -22.686 132.620 1.00 39.40  ? 214 ARG A CD  1 
ATOM   1404  N NE  . ARG A  1 190 ? 34.039  -22.994 133.488 1.00 41.58  ? 214 ARG A NE  1 
ATOM   1405  C CZ  . ARG A  1 190 ? 35.287  -23.149 133.022 1.00 47.91  ? 214 ARG A CZ  1 
ATOM   1406  N NH1 . ARG A  1 190 ? 36.325  -23.396 133.906 1.00 47.28  ? 214 ARG A NH1 1 
ATOM   1407  N NH2 . ARG A  1 190 ? 35.508  -23.053 131.659 1.00 45.32  ? 214 ARG A NH2 1 
ATOM   1408  N N   . VAL A  1 191 ? 28.154  -21.797 133.448 1.00 32.09  ? 215 VAL A N   1 
ATOM   1409  C CA  . VAL A  1 191 ? 27.453  -20.826 132.673 1.00 31.60  ? 215 VAL A CA  1 
ATOM   1410  C C   . VAL A  1 191 ? 28.394  -19.654 132.451 1.00 31.40  ? 215 VAL A C   1 
ATOM   1411  O O   . VAL A  1 191 ? 29.071  -19.189 133.364 1.00 29.64  ? 215 VAL A O   1 
ATOM   1412  C CB  . VAL A  1 191 ? 26.151  -20.373 133.395 1.00 31.27  ? 215 VAL A CB  1 
ATOM   1413  C CG1 . VAL A  1 191 ? 25.361  -19.332 132.599 1.00 30.80  ? 215 VAL A CG1 1 
ATOM   1414  C CG2 . VAL A  1 191 ? 25.264  -21.572 133.621 1.00 31.38  ? 215 VAL A CG2 1 
ATOM   1415  N N   . THR A  1 192 ? 28.404  -19.180 131.216 1.00 31.90  ? 216 THR A N   1 
ATOM   1416  C CA  . THR A  1 192 ? 29.168  -18.025 130.860 1.00 33.22  ? 216 THR A CA  1 
ATOM   1417  C C   . THR A  1 192 ? 28.351  -16.961 130.109 1.00 33.20  ? 216 THR A C   1 
ATOM   1418  O O   . THR A  1 192 ? 27.743  -17.216 129.083 1.00 32.87  ? 216 THR A O   1 
ATOM   1419  C CB  . THR A  1 192 ? 30.324  -18.477 129.988 1.00 33.62  ? 216 THR A CB  1 
ATOM   1420  O OG1 . THR A  1 192 ? 31.133  -19.377 130.754 1.00 33.43  ? 216 THR A OG1 1 
ATOM   1421  C CG2 . THR A  1 192 ? 31.139  -17.274 129.512 1.00 33.50  ? 216 THR A CG2 1 
ATOM   1422  N N   . MET A  1 193 ? 28.407  -15.752 130.615 1.00 34.12  ? 217 MET A N   1 
ATOM   1423  C CA  . MET A  1 193 ? 27.772  -14.605 130.001 1.00 36.03  ? 217 MET A CA  1 
ATOM   1424  C C   . MET A  1 193 ? 28.817  -13.706 129.303 1.00 33.79  ? 217 MET A C   1 
ATOM   1425  O O   . MET A  1 193 ? 29.803  -13.279 129.907 1.00 29.92  ? 217 MET A O   1 
ATOM   1426  C CB  . MET A  1 193 ? 27.017  -13.786 131.058 1.00 39.11  ? 217 MET A CB  1 
ATOM   1427  C CG  . MET A  1 193 ? 25.610  -14.308 131.312 1.00 44.05  ? 217 MET A CG  1 
ATOM   1428  S SD  . MET A  1 193 ? 24.750  -13.481 132.672 1.00 53.26  ? 217 MET A SD  1 
ATOM   1429  C CE  . MET A  1 193 ? 26.119  -12.501 133.322 1.00 48.40  ? 217 MET A CE  1 
ATOM   1430  N N   . TYR A  1 194 ? 28.530  -13.411 128.040 1.00 32.49  ? 218 TYR A N   1 
ATOM   1431  C CA  . TYR A  1 194 ? 29.285  -12.494 127.262 1.00 32.78  ? 218 TYR A CA  1 
ATOM   1432  C C   . TYR A  1 194 ? 28.468  -11.210 127.296 1.00 30.94  ? 218 TYR A C   1 
ATOM   1433  O O   . TYR A  1 194 ? 27.456  -11.096 126.721 1.00 29.38  ? 218 TYR A O   1 
ATOM   1434  C CB  . TYR A  1 194 ? 29.533  -13.066 125.857 1.00 33.74  ? 218 TYR A CB  1 
ATOM   1435  C CG  . TYR A  1 194 ? 30.376  -14.367 125.851 1.00 34.88  ? 218 TYR A CG  1 
ATOM   1436  C CD1 . TYR A  1 194 ? 29.770  -15.639 126.002 1.00 34.94  ? 218 TYR A CD1 1 
ATOM   1437  C CD2 . TYR A  1 194 ? 31.770  -14.321 125.705 1.00 34.85  ? 218 TYR A CD2 1 
ATOM   1438  C CE1 . TYR A  1 194 ? 30.528  -16.808 125.991 1.00 35.89  ? 218 TYR A CE1 1 
ATOM   1439  C CE2 . TYR A  1 194 ? 32.539  -15.492 125.700 1.00 35.82  ? 218 TYR A CE2 1 
ATOM   1440  C CZ  . TYR A  1 194 ? 31.922  -16.738 125.831 1.00 37.06  ? 218 TYR A CZ  1 
ATOM   1441  O OH  . TYR A  1 194 ? 32.693  -17.905 125.839 1.00 38.41  ? 218 TYR A OH  1 
ATOM   1442  N N   . VAL A  1 195 ? 28.974  -10.275 128.064 1.00 31.95  ? 219 VAL A N   1 
ATOM   1443  C CA  . VAL A  1 195 ? 28.310  -9.089  128.534 1.00 31.85  ? 219 VAL A CA  1 
ATOM   1444  C C   . VAL A  1 195 ? 29.044  -7.914  127.952 1.00 31.17  ? 219 VAL A C   1 
ATOM   1445  O O   . VAL A  1 195 ? 30.275  -7.889  127.859 1.00 29.86  ? 219 VAL A O   1 
ATOM   1446  C CB  . VAL A  1 195 ? 28.398  -8.989  130.081 1.00 32.12  ? 219 VAL A CB  1 
ATOM   1447  C CG1 . VAL A  1 195 ? 27.633  -7.775  130.598 1.00 32.43  ? 219 VAL A CG1 1 
ATOM   1448  C CG2 . VAL A  1 195 ? 27.813  -10.243 130.716 1.00 32.93  ? 219 VAL A CG2 1 
ATOM   1449  N N   . GLN A  1 196 ? 28.270  -6.925  127.580 1.00 31.39  ? 220 GLN A N   1 
ATOM   1450  C CA  . GLN A  1 196 ? 28.814  -5.714  127.016 1.00 31.80  ? 220 GLN A CA  1 
ATOM   1451  C C   . GLN A  1 196 ? 28.340  -4.691  127.987 1.00 30.74  ? 220 GLN A C   1 
ATOM   1452  O O   . GLN A  1 196 ? 27.161  -4.542  128.178 1.00 30.73  ? 220 GLN A O   1 
ATOM   1453  C CB  . GLN A  1 196 ? 28.225  -5.519  125.648 1.00 32.83  ? 220 GLN A CB  1 
ATOM   1454  C CG  . GLN A  1 196 ? 28.707  -4.339  124.859 1.00 34.33  ? 220 GLN A CG  1 
ATOM   1455  C CD  . GLN A  1 196 ? 28.257  -4.464  123.403 1.00 34.54  ? 220 GLN A CD  1 
ATOM   1456  O OE1 . GLN A  1 196 ? 27.088  -4.282  123.114 1.00 34.66  ? 220 GLN A OE1 1 
ATOM   1457  N NE2 . GLN A  1 196 ? 29.176  -4.809  122.496 1.00 35.64  ? 220 GLN A NE2 1 
ATOM   1458  N N   . PHE A  1 197 ? 29.269  -4.066  128.674 1.00 30.89  ? 221 PHE A N   1 
ATOM   1459  C CA  . PHE A  1 197 ? 28.974  -2.952  129.542 1.00 31.45  ? 221 PHE A CA  1 
ATOM   1460  C C   . PHE A  1 197 ? 29.149  -1.611  128.799 1.00 31.93  ? 221 PHE A C   1 
ATOM   1461  O O   . PHE A  1 197 ? 29.936  -1.479  127.840 1.00 29.75  ? 221 PHE A O   1 
ATOM   1462  C CB  . PHE A  1 197 ? 29.917  -2.988  130.738 1.00 32.20  ? 221 PHE A CB  1 
ATOM   1463  C CG  . PHE A  1 197 ? 29.750  -4.205  131.611 1.00 32.28  ? 221 PHE A CG  1 
ATOM   1464  C CD1 . PHE A  1 197 ? 28.753  -4.244  132.557 1.00 31.04  ? 221 PHE A CD1 1 
ATOM   1465  C CD2 . PHE A  1 197 ? 30.586  -5.329  131.456 1.00 31.18  ? 221 PHE A CD2 1 
ATOM   1466  C CE1 . PHE A  1 197 ? 28.598  -5.358  133.353 1.00 31.32  ? 221 PHE A CE1 1 
ATOM   1467  C CE2 . PHE A  1 197 ? 30.419  -6.420  132.255 1.00 29.83  ? 221 PHE A CE2 1 
ATOM   1468  C CZ  . PHE A  1 197 ? 29.426  -6.444  133.191 1.00 30.34  ? 221 PHE A CZ  1 
ATOM   1469  N N   . ARG A  1 198 ? 28.442  -0.597  129.275 1.00 32.70  ? 222 ARG A N   1 
ATOM   1470  C CA  . ARG A  1 198 ? 28.566  0.728   128.689 1.00 33.02  ? 222 ARG A CA  1 
ATOM   1471  C C   . ARG A  1 198 ? 28.508  1.798   129.758 1.00 33.11  ? 222 ARG A C   1 
ATOM   1472  O O   . ARG A  1 198 ? 27.788  1.647   130.739 1.00 31.43  ? 222 ARG A O   1 
ATOM   1473  C CB  . ARG A  1 198 ? 27.431  0.915   127.713 1.00 34.92  ? 222 ARG A CB  1 
ATOM   1474  C CG  . ARG A  1 198 ? 27.435  2.239   126.983 1.00 35.93  ? 222 ARG A CG  1 
ATOM   1475  C CD  . ARG A  1 198 ? 26.146  2.481   126.236 1.00 35.70  ? 222 ARG A CD  1 
ATOM   1476  N NE  . ARG A  1 198 ? 25.965  3.935   125.946 1.00 36.10  ? 222 ARG A NE  1 
ATOM   1477  C CZ  . ARG A  1 198 ? 24.942  4.384   125.231 1.00 34.95  ? 222 ARG A CZ  1 
ATOM   1478  N NH1 . ARG A  1 198 ? 24.775  5.658   124.938 1.00 33.80  ? 222 ARG A NH1 1 
ATOM   1479  N NH2 . ARG A  1 198 ? 24.041  3.508   124.819 1.00 37.46  ? 222 ARG A NH2 1 
ATOM   1480  N N   . GLU A  1 199 ? 29.289  2.866   129.530 1.00 34.54  ? 223 GLU A N   1 
ATOM   1481  C CA  . GLU A  1 199 ? 29.388  4.076   130.382 1.00 33.44  ? 223 GLU A CA  1 
ATOM   1482  C C   . GLU A  1 199 ? 30.145  3.824   131.650 1.00 31.87  ? 223 GLU A C   1 
ATOM   1483  O O   . GLU A  1 199 ? 29.605  3.450   132.671 1.00 28.48  ? 223 GLU A O   1 
ATOM   1484  C CB  . GLU A  1 199 ? 28.030  4.707   130.672 1.00 34.71  ? 223 GLU A CB  1 
ATOM   1485  C CG  . GLU A  1 199 ? 28.134  6.020   131.433 1.00 36.13  ? 223 GLU A CG  1 
ATOM   1486  C CD  . GLU A  1 199 ? 28.218  7.260   130.553 1.00 38.75  ? 223 GLU A CD  1 
ATOM   1487  O OE1 . GLU A  1 199 ? 27.933  7.201   129.332 1.00 42.85  ? 223 GLU A OE1 1 
ATOM   1488  O OE2 . GLU A  1 199 ? 28.554  8.333   131.102 1.00 40.27  ? 223 GLU A OE2 1 
ATOM   1489  N N   . PHE A  1 200 ? 31.434  4.049   131.553 1.00 33.69  ? 224 PHE A N   1 
ATOM   1490  C CA  . PHE A  1 200 ? 32.316  3.999   132.705 1.00 36.27  ? 224 PHE A CA  1 
ATOM   1491  C C   . PHE A  1 200 ? 31.827  5.073   133.723 1.00 37.40  ? 224 PHE A C   1 
ATOM   1492  O O   . PHE A  1 200 ? 31.585  6.217   133.328 1.00 35.33  ? 224 PHE A O   1 
ATOM   1493  C CB  . PHE A  1 200 ? 33.743  4.267   132.226 1.00 37.09  ? 224 PHE A CB  1 
ATOM   1494  C CG  . PHE A  1 200 ? 34.794  3.982   133.239 1.00 39.03  ? 224 PHE A CG  1 
ATOM   1495  C CD1 . PHE A  1 200 ? 35.050  2.687   133.637 1.00 41.04  ? 224 PHE A CD1 1 
ATOM   1496  C CD2 . PHE A  1 200 ? 35.551  5.003   133.778 1.00 39.69  ? 224 PHE A CD2 1 
ATOM   1497  C CE1 . PHE A  1 200 ? 36.057  2.424   134.561 1.00 41.28  ? 224 PHE A CE1 1 
ATOM   1498  C CE2 . PHE A  1 200 ? 36.552  4.749   134.693 1.00 40.37  ? 224 PHE A CE2 1 
ATOM   1499  C CZ  . PHE A  1 200 ? 36.804  3.461   135.091 1.00 40.89  ? 224 PHE A CZ  1 
ATOM   1500  N N   . ASN A  1 201 ? 31.671  4.671   135.006 1.00 38.30  ? 225 ASN A N   1 
ATOM   1501  C CA  . ASN A  1 201 ? 31.121  5.514   136.109 1.00 36.61  ? 225 ASN A CA  1 
ATOM   1502  C C   . ASN A  1 201 ? 31.956  5.580   137.411 1.00 35.49  ? 225 ASN A C   1 
ATOM   1503  O O   . ASN A  1 201 ? 31.477  6.077   138.416 1.00 35.60  ? 225 ASN A O   1 
ATOM   1504  C CB  . ASN A  1 201 ? 29.654  5.112   136.427 1.00 35.86  ? 225 ASN A CB  1 
ATOM   1505  C CG  . ASN A  1 201 ? 29.521  3.746   137.124 1.00 35.28  ? 225 ASN A CG  1 
ATOM   1506  O OD1 . ASN A  1 201 ? 30.494  3.131   137.577 1.00 34.27  ? 225 ASN A OD1 1 
ATOM   1507  N ND2 . ASN A  1 201 ? 28.280  3.279   137.221 1.00 34.73  ? 225 ASN A ND2 1 
ATOM   1508  N N   . LEU A  1 202 ? 33.203  5.138   137.378 1.00 34.90  ? 226 LEU A N   1 
ATOM   1509  C CA  . LEU A  1 202 ? 34.077  5.185   138.565 1.00 34.74  ? 226 LEU A CA  1 
ATOM   1510  C C   . LEU A  1 202 ? 34.065  6.510   139.308 1.00 32.97  ? 226 LEU A C   1 
ATOM   1511  O O   . LEU A  1 202 ? 34.328  7.567   138.775 1.00 29.46  ? 226 LEU A O   1 
ATOM   1512  C CB  . LEU A  1 202 ? 35.533  4.871   138.213 1.00 35.92  ? 226 LEU A CB  1 
ATOM   1513  C CG  . LEU A  1 202 ? 36.386  4.469   139.415 1.00 37.73  ? 226 LEU A CG  1 
ATOM   1514  C CD1 . LEU A  1 202 ? 36.192  3.032   139.835 1.00 37.61  ? 226 LEU A CD1 1 
ATOM   1515  C CD2 . LEU A  1 202 ? 37.848  4.652   139.047 1.00 41.22  ? 226 LEU A CD2 1 
ATOM   1516  N N   . LYS A  1 203 ? 33.746  6.373   140.575 1.00 33.74  ? 227 LYS A N   1 
ATOM   1517  C CA  . LYS A  1 203 ? 33.747  7.436   141.549 1.00 34.59  ? 227 LYS A CA  1 
ATOM   1518  C C   . LYS A  1 203 ? 35.054  7.336   142.310 1.00 35.29  ? 227 LYS A C   1 
ATOM   1519  O O   . LYS A  1 203 ? 35.448  6.242   142.734 1.00 35.45  ? 227 LYS A O   1 
ATOM   1520  C CB  . LYS A  1 203 ? 32.610  7.212   142.541 1.00 34.42  ? 227 LYS A CB  1 
ATOM   1521  C CG  . LYS A  1 203 ? 31.260  6.898   141.929 1.00 33.93  ? 227 LYS A CG  1 
ATOM   1522  C CD  . LYS A  1 203 ? 30.761  8.101   141.160 1.00 34.67  ? 227 LYS A CD  1 
ATOM   1523  C CE  . LYS A  1 203 ? 29.280  7.991   140.863 1.00 35.29  ? 227 LYS A CE  1 
ATOM   1524  N NZ  . LYS A  1 203 ? 28.993  6.886   139.903 1.00 35.57  ? 227 LYS A NZ  1 
ATOM   1525  N N   . ASP A  1 204 ? 35.693  8.480   142.502 1.00 36.49  ? 228 ASP A N   1 
ATOM   1526  C CA  . ASP A  1 204 ? 36.965  8.602   143.199 1.00 38.06  ? 228 ASP A CA  1 
ATOM   1527  C C   . ASP A  1 204 ? 36.880  9.648   144.318 1.00 39.73  ? 228 ASP A C   1 
ATOM   1528  O O   . ASP A  1 204 ? 37.261  10.799  144.136 1.00 37.18  ? 228 ASP A O   1 
ATOM   1529  C CB  . ASP A  1 204 ? 37.990  9.022   142.163 1.00 38.73  ? 228 ASP A CB  1 
ATOM   1530  C CG  . ASP A  1 204 ? 39.400  8.904   142.646 1.00 37.85  ? 228 ASP A CG  1 
ATOM   1531  O OD1 . ASP A  1 204 ? 39.667  8.000   143.464 1.00 36.98  ? 228 ASP A OD1 1 
ATOM   1532  O OD2 . ASP A  1 204 ? 40.226  9.700   142.129 1.00 35.80  ? 228 ASP A OD2 1 
ATOM   1533  N N   . PRO A  1 205 ? 36.346  9.253   145.489 1.00 45.99  ? 229 PRO A N   1 
ATOM   1534  C CA  . PRO A  1 205 ? 36.416  10.145  146.651 1.00 49.09  ? 229 PRO A CA  1 
ATOM   1535  C C   . PRO A  1 205 ? 37.869  10.359  147.103 1.00 52.27  ? 229 PRO A C   1 
ATOM   1536  O O   . PRO A  1 205 ? 38.742  9.551   146.773 1.00 52.57  ? 229 PRO A O   1 
ATOM   1537  C CB  . PRO A  1 205 ? 35.590  9.419   147.731 1.00 47.48  ? 229 PRO A CB  1 
ATOM   1538  C CG  . PRO A  1 205 ? 35.179  8.110   147.175 1.00 46.50  ? 229 PRO A CG  1 
ATOM   1539  C CD  . PRO A  1 205 ? 35.882  7.906   145.873 1.00 47.95  ? 229 PRO A CD  1 
ATOM   1540  N N   . PRO A  1 206 ? 38.142  11.452  147.825 1.00 56.87  ? 230 PRO A N   1 
ATOM   1541  C CA  . PRO A  1 206 ? 39.542  11.706  148.145 1.00 59.56  ? 230 PRO A CA  1 
ATOM   1542  C C   . PRO A  1 206 ? 39.804  11.374  149.622 1.00 55.09  ? 230 PRO A C   1 
ATOM   1543  O O   . PRO A  1 206 ? 39.489  10.262  150.048 1.00 49.36  ? 230 PRO A O   1 
ATOM   1544  C CB  . PRO A  1 206 ? 39.667  13.198  147.821 1.00 58.91  ? 230 PRO A CB  1 
ATOM   1545  C CG  . PRO A  1 206 ? 38.307  13.717  148.199 1.00 59.32  ? 230 PRO A CG  1 
ATOM   1546  C CD  . PRO A  1 206 ? 37.317  12.582  148.260 1.00 57.24  ? 230 PRO A CD  1 
ATOM   1547  N N   . SER B  1 19  ? 40.353  -8.518  127.378 1.00 59.44  ? 43  SER B N   1 
ATOM   1548  C CA  . SER B  1 19  ? 41.851  -8.418  127.277 1.00 61.24  ? 43  SER B CA  1 
ATOM   1549  C C   . SER B  1 19  ? 42.396  -7.028  127.813 1.00 56.44  ? 43  SER B C   1 
ATOM   1550  O O   . SER B  1 19  ? 42.710  -6.964  128.990 1.00 56.65  ? 43  SER B O   1 
ATOM   1551  C CB  . SER B  1 19  ? 42.304  -8.792  125.818 1.00 67.52  ? 43  SER B CB  1 
ATOM   1552  O OG  . SER B  1 19  ? 43.677  -9.203  125.717 1.00 65.34  ? 43  SER B OG  1 
ATOM   1553  N N   . HIS B  1 20  ? 42.494  -5.964  126.987 1.00 51.99  ? 44  HIS B N   1 
ATOM   1554  C CA  . HIS B  1 20  ? 42.952  -4.620  127.391 1.00 52.74  ? 44  HIS B CA  1 
ATOM   1555  C C   . HIS B  1 20  ? 41.831  -3.668  127.475 1.00 46.16  ? 44  HIS B C   1 
ATOM   1556  O O   . HIS B  1 20  ? 40.930  -3.733  126.725 1.00 45.54  ? 44  HIS B O   1 
ATOM   1557  C CB  . HIS B  1 20  ? 43.955  -4.054  126.424 1.00 59.43  ? 44  HIS B CB  1 
ATOM   1558  C CG  . HIS B  1 20  ? 44.989  -5.055  126.086 1.00 77.72  ? 44  HIS B CG  1 
ATOM   1559  N ND1 . HIS B  1 20  ? 44.912  -5.852  124.958 1.00 103.55 ? 44  HIS B ND1 1 
ATOM   1560  C CD2 . HIS B  1 20  ? 46.041  -5.521  126.797 1.00 87.07  ? 44  HIS B CD2 1 
ATOM   1561  C CE1 . HIS B  1 20  ? 45.928  -6.702  124.941 1.00 108.17 ? 44  HIS B CE1 1 
ATOM   1562  N NE2 . HIS B  1 20  ? 46.628  -6.525  126.051 1.00 104.11 ? 44  HIS B NE2 1 
ATOM   1563  N N   . PHE B  1 21  ? 41.917  -2.744  128.404 1.00 43.51  ? 45  PHE B N   1 
ATOM   1564  C CA  . PHE B  1 21  ? 40.894  -1.761  128.626 1.00 39.80  ? 45  PHE B CA  1 
ATOM   1565  C C   . PHE B  1 21  ? 41.554  -0.395  128.779 1.00 37.21  ? 45  PHE B C   1 
ATOM   1566  O O   . PHE B  1 21  ? 42.339  -0.147  129.696 1.00 37.31  ? 45  PHE B O   1 
ATOM   1567  C CB  . PHE B  1 21  ? 40.104  -2.130  129.861 1.00 40.49  ? 45  PHE B CB  1 
ATOM   1568  C CG  . PHE B  1 21  ? 39.045  -1.130  130.239 1.00 41.53  ? 45  PHE B CG  1 
ATOM   1569  C CD1 . PHE B  1 21  ? 38.113  -0.674  129.295 1.00 41.44  ? 45  PHE B CD1 1 
ATOM   1570  C CD2 . PHE B  1 21  ? 38.977  -0.644  131.547 1.00 42.62  ? 45  PHE B CD2 1 
ATOM   1571  C CE1 . PHE B  1 21  ? 37.162  0.255   129.632 1.00 40.90  ? 45  PHE B CE1 1 
ATOM   1572  C CE2 . PHE B  1 21  ? 38.007  0.261   131.901 1.00 43.19  ? 45  PHE B CE2 1 
ATOM   1573  C CZ  . PHE B  1 21  ? 37.104  0.711   130.939 1.00 42.81  ? 45  PHE B CZ  1 
ATOM   1574  N N   . ASN B  1 22  ? 41.190  0.486   127.872 1.00 34.52  ? 46  ASN B N   1 
ATOM   1575  C CA  . ASN B  1 22  ? 41.662  1.835   127.874 1.00 33.73  ? 46  ASN B CA  1 
ATOM   1576  C C   . ASN B  1 22  ? 40.683  2.690   128.610 1.00 32.65  ? 46  ASN B C   1 
ATOM   1577  O O   . ASN B  1 22  ? 39.552  2.613   128.357 1.00 32.55  ? 46  ASN B O   1 
ATOM   1578  C CB  . ASN B  1 22  ? 41.751  2.274   126.419 1.00 33.51  ? 46  ASN B CB  1 
ATOM   1579  C CG  . ASN B  1 22  ? 42.953  1.663   125.714 1.00 32.49  ? 46  ASN B CG  1 
ATOM   1580  O OD1 . ASN B  1 22  ? 44.087  1.846   126.137 1.00 33.36  ? 46  ASN B OD1 1 
ATOM   1581  N ND2 . ASN B  1 22  ? 42.715  0.984   124.649 1.00 30.71  ? 46  ASN B ND2 1 
ATOM   1582  N N   . THR B  1 23  ? 41.084  3.494   129.555 1.00 33.66  ? 47  THR B N   1 
ATOM   1583  C CA  . THR B  1 23  ? 40.127  4.408   130.136 1.00 34.68  ? 47  THR B CA  1 
ATOM   1584  C C   . THR B  1 23  ? 40.839  5.630   130.663 1.00 34.52  ? 47  THR B C   1 
ATOM   1585  O O   . THR B  1 23  ? 42.055  5.721   130.502 1.00 32.90  ? 47  THR B O   1 
ATOM   1586  C CB  . THR B  1 23  ? 39.290  3.699   131.217 1.00 37.60  ? 47  THR B CB  1 
ATOM   1587  O OG1 . THR B  1 23  ? 38.047  4.413   131.498 1.00 37.98  ? 47  THR B OG1 1 
ATOM   1588  C CG2 . THR B  1 23  ? 40.142  3.471   132.475 1.00 38.58  ? 47  THR B CG2 1 
ATOM   1589  N N   . ARG B  1 24  ? 40.064  6.581   131.221 1.00 36.10  ? 48  ARG B N   1 
ATOM   1590  C CA  . ARG B  1 24  ? 40.594  7.855   131.703 1.00 38.59  ? 48  ARG B CA  1 
ATOM   1591  C C   . ARG B  1 24  ? 40.073  8.140   133.108 1.00 38.90  ? 48  ARG B C   1 
ATOM   1592  O O   . ARG B  1 24  ? 38.854  8.073   133.348 1.00 41.62  ? 48  ARG B O   1 
ATOM   1593  C CB  . ARG B  1 24  ? 40.345  9.048   130.707 1.00 39.27  ? 48  ARG B CB  1 
ATOM   1594  C CG  . ARG B  1 24  ? 39.150  9.948   131.017 1.00 39.55  ? 48  ARG B CG  1 
ATOM   1595  C CD  . ARG B  1 24  ? 39.024  11.231  130.211 1.00 40.26  ? 48  ARG B CD  1 
ATOM   1596  N NE  . ARG B  1 24  ? 37.718  11.432  129.523 1.00 39.61  ? 48  ARG B NE  1 
ATOM   1597  C CZ  . ARG B  1 24  ? 36.492  11.374  130.053 1.00 40.84  ? 48  ARG B CZ  1 
ATOM   1598  N NH1 . ARG B  1 24  ? 36.280  11.053  131.327 1.00 42.73  ? 48  ARG B NH1 1 
ATOM   1599  N NH2 . ARG B  1 24  ? 35.407  11.606  129.284 1.00 42.49  ? 48  ARG B NH2 1 
ATOM   1600  N N   . LEU B  1 25  ? 40.996  8.506   133.999 1.00 37.53  ? 49  LEU B N   1 
ATOM   1601  C CA  . LEU B  1 25  ? 40.684  8.748   135.403 1.00 37.69  ? 49  LEU B CA  1 
ATOM   1602  C C   . LEU B  1 25  ? 41.075  10.137  135.738 1.00 35.69  ? 49  LEU B C   1 
ATOM   1603  O O   . LEU B  1 25  ? 42.103  10.587  135.243 1.00 33.92  ? 49  LEU B O   1 
ATOM   1604  C CB  . LEU B  1 25  ? 41.508  7.826   136.286 1.00 39.62  ? 49  LEU B CB  1 
ATOM   1605  C CG  . LEU B  1 25  ? 41.373  6.329   135.953 1.00 42.29  ? 49  LEU B CG  1 
ATOM   1606  C CD1 . LEU B  1 25  ? 42.410  5.535   136.734 1.00 41.94  ? 49  LEU B CD1 1 
ATOM   1607  C CD2 . LEU B  1 25  ? 39.952  5.805   136.237 1.00 43.32  ? 49  LEU B CD2 1 
ATOM   1608  N N   . SER B  1 26  ? 40.292  10.811  136.592 1.00 34.51  ? 50  SER B N   1 
ATOM   1609  C CA  . SER B  1 26  ? 40.593  12.205  136.939 1.00 33.70  ? 50  SER B CA  1 
ATOM   1610  C C   . SER B  1 26  ? 40.451  12.513  138.421 1.00 34.90  ? 50  SER B C   1 
ATOM   1611  O O   . SER B  1 26  ? 39.853  11.763  139.195 1.00 36.28  ? 50  SER B O   1 
ATOM   1612  C CB  . SER B  1 26  ? 39.732  13.172  136.112 1.00 32.38  ? 50  SER B CB  1 
ATOM   1613  O OG  . SER B  1 26  ? 40.049  13.142  134.719 1.00 29.94  ? 50  SER B OG  1 
ATOM   1614  N N   . ARG B  1 27  ? 41.030  13.639  138.812 1.00 36.50  ? 51  ARG B N   1 
ATOM   1615  C CA  . ARG B  1 27  ? 40.859  14.202  140.171 1.00 36.20  ? 51  ARG B CA  1 
ATOM   1616  C C   . ARG B  1 27  ? 41.158  15.678  140.117 1.00 35.61  ? 51  ARG B C   1 
ATOM   1617  O O   . ARG B  1 27  ? 41.797  16.186  139.159 1.00 34.49  ? 51  ARG B O   1 
ATOM   1618  C CB  . ARG B  1 27  ? 41.790  13.559  141.184 1.00 38.11  ? 51  ARG B CB  1 
ATOM   1619  C CG  . ARG B  1 27  ? 43.286  13.589  140.845 1.00 40.74  ? 51  ARG B CG  1 
ATOM   1620  C CD  . ARG B  1 27  ? 44.113  12.759  141.851 1.00 44.59  ? 51  ARG B CD  1 
ATOM   1621  N NE  . ARG B  1 27  ? 44.173  13.388  143.187 1.00 46.32  ? 51  ARG B NE  1 
ATOM   1622  C CZ  . ARG B  1 27  ? 45.227  14.049  143.670 1.00 46.16  ? 51  ARG B CZ  1 
ATOM   1623  N NH1 . ARG B  1 27  ? 45.147  14.633  144.858 1.00 45.58  ? 51  ARG B NH1 1 
ATOM   1624  N NH2 . ARG B  1 27  ? 46.355  14.146  142.972 1.00 46.14  ? 51  ARG B NH2 1 
ATOM   1625  N N   . THR B  1 28  ? 40.683  16.375  141.129 1.00 35.47  ? 52  THR B N   1 
ATOM   1626  C CA  . THR B  1 28  ? 40.867  17.800  141.175 1.00 36.06  ? 52  THR B CA  1 
ATOM   1627  C C   . THR B  1 28  ? 41.229  18.234  142.586 1.00 36.45  ? 52  THR B C   1 
ATOM   1628  O O   . THR B  1 28  ? 40.630  17.768  143.540 1.00 37.58  ? 52  THR B O   1 
ATOM   1629  C CB  . THR B  1 28  ? 39.588  18.516  140.726 1.00 36.28  ? 52  THR B CB  1 
ATOM   1630  O OG1 . THR B  1 28  ? 39.212  18.104  139.400 1.00 34.91  ? 52  THR B OG1 1 
ATOM   1631  C CG2 . THR B  1 28  ? 39.810  19.995  140.756 1.00 36.77  ? 52  THR B CG2 1 
ATOM   1632  N N   . PHE B  1 29  ? 42.214  19.124  142.690 1.00 37.07  ? 53  PHE B N   1 
ATOM   1633  C CA  . PHE B  1 29  ? 42.654  19.720  143.946 1.00 37.95  ? 53  PHE B CA  1 
ATOM   1634  C C   . PHE B  1 29  ? 43.054  21.208  143.834 1.00 39.15  ? 53  PHE B C   1 
ATOM   1635  O O   . PHE B  1 29  ? 43.331  21.703  142.739 1.00 39.05  ? 53  PHE B O   1 
ATOM   1636  C CB  . PHE B  1 29  ? 43.796  18.929  144.536 1.00 37.77  ? 53  PHE B CB  1 
ATOM   1637  C CG  . PHE B  1 29  ? 44.967  18.746  143.618 1.00 39.44  ? 53  PHE B CG  1 
ATOM   1638  C CD1 . PHE B  1 29  ? 45.073  17.618  142.812 1.00 40.86  ? 53  PHE B CD1 1 
ATOM   1639  C CD2 . PHE B  1 29  ? 46.000  19.656  143.597 1.00 39.94  ? 53  PHE B CD2 1 
ATOM   1640  C CE1 . PHE B  1 29  ? 46.164  17.441  141.979 1.00 40.04  ? 53  PHE B CE1 1 
ATOM   1641  C CE2 . PHE B  1 29  ? 47.114  19.458  142.796 1.00 39.18  ? 53  PHE B CE2 1 
ATOM   1642  C CZ  . PHE B  1 29  ? 47.187  18.363  141.982 1.00 39.14  ? 53  PHE B CZ  1 
ATOM   1643  N N   . GLY B  1 30  ? 43.035  21.908  144.988 1.00 39.30  ? 54  GLY B N   1 
ATOM   1644  C CA  . GLY B  1 30  ? 43.370  23.329  145.074 1.00 37.61  ? 54  GLY B CA  1 
ATOM   1645  C C   . GLY B  1 30  ? 44.866  23.572  145.040 1.00 37.09  ? 54  GLY B C   1 
ATOM   1646  O O   . GLY B  1 30  ? 45.691  22.657  145.319 1.00 34.27  ? 54  GLY B O   1 
ATOM   1647  N N   . TYR B  1 31  ? 45.226  24.791  144.653 1.00 37.24  ? 55  TYR B N   1 
ATOM   1648  C CA  . TYR B  1 31  ? 46.628  25.241  144.703 1.00 39.38  ? 55  TYR B CA  1 
ATOM   1649  C C   . TYR B  1 31  ? 46.591  26.711  144.725 1.00 40.49  ? 55  TYR B C   1 
ATOM   1650  O O   . TYR B  1 31  ? 45.983  27.356  143.831 1.00 38.13  ? 55  TYR B O   1 
ATOM   1651  C CB  . TYR B  1 31  ? 47.468  24.822  143.472 1.00 40.47  ? 55  TYR B CB  1 
ATOM   1652  C CG  . TYR B  1 31  ? 48.939  25.317  143.370 1.00 40.61  ? 55  TYR B CG  1 
ATOM   1653  C CD1 . TYR B  1 31  ? 49.912  24.941  144.300 1.00 42.41  ? 55  TYR B CD1 1 
ATOM   1654  C CD2 . TYR B  1 31  ? 49.352  26.065  142.281 1.00 41.14  ? 55  TYR B CD2 1 
ATOM   1655  C CE1 . TYR B  1 31  ? 51.231  25.380  144.199 1.00 43.55  ? 55  TYR B CE1 1 
ATOM   1656  C CE2 . TYR B  1 31  ? 50.668  26.474  142.134 1.00 43.53  ? 55  TYR B CE2 1 
ATOM   1657  C CZ  . TYR B  1 31  ? 51.613  26.153  143.095 1.00 45.52  ? 55  TYR B CZ  1 
ATOM   1658  O OH  . TYR B  1 31  ? 52.920  26.611  142.889 1.00 47.06  ? 55  TYR B OH  1 
ATOM   1659  N N   . THR B  1 32  ? 47.289  27.235  145.719 1.00 42.37  ? 56  THR B N   1 
ATOM   1660  C CA  . THR B  1 32  ? 47.414  28.664  145.894 1.00 43.74  ? 56  THR B CA  1 
ATOM   1661  C C   . THR B  1 32  ? 48.887  29.078  145.863 1.00 42.41  ? 56  THR B C   1 
ATOM   1662  O O   . THR B  1 32  ? 49.733  28.426  146.393 1.00 40.76  ? 56  THR B O   1 
ATOM   1663  C CB  . THR B  1 32  ? 46.722  29.064  147.201 1.00 44.08  ? 56  THR B CB  1 
ATOM   1664  O OG1 . THR B  1 32  ? 45.419  28.463  147.214 1.00 45.51  ? 56  THR B OG1 1 
ATOM   1665  C CG2 . THR B  1 32  ? 46.561  30.512  147.272 1.00 44.67  ? 56  THR B CG2 1 
ATOM   1666  N N   . ILE B  1 33  ? 49.182  30.131  145.138 1.00 44.03  ? 57  ILE B N   1 
ATOM   1667  C CA  . ILE B  1 33  ? 50.402  30.851  145.339 1.00 45.81  ? 57  ILE B CA  1 
ATOM   1668  C C   . ILE B  1 33  ? 49.990  32.046  146.162 1.00 47.67  ? 57  ILE B C   1 
ATOM   1669  O O   . ILE B  1 33  ? 49.138  32.824  145.713 1.00 47.76  ? 57  ILE B O   1 
ATOM   1670  C CB  . ILE B  1 33  ? 51.007  31.333  144.023 1.00 45.96  ? 57  ILE B CB  1 
ATOM   1671  C CG1 . ILE B  1 33  ? 51.386  30.139  143.132 1.00 47.04  ? 57  ILE B CG1 1 
ATOM   1672  C CG2 . ILE B  1 33  ? 52.207  32.223  144.308 1.00 47.32  ? 57  ILE B CG2 1 
ATOM   1673  C CD1 . ILE B  1 33  ? 50.337  29.870  142.081 1.00 48.73  ? 57  ILE B CD1 1 
ATOM   1674  N N   . LYS B  1 34  ? 50.622  32.220  147.326 1.00 49.98  ? 58  LYS B N   1 
ATOM   1675  C CA  . LYS B  1 34  ? 50.251  33.281  148.236 1.00 50.57  ? 58  LYS B CA  1 
ATOM   1676  C C   . LYS B  1 34  ? 50.867  34.595  147.773 1.00 47.03  ? 58  LYS B C   1 
ATOM   1677  O O   . LYS B  1 34  ? 51.968  34.636  147.183 1.00 43.78  ? 58  LYS B O   1 
ATOM   1678  C CB  . LYS B  1 34  ? 50.646  32.942  149.675 1.00 56.26  ? 58  LYS B CB  1 
ATOM   1679  C CG  . LYS B  1 34  ? 50.025  31.647  150.201 1.00 62.67  ? 58  LYS B CG  1 
ATOM   1680  C CD  . LYS B  1 34  ? 49.361  31.731  151.593 1.00 68.94  ? 58  LYS B CD  1 
ATOM   1681  C CE  . LYS B  1 34  ? 50.328  31.492  152.782 1.00 71.28  ? 58  LYS B CE  1 
ATOM   1682  N NZ  . LYS B  1 34  ? 49.652  30.904  153.995 1.00 70.44  ? 58  LYS B NZ  1 
ATOM   1683  N N   . ARG B  1 35  ? 50.136  35.668  148.048 1.00 47.36  ? 59  ARG B N   1 
ATOM   1684  C CA  . ARG B  1 35  ? 50.559  37.003  147.665 1.00 53.39  ? 59  ARG B CA  1 
ATOM   1685  C C   . ARG B  1 35  ? 51.960  37.350  148.242 1.00 52.76  ? 59  ARG B C   1 
ATOM   1686  O O   . ARG B  1 35  ? 52.219  37.007  149.345 1.00 52.57  ? 59  ARG B O   1 
ATOM   1687  C CB  . ARG B  1 35  ? 49.485  38.023  148.059 1.00 56.93  ? 59  ARG B CB  1 
ATOM   1688  C CG  . ARG B  1 35  ? 49.741  38.871  149.307 1.00 63.17  ? 59  ARG B CG  1 
ATOM   1689  C CD  . ARG B  1 35  ? 48.969  38.412  150.517 1.00 66.81  ? 59  ARG B CD  1 
ATOM   1690  N NE  . ARG B  1 35  ? 47.548  38.617  150.266 1.00 73.69  ? 59  ARG B NE  1 
ATOM   1691  C CZ  . ARG B  1 35  ? 46.570  38.298  151.104 1.00 78.96  ? 59  ARG B CZ  1 
ATOM   1692  N NH1 . ARG B  1 35  ? 46.817  37.773  152.310 1.00 82.54  ? 59  ARG B NH1 1 
ATOM   1693  N NH2 . ARG B  1 35  ? 45.325  38.516  150.728 1.00 80.15  ? 59  ARG B NH2 1 
ATOM   1694  N N   . THR B  1 36  ? 52.859  37.982  147.497 1.00 55.58  ? 60  THR B N   1 
ATOM   1695  C CA  . THR B  1 36  ? 54.118  38.535  148.087 1.00 58.09  ? 60  THR B CA  1 
ATOM   1696  C C   . THR B  1 36  ? 54.114  40.036  147.934 1.00 59.37  ? 60  THR B C   1 
ATOM   1697  O O   . THR B  1 36  ? 53.263  40.622  147.266 1.00 57.14  ? 60  THR B O   1 
ATOM   1698  C CB  . THR B  1 36  ? 55.448  37.994  147.468 1.00 59.89  ? 60  THR B CB  1 
ATOM   1699  O OG1 . THR B  1 36  ? 55.466  38.175  146.032 1.00 52.19  ? 60  THR B OG1 1 
ATOM   1700  C CG2 . THR B  1 36  ? 55.656  36.488  147.855 1.00 63.28  ? 60  THR B CG2 1 
ATOM   1701  N N   . THR B  1 37  ? 55.047  40.649  148.629 1.00 62.25  ? 61  THR B N   1 
ATOM   1702  C CA  . THR B  1 37  ? 55.299  42.070  148.512 1.00 65.52  ? 61  THR B CA  1 
ATOM   1703  C C   . THR B  1 37  ? 56.717  42.336  148.019 1.00 68.19  ? 61  THR B C   1 
ATOM   1704  O O   . THR B  1 37  ? 57.017  43.490  147.721 1.00 79.54  ? 61  THR B O   1 
ATOM   1705  C CB  . THR B  1 37  ? 55.018  42.824  149.851 1.00 65.81  ? 61  THR B CB  1 
ATOM   1706  O OG1 . THR B  1 37  ? 55.396  42.009  150.977 1.00 61.25  ? 61  THR B OG1 1 
ATOM   1707  C CG2 . THR B  1 37  ? 53.509  43.246  149.964 1.00 64.24  ? 61  THR B CG2 1 
ATOM   1708  N N   . VAL B  1 38  ? 57.577  41.310  147.917 1.00 65.51  ? 62  VAL B N   1 
ATOM   1709  C CA  . VAL B  1 38  ? 58.796  41.412  147.102 1.00 65.24  ? 62  VAL B CA  1 
ATOM   1710  C C   . VAL B  1 38  ? 58.498  42.241  145.824 1.00 68.90  ? 62  VAL B C   1 
ATOM   1711  O O   . VAL B  1 38  ? 57.481  42.015  145.126 1.00 63.99  ? 62  VAL B O   1 
ATOM   1712  C CB  . VAL B  1 38  ? 59.374  40.043  146.652 1.00 66.14  ? 62  VAL B CB  1 
ATOM   1713  C CG1 . VAL B  1 38  ? 60.808  40.246  146.117 1.00 64.38  ? 62  VAL B CG1 1 
ATOM   1714  C CG2 . VAL B  1 38  ? 59.283  38.937  147.733 1.00 61.88  ? 62  VAL B CG2 1 
ATOM   1715  N N   . LYS B  1 39  ? 59.340  43.241  145.556 1.00 75.13  ? 63  LYS B N   1 
ATOM   1716  C CA  . LYS B  1 39  ? 59.074  44.199  144.450 1.00 79.26  ? 63  LYS B CA  1 
ATOM   1717  C C   . LYS B  1 39  ? 59.591  43.608  143.147 1.00 73.34  ? 63  LYS B C   1 
ATOM   1718  O O   . LYS B  1 39  ? 58.875  43.566  142.134 1.00 65.32  ? 63  LYS B O   1 
ATOM   1719  C CB  . LYS B  1 39  ? 59.730  45.579  144.686 1.00 85.67  ? 63  LYS B CB  1 
ATOM   1720  C CG  . LYS B  1 39  ? 59.194  46.379  145.874 1.00 87.73  ? 63  LYS B CG  1 
ATOM   1721  C CD  . LYS B  1 39  ? 60.089  46.286  147.112 1.00 87.95  ? 63  LYS B CD  1 
ATOM   1722  C CE  . LYS B  1 39  ? 59.277  46.359  148.410 1.00 87.15  ? 63  LYS B CE  1 
ATOM   1723  N NZ  . LYS B  1 39  ? 59.975  47.204  149.407 1.00 86.20  ? 63  LYS B NZ  1 
ATOM   1724  N N   . THR B  1 40  ? 60.836  43.129  143.199 1.00 70.78  ? 64  THR B N   1 
ATOM   1725  C CA  . THR B  1 40  ? 61.475  42.486  142.034 1.00 69.34  ? 64  THR B CA  1 
ATOM   1726  C C   . THR B  1 40  ? 60.769  41.111  141.697 1.00 63.69  ? 64  THR B C   1 
ATOM   1727  O O   . THR B  1 40  ? 60.269  40.414  142.629 1.00 61.85  ? 64  THR B O   1 
ATOM   1728  C CB  . THR B  1 40  ? 63.007  42.324  142.246 1.00 66.44  ? 64  THR B CB  1 
ATOM   1729  O OG1 . THR B  1 40  ? 63.220  41.622  143.457 1.00 64.50  ? 64  THR B OG1 1 
ATOM   1730  C CG2 . THR B  1 40  ? 63.728  43.685  142.370 1.00 67.25  ? 64  THR B CG2 1 
ATOM   1731  N N   . PRO B  1 41  ? 60.686  40.753  140.384 1.00 54.12  ? 65  PRO B N   1 
ATOM   1732  C CA  . PRO B  1 41  ? 60.087  39.510  139.916 1.00 50.53  ? 65  PRO B CA  1 
ATOM   1733  C C   . PRO B  1 41  ? 60.666  38.302  140.606 1.00 47.13  ? 65  PRO B C   1 
ATOM   1734  O O   . PRO B  1 41  ? 61.913  38.189  140.703 1.00 43.59  ? 65  PRO B O   1 
ATOM   1735  C CB  . PRO B  1 41  ? 60.478  39.460  138.429 1.00 51.48  ? 65  PRO B CB  1 
ATOM   1736  C CG  . PRO B  1 41  ? 60.573  40.886  138.046 1.00 53.05  ? 65  PRO B CG  1 
ATOM   1737  C CD  . PRO B  1 41  ? 61.149  41.571  139.253 1.00 54.30  ? 65  PRO B CD  1 
ATOM   1738  N N   . SER B  1 42  ? 59.754  37.428  141.061 1.00 45.16  ? 66  SER B N   1 
ATOM   1739  C CA  . SER B  1 42  ? 60.083  36.183  141.744 1.00 44.96  ? 66  SER B CA  1 
ATOM   1740  C C   . SER B  1 42  ? 59.069  35.064  141.460 1.00 47.24  ? 66  SER B C   1 
ATOM   1741  O O   . SER B  1 42  ? 57.887  35.313  141.220 1.00 51.23  ? 66  SER B O   1 
ATOM   1742  C CB  . SER B  1 42  ? 60.194  36.393  143.262 1.00 45.21  ? 66  SER B CB  1 
ATOM   1743  O OG  . SER B  1 42  ? 59.002  36.931  143.832 1.00 44.57  ? 66  SER B OG  1 
ATOM   1744  N N   . TRP B  1 43  ? 59.534  33.819  141.555 1.00 46.81  ? 67  TRP B N   1 
ATOM   1745  C CA  . TRP B  1 43  ? 58.772  32.654  141.135 1.00 45.18  ? 67  TRP B CA  1 
ATOM   1746  C C   . TRP B  1 43  ? 58.596  31.663  142.290 1.00 44.67  ? 67  TRP B C   1 
ATOM   1747  O O   . TRP B  1 43  ? 59.530  31.439  143.031 1.00 44.21  ? 67  TRP B O   1 
ATOM   1748  C CB  . TRP B  1 43  ? 59.507  31.986  139.952 1.00 44.37  ? 67  TRP B CB  1 
ATOM   1749  C CG  . TRP B  1 43  ? 59.316  32.721  138.693 1.00 43.43  ? 67  TRP B CG  1 
ATOM   1750  C CD1 . TRP B  1 43  ? 58.390  32.463  137.762 1.00 42.84  ? 67  TRP B CD1 1 
ATOM   1751  C CD2 . TRP B  1 43  ? 60.024  33.875  138.253 1.00 43.49  ? 67  TRP B CD2 1 
ATOM   1752  N NE1 . TRP B  1 43  ? 58.484  33.355  136.745 1.00 42.96  ? 67  TRP B NE1 1 
ATOM   1753  C CE2 . TRP B  1 43  ? 59.485  34.242  137.021 1.00 43.63  ? 67  TRP B CE2 1 
ATOM   1754  C CE3 . TRP B  1 43  ? 61.092  34.615  138.763 1.00 44.47  ? 67  TRP B CE3 1 
ATOM   1755  C CZ2 . TRP B  1 43  ? 59.978  35.336  136.263 1.00 43.42  ? 67  TRP B CZ2 1 
ATOM   1756  C CZ3 . TRP B  1 43  ? 61.565  35.720  138.017 1.00 43.84  ? 67  TRP B CZ3 1 
ATOM   1757  C CH2 . TRP B  1 43  ? 61.001  36.064  136.784 1.00 42.22  ? 67  TRP B CH2 1 
ATOM   1758  N N   . ALA B  1 44  ? 57.385  31.115  142.445 1.00 43.48  ? 68  ALA B N   1 
ATOM   1759  C CA  . ALA B  1 44  ? 57.109  29.966  143.293 1.00 41.35  ? 68  ALA B CA  1 
ATOM   1760  C C   . ALA B  1 44  ? 57.282  28.708  142.458 1.00 41.10  ? 68  ALA B C   1 
ATOM   1761  O O   . ALA B  1 44  ? 56.601  28.493  141.430 1.00 40.83  ? 68  ALA B O   1 
ATOM   1762  C CB  . ALA B  1 44  ? 55.690  30.017  143.836 1.00 41.78  ? 68  ALA B CB  1 
ATOM   1763  N N   . VAL B  1 45  ? 58.174  27.863  142.919 1.00 40.11  ? 69  VAL B N   1 
ATOM   1764  C CA  . VAL B  1 45  ? 58.640  26.736  142.160 1.00 40.27  ? 69  VAL B CA  1 
ATOM   1765  C C   . VAL B  1 45  ? 58.098  25.560  142.904 1.00 42.31  ? 69  VAL B C   1 
ATOM   1766  O O   . VAL B  1 45  ? 58.011  25.592  144.126 1.00 43.97  ? 69  VAL B O   1 
ATOM   1767  C CB  . VAL B  1 45  ? 60.173  26.698  142.165 1.00 40.35  ? 69  VAL B CB  1 
ATOM   1768  C CG1 . VAL B  1 45  ? 60.729  25.474  141.447 1.00 40.58  ? 69  VAL B CG1 1 
ATOM   1769  C CG2 . VAL B  1 45  ? 60.734  27.997  141.584 1.00 39.82  ? 69  VAL B CG2 1 
ATOM   1770  N N   . ASP B  1 46  ? 57.680  24.546  142.168 1.00 44.56  ? 70  ASP B N   1 
ATOM   1771  C CA  . ASP B  1 46  ? 57.031  23.412  142.772 1.00 46.39  ? 70  ASP B CA  1 
ATOM   1772  C C   . ASP B  1 46  ? 57.067  22.187  141.861 1.00 47.14  ? 70  ASP B C   1 
ATOM   1773  O O   . ASP B  1 46  ? 57.701  22.212  140.807 1.00 45.71  ? 70  ASP B O   1 
ATOM   1774  C CB  . ASP B  1 46  ? 55.604  23.784  143.173 1.00 47.52  ? 70  ASP B CB  1 
ATOM   1775  C CG  . ASP B  1 46  ? 55.186  23.107  144.453 1.00 49.41  ? 70  ASP B CG  1 
ATOM   1776  O OD1 . ASP B  1 46  ? 55.615  21.931  144.651 1.00 46.27  ? 70  ASP B OD1 1 
ATOM   1777  O OD2 . ASP B  1 46  ? 54.458  23.748  145.240 1.00 49.34  ? 70  ASP B OD2 1 
ATOM   1778  N N   . MET B  1 47  ? 56.442  21.100  142.289 1.00 46.74  ? 71  MET B N   1 
ATOM   1779  C CA  . MET B  1 47  ? 56.499  19.875  141.515 1.00 47.98  ? 71  MET B CA  1 
ATOM   1780  C C   . MET B  1 47  ? 55.167  19.102  141.581 1.00 46.73  ? 71  MET B C   1 
ATOM   1781  O O   . MET B  1 47  ? 54.213  19.418  142.353 1.00 43.91  ? 71  MET B O   1 
ATOM   1782  C CB  . MET B  1 47  ? 57.649  19.037  141.969 1.00 48.26  ? 71  MET B CB  1 
ATOM   1783  C CG  . MET B  1 47  ? 57.501  18.785  143.415 1.00 53.02  ? 71  MET B CG  1 
ATOM   1784  S SD  . MET B  1 47  ? 58.742  17.705  144.048 1.00 69.82  ? 71  MET B SD  1 
ATOM   1785  C CE  . MET B  1 47  ? 59.951  18.825  144.824 1.00 66.21  ? 71  MET B CE  1 
ATOM   1786  N N   . MET B  1 48  ? 55.101  18.144  140.673 1.00 44.49  ? 72  MET B N   1 
ATOM   1787  C CA  . MET B  1 48  ? 53.955  17.281  140.550 1.00 44.10  ? 72  MET B CA  1 
ATOM   1788  C C   . MET B  1 48  ? 54.421  15.900  140.167 1.00 40.70  ? 72  MET B C   1 
ATOM   1789  O O   . MET B  1 48  ? 55.152  15.713  139.176 1.00 39.81  ? 72  MET B O   1 
ATOM   1790  C CB  . MET B  1 48  ? 52.954  17.805  139.517 1.00 46.70  ? 72  MET B CB  1 
ATOM   1791  C CG  . MET B  1 48  ? 51.835  18.590  140.142 1.00 49.02  ? 72  MET B CG  1 
ATOM   1792  S SD  . MET B  1 48  ? 50.503  18.880  138.982 1.00 52.60  ? 72  MET B SD  1 
ATOM   1793  C CE  . MET B  1 48  ? 51.346  20.248  138.264 1.00 53.49  ? 72  MET B CE  1 
ATOM   1794  N N   . ARG B  1 49  ? 54.006  14.977  141.015 1.00 38.27  ? 73  ARG B N   1 
ATOM   1795  C CA  . ARG B  1 49  ? 54.002  13.599  140.743 1.00 40.16  ? 73  ARG B CA  1 
ATOM   1796  C C   . ARG B  1 49  ? 52.565  13.110  140.603 1.00 39.32  ? 73  ARG B C   1 
ATOM   1797  O O   . ARG B  1 49  ? 51.630  13.829  140.892 1.00 39.42  ? 73  ARG B O   1 
ATOM   1798  C CB  . ARG B  1 49  ? 54.696  12.880  141.857 1.00 42.00  ? 73  ARG B CB  1 
ATOM   1799  C CG  . ARG B  1 49  ? 56.156  13.245  142.056 1.00 43.35  ? 73  ARG B CG  1 
ATOM   1800  C CD  . ARG B  1 49  ? 56.647  12.387  143.225 1.00 46.90  ? 73  ARG B CD  1 
ATOM   1801  N NE  . ARG B  1 49  ? 58.084  12.469  143.415 1.00 51.00  ? 73  ARG B NE  1 
ATOM   1802  C CZ  . ARG B  1 49  ? 58.708  13.438  144.076 1.00 52.17  ? 73  ARG B CZ  1 
ATOM   1803  N NH1 . ARG B  1 49  ? 60.038  13.432  144.146 1.00 55.86  ? 73  ARG B NH1 1 
ATOM   1804  N NH2 . ARG B  1 49  ? 58.029  14.429  144.622 1.00 49.76  ? 73  ARG B NH2 1 
ATOM   1805  N N   . PHE B  1 50  ? 52.421  11.884  140.107 1.00 40.46  ? 74  PHE B N   1 
ATOM   1806  C CA  . PHE B  1 50  ? 51.129  11.247  139.779 1.00 39.20  ? 74  PHE B CA  1 
ATOM   1807  C C   . PHE B  1 50  ? 51.158  9.842   140.234 1.00 40.34  ? 74  PHE B C   1 
ATOM   1808  O O   . PHE B  1 50  ? 52.030  9.083   139.755 1.00 42.28  ? 74  PHE B O   1 
ATOM   1809  C CB  . PHE B  1 50  ? 50.985  11.166  138.297 1.00 37.86  ? 74  PHE B CB  1 
ATOM   1810  C CG  . PHE B  1 50  ? 51.308  12.422  137.631 1.00 38.04  ? 74  PHE B CG  1 
ATOM   1811  C CD1 . PHE B  1 50  ? 50.520  13.538  137.849 1.00 38.75  ? 74  PHE B CD1 1 
ATOM   1812  C CD2 . PHE B  1 50  ? 52.415  12.519  136.834 1.00 38.94  ? 74  PHE B CD2 1 
ATOM   1813  C CE1 . PHE B  1 50  ? 50.810  14.734  137.243 1.00 40.11  ? 74  PHE B CE1 1 
ATOM   1814  C CE2 . PHE B  1 50  ? 52.706  13.698  136.188 1.00 39.50  ? 74  PHE B CE2 1 
ATOM   1815  C CZ  . PHE B  1 50  ? 51.904  14.815  136.383 1.00 40.43  ? 74  PHE B CZ  1 
ATOM   1816  N N   . ASN B  1 51  ? 50.235  9.478   141.125 1.00 39.08  ? 75  ASN B N   1 
ATOM   1817  C CA  . ASN B  1 51  ? 50.138  8.098   141.622 1.00 37.90  ? 75  ASN B CA  1 
ATOM   1818  C C   . ASN B  1 51  ? 48.751  7.602   141.477 1.00 36.82  ? 75  ASN B C   1 
ATOM   1819  O O   . ASN B  1 51  ? 47.841  8.165   142.034 1.00 36.23  ? 75  ASN B O   1 
ATOM   1820  C CB  . ASN B  1 51  ? 50.510  8.005   143.106 1.00 38.64  ? 75  ASN B CB  1 
ATOM   1821  C CG  . ASN B  1 51  ? 50.720  6.576   143.548 1.00 39.10  ? 75  ASN B CG  1 
ATOM   1822  O OD1 . ASN B  1 51  ? 49.783  5.799   143.488 1.00 41.06  ? 75  ASN B OD1 1 
ATOM   1823  N ND2 . ASN B  1 51  ? 51.951  6.207   143.927 1.00 36.04  ? 75  ASN B ND2 1 
ATOM   1824  N N   . ILE B  1 52  ? 48.596  6.477   140.814 1.00 38.17  ? 76  ILE B N   1 
ATOM   1825  C CA  . ILE B  1 52  ? 47.253  5.869   140.640 1.00 38.09  ? 76  ILE B CA  1 
ATOM   1826  C C   . ILE B  1 52  ? 46.464  5.679   141.970 1.00 37.65  ? 76  ILE B C   1 
ATOM   1827  O O   . ILE B  1 52  ? 45.238  5.605   141.917 1.00 36.83  ? 76  ILE B O   1 
ATOM   1828  C CB  . ILE B  1 52  ? 47.325  4.556   139.786 1.00 36.91  ? 76  ILE B CB  1 
ATOM   1829  C CG1 . ILE B  1 52  ? 45.989  4.186   139.190 1.00 36.65  ? 76  ILE B CG1 1 
ATOM   1830  C CG2 . ILE B  1 52  ? 47.883  3.360   140.570 1.00 36.50  ? 76  ILE B CG2 1 
ATOM   1831  C CD1 . ILE B  1 52  ? 46.192  3.281   137.990 1.00 37.61  ? 76  ILE B CD1 1 
ATOM   1832  N N   . ASN B  1 53  ? 47.124  5.633   143.135 1.00 36.21  ? 77  ASN B N   1 
ATOM   1833  C CA  . ASN B  1 53  ? 46.377  5.506   144.405 1.00 38.25  ? 77  ASN B CA  1 
ATOM   1834  C C   . ASN B  1 53  ? 45.371  6.604   144.621 1.00 36.46  ? 77  ASN B C   1 
ATOM   1835  O O   . ASN B  1 53  ? 44.375  6.367   145.255 1.00 34.97  ? 77  ASN B O   1 
ATOM   1836  C CB  . ASN B  1 53  ? 47.280  5.552   145.643 1.00 41.89  ? 77  ASN B CB  1 
ATOM   1837  C CG  . ASN B  1 53  ? 48.282  4.405   145.699 1.00 44.80  ? 77  ASN B CG  1 
ATOM   1838  O OD1 . ASN B  1 53  ? 47.967  3.258   145.233 1.00 43.89  ? 77  ASN B OD1 1 
ATOM   1839  N ND2 . ASN B  1 53  ? 49.535  4.712   146.237 1.00 41.27  ? 77  ASN B ND2 1 
ATOM   1840  N N   . ASP B  1 54  ? 45.661  7.790   144.101 1.00 35.45  ? 78  ASP B N   1 
ATOM   1841  C CA  . ASP B  1 54  ? 44.730  8.898   144.095 1.00 35.98  ? 78  ASP B CA  1 
ATOM   1842  C C   . ASP B  1 54  ? 43.646  8.940   142.998 1.00 34.57  ? 78  ASP B C   1 
ATOM   1843  O O   . ASP B  1 54  ? 42.818  9.839   142.991 1.00 32.75  ? 78  ASP B O   1 
ATOM   1844  C CB  . ASP B  1 54  ? 45.519  10.188  143.975 1.00 37.34  ? 78  ASP B CB  1 
ATOM   1845  C CG  . ASP B  1 54  ? 46.519  10.327  145.036 1.00 37.34  ? 78  ASP B CG  1 
ATOM   1846  O OD1 . ASP B  1 54  ? 46.114  10.075  146.199 1.00 37.98  ? 78  ASP B OD1 1 
ATOM   1847  O OD2 . ASP B  1 54  ? 47.684  10.671  144.678 1.00 36.49  ? 78  ASP B OD2 1 
ATOM   1848  N N   . PHE B  1 55  ? 43.652  8.012   142.068 1.00 34.08  ? 79  PHE B N   1 
ATOM   1849  C CA  . PHE B  1 55  ? 42.623  7.979   141.016 1.00 34.45  ? 79  PHE B CA  1 
ATOM   1850  C C   . PHE B  1 55  ? 41.602  6.816   141.080 1.00 36.37  ? 79  PHE B C   1 
ATOM   1851  O O   . PHE B  1 55  ? 40.473  6.906   140.563 1.00 36.13  ? 79  PHE B O   1 
ATOM   1852  C CB  . PHE B  1 55  ? 43.353  7.996   139.710 1.00 32.61  ? 79  PHE B CB  1 
ATOM   1853  C CG  . PHE B  1 55  ? 44.184  9.237   139.515 1.00 30.60  ? 79  PHE B CG  1 
ATOM   1854  C CD1 . PHE B  1 55  ? 45.387  9.366   140.097 1.00 30.69  ? 79  PHE B CD1 1 
ATOM   1855  C CD2 . PHE B  1 55  ? 43.750  10.246  138.719 1.00 30.27  ? 79  PHE B CD2 1 
ATOM   1856  C CE1 . PHE B  1 55  ? 46.151  10.517  139.907 1.00 31.13  ? 79  PHE B CE1 1 
ATOM   1857  C CE2 . PHE B  1 55  ? 44.499  11.374  138.511 1.00 30.20  ? 79  PHE B CE2 1 
ATOM   1858  C CZ  . PHE B  1 55  ? 45.692  11.523  139.115 1.00 30.20  ? 79  PHE B CZ  1 
ATOM   1859  N N   . LEU B  1 56  ? 41.995  5.770   141.805 1.00 40.24  ? 80  LEU B N   1 
ATOM   1860  C CA  . LEU B  1 56  ? 41.377  4.460   141.802 1.00 41.21  ? 80  LEU B CA  1 
ATOM   1861  C C   . LEU B  1 56  ? 41.172  4.087   143.217 1.00 40.52  ? 80  LEU B C   1 
ATOM   1862  O O   . LEU B  1 56  ? 42.127  3.679   143.887 1.00 39.79  ? 80  LEU B O   1 
ATOM   1863  C CB  . LEU B  1 56  ? 42.357  3.454   141.198 1.00 44.93  ? 80  LEU B CB  1 
ATOM   1864  C CG  . LEU B  1 56  ? 41.723  2.399   140.323 1.00 50.28  ? 80  LEU B CG  1 
ATOM   1865  C CD1 . LEU B  1 56  ? 40.907  3.081   139.212 1.00 55.79  ? 80  LEU B CD1 1 
ATOM   1866  C CD2 . LEU B  1 56  ? 42.783  1.511   139.731 1.00 50.21  ? 80  LEU B CD2 1 
ATOM   1867  N N   . PRO B  1 57  ? 39.940  4.214   143.713 1.00 41.96  ? 81  PRO B N   1 
ATOM   1868  C CA  . PRO B  1 57  ? 39.794  3.833   145.136 1.00 42.90  ? 81  PRO B CA  1 
ATOM   1869  C C   . PRO B  1 57  ? 39.823  2.313   145.377 1.00 43.63  ? 81  PRO B C   1 
ATOM   1870  O O   . PRO B  1 57  ? 39.836  1.484   144.414 1.00 38.57  ? 81  PRO B O   1 
ATOM   1871  C CB  . PRO B  1 57  ? 38.462  4.439   145.538 1.00 41.21  ? 81  PRO B CB  1 
ATOM   1872  C CG  . PRO B  1 57  ? 37.705  4.527   144.276 1.00 41.68  ? 81  PRO B CG  1 
ATOM   1873  C CD  . PRO B  1 57  ? 38.672  4.657   143.122 1.00 41.95  ? 81  PRO B CD  1 
ATOM   1874  N N   . PRO B  1 58  ? 39.903  1.944   146.661 1.00 46.46  ? 82  PRO B N   1 
ATOM   1875  C CA  . PRO B  1 58  ? 39.721  0.521   147.032 1.00 48.38  ? 82  PRO B CA  1 
ATOM   1876  C C   . PRO B  1 58  ? 38.347  -0.087  146.611 1.00 45.80  ? 82  PRO B C   1 
ATOM   1877  O O   . PRO B  1 58  ? 37.327  0.607   146.634 1.00 41.95  ? 82  PRO B O   1 
ATOM   1878  C CB  . PRO B  1 58  ? 39.916  0.532   148.563 1.00 47.81  ? 82  PRO B CB  1 
ATOM   1879  C CG  . PRO B  1 58  ? 40.875  1.664   148.772 1.00 47.70  ? 82  PRO B CG  1 
ATOM   1880  C CD  . PRO B  1 58  ? 40.459  2.731   147.778 1.00 46.50  ? 82  PRO B CD  1 
ATOM   1881  N N   . GLY B  1 59  ? 38.392  -1.357  146.187 1.00 46.64  ? 83  GLY B N   1 
ATOM   1882  C CA  . GLY B  1 59  ? 37.225  -2.175  145.832 1.00 48.24  ? 83  GLY B CA  1 
ATOM   1883  C C   . GLY B  1 59  ? 36.628  -2.837  147.063 1.00 48.39  ? 83  GLY B C   1 
ATOM   1884  O O   . GLY B  1 59  ? 36.626  -2.261  148.125 1.00 47.91  ? 83  GLY B O   1 
ATOM   1885  N N   . GLY B  1 60  ? 36.138  -4.055  146.916 1.00 51.35  ? 84  GLY B N   1 
ATOM   1886  C CA  . GLY B  1 60  ? 35.529  -4.789  148.010 1.00 50.71  ? 84  GLY B CA  1 
ATOM   1887  C C   . GLY B  1 60  ? 35.393  -6.293  147.822 1.00 52.11  ? 84  GLY B C   1 
ATOM   1888  O O   . GLY B  1 60  ? 35.252  -6.841  146.700 1.00 49.83  ? 84  GLY B O   1 
ATOM   1889  N N   . GLY B  1 61  ? 35.375  -6.962  148.972 1.00 53.64  ? 85  GLY B N   1 
ATOM   1890  C CA  . GLY B  1 61  ? 35.510  -8.410  149.062 1.00 52.95  ? 85  GLY B CA  1 
ATOM   1891  C C   . GLY B  1 61  ? 36.794  -8.895  148.384 1.00 52.91  ? 85  GLY B C   1 
ATOM   1892  O O   . GLY B  1 61  ? 37.913  -8.323  148.504 1.00 49.05  ? 85  GLY B O   1 
ATOM   1893  N N   . SER B  1 62  ? 36.573  -9.937  147.606 1.00 55.14  ? 86  SER B N   1 
ATOM   1894  C CA  . SER B  1 62  ? 37.598  -10.655 146.874 1.00 53.82  ? 86  SER B CA  1 
ATOM   1895  C C   . SER B  1 62  ? 38.156  -9.888  145.711 1.00 53.49  ? 86  SER B C   1 
ATOM   1896  O O   . SER B  1 62  ? 39.125  -10.374 145.123 1.00 54.65  ? 86  SER B O   1 
ATOM   1897  C CB  . SER B  1 62  ? 36.994  -11.956 146.353 1.00 53.46  ? 86  SER B CB  1 
ATOM   1898  O OG  . SER B  1 62  ? 36.461  -12.681 147.463 1.00 54.76  ? 86  SER B OG  1 
ATOM   1899  N N   . ASN B  1 63  ? 37.530  -8.736  145.362 1.00 53.27  ? 87  ASN B N   1 
ATOM   1900  C CA  . ASN B  1 63  ? 38.021  -7.765  144.349 1.00 48.82  ? 87  ASN B CA  1 
ATOM   1901  C C   . ASN B  1 63  ? 38.588  -6.485  145.037 1.00 47.78  ? 87  ASN B C   1 
ATOM   1902  O O   . ASN B  1 63  ? 37.860  -5.528  145.277 1.00 44.71  ? 87  ASN B O   1 
ATOM   1903  C CB  . ASN B  1 63  ? 36.908  -7.412  143.362 1.00 47.42  ? 87  ASN B CB  1 
ATOM   1904  C CG  . ASN B  1 63  ? 36.492  -8.589  142.495 1.00 47.19  ? 87  ASN B CG  1 
ATOM   1905  O OD1 . ASN B  1 63  ? 37.299  -9.155  141.739 1.00 46.61  ? 87  ASN B OD1 1 
ATOM   1906  N ND2 . ASN B  1 63  ? 35.221  -8.969  142.602 1.00 47.81  ? 87  ASN B ND2 1 
ATOM   1907  N N   . PRO B  1 64  ? 39.908  -6.479  145.349 1.00 47.48  ? 88  PRO B N   1 
ATOM   1908  C CA  . PRO B  1 64  ? 40.473  -5.374  146.123 1.00 46.65  ? 88  PRO B CA  1 
ATOM   1909  C C   . PRO B  1 64  ? 40.486  -4.047  145.402 1.00 46.31  ? 88  PRO B C   1 
ATOM   1910  O O   . PRO B  1 64  ? 40.485  -3.005  146.055 1.00 42.23  ? 88  PRO B O   1 
ATOM   1911  C CB  . PRO B  1 64  ? 41.910  -5.805  146.387 1.00 47.16  ? 88  PRO B CB  1 
ATOM   1912  C CG  . PRO B  1 64  ? 42.151  -7.038  145.564 1.00 45.93  ? 88  PRO B CG  1 
ATOM   1913  C CD  . PRO B  1 64  ? 40.950  -7.364  144.789 1.00 46.12  ? 88  PRO B CD  1 
ATOM   1914  N N   . ARG B  1 65  ? 40.529  -4.046  144.077 1.00 48.16  ? 89  ARG B N   1 
ATOM   1915  C CA  . ARG B  1 65  ? 40.522  -2.753  143.411 1.00 49.55  ? 89  ARG B CA  1 
ATOM   1916  C C   . ARG B  1 65  ? 39.252  -2.551  142.656 1.00 46.58  ? 89  ARG B C   1 
ATOM   1917  O O   . ARG B  1 65  ? 38.597  -3.504  142.250 1.00 48.00  ? 89  ARG B O   1 
ATOM   1918  C CB  . ARG B  1 65  ? 41.759  -2.619  142.575 1.00 53.39  ? 89  ARG B CB  1 
ATOM   1919  C CG  . ARG B  1 65  ? 42.969  -2.579  143.487 1.00 58.39  ? 89  ARG B CG  1 
ATOM   1920  C CD  . ARG B  1 65  ? 44.181  -3.327  142.987 1.00 60.61  ? 89  ARG B CD  1 
ATOM   1921  N NE  . ARG B  1 65  ? 44.053  -4.770  142.774 1.00 63.77  ? 89  ARG B NE  1 
ATOM   1922  C CZ  . ARG B  1 65  ? 44.711  -5.746  143.430 1.00 64.69  ? 89  ARG B CZ  1 
ATOM   1923  N NH1 . ARG B  1 65  ? 44.518  -6.996  143.027 1.00 67.23  ? 89  ARG B NH1 1 
ATOM   1924  N NH2 . ARG B  1 65  ? 45.535  -5.530  144.474 1.00 62.76  ? 89  ARG B NH2 1 
ATOM   1925  N N   . SER B  1 66  ? 38.888  -1.296  142.516 1.00 44.34  ? 90  SER B N   1 
ATOM   1926  C CA  . SER B  1 66  ? 37.611  -0.940  141.952 1.00 42.97  ? 90  SER B CA  1 
ATOM   1927  C C   . SER B  1 66  ? 37.581  -1.238  140.467 1.00 42.67  ? 90  SER B C   1 
ATOM   1928  O O   . SER B  1 66  ? 36.511  -1.388  139.940 1.00 43.22  ? 90  SER B O   1 
ATOM   1929  C CB  . SER B  1 66  ? 37.307  0.538   142.206 1.00 42.92  ? 90  SER B CB  1 
ATOM   1930  O OG  . SER B  1 66  ? 38.477  1.363   142.052 1.00 40.96  ? 90  SER B OG  1 
ATOM   1931  N N   . VAL B  1 67  ? 38.732  -1.307  139.788 1.00 42.53  ? 91  VAL B N   1 
ATOM   1932  C CA  . VAL B  1 67  ? 38.746  -1.845  138.423 1.00 43.29  ? 91  VAL B CA  1 
ATOM   1933  C C   . VAL B  1 67  ? 39.408  -3.209  138.460 1.00 43.11  ? 91  VAL B C   1 
ATOM   1934  O O   . VAL B  1 67  ? 40.510  -3.356  139.011 1.00 43.65  ? 91  VAL B O   1 
ATOM   1935  C CB  . VAL B  1 67  ? 39.343  -0.896  137.351 1.00 45.23  ? 91  VAL B CB  1 
ATOM   1936  C CG1 . VAL B  1 67  ? 39.008  0.544   137.670 1.00 46.25  ? 91  VAL B CG1 1 
ATOM   1937  C CG2 . VAL B  1 67  ? 40.820  -1.025  137.184 1.00 45.34  ? 91  VAL B CG2 1 
ATOM   1938  N N   . PRO B  1 68  ? 38.715  -4.240  137.954 1.00 41.84  ? 92  PRO B N   1 
ATOM   1939  C CA  . PRO B  1 68  ? 39.201  -5.604  138.152 1.00 41.62  ? 92  PRO B CA  1 
ATOM   1940  C C   . PRO B  1 68  ? 40.158  -6.041  137.071 1.00 37.07  ? 92  PRO B C   1 
ATOM   1941  O O   . PRO B  1 68  ? 39.814  -6.815  136.202 1.00 36.67  ? 92  PRO B O   1 
ATOM   1942  C CB  . PRO B  1 68  ? 37.915  -6.422  138.179 1.00 42.77  ? 92  PRO B CB  1 
ATOM   1943  C CG  . PRO B  1 68  ? 37.044  -5.689  137.263 1.00 42.84  ? 92  PRO B CG  1 
ATOM   1944  C CD  . PRO B  1 68  ? 37.329  -4.243  137.490 1.00 42.36  ? 92  PRO B CD  1 
ATOM   1945  N N   . PHE B  1 69  ? 41.354  -5.505  137.162 1.00 35.17  ? 93  PHE B N   1 
ATOM   1946  C CA  . PHE B  1 69  ? 42.451  -5.836  136.260 1.00 37.03  ? 93  PHE B CA  1 
ATOM   1947  C C   . PHE B  1 69  ? 43.729  -6.058  137.050 1.00 36.60  ? 93  PHE B C   1 
ATOM   1948  O O   . PHE B  1 69  ? 43.873  -5.545  138.169 1.00 37.38  ? 93  PHE B O   1 
ATOM   1949  C CB  . PHE B  1 69  ? 42.698  -4.760  135.205 1.00 37.22  ? 93  PHE B CB  1 
ATOM   1950  C CG  . PHE B  1 69  ? 41.619  -4.663  134.220 1.00 38.90  ? 93  PHE B CG  1 
ATOM   1951  C CD1 . PHE B  1 69  ? 41.661  -5.427  133.088 1.00 40.49  ? 93  PHE B CD1 1 
ATOM   1952  C CD2 . PHE B  1 69  ? 40.555  -3.825  134.432 1.00 40.75  ? 93  PHE B CD2 1 
ATOM   1953  C CE1 . PHE B  1 69  ? 40.655  -5.373  132.167 1.00 41.19  ? 93  PHE B CE1 1 
ATOM   1954  C CE2 . PHE B  1 69  ? 39.519  -3.780  133.531 1.00 41.98  ? 93  PHE B CE2 1 
ATOM   1955  C CZ  . PHE B  1 69  ? 39.561  -4.571  132.402 1.00 41.66  ? 93  PHE B CZ  1 
ATOM   1956  N N   . GLU B  1 70  ? 44.642  -6.798  136.437 1.00 36.00  ? 94  GLU B N   1 
ATOM   1957  C CA  . GLU B  1 70  ? 45.861  -7.199  137.059 1.00 36.29  ? 94  GLU B CA  1 
ATOM   1958  C C   . GLU B  1 70  ? 47.031  -6.254  136.835 1.00 34.08  ? 94  GLU B C   1 
ATOM   1959  O O   . GLU B  1 70  ? 47.811  -6.032  137.755 1.00 33.21  ? 94  GLU B O   1 
ATOM   1960  C CB  . GLU B  1 70  ? 46.250  -8.562  136.558 1.00 39.44  ? 94  GLU B CB  1 
ATOM   1961  C CG  . GLU B  1 70  ? 47.342  -9.205  137.399 1.00 44.27  ? 94  GLU B CG  1 
ATOM   1962  C CD  . GLU B  1 70  ? 46.985  -9.303  138.902 1.00 47.57  ? 94  GLU B CD  1 
ATOM   1963  O OE1 . GLU B  1 70  ? 47.912  -8.953  139.751 1.00 44.73  ? 94  GLU B OE1 1 
ATOM   1964  O OE2 . GLU B  1 70  ? 45.779  -9.718  139.174 1.00 46.38  ? 94  GLU B OE2 1 
ATOM   1965  N N   . TYR B  1 71  ? 47.167  -5.734  135.621 1.00 33.41  ? 95  TYR B N   1 
ATOM   1966  C CA  . TYR B  1 71  ? 48.315  -4.900  135.217 1.00 33.06  ? 95  TYR B CA  1 
ATOM   1967  C C   . TYR B  1 71  ? 47.800  -3.596  134.686 1.00 32.39  ? 95  TYR B C   1 
ATOM   1968  O O   . TYR B  1 71  ? 46.685  -3.537  134.173 1.00 32.39  ? 95  TYR B O   1 
ATOM   1969  C CB  . TYR B  1 71  ? 49.141  -5.553  134.103 1.00 33.56  ? 95  TYR B CB  1 
ATOM   1970  C CG  . TYR B  1 71  ? 49.202  -7.078  134.089 1.00 34.57  ? 95  TYR B CG  1 
ATOM   1971  C CD1 . TYR B  1 71  ? 49.723  -7.807  135.203 1.00 34.61  ? 95  TYR B CD1 1 
ATOM   1972  C CD2 . TYR B  1 71  ? 48.774  -7.799  132.955 1.00 33.82  ? 95  TYR B CD2 1 
ATOM   1973  C CE1 . TYR B  1 71  ? 49.793  -9.206  135.178 1.00 34.74  ? 95  TYR B CE1 1 
ATOM   1974  C CE2 . TYR B  1 71  ? 48.850  -9.191  132.926 1.00 34.71  ? 95  TYR B CE2 1 
ATOM   1975  C CZ  . TYR B  1 71  ? 49.344  -9.903  134.044 1.00 35.44  ? 95  TYR B CZ  1 
ATOM   1976  O OH  . TYR B  1 71  ? 49.405  -11.316 134.011 1.00 37.85  ? 95  TYR B OH  1 
ATOM   1977  N N   . TYR B  1 72  ? 48.596  -2.539  134.780 1.00 32.55  ? 96  TYR B N   1 
ATOM   1978  C CA  . TYR B  1 72  ? 48.243  -1.276  134.103 1.00 32.52  ? 96  TYR B CA  1 
ATOM   1979  C C   . TYR B  1 72  ? 49.473  -0.632  133.565 1.00 32.51  ? 96  TYR B C   1 
ATOM   1980  O O   . TYR B  1 72  ? 50.570  -1.056  133.899 1.00 33.82  ? 96  TYR B O   1 
ATOM   1981  C CB  . TYR B  1 72  ? 47.525  -0.332  135.039 1.00 32.37  ? 96  TYR B CB  1 
ATOM   1982  C CG  . TYR B  1 72  ? 48.441  0.340   136.014 1.00 33.13  ? 96  TYR B CG  1 
ATOM   1983  C CD1 . TYR B  1 72  ? 48.926  -0.352  137.124 1.00 34.55  ? 96  TYR B CD1 1 
ATOM   1984  C CD2 . TYR B  1 72  ? 48.845  1.665   135.838 1.00 32.62  ? 96  TYR B CD2 1 
ATOM   1985  C CE1 . TYR B  1 72  ? 49.795  0.268   138.055 1.00 34.94  ? 96  TYR B CE1 1 
ATOM   1986  C CE2 . TYR B  1 72  ? 49.680  2.309   136.756 1.00 33.31  ? 96  TYR B CE2 1 
ATOM   1987  C CZ  . TYR B  1 72  ? 50.180  1.617   137.877 1.00 34.33  ? 96  TYR B CZ  1 
ATOM   1988  O OH  . TYR B  1 72  ? 51.054  2.231   138.805 1.00 32.02  ? 96  TYR B OH  1 
ATOM   1989  N N   . ARG B  1 73  ? 49.305  0.366   132.709 1.00 33.02  ? 97  ARG B N   1 
ATOM   1990  C CA  . ARG B  1 73  ? 50.393  1.313   132.413 1.00 33.87  ? 97  ARG B CA  1 
ATOM   1991  C C   . ARG B  1 73  ? 49.820  2.602   132.026 1.00 33.99  ? 97  ARG B C   1 
ATOM   1992  O O   . ARG B  1 73  ? 48.705  2.650   131.467 1.00 32.93  ? 97  ARG B O   1 
ATOM   1993  C CB  . ARG B  1 73  ? 51.301  0.841   131.302 1.00 35.92  ? 97  ARG B CB  1 
ATOM   1994  C CG  . ARG B  1 73  ? 50.617  0.541   129.959 1.00 36.46  ? 97  ARG B CG  1 
ATOM   1995  C CD  . ARG B  1 73  ? 51.539  -0.320  129.100 1.00 35.94  ? 97  ARG B CD  1 
ATOM   1996  N NE  . ARG B  1 73  ? 50.971  -0.585  127.794 1.00 36.36  ? 97  ARG B NE  1 
ATOM   1997  C CZ  . ARG B  1 73  ? 51.525  -1.335  126.848 1.00 36.65  ? 97  ARG B CZ  1 
ATOM   1998  N NH1 . ARG B  1 73  ? 50.905  -1.516  125.728 1.00 34.45  ? 97  ARG B NH1 1 
ATOM   1999  N NH2 . ARG B  1 73  ? 52.698  -1.927  127.017 1.00 39.74  ? 97  ARG B NH2 1 
ATOM   2000  N N   . ILE B  1 74  ? 50.558  3.665   132.320 1.00 34.34  ? 98  ILE B N   1 
ATOM   2001  C CA  . ILE B  1 74  ? 49.977  4.984   132.154 1.00 34.67  ? 98  ILE B CA  1 
ATOM   2002  C C   . ILE B  1 74  ? 50.467  5.473   130.842 1.00 36.42  ? 98  ILE B C   1 
ATOM   2003  O O   . ILE B  1 74  ? 51.629  5.675   130.668 1.00 40.93  ? 98  ILE B O   1 
ATOM   2004  C CB  . ILE B  1 74  ? 50.329  5.967   133.255 1.00 33.89  ? 98  ILE B CB  1 
ATOM   2005  C CG1 . ILE B  1 74  ? 49.905  5.426   134.600 1.00 33.30  ? 98  ILE B CG1 1 
ATOM   2006  C CG2 . ILE B  1 74  ? 49.594  7.292   133.039 1.00 34.15  ? 98  ILE B CG2 1 
ATOM   2007  C CD1 . ILE B  1 74  ? 50.367  6.331   135.707 1.00 33.79  ? 98  ILE B CD1 1 
ATOM   2008  N N   . ARG B  1 75  ? 49.546  5.682   129.936 1.00 38.79  ? 99  ARG B N   1 
ATOM   2009  C CA  . ARG B  1 75  ? 49.831  6.009   128.543 1.00 40.46  ? 99  ARG B CA  1 
ATOM   2010  C C   . ARG B  1 75  ? 50.192  7.523   128.353 1.00 38.15  ? 99  ARG B C   1 
ATOM   2011  O O   . ARG B  1 75  ? 51.231  7.893   127.801 1.00 35.38  ? 99  ARG B O   1 
ATOM   2012  C CB  . ARG B  1 75  ? 48.597  5.629   127.701 1.00 43.48  ? 99  ARG B CB  1 
ATOM   2013  C CG  . ARG B  1 75  ? 48.934  4.782   126.501 1.00 49.45  ? 99  ARG B CG  1 
ATOM   2014  C CD  . ARG B  1 75  ? 49.084  3.315   126.831 1.00 54.34  ? 99  ARG B CD  1 
ATOM   2015  N NE  . ARG B  1 75  ? 50.150  2.658   126.029 1.00 62.31  ? 99  ARG B NE  1 
ATOM   2016  C CZ  . ARG B  1 75  ? 50.094  2.335   124.727 1.00 65.36  ? 99  ARG B CZ  1 
ATOM   2017  N NH1 . ARG B  1 75  ? 51.130  1.703   124.172 1.00 63.67  ? 99  ARG B NH1 1 
ATOM   2018  N NH2 . ARG B  1 75  ? 49.018  2.634   123.972 1.00 69.25  ? 99  ARG B NH2 1 
ATOM   2019  N N   . LYS B  1 76  ? 49.301  8.367   128.842 1.00 37.15  ? 100 LYS B N   1 
ATOM   2020  C CA  . LYS B  1 76  ? 49.398  9.804   128.743 1.00 36.25  ? 100 LYS B CA  1 
ATOM   2021  C C   . LYS B  1 76  ? 48.948  10.364  130.044 1.00 34.09  ? 100 LYS B C   1 
ATOM   2022  O O   . LYS B  1 76  ? 48.186  9.725   130.699 1.00 34.44  ? 100 LYS B O   1 
ATOM   2023  C CB  . LYS B  1 76  ? 48.457  10.278  127.624 1.00 37.12  ? 100 LYS B CB  1 
ATOM   2024  C CG  . LYS B  1 76  ? 49.148  10.811  126.372 1.00 37.31  ? 100 LYS B CG  1 
ATOM   2025  C CD  . LYS B  1 76  ? 50.300  10.001  125.829 1.00 36.71  ? 100 LYS B CD  1 
ATOM   2026  C CE  . LYS B  1 76  ? 50.914  10.653  124.601 1.00 37.49  ? 100 LYS B CE  1 
ATOM   2027  N NZ  . LYS B  1 76  ? 52.408  10.626  124.679 1.00 37.80  ? 100 LYS B NZ  1 
ATOM   2028  N N   . VAL B  1 77  ? 49.424  11.539  130.424 1.00 34.76  ? 101 VAL B N   1 
ATOM   2029  C CA  . VAL B  1 77  ? 48.800  12.332  131.519 1.00 36.86  ? 101 VAL B CA  1 
ATOM   2030  C C   . VAL B  1 77  ? 48.482  13.728  131.028 1.00 34.78  ? 101 VAL B C   1 
ATOM   2031  O O   . VAL B  1 77  ? 49.321  14.296  130.363 1.00 35.20  ? 101 VAL B O   1 
ATOM   2032  C CB  . VAL B  1 77  ? 49.703  12.485  132.732 1.00 38.09  ? 101 VAL B CB  1 
ATOM   2033  C CG1 . VAL B  1 77  ? 48.978  13.096  133.888 1.00 40.91  ? 101 VAL B CG1 1 
ATOM   2034  C CG2 . VAL B  1 77  ? 50.152  11.153  133.177 1.00 39.34  ? 101 VAL B CG2 1 
ATOM   2035  N N   . LYS B  1 78  ? 47.294  14.240  131.346 1.00 33.25  ? 102 LYS B N   1 
ATOM   2036  C CA  . LYS B  1 78  ? 46.974  15.602  131.114 1.00 34.80  ? 102 LYS B CA  1 
ATOM   2037  C C   . LYS B  1 78  ? 46.915  16.322  132.454 1.00 34.48  ? 102 LYS B C   1 
ATOM   2038  O O   . LYS B  1 78  ? 46.193  15.916  133.346 1.00 34.20  ? 102 LYS B O   1 
ATOM   2039  C CB  . LYS B  1 78  ? 45.651  15.729  130.398 1.00 38.00  ? 102 LYS B CB  1 
ATOM   2040  C CG  . LYS B  1 78  ? 45.366  17.149  129.930 1.00 41.41  ? 102 LYS B CG  1 
ATOM   2041  C CD  . LYS B  1 78  ? 44.108  17.264  129.076 1.00 46.94  ? 102 LYS B CD  1 
ATOM   2042  C CE  . LYS B  1 78  ? 44.345  18.054  127.766 1.00 52.36  ? 102 LYS B CE  1 
ATOM   2043  N NZ  . LYS B  1 78  ? 43.276  19.078  127.445 1.00 54.70  ? 102 LYS B NZ  1 
ATOM   2044  N N   . VAL B  1 79  ? 47.694  17.387  132.593 1.00 34.88  ? 103 VAL B N   1 
ATOM   2045  C CA  . VAL B  1 79  ? 47.564  18.329  133.728 1.00 36.08  ? 103 VAL B CA  1 
ATOM   2046  C C   . VAL B  1 79  ? 46.962  19.689  133.317 1.00 35.12  ? 103 VAL B C   1 
ATOM   2047  O O   . VAL B  1 79  ? 47.548  20.429  132.535 1.00 34.81  ? 103 VAL B O   1 
ATOM   2048  C CB  . VAL B  1 79  ? 48.934  18.575  134.447 1.00 35.78  ? 103 VAL B CB  1 
ATOM   2049  C CG1 . VAL B  1 79  ? 48.759  19.513  135.647 1.00 35.06  ? 103 VAL B CG1 1 
ATOM   2050  C CG2 . VAL B  1 79  ? 49.543  17.252  134.907 1.00 35.45  ? 103 VAL B CG2 1 
ATOM   2051  N N   . GLU B  1 80  ? 45.822  20.032  133.889 1.00 35.25  ? 104 GLU B N   1 
ATOM   2052  C CA  . GLU B  1 80  ? 45.131  21.276  133.553 1.00 34.93  ? 104 GLU B CA  1 
ATOM   2053  C C   . GLU B  1 80  ? 45.184  22.238  134.721 1.00 35.08  ? 104 GLU B C   1 
ATOM   2054  O O   . GLU B  1 80  ? 44.693  21.923  135.791 1.00 35.07  ? 104 GLU B O   1 
ATOM   2055  C CB  . GLU B  1 80  ? 43.670  20.964  133.243 1.00 34.68  ? 104 GLU B CB  1 
ATOM   2056  C CG  . GLU B  1 80  ? 43.560  20.164  131.980 1.00 35.09  ? 104 GLU B CG  1 
ATOM   2057  C CD  . GLU B  1 80  ? 42.168  19.681  131.663 1.00 33.56  ? 104 GLU B CD  1 
ATOM   2058  O OE1 . GLU B  1 80  ? 41.666  18.881  132.475 1.00 31.73  ? 104 GLU B OE1 1 
ATOM   2059  O OE2 . GLU B  1 80  ? 41.645  20.076  130.563 1.00 32.34  ? 104 GLU B OE2 1 
ATOM   2060  N N   . PHE B  1 81  ? 45.734  23.429  134.512 1.00 36.58  ? 105 PHE B N   1 
ATOM   2061  C CA  . PHE B  1 81  ? 45.589  24.500  135.496 1.00 36.82  ? 105 PHE B CA  1 
ATOM   2062  C C   . PHE B  1 81  ? 44.424  25.373  135.153 1.00 36.64  ? 105 PHE B C   1 
ATOM   2063  O O   . PHE B  1 81  ? 44.517  26.174  134.282 1.00 36.28  ? 105 PHE B O   1 
ATOM   2064  C CB  . PHE B  1 81  ? 46.850  25.301  135.595 1.00 35.71  ? 105 PHE B CB  1 
ATOM   2065  C CG  . PHE B  1 81  ? 47.999  24.512  136.110 1.00 34.50  ? 105 PHE B CG  1 
ATOM   2066  C CD1 . PHE B  1 81  ? 48.731  23.729  135.275 1.00 35.38  ? 105 PHE B CD1 1 
ATOM   2067  C CD2 . PHE B  1 81  ? 48.335  24.557  137.421 1.00 34.75  ? 105 PHE B CD2 1 
ATOM   2068  C CE1 . PHE B  1 81  ? 49.825  23.003  135.738 1.00 36.09  ? 105 PHE B CE1 1 
ATOM   2069  C CE2 . PHE B  1 81  ? 49.405  23.849  137.903 1.00 35.04  ? 105 PHE B CE2 1 
ATOM   2070  C CZ  . PHE B  1 81  ? 50.162  23.074  137.056 1.00 35.10  ? 105 PHE B CZ  1 
ATOM   2071  N N   . TRP B  1 82  ? 43.305  25.148  135.822 1.00 38.73  ? 106 TRP B N   1 
ATOM   2072  C CA  . TRP B  1 82  ? 42.128  25.993  135.664 1.00 39.28  ? 106 TRP B CA  1 
ATOM   2073  C C   . TRP B  1 82  ? 42.206  27.164  136.661 1.00 39.02  ? 106 TRP B C   1 
ATOM   2074  O O   . TRP B  1 82  ? 42.071  26.990  137.891 1.00 34.93  ? 106 TRP B O   1 
ATOM   2075  C CB  . TRP B  1 82  ? 40.848  25.193  135.926 1.00 39.88  ? 106 TRP B CB  1 
ATOM   2076  C CG  . TRP B  1 82  ? 40.632  23.982  135.081 1.00 38.61  ? 106 TRP B CG  1 
ATOM   2077  C CD1 . TRP B  1 82  ? 40.946  22.679  135.386 1.00 38.67  ? 106 TRP B CD1 1 
ATOM   2078  C CD2 . TRP B  1 82  ? 39.983  23.954  133.850 1.00 38.42  ? 106 TRP B CD2 1 
ATOM   2079  N NE1 . TRP B  1 82  ? 40.543  21.853  134.391 1.00 38.11  ? 106 TRP B NE1 1 
ATOM   2080  C CE2 . TRP B  1 82  ? 39.957  22.608  133.420 1.00 38.68  ? 106 TRP B CE2 1 
ATOM   2081  C CE3 . TRP B  1 82  ? 39.410  24.940  133.042 1.00 39.33  ? 106 TRP B CE3 1 
ATOM   2082  C CZ2 . TRP B  1 82  ? 39.381  22.219  132.199 1.00 39.83  ? 106 TRP B CZ2 1 
ATOM   2083  C CZ3 . TRP B  1 82  ? 38.820  24.561  131.810 1.00 39.23  ? 106 TRP B CZ3 1 
ATOM   2084  C CH2 . TRP B  1 82  ? 38.825  23.215  131.399 1.00 39.61  ? 106 TRP B CH2 1 
ATOM   2085  N N   . PRO B  1 83  ? 42.416  28.363  136.139 1.00 40.66  ? 107 PRO B N   1 
ATOM   2086  C CA  . PRO B  1 83  ? 42.500  29.508  137.032 1.00 41.96  ? 107 PRO B CA  1 
ATOM   2087  C C   . PRO B  1 83  ? 41.171  29.828  137.798 1.00 41.55  ? 107 PRO B C   1 
ATOM   2088  O O   . PRO B  1 83  ? 40.129  29.807  137.216 1.00 39.94  ? 107 PRO B O   1 
ATOM   2089  C CB  . PRO B  1 83  ? 42.861  30.644  136.060 1.00 41.27  ? 107 PRO B CB  1 
ATOM   2090  C CG  . PRO B  1 83  ? 42.136  30.285  134.823 1.00 41.07  ? 107 PRO B CG  1 
ATOM   2091  C CD  . PRO B  1 83  ? 42.310  28.786  134.735 1.00 41.75  ? 107 PRO B CD  1 
ATOM   2092  N N   . CYS B  1 84  ? 41.263  30.120  139.091 1.00 41.93  ? 108 CYS B N   1 
ATOM   2093  C CA  . CYS B  1 84  ? 40.201  30.760  139.855 1.00 41.79  ? 108 CYS B CA  1 
ATOM   2094  C C   . CYS B  1 84  ? 40.122  32.289  139.703 1.00 42.33  ? 108 CYS B C   1 
ATOM   2095  O O   . CYS B  1 84  ? 39.013  32.848  139.836 1.00 41.64  ? 108 CYS B O   1 
ATOM   2096  C CB  . CYS B  1 84  ? 40.358  30.435  141.343 1.00 42.85  ? 108 CYS B CB  1 
ATOM   2097  S SG  . CYS B  1 84  ? 40.393  28.648  141.756 1.00 45.32  ? 108 CYS B SG  1 
ATOM   2098  N N   . SER B  1 85  ? 41.249  32.969  139.436 1.00 43.91  ? 109 SER B N   1 
ATOM   2099  C CA  . SER B  1 85  ? 41.260  34.448  139.407 1.00 46.33  ? 109 SER B CA  1 
ATOM   2100  C C   . SER B  1 85  ? 40.466  34.972  138.217 1.00 47.52  ? 109 SER B C   1 
ATOM   2101  O O   . SER B  1 85  ? 40.541  34.413  137.118 1.00 48.11  ? 109 SER B O   1 
ATOM   2102  C CB  . SER B  1 85  ? 42.670  35.004  139.329 1.00 49.34  ? 109 SER B CB  1 
ATOM   2103  O OG  . SER B  1 85  ? 43.487  34.549  140.395 1.00 52.53  ? 109 SER B OG  1 
ATOM   2104  N N   . PRO B  1 86  ? 39.680  36.041  138.422 1.00 48.58  ? 110 PRO B N   1 
ATOM   2105  C CA  . PRO B  1 86  ? 38.820  36.559  137.332 1.00 47.87  ? 110 PRO B CA  1 
ATOM   2106  C C   . PRO B  1 86  ? 39.605  37.235  136.239 1.00 48.84  ? 110 PRO B C   1 
ATOM   2107  O O   . PRO B  1 86  ? 40.786  37.604  136.424 1.00 47.35  ? 110 PRO B O   1 
ATOM   2108  C CB  . PRO B  1 86  ? 37.966  37.604  138.041 1.00 48.56  ? 110 PRO B CB  1 
ATOM   2109  C CG  . PRO B  1 86  ? 38.851  38.096  139.157 1.00 48.05  ? 110 PRO B CG  1 
ATOM   2110  C CD  . PRO B  1 86  ? 39.643  36.902  139.624 1.00 47.92  ? 110 PRO B CD  1 
ATOM   2111  N N   . ILE B  1 87  ? 38.951  37.473  135.119 1.00 54.01  ? 111 ILE B N   1 
ATOM   2112  C CA  . ILE B  1 87  ? 39.718  37.973  133.967 1.00 59.09  ? 111 ILE B CA  1 
ATOM   2113  C C   . ILE B  1 87  ? 40.121  39.438  134.108 1.00 62.06  ? 111 ILE B C   1 
ATOM   2114  O O   . ILE B  1 87  ? 40.980  39.923  133.317 1.00 66.78  ? 111 ILE B O   1 
ATOM   2115  C CB  . ILE B  1 87  ? 38.991  37.754  132.659 1.00 62.97  ? 111 ILE B CB  1 
ATOM   2116  C CG1 . ILE B  1 87  ? 37.886  38.794  132.487 1.00 65.71  ? 111 ILE B CG1 1 
ATOM   2117  C CG2 . ILE B  1 87  ? 38.476  36.293  132.548 1.00 63.63  ? 111 ILE B CG2 1 
ATOM   2118  C CD1 . ILE B  1 87  ? 37.085  38.523  131.224 1.00 67.71  ? 111 ILE B CD1 1 
ATOM   2119  N N   . THR B  1 88  ? 39.516  40.103  135.121 1.00 58.98  ? 112 THR B N   1 
ATOM   2120  C CA  . THR B  1 88  ? 39.888  41.447  135.576 1.00 54.47  ? 112 THR B CA  1 
ATOM   2121  C C   . THR B  1 88  ? 41.129  41.546  136.422 1.00 51.73  ? 112 THR B C   1 
ATOM   2122  O O   . THR B  1 88  ? 41.569  42.649  136.678 1.00 54.24  ? 112 THR B O   1 
ATOM   2123  C CB  . THR B  1 88  ? 38.757  42.178  136.404 1.00 55.69  ? 112 THR B CB  1 
ATOM   2124  O OG1 . THR B  1 88  ? 38.650  41.686  137.778 1.00 51.08  ? 112 THR B OG1 1 
ATOM   2125  C CG2 . THR B  1 88  ? 37.404  42.163  135.636 1.00 54.55  ? 112 THR B CG2 1 
ATOM   2126  N N   . GLN B  1 89  ? 41.684  40.458  136.926 1.00 49.27  ? 113 GLN B N   1 
ATOM   2127  C CA  . GLN B  1 89  ? 42.820  40.641  137.881 1.00 51.23  ? 113 GLN B CA  1 
ATOM   2128  C C   . GLN B  1 89  ? 44.052  41.246  137.175 1.00 51.42  ? 113 GLN B C   1 
ATOM   2129  O O   . GLN B  1 89  ? 44.270  40.984  135.976 1.00 56.74  ? 113 GLN B O   1 
ATOM   2130  C CB  . GLN B  1 89  ? 43.173  39.332  138.648 1.00 47.74  ? 113 GLN B CB  1 
ATOM   2131  C CG  . GLN B  1 89  ? 44.110  39.452  139.861 1.00 43.93  ? 113 GLN B CG  1 
ATOM   2132  C CD  . GLN B  1 89  ? 44.051  38.185  140.709 1.00 43.63  ? 113 GLN B CD  1 
ATOM   2133  O OE1 . GLN B  1 89  ? 42.979  37.781  141.122 1.00 45.82  ? 113 GLN B OE1 1 
ATOM   2134  N NE2 . GLN B  1 89  ? 45.178  37.528  140.922 1.00 41.54  ? 113 GLN B NE2 1 
ATOM   2135  N N   . GLY B  1 90  ? 44.792  42.083  137.914 1.00 49.83  ? 114 GLY B N   1 
ATOM   2136  C CA  . GLY B  1 90  ? 46.083  42.590  137.493 1.00 48.28  ? 114 GLY B CA  1 
ATOM   2137  C C   . GLY B  1 90  ? 47.303  41.930  138.126 1.00 49.96  ? 114 GLY B C   1 
ATOM   2138  O O   . GLY B  1 90  ? 47.312  40.731  138.515 1.00 60.08  ? 114 GLY B O   1 
ATOM   2139  N N   . ASP B  1 91  ? 48.336  42.744  138.269 1.00 48.17  ? 115 ASP B N   1 
ATOM   2140  C CA  . ASP B  1 91  ? 49.701  42.309  138.436 1.00 46.26  ? 115 ASP B CA  1 
ATOM   2141  C C   . ASP B  1 91  ? 49.987  40.938  137.793 1.00 44.62  ? 115 ASP B C   1 
ATOM   2142  O O   . ASP B  1 91  ? 50.428  39.983  138.427 1.00 47.21  ? 115 ASP B O   1 
ATOM   2143  C CB  . ASP B  1 91  ? 50.088  42.374  139.888 1.00 46.97  ? 115 ASP B CB  1 
ATOM   2144  C CG  . ASP B  1 91  ? 51.574  42.261  140.074 1.00 48.66  ? 115 ASP B CG  1 
ATOM   2145  O OD1 . ASP B  1 91  ? 52.304  42.763  139.184 1.00 48.73  ? 115 ASP B OD1 1 
ATOM   2146  O OD2 . ASP B  1 91  ? 51.998  41.654  141.087 1.00 48.67  ? 115 ASP B OD2 1 
ATOM   2147  N N   . ARG B  1 92  ? 49.713  40.877  136.502 1.00 42.70  ? 116 ARG B N   1 
ATOM   2148  C CA  . ARG B  1 92  ? 49.873  39.676  135.714 1.00 42.36  ? 116 ARG B CA  1 
ATOM   2149  C C   . ARG B  1 92  ? 51.339  39.281  135.558 1.00 41.15  ? 116 ARG B C   1 
ATOM   2150  O O   . ARG B  1 92  ? 52.221  40.120  135.679 1.00 41.37  ? 116 ARG B O   1 
ATOM   2151  C CB  . ARG B  1 92  ? 49.343  39.909  134.310 1.00 44.04  ? 116 ARG B CB  1 
ATOM   2152  C CG  . ARG B  1 92  ? 47.902  40.382  134.144 1.00 44.18  ? 116 ARG B CG  1 
ATOM   2153  C CD  . ARG B  1 92  ? 47.449  39.869  132.797 1.00 44.90  ? 116 ARG B CD  1 
ATOM   2154  N NE  . ARG B  1 92  ? 46.994  40.912  131.921 1.00 45.63  ? 116 ARG B NE  1 
ATOM   2155  C CZ  . ARG B  1 92  ? 46.899  40.783  130.602 1.00 44.60  ? 116 ARG B CZ  1 
ATOM   2156  N NH1 . ARG B  1 92  ? 46.497  41.828  129.895 1.00 46.90  ? 116 ARG B NH1 1 
ATOM   2157  N NH2 . ARG B  1 92  ? 47.200  39.650  129.988 1.00 41.21  ? 116 ARG B NH2 1 
ATOM   2158  N N   . GLY B  1 93  ? 51.577  38.012  135.239 1.00 39.92  ? 117 GLY B N   1 
ATOM   2159  C CA  . GLY B  1 93  ? 52.927  37.473  135.140 1.00 39.78  ? 117 GLY B CA  1 
ATOM   2160  C C   . GLY B  1 93  ? 53.075  36.284  134.221 1.00 39.60  ? 117 GLY B C   1 
ATOM   2161  O O   . GLY B  1 93  ? 52.161  35.931  133.497 1.00 37.36  ? 117 GLY B O   1 
ATOM   2162  N N   . VAL B  1 94  ? 54.236  35.649  134.305 1.00 40.79  ? 118 VAL B N   1 
ATOM   2163  C CA  . VAL B  1 94  ? 54.715  34.758  133.270 1.00 41.00  ? 118 VAL B CA  1 
ATOM   2164  C C   . VAL B  1 94  ? 55.661  33.713  133.879 1.00 39.49  ? 118 VAL B C   1 
ATOM   2165  O O   . VAL B  1 94  ? 56.673  34.005  134.478 1.00 38.62  ? 118 VAL B O   1 
ATOM   2166  C CB  . VAL B  1 94  ? 55.362  35.585  132.144 1.00 44.81  ? 118 VAL B CB  1 
ATOM   2167  C CG1 . VAL B  1 94  ? 56.735  36.113  132.534 1.00 47.70  ? 118 VAL B CG1 1 
ATOM   2168  C CG2 . VAL B  1 94  ? 55.543  34.772  130.903 1.00 48.47  ? 118 VAL B CG2 1 
ATOM   2169  N N   . GLY B  1 95  ? 55.266  32.470  133.743 1.00 40.62  ? 119 GLY B N   1 
ATOM   2170  C CA  . GLY B  1 95  ? 55.882  31.322  134.402 1.00 39.77  ? 119 GLY B CA  1 
ATOM   2171  C C   . GLY B  1 95  ? 56.120  30.219  133.373 1.00 40.39  ? 119 GLY B C   1 
ATOM   2172  O O   . GLY B  1 95  ? 56.016  30.433  132.124 1.00 40.66  ? 119 GLY B O   1 
ATOM   2173  N N   . SER B  1 96  ? 56.459  29.042  133.884 1.00 38.08  ? 120 SER B N   1 
ATOM   2174  C CA  . SER B  1 96  ? 56.893  27.957  133.037 1.00 35.85  ? 120 SER B CA  1 
ATOM   2175  C C   . SER B  1 96  ? 56.440  26.661  133.623 1.00 35.53  ? 120 SER B C   1 
ATOM   2176  O O   . SER B  1 96  ? 56.473  26.483  134.836 1.00 35.35  ? 120 SER B O   1 
ATOM   2177  C CB  . SER B  1 96  ? 58.408  27.996  132.938 1.00 35.14  ? 120 SER B CB  1 
ATOM   2178  O OG  . SER B  1 96  ? 58.820  29.164  132.205 1.00 34.88  ? 120 SER B OG  1 
ATOM   2179  N N   . SER B  1 97  ? 55.954  25.768  132.785 1.00 35.18  ? 121 SER B N   1 
ATOM   2180  C CA  . SER B  1 97  ? 55.839  24.372  133.212 1.00 36.36  ? 121 SER B CA  1 
ATOM   2181  C C   . SER B  1 97  ? 56.921  23.608  132.484 1.00 36.05  ? 121 SER B C   1 
ATOM   2182  O O   . SER B  1 97  ? 57.198  23.931  131.304 1.00 36.30  ? 121 SER B O   1 
ATOM   2183  C CB  . SER B  1 97  ? 54.444  23.741  132.920 1.00 35.71  ? 121 SER B CB  1 
ATOM   2184  O OG  . SER B  1 97  ? 54.194  23.590  131.538 1.00 33.80  ? 121 SER B OG  1 
ATOM   2185  N N   . ALA B  1 98  ? 57.508  22.612  133.154 1.00 34.18  ? 122 ALA B N   1 
ATOM   2186  C CA  . ALA B  1 98  ? 58.358  21.658  132.441 1.00 34.89  ? 122 ALA B CA  1 
ATOM   2187  C C   . ALA B  1 98  ? 58.121  20.166  132.814 1.00 35.51  ? 122 ALA B C   1 
ATOM   2188  O O   . ALA B  1 98  ? 57.654  19.850  133.924 1.00 34.51  ? 122 ALA B O   1 
ATOM   2189  C CB  . ALA B  1 98  ? 59.801  22.042  132.589 1.00 33.65  ? 122 ALA B CB  1 
ATOM   2190  N N   . VAL B  1 99  ? 58.419  19.299  131.835 1.00 34.78  ? 123 VAL B N   1 
ATOM   2191  C CA  . VAL B  1 99  ? 58.250  17.875  131.939 1.00 35.88  ? 123 VAL B CA  1 
ATOM   2192  C C   . VAL B  1 99  ? 59.566  17.223  132.367 1.00 36.97  ? 123 VAL B C   1 
ATOM   2193  O O   . VAL B  1 99  ? 60.605  17.284  131.646 1.00 39.67  ? 123 VAL B O   1 
ATOM   2194  C CB  . VAL B  1 99  ? 57.805  17.198  130.604 1.00 37.21  ? 123 VAL B CB  1 
ATOM   2195  C CG1 . VAL B  1 99  ? 57.472  15.712  130.796 1.00 36.16  ? 123 VAL B CG1 1 
ATOM   2196  C CG2 . VAL B  1 99  ? 56.557  17.840  130.012 1.00 39.06  ? 123 VAL B CG2 1 
ATOM   2197  N N   . ILE B  1 100 ? 59.452  16.520  133.491 1.00 35.95  ? 124 ILE B N   1 
ATOM   2198  C CA  . ILE B  1 100 ? 60.519  15.929  134.241 1.00 36.66  ? 124 ILE B CA  1 
ATOM   2199  C C   . ILE B  1 100 ? 60.304  14.412  134.390 1.00 36.65  ? 124 ILE B C   1 
ATOM   2200  O O   . ILE B  1 100 ? 59.526  13.945  135.228 1.00 33.71  ? 124 ILE B O   1 
ATOM   2201  C CB  . ILE B  1 100 ? 60.524  16.521  135.656 1.00 38.22  ? 124 ILE B CB  1 
ATOM   2202  C CG1 . ILE B  1 100 ? 60.516  18.053  135.604 1.00 38.00  ? 124 ILE B CG1 1 
ATOM   2203  C CG2 . ILE B  1 100 ? 61.703  15.944  136.447 1.00 38.91  ? 124 ILE B CG2 1 
ATOM   2204  C CD1 . ILE B  1 100 ? 61.778  18.605  134.992 1.00 38.16  ? 124 ILE B CD1 1 
ATOM   2205  N N   . LEU B  1 101 ? 61.032  13.652  133.582 1.00 36.16  ? 125 LEU B N   1 
ATOM   2206  C CA  . LEU B  1 101 ? 60.801  12.234  133.488 1.00 35.93  ? 125 LEU B CA  1 
ATOM   2207  C C   . LEU B  1 101 ? 61.644  11.426  134.435 1.00 36.86  ? 125 LEU B C   1 
ATOM   2208  O O   . LEU B  1 101 ? 61.414  10.224  134.585 1.00 41.21  ? 125 LEU B O   1 
ATOM   2209  C CB  . LEU B  1 101 ? 61.025  11.798  132.045 1.00 35.40  ? 125 LEU B CB  1 
ATOM   2210  C CG  . LEU B  1 101 ? 60.176  12.568  130.988 1.00 34.02  ? 125 LEU B CG  1 
ATOM   2211  C CD1 . LEU B  1 101 ? 60.597  12.253  129.525 1.00 32.76  ? 125 LEU B CD1 1 
ATOM   2212  C CD2 . LEU B  1 101 ? 58.655  12.394  131.214 1.00 32.66  ? 125 LEU B CD2 1 
ATOM   2213  N N   . ASP B  1 102 ? 62.556  12.071  135.144 1.00 38.42  ? 126 ASP B N   1 
ATOM   2214  C CA  . ASP B  1 102 ? 63.560  11.337  135.891 1.00 41.13  ? 126 ASP B CA  1 
ATOM   2215  C C   . ASP B  1 102 ? 63.464  11.634  137.382 1.00 42.69  ? 126 ASP B C   1 
ATOM   2216  O O   . ASP B  1 102 ? 64.396  11.286  138.121 1.00 44.24  ? 126 ASP B O   1 
ATOM   2217  C CB  . ASP B  1 102 ? 64.971  11.645  135.364 1.00 40.48  ? 126 ASP B CB  1 
ATOM   2218  C CG  . ASP B  1 102 ? 65.406  13.077  135.667 1.00 41.45  ? 126 ASP B CG  1 
ATOM   2219  O OD1 . ASP B  1 102 ? 64.540  13.904  136.079 1.00 41.36  ? 126 ASP B OD1 1 
ATOM   2220  O OD2 . ASP B  1 102 ? 66.602  13.382  135.478 1.00 40.69  ? 126 ASP B OD2 1 
ATOM   2221  N N   . ASP B  1 103 ? 62.360  12.247  137.826 1.00 42.83  ? 127 ASP B N   1 
ATOM   2222  C CA  . ASP B  1 103 ? 62.106  12.468  139.274 1.00 44.23  ? 127 ASP B CA  1 
ATOM   2223  C C   . ASP B  1 103 ? 63.165  13.389  139.925 1.00 46.03  ? 127 ASP B C   1 
ATOM   2224  O O   . ASP B  1 103 ? 63.622  13.131  141.018 1.00 47.65  ? 127 ASP B O   1 
ATOM   2225  C CB  . ASP B  1 103 ? 62.030  11.125  140.030 1.00 43.13  ? 127 ASP B CB  1 
ATOM   2226  C CG  . ASP B  1 103 ? 61.457  11.267  141.472 1.00 44.43  ? 127 ASP B CG  1 
ATOM   2227  O OD1 . ASP B  1 103 ? 60.509  12.086  141.706 1.00 42.94  ? 127 ASP B OD1 1 
ATOM   2228  O OD2 . ASP B  1 103 ? 61.975  10.536  142.358 1.00 43.75  ? 127 ASP B OD2 1 
ATOM   2229  N N   . ASN B  1 104 ? 63.582  14.421  139.198 1.00 48.11  ? 128 ASN B N   1 
ATOM   2230  C CA  . ASN B  1 104 ? 64.589  15.376  139.622 1.00 48.04  ? 128 ASN B CA  1 
ATOM   2231  C C   . ASN B  1 104 ? 64.139  16.806  139.326 1.00 47.35  ? 128 ASN B C   1 
ATOM   2232  O O   . ASN B  1 104 ? 64.563  17.446  138.368 1.00 49.06  ? 128 ASN B O   1 
ATOM   2233  C CB  . ASN B  1 104 ? 65.901  15.107  138.939 1.00 49.09  ? 128 ASN B CB  1 
ATOM   2234  C CG  . ASN B  1 104 ? 67.047  15.891  139.569 1.00 52.12  ? 128 ASN B CG  1 
ATOM   2235  O OD1 . ASN B  1 104 ? 67.307  15.739  140.773 1.00 52.49  ? 128 ASN B OD1 1 
ATOM   2236  N ND2 . ASN B  1 104 ? 67.759  16.703  138.758 1.00 51.47  ? 128 ASN B ND2 1 
ATOM   2237  N N   . PHE B  1 105 ? 63.306  17.296  140.218 1.00 45.45  ? 129 PHE B N   1 
ATOM   2238  C CA  . PHE B  1 105 ? 62.708  18.590  140.102 1.00 43.63  ? 129 PHE B CA  1 
ATOM   2239  C C   . PHE B  1 105 ? 63.640  19.629  140.689 1.00 40.64  ? 129 PHE B C   1 
ATOM   2240  O O   . PHE B  1 105 ? 64.505  19.301  141.492 1.00 38.59  ? 129 PHE B O   1 
ATOM   2241  C CB  . PHE B  1 105 ? 61.415  18.578  140.910 1.00 45.13  ? 129 PHE B CB  1 
ATOM   2242  C CG  . PHE B  1 105 ? 60.471  17.500  140.498 1.00 44.03  ? 129 PHE B CG  1 
ATOM   2243  C CD1 . PHE B  1 105 ? 59.620  17.716  139.435 1.00 45.47  ? 129 PHE B CD1 1 
ATOM   2244  C CD2 . PHE B  1 105 ? 60.477  16.275  141.129 1.00 43.41  ? 129 PHE B CD2 1 
ATOM   2245  C CE1 . PHE B  1 105 ? 58.743  16.741  139.016 1.00 45.01  ? 129 PHE B CE1 1 
ATOM   2246  C CE2 . PHE B  1 105 ? 59.634  15.282  140.723 1.00 44.17  ? 129 PHE B CE2 1 
ATOM   2247  C CZ  . PHE B  1 105 ? 58.757  15.523  139.657 1.00 46.00  ? 129 PHE B CZ  1 
ATOM   2248  N N   . VAL B  1 106 ? 63.429  20.885  140.312 1.00 38.60  ? 130 VAL B N   1 
ATOM   2249  C CA  . VAL B  1 106 ? 64.059  22.001  140.998 1.00 38.36  ? 130 VAL B CA  1 
ATOM   2250  C C   . VAL B  1 106 ? 63.395  22.177  142.376 1.00 37.71  ? 130 VAL B C   1 
ATOM   2251  O O   . VAL B  1 106 ? 62.194  22.064  142.573 1.00 35.89  ? 130 VAL B O   1 
ATOM   2252  C CB  . VAL B  1 106 ? 63.961  23.297  140.173 1.00 39.68  ? 130 VAL B CB  1 
ATOM   2253  C CG1 . VAL B  1 106 ? 64.573  24.485  140.914 1.00 40.09  ? 130 VAL B CG1 1 
ATOM   2254  C CG2 . VAL B  1 106 ? 64.633  23.129  138.809 1.00 39.78  ? 130 VAL B CG2 1 
ATOM   2255  N N   . THR B  1 107 ? 64.222  22.488  143.335 1.00 39.56  ? 131 THR B N   1 
ATOM   2256  C CA  . THR B  1 107 ? 63.826  22.489  144.713 1.00 40.24  ? 131 THR B CA  1 
ATOM   2257  C C   . THR B  1 107 ? 62.702  23.444  144.975 1.00 39.63  ? 131 THR B C   1 
ATOM   2258  O O   . THR B  1 107 ? 62.728  24.589  144.546 1.00 37.32  ? 131 THR B O   1 
ATOM   2259  C CB  . THR B  1 107 ? 65.034  22.794  145.621 1.00 41.15  ? 131 THR B CB  1 
ATOM   2260  O OG1 . THR B  1 107 ? 65.772  21.571  145.801 1.00 44.48  ? 131 THR B OG1 1 
ATOM   2261  C CG2 . THR B  1 107 ? 64.615  23.283  146.997 1.00 41.05  ? 131 THR B CG2 1 
ATOM   2262  N N   . LYS B  1 108 ? 61.739  22.963  145.744 1.00 40.96  ? 132 LYS B N   1 
ATOM   2263  C CA  . LYS B  1 108 ? 60.597  23.746  146.022 1.00 44.41  ? 132 LYS B CA  1 
ATOM   2264  C C   . LYS B  1 108 ? 61.076  25.079  146.622 1.00 44.46  ? 132 LYS B C   1 
ATOM   2265  O O   . LYS B  1 108 ? 62.034  25.083  147.359 1.00 45.30  ? 132 LYS B O   1 
ATOM   2266  C CB  . LYS B  1 108 ? 59.673  22.962  146.930 1.00 48.31  ? 132 LYS B CB  1 
ATOM   2267  C CG  . LYS B  1 108 ? 58.383  23.684  147.175 1.00 52.01  ? 132 LYS B CG  1 
ATOM   2268  C CD  . LYS B  1 108 ? 57.590  22.987  148.245 1.00 57.13  ? 132 LYS B CD  1 
ATOM   2269  C CE  . LYS B  1 108 ? 56.547  23.982  148.783 1.00 62.82  ? 132 LYS B CE  1 
ATOM   2270  N NZ  . LYS B  1 108 ? 55.489  23.286  149.574 1.00 63.32  ? 132 LYS B NZ  1 
ATOM   2271  N N   . ALA B  1 109 ? 60.447  26.199  146.249 1.00 44.99  ? 133 ALA B N   1 
ATOM   2272  C CA  . ALA B  1 109 ? 60.910  27.565  146.612 1.00 45.32  ? 133 ALA B CA  1 
ATOM   2273  C C   . ALA B  1 109 ? 59.740  28.579  146.567 1.00 46.83  ? 133 ALA B C   1 
ATOM   2274  O O   . ALA B  1 109 ? 58.867  28.479  145.724 1.00 46.51  ? 133 ALA B O   1 
ATOM   2275  C CB  . ALA B  1 109 ? 62.074  28.015  145.705 1.00 44.20  ? 133 ALA B CB  1 
ATOM   2276  N N   . THR B  1 110 ? 59.719  29.550  147.473 1.00 49.44  ? 134 THR B N   1 
ATOM   2277  C CA  . THR B  1 110 ? 58.606  30.491  147.545 1.00 50.54  ? 134 THR B CA  1 
ATOM   2278  C C   . THR B  1 110 ? 58.736  31.709  146.664 1.00 51.17  ? 134 THR B C   1 
ATOM   2279  O O   . THR B  1 110 ? 57.712  32.207  146.138 1.00 53.37  ? 134 THR B O   1 
ATOM   2280  C CB  . THR B  1 110 ? 58.437  30.973  148.978 1.00 51.32  ? 134 THR B CB  1 
ATOM   2281  O OG1 . THR B  1 110 ? 58.519  29.815  149.804 1.00 54.72  ? 134 THR B OG1 1 
ATOM   2282  C CG2 . THR B  1 110 ? 57.063  31.684  149.192 1.00 48.85  ? 134 THR B CG2 1 
ATOM   2283  N N   . ALA B  1 111 ? 59.972  32.215  146.570 1.00 51.46  ? 135 ALA B N   1 
ATOM   2284  C CA  . ALA B  1 111 ? 60.309  33.352  145.722 1.00 48.58  ? 135 ALA B CA  1 
ATOM   2285  C C   . ALA B  1 111 ? 61.729  33.256  145.175 1.00 47.11  ? 135 ALA B C   1 
ATOM   2286  O O   . ALA B  1 111 ? 62.604  34.053  145.493 1.00 47.27  ? 135 ALA B O   1 
ATOM   2287  C CB  . ALA B  1 111 ? 60.091  34.657  146.476 1.00 49.01  ? 135 ALA B CB  1 
ATOM   2288  N N   . LEU B  1 112 ? 61.934  32.306  144.276 1.00 46.30  ? 136 LEU B N   1 
ATOM   2289  C CA  . LEU B  1 112 ? 63.150  32.317  143.434 1.00 43.70  ? 136 LEU B CA  1 
ATOM   2290  C C   . LEU B  1 112 ? 63.312  33.608  142.588 1.00 42.95  ? 136 LEU B C   1 
ATOM   2291  O O   . LEU B  1 112 ? 62.375  34.152  142.032 1.00 42.45  ? 136 LEU B O   1 
ATOM   2292  C CB  . LEU B  1 112 ? 63.214  31.074  142.561 1.00 40.35  ? 136 LEU B CB  1 
ATOM   2293  C CG  . LEU B  1 112 ? 64.600  30.473  142.429 1.00 40.86  ? 136 LEU B CG  1 
ATOM   2294  C CD1 . LEU B  1 112 ? 65.146  29.960  143.744 1.00 39.12  ? 136 LEU B CD1 1 
ATOM   2295  C CD2 . LEU B  1 112 ? 64.550  29.333  141.422 1.00 42.54  ? 136 LEU B CD2 1 
ATOM   2296  N N   . THR B  1 113 ? 64.538  34.078  142.470 1.00 44.12  ? 137 THR B N   1 
ATOM   2297  C CA  . THR B  1 113 ? 64.826  35.300  141.709 1.00 44.23  ? 137 THR B CA  1 
ATOM   2298  C C   . THR B  1 113 ? 64.846  35.094  140.210 1.00 42.66  ? 137 THR B C   1 
ATOM   2299  O O   . THR B  1 113 ? 65.198  35.993  139.479 1.00 42.82  ? 137 THR B O   1 
ATOM   2300  C CB  . THR B  1 113 ? 66.149  35.976  142.171 1.00 45.06  ? 137 THR B CB  1 
ATOM   2301  O OG1 . THR B  1 113 ? 67.257  35.097  141.995 1.00 45.66  ? 137 THR B OG1 1 
ATOM   2302  C CG2 . THR B  1 113 ? 66.073  36.320  143.642 1.00 45.76  ? 137 THR B CG2 1 
ATOM   2303  N N   . TYR B  1 114 ? 64.475  33.915  139.747 1.00 42.75  ? 138 TYR B N   1 
ATOM   2304  C CA  . TYR B  1 114 ? 64.328  33.645  138.326 1.00 41.94  ? 138 TYR B CA  1 
ATOM   2305  C C   . TYR B  1 114 ? 63.407  32.406  138.154 1.00 42.97  ? 138 TYR B C   1 
ATOM   2306  O O   . TYR B  1 114 ? 63.155  31.635  139.102 1.00 44.08  ? 138 TYR B O   1 
ATOM   2307  C CB  . TYR B  1 114 ? 65.721  33.461  137.691 1.00 41.26  ? 138 TYR B CB  1 
ATOM   2308  C CG  . TYR B  1 114 ? 66.478  32.266  138.191 1.00 41.69  ? 138 TYR B CG  1 
ATOM   2309  C CD1 . TYR B  1 114 ? 67.056  32.216  139.478 1.00 41.35  ? 138 TYR B CD1 1 
ATOM   2310  C CD2 . TYR B  1 114 ? 66.575  31.168  137.410 1.00 42.41  ? 138 TYR B CD2 1 
ATOM   2311  C CE1 . TYR B  1 114 ? 67.721  31.088  139.925 1.00 40.57  ? 138 TYR B CE1 1 
ATOM   2312  C CE2 . TYR B  1 114 ? 67.232  30.041  137.853 1.00 43.50  ? 138 TYR B CE2 1 
ATOM   2313  C CZ  . TYR B  1 114 ? 67.813  30.012  139.088 1.00 42.42  ? 138 TYR B CZ  1 
ATOM   2314  O OH  . TYR B  1 114 ? 68.414  28.816  139.390 1.00 46.34  ? 138 TYR B OH  1 
ATOM   2315  N N   . ASP B  1 115 ? 62.844  32.269  136.961 1.00 43.11  ? 139 ASP B N   1 
ATOM   2316  C CA  . ASP B  1 115 ? 62.145  31.044  136.527 1.00 40.87  ? 139 ASP B CA  1 
ATOM   2317  C C   . ASP B  1 115 ? 63.201  29.989  136.190 1.00 39.83  ? 139 ASP B C   1 
ATOM   2318  O O   . ASP B  1 115 ? 63.868  30.073  135.160 1.00 37.82  ? 139 ASP B O   1 
ATOM   2319  C CB  . ASP B  1 115 ? 61.282  31.370  135.307 1.00 40.65  ? 139 ASP B CB  1 
ATOM   2320  C CG  . ASP B  1 115 ? 60.461  30.209  134.812 1.00 40.47  ? 139 ASP B CG  1 
ATOM   2321  O OD1 . ASP B  1 115 ? 60.756  29.029  135.127 1.00 42.14  ? 139 ASP B OD1 1 
ATOM   2322  O OD2 . ASP B  1 115 ? 59.502  30.509  134.085 1.00 39.28  ? 139 ASP B OD2 1 
ATOM   2323  N N   . PRO B  1 116 ? 63.367  28.980  137.061 1.00 41.53  ? 140 PRO B N   1 
ATOM   2324  C CA  . PRO B  1 116 ? 64.449  28.022  136.775 1.00 41.08  ? 140 PRO B CA  1 
ATOM   2325  C C   . PRO B  1 116 ? 64.093  27.111  135.646 1.00 39.36  ? 140 PRO B C   1 
ATOM   2326  O O   . PRO B  1 116 ? 64.981  26.421  135.126 1.00 40.98  ? 140 PRO B O   1 
ATOM   2327  C CB  . PRO B  1 116 ? 64.577  27.208  138.067 1.00 41.12  ? 140 PRO B CB  1 
ATOM   2328  C CG  . PRO B  1 116 ? 63.236  27.276  138.697 1.00 41.50  ? 140 PRO B CG  1 
ATOM   2329  C CD  . PRO B  1 116 ? 62.513  28.514  138.170 1.00 41.36  ? 140 PRO B CD  1 
ATOM   2330  N N   . TYR B  1 117 ? 62.826  27.096  135.252 1.00 36.76  ? 141 TYR B N   1 
ATOM   2331  C CA  . TYR B  1 117 ? 62.433  26.171  134.214 1.00 37.54  ? 141 TYR B CA  1 
ATOM   2332  C C   . TYR B  1 117 ? 62.385  26.780  132.805 1.00 36.32  ? 141 TYR B C   1 
ATOM   2333  O O   . TYR B  1 117 ? 62.230  26.024  131.862 1.00 35.57  ? 141 TYR B O   1 
ATOM   2334  C CB  . TYR B  1 117 ? 61.078  25.481  134.563 1.00 37.53  ? 141 TYR B CB  1 
ATOM   2335  C CG  . TYR B  1 117 ? 61.149  24.357  135.597 1.00 35.83  ? 141 TYR B CG  1 
ATOM   2336  C CD1 . TYR B  1 117 ? 61.913  23.201  135.363 1.00 34.36  ? 141 TYR B CD1 1 
ATOM   2337  C CD2 . TYR B  1 117 ? 60.405  24.453  136.799 1.00 35.49  ? 141 TYR B CD2 1 
ATOM   2338  C CE1 . TYR B  1 117 ? 61.939  22.189  136.299 1.00 34.75  ? 141 TYR B CE1 1 
ATOM   2339  C CE2 . TYR B  1 117 ? 60.455  23.474  137.753 1.00 34.93  ? 141 TYR B CE2 1 
ATOM   2340  C CZ  . TYR B  1 117 ? 61.207  22.347  137.508 1.00 35.58  ? 141 TYR B CZ  1 
ATOM   2341  O OH  . TYR B  1 117 ? 61.257  21.396  138.510 1.00 36.88  ? 141 TYR B OH  1 
ATOM   2342  N N   . VAL B  1 118 ? 62.507  28.104  132.659 1.00 36.71  ? 142 VAL B N   1 
ATOM   2343  C CA  . VAL B  1 118 ? 62.288  28.780  131.363 1.00 37.24  ? 142 VAL B CA  1 
ATOM   2344  C C   . VAL B  1 118 ? 63.199  28.287  130.213 1.00 37.19  ? 142 VAL B C   1 
ATOM   2345  O O   . VAL B  1 118 ? 62.837  28.454  129.070 1.00 36.44  ? 142 VAL B O   1 
ATOM   2346  C CB  . VAL B  1 118 ? 62.479  30.320  131.481 1.00 38.77  ? 142 VAL B CB  1 
ATOM   2347  C CG1 . VAL B  1 118 ? 63.980  30.686  131.542 1.00 37.68  ? 142 VAL B CG1 1 
ATOM   2348  C CG2 . VAL B  1 118 ? 61.737  31.069  130.345 1.00 38.71  ? 142 VAL B CG2 1 
ATOM   2349  N N   . ASN B  1 119 ? 64.382  27.745  130.517 1.00 35.55  ? 143 ASN B N   1 
ATOM   2350  C CA  . ASN B  1 119 ? 65.254  27.246  129.482 1.00 36.09  ? 143 ASN B CA  1 
ATOM   2351  C C   . ASN B  1 119 ? 65.097  25.763  129.242 1.00 37.22  ? 143 ASN B C   1 
ATOM   2352  O O   . ASN B  1 119 ? 65.880  25.170  128.462 1.00 41.32  ? 143 ASN B O   1 
ATOM   2353  C CB  . ASN B  1 119 ? 66.751  27.543  129.774 1.00 35.91  ? 143 ASN B CB  1 
ATOM   2354  C CG  . ASN B  1 119 ? 67.098  29.011  129.640 1.00 35.68  ? 143 ASN B CG  1 
ATOM   2355  O OD1 . ASN B  1 119 ? 66.549  29.745  128.802 1.00 35.15  ? 143 ASN B OD1 1 
ATOM   2356  N ND2 . ASN B  1 119 ? 67.989  29.459  130.493 1.00 35.36  ? 143 ASN B ND2 1 
ATOM   2357  N N   . TYR B  1 120 ? 64.116  25.118  129.842 1.00 36.11  ? 144 TYR B N   1 
ATOM   2358  C CA  . TYR B  1 120 ? 64.048  23.659  129.640 1.00 35.84  ? 144 TYR B CA  1 
ATOM   2359  C C   . TYR B  1 120 ? 63.521  23.371  128.205 1.00 35.24  ? 144 TYR B C   1 
ATOM   2360  O O   . TYR B  1 120 ? 62.632  24.048  127.712 1.00 36.38  ? 144 TYR B O   1 
ATOM   2361  C CB  . TYR B  1 120 ? 63.196  22.951  130.722 1.00 34.80  ? 144 TYR B CB  1 
ATOM   2362  C CG  . TYR B  1 120 ? 63.896  22.544  132.006 1.00 33.60  ? 144 TYR B CG  1 
ATOM   2363  C CD1 . TYR B  1 120 ? 64.695  23.457  132.729 1.00 34.00  ? 144 TYR B CD1 1 
ATOM   2364  C CD2 . TYR B  1 120 ? 63.738  21.248  132.519 1.00 32.42  ? 144 TYR B CD2 1 
ATOM   2365  C CE1 . TYR B  1 120 ? 65.329  23.070  133.923 1.00 34.09  ? 144 TYR B CE1 1 
ATOM   2366  C CE2 . TYR B  1 120 ? 64.358  20.852  133.702 1.00 32.97  ? 144 TYR B CE2 1 
ATOM   2367  C CZ  . TYR B  1 120 ? 65.145  21.763  134.400 1.00 33.40  ? 144 TYR B CZ  1 
ATOM   2368  O OH  . TYR B  1 120 ? 65.708  21.362  135.566 1.00 31.71  ? 144 TYR B OH  1 
ATOM   2369  N N   . SER B  1 121 ? 64.093  22.393  127.531 1.00 34.58  ? 145 SER B N   1 
ATOM   2370  C CA  . SER B  1 121 ? 63.607  21.984  126.213 1.00 34.70  ? 145 SER B CA  1 
ATOM   2371  C C   . SER B  1 121 ? 62.101  21.698  126.201 1.00 35.38  ? 145 SER B C   1 
ATOM   2372  O O   . SER B  1 121 ? 61.406  22.041  125.252 1.00 34.28  ? 145 SER B O   1 
ATOM   2373  C CB  . SER B  1 121 ? 64.378  20.727  125.746 1.00 35.28  ? 145 SER B CB  1 
ATOM   2374  O OG  . SER B  1 121 ? 65.744  21.003  125.396 1.00 34.11  ? 145 SER B OG  1 
ATOM   2375  N N   . SER B  1 122 ? 61.599  21.121  127.293 1.00 36.93  ? 146 SER B N   1 
ATOM   2376  C CA  . SER B  1 122 ? 60.188  20.770  127.422 1.00 38.20  ? 146 SER B CA  1 
ATOM   2377  C C   . SER B  1 122 ? 59.289  21.873  128.025 1.00 37.99  ? 146 SER B C   1 
ATOM   2378  O O   . SER B  1 122 ? 58.083  21.641  128.282 1.00 36.86  ? 146 SER B O   1 
ATOM   2379  C CB  . SER B  1 122 ? 60.055  19.505  128.259 1.00 39.02  ? 146 SER B CB  1 
ATOM   2380  O OG  . SER B  1 122 ? 60.400  19.786  129.595 1.00 40.04  ? 146 SER B OG  1 
ATOM   2381  N N   . ARG B  1 123 ? 59.846  23.065  128.210 1.00 36.63  ? 147 ARG B N   1 
ATOM   2382  C CA  . ARG B  1 123 ? 59.097  24.129  128.836 1.00 36.62  ? 147 ARG B CA  1 
ATOM   2383  C C   . ARG B  1 123 ? 57.974  24.586  127.965 1.00 36.21  ? 147 ARG B C   1 
ATOM   2384  O O   . ARG B  1 123 ? 58.158  24.773  126.788 1.00 35.94  ? 147 ARG B O   1 
ATOM   2385  C CB  . ARG B  1 123 ? 59.978  25.340  129.092 1.00 37.62  ? 147 ARG B CB  1 
ATOM   2386  C CG  . ARG B  1 123 ? 59.228  26.565  129.619 1.00 37.98  ? 147 ARG B CG  1 
ATOM   2387  C CD  . ARG B  1 123 ? 58.885  27.568  128.540 1.00 37.33  ? 147 ARG B CD  1 
ATOM   2388  N NE  . ARG B  1 123 ? 60.063  28.301  128.103 1.00 38.12  ? 147 ARG B NE  1 
ATOM   2389  C CZ  . ARG B  1 123 ? 60.097  29.107  127.038 1.00 38.62  ? 147 ARG B CZ  1 
ATOM   2390  N NH1 . ARG B  1 123 ? 61.212  29.775  126.713 1.00 39.27  ? 147 ARG B NH1 1 
ATOM   2391  N NH2 . ARG B  1 123 ? 59.011  29.282  126.304 1.00 38.66  ? 147 ARG B NH2 1 
ATOM   2392  N N   . HIS B  1 124 ? 56.833  24.825  128.592 1.00 37.31  ? 148 HIS B N   1 
ATOM   2393  C CA  . HIS B  1 124 ? 55.747  25.637  128.033 1.00 36.38  ? 148 HIS B CA  1 
ATOM   2394  C C   . HIS B  1 124 ? 55.532  26.871  128.962 1.00 33.77  ? 148 HIS B C   1 
ATOM   2395  O O   . HIS B  1 124 ? 55.562  26.760  130.212 1.00 31.55  ? 148 HIS B O   1 
ATOM   2396  C CB  . HIS B  1 124 ? 54.425  24.842  127.960 1.00 36.34  ? 148 HIS B CB  1 
ATOM   2397  C CG  . HIS B  1 124 ? 54.329  23.902  126.821 1.00 38.16  ? 148 HIS B CG  1 
ATOM   2398  N ND1 . HIS B  1 124 ? 53.117  23.543  126.273 1.00 40.77  ? 148 HIS B ND1 1 
ATOM   2399  C CD2 . HIS B  1 124 ? 55.278  23.248  126.108 1.00 40.84  ? 148 HIS B CD2 1 
ATOM   2400  C CE1 . HIS B  1 124 ? 53.315  22.666  125.300 1.00 41.95  ? 148 HIS B CE1 1 
ATOM   2401  N NE2 . HIS B  1 124 ? 54.620  22.472  125.180 1.00 43.54  ? 148 HIS B NE2 1 
ATOM   2402  N N   . THR B  1 125 ? 55.243  28.002  128.313 1.00 33.02  ? 149 THR B N   1 
ATOM   2403  C CA  . THR B  1 125 ? 54.873  29.270  128.944 1.00 32.58  ? 149 THR B CA  1 
ATOM   2404  C C   . THR B  1 125 ? 53.533  29.213  129.647 1.00 32.02  ? 149 THR B C   1 
ATOM   2405  O O   . THR B  1 125 ? 52.625  28.744  129.083 1.00 29.54  ? 149 THR B O   1 
ATOM   2406  C CB  . THR B  1 125 ? 54.806  30.376  127.884 1.00 32.35  ? 149 THR B CB  1 
ATOM   2407  O OG1 . THR B  1 125 ? 56.077  30.464  127.243 1.00 31.34  ? 149 THR B OG1 1 
ATOM   2408  C CG2 . THR B  1 125 ? 54.386  31.767  128.518 1.00 31.99  ? 149 THR B CG2 1 
ATOM   2409  N N   . ILE B  1 126 ? 53.492  29.670  130.901 1.00 34.70  ? 150 ILE B N   1 
ATOM   2410  C CA  . ILE B  1 126 ? 52.294  29.905  131.706 1.00 36.12  ? 150 ILE B CA  1 
ATOM   2411  C C   . ILE B  1 126 ? 51.975  31.403  131.784 1.00 36.22  ? 150 ILE B C   1 
ATOM   2412  O O   . ILE B  1 126 ? 52.792  32.170  132.087 1.00 38.82  ? 150 ILE B O   1 
ATOM   2413  C CB  . ILE B  1 126 ? 52.496  29.457  133.162 1.00 36.40  ? 150 ILE B CB  1 
ATOM   2414  C CG1 . ILE B  1 126 ? 53.150  28.073  133.188 1.00 37.66  ? 150 ILE B CG1 1 
ATOM   2415  C CG2 . ILE B  1 126 ? 51.145  29.474  133.907 1.00 36.18  ? 150 ILE B CG2 1 
ATOM   2416  C CD1 . ILE B  1 126 ? 53.342  27.486  134.596 1.00 38.29  ? 150 ILE B CD1 1 
ATOM   2417  N N   . THR B  1 127 ? 50.738  31.782  131.623 1.00 37.82  ? 151 THR B N   1 
ATOM   2418  C CA  . THR B  1 127 ? 50.287  33.152  131.508 1.00 37.18  ? 151 THR B CA  1 
ATOM   2419  C C   . THR B  1 127 ? 49.357  33.291  132.727 1.00 37.69  ? 151 THR B C   1 
ATOM   2420  O O   . THR B  1 127 ? 48.464  32.473  132.947 1.00 36.52  ? 151 THR B O   1 
ATOM   2421  C CB  . THR B  1 127 ? 49.655  33.229  130.105 1.00 38.35  ? 151 THR B CB  1 
ATOM   2422  O OG1 . THR B  1 127 ? 50.593  33.811  129.208 1.00 39.97  ? 151 THR B OG1 1 
ATOM   2423  C CG2 . THR B  1 127 ? 48.463  34.010  130.064 1.00 40.35  ? 151 THR B CG2 1 
ATOM   2424  N N   . GLN B  1 128 ? 49.600  34.279  133.574 1.00 39.92  ? 152 GLN B N   1 
ATOM   2425  C CA  . GLN B  1 128 ? 48.964  34.322  134.915 1.00 39.99  ? 152 GLN B CA  1 
ATOM   2426  C C   . GLN B  1 128 ? 48.232  35.638  135.093 1.00 39.06  ? 152 GLN B C   1 
ATOM   2427  O O   . GLN B  1 128 ? 48.657  36.663  134.500 1.00 36.98  ? 152 GLN B O   1 
ATOM   2428  C CB  . GLN B  1 128 ? 50.006  34.215  136.047 1.00 41.06  ? 152 GLN B CB  1 
ATOM   2429  C CG  . GLN B  1 128 ? 50.818  32.938  136.063 1.00 41.88  ? 152 GLN B CG  1 
ATOM   2430  C CD  . GLN B  1 128 ? 52.010  32.954  137.034 1.00 42.95  ? 152 GLN B CD  1 
ATOM   2431  O OE1 . GLN B  1 128 ? 53.071  32.441  136.670 1.00 43.95  ? 152 GLN B OE1 1 
ATOM   2432  N NE2 . GLN B  1 128 ? 51.846  33.523  138.261 1.00 41.44  ? 152 GLN B NE2 1 
ATOM   2433  N N   . PRO B  1 129 ? 47.195  35.654  135.941 1.00 35.39  ? 153 PRO B N   1 
ATOM   2434  C CA  . PRO B  1 129 ? 46.723  34.564  136.773 1.00 34.84  ? 153 PRO B CA  1 
ATOM   2435  C C   . PRO B  1 129 ? 45.389  33.933  136.320 1.00 35.35  ? 153 PRO B C   1 
ATOM   2436  O O   . PRO B  1 129 ? 44.800  33.059  137.065 1.00 34.23  ? 153 PRO B O   1 
ATOM   2437  C CB  . PRO B  1 129 ? 46.423  35.301  138.047 1.00 34.19  ? 153 PRO B CB  1 
ATOM   2438  C CG  . PRO B  1 129 ? 45.823  36.545  137.565 1.00 33.81  ? 153 PRO B CG  1 
ATOM   2439  C CD  . PRO B  1 129 ? 46.771  36.938  136.494 1.00 34.20  ? 153 PRO B CD  1 
ATOM   2440  N N   . PHE B  1 130 ? 44.901  34.435  135.170 1.00 35.89  ? 154 PHE B N   1 
ATOM   2441  C CA  . PHE B  1 130 ? 43.555  34.181  134.686 1.00 35.87  ? 154 PHE B CA  1 
ATOM   2442  C C   . PHE B  1 130 ? 43.461  33.275  133.472 1.00 37.36  ? 154 PHE B C   1 
ATOM   2443  O O   . PHE B  1 130 ? 42.381  33.043  132.971 1.00 39.12  ? 154 PHE B O   1 
ATOM   2444  C CB  . PHE B  1 130 ? 42.745  35.454  134.504 1.00 35.62  ? 154 PHE B CB  1 
ATOM   2445  C CG  . PHE B  1 130 ? 43.313  36.446  133.579 1.00 36.26  ? 154 PHE B CG  1 
ATOM   2446  C CD1 . PHE B  1 130 ? 43.332  36.223  132.215 1.00 37.15  ? 154 PHE B CD1 1 
ATOM   2447  C CD2 . PHE B  1 130 ? 43.727  37.694  134.067 1.00 37.42  ? 154 PHE B CD2 1 
ATOM   2448  C CE1 . PHE B  1 130 ? 43.848  37.191  131.337 1.00 37.42  ? 154 PHE B CE1 1 
ATOM   2449  C CE2 . PHE B  1 130 ? 44.212  38.664  133.210 1.00 38.90  ? 154 PHE B CE2 1 
ATOM   2450  C CZ  . PHE B  1 130 ? 44.292  38.405  131.828 1.00 38.32  ? 154 PHE B CZ  1 
ATOM   2451  N N   . SER B  1 131 ? 44.574  32.673  133.061 1.00 39.87  ? 155 SER B N   1 
ATOM   2452  C CA  . SER B  1 131 ? 44.607  31.823  131.859 1.00 39.40  ? 155 SER B CA  1 
ATOM   2453  C C   . SER B  1 131 ? 44.634  30.324  132.214 1.00 38.83  ? 155 SER B C   1 
ATOM   2454  O O   . SER B  1 131 ? 45.143  29.905  133.274 1.00 35.44  ? 155 SER B O   1 
ATOM   2455  C CB  . SER B  1 131 ? 45.781  32.243  130.993 1.00 39.15  ? 155 SER B CB  1 
ATOM   2456  O OG  . SER B  1 131 ? 45.547  33.593  130.553 1.00 39.36  ? 155 SER B OG  1 
ATOM   2457  N N   . TYR B  1 132 ? 43.989  29.540  131.356 1.00 37.22  ? 156 TYR B N   1 
ATOM   2458  C CA  . TYR B  1 132 ? 44.100  28.082  131.414 1.00 35.46  ? 156 TYR B CA  1 
ATOM   2459  C C   . TYR B  1 132 ? 45.520  27.756  131.064 1.00 35.69  ? 156 TYR B C   1 
ATOM   2460  O O   . TYR B  1 132 ? 46.136  28.526  130.351 1.00 34.94  ? 156 TYR B O   1 
ATOM   2461  C CB  . TYR B  1 132 ? 43.202  27.534  130.359 1.00 33.67  ? 156 TYR B CB  1 
ATOM   2462  C CG  . TYR B  1 132 ? 43.189  26.069  130.086 1.00 32.77  ? 156 TYR B CG  1 
ATOM   2463  C CD1 . TYR B  1 132 ? 42.475  25.195  130.926 1.00 31.67  ? 156 TYR B CD1 1 
ATOM   2464  C CD2 . TYR B  1 132 ? 43.722  25.543  128.856 1.00 32.01  ? 156 TYR B CD2 1 
ATOM   2465  C CE1 . TYR B  1 132 ? 42.403  23.839  130.641 1.00 31.13  ? 156 TYR B CE1 1 
ATOM   2466  C CE2 . TYR B  1 132 ? 43.619  24.173  128.555 1.00 30.22  ? 156 TYR B CE2 1 
ATOM   2467  C CZ  . TYR B  1 132 ? 42.979  23.336  129.458 1.00 30.28  ? 156 TYR B CZ  1 
ATOM   2468  O OH  . TYR B  1 132 ? 42.843  22.002  129.207 1.00 30.08  ? 156 TYR B OH  1 
ATOM   2469  N N   . HIS B  1 133 ? 46.057  26.674  131.611 1.00 36.84  ? 157 HIS B N   1 
ATOM   2470  C CA  . HIS B  1 133 ? 47.304  26.091  131.109 1.00 37.14  ? 157 HIS B CA  1 
ATOM   2471  C C   . HIS B  1 133 ? 47.138  24.610  131.160 1.00 37.42  ? 157 HIS B C   1 
ATOM   2472  O O   . HIS B  1 133 ? 46.507  24.101  132.104 1.00 37.20  ? 157 HIS B O   1 
ATOM   2473  C CB  . HIS B  1 133 ? 48.463  26.478  131.994 1.00 36.62  ? 157 HIS B CB  1 
ATOM   2474  C CG  . HIS B  1 133 ? 49.803  26.035  131.484 1.00 38.11  ? 157 HIS B CG  1 
ATOM   2475  N ND1 . HIS B  1 133 ? 50.332  26.467  130.279 1.00 39.33  ? 157 HIS B ND1 1 
ATOM   2476  C CD2 . HIS B  1 133 ? 50.748  25.249  132.052 1.00 36.97  ? 157 HIS B CD2 1 
ATOM   2477  C CE1 . HIS B  1 133 ? 51.549  25.972  130.146 1.00 37.86  ? 157 HIS B CE1 1 
ATOM   2478  N NE2 . HIS B  1 133 ? 51.820  25.218  131.197 1.00 36.27  ? 157 HIS B NE2 1 
ATOM   2479  N N   . SER B  1 134 ? 47.685  23.907  130.167 1.00 36.68  ? 158 SER B N   1 
ATOM   2480  C CA  . SER B  1 134 ? 47.681  22.431  130.240 1.00 35.82  ? 158 SER B CA  1 
ATOM   2481  C C   . SER B  1 134 ? 48.904  21.797  129.648 1.00 32.97  ? 158 SER B C   1 
ATOM   2482  O O   . SER B  1 134 ? 49.601  22.401  128.854 1.00 32.47  ? 158 SER B O   1 
ATOM   2483  C CB  . SER B  1 134 ? 46.409  21.815  129.618 1.00 36.74  ? 158 SER B CB  1 
ATOM   2484  O OG  . SER B  1 134 ? 46.547  21.581  128.213 1.00 37.47  ? 158 SER B OG  1 
ATOM   2485  N N   . ARG B  1 135 ? 49.164  20.582  130.067 1.00 31.71  ? 159 ARG B N   1 
ATOM   2486  C CA  . ARG B  1 135 ? 50.293  19.806  129.539 1.00 33.66  ? 159 ARG B CA  1 
ATOM   2487  C C   . ARG B  1 135 ? 49.766  18.408  129.402 1.00 33.66  ? 159 ARG B C   1 
ATOM   2488  O O   . ARG B  1 135 ? 48.935  18.014  130.217 1.00 32.98  ? 159 ARG B O   1 
ATOM   2489  C CB  . ARG B  1 135 ? 51.545  19.835  130.473 1.00 33.69  ? 159 ARG B CB  1 
ATOM   2490  C CG  . ARG B  1 135 ? 52.105  21.245  130.682 1.00 33.15  ? 159 ARG B CG  1 
ATOM   2491  C CD  . ARG B  1 135 ? 52.578  21.902  129.372 1.00 33.10  ? 159 ARG B CD  1 
ATOM   2492  N NE  . ARG B  1 135 ? 53.596  21.131  128.622 1.00 32.45  ? 159 ARG B NE  1 
ATOM   2493  C CZ  . ARG B  1 135 ? 54.911  21.256  128.733 1.00 32.21  ? 159 ARG B CZ  1 
ATOM   2494  N NH1 . ARG B  1 135 ? 55.680  20.504  127.998 1.00 32.40  ? 159 ARG B NH1 1 
ATOM   2495  N NH2 . ARG B  1 135 ? 55.480  22.119  129.567 1.00 34.03  ? 159 ARG B NH2 1 
ATOM   2496  N N   . TYR B  1 136 ? 50.238  17.687  128.382 1.00 33.37  ? 160 TYR B N   1 
ATOM   2497  C CA  . TYR B  1 136 ? 49.762  16.355  128.040 1.00 32.21  ? 160 TYR B CA  1 
ATOM   2498  C C   . TYR B  1 136 ? 50.989  15.602  127.611 1.00 32.19  ? 160 TYR B C   1 
ATOM   2499  O O   . TYR B  1 136 ? 51.647  15.995  126.641 1.00 31.59  ? 160 TYR B O   1 
ATOM   2500  C CB  . TYR B  1 136 ? 48.769  16.495  126.903 1.00 33.56  ? 160 TYR B CB  1 
ATOM   2501  C CG  . TYR B  1 136 ? 48.166  15.207  126.322 1.00 34.46  ? 160 TYR B CG  1 
ATOM   2502  C CD1 . TYR B  1 136 ? 47.247  14.408  127.081 1.00 34.56  ? 160 TYR B CD1 1 
ATOM   2503  C CD2 . TYR B  1 136 ? 48.459  14.823  125.006 1.00 33.59  ? 160 TYR B CD2 1 
ATOM   2504  C CE1 . TYR B  1 136 ? 46.678  13.256  126.540 1.00 34.05  ? 160 TYR B CE1 1 
ATOM   2505  C CE2 . TYR B  1 136 ? 47.929  13.670  124.468 1.00 34.08  ? 160 TYR B CE2 1 
ATOM   2506  C CZ  . TYR B  1 136 ? 47.028  12.920  125.234 1.00 34.95  ? 160 TYR B CZ  1 
ATOM   2507  O OH  . TYR B  1 136 ? 46.528  11.808  124.691 1.00 35.41  ? 160 TYR B OH  1 
ATOM   2508  N N   . PHE B  1 137 ? 51.359  14.573  128.362 1.00 32.82  ? 161 PHE B N   1 
ATOM   2509  C CA  . PHE B  1 137 ? 52.598  13.832  128.066 1.00 33.39  ? 161 PHE B CA  1 
ATOM   2510  C C   . PHE B  1 137 ? 52.611  12.437  128.625 1.00 34.02  ? 161 PHE B C   1 
ATOM   2511  O O   . PHE B  1 137 ? 51.786  12.087  129.444 1.00 32.47  ? 161 PHE B O   1 
ATOM   2512  C CB  . PHE B  1 137 ? 53.819  14.560  128.582 1.00 33.21  ? 161 PHE B CB  1 
ATOM   2513  C CG  . PHE B  1 137 ? 53.805  14.829  130.078 1.00 34.51  ? 161 PHE B CG  1 
ATOM   2514  C CD1 . PHE B  1 137 ? 52.976  15.833  130.629 1.00 35.21  ? 161 PHE B CD1 1 
ATOM   2515  C CD2 . PHE B  1 137 ? 54.620  14.113  130.923 1.00 33.55  ? 161 PHE B CD2 1 
ATOM   2516  C CE1 . PHE B  1 137 ? 52.978  16.087  131.984 1.00 36.00  ? 161 PHE B CE1 1 
ATOM   2517  C CE2 . PHE B  1 137 ? 54.611  14.357  132.276 1.00 34.45  ? 161 PHE B CE2 1 
ATOM   2518  C CZ  . PHE B  1 137 ? 53.808  15.352  132.824 1.00 35.14  ? 161 PHE B CZ  1 
ATOM   2519  N N   . THR B  1 138 ? 53.577  11.654  128.163 1.00 35.66  ? 162 THR B N   1 
ATOM   2520  C CA  . THR B  1 138 ? 53.786  10.318  128.671 1.00 36.17  ? 162 THR B CA  1 
ATOM   2521  C C   . THR B  1 138 ? 54.682  10.412  129.911 1.00 36.61  ? 162 THR B C   1 
ATOM   2522  O O   . THR B  1 138 ? 55.839  10.837  129.825 1.00 37.18  ? 162 THR B O   1 
ATOM   2523  C CB  . THR B  1 138 ? 54.469  9.430   127.636 1.00 36.84  ? 162 THR B CB  1 
ATOM   2524  O OG1 . THR B  1 138 ? 53.660  9.349   126.439 1.00 36.28  ? 162 THR B OG1 1 
ATOM   2525  C CG2 . THR B  1 138 ? 54.730  8.042   128.238 1.00 36.37  ? 162 THR B CG2 1 
ATOM   2526  N N   . PRO B  1 139 ? 54.140  10.038  131.077 1.00 35.94  ? 163 PRO B N   1 
ATOM   2527  C CA  . PRO B  1 139 ? 54.924  10.124  132.291 1.00 34.70  ? 163 PRO B CA  1 
ATOM   2528  C C   . PRO B  1 139 ? 55.667  8.833   132.407 1.00 34.16  ? 163 PRO B C   1 
ATOM   2529  O O   . PRO B  1 139 ? 55.462  7.934   131.583 1.00 35.28  ? 163 PRO B O   1 
ATOM   2530  C CB  . PRO B  1 139 ? 53.845  10.212  133.356 1.00 35.22  ? 163 PRO B CB  1 
ATOM   2531  C CG  . PRO B  1 139 ? 52.804  9.287   132.850 1.00 35.32  ? 163 PRO B CG  1 
ATOM   2532  C CD  . PRO B  1 139 ? 52.806  9.453   131.344 1.00 35.11  ? 163 PRO B CD  1 
ATOM   2533  N N   . LYS B  1 140 ? 56.516  8.729   133.411 1.00 34.01  ? 164 LYS B N   1 
ATOM   2534  C CA  . LYS B  1 140 ? 57.342  7.524   133.614 1.00 33.51  ? 164 LYS B CA  1 
ATOM   2535  C C   . LYS B  1 140 ? 57.292  7.126   135.065 1.00 34.45  ? 164 LYS B C   1 
ATOM   2536  O O   . LYS B  1 140 ? 57.217  7.978   135.996 1.00 35.15  ? 164 LYS B O   1 
ATOM   2537  C CB  . LYS B  1 140 ? 58.796  7.775   133.230 1.00 33.01  ? 164 LYS B CB  1 
ATOM   2538  C CG  . LYS B  1 140 ? 58.971  8.453   131.872 1.00 32.76  ? 164 LYS B CG  1 
ATOM   2539  C CD  . LYS B  1 140 ? 58.557  7.489   130.769 1.00 32.35  ? 164 LYS B CD  1 
ATOM   2540  C CE  . LYS B  1 140 ? 58.603  8.120   129.415 1.00 32.81  ? 164 LYS B CE  1 
ATOM   2541  N NZ  . LYS B  1 140 ? 58.522  7.089   128.337 1.00 33.63  ? 164 LYS B NZ  1 
ATOM   2542  N N   . PRO B  1 141 ? 57.334  5.836   135.295 1.00 33.57  ? 165 PRO B N   1 
ATOM   2543  C CA  . PRO B  1 141 ? 57.370  5.443   136.658 1.00 33.34  ? 165 PRO B CA  1 
ATOM   2544  C C   . PRO B  1 141 ? 58.766  5.615   137.262 1.00 33.73  ? 165 PRO B C   1 
ATOM   2545  O O   . PRO B  1 141 ? 59.807  5.536   136.546 1.00 34.33  ? 165 PRO B O   1 
ATOM   2546  C CB  . PRO B  1 141 ? 56.940  4.004   136.581 1.00 34.41  ? 165 PRO B CB  1 
ATOM   2547  C CG  . PRO B  1 141 ? 57.406  3.528   135.242 1.00 34.69  ? 165 PRO B CG  1 
ATOM   2548  C CD  . PRO B  1 141 ? 57.195  4.709   134.371 1.00 34.24  ? 165 PRO B CD  1 
ATOM   2549  N N   . VAL B  1 142 ? 58.768  5.844   138.580 1.00 34.11  ? 166 VAL B N   1 
ATOM   2550  C CA  . VAL B  1 142 ? 60.001  5.857   139.400 1.00 34.83  ? 166 VAL B CA  1 
ATOM   2551  C C   . VAL B  1 142 ? 60.415  4.425   139.817 1.00 35.34  ? 166 VAL B C   1 
ATOM   2552  O O   . VAL B  1 142 ? 60.007  3.923   140.878 1.00 37.52  ? 166 VAL B O   1 
ATOM   2553  C CB  . VAL B  1 142 ? 59.860  6.776   140.653 1.00 34.67  ? 166 VAL B CB  1 
ATOM   2554  C CG1 . VAL B  1 142 ? 61.180  6.859   141.427 1.00 34.09  ? 166 VAL B CG1 1 
ATOM   2555  C CG2 . VAL B  1 142 ? 59.418  8.177   140.242 1.00 34.22  ? 166 VAL B CG2 1 
ATOM   2556  N N   . LEU B  1 143 ? 61.227  3.780   138.989 1.00 35.01  ? 167 LEU B N   1 
ATOM   2557  C CA  . LEU B  1 143 ? 61.563  2.383   139.199 1.00 36.10  ? 167 LEU B CA  1 
ATOM   2558  C C   . LEU B  1 143 ? 62.726  2.238   140.141 1.00 36.58  ? 167 LEU B C   1 
ATOM   2559  O O   . LEU B  1 143 ? 62.768  1.315   140.917 1.00 35.58  ? 167 LEU B O   1 
ATOM   2560  C CB  . LEU B  1 143 ? 61.894  1.725   137.866 1.00 36.91  ? 167 LEU B CB  1 
ATOM   2561  C CG  . LEU B  1 143 ? 60.722  1.163   137.030 1.00 38.93  ? 167 LEU B CG  1 
ATOM   2562  C CD1 . LEU B  1 143 ? 59.269  1.374   137.539 1.00 38.99  ? 167 LEU B CD1 1 
ATOM   2563  C CD2 . LEU B  1 143 ? 60.873  1.650   135.609 1.00 38.39  ? 167 LEU B CD2 1 
ATOM   2564  N N   . ASP B  1 144 ? 63.668  3.163   140.053 1.00 38.93  ? 168 ASP B N   1 
ATOM   2565  C CA  . ASP B  1 144 ? 64.836  3.190   140.906 1.00 42.89  ? 168 ASP B CA  1 
ATOM   2566  C C   . ASP B  1 144 ? 65.241  4.667   141.039 1.00 43.21  ? 168 ASP B C   1 
ATOM   2567  O O   . ASP B  1 144 ? 65.733  5.251   140.084 1.00 45.33  ? 168 ASP B O   1 
ATOM   2568  C CB  . ASP B  1 144 ? 65.941  2.345   140.256 1.00 46.33  ? 168 ASP B CB  1 
ATOM   2569  C CG  . ASP B  1 144 ? 67.205  2.212   141.124 1.00 50.68  ? 168 ASP B CG  1 
ATOM   2570  O OD1 . ASP B  1 144 ? 67.358  2.971   142.110 1.00 50.99  ? 168 ASP B OD1 1 
ATOM   2571  O OD2 . ASP B  1 144 ? 68.043  1.326   140.808 1.00 55.32  ? 168 ASP B OD2 1 
ATOM   2572  N N   . SER B  1 145 ? 65.007  5.283   142.194 1.00 43.00  ? 169 SER B N   1 
ATOM   2573  C CA  . SER B  1 145 ? 65.314  6.722   142.379 1.00 44.78  ? 169 SER B CA  1 
ATOM   2574  C C   . SER B  1 145 ? 66.777  7.026   142.745 1.00 46.37  ? 169 SER B C   1 
ATOM   2575  O O   . SER B  1 145 ? 67.138  8.154   142.977 1.00 47.35  ? 169 SER B O   1 
ATOM   2576  C CB  . SER B  1 145 ? 64.422  7.313   143.446 1.00 44.94  ? 169 SER B CB  1 
ATOM   2577  O OG  . SER B  1 145 ? 64.693  6.622   144.661 1.00 43.94  ? 169 SER B OG  1 
ATOM   2578  N N   . THR B  1 146 ? 67.621  6.022   142.832 1.00 48.75  ? 170 THR B N   1 
ATOM   2579  C CA  . THR B  1 146 ? 69.071  6.246   142.810 1.00 49.73  ? 170 THR B CA  1 
ATOM   2580  C C   . THR B  1 146 ? 69.546  6.573   141.384 1.00 47.69  ? 170 THR B C   1 
ATOM   2581  O O   . THR B  1 146 ? 70.136  7.608   141.145 1.00 49.93  ? 170 THR B O   1 
ATOM   2582  C CB  . THR B  1 146 ? 69.781  4.979   143.322 1.00 51.13  ? 170 THR B CB  1 
ATOM   2583  O OG1 . THR B  1 146 ? 69.333  4.748   144.647 1.00 45.19  ? 170 THR B OG1 1 
ATOM   2584  C CG2 . THR B  1 146 ? 71.344  5.104   143.277 1.00 55.84  ? 170 THR B CG2 1 
ATOM   2585  N N   . ILE B  1 147 ? 69.236  5.679   140.461 1.00 44.61  ? 171 ILE B N   1 
ATOM   2586  C CA  . ILE B  1 147 ? 69.675  5.773   139.099 1.00 44.57  ? 171 ILE B CA  1 
ATOM   2587  C C   . ILE B  1 147 ? 68.722  6.575   138.206 1.00 44.41  ? 171 ILE B C   1 
ATOM   2588  O O   . ILE B  1 147 ? 69.170  7.203   137.284 1.00 46.01  ? 171 ILE B O   1 
ATOM   2589  C CB  . ILE B  1 147 ? 69.861  4.393   138.471 1.00 43.34  ? 171 ILE B CB  1 
ATOM   2590  C CG1 . ILE B  1 147 ? 70.699  3.499   139.376 1.00 42.80  ? 171 ILE B CG1 1 
ATOM   2591  C CG2 . ILE B  1 147 ? 70.575  4.556   137.140 1.00 43.88  ? 171 ILE B CG2 1 
ATOM   2592  C CD1 . ILE B  1 147 ? 70.735  2.031   138.983 1.00 42.59  ? 171 ILE B CD1 1 
ATOM   2593  N N   . ASP B  1 148 ? 67.423  6.530   138.459 1.00 44.64  ? 172 ASP B N   1 
ATOM   2594  C CA  . ASP B  1 148 ? 66.446  7.370   137.766 1.00 44.73  ? 172 ASP B CA  1 
ATOM   2595  C C   . ASP B  1 148 ? 66.428  7.181   136.270 1.00 42.76  ? 172 ASP B C   1 
ATOM   2596  O O   . ASP B  1 148 ? 66.667  8.095   135.508 1.00 40.72  ? 172 ASP B O   1 
ATOM   2597  C CB  . ASP B  1 148 ? 66.639  8.861   138.106 1.00 47.84  ? 172 ASP B CB  1 
ATOM   2598  C CG  . ASP B  1 148 ? 65.967  9.259   139.417 1.00 48.57  ? 172 ASP B CG  1 
ATOM   2599  O OD1 . ASP B  1 148 ? 64.832  8.755   139.720 1.00 51.28  ? 172 ASP B OD1 1 
ATOM   2600  O OD2 . ASP B  1 148 ? 66.580  10.111  140.092 1.00 44.70  ? 172 ASP B OD2 1 
ATOM   2601  N N   . TYR B  1 149 ? 66.077  5.969   135.885 1.00 42.86  ? 173 TYR B N   1 
ATOM   2602  C CA  . TYR B  1 149 ? 65.920  5.583   134.492 1.00 41.93  ? 173 TYR B CA  1 
ATOM   2603  C C   . TYR B  1 149 ? 64.458  5.506   133.993 1.00 42.42  ? 173 TYR B C   1 
ATOM   2604  O O   . TYR B  1 149 ? 63.478  5.224   134.736 1.00 42.79  ? 173 TYR B O   1 
ATOM   2605  C CB  . TYR B  1 149 ? 66.648  4.274   134.220 1.00 40.59  ? 173 TYR B CB  1 
ATOM   2606  C CG  . TYR B  1 149 ? 66.220  3.068   135.054 1.00 42.47  ? 173 TYR B CG  1 
ATOM   2607  C CD1 . TYR B  1 149 ? 65.107  2.288   134.711 1.00 43.04  ? 173 TYR B CD1 1 
ATOM   2608  C CD2 . TYR B  1 149 ? 66.981  2.662   136.148 1.00 43.94  ? 173 TYR B CD2 1 
ATOM   2609  C CE1 . TYR B  1 149 ? 64.773  1.151   135.443 1.00 44.13  ? 173 TYR B CE1 1 
ATOM   2610  C CE2 . TYR B  1 149 ? 66.654  1.541   136.898 1.00 45.20  ? 173 TYR B CE2 1 
ATOM   2611  C CZ  . TYR B  1 149 ? 65.552  0.792   136.556 1.00 46.31  ? 173 TYR B CZ  1 
ATOM   2612  O OH  . TYR B  1 149 ? 65.277  -0.306  137.350 1.00 46.64  ? 173 TYR B OH  1 
ATOM   2613  N N   . PHE B  1 150 ? 64.325  5.765   132.703 1.00 40.99  ? 174 PHE B N   1 
ATOM   2614  C CA  . PHE B  1 150 ? 63.053  5.642   132.072 1.00 39.56  ? 174 PHE B CA  1 
ATOM   2615  C C   . PHE B  1 150 ? 63.183  5.189   130.628 1.00 39.95  ? 174 PHE B C   1 
ATOM   2616  O O   . PHE B  1 150 ? 64.260  5.299   130.040 1.00 38.54  ? 174 PHE B O   1 
ATOM   2617  C CB  . PHE B  1 150 ? 62.280  6.933   132.249 1.00 38.26  ? 174 PHE B CB  1 
ATOM   2618  C CG  . PHE B  1 150 ? 62.898  8.139   131.610 1.00 37.60  ? 174 PHE B CG  1 
ATOM   2619  C CD1 . PHE B  1 150 ? 62.541  8.531   130.329 1.00 36.36  ? 174 PHE B CD1 1 
ATOM   2620  C CD2 . PHE B  1 150 ? 63.769  8.941   132.300 1.00 38.34  ? 174 PHE B CD2 1 
ATOM   2621  C CE1 . PHE B  1 150 ? 63.043  9.677   129.748 1.00 34.62  ? 174 PHE B CE1 1 
ATOM   2622  C CE2 . PHE B  1 150 ? 64.287  10.088  131.703 1.00 37.17  ? 174 PHE B CE2 1 
ATOM   2623  C CZ  . PHE B  1 150 ? 63.918  10.449  130.424 1.00 35.15  ? 174 PHE B CZ  1 
ATOM   2624  N N   . GLN B  1 151 ? 62.094  4.589   130.123 1.00 39.87  ? 175 GLN B N   1 
ATOM   2625  C CA  . GLN B  1 151 ? 61.977  4.140   128.742 1.00 38.10  ? 175 GLN B CA  1 
ATOM   2626  C C   . GLN B  1 151 ? 61.792  5.335   127.866 1.00 38.84  ? 175 GLN B C   1 
ATOM   2627  O O   . GLN B  1 151 ? 61.234  6.297   128.294 1.00 36.04  ? 175 GLN B O   1 
ATOM   2628  C CB  . GLN B  1 151 ? 60.727  3.304   128.566 1.00 37.65  ? 175 GLN B CB  1 
ATOM   2629  C CG  . GLN B  1 151 ? 60.818  1.981   129.261 1.00 38.33  ? 175 GLN B CG  1 
ATOM   2630  C CD  . GLN B  1 151 ? 59.590  1.126   129.039 1.00 39.03  ? 175 GLN B CD  1 
ATOM   2631  O OE1 . GLN B  1 151 ? 58.506  1.391   129.621 1.00 40.06  ? 175 GLN B OE1 1 
ATOM   2632  N NE2 . GLN B  1 151 ? 59.762  0.047   128.276 1.00 35.65  ? 175 GLN B NE2 1 
ATOM   2633  N N   . PRO B  1 152 ? 62.232  5.274   126.623 1.00 43.34  ? 176 PRO B N   1 
ATOM   2634  C CA  . PRO B  1 152 ? 61.801  6.280   125.680 1.00 46.71  ? 176 PRO B CA  1 
ATOM   2635  C C   . PRO B  1 152 ? 60.351  6.134   125.363 1.00 53.44  ? 176 PRO B C   1 
ATOM   2636  O O   . PRO B  1 152 ? 59.825  5.020   125.380 1.00 49.57  ? 176 PRO B O   1 
ATOM   2637  C CB  . PRO B  1 152 ? 62.595  5.968   124.453 1.00 44.97  ? 176 PRO B CB  1 
ATOM   2638  C CG  . PRO B  1 152 ? 63.850  5.442   125.017 1.00 45.45  ? 176 PRO B CG  1 
ATOM   2639  C CD  . PRO B  1 152 ? 63.452  4.610   126.175 1.00 44.62  ? 176 PRO B CD  1 
ATOM   2640  N N   . ASN B  1 153 ? 59.737  7.287   125.077 1.00 68.97  ? 177 ASN B N   1 
ATOM   2641  C CA  . ASN B  1 153 ? 58.314  7.422   124.727 1.00 74.80  ? 177 ASN B CA  1 
ATOM   2642  C C   . ASN B  1 153 ? 58.106  6.472   123.516 1.00 80.28  ? 177 ASN B C   1 
ATOM   2643  O O   . ASN B  1 153 ? 58.854  6.481   122.530 1.00 76.59  ? 177 ASN B O   1 
ATOM   2644  C CB  . ASN B  1 153 ? 57.956  8.917   124.429 1.00 73.62  ? 177 ASN B CB  1 
ATOM   2645  C CG  . ASN B  1 153 ? 58.357  9.872   125.566 1.00 73.14  ? 177 ASN B CG  1 
ATOM   2646  O OD1 . ASN B  1 153 ? 59.526  10.318  125.727 1.00 61.44  ? 177 ASN B OD1 1 
ATOM   2647  N ND2 . ASN B  1 153 ? 57.377  10.186  126.364 1.00 75.24  ? 177 ASN B ND2 1 
ATOM   2648  N N   . ASN B  1 154 ? 57.143  5.582   123.651 1.00 93.67  ? 178 ASN B N   1 
ATOM   2649  C CA  . ASN B  1 154 ? 56.947  4.471   122.701 1.00 104.23 ? 178 ASN B CA  1 
ATOM   2650  C C   . ASN B  1 154 ? 55.618  3.765   123.074 1.00 115.24 ? 178 ASN B C   1 
ATOM   2651  O O   . ASN B  1 154 ? 55.094  3.997   124.179 1.00 122.46 ? 178 ASN B O   1 
ATOM   2652  C CB  . ASN B  1 154 ? 58.129  3.495   122.790 1.00 99.88  ? 178 ASN B CB  1 
ATOM   2653  C CG  . ASN B  1 154 ? 58.239  2.606   121.590 1.00 95.28  ? 178 ASN B CG  1 
ATOM   2654  O OD1 . ASN B  1 154 ? 57.462  1.666   121.430 1.00 90.58  ? 178 ASN B OD1 1 
ATOM   2655  N ND2 . ASN B  1 154 ? 59.214  2.887   120.742 1.00 87.94  ? 178 ASN B ND2 1 
ATOM   2656  N N   . LYS B  1 155 ? 55.074  2.933   122.181 1.00 114.88 ? 179 LYS B N   1 
ATOM   2657  C CA  . LYS B  1 155 ? 53.737  2.319   122.398 1.00 110.89 ? 179 LYS B CA  1 
ATOM   2658  C C   . LYS B  1 155 ? 53.822  0.826   122.821 1.00 94.92  ? 179 LYS B C   1 
ATOM   2659  O O   . LYS B  1 155 ? 53.639  0.479   123.976 1.00 80.22  ? 179 LYS B O   1 
ATOM   2660  C CB  . LYS B  1 155 ? 52.765  2.541   121.177 1.00 121.89 ? 179 LYS B CB  1 
ATOM   2661  C CG  . LYS B  1 155 ? 53.332  2.577   119.729 1.00 120.47 ? 179 LYS B CG  1 
ATOM   2662  C CD  . LYS B  1 155 ? 52.304  3.133   118.751 1.00 117.93 ? 179 LYS B CD  1 
ATOM   2663  C CE  . LYS B  1 155 ? 52.224  4.669   118.828 1.00 118.25 ? 179 LYS B CE  1 
ATOM   2664  N NZ  . LYS B  1 155 ? 50.876  5.216   118.482 1.00 116.10 ? 179 LYS B NZ  1 
ATOM   2665  N N   . ARG B  1 156 ? 54.123  -0.028  121.853 1.00 92.38  ? 180 ARG B N   1 
ATOM   2666  C CA  . ARG B  1 156 ? 54.102  -1.476  122.007 1.00 85.36  ? 180 ARG B CA  1 
ATOM   2667  C C   . ARG B  1 156 ? 54.987  -1.968  123.144 1.00 74.67  ? 180 ARG B C   1 
ATOM   2668  O O   . ARG B  1 156 ? 54.571  -2.915  123.792 1.00 74.51  ? 180 ARG B O   1 
ATOM   2669  C CB  . ARG B  1 156 ? 54.410  -2.231  120.664 1.00 93.99  ? 180 ARG B CB  1 
ATOM   2670  C CG  . ARG B  1 156 ? 55.202  -1.495  119.557 1.00 98.00  ? 180 ARG B CG  1 
ATOM   2671  C CD  . ARG B  1 156 ? 55.814  -2.431  118.505 1.00 101.56 ? 180 ARG B CD  1 
ATOM   2672  N NE  . ARG B  1 156 ? 56.957  -1.801  117.800 1.00 105.68 ? 180 ARG B NE  1 
ATOM   2673  C CZ  . ARG B  1 156 ? 58.144  -2.374  117.499 1.00 100.98 ? 180 ARG B CZ  1 
ATOM   2674  N NH1 . ARG B  1 156 ? 59.073  -1.666  116.867 1.00 97.22  ? 180 ARG B NH1 1 
ATOM   2675  N NH2 . ARG B  1 156 ? 58.444  -3.632  117.821 1.00 97.03  ? 180 ARG B NH2 1 
ATOM   2676  N N   . ASN B  1 157 ? 56.126  -1.278  123.404 1.00 63.60  ? 181 ASN B N   1 
ATOM   2677  C CA  . ASN B  1 157 ? 57.219  -1.662  124.376 1.00 53.26  ? 181 ASN B CA  1 
ATOM   2678  C C   . ASN B  1 157 ? 57.132  -1.148  125.817 1.00 44.97  ? 181 ASN B C   1 
ATOM   2679  O O   . ASN B  1 157 ? 57.952  -1.529  126.658 1.00 39.26  ? 181 ASN B O   1 
ATOM   2680  C CB  . ASN B  1 157 ? 58.611  -1.223  123.834 1.00 54.70  ? 181 ASN B CB  1 
ATOM   2681  C CG  . ASN B  1 157 ? 59.045  -2.020  122.597 1.00 56.68  ? 181 ASN B CG  1 
ATOM   2682  O OD1 . ASN B  1 157 ? 59.144  -3.253  122.636 1.00 59.96  ? 181 ASN B OD1 1 
ATOM   2683  N ND2 . ASN B  1 157 ? 59.277  -1.320  121.482 1.00 58.11  ? 181 ASN B ND2 1 
ATOM   2684  N N   . GLN B  1 158 ? 56.142  -0.314  126.124 1.00 40.42  ? 182 GLN B N   1 
ATOM   2685  C CA  . GLN B  1 158 ? 55.997  0.214   127.480 1.00 37.70  ? 182 GLN B CA  1 
ATOM   2686  C C   . GLN B  1 158 ? 55.782  -0.807  128.616 1.00 35.15  ? 182 GLN B C   1 
ATOM   2687  O O   . GLN B  1 158 ? 54.918  -1.691  128.550 1.00 32.21  ? 182 GLN B O   1 
ATOM   2688  C CB  . GLN B  1 158 ? 54.842  1.194   127.523 1.00 39.52  ? 182 GLN B CB  1 
ATOM   2689  C CG  . GLN B  1 158 ? 54.773  1.972   128.846 1.00 40.42  ? 182 GLN B CG  1 
ATOM   2690  C CD  . GLN B  1 158 ? 53.674  2.996   128.926 1.00 39.54  ? 182 GLN B CD  1 
ATOM   2691  O OE1 . GLN B  1 158 ? 52.683  2.940   128.217 1.00 37.50  ? 182 GLN B OE1 1 
ATOM   2692  N NE2 . GLN B  1 158 ? 53.835  3.908   129.855 1.00 41.71  ? 182 GLN B NE2 1 
ATOM   2693  N N   . LEU B  1 159 ? 56.513  -0.635  129.708 1.00 34.16  ? 183 LEU B N   1 
ATOM   2694  C CA  . LEU B  1 159 ? 56.433  -1.597  130.796 1.00 34.38  ? 183 LEU B CA  1 
ATOM   2695  C C   . LEU B  1 159 ? 55.039  -1.663  131.385 1.00 33.80  ? 183 LEU B C   1 
ATOM   2696  O O   . LEU B  1 159 ? 54.366  -0.622  131.521 1.00 33.47  ? 183 LEU B O   1 
ATOM   2697  C CB  . LEU B  1 159 ? 57.412  -1.210  131.865 1.00 35.76  ? 183 LEU B CB  1 
ATOM   2698  C CG  . LEU B  1 159 ? 58.811  -1.844  131.912 1.00 38.16  ? 183 LEU B CG  1 
ATOM   2699  C CD1 . LEU B  1 159 ? 59.207  -2.757  130.758 1.00 37.24  ? 183 LEU B CD1 1 
ATOM   2700  C CD2 . LEU B  1 159 ? 59.865  -0.743  132.177 1.00 39.86  ? 183 LEU B CD2 1 
ATOM   2701  N N   . TRP B  1 160 ? 54.584  -2.881  131.683 1.00 32.83  ? 184 TRP B N   1 
ATOM   2702  C CA  . TRP B  1 160 ? 53.340  -3.099  132.461 1.00 31.50  ? 184 TRP B CA  1 
ATOM   2703  C C   . TRP B  1 160 ? 53.731  -3.118  133.917 1.00 30.94  ? 184 TRP B C   1 
ATOM   2704  O O   . TRP B  1 160 ? 54.798  -3.535  134.237 1.00 30.45  ? 184 TRP B O   1 
ATOM   2705  C CB  . TRP B  1 160 ? 52.703  -4.443  132.118 1.00 31.35  ? 184 TRP B CB  1 
ATOM   2706  C CG  . TRP B  1 160 ? 52.149  -4.540  130.728 1.00 31.77  ? 184 TRP B CG  1 
ATOM   2707  C CD1 . TRP B  1 160 ? 52.712  -5.177  129.650 1.00 33.02  ? 184 TRP B CD1 1 
ATOM   2708  C CD2 . TRP B  1 160 ? 50.909  -3.989  130.255 1.00 31.63  ? 184 TRP B CD2 1 
ATOM   2709  N NE1 . TRP B  1 160 ? 51.898  -5.027  128.517 1.00 32.65  ? 184 TRP B NE1 1 
ATOM   2710  C CE2 . TRP B  1 160 ? 50.791  -4.315  128.871 1.00 31.33  ? 184 TRP B CE2 1 
ATOM   2711  C CE3 . TRP B  1 160 ? 49.915  -3.210  130.852 1.00 31.27  ? 184 TRP B CE3 1 
ATOM   2712  C CZ2 . TRP B  1 160 ? 49.735  -3.907  128.101 1.00 31.13  ? 184 TRP B CZ2 1 
ATOM   2713  C CZ3 . TRP B  1 160 ? 48.844  -2.825  130.092 1.00 31.63  ? 184 TRP B CZ3 1 
ATOM   2714  C CH2 . TRP B  1 160 ? 48.758  -3.163  128.715 1.00 31.52  ? 184 TRP B CH2 1 
ATOM   2715  N N   . LEU B  1 161 ? 52.861  -2.630  134.782 1.00 32.00  ? 185 LEU B N   1 
ATOM   2716  C CA  . LEU B  1 161 ? 53.039  -2.591  136.238 1.00 31.96  ? 185 LEU B CA  1 
ATOM   2717  C C   . LEU B  1 161 ? 51.862  -3.344  136.851 1.00 32.72  ? 185 LEU B C   1 
ATOM   2718  O O   . LEU B  1 161 ? 50.754  -3.286  136.357 1.00 30.68  ? 185 LEU B O   1 
ATOM   2719  C CB  . LEU B  1 161 ? 52.959  -1.167  136.744 1.00 32.15  ? 185 LEU B CB  1 
ATOM   2720  C CG  . LEU B  1 161 ? 53.859  -0.176  136.032 1.00 33.04  ? 185 LEU B CG  1 
ATOM   2721  C CD1 . LEU B  1 161 ? 53.606  1.226   136.525 1.00 34.59  ? 185 LEU B CD1 1 
ATOM   2722  C CD2 . LEU B  1 161 ? 55.295  -0.513  136.281 1.00 32.71  ? 185 LEU B CD2 1 
ATOM   2723  N N   . ARG B  1 162 ? 52.111  -4.057  137.929 1.00 35.63  ? 186 ARG B N   1 
ATOM   2724  C CA  . ARG B  1 162 ? 51.049  -4.615  138.725 1.00 37.84  ? 186 ARG B CA  1 
ATOM   2725  C C   . ARG B  1 162 ? 50.205  -3.484  139.329 1.00 37.92  ? 186 ARG B C   1 
ATOM   2726  O O   . ARG B  1 162 ? 50.764  -2.481  139.857 1.00 39.20  ? 186 ARG B O   1 
ATOM   2727  C CB  . ARG B  1 162 ? 51.647  -5.453  139.829 1.00 39.96  ? 186 ARG B CB  1 
ATOM   2728  C CG  . ARG B  1 162 ? 50.667  -5.982  140.863 1.00 42.16  ? 186 ARG B CG  1 
ATOM   2729  C CD  . ARG B  1 162 ? 51.330  -7.075  141.750 1.00 45.34  ? 186 ARG B CD  1 
ATOM   2730  N NE  . ARG B  1 162 ? 51.572  -6.630  143.130 1.00 46.58  ? 186 ARG B NE  1 
ATOM   2731  C CZ  . ARG B  1 162 ? 50.633  -6.552  144.061 1.00 47.05  ? 186 ARG B CZ  1 
ATOM   2732  N NH1 . ARG B  1 162 ? 50.887  -6.070  145.273 1.00 48.02  ? 186 ARG B NH1 1 
ATOM   2733  N NH2 . ARG B  1 162 ? 49.404  -6.885  143.756 1.00 49.70  ? 186 ARG B NH2 1 
ATOM   2734  N N   . LEU B  1 163 ? 48.883  -3.663  139.244 1.00 37.06  ? 187 LEU B N   1 
ATOM   2735  C CA  . LEU B  1 163 ? 47.923  -2.760  139.853 1.00 38.53  ? 187 LEU B CA  1 
ATOM   2736  C C   . LEU B  1 163 ? 47.817  -3.194  141.291 1.00 40.68  ? 187 LEU B C   1 
ATOM   2737  O O   . LEU B  1 163 ? 47.297  -4.265  141.576 1.00 44.14  ? 187 LEU B O   1 
ATOM   2738  C CB  . LEU B  1 163 ? 46.564  -2.881  139.195 1.00 38.69  ? 187 LEU B CB  1 
ATOM   2739  C CG  . LEU B  1 163 ? 45.563  -1.712  139.074 1.00 38.74  ? 187 LEU B CG  1 
ATOM   2740  C CD1 . LEU B  1 163 ? 44.119  -2.243  138.969 1.00 38.37  ? 187 LEU B CD1 1 
ATOM   2741  C CD2 . LEU B  1 163 ? 45.660  -0.753  140.209 1.00 38.12  ? 187 LEU B CD2 1 
ATOM   2742  N N   . GLN B  1 164 ? 48.380  -2.400  142.188 1.00 41.97  ? 188 GLN B N   1 
ATOM   2743  C CA  . GLN B  1 164 ? 48.471  -2.749  143.585 1.00 42.12  ? 188 GLN B CA  1 
ATOM   2744  C C   . GLN B  1 164 ? 47.253  -2.154  144.303 1.00 43.51  ? 188 GLN B C   1 
ATOM   2745  O O   . GLN B  1 164 ? 46.618  -1.187  143.786 1.00 35.95  ? 188 GLN B O   1 
ATOM   2746  C CB  . GLN B  1 164 ? 49.775  -2.226  144.158 1.00 42.98  ? 188 GLN B CB  1 
ATOM   2747  C CG  . GLN B  1 164 ? 50.978  -3.013  143.699 1.00 45.06  ? 188 GLN B CG  1 
ATOM   2748  C CD  . GLN B  1 164 ? 52.286  -2.408  144.170 1.00 46.65  ? 188 GLN B CD  1 
ATOM   2749  O OE1 . GLN B  1 164 ? 53.097  -2.041  143.361 1.00 49.57  ? 188 GLN B OE1 1 
ATOM   2750  N NE2 . GLN B  1 164 ? 52.465  -2.251  145.470 1.00 49.55  ? 188 GLN B NE2 1 
ATOM   2751  N N   . THR B  1 165 ? 46.910  -2.736  145.479 1.00 47.06  ? 189 THR B N   1 
ATOM   2752  C CA  . THR B  1 165 ? 45.764  -2.189  146.252 1.00 50.05  ? 189 THR B CA  1 
ATOM   2753  C C   . THR B  1 165 ? 46.213  -0.834  146.869 1.00 50.28  ? 189 THR B C   1 
ATOM   2754  O O   . THR B  1 165 ? 45.644  0.247   146.628 1.00 43.99  ? 189 THR B O   1 
ATOM   2755  C CB  . THR B  1 165 ? 45.207  -3.170  147.333 1.00 52.39  ? 189 THR B CB  1 
ATOM   2756  O OG1 . THR B  1 165 ? 45.468  -4.579  147.015 1.00 54.80  ? 189 THR B OG1 1 
ATOM   2757  C CG2 . THR B  1 165 ? 43.720  -2.888  147.564 1.00 49.14  ? 189 THR B CG2 1 
ATOM   2758  N N   . ALA B  1 166 ? 47.342  -0.898  147.569 1.00 54.80  ? 190 ALA B N   1 
ATOM   2759  C CA  . ALA B  1 166 ? 47.794  0.224   148.382 1.00 53.61  ? 190 ALA B CA  1 
ATOM   2760  C C   . ALA B  1 166 ? 49.000  0.927   147.845 1.00 50.54  ? 190 ALA B C   1 
ATOM   2761  O O   . ALA B  1 166 ? 49.029  2.150   147.898 1.00 60.51  ? 190 ALA B O   1 
ATOM   2762  C CB  . ALA B  1 166 ? 48.081  -0.239  149.813 1.00 55.34  ? 190 ALA B CB  1 
ATOM   2763  N N   . GLY B  1 167 ? 50.042  0.232   147.434 1.00 44.45  ? 191 GLY B N   1 
ATOM   2764  C CA  . GLY B  1 167 ? 51.340  0.949   147.457 1.00 44.16  ? 191 GLY B CA  1 
ATOM   2765  C C   . GLY B  1 167 ? 51.889  1.297   146.099 1.00 44.10  ? 191 GLY B C   1 
ATOM   2766  O O   . GLY B  1 167 ? 53.007  0.910   145.798 1.00 46.08  ? 191 GLY B O   1 
ATOM   2767  N N   . ASN B  1 168 ? 51.095  1.956   145.245 1.00 41.26  ? 192 ASN B N   1 
ATOM   2768  C CA  . ASN B  1 168 ? 51.406  1.967   143.836 1.00 37.38  ? 192 ASN B CA  1 
ATOM   2769  C C   . ASN B  1 168 ? 52.589  2.901   143.603 1.00 37.59  ? 192 ASN B C   1 
ATOM   2770  O O   . ASN B  1 168 ? 52.919  3.721   144.434 1.00 34.00  ? 192 ASN B O   1 
ATOM   2771  C CB  . ASN B  1 168 ? 50.207  2.310   142.994 1.00 35.88  ? 192 ASN B CB  1 
ATOM   2772  C CG  . ASN B  1 168 ? 49.359  1.089   142.670 1.00 36.35  ? 192 ASN B CG  1 
ATOM   2773  O OD1 . ASN B  1 168 ? 49.672  0.270   141.784 1.00 34.95  ? 192 ASN B OD1 1 
ATOM   2774  N ND2 . ASN B  1 168 ? 48.239  0.982   143.355 1.00 37.50  ? 192 ASN B ND2 1 
ATOM   2775  N N   . VAL B  1 169 ? 53.256  2.731   142.478 1.00 37.95  ? 193 VAL B N   1 
ATOM   2776  C CA  . VAL B  1 169 ? 54.486  3.442   142.266 1.00 39.21  ? 193 VAL B CA  1 
ATOM   2777  C C   . VAL B  1 169 ? 54.212  4.823   141.695 1.00 39.13  ? 193 VAL B C   1 
ATOM   2778  O O   . VAL B  1 169 ? 53.443  4.957   140.775 1.00 41.08  ? 193 VAL B O   1 
ATOM   2779  C CB  . VAL B  1 169 ? 55.459  2.622   141.397 1.00 40.06  ? 193 VAL B CB  1 
ATOM   2780  C CG1 . VAL B  1 169 ? 54.988  2.505   139.960 1.00 40.07  ? 193 VAL B CG1 1 
ATOM   2781  C CG2 . VAL B  1 169 ? 56.862  3.227   141.468 1.00 41.72  ? 193 VAL B CG2 1 
ATOM   2782  N N   . ASP B  1 170 ? 54.824  5.852   142.268 1.00 41.00  ? 194 ASP B N   1 
ATOM   2783  C CA  . ASP B  1 170 ? 54.757  7.234   141.734 1.00 42.30  ? 194 ASP B CA  1 
ATOM   2784  C C   . ASP B  1 170 ? 55.186  7.337   140.271 1.00 40.43  ? 194 ASP B C   1 
ATOM   2785  O O   . ASP B  1 170 ? 56.211  6.780   139.883 1.00 41.57  ? 194 ASP B O   1 
ATOM   2786  C CB  . ASP B  1 170 ? 55.715  8.137   142.525 1.00 44.73  ? 194 ASP B CB  1 
ATOM   2787  C CG  . ASP B  1 170 ? 55.137  8.648   143.864 1.00 46.88  ? 194 ASP B CG  1 
ATOM   2788  O OD1 . ASP B  1 170 ? 53.880  8.615   144.146 1.00 45.28  ? 194 ASP B OD1 1 
ATOM   2789  O OD2 . ASP B  1 170 ? 56.016  9.122   144.633 1.00 48.19  ? 194 ASP B OD2 1 
ATOM   2790  N N   . HIS B  1 171 ? 54.421  8.061   139.471 1.00 38.82  ? 195 HIS B N   1 
ATOM   2791  C CA  . HIS B  1 171 ? 54.837  8.380   138.093 1.00 37.54  ? 195 HIS B CA  1 
ATOM   2792  C C   . HIS B  1 171 ? 55.256  9.828   138.039 1.00 34.69  ? 195 HIS B C   1 
ATOM   2793  O O   . HIS B  1 171 ? 54.957  10.636  138.897 1.00 32.74  ? 195 HIS B O   1 
ATOM   2794  C CB  . HIS B  1 171 ? 53.737  8.084   137.033 1.00 38.15  ? 195 HIS B CB  1 
ATOM   2795  C CG  . HIS B  1 171 ? 53.574  6.633   136.721 1.00 37.04  ? 195 HIS B CG  1 
ATOM   2796  N ND1 . HIS B  1 171 ? 53.185  5.707   137.675 1.00 36.53  ? 195 HIS B ND1 1 
ATOM   2797  C CD2 . HIS B  1 171 ? 53.751  5.947   135.570 1.00 37.61  ? 195 HIS B CD2 1 
ATOM   2798  C CE1 . HIS B  1 171 ? 53.114  4.510   137.116 1.00 38.17  ? 195 HIS B CE1 1 
ATOM   2799  N NE2 . HIS B  1 171 ? 53.465  4.621   135.840 1.00 38.81  ? 195 HIS B NE2 1 
ATOM   2800  N N   . VAL B  1 172 ? 55.981  10.160  137.009 1.00 34.03  ? 196 VAL B N   1 
ATOM   2801  C CA  . VAL B  1 172 ? 56.699  11.378  137.094 1.00 34.26  ? 196 VAL B CA  1 
ATOM   2802  C C   . VAL B  1 172 ? 56.759  12.247  135.874 1.00 35.49  ? 196 VAL B C   1 
ATOM   2803  O O   . VAL B  1 172 ? 56.727  11.795  134.714 1.00 31.68  ? 196 VAL B O   1 
ATOM   2804  C CB  . VAL B  1 172 ? 58.036  11.093  137.731 1.00 33.06  ? 196 VAL B CB  1 
ATOM   2805  C CG1 . VAL B  1 172 ? 59.188  11.207  136.793 1.00 31.09  ? 196 VAL B CG1 1 
ATOM   2806  C CG2 . VAL B  1 172 ? 58.104  11.965  138.946 1.00 35.06  ? 196 VAL B CG2 1 
ATOM   2807  N N   . GLY B  1 173 ? 56.834  13.540  136.215 1.00 37.11  ? 197 GLY B N   1 
ATOM   2808  C CA  . GLY B  1 173 ? 56.163  14.486  135.424 1.00 36.98  ? 197 GLY B CA  1 
ATOM   2809  C C   . GLY B  1 173 ? 56.385  15.949  135.494 1.00 36.84  ? 197 GLY B C   1 
ATOM   2810  O O   . GLY B  1 173 ? 57.075  16.421  134.616 1.00 41.09  ? 197 GLY B O   1 
ATOM   2811  N N   . LEU B  1 174 ? 55.757  16.716  136.397 1.00 35.63  ? 198 LEU B N   1 
ATOM   2812  C CA  . LEU B  1 174 ? 55.666  18.182  136.090 1.00 34.71  ? 198 LEU B CA  1 
ATOM   2813  C C   . LEU B  1 174 ? 56.289  19.093  137.080 1.00 33.31  ? 198 LEU B C   1 
ATOM   2814  O O   . LEU B  1 174 ? 56.050  18.972  138.283 1.00 31.68  ? 198 LEU B O   1 
ATOM   2815  C CB  . LEU B  1 174 ? 54.222  18.641  135.796 1.00 36.02  ? 198 LEU B CB  1 
ATOM   2816  C CG  . LEU B  1 174 ? 54.003  19.846  134.876 1.00 35.20  ? 198 LEU B CG  1 
ATOM   2817  C CD1 . LEU B  1 174 ? 54.197  19.394  133.454 1.00 37.48  ? 198 LEU B CD1 1 
ATOM   2818  C CD2 . LEU B  1 174 ? 52.612  20.417  135.004 1.00 34.29  ? 198 LEU B CD2 1 
ATOM   2819  N N   . GLY B  1 175 ? 57.101  19.990  136.540 1.00 33.62  ? 199 GLY B N   1 
ATOM   2820  C CA  . GLY B  1 175 ? 57.705  21.086  137.290 1.00 34.98  ? 199 GLY B CA  1 
ATOM   2821  C C   . GLY B  1 175 ? 57.035  22.402  136.903 1.00 36.19  ? 199 GLY B C   1 
ATOM   2822  O O   . GLY B  1 175 ? 56.700  22.617  135.740 1.00 39.44  ? 199 GLY B O   1 
ATOM   2823  N N   . THR B  1 176 ? 56.859  23.284  137.874 1.00 36.47  ? 200 THR B N   1 
ATOM   2824  C CA  . THR B  1 176 ? 56.076  24.503  137.721 1.00 36.13  ? 200 THR B CA  1 
ATOM   2825  C C   . THR B  1 176 ? 56.837  25.634  138.344 1.00 35.18  ? 200 THR B C   1 
ATOM   2826  O O   . THR B  1 176 ? 57.492  25.458  139.343 1.00 34.04  ? 200 THR B O   1 
ATOM   2827  C CB  . THR B  1 176 ? 54.678  24.394  138.368 1.00 36.33  ? 200 THR B CB  1 
ATOM   2828  O OG1 . THR B  1 176 ? 54.751  23.934  139.738 1.00 37.36  ? 200 THR B OG1 1 
ATOM   2829  C CG2 . THR B  1 176 ? 53.878  23.391  137.595 1.00 36.31  ? 200 THR B CG2 1 
ATOM   2830  N N   . ALA B  1 177 ? 56.776  26.777  137.688 1.00 33.93  ? 201 ALA B N   1 
ATOM   2831  C CA  . ALA B  1 177 ? 57.338  27.973  138.188 1.00 33.54  ? 201 ALA B CA  1 
ATOM   2832  C C   . ALA B  1 177 ? 56.335  29.068  137.828 1.00 33.82  ? 201 ALA B C   1 
ATOM   2833  O O   . ALA B  1 177 ? 56.215  29.454  136.664 1.00 32.57  ? 201 ALA B O   1 
ATOM   2834  C CB  . ALA B  1 177 ? 58.707  28.214  137.575 1.00 32.45  ? 201 ALA B CB  1 
ATOM   2835  N N   . PHE B  1 178 ? 55.601  29.525  138.833 1.00 34.57  ? 202 PHE B N   1 
ATOM   2836  C CA  . PHE B  1 178 ? 54.654  30.597  138.678 1.00 36.06  ? 202 PHE B CA  1 
ATOM   2837  C C   . PHE B  1 178 ? 55.224  31.873  139.271 1.00 37.62  ? 202 PHE B C   1 
ATOM   2838  O O   . PHE B  1 178 ? 55.537  31.912  140.462 1.00 37.56  ? 202 PHE B O   1 
ATOM   2839  C CB  . PHE B  1 178 ? 53.384  30.307  139.464 1.00 36.86  ? 202 PHE B CB  1 
ATOM   2840  C CG  . PHE B  1 178 ? 52.512  29.253  138.871 1.00 38.43  ? 202 PHE B CG  1 
ATOM   2841  C CD1 . PHE B  1 178 ? 52.809  27.902  139.047 1.00 38.60  ? 202 PHE B CD1 1 
ATOM   2842  C CD2 . PHE B  1 178 ? 51.341  29.607  138.187 1.00 40.57  ? 202 PHE B CD2 1 
ATOM   2843  C CE1 . PHE B  1 178 ? 51.995  26.927  138.553 1.00 38.23  ? 202 PHE B CE1 1 
ATOM   2844  C CE2 . PHE B  1 178 ? 50.504  28.637  137.679 1.00 40.78  ? 202 PHE B CE2 1 
ATOM   2845  C CZ  . PHE B  1 178 ? 50.852  27.291  137.859 1.00 42.20  ? 202 PHE B CZ  1 
ATOM   2846  N N   . GLU B  1 179 ? 55.257  32.945  138.475 1.00 39.74  ? 203 GLU B N   1 
ATOM   2847  C CA  . GLU B  1 179 ? 55.599  34.318  138.973 1.00 40.67  ? 203 GLU B CA  1 
ATOM   2848  C C   . GLU B  1 179 ? 54.634  34.726  140.087 1.00 38.83  ? 203 GLU B C   1 
ATOM   2849  O O   . GLU B  1 179 ? 53.394  34.473  139.998 1.00 35.21  ? 203 GLU B O   1 
ATOM   2850  C CB  . GLU B  1 179 ? 55.644  35.402  137.833 1.00 41.76  ? 203 GLU B CB  1 
ATOM   2851  C CG  . GLU B  1 179 ? 56.219  36.786  138.187 1.00 41.61  ? 203 GLU B CG  1 
ATOM   2852  C CD  . GLU B  1 179 ? 56.506  37.701  136.963 1.00 43.80  ? 203 GLU B CD  1 
ATOM   2853  O OE1 . GLU B  1 179 ? 57.120  38.765  137.143 1.00 44.97  ? 203 GLU B OE1 1 
ATOM   2854  O OE2 . GLU B  1 179 ? 56.142  37.417  135.793 1.00 44.77  ? 203 GLU B OE2 1 
ATOM   2855  N N   . ASN B  1 180 ? 55.246  35.335  141.117 1.00 38.14  ? 204 ASN B N   1 
ATOM   2856  C CA  . ASN B  1 180 ? 54.562  35.738  142.322 1.00 38.76  ? 204 ASN B CA  1 
ATOM   2857  C C   . ASN B  1 180 ? 53.833  37.048  142.028 1.00 38.92  ? 204 ASN B C   1 
ATOM   2858  O O   . ASN B  1 180 ? 54.139  37.701  141.071 1.00 35.71  ? 204 ASN B O   1 
ATOM   2859  C CB  . ASN B  1 180 ? 55.537  35.878  143.505 1.00 38.86  ? 204 ASN B CB  1 
ATOM   2860  C CG  . ASN B  1 180 ? 55.960  34.539  144.103 1.00 38.83  ? 204 ASN B CG  1 
ATOM   2861  O OD1 . ASN B  1 180 ? 55.123  33.724  144.516 1.00 39.95  ? 204 ASN B OD1 1 
ATOM   2862  N ND2 . ASN B  1 180 ? 57.270  34.330  144.210 1.00 36.99  ? 204 ASN B ND2 1 
ATOM   2863  N N   . SER B  1 181 ? 52.873  37.396  142.879 1.00 42.03  ? 205 SER B N   1 
ATOM   2864  C CA  . SER B  1 181 ? 51.991  38.553  142.681 1.00 44.75  ? 205 SER B CA  1 
ATOM   2865  C C   . SER B  1 181 ? 51.658  39.276  144.009 1.00 45.36  ? 205 SER B C   1 
ATOM   2866  O O   . SER B  1 181 ? 51.634  38.703  145.115 1.00 41.24  ? 205 SER B O   1 
ATOM   2867  C CB  . SER B  1 181 ? 50.658  38.094  141.953 1.00 46.17  ? 205 SER B CB  1 
ATOM   2868  O OG  . SER B  1 181 ? 49.644  39.108  141.677 1.00 44.59  ? 205 SER B OG  1 
ATOM   2869  N N   . ILE B  1 182 ? 51.335  40.542  143.819 1.00 47.05  ? 206 ILE B N   1 
ATOM   2870  C CA  . ILE B  1 182 ? 50.748  41.428  144.823 1.00 49.86  ? 206 ILE B CA  1 
ATOM   2871  C C   . ILE B  1 182 ? 49.427  40.786  145.378 1.00 50.25  ? 206 ILE B C   1 
ATOM   2872  O O   . ILE B  1 182 ? 49.077  40.955  146.585 1.00 48.10  ? 206 ILE B O   1 
ATOM   2873  C CB  . ILE B  1 182 ? 50.657  42.907  144.197 1.00 53.62  ? 206 ILE B CB  1 
ATOM   2874  C CG1 . ILE B  1 182 ? 51.550  43.849  144.971 1.00 58.37  ? 206 ILE B CG1 1 
ATOM   2875  C CG2 . ILE B  1 182 ? 49.260  43.487  143.879 1.00 51.70  ? 206 ILE B CG2 1 
ATOM   2876  C CD1 . ILE B  1 182 ? 52.999  43.721  144.481 1.00 63.59  ? 206 ILE B CD1 1 
ATOM   2877  N N   . TYR B  1 183 ? 48.750  40.007  144.512 1.00 49.91  ? 207 TYR B N   1 
ATOM   2878  C CA  . TYR B  1 183 ? 47.540  39.263  144.870 1.00 49.81  ? 207 TYR B CA  1 
ATOM   2879  C C   . TYR B  1 183 ? 47.723  37.767  144.908 1.00 48.22  ? 207 TYR B C   1 
ATOM   2880  O O   . TYR B  1 183 ? 48.613  37.219  144.251 1.00 47.27  ? 207 TYR B O   1 
ATOM   2881  C CB  . TYR B  1 183 ? 46.427  39.504  143.864 1.00 51.28  ? 207 TYR B CB  1 
ATOM   2882  C CG  . TYR B  1 183 ? 46.246  40.922  143.423 1.00 54.99  ? 207 TYR B CG  1 
ATOM   2883  C CD1 . TYR B  1 183 ? 45.532  41.845  144.217 1.00 55.31  ? 207 TYR B CD1 1 
ATOM   2884  C CD2 . TYR B  1 183 ? 46.767  41.349  142.205 1.00 56.03  ? 207 TYR B CD2 1 
ATOM   2885  C CE1 . TYR B  1 183 ? 45.369  43.143  143.809 1.00 53.94  ? 207 TYR B CE1 1 
ATOM   2886  C CE2 . TYR B  1 183 ? 46.595  42.650  141.795 1.00 58.55  ? 207 TYR B CE2 1 
ATOM   2887  C CZ  . TYR B  1 183 ? 45.903  43.538  142.610 1.00 56.35  ? 207 TYR B CZ  1 
ATOM   2888  O OH  . TYR B  1 183 ? 45.742  44.810  142.169 1.00 55.94  ? 207 TYR B OH  1 
ATOM   2889  N N   . ASP B  1 184 ? 46.810  37.114  145.640 1.00 47.38  ? 208 ASP B N   1 
ATOM   2890  C CA  . ASP B  1 184 ? 46.727  35.660  145.688 1.00 46.04  ? 208 ASP B CA  1 
ATOM   2891  C C   . ASP B  1 184 ? 46.351  35.151  144.294 1.00 44.68  ? 208 ASP B C   1 
ATOM   2892  O O   . ASP B  1 184 ? 45.525  35.742  143.621 1.00 46.41  ? 208 ASP B O   1 
ATOM   2893  C CB  . ASP B  1 184 ? 45.736  35.176  146.785 1.00 45.99  ? 208 ASP B CB  1 
ATOM   2894  C CG  . ASP B  1 184 ? 46.362  35.106  148.200 1.00 48.57  ? 208 ASP B CG  1 
ATOM   2895  O OD1 . ASP B  1 184 ? 47.590  35.050  148.354 1.00 52.58  ? 208 ASP B OD1 1 
ATOM   2896  O OD2 . ASP B  1 184 ? 45.637  35.091  149.213 1.00 51.75  ? 208 ASP B OD2 1 
ATOM   2897  N N   . GLN B  1 185 ? 47.010  34.094  143.841 1.00 44.04  ? 209 GLN B N   1 
ATOM   2898  C CA  . GLN B  1 185 ? 46.666  33.425  142.564 1.00 42.62  ? 209 GLN B CA  1 
ATOM   2899  C C   . GLN B  1 185 ? 46.290  31.986  142.930 1.00 43.10  ? 209 GLN B C   1 
ATOM   2900  O O   . GLN B  1 185 ? 47.129  31.195  143.376 1.00 40.11  ? 209 GLN B O   1 
ATOM   2901  C CB  . GLN B  1 185 ? 47.830  33.432  141.530 1.00 40.20  ? 209 GLN B CB  1 
ATOM   2902  C CG  . GLN B  1 185 ? 48.455  34.802  141.264 1.00 39.83  ? 209 GLN B CG  1 
ATOM   2903  C CD  . GLN B  1 185 ? 49.766  34.771  140.466 1.00 39.11  ? 209 GLN B CD  1 
ATOM   2904  O OE1 . GLN B  1 185 ? 49.762  34.980  139.220 1.00 38.90  ? 209 GLN B OE1 1 
ATOM   2905  N NE2 . GLN B  1 185 ? 50.885  34.528  141.160 1.00 35.16  ? 209 GLN B NE2 1 
ATOM   2906  N N   . GLU B  1 186 ? 45.016  31.670  142.729 1.00 46.92  ? 210 GLU B N   1 
ATOM   2907  C CA  . GLU B  1 186 ? 44.420  30.370  143.093 1.00 48.30  ? 210 GLU B CA  1 
ATOM   2908  C C   . GLU B  1 186 ? 44.072  29.598  141.826 1.00 43.48  ? 210 GLU B C   1 
ATOM   2909  O O   . GLU B  1 186 ? 43.872  30.214  140.753 1.00 44.88  ? 210 GLU B O   1 
ATOM   2910  C CB  . GLU B  1 186 ? 43.189  30.610  143.972 1.00 52.60  ? 210 GLU B CB  1 
ATOM   2911  C CG  . GLU B  1 186 ? 43.052  29.641  145.103 1.00 59.64  ? 210 GLU B CG  1 
ATOM   2912  C CD  . GLU B  1 186 ? 41.869  29.986  145.947 1.00 67.73  ? 210 GLU B CD  1 
ATOM   2913  O OE1 . GLU B  1 186 ? 40.771  29.355  145.730 1.00 76.37  ? 210 GLU B OE1 1 
ATOM   2914  O OE2 . GLU B  1 186 ? 42.065  30.914  146.776 1.00 67.11  ? 210 GLU B OE2 1 
ATOM   2915  N N   . TYR B  1 187 ? 44.069  28.271  141.933 1.00 39.51  ? 211 TYR B N   1 
ATOM   2916  C CA  . TYR B  1 187 ? 43.783  27.366  140.768 1.00 37.81  ? 211 TYR B CA  1 
ATOM   2917  C C   . TYR B  1 187 ? 43.031  26.087  141.203 1.00 37.54  ? 211 TYR B C   1 
ATOM   2918  O O   . TYR B  1 187 ? 43.206  25.593  142.327 1.00 38.23  ? 211 TYR B O   1 
ATOM   2919  C CB  . TYR B  1 187 ? 45.076  26.960  140.043 1.00 34.99  ? 211 TYR B CB  1 
ATOM   2920  C CG  . TYR B  1 187 ? 45.802  28.084  139.317 1.00 33.02  ? 211 TYR B CG  1 
ATOM   2921  C CD1 . TYR B  1 187 ? 46.720  28.881  139.959 1.00 32.30  ? 211 TYR B CD1 1 
ATOM   2922  C CD2 . TYR B  1 187 ? 45.558  28.321  137.962 1.00 33.62  ? 211 TYR B CD2 1 
ATOM   2923  C CE1 . TYR B  1 187 ? 47.365  29.921  139.293 1.00 32.91  ? 211 TYR B CE1 1 
ATOM   2924  C CE2 . TYR B  1 187 ? 46.196  29.331  137.260 1.00 33.32  ? 211 TYR B CE2 1 
ATOM   2925  C CZ  . TYR B  1 187 ? 47.109  30.144  137.930 1.00 33.64  ? 211 TYR B CZ  1 
ATOM   2926  O OH  . TYR B  1 187 ? 47.733  31.159  137.210 1.00 33.26  ? 211 TYR B OH  1 
ATOM   2927  N N   . ASN B  1 188 ? 42.147  25.596  140.341 1.00 37.79  ? 212 ASN B N   1 
ATOM   2928  C CA  . ASN B  1 188 ? 41.686  24.190  140.414 1.00 36.74  ? 212 ASN B CA  1 
ATOM   2929  C C   . ASN B  1 188 ? 42.549  23.414  139.468 1.00 35.41  ? 212 ASN B C   1 
ATOM   2930  O O   . ASN B  1 188 ? 42.626  23.766  138.268 1.00 35.76  ? 212 ASN B O   1 
ATOM   2931  C CB  . ASN B  1 188 ? 40.225  24.064  140.062 1.00 36.48  ? 212 ASN B CB  1 
ATOM   2932  C CG  . ASN B  1 188 ? 39.343  24.426  141.231 1.00 36.86  ? 212 ASN B CG  1 
ATOM   2933  O OD1 . ASN B  1 188 ? 38.636  25.444  141.219 1.00 37.20  ? 212 ASN B OD1 1 
ATOM   2934  N ND2 . ASN B  1 188 ? 39.428  23.610  142.293 1.00 36.36  ? 212 ASN B ND2 1 
ATOM   2935  N N   . ILE B  1 189 ? 43.281  22.444  140.010 1.00 33.59  ? 213 ILE B N   1 
ATOM   2936  C CA  . ILE B  1 189 ? 44.215  21.681  139.196 1.00 34.78  ? 213 ILE B CA  1 
ATOM   2937  C C   . ILE B  1 189 ? 43.503  20.398  138.880 1.00 36.26  ? 213 ILE B C   1 
ATOM   2938  O O   . ILE B  1 189 ? 43.117  19.678  139.801 1.00 38.57  ? 213 ILE B O   1 
ATOM   2939  C CB  . ILE B  1 189 ? 45.561  21.371  139.891 1.00 34.38  ? 213 ILE B CB  1 
ATOM   2940  C CG1 . ILE B  1 189 ? 46.434  22.632  139.992 1.00 34.81  ? 213 ILE B CG1 1 
ATOM   2941  C CG2 . ILE B  1 189 ? 46.378  20.363  139.093 1.00 33.27  ? 213 ILE B CG2 1 
ATOM   2942  C CD1 . ILE B  1 189 ? 47.674  22.459  140.867 1.00 34.93  ? 213 ILE B CD1 1 
ATOM   2943  N N   . ARG B  1 190 ? 43.308  20.098  137.595 1.00 37.13  ? 214 ARG B N   1 
ATOM   2944  C CA  . ARG B  1 190 ? 42.749  18.784  137.236 1.00 38.37  ? 214 ARG B CA  1 
ATOM   2945  C C   . ARG B  1 190 ? 43.785  17.889  136.579 1.00 35.29  ? 214 ARG B C   1 
ATOM   2946  O O   . ARG B  1 190 ? 44.323  18.223  135.519 1.00 33.58  ? 214 ARG B O   1 
ATOM   2947  C CB  . ARG B  1 190 ? 41.530  18.913  136.361 1.00 39.99  ? 214 ARG B CB  1 
ATOM   2948  C CG  . ARG B  1 190 ? 40.700  17.643  136.310 1.00 40.99  ? 214 ARG B CG  1 
ATOM   2949  C CD  . ARG B  1 190 ? 39.807  17.734  135.094 1.00 43.40  ? 214 ARG B CD  1 
ATOM   2950  N NE  . ARG B  1 190 ? 38.388  17.920  135.352 1.00 44.57  ? 214 ARG B NE  1 
ATOM   2951  C CZ  . ARG B  1 190 ? 37.504  18.105  134.373 1.00 50.03  ? 214 ARG B CZ  1 
ATOM   2952  N NH1 . ARG B  1 190 ? 36.188  18.197  134.684 1.00 53.21  ? 214 ARG B NH1 1 
ATOM   2953  N NH2 . ARG B  1 190 ? 37.926  18.225  133.078 1.00 48.40  ? 214 ARG B NH2 1 
ATOM   2954  N N   . VAL B  1 191 ? 44.058  16.772  137.239 1.00 33.43  ? 215 VAL B N   1 
ATOM   2955  C CA  . VAL B  1 191 ? 44.930  15.768  136.669 1.00 34.75  ? 215 VAL B CA  1 
ATOM   2956  C C   . VAL B  1 191 ? 44.111  14.589  136.077 1.00 35.06  ? 215 VAL B C   1 
ATOM   2957  O O   . VAL B  1 191 ? 43.202  14.058  136.749 1.00 35.57  ? 215 VAL B O   1 
ATOM   2958  C CB  . VAL B  1 191 ? 45.985  15.306  137.688 1.00 33.83  ? 215 VAL B CB  1 
ATOM   2959  C CG1 . VAL B  1 191 ? 46.964  14.311  137.049 1.00 33.43  ? 215 VAL B CG1 1 
ATOM   2960  C CG2 . VAL B  1 191 ? 46.728  16.511  138.219 1.00 33.46  ? 215 VAL B CG2 1 
ATOM   2961  N N   . THR B  1 192 ? 44.433  14.214  134.835 1.00 33.77  ? 216 THR B N   1 
ATOM   2962  C CA  . THR B  1 192 ? 43.759  13.159  134.167 1.00 35.33  ? 216 THR B CA  1 
ATOM   2963  C C   . THR B  1 192 ? 44.777  12.106  133.678 1.00 38.97  ? 216 THR B C   1 
ATOM   2964  O O   . THR B  1 192 ? 45.748  12.426  132.955 1.00 39.59  ? 216 THR B O   1 
ATOM   2965  C CB  . THR B  1 192 ? 42.961  13.740  133.017 1.00 35.23  ? 216 THR B CB  1 
ATOM   2966  O OG1 . THR B  1 192 ? 41.914  14.575  133.532 1.00 34.79  ? 216 THR B OG1 1 
ATOM   2967  C CG2 . THR B  1 192 ? 42.338  12.654  132.193 1.00 35.93  ? 216 THR B CG2 1 
ATOM   2968  N N   . MET B  1 193 ? 44.551  10.849  134.073 1.00 40.60  ? 217 MET B N   1 
ATOM   2969  C CA  . MET B  1 193 ? 45.422  9.747   133.704 1.00 41.38  ? 217 MET B CA  1 
ATOM   2970  C C   . MET B  1 193 ? 44.714  8.937   132.632 1.00 39.40  ? 217 MET B C   1 
ATOM   2971  O O   . MET B  1 193 ? 43.609  8.451   132.834 1.00 38.46  ? 217 MET B O   1 
ATOM   2972  C CB  . MET B  1 193 ? 45.808  8.877   134.931 1.00 45.44  ? 217 MET B CB  1 
ATOM   2973  C CG  . MET B  1 193 ? 47.055  9.392   135.671 1.00 50.80  ? 217 MET B CG  1 
ATOM   2974  S SD  . MET B  1 193 ? 47.724  8.466   137.117 1.00 61.31  ? 217 MET B SD  1 
ATOM   2975  C CE  . MET B  1 193 ? 46.394  7.285   137.354 1.00 55.15  ? 217 MET B CE  1 
ATOM   2976  N N   . TYR B  1 194 ? 45.369  8.837   131.475 1.00 39.49  ? 218 TYR B N   1 
ATOM   2977  C CA  . TYR B  1 194 ? 44.937  8.023   130.322 1.00 37.07  ? 218 TYR B CA  1 
ATOM   2978  C C   . TYR B  1 194 ? 45.637  6.684   130.524 1.00 36.22  ? 218 TYR B C   1 
ATOM   2979  O O   . TYR B  1 194 ? 46.809  6.575   130.257 1.00 34.29  ? 218 TYR B O   1 
ATOM   2980  C CB  . TYR B  1 194 ? 45.318  8.733   128.986 1.00 35.43  ? 218 TYR B CB  1 
ATOM   2981  C CG  . TYR B  1 194 ? 44.451  9.973   128.776 1.00 35.28  ? 218 TYR B CG  1 
ATOM   2982  C CD1 . TYR B  1 194 ? 43.218  9.863   128.201 1.00 35.37  ? 218 TYR B CD1 1 
ATOM   2983  C CD2 . TYR B  1 194 ? 44.815  11.242  129.271 1.00 35.26  ? 218 TYR B CD2 1 
ATOM   2984  C CE1 . TYR B  1 194 ? 42.369  10.961  128.050 1.00 35.80  ? 218 TYR B CE1 1 
ATOM   2985  C CE2 . TYR B  1 194 ? 43.986  12.367  129.091 1.00 34.91  ? 218 TYR B CE2 1 
ATOM   2986  C CZ  . TYR B  1 194 ? 42.749  12.220  128.482 1.00 36.14  ? 218 TYR B CZ  1 
ATOM   2987  O OH  . TYR B  1 194 ? 41.810  13.275  128.325 1.00 38.09  ? 218 TYR B OH  1 
ATOM   2988  N N   . VAL B  1 195 ? 44.892  5.686   130.995 1.00 35.91  ? 219 VAL B N   1 
ATOM   2989  C CA  . VAL B  1 195 ? 45.433  4.446   131.529 1.00 36.84  ? 219 VAL B CA  1 
ATOM   2990  C C   . VAL B  1 195 ? 45.018  3.230   130.754 1.00 36.23  ? 219 VAL B C   1 
ATOM   2991  O O   . VAL B  1 195 ? 43.877  3.120   130.361 1.00 36.52  ? 219 VAL B O   1 
ATOM   2992  C CB  . VAL B  1 195 ? 44.895  4.219   132.964 1.00 38.25  ? 219 VAL B CB  1 
ATOM   2993  C CG1 . VAL B  1 195 ? 45.449  2.943   133.600 1.00 38.48  ? 219 VAL B CG1 1 
ATOM   2994  C CG2 . VAL B  1 195 ? 45.230  5.425   133.810 1.00 39.36  ? 219 VAL B CG2 1 
ATOM   2995  N N   . GLN B  1 196 ? 45.925  2.268   130.630 1.00 36.48  ? 220 GLN B N   1 
ATOM   2996  C CA  . GLN B  1 196 ? 45.670  1.073   129.839 1.00 35.52  ? 220 GLN B CA  1 
ATOM   2997  C C   . GLN B  1 196 ? 45.819  -0.080  130.792 1.00 32.91  ? 220 GLN B C   1 
ATOM   2998  O O   . GLN B  1 196 ? 46.843  -0.280  131.307 1.00 30.57  ? 220 GLN B O   1 
ATOM   2999  C CB  . GLN B  1 196 ? 46.612  1.029   128.637 1.00 37.37  ? 220 GLN B CB  1 
ATOM   3000  C CG  . GLN B  1 196 ? 46.245  -0.008  127.578 1.00 40.35  ? 220 GLN B CG  1 
ATOM   3001  C CD  . GLN B  1 196 ? 47.177  0.036   126.372 1.00 39.87  ? 220 GLN B CD  1 
ATOM   3002  O OE1 . GLN B  1 196 ? 48.356  -0.152  126.516 1.00 44.40  ? 220 GLN B OE1 1 
ATOM   3003  N NE2 . GLN B  1 196 ? 46.653  0.266   125.199 1.00 40.25  ? 220 GLN B NE2 1 
ATOM   3004  N N   . PHE B  1 197 ? 44.703  -0.726  131.111 1.00 34.23  ? 221 PHE B N   1 
ATOM   3005  C CA  . PHE B  1 197 ? 44.617  -1.867  132.018 1.00 33.38  ? 221 PHE B CA  1 
ATOM   3006  C C   . PHE B  1 197 ? 44.691  -3.128  131.189 1.00 34.78  ? 221 PHE B C   1 
ATOM   3007  O O   . PHE B  1 197 ? 44.273  -3.111  130.046 1.00 36.81  ? 221 PHE B O   1 
ATOM   3008  C CB  . PHE B  1 197 ? 43.275  -1.848  132.722 1.00 32.20  ? 221 PHE B CB  1 
ATOM   3009  C CG  . PHE B  1 197 ? 43.186  -0.814  133.762 1.00 31.07  ? 221 PHE B CG  1 
ATOM   3010  C CD1 . PHE B  1 197 ? 43.821  -0.987  134.956 1.00 30.96  ? 221 PHE B CD1 1 
ATOM   3011  C CD2 . PHE B  1 197 ? 42.542  0.364   133.520 1.00 30.33  ? 221 PHE B CD2 1 
ATOM   3012  C CE1 . PHE B  1 197 ? 43.785  0.017   135.915 1.00 31.13  ? 221 PHE B CE1 1 
ATOM   3013  C CE2 . PHE B  1 197 ? 42.477  1.345   134.460 1.00 29.64  ? 221 PHE B CE2 1 
ATOM   3014  C CZ  . PHE B  1 197 ? 43.095  1.173   135.665 1.00 30.17  ? 221 PHE B CZ  1 
ATOM   3015  N N   . ARG B  1 198 ? 45.187  -4.219  131.758 1.00 34.11  ? 222 ARG B N   1 
ATOM   3016  C CA  . ARG B  1 198 ? 45.279  -5.470  131.054 1.00 33.41  ? 222 ARG B CA  1 
ATOM   3017  C C   . ARG B  1 198 ? 45.040  -6.666  132.013 1.00 33.61  ? 222 ARG B C   1 
ATOM   3018  O O   . ARG B  1 198 ? 45.411  -6.619  133.189 1.00 31.59  ? 222 ARG B O   1 
ATOM   3019  C CB  . ARG B  1 198 ? 46.636  -5.547  130.402 1.00 34.04  ? 222 ARG B CB  1 
ATOM   3020  C CG  . ARG B  1 198 ? 46.872  -6.894  129.735 1.00 36.86  ? 222 ARG B CG  1 
ATOM   3021  C CD  . ARG B  1 198 ? 48.261  -7.061  129.151 1.00 37.22  ? 222 ARG B CD  1 
ATOM   3022  N NE  . ARG B  1 198 ? 48.631  -8.479  129.000 1.00 36.75  ? 222 ARG B NE  1 
ATOM   3023  C CZ  . ARG B  1 198 ? 49.853  -8.881  128.666 1.00 35.50  ? 222 ARG B CZ  1 
ATOM   3024  N NH1 . ARG B  1 198 ? 50.137  -10.163 128.539 1.00 35.70  ? 222 ARG B NH1 1 
ATOM   3025  N NH2 . ARG B  1 198 ? 50.807  -7.998  128.472 1.00 35.81  ? 222 ARG B NH2 1 
ATOM   3026  N N   . GLU B  1 199 ? 44.419  -7.732  131.492 1.00 34.32  ? 223 GLU B N   1 
ATOM   3027  C CA  . GLU B  1 199 ? 44.061  -8.935  132.286 1.00 35.36  ? 223 GLU B CA  1 
ATOM   3028  C C   . GLU B  1 199 ? 42.929  -8.685  133.263 1.00 32.95  ? 223 GLU B C   1 
ATOM   3029  O O   . GLU B  1 199 ? 43.161  -8.330  134.412 1.00 30.71  ? 223 GLU B O   1 
ATOM   3030  C CB  . GLU B  1 199 ? 45.287  -9.518  133.036 1.00 37.76  ? 223 GLU B CB  1 
ATOM   3031  C CG  . GLU B  1 199 ? 45.114  -10.941 133.585 1.00 40.53  ? 223 GLU B CG  1 
ATOM   3032  C CD  . GLU B  1 199 ? 45.215  -12.046 132.525 1.00 43.39  ? 223 GLU B CD  1 
ATOM   3033  O OE1 . GLU B  1 199 ? 45.664  -11.782 131.387 1.00 43.82  ? 223 GLU B OE1 1 
ATOM   3034  O OE2 . GLU B  1 199 ? 44.812  -13.200 132.828 1.00 46.64  ? 223 GLU B OE2 1 
ATOM   3035  N N   . PHE B  1 200 ? 41.713  -8.861  132.777 1.00 32.64  ? 224 PHE B N   1 
ATOM   3036  C CA  . PHE B  1 200 ? 40.475  -8.963  133.625 1.00 33.89  ? 224 PHE B CA  1 
ATOM   3037  C C   . PHE B  1 200 ? 40.752  -10.060 134.703 1.00 35.74  ? 224 PHE B C   1 
ATOM   3038  O O   . PHE B  1 200 ? 41.334  -11.150 134.360 1.00 38.33  ? 224 PHE B O   1 
ATOM   3039  C CB  . PHE B  1 200 ? 39.268  -9.350  132.727 1.00 32.45  ? 224 PHE B CB  1 
ATOM   3040  C CG  . PHE B  1 200 ? 37.951  -9.090  133.328 1.00 31.94  ? 224 PHE B CG  1 
ATOM   3041  C CD1 . PHE B  1 200 ? 37.572  -7.797  133.701 1.00 32.79  ? 224 PHE B CD1 1 
ATOM   3042  C CD2 . PHE B  1 200 ? 37.038  -10.111 133.503 1.00 31.72  ? 224 PHE B CD2 1 
ATOM   3043  C CE1 . PHE B  1 200 ? 36.316  -7.537  134.271 1.00 31.24  ? 224 PHE B CE1 1 
ATOM   3044  C CE2 . PHE B  1 200 ? 35.785  -9.854  134.067 1.00 31.13  ? 224 PHE B CE2 1 
ATOM   3045  C CZ  . PHE B  1 200 ? 35.446  -8.571  134.493 1.00 30.81  ? 224 PHE B CZ  1 
ATOM   3046  N N   . ASN B  1 201 ? 40.454  -9.758  135.975 1.00 33.22  ? 225 ASN B N   1 
ATOM   3047  C CA  . ASN B  1 201 ? 40.716  -10.714 137.046 1.00 33.48  ? 225 ASN B CA  1 
ATOM   3048  C C   . ASN B  1 201 ? 39.537  -10.902 138.013 1.00 35.26  ? 225 ASN B C   1 
ATOM   3049  O O   . ASN B  1 201 ? 39.761  -11.373 139.116 1.00 34.26  ? 225 ASN B O   1 
ATOM   3050  C CB  . ASN B  1 201 ? 41.978  -10.363 137.855 1.00 32.07  ? 225 ASN B CB  1 
ATOM   3051  C CG  . ASN B  1 201 ? 41.869  -9.065  138.641 1.00 31.80  ? 225 ASN B CG  1 
ATOM   3052  O OD1 . ASN B  1 201 ? 40.792  -8.423  138.782 1.00 32.74  ? 225 ASN B OD1 1 
ATOM   3053  N ND2 . ASN B  1 201 ? 43.017  -8.633  139.125 1.00 30.41  ? 225 ASN B ND2 1 
ATOM   3054  N N   . LEU B  1 202 ? 38.319  -10.534 137.611 1.00 35.14  ? 226 LEU B N   1 
ATOM   3055  C CA  . LEU B  1 202 ? 37.194  -10.522 138.505 1.00 34.63  ? 226 LEU B CA  1 
ATOM   3056  C C   . LEU B  1 202 ? 36.975  -11.850 139.227 1.00 34.72  ? 226 LEU B C   1 
ATOM   3057  O O   . LEU B  1 202 ? 36.942  -12.900 138.630 1.00 33.70  ? 226 LEU B O   1 
ATOM   3058  C CB  . LEU B  1 202 ? 35.928  -10.167 137.765 1.00 34.74  ? 226 LEU B CB  1 
ATOM   3059  C CG  . LEU B  1 202 ? 34.813  -9.886  138.748 1.00 36.09  ? 226 LEU B CG  1 
ATOM   3060  C CD1 . LEU B  1 202 ? 34.976  -8.443  139.270 1.00 36.57  ? 226 LEU B CD1 1 
ATOM   3061  C CD2 . LEU B  1 202 ? 33.450  -10.134 138.130 1.00 35.85  ? 226 LEU B CD2 1 
ATOM   3062  N N   . LYS B  1 203 ? 36.835  -11.754 140.540 1.00 35.49  ? 227 LYS B N   1 
ATOM   3063  C CA  . LYS B  1 203 ? 36.495  -12.856 141.373 1.00 36.62  ? 227 LYS B CA  1 
ATOM   3064  C C   . LYS B  1 203 ? 35.026  -12.755 141.746 1.00 38.32  ? 227 LYS B C   1 
ATOM   3065  O O   . LYS B  1 203 ? 34.532  -11.724 142.201 1.00 37.08  ? 227 LYS B O   1 
ATOM   3066  C CB  . LYS B  1 203 ? 37.285  -12.793 142.638 1.00 37.57  ? 227 LYS B CB  1 
ATOM   3067  C CG  . LYS B  1 203 ? 38.771  -12.533 142.442 1.00 38.14  ? 227 LYS B CG  1 
ATOM   3068  C CD  . LYS B  1 203 ? 39.519  -13.726 141.847 1.00 37.32  ? 227 LYS B CD  1 
ATOM   3069  C CE  . LYS B  1 203 ? 41.035  -13.423 141.813 1.00 37.16  ? 227 LYS B CE  1 
ATOM   3070  N NZ  . LYS B  1 203 ? 41.495  -12.183 141.067 1.00 37.23  ? 227 LYS B NZ  1 
ATOM   3071  N N   . ASP B  1 204 ? 34.353  -13.882 141.616 1.00 41.58  ? 228 ASP B N   1 
ATOM   3072  C CA  . ASP B  1 204 ? 32.945  -14.000 141.888 1.00 44.02  ? 228 ASP B CA  1 
ATOM   3073  C C   . ASP B  1 204 ? 32.643  -15.174 142.835 1.00 44.90  ? 228 ASP B C   1 
ATOM   3074  O O   . ASP B  1 204 ? 32.285  -16.273 142.373 1.00 45.34  ? 228 ASP B O   1 
ATOM   3075  C CB  . ASP B  1 204 ? 32.250  -14.210 140.578 1.00 45.01  ? 228 ASP B CB  1 
ATOM   3076  C CG  . ASP B  1 204 ? 30.800  -14.300 140.729 1.00 44.54  ? 228 ASP B CG  1 
ATOM   3077  O OD1 . ASP B  1 204 ? 30.171  -13.591 141.530 1.00 46.03  ? 228 ASP B OD1 1 
ATOM   3078  O OD2 . ASP B  1 204 ? 30.282  -15.111 140.026 1.00 47.85  ? 228 ASP B OD2 1 
ATOM   3079  N N   . PRO B  1 205 ? 32.822  -14.942 144.148 1.00 44.32  ? 229 PRO B N   1 
ATOM   3080  C CA  . PRO B  1 205 ? 32.427  -15.882 145.179 1.00 45.88  ? 229 PRO B CA  1 
ATOM   3081  C C   . PRO B  1 205 ? 30.913  -16.009 145.257 1.00 47.02  ? 229 PRO B C   1 
ATOM   3082  O O   . PRO B  1 205 ? 30.225  -15.014 145.046 1.00 44.49  ? 229 PRO B O   1 
ATOM   3083  C CB  . PRO B  1 205 ? 32.922  -15.226 146.483 1.00 44.96  ? 229 PRO B CB  1 
ATOM   3084  C CG  . PRO B  1 205 ? 33.722  -14.039 146.093 1.00 43.90  ? 229 PRO B CG  1 
ATOM   3085  C CD  . PRO B  1 205 ? 33.294  -13.667 144.719 1.00 44.31  ? 229 PRO B CD  1 
ATOM   3086  N N   . PRO B  1 206 ? 30.397  -17.204 145.614 1.00 52.30  ? 230 PRO B N   1 
ATOM   3087  C CA  . PRO B  1 206 ? 28.910  -17.648 145.615 1.00 56.20  ? 230 PRO B CA  1 
ATOM   3088  C C   . PRO B  1 206 ? 27.620  -16.685 145.888 1.00 54.69  ? 230 PRO B C   1 
ATOM   3089  O O   . PRO B  1 206 ? 27.375  -16.065 146.969 1.00 49.59  ? 230 PRO B O   1 
ATOM   3090  C CB  . PRO B  1 206 ? 28.931  -18.882 146.557 1.00 55.09  ? 230 PRO B CB  1 
ATOM   3091  C CG  . PRO B  1 206 ? 30.380  -19.385 146.504 1.00 53.82  ? 230 PRO B CG  1 
ATOM   3092  C CD  . PRO B  1 206 ? 31.301  -18.330 145.950 1.00 50.93  ? 230 PRO B CD  1 
ATOM   3093  N N   . SER C  1 19  ? 0.246   13.898  107.731 1.00 81.42  ? 43  SER C N   1 
ATOM   3094  C CA  . SER C  1 19  ? 1.045   12.643  108.053 1.00 81.52  ? 43  SER C CA  1 
ATOM   3095  C C   . SER C  1 19  ? 1.847   12.772  109.412 1.00 76.20  ? 43  SER C C   1 
ATOM   3096  O O   . SER C  1 19  ? 1.605   12.028  110.400 1.00 65.70  ? 43  SER C O   1 
ATOM   3097  C CB  . SER C  1 19  ? 1.964   12.233  106.835 1.00 82.64  ? 43  SER C CB  1 
ATOM   3098  O OG  . SER C  1 19  ? 2.558   10.924  106.950 1.00 75.52  ? 43  SER C OG  1 
ATOM   3099  N N   . HIS C  1 20  ? 2.767   13.738  109.467 1.00 70.97  ? 44  HIS C N   1 
ATOM   3100  C CA  . HIS C  1 20  ? 3.852   13.663  110.432 1.00 64.92  ? 44  HIS C CA  1 
ATOM   3101  C C   . HIS C  1 20  ? 4.763   14.957  110.555 1.00 54.33  ? 44  HIS C C   1 
ATOM   3102  O O   . HIS C  1 20  ? 5.231   15.476  109.601 1.00 53.14  ? 44  HIS C O   1 
ATOM   3103  C CB  . HIS C  1 20  ? 4.635   12.394  110.088 1.00 69.75  ? 44  HIS C CB  1 
ATOM   3104  C CG  . HIS C  1 20  ? 6.058   12.513  110.403 1.00 78.51  ? 44  HIS C CG  1 
ATOM   3105  N ND1 . HIS C  1 20  ? 6.921   13.206  109.592 1.00 86.97  ? 44  HIS C ND1 1 
ATOM   3106  C CD2 . HIS C  1 20  ? 6.761   12.149  111.492 1.00 89.58  ? 44  HIS C CD2 1 
ATOM   3107  C CE1 . HIS C  1 20  ? 8.117   13.216  110.143 1.00 93.59  ? 44  HIS C CE1 1 
ATOM   3108  N NE2 . HIS C  1 20  ? 8.047   12.587  111.299 1.00 92.85  ? 44  HIS C NE2 1 
ATOM   3109  N N   . PHE C  1 21  ? 5.023   15.443  111.754 1.00 47.49  ? 45  PHE C N   1 
ATOM   3110  C CA  . PHE C  1 21  ? 5.468   16.801  111.981 1.00 43.31  ? 45  PHE C CA  1 
ATOM   3111  C C   . PHE C  1 21  ? 6.715   16.893  112.877 1.00 40.88  ? 45  PHE C C   1 
ATOM   3112  O O   . PHE C  1 21  ? 6.731   16.515  114.064 1.00 37.00  ? 45  PHE C O   1 
ATOM   3113  C CB  . PHE C  1 21  ? 4.300   17.552  112.619 1.00 44.82  ? 45  PHE C CB  1 
ATOM   3114  C CG  . PHE C  1 21  ? 4.575   18.996  112.930 1.00 46.67  ? 45  PHE C CG  1 
ATOM   3115  C CD1 . PHE C  1 21  ? 5.203   19.843  111.991 1.00 48.44  ? 45  PHE C CD1 1 
ATOM   3116  C CD2 . PHE C  1 21  ? 4.145   19.532  114.127 1.00 48.43  ? 45  PHE C CD2 1 
ATOM   3117  C CE1 . PHE C  1 21  ? 5.425   21.188  112.269 1.00 50.18  ? 45  PHE C CE1 1 
ATOM   3118  C CE2 . PHE C  1 21  ? 4.361   20.876  114.422 1.00 50.66  ? 45  PHE C CE2 1 
ATOM   3119  C CZ  . PHE C  1 21  ? 5.016   21.702  113.504 1.00 51.33  ? 45  PHE C CZ  1 
ATOM   3120  N N   . ASN C  1 22  ? 7.774   17.417  112.285 1.00 39.02  ? 46  ASN C N   1 
ATOM   3121  C CA  . ASN C  1 22  ? 8.983   17.788  113.027 1.00 36.98  ? 46  ASN C CA  1 
ATOM   3122  C C   . ASN C  1 22  ? 9.006   19.246  113.516 1.00 34.47  ? 46  ASN C C   1 
ATOM   3123  O O   . ASN C  1 22  ? 8.844   20.213  112.752 1.00 34.52  ? 46  ASN C O   1 
ATOM   3124  C CB  . ASN C  1 22  ? 10.195  17.552  112.138 1.00 37.33  ? 46  ASN C CB  1 
ATOM   3125  C CG  . ASN C  1 22  ? 10.369  16.106  111.798 1.00 37.00  ? 46  ASN C CG  1 
ATOM   3126  O OD1 . ASN C  1 22  ? 10.623  15.303  112.673 1.00 40.55  ? 46  ASN C OD1 1 
ATOM   3127  N ND2 . ASN C  1 22  ? 10.217  15.762  110.551 1.00 35.72  ? 46  ASN C ND2 1 
ATOM   3128  N N   . THR C  1 23  ? 9.254   19.389  114.795 1.00 33.32  ? 47  THR C N   1 
ATOM   3129  C CA  . THR C  1 23  ? 9.365   20.680  115.382 1.00 34.07  ? 47  THR C CA  1 
ATOM   3130  C C   . THR C  1 23  ? 10.164  20.656  116.697 1.00 33.46  ? 47  THR C C   1 
ATOM   3131  O O   . THR C  1 23  ? 10.699  19.606  117.156 1.00 32.85  ? 47  THR C O   1 
ATOM   3132  C CB  . THR C  1 23  ? 7.955   21.306  115.578 1.00 35.85  ? 47  THR C CB  1 
ATOM   3133  O OG1 . THR C  1 23  ? 8.031   22.759  115.540 1.00 36.11  ? 47  THR C OG1 1 
ATOM   3134  C CG2 . THR C  1 23  ? 7.247   20.756  116.901 1.00 36.34  ? 47  THR C CG2 1 
ATOM   3135  N N   . ARG C  1 24  ? 10.209  21.840  117.292 1.00 32.12  ? 48  ARG C N   1 
ATOM   3136  C CA  . ARG C  1 24  ? 11.104  22.134  118.336 1.00 32.20  ? 48  ARG C CA  1 
ATOM   3137  C C   . ARG C  1 24  ? 10.329  22.891  119.422 1.00 30.81  ? 48  ARG C C   1 
ATOM   3138  O O   . ARG C  1 24  ? 9.628   23.839  119.124 1.00 30.17  ? 48  ARG C O   1 
ATOM   3139  C CB  . ARG C  1 24  ? 12.204  22.926  117.667 1.00 33.43  ? 48  ARG C CB  1 
ATOM   3140  C CG  . ARG C  1 24  ? 13.311  23.409  118.531 1.00 35.59  ? 48  ARG C CG  1 
ATOM   3141  C CD  . ARG C  1 24  ? 13.940  24.636  117.877 1.00 38.55  ? 48  ARG C CD  1 
ATOM   3142  N NE  . ARG C  1 24  ? 12.986  25.749  117.796 1.00 41.67  ? 48  ARG C NE  1 
ATOM   3143  C CZ  . ARG C  1 24  ? 13.259  26.943  117.274 1.00 44.19  ? 48  ARG C CZ  1 
ATOM   3144  N NH1 . ARG C  1 24  ? 14.480  27.199  116.800 1.00 44.87  ? 48  ARG C NH1 1 
ATOM   3145  N NH2 . ARG C  1 24  ? 12.305  27.884  117.224 1.00 44.61  ? 48  ARG C NH2 1 
ATOM   3146  N N   . LEU C  1 25  ? 10.457  22.434  120.672 1.00 30.21  ? 49  LEU C N   1 
ATOM   3147  C CA  . LEU C  1 25  ? 9.811   23.053  121.854 1.00 29.81  ? 49  LEU C CA  1 
ATOM   3148  C C   . LEU C  1 25  ? 10.809  23.504  122.956 1.00 28.79  ? 49  LEU C C   1 
ATOM   3149  O O   . LEU C  1 25  ? 11.729  22.799  123.280 1.00 27.44  ? 49  LEU C O   1 
ATOM   3150  C CB  . LEU C  1 25  ? 8.761   22.103  122.427 1.00 29.44  ? 49  LEU C CB  1 
ATOM   3151  C CG  . LEU C  1 25  ? 7.733   21.690  121.352 1.00 29.38  ? 49  LEU C CG  1 
ATOM   3152  C CD1 . LEU C  1 25  ? 6.915   20.544  121.893 1.00 29.14  ? 49  LEU C CD1 1 
ATOM   3153  C CD2 . LEU C  1 25  ? 6.850   22.837  120.937 1.00 29.71  ? 49  LEU C CD2 1 
ATOM   3154  N N   . SER C  1 26  ? 10.620  24.698  123.508 1.00 28.54  ? 50  SER C N   1 
ATOM   3155  C CA  . SER C  1 26  ? 11.558  25.203  124.484 1.00 29.32  ? 50  SER C CA  1 
ATOM   3156  C C   . SER C  1 26  ? 10.880  25.810  125.708 1.00 30.10  ? 50  SER C C   1 
ATOM   3157  O O   . SER C  1 26  ? 9.723   26.254  125.662 1.00 30.38  ? 50  SER C O   1 
ATOM   3158  C CB  . SER C  1 26  ? 12.549  26.169  123.831 1.00 28.73  ? 50  SER C CB  1 
ATOM   3159  O OG  . SER C  1 26  ? 13.356  25.471  122.901 1.00 28.15  ? 50  SER C OG  1 
ATOM   3160  N N   . ARG C  1 27  ? 11.600  25.711  126.812 1.00 31.27  ? 51  ARG C N   1 
ATOM   3161  C CA  . ARG C  1 27  ? 11.275  26.375  128.034 1.00 34.02  ? 51  ARG C CA  1 
ATOM   3162  C C   . ARG C  1 27  ? 12.574  26.733  128.760 1.00 35.56  ? 51  ARG C C   1 
ATOM   3163  O O   . ARG C  1 27  ? 13.617  26.039  128.593 1.00 33.68  ? 51  ARG C O   1 
ATOM   3164  C CB  . ARG C  1 27  ? 10.434  25.474  128.918 1.00 35.01  ? 51  ARG C CB  1 
ATOM   3165  C CG  . ARG C  1 27  ? 11.215  24.354  129.570 1.00 36.50  ? 51  ARG C CG  1 
ATOM   3166  C CD  . ARG C  1 27  ? 10.248  23.375  130.195 1.00 38.74  ? 51  ARG C CD  1 
ATOM   3167  N NE  . ARG C  1 27  ? 9.982   23.836  131.543 1.00 39.00  ? 51  ARG C NE  1 
ATOM   3168  C CZ  . ARG C  1 27  ? 10.571  23.350  132.623 1.00 39.24  ? 51  ARG C CZ  1 
ATOM   3169  N NH1 . ARG C  1 27  ? 10.291  23.915  133.765 1.00 39.63  ? 51  ARG C NH1 1 
ATOM   3170  N NH2 . ARG C  1 27  ? 11.439  22.331  132.582 1.00 38.77  ? 51  ARG C NH2 1 
ATOM   3171  N N   . THR C  1 28  ? 12.484  27.783  129.595 1.00 37.31  ? 52  THR C N   1 
ATOM   3172  C CA  . THR C  1 28  ? 13.628  28.326  130.361 1.00 37.58  ? 52  THR C CA  1 
ATOM   3173  C C   . THR C  1 28  ? 13.263  28.484  131.830 1.00 36.57  ? 52  THR C C   1 
ATOM   3174  O O   . THR C  1 28  ? 12.224  29.093  132.126 1.00 38.05  ? 52  THR C O   1 
ATOM   3175  C CB  . THR C  1 28  ? 14.072  29.677  129.790 1.00 38.99  ? 52  THR C CB  1 
ATOM   3176  O OG1 . THR C  1 28  ? 14.350  29.528  128.381 1.00 40.57  ? 52  THR C OG1 1 
ATOM   3177  C CG2 . THR C  1 28  ? 15.345  30.136  130.476 1.00 40.28  ? 52  THR C CG2 1 
ATOM   3178  N N   . PHE C  1 29  ? 14.101  27.934  132.726 1.00 34.96  ? 53  PHE C N   1 
ATOM   3179  C CA  . PHE C  1 29  ? 13.904  28.012  134.191 1.00 34.74  ? 53  PHE C CA  1 
ATOM   3180  C C   . PHE C  1 29  ? 15.227  28.355  134.891 1.00 35.73  ? 53  PHE C C   1 
ATOM   3181  O O   . PHE C  1 29  ? 16.294  28.235  134.283 1.00 34.68  ? 53  PHE C O   1 
ATOM   3182  C CB  . PHE C  1 29  ? 13.331  26.727  134.772 1.00 33.96  ? 53  PHE C CB  1 
ATOM   3183  C CG  . PHE C  1 29  ? 14.198  25.519  134.545 1.00 36.61  ? 53  PHE C CG  1 
ATOM   3184  C CD1 . PHE C  1 29  ? 15.188  25.156  135.453 1.00 35.89  ? 53  PHE C CD1 1 
ATOM   3185  C CD2 . PHE C  1 29  ? 14.040  24.730  133.404 1.00 37.83  ? 53  PHE C CD2 1 
ATOM   3186  C CE1 . PHE C  1 29  ? 15.976  24.045  135.248 1.00 34.29  ? 53  PHE C CE1 1 
ATOM   3187  C CE2 . PHE C  1 29  ? 14.849  23.631  133.188 1.00 37.02  ? 53  PHE C CE2 1 
ATOM   3188  C CZ  . PHE C  1 29  ? 15.797  23.272  134.134 1.00 36.10  ? 53  PHE C CZ  1 
ATOM   3189  N N   . GLY C  1 30  ? 15.128  28.796  136.162 1.00 36.13  ? 54  GLY C N   1 
ATOM   3190  C CA  . GLY C  1 30  ? 16.256  29.246  136.955 1.00 35.22  ? 54  GLY C CA  1 
ATOM   3191  C C   . GLY C  1 30  ? 16.939  28.171  137.759 1.00 36.27  ? 54  GLY C C   1 
ATOM   3192  O O   . GLY C  1 30  ? 16.302  27.255  138.246 1.00 38.05  ? 54  GLY C O   1 
ATOM   3193  N N   . TYR C  1 31  ? 18.253  28.264  137.887 1.00 38.16  ? 55  TYR C N   1 
ATOM   3194  C CA  . TYR C  1 31  ? 19.042  27.366  138.763 1.00 39.38  ? 55  TYR C CA  1 
ATOM   3195  C C   . TYR C  1 31  ? 20.076  28.220  139.467 1.00 40.15  ? 55  TYR C C   1 
ATOM   3196  O O   . TYR C  1 31  ? 20.893  28.878  138.793 1.00 36.87  ? 55  TYR C O   1 
ATOM   3197  C CB  . TYR C  1 31  ? 19.785  26.297  137.956 1.00 38.48  ? 55  TYR C CB  1 
ATOM   3198  C CG  . TYR C  1 31  ? 20.655  25.325  138.749 1.00 38.23  ? 55  TYR C CG  1 
ATOM   3199  C CD1 . TYR C  1 31  ? 20.172  24.695  139.897 1.00 38.01  ? 55  TYR C CD1 1 
ATOM   3200  C CD2 . TYR C  1 31  ? 21.926  24.954  138.280 1.00 38.82  ? 55  TYR C CD2 1 
ATOM   3201  C CE1 . TYR C  1 31  ? 20.921  23.739  140.571 1.00 39.08  ? 55  TYR C CE1 1 
ATOM   3202  C CE2 . TYR C  1 31  ? 22.707  23.996  138.940 1.00 38.75  ? 55  TYR C CE2 1 
ATOM   3203  C CZ  . TYR C  1 31  ? 22.214  23.387  140.095 1.00 39.81  ? 55  TYR C CZ  1 
ATOM   3204  O OH  . TYR C  1 31  ? 22.983  22.468  140.800 1.00 38.86  ? 55  TYR C OH  1 
ATOM   3205  N N   . THR C  1 32  ? 20.031  28.213  140.801 1.00 42.09  ? 56  THR C N   1 
ATOM   3206  C CA  . THR C  1 32  ? 21.059  28.874  141.596 1.00 42.86  ? 56  THR C CA  1 
ATOM   3207  C C   . THR C  1 32  ? 21.888  27.893  142.405 1.00 42.46  ? 56  THR C C   1 
ATOM   3208  O O   . THR C  1 32  ? 21.338  27.109  143.116 1.00 45.54  ? 56  THR C O   1 
ATOM   3209  C CB  . THR C  1 32  ? 20.413  29.875  142.522 1.00 42.86  ? 56  THR C CB  1 
ATOM   3210  O OG1 . THR C  1 32  ? 19.656  30.785  141.732 1.00 41.87  ? 56  THR C OG1 1 
ATOM   3211  C CG2 . THR C  1 32  ? 21.466  30.641  143.250 1.00 44.04  ? 56  THR C CG2 1 
ATOM   3212  N N   . ILE C  1 33  ? 23.201  27.938  142.279 1.00 41.76  ? 57  ILE C N   1 
ATOM   3213  C CA  . ILE C  1 33  ? 24.073  27.239  143.189 1.00 44.50  ? 57  ILE C CA  1 
ATOM   3214  C C   . ILE C  1 33  ? 24.474  28.257  144.264 1.00 48.07  ? 57  ILE C C   1 
ATOM   3215  O O   . ILE C  1 33  ? 25.141  29.254  143.987 1.00 48.10  ? 57  ILE C O   1 
ATOM   3216  C CB  . ILE C  1 33  ? 25.279  26.659  142.425 1.00 45.41  ? 57  ILE C CB  1 
ATOM   3217  C CG1 . ILE C  1 33  ? 24.763  25.631  141.382 1.00 44.75  ? 57  ILE C CG1 1 
ATOM   3218  C CG2 . ILE C  1 33  ? 26.311  26.016  143.375 1.00 44.90  ? 57  ILE C CG2 1 
ATOM   3219  C CD1 . ILE C  1 33  ? 25.510  25.708  140.077 1.00 44.90  ? 57  ILE C CD1 1 
ATOM   3220  N N   . LYS C  1 34  ? 24.026  28.009  145.491 1.00 53.19  ? 58  LYS C N   1 
ATOM   3221  C CA  . LYS C  1 34  ? 24.221  28.947  146.605 1.00 56.10  ? 58  LYS C CA  1 
ATOM   3222  C C   . LYS C  1 34  ? 25.682  28.978  147.065 1.00 53.26  ? 58  LYS C C   1 
ATOM   3223  O O   . LYS C  1 34  ? 26.370  27.948  147.085 1.00 52.71  ? 58  LYS C O   1 
ATOM   3224  C CB  . LYS C  1 34  ? 23.326  28.530  147.788 1.00 60.70  ? 58  LYS C CB  1 
ATOM   3225  C CG  . LYS C  1 34  ? 21.838  28.554  147.518 1.00 65.09  ? 58  LYS C CG  1 
ATOM   3226  C CD  . LYS C  1 34  ? 21.217  29.879  147.971 1.00 74.56  ? 58  LYS C CD  1 
ATOM   3227  C CE  . LYS C  1 34  ? 20.220  30.452  146.938 1.00 83.62  ? 58  LYS C CE  1 
ATOM   3228  N NZ  . LYS C  1 34  ? 18.855  30.746  147.471 1.00 87.84  ? 58  LYS C NZ  1 
ATOM   3229  N N   . ARG C  1 35  ? 26.147  30.151  147.487 1.00 53.30  ? 59  ARG C N   1 
ATOM   3230  C CA  . ARG C  1 35  ? 27.543  30.289  147.889 1.00 52.54  ? 59  ARG C CA  1 
ATOM   3231  C C   . ARG C  1 35  ? 27.835  29.447  149.110 1.00 50.34  ? 59  ARG C C   1 
ATOM   3232  O O   . ARG C  1 35  ? 26.935  29.140  149.858 1.00 48.20  ? 59  ARG C O   1 
ATOM   3233  C CB  . ARG C  1 35  ? 27.947  31.739  148.079 1.00 55.17  ? 59  ARG C CB  1 
ATOM   3234  C CG  . ARG C  1 35  ? 27.891  32.303  149.477 1.00 60.41  ? 59  ARG C CG  1 
ATOM   3235  C CD  . ARG C  1 35  ? 26.546  32.909  149.799 1.00 65.56  ? 59  ARG C CD  1 
ATOM   3236  N NE  . ARG C  1 35  ? 26.479  34.337  149.491 1.00 71.53  ? 59  ARG C NE  1 
ATOM   3237  C CZ  . ARG C  1 35  ? 25.361  35.063  149.515 1.00 78.78  ? 59  ARG C CZ  1 
ATOM   3238  N NH1 . ARG C  1 35  ? 24.179  34.511  149.810 1.00 83.82  ? 59  ARG C NH1 1 
ATOM   3239  N NH2 . ARG C  1 35  ? 25.421  36.360  149.231 1.00 80.59  ? 59  ARG C NH2 1 
ATOM   3240  N N   . THR C  1 36  ? 29.080  29.016  149.256 1.00 51.26  ? 60  THR C N   1 
ATOM   3241  C CA  . THR C  1 36  ? 29.522  28.331  150.450 1.00 53.16  ? 60  THR C CA  1 
ATOM   3242  C C   . THR C  1 36  ? 30.800  28.911  151.021 1.00 56.47  ? 60  THR C C   1 
ATOM   3243  O O   . THR C  1 36  ? 31.499  29.740  150.434 1.00 51.87  ? 60  THR C O   1 
ATOM   3244  C CB  . THR C  1 36  ? 29.742  26.817  150.241 1.00 56.28  ? 60  THR C CB  1 
ATOM   3245  O OG1 . THR C  1 36  ? 30.903  26.599  149.421 1.00 56.15  ? 60  THR C OG1 1 
ATOM   3246  C CG2 . THR C  1 36  ? 28.434  26.113  149.649 1.00 57.99  ? 60  THR C CG2 1 
ATOM   3247  N N   . THR C  1 37  ? 31.061  28.473  152.242 1.00 66.83  ? 61  THR C N   1 
ATOM   3248  C CA  . THR C  1 37  ? 32.254  28.852  152.982 1.00 69.64  ? 61  THR C CA  1 
ATOM   3249  C C   . THR C  1 37  ? 33.242  27.695  153.121 1.00 67.42  ? 61  THR C C   1 
ATOM   3250  O O   . THR C  1 37  ? 34.403  27.970  153.369 1.00 72.21  ? 61  THR C O   1 
ATOM   3251  C CB  . THR C  1 37  ? 31.880  29.489  154.343 1.00 70.54  ? 61  THR C CB  1 
ATOM   3252  O OG1 . THR C  1 37  ? 30.549  29.077  154.736 1.00 64.50  ? 61  THR C OG1 1 
ATOM   3253  C CG2 . THR C  1 37  ? 31.960  31.056  154.216 1.00 70.96  ? 61  THR C CG2 1 
ATOM   3254  N N   . VAL C  1 38  ? 32.817  26.443  152.891 1.00 63.70  ? 62  VAL C N   1 
ATOM   3255  C CA  . VAL C  1 38  ? 33.760  25.308  152.690 1.00 66.84  ? 62  VAL C CA  1 
ATOM   3256  C C   . VAL C  1 38  ? 34.941  25.781  151.802 1.00 70.97  ? 62  VAL C C   1 
ATOM   3257  O O   . VAL C  1 38  ? 34.756  26.478  150.756 1.00 68.55  ? 62  VAL C O   1 
ATOM   3258  C CB  . VAL C  1 38  ? 33.097  24.037  152.068 1.00 67.67  ? 62  VAL C CB  1 
ATOM   3259  C CG1 . VAL C  1 38  ? 34.081  22.858  152.030 1.00 62.95  ? 62  VAL C CG1 1 
ATOM   3260  C CG2 . VAL C  1 38  ? 31.763  23.671  152.763 1.00 67.28  ? 62  VAL C CG2 1 
ATOM   3261  N N   . LYS C  1 39  ? 36.152  25.489  152.282 1.00 74.64  ? 63  LYS C N   1 
ATOM   3262  C CA  . LYS C  1 39  ? 37.380  26.097  151.711 1.00 75.71  ? 63  LYS C CA  1 
ATOM   3263  C C   . LYS C  1 39  ? 37.977  25.078  150.731 1.00 67.63  ? 63  LYS C C   1 
ATOM   3264  O O   . LYS C  1 39  ? 38.391  25.433  149.591 1.00 58.82  ? 63  LYS C O   1 
ATOM   3265  C CB  . LYS C  1 39  ? 38.371  26.654  152.803 1.00 81.53  ? 63  LYS C CB  1 
ATOM   3266  C CG  . LYS C  1 39  ? 38.880  25.683  153.872 1.00 85.21  ? 63  LYS C CG  1 
ATOM   3267  C CD  . LYS C  1 39  ? 37.987  25.627  155.101 1.00 85.54  ? 63  LYS C CD  1 
ATOM   3268  C CE  . LYS C  1 39  ? 37.872  24.193  155.598 1.00 88.79  ? 63  LYS C CE  1 
ATOM   3269  N NZ  . LYS C  1 39  ? 37.208  24.146  156.924 1.00 90.53  ? 63  LYS C NZ  1 
ATOM   3270  N N   . THR C  1 40  ? 37.926  23.805  151.142 1.00 61.33  ? 64  THR C N   1 
ATOM   3271  C CA  . THR C  1 40  ? 38.279  22.725  150.241 1.00 58.97  ? 64  THR C CA  1 
ATOM   3272  C C   . THR C  1 40  ? 37.317  22.671  149.016 1.00 55.11  ? 64  THR C C   1 
ATOM   3273  O O   . THR C  1 40  ? 36.107  23.064  149.101 1.00 55.60  ? 64  THR C O   1 
ATOM   3274  C CB  . THR C  1 40  ? 38.277  21.339  150.925 1.00 59.25  ? 64  THR C CB  1 
ATOM   3275  O OG1 . THR C  1 40  ? 36.939  20.957  151.199 1.00 65.30  ? 64  THR C OG1 1 
ATOM   3276  C CG2 . THR C  1 40  ? 39.028  21.332  152.235 1.00 61.56  ? 64  THR C CG2 1 
ATOM   3277  N N   . PRO C  1 41  ? 37.834  22.177  147.874 1.00 49.78  ? 65  PRO C N   1 
ATOM   3278  C CA  . PRO C  1 41  ? 36.937  21.957  146.732 1.00 48.09  ? 65  PRO C CA  1 
ATOM   3279  C C   . PRO C  1 41  ? 35.763  20.962  147.004 1.00 46.95  ? 65  PRO C C   1 
ATOM   3280  O O   . PRO C  1 41  ? 35.979  19.787  147.406 1.00 46.96  ? 65  PRO C O   1 
ATOM   3281  C CB  . PRO C  1 41  ? 37.871  21.458  145.625 1.00 48.51  ? 65  PRO C CB  1 
ATOM   3282  C CG  . PRO C  1 41  ? 39.255  21.788  146.082 1.00 50.21  ? 65  PRO C CG  1 
ATOM   3283  C CD  . PRO C  1 41  ? 39.237  21.839  147.569 1.00 49.42  ? 65  PRO C CD  1 
ATOM   3284  N N   . SER C  1 42  ? 34.537  21.459  146.799 1.00 45.89  ? 66  SER C N   1 
ATOM   3285  C CA  . SER C  1 42  ? 33.302  20.653  146.864 1.00 42.70  ? 66  SER C CA  1 
ATOM   3286  C C   . SER C  1 42  ? 32.432  20.868  145.609 1.00 40.45  ? 66  SER C C   1 
ATOM   3287  O O   . SER C  1 42  ? 32.665  21.787  144.821 1.00 38.56  ? 66  SER C O   1 
ATOM   3288  C CB  . SER C  1 42  ? 32.493  20.997  148.121 1.00 41.61  ? 66  SER C CB  1 
ATOM   3289  O OG  . SER C  1 42  ? 32.377  22.405  148.282 1.00 42.16  ? 66  SER C OG  1 
ATOM   3290  N N   . TRP C  1 43  ? 31.405  20.021  145.485 1.00 37.95  ? 67  TRP C N   1 
ATOM   3291  C CA  . TRP C  1 43  ? 30.565  19.964  144.326 1.00 35.90  ? 67  TRP C CA  1 
ATOM   3292  C C   . TRP C  1 43  ? 29.108  19.843  144.659 1.00 35.19  ? 67  TRP C C   1 
ATOM   3293  O O   . TRP C  1 43  ? 28.726  19.101  145.552 1.00 37.41  ? 67  TRP C O   1 
ATOM   3294  C CB  . TRP C  1 43  ? 30.999  18.790  143.450 1.00 36.58  ? 67  TRP C CB  1 
ATOM   3295  C CG  . TRP C  1 43  ? 32.136  19.185  142.557 1.00 35.60  ? 67  TRP C CG  1 
ATOM   3296  C CD1 . TRP C  1 43  ? 32.043  19.762  141.339 1.00 33.77  ? 67  TRP C CD1 1 
ATOM   3297  C CD2 . TRP C  1 43  ? 33.520  19.111  142.879 1.00 34.56  ? 67  TRP C CD2 1 
ATOM   3298  N NE1 . TRP C  1 43  ? 33.287  20.020  140.863 1.00 34.50  ? 67  TRP C NE1 1 
ATOM   3299  C CE2 . TRP C  1 43  ? 34.220  19.650  141.795 1.00 34.14  ? 67  TRP C CE2 1 
ATOM   3300  C CE3 . TRP C  1 43  ? 34.227  18.641  143.986 1.00 34.86  ? 67  TRP C CE3 1 
ATOM   3301  C CZ2 . TRP C  1 43  ? 35.610  19.702  141.745 1.00 33.70  ? 67  TRP C CZ2 1 
ATOM   3302  C CZ3 . TRP C  1 43  ? 35.603  18.677  143.952 1.00 35.01  ? 67  TRP C CZ3 1 
ATOM   3303  C CH2 . TRP C  1 43  ? 36.286  19.213  142.826 1.00 35.09  ? 67  TRP C CH2 1 
ATOM   3304  N N   . ALA C  1 44  ? 28.301  20.605  143.931 1.00 34.09  ? 68  ALA C N   1 
ATOM   3305  C CA  . ALA C  1 44  ? 26.853  20.585  144.044 1.00 33.18  ? 68  ALA C CA  1 
ATOM   3306  C C   . ALA C  1 44  ? 26.285  19.678  142.909 1.00 32.52  ? 68  ALA C C   1 
ATOM   3307  O O   . ALA C  1 44  ? 26.481  19.911  141.666 1.00 30.09  ? 68  ALA C O   1 
ATOM   3308  C CB  . ALA C  1 44  ? 26.308  22.028  143.997 1.00 32.70  ? 68  ALA C CB  1 
ATOM   3309  N N   . VAL C  1 45  ? 25.592  18.648  143.377 1.00 32.83  ? 69  VAL C N   1 
ATOM   3310  C CA  . VAL C  1 45  ? 25.216  17.509  142.577 1.00 33.43  ? 69  VAL C CA  1 
ATOM   3311  C C   . VAL C  1 45  ? 23.729  17.487  142.491 1.00 33.86  ? 69  VAL C C   1 
ATOM   3312  O O   . VAL C  1 45  ? 23.044  17.598  143.485 1.00 33.68  ? 69  VAL C O   1 
ATOM   3313  C CB  . VAL C  1 45  ? 25.750  16.211  143.178 1.00 34.45  ? 69  VAL C CB  1 
ATOM   3314  C CG1 . VAL C  1 45  ? 25.260  15.013  142.429 1.00 34.50  ? 69  VAL C CG1 1 
ATOM   3315  C CG2 . VAL C  1 45  ? 27.288  16.194  143.128 1.00 35.90  ? 69  VAL C CG2 1 
ATOM   3316  N N   . ASP C  1 46  ? 23.252  17.335  141.262 1.00 37.15  ? 70  ASP C N   1 
ATOM   3317  C CA  . ASP C  1 46  ? 21.846  17.412  140.911 1.00 38.87  ? 70  ASP C CA  1 
ATOM   3318  C C   . ASP C  1 46  ? 21.561  16.714  139.584 1.00 40.65  ? 70  ASP C C   1 
ATOM   3319  O O   . ASP C  1 46  ? 22.410  16.030  139.053 1.00 44.65  ? 70  ASP C O   1 
ATOM   3320  C CB  . ASP C  1 46  ? 21.442  18.863  140.811 1.00 39.53  ? 70  ASP C CB  1 
ATOM   3321  C CG  . ASP C  1 46  ? 20.133  19.146  141.492 1.00 40.93  ? 70  ASP C CG  1 
ATOM   3322  O OD1 . ASP C  1 46  ? 19.190  18.280  141.431 1.00 38.00  ? 70  ASP C OD1 1 
ATOM   3323  O OD2 . ASP C  1 46  ? 20.104  20.260  142.100 1.00 42.94  ? 70  ASP C OD2 1 
ATOM   3324  N N   . MET C  1 47  ? 20.362  16.901  139.050 1.00 44.00  ? 71  MET C N   1 
ATOM   3325  C CA  . MET C  1 47  ? 19.863  16.131  137.917 1.00 45.33  ? 71  MET C CA  1 
ATOM   3326  C C   . MET C  1 47  ? 18.674  16.848  137.262 1.00 44.54  ? 71  MET C C   1 
ATOM   3327  O O   . MET C  1 47  ? 18.198  17.931  137.728 1.00 45.58  ? 71  MET C O   1 
ATOM   3328  C CB  . MET C  1 47  ? 19.433  14.782  138.397 1.00 47.03  ? 71  MET C CB  1 
ATOM   3329  C CG  . MET C  1 47  ? 18.598  15.007  139.609 1.00 50.86  ? 71  MET C CG  1 
ATOM   3330  S SD  . MET C  1 47  ? 17.478  13.691  139.813 1.00 61.15  ? 71  MET C SD  1 
ATOM   3331  C CE  . MET C  1 47  ? 17.995  13.119  141.471 1.00 62.92  ? 71  MET C CE  1 
ATOM   3332  N N   . MET C  1 48  ? 18.270  16.240  136.153 1.00 42.31  ? 72  MET C N   1 
ATOM   3333  C CA  . MET C  1 48  ? 17.352  16.782  135.211 1.00 41.69  ? 72  MET C CA  1 
ATOM   3334  C C   . MET C  1 48  ? 16.636  15.672  134.528 1.00 39.98  ? 72  MET C C   1 
ATOM   3335  O O   . MET C  1 48  ? 17.278  14.771  133.942 1.00 38.30  ? 72  MET C O   1 
ATOM   3336  C CB  . MET C  1 48  ? 18.112  17.495  134.107 1.00 44.71  ? 72  MET C CB  1 
ATOM   3337  C CG  . MET C  1 48  ? 17.912  18.971  134.162 1.00 49.57  ? 72  MET C CG  1 
ATOM   3338  S SD  . MET C  1 48  ? 18.678  19.896  132.844 1.00 54.50  ? 72  MET C SD  1 
ATOM   3339  C CE  . MET C  1 48  ? 20.301  19.883  133.609 1.00 53.70  ? 72  MET C CE  1 
ATOM   3340  N N   . ARG C  1 49  ? 15.315  15.774  134.553 1.00 38.23  ? 73  ARG C N   1 
ATOM   3341  C CA  . ARG C  1 49  ? 14.469  14.985  133.671 1.00 38.61  ? 73  ARG C CA  1 
ATOM   3342  C C   . ARG C  1 49  ? 13.755  15.855  132.637 1.00 36.38  ? 73  ARG C C   1 
ATOM   3343  O O   . ARG C  1 49  ? 13.782  17.074  132.724 1.00 38.34  ? 73  ARG C O   1 
ATOM   3344  C CB  . ARG C  1 49  ? 13.499  14.160  134.495 1.00 40.46  ? 73  ARG C CB  1 
ATOM   3345  C CG  . ARG C  1 49  ? 14.229  13.241  135.442 1.00 41.37  ? 73  ARG C CG  1 
ATOM   3346  C CD  . ARG C  1 49  ? 13.311  12.157  135.958 1.00 42.29  ? 73  ARG C CD  1 
ATOM   3347  N NE  . ARG C  1 49  ? 14.039  11.355  136.951 1.00 43.06  ? 73  ARG C NE  1 
ATOM   3348  C CZ  . ARG C  1 49  ? 14.120  11.647  138.238 1.00 41.58  ? 73  ARG C CZ  1 
ATOM   3349  N NH1 . ARG C  1 49  ? 14.807  10.895  139.054 1.00 41.59  ? 73  ARG C NH1 1 
ATOM   3350  N NH2 . ARG C  1 49  ? 13.525  12.710  138.713 1.00 45.25  ? 73  ARG C NH2 1 
ATOM   3351  N N   . PHE C  1 50  ? 13.167  15.247  131.625 1.00 34.98  ? 74  PHE C N   1 
ATOM   3352  C CA  . PHE C  1 50  ? 12.483  16.031  130.615 1.00 35.22  ? 74  PHE C CA  1 
ATOM   3353  C C   . PHE C  1 50  ? 11.123  15.421  130.450 1.00 35.09  ? 74  PHE C C   1 
ATOM   3354  O O   . PHE C  1 50  ? 11.024  14.327  129.982 1.00 36.65  ? 74  PHE C O   1 
ATOM   3355  C CB  . PHE C  1 50  ? 13.253  16.039  129.314 1.00 35.37  ? 74  PHE C CB  1 
ATOM   3356  C CG  . PHE C  1 50  ? 14.722  16.192  129.515 1.00 36.40  ? 74  PHE C CG  1 
ATOM   3357  C CD1 . PHE C  1 50  ? 15.251  17.380  129.987 1.00 37.10  ? 74  PHE C CD1 1 
ATOM   3358  C CD2 . PHE C  1 50  ? 15.577  15.130  129.307 1.00 37.10  ? 74  PHE C CD2 1 
ATOM   3359  C CE1 . PHE C  1 50  ? 16.619  17.501  130.203 1.00 36.79  ? 74  PHE C CE1 1 
ATOM   3360  C CE2 . PHE C  1 50  ? 16.935  15.246  129.520 1.00 35.62  ? 74  PHE C CE2 1 
ATOM   3361  C CZ  . PHE C  1 50  ? 17.453  16.417  129.957 1.00 35.99  ? 74  PHE C CZ  1 
ATOM   3362  N N   . ASN C  1 51  ? 10.086  16.124  130.890 1.00 33.45  ? 75  ASN C N   1 
ATOM   3363  C CA  . ASN C  1 51  ? 8.731   15.781  130.571 1.00 31.00  ? 75  ASN C CA  1 
ATOM   3364  C C   . ASN C  1 51  ? 8.076   16.806  129.630 1.00 32.00  ? 75  ASN C C   1 
ATOM   3365  O O   . ASN C  1 51  ? 8.006   17.934  129.966 1.00 32.06  ? 75  ASN C O   1 
ATOM   3366  C CB  . ASN C  1 51  ? 7.943   15.707  131.844 1.00 29.14  ? 75  ASN C CB  1 
ATOM   3367  C CG  . ASN C  1 51  ? 6.742   14.817  131.694 1.00 28.13  ? 75  ASN C CG  1 
ATOM   3368  O OD1 . ASN C  1 51  ? 5.912   15.089  130.854 1.00 27.15  ? 75  ASN C OD1 1 
ATOM   3369  N ND2 . ASN C  1 51  ? 6.689   13.706  132.434 1.00 26.14  ? 75  ASN C ND2 1 
ATOM   3370  N N   . ILE C  1 52  ? 7.553   16.370  128.475 1.00 33.68  ? 76  ILE C N   1 
ATOM   3371  C CA  . ILE C  1 52  ? 6.743   17.165  127.519 1.00 32.83  ? 76  ILE C CA  1 
ATOM   3372  C C   . ILE C  1 52  ? 5.515   17.856  128.147 1.00 33.69  ? 76  ILE C C   1 
ATOM   3373  O O   . ILE C  1 52  ? 4.932   18.776  127.550 1.00 34.25  ? 76  ILE C O   1 
ATOM   3374  C CB  . ILE C  1 52  ? 6.293   16.245  126.351 1.00 33.65  ? 76  ILE C CB  1 
ATOM   3375  C CG1 . ILE C  1 52  ? 6.073   17.007  125.036 1.00 36.66  ? 76  ILE C CG1 1 
ATOM   3376  C CG2 . ILE C  1 52  ? 5.018   15.494  126.682 1.00 33.89  ? 76  ILE C CG2 1 
ATOM   3377  C CD1 . ILE C  1 52  ? 6.040   16.141  123.769 1.00 37.72  ? 76  ILE C CD1 1 
ATOM   3378  N N   . ASN C  1 53  ? 5.076   17.418  129.327 1.00 33.54  ? 77  ASN C N   1 
ATOM   3379  C CA  . ASN C  1 53  ? 4.082   18.190  130.072 1.00 33.79  ? 77  ASN C CA  1 
ATOM   3380  C C   . ASN C  1 53  ? 4.493   19.638  130.213 1.00 33.75  ? 77  ASN C C   1 
ATOM   3381  O O   . ASN C  1 53  ? 3.685   20.514  129.971 1.00 38.43  ? 77  ASN C O   1 
ATOM   3382  C CB  . ASN C  1 53  ? 3.846   17.616  131.460 1.00 34.83  ? 77  ASN C CB  1 
ATOM   3383  C CG  . ASN C  1 53  ? 3.180   16.230  131.451 1.00 35.66  ? 77  ASN C CG  1 
ATOM   3384  O OD1 . ASN C  1 53  ? 2.477   15.823  130.497 1.00 37.30  ? 77  ASN C OD1 1 
ATOM   3385  N ND2 . ASN C  1 53  ? 3.468   15.463  132.503 1.00 35.17  ? 77  ASN C ND2 1 
ATOM   3386  N N   . ASP C  1 54  ? 5.760   19.890  130.519 1.00 33.01  ? 78  ASP C N   1 
ATOM   3387  C CA  . ASP C  1 54  ? 6.297   21.237  130.671 1.00 32.30  ? 78  ASP C CA  1 
ATOM   3388  C C   . ASP C  1 54  ? 6.537   21.939  129.375 1.00 32.51  ? 78  ASP C C   1 
ATOM   3389  O O   . ASP C  1 54  ? 6.960   23.067  129.391 1.00 33.38  ? 78  ASP C O   1 
ATOM   3390  C CB  . ASP C  1 54  ? 7.646   21.232  131.399 1.00 32.75  ? 78  ASP C CB  1 
ATOM   3391  C CG  . ASP C  1 54  ? 7.595   20.500  132.684 1.00 34.89  ? 78  ASP C CG  1 
ATOM   3392  O OD1 . ASP C  1 54  ? 6.750   20.869  133.555 1.00 34.65  ? 78  ASP C OD1 1 
ATOM   3393  O OD2 . ASP C  1 54  ? 8.366   19.506  132.783 1.00 36.61  ? 78  ASP C OD2 1 
ATOM   3394  N N   . PHE C  1 55  ? 6.370   21.291  128.239 1.00 33.89  ? 79  PHE C N   1 
ATOM   3395  C CA  . PHE C  1 55  ? 6.682   21.941  126.951 1.00 34.51  ? 79  PHE C CA  1 
ATOM   3396  C C   . PHE C  1 55  ? 5.481   22.340  126.079 1.00 36.24  ? 79  PHE C C   1 
ATOM   3397  O O   . PHE C  1 55  ? 5.608   23.155  125.174 1.00 36.04  ? 79  PHE C O   1 
ATOM   3398  C CB  . PHE C  1 55  ? 7.607   21.047  126.207 1.00 32.99  ? 79  PHE C CB  1 
ATOM   3399  C CG  . PHE C  1 55  ? 8.938   20.972  126.817 1.00 31.42  ? 79  PHE C CG  1 
ATOM   3400  C CD1 . PHE C  1 55  ? 9.142   20.180  127.864 1.00 31.14  ? 79  PHE C CD1 1 
ATOM   3401  C CD2 . PHE C  1 55  ? 9.983   21.709  126.316 1.00 31.98  ? 79  PHE C CD2 1 
ATOM   3402  C CE1 . PHE C  1 55  ? 10.379  20.120  128.477 1.00 32.28  ? 79  PHE C CE1 1 
ATOM   3403  C CE2 . PHE C  1 55  ? 11.244  21.654  126.889 1.00 32.45  ? 79  PHE C CE2 1 
ATOM   3404  C CZ  . PHE C  1 55  ? 11.441  20.863  127.992 1.00 32.75  ? 79  PHE C CZ  1 
ATOM   3405  N N   . LEU C  1 56  ? 4.318   21.821  126.447 1.00 39.73  ? 80  LEU C N   1 
ATOM   3406  C CA  . LEU C  1 56  ? 3.143   21.759  125.620 1.00 41.41  ? 80  LEU C CA  1 
ATOM   3407  C C   . LEU C  1 56  ? 1.922   21.938  126.528 1.00 41.51  ? 80  LEU C C   1 
ATOM   3408  O O   . LEU C  1 56  ? 1.525   20.984  127.245 1.00 41.90  ? 80  LEU C O   1 
ATOM   3409  C CB  . LEU C  1 56  ? 3.092   20.353  125.081 1.00 44.40  ? 80  LEU C CB  1 
ATOM   3410  C CG  . LEU C  1 56  ? 2.685   20.191  123.659 1.00 46.74  ? 80  LEU C CG  1 
ATOM   3411  C CD1 . LEU C  1 56  ? 3.953   20.468  122.908 1.00 48.36  ? 80  LEU C CD1 1 
ATOM   3412  C CD2 . LEU C  1 56  ? 2.220   18.770  123.382 1.00 48.23  ? 80  LEU C CD2 1 
ATOM   3413  N N   . PRO C  1 57  ? 1.306   23.131  126.510 1.00 38.95  ? 81  PRO C N   1 
ATOM   3414  C CA  . PRO C  1 57  ? 0.178   23.303  127.436 1.00 40.10  ? 81  PRO C CA  1 
ATOM   3415  C C   . PRO C  1 57  ? -1.041  22.530  126.992 1.00 41.79  ? 81  PRO C C   1 
ATOM   3416  O O   . PRO C  1 57  ? -1.055  21.961  125.871 1.00 41.95  ? 81  PRO C O   1 
ATOM   3417  C CB  . PRO C  1 57  ? -0.093  24.777  127.425 1.00 37.79  ? 81  PRO C CB  1 
ATOM   3418  C CG  . PRO C  1 57  ? 0.484   25.239  126.160 1.00 37.60  ? 81  PRO C CG  1 
ATOM   3419  C CD  . PRO C  1 57  ? 1.488   24.274  125.639 1.00 36.89  ? 81  PRO C CD  1 
ATOM   3420  N N   . PRO C  1 58  ? -2.020  22.417  127.892 1.00 43.67  ? 82  PRO C N   1 
ATOM   3421  C CA  . PRO C  1 58  ? -3.326  21.840  127.491 1.00 44.38  ? 82  PRO C CA  1 
ATOM   3422  C C   . PRO C  1 58  ? -3.995  22.661  126.361 1.00 43.76  ? 82  PRO C C   1 
ATOM   3423  O O   . PRO C  1 58  ? -3.627  23.817  126.134 1.00 43.24  ? 82  PRO C O   1 
ATOM   3424  C CB  . PRO C  1 58  ? -4.154  21.882  128.773 1.00 43.92  ? 82  PRO C CB  1 
ATOM   3425  C CG  . PRO C  1 58  ? -3.194  22.151  129.886 1.00 44.80  ? 82  PRO C CG  1 
ATOM   3426  C CD  . PRO C  1 58  ? -1.807  22.390  129.346 1.00 43.95  ? 82  PRO C CD  1 
ATOM   3427  N N   . GLY C  1 59  ? -4.921  22.032  125.642 1.00 44.36  ? 83  GLY C N   1 
ATOM   3428  C CA  . GLY C  1 59  ? -5.703  22.651  124.539 1.00 45.63  ? 83  GLY C CA  1 
ATOM   3429  C C   . GLY C  1 59  ? -7.068  22.996  125.105 1.00 47.03  ? 83  GLY C C   1 
ATOM   3430  O O   . GLY C  1 59  ? -7.179  23.206  126.288 1.00 55.46  ? 83  GLY C O   1 
ATOM   3431  N N   . GLY C  1 60  ? -8.108  23.033  124.292 1.00 46.32  ? 84  GLY C N   1 
ATOM   3432  C CA  . GLY C  1 60  ? -9.476  23.264  124.762 1.00 43.87  ? 84  GLY C CA  1 
ATOM   3433  C C   . GLY C  1 60  ? -10.475 22.595  123.830 1.00 44.85  ? 84  GLY C C   1 
ATOM   3434  O O   . GLY C  1 60  ? -10.133 22.105  122.721 1.00 45.36  ? 84  GLY C O   1 
ATOM   3435  N N   . GLY C  1 61  ? -11.726 22.585  124.271 1.00 43.99  ? 85  GLY C N   1 
ATOM   3436  C CA  . GLY C  1 61  ? -12.799 21.888  123.587 1.00 42.52  ? 85  GLY C CA  1 
ATOM   3437  C C   . GLY C  1 61  ? -12.470 20.408  123.457 1.00 43.91  ? 85  GLY C C   1 
ATOM   3438  O O   . GLY C  1 61  ? -12.016 19.733  124.411 1.00 41.70  ? 85  GLY C O   1 
ATOM   3439  N N   . SER C  1 62  ? -12.633 19.924  122.236 1.00 46.01  ? 86  SER C N   1 
ATOM   3440  C CA  . SER C  1 62  ? -12.412 18.522  121.917 1.00 47.40  ? 86  SER C CA  1 
ATOM   3441  C C   . SER C  1 62  ? -11.015 18.164  121.403 1.00 46.42  ? 86  SER C C   1 
ATOM   3442  O O   . SER C  1 62  ? -10.850 17.055  120.899 1.00 46.80  ? 86  SER C O   1 
ATOM   3443  C CB  . SER C  1 62  ? -13.393 18.149  120.827 1.00 50.29  ? 86  SER C CB  1 
ATOM   3444  O OG  . SER C  1 62  ? -14.703 18.480  121.213 1.00 54.32  ? 86  SER C OG  1 
ATOM   3445  N N   . ASN C  1 63  ? -10.062 19.114  121.447 1.00 44.81  ? 87  ASN C N   1 
ATOM   3446  C CA  . ASN C  1 63  ? -8.667  18.916  121.068 1.00 41.85  ? 87  ASN C CA  1 
ATOM   3447  C C   . ASN C  1 63  ? -7.949  19.209  122.367 1.00 45.07  ? 87  ASN C C   1 
ATOM   3448  O O   . ASN C  1 63  ? -7.510  20.355  122.539 1.00 47.53  ? 87  ASN C O   1 
ATOM   3449  C CB  . ASN C  1 63  ? -8.226  19.877  119.964 1.00 38.98  ? 87  ASN C CB  1 
ATOM   3450  C CG  . ASN C  1 63  ? -9.009  19.687  118.658 1.00 38.79  ? 87  ASN C CG  1 
ATOM   3451  O OD1 . ASN C  1 63  ? -8.923  18.635  118.014 1.00 39.45  ? 87  ASN C OD1 1 
ATOM   3452  N ND2 . ASN C  1 63  ? -9.770  20.720  118.247 1.00 36.70  ? 87  ASN C ND2 1 
ATOM   3453  N N   . PRO C  1 64  ? -7.839  18.185  123.294 1.00 45.57  ? 88  PRO C N   1 
ATOM   3454  C CA  . PRO C  1 64  ? -7.259  18.362  124.636 1.00 44.27  ? 88  PRO C CA  1 
ATOM   3455  C C   . PRO C  1 64  ? -5.809  18.884  124.707 1.00 44.81  ? 88  PRO C C   1 
ATOM   3456  O O   . PRO C  1 64  ? -5.414  19.422  125.777 1.00 46.41  ? 88  PRO C O   1 
ATOM   3457  C CB  . PRO C  1 64  ? -7.275  16.960  125.244 1.00 43.33  ? 88  PRO C CB  1 
ATOM   3458  C CG  . PRO C  1 64  ? -7.756  16.032  124.207 1.00 43.74  ? 88  PRO C CG  1 
ATOM   3459  C CD  . PRO C  1 64  ? -7.924  16.753  122.933 1.00 44.82  ? 88  PRO C CD  1 
ATOM   3460  N N   . ARG C  1 65  ? -5.006  18.694  123.650 1.00 44.41  ? 89  ARG C N   1 
ATOM   3461  C CA  . ARG C  1 65  ? -3.604  19.160  123.669 1.00 44.68  ? 89  ARG C CA  1 
ATOM   3462  C C   . ARG C  1 65  ? -3.375  20.181  122.588 1.00 43.39  ? 89  ARG C C   1 
ATOM   3463  O O   . ARG C  1 65  ? -3.934  20.080  121.501 1.00 45.83  ? 89  ARG C O   1 
ATOM   3464  C CB  . ARG C  1 65  ? -2.677  18.005  123.466 1.00 47.24  ? 89  ARG C CB  1 
ATOM   3465  C CG  . ARG C  1 65  ? -2.841  16.925  124.532 1.00 50.36  ? 89  ARG C CG  1 
ATOM   3466  C CD  . ARG C  1 65  ? -2.643  15.523  123.994 1.00 50.40  ? 89  ARG C CD  1 
ATOM   3467  N NE  . ARG C  1 65  ? -3.731  14.905  123.215 1.00 50.51  ? 89  ARG C NE  1 
ATOM   3468  C CZ  . ARG C  1 65  ? -4.639  14.033  123.689 1.00 49.64  ? 89  ARG C CZ  1 
ATOM   3469  N NH1 . ARG C  1 65  ? -5.510  13.489  122.840 1.00 52.02  ? 89  ARG C NH1 1 
ATOM   3470  N NH2 . ARG C  1 65  ? -4.702  13.686  124.978 1.00 47.08  ? 89  ARG C NH2 1 
ATOM   3471  N N   . SER C  1 66  ? -2.554  21.173  122.906 1.00 40.03  ? 90  SER C N   1 
ATOM   3472  C CA  . SER C  1 66  ? -2.260  22.293  122.005 1.00 35.86  ? 90  SER C CA  1 
ATOM   3473  C C   . SER C  1 66  ? -1.622  21.893  120.652 1.00 34.54  ? 90  SER C C   1 
ATOM   3474  O O   . SER C  1 66  ? -1.765  22.640  119.693 1.00 33.11  ? 90  SER C O   1 
ATOM   3475  C CB  . SER C  1 66  ? -1.405  23.346  122.742 1.00 34.21  ? 90  SER C CB  1 
ATOM   3476  O OG  . SER C  1 66  ? -0.177  22.841  123.247 1.00 32.09  ? 90  SER C OG  1 
ATOM   3477  N N   . VAL C  1 67  ? -0.943  20.739  120.552 1.00 34.20  ? 91  VAL C N   1 
ATOM   3478  C CA  . VAL C  1 67  ? -0.626  20.229  119.205 1.00 35.07  ? 91  VAL C CA  1 
ATOM   3479  C C   . VAL C  1 67  ? -1.567  19.079  118.923 1.00 33.33  ? 91  VAL C C   1 
ATOM   3480  O O   . VAL C  1 67  ? -1.756  18.274  119.789 1.00 31.34  ? 91  VAL C O   1 
ATOM   3481  C CB  . VAL C  1 67  ? 0.871   19.961  118.971 1.00 36.53  ? 91  VAL C CB  1 
ATOM   3482  C CG1 . VAL C  1 67  ? 1.660   20.934  119.819 1.00 37.90  ? 91  VAL C CG1 1 
ATOM   3483  C CG2 . VAL C  1 67  ? 1.292   18.560  119.261 1.00 37.31  ? 91  VAL C CG2 1 
ATOM   3484  N N   . PRO C  1 68  ? -2.272  19.089  117.775 1.00 33.64  ? 92  PRO C N   1 
ATOM   3485  C CA  . PRO C  1 68  ? -3.305  18.060  117.576 1.00 33.69  ? 92  PRO C CA  1 
ATOM   3486  C C   . PRO C  1 68  ? -2.747  16.837  116.915 1.00 32.68  ? 92  PRO C C   1 
ATOM   3487  O O   . PRO C  1 68  ? -3.073  16.563  115.804 1.00 34.60  ? 92  PRO C O   1 
ATOM   3488  C CB  . PRO C  1 68  ? -4.358  18.775  116.684 1.00 33.57  ? 92  PRO C CB  1 
ATOM   3489  C CG  . PRO C  1 68  ? -3.575  19.743  115.916 1.00 34.15  ? 92  PRO C CG  1 
ATOM   3490  C CD  . PRO C  1 68  ? -2.438  20.197  116.812 1.00 33.64  ? 92  PRO C CD  1 
ATOM   3491  N N   . PHE C  1 69  ? -1.874  16.117  117.590 1.00 33.39  ? 93  PHE C N   1 
ATOM   3492  C CA  . PHE C  1 69  ? -1.349  14.843  117.090 1.00 33.56  ? 93  PHE C CA  1 
ATOM   3493  C C   . PHE C  1 69  ? -1.530  13.794  118.154 1.00 33.31  ? 93  PHE C C   1 
ATOM   3494  O O   . PHE C  1 69  ? -1.563  14.101  119.339 1.00 31.27  ? 93  PHE C O   1 
ATOM   3495  C CB  . PHE C  1 69  ? 0.127   14.956  116.713 1.00 33.71  ? 93  PHE C CB  1 
ATOM   3496  C CG  . PHE C  1 69  ? 0.372   15.801  115.490 1.00 34.75  ? 93  PHE C CG  1 
ATOM   3497  C CD1 . PHE C  1 69  ? 0.347   17.193  115.563 1.00 34.59  ? 93  PHE C CD1 1 
ATOM   3498  C CD2 . PHE C  1 69  ? 0.621   15.208  114.258 1.00 36.04  ? 93  PHE C CD2 1 
ATOM   3499  C CE1 . PHE C  1 69  ? 0.564   17.974  114.451 1.00 35.14  ? 93  PHE C CE1 1 
ATOM   3500  C CE2 . PHE C  1 69  ? 0.860   15.998  113.130 1.00 36.38  ? 93  PHE C CE2 1 
ATOM   3501  C CZ  . PHE C  1 69  ? 0.838   17.391  113.237 1.00 35.57  ? 93  PHE C CZ  1 
ATOM   3502  N N   . GLU C  1 70  ? -1.641  12.549  117.703 1.00 35.04  ? 94  GLU C N   1 
ATOM   3503  C CA  . GLU C  1 70  ? -1.886  11.421  118.598 1.00 35.97  ? 94  GLU C CA  1 
ATOM   3504  C C   . GLU C  1 70  ? -0.611  10.829  119.233 1.00 32.79  ? 94  GLU C C   1 
ATOM   3505  O O   . GLU C  1 70  ? -0.652  10.346  120.380 1.00 30.69  ? 94  GLU C O   1 
ATOM   3506  C CB  . GLU C  1 70  ? -2.675  10.322  117.880 1.00 38.77  ? 94  GLU C CB  1 
ATOM   3507  C CG  . GLU C  1 70  ? -3.057  9.169   118.817 1.00 42.22  ? 94  GLU C CG  1 
ATOM   3508  C CD  . GLU C  1 70  ? -4.176  9.508   119.804 1.00 44.90  ? 94  GLU C CD  1 
ATOM   3509  O OE1 . GLU C  1 70  ? -4.074  9.211   121.035 1.00 42.77  ? 94  GLU C OE1 1 
ATOM   3510  O OE2 . GLU C  1 70  ? -5.182  10.052  119.305 1.00 49.31  ? 94  GLU C OE2 1 
ATOM   3511  N N   . TYR C  1 71  ? 0.487   10.833  118.476 1.00 30.77  ? 95  TYR C N   1 
ATOM   3512  C CA  . TYR C  1 71  ? 1.724   10.167  118.893 1.00 29.53  ? 95  TYR C CA  1 
ATOM   3513  C C   . TYR C  1 71  ? 2.892   11.158  118.853 1.00 29.52  ? 95  TYR C C   1 
ATOM   3514  O O   . TYR C  1 71  ? 2.897   12.101  118.068 1.00 28.37  ? 95  TYR C O   1 
ATOM   3515  C CB  . TYR C  1 71  ? 2.080   8.942   117.993 1.00 28.64  ? 95  TYR C CB  1 
ATOM   3516  C CG  . TYR C  1 71  ? 0.957   8.095   117.426 1.00 27.74  ? 95  TYR C CG  1 
ATOM   3517  C CD1 . TYR C  1 71  ? 0.027   7.487   118.258 1.00 27.82  ? 95  TYR C CD1 1 
ATOM   3518  C CD2 . TYR C  1 71  ? 0.846   7.869   116.048 1.00 26.72  ? 95  TYR C CD2 1 
ATOM   3519  C CE1 . TYR C  1 71  ? -0.993  6.707   117.717 1.00 27.99  ? 95  TYR C CE1 1 
ATOM   3520  C CE2 . TYR C  1 71  ? -0.162  7.096   115.499 1.00 26.14  ? 95  TYR C CE2 1 
ATOM   3521  C CZ  . TYR C  1 71  ? -1.098  6.512   116.321 1.00 27.29  ? 95  TYR C CZ  1 
ATOM   3522  O OH  . TYR C  1 71  ? -2.168  5.706   115.827 1.00 27.18  ? 95  TYR C OH  1 
ATOM   3523  N N   . TYR C  1 72  ? 3.898   10.906  119.686 1.00 30.64  ? 96  TYR C N   1 
ATOM   3524  C CA  . TYR C  1 72  ? 5.183   11.598  119.574 1.00 30.80  ? 96  TYR C CA  1 
ATOM   3525  C C   . TYR C  1 72  ? 6.375   10.754  119.995 1.00 32.50  ? 96  TYR C C   1 
ATOM   3526  O O   . TYR C  1 72  ? 6.250   9.678   120.630 1.00 34.21  ? 96  TYR C O   1 
ATOM   3527  C CB  . TYR C  1 72  ? 5.182   12.825  120.459 1.00 29.58  ? 96  TYR C CB  1 
ATOM   3528  C CG  . TYR C  1 72  ? 5.397   12.494  121.935 1.00 28.92  ? 96  TYR C CG  1 
ATOM   3529  C CD1 . TYR C  1 72  ? 4.351   11.973  122.736 1.00 28.22  ? 96  TYR C CD1 1 
ATOM   3530  C CD2 . TYR C  1 72  ? 6.651   12.704  122.536 1.00 27.89  ? 96  TYR C CD2 1 
ATOM   3531  C CE1 . TYR C  1 72  ? 4.565   11.705  124.093 1.00 27.84  ? 96  TYR C CE1 1 
ATOM   3532  C CE2 . TYR C  1 72  ? 6.865   12.447  123.889 1.00 27.16  ? 96  TYR C CE2 1 
ATOM   3533  C CZ  . TYR C  1 72  ? 5.840   11.943  124.667 1.00 26.95  ? 96  TYR C CZ  1 
ATOM   3534  O OH  . TYR C  1 72  ? 6.109   11.663  125.979 1.00 25.33  ? 96  TYR C OH  1 
ATOM   3535  N N   . ARG C  1 73  ? 7.538   11.293  119.667 1.00 33.07  ? 97  ARG C N   1 
ATOM   3536  C CA  . ARG C  1 73  ? 8.777   10.853  120.250 1.00 33.79  ? 97  ARG C CA  1 
ATOM   3537  C C   . ARG C  1 73  ? 9.815   11.947  120.197 1.00 34.65  ? 97  ARG C C   1 
ATOM   3538  O O   . ARG C  1 73  ? 9.785   12.867  119.329 1.00 34.24  ? 97  ARG C O   1 
ATOM   3539  C CB  . ARG C  1 73  ? 9.277   9.592   119.558 1.00 35.19  ? 97  ARG C CB  1 
ATOM   3540  C CG  . ARG C  1 73  ? 9.677   9.725   118.108 1.00 35.77  ? 97  ARG C CG  1 
ATOM   3541  C CD  . ARG C  1 73  ? 9.782   8.369   117.447 1.00 36.36  ? 97  ARG C CD  1 
ATOM   3542  N NE  . ARG C  1 73  ? 9.992   8.579   116.014 1.00 38.10  ? 97  ARG C NE  1 
ATOM   3543  C CZ  . ARG C  1 73  ? 10.126  7.630   115.082 1.00 36.03  ? 97  ARG C CZ  1 
ATOM   3544  N NH1 . ARG C  1 73  ? 10.346  7.965   113.844 1.00 33.92  ? 97  ARG C NH1 1 
ATOM   3545  N NH2 . ARG C  1 73  ? 10.065  6.357   115.385 1.00 37.23  ? 97  ARG C NH2 1 
ATOM   3546  N N   . ILE C  1 74  ? 10.757  11.845  121.121 1.00 35.43  ? 98  ILE C N   1 
ATOM   3547  C CA  . ILE C  1 74  ? 11.678  12.943  121.390 1.00 35.73  ? 98  ILE C CA  1 
ATOM   3548  C C   . ILE C  1 74  ? 12.938  12.523  120.770 1.00 36.73  ? 98  ILE C C   1 
ATOM   3549  O O   . ILE C  1 74  ? 13.590  11.606  121.241 1.00 40.35  ? 98  ILE C O   1 
ATOM   3550  C CB  . ILE C  1 74  ? 11.822  13.214  122.890 1.00 35.13  ? 98  ILE C CB  1 
ATOM   3551  C CG1 . ILE C  1 74  ? 10.453  13.721  123.357 1.00 35.93  ? 98  ILE C CG1 1 
ATOM   3552  C CG2 . ILE C  1 74  ? 12.964  14.205  123.140 1.00 34.54  ? 98  ILE C CG2 1 
ATOM   3553  C CD1 . ILE C  1 74  ? 10.236  13.855  124.845 1.00 37.57  ? 98  ILE C CD1 1 
ATOM   3554  N N   . ARG C  1 75  ? 13.234  13.179  119.666 1.00 39.66  ? 99  ARG C N   1 
ATOM   3555  C CA  . ARG C  1 75  ? 14.405  12.890  118.834 1.00 39.61  ? 99  ARG C CA  1 
ATOM   3556  C C   . ARG C  1 75  ? 15.733  13.209  119.508 1.00 35.96  ? 99  ARG C C   1 
ATOM   3557  O O   . ARG C  1 75  ? 16.595  12.373  119.540 1.00 33.63  ? 99  ARG C O   1 
ATOM   3558  C CB  . ARG C  1 75  ? 14.275  13.677  117.540 1.00 42.12  ? 99  ARG C CB  1 
ATOM   3559  C CG  . ARG C  1 75  ? 14.325  12.774  116.353 1.00 47.60  ? 99  ARG C CG  1 
ATOM   3560  C CD  . ARG C  1 75  ? 13.023  12.039  116.258 1.00 52.50  ? 99  ARG C CD  1 
ATOM   3561  N NE  . ARG C  1 75  ? 13.281  10.645  115.963 1.00 58.83  ? 99  ARG C NE  1 
ATOM   3562  C CZ  . ARG C  1 75  ? 13.613  10.173  114.768 1.00 60.95  ? 99  ARG C CZ  1 
ATOM   3563  N NH1 . ARG C  1 75  ? 13.787  8.865   114.645 1.00 60.06  ? 99  ARG C NH1 1 
ATOM   3564  N NH2 . ARG C  1 75  ? 13.745  10.995  113.701 1.00 61.89  ? 99  ARG C NH2 1 
ATOM   3565  N N   . LYS C  1 76  ? 15.818  14.415  120.068 1.00 35.50  ? 100 LYS C N   1 
ATOM   3566  C CA  . LYS C  1 76  ? 17.010  15.023  120.695 1.00 36.00  ? 100 LYS C CA  1 
ATOM   3567  C C   . LYS C  1 76  ? 16.610  15.945  121.861 1.00 35.36  ? 100 LYS C C   1 
ATOM   3568  O O   . LYS C  1 76  ? 15.522  16.494  121.827 1.00 39.19  ? 100 LYS C O   1 
ATOM   3569  C CB  . LYS C  1 76  ? 17.658  15.894  119.611 1.00 37.36  ? 100 LYS C CB  1 
ATOM   3570  C CG  . LYS C  1 76  ? 18.812  15.340  118.756 1.00 37.91  ? 100 LYS C CG  1 
ATOM   3571  C CD  . LYS C  1 76  ? 19.071  13.833  118.780 1.00 39.31  ? 100 LYS C CD  1 
ATOM   3572  C CE  . LYS C  1 76  ? 20.563  13.513  118.879 1.00 40.13  ? 100 LYS C CE  1 
ATOM   3573  N NZ  . LYS C  1 76  ? 20.948  12.226  118.246 1.00 39.39  ? 100 LYS C NZ  1 
ATOM   3574  N N   . VAL C  1 77  ? 17.419  16.137  122.890 1.00 33.68  ? 101 VAL C N   1 
ATOM   3575  C CA  . VAL C  1 77  ? 17.205  17.276  123.772 1.00 33.91  ? 101 VAL C CA  1 
ATOM   3576  C C   . VAL C  1 77  ? 18.435  18.136  123.688 1.00 34.51  ? 101 VAL C C   1 
ATOM   3577  O O   . VAL C  1 77  ? 19.543  17.603  123.651 1.00 33.66  ? 101 VAL C O   1 
ATOM   3578  C CB  . VAL C  1 77  ? 17.177  16.948  125.241 1.00 36.49  ? 101 VAL C CB  1 
ATOM   3579  C CG1 . VAL C  1 77  ? 16.434  18.017  126.011 1.00 37.67  ? 101 VAL C CG1 1 
ATOM   3580  C CG2 . VAL C  1 77  ? 16.417  15.744  125.462 1.00 40.64  ? 101 VAL C CG2 1 
ATOM   3581  N N   . LYS C  1 78  ? 18.261  19.459  123.704 1.00 33.89  ? 102 LYS C N   1 
ATOM   3582  C CA  . LYS C  1 78  ? 19.378  20.338  123.916 1.00 34.99  ? 102 LYS C CA  1 
ATOM   3583  C C   . LYS C  1 78  ? 19.153  20.964  125.236 1.00 33.64  ? 102 LYS C C   1 
ATOM   3584  O O   . LYS C  1 78  ? 18.155  21.574  125.397 1.00 35.50  ? 102 LYS C O   1 
ATOM   3585  C CB  . LYS C  1 78  ? 19.465  21.388  122.818 1.00 37.17  ? 102 LYS C CB  1 
ATOM   3586  C CG  . LYS C  1 78  ? 20.669  22.329  122.872 1.00 37.95  ? 102 LYS C CG  1 
ATOM   3587  C CD  . LYS C  1 78  ? 21.325  22.514  121.506 1.00 40.56  ? 102 LYS C CD  1 
ATOM   3588  C CE  . LYS C  1 78  ? 21.524  23.975  121.058 1.00 44.91  ? 102 LYS C CE  1 
ATOM   3589  N NZ  . LYS C  1 78  ? 20.304  24.736  120.510 1.00 46.30  ? 102 LYS C NZ  1 
ATOM   3590  N N   . VAL C  1 79  ? 20.056  20.749  126.185 1.00 32.74  ? 103 VAL C N   1 
ATOM   3591  C CA  . VAL C  1 79  ? 20.091  21.440  127.458 1.00 31.53  ? 103 VAL C CA  1 
ATOM   3592  C C   . VAL C  1 79  ? 21.178  22.534  127.387 1.00 31.52  ? 103 VAL C C   1 
ATOM   3593  O O   . VAL C  1 79  ? 22.351  22.245  127.161 1.00 29.52  ? 103 VAL C O   1 
ATOM   3594  C CB  . VAL C  1 79  ? 20.391  20.421  128.570 1.00 32.21  ? 103 VAL C CB  1 
ATOM   3595  C CG1 . VAL C  1 79  ? 20.478  21.102  129.921 1.00 32.33  ? 103 VAL C CG1 1 
ATOM   3596  C CG2 . VAL C  1 79  ? 19.305  19.332  128.627 1.00 32.13  ? 103 VAL C CG2 1 
ATOM   3597  N N   . GLU C  1 80  ? 20.779  23.791  127.554 1.00 32.68  ? 104 GLU C N   1 
ATOM   3598  C CA  . GLU C  1 80  ? 21.696  24.940  127.511 1.00 33.96  ? 104 GLU C CA  1 
ATOM   3599  C C   . GLU C  1 80  ? 21.710  25.688  128.897 1.00 35.01  ? 104 GLU C C   1 
ATOM   3600  O O   . GLU C  1 80  ? 20.657  26.208  129.343 1.00 34.84  ? 104 GLU C O   1 
ATOM   3601  C CB  . GLU C  1 80  ? 21.268  25.934  126.434 1.00 34.79  ? 104 GLU C CB  1 
ATOM   3602  C CG  . GLU C  1 80  ? 21.181  25.423  125.021 1.00 36.08  ? 104 GLU C CG  1 
ATOM   3603  C CD  . GLU C  1 80  ? 20.680  26.486  124.035 1.00 38.76  ? 104 GLU C CD  1 
ATOM   3604  O OE1 . GLU C  1 80  ? 19.456  26.858  124.049 1.00 39.47  ? 104 GLU C OE1 1 
ATOM   3605  O OE2 . GLU C  1 80  ? 21.535  26.986  123.233 1.00 41.26  ? 104 GLU C OE2 1 
ATOM   3606  N N   . PHE C  1 81  ? 22.888  25.745  129.537 1.00 34.25  ? 105 PHE C N   1 
ATOM   3607  C CA  . PHE C  1 81  ? 23.108  26.513  130.735 1.00 35.20  ? 105 PHE C CA  1 
ATOM   3608  C C   . PHE C  1 81  ? 23.640  27.897  130.369 1.00 36.02  ? 105 PHE C C   1 
ATOM   3609  O O   . PHE C  1 81  ? 24.816  28.050  130.095 1.00 36.30  ? 105 PHE C O   1 
ATOM   3610  C CB  . PHE C  1 81  ? 24.115  25.833  131.650 1.00 35.96  ? 105 PHE C CB  1 
ATOM   3611  C CG  . PHE C  1 81  ? 23.660  24.522  132.174 1.00 37.91  ? 105 PHE C CG  1 
ATOM   3612  C CD1 . PHE C  1 81  ? 23.773  23.362  131.397 1.00 38.44  ? 105 PHE C CD1 1 
ATOM   3613  C CD2 . PHE C  1 81  ? 23.113  24.419  133.468 1.00 38.76  ? 105 PHE C CD2 1 
ATOM   3614  C CE1 . PHE C  1 81  ? 23.333  22.127  131.917 1.00 39.54  ? 105 PHE C CE1 1 
ATOM   3615  C CE2 . PHE C  1 81  ? 22.684  23.181  133.993 1.00 38.99  ? 105 PHE C CE2 1 
ATOM   3616  C CZ  . PHE C  1 81  ? 22.795  22.033  133.220 1.00 38.24  ? 105 PHE C CZ  1 
ATOM   3617  N N   . TRP C  1 82  ? 22.770  28.907  130.364 1.00 35.56  ? 106 TRP C N   1 
ATOM   3618  C CA  . TRP C  1 82  ? 23.177  30.220  130.027 1.00 33.09  ? 106 TRP C CA  1 
ATOM   3619  C C   . TRP C  1 82  ? 23.539  30.842  131.342 1.00 33.11  ? 106 TRP C C   1 
ATOM   3620  O O   . TRP C  1 82  ? 22.701  31.081  132.142 1.00 32.15  ? 106 TRP C O   1 
ATOM   3621  C CB  . TRP C  1 82  ? 22.062  30.973  129.387 1.00 33.19  ? 106 TRP C CB  1 
ATOM   3622  C CG  . TRP C  1 82  ? 21.627  30.425  128.051 1.00 33.50  ? 106 TRP C CG  1 
ATOM   3623  C CD1 . TRP C  1 82  ? 20.628  29.528  127.822 1.00 33.46  ? 106 TRP C CD1 1 
ATOM   3624  C CD2 . TRP C  1 82  ? 22.107  30.803  126.763 1.00 33.84  ? 106 TRP C CD2 1 
ATOM   3625  N NE1 . TRP C  1 82  ? 20.484  29.290  126.489 1.00 32.66  ? 106 TRP C NE1 1 
ATOM   3626  C CE2 . TRP C  1 82  ? 21.385  30.056  125.811 1.00 33.69  ? 106 TRP C CE2 1 
ATOM   3627  C CE3 . TRP C  1 82  ? 23.080  31.680  126.319 1.00 33.42  ? 106 TRP C CE3 1 
ATOM   3628  C CZ2 . TRP C  1 82  ? 21.628  30.160  124.445 1.00 33.58  ? 106 TRP C CZ2 1 
ATOM   3629  C CZ3 . TRP C  1 82  ? 23.318  31.773  124.971 1.00 33.71  ? 106 TRP C CZ3 1 
ATOM   3630  C CH2 . TRP C  1 82  ? 22.591  31.035  124.050 1.00 33.36  ? 106 TRP C CH2 1 
ATOM   3631  N N   . PRO C  1 83  ? 24.823  31.107  131.565 1.00 34.90  ? 107 PRO C N   1 
ATOM   3632  C CA  . PRO C  1 83  ? 25.220  31.744  132.796 1.00 35.59  ? 107 PRO C CA  1 
ATOM   3633  C C   . PRO C  1 83  ? 24.744  33.223  132.960 1.00 35.49  ? 107 PRO C C   1 
ATOM   3634  O O   . PRO C  1 83  ? 24.693  34.022  131.998 1.00 33.76  ? 107 PRO C O   1 
ATOM   3635  C CB  . PRO C  1 83  ? 26.749  31.652  132.717 1.00 35.64  ? 107 PRO C CB  1 
ATOM   3636  C CG  . PRO C  1 83  ? 27.028  31.872  131.280 1.00 34.56  ? 107 PRO C CG  1 
ATOM   3637  C CD  . PRO C  1 83  ? 25.937  31.121  130.584 1.00 35.03  ? 107 PRO C CD  1 
ATOM   3638  N N   . CYS C  1 84  ? 24.404  33.525  134.206 1.00 36.65  ? 108 CYS C N   1 
ATOM   3639  C CA  . CYS C  1 84  ? 24.036  34.868  134.661 1.00 38.14  ? 108 CYS C CA  1 
ATOM   3640  C C   . CYS C  1 84  ? 25.220  35.691  135.097 1.00 37.65  ? 108 CYS C C   1 
ATOM   3641  O O   . CYS C  1 84  ? 25.197  36.902  134.918 1.00 37.47  ? 108 CYS C O   1 
ATOM   3642  C CB  . CYS C  1 84  ? 23.018  34.814  135.811 1.00 38.65  ? 108 CYS C CB  1 
ATOM   3643  S SG  . CYS C  1 84  ? 21.482  34.011  135.294 1.00 41.89  ? 108 CYS C SG  1 
ATOM   3644  N N   . SER C  1 85  ? 26.238  35.040  135.653 1.00 38.09  ? 109 SER C N   1 
ATOM   3645  C CA  . SER C  1 85  ? 27.368  35.728  136.248 1.00 38.68  ? 109 SER C CA  1 
ATOM   3646  C C   . SER C  1 85  ? 28.187  36.492  135.210 1.00 40.40  ? 109 SER C C   1 
ATOM   3647  O O   . SER C  1 85  ? 28.445  36.013  134.098 1.00 41.48  ? 109 SER C O   1 
ATOM   3648  C CB  . SER C  1 85  ? 28.236  34.727  136.990 1.00 39.02  ? 109 SER C CB  1 
ATOM   3649  O OG  . SER C  1 85  ? 27.502  34.093  138.054 1.00 40.38  ? 109 SER C OG  1 
ATOM   3650  N N   . PRO C  1 86  ? 28.611  37.695  135.564 1.00 41.97  ? 110 PRO C N   1 
ATOM   3651  C CA  . PRO C  1 86  ? 29.389  38.458  134.612 1.00 43.31  ? 110 PRO C CA  1 
ATOM   3652  C C   . PRO C  1 86  ? 30.754  37.839  134.403 1.00 44.28  ? 110 PRO C C   1 
ATOM   3653  O O   . PRO C  1 86  ? 31.246  37.095  135.270 1.00 41.02  ? 110 PRO C O   1 
ATOM   3654  C CB  . PRO C  1 86  ? 29.540  39.791  135.315 1.00 43.65  ? 110 PRO C CB  1 
ATOM   3655  C CG  . PRO C  1 86  ? 29.610  39.424  136.778 1.00 43.09  ? 110 PRO C CG  1 
ATOM   3656  C CD  . PRO C  1 86  ? 28.627  38.302  136.909 1.00 42.93  ? 110 PRO C CD  1 
ATOM   3657  N N   . ILE C  1 87  ? 31.402  38.205  133.302 1.00 48.16  ? 111 ILE C N   1 
ATOM   3658  C CA  . ILE C  1 87  ? 32.745  37.664  133.035 1.00 50.06  ? 111 ILE C CA  1 
ATOM   3659  C C   . ILE C  1 87  ? 33.809  38.232  133.943 1.00 49.57  ? 111 ILE C C   1 
ATOM   3660  O O   . ILE C  1 87  ? 34.954  37.834  133.846 1.00 53.37  ? 111 ILE C O   1 
ATOM   3661  C CB  . ILE C  1 87  ? 33.177  37.862  131.592 1.00 54.90  ? 111 ILE C CB  1 
ATOM   3662  C CG1 . ILE C  1 87  ? 33.560  39.337  131.361 1.00 59.83  ? 111 ILE C CG1 1 
ATOM   3663  C CG2 . ILE C  1 87  ? 32.093  37.366  130.600 1.00 56.86  ? 111 ILE C CG2 1 
ATOM   3664  C CD1 . ILE C  1 87  ? 33.668  39.686  129.880 1.00 61.53  ? 111 ILE C CD1 1 
ATOM   3665  N N   . THR C  1 88  ? 33.421  39.125  134.846 1.00 50.72  ? 112 THR C N   1 
ATOM   3666  C CA  . THR C  1 88  ? 34.308  39.709  135.866 1.00 52.84  ? 112 THR C CA  1 
ATOM   3667  C C   . THR C  1 88  ? 34.445  38.960  137.194 1.00 52.66  ? 112 THR C C   1 
ATOM   3668  O O   . THR C  1 88  ? 35.217  39.382  138.064 1.00 58.42  ? 112 THR C O   1 
ATOM   3669  C CB  . THR C  1 88  ? 33.836  41.157  136.224 1.00 54.65  ? 112 THR C CB  1 
ATOM   3670  O OG1 . THR C  1 88  ? 32.647  41.163  137.069 1.00 54.50  ? 112 THR C OG1 1 
ATOM   3671  C CG2 . THR C  1 88  ? 33.573  41.916  134.956 1.00 55.07  ? 112 THR C CG2 1 
ATOM   3672  N N   . GLN C  1 89  ? 33.653  37.911  137.375 1.00 49.61  ? 113 GLN C N   1 
ATOM   3673  C CA  . GLN C  1 89  ? 33.532  37.192  138.659 1.00 46.25  ? 113 GLN C CA  1 
ATOM   3674  C C   . GLN C  1 89  ? 34.583  36.104  138.819 1.00 44.72  ? 113 GLN C C   1 
ATOM   3675  O O   . GLN C  1 89  ? 34.880  35.334  137.876 1.00 46.24  ? 113 GLN C O   1 
ATOM   3676  C CB  . GLN C  1 89  ? 32.185  36.492  138.707 1.00 43.73  ? 113 GLN C CB  1 
ATOM   3677  C CG  . GLN C  1 89  ? 31.987  35.611  139.905 1.00 41.98  ? 113 GLN C CG  1 
ATOM   3678  C CD  . GLN C  1 89  ? 30.535  35.360  140.118 1.00 41.77  ? 113 GLN C CD  1 
ATOM   3679  O OE1 . GLN C  1 89  ? 29.736  36.260  139.909 1.00 41.76  ? 113 GLN C OE1 1 
ATOM   3680  N NE2 . GLN C  1 89  ? 30.167  34.128  140.516 1.00 44.46  ? 113 GLN C NE2 1 
ATOM   3681  N N   . GLY C  1 90  ? 35.064  35.995  140.040 1.00 41.45  ? 114 GLY C N   1 
ATOM   3682  C CA  . GLY C  1 90  ? 36.170  35.147  140.360 1.00 40.60  ? 114 GLY C CA  1 
ATOM   3683  C C   . GLY C  1 90  ? 35.708  33.874  140.989 1.00 40.60  ? 114 GLY C C   1 
ATOM   3684  O O   . GLY C  1 90  ? 34.584  33.403  140.769 1.00 41.80  ? 114 GLY C O   1 
ATOM   3685  N N   . ASP C  1 91  ? 36.584  33.341  141.821 1.00 41.19  ? 115 ASP C N   1 
ATOM   3686  C CA  . ASP C  1 91  ? 36.467  31.980  142.353 1.00 41.47  ? 115 ASP C CA  1 
ATOM   3687  C C   . ASP C  1 91  ? 35.935  30.965  141.355 1.00 41.61  ? 115 ASP C C   1 
ATOM   3688  O O   . ASP C  1 91  ? 35.050  30.190  141.658 1.00 44.25  ? 115 ASP C O   1 
ATOM   3689  C CB  . ASP C  1 91  ? 35.608  31.943  143.604 1.00 40.75  ? 115 ASP C CB  1 
ATOM   3690  C CG  . ASP C  1 91  ? 35.920  30.743  144.455 1.00 41.04  ? 115 ASP C CG  1 
ATOM   3691  O OD1 . ASP C  1 91  ? 36.987  30.132  144.248 1.00 40.66  ? 115 ASP C OD1 1 
ATOM   3692  O OD2 . ASP C  1 91  ? 35.114  30.402  145.324 1.00 42.80  ? 115 ASP C OD2 1 
ATOM   3693  N N   . ARG C  1 92  ? 36.489  31.000  140.160 1.00 40.20  ? 116 ARG C N   1 
ATOM   3694  C CA  . ARG C  1 92  ? 36.048  30.174  139.067 1.00 39.52  ? 116 ARG C CA  1 
ATOM   3695  C C   . ARG C  1 92  ? 36.375  28.729  139.282 1.00 39.93  ? 116 ARG C C   1 
ATOM   3696  O O   . ARG C  1 92  ? 37.404  28.384  139.849 1.00 38.73  ? 116 ARG C O   1 
ATOM   3697  C CB  . ARG C  1 92  ? 36.767  30.529  137.791 1.00 39.96  ? 116 ARG C CB  1 
ATOM   3698  C CG  . ARG C  1 92  ? 36.704  31.980  137.363 1.00 40.57  ? 116 ARG C CG  1 
ATOM   3699  C CD  . ARG C  1 92  ? 36.914  31.916  135.892 1.00 40.34  ? 116 ARG C CD  1 
ATOM   3700  N NE  . ARG C  1 92  ? 38.155  32.480  135.526 1.00 40.74  ? 116 ARG C NE  1 
ATOM   3701  C CZ  . ARG C  1 92  ? 38.763  32.227  134.392 1.00 40.03  ? 116 ARG C CZ  1 
ATOM   3702  N NH1 . ARG C  1 92  ? 39.933  32.838  134.164 1.00 40.40  ? 116 ARG C NH1 1 
ATOM   3703  N NH2 . ARG C  1 92  ? 38.216  31.388  133.513 1.00 37.90  ? 116 ARG C NH2 1 
ATOM   3704  N N   . GLY C  1 93  ? 35.514  27.892  138.718 1.00 41.93  ? 117 GLY C N   1 
ATOM   3705  C CA  . GLY C  1 93  ? 35.459  26.480  139.038 1.00 41.21  ? 117 GLY C CA  1 
ATOM   3706  C C   . GLY C  1 93  ? 35.242  25.598  137.846 1.00 39.83  ? 117 GLY C C   1 
ATOM   3707  O O   . GLY C  1 93  ? 35.064  26.054  136.707 1.00 39.65  ? 117 GLY C O   1 
ATOM   3708  N N   . VAL C  1 94  ? 35.237  24.313  138.121 1.00 38.16  ? 118 VAL C N   1 
ATOM   3709  C CA  . VAL C  1 94  ? 35.179  23.374  137.060 1.00 37.98  ? 118 VAL C CA  1 
ATOM   3710  C C   . VAL C  1 94  ? 34.388  22.181  137.521 1.00 36.45  ? 118 VAL C C   1 
ATOM   3711  O O   . VAL C  1 94  ? 34.577  21.724  138.626 1.00 35.04  ? 118 VAL C O   1 
ATOM   3712  C CB  . VAL C  1 94  ? 36.570  23.018  136.565 1.00 38.16  ? 118 VAL C CB  1 
ATOM   3713  C CG1 . VAL C  1 94  ? 37.427  22.560  137.716 1.00 41.78  ? 118 VAL C CG1 1 
ATOM   3714  C CG2 . VAL C  1 94  ? 36.476  21.885  135.580 1.00 38.36  ? 118 VAL C CG2 1 
ATOM   3715  N N   . GLY C  1 95  ? 33.511  21.701  136.639 1.00 35.82  ? 119 GLY C N   1 
ATOM   3716  C CA  . GLY C  1 95  ? 32.509  20.675  136.956 1.00 35.73  ? 119 GLY C CA  1 
ATOM   3717  C C   . GLY C  1 95  ? 32.193  19.751  135.801 1.00 35.07  ? 119 GLY C C   1 
ATOM   3718  O O   . GLY C  1 95  ? 33.018  19.540  134.903 1.00 38.42  ? 119 GLY C O   1 
ATOM   3719  N N   . SER C  1 96  ? 31.008  19.186  135.801 1.00 33.30  ? 120 SER C N   1 
ATOM   3720  C CA  . SER C  1 96  ? 30.780  18.031  134.957 1.00 33.04  ? 120 SER C CA  1 
ATOM   3721  C C   . SER C  1 96  ? 29.298  17.846  134.669 1.00 31.30  ? 120 SER C C   1 
ATOM   3722  O O   . SER C  1 96  ? 28.488  17.850  135.583 1.00 31.77  ? 120 SER C O   1 
ATOM   3723  C CB  . SER C  1 96  ? 31.340  16.732  135.679 1.00 34.13  ? 120 SER C CB  1 
ATOM   3724  O OG  . SER C  1 96  ? 32.749  16.417  135.484 1.00 32.29  ? 120 SER C OG  1 
ATOM   3725  N N   . SER C  1 97  ? 28.939  17.705  133.407 1.00 30.26  ? 121 SER C N   1 
ATOM   3726  C CA  . SER C  1 97  ? 27.636  17.097  133.042 1.00 29.88  ? 121 SER C CA  1 
ATOM   3727  C C   . SER C  1 97  ? 27.831  15.697  132.506 1.00 29.27  ? 121 SER C C   1 
ATOM   3728  O O   . SER C  1 97  ? 28.849  15.394  131.836 1.00 29.28  ? 121 SER C O   1 
ATOM   3729  C CB  . SER C  1 97  ? 26.869  17.928  131.999 1.00 29.85  ? 121 SER C CB  1 
ATOM   3730  O OG  . SER C  1 97  ? 27.545  18.031  130.747 1.00 29.13  ? 121 SER C OG  1 
ATOM   3731  N N   . ALA C  1 98  ? 26.877  14.824  132.795 1.00 28.86  ? 122 ALA C N   1 
ATOM   3732  C CA  . ALA C  1 98  ? 26.890  13.486  132.165 1.00 28.27  ? 122 ALA C CA  1 
ATOM   3733  C C   . ALA C  1 98  ? 25.507  13.109  131.749 1.00 27.73  ? 122 ALA C C   1 
ATOM   3734  O O   . ALA C  1 98  ? 24.515  13.541  132.350 1.00 28.99  ? 122 ALA C O   1 
ATOM   3735  C CB  . ALA C  1 98  ? 27.449  12.448  133.101 1.00 28.02  ? 122 ALA C CB  1 
ATOM   3736  N N   . VAL C  1 99  ? 25.447  12.344  130.685 1.00 27.69  ? 123 VAL C N   1 
ATOM   3737  C CA  . VAL C  1 99  ? 24.203  11.837  130.137 1.00 28.01  ? 123 VAL C CA  1 
ATOM   3738  C C   . VAL C  1 99  ? 23.873  10.544  130.847 1.00 28.90  ? 123 VAL C C   1 
ATOM   3739  O O   . VAL C  1 99  ? 24.690  9.586   130.828 1.00 33.40  ? 123 VAL C O   1 
ATOM   3740  C CB  . VAL C  1 99  ? 24.314  11.579  128.639 1.00 27.51  ? 123 VAL C CB  1 
ATOM   3741  C CG1 . VAL C  1 99  ? 23.024  10.996  128.080 1.00 28.05  ? 123 VAL C CG1 1 
ATOM   3742  C CG2 . VAL C  1 99  ? 24.603  12.876  127.929 1.00 27.69  ? 123 VAL C CG2 1 
ATOM   3743  N N   . ILE C  1 100 ? 22.698  10.529  131.455 1.00 28.21  ? 124 ILE C N   1 
ATOM   3744  C CA  . ILE C  1 100 ? 22.196  9.453   132.223 1.00 29.56  ? 124 ILE C CA  1 
ATOM   3745  C C   . ILE C  1 100 ? 20.934  8.918   131.567 1.00 30.40  ? 124 ILE C C   1 
ATOM   3746  O O   . ILE C  1 100 ? 19.855  9.410   131.786 1.00 31.51  ? 124 ILE C O   1 
ATOM   3747  C CB  . ILE C  1 100 ? 21.839  9.955   133.618 1.00 30.60  ? 124 ILE C CB  1 
ATOM   3748  C CG1 . ILE C  1 100 ? 23.073  10.573  134.279 1.00 32.28  ? 124 ILE C CG1 1 
ATOM   3749  C CG2 . ILE C  1 100 ? 21.281  8.812   134.443 1.00 30.35  ? 124 ILE C CG2 1 
ATOM   3750  C CD1 . ILE C  1 100 ? 24.300  9.619   134.302 1.00 32.90  ? 124 ILE C CD1 1 
ATOM   3751  N N   . LEU C  1 101 ? 21.064  7.854   130.804 1.00 31.35  ? 125 LEU C N   1 
ATOM   3752  C CA  . LEU C  1 101 ? 19.939  7.334   130.061 1.00 31.73  ? 125 LEU C CA  1 
ATOM   3753  C C   . LEU C  1 101 ? 19.033  6.323   130.823 1.00 31.69  ? 125 LEU C C   1 
ATOM   3754  O O   . LEU C  1 101 ? 18.018  5.871   130.243 1.00 30.18  ? 125 LEU C O   1 
ATOM   3755  C CB  . LEU C  1 101 ? 20.456  6.713   128.777 1.00 31.79  ? 125 LEU C CB  1 
ATOM   3756  C CG  . LEU C  1 101 ? 21.295  7.685   127.951 1.00 32.96  ? 125 LEU C CG  1 
ATOM   3757  C CD1 . LEU C  1 101 ? 22.076  6.920   126.869 1.00 34.50  ? 125 LEU C CD1 1 
ATOM   3758  C CD2 . LEU C  1 101 ? 20.506  8.845   127.336 1.00 32.60  ? 125 LEU C CD2 1 
ATOM   3759  N N   . ASP C  1 102 ? 19.369  5.974   132.076 1.00 31.73  ? 126 ASP C N   1 
ATOM   3760  C CA  . ASP C  1 102 ? 18.665  4.885   132.752 1.00 34.01  ? 126 ASP C CA  1 
ATOM   3761  C C   . ASP C  1 102 ? 18.036  5.364   134.026 1.00 35.11  ? 126 ASP C C   1 
ATOM   3762  O O   . ASP C  1 102 ? 17.764  4.534   134.886 1.00 35.57  ? 126 ASP C O   1 
ATOM   3763  C CB  . ASP C  1 102 ? 19.593  3.658   133.031 1.00 34.77  ? 126 ASP C CB  1 
ATOM   3764  C CG  . ASP C  1 102 ? 20.699  3.981   134.005 1.00 37.01  ? 126 ASP C CG  1 
ATOM   3765  O OD1 . ASP C  1 102 ? 20.687  5.161   134.422 1.00 40.63  ? 126 ASP C OD1 1 
ATOM   3766  O OD2 . ASP C  1 102 ? 21.588  3.130   134.327 1.00 37.03  ? 126 ASP C OD2 1 
ATOM   3767  N N   . ASP C  1 103 ? 17.870  6.681   134.179 1.00 35.75  ? 127 ASP C N   1 
ATOM   3768  C CA  . ASP C  1 103 ? 17.202  7.236   135.326 1.00 37.78  ? 127 ASP C CA  1 
ATOM   3769  C C   . ASP C  1 103 ? 17.846  6.885   136.716 1.00 40.25  ? 127 ASP C C   1 
ATOM   3770  O O   . ASP C  1 103 ? 17.157  6.721   137.711 1.00 41.54  ? 127 ASP C O   1 
ATOM   3771  C CB  . ASP C  1 103 ? 15.731  6.794   135.293 1.00 38.02  ? 127 ASP C CB  1 
ATOM   3772  C CG  . ASP C  1 103 ? 14.862  7.559   136.290 1.00 38.73  ? 127 ASP C CG  1 
ATOM   3773  O OD1 . ASP C  1 103 ? 15.109  8.777   136.534 1.00 36.53  ? 127 ASP C OD1 1 
ATOM   3774  O OD2 . ASP C  1 103 ? 13.943  6.895   136.825 1.00 38.81  ? 127 ASP C OD2 1 
ATOM   3775  N N   . ASN C  1 104 ? 19.164  6.780   136.760 1.00 41.32  ? 128 ASN C N   1 
ATOM   3776  C CA  . ASN C  1 104 ? 19.898  6.501   137.969 1.00 42.61  ? 128 ASN C CA  1 
ATOM   3777  C C   . ASN C  1 104 ? 21.029  7.552   138.139 1.00 42.70  ? 128 ASN C C   1 
ATOM   3778  O O   . ASN C  1 104 ? 22.224  7.394   137.731 1.00 43.61  ? 128 ASN C O   1 
ATOM   3779  C CB  . ASN C  1 104 ? 20.481  5.118   137.857 1.00 45.81  ? 128 ASN C CB  1 
ATOM   3780  C CG  . ASN C  1 104 ? 21.250  4.723   139.082 1.00 47.87  ? 128 ASN C CG  1 
ATOM   3781  O OD1 . ASN C  1 104 ? 20.831  5.049   140.202 1.00 50.94  ? 128 ASN C OD1 1 
ATOM   3782  N ND2 . ASN C  1 104 ? 22.389  4.047   138.888 1.00 46.60  ? 128 ASN C ND2 1 
ATOM   3783  N N   . PHE C  1 105 ? 20.621  8.641   138.746 1.00 40.24  ? 129 PHE C N   1 
ATOM   3784  C CA  . PHE C  1 105 ? 21.477  9.762   138.930 1.00 37.39  ? 129 PHE C CA  1 
ATOM   3785  C C   . PHE C  1 105 ? 22.239  9.557   140.191 1.00 35.25  ? 129 PHE C C   1 
ATOM   3786  O O   . PHE C  1 105 ? 21.829  8.832   141.028 1.00 32.15  ? 129 PHE C O   1 
ATOM   3787  C CB  . PHE C  1 105 ? 20.630  11.001  139.033 1.00 36.34  ? 129 PHE C CB  1 
ATOM   3788  C CG  . PHE C  1 105 ? 19.860  11.261  137.806 1.00 35.66  ? 129 PHE C CG  1 
ATOM   3789  C CD1 . PHE C  1 105 ? 20.436  11.970  136.763 1.00 36.22  ? 129 PHE C CD1 1 
ATOM   3790  C CD2 . PHE C  1 105 ? 18.576  10.775  137.664 1.00 34.46  ? 129 PHE C CD2 1 
ATOM   3791  C CE1 . PHE C  1 105 ? 19.719  12.222  135.621 1.00 35.10  ? 129 PHE C CE1 1 
ATOM   3792  C CE2 . PHE C  1 105 ? 17.834  11.028  136.518 1.00 33.78  ? 129 PHE C CE2 1 
ATOM   3793  C CZ  . PHE C  1 105 ? 18.416  11.748  135.503 1.00 34.72  ? 129 PHE C CZ  1 
ATOM   3794  N N   . VAL C  1 106 ? 23.372  10.223  140.290 1.00 36.66  ? 130 VAL C N   1 
ATOM   3795  C CA  . VAL C  1 106 ? 24.108  10.337  141.557 1.00 36.84  ? 130 VAL C CA  1 
ATOM   3796  C C   . VAL C  1 106 ? 23.249  11.133  142.511 1.00 34.85  ? 130 VAL C C   1 
ATOM   3797  O O   . VAL C  1 106 ? 22.516  11.999  142.108 1.00 33.70  ? 130 VAL C O   1 
ATOM   3798  C CB  . VAL C  1 106 ? 25.492  11.009  141.328 1.00 37.45  ? 130 VAL C CB  1 
ATOM   3799  C CG1 . VAL C  1 106 ? 26.270  11.124  142.629 1.00 37.55  ? 130 VAL C CG1 1 
ATOM   3800  C CG2 . VAL C  1 106 ? 26.317  10.207  140.307 1.00 37.34  ? 130 VAL C CG2 1 
ATOM   3801  N N   . THR C  1 107 ? 23.342  10.827  143.781 1.00 36.52  ? 131 THR C N   1 
ATOM   3802  C CA  . THR C  1 107 ? 22.423  11.401  144.757 1.00 38.95  ? 131 THR C CA  1 
ATOM   3803  C C   . THR C  1 107 ? 22.661  12.902  144.935 1.00 39.92  ? 131 THR C C   1 
ATOM   3804  O O   . THR C  1 107 ? 23.797  13.324  145.114 1.00 40.00  ? 131 THR C O   1 
ATOM   3805  C CB  . THR C  1 107 ? 22.574  10.747  146.153 1.00 39.91  ? 131 THR C CB  1 
ATOM   3806  O OG1 . THR C  1 107 ? 22.414  9.335   146.057 1.00 39.24  ? 131 THR C OG1 1 
ATOM   3807  C CG2 . THR C  1 107 ? 21.522  11.303  147.140 1.00 39.65  ? 131 THR C CG2 1 
ATOM   3808  N N   . LYS C  1 108 ? 21.571  13.669  144.944 1.00 41.70  ? 132 LYS C N   1 
ATOM   3809  C CA  . LYS C  1 108 ? 21.612  15.093  145.126 1.00 42.63  ? 132 LYS C CA  1 
ATOM   3810  C C   . LYS C  1 108 ? 22.413  15.446  146.387 1.00 43.32  ? 132 LYS C C   1 
ATOM   3811  O O   . LYS C  1 108 ? 22.287  14.829  147.457 1.00 42.38  ? 132 LYS C O   1 
ATOM   3812  C CB  . LYS C  1 108 ? 20.210  15.608  145.197 1.00 45.49  ? 132 LYS C CB  1 
ATOM   3813  C CG  . LYS C  1 108 ? 20.155  17.092  145.035 1.00 52.66  ? 132 LYS C CG  1 
ATOM   3814  C CD  . LYS C  1 108 ? 19.234  17.768  146.070 1.00 57.11  ? 132 LYS C CD  1 
ATOM   3815  C CE  . LYS C  1 108 ? 19.240  19.297  145.917 1.00 56.73  ? 132 LYS C CE  1 
ATOM   3816  N NZ  . LYS C  1 108 ? 18.223  19.646  144.886 1.00 55.53  ? 132 LYS C NZ  1 
ATOM   3817  N N   . ALA C  1 109 ? 23.311  16.398  146.235 1.00 44.97  ? 133 ALA C N   1 
ATOM   3818  C CA  . ALA C  1 109 ? 24.287  16.708  147.300 1.00 46.48  ? 133 ALA C CA  1 
ATOM   3819  C C   . ALA C  1 109 ? 24.579  18.190  147.254 1.00 45.09  ? 133 ALA C C   1 
ATOM   3820  O O   . ALA C  1 109 ? 24.565  18.770  146.139 1.00 44.63  ? 133 ALA C O   1 
ATOM   3821  C CB  . ALA C  1 109 ? 25.601  15.919  147.090 1.00 48.10  ? 133 ALA C CB  1 
ATOM   3822  N N   . THR C  1 110 ? 24.861  18.801  148.416 1.00 42.24  ? 134 THR C N   1 
ATOM   3823  C CA  . THR C  1 110 ? 25.235  20.231  148.386 1.00 42.55  ? 134 THR C CA  1 
ATOM   3824  C C   . THR C  1 110 ? 26.734  20.539  148.143 1.00 42.11  ? 134 THR C C   1 
ATOM   3825  O O   . THR C  1 110 ? 27.070  21.506  147.441 1.00 39.19  ? 134 THR C O   1 
ATOM   3826  C CB  . THR C  1 110 ? 24.733  20.991  149.612 1.00 41.44  ? 134 THR C CB  1 
ATOM   3827  O OG1 . THR C  1 110 ? 23.388  20.622  149.849 1.00 41.55  ? 134 THR C OG1 1 
ATOM   3828  C CG2 . THR C  1 110 ? 24.745  22.489  149.333 1.00 42.08  ? 134 THR C CG2 1 
ATOM   3829  N N   . ALA C  1 111 ? 27.590  19.738  148.781 1.00 42.94  ? 135 ALA C N   1 
ATOM   3830  C CA  . ALA C  1 111 ? 29.036  19.940  148.837 1.00 41.13  ? 135 ALA C CA  1 
ATOM   3831  C C   . ALA C  1 111 ? 29.701  18.571  149.013 1.00 40.25  ? 135 ALA C C   1 
ATOM   3832  O O   . ALA C  1 111 ? 30.270  18.273  150.042 1.00 38.76  ? 135 ALA C O   1 
ATOM   3833  C CB  . ALA C  1 111 ? 29.420  20.901  149.961 1.00 39.09  ? 135 ALA C CB  1 
ATOM   3834  N N   . LEU C  1 112 ? 29.589  17.762  147.972 1.00 39.17  ? 136 LEU C N   1 
ATOM   3835  C CA  . LEU C  1 112 ? 30.332  16.551  147.862 1.00 39.58  ? 136 LEU C CA  1 
ATOM   3836  C C   . LEU C  1 112 ? 31.811  16.843  147.706 1.00 37.96  ? 136 LEU C C   1 
ATOM   3837  O O   . LEU C  1 112 ? 32.234  17.723  146.986 1.00 36.49  ? 136 LEU C O   1 
ATOM   3838  C CB  . LEU C  1 112 ? 29.830  15.748  146.666 1.00 43.43  ? 136 LEU C CB  1 
ATOM   3839  C CG  . LEU C  1 112 ? 30.047  14.215  146.779 1.00 48.22  ? 136 LEU C CG  1 
ATOM   3840  C CD1 . LEU C  1 112 ? 29.097  13.606  147.811 1.00 49.45  ? 136 LEU C CD1 1 
ATOM   3841  C CD2 . LEU C  1 112 ? 29.872  13.468  145.437 1.00 49.32  ? 136 LEU C CD2 1 
ATOM   3842  N N   . THR C  1 113 ? 32.624  16.041  148.357 1.00 38.25  ? 137 THR C N   1 
ATOM   3843  C CA  . THR C  1 113 ? 34.092  16.265  148.361 1.00 37.53  ? 137 THR C CA  1 
ATOM   3844  C C   . THR C  1 113 ? 34.869  15.912  147.081 1.00 36.52  ? 137 THR C C   1 
ATOM   3845  O O   . THR C  1 113 ? 36.101  16.027  147.056 1.00 34.96  ? 137 THR C O   1 
ATOM   3846  C CB  . THR C  1 113 ? 34.741  15.512  149.534 1.00 37.03  ? 137 THR C CB  1 
ATOM   3847  O OG1 . THR C  1 113 ? 34.640  14.087  149.330 1.00 35.30  ? 137 THR C OG1 1 
ATOM   3848  C CG2 . THR C  1 113 ? 34.062  15.964  150.855 1.00 36.84  ? 137 THR C CG2 1 
ATOM   3849  N N   . TYR C  1 114 ? 34.140  15.473  146.049 1.00 36.08  ? 138 TYR C N   1 
ATOM   3850  C CA  . TYR C  1 114 ? 34.687  15.188  144.704 1.00 35.60  ? 138 TYR C CA  1 
ATOM   3851  C C   . TYR C  1 114 ? 33.580  15.369  143.648 1.00 35.10  ? 138 TYR C C   1 
ATOM   3852  O O   . TYR C  1 114 ? 32.413  15.515  143.967 1.00 33.78  ? 138 TYR C O   1 
ATOM   3853  C CB  . TYR C  1 114 ? 35.305  13.774  144.599 1.00 34.73  ? 138 TYR C CB  1 
ATOM   3854  C CG  . TYR C  1 114 ? 34.303  12.666  144.841 1.00 33.95  ? 138 TYR C CG  1 
ATOM   3855  C CD1 . TYR C  1 114 ? 33.767  12.418  146.107 1.00 32.56  ? 138 TYR C CD1 1 
ATOM   3856  C CD2 . TYR C  1 114 ? 33.856  11.902  143.812 1.00 33.85  ? 138 TYR C CD2 1 
ATOM   3857  C CE1 . TYR C  1 114 ? 32.846  11.438  146.296 1.00 31.81  ? 138 TYR C CE1 1 
ATOM   3858  C CE2 . TYR C  1 114 ? 32.898  10.919  144.011 1.00 33.07  ? 138 TYR C CE2 1 
ATOM   3859  C CZ  . TYR C  1 114 ? 32.416  10.702  145.245 1.00 32.30  ? 138 TYR C CZ  1 
ATOM   3860  O OH  . TYR C  1 114 ? 31.529  9.683   145.392 1.00 33.58  ? 138 TYR C OH  1 
ATOM   3861  N N   . ASP C  1 115 ? 33.985  15.431  142.389 1.00 35.01  ? 139 ASP C N   1 
ATOM   3862  C CA  . ASP C  1 115 ? 33.025  15.608  141.293 1.00 33.27  ? 139 ASP C CA  1 
ATOM   3863  C C   . ASP C  1 115 ? 32.654  14.162  140.882 1.00 31.66  ? 139 ASP C C   1 
ATOM   3864  O O   . ASP C  1 115 ? 33.411  13.433  140.230 1.00 28.87  ? 139 ASP C O   1 
ATOM   3865  C CB  . ASP C  1 115 ? 33.637  16.471  140.182 1.00 31.71  ? 139 ASP C CB  1 
ATOM   3866  C CG  . ASP C  1 115 ? 32.910  16.396  138.901 1.00 30.73  ? 139 ASP C CG  1 
ATOM   3867  O OD1 . ASP C  1 115 ? 31.948  15.645  138.795 1.00 30.79  ? 139 ASP C OD1 1 
ATOM   3868  O OD2 . ASP C  1 115 ? 33.327  17.115  137.988 1.00 31.52  ? 139 ASP C OD2 1 
ATOM   3869  N N   . PRO C  1 116 ? 31.488  13.751  141.294 1.00 31.24  ? 140 PRO C N   1 
ATOM   3870  C CA  . PRO C  1 116 ? 31.133  12.367  141.079 1.00 32.44  ? 140 PRO C CA  1 
ATOM   3871  C C   . PRO C  1 116 ? 30.913  11.962  139.601 1.00 33.01  ? 140 PRO C C   1 
ATOM   3872  O O   . PRO C  1 116 ? 30.863  10.763  139.317 1.00 31.99  ? 140 PRO C O   1 
ATOM   3873  C CB  . PRO C  1 116 ? 29.840  12.221  141.873 1.00 32.65  ? 140 PRO C CB  1 
ATOM   3874  C CG  . PRO C  1 116 ? 29.248  13.585  141.924 1.00 32.72  ? 140 PRO C CG  1 
ATOM   3875  C CD  . PRO C  1 116 ? 30.323  14.591  141.560 1.00 31.88  ? 140 PRO C CD  1 
ATOM   3876  N N   . TYR C  1 117 ? 30.835  12.936  138.681 1.00 33.19  ? 141 TYR C N   1 
ATOM   3877  C CA  . TYR C  1 117 ? 30.656  12.662  137.244 1.00 32.60  ? 141 TYR C CA  1 
ATOM   3878  C C   . TYR C  1 117 ? 31.909  12.718  136.381 1.00 32.07  ? 141 TYR C C   1 
ATOM   3879  O O   . TYR C  1 117 ? 31.917  12.200  135.224 1.00 33.17  ? 141 TYR C O   1 
ATOM   3880  C CB  . TYR C  1 117 ? 29.574  13.583  136.656 1.00 31.89  ? 141 TYR C CB  1 
ATOM   3881  C CG  . TYR C  1 117 ? 28.178  13.171  137.111 1.00 32.13  ? 141 TYR C CG  1 
ATOM   3882  C CD1 . TYR C  1 117 ? 27.680  11.913  136.818 1.00 31.44  ? 141 TYR C CD1 1 
ATOM   3883  C CD2 . TYR C  1 117 ? 27.354  14.065  137.837 1.00 32.16  ? 141 TYR C CD2 1 
ATOM   3884  C CE1 . TYR C  1 117 ? 26.393  11.568  137.212 1.00 32.73  ? 141 TYR C CE1 1 
ATOM   3885  C CE2 . TYR C  1 117 ? 26.064  13.722  138.250 1.00 31.66  ? 141 TYR C CE2 1 
ATOM   3886  C CZ  . TYR C  1 117 ? 25.578  12.480  137.946 1.00 31.63  ? 141 TYR C CZ  1 
ATOM   3887  O OH  . TYR C  1 117 ? 24.329  12.115  138.383 1.00 29.52  ? 141 TYR C OH  1 
ATOM   3888  N N   . VAL C  1 118 ? 32.967  13.305  136.919 1.00 31.27  ? 142 VAL C N   1 
ATOM   3889  C CA  . VAL C  1 118 ? 34.198  13.529  136.132 1.00 30.17  ? 142 VAL C CA  1 
ATOM   3890  C C   . VAL C  1 118 ? 34.675  12.298  135.273 1.00 29.04  ? 142 VAL C C   1 
ATOM   3891  O O   . VAL C  1 118 ? 35.030  12.481  134.106 1.00 28.44  ? 142 VAL C O   1 
ATOM   3892  C CB  . VAL C  1 118 ? 35.325  14.082  137.033 1.00 30.03  ? 142 VAL C CB  1 
ATOM   3893  C CG1 . VAL C  1 118 ? 35.941  13.006  137.917 1.00 29.25  ? 142 VAL C CG1 1 
ATOM   3894  C CG2 . VAL C  1 118 ? 36.369  14.717  136.175 1.00 31.19  ? 142 VAL C CG2 1 
ATOM   3895  N N   . ASN C  1 119 ? 34.609  11.076  135.809 1.00 27.39  ? 143 ASN C N   1 
ATOM   3896  C CA  . ASN C  1 119 ? 35.054  9.903   135.087 1.00 27.56  ? 143 ASN C CA  1 
ATOM   3897  C C   . ASN C  1 119 ? 33.966  9.259   134.177 1.00 28.17  ? 143 ASN C C   1 
ATOM   3898  O O   . ASN C  1 119 ? 34.277  8.262   133.372 1.00 26.64  ? 143 ASN C O   1 
ATOM   3899  C CB  . ASN C  1 119 ? 35.550  8.811   136.030 1.00 27.95  ? 143 ASN C CB  1 
ATOM   3900  C CG  . ASN C  1 119 ? 36.770  9.192   136.824 1.00 28.36  ? 143 ASN C CG  1 
ATOM   3901  O OD1 . ASN C  1 119 ? 37.707  9.881   136.331 1.00 29.11  ? 143 ASN C OD1 1 
ATOM   3902  N ND2 . ASN C  1 119 ? 36.825  8.648   138.052 1.00 27.83  ? 143 ASN C ND2 1 
ATOM   3903  N N   . TYR C  1 120 ? 32.732  9.792   134.247 1.00 27.61  ? 144 TYR C N   1 
ATOM   3904  C CA  . TYR C  1 120 ? 31.734  9.308   133.290 1.00 28.68  ? 144 TYR C CA  1 
ATOM   3905  C C   . TYR C  1 120 ? 32.174  9.330   131.784 1.00 29.67  ? 144 TYR C C   1 
ATOM   3906  O O   . TYR C  1 120 ? 32.837  10.267  131.277 1.00 31.63  ? 144 TYR C O   1 
ATOM   3907  C CB  . TYR C  1 120 ? 30.406  9.973   133.473 1.00 27.98  ? 144 TYR C CB  1 
ATOM   3908  C CG  . TYR C  1 120 ? 29.561  9.358   134.565 1.00 27.73  ? 144 TYR C CG  1 
ATOM   3909  C CD1 . TYR C  1 120 ? 30.040  9.306   135.879 1.00 27.87  ? 144 TYR C CD1 1 
ATOM   3910  C CD2 . TYR C  1 120 ? 28.267  8.873   134.318 1.00 27.39  ? 144 TYR C CD2 1 
ATOM   3911  C CE1 . TYR C  1 120 ? 29.286  8.779   136.924 1.00 27.69  ? 144 TYR C CE1 1 
ATOM   3912  C CE2 . TYR C  1 120 ? 27.504  8.343   135.375 1.00 28.41  ? 144 TYR C CE2 1 
ATOM   3913  C CZ  . TYR C  1 120 ? 28.045  8.293   136.680 1.00 27.60  ? 144 TYR C CZ  1 
ATOM   3914  O OH  . TYR C  1 120 ? 27.389  7.810   137.746 1.00 25.84  ? 144 TYR C OH  1 
ATOM   3915  N N   . SER C  1 121 ? 31.872  8.266   131.078 1.00 30.31  ? 145 SER C N   1 
ATOM   3916  C CA  . SER C  1 121 ? 32.228  8.202   129.648 1.00 31.09  ? 145 SER C CA  1 
ATOM   3917  C C   . SER C  1 121 ? 31.617  9.367   128.929 1.00 31.17  ? 145 SER C C   1 
ATOM   3918  O O   . SER C  1 121 ? 32.317  10.001  128.187 1.00 31.92  ? 145 SER C O   1 
ATOM   3919  C CB  . SER C  1 121 ? 31.824  6.875   128.991 1.00 29.97  ? 145 SER C CB  1 
ATOM   3920  O OG  . SER C  1 121 ? 32.605  5.871   129.575 1.00 28.96  ? 145 SER C OG  1 
ATOM   3921  N N   . SER C  1 122 ? 30.361  9.699   129.256 1.00 31.78  ? 146 SER C N   1 
ATOM   3922  C CA  . SER C  1 122 ? 29.593  10.842  128.640 1.00 31.69  ? 146 SER C CA  1 
ATOM   3923  C C   . SER C  1 122 ? 29.887  12.248  129.211 1.00 31.71  ? 146 SER C C   1 
ATOM   3924  O O   . SER C  1 122 ? 29.253  13.213  128.814 1.00 30.63  ? 146 SER C O   1 
ATOM   3925  C CB  . SER C  1 122 ? 28.071  10.589  128.750 1.00 30.76  ? 146 SER C CB  1 
ATOM   3926  O OG  . SER C  1 122 ? 27.640  10.443  130.119 1.00 31.22  ? 146 SER C OG  1 
ATOM   3927  N N   . ARG C  1 123 ? 30.833  12.355  130.136 1.00 33.79  ? 147 ARG C N   1 
ATOM   3928  C CA  . ARG C  1 123 ? 31.154  13.626  130.767 1.00 36.34  ? 147 ARG C CA  1 
ATOM   3929  C C   . ARG C  1 123 ? 31.696  14.644  129.765 1.00 35.37  ? 147 ARG C C   1 
ATOM   3930  O O   . ARG C  1 123 ? 32.544  14.306  128.919 1.00 34.15  ? 147 ARG C O   1 
ATOM   3931  C CB  . ARG C  1 123 ? 32.165  13.445  131.919 1.00 39.05  ? 147 ARG C CB  1 
ATOM   3932  C CG  . ARG C  1 123 ? 32.650  14.757  132.564 1.00 40.20  ? 147 ARG C CG  1 
ATOM   3933  C CD  . ARG C  1 123 ? 33.959  15.290  131.969 1.00 41.03  ? 147 ARG C CD  1 
ATOM   3934  N NE  . ARG C  1 123 ? 35.185  14.618  132.439 1.00 42.25  ? 147 ARG C NE  1 
ATOM   3935  C CZ  . ARG C  1 123 ? 36.422  14.810  131.922 1.00 43.35  ? 147 ARG C CZ  1 
ATOM   3936  N NH1 . ARG C  1 123 ? 37.471  14.138  132.424 1.00 41.98  ? 147 ARG C NH1 1 
ATOM   3937  N NH2 . ARG C  1 123 ? 36.630  15.659  130.884 1.00 44.55  ? 147 ARG C NH2 1 
ATOM   3938  N N   . HIS C  1 124 ? 31.169  15.865  129.879 1.00 33.86  ? 148 HIS C N   1 
ATOM   3939  C CA  . HIS C  1 124 ? 31.790  17.065  129.306 1.00 33.66  ? 148 HIS C CA  1 
ATOM   3940  C C   . HIS C  1 124 ? 32.092  18.012  130.459 1.00 30.97  ? 148 HIS C C   1 
ATOM   3941  O O   . HIS C  1 124 ? 31.362  18.021  131.463 1.00 28.61  ? 148 HIS C O   1 
ATOM   3942  C CB  . HIS C  1 124 ? 30.857  17.840  128.362 1.00 34.41  ? 148 HIS C CB  1 
ATOM   3943  C CG  . HIS C  1 124 ? 30.631  17.191  127.057 1.00 34.27  ? 148 HIS C CG  1 
ATOM   3944  N ND1 . HIS C  1 124 ? 30.254  17.909  125.954 1.00 36.25  ? 148 HIS C ND1 1 
ATOM   3945  C CD2 . HIS C  1 124 ? 30.666  15.896  126.677 1.00 34.37  ? 148 HIS C CD2 1 
ATOM   3946  C CE1 . HIS C  1 124 ? 30.127  17.088  124.924 1.00 36.43  ? 148 HIS C CE1 1 
ATOM   3947  N NE2 . HIS C  1 124 ? 30.350  15.858  125.339 1.00 34.54  ? 148 HIS C NE2 1 
ATOM   3948  N N   . THR C  1 125 ? 33.122  18.838  130.261 1.00 29.66  ? 149 THR C N   1 
ATOM   3949  C CA  . THR C  1 125 ? 33.598  19.710  131.296 1.00 29.62  ? 149 THR C CA  1 
ATOM   3950  C C   . THR C  1 125 ? 32.725  20.954  131.283 1.00 28.99  ? 149 THR C C   1 
ATOM   3951  O O   . THR C  1 125 ? 32.447  21.472  130.215 1.00 27.86  ? 149 THR C O   1 
ATOM   3952  C CB  . THR C  1 125 ? 35.054  20.103  131.054 1.00 30.08  ? 149 THR C CB  1 
ATOM   3953  O OG1 . THR C  1 125 ? 35.859  18.926  130.935 1.00 30.80  ? 149 THR C OG1 1 
ATOM   3954  C CG2 . THR C  1 125 ? 35.568  20.999  132.175 1.00 29.31  ? 149 THR C CG2 1 
ATOM   3955  N N   . ILE C  1 126 ? 32.251  21.362  132.463 1.00 28.43  ? 150 ILE C N   1 
ATOM   3956  C CA  . ILE C  1 126 ? 31.603  22.622  132.645 1.00 29.86  ? 150 ILE C CA  1 
ATOM   3957  C C   . ILE C  1 126 ? 32.645  23.609  133.196 1.00 30.69  ? 150 ILE C C   1 
ATOM   3958  O O   . ILE C  1 126 ? 33.290  23.342  134.176 1.00 28.99  ? 150 ILE C O   1 
ATOM   3959  C CB  . ILE C  1 126 ? 30.477  22.554  133.691 1.00 29.72  ? 150 ILE C CB  1 
ATOM   3960  C CG1 . ILE C  1 126 ? 29.382  21.641  133.268 1.00 30.66  ? 150 ILE C CG1 1 
ATOM   3961  C CG2 . ILE C  1 126 ? 29.847  23.928  133.921 1.00 29.86  ? 150 ILE C CG2 1 
ATOM   3962  C CD1 . ILE C  1 126 ? 28.503  21.252  134.449 1.00 31.54  ? 150 ILE C CD1 1 
ATOM   3963  N N   . THR C  1 127 ? 32.720  24.796  132.641 1.00 32.98  ? 151 THR C N   1 
ATOM   3964  C CA  . THR C  1 127 ? 33.626  25.824  133.173 1.00 35.49  ? 151 THR C CA  1 
ATOM   3965  C C   . THR C  1 127 ? 32.743  26.916  133.861 1.00 35.52  ? 151 THR C C   1 
ATOM   3966  O O   . THR C  1 127 ? 31.616  27.179  133.406 1.00 36.92  ? 151 THR C O   1 
ATOM   3967  C CB  . THR C  1 127 ? 34.561  26.245  132.001 1.00 36.43  ? 151 THR C CB  1 
ATOM   3968  O OG1 . THR C  1 127 ? 35.911  25.790  132.282 1.00 37.81  ? 151 THR C OG1 1 
ATOM   3969  C CG2 . THR C  1 127 ? 34.541  27.680  131.813 1.00 37.02  ? 151 THR C CG2 1 
ATOM   3970  N N   . GLN C  1 128 ? 33.191  27.505  134.960 1.00 34.09  ? 152 GLN C N   1 
ATOM   3971  C CA  . GLN C  1 128 ? 32.272  28.280  135.828 1.00 34.40  ? 152 GLN C CA  1 
ATOM   3972  C C   . GLN C  1 128 ? 32.873  29.587  136.256 1.00 35.24  ? 152 GLN C C   1 
ATOM   3973  O O   . GLN C  1 128 ? 34.063  29.653  136.423 1.00 37.66  ? 152 GLN C O   1 
ATOM   3974  C CB  . GLN C  1 128 ? 31.965  27.488  137.111 1.00 34.68  ? 152 GLN C CB  1 
ATOM   3975  C CG  . GLN C  1 128 ? 31.080  26.240  136.959 1.00 34.08  ? 152 GLN C CG  1 
ATOM   3976  C CD  . GLN C  1 128 ? 31.123  25.288  138.175 1.00 34.32  ? 152 GLN C CD  1 
ATOM   3977  O OE1 . GLN C  1 128 ? 31.577  24.120  138.078 1.00 35.10  ? 152 GLN C OE1 1 
ATOM   3978  N NE2 . GLN C  1 128 ? 30.631  25.761  139.311 1.00 33.03  ? 152 GLN C NE2 1 
ATOM   3979  N N   . PRO C  1 129 ? 32.105  30.633  136.526 1.00 36.78  ? 153 PRO C N   1 
ATOM   3980  C CA  . PRO C  1 129 ? 30.657  30.667  136.549 1.00 36.68  ? 153 PRO C CA  1 
ATOM   3981  C C   . PRO C  1 129 ? 30.099  31.406  135.357 1.00 36.68  ? 153 PRO C C   1 
ATOM   3982  O O   . PRO C  1 129 ? 28.871  31.525  135.263 1.00 35.43  ? 153 PRO C O   1 
ATOM   3983  C CB  . PRO C  1 129 ? 30.382  31.535  137.784 1.00 36.83  ? 153 PRO C CB  1 
ATOM   3984  C CG  . PRO C  1 129 ? 31.469  32.507  137.791 1.00 36.40  ? 153 PRO C CG  1 
ATOM   3985  C CD  . PRO C  1 129 ? 32.673  31.777  137.266 1.00 36.96  ? 153 PRO C CD  1 
ATOM   3986  N N   . PHE C  1 130 ? 30.978  31.927  134.484 1.00 35.89  ? 154 PHE C N   1 
ATOM   3987  C CA  . PHE C  1 130 ? 30.517  32.749  133.381 1.00 36.09  ? 154 PHE C CA  1 
ATOM   3988  C C   . PHE C  1 130 ? 30.439  32.081  132.019 1.00 34.09  ? 154 PHE C C   1 
ATOM   3989  O O   . PHE C  1 130 ? 30.116  32.717  131.097 1.00 35.40  ? 154 PHE C O   1 
ATOM   3990  C CB  . PHE C  1 130 ? 31.279  34.087  133.293 1.00 37.98  ? 154 PHE C CB  1 
ATOM   3991  C CG  . PHE C  1 130 ? 32.749  33.950  133.225 1.00 38.31  ? 154 PHE C CG  1 
ATOM   3992  C CD1 . PHE C  1 130 ? 33.372  33.574  132.027 1.00 40.77  ? 154 PHE C CD1 1 
ATOM   3993  C CD2 . PHE C  1 130 ? 33.506  34.210  134.327 1.00 38.62  ? 154 PHE C CD2 1 
ATOM   3994  C CE1 . PHE C  1 130 ? 34.749  33.444  131.949 1.00 41.25  ? 154 PHE C CE1 1 
ATOM   3995  C CE2 . PHE C  1 130 ? 34.891  34.095  134.268 1.00 41.38  ? 154 PHE C CE2 1 
ATOM   3996  C CZ  . PHE C  1 130 ? 35.517  33.690  133.083 1.00 41.92  ? 154 PHE C CZ  1 
ATOM   3997  N N   . SER C  1 131 ? 30.642  30.808  131.875 1.00 34.26  ? 155 SER C N   1 
ATOM   3998  C CA  . SER C  1 131 ? 30.727  30.229  130.534 1.00 34.88  ? 155 SER C CA  1 
ATOM   3999  C C   . SER C  1 131 ? 29.466  29.464  130.155 1.00 34.03  ? 155 SER C C   1 
ATOM   4000  O O   . SER C  1 131 ? 28.845  28.829  130.997 1.00 32.09  ? 155 SER C O   1 
ATOM   4001  C CB  . SER C  1 131 ? 31.977  29.337  130.479 1.00 35.51  ? 155 SER C CB  1 
ATOM   4002  O OG  . SER C  1 131 ? 33.137  30.148  130.762 1.00 35.46  ? 155 SER C OG  1 
ATOM   4003  N N   . TYR C  1 132 ? 29.070  29.566  128.885 1.00 34.07  ? 156 TYR C N   1 
ATOM   4004  C CA  . TYR C  1 132 ? 27.984  28.727  128.315 1.00 33.18  ? 156 TYR C CA  1 
ATOM   4005  C C   . TYR C  1 132 ? 28.335  27.260  128.480 1.00 33.98  ? 156 TYR C C   1 
ATOM   4006  O O   . TYR C  1 132 ? 29.479  26.901  128.479 1.00 34.52  ? 156 TYR C O   1 
ATOM   4007  C CB  . TYR C  1 132 ? 27.874  29.043  126.850 1.00 32.77  ? 156 TYR C CB  1 
ATOM   4008  C CG  . TYR C  1 132 ? 26.851  28.289  126.029 1.00 34.27  ? 156 TYR C CG  1 
ATOM   4009  C CD1 . TYR C  1 132 ? 25.505  28.698  125.962 1.00 36.36  ? 156 TYR C CD1 1 
ATOM   4010  C CD2 . TYR C  1 132 ? 27.226  27.261  125.212 1.00 34.71  ? 156 TYR C CD2 1 
ATOM   4011  C CE1 . TYR C  1 132 ? 24.567  28.022  125.167 1.00 36.43  ? 156 TYR C CE1 1 
ATOM   4012  C CE2 . TYR C  1 132 ? 26.311  26.604  124.382 1.00 35.71  ? 156 TYR C CE2 1 
ATOM   4013  C CZ  . TYR C  1 132 ? 24.972  26.961  124.366 1.00 36.39  ? 156 TYR C CZ  1 
ATOM   4014  O OH  . TYR C  1 132 ? 24.077  26.252  123.536 1.00 36.42  ? 156 TYR C OH  1 
ATOM   4015  N N   . HIS C  1 133 ? 27.366  26.403  128.703 1.00 36.19  ? 157 HIS C N   1 
ATOM   4016  C CA  . HIS C  1 133 ? 27.591  24.951  128.638 1.00 36.66  ? 157 HIS C CA  1 
ATOM   4017  C C   . HIS C  1 133 ? 26.341  24.393  128.035 1.00 36.28  ? 157 HIS C C   1 
ATOM   4018  O O   . HIS C  1 133 ? 25.262  24.882  128.364 1.00 38.08  ? 157 HIS C O   1 
ATOM   4019  C CB  . HIS C  1 133 ? 27.795  24.331  130.023 1.00 36.78  ? 157 HIS C CB  1 
ATOM   4020  C CG  . HIS C  1 133 ? 28.080  22.866  129.968 1.00 37.38  ? 157 HIS C CG  1 
ATOM   4021  N ND1 . HIS C  1 133 ? 29.265  22.363  129.485 1.00 39.35  ? 157 HIS C ND1 1 
ATOM   4022  C CD2 . HIS C  1 133 ? 27.320  21.795  130.287 1.00 37.09  ? 157 HIS C CD2 1 
ATOM   4023  C CE1 . HIS C  1 133 ? 29.227  21.041  129.534 1.00 38.56  ? 157 HIS C CE1 1 
ATOM   4024  N NE2 . HIS C  1 133 ? 28.066  20.672  130.037 1.00 36.24  ? 157 HIS C NE2 1 
ATOM   4025  N N   . SER C  1 134 ? 26.476  23.411  127.142 1.00 34.60  ? 158 SER C N   1 
ATOM   4026  C CA  . SER C  1 134 ? 25.316  22.719  126.551 1.00 31.94  ? 158 SER C CA  1 
ATOM   4027  C C   . SER C  1 134 ? 25.642  21.278  126.162 1.00 30.59  ? 158 SER C C   1 
ATOM   4028  O O   . SER C  1 134 ? 26.799  20.923  125.961 1.00 29.15  ? 158 SER C O   1 
ATOM   4029  C CB  . SER C  1 134 ? 24.791  23.475  125.341 1.00 31.90  ? 158 SER C CB  1 
ATOM   4030  O OG  . SER C  1 134 ? 25.566  23.229  124.182 1.00 31.24  ? 158 SER C OG  1 
ATOM   4031  N N   . ARG C  1 135 ? 24.590  20.475  126.134 1.00 30.70  ? 159 ARG C N   1 
ATOM   4032  C CA  . ARG C  1 135 ? 24.584  19.037  125.845 1.00 29.61  ? 159 ARG C CA  1 
ATOM   4033  C C   . ARG C  1 135 ? 23.463  18.798  124.854 1.00 30.02  ? 159 ARG C C   1 
ATOM   4034  O O   . ARG C  1 135 ? 22.444  19.542  124.780 1.00 29.21  ? 159 ARG C O   1 
ATOM   4035  C CB  . ARG C  1 135 ? 24.288  18.238  127.089 1.00 29.51  ? 159 ARG C CB  1 
ATOM   4036  C CG  . ARG C  1 135 ? 25.312  18.383  128.199 1.00 30.35  ? 159 ARG C CG  1 
ATOM   4037  C CD  . ARG C  1 135 ? 26.735  18.074  127.736 1.00 30.24  ? 159 ARG C CD  1 
ATOM   4038  N NE  . ARG C  1 135 ? 26.963  16.732  127.180 1.00 29.81  ? 159 ARG C NE  1 
ATOM   4039  C CZ  . ARG C  1 135 ? 27.533  15.703  127.823 1.00 29.17  ? 159 ARG C CZ  1 
ATOM   4040  N NH1 . ARG C  1 135 ? 27.739  14.581  127.173 1.00 27.59  ? 159 ARG C NH1 1 
ATOM   4041  N NH2 . ARG C  1 135 ? 27.949  15.785  129.102 1.00 29.75  ? 159 ARG C NH2 1 
ATOM   4042  N N   . TYR C  1 136 ? 23.650  17.769  124.057 1.00 30.10  ? 160 TYR C N   1 
ATOM   4043  C CA  . TYR C  1 136 ? 22.743  17.521  122.925 1.00 29.75  ? 160 TYR C CA  1 
ATOM   4044  C C   . TYR C  1 136 ? 22.885  16.053  122.642 1.00 29.73  ? 160 TYR C C   1 
ATOM   4045  O O   . TYR C  1 136 ? 23.959  15.599  122.220 1.00 29.41  ? 160 TYR C O   1 
ATOM   4046  C CB  . TYR C  1 136 ? 23.090  18.427  121.715 1.00 28.76  ? 160 TYR C CB  1 
ATOM   4047  C CG  . TYR C  1 136 ? 22.263  18.198  120.470 1.00 28.48  ? 160 TYR C CG  1 
ATOM   4048  C CD1 . TYR C  1 136 ? 20.950  18.759  120.318 1.00 28.11  ? 160 TYR C CD1 1 
ATOM   4049  C CD2 . TYR C  1 136 ? 22.779  17.432  119.422 1.00 28.13  ? 160 TYR C CD2 1 
ATOM   4050  C CE1 . TYR C  1 136 ? 20.204  18.562  119.144 1.00 27.59  ? 160 TYR C CE1 1 
ATOM   4051  C CE2 . TYR C  1 136 ? 22.041  17.201  118.270 1.00 27.82  ? 160 TYR C CE2 1 
ATOM   4052  C CZ  . TYR C  1 136 ? 20.774  17.767  118.129 1.00 28.00  ? 160 TYR C CZ  1 
ATOM   4053  O OH  . TYR C  1 136 ? 20.120  17.462  116.979 1.00 27.79  ? 160 TYR C OH  1 
ATOM   4054  N N   . PHE C  1 137 ? 21.799  15.328  122.900 1.00 29.88  ? 161 PHE C N   1 
ATOM   4055  C CA  . PHE C  1 137 ? 21.812  13.882  122.925 1.00 30.46  ? 161 PHE C CA  1 
ATOM   4056  C C   . PHE C  1 137 ? 20.391  13.347  122.782 1.00 30.70  ? 161 PHE C C   1 
ATOM   4057  O O   . PHE C  1 137 ? 19.429  14.054  123.019 1.00 32.36  ? 161 PHE C O   1 
ATOM   4058  C CB  . PHE C  1 137 ? 22.459  13.430  124.251 1.00 31.71  ? 161 PHE C CB  1 
ATOM   4059  C CG  . PHE C  1 137 ? 21.694  13.860  125.511 1.00 32.34  ? 161 PHE C CG  1 
ATOM   4060  C CD1 . PHE C  1 137 ? 21.947  15.064  126.105 1.00 31.44  ? 161 PHE C CD1 1 
ATOM   4061  C CD2 . PHE C  1 137 ? 20.690  13.048  126.060 1.00 32.09  ? 161 PHE C CD2 1 
ATOM   4062  C CE1 . PHE C  1 137 ? 21.223  15.467  127.213 1.00 31.90  ? 161 PHE C CE1 1 
ATOM   4063  C CE2 . PHE C  1 137 ? 19.997  13.447  127.168 1.00 32.28  ? 161 PHE C CE2 1 
ATOM   4064  C CZ  . PHE C  1 137 ? 20.264  14.654  127.751 1.00 32.16  ? 161 PHE C CZ  1 
ATOM   4065  N N   . THR C  1 138 ? 20.238  12.088  122.406 1.00 31.99  ? 162 THR C N   1 
ATOM   4066  C CA  . THR C  1 138 ? 18.890  11.435  122.432 1.00 30.86  ? 162 THR C CA  1 
ATOM   4067  C C   . THR C  1 138 ? 18.530  10.902  123.818 1.00 29.76  ? 162 THR C C   1 
ATOM   4068  O O   . THR C  1 138 ? 19.091  9.951   124.268 1.00 28.95  ? 162 THR C O   1 
ATOM   4069  C CB  . THR C  1 138 ? 18.796  10.308  121.410 1.00 30.21  ? 162 THR C CB  1 
ATOM   4070  O OG1 . THR C  1 138 ? 19.107  10.869  120.132 1.00 30.07  ? 162 THR C OG1 1 
ATOM   4071  C CG2 . THR C  1 138 ? 17.417  9.711   121.383 1.00 29.79  ? 162 THR C CG2 1 
ATOM   4072  N N   . PRO C  1 139 ? 17.568  11.532  124.486 1.00 30.16  ? 163 PRO C N   1 
ATOM   4073  C CA  . PRO C  1 139 ? 17.156  11.061  125.787 1.00 30.10  ? 163 PRO C CA  1 
ATOM   4074  C C   . PRO C  1 139 ? 16.257  9.817   125.701 1.00 30.70  ? 163 PRO C C   1 
ATOM   4075  O O   . PRO C  1 139 ? 15.720  9.516   124.632 1.00 29.47  ? 163 PRO C O   1 
ATOM   4076  C CB  . PRO C  1 139 ? 16.317  12.242  126.277 1.00 29.81  ? 163 PRO C CB  1 
ATOM   4077  C CG  . PRO C  1 139 ? 15.582  12.654  125.046 1.00 29.52  ? 163 PRO C CG  1 
ATOM   4078  C CD  . PRO C  1 139 ? 16.632  12.565  123.973 1.00 29.72  ? 163 PRO C CD  1 
ATOM   4079  N N   . LYS C  1 140 ? 16.001  9.168   126.841 1.00 31.93  ? 164 LYS C N   1 
ATOM   4080  C CA  . LYS C  1 140 ? 15.145  7.974   126.823 1.00 31.90  ? 164 LYS C CA  1 
ATOM   4081  C C   . LYS C  1 140 ? 13.920  8.060   127.718 1.00 31.96  ? 164 LYS C C   1 
ATOM   4082  O O   . LYS C  1 140 ? 13.969  8.596   128.823 1.00 31.56  ? 164 LYS C O   1 
ATOM   4083  C CB  . LYS C  1 140 ? 15.962  6.757   127.214 1.00 31.92  ? 164 LYS C CB  1 
ATOM   4084  C CG  . LYS C  1 140 ? 17.272  6.631   126.447 1.00 31.96  ? 164 LYS C CG  1 
ATOM   4085  C CD  . LYS C  1 140 ? 17.004  6.420   124.978 1.00 31.92  ? 164 LYS C CD  1 
ATOM   4086  C CE  . LYS C  1 140 ? 18.309  6.272   124.287 1.00 32.42  ? 164 LYS C CE  1 
ATOM   4087  N NZ  . LYS C  1 140 ? 18.176  5.998   122.856 1.00 32.63  ? 164 LYS C NZ  1 
ATOM   4088  N N   . PRO C  1 141 ? 12.823  7.465   127.261 1.00 31.33  ? 165 PRO C N   1 
ATOM   4089  C CA  . PRO C  1 141 ? 11.716  7.382   128.197 1.00 31.07  ? 165 PRO C CA  1 
ATOM   4090  C C   . PRO C  1 141 ? 12.016  6.429   129.369 1.00 30.99  ? 165 PRO C C   1 
ATOM   4091  O O   . PRO C  1 141 ? 12.812  5.493   129.246 1.00 31.31  ? 165 PRO C O   1 
ATOM   4092  C CB  . PRO C  1 141 ? 10.575  6.869   127.315 1.00 30.97  ? 165 PRO C CB  1 
ATOM   4093  C CG  . PRO C  1 141 ? 11.276  5.989   126.334 1.00 30.70  ? 165 PRO C CG  1 
ATOM   4094  C CD  . PRO C  1 141 ? 12.602  6.656   126.049 1.00 30.49  ? 165 PRO C CD  1 
ATOM   4095  N N   . VAL C  1 142 ? 11.365  6.691   130.492 1.00 31.27  ? 166 VAL C N   1 
ATOM   4096  C CA  . VAL C  1 142 ? 11.409  5.822   131.663 1.00 31.18  ? 166 VAL C CA  1 
ATOM   4097  C C   . VAL C  1 142 ? 10.164  4.913   131.558 1.00 32.70  ? 166 VAL C C   1 
ATOM   4098  O O   . VAL C  1 142 ? 9.006   5.288   131.952 1.00 30.49  ? 166 VAL C O   1 
ATOM   4099  C CB  . VAL C  1 142 ? 11.373  6.605   132.985 1.00 30.38  ? 166 VAL C CB  1 
ATOM   4100  C CG1 . VAL C  1 142 ? 11.784  5.718   134.122 1.00 30.53  ? 166 VAL C CG1 1 
ATOM   4101  C CG2 . VAL C  1 142 ? 12.328  7.756   132.975 1.00 30.63  ? 166 VAL C CG2 1 
ATOM   4102  N N   . LEU C  1 143 ? 10.411  3.723   131.001 1.00 33.54  ? 167 LEU C N   1 
ATOM   4103  C CA  . LEU C  1 143 ? 9.353   2.800   130.688 1.00 34.09  ? 167 LEU C CA  1 
ATOM   4104  C C   . LEU C  1 143 ? 9.038   1.883   131.840 1.00 36.96  ? 167 LEU C C   1 
ATOM   4105  O O   . LEU C  1 143 ? 7.887   1.546   132.031 1.00 38.62  ? 167 LEU C O   1 
ATOM   4106  C CB  . LEU C  1 143 ? 9.733   1.982   129.507 1.00 33.99  ? 167 LEU C CB  1 
ATOM   4107  C CG  . LEU C  1 143 ? 9.343   2.406   128.106 1.00 36.35  ? 167 LEU C CG  1 
ATOM   4108  C CD1 . LEU C  1 143 ? 8.869   3.840   127.943 1.00 37.50  ? 167 LEU C CD1 1 
ATOM   4109  C CD2 . LEU C  1 143 ? 10.514  2.112   127.161 1.00 37.25  ? 167 LEU C CD2 1 
ATOM   4110  N N   . ASP C  1 144 ? 10.060  1.456   132.581 1.00 41.19  ? 168 ASP C N   1 
ATOM   4111  C CA  . ASP C  1 144 ? 9.936   0.535   133.745 1.00 43.46  ? 168 ASP C CA  1 
ATOM   4112  C C   . ASP C  1 144 ? 11.092  0.899   134.655 1.00 44.42  ? 168 ASP C C   1 
ATOM   4113  O O   . ASP C  1 144 ? 12.222  0.531   134.405 1.00 46.72  ? 168 ASP C O   1 
ATOM   4114  C CB  . ASP C  1 144 ? 10.060  -0.929  133.281 1.00 44.40  ? 168 ASP C CB  1 
ATOM   4115  C CG  . ASP C  1 144 ? 9.825   -1.980  134.411 1.00 45.77  ? 168 ASP C CG  1 
ATOM   4116  O OD1 . ASP C  1 144 ? 10.046  -1.708  135.608 1.00 48.25  ? 168 ASP C OD1 1 
ATOM   4117  O OD2 . ASP C  1 144 ? 9.456   -3.132  134.071 1.00 44.54  ? 168 ASP C OD2 1 
ATOM   4118  N N   . SER C  1 145 ? 10.833  1.656   135.688 1.00 44.83  ? 169 SER C N   1 
ATOM   4119  C CA  . SER C  1 145 ? 11.913  2.054   136.572 1.00 46.73  ? 169 SER C CA  1 
ATOM   4120  C C   . SER C  1 145 ? 12.350  0.948   137.520 1.00 45.07  ? 169 SER C C   1 
ATOM   4121  O O   . SER C  1 145 ? 13.173  1.174   138.349 1.00 46.31  ? 169 SER C O   1 
ATOM   4122  C CB  . SER C  1 145 ? 11.508  3.299   137.378 1.00 46.77  ? 169 SER C CB  1 
ATOM   4123  O OG  . SER C  1 145 ? 10.286  3.034   137.973 1.00 46.46  ? 169 SER C OG  1 
ATOM   4124  N N   . THR C  1 146 ? 11.784  -0.230  137.447 1.00 45.37  ? 170 THR C N   1 
ATOM   4125  C CA  . THR C  1 146 ? 12.379  -1.377  138.148 1.00 46.92  ? 170 THR C CA  1 
ATOM   4126  C C   . THR C  1 146 ? 13.623  -1.904  137.425 1.00 45.30  ? 170 THR C C   1 
ATOM   4127  O O   . THR C  1 146 ? 14.664  -2.114  138.052 1.00 46.72  ? 170 THR C O   1 
ATOM   4128  C CB  . THR C  1 146 ? 11.307  -2.450  138.339 1.00 47.94  ? 170 THR C CB  1 
ATOM   4129  O OG1 . THR C  1 146 ? 10.361  -1.858  139.216 1.00 47.34  ? 170 THR C OG1 1 
ATOM   4130  C CG2 . THR C  1 146 ? 11.843  -3.778  138.962 1.00 49.84  ? 170 THR C CG2 1 
ATOM   4131  N N   . ILE C  1 147 ? 13.497  -2.063  136.111 1.00 42.22  ? 171 ILE C N   1 
ATOM   4132  C CA  . ILE C  1 147 ? 14.560  -2.591  135.260 1.00 42.45  ? 171 ILE C CA  1 
ATOM   4133  C C   . ILE C  1 147 ? 15.478  -1.543  134.594 1.00 39.51  ? 171 ILE C C   1 
ATOM   4134  O O   . ILE C  1 147 ? 16.681  -1.779  134.381 1.00 37.61  ? 171 ILE C O   1 
ATOM   4135  C CB  . ILE C  1 147 ? 13.940  -3.525  134.189 1.00 43.14  ? 171 ILE C CB  1 
ATOM   4136  C CG1 . ILE C  1 147 ? 13.157  -4.658  134.892 1.00 42.88  ? 171 ILE C CG1 1 
ATOM   4137  C CG2 . ILE C  1 147 ? 15.024  -4.122  133.262 1.00 42.50  ? 171 ILE C CG2 1 
ATOM   4138  C CD1 . ILE C  1 147 ? 12.067  -5.232  134.030 1.00 43.05  ? 171 ILE C CD1 1 
ATOM   4139  N N   . ASP C  1 148 ? 14.874  -0.423  134.240 1.00 38.17  ? 172 ASP C N   1 
ATOM   4140  C CA  . ASP C  1 148 ? 15.551  0.734   133.668 1.00 38.44  ? 172 ASP C CA  1 
ATOM   4141  C C   . ASP C  1 148 ? 16.215  0.447   132.316 1.00 38.51  ? 172 ASP C C   1 
ATOM   4142  O O   . ASP C  1 148 ? 17.424  0.508   132.170 1.00 43.23  ? 172 ASP C O   1 
ATOM   4143  C CB  . ASP C  1 148 ? 16.524  1.385   134.678 1.00 37.80  ? 172 ASP C CB  1 
ATOM   4144  C CG  . ASP C  1 148 ? 15.843  2.349   135.608 1.00 38.52  ? 172 ASP C CG  1 
ATOM   4145  O OD1 . ASP C  1 148 ? 14.998  3.165   135.174 1.00 43.28  ? 172 ASP C OD1 1 
ATOM   4146  O OD2 . ASP C  1 148 ? 16.188  2.352   136.789 1.00 38.24  ? 172 ASP C OD2 1 
ATOM   4147  N N   . TYR C  1 149 ? 15.407  0.179   131.312 1.00 37.12  ? 173 TYR C N   1 
ATOM   4148  C CA  . TYR C  1 149 ? 15.929  -0.218  130.039 1.00 35.81  ? 173 TYR C CA  1 
ATOM   4149  C C   . TYR C  1 149 ? 15.624  0.837   129.014 1.00 36.23  ? 173 TYR C C   1 
ATOM   4150  O O   . TYR C  1 149 ? 14.697  1.664   129.189 1.00 38.85  ? 173 TYR C O   1 
ATOM   4151  C CB  . TYR C  1 149 ? 15.365  -1.567  129.649 1.00 35.19  ? 173 TYR C CB  1 
ATOM   4152  C CG  . TYR C  1 149 ? 13.876  -1.664  129.569 1.00 35.62  ? 173 TYR C CG  1 
ATOM   4153  C CD1 . TYR C  1 149 ? 13.181  -1.312  128.396 1.00 36.58  ? 173 TYR C CD1 1 
ATOM   4154  C CD2 . TYR C  1 149 ? 13.150  -2.192  130.624 1.00 36.30  ? 173 TYR C CD2 1 
ATOM   4155  C CE1 . TYR C  1 149 ? 11.778  -1.455  128.309 1.00 37.61  ? 173 TYR C CE1 1 
ATOM   4156  C CE2 . TYR C  1 149 ? 11.750  -2.336  130.567 1.00 37.12  ? 173 TYR C CE2 1 
ATOM   4157  C CZ  . TYR C  1 149 ? 11.058  -1.976  129.419 1.00 37.60  ? 173 TYR C CZ  1 
ATOM   4158  O OH  . TYR C  1 149 ? 9.707   -2.199  129.366 1.00 35.95  ? 173 TYR C OH  1 
ATOM   4159  N N   . PHE C  1 150 ? 16.383  0.814   127.928 1.00 34.29  ? 174 PHE C N   1 
ATOM   4160  C CA  . PHE C  1 150 ? 16.178  1.783   126.885 1.00 32.46  ? 174 PHE C CA  1 
ATOM   4161  C C   . PHE C  1 150 ? 16.781  1.321   125.590 1.00 32.54  ? 174 PHE C C   1 
ATOM   4162  O O   . PHE C  1 150 ? 17.599  0.406   125.581 1.00 32.72  ? 174 PHE C O   1 
ATOM   4163  C CB  . PHE C  1 150 ? 16.780  3.097   127.324 1.00 32.90  ? 174 PHE C CB  1 
ATOM   4164  C CG  . PHE C  1 150 ? 18.252  3.039   127.650 1.00 32.69  ? 174 PHE C CG  1 
ATOM   4165  C CD1 . PHE C  1 150 ? 18.682  2.819   128.946 1.00 32.64  ? 174 PHE C CD1 1 
ATOM   4166  C CD2 . PHE C  1 150 ? 19.195  3.285   126.655 1.00 33.43  ? 174 PHE C CD2 1 
ATOM   4167  C CE1 . PHE C  1 150 ? 20.023  2.810   129.274 1.00 33.51  ? 174 PHE C CE1 1 
ATOM   4168  C CE2 . PHE C  1 150 ? 20.542  3.260   126.947 1.00 35.02  ? 174 PHE C CE2 1 
ATOM   4169  C CZ  . PHE C  1 150 ? 20.967  3.024   128.279 1.00 35.45  ? 174 PHE C CZ  1 
ATOM   4170  N N   . GLN C  1 151 ? 16.385  1.968   124.495 1.00 32.11  ? 175 GLN C N   1 
ATOM   4171  C CA  . GLN C  1 151 ? 16.816  1.566   123.157 1.00 31.40  ? 175 GLN C CA  1 
ATOM   4172  C C   . GLN C  1 151 ? 18.171  2.135   122.800 1.00 33.81  ? 175 GLN C C   1 
ATOM   4173  O O   . GLN C  1 151 ? 18.499  3.225   123.216 1.00 35.66  ? 175 GLN C O   1 
ATOM   4174  C CB  . GLN C  1 151 ? 15.826  2.088   122.158 1.00 29.25  ? 175 GLN C CB  1 
ATOM   4175  C CG  . GLN C  1 151 ? 14.477  1.431   122.234 1.00 28.30  ? 175 GLN C CG  1 
ATOM   4176  C CD  . GLN C  1 151 ? 13.518  2.026   121.218 1.00 28.02  ? 175 GLN C CD  1 
ATOM   4177  O OE1 . GLN C  1 151 ? 13.073  3.179   121.363 1.00 30.02  ? 175 GLN C OE1 1 
ATOM   4178  N NE2 . GLN C  1 151 ? 13.204  1.283   120.200 1.00 25.83  ? 175 GLN C NE2 1 
ATOM   4179  N N   . PRO C  1 152 ? 18.968  1.418   122.014 1.00 37.43  ? 176 PRO C N   1 
ATOM   4180  C CA  . PRO C  1 152 ? 20.104  2.092   121.446 1.00 40.02  ? 176 PRO C CA  1 
ATOM   4181  C C   . PRO C  1 152 ? 19.709  3.229   120.540 1.00 46.58  ? 176 PRO C C   1 
ATOM   4182  O O   . PRO C  1 152 ? 18.611  3.280   119.975 1.00 41.64  ? 176 PRO C O   1 
ATOM   4183  C CB  . PRO C  1 152 ? 20.814  1.000   120.672 1.00 37.93  ? 176 PRO C CB  1 
ATOM   4184  C CG  . PRO C  1 152 ? 20.602  -0.190  121.489 1.00 37.76  ? 176 PRO C CG  1 
ATOM   4185  C CD  . PRO C  1 152 ? 19.176  -0.040  122.011 1.00 38.54  ? 176 PRO C CD  1 
ATOM   4186  N N   . ASN C  1 153 ? 20.660  4.157   120.448 1.00 62.70  ? 177 ASN C N   1 
ATOM   4187  C CA  . ASN C  1 153 ? 20.388  5.550   120.023 1.00 68.95  ? 177 ASN C CA  1 
ATOM   4188  C C   . ASN C  1 153 ? 20.173  5.386   118.485 1.00 75.07  ? 177 ASN C C   1 
ATOM   4189  O O   . ASN C  1 153 ? 21.055  4.931   117.742 1.00 65.66  ? 177 ASN C O   1 
ATOM   4190  C CB  . ASN C  1 153 ? 21.493  6.583   120.561 1.00 64.26  ? 177 ASN C CB  1 
ATOM   4191  C CG  . ASN C  1 153 ? 21.903  6.352   122.092 1.00 62.20  ? 177 ASN C CG  1 
ATOM   4192  O OD1 . ASN C  1 153 ? 22.563  5.402   122.485 1.00 51.10  ? 177 ASN C OD1 1 
ATOM   4193  N ND2 . ASN C  1 153 ? 21.507  7.260   122.918 1.00 66.11  ? 177 ASN C ND2 1 
ATOM   4194  N N   . ASN C  1 154 ? 18.933  5.635   118.057 1.00 90.10  ? 178 ASN C N   1 
ATOM   4195  C CA  . ASN C  1 154 ? 18.483  5.278   116.693 1.00 98.10  ? 178 ASN C CA  1 
ATOM   4196  C C   . ASN C  1 154 ? 17.538  6.322   116.076 1.00 100.35 ? 178 ASN C C   1 
ATOM   4197  O O   . ASN C  1 154 ? 17.127  7.309   116.750 1.00 97.35  ? 178 ASN C O   1 
ATOM   4198  C CB  . ASN C  1 154 ? 17.812  3.887   116.713 1.00 99.61  ? 178 ASN C CB  1 
ATOM   4199  C CG  . ASN C  1 154 ? 17.775  3.240   115.349 1.00 95.47  ? 178 ASN C CG  1 
ATOM   4200  O OD1 . ASN C  1 154 ? 17.134  3.748   114.448 1.00 93.60  ? 178 ASN C OD1 1 
ATOM   4201  N ND2 . ASN C  1 154 ? 18.481  2.138   115.189 1.00 90.07  ? 178 ASN C ND2 1 
ATOM   4202  N N   . LYS C  1 155 ? 17.252  6.113   114.783 1.00 93.15  ? 179 LYS C N   1 
ATOM   4203  C CA  . LYS C  1 155 ? 16.211  6.845   114.076 1.00 95.19  ? 179 LYS C CA  1 
ATOM   4204  C C   . LYS C  1 155 ? 14.946  5.977   113.797 1.00 83.35  ? 179 LYS C C   1 
ATOM   4205  O O   . LYS C  1 155 ? 14.014  6.013   114.550 1.00 76.91  ? 179 LYS C O   1 
ATOM   4206  C CB  . LYS C  1 155 ? 16.776  7.529   112.797 1.00 108.80 ? 179 LYS C CB  1 
ATOM   4207  C CG  . LYS C  1 155 ? 17.517  8.880   113.017 1.00 113.76 ? 179 LYS C CG  1 
ATOM   4208  C CD  . LYS C  1 155 ? 17.600  9.740   111.724 1.00 113.20 ? 179 LYS C CD  1 
ATOM   4209  C CE  . LYS C  1 155 ? 18.138  11.158  111.950 1.00 109.63 ? 179 LYS C CE  1 
ATOM   4210  N NZ  . LYS C  1 155 ? 17.441  11.930  113.030 1.00 109.24 ? 179 LYS C NZ  1 
ATOM   4211  N N   . ARG C  1 156 ? 14.894  5.195   112.740 1.00 83.62  ? 180 ARG C N   1 
ATOM   4212  C CA  . ARG C  1 156 ? 13.626  4.565   112.353 1.00 85.47  ? 180 ARG C CA  1 
ATOM   4213  C C   . ARG C  1 156 ? 13.069  3.462   113.264 1.00 79.22  ? 180 ARG C C   1 
ATOM   4214  O O   . ARG C  1 156 ? 11.994  2.965   112.951 1.00 79.93  ? 180 ARG C O   1 
ATOM   4215  C CB  . ARG C  1 156 ? 13.718  4.009   110.924 1.00 96.65  ? 180 ARG C CB  1 
ATOM   4216  C CG  . ARG C  1 156 ? 14.528  2.718   110.745 1.00 102.57 ? 180 ARG C CG  1 
ATOM   4217  C CD  . ARG C  1 156 ? 14.559  2.289   109.272 1.00 108.22 ? 180 ARG C CD  1 
ATOM   4218  N NE  . ARG C  1 156 ? 15.197  3.307   108.413 1.00 105.41 ? 180 ARG C NE  1 
ATOM   4219  C CZ  . ARG C  1 156 ? 16.503  3.418   108.160 1.00 100.40 ? 180 ARG C CZ  1 
ATOM   4220  N NH1 . ARG C  1 156 ? 16.942  4.403   107.384 1.00 96.35  ? 180 ARG C NH1 1 
ATOM   4221  N NH2 . ARG C  1 156 ? 17.380  2.564   108.673 1.00 102.75 ? 180 ARG C NH2 1 
ATOM   4222  N N   . ASN C  1 157 ? 13.790  3.059   114.331 1.00 69.29  ? 181 ASN C N   1 
ATOM   4223  C CA  . ASN C  1 157 ? 13.330  2.037   115.334 1.00 55.97  ? 181 ASN C CA  1 
ATOM   4224  C C   . ASN C  1 157 ? 12.886  2.552   116.688 1.00 46.54  ? 181 ASN C C   1 
ATOM   4225  O O   . ASN C  1 157 ? 12.592  1.767   117.565 1.00 39.23  ? 181 ASN C O   1 
ATOM   4226  C CB  . ASN C  1 157 ? 14.448  1.038   115.567 1.00 58.24  ? 181 ASN C CB  1 
ATOM   4227  C CG  . ASN C  1 157 ? 14.713  0.230   114.333 1.00 66.15  ? 181 ASN C CG  1 
ATOM   4228  O OD1 . ASN C  1 157 ? 13.768  -0.274  113.713 1.00 68.57  ? 181 ASN C OD1 1 
ATOM   4229  N ND2 . ASN C  1 157 ? 15.983  0.157   113.910 1.00 72.76  ? 181 ASN C ND2 1 
ATOM   4230  N N   . GLN C  1 158 ? 12.822  3.871   116.856 1.00 41.78  ? 182 GLN C N   1 
ATOM   4231  C CA  . GLN C  1 158 ? 12.560  4.483   118.163 1.00 39.48  ? 182 GLN C CA  1 
ATOM   4232  C C   . GLN C  1 158 ? 11.121  4.373   118.442 1.00 36.00  ? 182 GLN C C   1 
ATOM   4233  O O   . GLN C  1 158 ? 10.341  4.623   117.602 1.00 33.48  ? 182 GLN C O   1 
ATOM   4234  C CB  . GLN C  1 158 ? 12.941  5.947   118.175 1.00 40.59  ? 182 GLN C CB  1 
ATOM   4235  C CG  . GLN C  1 158 ? 12.683  6.763   119.431 1.00 40.51  ? 182 GLN C CG  1 
ATOM   4236  C CD  . GLN C  1 158 ? 13.291  8.153   119.272 1.00 40.32  ? 182 GLN C CD  1 
ATOM   4237  O OE1 . GLN C  1 158 ? 13.481  8.598   118.153 1.00 42.00  ? 182 GLN C OE1 1 
ATOM   4238  N NE2 . GLN C  1 158 ? 13.590  8.835   120.372 1.00 40.02  ? 182 GLN C NE2 1 
ATOM   4239  N N   . LEU C  1 159 ? 10.800  3.957   119.645 1.00 35.58  ? 183 LEU C N   1 
ATOM   4240  C CA  . LEU C  1 159 ? 9.432   3.809   120.090 1.00 34.67  ? 183 LEU C CA  1 
ATOM   4241  C C   . LEU C  1 159 ? 8.685   5.146   119.935 1.00 33.67  ? 183 LEU C C   1 
ATOM   4242  O O   . LEU C  1 159 ? 9.258   6.251   120.213 1.00 33.86  ? 183 LEU C O   1 
ATOM   4243  C CB  . LEU C  1 159 ? 9.425   3.430   121.576 1.00 34.18  ? 183 LEU C CB  1 
ATOM   4244  C CG  . LEU C  1 159 ? 9.293   2.019   122.099 1.00 35.46  ? 183 LEU C CG  1 
ATOM   4245  C CD1 . LEU C  1 159 ? 9.371   0.911   121.051 1.00 36.99  ? 183 LEU C CD1 1 
ATOM   4246  C CD2 . LEU C  1 159 ? 10.283  1.790   123.214 1.00 35.47  ? 183 LEU C CD2 1 
ATOM   4247  N N   . TRP C  1 160 ? 7.446   5.011   119.476 1.00 30.99  ? 184 TRP C N   1 
ATOM   4248  C CA  . TRP C  1 160 ? 6.440   6.045   119.558 1.00 31.55  ? 184 TRP C CA  1 
ATOM   4249  C C   . TRP C  1 160 ? 5.685   5.940   120.865 1.00 31.90  ? 184 TRP C C   1 
ATOM   4250  O O   . TRP C  1 160 ? 5.475   4.843   121.385 1.00 30.44  ? 184 TRP C O   1 
ATOM   4251  C CB  . TRP C  1 160 ? 5.393   5.903   118.448 1.00 30.80  ? 184 TRP C CB  1 
ATOM   4252  C CG  . TRP C  1 160 ? 5.933   6.154   117.041 1.00 30.28  ? 184 TRP C CG  1 
ATOM   4253  C CD1 . TRP C  1 160 ? 6.233   5.229   116.108 1.00 28.79  ? 184 TRP C CD1 1 
ATOM   4254  C CD2 . TRP C  1 160 ? 6.186   7.437   116.440 1.00 29.84  ? 184 TRP C CD2 1 
ATOM   4255  N NE1 . TRP C  1 160 ? 6.647   5.829   114.974 1.00 29.21  ? 184 TRP C NE1 1 
ATOM   4256  C CE2 . TRP C  1 160 ? 6.636   7.187   115.137 1.00 29.06  ? 184 TRP C CE2 1 
ATOM   4257  C CE3 . TRP C  1 160 ? 6.073   8.763   116.892 1.00 28.63  ? 184 TRP C CE3 1 
ATOM   4258  C CZ2 . TRP C  1 160 ? 6.961   8.186   114.266 1.00 28.08  ? 184 TRP C CZ2 1 
ATOM   4259  C CZ3 . TRP C  1 160 ? 6.418   9.722   116.076 1.00 28.84  ? 184 TRP C CZ3 1 
ATOM   4260  C CH2 . TRP C  1 160 ? 6.874   9.446   114.745 1.00 28.92  ? 184 TRP C CH2 1 
ATOM   4261  N N   . LEU C  1 161 ? 5.232   7.102   121.325 1.00 32.54  ? 185 LEU C N   1 
ATOM   4262  C CA  . LEU C  1 161 ? 4.514   7.254   122.584 1.00 33.09  ? 185 LEU C CA  1 
ATOM   4263  C C   . LEU C  1 161 ? 3.264   8.002   122.281 1.00 32.31  ? 185 LEU C C   1 
ATOM   4264  O O   . LEU C  1 161 ? 3.264   8.850   121.405 1.00 31.56  ? 185 LEU C O   1 
ATOM   4265  C CB  . LEU C  1 161 ? 5.362   8.080   123.560 1.00 33.86  ? 185 LEU C CB  1 
ATOM   4266  C CG  . LEU C  1 161 ? 6.826   7.614   123.736 1.00 33.77  ? 185 LEU C CG  1 
ATOM   4267  C CD1 . LEU C  1 161 ? 7.679   8.691   124.356 1.00 34.43  ? 185 LEU C CD1 1 
ATOM   4268  C CD2 . LEU C  1 161 ? 6.905   6.397   124.609 1.00 33.06  ? 185 LEU C CD2 1 
ATOM   4269  N N   . ARG C  1 162 ? 2.207   7.699   123.001 1.00 33.38  ? 186 ARG C N   1 
ATOM   4270  C CA  . ARG C  1 162 ? 0.944   8.458   122.896 1.00 35.20  ? 186 ARG C CA  1 
ATOM   4271  C C   . ARG C  1 162 ? 1.172   9.793   123.504 1.00 35.37  ? 186 ARG C C   1 
ATOM   4272  O O   . ARG C  1 162 ? 1.872   9.884   124.509 1.00 37.97  ? 186 ARG C O   1 
ATOM   4273  C CB  . ARG C  1 162 ? -0.133  7.778   123.704 1.00 36.20  ? 186 ARG C CB  1 
ATOM   4274  C CG  . ARG C  1 162 ? -1.366  8.574   123.912 1.00 37.22  ? 186 ARG C CG  1 
ATOM   4275  C CD  . ARG C  1 162 ? -2.540  7.665   124.289 1.00 40.50  ? 186 ARG C CD  1 
ATOM   4276  N NE  . ARG C  1 162 ? -2.658  7.480   125.745 1.00 41.54  ? 186 ARG C NE  1 
ATOM   4277  C CZ  . ARG C  1 162 ? -3.279  8.317   126.563 1.00 42.31  ? 186 ARG C CZ  1 
ATOM   4278  N NH1 . ARG C  1 162 ? -3.222  8.079   127.868 1.00 41.65  ? 186 ARG C NH1 1 
ATOM   4279  N NH2 . ARG C  1 162 ? -3.869  9.437   126.096 1.00 42.76  ? 186 ARG C NH2 1 
ATOM   4280  N N   . LEU C  1 163 ? 0.610   10.831  122.904 1.00 35.80  ? 187 LEU C N   1 
ATOM   4281  C CA  . LEU C  1 163 ? 0.680   12.212  123.477 1.00 35.51  ? 187 LEU C CA  1 
ATOM   4282  C C   . LEU C  1 163 ? -0.515  12.383  124.417 1.00 34.45  ? 187 LEU C C   1 
ATOM   4283  O O   . LEU C  1 163 ? -1.646  12.517  123.964 1.00 30.93  ? 187 LEU C O   1 
ATOM   4284  C CB  . LEU C  1 163 ? 0.626   13.263  122.380 1.00 34.69  ? 187 LEU C CB  1 
ATOM   4285  C CG  . LEU C  1 163 ? 1.229   14.636  122.552 1.00 34.47  ? 187 LEU C CG  1 
ATOM   4286  C CD1 . LEU C  1 163 ? 0.404   15.664  121.791 1.00 34.35  ? 187 LEU C CD1 1 
ATOM   4287  C CD2 . LEU C  1 163 ? 1.352   15.050  123.968 1.00 35.77  ? 187 LEU C CD2 1 
ATOM   4288  N N   . GLN C  1 164 ? -0.248  12.305  125.712 1.00 35.90  ? 188 GLN C N   1 
ATOM   4289  C CA  . GLN C  1 164 ? -1.288  12.395  126.719 1.00 38.73  ? 188 GLN C CA  1 
ATOM   4290  C C   . GLN C  1 164 ? -1.548  13.869  127.058 1.00 42.04  ? 188 GLN C C   1 
ATOM   4291  O O   . GLN C  1 164 ? -0.626  14.750  126.917 1.00 38.20  ? 188 GLN C O   1 
ATOM   4292  C CB  . GLN C  1 164 ? -0.872  11.664  127.978 1.00 38.35  ? 188 GLN C CB  1 
ATOM   4293  C CG  . GLN C  1 164 ? -0.709  10.212  127.755 1.00 39.88  ? 188 GLN C CG  1 
ATOM   4294  C CD  . GLN C  1 164 ? -0.090  9.474   128.921 1.00 40.89  ? 188 GLN C CD  1 
ATOM   4295  O OE1 . GLN C  1 164 ? 0.986   8.903   128.757 1.00 43.26  ? 188 GLN C OE1 1 
ATOM   4296  N NE2 . GLN C  1 164 ? -0.762  9.446   130.081 1.00 39.84  ? 188 GLN C NE2 1 
ATOM   4297  N N   . THR C  1 165 ? -2.779  14.135  127.531 1.00 44.51  ? 189 THR C N   1 
ATOM   4298  C CA  . THR C  1 165 ? -3.065  15.472  127.967 1.00 49.83  ? 189 THR C CA  1 
ATOM   4299  C C   . THR C  1 165 ? -2.181  15.833  129.194 1.00 53.34  ? 189 THR C C   1 
ATOM   4300  O O   . THR C  1 165 ? -1.597  16.945  129.256 1.00 47.55  ? 189 THR C O   1 
ATOM   4301  C CB  . THR C  1 165 ? -4.543  15.691  128.229 1.00 51.25  ? 189 THR C CB  1 
ATOM   4302  O OG1 . THR C  1 165 ? -5.279  15.296  127.068 1.00 52.17  ? 189 THR C OG1 1 
ATOM   4303  C CG2 . THR C  1 165 ? -4.805  17.189  128.482 1.00 50.78  ? 189 THR C CG2 1 
ATOM   4304  N N   . ALA C  1 166 ? -2.005  14.851  130.092 1.00 54.98  ? 190 ALA C N   1 
ATOM   4305  C CA  . ALA C  1 166 ? -1.481  15.134  131.409 1.00 52.70  ? 190 ALA C CA  1 
ATOM   4306  C C   . ALA C  1 166 ? -0.395  14.225  131.932 1.00 48.73  ? 190 ALA C C   1 
ATOM   4307  O O   . ALA C  1 166 ? 0.501   14.699  132.617 1.00 51.70  ? 190 ALA C O   1 
ATOM   4308  C CB  . ALA C  1 166 ? -2.625  15.186  132.417 1.00 54.43  ? 190 ALA C CB  1 
ATOM   4309  N N   . GLY C  1 167 ? -0.468  12.933  131.748 1.00 44.28  ? 191 GLY C N   1 
ATOM   4310  C CA  . GLY C  1 167 ? 0.431   12.089  132.559 1.00 43.49  ? 191 GLY C CA  1 
ATOM   4311  C C   . GLY C  1 167 ? 1.636   11.638  131.772 1.00 43.79  ? 191 GLY C C   1 
ATOM   4312  O O   . GLY C  1 167 ? 1.978   10.464  131.787 1.00 48.19  ? 191 GLY C O   1 
ATOM   4313  N N   . ASN C  1 168 ? 2.278   12.536  131.037 1.00 41.16  ? 192 ASN C N   1 
ATOM   4314  C CA  . ASN C  1 168 ? 3.277   12.088  130.092 1.00 39.20  ? 192 ASN C CA  1 
ATOM   4315  C C   . ASN C  1 168 ? 4.508   11.516  130.812 1.00 37.87  ? 192 ASN C C   1 
ATOM   4316  O O   . ASN C  1 168 ? 4.780   11.844  131.946 1.00 38.55  ? 192 ASN C O   1 
ATOM   4317  C CB  . ASN C  1 168 ? 3.660   13.201  129.128 1.00 38.41  ? 192 ASN C CB  1 
ATOM   4318  C CG  . ASN C  1 168 ? 2.620   13.408  128.084 1.00 37.11  ? 192 ASN C CG  1 
ATOM   4319  O OD1 . ASN C  1 168 ? 2.546   12.622  127.135 1.00 34.78  ? 192 ASN C OD1 1 
ATOM   4320  N ND2 . ASN C  1 168 ? 1.769   14.427  128.269 1.00 36.07  ? 192 ASN C ND2 1 
ATOM   4321  N N   . VAL C  1 169 ? 5.225   10.664  130.122 1.00 34.22  ? 193 VAL C N   1 
ATOM   4322  C CA  . VAL C  1 169 ? 6.312   9.982   130.700 1.00 34.44  ? 193 VAL C CA  1 
ATOM   4323  C C   . VAL C  1 169 ? 7.613   10.871  130.741 1.00 35.63  ? 193 VAL C C   1 
ATOM   4324  O O   . VAL C  1 169 ? 8.040   11.514  129.778 1.00 34.18  ? 193 VAL C O   1 
ATOM   4325  C CB  . VAL C  1 169 ? 6.482   8.654   129.926 1.00 34.63  ? 193 VAL C CB  1 
ATOM   4326  C CG1 . VAL C  1 169 ? 7.245   8.844   128.604 1.00 34.44  ? 193 VAL C CG1 1 
ATOM   4327  C CG2 . VAL C  1 169 ? 7.084   7.565   130.797 1.00 34.83  ? 193 VAL C CG2 1 
ATOM   4328  N N   . ASP C  1 170 ? 8.238   10.899  131.901 1.00 37.17  ? 194 ASP C N   1 
ATOM   4329  C CA  . ASP C  1 170 ? 9.573   11.406  132.053 1.00 37.18  ? 194 ASP C CA  1 
ATOM   4330  C C   . ASP C  1 170 ? 10.497  10.703  131.059 1.00 37.01  ? 194 ASP C C   1 
ATOM   4331  O O   . ASP C  1 170 ? 10.366  9.515   130.822 1.00 36.90  ? 194 ASP C O   1 
ATOM   4332  C CB  . ASP C  1 170 ? 10.056  11.141  133.485 1.00 38.20  ? 194 ASP C CB  1 
ATOM   4333  C CG  . ASP C  1 170 ? 9.436   12.091  134.501 1.00 40.14  ? 194 ASP C CG  1 
ATOM   4334  O OD1 . ASP C  1 170 ? 8.666   12.999  134.071 1.00 41.22  ? 194 ASP C OD1 1 
ATOM   4335  O OD2 . ASP C  1 170 ? 9.729   11.943  135.715 1.00 38.77  ? 194 ASP C OD2 1 
ATOM   4336  N N   . HIS C  1 171 ? 11.375  11.502  130.461 1.00 36.95  ? 195 HIS C N   1 
ATOM   4337  C CA  . HIS C  1 171 ? 12.503  11.100  129.664 1.00 36.36  ? 195 HIS C CA  1 
ATOM   4338  C C   . HIS C  1 171 ? 13.730  11.567  130.408 1.00 37.12  ? 195 HIS C C   1 
ATOM   4339  O O   . HIS C  1 171 ? 13.684  12.548  131.141 1.00 38.56  ? 195 HIS C O   1 
ATOM   4340  C CB  . HIS C  1 171 ? 12.524  11.789  128.301 1.00 35.69  ? 195 HIS C CB  1 
ATOM   4341  C CG  . HIS C  1 171 ? 11.492  11.285  127.369 1.00 34.79  ? 195 HIS C CG  1 
ATOM   4342  N ND1 . HIS C  1 171 ? 10.145  11.322  127.666 1.00 33.36  ? 195 HIS C ND1 1 
ATOM   4343  C CD2 . HIS C  1 171 ? 11.605  10.720  126.143 1.00 35.32  ? 195 HIS C CD2 1 
ATOM   4344  C CE1 . HIS C  1 171 ? 9.473   10.800  126.655 1.00 34.53  ? 195 HIS C CE1 1 
ATOM   4345  N NE2 . HIS C  1 171 ? 10.332  10.424  125.715 1.00 34.04  ? 195 HIS C NE2 1 
ATOM   4346  N N   . VAL C  1 172 ? 14.848  10.909  130.139 1.00 36.34  ? 196 VAL C N   1 
ATOM   4347  C CA  . VAL C  1 172 ? 15.904  10.945  131.060 1.00 34.77  ? 196 VAL C CA  1 
ATOM   4348  C C   . VAL C  1 172 ? 17.190  11.166  130.377 1.00 34.56  ? 196 VAL C C   1 
ATOM   4349  O O   . VAL C  1 172 ? 17.356  10.815  129.179 1.00 29.04  ? 196 VAL C O   1 
ATOM   4350  C CB  . VAL C  1 172 ? 15.880  9.679   131.888 1.00 34.77  ? 196 VAL C CB  1 
ATOM   4351  C CG1 . VAL C  1 172 ? 16.843  8.645   131.420 1.00 33.63  ? 196 VAL C CG1 1 
ATOM   4352  C CG2 . VAL C  1 172 ? 16.083  10.001  133.353 1.00 37.26  ? 196 VAL C CG2 1 
ATOM   4353  N N   . GLY C  1 173 ? 18.086  11.744  131.203 1.00 35.26  ? 197 GLY C N   1 
ATOM   4354  C CA  . GLY C  1 173 ? 19.064  12.560  130.656 1.00 36.71  ? 197 GLY C CA  1 
ATOM   4355  C C   . GLY C  1 173 ? 20.226  13.151  131.372 1.00 37.40  ? 197 GLY C C   1 
ATOM   4356  O O   . GLY C  1 173 ? 21.329  12.806  130.982 1.00 40.47  ? 197 GLY C O   1 
ATOM   4357  N N   . LEU C  1 174 ? 20.082  14.156  132.240 1.00 36.63  ? 198 LEU C N   1 
ATOM   4358  C CA  . LEU C  1 174 ? 21.336  14.891  132.622 1.00 35.72  ? 198 LEU C CA  1 
ATOM   4359  C C   . LEU C  1 174 ? 21.694  14.989  134.087 1.00 34.94  ? 198 LEU C C   1 
ATOM   4360  O O   . LEU C  1 174 ? 20.905  15.480  134.877 1.00 34.80  ? 198 LEU C O   1 
ATOM   4361  C CB  . LEU C  1 174 ? 21.348  16.281  132.065 1.00 35.58  ? 198 LEU C CB  1 
ATOM   4362  C CG  . LEU C  1 174 ? 22.772  16.737  131.789 1.00 35.73  ? 198 LEU C CG  1 
ATOM   4363  C CD1 . LEU C  1 174 ? 23.320  16.081  130.519 1.00 35.18  ? 198 LEU C CD1 1 
ATOM   4364  C CD2 . LEU C  1 174 ? 22.737  18.248  131.610 1.00 35.59  ? 198 LEU C CD2 1 
ATOM   4365  N N   . GLY C  1 175 ? 22.875  14.496  134.429 1.00 33.58  ? 199 GLY C N   1 
ATOM   4366  C CA  . GLY C  1 175 ? 23.471  14.760  135.730 1.00 33.89  ? 199 GLY C CA  1 
ATOM   4367  C C   . GLY C  1 175 ? 24.519  15.885  135.697 1.00 33.13  ? 199 GLY C C   1 
ATOM   4368  O O   . GLY C  1 175 ? 25.302  16.037  134.750 1.00 33.08  ? 199 GLY C O   1 
ATOM   4369  N N   . THR C  1 176 ? 24.543  16.645  136.771 1.00 32.04  ? 200 THR C N   1 
ATOM   4370  C CA  . THR C  1 176 ? 25.400  17.792  136.886 1.00 32.13  ? 200 THR C CA  1 
ATOM   4371  C C   . THR C  1 176 ? 26.070  17.824  138.232 1.00 31.77  ? 200 THR C C   1 
ATOM   4372  O O   . THR C  1 176 ? 25.468  17.438  139.246 1.00 29.87  ? 200 THR C O   1 
ATOM   4373  C CB  . THR C  1 176 ? 24.611  19.096  136.757 1.00 32.61  ? 200 THR C CB  1 
ATOM   4374  O OG1 . THR C  1 176 ? 23.481  19.090  137.640 1.00 32.53  ? 200 THR C OG1 1 
ATOM   4375  C CG2 . THR C  1 176 ? 24.116  19.193  135.383 1.00 33.18  ? 200 THR C CG2 1 
ATOM   4376  N N   . ALA C  1 177 ? 27.330  18.278  138.189 1.00 31.45  ? 201 ALA C N   1 
ATOM   4377  C CA  . ALA C  1 177 ? 28.182  18.518  139.341 1.00 30.90  ? 201 ALA C CA  1 
ATOM   4378  C C   . ALA C  1 177 ? 28.839  19.894  139.037 1.00 31.06  ? 201 ALA C C   1 
ATOM   4379  O O   . ALA C  1 177 ? 29.709  20.003  138.143 1.00 30.59  ? 201 ALA C O   1 
ATOM   4380  C CB  . ALA C  1 177 ? 29.215  17.407  139.457 1.00 30.39  ? 201 ALA C CB  1 
ATOM   4381  N N   . PHE C  1 178 ? 28.383  20.954  139.716 1.00 30.86  ? 202 PHE C N   1 
ATOM   4382  C CA  . PHE C  1 178 ? 29.053  22.298  139.592 1.00 30.34  ? 202 PHE C CA  1 
ATOM   4383  C C   . PHE C  1 178 ? 29.873  22.499  140.848 1.00 28.73  ? 202 PHE C C   1 
ATOM   4384  O O   . PHE C  1 178 ? 29.398  22.235  141.964 1.00 26.07  ? 202 PHE C O   1 
ATOM   4385  C CB  . PHE C  1 178 ? 28.044  23.483  139.516 1.00 30.31  ? 202 PHE C CB  1 
ATOM   4386  C CG  . PHE C  1 178 ? 27.257  23.571  138.253 1.00 29.86  ? 202 PHE C CG  1 
ATOM   4387  C CD1 . PHE C  1 178 ? 26.221  22.650  137.984 1.00 29.87  ? 202 PHE C CD1 1 
ATOM   4388  C CD2 . PHE C  1 178 ? 27.490  24.617  137.359 1.00 29.72  ? 202 PHE C CD2 1 
ATOM   4389  C CE1 . PHE C  1 178 ? 25.464  22.762  136.819 1.00 29.56  ? 202 PHE C CE1 1 
ATOM   4390  C CE2 . PHE C  1 178 ? 26.734  24.753  136.216 1.00 29.50  ? 202 PHE C CE2 1 
ATOM   4391  C CZ  . PHE C  1 178 ? 25.714  23.826  135.948 1.00 30.07  ? 202 PHE C CZ  1 
ATOM   4392  N N   . GLU C  1 179 ? 31.073  22.986  140.664 1.00 28.85  ? 203 GLU C N   1 
ATOM   4393  C CA  . GLU C  1 179 ? 31.945  23.240  141.782 1.00 30.96  ? 203 GLU C CA  1 
ATOM   4394  C C   . GLU C  1 179 ? 31.392  24.441  142.569 1.00 33.13  ? 203 GLU C C   1 
ATOM   4395  O O   . GLU C  1 179 ? 30.871  25.433  141.979 1.00 34.28  ? 203 GLU C O   1 
ATOM   4396  C CB  . GLU C  1 179 ? 33.369  23.485  141.285 1.00 31.73  ? 203 GLU C CB  1 
ATOM   4397  C CG  . GLU C  1 179 ? 34.358  23.747  142.386 1.00 32.98  ? 203 GLU C CG  1 
ATOM   4398  C CD  . GLU C  1 179 ? 35.813  23.662  141.960 1.00 33.65  ? 203 GLU C CD  1 
ATOM   4399  O OE1 . GLU C  1 179 ? 36.635  23.346  142.805 1.00 37.22  ? 203 GLU C OE1 1 
ATOM   4400  O OE2 . GLU C  1 179 ? 36.184  23.929  140.818 1.00 34.60  ? 203 GLU C OE2 1 
ATOM   4401  N N   . ASN C  1 180 ? 31.430  24.324  143.897 1.00 33.87  ? 204 ASN C N   1 
ATOM   4402  C CA  . ASN C  1 180 ? 30.928  25.377  144.761 1.00 34.27  ? 204 ASN C CA  1 
ATOM   4403  C C   . ASN C  1 180 ? 31.897  26.571  144.802 1.00 34.65  ? 204 ASN C C   1 
ATOM   4404  O O   . ASN C  1 180 ? 33.054  26.411  144.467 1.00 33.18  ? 204 ASN C O   1 
ATOM   4405  C CB  . ASN C  1 180 ? 30.736  24.838  146.170 1.00 35.27  ? 204 ASN C CB  1 
ATOM   4406  C CG  . ASN C  1 180 ? 29.503  24.004  146.320 1.00 34.06  ? 204 ASN C CG  1 
ATOM   4407  O OD1 . ASN C  1 180 ? 28.394  24.385  145.846 1.00 35.78  ? 204 ASN C OD1 1 
ATOM   4408  N ND2 . ASN C  1 180 ? 29.642  22.939  147.078 1.00 31.01  ? 204 ASN C ND2 1 
ATOM   4409  N N   . SER C  1 181 ? 31.391  27.731  145.236 1.00 35.60  ? 205 SER C N   1 
ATOM   4410  C CA  . SER C  1 181 ? 32.087  29.017  145.162 1.00 35.84  ? 205 SER C CA  1 
ATOM   4411  C C   . SER C  1 181 ? 31.725  29.927  146.369 1.00 37.29  ? 205 SER C C   1 
ATOM   4412  O O   . SER C  1 181 ? 30.643  29.875  146.949 1.00 34.61  ? 205 SER C O   1 
ATOM   4413  C CB  . SER C  1 181 ? 31.704  29.704  143.836 1.00 36.33  ? 205 SER C CB  1 
ATOM   4414  O OG  . SER C  1 181 ? 32.165  31.073  143.621 1.00 37.23  ? 205 SER C OG  1 
ATOM   4415  N N   . ILE C  1 182 ? 32.703  30.729  146.743 1.00 39.72  ? 206 ILE C N   1 
ATOM   4416  C CA  . ILE C  1 182 ? 32.581  31.922  147.578 1.00 39.96  ? 206 ILE C CA  1 
ATOM   4417  C C   . ILE C  1 182 ? 31.399  32.816  147.160 1.00 40.60  ? 206 ILE C C   1 
ATOM   4418  O O   . ILE C  1 182 ? 30.707  33.329  148.035 1.00 39.20  ? 206 ILE C O   1 
ATOM   4419  C CB  . ILE C  1 182 ? 34.013  32.598  147.616 1.00 41.98  ? 206 ILE C CB  1 
ATOM   4420  C CG1 . ILE C  1 182 ? 34.658  32.208  148.908 1.00 45.21  ? 206 ILE C CG1 1 
ATOM   4421  C CG2 . ILE C  1 182 ? 34.093  34.111  147.470 1.00 41.12  ? 206 ILE C CG2 1 
ATOM   4422  C CD1 . ILE C  1 182 ? 34.702  30.696  149.130 1.00 49.24  ? 206 ILE C CD1 1 
ATOM   4423  N N   . TYR C  1 183 ? 31.132  32.943  145.847 1.00 40.74  ? 207 TYR C N   1 
ATOM   4424  C CA  . TYR C  1 183 ? 29.947  33.650  145.317 1.00 40.70  ? 207 TYR C CA  1 
ATOM   4425  C C   . TYR C  1 183 ? 28.808  32.744  144.808 1.00 40.84  ? 207 TYR C C   1 
ATOM   4426  O O   . TYR C  1 183 ? 29.042  31.624  144.450 1.00 42.38  ? 207 TYR C O   1 
ATOM   4427  C CB  . TYR C  1 183 ? 30.357  34.542  144.178 1.00 41.32  ? 207 TYR C CB  1 
ATOM   4428  C CG  . TYR C  1 183 ? 31.635  35.288  144.425 1.00 43.21  ? 207 TYR C CG  1 
ATOM   4429  C CD1 . TYR C  1 183 ? 31.743  36.293  145.405 1.00 43.66  ? 207 TYR C CD1 1 
ATOM   4430  C CD2 . TYR C  1 183 ? 32.742  34.993  143.652 1.00 45.84  ? 207 TYR C CD2 1 
ATOM   4431  C CE1 . TYR C  1 183 ? 32.944  36.982  145.592 1.00 45.82  ? 207 TYR C CE1 1 
ATOM   4432  C CE2 . TYR C  1 183 ? 33.953  35.629  143.838 1.00 48.74  ? 207 TYR C CE2 1 
ATOM   4433  C CZ  . TYR C  1 183 ? 34.079  36.625  144.805 1.00 49.56  ? 207 TYR C CZ  1 
ATOM   4434  O OH  . TYR C  1 183 ? 35.369  37.196  144.854 1.00 49.21  ? 207 TYR C OH  1 
ATOM   4435  N N   . ASP C  1 184 ? 27.568  33.239  144.799 1.00 42.03  ? 208 ASP C N   1 
ATOM   4436  C CA  . ASP C  1 184 ? 26.440  32.593  144.095 1.00 41.33  ? 208 ASP C CA  1 
ATOM   4437  C C   . ASP C  1 184 ? 26.706  32.419  142.591 1.00 39.38  ? 208 ASP C C   1 
ATOM   4438  O O   . ASP C  1 184 ? 27.293  33.290  141.940 1.00 36.87  ? 208 ASP C O   1 
ATOM   4439  C CB  . ASP C  1 184 ? 25.181  33.458  144.187 1.00 44.81  ? 208 ASP C CB  1 
ATOM   4440  C CG  . ASP C  1 184 ? 24.399  33.276  145.472 1.00 48.67  ? 208 ASP C CG  1 
ATOM   4441  O OD1 . ASP C  1 184 ? 24.963  32.843  146.498 1.00 55.98  ? 208 ASP C OD1 1 
ATOM   4442  O OD2 . ASP C  1 184 ? 23.193  33.624  145.458 1.00 49.51  ? 208 ASP C OD2 1 
ATOM   4443  N N   . GLN C  1 185 ? 26.239  31.297  142.034 1.00 38.88  ? 209 GLN C N   1 
ATOM   4444  C CA  . GLN C  1 185 ? 26.384  31.017  140.599 1.00 37.90  ? 209 GLN C CA  1 
ATOM   4445  C C   . GLN C  1 185 ? 25.019  30.699  140.099 1.00 37.86  ? 209 GLN C C   1 
ATOM   4446  O O   . GLN C  1 185 ? 24.476  29.702  140.486 1.00 36.15  ? 209 GLN C O   1 
ATOM   4447  C CB  . GLN C  1 185 ? 27.302  29.833  140.333 1.00 36.42  ? 209 GLN C CB  1 
ATOM   4448  C CG  . GLN C  1 185 ? 28.681  30.046  140.820 1.00 35.51  ? 209 GLN C CG  1 
ATOM   4449  C CD  . GLN C  1 185 ? 29.476  28.767  140.880 1.00 36.06  ? 209 GLN C CD  1 
ATOM   4450  O OE1 . GLN C  1 185 ? 30.289  28.539  140.006 1.00 36.74  ? 209 GLN C OE1 1 
ATOM   4451  N NE2 . GLN C  1 185 ? 29.265  27.930  141.919 1.00 35.29  ? 209 GLN C NE2 1 
ATOM   4452  N N   . GLU C  1 186 ? 24.510  31.567  139.226 1.00 41.22  ? 210 GLU C N   1 
ATOM   4453  C CA  . GLU C  1 186 ? 23.126  31.611  138.801 1.00 43.58  ? 210 GLU C CA  1 
ATOM   4454  C C   . GLU C  1 186 ? 23.142  31.381  137.254 1.00 40.69  ? 210 GLU C C   1 
ATOM   4455  O O   . GLU C  1 186 ? 24.104  31.749  136.569 1.00 38.44  ? 210 GLU C O   1 
ATOM   4456  C CB  . GLU C  1 186 ? 22.505  32.957  139.242 1.00 51.68  ? 210 GLU C CB  1 
ATOM   4457  C CG  . GLU C  1 186 ? 21.152  32.845  139.944 1.00 61.53  ? 210 GLU C CG  1 
ATOM   4458  C CD  . GLU C  1 186 ? 20.147  33.997  139.638 1.00 70.03  ? 210 GLU C CD  1 
ATOM   4459  O OE1 . GLU C  1 186 ? 19.083  33.775  138.923 1.00 68.97  ? 210 GLU C OE1 1 
ATOM   4460  O OE2 . GLU C  1 186 ? 20.425  35.116  140.146 1.00 74.53  ? 210 GLU C OE2 1 
ATOM   4461  N N   . TYR C  1 187 ? 22.119  30.664  136.752 1.00 37.90  ? 211 TYR C N   1 
ATOM   4462  C CA  . TYR C  1 187 ? 22.008  30.178  135.375 1.00 34.23  ? 211 TYR C CA  1 
ATOM   4463  C C   . TYR C  1 187 ? 20.543  30.195  134.956 1.00 33.31  ? 211 TYR C C   1 
ATOM   4464  O O   . TYR C  1 187 ? 19.641  29.870  135.751 1.00 31.62  ? 211 TYR C O   1 
ATOM   4465  C CB  . TYR C  1 187 ? 22.536  28.751  135.249 1.00 33.44  ? 211 TYR C CB  1 
ATOM   4466  C CG  . TYR C  1 187 ? 24.071  28.595  135.374 1.00 33.55  ? 211 TYR C CG  1 
ATOM   4467  C CD1 . TYR C  1 187 ? 24.914  28.695  134.260 1.00 33.82  ? 211 TYR C CD1 1 
ATOM   4468  C CD2 . TYR C  1 187 ? 24.677  28.325  136.600 1.00 34.09  ? 211 TYR C CD2 1 
ATOM   4469  C CE1 . TYR C  1 187 ? 26.304  28.536  134.378 1.00 33.54  ? 211 TYR C CE1 1 
ATOM   4470  C CE2 . TYR C  1 187 ? 26.061  28.169  136.727 1.00 33.96  ? 211 TYR C CE2 1 
ATOM   4471  C CZ  . TYR C  1 187 ? 26.869  28.256  135.612 1.00 33.58  ? 211 TYR C CZ  1 
ATOM   4472  O OH  . TYR C  1 187 ? 28.231  28.103  135.739 1.00 33.53  ? 211 TYR C OH  1 
ATOM   4473  N N   . ASN C  1 188 ? 20.318  30.668  133.734 1.00 32.36  ? 212 ASN C N   1 
ATOM   4474  C CA  . ASN C  1 188 ? 19.097  30.448  133.011 1.00 32.07  ? 212 ASN C CA  1 
ATOM   4475  C C   . ASN C  1 188 ? 19.311  29.172  132.223 1.00 32.40  ? 212 ASN C C   1 
ATOM   4476  O O   . ASN C  1 188 ? 20.219  29.079  131.405 1.00 31.45  ? 212 ASN C O   1 
ATOM   4477  C CB  . ASN C  1 188 ? 18.802  31.622  132.090 1.00 32.41  ? 212 ASN C CB  1 
ATOM   4478  C CG  . ASN C  1 188 ? 18.239  32.820  132.849 1.00 33.55  ? 212 ASN C CG  1 
ATOM   4479  O OD1 . ASN C  1 188 ? 18.933  33.859  133.045 1.00 33.66  ? 212 ASN C OD1 1 
ATOM   4480  N ND2 . ASN C  1 188 ? 16.964  32.681  133.306 1.00 32.69  ? 212 ASN C ND2 1 
ATOM   4481  N N   . ILE C  1 189 ? 18.498  28.168  132.515 1.00 33.40  ? 213 ILE C N   1 
ATOM   4482  C CA  . ILE C  1 189 ? 18.592  26.884  131.873 1.00 34.66  ? 213 ILE C CA  1 
ATOM   4483  C C   . ILE C  1 189 ? 17.518  26.792  130.841 1.00 34.98  ? 213 ILE C C   1 
ATOM   4484  O O   . ILE C  1 189 ? 16.339  26.828  131.167 1.00 34.86  ? 213 ILE C O   1 
ATOM   4485  C CB  . ILE C  1 189 ? 18.419  25.730  132.857 1.00 36.59  ? 213 ILE C CB  1 
ATOM   4486  C CG1 . ILE C  1 189 ? 19.655  25.637  133.746 1.00 39.03  ? 213 ILE C CG1 1 
ATOM   4487  C CG2 . ILE C  1 189 ? 18.262  24.407  132.103 1.00 37.47  ? 213 ILE C CG2 1 
ATOM   4488  C CD1 . ILE C  1 189 ? 19.537  24.684  134.929 1.00 40.99  ? 213 ILE C CD1 1 
ATOM   4489  N N   . ARG C  1 190 ? 17.928  26.649  129.593 1.00 36.34  ? 214 ARG C N   1 
ATOM   4490  C CA  . ARG C  1 190 ? 16.972  26.494  128.522 1.00 37.47  ? 214 ARG C CA  1 
ATOM   4491  C C   . ARG C  1 190 ? 17.078  25.095  127.983 1.00 36.91  ? 214 ARG C C   1 
ATOM   4492  O O   . ARG C  1 190 ? 18.146  24.695  127.531 1.00 38.19  ? 214 ARG C O   1 
ATOM   4493  C CB  . ARG C  1 190 ? 17.248  27.462  127.401 1.00 37.63  ? 214 ARG C CB  1 
ATOM   4494  C CG  . ARG C  1 190 ? 16.261  27.305  126.274 1.00 37.55  ? 214 ARG C CG  1 
ATOM   4495  C CD  . ARG C  1 190 ? 16.781  28.003  125.078 1.00 38.50  ? 214 ARG C CD  1 
ATOM   4496  N NE  . ARG C  1 190 ? 16.102  29.241  124.841 1.00 40.21  ? 214 ARG C NE  1 
ATOM   4497  C CZ  . ARG C  1 190 ? 16.477  30.059  123.879 1.00 44.31  ? 214 ARG C CZ  1 
ATOM   4498  N NH1 . ARG C  1 190 ? 15.813  31.218  123.680 1.00 46.22  ? 214 ARG C NH1 1 
ATOM   4499  N NH2 . ARG C  1 190 ? 17.535  29.715  123.117 1.00 45.75  ? 214 ARG C NH2 1 
ATOM   4500  N N   . VAL C  1 191 ? 15.946  24.403  127.997 1.00 35.58  ? 215 VAL C N   1 
ATOM   4501  C CA  . VAL C  1 191 ? 15.814  23.036  127.521 1.00 35.22  ? 215 VAL C CA  1 
ATOM   4502  C C   . VAL C  1 191 ? 14.952  23.082  126.272 1.00 34.29  ? 215 VAL C C   1 
ATOM   4503  O O   . VAL C  1 191 ? 13.836  23.619  126.281 1.00 33.25  ? 215 VAL C O   1 
ATOM   4504  C CB  . VAL C  1 191 ? 15.156  22.120  128.596 1.00 35.38  ? 215 VAL C CB  1 
ATOM   4505  C CG1 . VAL C  1 191 ? 14.920  20.724  128.074 1.00 35.31  ? 215 VAL C CG1 1 
ATOM   4506  C CG2 . VAL C  1 191 ? 16.062  22.024  129.817 1.00 35.99  ? 215 VAL C CG2 1 
ATOM   4507  N N   . THR C  1 192 ? 15.460  22.471  125.214 1.00 34.51  ? 216 THR C N   1 
ATOM   4508  C CA  . THR C  1 192 ? 14.778  22.408  123.910 1.00 34.83  ? 216 THR C CA  1 
ATOM   4509  C C   . THR C  1 192 ? 14.570  20.935  123.542 1.00 33.90  ? 216 THR C C   1 
ATOM   4510  O O   . THR C  1 192 ? 15.539  20.182  123.551 1.00 35.33  ? 216 THR C O   1 
ATOM   4511  C CB  . THR C  1 192 ? 15.635  23.126  122.845 1.00 34.32  ? 216 THR C CB  1 
ATOM   4512  O OG1 . THR C  1 192 ? 15.831  24.473  123.276 1.00 34.55  ? 216 THR C OG1 1 
ATOM   4513  C CG2 . THR C  1 192 ? 14.988  23.117  121.457 1.00 34.11  ? 216 THR C CG2 1 
ATOM   4514  N N   . MET C  1 193 ? 13.335  20.544  123.248 1.00 32.83  ? 217 MET C N   1 
ATOM   4515  C CA  . MET C  1 193 ? 13.021  19.205  122.768 1.00 35.08  ? 217 MET C CA  1 
ATOM   4516  C C   . MET C  1 193 ? 12.814  19.242  121.278 1.00 33.09  ? 217 MET C C   1 
ATOM   4517  O O   . MET C  1 193 ? 12.061  20.065  120.796 1.00 30.44  ? 217 MET C O   1 
ATOM   4518  C CB  . MET C  1 193 ? 11.794  18.615  123.490 1.00 38.39  ? 217 MET C CB  1 
ATOM   4519  C CG  . MET C  1 193 ? 12.094  18.418  124.999 1.00 43.01  ? 217 MET C CG  1 
ATOM   4520  S SD  . MET C  1 193 ? 10.918  17.463  126.028 1.00 50.65  ? 217 MET C SD  1 
ATOM   4521  C CE  . MET C  1 193 ? 9.495   17.373  124.909 1.00 44.82  ? 217 MET C CE  1 
ATOM   4522  N N   . TYR C  1 194 ? 13.530  18.384  120.548 1.00 33.30  ? 218 TYR C N   1 
ATOM   4523  C CA  . TYR C  1 194 ? 13.294  18.203  119.099 1.00 34.16  ? 218 TYR C CA  1 
ATOM   4524  C C   . TYR C  1 194 ? 12.339  17.008  118.961 1.00 33.73  ? 218 TYR C C   1 
ATOM   4525  O O   . TYR C  1 194 ? 12.719  15.857  119.130 1.00 33.26  ? 218 TYR C O   1 
ATOM   4526  C CB  . TYR C  1 194 ? 14.621  18.053  118.314 1.00 34.64  ? 218 TYR C CB  1 
ATOM   4527  C CG  . TYR C  1 194 ? 15.468  19.316  118.385 1.00 36.14  ? 218 TYR C CG  1 
ATOM   4528  C CD1 . TYR C  1 194 ? 16.306  19.566  119.492 1.00 37.75  ? 218 TYR C CD1 1 
ATOM   4529  C CD2 . TYR C  1 194 ? 15.370  20.294  117.417 1.00 36.24  ? 218 TYR C CD2 1 
ATOM   4530  C CE1 . TYR C  1 194 ? 17.053  20.732  119.599 1.00 39.28  ? 218 TYR C CE1 1 
ATOM   4531  C CE2 . TYR C  1 194 ? 16.108  21.474  117.511 1.00 37.99  ? 218 TYR C CE2 1 
ATOM   4532  C CZ  . TYR C  1 194 ? 16.956  21.691  118.599 1.00 39.75  ? 218 TYR C CZ  1 
ATOM   4533  O OH  . TYR C  1 194 ? 17.682  22.874  118.707 1.00 41.37  ? 218 TYR C OH  1 
ATOM   4534  N N   . VAL C  1 195 ? 11.076  17.315  118.686 1.00 33.50  ? 219 VAL C N   1 
ATOM   4535  C CA  . VAL C  1 195 ? 9.995   16.365  118.869 1.00 33.30  ? 219 VAL C CA  1 
ATOM   4536  C C   . VAL C  1 195 ? 9.453   16.012  117.524 1.00 32.99  ? 219 VAL C C   1 
ATOM   4537  O O   . VAL C  1 195 ? 9.333   16.878  116.686 1.00 32.77  ? 219 VAL C O   1 
ATOM   4538  C CB  . VAL C  1 195 ? 8.882   16.975  119.719 1.00 33.35  ? 219 VAL C CB  1 
ATOM   4539  C CG1 . VAL C  1 195 ? 7.764   15.985  119.932 1.00 33.80  ? 219 VAL C CG1 1 
ATOM   4540  C CG2 . VAL C  1 195 ? 9.440   17.326  121.069 1.00 34.13  ? 219 VAL C CG2 1 
ATOM   4541  N N   . GLN C  1 196 ? 9.157   14.733  117.318 1.00 33.37  ? 220 GLN C N   1 
ATOM   4542  C CA  . GLN C  1 196 ? 8.483   14.274  116.110 1.00 34.27  ? 220 GLN C CA  1 
ATOM   4543  C C   . GLN C  1 196 ? 7.067   13.825  116.478 1.00 31.08  ? 220 GLN C C   1 
ATOM   4544  O O   . GLN C  1 196 ? 6.904   13.013  117.328 1.00 31.32  ? 220 GLN C O   1 
ATOM   4545  C CB  . GLN C  1 196 ? 9.281   13.123  115.515 1.00 37.86  ? 220 GLN C CB  1 
ATOM   4546  C CG  . GLN C  1 196 ? 9.049   12.852  114.026 1.00 40.52  ? 220 GLN C CG  1 
ATOM   4547  C CD  . GLN C  1 196 ? 10.153  11.973  113.417 1.00 40.41  ? 220 GLN C CD  1 
ATOM   4548  O OE1 . GLN C  1 196 ? 10.521  10.978  114.022 1.00 43.55  ? 220 GLN C OE1 1 
ATOM   4549  N NE2 . GLN C  1 196 ? 10.668  12.332  112.241 1.00 38.10  ? 220 GLN C NE2 1 
ATOM   4550  N N   . PHE C  1 197 ? 6.052   14.423  115.884 1.00 29.13  ? 221 PHE C N   1 
ATOM   4551  C CA  . PHE C  1 197 ? 4.649   14.062  116.131 1.00 27.90  ? 221 PHE C CA  1 
ATOM   4552  C C   . PHE C  1 197 ? 4.045   13.316  114.930 1.00 27.71  ? 221 PHE C C   1 
ATOM   4553  O O   . PHE C  1 197 ? 4.432   13.493  113.793 1.00 26.50  ? 221 PHE C O   1 
ATOM   4554  C CB  . PHE C  1 197 ? 3.811   15.315  116.378 1.00 27.35  ? 221 PHE C CB  1 
ATOM   4555  C CG  . PHE C  1 197 ? 4.208   16.110  117.594 1.00 26.00  ? 221 PHE C CG  1 
ATOM   4556  C CD1 . PHE C  1 197 ? 3.691   15.786  118.830 1.00 26.15  ? 221 PHE C CD1 1 
ATOM   4557  C CD2 . PHE C  1 197 ? 5.004   17.218  117.472 1.00 25.41  ? 221 PHE C CD2 1 
ATOM   4558  C CE1 . PHE C  1 197 ? 4.011   16.518  119.960 1.00 26.43  ? 221 PHE C CE1 1 
ATOM   4559  C CE2 . PHE C  1 197 ? 5.315   17.967  118.564 1.00 25.61  ? 221 PHE C CE2 1 
ATOM   4560  C CZ  . PHE C  1 197 ? 4.846   17.605  119.832 1.00 25.81  ? 221 PHE C CZ  1 
ATOM   4561  N N   . ARG C  1 198 ? 3.092   12.453  115.177 1.00 28.43  ? 222 ARG C N   1 
ATOM   4562  C CA  . ARG C  1 198 ? 2.566   11.638  114.109 1.00 28.92  ? 222 ARG C CA  1 
ATOM   4563  C C   . ARG C  1 198 ? 1.094   11.464  114.350 1.00 28.81  ? 222 ARG C C   1 
ATOM   4564  O O   . ARG C  1 198 ? 0.662   11.393  115.495 1.00 28.67  ? 222 ARG C O   1 
ATOM   4565  C CB  . ARG C  1 198 ? 3.282   10.289  114.109 1.00 30.17  ? 222 ARG C CB  1 
ATOM   4566  C CG  . ARG C  1 198 ? 2.741   9.231   113.124 1.00 31.59  ? 222 ARG C CG  1 
ATOM   4567  C CD  . ARG C  1 198 ? 3.425   7.880   113.264 1.00 32.62  ? 222 ARG C CD  1 
ATOM   4568  N NE  . ARG C  1 198 ? 2.621   6.803   112.644 1.00 34.37  ? 222 ARG C NE  1 
ATOM   4569  C CZ  . ARG C  1 198 ? 2.918   5.502   112.683 1.00 34.06  ? 222 ARG C CZ  1 
ATOM   4570  N NH1 . ARG C  1 198 ? 2.130   4.603   112.126 1.00 33.57  ? 222 ARG C NH1 1 
ATOM   4571  N NH2 . ARG C  1 198 ? 4.007   5.085   113.303 1.00 36.65  ? 222 ARG C NH2 1 
ATOM   4572  N N   . GLU C  1 199 ? 0.342   11.434  113.257 1.00 29.60  ? 223 GLU C N   1 
ATOM   4573  C CA  . GLU C  1 199 ? -1.094  11.130  113.225 1.00 30.53  ? 223 GLU C CA  1 
ATOM   4574  C C   . GLU C  1 199 ? -1.870  12.333  113.670 1.00 30.90  ? 223 GLU C C   1 
ATOM   4575  O O   . GLU C  1 199 ? -2.285  12.421  114.834 1.00 29.97  ? 223 GLU C O   1 
ATOM   4576  C CB  . GLU C  1 199 ? -1.452  9.871   114.012 1.00 31.62  ? 223 GLU C CB  1 
ATOM   4577  C CG  . GLU C  1 199 ? -2.871  9.350   113.811 1.00 33.66  ? 223 GLU C CG  1 
ATOM   4578  C CD  . GLU C  1 199 ? -3.177  8.733   112.415 1.00 35.70  ? 223 GLU C CD  1 
ATOM   4579  O OE1 . GLU C  1 199 ? -2.255  8.205   111.722 1.00 36.38  ? 223 GLU C OE1 1 
ATOM   4580  O OE2 . GLU C  1 199 ? -4.373  8.786   111.996 1.00 36.99  ? 223 GLU C OE2 1 
ATOM   4581  N N   . PHE C  1 200 ? -2.012  13.273  112.723 1.00 31.40  ? 224 PHE C N   1 
ATOM   4582  C CA  . PHE C  1 200 ? -2.840  14.480  112.891 1.00 32.60  ? 224 PHE C CA  1 
ATOM   4583  C C   . PHE C  1 200 ? -4.210  14.018  113.304 1.00 32.51  ? 224 PHE C C   1 
ATOM   4584  O O   . PHE C  1 200 ? -4.737  13.103  112.646 1.00 32.95  ? 224 PHE C O   1 
ATOM   4585  C CB  . PHE C  1 200 ? -2.942  15.226  111.554 1.00 33.40  ? 224 PHE C CB  1 
ATOM   4586  C CG  . PHE C  1 200 ? -3.606  16.583  111.639 1.00 34.22  ? 224 PHE C CG  1 
ATOM   4587  C CD1 . PHE C  1 200 ? -2.951  17.674  112.265 1.00 35.56  ? 224 PHE C CD1 1 
ATOM   4588  C CD2 . PHE C  1 200 ? -4.841  16.805  111.059 1.00 34.39  ? 224 PHE C CD2 1 
ATOM   4589  C CE1 . PHE C  1 200 ? -3.550  18.955  112.349 1.00 35.83  ? 224 PHE C CE1 1 
ATOM   4590  C CE2 . PHE C  1 200 ? -5.428  18.067  111.105 1.00 35.93  ? 224 PHE C CE2 1 
ATOM   4591  C CZ  . PHE C  1 200 ? -4.786  19.151  111.752 1.00 36.70  ? 224 PHE C CZ  1 
ATOM   4592  N N   . ASN C  1 201 ? -4.762  14.580  114.378 1.00 32.02  ? 225 ASN C N   1 
ATOM   4593  C CA  . ASN C  1 201 ? -6.080  14.120  114.902 1.00 34.40  ? 225 ASN C CA  1 
ATOM   4594  C C   . ASN C  1 201 ? -7.113  15.220  115.163 1.00 35.65  ? 225 ASN C C   1 
ATOM   4595  O O   . ASN C  1 201 ? -7.975  15.073  116.043 1.00 33.74  ? 225 ASN C O   1 
ATOM   4596  C CB  . ASN C  1 201 ? -5.958  13.203  116.165 1.00 34.54  ? 225 ASN C CB  1 
ATOM   4597  C CG  . ASN C  1 201 ? -5.334  13.894  117.367 1.00 33.88  ? 225 ASN C CG  1 
ATOM   4598  O OD1 . ASN C  1 201 ? -5.436  15.107  117.529 1.00 33.18  ? 225 ASN C OD1 1 
ATOM   4599  N ND2 . ASN C  1 201 ? -4.662  13.102  118.223 1.00 34.48  ? 225 ASN C ND2 1 
ATOM   4600  N N   . LEU C  1 202 ? -7.054  16.308  114.400 1.00 38.09  ? 226 LEU C N   1 
ATOM   4601  C CA  . LEU C  1 202 ? -7.889  17.461  114.777 1.00 39.63  ? 226 LEU C CA  1 
ATOM   4602  C C   . LEU C  1 202 ? -9.397  17.169  114.718 1.00 37.54  ? 226 LEU C C   1 
ATOM   4603  O O   . LEU C  1 202 ? -9.917  16.775  113.659 1.00 33.50  ? 226 LEU C O   1 
ATOM   4604  C CB  . LEU C  1 202 ? -7.584  18.664  113.903 1.00 42.07  ? 226 LEU C CB  1 
ATOM   4605  C CG  . LEU C  1 202 ? -8.199  19.994  114.356 1.00 41.92  ? 226 LEU C CG  1 
ATOM   4606  C CD1 . LEU C  1 202 ? -7.246  20.804  115.238 1.00 43.51  ? 226 LEU C CD1 1 
ATOM   4607  C CD2 . LEU C  1 202 ? -8.466  20.781  113.118 1.00 43.34  ? 226 LEU C CD2 1 
ATOM   4608  N N   . LYS C  1 203 ? -10.056 17.353  115.873 1.00 36.37  ? 227 LYS C N   1 
ATOM   4609  C CA  . LYS C  1 203 ? -11.527 17.283  115.970 1.00 36.98  ? 227 LYS C CA  1 
ATOM   4610  C C   . LYS C  1 203 ? -12.130 18.666  115.641 1.00 37.64  ? 227 LYS C C   1 
ATOM   4611  O O   . LYS C  1 203 ? -11.570 19.709  116.004 1.00 36.11  ? 227 LYS C O   1 
ATOM   4612  C CB  . LYS C  1 203 ? -12.024 16.869  117.367 1.00 36.69  ? 227 LYS C CB  1 
ATOM   4613  C CG  . LYS C  1 203 ? -11.390 15.636  117.979 1.00 36.58  ? 227 LYS C CG  1 
ATOM   4614  C CD  . LYS C  1 203 ? -11.532 14.374  117.151 1.00 36.32  ? 227 LYS C CD  1 
ATOM   4615  C CE  . LYS C  1 203 ? -10.734 13.248  117.786 1.00 37.20  ? 227 LYS C CE  1 
ATOM   4616  N NZ  . LYS C  1 203 ? -9.229  13.439  117.791 1.00 37.91  ? 227 LYS C NZ  1 
ATOM   4617  N N   . ASP C  1 204 ? -13.287 18.654  114.983 1.00 37.42  ? 228 ASP C N   1 
ATOM   4618  C CA  . ASP C  1 204 ? -13.934 19.876  114.522 1.00 37.20  ? 228 ASP C CA  1 
ATOM   4619  C C   . ASP C  1 204 ? -15.472 19.869  114.765 1.00 37.65  ? 228 ASP C C   1 
ATOM   4620  O O   . ASP C  1 204 ? -16.243 19.665  113.828 1.00 39.51  ? 228 ASP C O   1 
ATOM   4621  C CB  . ASP C  1 204 ? -13.602 20.002  113.036 1.00 36.10  ? 228 ASP C CB  1 
ATOM   4622  C CG  . ASP C  1 204 ? -14.155 21.254  112.418 1.00 34.33  ? 228 ASP C CG  1 
ATOM   4623  O OD1 . ASP C  1 204 ? -13.996 22.303  113.070 1.00 31.45  ? 228 ASP C OD1 1 
ATOM   4624  O OD2 . ASP C  1 204 ? -14.700 21.150  111.270 1.00 34.58  ? 228 ASP C OD2 1 
ATOM   4625  N N   . PRO C  1 205 ? -15.921 20.055  116.022 1.00 38.29  ? 229 PRO C N   1 
ATOM   4626  C CA  . PRO C  1 205 ? -17.359 20.082  116.349 1.00 39.91  ? 229 PRO C CA  1 
ATOM   4627  C C   . PRO C  1 205 ? -18.042 21.239  115.665 1.00 42.75  ? 229 PRO C C   1 
ATOM   4628  O O   . PRO C  1 205 ? -17.366 22.236  115.374 1.00 45.25  ? 229 PRO C O   1 
ATOM   4629  C CB  . PRO C  1 205 ? -17.384 20.316  117.852 1.00 39.33  ? 229 PRO C CB  1 
ATOM   4630  C CG  . PRO C  1 205 ? -15.988 20.033  118.332 1.00 37.96  ? 229 PRO C CG  1 
ATOM   4631  C CD  . PRO C  1 205 ? -15.087 20.335  117.198 1.00 38.02  ? 229 PRO C CD  1 
ATOM   4632  N N   . PRO C  1 206 ? -19.347 21.141  115.424 1.00 47.09  ? 230 PRO C N   1 
ATOM   4633  C CA  . PRO C  1 206 ? -20.072 22.042  114.460 1.00 52.73  ? 230 PRO C CA  1 
ATOM   4634  C C   . PRO C  1 206 ? -20.707 23.378  114.920 1.00 50.24  ? 230 PRO C C   1 
ATOM   4635  O O   . PRO C  1 206 ? -20.189 24.059  115.782 1.00 47.78  ? 230 PRO C O   1 
ATOM   4636  C CB  . PRO C  1 206 ? -21.209 21.137  113.944 1.00 54.62  ? 230 PRO C CB  1 
ATOM   4637  C CG  . PRO C  1 206 ? -21.502 20.223  115.112 1.00 53.87  ? 230 PRO C CG  1 
ATOM   4638  C CD  . PRO C  1 206 ? -20.190 20.011  115.851 1.00 51.59  ? 230 PRO C CD  1 
ATOM   4639  N N   . SER D  1 19  ? 8.798   24.372  109.992 1.00 70.97  ? 43  SER D N   1 
ATOM   4640  C CA  . SER D  1 19  ? 8.307   25.699  109.452 1.00 70.76  ? 43  SER D CA  1 
ATOM   4641  C C   . SER D  1 19  ? 6.992   25.694  108.587 1.00 64.42  ? 43  SER D C   1 
ATOM   4642  O O   . SER D  1 19  ? 6.106   26.464  108.894 1.00 58.20  ? 43  SER D O   1 
ATOM   4643  C CB  . SER D  1 19  ? 9.470   26.446  108.712 1.00 74.36  ? 43  SER D CB  1 
ATOM   4644  O OG  . SER D  1 19  ? 10.351  25.562  108.009 1.00 75.02  ? 43  SER D OG  1 
ATOM   4645  N N   . HIS D  1 20  ? 6.921   24.882  107.507 1.00 62.76  ? 44  HIS D N   1 
ATOM   4646  C CA  . HIS D  1 20  ? 5.769   24.778  106.547 1.00 61.86  ? 44  HIS D CA  1 
ATOM   4647  C C   . HIS D  1 20  ? 5.051   23.456  106.902 1.00 51.50  ? 44  HIS D C   1 
ATOM   4648  O O   . HIS D  1 20  ? 5.720   22.478  107.032 1.00 46.04  ? 44  HIS D O   1 
ATOM   4649  C CB  . HIS D  1 20  ? 6.166   24.876  105.034 1.00 66.41  ? 44  HIS D CB  1 
ATOM   4650  C CG  . HIS D  1 20  ? 7.667   24.767  104.736 1.00 89.07  ? 44  HIS D CG  1 
ATOM   4651  N ND1 . HIS D  1 20  ? 8.605   25.699  105.172 1.00 100.81 ? 44  HIS D ND1 1 
ATOM   4652  C CD2 . HIS D  1 20  ? 8.386   23.867  103.988 1.00 96.28  ? 44  HIS D CD2 1 
ATOM   4653  C CE1 . HIS D  1 20  ? 9.820   25.368  104.739 1.00 94.36  ? 44  HIS D CE1 1 
ATOM   4654  N NE2 . HIS D  1 20  ? 9.716   24.262  104.017 1.00 92.77  ? 44  HIS D NE2 1 
ATOM   4655  N N   . PHE D  1 21  ? 3.730   23.469  107.176 1.00 45.24  ? 45  PHE D N   1 
ATOM   4656  C CA  . PHE D  1 21  ? 2.935   22.259  107.538 1.00 41.77  ? 45  PHE D CA  1 
ATOM   4657  C C   . PHE D  1 21  ? 1.720   22.019  106.619 1.00 38.70  ? 45  PHE D C   1 
ATOM   4658  O O   . PHE D  1 21  ? 0.851   22.861  106.585 1.00 41.20  ? 45  PHE D O   1 
ATOM   4659  C CB  . PHE D  1 21  ? 2.419   22.315  108.995 1.00 41.90  ? 45  PHE D CB  1 
ATOM   4660  C CG  . PHE D  1 21  ? 1.553   21.109  109.386 1.00 42.87  ? 45  PHE D CG  1 
ATOM   4661  C CD1 . PHE D  1 21  ? 1.989   19.785  109.144 1.00 40.45  ? 45  PHE D CD1 1 
ATOM   4662  C CD2 . PHE D  1 21  ? 0.312   21.285  110.013 1.00 43.56  ? 45  PHE D CD2 1 
ATOM   4663  C CE1 . PHE D  1 21  ? 1.215   18.702  109.482 1.00 40.17  ? 45  PHE D CE1 1 
ATOM   4664  C CE2 . PHE D  1 21  ? -0.448  20.169  110.382 1.00 41.94  ? 45  PHE D CE2 1 
ATOM   4665  C CZ  . PHE D  1 21  ? 0.004   18.895  110.103 1.00 40.42  ? 45  PHE D CZ  1 
ATOM   4666  N N   . ASN D  1 22  ? 1.650   20.882  105.914 1.00 35.33  ? 46  ASN D N   1 
ATOM   4667  C CA  . ASN D  1 22  ? 0.589   20.628  104.938 1.00 35.20  ? 46  ASN D CA  1 
ATOM   4668  C C   . ASN D  1 22  ? -0.376  19.639  105.464 1.00 35.35  ? 46  ASN D C   1 
ATOM   4669  O O   . ASN D  1 22  ? 0.053   18.576  105.843 1.00 35.85  ? 46  ASN D O   1 
ATOM   4670  C CB  . ASN D  1 22  ? 1.120   20.053  103.627 1.00 34.51  ? 46  ASN D CB  1 
ATOM   4671  C CG  . ASN D  1 22  ? 1.935   21.042  102.875 1.00 33.49  ? 46  ASN D CG  1 
ATOM   4672  O OD1 . ASN D  1 22  ? 1.464   22.149  102.514 1.00 32.83  ? 46  ASN D OD1 1 
ATOM   4673  N ND2 . ASN D  1 22  ? 3.163   20.688  102.675 1.00 30.09  ? 46  ASN D ND2 1 
ATOM   4674  N N   . THR D  1 23  ? -1.669  19.977  105.436 1.00 36.35  ? 47  THR D N   1 
ATOM   4675  C CA  . THR D  1 23  ? -2.702  19.133  105.977 1.00 36.50  ? 47  THR D CA  1 
ATOM   4676  C C   . THR D  1 23  ? -4.047  19.388  105.363 1.00 35.67  ? 47  THR D C   1 
ATOM   4677  O O   . THR D  1 23  ? -4.260  20.340  104.653 1.00 36.04  ? 47  THR D O   1 
ATOM   4678  C CB  . THR D  1 23  ? -2.832  19.363  107.477 1.00 38.74  ? 47  THR D CB  1 
ATOM   4679  O OG1 . THR D  1 23  ? -3.547  18.293  108.104 1.00 37.83  ? 47  THR D OG1 1 
ATOM   4680  C CG2 . THR D  1 23  ? -3.594  20.643  107.729 1.00 42.23  ? 47  THR D CG2 1 
ATOM   4681  N N   . ARG D  1 24  ? -4.969  18.557  105.770 1.00 35.53  ? 48  ARG D N   1 
ATOM   4682  C CA  . ARG D  1 24  ? -6.242  18.427  105.182 1.00 35.97  ? 48  ARG D CA  1 
ATOM   4683  C C   . ARG D  1 24  ? -7.303  18.464  106.304 1.00 35.07  ? 48  ARG D C   1 
ATOM   4684  O O   . ARG D  1 24  ? -7.150  17.785  107.273 1.00 35.07  ? 48  ARG D O   1 
ATOM   4685  C CB  . ARG D  1 24  ? -6.219  17.093  104.477 1.00 36.71  ? 48  ARG D CB  1 
ATOM   4686  C CG  . ARG D  1 24  ? -7.592  16.598  104.175 1.00 38.39  ? 48  ARG D CG  1 
ATOM   4687  C CD  . ARG D  1 24  ? -7.576  15.151  103.825 1.00 38.93  ? 48  ARG D CD  1 
ATOM   4688  N NE  . ARG D  1 24  ? -7.633  14.330  104.998 1.00 40.52  ? 48  ARG D NE  1 
ATOM   4689  C CZ  . ARG D  1 24  ? -7.427  13.025  104.954 1.00 43.38  ? 48  ARG D CZ  1 
ATOM   4690  N NH1 . ARG D  1 24  ? -7.226  12.413  103.777 1.00 44.18  ? 48  ARG D NH1 1 
ATOM   4691  N NH2 . ARG D  1 24  ? -7.450  12.323  106.077 1.00 44.39  ? 48  ARG D NH2 1 
ATOM   4692  N N   . LEU D  1 25  ? -8.371  19.236  106.127 1.00 35.91  ? 49  LEU D N   1 
ATOM   4693  C CA  . LEU D  1 25  ? -9.438  19.491  107.133 1.00 35.08  ? 49  LEU D CA  1 
ATOM   4694  C C   . LEU D  1 25  ? -10.759 19.268  106.446 1.00 33.38  ? 49  LEU D C   1 
ATOM   4695  O O   . LEU D  1 25  ? -10.875 19.519  105.284 1.00 32.06  ? 49  LEU D O   1 
ATOM   4696  C CB  . LEU D  1 25  ? -9.420  20.942  107.637 1.00 35.04  ? 49  LEU D CB  1 
ATOM   4697  C CG  . LEU D  1 25  ? -8.098  21.426  108.221 1.00 37.81  ? 49  LEU D CG  1 
ATOM   4698  C CD1 . LEU D  1 25  ? -8.083  22.933  108.358 1.00 39.06  ? 49  LEU D CD1 1 
ATOM   4699  C CD2 . LEU D  1 25  ? -7.775  20.831  109.573 1.00 38.23  ? 49  LEU D CD2 1 
ATOM   4700  N N   . SER D  1 26  ? -11.772 18.880  107.196 1.00 33.76  ? 50  SER D N   1 
ATOM   4701  C CA  . SER D  1 26  ? -13.043 18.464  106.641 1.00 33.66  ? 50  SER D CA  1 
ATOM   4702  C C   . SER D  1 26  ? -14.210 18.738  107.538 1.00 33.46  ? 50  SER D C   1 
ATOM   4703  O O   . SER D  1 26  ? -14.076 18.754  108.774 1.00 32.91  ? 50  SER D O   1 
ATOM   4704  C CB  . SER D  1 26  ? -12.999 16.959  106.362 1.00 33.41  ? 50  SER D CB  1 
ATOM   4705  O OG  . SER D  1 26  ? -12.410 16.716  105.089 1.00 34.34  ? 50  SER D OG  1 
ATOM   4706  N N   . ARG D  1 27  ? -15.364 18.943  106.907 1.00 33.44  ? 51  ARG D N   1 
ATOM   4707  C CA  . ARG D  1 27  ? -16.627 18.901  107.611 1.00 34.36  ? 51  ARG D CA  1 
ATOM   4708  C C   . ARG D  1 27  ? -17.709 18.378  106.731 1.00 36.03  ? 51  ARG D C   1 
ATOM   4709  O O   . ARG D  1 27  ? -17.600 18.447  105.492 1.00 35.90  ? 51  ARG D O   1 
ATOM   4710  C CB  . ARG D  1 27  ? -17.038 20.276  108.088 1.00 35.58  ? 51  ARG D CB  1 
ATOM   4711  C CG  . ARG D  1 27  ? -17.204 21.296  106.972 1.00 36.66  ? 51  ARG D CG  1 
ATOM   4712  C CD  . ARG D  1 27  ? -17.264 22.708  107.524 1.00 37.57  ? 51  ARG D CD  1 
ATOM   4713  N NE  . ARG D  1 27  ? -18.634 22.977  107.954 1.00 38.70  ? 51  ARG D NE  1 
ATOM   4714  C CZ  . ARG D  1 27  ? -19.543 23.666  107.274 1.00 37.17  ? 51  ARG D CZ  1 
ATOM   4715  N NH1 . ARG D  1 27  ? -20.719 23.739  107.780 1.00 37.78  ? 51  ARG D NH1 1 
ATOM   4716  N NH2 . ARG D  1 27  ? -19.307 24.262  106.119 1.00 37.64  ? 51  ARG D NH2 1 
ATOM   4717  N N   . THR D  1 28  ? -18.779 17.882  107.374 1.00 37.33  ? 52  THR D N   1 
ATOM   4718  C CA  . THR D  1 28  ? -19.920 17.365  106.635 1.00 35.68  ? 52  THR D CA  1 
ATOM   4719  C C   . THR D  1 28  ? -21.208 17.996  107.165 1.00 34.84  ? 52  THR D C   1 
ATOM   4720  O O   . THR D  1 28  ? -21.374 18.086  108.387 1.00 33.67  ? 52  THR D O   1 
ATOM   4721  C CB  . THR D  1 28  ? -19.961 15.842  106.693 1.00 36.01  ? 52  THR D CB  1 
ATOM   4722  O OG1 . THR D  1 28  ? -18.697 15.292  106.289 1.00 33.74  ? 52  THR D OG1 1 
ATOM   4723  C CG2 . THR D  1 28  ? -21.018 15.325  105.729 1.00 38.58  ? 52  THR D CG2 1 
ATOM   4724  N N   . PHE D  1 29  ? -22.058 18.465  106.230 1.00 32.65  ? 53  PHE D N   1 
ATOM   4725  C CA  . PHE D  1 29  ? -23.359 19.049  106.529 1.00 32.26  ? 53  PHE D CA  1 
ATOM   4726  C C   . PHE D  1 29  ? -24.435 18.564  105.570 1.00 32.32  ? 53  PHE D C   1 
ATOM   4727  O O   . PHE D  1 29  ? -24.083 17.963  104.571 1.00 33.57  ? 53  PHE D O   1 
ATOM   4728  C CB  . PHE D  1 29  ? -23.310 20.579  106.541 1.00 32.07  ? 53  PHE D CB  1 
ATOM   4729  C CG  . PHE D  1 29  ? -22.872 21.198  105.276 1.00 32.71  ? 53  PHE D CG  1 
ATOM   4730  C CD1 . PHE D  1 29  ? -23.792 21.569  104.311 1.00 32.81  ? 53  PHE D CD1 1 
ATOM   4731  C CD2 . PHE D  1 29  ? -21.538 21.466  105.067 1.00 33.50  ? 53  PHE D CD2 1 
ATOM   4732  C CE1 . PHE D  1 29  ? -23.386 22.152  103.131 1.00 33.13  ? 53  PHE D CE1 1 
ATOM   4733  C CE2 . PHE D  1 29  ? -21.114 22.007  103.871 1.00 33.27  ? 53  PHE D CE2 1 
ATOM   4734  C CZ  . PHE D  1 29  ? -22.045 22.365  102.900 1.00 33.50  ? 53  PHE D CZ  1 
ATOM   4735  N N   . GLY D  1 30  ? -25.724 18.805  105.877 1.00 31.12  ? 54  GLY D N   1 
ATOM   4736  C CA  . GLY D  1 30  ? -26.838 18.270  105.085 1.00 31.20  ? 54  GLY D CA  1 
ATOM   4737  C C   . GLY D  1 30  ? -27.306 19.271  104.018 1.00 32.87  ? 54  GLY D C   1 
ATOM   4738  O O   . GLY D  1 30  ? -27.116 20.480  104.142 1.00 33.37  ? 54  GLY D O   1 
ATOM   4739  N N   . TYR D  1 31  ? -27.912 18.784  102.950 1.00 33.97  ? 55  TYR D N   1 
ATOM   4740  C CA  . TYR D  1 31  ? -28.493 19.640  101.934 1.00 35.55  ? 55  TYR D CA  1 
ATOM   4741  C C   . TYR D  1 31  ? -29.706 18.891  101.359 1.00 35.82  ? 55  TYR D C   1 
ATOM   4742  O O   . TYR D  1 31  ? -29.622 17.736  101.126 1.00 37.88  ? 55  TYR D O   1 
ATOM   4743  C CB  . TYR D  1 31  ? -27.451 20.012  100.862 1.00 36.89  ? 55  TYR D CB  1 
ATOM   4744  C CG  . TYR D  1 31  ? -28.002 20.852  99.673  1.00 39.01  ? 55  TYR D CG  1 
ATOM   4745  C CD1 . TYR D  1 31  ? -28.763 22.025  99.877  1.00 39.37  ? 55  TYR D CD1 1 
ATOM   4746  C CD2 . TYR D  1 31  ? -27.752 20.491  98.359  1.00 39.28  ? 55  TYR D CD2 1 
ATOM   4747  C CE1 . TYR D  1 31  ? -29.243 22.797  98.807  1.00 39.03  ? 55  TYR D CE1 1 
ATOM   4748  C CE2 . TYR D  1 31  ? -28.261 21.246  97.286  1.00 39.81  ? 55  TYR D CE2 1 
ATOM   4749  C CZ  . TYR D  1 31  ? -28.995 22.398  97.504  1.00 38.99  ? 55  TYR D CZ  1 
ATOM   4750  O OH  . TYR D  1 31  ? -29.440 23.137  96.412  1.00 36.33  ? 55  TYR D OH  1 
ATOM   4751  N N   . THR D  1 32  ? -30.846 19.542  101.179 1.00 36.66  ? 56  THR D N   1 
ATOM   4752  C CA  . THR D  1 32  ? -32.047 18.872  100.707 1.00 36.91  ? 56  THR D CA  1 
ATOM   4753  C C   . THR D  1 32  ? -32.697 19.761  99.699  1.00 36.87  ? 56  THR D C   1 
ATOM   4754  O O   . THR D  1 32  ? -32.948 20.867  100.003 1.00 40.56  ? 56  THR D O   1 
ATOM   4755  C CB  . THR D  1 32  ? -33.036 18.706  101.851 1.00 38.46  ? 56  THR D CB  1 
ATOM   4756  O OG1 . THR D  1 32  ? -32.378 18.044  102.933 1.00 41.62  ? 56  THR D OG1 1 
ATOM   4757  C CG2 . THR D  1 32  ? -34.166 17.858  101.440 1.00 39.78  ? 56  THR D CG2 1 
ATOM   4758  N N   . ILE D  1 33  ? -32.910 19.298  98.493  1.00 36.04  ? 57  ILE D N   1 
ATOM   4759  C CA  . ILE D  1 33  ? -33.732 19.968  97.532  1.00 37.19  ? 57  ILE D CA  1 
ATOM   4760  C C   . ILE D  1 33  ? -35.124 19.416  97.782  1.00 40.10  ? 57  ILE D C   1 
ATOM   4761  O O   . ILE D  1 33  ? -35.311 18.180  97.773  1.00 37.38  ? 57  ILE D O   1 
ATOM   4762  C CB  . ILE D  1 33  ? -33.276 19.596  96.136  1.00 36.73  ? 57  ILE D CB  1 
ATOM   4763  C CG1 . ILE D  1 33  ? -31.881 20.140  95.916  1.00 39.26  ? 57  ILE D CG1 1 
ATOM   4764  C CG2 . ILE D  1 33  ? -34.181 20.183  95.111  1.00 36.83  ? 57  ILE D CG2 1 
ATOM   4765  C CD1 . ILE D  1 33  ? -31.008 19.228  95.111  1.00 39.82  ? 57  ILE D CD1 1 
ATOM   4766  N N   . LYS D  1 34  ? -36.091 20.305  98.016  1.00 44.07  ? 58  LYS D N   1 
ATOM   4767  C CA  . LYS D  1 34  ? -37.436 19.859  98.289  1.00 47.96  ? 58  LYS D CA  1 
ATOM   4768  C C   . LYS D  1 34  ? -38.144 19.451  97.030  1.00 47.42  ? 58  LYS D C   1 
ATOM   4769  O O   . LYS D  1 34  ? -37.863 19.943  95.952  1.00 45.19  ? 58  LYS D O   1 
ATOM   4770  C CB  . LYS D  1 34  ? -38.245 20.913  98.995  1.00 55.47  ? 58  LYS D CB  1 
ATOM   4771  C CG  . LYS D  1 34  ? -38.422 20.624  100.479 1.00 63.95  ? 58  LYS D CG  1 
ATOM   4772  C CD  . LYS D  1 34  ? -38.704 21.903  101.248 1.00 71.85  ? 58  LYS D CD  1 
ATOM   4773  C CE  . LYS D  1 34  ? -37.649 22.988  100.942 1.00 75.31  ? 58  LYS D CE  1 
ATOM   4774  N NZ  . LYS D  1 34  ? -37.415 23.884  102.104 1.00 74.92  ? 58  LYS D NZ  1 
ATOM   4775  N N   . ARG D  1 35  ? -39.085 18.526  97.180  1.00 50.02  ? 59  ARG D N   1 
ATOM   4776  C CA  . ARG D  1 35  ? -39.831 18.013  96.043  1.00 50.29  ? 59  ARG D CA  1 
ATOM   4777  C C   . ARG D  1 35  ? -40.722 19.167  95.496  1.00 49.41  ? 59  ARG D C   1 
ATOM   4778  O O   . ARG D  1 35  ? -41.143 19.959  96.279  1.00 46.60  ? 59  ARG D O   1 
ATOM   4779  C CB  . ARG D  1 35  ? -40.535 16.700  96.436  1.00 52.19  ? 59  ARG D CB  1 
ATOM   4780  C CG  . ARG D  1 35  ? -42.016 16.682  96.707  1.00 58.07  ? 59  ARG D CG  1 
ATOM   4781  C CD  . ARG D  1 35  ? -42.415 17.112  98.103  1.00 65.02  ? 59  ARG D CD  1 
ATOM   4782  N NE  . ARG D  1 35  ? -42.269 16.062  99.119  1.00 69.67  ? 59  ARG D NE  1 
ATOM   4783  C CZ  . ARG D  1 35  ? -42.733 16.129  100.376 1.00 73.26  ? 59  ARG D CZ  1 
ATOM   4784  N NH1 . ARG D  1 35  ? -43.464 17.166  100.800 1.00 76.06  ? 59  ARG D NH1 1 
ATOM   4785  N NH2 . ARG D  1 35  ? -42.498 15.120  101.215 1.00 76.21  ? 59  ARG D NH2 1 
ATOM   4786  N N   . THR D  1 36  ? -40.876 19.324  94.171  1.00 51.22  ? 60  THR D N   1 
ATOM   4787  C CA  . THR D  1 36  ? -41.864 20.228  93.567  1.00 53.78  ? 60  THR D CA  1 
ATOM   4788  C C   . THR D  1 36  ? -42.859 19.487  92.724  1.00 53.20  ? 60  THR D C   1 
ATOM   4789  O O   . THR D  1 36  ? -42.684 18.313  92.451  1.00 52.37  ? 60  THR D O   1 
ATOM   4790  C CB  . THR D  1 36  ? -41.242 21.256  92.605  1.00 58.24  ? 60  THR D CB  1 
ATOM   4791  O OG1 . THR D  1 36  ? -40.356 20.568  91.716  1.00 60.90  ? 60  THR D OG1 1 
ATOM   4792  C CG2 . THR D  1 36  ? -40.532 22.432  93.382  1.00 63.12  ? 60  THR D CG2 1 
ATOM   4793  N N   . THR D  1 37  ? -43.898 20.218  92.305  1.00 56.47  ? 61  THR D N   1 
ATOM   4794  C CA  . THR D  1 37  ? -44.875 19.781  91.289  1.00 57.68  ? 61  THR D CA  1 
ATOM   4795  C C   . THR D  1 37  ? -44.909 20.654  90.058  1.00 57.14  ? 61  THR D C   1 
ATOM   4796  O O   . THR D  1 37  ? -45.704 20.383  89.180  1.00 65.40  ? 61  THR D O   1 
ATOM   4797  C CB  . THR D  1 37  ? -46.333 19.748  91.847  1.00 59.71  ? 61  THR D CB  1 
ATOM   4798  O OG1 . THR D  1 37  ? -46.654 21.010  92.457  1.00 53.64  ? 61  THR D OG1 1 
ATOM   4799  C CG2 . THR D  1 37  ? -46.506 18.586  92.869  1.00 61.14  ? 61  THR D CG2 1 
ATOM   4800  N N   . VAL D  1 38  ? -44.117 21.720  89.998  1.00 57.65  ? 62  VAL D N   1 
ATOM   4801  C CA  . VAL D  1 38  ? -43.800 22.390  88.720  1.00 58.46  ? 62  VAL D CA  1 
ATOM   4802  C C   . VAL D  1 38  ? -43.529 21.272  87.687  1.00 61.25  ? 62  VAL D C   1 
ATOM   4803  O O   . VAL D  1 38  ? -42.689 20.385  87.899  1.00 59.96  ? 62  VAL D O   1 
ATOM   4804  C CB  . VAL D  1 38  ? -42.549 23.304  88.838  1.00 58.59  ? 62  VAL D CB  1 
ATOM   4805  C CG1 . VAL D  1 38  ? -42.190 23.873  87.476  1.00 59.77  ? 62  VAL D CG1 1 
ATOM   4806  C CG2 . VAL D  1 38  ? -42.727 24.433  89.865  1.00 55.93  ? 62  VAL D CG2 1 
ATOM   4807  N N   . LYS D  1 39  ? -44.274 21.266  86.595  1.00 65.90  ? 63  LYS D N   1 
ATOM   4808  C CA  . LYS D  1 39  ? -44.272 20.071  85.719  1.00 70.41  ? 63  LYS D CA  1 
ATOM   4809  C C   . LYS D  1 39  ? -43.096 20.164  84.760  1.00 68.79  ? 63  LYS D C   1 
ATOM   4810  O O   . LYS D  1 39  ? -42.391 19.159  84.543  1.00 68.65  ? 63  LYS D O   1 
ATOM   4811  C CB  . LYS D  1 39  ? -45.617 19.812  84.981  1.00 76.00  ? 63  LYS D CB  1 
ATOM   4812  C CG  . LYS D  1 39  ? -46.438 21.040  84.556  1.00 81.91  ? 63  LYS D CG  1 
ATOM   4813  C CD  . LYS D  1 39  ? -47.480 21.419  85.632  1.00 85.30  ? 63  LYS D CD  1 
ATOM   4814  C CE  . LYS D  1 39  ? -48.028 22.844  85.488  1.00 84.84  ? 63  LYS D CE  1 
ATOM   4815  N NZ  . LYS D  1 39  ? -47.146 23.865  86.111  1.00 82.47  ? 63  LYS D NZ  1 
ATOM   4816  N N   . THR D  1 40  ? -42.875 21.365  84.209  1.00 63.15  ? 64  THR D N   1 
ATOM   4817  C CA  . THR D  1 40  ? -41.728 21.611  83.320  1.00 60.30  ? 64  THR D CA  1 
ATOM   4818  C C   . THR D  1 40  ? -40.389 21.589  84.047  1.00 53.72  ? 64  THR D C   1 
ATOM   4819  O O   . THR D  1 40  ? -40.346 21.821  85.255  1.00 48.31  ? 64  THR D O   1 
ATOM   4820  C CB  . THR D  1 40  ? -41.825 22.987  82.655  1.00 63.75  ? 64  THR D CB  1 
ATOM   4821  O OG1 . THR D  1 40  ? -42.034 23.979  83.683  1.00 65.96  ? 64  THR D OG1 1 
ATOM   4822  C CG2 . THR D  1 40  ? -42.964 23.004  81.616  1.00 65.79  ? 64  THR D CG2 1 
ATOM   4823  N N   . PRO D  1 41  ? -39.285 21.346  83.304  1.00 51.56  ? 65  PRO D N   1 
ATOM   4824  C CA  . PRO D  1 41  ? -37.923 21.431  83.933  1.00 50.18  ? 65  PRO D CA  1 
ATOM   4825  C C   . PRO D  1 41  ? -37.635 22.737  84.675  1.00 46.62  ? 65  PRO D C   1 
ATOM   4826  O O   . PRO D  1 41  ? -37.892 23.839  84.147  1.00 47.01  ? 65  PRO D O   1 
ATOM   4827  C CB  . PRO D  1 41  ? -36.949 21.223  82.752  1.00 50.60  ? 65  PRO D CB  1 
ATOM   4828  C CG  . PRO D  1 41  ? -37.739 20.381  81.782  1.00 53.14  ? 65  PRO D CG  1 
ATOM   4829  C CD  . PRO D  1 41  ? -39.221 20.748  81.949  1.00 52.83  ? 65  PRO D CD  1 
ATOM   4830  N N   . SER D  1 42  ? -37.145 22.601  85.905  1.00 42.26  ? 66  SER D N   1 
ATOM   4831  C CA  . SER D  1 42  ? -36.825 23.763  86.751  1.00 38.26  ? 66  SER D CA  1 
ATOM   4832  C C   . SER D  1 42  ? -35.585 23.447  87.607  1.00 36.57  ? 66  SER D C   1 
ATOM   4833  O O   . SER D  1 42  ? -35.234 22.261  87.779  1.00 32.32  ? 66  SER D O   1 
ATOM   4834  C CB  . SER D  1 42  ? -38.017 24.201  87.596  1.00 36.04  ? 66  SER D CB  1 
ATOM   4835  O OG  . SER D  1 42  ? -38.106 23.405  88.753  1.00 35.33  ? 66  SER D OG  1 
ATOM   4836  N N   . TRP D  1 43  ? -34.899 24.504  88.084  1.00 35.64  ? 67  TRP D N   1 
ATOM   4837  C CA  . TRP D  1 43  ? -33.639 24.294  88.802  1.00 35.57  ? 67  TRP D CA  1 
ATOM   4838  C C   . TRP D  1 43  ? -33.528 24.959  90.165  1.00 34.44  ? 67  TRP D C   1 
ATOM   4839  O O   . TRP D  1 43  ? -33.907 26.086  90.315  1.00 34.84  ? 67  TRP D O   1 
ATOM   4840  C CB  . TRP D  1 43  ? -32.447 24.668  87.932  1.00 34.89  ? 67  TRP D CB  1 
ATOM   4841  C CG  . TRP D  1 43  ? -32.123 23.617  86.980  1.00 34.05  ? 67  TRP D CG  1 
ATOM   4842  C CD1 . TRP D  1 43  ? -31.208 22.662  87.119  1.00 33.88  ? 67  TRP D CD1 1 
ATOM   4843  C CD2 . TRP D  1 43  ? -32.733 23.424  85.707  1.00 34.51  ? 67  TRP D CD2 1 
ATOM   4844  N NE1 . TRP D  1 43  ? -31.189 21.857  85.997  1.00 34.26  ? 67  TRP D NE1 1 
ATOM   4845  C CE2 . TRP D  1 43  ? -32.127 22.313  85.120  1.00 33.71  ? 67  TRP D CE2 1 
ATOM   4846  C CE3 . TRP D  1 43  ? -33.743 24.105  84.999  1.00 34.96  ? 67  TRP D CE3 1 
ATOM   4847  C CZ2 . TRP D  1 43  ? -32.484 21.850  83.872  1.00 34.22  ? 67  TRP D CZ2 1 
ATOM   4848  C CZ3 . TRP D  1 43  ? -34.113 23.638  83.776  1.00 33.99  ? 67  TRP D CZ3 1 
ATOM   4849  C CH2 . TRP D  1 43  ? -33.480 22.524  83.210  1.00 33.82  ? 67  TRP D CH2 1 
ATOM   4850  N N   . ALA D  1 44  ? -32.976 24.224  91.132  1.00 33.51  ? 68  ALA D N   1 
ATOM   4851  C CA  . ALA D  1 44  ? -32.657 24.753  92.446  1.00 33.21  ? 68  ALA D CA  1 
ATOM   4852  C C   . ALA D  1 44  ? -31.232 25.335  92.390  1.00 32.78  ? 68  ALA D C   1 
ATOM   4853  O O   . ALA D  1 44  ? -30.250 24.580  92.267  1.00 29.86  ? 68  ALA D O   1 
ATOM   4854  C CB  . ALA D  1 44  ? -32.759 23.655  93.497  1.00 32.64  ? 68  ALA D CB  1 
ATOM   4855  N N   . VAL D  1 45  ? -31.159 26.671  92.470  1.00 31.79  ? 69  VAL D N   1 
ATOM   4856  C CA  . VAL D  1 45  ? -29.910 27.414  92.342  1.00 32.12  ? 69  VAL D CA  1 
ATOM   4857  C C   . VAL D  1 45  ? -29.422 27.854  93.720  1.00 32.56  ? 69  VAL D C   1 
ATOM   4858  O O   . VAL D  1 45  ? -30.204 28.285  94.582  1.00 31.32  ? 69  VAL D O   1 
ATOM   4859  C CB  . VAL D  1 45  ? -30.088 28.635  91.410  1.00 32.09  ? 69  VAL D CB  1 
ATOM   4860  C CG1 . VAL D  1 45  ? -28.757 29.323  91.091  1.00 31.34  ? 69  VAL D CG1 1 
ATOM   4861  C CG2 . VAL D  1 45  ? -30.775 28.184  90.126  1.00 32.74  ? 69  VAL D CG2 1 
ATOM   4862  N N   . ASP D  1 46  ? -28.122 27.698  93.930  1.00 33.65  ? 70  ASP D N   1 
ATOM   4863  C CA  . ASP D  1 46  ? -27.529 27.937  95.239  1.00 35.74  ? 70  ASP D CA  1 
ATOM   4864  C C   . ASP D  1 46  ? -26.011 28.078  95.134  1.00 36.86  ? 70  ASP D C   1 
ATOM   4865  O O   . ASP D  1 46  ? -25.479 28.207  94.053  1.00 35.29  ? 70  ASP D O   1 
ATOM   4866  C CB  . ASP D  1 46  ? -27.968 26.860  96.266  1.00 35.45  ? 70  ASP D CB  1 
ATOM   4867  C CG  . ASP D  1 46  ? -28.224 27.460  97.694  1.00 36.82  ? 70  ASP D CG  1 
ATOM   4868  O OD1 . ASP D  1 46  ? -27.560 28.496  98.015  1.00 37.36  ? 70  ASP D OD1 1 
ATOM   4869  O OD2 . ASP D  1 46  ? -29.055 26.917  98.492  1.00 35.87  ? 70  ASP D OD2 1 
ATOM   4870  N N   . MET D  1 47  ? -25.326 28.116  96.267  1.00 41.09  ? 71  MET D N   1 
ATOM   4871  C CA  . MET D  1 47  ? -23.920 28.504  96.326  1.00 41.28  ? 71  MET D CA  1 
ATOM   4872  C C   . MET D  1 47  ? -23.205 28.030  97.578  1.00 39.49  ? 71  MET D C   1 
ATOM   4873  O O   . MET D  1 47  ? -23.775 27.464  98.501  1.00 37.34  ? 71  MET D O   1 
ATOM   4874  C CB  . MET D  1 47  ? -23.817 29.999  96.281  1.00 44.71  ? 71  MET D CB  1 
ATOM   4875  C CG  . MET D  1 47  ? -24.296 30.664  97.544  1.00 47.10  ? 71  MET D CG  1 
ATOM   4876  S SD  . MET D  1 47  ? -24.572 32.399  97.192  1.00 55.91  ? 71  MET D SD  1 
ATOM   4877  C CE  . MET D  1 47  ? -26.092 32.411  96.151  1.00 48.75  ? 71  MET D CE  1 
ATOM   4878  N N   . MET D  1 48  ? -21.914 28.248  97.574  1.00 40.45  ? 72  MET D N   1 
ATOM   4879  C CA  . MET D  1 48  ? -21.071 27.595  98.521  1.00 41.29  ? 72  MET D CA  1 
ATOM   4880  C C   . MET D  1 48  ? -19.816 28.396  98.660  1.00 38.80  ? 72  MET D C   1 
ATOM   4881  O O   . MET D  1 48  ? -19.048 28.485  97.705  1.00 37.50  ? 72  MET D O   1 
ATOM   4882  C CB  . MET D  1 48  ? -20.750 26.184  98.007  1.00 43.57  ? 72  MET D CB  1 
ATOM   4883  C CG  . MET D  1 48  ? -21.331 25.137  98.904  1.00 46.62  ? 72  MET D CG  1 
ATOM   4884  S SD  . MET D  1 48  ? -20.527 23.552  98.763  1.00 50.13  ? 72  MET D SD  1 
ATOM   4885  C CE  . MET D  1 48  ? -21.567 23.151  97.400  1.00 52.66  ? 72  MET D CE  1 
ATOM   4886  N N   . ARG D  1 49  ? -19.645 29.003  99.835  1.00 36.50  ? 73  ARG D N   1 
ATOM   4887  C CA  . ARG D  1 49  ? -18.382 29.632  100.215 1.00 35.78  ? 73  ARG D CA  1 
ATOM   4888  C C   . ARG D  1 49  ? -17.691 28.776  101.265 1.00 33.32  ? 73  ARG D C   1 
ATOM   4889  O O   . ARG D  1 49  ? -18.293 27.989  101.937 1.00 32.55  ? 73  ARG D O   1 
ATOM   4890  C CB  . ARG D  1 49  ? -18.630 31.037  100.753 1.00 38.15  ? 73  ARG D CB  1 
ATOM   4891  C CG  . ARG D  1 49  ? -19.448 31.978  99.851  1.00 40.12  ? 73  ARG D CG  1 
ATOM   4892  C CD  . ARG D  1 49  ? -19.743 33.277  100.597 1.00 40.78  ? 73  ARG D CD  1 
ATOM   4893  N NE  . ARG D  1 49  ? -20.366 34.269  99.734  1.00 41.81  ? 73  ARG D NE  1 
ATOM   4894  C CZ  . ARG D  1 49  ? -21.670 34.398  99.480  1.00 42.19  ? 73  ARG D CZ  1 
ATOM   4895  N NH1 . ARG D  1 49  ? -22.096 35.360  98.667  1.00 42.52  ? 73  ARG D NH1 1 
ATOM   4896  N NH2 . ARG D  1 49  ? -22.559 33.583  100.010 1.00 44.53  ? 73  ARG D NH2 1 
ATOM   4897  N N   . PHE D  1 50  ? -16.411 28.956  101.417 1.00 33.23  ? 74  PHE D N   1 
ATOM   4898  C CA  . PHE D  1 50  ? -15.649 28.161  102.344 1.00 32.89  ? 74  PHE D CA  1 
ATOM   4899  C C   . PHE D  1 50  ? -14.960 29.085  103.351 1.00 32.19  ? 74  PHE D C   1 
ATOM   4900  O O   . PHE D  1 50  ? -14.254 29.997  102.988 1.00 30.91  ? 74  PHE D O   1 
ATOM   4901  C CB  . PHE D  1 50  ? -14.604 27.389  101.548 1.00 33.55  ? 74  PHE D CB  1 
ATOM   4902  C CG  . PHE D  1 50  ? -15.154 26.770  100.333 1.00 32.40  ? 74  PHE D CG  1 
ATOM   4903  C CD1 . PHE D  1 50  ? -16.041 25.744  100.439 1.00 32.66  ? 74  PHE D CD1 1 
ATOM   4904  C CD2 . PHE D  1 50  ? -14.855 27.270  99.119  1.00 32.66  ? 74  PHE D CD2 1 
ATOM   4905  C CE1 . PHE D  1 50  ? -16.621 25.200  99.327  1.00 33.48  ? 74  PHE D CE1 1 
ATOM   4906  C CE2 . PHE D  1 50  ? -15.421 26.751  97.984  1.00 33.08  ? 74  PHE D CE2 1 
ATOM   4907  C CZ  . PHE D  1 50  ? -16.302 25.710  98.075  1.00 34.10  ? 74  PHE D CZ  1 
ATOM   4908  N N   . ASN D  1 51  ? -15.104 28.802  104.622 1.00 31.07  ? 75  ASN D N   1 
ATOM   4909  C CA  . ASN D  1 51  ? -14.376 29.580  105.596 1.00 30.49  ? 75  ASN D CA  1 
ATOM   4910  C C   . ASN D  1 51  ? -13.678 28.688  106.644 1.00 29.54  ? 75  ASN D C   1 
ATOM   4911  O O   . ASN D  1 51  ? -14.334 27.933  107.359 1.00 29.65  ? 75  ASN D O   1 
ATOM   4912  C CB  . ASN D  1 51  ? -15.363 30.559  106.230 1.00 29.73  ? 75  ASN D CB  1 
ATOM   4913  C CG  . ASN D  1 51  ? -14.681 31.594  107.082 1.00 29.27  ? 75  ASN D CG  1 
ATOM   4914  O OD1 . ASN D  1 51  ? -13.827 31.287  107.987 1.00 27.78  ? 75  ASN D OD1 1 
ATOM   4915  N ND2 . ASN D  1 51  ? -15.032 32.847  106.799 1.00 28.39  ? 75  ASN D ND2 1 
ATOM   4916  N N   . ILE D  1 52  ? -12.363 28.811  106.764 1.00 29.03  ? 76  ILE D N   1 
ATOM   4917  C CA  . ILE D  1 52  ? -11.632 27.994  107.692 1.00 29.72  ? 76  ILE D CA  1 
ATOM   4918  C C   . ILE D  1 52  ? -12.224 28.067  109.128 1.00 28.80  ? 76  ILE D C   1 
ATOM   4919  O O   . ILE D  1 52  ? -12.044 27.120  109.872 1.00 28.74  ? 76  ILE D O   1 
ATOM   4920  C CB  . ILE D  1 52  ? -10.111 28.325  107.678 1.00 31.34  ? 76  ILE D CB  1 
ATOM   4921  C CG1 . ILE D  1 52  ? -9.275  27.175  108.299 1.00 32.16  ? 76  ILE D CG1 1 
ATOM   4922  C CG2 . ILE D  1 52  ? -9.826  29.630  108.432 1.00 31.94  ? 76  ILE D CG2 1 
ATOM   4923  C CD1 . ILE D  1 52  ? -7.830  27.086  107.793 1.00 32.57  ? 76  ILE D CD1 1 
ATOM   4924  N N   . ASN D  1 53  ? -12.950 29.130  109.503 1.00 27.68  ? 77  ASN D N   1 
ATOM   4925  C CA  . ASN D  1 53  ? -13.633 29.150  110.813 1.00 28.19  ? 77  ASN D CA  1 
ATOM   4926  C C   . ASN D  1 53  ? -14.306 27.816  111.096 1.00 28.57  ? 77  ASN D C   1 
ATOM   4927  O O   . ASN D  1 53  ? -14.211 27.284  112.214 1.00 28.22  ? 77  ASN D O   1 
ATOM   4928  C CB  . ASN D  1 53  ? -14.737 30.217  110.942 1.00 28.26  ? 77  ASN D CB  1 
ATOM   4929  C CG  . ASN D  1 53  ? -14.233 31.632  110.882 1.00 28.78  ? 77  ASN D CG  1 
ATOM   4930  O OD1 . ASN D  1 53  ? -13.063 31.885  111.073 1.00 30.61  ? 77  ASN D OD1 1 
ATOM   4931  N ND2 . ASN D  1 53  ? -15.137 32.585  110.575 1.00 30.07  ? 77  ASN D ND2 1 
ATOM   4932  N N   . ASP D  1 54  ? -14.968 27.282  110.073 1.00 29.02  ? 78  ASP D N   1 
ATOM   4933  C CA  . ASP D  1 54  ? -15.777 26.109  110.211 1.00 30.44  ? 78  ASP D CA  1 
ATOM   4934  C C   . ASP D  1 54  ? -14.986 24.819  110.255 1.00 30.76  ? 78  ASP D C   1 
ATOM   4935  O O   . ASP D  1 54  ? -15.550 23.731  110.495 1.00 31.72  ? 78  ASP D O   1 
ATOM   4936  C CB  . ASP D  1 54  ? -16.769 26.043  109.039 1.00 32.18  ? 78  ASP D CB  1 
ATOM   4937  C CG  . ASP D  1 54  ? -17.736 27.201  109.025 1.00 33.30  ? 78  ASP D CG  1 
ATOM   4938  O OD1 . ASP D  1 54  ? -18.071 27.627  110.144 1.00 37.16  ? 78  ASP D OD1 1 
ATOM   4939  O OD2 . ASP D  1 54  ? -18.176 27.672  107.943 1.00 32.10  ? 78  ASP D OD2 1 
ATOM   4940  N N   . PHE D  1 55  ? -13.710 24.872  109.966 1.00 31.21  ? 79  PHE D N   1 
ATOM   4941  C CA  . PHE D  1 55  ? -12.955 23.643  109.948 1.00 33.18  ? 79  PHE D CA  1 
ATOM   4942  C C   . PHE D  1 55  ? -11.990 23.521  111.143 1.00 34.38  ? 79  PHE D C   1 
ATOM   4943  O O   . PHE D  1 55  ? -11.443 22.423  111.450 1.00 31.37  ? 79  PHE D O   1 
ATOM   4944  C CB  . PHE D  1 55  ? -12.185 23.562  108.653 1.00 32.95  ? 79  PHE D CB  1 
ATOM   4945  C CG  . PHE D  1 55  ? -13.045 23.480  107.461 1.00 32.93  ? 79  PHE D CG  1 
ATOM   4946  C CD1 . PHE D  1 55  ? -13.698 24.625  106.992 1.00 32.82  ? 79  PHE D CD1 1 
ATOM   4947  C CD2 . PHE D  1 55  ? -13.170 22.274  106.765 1.00 34.07  ? 79  PHE D CD2 1 
ATOM   4948  C CE1 . PHE D  1 55  ? -14.507 24.578  105.871 1.00 33.23  ? 79  PHE D CE1 1 
ATOM   4949  C CE2 . PHE D  1 55  ? -13.968 22.210  105.634 1.00 34.53  ? 79  PHE D CE2 1 
ATOM   4950  C CZ  . PHE D  1 55  ? -14.643 23.374  105.194 1.00 34.41  ? 79  PHE D CZ  1 
ATOM   4951  N N   . LEU D  1 56  ? -11.783 24.635  111.819 1.00 36.52  ? 80  LEU D N   1 
ATOM   4952  C CA  . LEU D  1 56  ? -10.613 24.738  112.631 1.00 40.14  ? 80  LEU D CA  1 
ATOM   4953  C C   . LEU D  1 56  ? -11.061 25.361  113.927 1.00 39.40  ? 80  LEU D C   1 
ATOM   4954  O O   . LEU D  1 56  ? -11.053 26.556  114.053 1.00 37.94  ? 80  LEU D O   1 
ATOM   4955  C CB  . LEU D  1 56  ? -9.589  25.532  111.855 1.00 41.59  ? 80  LEU D CB  1 
ATOM   4956  C CG  . LEU D  1 56  ? -8.171  25.463  112.332 1.00 45.75  ? 80  LEU D CG  1 
ATOM   4957  C CD1 . LEU D  1 56  ? -7.259  25.613  111.119 1.00 49.52  ? 80  LEU D CD1 1 
ATOM   4958  C CD2 . LEU D  1 56  ? -7.869  26.606  113.277 1.00 47.42  ? 80  LEU D CD2 1 
ATOM   4959  N N   . PRO D  1 57  ? -11.475 24.538  114.902 1.00 40.35  ? 81  PRO D N   1 
ATOM   4960  C CA  . PRO D  1 57  ? -12.056 25.156  116.110 1.00 42.60  ? 81  PRO D CA  1 
ATOM   4961  C C   . PRO D  1 57  ? -11.125 26.075  116.961 1.00 40.37  ? 81  PRO D C   1 
ATOM   4962  O O   . PRO D  1 57  ? -9.929  26.154  116.771 1.00 38.03  ? 81  PRO D O   1 
ATOM   4963  C CB  . PRO D  1 57  ? -12.501 23.941  116.929 1.00 41.97  ? 81  PRO D CB  1 
ATOM   4964  C CG  . PRO D  1 57  ? -11.503 22.922  116.566 1.00 41.90  ? 81  PRO D CG  1 
ATOM   4965  C CD  . PRO D  1 57  ? -11.227 23.113  115.105 1.00 40.12  ? 81  PRO D CD  1 
ATOM   4966  N N   . PRO D  1 58  ? -11.713 26.799  117.882 1.00 42.67  ? 82  PRO D N   1 
ATOM   4967  C CA  . PRO D  1 58  ? -10.867 27.569  118.830 1.00 43.54  ? 82  PRO D CA  1 
ATOM   4968  C C   . PRO D  1 58  ? -10.055 26.694  119.737 1.00 40.88  ? 82  PRO D C   1 
ATOM   4969  O O   . PRO D  1 58  ? -10.565 25.685  120.145 1.00 48.84  ? 82  PRO D O   1 
ATOM   4970  C CB  . PRO D  1 58  ? -11.914 28.364  119.646 1.00 42.77  ? 82  PRO D CB  1 
ATOM   4971  C CG  . PRO D  1 58  ? -12.985 28.635  118.623 1.00 43.01  ? 82  PRO D CG  1 
ATOM   4972  C CD  . PRO D  1 58  ? -13.095 27.321  117.836 1.00 43.75  ? 82  PRO D CD  1 
ATOM   4973  N N   . GLY D  1 59  ? -8.837  27.080  120.056 1.00 38.42  ? 83  GLY D N   1 
ATOM   4974  C CA  . GLY D  1 59  ? -8.009  26.382  121.045 1.00 39.99  ? 83  GLY D CA  1 
ATOM   4975  C C   . GLY D  1 59  ? -8.341  26.832  122.471 1.00 42.29  ? 83  GLY D C   1 
ATOM   4976  O O   . GLY D  1 59  ? -9.517  27.031  122.791 1.00 46.39  ? 83  GLY D O   1 
ATOM   4977  N N   . GLY D  1 60  ? -7.318  27.019  123.316 1.00 43.52  ? 84  GLY D N   1 
ATOM   4978  C CA  . GLY D  1 60  ? -7.462  27.389  124.724 1.00 42.88  ? 84  GLY D CA  1 
ATOM   4979  C C   . GLY D  1 60  ? -6.210  28.021  125.312 1.00 44.45  ? 84  GLY D C   1 
ATOM   4980  O O   . GLY D  1 60  ? -5.106  27.907  124.778 1.00 42.03  ? 84  GLY D O   1 
ATOM   4981  N N   . GLY D  1 61  ? -6.389  28.699  126.438 1.00 47.59  ? 85  GLY D N   1 
ATOM   4982  C CA  . GLY D  1 61  ? -5.290  29.419  127.114 1.00 47.86  ? 85  GLY D CA  1 
ATOM   4983  C C   . GLY D  1 61  ? -4.588  30.380  126.184 1.00 47.02  ? 85  GLY D C   1 
ATOM   4984  O O   . GLY D  1 61  ? -5.223  31.133  125.443 1.00 47.83  ? 85  GLY D O   1 
ATOM   4985  N N   . SER D  1 62  ? -3.273  30.275  126.165 1.00 48.22  ? 86  SER D N   1 
ATOM   4986  C CA  . SER D  1 62  ? -2.399  31.107  125.330 1.00 47.24  ? 86  SER D CA  1 
ATOM   4987  C C   . SER D  1 62  ? -2.210  30.661  123.876 1.00 44.65  ? 86  SER D C   1 
ATOM   4988  O O   . SER D  1 62  ? -1.473  31.330  123.153 1.00 49.69  ? 86  SER D O   1 
ATOM   4989  C CB  . SER D  1 62  ? -1.022  31.198  126.001 1.00 50.97  ? 86  SER D CB  1 
ATOM   4990  O OG  . SER D  1 62  ? -1.116  31.841  127.306 1.00 52.70  ? 86  SER D OG  1 
ATOM   4991  N N   . ASN D  1 63  ? -2.855  29.566  123.444 1.00 40.24  ? 87  ASN D N   1 
ATOM   4992  C CA  . ASN D  1 63  ? -2.833  29.134  122.043 1.00 37.03  ? 87  ASN D CA  1 
ATOM   4993  C C   . ASN D  1 63  ? -4.248  29.288  121.557 1.00 37.30  ? 87  ASN D C   1 
ATOM   4994  O O   . ASN D  1 63  ? -5.062  28.415  121.676 1.00 36.40  ? 87  ASN D O   1 
ATOM   4995  C CB  . ASN D  1 63  ? -2.215  27.729  121.875 1.00 35.28  ? 87  ASN D CB  1 
ATOM   4996  C CG  . ASN D  1 63  ? -0.723  27.700  122.262 1.00 33.72  ? 87  ASN D CG  1 
ATOM   4997  O OD1 . ASN D  1 63  ? 0.122   28.274  121.549 1.00 31.57  ? 87  ASN D OD1 1 
ATOM   4998  N ND2 . ASN D  1 63  ? -0.405  27.110  123.430 1.00 31.68  ? 87  ASN D ND2 1 
ATOM   4999  N N   . PRO D  1 64  ? -4.571  30.465  121.027 1.00 40.35  ? 88  PRO D N   1 
ATOM   5000  C CA  . PRO D  1 64  ? -5.979  30.708  120.705 1.00 39.64  ? 88  PRO D CA  1 
ATOM   5001  C C   . PRO D  1 64  ? -6.580  29.779  119.647 1.00 38.27  ? 88  PRO D C   1 
ATOM   5002  O O   . PRO D  1 64  ? -7.803  29.691  119.535 1.00 35.25  ? 88  PRO D O   1 
ATOM   5003  C CB  . PRO D  1 64  ? -5.963  32.152  120.177 1.00 39.85  ? 88  PRO D CB  1 
ATOM   5004  C CG  . PRO D  1 64  ? -4.675  32.753  120.668 1.00 40.25  ? 88  PRO D CG  1 
ATOM   5005  C CD  . PRO D  1 64  ? -3.721  31.609  120.630 1.00 41.15  ? 88  PRO D CD  1 
ATOM   5006  N N   . ARG D  1 65  ? -5.736  29.121  118.858 1.00 38.93  ? 89  ARG D N   1 
ATOM   5007  C CA  . ARG D  1 65  ? -6.222  28.265  117.771 1.00 39.86  ? 89  ARG D CA  1 
ATOM   5008  C C   . ARG D  1 65  ? -5.695  26.834  117.917 1.00 38.59  ? 89  ARG D C   1 
ATOM   5009  O O   . ARG D  1 65  ? -4.529  26.580  118.307 1.00 37.96  ? 89  ARG D O   1 
ATOM   5010  C CB  . ARG D  1 65  ? -5.837  28.869  116.438 1.00 40.84  ? 89  ARG D CB  1 
ATOM   5011  C CG  . ARG D  1 65  ? -6.190  30.357  116.361 1.00 43.11  ? 89  ARG D CG  1 
ATOM   5012  C CD  . ARG D  1 65  ? -5.256  31.070  115.441 1.00 44.91  ? 89  ARG D CD  1 
ATOM   5013  N NE  . ARG D  1 65  ? -4.162  31.804  116.057 1.00 44.51  ? 89  ARG D NE  1 
ATOM   5014  C CZ  . ARG D  1 65  ? -4.252  33.045  116.493 1.00 46.49  ? 89  ARG D CZ  1 
ATOM   5015  N NH1 . ARG D  1 65  ? -3.186  33.623  116.980 1.00 49.83  ? 89  ARG D NH1 1 
ATOM   5016  N NH2 . ARG D  1 65  ? -5.392  33.724  116.479 1.00 50.91  ? 89  ARG D NH2 1 
ATOM   5017  N N   . SER D  1 66  ? -6.580  25.913  117.569 1.00 37.85  ? 90  SER D N   1 
ATOM   5018  C CA  . SER D  1 66  ? -6.315  24.516  117.653 1.00 38.96  ? 90  SER D CA  1 
ATOM   5019  C C   . SER D  1 66  ? -5.116  24.060  116.766 1.00 39.12  ? 90  SER D C   1 
ATOM   5020  O O   . SER D  1 66  ? -4.487  23.079  117.101 1.00 41.14  ? 90  SER D O   1 
ATOM   5021  C CB  . SER D  1 66  ? -7.610  23.712  117.386 1.00 39.94  ? 90  SER D CB  1 
ATOM   5022  O OG  . SER D  1 66  ? -8.285  24.023  116.164 1.00 39.82  ? 90  SER D OG  1 
ATOM   5023  N N   . VAL D  1 67  ? -4.759  24.751  115.691 1.00 37.63  ? 91  VAL D N   1 
ATOM   5024  C CA  . VAL D  1 67  ? -3.403  24.549  115.190 1.00 39.08  ? 91  VAL D CA  1 
ATOM   5025  C C   . VAL D  1 67  ? -2.493  25.805  115.420 1.00 38.65  ? 91  VAL D C   1 
ATOM   5026  O O   . VAL D  1 67  ? -2.849  26.918  115.098 1.00 35.75  ? 91  VAL D O   1 
ATOM   5027  C CB  . VAL D  1 67  ? -3.353  23.997  113.746 1.00 41.57  ? 91  VAL D CB  1 
ATOM   5028  C CG1 . VAL D  1 67  ? -4.483  23.008  113.523 1.00 42.82  ? 91  VAL D CG1 1 
ATOM   5029  C CG2 . VAL D  1 67  ? -3.456  25.097  112.724 1.00 43.76  ? 91  VAL D CG2 1 
ATOM   5030  N N   . PRO D  1 68  ? -1.301  25.603  116.003 1.00 37.59  ? 92  PRO D N   1 
ATOM   5031  C CA  . PRO D  1 68  ? -0.414  26.693  116.363 1.00 35.19  ? 92  PRO D CA  1 
ATOM   5032  C C   . PRO D  1 68  ? 0.495   27.144  115.238 1.00 33.50  ? 92  PRO D C   1 
ATOM   5033  O O   . PRO D  1 68  ? 1.711   26.989  115.271 1.00 32.60  ? 92  PRO D O   1 
ATOM   5034  C CB  . PRO D  1 68  ? 0.367   26.115  117.520 1.00 36.43  ? 92  PRO D CB  1 
ATOM   5035  C CG  . PRO D  1 68  ? 0.441   24.669  117.195 1.00 38.00  ? 92  PRO D CG  1 
ATOM   5036  C CD  . PRO D  1 68  ? -0.825  24.301  116.511 1.00 37.14  ? 92  PRO D CD  1 
ATOM   5037  N N   . PHE D  1 69  ? -0.129  27.753  114.257 1.00 32.59  ? 93  PHE D N   1 
ATOM   5038  C CA  . PHE D  1 69  ? 0.557   28.372  113.148 1.00 33.03  ? 93  PHE D CA  1 
ATOM   5039  C C   . PHE D  1 69  ? 0.012   29.790  112.922 1.00 33.88  ? 93  PHE D C   1 
ATOM   5040  O O   . PHE D  1 69  ? -1.140  30.097  113.221 1.00 33.98  ? 93  PHE D O   1 
ATOM   5041  C CB  . PHE D  1 69  ? 0.385   27.519  111.911 1.00 32.55  ? 93  PHE D CB  1 
ATOM   5042  C CG  . PHE D  1 69  ? 1.195   26.268  111.944 1.00 32.85  ? 93  PHE D CG  1 
ATOM   5043  C CD1 . PHE D  1 69  ? 0.669   25.097  112.478 1.00 33.56  ? 93  PHE D CD1 1 
ATOM   5044  C CD2 . PHE D  1 69  ? 2.497   26.257  111.440 1.00 33.24  ? 93  PHE D CD2 1 
ATOM   5045  C CE1 . PHE D  1 69  ? 1.448   23.944  112.536 1.00 34.51  ? 93  PHE D CE1 1 
ATOM   5046  C CE2 . PHE D  1 69  ? 3.272   25.124  111.495 1.00 33.58  ? 93  PHE D CE2 1 
ATOM   5047  C CZ  . PHE D  1 69  ? 2.744   23.959  112.041 1.00 34.64  ? 93  PHE D CZ  1 
ATOM   5048  N N   . GLU D  1 70  ? 0.866   30.661  112.422 1.00 35.07  ? 94  GLU D N   1 
ATOM   5049  C CA  . GLU D  1 70  ? 0.555   32.073  112.367 1.00 35.19  ? 94  GLU D CA  1 
ATOM   5050  C C   . GLU D  1 70  ? -0.103  32.397  111.031 1.00 34.12  ? 94  GLU D C   1 
ATOM   5051  O O   . GLU D  1 70  ? -1.053  33.105  110.986 1.00 34.89  ? 94  GLU D O   1 
ATOM   5052  C CB  . GLU D  1 70  ? 1.833   32.827  112.582 1.00 36.70  ? 94  GLU D CB  1 
ATOM   5053  C CG  . GLU D  1 70  ? 1.701   34.307  112.683 1.00 39.54  ? 94  GLU D CG  1 
ATOM   5054  C CD  . GLU D  1 70  ? 0.882   34.743  113.878 1.00 42.12  ? 94  GLU D CD  1 
ATOM   5055  O OE1 . GLU D  1 70  ? 0.029   35.659  113.642 1.00 41.23  ? 94  GLU D OE1 1 
ATOM   5056  O OE2 . GLU D  1 70  ? 1.102   34.166  115.007 1.00 41.64  ? 94  GLU D OE2 1 
ATOM   5057  N N   . TYR D  1 71  ? 0.376   31.834  109.942 1.00 34.33  ? 95  TYR D N   1 
ATOM   5058  C CA  . TYR D  1 71  ? -0.171  32.114  108.627 1.00 33.42  ? 95  TYR D CA  1 
ATOM   5059  C C   . TYR D  1 71  ? -0.731  30.832  108.020 1.00 32.03  ? 95  TYR D C   1 
ATOM   5060  O O   . TYR D  1 71  ? -0.372  29.761  108.437 1.00 32.90  ? 95  TYR D O   1 
ATOM   5061  C CB  . TYR D  1 71  ? 0.944   32.628  107.687 1.00 34.57  ? 95  TYR D CB  1 
ATOM   5062  C CG  . TYR D  1 71  ? 2.071   33.444  108.303 1.00 34.00  ? 95  TYR D CG  1 
ATOM   5063  C CD1 . TYR D  1 71  ? 1.816   34.667  108.949 1.00 32.98  ? 95  TYR D CD1 1 
ATOM   5064  C CD2 . TYR D  1 71  ? 3.382   33.006  108.207 1.00 34.47  ? 95  TYR D CD2 1 
ATOM   5065  C CE1 . TYR D  1 71  ? 2.823   35.418  109.510 1.00 33.02  ? 95  TYR D CE1 1 
ATOM   5066  C CE2 . TYR D  1 71  ? 4.414   33.757  108.749 1.00 36.54  ? 95  TYR D CE2 1 
ATOM   5067  C CZ  . TYR D  1 71  ? 4.127   34.981  109.425 1.00 35.81  ? 95  TYR D CZ  1 
ATOM   5068  O OH  . TYR D  1 71  ? 5.173   35.744  109.993 1.00 35.63  ? 95  TYR D OH  1 
ATOM   5069  N N   . TYR D  1 72  ? -1.596  30.963  107.023 1.00 31.35  ? 96  TYR D N   1 
ATOM   5070  C CA  . TYR D  1 72  ? -2.109  29.834  106.202 1.00 30.97  ? 96  TYR D CA  1 
ATOM   5071  C C   . TYR D  1 72  ? -2.480  30.221  104.793 1.00 31.20  ? 96  TYR D C   1 
ATOM   5072  O O   . TYR D  1 72  ? -2.562  31.413  104.437 1.00 32.32  ? 96  TYR D O   1 
ATOM   5073  C CB  . TYR D  1 72  ? -3.364  29.202  106.795 1.00 30.14  ? 96  TYR D CB  1 
ATOM   5074  C CG  . TYR D  1 72  ? -4.650  29.977  106.567 1.00 29.40  ? 96  TYR D CG  1 
ATOM   5075  C CD1 . TYR D  1 72  ? -4.835  31.243  107.110 1.00 30.21  ? 96  TYR D CD1 1 
ATOM   5076  C CD2 . TYR D  1 72  ? -5.698  29.441  105.858 1.00 28.76  ? 96  TYR D CD2 1 
ATOM   5077  C CE1 . TYR D  1 72  ? -6.030  31.946  106.906 1.00 29.94  ? 96  TYR D CE1 1 
ATOM   5078  C CE2 . TYR D  1 72  ? -6.883  30.151  105.651 1.00 28.61  ? 96  TYR D CE2 1 
ATOM   5079  C CZ  . TYR D  1 72  ? -7.040  31.395  106.170 1.00 28.34  ? 96  TYR D CZ  1 
ATOM   5080  O OH  . TYR D  1 72  ? -8.177  32.093  105.978 1.00 27.75  ? 96  TYR D OH  1 
ATOM   5081  N N   . ARG D  1 73  ? -2.737  29.200  103.996 1.00 30.82  ? 97  ARG D N   1 
ATOM   5082  C CA  . ARG D  1 73  ? -3.368  29.419  102.704 1.00 31.40  ? 97  ARG D CA  1 
ATOM   5083  C C   . ARG D  1 73  ? -4.000  28.160  102.214 1.00 30.42  ? 97  ARG D C   1 
ATOM   5084  O O   . ARG D  1 73  ? -3.528  27.064  102.539 1.00 28.76  ? 97  ARG D O   1 
ATOM   5085  C CB  . ARG D  1 73  ? -2.372  29.947  101.658 1.00 32.76  ? 97  ARG D CB  1 
ATOM   5086  C CG  . ARG D  1 73  ? -1.131  29.083  101.446 1.00 32.86  ? 97  ARG D CG  1 
ATOM   5087  C CD  . ARG D  1 73  ? -0.084  29.900  100.739 1.00 33.52  ? 97  ARG D CD  1 
ATOM   5088  N NE  . ARG D  1 73  ? 1.090   29.107  100.463 1.00 34.07  ? 97  ARG D NE  1 
ATOM   5089  C CZ  . ARG D  1 73  ? 2.098   29.474  99.680  1.00 34.47  ? 97  ARG D CZ  1 
ATOM   5090  N NH1 . ARG D  1 73  ? 3.083   28.636  99.523  1.00 33.55  ? 97  ARG D NH1 1 
ATOM   5091  N NH2 . ARG D  1 73  ? 2.134   30.653  99.039  1.00 35.38  ? 97  ARG D NH2 1 
ATOM   5092  N N   . ILE D  1 74  ? -5.061  28.330  101.426 1.00 31.16  ? 98  ILE D N   1 
ATOM   5093  C CA  . ILE D  1 74  ? -5.849  27.212  100.982 1.00 32.88  ? 98  ILE D CA  1 
ATOM   5094  C C   . ILE D  1 74  ? -5.385  26.878  99.576  1.00 34.28  ? 98  ILE D C   1 
ATOM   5095  O O   . ILE D  1 74  ? -5.440  27.691  98.668  1.00 36.15  ? 98  ILE D O   1 
ATOM   5096  C CB  . ILE D  1 74  ? -7.330  27.519  101.076 1.00 33.78  ? 98  ILE D CB  1 
ATOM   5097  C CG1 . ILE D  1 74  ? -7.626  27.941  102.511 1.00 34.09  ? 98  ILE D CG1 1 
ATOM   5098  C CG2 . ILE D  1 74  ? -8.166  26.285  100.668 1.00 34.37  ? 98  ILE D CG2 1 
ATOM   5099  C CD1 . ILE D  1 74  ? -9.085  28.213  102.803 1.00 34.94  ? 98  ILE D CD1 1 
ATOM   5100  N N   . ARG D  1 75  ? -4.886  25.677  99.432  1.00 35.52  ? 99  ARG D N   1 
ATOM   5101  C CA  . ARG D  1 75  ? -4.226  25.234  98.240  1.00 37.37  ? 99  ARG D CA  1 
ATOM   5102  C C   . ARG D  1 75  ? -5.283  24.706  97.262  1.00 35.71  ? 99  ARG D C   1 
ATOM   5103  O O   . ARG D  1 75  ? -5.313  25.030  96.066  1.00 32.99  ? 99  ARG D O   1 
ATOM   5104  C CB  . ARG D  1 75  ? -3.256  24.141  98.675  1.00 41.66  ? 99  ARG D CB  1 
ATOM   5105  C CG  . ARG D  1 75  ? -1.815  24.395  98.344  1.00 47.41  ? 99  ARG D CG  1 
ATOM   5106  C CD  . ARG D  1 75  ? -1.276  25.697  98.872  1.00 53.32  ? 99  ARG D CD  1 
ATOM   5107  N NE  . ARG D  1 75  ? -0.422  26.395  97.883  1.00 57.90  ? 99  ARG D NE  1 
ATOM   5108  C CZ  . ARG D  1 75  ? 0.804   26.008  97.501  1.00 64.04  ? 99  ARG D CZ  1 
ATOM   5109  N NH1 . ARG D  1 75  ? 1.454   26.743  96.634  1.00 68.48  ? 99  ARG D NH1 1 
ATOM   5110  N NH2 . ARG D  1 75  ? 1.395   24.893  97.958  1.00 68.50  ? 99  ARG D NH2 1 
ATOM   5111  N N   . LYS D  1 76  ? -6.208  23.961  97.837  1.00 34.78  ? 100 LYS D N   1 
ATOM   5112  C CA  . LYS D  1 76  ? -7.230  23.266  97.122  1.00 34.30  ? 100 LYS D CA  1 
ATOM   5113  C C   . LYS D  1 76  ? -8.478  23.107  98.008  1.00 33.32  ? 100 LYS D C   1 
ATOM   5114  O O   . LYS D  1 76  ? -8.376  23.069  99.243  1.00 33.68  ? 100 LYS D O   1 
ATOM   5115  C CB  . LYS D  1 76  ? -6.644  21.881  96.807  1.00 35.04  ? 100 LYS D CB  1 
ATOM   5116  C CG  . LYS D  1 76  ? -6.341  21.533  95.381  1.00 35.61  ? 100 LYS D CG  1 
ATOM   5117  C CD  . LYS D  1 76  ? -5.564  22.549  94.573  1.00 37.19  ? 100 LYS D CD  1 
ATOM   5118  C CE  . LYS D  1 76  ? -5.777  22.292  93.082  1.00 38.90  ? 100 LYS D CE  1 
ATOM   5119  N NZ  . LYS D  1 76  ? -5.117  23.281  92.199  1.00 39.26  ? 100 LYS D NZ  1 
ATOM   5120  N N   . VAL D  1 77  ? -9.651  23.012  97.392  1.00 33.17  ? 101 VAL D N   1 
ATOM   5121  C CA  . VAL D  1 77  ? -10.834 22.485  98.080  1.00 34.80  ? 101 VAL D CA  1 
ATOM   5122  C C   . VAL D  1 77  ? -11.456 21.404  97.251  1.00 34.83  ? 101 VAL D C   1 
ATOM   5123  O O   . VAL D  1 77  ? -11.636 21.568  96.045  1.00 32.46  ? 101 VAL D O   1 
ATOM   5124  C CB  . VAL D  1 77  ? -11.965 23.504  98.267  1.00 35.87  ? 101 VAL D CB  1 
ATOM   5125  C CG1 . VAL D  1 77  ? -13.196 22.887  98.910  1.00 36.90  ? 101 VAL D CG1 1 
ATOM   5126  C CG2 . VAL D  1 77  ? -11.497 24.645  99.093  1.00 37.78  ? 101 VAL D CG2 1 
ATOM   5127  N N   . LYS D  1 78  ? -11.883 20.357  97.946  1.00 36.62  ? 102 LYS D N   1 
ATOM   5128  C CA  . LYS D  1 78  ? -12.664 19.313  97.360  1.00 39.18  ? 102 LYS D CA  1 
ATOM   5129  C C   . LYS D  1 78  ? -14.018 19.504  97.924  1.00 36.25  ? 102 LYS D C   1 
ATOM   5130  O O   . LYS D  1 78  ? -14.150 19.547  99.141  1.00 36.42  ? 102 LYS D O   1 
ATOM   5131  C CB  . LYS D  1 78  ? -12.123 17.933  97.730  1.00 44.47  ? 102 LYS D CB  1 
ATOM   5132  C CG  . LYS D  1 78  ? -12.672 16.744  96.933  1.00 47.53  ? 102 LYS D CG  1 
ATOM   5133  C CD  . LYS D  1 78  ? -12.054 15.426  97.432  1.00 51.85  ? 102 LYS D CD  1 
ATOM   5134  C CE  . LYS D  1 78  ? -11.640 14.617  96.206  1.00 58.99  ? 102 LYS D CE  1 
ATOM   5135  N NZ  . LYS D  1 78  ? -11.440 13.178  96.516  1.00 64.20  ? 102 LYS D NZ  1 
ATOM   5136  N N   . VAL D  1 79  ? -15.012 19.644  97.041  1.00 33.64  ? 103 VAL D N   1 
ATOM   5137  C CA  . VAL D  1 79  ? -16.398 19.564  97.462  1.00 32.05  ? 103 VAL D CA  1 
ATOM   5138  C C   . VAL D  1 79  ? -17.014 18.270  96.956  1.00 31.21  ? 103 VAL D C   1 
ATOM   5139  O O   . VAL D  1 79  ? -16.950 18.002  95.752  1.00 30.26  ? 103 VAL D O   1 
ATOM   5140  C CB  . VAL D  1 79  ? -17.200 20.741  96.970  1.00 31.05  ? 103 VAL D CB  1 
ATOM   5141  C CG1 . VAL D  1 79  ? -18.645 20.552  97.391  1.00 31.61  ? 103 VAL D CG1 1 
ATOM   5142  C CG2 . VAL D  1 79  ? -16.620 22.029  97.510  1.00 30.21  ? 103 VAL D CG2 1 
ATOM   5143  N N   . GLU D  1 80  ? -17.598 17.487  97.878  1.00 30.58  ? 104 GLU D N   1 
ATOM   5144  C CA  . GLU D  1 80  ? -18.155 16.174  97.553  1.00 31.25  ? 104 GLU D CA  1 
ATOM   5145  C C   . GLU D  1 80  ? -19.619 16.176  97.911  1.00 31.34  ? 104 GLU D C   1 
ATOM   5146  O O   . GLU D  1 80  ? -19.954 16.505  99.042  1.00 32.11  ? 104 GLU D O   1 
ATOM   5147  C CB  . GLU D  1 80  ? -17.485 15.071  98.340  1.00 31.58  ? 104 GLU D CB  1 
ATOM   5148  C CG  . GLU D  1 80  ? -16.013 14.934  98.066  1.00 32.91  ? 104 GLU D CG  1 
ATOM   5149  C CD  . GLU D  1 80  ? -15.317 13.830  98.879  1.00 34.87  ? 104 GLU D CD  1 
ATOM   5150  O OE1 . GLU D  1 80  ? -14.964 13.929  100.147 1.00 36.44  ? 104 GLU D OE1 1 
ATOM   5151  O OE2 . GLU D  1 80  ? -15.129 12.829  98.170  1.00 34.58  ? 104 GLU D OE2 1 
ATOM   5152  N N   . PHE D  1 81  ? -20.482 15.824  96.956  1.00 30.91  ? 105 PHE D N   1 
ATOM   5153  C CA  . PHE D  1 81  ? -21.922 15.645  97.210  1.00 31.49  ? 105 PHE D CA  1 
ATOM   5154  C C   . PHE D  1 81  ? -22.183 14.166  97.297  1.00 31.92  ? 105 PHE D C   1 
ATOM   5155  O O   . PHE D  1 81  ? -22.228 13.510  96.245  1.00 31.44  ? 105 PHE D O   1 
ATOM   5156  C CB  . PHE D  1 81  ? -22.762 16.193  96.057  1.00 31.56  ? 105 PHE D CB  1 
ATOM   5157  C CG  . PHE D  1 81  ? -22.659 17.657  95.911  1.00 32.44  ? 105 PHE D CG  1 
ATOM   5158  C CD1 . PHE D  1 81  ? -21.583 18.225  95.273  1.00 32.85  ? 105 PHE D CD1 1 
ATOM   5159  C CD2 . PHE D  1 81  ? -23.603 18.485  96.477  1.00 33.05  ? 105 PHE D CD2 1 
ATOM   5160  C CE1 . PHE D  1 81  ? -21.481 19.607  95.184  1.00 33.78  ? 105 PHE D CE1 1 
ATOM   5161  C CE2 . PHE D  1 81  ? -23.505 19.861  96.362  1.00 33.19  ? 105 PHE D CE2 1 
ATOM   5162  C CZ  . PHE D  1 81  ? -22.453 20.418  95.708  1.00 32.41  ? 105 PHE D CZ  1 
ATOM   5163  N N   . TRP D  1 82  ? -22.342 13.629  98.516  1.00 30.69  ? 106 TRP D N   1 
ATOM   5164  C CA  . TRP D  1 82  ? -22.598 12.222  98.663  1.00 29.49  ? 106 TRP D CA  1 
ATOM   5165  C C   . TRP D  1 82  ? -24.108 12.044  98.649  1.00 29.79  ? 106 TRP D C   1 
ATOM   5166  O O   . TRP D  1 82  ? -24.804 12.498  99.532  1.00 32.73  ? 106 TRP D O   1 
ATOM   5167  C CB  . TRP D  1 82  ? -22.031 11.748  99.952  1.00 30.45  ? 106 TRP D CB  1 
ATOM   5168  C CG  . TRP D  1 82  ? -20.543 11.818  100.069 1.00 30.84  ? 106 TRP D CG  1 
ATOM   5169  C CD1 . TRP D  1 82  ? -19.830 12.812  100.645 1.00 32.32  ? 106 TRP D CD1 1 
ATOM   5170  C CD2 . TRP D  1 82  ? -19.604 10.831  99.680  1.00 30.64  ? 106 TRP D CD2 1 
ATOM   5171  N NE1 . TRP D  1 82  ? -18.486 12.542  100.584 1.00 32.26  ? 106 TRP D NE1 1 
ATOM   5172  C CE2 . TRP D  1 82  ? -18.321 11.332  99.971  1.00 31.03  ? 106 TRP D CE2 1 
ATOM   5173  C CE3 . TRP D  1 82  ? -19.715 9.582   99.077  1.00 32.06  ? 106 TRP D CE3 1 
ATOM   5174  C CZ2 . TRP D  1 82  ? -17.143 10.610  99.717  1.00 31.00  ? 106 TRP D CZ2 1 
ATOM   5175  C CZ3 . TRP D  1 82  ? -18.553 8.855   98.811  1.00 32.57  ? 106 TRP D CZ3 1 
ATOM   5176  C CH2 . TRP D  1 82  ? -17.270 9.376   99.159  1.00 31.99  ? 106 TRP D CH2 1 
ATOM   5177  N N   . PRO D  1 83  ? -24.655 11.450  97.618  1.00 29.48  ? 107 PRO D N   1 
ATOM   5178  C CA  . PRO D  1 83  ? -26.082 11.312  97.604  1.00 30.55  ? 107 PRO D CA  1 
ATOM   5179  C C   . PRO D  1 83  ? -26.742 10.436  98.701  1.00 32.01  ? 107 PRO D C   1 
ATOM   5180  O O   . PRO D  1 83  ? -26.320 9.301   98.930  1.00 31.53  ? 107 PRO D O   1 
ATOM   5181  C CB  . PRO D  1 83  ? -26.317 10.595  96.292  1.00 30.84  ? 107 PRO D CB  1 
ATOM   5182  C CG  . PRO D  1 83  ? -25.038 9.917   95.964  1.00 30.26  ? 107 PRO D CG  1 
ATOM   5183  C CD  . PRO D  1 83  ? -24.070 10.950  96.370  1.00 30.40  ? 107 PRO D CD  1 
ATOM   5184  N N   . CYS D  1 84  ? -27.809 10.943  99.315  1.00 32.31  ? 108 CYS D N   1 
ATOM   5185  C CA  . CYS D  1 84  ? -28.614 10.116  100.190 1.00 33.04  ? 108 CYS D CA  1 
ATOM   5186  C C   . CYS D  1 84  ? -29.574 9.162   99.513  1.00 33.90  ? 108 CYS D C   1 
ATOM   5187  O O   . CYS D  1 84  ? -29.833 8.091   100.037 1.00 34.31  ? 108 CYS D O   1 
ATOM   5188  C CB  . CYS D  1 84  ? -29.389 11.009  101.107 1.00 33.40  ? 108 CYS D CB  1 
ATOM   5189  S SG  . CYS D  1 84  ? -28.236 11.873  102.190 1.00 33.41  ? 108 CYS D SG  1 
ATOM   5190  N N   . SER D  1 85  ? -30.142 9.572   98.385  1.00 35.41  ? 109 SER D N   1 
ATOM   5191  C CA  . SER D  1 85  ? -31.199 8.803   97.696  1.00 35.11  ? 109 SER D CA  1 
ATOM   5192  C C   . SER D  1 85  ? -30.669 7.451   97.215  1.00 35.84  ? 109 SER D C   1 
ATOM   5193  O O   . SER D  1 85  ? -29.482 7.280   96.877  1.00 35.41  ? 109 SER D O   1 
ATOM   5194  C CB  . SER D  1 85  ? -31.803 9.604   96.532  1.00 34.26  ? 109 SER D CB  1 
ATOM   5195  O OG  . SER D  1 85  ? -31.762 11.019  96.808  1.00 35.75  ? 109 SER D OG  1 
ATOM   5196  N N   . PRO D  1 86  ? -31.559 6.477   97.165  1.00 37.50  ? 110 PRO D N   1 
ATOM   5197  C CA  . PRO D  1 86  ? -31.138 5.170   96.729  1.00 38.62  ? 110 PRO D CA  1 
ATOM   5198  C C   . PRO D  1 86  ? -30.997 5.054   95.204  1.00 39.50  ? 110 PRO D C   1 
ATOM   5199  O O   . PRO D  1 86  ? -31.779 5.660   94.475  1.00 37.19  ? 110 PRO D O   1 
ATOM   5200  C CB  . PRO D  1 86  ? -32.270 4.301   97.238  1.00 38.35  ? 110 PRO D CB  1 
ATOM   5201  C CG  . PRO D  1 86  ? -33.465 5.167   97.055  1.00 37.91  ? 110 PRO D CG  1 
ATOM   5202  C CD  . PRO D  1 86  ? -33.012 6.536   97.413  1.00 38.11  ? 110 PRO D CD  1 
ATOM   5203  N N   . ILE D  1 87  ? -30.079 4.217   94.725  1.00 42.49  ? 111 ILE D N   1 
ATOM   5204  C CA  . ILE D  1 87  ? -30.000 3.937   93.253  1.00 45.26  ? 111 ILE D CA  1 
ATOM   5205  C C   . ILE D  1 87  ? -31.334 3.453   92.554  1.00 47.31  ? 111 ILE D C   1 
ATOM   5206  O O   . ILE D  1 87  ? -31.471 3.498   91.300  1.00 54.87  ? 111 ILE D O   1 
ATOM   5207  C CB  . ILE D  1 87  ? -28.846 2.986   92.881  1.00 46.60  ? 111 ILE D CB  1 
ATOM   5208  C CG1 . ILE D  1 87  ? -29.222 1.542   93.208  1.00 49.72  ? 111 ILE D CG1 1 
ATOM   5209  C CG2 . ILE D  1 87  ? -27.494 3.381   93.528  1.00 45.76  ? 111 ILE D CG2 1 
ATOM   5210  C CD1 . ILE D  1 87  ? -28.081 0.584   92.890  1.00 52.05  ? 111 ILE D CD1 1 
ATOM   5211  N N   . THR D  1 88  ? -32.320 3.028   93.341  1.00 44.76  ? 112 THR D N   1 
ATOM   5212  C CA  . THR D  1 88  ? -33.653 2.752   92.815  1.00 42.67  ? 112 THR D CA  1 
ATOM   5213  C C   . THR D  1 88  ? -34.525 3.958   92.504  1.00 42.42  ? 112 THR D C   1 
ATOM   5214  O O   . THR D  1 88  ? -35.572 3.771   91.963  1.00 43.82  ? 112 THR D O   1 
ATOM   5215  C CB  . THR D  1 88  ? -34.471 1.831   93.776  1.00 43.06  ? 112 THR D CB  1 
ATOM   5216  O OG1 . THR D  1 88  ? -34.888 2.511   94.986  1.00 39.53  ? 112 THR D OG1 1 
ATOM   5217  C CG2 . THR D  1 88  ? -33.655 0.529   94.104  1.00 43.93  ? 112 THR D CG2 1 
ATOM   5218  N N   . GLN D  1 89  ? -34.169 5.177   92.889  1.00 42.88  ? 113 GLN D N   1 
ATOM   5219  C CA  . GLN D  1 89  ? -35.141 6.320   92.803  1.00 43.33  ? 113 GLN D CA  1 
ATOM   5220  C C   . GLN D  1 89  ? -35.174 6.829   91.369  1.00 45.02  ? 113 GLN D C   1 
ATOM   5221  O O   . GLN D  1 89  ? -34.104 6.962   90.696  1.00 48.62  ? 113 GLN D O   1 
ATOM   5222  C CB  . GLN D  1 89  ? -34.789 7.484   93.796  1.00 41.65  ? 113 GLN D CB  1 
ATOM   5223  C CG  . GLN D  1 89  ? -35.572 8.825   93.702  1.00 40.07  ? 113 GLN D CG  1 
ATOM   5224  C CD  . GLN D  1 89  ? -35.346 9.753   94.926  1.00 38.16  ? 113 GLN D CD  1 
ATOM   5225  O OE1 . GLN D  1 89  ? -35.302 9.255   96.029  1.00 39.97  ? 113 GLN D OE1 1 
ATOM   5226  N NE2 . GLN D  1 89  ? -35.172 11.069  94.727  1.00 33.80  ? 113 GLN D NE2 1 
ATOM   5227  N N   . GLY D  1 90  ? -36.399 7.092   90.913  1.00 43.01  ? 114 GLY D N   1 
ATOM   5228  C CA  . GLY D  1 90  ? -36.645 7.648   89.590  1.00 40.98  ? 114 GLY D CA  1 
ATOM   5229  C C   . GLY D  1 90  ? -36.649 9.150   89.596  1.00 38.79  ? 114 GLY D C   1 
ATOM   5230  O O   . GLY D  1 90  ? -35.980 9.767   90.436  1.00 41.05  ? 114 GLY D O   1 
ATOM   5231  N N   . ASP D  1 91  ? -37.426 9.715   88.663  1.00 36.69  ? 115 ASP D N   1 
ATOM   5232  C CA  . ASP D  1 91  ? -37.418 11.157  88.277  1.00 35.01  ? 115 ASP D CA  1 
ATOM   5233  C C   . ASP D  1 91  ? -36.022 11.819  88.249  1.00 33.53  ? 115 ASP D C   1 
ATOM   5234  O O   . ASP D  1 91  ? -35.803 12.968  88.716  1.00 35.10  ? 115 ASP D O   1 
ATOM   5235  C CB  . ASP D  1 91  ? -38.407 11.983  89.129  1.00 34.41  ? 115 ASP D CB  1 
ATOM   5236  C CG  . ASP D  1 91  ? -38.786 13.275  88.475  1.00 33.37  ? 115 ASP D CG  1 
ATOM   5237  O OD1 . ASP D  1 91  ? -38.857 13.256  87.226  1.00 34.14  ? 115 ASP D OD1 1 
ATOM   5238  O OD2 . ASP D  1 91  ? -38.986 14.281  89.179  1.00 31.98  ? 115 ASP D OD2 1 
ATOM   5239  N N   . ARG D  1 92  ? -35.091 11.065  87.689  1.00 31.79  ? 116 ARG D N   1 
ATOM   5240  C CA  . ARG D  1 92  ? -33.699 11.468  87.585  1.00 31.52  ? 116 ARG D CA  1 
ATOM   5241  C C   . ARG D  1 92  ? -33.601 12.741  86.767  1.00 31.19  ? 116 ARG D C   1 
ATOM   5242  O O   . ARG D  1 92  ? -34.507 13.044  85.941  1.00 30.68  ? 116 ARG D O   1 
ATOM   5243  C CB  . ARG D  1 92  ? -32.912 10.424  86.848  1.00 31.27  ? 116 ARG D CB  1 
ATOM   5244  C CG  . ARG D  1 92  ? -32.902 9.081   87.502  1.00 32.15  ? 116 ARG D CG  1 
ATOM   5245  C CD  . ARG D  1 92  ? -31.645 8.434   87.065  1.00 32.95  ? 116 ARG D CD  1 
ATOM   5246  N NE  . ARG D  1 92  ? -31.823 7.326   86.199  1.00 33.77  ? 116 ARG D NE  1 
ATOM   5247  C CZ  . ARG D  1 92  ? -30.851 6.825   85.427  1.00 35.31  ? 116 ARG D CZ  1 
ATOM   5248  N NH1 . ARG D  1 92  ? -31.136 5.774   84.654  1.00 37.22  ? 116 ARG D NH1 1 
ATOM   5249  N NH2 . ARG D  1 92  ? -29.614 7.350   85.380  1.00 33.43  ? 116 ARG D NH2 1 
ATOM   5250  N N   . GLY D  1 93  ? -32.495 13.449  86.949  1.00 29.22  ? 117 GLY D N   1 
ATOM   5251  C CA  . GLY D  1 93  ? -32.369 14.729  86.302  1.00 29.79  ? 117 GLY D CA  1 
ATOM   5252  C C   . GLY D  1 93  ? -30.953 15.175  86.277  1.00 29.88  ? 117 GLY D C   1 
ATOM   5253  O O   . GLY D  1 93  ? -30.113 14.476  86.751  1.00 30.60  ? 117 GLY D O   1 
ATOM   5254  N N   . VAL D  1 94  ? -30.694 16.370  85.778  1.00 30.89  ? 118 VAL D N   1 
ATOM   5255  C CA  . VAL D  1 94  ? -29.348 16.737  85.402  1.00 31.45  ? 118 VAL D CA  1 
ATOM   5256  C C   . VAL D  1 94  ? -29.172 18.225  85.676  1.00 30.02  ? 118 VAL D C   1 
ATOM   5257  O O   . VAL D  1 94  ? -30.021 19.027  85.345  1.00 29.50  ? 118 VAL D O   1 
ATOM   5258  C CB  . VAL D  1 94  ? -29.021 16.249  83.952  1.00 32.32  ? 118 VAL D CB  1 
ATOM   5259  C CG1 . VAL D  1 94  ? -29.922 16.891  82.948  1.00 35.32  ? 118 VAL D CG1 1 
ATOM   5260  C CG2 . VAL D  1 94  ? -27.648 16.640  83.543  1.00 33.42  ? 118 VAL D CG2 1 
ATOM   5261  N N   . GLY D  1 95  ? -28.061 18.547  86.332  1.00 30.31  ? 119 GLY D N   1 
ATOM   5262  C CA  . GLY D  1 95  ? -27.672 19.924  86.694  1.00 30.37  ? 119 GLY D CA  1 
ATOM   5263  C C   . GLY D  1 95  ? -26.185 20.196  86.538  1.00 29.93  ? 119 GLY D C   1 
ATOM   5264  O O   . GLY D  1 95  ? -25.519 19.499  85.780  1.00 31.53  ? 119 GLY D O   1 
ATOM   5265  N N   . SER D  1 96  ? -25.663 21.185  87.255  1.00 28.71  ? 120 SER D N   1 
ATOM   5266  C CA  . SER D  1 96  ? -24.385 21.796  86.926  1.00 28.32  ? 120 SER D CA  1 
ATOM   5267  C C   . SER D  1 96  ? -23.772 22.403  88.153  1.00 28.32  ? 120 SER D C   1 
ATOM   5268  O O   . SER D  1 96  ? -24.502 23.018  88.940  1.00 27.71  ? 120 SER D O   1 
ATOM   5269  C CB  . SER D  1 96  ? -24.581 22.904  85.882  1.00 28.65  ? 120 SER D CB  1 
ATOM   5270  O OG  . SER D  1 96  ? -25.086 22.379  84.635  1.00 29.26  ? 120 SER D OG  1 
ATOM   5271  N N   . SER D  1 97  ? -22.453 22.208  88.328  1.00 28.47  ? 121 SER D N   1 
ATOM   5272  C CA  . SER D  1 97  ? -21.617 22.935  89.323  1.00 28.66  ? 121 SER D CA  1 
ATOM   5273  C C   . SER D  1 97  ? -20.690 23.837  88.550  1.00 29.10  ? 121 SER D C   1 
ATOM   5274  O O   . SER D  1 97  ? -20.189 23.432  87.504  1.00 28.29  ? 121 SER D O   1 
ATOM   5275  C CB  . SER D  1 97  ? -20.744 21.988  90.178  1.00 28.43  ? 121 SER D CB  1 
ATOM   5276  O OG  . SER D  1 97  ? -19.884 21.156  89.384  1.00 27.59  ? 121 SER D OG  1 
ATOM   5277  N N   . ALA D  1 98  ? -20.425 25.034  89.069  1.00 30.06  ? 122 ALA D N   1 
ATOM   5278  C CA  . ALA D  1 98  ? -19.388 25.924  88.469  1.00 30.42  ? 122 ALA D CA  1 
ATOM   5279  C C   . ALA D  1 98  ? -18.519 26.518  89.518  1.00 30.10  ? 122 ALA D C   1 
ATOM   5280  O O   . ALA D  1 98  ? -18.972 26.838  90.611  1.00 30.16  ? 122 ALA D O   1 
ATOM   5281  C CB  . ALA D  1 98  ? -20.012 27.078  87.686  1.00 30.59  ? 122 ALA D CB  1 
ATOM   5282  N N   . VAL D  1 99  ? -17.291 26.753  89.138  1.00 30.02  ? 123 VAL D N   1 
ATOM   5283  C CA  . VAL D  1 99  ? -16.346 27.384  90.016  1.00 31.45  ? 123 VAL D CA  1 
ATOM   5284  C C   . VAL D  1 99  ? -16.412 28.891  89.809  1.00 31.77  ? 123 VAL D C   1 
ATOM   5285  O O   . VAL D  1 99  ? -16.208 29.357  88.716  1.00 34.78  ? 123 VAL D O   1 
ATOM   5286  C CB  . VAL D  1 99  ? -14.920 26.865  89.748  1.00 32.48  ? 123 VAL D CB  1 
ATOM   5287  C CG1 . VAL D  1 99  ? -13.901 27.661  90.545  1.00 33.18  ? 123 VAL D CG1 1 
ATOM   5288  C CG2 . VAL D  1 99  ? -14.830 25.372  90.088  1.00 32.16  ? 123 VAL D CG2 1 
ATOM   5289  N N   . ILE D  1 100 ? -16.667 29.621  90.888  1.00 32.00  ? 124 ILE D N   1 
ATOM   5290  C CA  . ILE D  1 100 ? -16.838 31.064  90.979  1.00 32.07  ? 124 ILE D CA  1 
ATOM   5291  C C   . ILE D  1 100 ? -15.742 31.671  91.871  1.00 30.70  ? 124 ILE D C   1 
ATOM   5292  O O   . ILE D  1 100 ? -15.795 31.605  93.046  1.00 30.60  ? 124 ILE D O   1 
ATOM   5293  C CB  . ILE D  1 100 ? -18.201 31.323  91.639  1.00 34.12  ? 124 ILE D CB  1 
ATOM   5294  C CG1 . ILE D  1 100 ? -19.285 30.548  90.902  1.00 35.80  ? 124 ILE D CG1 1 
ATOM   5295  C CG2 . ILE D  1 100 ? -18.519 32.821  91.733  1.00 34.60  ? 124 ILE D CG2 1 
ATOM   5296  C CD1 . ILE D  1 100 ? -19.354 30.841  89.412  1.00 37.61  ? 124 ILE D CD1 1 
ATOM   5297  N N   . LEU D  1 101 ? -14.751 32.301  91.306  1.00 30.79  ? 125 LEU D N   1 
ATOM   5298  C CA  . LEU D  1 101 ? -13.593 32.754  92.064  1.00 30.60  ? 125 LEU D CA  1 
ATOM   5299  C C   . LEU D  1 101 ? -13.762 34.215  92.456  1.00 31.63  ? 125 LEU D C   1 
ATOM   5300  O O   . LEU D  1 101 ? -12.877 34.797  93.101  1.00 30.07  ? 125 LEU D O   1 
ATOM   5301  C CB  . LEU D  1 101 ? -12.327 32.566  91.224  1.00 30.15  ? 125 LEU D CB  1 
ATOM   5302  C CG  . LEU D  1 101 ? -12.198 31.148  90.615  1.00 30.15  ? 125 LEU D CG  1 
ATOM   5303  C CD1 . LEU D  1 101 ? -11.088 31.046  89.628  1.00 30.20  ? 125 LEU D CD1 1 
ATOM   5304  C CD2 . LEU D  1 101 ? -11.983 30.065  91.644  1.00 30.58  ? 125 LEU D CD2 1 
ATOM   5305  N N   . ASP D  1 102 ? -14.888 34.818  92.067  1.00 33.49  ? 126 ASP D N   1 
ATOM   5306  C CA  . ASP D  1 102 ? -15.058 36.243  92.272  1.00 35.91  ? 126 ASP D CA  1 
ATOM   5307  C C   . ASP D  1 102 ? -16.215 36.509  93.218  1.00 37.62  ? 126 ASP D C   1 
ATOM   5308  O O   . ASP D  1 102 ? -16.617 37.660  93.347  1.00 39.29  ? 126 ASP D O   1 
ATOM   5309  C CB  . ASP D  1 102 ? -15.180 37.032  90.938  1.00 35.06  ? 126 ASP D CB  1 
ATOM   5310  C CG  . ASP D  1 102 ? -16.432 36.686  90.152  1.00 37.06  ? 126 ASP D CG  1 
ATOM   5311  O OD1 . ASP D  1 102 ? -17.174 35.760  90.550  1.00 38.23  ? 126 ASP D OD1 1 
ATOM   5312  O OD2 . ASP D  1 102 ? -16.655 37.298  89.078  1.00 39.12  ? 126 ASP D OD2 1 
ATOM   5313  N N   . ASP D  1 103 ? -16.757 35.475  93.865  1.00 37.50  ? 127 ASP D N   1 
ATOM   5314  C CA  . ASP D  1 103 ? -17.838 35.685  94.798  1.00 39.52  ? 127 ASP D CA  1 
ATOM   5315  C C   . ASP D  1 103 ? -19.077 36.376  94.206  1.00 40.10  ? 127 ASP D C   1 
ATOM   5316  O O   . ASP D  1 103 ? -19.804 37.019  94.929  1.00 39.68  ? 127 ASP D O   1 
ATOM   5317  C CB  . ASP D  1 103 ? -17.345 36.516  95.987  1.00 41.23  ? 127 ASP D CB  1 
ATOM   5318  C CG  . ASP D  1 103 ? -18.361 36.574  97.133  1.00 43.17  ? 127 ASP D CG  1 
ATOM   5319  O OD1 . ASP D  1 103 ? -18.944 35.525  97.528  1.00 42.69  ? 127 ASP D OD1 1 
ATOM   5320  O OD2 . ASP D  1 103 ? -18.562 37.695  97.633  1.00 46.67  ? 127 ASP D OD2 1 
ATOM   5321  N N   . ASN D  1 104 ? -19.317 36.220  92.901  1.00 40.83  ? 128 ASN D N   1 
ATOM   5322  C CA  . ASN D  1 104 ? -20.500 36.714  92.239  1.00 39.61  ? 128 ASN D CA  1 
ATOM   5323  C C   . ASN D  1 104 ? -21.299 35.552  91.682  1.00 37.75  ? 128 ASN D C   1 
ATOM   5324  O O   . ASN D  1 104 ? -21.147 35.149  90.518  1.00 37.46  ? 128 ASN D O   1 
ATOM   5325  C CB  . ASN D  1 104 ? -20.100 37.622  91.101  1.00 42.94  ? 128 ASN D CB  1 
ATOM   5326  C CG  . ASN D  1 104 ? -21.315 38.163  90.338  1.00 45.15  ? 128 ASN D CG  1 
ATOM   5327  O OD1 . ASN D  1 104 ? -22.295 38.604  90.957  1.00 44.39  ? 128 ASN D OD1 1 
ATOM   5328  N ND2 . ASN D  1 104 ? -21.272 38.082  88.988  1.00 45.61  ? 128 ASN D ND2 1 
ATOM   5329  N N   . PHE D  1 105 ? -22.175 35.033  92.525  1.00 35.72  ? 129 PHE D N   1 
ATOM   5330  C CA  . PHE D  1 105 ? -22.952 33.862  92.208  1.00 33.37  ? 129 PHE D CA  1 
ATOM   5331  C C   . PHE D  1 105 ? -24.306 34.221  91.709  1.00 31.50  ? 129 PHE D C   1 
ATOM   5332  O O   . PHE D  1 105 ? -24.876 35.127  92.207  1.00 30.13  ? 129 PHE D O   1 
ATOM   5333  C CB  . PHE D  1 105 ? -23.243 33.094  93.455  1.00 33.28  ? 129 PHE D CB  1 
ATOM   5334  C CG  . PHE D  1 105 ? -22.072 32.602  94.141  1.00 32.43  ? 129 PHE D CG  1 
ATOM   5335  C CD1 . PHE D  1 105 ? -21.615 31.344  93.877  1.00 31.76  ? 129 PHE D CD1 1 
ATOM   5336  C CD2 . PHE D  1 105 ? -21.460 33.394  95.089  1.00 33.68  ? 129 PHE D CD2 1 
ATOM   5337  C CE1 . PHE D  1 105 ? -20.553 30.848  94.551  1.00 32.92  ? 129 PHE D CE1 1 
ATOM   5338  C CE2 . PHE D  1 105 ? -20.369 32.921  95.773  1.00 35.17  ? 129 PHE D CE2 1 
ATOM   5339  C CZ  . PHE D  1 105 ? -19.930 31.621  95.514  1.00 34.88  ? 129 PHE D CZ  1 
ATOM   5340  N N   . VAL D  1 106 ? -24.861 33.398  90.840  1.00 31.16  ? 130 VAL D N   1 
ATOM   5341  C CA  . VAL D  1 106 ? -26.224 33.551  90.423  1.00 32.29  ? 130 VAL D CA  1 
ATOM   5342  C C   . VAL D  1 106 ? -27.119 33.444  91.653  1.00 33.97  ? 130 VAL D C   1 
ATOM   5343  O O   . VAL D  1 106 ? -26.939 32.537  92.485  1.00 32.64  ? 130 VAL D O   1 
ATOM   5344  C CB  . VAL D  1 106 ? -26.664 32.410  89.506  1.00 32.49  ? 130 VAL D CB  1 
ATOM   5345  C CG1 . VAL D  1 106 ? -28.175 32.541  89.116  1.00 32.56  ? 130 VAL D CG1 1 
ATOM   5346  C CG2 . VAL D  1 106 ? -25.761 32.333  88.293  1.00 32.13  ? 130 VAL D CG2 1 
ATOM   5347  N N   . THR D  1 107 ? -28.099 34.345  91.724  1.00 35.63  ? 131 THR D N   1 
ATOM   5348  C CA  . THR D  1 107 ? -29.022 34.445  92.874  1.00 37.14  ? 131 THR D CA  1 
ATOM   5349  C C   . THR D  1 107 ? -29.789 33.168  93.147  1.00 36.36  ? 131 THR D C   1 
ATOM   5350  O O   . THR D  1 107 ? -30.253 32.474  92.251  1.00 38.39  ? 131 THR D O   1 
ATOM   5351  C CB  . THR D  1 107 ? -30.037 35.606  92.654  1.00 38.09  ? 131 THR D CB  1 
ATOM   5352  O OG1 . THR D  1 107 ? -29.295 36.818  92.639  1.00 38.40  ? 131 THR D OG1 1 
ATOM   5353  C CG2 . THR D  1 107 ? -31.142 35.693  93.725  1.00 37.38  ? 131 THR D CG2 1 
ATOM   5354  N N   . LYS D  1 108 ? -29.925 32.892  94.418  1.00 36.14  ? 132 LYS D N   1 
ATOM   5355  C CA  . LYS D  1 108 ? -30.617 31.736  94.868  1.00 36.70  ? 132 LYS D CA  1 
ATOM   5356  C C   . LYS D  1 108 ? -32.033 31.700  94.283  1.00 36.06  ? 132 LYS D C   1 
ATOM   5357  O O   . LYS D  1 108 ? -32.728 32.731  94.133  1.00 36.36  ? 132 LYS D O   1 
ATOM   5358  C CB  . LYS D  1 108 ? -30.625 31.749  96.392  1.00 38.70  ? 132 LYS D CB  1 
ATOM   5359  C CG  . LYS D  1 108 ? -30.969 30.416  96.979  1.00 42.57  ? 132 LYS D CG  1 
ATOM   5360  C CD  . LYS D  1 108 ? -31.009 30.416  98.501  1.00 45.61  ? 132 LYS D CD  1 
ATOM   5361  C CE  . LYS D  1 108 ? -31.634 29.082  98.941  1.00 48.41  ? 132 LYS D CE  1 
ATOM   5362  N NZ  . LYS D  1 108 ? -31.397 28.875  100.383 1.00 48.92  ? 132 LYS D NZ  1 
ATOM   5363  N N   . ALA D  1 109 ? -32.457 30.495  93.941  1.00 36.01  ? 133 ALA D N   1 
ATOM   5364  C CA  . ALA D  1 109 ? -33.733 30.293  93.324  1.00 35.79  ? 133 ALA D CA  1 
ATOM   5365  C C   . ALA D  1 109 ? -34.203 28.896  93.633  1.00 37.05  ? 133 ALA D C   1 
ATOM   5366  O O   . ALA D  1 109 ? -33.476 27.931  93.409  1.00 36.99  ? 133 ALA D O   1 
ATOM   5367  C CB  . ALA D  1 109 ? -33.563 30.480  91.834  1.00 35.23  ? 133 ALA D CB  1 
ATOM   5368  N N   . THR D  1 110 ? -35.419 28.775  94.143  1.00 39.48  ? 134 THR D N   1 
ATOM   5369  C CA  . THR D  1 110 ? -36.079 27.440  94.273  1.00 41.72  ? 134 THR D CA  1 
ATOM   5370  C C   . THR D  1 110 ? -36.274 26.616  92.967  1.00 40.81  ? 134 THR D C   1 
ATOM   5371  O O   . THR D  1 110 ? -36.157 25.349  92.965  1.00 41.29  ? 134 THR D O   1 
ATOM   5372  C CB  . THR D  1 110 ? -37.521 27.586  94.834  1.00 41.90  ? 134 THR D CB  1 
ATOM   5373  O OG1 . THR D  1 110 ? -37.526 28.573  95.864  1.00 43.39  ? 134 THR D OG1 1 
ATOM   5374  C CG2 . THR D  1 110 ? -38.018 26.262  95.387  1.00 41.17  ? 134 THR D CG2 1 
ATOM   5375  N N   . ALA D  1 111 ? -36.653 27.354  91.913  1.00 39.40  ? 135 ALA D N   1 
ATOM   5376  C CA  . ALA D  1 111 ? -37.050 26.789  90.620  1.00 38.88  ? 135 ALA D CA  1 
ATOM   5377  C C   . ALA D  1 111 ? -36.897 27.755  89.389  1.00 38.25  ? 135 ALA D C   1 
ATOM   5378  O O   . ALA D  1 111 ? -37.877 28.095  88.728  1.00 37.82  ? 135 ALA D O   1 
ATOM   5379  C CB  . ALA D  1 111 ? -38.481 26.287  90.719  1.00 38.44  ? 135 ALA D CB  1 
ATOM   5380  N N   . LEU D  1 112 ? -35.682 28.183  89.077  1.00 36.42  ? 136 LEU D N   1 
ATOM   5381  C CA  . LEU D  1 112 ? -35.424 28.814  87.774  1.00 36.23  ? 136 LEU D CA  1 
ATOM   5382  C C   . LEU D  1 112 ? -35.887 27.889  86.639  1.00 34.96  ? 136 LEU D C   1 
ATOM   5383  O O   . LEU D  1 112 ? -35.815 26.673  86.763  1.00 34.74  ? 136 LEU D O   1 
ATOM   5384  C CB  . LEU D  1 112 ? -33.931 29.078  87.608  1.00 37.28  ? 136 LEU D CB  1 
ATOM   5385  C CG  . LEU D  1 112 ? -33.499 30.429  87.093  1.00 39.52  ? 136 LEU D CG  1 
ATOM   5386  C CD1 . LEU D  1 112 ? -34.046 31.604  87.944  1.00 39.55  ? 136 LEU D CD1 1 
ATOM   5387  C CD2 . LEU D  1 112 ? -31.974 30.439  87.095  1.00 39.54  ? 136 LEU D CD2 1 
ATOM   5388  N N   . THR D  1 113 ? -36.310 28.471  85.524  1.00 34.10  ? 137 THR D N   1 
ATOM   5389  C CA  . THR D  1 113 ? -36.804 27.706  84.404  1.00 33.17  ? 137 THR D CA  1 
ATOM   5390  C C   . THR D  1 113 ? -35.660 27.266  83.461  1.00 34.44  ? 137 THR D C   1 
ATOM   5391  O O   . THR D  1 113 ? -35.897 26.678  82.411  1.00 36.16  ? 137 THR D O   1 
ATOM   5392  C CB  . THR D  1 113 ? -37.879 28.486  83.628  1.00 32.93  ? 137 THR D CB  1 
ATOM   5393  O OG1 . THR D  1 113 ? -37.308 29.648  83.028  1.00 34.36  ? 137 THR D OG1 1 
ATOM   5394  C CG2 . THR D  1 113 ? -39.011 28.929  84.506  1.00 32.46  ? 137 THR D CG2 1 
ATOM   5395  N N   . TYR D  1 114 ? -34.421 27.559  83.819  1.00 34.69  ? 138 TYR D N   1 
ATOM   5396  C CA  . TYR D  1 114 ? -33.270 27.057  83.109  1.00 33.92  ? 138 TYR D CA  1 
ATOM   5397  C C   . TYR D  1 114 ? -32.132 26.844  84.108  1.00 34.52  ? 138 TYR D C   1 
ATOM   5398  O O   . TYR D  1 114 ? -32.154 27.393  85.230  1.00 34.00  ? 138 TYR D O   1 
ATOM   5399  C CB  . TYR D  1 114 ? -32.850 28.031  81.989  1.00 34.01  ? 138 TYR D CB  1 
ATOM   5400  C CG  . TYR D  1 114 ? -32.417 29.394  82.447  1.00 34.93  ? 138 TYR D CG  1 
ATOM   5401  C CD1 . TYR D  1 114 ? -33.365 30.341  82.964  1.00 36.11  ? 138 TYR D CD1 1 
ATOM   5402  C CD2 . TYR D  1 114 ? -31.065 29.778  82.406  1.00 34.43  ? 138 TYR D CD2 1 
ATOM   5403  C CE1 . TYR D  1 114 ? -32.941 31.606  83.423  1.00 34.71  ? 138 TYR D CE1 1 
ATOM   5404  C CE2 . TYR D  1 114 ? -30.662 31.042  82.848  1.00 33.70  ? 138 TYR D CE2 1 
ATOM   5405  C CZ  . TYR D  1 114 ? -31.597 31.942  83.336  1.00 33.98  ? 138 TYR D CZ  1 
ATOM   5406  O OH  . TYR D  1 114 ? -31.204 33.165  83.787  1.00 35.14  ? 138 TYR D OH  1 
ATOM   5407  N N   . ASP D  1 115 ? -31.150 26.036  83.702  1.00 34.21  ? 139 ASP D N   1 
ATOM   5408  C CA  . ASP D  1 115 ? -29.940 25.815  84.505  1.00 33.23  ? 139 ASP D CA  1 
ATOM   5409  C C   . ASP D  1 115 ? -28.951 26.953  84.170  1.00 32.73  ? 139 ASP D C   1 
ATOM   5410  O O   . ASP D  1 115 ? -28.288 26.896  83.155  1.00 34.38  ? 139 ASP D O   1 
ATOM   5411  C CB  . ASP D  1 115 ? -29.395 24.450  84.150  1.00 33.18  ? 139 ASP D CB  1 
ATOM   5412  C CG  . ASP D  1 115 ? -28.116 24.123  84.788  1.00 33.88  ? 139 ASP D CG  1 
ATOM   5413  O OD1 . ASP D  1 115 ? -27.490 25.020  85.396  1.00 35.61  ? 139 ASP D OD1 1 
ATOM   5414  O OD2 . ASP D  1 115 ? -27.727 22.925  84.656  1.00 35.97  ? 139 ASP D OD2 1 
ATOM   5415  N N   . PRO D  1 116 ? -28.842 27.971  85.020  1.00 31.50  ? 140 PRO D N   1 
ATOM   5416  C CA  . PRO D  1 116 ? -28.013 29.089  84.672  1.00 31.96  ? 140 PRO D CA  1 
ATOM   5417  C C   . PRO D  1 116 ? -26.519 28.811  84.730  1.00 32.87  ? 140 PRO D C   1 
ATOM   5418  O O   . PRO D  1 116 ? -25.765 29.723  84.380  1.00 32.82  ? 140 PRO D O   1 
ATOM   5419  C CB  . PRO D  1 116 ? -28.311 30.089  85.785  1.00 32.28  ? 140 PRO D CB  1 
ATOM   5420  C CG  . PRO D  1 116 ? -28.466 29.223  86.997  1.00 31.91  ? 140 PRO D CG  1 
ATOM   5421  C CD  . PRO D  1 116 ? -29.129 27.960  86.466  1.00 32.07  ? 140 PRO D CD  1 
ATOM   5422  N N   . TYR D  1 117 ? -26.048 27.641  85.205  1.00 33.05  ? 141 TYR D N   1 
ATOM   5423  C CA  . TYR D  1 117 ? -24.568 27.383  85.159  1.00 33.31  ? 141 TYR D CA  1 
ATOM   5424  C C   . TYR D  1 117 ? -24.124 26.511  83.979  1.00 34.36  ? 141 TYR D C   1 
ATOM   5425  O O   . TYR D  1 117 ? -22.928 26.239  83.823  1.00 35.48  ? 141 TYR D O   1 
ATOM   5426  C CB  . TYR D  1 117 ? -24.042 26.809  86.487  1.00 32.79  ? 141 TYR D CB  1 
ATOM   5427  C CG  . TYR D  1 117 ? -24.033 27.831  87.635  1.00 32.74  ? 141 TYR D CG  1 
ATOM   5428  C CD1 . TYR D  1 117 ? -23.249 28.993  87.550  1.00 33.55  ? 141 TYR D CD1 1 
ATOM   5429  C CD2 . TYR D  1 117 ? -24.828 27.659  88.789  1.00 31.89  ? 141 TYR D CD2 1 
ATOM   5430  C CE1 . TYR D  1 117 ? -23.250 29.946  88.562  1.00 32.39  ? 141 TYR D CE1 1 
ATOM   5431  C CE2 . TYR D  1 117 ? -24.841 28.602  89.790  1.00 31.60  ? 141 TYR D CE2 1 
ATOM   5432  C CZ  . TYR D  1 117 ? -24.056 29.736  89.663  1.00 32.52  ? 141 TYR D CZ  1 
ATOM   5433  O OH  . TYR D  1 117 ? -24.039 30.676  90.640  1.00 33.18  ? 141 TYR D OH  1 
ATOM   5434  N N   . VAL D  1 118 ? -25.047 26.093  83.125  1.00 33.84  ? 142 VAL D N   1 
ATOM   5435  C CA  . VAL D  1 118 ? -24.701 25.038  82.214  1.00 34.52  ? 142 VAL D CA  1 
ATOM   5436  C C   . VAL D  1 118 ? -23.652 25.484  81.180  1.00 34.27  ? 142 VAL D C   1 
ATOM   5437  O O   . VAL D  1 118 ? -22.850 24.659  80.740  1.00 35.75  ? 142 VAL D O   1 
ATOM   5438  C CB  . VAL D  1 118 ? -25.919 24.469  81.494  1.00 36.73  ? 142 VAL D CB  1 
ATOM   5439  C CG1 . VAL D  1 118 ? -26.558 25.503  80.538  1.00 37.41  ? 142 VAL D CG1 1 
ATOM   5440  C CG2 . VAL D  1 118 ? -25.502 23.212  80.726  1.00 37.81  ? 142 VAL D CG2 1 
ATOM   5441  N N   . ASN D  1 119 ? -23.666 26.764  80.784  1.00 31.69  ? 143 ASN D N   1 
ATOM   5442  C CA  . ASN D  1 119 ? -22.723 27.267  79.785  1.00 30.28  ? 143 ASN D CA  1 
ATOM   5443  C C   . ASN D  1 119 ? -21.394 27.807  80.402  1.00 30.43  ? 143 ASN D C   1 
ATOM   5444  O O   . ASN D  1 119 ? -20.471 28.190  79.643  1.00 30.96  ? 143 ASN D O   1 
ATOM   5445  C CB  . ASN D  1 119 ? -23.345 28.380  78.941  1.00 29.59  ? 143 ASN D CB  1 
ATOM   5446  C CG  . ASN D  1 119 ? -24.566 27.940  78.118  1.00 29.32  ? 143 ASN D CG  1 
ATOM   5447  O OD1 . ASN D  1 119 ? -24.651 26.821  77.614  1.00 28.34  ? 143 ASN D OD1 1 
ATOM   5448  N ND2 . ASN D  1 119 ? -25.485 28.890  77.908  1.00 29.36  ? 143 ASN D ND2 1 
ATOM   5449  N N   . TYR D  1 120 ? -21.265 27.850  81.732  1.00 29.38  ? 144 TYR D N   1 
ATOM   5450  C CA  . TYR D  1 120 ? -20.033 28.395  82.347  1.00 29.69  ? 144 TYR D CA  1 
ATOM   5451  C C   . TYR D  1 120 ? -18.831 27.543  81.872  1.00 29.64  ? 144 TYR D C   1 
ATOM   5452  O O   . TYR D  1 120 ? -18.984 26.328  81.730  1.00 29.09  ? 144 TYR D O   1 
ATOM   5453  C CB  . TYR D  1 120 ? -20.093 28.405  83.891  1.00 29.11  ? 144 TYR D CB  1 
ATOM   5454  C CG  . TYR D  1 120 ? -20.814 29.595  84.508  1.00 28.48  ? 144 TYR D CG  1 
ATOM   5455  C CD1 . TYR D  1 120 ? -22.115 29.878  84.167  1.00 28.08  ? 144 TYR D CD1 1 
ATOM   5456  C CD2 . TYR D  1 120 ? -20.181 30.437  85.470  1.00 27.73  ? 144 TYR D CD2 1 
ATOM   5457  C CE1 . TYR D  1 120 ? -22.774 30.963  84.726  1.00 27.43  ? 144 TYR D CE1 1 
ATOM   5458  C CE2 . TYR D  1 120 ? -20.826 31.524  86.007  1.00 26.97  ? 144 TYR D CE2 1 
ATOM   5459  C CZ  . TYR D  1 120 ? -22.119 31.763  85.603  1.00 27.08  ? 144 TYR D CZ  1 
ATOM   5460  O OH  . TYR D  1 120 ? -22.828 32.775  86.084  1.00 27.02  ? 144 TYR D OH  1 
ATOM   5461  N N   . SER D  1 121 ? -17.683 28.164  81.614  1.00 29.35  ? 145 SER D N   1 
ATOM   5462  C CA  . SER D  1 121 ? -16.483 27.426  81.169  1.00 30.50  ? 145 SER D CA  1 
ATOM   5463  C C   . SER D  1 121 ? -16.130 26.293  82.128  1.00 31.53  ? 145 SER D C   1 
ATOM   5464  O O   . SER D  1 121 ? -15.953 25.151  81.755  1.00 34.38  ? 145 SER D O   1 
ATOM   5465  C CB  . SER D  1 121 ? -15.291 28.368  81.043  1.00 30.33  ? 145 SER D CB  1 
ATOM   5466  O OG  . SER D  1 121 ? -15.511 29.328  80.005  1.00 29.52  ? 145 SER D OG  1 
ATOM   5467  N N   . SER D  1 122 ? -16.167 26.617  83.398  1.00 31.90  ? 146 SER D N   1 
ATOM   5468  C CA  . SER D  1 122 ? -15.879 25.694  84.483  1.00 30.72  ? 146 SER D CA  1 
ATOM   5469  C C   . SER D  1 122 ? -17.001 24.713  84.833  1.00 30.75  ? 146 SER D C   1 
ATOM   5470  O O   . SER D  1 122 ? -16.889 24.015  85.838  1.00 30.77  ? 146 SER D O   1 
ATOM   5471  C CB  . SER D  1 122 ? -15.534 26.547  85.743  1.00 30.14  ? 146 SER D CB  1 
ATOM   5472  O OG  . SER D  1 122 ? -16.665 27.250  86.274  1.00 29.31  ? 146 SER D OG  1 
ATOM   5473  N N   . ARG D  1 123 ? -18.100 24.654  84.085  1.00 31.40  ? 147 ARG D N   1 
ATOM   5474  C CA  . ARG D  1 123 ? -19.221 23.771  84.503  1.00 32.49  ? 147 ARG D CA  1 
ATOM   5475  C C   . ARG D  1 123 ? -18.836 22.277  84.506  1.00 33.88  ? 147 ARG D C   1 
ATOM   5476  O O   . ARG D  1 123 ? -18.200 21.845  83.587  1.00 38.09  ? 147 ARG D O   1 
ATOM   5477  C CB  . ARG D  1 123 ? -20.388 23.967  83.551  1.00 32.56  ? 147 ARG D CB  1 
ATOM   5478  C CG  . ARG D  1 123 ? -21.574 23.080  83.831  1.00 32.73  ? 147 ARG D CG  1 
ATOM   5479  C CD  . ARG D  1 123 ? -21.636 21.867  82.917  1.00 32.88  ? 147 ARG D CD  1 
ATOM   5480  N NE  . ARG D  1 123 ? -22.025 22.177  81.542  1.00 32.55  ? 147 ARG D NE  1 
ATOM   5481  C CZ  . ARG D  1 123 ? -21.856 21.357  80.508  1.00 32.39  ? 147 ARG D CZ  1 
ATOM   5482  N NH1 . ARG D  1 123 ? -22.210 21.743  79.288  1.00 32.20  ? 147 ARG D NH1 1 
ATOM   5483  N NH2 . ARG D  1 123 ? -21.293 20.158  80.668  1.00 33.43  ? 147 ARG D NH2 1 
ATOM   5484  N N   . HIS D  1 124 ? -19.181 21.472  85.497  1.00 33.93  ? 148 HIS D N   1 
ATOM   5485  C CA  . HIS D  1 124 ? -19.232 20.008  85.243  1.00 33.48  ? 148 HIS D CA  1 
ATOM   5486  C C   . HIS D  1 124 ? -20.701 19.614  85.378  1.00 31.48  ? 148 HIS D C   1 
ATOM   5487  O O   . HIS D  1 124 ? -21.455 20.301  86.037  1.00 31.09  ? 148 HIS D O   1 
ATOM   5488  C CB  . HIS D  1 124 ? -18.393 19.172  86.209  1.00 33.87  ? 148 HIS D CB  1 
ATOM   5489  C CG  . HIS D  1 124 ? -16.921 19.345  86.061  1.00 33.77  ? 148 HIS D CG  1 
ATOM   5490  N ND1 . HIS D  1 124 ? -16.019 18.565  86.764  1.00 33.87  ? 148 HIS D ND1 1 
ATOM   5491  C CD2 . HIS D  1 124 ? -16.183 20.207  85.332  1.00 33.33  ? 148 HIS D CD2 1 
ATOM   5492  C CE1 . HIS D  1 124 ? -14.786 18.940  86.484  1.00 33.61  ? 148 HIS D CE1 1 
ATOM   5493  N NE2 . HIS D  1 124 ? -14.855 19.945  85.628  1.00 35.05  ? 148 HIS D NE2 1 
ATOM   5494  N N   . THR D  1 125 ? -21.090 18.517  84.749  1.00 30.09  ? 149 THR D N   1 
ATOM   5495  C CA  . THR D  1 125 ? -22.451 18.008  84.869  1.00 29.87  ? 149 THR D CA  1 
ATOM   5496  C C   . THR D  1 125 ? -22.731 17.287  86.214  1.00 30.26  ? 149 THR D C   1 
ATOM   5497  O O   . THR D  1 125 ? -21.897 16.627  86.744  1.00 28.53  ? 149 THR D O   1 
ATOM   5498  C CB  . THR D  1 125 ? -22.706 17.037  83.716  1.00 29.50  ? 149 THR D CB  1 
ATOM   5499  O OG1 . THR D  1 125 ? -22.217 17.645  82.496  1.00 28.83  ? 149 THR D OG1 1 
ATOM   5500  C CG2 . THR D  1 125 ? -24.242 16.568  83.664  1.00 28.15  ? 149 THR D CG2 1 
ATOM   5501  N N   . ILE D  1 126 ? -23.914 17.471  86.767  1.00 32.01  ? 150 ILE D N   1 
ATOM   5502  C CA  . ILE D  1 126 ? -24.323 16.796  87.968  1.00 32.69  ? 150 ILE D CA  1 
ATOM   5503  C C   . ILE D  1 126 ? -25.437 15.849  87.557  1.00 31.78  ? 150 ILE D C   1 
ATOM   5504  O O   . ILE D  1 126 ? -26.360 16.236  86.907  1.00 31.25  ? 150 ILE D O   1 
ATOM   5505  C CB  . ILE D  1 126 ? -24.874 17.755  89.041  1.00 34.77  ? 150 ILE D CB  1 
ATOM   5506  C CG1 . ILE D  1 126 ? -23.811 18.750  89.514  1.00 36.62  ? 150 ILE D CG1 1 
ATOM   5507  C CG2 . ILE D  1 126 ? -25.316 16.971  90.273  1.00 34.62  ? 150 ILE D CG2 1 
ATOM   5508  C CD1 . ILE D  1 126 ? -24.310 19.730  90.580  1.00 37.01  ? 150 ILE D CD1 1 
ATOM   5509  N N   . THR D  1 127 ? -25.366 14.628  88.028  1.00 31.09  ? 151 THR D N   1 
ATOM   5510  C CA  . THR D  1 127 ? -26.259 13.577  87.657  1.00 31.12  ? 151 THR D CA  1 
ATOM   5511  C C   . THR D  1 127 ? -27.058 13.262  88.903  1.00 32.26  ? 151 THR D C   1 
ATOM   5512  O O   . THR D  1 127 ? -26.494 13.066  89.978  1.00 36.36  ? 151 THR D O   1 
ATOM   5513  C CB  . THR D  1 127 ? -25.337 12.479  87.111  1.00 31.02  ? 151 THR D CB  1 
ATOM   5514  O OG1 . THR D  1 127 ? -25.464 12.525  85.685  1.00 33.43  ? 151 THR D OG1 1 
ATOM   5515  C CG2 . THR D  1 127 ? -25.624 11.145  87.586  1.00 30.28  ? 151 THR D CG2 1 
ATOM   5516  N N   . GLN D  1 128 ? -28.362 13.270  88.820  1.00 31.33  ? 152 GLN D N   1 
ATOM   5517  C CA  . GLN D  1 128 ? -29.168 13.207  90.038  1.00 31.81  ? 152 GLN D CA  1 
ATOM   5518  C C   . GLN D  1 128 ? -30.145 12.043  89.992  1.00 33.61  ? 152 GLN D C   1 
ATOM   5519  O O   . GLN D  1 128 ? -30.566 11.665  88.863  1.00 36.19  ? 152 GLN D O   1 
ATOM   5520  C CB  . GLN D  1 128 ? -29.985 14.466  90.163  1.00 31.34  ? 152 GLN D CB  1 
ATOM   5521  C CG  . GLN D  1 128 ? -29.148 15.730  90.157  1.00 31.09  ? 152 GLN D CG  1 
ATOM   5522  C CD  . GLN D  1 128 ? -29.994 16.982  90.018  1.00 30.04  ? 152 GLN D CD  1 
ATOM   5523  O OE1 . GLN D  1 128 ? -29.693 17.832  89.162  1.00 30.32  ? 152 GLN D OE1 1 
ATOM   5524  N NE2 . GLN D  1 128 ? -31.035 17.108  90.849  1.00 27.68  ? 152 GLN D NE2 1 
ATOM   5525  N N   . PRO D  1 129 ? -30.562 11.502  91.149  1.00 33.10  ? 153 PRO D N   1 
ATOM   5526  C CA  . PRO D  1 129 ? -30.205 11.969  92.470  1.00 32.76  ? 153 PRO D CA  1 
ATOM   5527  C C   . PRO D  1 129 ? -29.300 10.985  93.217  1.00 31.22  ? 153 PRO D C   1 
ATOM   5528  O O   . PRO D  1 129 ? -29.118 11.150  94.426  1.00 31.97  ? 153 PRO D O   1 
ATOM   5529  C CB  . PRO D  1 129 ? -31.578 11.971  93.170  1.00 33.65  ? 153 PRO D CB  1 
ATOM   5530  C CG  . PRO D  1 129 ? -32.225 10.706  92.688  1.00 32.94  ? 153 PRO D CG  1 
ATOM   5531  C CD  . PRO D  1 129 ? -31.751 10.619  91.237  1.00 34.00  ? 153 PRO D CD  1 
ATOM   5532  N N   . PHE D  1 130 ? -28.812 9.948   92.558  1.00 29.75  ? 154 PHE D N   1 
ATOM   5533  C CA  . PHE D  1 130 ? -28.098 8.902   93.280  1.00 30.08  ? 154 PHE D CA  1 
ATOM   5534  C C   . PHE D  1 130 ? -26.628 8.825   92.969  1.00 29.18  ? 154 PHE D C   1 
ATOM   5535  O O   . PHE D  1 130 ? -25.983 7.852   93.295  1.00 27.58  ? 154 PHE D O   1 
ATOM   5536  C CB  . PHE D  1 130 ? -28.749 7.525   93.141  1.00 31.20  ? 154 PHE D CB  1 
ATOM   5537  C CG  . PHE D  1 130 ? -28.990 7.105   91.718  1.00 31.45  ? 154 PHE D CG  1 
ATOM   5538  C CD1 . PHE D  1 130 ? -27.939 6.639   90.917  1.00 29.99  ? 154 PHE D CD1 1 
ATOM   5539  C CD2 . PHE D  1 130 ? -30.296 7.156   91.183  1.00 31.32  ? 154 PHE D CD2 1 
ATOM   5540  C CE1 . PHE D  1 130 ? -28.170 6.299   89.610  1.00 29.44  ? 154 PHE D CE1 1 
ATOM   5541  C CE2 . PHE D  1 130 ? -30.523 6.777   89.868  1.00 31.40  ? 154 PHE D CE2 1 
ATOM   5542  C CZ  . PHE D  1 130 ? -29.451 6.363   89.083  1.00 30.17  ? 154 PHE D CZ  1 
ATOM   5543  N N   . SER D  1 131 ? -26.065 9.907   92.464  1.00 30.68  ? 155 SER D N   1 
ATOM   5544  C CA  . SER D  1 131 ? -24.653 9.898   92.064  1.00 30.98  ? 155 SER D CA  1 
ATOM   5545  C C   . SER D  1 131 ? -23.812 10.887  92.829  1.00 29.90  ? 155 SER D C   1 
ATOM   5546  O O   . SER D  1 131 ? -24.252 11.981  93.202  1.00 28.08  ? 155 SER D O   1 
ATOM   5547  C CB  . SER D  1 131 ? -24.554 10.220  90.606  1.00 31.55  ? 155 SER D CB  1 
ATOM   5548  O OG  . SER D  1 131 ? -25.342 9.300   89.885  1.00 32.76  ? 155 SER D OG  1 
ATOM   5549  N N   . TYR D  1 132 ? -22.584 10.434  93.045  1.00 28.93  ? 156 TYR D N   1 
ATOM   5550  C CA  . TYR D  1 132 ? -21.527 11.228  93.627  1.00 27.34  ? 156 TYR D CA  1 
ATOM   5551  C C   . TYR D  1 132 ? -21.174 12.340  92.621  1.00 26.94  ? 156 TYR D C   1 
ATOM   5552  O O   . TYR D  1 132 ? -21.276 12.158  91.433  1.00 24.77  ? 156 TYR D O   1 
ATOM   5553  C CB  . TYR D  1 132 ? -20.350 10.323  93.903  1.00 25.91  ? 156 TYR D CB  1 
ATOM   5554  C CG  . TYR D  1 132 ? -19.096 10.974  94.386  1.00 26.14  ? 156 TYR D CG  1 
ATOM   5555  C CD1 . TYR D  1 132 ? -18.859 11.183  95.730  1.00 25.92  ? 156 TYR D CD1 1 
ATOM   5556  C CD2 . TYR D  1 132 ? -18.071 11.296  93.487  1.00 25.91  ? 156 TYR D CD2 1 
ATOM   5557  C CE1 . TYR D  1 132 ? -17.653 11.761  96.151  1.00 25.63  ? 156 TYR D CE1 1 
ATOM   5558  C CE2 . TYR D  1 132 ? -16.867 11.838  93.903  1.00 25.10  ? 156 TYR D CE2 1 
ATOM   5559  C CZ  . TYR D  1 132 ? -16.675 12.078  95.229  1.00 25.35  ? 156 TYR D CZ  1 
ATOM   5560  O OH  . TYR D  1 132 ? -15.480 12.611  95.603  1.00 25.86  ? 156 TYR D OH  1 
ATOM   5561  N N   . HIS D  1 133 ? -20.826 13.493  93.147  1.00 27.82  ? 157 HIS D N   1 
ATOM   5562  C CA  . HIS D  1 133 ? -20.371 14.596  92.352  1.00 29.90  ? 157 HIS D CA  1 
ATOM   5563  C C   . HIS D  1 133 ? -19.272 15.283  93.125  1.00 30.15  ? 157 HIS D C   1 
ATOM   5564  O O   . HIS D  1 133 ? -19.454 15.675  94.299  1.00 30.05  ? 157 HIS D O   1 
ATOM   5565  C CB  . HIS D  1 133 ? -21.519 15.613  92.065  1.00 29.92  ? 157 HIS D CB  1 
ATOM   5566  C CG  . HIS D  1 133 ? -21.086 16.758  91.199  1.00 29.85  ? 157 HIS D CG  1 
ATOM   5567  N ND1 . HIS D  1 133 ? -20.773 16.597  89.877  1.00 30.17  ? 157 HIS D ND1 1 
ATOM   5568  C CD2 . HIS D  1 133 ? -20.818 18.055  91.492  1.00 30.34  ? 157 HIS D CD2 1 
ATOM   5569  C CE1 . HIS D  1 133 ? -20.380 17.759  89.379  1.00 30.74  ? 157 HIS D CE1 1 
ATOM   5570  N NE2 . HIS D  1 133 ? -20.395 18.662  90.341  1.00 29.53  ? 157 HIS D NE2 1 
ATOM   5571  N N   . SER D  1 134 ? -18.131 15.485  92.491  1.00 30.20  ? 158 SER D N   1 
ATOM   5572  C CA  . SER D  1 134 ? -17.147 16.293  93.216  1.00 30.35  ? 158 SER D CA  1 
ATOM   5573  C C   . SER D  1 134 ? -16.446 17.290  92.358  1.00 29.90  ? 158 SER D C   1 
ATOM   5574  O O   . SER D  1 134 ? -16.469 17.199  91.112  1.00 29.10  ? 158 SER D O   1 
ATOM   5575  C CB  . SER D  1 134 ? -16.133 15.430  93.937  1.00 30.85  ? 158 SER D CB  1 
ATOM   5576  O OG  . SER D  1 134 ? -15.478 14.573  93.020  1.00 31.48  ? 158 SER D OG  1 
ATOM   5577  N N   . ARG D  1 135 ? -15.875 18.272  93.046  1.00 29.54  ? 159 ARG D N   1 
ATOM   5578  C CA  . ARG D  1 135 ? -15.053 19.278  92.392  1.00 30.20  ? 159 ARG D CA  1 
ATOM   5579  C C   . ARG D  1 135 ? -13.868 19.479  93.253  1.00 29.69  ? 159 ARG D C   1 
ATOM   5580  O O   . ARG D  1 135 ? -13.930 19.275  94.456  1.00 30.48  ? 159 ARG D O   1 
ATOM   5581  C CB  . ARG D  1 135 ? -15.764 20.629  92.205  1.00 29.94  ? 159 ARG D CB  1 
ATOM   5582  C CG  . ARG D  1 135 ? -17.009 20.623  91.332  1.00 30.18  ? 159 ARG D CG  1 
ATOM   5583  C CD  . ARG D  1 135 ? -16.784 20.140  89.924  1.00 30.12  ? 159 ARG D CD  1 
ATOM   5584  N NE  . ARG D  1 135 ? -15.839 20.968  89.195  1.00 30.61  ? 159 ARG D NE  1 
ATOM   5585  C CZ  . ARG D  1 135 ? -16.147 21.994  88.387  1.00 30.78  ? 159 ARG D CZ  1 
ATOM   5586  N NH1 . ARG D  1 135 ? -15.154 22.628  87.796  1.00 29.32  ? 159 ARG D NH1 1 
ATOM   5587  N NH2 . ARG D  1 135 ? -17.419 22.414  88.177  1.00 31.35  ? 159 ARG D NH2 1 
ATOM   5588  N N   . TYR D  1 136 ? -12.815 19.932  92.616  1.00 28.95  ? 160 TYR D N   1 
ATOM   5589  C CA  . TYR D  1 136 ? -11.538 20.055  93.247  1.00 29.31  ? 160 TYR D CA  1 
ATOM   5590  C C   . TYR D  1 136 ? -10.810 21.174  92.536  1.00 29.77  ? 160 TYR D C   1 
ATOM   5591  O O   . TYR D  1 136 ? -10.590 21.086  91.344  1.00 29.34  ? 160 TYR D O   1 
ATOM   5592  C CB  . TYR D  1 136 ? -10.806 18.749  93.067  1.00 28.89  ? 160 TYR D CB  1 
ATOM   5593  C CG  . TYR D  1 136 ? -9.420  18.707  93.561  1.00 28.17  ? 160 TYR D CG  1 
ATOM   5594  C CD1 . TYR D  1 136 ? -9.153  18.526  94.897  1.00 28.25  ? 160 TYR D CD1 1 
ATOM   5595  C CD2 . TYR D  1 136 ? -8.384  18.835  92.710  1.00 28.16  ? 160 TYR D CD2 1 
ATOM   5596  C CE1 . TYR D  1 136 ? -7.856  18.472  95.373  1.00 27.85  ? 160 TYR D CE1 1 
ATOM   5597  C CE2 . TYR D  1 136 ? -7.082  18.766  93.171  1.00 28.86  ? 160 TYR D CE2 1 
ATOM   5598  C CZ  . TYR D  1 136 ? -6.833  18.559  94.511  1.00 28.40  ? 160 TYR D CZ  1 
ATOM   5599  O OH  . TYR D  1 136 ? -5.519  18.495  94.952  1.00 29.26  ? 160 TYR D OH  1 
ATOM   5600  N N   . PHE D  1 137 ? -10.448 22.221  93.266  1.00 31.13  ? 161 PHE D N   1 
ATOM   5601  C CA  . PHE D  1 137 ? -9.953  23.450  92.661  1.00 32.38  ? 161 PHE D CA  1 
ATOM   5602  C C   . PHE D  1 137 ? -9.386  24.381  93.676  1.00 34.78  ? 161 PHE D C   1 
ATOM   5603  O O   . PHE D  1 137 ? -9.573  24.193  94.861  1.00 37.25  ? 161 PHE D O   1 
ATOM   5604  C CB  . PHE D  1 137 ? -11.060 24.192  91.931  1.00 31.36  ? 161 PHE D CB  1 
ATOM   5605  C CG  . PHE D  1 137 ? -12.194 24.616  92.789  1.00 31.70  ? 161 PHE D CG  1 
ATOM   5606  C CD1 . PHE D  1 137 ? -13.221 23.715  93.118  1.00 32.19  ? 161 PHE D CD1 1 
ATOM   5607  C CD2 . PHE D  1 137 ? -12.267 25.895  93.259  1.00 32.02  ? 161 PHE D CD2 1 
ATOM   5608  C CE1 . PHE D  1 137 ? -14.317 24.115  93.877  1.00 32.25  ? 161 PHE D CE1 1 
ATOM   5609  C CE2 . PHE D  1 137 ? -13.357 26.295  94.044  1.00 33.04  ? 161 PHE D CE2 1 
ATOM   5610  C CZ  . PHE D  1 137 ? -14.388 25.413  94.350  1.00 32.32  ? 161 PHE D CZ  1 
ATOM   5611  N N   . THR D  1 138 ? -8.712  25.419  93.190  1.00 37.17  ? 162 THR D N   1 
ATOM   5612  C CA  . THR D  1 138 ? -8.100  26.412  94.066  1.00 34.58  ? 162 THR D CA  1 
ATOM   5613  C C   . THR D  1 138 ? -9.099  27.504  94.281  1.00 32.41  ? 162 THR D C   1 
ATOM   5614  O O   . THR D  1 138 ? -9.343  28.263  93.395  1.00 34.46  ? 162 THR D O   1 
ATOM   5615  C CB  . THR D  1 138 ? -6.771  26.903  93.488  1.00 33.35  ? 162 THR D CB  1 
ATOM   5616  O OG1 . THR D  1 138 ? -5.972  25.765  93.245  1.00 30.66  ? 162 THR D OG1 1 
ATOM   5617  C CG2 . THR D  1 138 ? -6.068  27.797  94.465  1.00 33.47  ? 162 THR D CG2 1 
ATOM   5618  N N   . PRO D  1 139 ? -9.681  27.567  95.463  1.00 32.10  ? 163 PRO D N   1 
ATOM   5619  C CA  . PRO D  1 139 ? -10.564 28.658  95.720  1.00 32.13  ? 163 PRO D CA  1 
ATOM   5620  C C   . PRO D  1 139 ? -9.741  29.947  95.946  1.00 32.21  ? 163 PRO D C   1 
ATOM   5621  O O   . PRO D  1 139 ? -8.494  29.925  95.904  1.00 30.34  ? 163 PRO D O   1 
ATOM   5622  C CB  . PRO D  1 139 ? -11.232 28.217  97.015  1.00 31.67  ? 163 PRO D CB  1 
ATOM   5623  C CG  . PRO D  1 139 ? -10.072 27.644  97.773  1.00 31.91  ? 163 PRO D CG  1 
ATOM   5624  C CD  . PRO D  1 139 ? -9.249  26.946  96.742  1.00 32.32  ? 163 PRO D CD  1 
ATOM   5625  N N   . LYS D  1 140 ? -10.468 31.048  96.139  1.00 31.94  ? 164 LYS D N   1 
ATOM   5626  C CA  . LYS D  1 140 ? -9.857  32.346  96.344  1.00 31.63  ? 164 LYS D CA  1 
ATOM   5627  C C   . LYS D  1 140 ? -10.450 33.102  97.527  1.00 30.26  ? 164 LYS D C   1 
ATOM   5628  O O   . LYS D  1 140 ? -11.661 33.076  97.741  1.00 29.43  ? 164 LYS D O   1 
ATOM   5629  C CB  . LYS D  1 140 ? -10.028 33.197  95.079  1.00 32.17  ? 164 LYS D CB  1 
ATOM   5630  C CG  . LYS D  1 140 ? -9.558  32.534  93.811  1.00 33.12  ? 164 LYS D CG  1 
ATOM   5631  C CD  . LYS D  1 140 ? -8.045  32.329  93.751  1.00 33.96  ? 164 LYS D CD  1 
ATOM   5632  C CE  . LYS D  1 140 ? -7.714  31.575  92.485  1.00 34.14  ? 164 LYS D CE  1 
ATOM   5633  N NZ  . LYS D  1 140 ? -6.290  31.164  92.475  1.00 35.28  ? 164 LYS D NZ  1 
ATOM   5634  N N   . PRO D  1 141 ? -9.610  33.826  98.263  1.00 29.85  ? 165 PRO D N   1 
ATOM   5635  C CA  . PRO D  1 141 ? -10.135 34.618  99.336  1.00 30.27  ? 165 PRO D CA  1 
ATOM   5636  C C   . PRO D  1 141 ? -10.870 35.845  98.825  1.00 30.14  ? 165 PRO D C   1 
ATOM   5637  O O   . PRO D  1 141 ? -10.544 36.374  97.773  1.00 31.33  ? 165 PRO D O   1 
ATOM   5638  C CB  . PRO D  1 141 ? -8.859  35.014  100.094 1.00 31.00  ? 165 PRO D CB  1 
ATOM   5639  C CG  . PRO D  1 141 ? -7.847  35.202  99.028  1.00 30.60  ? 165 PRO D CG  1 
ATOM   5640  C CD  . PRO D  1 141 ? -8.148  33.997  98.148  1.00 30.65  ? 165 PRO D CD  1 
ATOM   5641  N N   . VAL D  1 142 ? -11.852 36.288  99.583  1.00 30.81  ? 166 VAL D N   1 
ATOM   5642  C CA  . VAL D  1 142 ? -12.678 37.438  99.233  1.00 31.85  ? 166 VAL D CA  1 
ATOM   5643  C C   . VAL D  1 142 ? -11.998 38.574  99.918  1.00 32.25  ? 166 VAL D C   1 
ATOM   5644  O O   . VAL D  1 142 ? -12.327 38.885  101.084 1.00 33.20  ? 166 VAL D O   1 
ATOM   5645  C CB  . VAL D  1 142 ? -14.125 37.322  99.796  1.00 31.33  ? 166 VAL D CB  1 
ATOM   5646  C CG1 . VAL D  1 142 ? -14.928 38.531  99.398  1.00 31.13  ? 166 VAL D CG1 1 
ATOM   5647  C CG2 . VAL D  1 142 ? -14.813 36.054  99.321  1.00 30.84  ? 166 VAL D CG2 1 
ATOM   5648  N N   . LEU D  1 143 ? -11.068 39.186  99.200  1.00 33.43  ? 167 LEU D N   1 
ATOM   5649  C CA  . LEU D  1 143 ? -10.145 40.161  99.781  1.00 35.94  ? 167 LEU D CA  1 
ATOM   5650  C C   . LEU D  1 143 ? -10.674 41.533  99.837  1.00 36.67  ? 167 LEU D C   1 
ATOM   5651  O O   . LEU D  1 143 ? -10.234 42.295  100.688 1.00 36.64  ? 167 LEU D O   1 
ATOM   5652  C CB  . LEU D  1 143 ? -8.832  40.241  99.004  1.00 37.66  ? 167 LEU D CB  1 
ATOM   5653  C CG  . LEU D  1 143 ? -7.600  39.467  99.509  1.00 39.89  ? 167 LEU D CG  1 
ATOM   5654  C CD1 . LEU D  1 143 ? -7.883  38.453  100.619 1.00 40.01  ? 167 LEU D CD1 1 
ATOM   5655  C CD2 . LEU D  1 143 ? -6.845  38.797  98.343  1.00 41.09  ? 167 LEU D CD2 1 
ATOM   5656  N N   . ASP D  1 144 ? -11.541 41.859  98.889  1.00 39.18  ? 168 ASP D N   1 
ATOM   5657  C CA  . ASP D  1 144 ? -12.238 43.129  98.849  1.00 43.94  ? 168 ASP D CA  1 
ATOM   5658  C C   . ASP D  1 144 ? -13.466 42.872  98.014  1.00 44.71  ? 168 ASP D C   1 
ATOM   5659  O O   . ASP D  1 144 ? -13.304 42.760  96.812  1.00 46.58  ? 168 ASP D O   1 
ATOM   5660  C CB  . ASP D  1 144 ? -11.343 44.215  98.197  1.00 46.52  ? 168 ASP D CB  1 
ATOM   5661  C CG  . ASP D  1 144 ? -12.043 45.574  98.033  1.00 50.14  ? 168 ASP D CG  1 
ATOM   5662  O OD1 . ASP D  1 144 ? -13.275 45.606  97.813  1.00 54.76  ? 168 ASP D OD1 1 
ATOM   5663  O OD2 . ASP D  1 144 ? -11.362 46.629  98.062  1.00 52.48  ? 168 ASP D OD2 1 
ATOM   5664  N N   . SER D  1 145 ? -14.674 42.802  98.599  1.00 45.18  ? 169 SER D N   1 
ATOM   5665  C CA  . SER D  1 145 ? -15.852 42.438  97.772  1.00 46.17  ? 169 SER D CA  1 
ATOM   5666  C C   . SER D  1 145 ? -16.427 43.535  96.901  1.00 45.54  ? 169 SER D C   1 
ATOM   5667  O O   . SER D  1 145 ? -17.400 43.323  96.233  1.00 47.30  ? 169 SER D O   1 
ATOM   5668  C CB  . SER D  1 145 ? -16.964 41.702  98.553  1.00 46.18  ? 169 SER D CB  1 
ATOM   5669  O OG  . SER D  1 145 ? -17.289 42.381  99.712  1.00 46.75  ? 169 SER D OG  1 
ATOM   5670  N N   . THR D  1 146 ? -15.816 44.693  96.820  1.00 48.75  ? 170 THR D N   1 
ATOM   5671  C CA  . THR D  1 146 ? -16.306 45.682  95.844  1.00 51.90  ? 170 THR D CA  1 
ATOM   5672  C C   . THR D  1 146 ? -15.618 45.574  94.501  1.00 50.73  ? 170 THR D C   1 
ATOM   5673  O O   . THR D  1 146 ? -16.208 45.868  93.490  1.00 51.82  ? 170 THR D O   1 
ATOM   5674  C CB  . THR D  1 146 ? -16.135 47.101  96.361  1.00 55.90  ? 170 THR D CB  1 
ATOM   5675  O OG1 . THR D  1 146 ? -16.552 47.130  97.717  1.00 54.99  ? 170 THR D OG1 1 
ATOM   5676  C CG2 . THR D  1 146 ? -17.079 48.061  95.603  1.00 62.97  ? 170 THR D CG2 1 
ATOM   5677  N N   . ILE D  1 147 ? -14.356 45.192  94.519  1.00 48.57  ? 171 ILE D N   1 
ATOM   5678  C CA  . ILE D  1 147 ? -13.602 44.991  93.333  1.00 48.30  ? 171 ILE D CA  1 
ATOM   5679  C C   . ILE D  1 147 ? -13.647 43.521  92.877  1.00 46.31  ? 171 ILE D C   1 
ATOM   5680  O O   . ILE D  1 147 ? -13.751 43.240  91.652  1.00 47.44  ? 171 ILE D O   1 
ATOM   5681  C CB  . ILE D  1 147 ? -12.168 45.460  93.551  1.00 49.08  ? 171 ILE D CB  1 
ATOM   5682  C CG1 . ILE D  1 147 ? -12.213 46.923  94.020  1.00 49.14  ? 171 ILE D CG1 1 
ATOM   5683  C CG2 . ILE D  1 147 ? -11.386 45.269  92.243  1.00 50.56  ? 171 ILE D CG2 1 
ATOM   5684  C CD1 . ILE D  1 147 ? -10.877 47.569  94.347  1.00 50.04  ? 171 ILE D CD1 1 
ATOM   5685  N N   . ASP D  1 148 ? -13.535 42.622  93.853  1.00 42.20  ? 172 ASP D N   1 
ATOM   5686  C CA  . ASP D  1 148 ? -13.634 41.188  93.674  1.00 42.09  ? 172 ASP D CA  1 
ATOM   5687  C C   . ASP D  1 148 ? -12.491 40.696  92.818  1.00 41.62  ? 172 ASP D C   1 
ATOM   5688  O O   . ASP D  1 148 ? -12.671 40.272  91.687  1.00 44.70  ? 172 ASP D O   1 
ATOM   5689  C CB  . ASP D  1 148 ? -15.020 40.774  93.111  1.00 42.35  ? 172 ASP D CB  1 
ATOM   5690  C CG  . ASP D  1 148 ? -16.073 40.485  94.211  1.00 42.91  ? 172 ASP D CG  1 
ATOM   5691  O OD1 . ASP D  1 148 ? -15.775 39.995  95.350  1.00 43.69  ? 172 ASP D OD1 1 
ATOM   5692  O OD2 . ASP D  1 148 ? -17.251 40.708  93.891  1.00 43.53  ? 172 ASP D OD2 1 
ATOM   5693  N N   . TYR D  1 149 ? -11.292 40.788  93.346  1.00 41.77  ? 173 TYR D N   1 
ATOM   5694  C CA  . TYR D  1 149 ? -10.107 40.431  92.570  1.00 40.93  ? 173 TYR D CA  1 
ATOM   5695  C C   . TYR D  1 149 ? -9.454  39.201  93.163  1.00 37.81  ? 173 TYR D C   1 
ATOM   5696  O O   . TYR D  1 149 ? -9.546  38.926  94.323  1.00 37.05  ? 173 TYR D O   1 
ATOM   5697  C CB  . TYR D  1 149 ? -9.128  41.630  92.442  1.00 41.24  ? 173 TYR D CB  1 
ATOM   5698  C CG  . TYR D  1 149 ? -8.579  42.115  93.755  1.00 42.40  ? 173 TYR D CG  1 
ATOM   5699  C CD1 . TYR D  1 149 ? -7.548  41.407  94.418  1.00 42.47  ? 173 TYR D CD1 1 
ATOM   5700  C CD2 . TYR D  1 149 ? -9.101  43.280  94.373  1.00 42.22  ? 173 TYR D CD2 1 
ATOM   5701  C CE1 . TYR D  1 149 ? -7.048  41.866  95.647  1.00 42.71  ? 173 TYR D CE1 1 
ATOM   5702  C CE2 . TYR D  1 149 ? -8.602  43.748  95.584  1.00 41.49  ? 173 TYR D CE2 1 
ATOM   5703  C CZ  . TYR D  1 149 ? -7.595  43.036  96.217  1.00 42.24  ? 173 TYR D CZ  1 
ATOM   5704  O OH  . TYR D  1 149 ? -7.119  43.464  97.411  1.00 43.95  ? 173 TYR D OH  1 
ATOM   5705  N N   . PHE D  1 150 ? -8.781  38.457  92.335  1.00 37.43  ? 174 PHE D N   1 
ATOM   5706  C CA  . PHE D  1 150 ? -8.131  37.247  92.798  1.00 36.63  ? 174 PHE D CA  1 
ATOM   5707  C C   . PHE D  1 150 ? -6.947  36.972  91.962  1.00 34.10  ? 174 PHE D C   1 
ATOM   5708  O O   . PHE D  1 150 ? -6.827  37.481  90.851  1.00 32.30  ? 174 PHE D O   1 
ATOM   5709  C CB  . PHE D  1 150 ? -9.075  36.058  92.740  1.00 38.13  ? 174 PHE D CB  1 
ATOM   5710  C CG  . PHE D  1 150 ? -9.649  35.766  91.357  1.00 38.78  ? 174 PHE D CG  1 
ATOM   5711  C CD1 . PHE D  1 150 ? -10.781 36.438  90.888  1.00 39.25  ? 174 PHE D CD1 1 
ATOM   5712  C CD2 . PHE D  1 150 ? -9.099  34.768  90.546  1.00 39.04  ? 174 PHE D CD2 1 
ATOM   5713  C CE1 . PHE D  1 150 ? -11.332 36.124  89.638  1.00 39.52  ? 174 PHE D CE1 1 
ATOM   5714  C CE2 . PHE D  1 150 ? -9.663  34.441  89.313  1.00 38.63  ? 174 PHE D CE2 1 
ATOM   5715  C CZ  . PHE D  1 150 ? -10.776 35.121  88.856  1.00 38.82  ? 174 PHE D CZ  1 
ATOM   5716  N N   . GLN D  1 151 ? -6.078  36.164  92.526  1.00 34.36  ? 175 GLN D N   1 
ATOM   5717  C CA  . GLN D  1 151 ? -4.810  35.833  91.888  1.00 36.31  ? 175 GLN D CA  1 
ATOM   5718  C C   . GLN D  1 151 ? -4.971  34.646  90.933  1.00 37.38  ? 175 GLN D C   1 
ATOM   5719  O O   . GLN D  1 151 ? -5.713  33.714  91.236  1.00 37.98  ? 175 GLN D O   1 
ATOM   5720  C CB  . GLN D  1 151 ? -3.773  35.374  92.890  1.00 35.57  ? 175 GLN D CB  1 
ATOM   5721  C CG  . GLN D  1 151 ? -3.366  36.265  94.032  1.00 34.08  ? 175 GLN D CG  1 
ATOM   5722  C CD  . GLN D  1 151 ? -2.438  35.461  94.914  1.00 32.84  ? 175 GLN D CD  1 
ATOM   5723  O OE1 . GLN D  1 151 ? -2.869  34.685  95.784  1.00 34.08  ? 175 GLN D OE1 1 
ATOM   5724  N NE2 . GLN D  1 151 ? -1.184  35.579  94.650  1.00 29.93  ? 175 GLN D NE2 1 
ATOM   5725  N N   . PRO D  1 152 ? -4.244  34.660  89.827  1.00 38.91  ? 176 PRO D N   1 
ATOM   5726  C CA  . PRO D  1 152 ? -4.270  33.523  88.937  1.00 42.63  ? 176 PRO D CA  1 
ATOM   5727  C C   . PRO D  1 152 ? -3.762  32.277  89.613  1.00 46.51  ? 176 PRO D C   1 
ATOM   5728  O O   . PRO D  1 152 ? -2.849  32.322  90.404  1.00 41.44  ? 176 PRO D O   1 
ATOM   5729  C CB  . PRO D  1 152 ? -3.336  33.906  87.790  1.00 41.48  ? 176 PRO D CB  1 
ATOM   5730  C CG  . PRO D  1 152 ? -3.157  35.357  87.886  1.00 41.43  ? 176 PRO D CG  1 
ATOM   5731  C CD  . PRO D  1 152 ? -3.541  35.817  89.265  1.00 39.97  ? 176 PRO D CD  1 
ATOM   5732  N N   . ASN D  1 153 ? -4.393  31.162  89.259  1.00 58.71  ? 177 ASN D N   1 
ATOM   5733  C CA  . ASN D  1 153 ? -4.197  29.872  89.949  1.00 66.69  ? 177 ASN D CA  1 
ATOM   5734  C C   . ASN D  1 153 ? -2.651  29.555  89.843  1.00 73.18  ? 177 ASN D C   1 
ATOM   5735  O O   . ASN D  1 153 ? -2.005  29.714  88.788  1.00 65.55  ? 177 ASN D O   1 
ATOM   5736  C CB  . ASN D  1 153 ? -5.232  28.770  89.443  1.00 61.59  ? 177 ASN D CB  1 
ATOM   5737  C CG  . ASN D  1 153 ? -6.729  29.265  89.444  1.00 57.32  ? 177 ASN D CG  1 
ATOM   5738  O OD1 . ASN D  1 153 ? -7.163  30.204  88.705  1.00 45.04  ? 177 ASN D OD1 1 
ATOM   5739  N ND2 . ASN D  1 153 ? -7.534  28.600  90.281  1.00 61.80  ? 177 ASN D ND2 1 
ATOM   5740  N N   . ASN D  1 154 ? -2.052  29.267  90.991  1.00 85.77  ? 178 ASN D N   1 
ATOM   5741  C CA  . ASN D  1 154 ? -0.577  29.307  91.126  1.00 97.56  ? 178 ASN D CA  1 
ATOM   5742  C C   . ASN D  1 154 ? -0.141  28.600  92.421  1.00 98.94  ? 178 ASN D C   1 
ATOM   5743  O O   . ASN D  1 154 ? -1.011  28.164  93.231  1.00 98.91  ? 178 ASN D O   1 
ATOM   5744  C CB  . ASN D  1 154 ? -0.070  30.776  91.093  1.00 101.82 ? 178 ASN D CB  1 
ATOM   5745  C CG  . ASN D  1 154 ? 1.421   30.892  90.824  1.00 96.35  ? 178 ASN D CG  1 
ATOM   5746  O OD1 . ASN D  1 154 ? 2.236   30.620  91.703  1.00 89.36  ? 178 ASN D OD1 1 
ATOM   5747  N ND2 . ASN D  1 154 ? 1.779   31.305  89.607  1.00 91.21  ? 178 ASN D ND2 1 
ATOM   5748  N N   . LYS D  1 155 ? 1.180   28.437  92.584  1.00 88.41  ? 179 LYS D N   1 
ATOM   5749  C CA  . LYS D  1 155 ? 1.723   27.822  93.782  1.00 86.92  ? 179 LYS D CA  1 
ATOM   5750  C C   . LYS D  1 155 ? 2.667   28.777  94.584  1.00 80.69  ? 179 LYS D C   1 
ATOM   5751  O O   . LYS D  1 155 ? 2.307   29.218  95.673  1.00 75.07  ? 179 LYS D O   1 
ATOM   5752  C CB  . LYS D  1 155 ? 2.318   26.419  93.456  1.00 92.64  ? 179 LYS D CB  1 
ATOM   5753  C CG  . LYS D  1 155 ? 1.317   25.228  93.518  1.00 97.97  ? 179 LYS D CG  1 
ATOM   5754  C CD  . LYS D  1 155 ? 1.479   24.109  92.437  1.00 96.94  ? 179 LYS D CD  1 
ATOM   5755  C CE  . LYS D  1 155 ? 0.618   24.322  91.169  1.00 95.31  ? 179 LYS D CE  1 
ATOM   5756  N NZ  . LYS D  1 155 ? 1.274   25.184  90.125  1.00 94.37  ? 179 LYS D NZ  1 
ATOM   5757  N N   . ARG D  1 156 ? 3.823   29.154  94.055  1.00 79.77  ? 180 ARG D N   1 
ATOM   5758  C CA  . ARG D  1 156 ? 4.817   29.885  94.865  1.00 78.93  ? 180 ARG D CA  1 
ATOM   5759  C C   . ARG D  1 156 ? 4.563   31.372  95.115  1.00 71.53  ? 180 ARG D C   1 
ATOM   5760  O O   . ARG D  1 156 ? 5.249   31.944  95.944  1.00 71.26  ? 180 ARG D O   1 
ATOM   5761  C CB  . ARG D  1 156 ? 6.237   29.682  94.311  1.00 87.68  ? 180 ARG D CB  1 
ATOM   5762  C CG  . ARG D  1 156 ? 6.846   30.782  93.433  1.00 92.82  ? 180 ARG D CG  1 
ATOM   5763  C CD  . ARG D  1 156 ? 8.314   30.464  93.112  1.00 99.57  ? 180 ARG D CD  1 
ATOM   5764  N NE  . ARG D  1 156 ? 8.441   29.570  91.941  1.00 105.56 ? 180 ARG D NE  1 
ATOM   5765  C CZ  . ARG D  1 156 ? 8.463   28.226  91.944  1.00 101.67 ? 180 ARG D CZ  1 
ATOM   5766  N NH1 . ARG D  1 156 ? 8.571   27.573  90.782  1.00 96.50  ? 180 ARG D NH1 1 
ATOM   5767  N NH2 . ARG D  1 156 ? 8.384   27.519  93.077  1.00 100.51 ? 180 ARG D NH2 1 
ATOM   5768  N N   . ASN D  1 157 ? 3.615   31.980  94.395  1.00 63.42  ? 181 ASN D N   1 
ATOM   5769  C CA  . ASN D  1 157 ? 3.185   33.382  94.582  1.00 54.78  ? 181 ASN D CA  1 
ATOM   5770  C C   . ASN D  1 157 ? 1.899   33.616  95.353  1.00 48.30  ? 181 ASN D C   1 
ATOM   5771  O O   . ASN D  1 157 ? 1.538   34.733  95.512  1.00 46.16  ? 181 ASN D O   1 
ATOM   5772  C CB  . ASN D  1 157 ? 2.984   33.986  93.213  1.00 58.39  ? 181 ASN D CB  1 
ATOM   5773  C CG  . ASN D  1 157 ? 4.287   34.119  92.467  1.00 67.68  ? 181 ASN D CG  1 
ATOM   5774  O OD1 . ASN D  1 157 ? 5.357   34.155  93.086  1.00 75.75  ? 181 ASN D OD1 1 
ATOM   5775  N ND2 . ASN D  1 157 ? 4.220   34.218  91.137  1.00 70.92  ? 181 ASN D ND2 1 
ATOM   5776  N N   . GLN D  1 158 ? 1.197   32.578  95.816  1.00 44.65  ? 182 GLN D N   1 
ATOM   5777  C CA  . GLN D  1 158 ? -0.108  32.697  96.478  1.00 40.07  ? 182 GLN D CA  1 
ATOM   5778  C C   . GLN D  1 158 ? -0.019  33.424  97.793  1.00 36.57  ? 182 GLN D C   1 
ATOM   5779  O O   . GLN D  1 158 ? 0.825   33.105  98.601  1.00 33.45  ? 182 GLN D O   1 
ATOM   5780  C CB  . GLN D  1 158 ? -0.714  31.310  96.727  1.00 40.99  ? 182 GLN D CB  1 
ATOM   5781  C CG  . GLN D  1 158 ? -2.126  31.295  97.354  1.00 40.95  ? 182 GLN D CG  1 
ATOM   5782  C CD  . GLN D  1 158 ? -2.638  29.874  97.653  1.00 40.28  ? 182 GLN D CD  1 
ATOM   5783  O OE1 . GLN D  1 158 ? -1.870  28.913  97.797  1.00 38.19  ? 182 GLN D OE1 1 
ATOM   5784  N NE2 . GLN D  1 158 ? -3.955  29.750  97.770  1.00 42.07  ? 182 GLN D NE2 1 
ATOM   5785  N N   . LEU D  1 159 ? -0.928  34.374  98.002  1.00 34.96  ? 183 LEU D N   1 
ATOM   5786  C CA  . LEU D  1 159 ? -0.930  35.216  99.193  1.00 34.09  ? 183 LEU D CA  1 
ATOM   5787  C C   . LEU D  1 159 ? -1.102  34.358  100.406 1.00 32.19  ? 183 LEU D C   1 
ATOM   5788  O O   . LEU D  1 159 ? -1.870  33.378  100.363 1.00 31.85  ? 183 LEU D O   1 
ATOM   5789  C CB  . LEU D  1 159 ? -2.102  36.176  99.161  1.00 35.25  ? 183 LEU D CB  1 
ATOM   5790  C CG  . LEU D  1 159 ? -1.935  37.616  98.651  1.00 36.66  ? 183 LEU D CG  1 
ATOM   5791  C CD1 . LEU D  1 159 ? -0.554  38.044  98.185  1.00 36.63  ? 183 LEU D CD1 1 
ATOM   5792  C CD2 . LEU D  1 159 ? -2.987  37.875  97.586  1.00 37.98  ? 183 LEU D CD2 1 
ATOM   5793  N N   . TRP D  1 160 ? -0.368  34.707  101.453 1.00 30.48  ? 184 TRP D N   1 
ATOM   5794  C CA  . TRP D  1 160 ? -0.530  34.104  102.766 1.00 30.53  ? 184 TRP D CA  1 
ATOM   5795  C C   . TRP D  1 160 ? -1.459  35.004  103.593 1.00 30.53  ? 184 TRP D C   1 
ATOM   5796  O O   . TRP D  1 160 ? -1.374  36.238  103.527 1.00 29.23  ? 184 TRP D O   1 
ATOM   5797  C CB  . TRP D  1 160 ? 0.766   34.033  103.541 1.00 30.28  ? 184 TRP D CB  1 
ATOM   5798  C CG  . TRP D  1 160 ? 1.782   33.135  103.066 1.00 30.03  ? 184 TRP D CG  1 
ATOM   5799  C CD1 . TRP D  1 160 ? 2.916   33.457  102.391 1.00 29.97  ? 184 TRP D CD1 1 
ATOM   5800  C CD2 . TRP D  1 160 ? 1.845   31.757  103.316 1.00 29.39  ? 184 TRP D CD2 1 
ATOM   5801  N NE1 . TRP D  1 160 ? 3.659   32.325  102.135 1.00 29.73  ? 184 TRP D NE1 1 
ATOM   5802  C CE2 . TRP D  1 160 ? 3.040   31.273  102.735 1.00 28.94  ? 184 TRP D CE2 1 
ATOM   5803  C CE3 . TRP D  1 160 ? 1.017   30.887  103.971 1.00 29.28  ? 184 TRP D CE3 1 
ATOM   5804  C CZ2 . TRP D  1 160 ? 3.397   29.982  102.754 1.00 28.47  ? 184 TRP D CZ2 1 
ATOM   5805  C CZ3 . TRP D  1 160 ? 1.400   29.598  104.032 1.00 29.90  ? 184 TRP D CZ3 1 
ATOM   5806  C CH2 . TRP D  1 160 ? 2.588   29.145  103.396 1.00 29.27  ? 184 TRP D CH2 1 
ATOM   5807  N N   . LEU D  1 161 ? -2.275  34.334  104.406 1.00 30.87  ? 185 LEU D N   1 
ATOM   5808  C CA  . LEU D  1 161 ? -3.288  34.921  105.235 1.00 31.59  ? 185 LEU D CA  1 
ATOM   5809  C C   . LEU D  1 161 ? -2.997  34.652  106.716 1.00 32.51  ? 185 LEU D C   1 
ATOM   5810  O O   . LEU D  1 161 ? -2.525  33.570  107.072 1.00 31.75  ? 185 LEU D O   1 
ATOM   5811  C CB  . LEU D  1 161 ? -4.615  34.294  104.920 1.00 31.19  ? 185 LEU D CB  1 
ATOM   5812  C CG  . LEU D  1 161 ? -4.999  34.382  103.452 1.00 32.51  ? 185 LEU D CG  1 
ATOM   5813  C CD1 . LEU D  1 161 ? -6.205  33.456  103.247 1.00 34.14  ? 185 LEU D CD1 1 
ATOM   5814  C CD2 . LEU D  1 161 ? -5.290  35.778  102.950 1.00 31.13  ? 185 LEU D CD2 1 
ATOM   5815  N N   . ARG D  1 162 ? -3.303  35.633  107.572 1.00 32.51  ? 186 ARG D N   1 
ATOM   5816  C CA  . ARG D  1 162 ? -3.248  35.420  108.992 1.00 33.62  ? 186 ARG D CA  1 
ATOM   5817  C C   . ARG D  1 162 ? -4.338  34.448  109.448 1.00 32.17  ? 186 ARG D C   1 
ATOM   5818  O O   . ARG D  1 162 ? -5.512  34.580  109.105 1.00 30.72  ? 186 ARG D O   1 
ATOM   5819  C CB  . ARG D  1 162 ? -3.410  36.738  109.739 1.00 36.41  ? 186 ARG D CB  1 
ATOM   5820  C CG  . ARG D  1 162 ? -3.333  36.564  111.246 1.00 37.90  ? 186 ARG D CG  1 
ATOM   5821  C CD  . ARG D  1 162 ? -2.973  37.849  111.920 1.00 40.09  ? 186 ARG D CD  1 
ATOM   5822  N NE  . ARG D  1 162 ? -4.140  38.729  111.945 1.00 43.90  ? 186 ARG D NE  1 
ATOM   5823  C CZ  . ARG D  1 162 ? -5.025  38.800  112.924 1.00 43.66  ? 186 ARG D CZ  1 
ATOM   5824  N NH1 . ARG D  1 162 ? -6.066  39.629  112.780 1.00 45.73  ? 186 ARG D NH1 1 
ATOM   5825  N NH2 . ARG D  1 162 ? -4.896  38.025  113.993 1.00 41.69  ? 186 ARG D NH2 1 
ATOM   5826  N N   . LEU D  1 163 ? -3.925  33.483  110.250 1.00 32.21  ? 187 LEU D N   1 
ATOM   5827  C CA  . LEU D  1 163 ? -4.857  32.594  110.909 1.00 32.23  ? 187 LEU D CA  1 
ATOM   5828  C C   . LEU D  1 163 ? -5.539  33.344  112.070 1.00 31.11  ? 187 LEU D C   1 
ATOM   5829  O O   . LEU D  1 163 ? -4.862  33.747  113.052 1.00 32.63  ? 187 LEU D O   1 
ATOM   5830  C CB  . LEU D  1 163 ? -4.155  31.385  111.477 1.00 32.29  ? 187 LEU D CB  1 
ATOM   5831  C CG  . LEU D  1 163 ? -4.865  30.046  111.294 1.00 33.56  ? 187 LEU D CG  1 
ATOM   5832  C CD1 . LEU D  1 163 ? -4.465  29.160  112.476 1.00 34.66  ? 187 LEU D CD1 1 
ATOM   5833  C CD2 . LEU D  1 163 ? -6.369  30.044  111.136 1.00 33.28  ? 187 LEU D CD2 1 
ATOM   5834  N N   . GLN D  1 164 ? -6.844  33.546  111.938 1.00 28.42  ? 188 GLN D N   1 
ATOM   5835  C CA  . GLN D  1 164 ? -7.630  34.164  112.972 1.00 28.72  ? 188 GLN D CA  1 
ATOM   5836  C C   . GLN D  1 164 ? -8.347  33.050  113.731 1.00 28.58  ? 188 GLN D C   1 
ATOM   5837  O O   . GLN D  1 164 ? -8.474  31.954  113.256 1.00 26.95  ? 188 GLN D O   1 
ATOM   5838  C CB  . GLN D  1 164 ? -8.604  35.201  112.358 1.00 28.91  ? 188 GLN D CB  1 
ATOM   5839  C CG  . GLN D  1 164 ? -7.836  36.292  111.657 1.00 29.01  ? 188 GLN D CG  1 
ATOM   5840  C CD  . GLN D  1 164 ? -8.698  37.288  110.991 1.00 29.86  ? 188 GLN D CD  1 
ATOM   5841  O OE1 . GLN D  1 164 ? -8.507  37.581  109.777 1.00 31.64  ? 188 GLN D OE1 1 
ATOM   5842  N NE2 . GLN D  1 164 ? -9.655  37.843  111.747 1.00 29.33  ? 188 GLN D NE2 1 
ATOM   5843  N N   . THR D  1 165 ? -8.750  33.327  114.954 1.00 29.41  ? 189 THR D N   1 
ATOM   5844  C CA  . THR D  1 165 ? -9.399  32.322  115.764 1.00 29.10  ? 189 THR D CA  1 
ATOM   5845  C C   . THR D  1 165 ? -10.783 32.048  115.195 1.00 28.77  ? 189 THR D C   1 
ATOM   5846  O O   . THR D  1 165 ? -11.211 30.945  115.116 1.00 27.25  ? 189 THR D O   1 
ATOM   5847  C CB  . THR D  1 165 ? -9.514  32.840  117.223 1.00 30.19  ? 189 THR D CB  1 
ATOM   5848  O OG1 . THR D  1 165 ? -8.229  33.314  117.668 1.00 32.84  ? 189 THR D OG1 1 
ATOM   5849  C CG2 . THR D  1 165 ? -10.062 31.765  118.201 1.00 29.28  ? 189 THR D CG2 1 
ATOM   5850  N N   . ALA D  1 166 ? -11.507 33.087  114.822 1.00 30.83  ? 190 ALA D N   1 
ATOM   5851  C CA  . ALA D  1 166 ? -12.950 32.959  114.483 1.00 31.00  ? 190 ALA D CA  1 
ATOM   5852  C C   . ALA D  1 166 ? -13.515 34.006  113.507 1.00 31.53  ? 190 ALA D C   1 
ATOM   5853  O O   . ALA D  1 166 ? -14.704 33.915  113.199 1.00 31.93  ? 190 ALA D O   1 
ATOM   5854  C CB  . ALA D  1 166 ? -13.790 32.962  115.771 1.00 30.27  ? 190 ALA D CB  1 
ATOM   5855  N N   . GLY D  1 167 ? -12.696 34.964  113.043 1.00 31.19  ? 191 GLY D N   1 
ATOM   5856  C CA  . GLY D  1 167 ? -13.120 35.953  112.031 1.00 32.14  ? 191 GLY D CA  1 
ATOM   5857  C C   . GLY D  1 167 ? -12.286 35.907  110.721 1.00 31.68  ? 191 GLY D C   1 
ATOM   5858  O O   . GLY D  1 167 ? -11.911 36.966  110.110 1.00 29.72  ? 191 GLY D O   1 
ATOM   5859  N N   . ASN D  1 168 ? -11.996 34.681  110.286 1.00 30.41  ? 192 ASN D N   1 
ATOM   5860  C CA  . ASN D  1 168 ? -11.271 34.494  109.050 1.00 29.77  ? 192 ASN D CA  1 
ATOM   5861  C C   . ASN D  1 168 ? -12.146 34.932  107.890 1.00 30.38  ? 192 ASN D C   1 
ATOM   5862  O O   . ASN D  1 168 ? -13.370 35.043  108.006 1.00 28.85  ? 192 ASN D O   1 
ATOM   5863  C CB  . ASN D  1 168 ? -10.880 33.034  108.888 1.00 28.89  ? 192 ASN D CB  1 
ATOM   5864  C CG  . ASN D  1 168 ? -9.784  32.646  109.817 1.00 27.76  ? 192 ASN D CG  1 
ATOM   5865  O OD1 . ASN D  1 168 ? -8.629  33.044  109.618 1.00 27.20  ? 192 ASN D OD1 1 
ATOM   5866  N ND2 . ASN D  1 168 ? -10.133 31.929  110.867 1.00 25.44  ? 192 ASN D ND2 1 
ATOM   5867  N N   . VAL D  1 169 ? -11.485 35.172  106.777 1.00 32.24  ? 193 VAL D N   1 
ATOM   5868  C CA  . VAL D  1 169 ? -12.112 35.714  105.585 1.00 34.23  ? 193 VAL D CA  1 
ATOM   5869  C C   . VAL D  1 169 ? -12.746 34.577  104.846 1.00 34.58  ? 193 VAL D C   1 
ATOM   5870  O O   . VAL D  1 169 ? -12.221 33.467  104.877 1.00 35.77  ? 193 VAL D O   1 
ATOM   5871  C CB  . VAL D  1 169 ? -11.064 36.424  104.674 1.00 36.48  ? 193 VAL D CB  1 
ATOM   5872  C CG1 . VAL D  1 169 ? -9.978  35.465  104.141 1.00 36.25  ? 193 VAL D CG1 1 
ATOM   5873  C CG2 . VAL D  1 169 ? -11.734 37.117  103.501 1.00 37.39  ? 193 VAL D CG2 1 
ATOM   5874  N N   . ASP D  1 170 ? -13.856 34.835  104.158 1.00 35.72  ? 194 ASP D N   1 
ATOM   5875  C CA  . ASP D  1 170 ? -14.448 33.808  103.284 1.00 35.92  ? 194 ASP D CA  1 
ATOM   5876  C C   . ASP D  1 170 ? -13.546 33.546  102.088 1.00 35.27  ? 194 ASP D C   1 
ATOM   5877  O O   . ASP D  1 170 ? -12.943 34.429  101.558 1.00 38.26  ? 194 ASP D O   1 
ATOM   5878  C CB  . ASP D  1 170 ? -15.811 34.233  102.741 1.00 36.75  ? 194 ASP D CB  1 
ATOM   5879  C CG  . ASP D  1 170 ? -16.938 34.096  103.746 1.00 38.34  ? 194 ASP D CG  1 
ATOM   5880  O OD1 . ASP D  1 170 ? -16.779 33.465  104.858 1.00 37.55  ? 194 ASP D OD1 1 
ATOM   5881  O OD2 . ASP D  1 170 ? -18.021 34.635  103.359 1.00 39.57  ? 194 ASP D OD2 1 
ATOM   5882  N N   . HIS D  1 171 ? -13.477 32.305  101.681 1.00 35.35  ? 195 HIS D N   1 
ATOM   5883  C CA  . HIS D  1 171 ? -12.957 31.893  100.384 1.00 34.72  ? 195 HIS D CA  1 
ATOM   5884  C C   . HIS D  1 171 ? -14.067 31.449  99.404  1.00 34.24  ? 195 HIS D C   1 
ATOM   5885  O O   . HIS D  1 171 ? -15.233 31.099  99.761  1.00 32.67  ? 195 HIS D O   1 
ATOM   5886  C CB  . HIS D  1 171 ? -11.993 30.733  100.550 1.00 34.23  ? 195 HIS D CB  1 
ATOM   5887  C CG  . HIS D  1 171 ? -10.682 31.137  101.091 1.00 33.99  ? 195 HIS D CG  1 
ATOM   5888  N ND1 . HIS D  1 171 ? -10.530 31.560  102.378 1.00 33.53  ? 195 HIS D ND1 1 
ATOM   5889  C CD2 . HIS D  1 171 ? -9.452  31.164  100.521 1.00 35.55  ? 195 HIS D CD2 1 
ATOM   5890  C CE1 . HIS D  1 171 ? -9.254  31.840  102.582 1.00 35.98  ? 195 HIS D CE1 1 
ATOM   5891  N NE2 . HIS D  1 171 ? -8.578  31.616  101.467 1.00 35.33  ? 195 HIS D NE2 1 
ATOM   5892  N N   . VAL D  1 172 ? -13.684 31.407  98.145  1.00 33.15  ? 196 VAL D N   1 
ATOM   5893  C CA  . VAL D  1 172 ? -14.713 31.396  97.187  1.00 32.95  ? 196 VAL D CA  1 
ATOM   5894  C C   . VAL D  1 172 ? -14.433 30.546  95.969  1.00 34.25  ? 196 VAL D C   1 
ATOM   5895  O O   . VAL D  1 172 ? -13.244 30.303  95.558  1.00 30.88  ? 196 VAL D O   1 
ATOM   5896  C CB  . VAL D  1 172 ? -15.138 32.812  96.932  1.00 32.45  ? 196 VAL D CB  1 
ATOM   5897  C CG1 . VAL D  1 172 ? -14.572 33.396  95.649  1.00 32.18  ? 196 VAL D CG1 1 
ATOM   5898  C CG2 . VAL D  1 172 ? -16.620 32.836  97.003  1.00 33.64  ? 196 VAL D CG2 1 
ATOM   5899  N N   . GLY D  1 173 ? -15.599 30.151  95.408  1.00 35.14  ? 197 GLY D N   1 
ATOM   5900  C CA  . GLY D  1 173 ? -15.863 28.771  95.165  1.00 34.39  ? 197 GLY D CA  1 
ATOM   5901  C C   . GLY D  1 173 ? -16.953 28.336  94.276  1.00 33.74  ? 197 GLY D C   1 
ATOM   5902  O O   . GLY D  1 173 ? -16.680 28.281  93.140  1.00 41.56  ? 197 GLY D O   1 
ATOM   5903  N N   . LEU D  1 174 ? -18.120 27.904  94.742  1.00 32.21  ? 198 LEU D N   1 
ATOM   5904  C CA  . LEU D  1 174 ? -18.966 26.947  93.928  1.00 31.21  ? 198 LEU D CA  1 
ATOM   5905  C C   . LEU D  1 174 ? -20.455 27.258  93.797  1.00 30.44  ? 198 LEU D C   1 
ATOM   5906  O O   . LEU D  1 174 ? -21.173 27.328  94.790  1.00 28.63  ? 198 LEU D O   1 
ATOM   5907  C CB  . LEU D  1 174 ? -18.827 25.522  94.463  1.00 31.85  ? 198 LEU D CB  1 
ATOM   5908  C CG  . LEU D  1 174 ? -19.196 24.364  93.493  1.00 33.29  ? 198 LEU D CG  1 
ATOM   5909  C CD1 . LEU D  1 174 ? -18.058 24.147  92.499  1.00 33.48  ? 198 LEU D CD1 1 
ATOM   5910  C CD2 . LEU D  1 174 ? -19.555 22.987  94.150  1.00 33.11  ? 198 LEU D CD2 1 
ATOM   5911  N N   . GLY D  1 175 ? -20.887 27.480  92.562  1.00 30.82  ? 199 GLY D N   1 
ATOM   5912  C CA  . GLY D  1 175 ? -22.307 27.602  92.204  1.00 31.06  ? 199 GLY D CA  1 
ATOM   5913  C C   . GLY D  1 175 ? -22.896 26.248  91.783  1.00 31.72  ? 199 GLY D C   1 
ATOM   5914  O O   . GLY D  1 175 ? -22.206 25.378  91.190  1.00 32.41  ? 199 GLY D O   1 
ATOM   5915  N N   . THR D  1 176 ? -24.175 26.083  92.097  1.00 31.05  ? 200 THR D N   1 
ATOM   5916  C CA  . THR D  1 176 ? -24.864 24.820  91.976  1.00 31.73  ? 200 THR D CA  1 
ATOM   5917  C C   . THR D  1 176 ? -26.214 25.097  91.404  1.00 32.83  ? 200 THR D C   1 
ATOM   5918  O O   . THR D  1 176 ? -26.950 25.984  91.850  1.00 31.99  ? 200 THR D O   1 
ATOM   5919  C CB  . THR D  1 176 ? -25.013 23.981  93.299  1.00 32.90  ? 200 THR D CB  1 
ATOM   5920  O OG1 . THR D  1 176 ? -25.444 24.755  94.479  1.00 33.84  ? 200 THR D OG1 1 
ATOM   5921  C CG2 . THR D  1 176 ? -23.680 23.305  93.596  1.00 33.10  ? 200 THR D CG2 1 
ATOM   5922  N N   . ALA D  1 177 ? -26.535 24.328  90.374  1.00 33.55  ? 201 ALA D N   1 
ATOM   5923  C CA  . ALA D  1 177 ? -27.893 24.198  89.966  1.00 33.13  ? 201 ALA D CA  1 
ATOM   5924  C C   . ALA D  1 177 ? -28.307 22.699  89.913  1.00 31.74  ? 201 ALA D C   1 
ATOM   5925  O O   . ALA D  1 177 ? -27.943 22.017  88.997  1.00 33.22  ? 201 ALA D O   1 
ATOM   5926  C CB  . ALA D  1 177 ? -28.063 24.894  88.633  1.00 33.26  ? 201 ALA D CB  1 
ATOM   5927  N N   . PHE D  1 178 ? -29.092 22.217  90.877  1.00 30.42  ? 202 PHE D N   1 
ATOM   5928  C CA  . PHE D  1 178 ? -29.722 20.869  90.825  1.00 29.04  ? 202 PHE D CA  1 
ATOM   5929  C C   . PHE D  1 178 ? -31.085 20.977  90.203  1.00 29.27  ? 202 PHE D C   1 
ATOM   5930  O O   . PHE D  1 178 ? -31.903 21.768  90.658  1.00 30.74  ? 202 PHE D O   1 
ATOM   5931  C CB  . PHE D  1 178 ? -29.884 20.290  92.249  1.00 28.29  ? 202 PHE D CB  1 
ATOM   5932  C CG  . PHE D  1 178 ? -28.574 19.898  92.882  1.00 28.02  ? 202 PHE D CG  1 
ATOM   5933  C CD1 . PHE D  1 178 ? -27.691 20.870  93.363  1.00 27.62  ? 202 PHE D CD1 1 
ATOM   5934  C CD2 . PHE D  1 178 ? -28.177 18.556  92.924  1.00 27.70  ? 202 PHE D CD2 1 
ATOM   5935  C CE1 . PHE D  1 178 ? -26.466 20.524  93.909  1.00 27.61  ? 202 PHE D CE1 1 
ATOM   5936  C CE2 . PHE D  1 178 ? -26.966 18.207  93.482  1.00 27.57  ? 202 PHE D CE2 1 
ATOM   5937  C CZ  . PHE D  1 178 ? -26.105 19.202  93.970  1.00 27.96  ? 202 PHE D CZ  1 
ATOM   5938  N N   . GLU D  1 179 ? -31.341 20.187  89.180  1.00 29.33  ? 203 GLU D N   1 
ATOM   5939  C CA  . GLU D  1 179 ? -32.668 20.033  88.665  1.00 30.87  ? 203 GLU D CA  1 
ATOM   5940  C C   . GLU D  1 179 ? -33.626 19.471  89.755  1.00 31.68  ? 203 GLU D C   1 
ATOM   5941  O O   . GLU D  1 179 ? -33.317 18.507  90.469  1.00 30.75  ? 203 GLU D O   1 
ATOM   5942  C CB  . GLU D  1 179 ? -32.681 19.160  87.377  1.00 32.24  ? 203 GLU D CB  1 
ATOM   5943  C CG  . GLU D  1 179 ? -34.062 19.054  86.683  1.00 33.46  ? 203 GLU D CG  1 
ATOM   5944  C CD  . GLU D  1 179 ? -34.062 18.355  85.334  1.00 34.57  ? 203 GLU D CD  1 
ATOM   5945  O OE1 . GLU D  1 179 ? -35.023 18.540  84.574  1.00 36.95  ? 203 GLU D OE1 1 
ATOM   5946  O OE2 . GLU D  1 179 ? -33.135 17.597  85.014  1.00 36.24  ? 203 GLU D OE2 1 
ATOM   5947  N N   . ASN D  1 180 ? -34.797 20.107  89.851  1.00 33.03  ? 204 ASN D N   1 
ATOM   5948  C CA  . ASN D  1 180 ? -35.867 19.707  90.793  1.00 34.09  ? 204 ASN D CA  1 
ATOM   5949  C C   . ASN D  1 180 ? -36.491 18.392  90.372  1.00 32.03  ? 204 ASN D C   1 
ATOM   5950  O O   . ASN D  1 180 ? -36.390 17.996  89.248  1.00 27.38  ? 204 ASN D O   1 
ATOM   5951  C CB  . ASN D  1 180 ? -37.001 20.797  90.947  1.00 34.14  ? 204 ASN D CB  1 
ATOM   5952  C CG  . ASN D  1 180 ? -36.534 22.029  91.693  1.00 33.13  ? 204 ASN D CG  1 
ATOM   5953  O OD1 . ASN D  1 180 ? -36.079 21.922  92.829  1.00 33.41  ? 204 ASN D OD1 1 
ATOM   5954  N ND2 . ASN D  1 180 ? -36.626 23.191  91.060  1.00 30.79  ? 204 ASN D ND2 1 
ATOM   5955  N N   . SER D  1 181 ? -37.178 17.799  91.343  1.00 34.40  ? 205 SER D N   1 
ATOM   5956  C CA  . SER D  1 181 ? -37.824 16.516  91.214  1.00 35.75  ? 205 SER D CA  1 
ATOM   5957  C C   . SER D  1 181 ? -39.189 16.435  91.910  1.00 36.73  ? 205 SER D C   1 
ATOM   5958  O O   . SER D  1 181 ? -39.540 17.190  92.781  1.00 33.42  ? 205 SER D O   1 
ATOM   5959  C CB  . SER D  1 181 ? -36.917 15.462  91.844  1.00 35.82  ? 205 SER D CB  1 
ATOM   5960  O OG  . SER D  1 181 ? -37.224 14.148  91.424  1.00 35.80  ? 205 SER D OG  1 
ATOM   5961  N N   . ILE D  1 182 ? -39.900 15.404  91.518  1.00 40.27  ? 206 ILE D N   1 
ATOM   5962  C CA  . ILE D  1 182 ? -41.175 15.036  92.059  1.00 42.37  ? 206 ILE D CA  1 
ATOM   5963  C C   . ILE D  1 182 ? -40.902 14.514  93.468  1.00 41.46  ? 206 ILE D C   1 
ATOM   5964  O O   . ILE D  1 182 ? -41.800 14.569  94.319  1.00 39.24  ? 206 ILE D O   1 
ATOM   5965  C CB  . ILE D  1 182 ? -41.847 14.027  91.059  1.00 46.70  ? 206 ILE D CB  1 
ATOM   5966  C CG1 . ILE D  1 182 ? -43.161 14.610  90.514  1.00 51.90  ? 206 ILE D CG1 1 
ATOM   5967  C CG2 . ILE D  1 182 ? -41.913 12.569  91.523  1.00 44.91  ? 206 ILE D CG2 1 
ATOM   5968  C CD1 . ILE D  1 182 ? -43.003 15.356  89.174  1.00 54.75  ? 206 ILE D CD1 1 
ATOM   5969  N N   . TYR D  1 183 ? -39.657 14.033  93.691  1.00 40.63  ? 207 TYR D N   1 
ATOM   5970  C CA  . TYR D  1 183 ? -39.141 13.558  95.001  1.00 40.31  ? 207 TYR D CA  1 
ATOM   5971  C C   . TYR D  1 183 ? -38.096 14.447  95.643  1.00 41.78  ? 207 TYR D C   1 
ATOM   5972  O O   . TYR D  1 183 ? -37.422 15.246  95.002  1.00 41.32  ? 207 TYR D O   1 
ATOM   5973  C CB  . TYR D  1 183 ? -38.505 12.153  94.930  1.00 39.19  ? 207 TYR D CB  1 
ATOM   5974  C CG  . TYR D  1 183 ? -39.287 11.132  94.152  1.00 39.56  ? 207 TYR D CG  1 
ATOM   5975  C CD1 . TYR D  1 183 ? -40.393 10.505  94.702  1.00 40.32  ? 207 TYR D CD1 1 
ATOM   5976  C CD2 . TYR D  1 183 ? -38.928 10.805  92.846  1.00 41.76  ? 207 TYR D CD2 1 
ATOM   5977  C CE1 . TYR D  1 183 ? -41.131 9.584   93.977  1.00 41.82  ? 207 TYR D CE1 1 
ATOM   5978  C CE2 . TYR D  1 183 ? -39.668 9.883   92.091  1.00 43.82  ? 207 TYR D CE2 1 
ATOM   5979  C CZ  . TYR D  1 183 ? -40.769 9.280   92.672  1.00 43.05  ? 207 TYR D CZ  1 
ATOM   5980  O OH  . TYR D  1 183 ? -41.480 8.369   91.959  1.00 44.50  ? 207 TYR D OH  1 
ATOM   5981  N N   . ASP D  1 184 ? -37.966 14.285  96.958  1.00 46.60  ? 208 ASP D N   1 
ATOM   5982  C CA  . ASP D  1 184 ? -36.951 15.007  97.721  1.00 46.58  ? 208 ASP D CA  1 
ATOM   5983  C C   . ASP D  1 184 ? -35.611 14.430  97.314  1.00 43.92  ? 208 ASP D C   1 
ATOM   5984  O O   . ASP D  1 184 ? -35.491 13.236  97.050  1.00 44.20  ? 208 ASP D O   1 
ATOM   5985  C CB  . ASP D  1 184 ? -37.183 14.877  99.237  1.00 47.32  ? 208 ASP D CB  1 
ATOM   5986  C CG  . ASP D  1 184 ? -38.285 15.779  99.751  1.00 49.73  ? 208 ASP D CG  1 
ATOM   5987  O OD1 . ASP D  1 184 ? -38.511 16.914  99.254  1.00 50.27  ? 208 ASP D OD1 1 
ATOM   5988  O OD2 . ASP D  1 184 ? -38.940 15.361  100.708 1.00 53.82  ? 208 ASP D OD2 1 
ATOM   5989  N N   . GLN D  1 185 ? -34.611 15.278  97.216  1.00 42.89  ? 209 GLN D N   1 
ATOM   5990  C CA  . GLN D  1 185 ? -33.266 14.787  96.927  1.00 41.85  ? 209 GLN D CA  1 
ATOM   5991  C C   . GLN D  1 185 ? -32.339 15.296  98.036  1.00 41.25  ? 209 GLN D C   1 
ATOM   5992  O O   . GLN D  1 185 ? -31.995 16.443  98.022  1.00 38.17  ? 209 GLN D O   1 
ATOM   5993  C CB  . GLN D  1 185 ? -32.802 15.219  95.509  1.00 40.43  ? 209 GLN D CB  1 
ATOM   5994  C CG  . GLN D  1 185 ? -33.842 15.177  94.380  1.00 39.03  ? 209 GLN D CG  1 
ATOM   5995  C CD  . GLN D  1 185 ? -33.338 15.828  93.081  1.00 38.36  ? 209 GLN D CD  1 
ATOM   5996  O OE1 . GLN D  1 185 ? -32.521 15.234  92.379  1.00 40.85  ? 209 GLN D OE1 1 
ATOM   5997  N NE2 . GLN D  1 185 ? -33.840 17.025  92.745  1.00 34.56  ? 209 GLN D NE2 1 
ATOM   5998  N N   . GLU D  1 186 ? -31.985 14.433  99.007  1.00 44.89  ? 210 GLU D N   1 
ATOM   5999  C CA  . GLU D  1 186 ? -31.032 14.739  100.095 1.00 43.89  ? 210 GLU D CA  1 
ATOM   6000  C C   . GLU D  1 186 ? -29.569 14.391  99.739  1.00 38.38  ? 210 GLU D C   1 
ATOM   6001  O O   . GLU D  1 186 ? -29.295 13.518  98.939  1.00 38.97  ? 210 GLU D O   1 
ATOM   6002  C CB  . GLU D  1 186 ? -31.466 14.022  101.375 1.00 50.71  ? 210 GLU D CB  1 
ATOM   6003  C CG  . GLU D  1 186 ? -31.062 14.773  102.664 1.00 61.98  ? 210 GLU D CG  1 
ATOM   6004  C CD  . GLU D  1 186 ? -31.252 14.007  104.007 1.00 69.23  ? 210 GLU D CD  1 
ATOM   6005  O OE1 . GLU D  1 186 ? -30.528 14.379  104.990 1.00 72.24  ? 210 GLU D OE1 1 
ATOM   6006  O OE2 . GLU D  1 186 ? -32.116 13.074  104.089 1.00 70.74  ? 210 GLU D OE2 1 
ATOM   6007  N N   . TYR D  1 187 ? -28.634 15.107  100.326 1.00 35.08  ? 211 TYR D N   1 
ATOM   6008  C CA  . TYR D  1 187 ? -27.200 14.853  100.154 1.00 34.03  ? 211 TYR D CA  1 
ATOM   6009  C C   . TYR D  1 187 ? -26.490 15.149  101.467 1.00 33.95  ? 211 TYR D C   1 
ATOM   6010  O O   . TYR D  1 187 ? -26.827 16.081  102.165 1.00 32.67  ? 211 TYR D O   1 
ATOM   6011  C CB  . TYR D  1 187 ? -26.562 15.779  99.091  1.00 32.77  ? 211 TYR D CB  1 
ATOM   6012  C CG  . TYR D  1 187 ? -26.942 15.498  97.648  1.00 31.68  ? 211 TYR D CG  1 
ATOM   6013  C CD1 . TYR D  1 187 ? -28.146 15.959  97.143  1.00 30.98  ? 211 TYR D CD1 1 
ATOM   6014  C CD2 . TYR D  1 187 ? -26.113 14.775  96.792  1.00 30.81  ? 211 TYR D CD2 1 
ATOM   6015  C CE1 . TYR D  1 187 ? -28.513 15.740  95.837  1.00 30.80  ? 211 TYR D CE1 1 
ATOM   6016  C CE2 . TYR D  1 187 ? -26.478 14.528  95.470  1.00 30.23  ? 211 TYR D CE2 1 
ATOM   6017  C CZ  . TYR D  1 187 ? -27.691 15.023  94.992  1.00 31.43  ? 211 TYR D CZ  1 
ATOM   6018  O OH  . TYR D  1 187 ? -28.165 14.850  93.675  1.00 31.92  ? 211 TYR D OH  1 
ATOM   6019  N N   . ASN D  1 188 ? -25.493 14.336  101.793 1.00 34.74  ? 212 ASN D N   1 
ATOM   6020  C CA  . ASN D  1 188 ? -24.450 14.734  102.726 1.00 34.67  ? 212 ASN D CA  1 
ATOM   6021  C C   . ASN D  1 188 ? -23.370 15.400  101.897 1.00 33.26  ? 212 ASN D C   1 
ATOM   6022  O O   . ASN D  1 188 ? -22.933 14.846  100.884 1.00 34.81  ? 212 ASN D O   1 
ATOM   6023  C CB  . ASN D  1 188 ? -23.965 13.514  103.518 1.00 36.02  ? 212 ASN D CB  1 
ATOM   6024  C CG  . ASN D  1 188 ? -25.027 13.037  104.523 1.00 37.50  ? 212 ASN D CG  1 
ATOM   6025  O OD1 . ASN D  1 188 ? -25.679 11.993  104.333 1.00 38.26  ? 212 ASN D OD1 1 
ATOM   6026  N ND2 . ASN D  1 188 ? -25.231 13.833  105.581 1.00 36.85  ? 212 ASN D ND2 1 
ATOM   6027  N N   . ILE D  1 189 ? -23.024 16.635  102.223 1.00 32.24  ? 213 ILE D N   1 
ATOM   6028  C CA  . ILE D  1 189 ? -21.954 17.306  101.503 1.00 32.80  ? 213 ILE D CA  1 
ATOM   6029  C C   . ILE D  1 189 ? -20.754 17.308  102.353 1.00 31.63  ? 213 ILE D C   1 
ATOM   6030  O O   . ILE D  1 189 ? -20.806 17.747  103.500 1.00 31.77  ? 213 ILE D O   1 
ATOM   6031  C CB  . ILE D  1 189 ? -22.254 18.775  101.177 1.00 34.21  ? 213 ILE D CB  1 
ATOM   6032  C CG1 . ILE D  1 189 ? -23.332 18.868  100.104 1.00 34.22  ? 213 ILE D CG1 1 
ATOM   6033  C CG2 . ILE D  1 189 ? -20.990 19.502  100.679 1.00 34.65  ? 213 ILE D CG2 1 
ATOM   6034  C CD1 . ILE D  1 189 ? -24.070 20.182  100.160 1.00 34.85  ? 213 ILE D CD1 1 
ATOM   6035  N N   . ARG D  1 190 ? -19.654 16.886  101.773 1.00 31.77  ? 214 ARG D N   1 
ATOM   6036  C CA  . ARG D  1 190 ? -18.403 16.960  102.481 1.00 32.52  ? 214 ARG D CA  1 
ATOM   6037  C C   . ARG D  1 190 ? -17.505 17.896  101.758 1.00 30.16  ? 214 ARG D C   1 
ATOM   6038  O O   . ARG D  1 190 ? -17.147 17.667  100.605 1.00 32.12  ? 214 ARG D O   1 
ATOM   6039  C CB  . ARG D  1 190 ? -17.755 15.592  102.634 1.00 34.75  ? 214 ARG D CB  1 
ATOM   6040  C CG  . ARG D  1 190 ? -16.496 15.621  103.515 1.00 37.16  ? 214 ARG D CG  1 
ATOM   6041  C CD  . ARG D  1 190 ? -15.617 14.365  103.350 1.00 39.40  ? 214 ARG D CD  1 
ATOM   6042  N NE  . ARG D  1 190 ? -15.918 13.395  104.396 1.00 42.66  ? 214 ARG D NE  1 
ATOM   6043  C CZ  . ARG D  1 190 ? -15.500 12.132  104.443 1.00 47.77  ? 214 ARG D CZ  1 
ATOM   6044  N NH1 . ARG D  1 190 ? -15.844 11.329  105.504 1.00 47.65  ? 214 ARG D NH1 1 
ATOM   6045  N NH2 . ARG D  1 190 ? -14.723 11.657  103.446 1.00 51.10  ? 214 ARG D NH2 1 
ATOM   6046  N N   . VAL D  1 191 ? -17.099 18.924  102.482 1.00 28.31  ? 215 VAL D N   1 
ATOM   6047  C CA  . VAL D  1 191 ? -16.082 19.909  102.051 1.00 27.19  ? 215 VAL D CA  1 
ATOM   6048  C C   . VAL D  1 191 ? -14.784 19.647  102.735 1.00 27.13  ? 215 VAL D C   1 
ATOM   6049  O O   . VAL D  1 191 ? -14.769 19.483  103.948 1.00 27.21  ? 215 VAL D O   1 
ATOM   6050  C CB  . VAL D  1 191 ? -16.511 21.343  102.423 1.00 25.62  ? 215 VAL D CB  1 
ATOM   6051  C CG1 . VAL D  1 191 ? -15.454 22.361  102.005 1.00 25.44  ? 215 VAL D CG1 1 
ATOM   6052  C CG2 . VAL D  1 191 ? -17.860 21.644  101.754 1.00 25.04  ? 215 VAL D CG2 1 
ATOM   6053  N N   . THR D  1 192 ? -13.708 19.658  101.962 1.00 28.37  ? 216 THR D N   1 
ATOM   6054  C CA  . THR D  1 192 ? -12.351 19.360  102.446 1.00 30.18  ? 216 THR D CA  1 
ATOM   6055  C C   . THR D  1 192 ? -11.372 20.429  101.990 1.00 30.34  ? 216 THR D C   1 
ATOM   6056  O O   . THR D  1 192 ? -11.270 20.737  100.840 1.00 30.16  ? 216 THR D O   1 
ATOM   6057  C CB  . THR D  1 192 ? -11.934 17.978  101.934 1.00 31.69  ? 216 THR D CB  1 
ATOM   6058  O OG1 . THR D  1 192 ? -12.977 17.027  102.282 1.00 36.05  ? 216 THR D OG1 1 
ATOM   6059  C CG2 . THR D  1 192 ? -10.583 17.542  102.447 1.00 31.13  ? 216 THR D CG2 1 
ATOM   6060  N N   . MET D  1 193 ? -10.666 21.033  102.900 1.00 32.91  ? 217 MET D N   1 
ATOM   6061  C CA  . MET D  1 193 ? -9.748  22.081  102.519 1.00 36.41  ? 217 MET D CA  1 
ATOM   6062  C C   . MET D  1 193 ? -8.342  21.525  102.619 1.00 35.27  ? 217 MET D C   1 
ATOM   6063  O O   . MET D  1 193 ? -8.013  20.889  103.600 1.00 34.31  ? 217 MET D O   1 
ATOM   6064  C CB  . MET D  1 193 ? -9.928  23.284  103.454 1.00 40.80  ? 217 MET D CB  1 
ATOM   6065  C CG  . MET D  1 193 ? -11.151 24.140  103.094 1.00 45.19  ? 217 MET D CG  1 
ATOM   6066  S SD  . MET D  1 193 ? -11.471 25.686  104.005 1.00 49.85  ? 217 MET D SD  1 
ATOM   6067  C CE  . MET D  1 193 ? -10.213 25.512  105.277 1.00 46.28  ? 217 MET D CE  1 
ATOM   6068  N N   . TYR D  1 194 ? -7.521  21.778  101.606 1.00 34.02  ? 218 TYR D N   1 
ATOM   6069  C CA  . TYR D  1 194 ? -6.131  21.381  101.615 1.00 32.16  ? 218 TYR D CA  1 
ATOM   6070  C C   . TYR D  1 194 ? -5.314  22.608  101.969 1.00 30.76  ? 218 TYR D C   1 
ATOM   6071  O O   . TYR D  1 194 ? -5.094  23.449  101.175 1.00 29.34  ? 218 TYR D O   1 
ATOM   6072  C CB  . TYR D  1 194 ? -5.741  20.743  100.281 1.00 32.11  ? 218 TYR D CB  1 
ATOM   6073  C CG  . TYR D  1 194 ? -6.407  19.404  100.126 1.00 33.04  ? 218 TYR D CG  1 
ATOM   6074  C CD1 . TYR D  1 194 ? -7.725  19.314  99.611  1.00 33.50  ? 218 TYR D CD1 1 
ATOM   6075  C CD2 . TYR D  1 194 ? -5.746  18.211  100.512 1.00 33.72  ? 218 TYR D CD2 1 
ATOM   6076  C CE1 . TYR D  1 194 ? -8.360  18.076  99.456  1.00 34.63  ? 218 TYR D CE1 1 
ATOM   6077  C CE2 . TYR D  1 194 ? -6.367  16.952  100.370 1.00 35.46  ? 218 TYR D CE2 1 
ATOM   6078  C CZ  . TYR D  1 194 ? -7.690  16.900  99.857  1.00 36.29  ? 218 TYR D CZ  1 
ATOM   6079  O OH  . TYR D  1 194 ? -8.361  15.712  99.729  1.00 39.50  ? 218 TYR D OH  1 
ATOM   6080  N N   . VAL D  1 195 ? -4.884  22.682  103.210 1.00 31.21  ? 219 VAL D N   1 
ATOM   6081  C CA  . VAL D  1 195 ? -4.366  23.893  103.763 1.00 32.41  ? 219 VAL D CA  1 
ATOM   6082  C C   . VAL D  1 195 ? -2.923  23.749  104.016 1.00 33.21  ? 219 VAL D C   1 
ATOM   6083  O O   . VAL D  1 195 ? -2.465  22.717  104.481 1.00 32.73  ? 219 VAL D O   1 
ATOM   6084  C CB  . VAL D  1 195 ? -5.022  24.204  105.106 1.00 32.38  ? 219 VAL D CB  1 
ATOM   6085  C CG1 . VAL D  1 195 ? -4.633  25.595  105.600 1.00 32.69  ? 219 VAL D CG1 1 
ATOM   6086  C CG2 . VAL D  1 195 ? -6.512  24.135  104.936 1.00 32.94  ? 219 VAL D CG2 1 
ATOM   6087  N N   . GLN D  1 196 ? -2.222  24.829  103.750 1.00 34.99  ? 220 GLN D N   1 
ATOM   6088  C CA  . GLN D  1 196 ? -0.794  24.911  103.997 1.00 36.91  ? 220 GLN D CA  1 
ATOM   6089  C C   . GLN D  1 196 ? -0.620  25.988  105.080 1.00 35.38  ? 220 GLN D C   1 
ATOM   6090  O O   . GLN D  1 196 ? -1.014  27.138  104.874 1.00 35.24  ? 220 GLN D O   1 
ATOM   6091  C CB  . GLN D  1 196 ? -0.082  25.265  102.675 1.00 38.61  ? 220 GLN D CB  1 
ATOM   6092  C CG  . GLN D  1 196 ? 1.426   25.194  102.731 1.00 40.26  ? 220 GLN D CG  1 
ATOM   6093  C CD  . GLN D  1 196 ? 2.034   25.350  101.375 1.00 40.10  ? 220 GLN D CD  1 
ATOM   6094  O OE1 . GLN D  1 196 ? 2.076   26.441  100.877 1.00 42.11  ? 220 GLN D OE1 1 
ATOM   6095  N NE2 . GLN D  1 196 ? 2.507   24.272  100.772 1.00 41.39  ? 220 GLN D NE2 1 
ATOM   6096  N N   . PHE D  1 197 ? -0.110  25.586  106.241 1.00 33.79  ? 221 PHE D N   1 
ATOM   6097  C CA  . PHE D  1 197 ? 0.175   26.502  107.349 1.00 33.21  ? 221 PHE D CA  1 
ATOM   6098  C C   . PHE D  1 197 ? 1.654   26.767  107.421 1.00 32.25  ? 221 PHE D C   1 
ATOM   6099  O O   . PHE D  1 197 ? 2.495   25.950  106.965 1.00 30.93  ? 221 PHE D O   1 
ATOM   6100  C CB  . PHE D  1 197 ? -0.191  25.922  108.712 1.00 34.93  ? 221 PHE D CB  1 
ATOM   6101  C CG  . PHE D  1 197 ? -1.659  25.616  108.897 1.00 35.75  ? 221 PHE D CG  1 
ATOM   6102  C CD1 . PHE D  1 197 ? -2.552  26.632  109.275 1.00 36.11  ? 221 PHE D CD1 1 
ATOM   6103  C CD2 . PHE D  1 197 ? -2.135  24.337  108.740 1.00 34.85  ? 221 PHE D CD2 1 
ATOM   6104  C CE1 . PHE D  1 197 ? -3.898  26.375  109.449 1.00 35.76  ? 221 PHE D CE1 1 
ATOM   6105  C CE2 . PHE D  1 197 ? -3.477  24.085  108.915 1.00 35.61  ? 221 PHE D CE2 1 
ATOM   6106  C CZ  . PHE D  1 197 ? -4.364  25.099  109.266 1.00 35.72  ? 221 PHE D CZ  1 
ATOM   6107  N N   . ARG D  1 198 ? 1.949   27.909  108.026 1.00 31.44  ? 222 ARG D N   1 
ATOM   6108  C CA  . ARG D  1 198 ? 3.281   28.435  108.097 1.00 31.95  ? 222 ARG D CA  1 
ATOM   6109  C C   . ARG D  1 198 ? 3.468   29.159  109.435 1.00 33.29  ? 222 ARG D C   1 
ATOM   6110  O O   . ARG D  1 198 ? 2.517   29.873  109.955 1.00 30.71  ? 222 ARG D O   1 
ATOM   6111  C CB  . ARG D  1 198 ? 3.551   29.392  106.940 1.00 31.74  ? 222 ARG D CB  1 
ATOM   6112  C CG  . ARG D  1 198 ? 4.944   30.032  106.959 1.00 32.07  ? 222 ARG D CG  1 
ATOM   6113  C CD  . ARG D  1 198 ? 5.203   30.963  105.766 1.00 32.60  ? 222 ARG D CD  1 
ATOM   6114  N NE  . ARG D  1 198 ? 6.375   31.825  105.983 1.00 32.46  ? 222 ARG D NE  1 
ATOM   6115  C CZ  . ARG D  1 198 ? 6.780   32.782  105.163 1.00 32.35  ? 222 ARG D CZ  1 
ATOM   6116  N NH1 . ARG D  1 198 ? 7.791   33.544  105.481 1.00 35.53  ? 222 ARG D NH1 1 
ATOM   6117  N NH2 . ARG D  1 198 ? 6.144   33.065  104.080 1.00 32.07  ? 222 ARG D NH2 1 
ATOM   6118  N N   . GLU D  1 199 ? 4.713   28.989  109.938 1.00 33.09  ? 223 GLU D N   1 
ATOM   6119  C CA  . GLU D  1 199 ? 5.220   29.664  111.137 1.00 33.84  ? 223 GLU D CA  1 
ATOM   6120  C C   . GLU D  1 199 ? 4.526   29.100  112.357 1.00 32.47  ? 223 GLU D C   1 
ATOM   6121  O O   . GLU D  1 199 ? 3.531   29.653  112.825 1.00 31.78  ? 223 GLU D O   1 
ATOM   6122  C CB  . GLU D  1 199 ? 5.102   31.212  111.051 1.00 34.18  ? 223 GLU D CB  1 
ATOM   6123  C CG  . GLU D  1 199 ? 5.765   31.943  112.229 1.00 36.16  ? 223 GLU D CG  1 
ATOM   6124  C CD  . GLU D  1 199 ? 7.279   32.212  112.075 1.00 38.24  ? 223 GLU D CD  1 
ATOM   6125  O OE1 . GLU D  1 199 ? 7.805   32.223  110.918 1.00 41.45  ? 223 GLU D OE1 1 
ATOM   6126  O OE2 . GLU D  1 199 ? 7.953   32.426  113.125 1.00 36.22  ? 223 GLU D OE2 1 
ATOM   6127  N N   . PHE D  1 200 ? 5.055   27.973  112.820 1.00 31.80  ? 224 PHE D N   1 
ATOM   6128  C CA  . PHE D  1 200 ? 4.747   27.400  114.146 1.00 32.86  ? 224 PHE D CA  1 
ATOM   6129  C C   . PHE D  1 200 ? 4.893   28.476  115.257 1.00 33.46  ? 224 PHE D C   1 
ATOM   6130  O O   . PHE D  1 200 ? 5.911   29.200  115.232 1.00 34.47  ? 224 PHE D O   1 
ATOM   6131  C CB  . PHE D  1 200 ? 5.731   26.239  114.406 1.00 32.34  ? 224 PHE D CB  1 
ATOM   6132  C CG  . PHE D  1 200 ? 5.425   25.419  115.624 1.00 31.76  ? 224 PHE D CG  1 
ATOM   6133  C CD1 . PHE D  1 200 ? 4.326   24.572  115.647 1.00 32.65  ? 224 PHE D CD1 1 
ATOM   6134  C CD2 . PHE D  1 200 ? 6.253   25.443  116.728 1.00 31.11  ? 224 PHE D CD2 1 
ATOM   6135  C CE1 . PHE D  1 200 ? 4.039   23.798  116.789 1.00 32.45  ? 224 PHE D CE1 1 
ATOM   6136  C CE2 . PHE D  1 200 ? 5.992   24.659  117.847 1.00 31.10  ? 224 PHE D CE2 1 
ATOM   6137  C CZ  . PHE D  1 200 ? 4.883   23.846  117.886 1.00 32.08  ? 224 PHE D CZ  1 
ATOM   6138  N N   . ASN D  1 201 ? 3.928   28.583  116.190 1.00 32.42  ? 225 ASN D N   1 
ATOM   6139  C CA  . ASN D  1 201 ? 3.904   29.701  117.163 1.00 33.83  ? 225 ASN D CA  1 
ATOM   6140  C C   . ASN D  1 201 ? 3.529   29.359  118.626 1.00 34.87  ? 225 ASN D C   1 
ATOM   6141  O O   . ASN D  1 201 ? 3.172   30.213  119.451 1.00 34.63  ? 225 ASN D O   1 
ATOM   6142  C CB  . ASN D  1 201 ? 3.003   30.863  116.627 1.00 34.66  ? 225 ASN D CB  1 
ATOM   6143  C CG  . ASN D  1 201 ? 1.473   30.532  116.578 1.00 34.10  ? 225 ASN D CG  1 
ATOM   6144  O OD1 . ASN D  1 201 ? 0.956   29.628  117.251 1.00 32.16  ? 225 ASN D OD1 1 
ATOM   6145  N ND2 . ASN D  1 201 ? 0.761   31.302  115.774 1.00 33.55  ? 225 ASN D ND2 1 
ATOM   6146  N N   . LEU D  1 202 ? 3.616   28.095  118.964 1.00 36.02  ? 226 LEU D N   1 
ATOM   6147  C CA  . LEU D  1 202 ? 3.077   27.625  120.224 1.00 34.34  ? 226 LEU D CA  1 
ATOM   6148  C C   . LEU D  1 202 ? 3.682   28.348  121.421 1.00 33.50  ? 226 LEU D C   1 
ATOM   6149  O O   . LEU D  1 202 ? 4.890   28.435  121.585 1.00 32.84  ? 226 LEU D O   1 
ATOM   6150  C CB  . LEU D  1 202 ? 3.311   26.132  120.343 1.00 33.76  ? 226 LEU D CB  1 
ATOM   6151  C CG  . LEU D  1 202 ? 2.720   25.552  121.612 1.00 34.21  ? 226 LEU D CG  1 
ATOM   6152  C CD1 . LEU D  1 202 ? 1.372   24.924  121.351 1.00 34.01  ? 226 LEU D CD1 1 
ATOM   6153  C CD2 . LEU D  1 202 ? 3.676   24.522  122.121 1.00 36.06  ? 226 LEU D CD2 1 
ATOM   6154  N N   . LYS D  1 203 ? 2.796   28.861  122.241 1.00 33.69  ? 227 LYS D N   1 
ATOM   6155  C CA  . LYS D  1 203 ? 3.135   29.420  123.534 1.00 34.72  ? 227 LYS D CA  1 
ATOM   6156  C C   . LYS D  1 203 ? 3.108   28.310  124.591 1.00 34.35  ? 227 LYS D C   1 
ATOM   6157  O O   . LYS D  1 203 ? 2.140   27.564  124.660 1.00 35.08  ? 227 LYS D O   1 
ATOM   6158  C CB  . LYS D  1 203 ? 2.092   30.497  123.923 1.00 35.86  ? 227 LYS D CB  1 
ATOM   6159  C CG  . LYS D  1 203 ? 1.847   31.571  122.850 1.00 37.15  ? 227 LYS D CG  1 
ATOM   6160  C CD  . LYS D  1 203 ? 3.156   32.183  122.304 1.00 37.28  ? 227 LYS D CD  1 
ATOM   6161  C CE  . LYS D  1 203 ? 2.864   33.238  121.273 1.00 37.37  ? 227 LYS D CE  1 
ATOM   6162  N NZ  . LYS D  1 203 ? 2.095   32.625  120.163 1.00 38.50  ? 227 LYS D NZ  1 
ATOM   6163  N N   . ASP D  1 204 ? 4.123   28.286  125.452 1.00 33.67  ? 228 ASP D N   1 
ATOM   6164  C CA  . ASP D  1 204 ? 4.209   27.406  126.595 1.00 34.28  ? 228 ASP D CA  1 
ATOM   6165  C C   . ASP D  1 204 ? 4.362   28.128  127.975 1.00 34.21  ? 228 ASP D C   1 
ATOM   6166  O O   . ASP D  1 204 ? 5.445   28.137  128.580 1.00 32.25  ? 228 ASP D O   1 
ATOM   6167  C CB  . ASP D  1 204 ? 5.401   26.501  126.332 1.00 35.16  ? 228 ASP D CB  1 
ATOM   6168  C CG  . ASP D  1 204 ? 5.628   25.481  127.432 1.00 35.51  ? 228 ASP D CG  1 
ATOM   6169  O OD1 . ASP D  1 204 ? 4.649   25.003  128.090 1.00 33.86  ? 228 ASP D OD1 1 
ATOM   6170  O OD2 . ASP D  1 204 ? 6.837   25.174  127.609 1.00 37.08  ? 228 ASP D OD2 1 
ATOM   6171  N N   . PRO D  1 205 ? 3.262   28.687  128.507 1.00 34.80  ? 229 PRO D N   1 
ATOM   6172  C CA  . PRO D  1 205 ? 3.306   29.222  129.844 1.00 37.02  ? 229 PRO D CA  1 
ATOM   6173  C C   . PRO D  1 205 ? 3.499   28.065  130.820 1.00 40.85  ? 229 PRO D C   1 
ATOM   6174  O O   . PRO D  1 205 ? 3.159   26.964  130.444 1.00 40.04  ? 229 PRO D O   1 
ATOM   6175  C CB  . PRO D  1 205 ? 1.917   29.824  130.039 1.00 34.70  ? 229 PRO D CB  1 
ATOM   6176  C CG  . PRO D  1 205 ? 1.294   29.810  128.754 1.00 33.52  ? 229 PRO D CG  1 
ATOM   6177  C CD  . PRO D  1 205 ? 1.907   28.723  127.982 1.00 34.09  ? 229 PRO D CD  1 
ATOM   6178  N N   . PRO D  1 206 ? 4.009   28.319  132.051 1.00 46.65  ? 230 PRO D N   1 
ATOM   6179  C CA  . PRO D  1 206 ? 4.463   27.251  133.023 1.00 50.97  ? 230 PRO D CA  1 
ATOM   6180  C C   . PRO D  1 206 ? 3.496   26.092  133.566 1.00 50.59  ? 230 PRO D C   1 
ATOM   6181  O O   . PRO D  1 206 ? 2.472   26.332  134.178 1.00 44.73  ? 230 PRO D O   1 
ATOM   6182  C CB  . PRO D  1 206 ? 5.142   28.071  134.188 1.00 52.93  ? 230 PRO D CB  1 
ATOM   6183  C CG  . PRO D  1 206 ? 5.293   29.504  133.691 1.00 50.60  ? 230 PRO D CG  1 
ATOM   6184  C CD  . PRO D  1 206 ? 4.497   29.680  132.420 1.00 49.03  ? 230 PRO D CD  1 
ATOM   6185  N N   . SER E  1 19  ? 0.940   -22.716 102.258 1.00 71.93  ? 43  SER E N   1 
ATOM   6186  C CA  . SER E  1 19  ? 0.026   -23.921 102.359 1.00 67.72  ? 43  SER E CA  1 
ATOM   6187  C C   . SER E  1 19  ? 0.722   -25.218 102.770 1.00 61.05  ? 43  SER E C   1 
ATOM   6188  O O   . SER E  1 19  ? 0.018   -26.152 103.124 1.00 55.81  ? 43  SER E O   1 
ATOM   6189  C CB  . SER E  1 19  ? -0.757  -24.160 101.040 1.00 68.02  ? 43  SER E CB  1 
ATOM   6190  O OG  . SER E  1 19  ? 0.106   -24.132 99.920  1.00 67.23  ? 43  SER E OG  1 
ATOM   6191  N N   . HIS E  1 20  ? 2.064   -25.271 102.682 1.00 58.11  ? 44  HIS E N   1 
ATOM   6192  C CA  . HIS E  1 20  ? 2.883   -26.402 103.144 1.00 57.22  ? 44  HIS E CA  1 
ATOM   6193  C C   . HIS E  1 20  ? 3.557   -26.077 104.380 1.00 50.76  ? 44  HIS E C   1 
ATOM   6194  O O   . HIS E  1 20  ? 4.088   -25.012 104.480 1.00 50.18  ? 44  HIS E O   1 
ATOM   6195  C CB  . HIS E  1 20  ? 4.018   -26.691 102.225 1.00 62.17  ? 44  HIS E CB  1 
ATOM   6196  C CG  . HIS E  1 20  ? 3.547   -27.138 100.926 1.00 79.97  ? 44  HIS E CG  1 
ATOM   6197  N ND1 . HIS E  1 20  ? 2.745   -28.245 100.805 1.00 97.23  ? 44  HIS E ND1 1 
ATOM   6198  C CD2 . HIS E  1 20  ? 3.647   -26.590 99.696  1.00 101.47 ? 44  HIS E CD2 1 
ATOM   6199  C CE1 . HIS E  1 20  ? 2.423   -28.405 99.534  1.00 115.70 ? 44  HIS E CE1 1 
ATOM   6200  N NE2 . HIS E  1 20  ? 2.959   -27.413 98.837  1.00 121.18 ? 44  HIS E NE2 1 
ATOM   6201  N N   . PHE E  1 21  ? 3.615   -27.030 105.299 1.00 45.69  ? 45  PHE E N   1 
ATOM   6202  C CA  . PHE E  1 21  ? 4.392   -26.880 106.516 1.00 40.36  ? 45  PHE E CA  1 
ATOM   6203  C C   . PHE E  1 21  ? 5.290   -28.096 106.679 1.00 36.83  ? 45  PHE E C   1 
ATOM   6204  O O   . PHE E  1 21  ? 4.805   -29.227 106.797 1.00 35.22  ? 45  PHE E O   1 
ATOM   6205  C CB  . PHE E  1 21  ? 3.438   -26.661 107.703 1.00 40.28  ? 45  PHE E CB  1 
ATOM   6206  C CG  . PHE E  1 21  ? 4.129   -26.630 109.034 1.00 40.18  ? 45  PHE E CG  1 
ATOM   6207  C CD1 . PHE E  1 21  ? 5.302   -25.884 109.212 1.00 38.73  ? 45  PHE E CD1 1 
ATOM   6208  C CD2 . PHE E  1 21  ? 3.601   -27.333 110.110 1.00 39.95  ? 45  PHE E CD2 1 
ATOM   6209  C CE1 . PHE E  1 21  ? 5.944   -25.854 110.417 1.00 38.96  ? 45  PHE E CE1 1 
ATOM   6210  C CE2 . PHE E  1 21  ? 4.245   -27.311 111.327 1.00 40.21  ? 45  PHE E CE2 1 
ATOM   6211  C CZ  . PHE E  1 21  ? 5.426   -26.593 111.478 1.00 39.89  ? 45  PHE E CZ  1 
ATOM   6212  N N   . ASN E  1 22  ? 6.602   -27.869 106.631 1.00 35.54  ? 46  ASN E N   1 
ATOM   6213  C CA  . ASN E  1 22  ? 7.607   -28.957 106.840 1.00 34.87  ? 46  ASN E CA  1 
ATOM   6214  C C   . ASN E  1 22  ? 7.985   -29.010 108.327 1.00 34.55  ? 46  ASN E C   1 
ATOM   6215  O O   . ASN E  1 22  ? 8.167   -27.969 108.956 1.00 37.28  ? 46  ASN E O   1 
ATOM   6216  C CB  . ASN E  1 22  ? 8.865   -28.715 106.027 1.00 34.53  ? 46  ASN E CB  1 
ATOM   6217  C CG  . ASN E  1 22  ? 8.614   -28.691 104.551 1.00 35.84  ? 46  ASN E CG  1 
ATOM   6218  O OD1 . ASN E  1 22  ? 8.317   -29.725 103.947 1.00 40.75  ? 46  ASN E OD1 1 
ATOM   6219  N ND2 . ASN E  1 22  ? 8.772   -27.521 103.936 1.00 35.39  ? 46  ASN E ND2 1 
ATOM   6220  N N   . THR E  1 23  ? 8.088   -30.186 108.910 1.00 33.30  ? 47  THR E N   1 
ATOM   6221  C CA  . THR E  1 23  ? 8.435   -30.261 110.307 1.00 33.74  ? 47  THR E CA  1 
ATOM   6222  C C   . THR E  1 23  ? 8.987   -31.615 110.656 1.00 32.83  ? 47  THR E C   1 
ATOM   6223  O O   . THR E  1 23  ? 9.071   -32.485 109.834 1.00 33.58  ? 47  THR E O   1 
ATOM   6224  C CB  . THR E  1 23  ? 7.202   -29.960 111.182 1.00 35.46  ? 47  THR E CB  1 
ATOM   6225  O OG1 . THR E  1 23  ? 7.596   -29.759 112.578 1.00 37.04  ? 47  THR E OG1 1 
ATOM   6226  C CG2 . THR E  1 23  ? 6.169   -31.073 111.036 1.00 34.25  ? 47  THR E CG2 1 
ATOM   6227  N N   . ARG E  1 24  ? 9.325   -31.786 111.910 1.00 33.00  ? 48  ARG E N   1 
ATOM   6228  C CA  . ARG E  1 24  ? 10.086  -32.900 112.384 1.00 33.04  ? 48  ARG E CA  1 
ATOM   6229  C C   . ARG E  1 24  ? 9.464   -33.370 113.675 1.00 32.02  ? 48  ARG E C   1 
ATOM   6230  O O   . ARG E  1 24  ? 9.396   -32.590 114.596 1.00 33.12  ? 48  ARG E O   1 
ATOM   6231  C CB  . ARG E  1 24  ? 11.490  -32.365 112.589 1.00 33.61  ? 48  ARG E CB  1 
ATOM   6232  C CG  . ARG E  1 24  ? 12.463  -33.368 113.033 1.00 35.87  ? 48  ARG E CG  1 
ATOM   6233  C CD  . ARG E  1 24  ? 13.662  -32.686 113.591 1.00 39.41  ? 48  ARG E CD  1 
ATOM   6234  N NE  . ARG E  1 24  ? 13.287  -31.926 114.774 1.00 42.97  ? 48  ARG E NE  1 
ATOM   6235  C CZ  . ARG E  1 24  ? 14.147  -31.255 115.520 1.00 44.85  ? 48  ARG E CZ  1 
ATOM   6236  N NH1 . ARG E  1 24  ? 15.436  -31.285 115.219 1.00 46.10  ? 48  ARG E NH1 1 
ATOM   6237  N NH2 . ARG E  1 24  ? 13.718  -30.590 116.581 1.00 45.82  ? 48  ARG E NH2 1 
ATOM   6238  N N   . LEU E  1 25  ? 8.990   -34.612 113.738 1.00 32.78  ? 49  LEU E N   1 
ATOM   6239  C CA  . LEU E  1 25  ? 8.393   -35.195 114.976 1.00 32.91  ? 49  LEU E CA  1 
ATOM   6240  C C   . LEU E  1 25  ? 9.218   -36.371 115.433 1.00 32.47  ? 49  LEU E C   1 
ATOM   6241  O O   . LEU E  1 25  ? 9.662   -37.154 114.615 1.00 31.11  ? 49  LEU E O   1 
ATOM   6242  C CB  . LEU E  1 25  ? 6.987   -35.680 114.742 1.00 32.68  ? 49  LEU E CB  1 
ATOM   6243  C CG  . LEU E  1 25  ? 6.076   -34.758 113.947 1.00 34.44  ? 49  LEU E CG  1 
ATOM   6244  C CD1 . LEU E  1 25  ? 4.768   -35.462 113.584 1.00 35.37  ? 49  LEU E CD1 1 
ATOM   6245  C CD2 . LEU E  1 25  ? 5.747   -33.530 114.748 1.00 35.01  ? 49  LEU E CD2 1 
ATOM   6246  N N   . SER E  1 26  ? 9.408   -36.487 116.735 1.00 33.02  ? 50  SER E N   1 
ATOM   6247  C CA  . SER E  1 26  ? 10.211  -37.543 117.301 1.00 34.56  ? 50  SER E CA  1 
ATOM   6248  C C   . SER E  1 26  ? 9.534   -38.233 118.496 1.00 35.89  ? 50  SER E C   1 
ATOM   6249  O O   . SER E  1 26  ? 8.645   -37.666 119.183 1.00 34.91  ? 50  SER E O   1 
ATOM   6250  C CB  . SER E  1 26  ? 11.530  -36.988 117.794 1.00 35.45  ? 50  SER E CB  1 
ATOM   6251  O OG  . SER E  1 26  ? 12.459  -36.679 116.756 1.00 38.16  ? 50  SER E OG  1 
ATOM   6252  N N   . ARG E  1 27  ? 9.985   -39.472 118.726 1.00 35.96  ? 51  ARG E N   1 
ATOM   6253  C CA  . ARG E  1 27  ? 9.649   -40.246 119.895 1.00 36.04  ? 51  ARG E CA  1 
ATOM   6254  C C   . ARG E  1 27  ? 10.767  -41.180 120.146 1.00 35.19  ? 51  ARG E C   1 
ATOM   6255  O O   . ARG E  1 27  ? 11.479  -41.593 119.232 1.00 33.47  ? 51  ARG E O   1 
ATOM   6256  C CB  . ARG E  1 27  ? 8.356   -41.058 119.720 1.00 38.86  ? 51  ARG E CB  1 
ATOM   6257  C CG  . ARG E  1 27  ? 8.355   -42.098 118.584 1.00 40.61  ? 51  ARG E CG  1 
ATOM   6258  C CD  . ARG E  1 27  ? 6.984   -42.719 118.369 1.00 41.23  ? 51  ARG E CD  1 
ATOM   6259  N NE  . ARG E  1 27  ? 6.816   -43.795 119.354 1.00 43.20  ? 51  ARG E NE  1 
ATOM   6260  C CZ  . ARG E  1 27  ? 6.849   -45.100 119.078 1.00 42.20  ? 51  ARG E CZ  1 
ATOM   6261  N NH1 . ARG E  1 27  ? 6.736   -45.982 120.073 1.00 40.69  ? 51  ARG E NH1 1 
ATOM   6262  N NH2 . ARG E  1 27  ? 7.013   -45.529 117.830 1.00 41.32  ? 51  ARG E NH2 1 
ATOM   6263  N N   . THR E  1 28  ? 10.866  -41.546 121.405 1.00 36.88  ? 52  THR E N   1 
ATOM   6264  C CA  . THR E  1 28  ? 11.890  -42.441 121.914 1.00 38.31  ? 52  THR E CA  1 
ATOM   6265  C C   . THR E  1 28  ? 11.242  -43.562 122.731 1.00 39.32  ? 52  THR E C   1 
ATOM   6266  O O   . THR E  1 28  ? 10.436  -43.260 123.608 1.00 42.22  ? 52  THR E O   1 
ATOM   6267  C CB  . THR E  1 28  ? 12.869  -41.660 122.808 1.00 37.38  ? 52  THR E CB  1 
ATOM   6268  O OG1 . THR E  1 28  ? 13.302  -40.512 122.101 1.00 34.79  ? 52  THR E OG1 1 
ATOM   6269  C CG2 . THR E  1 28  ? 14.098  -42.474 123.109 1.00 39.49  ? 52  THR E CG2 1 
ATOM   6270  N N   . PHE E  1 29  ? 11.582  -44.825 122.438 1.00 39.12  ? 53  PHE E N   1 
ATOM   6271  C CA  . PHE E  1 29  ? 11.154  -45.996 123.254 1.00 38.78  ? 53  PHE E CA  1 
ATOM   6272  C C   . PHE E  1 29  ? 12.305  -46.981 123.540 1.00 39.00  ? 53  PHE E C   1 
ATOM   6273  O O   . PHE E  1 29  ? 13.318  -46.972 122.816 1.00 40.67  ? 53  PHE E O   1 
ATOM   6274  C CB  . PHE E  1 29  ? 10.043  -46.723 122.581 1.00 38.08  ? 53  PHE E CB  1 
ATOM   6275  C CG  . PHE E  1 29  ? 10.336  -47.105 121.159 1.00 39.85  ? 53  PHE E CG  1 
ATOM   6276  C CD1 . PHE E  1 29  ? 10.118  -46.224 120.133 1.00 40.69  ? 53  PHE E CD1 1 
ATOM   6277  C CD2 . PHE E  1 29  ? 10.800  -48.357 120.845 1.00 40.69  ? 53  PHE E CD2 1 
ATOM   6278  C CE1 . PHE E  1 29  ? 10.335  -46.609 118.821 1.00 41.52  ? 53  PHE E CE1 1 
ATOM   6279  C CE2 . PHE E  1 29  ? 11.039  -48.741 119.530 1.00 40.18  ? 53  PHE E CE2 1 
ATOM   6280  C CZ  . PHE E  1 29  ? 10.797  -47.878 118.522 1.00 40.37  ? 53  PHE E CZ  1 
ATOM   6281  N N   . GLY E  1 30  ? 12.140  -47.814 124.574 1.00 36.81  ? 54  GLY E N   1 
ATOM   6282  C CA  . GLY E  1 30  ? 13.145  -48.811 124.955 1.00 35.16  ? 54  GLY E CA  1 
ATOM   6283  C C   . GLY E  1 30  ? 13.168  -50.034 124.065 1.00 34.30  ? 54  GLY E C   1 
ATOM   6284  O O   . GLY E  1 30  ? 12.123  -50.427 123.510 1.00 34.58  ? 54  GLY E O   1 
ATOM   6285  N N   . TYR E  1 31  ? 14.354  -50.605 123.839 1.00 33.49  ? 55  TYR E N   1 
ATOM   6286  C CA  . TYR E  1 31  ? 14.416  -51.937 123.212 1.00 34.07  ? 55  TYR E CA  1 
ATOM   6287  C C   . TYR E  1 31  ? 15.506  -52.736 123.854 1.00 34.03  ? 55  TYR E C   1 
ATOM   6288  O O   . TYR E  1 31  ? 16.599  -52.251 124.010 1.00 33.52  ? 55  TYR E O   1 
ATOM   6289  C CB  . TYR E  1 31  ? 14.659  -51.843 121.727 1.00 34.82  ? 55  TYR E CB  1 
ATOM   6290  C CG  . TYR E  1 31  ? 14.892  -53.190 120.964 1.00 36.46  ? 55  TYR E CG  1 
ATOM   6291  C CD1 . TYR E  1 31  ? 13.902  -54.187 120.897 1.00 35.88  ? 55  TYR E CD1 1 
ATOM   6292  C CD2 . TYR E  1 31  ? 16.096  -53.410 120.238 1.00 36.50  ? 55  TYR E CD2 1 
ATOM   6293  C CE1 . TYR E  1 31  ? 14.107  -55.346 120.166 1.00 36.54  ? 55  TYR E CE1 1 
ATOM   6294  C CE2 . TYR E  1 31  ? 16.305  -54.562 119.500 1.00 36.69  ? 55  TYR E CE2 1 
ATOM   6295  C CZ  . TYR E  1 31  ? 15.317  -55.541 119.473 1.00 37.41  ? 55  TYR E CZ  1 
ATOM   6296  O OH  . TYR E  1 31  ? 15.577  -56.703 118.778 1.00 36.33  ? 55  TYR E OH  1 
ATOM   6297  N N   . THR E  1 32  ? 15.198  -53.958 124.253 1.00 35.54  ? 56  THR E N   1 
ATOM   6298  C CA  . THR E  1 32  ? 16.162  -54.784 124.947 1.00 36.59  ? 56  THR E CA  1 
ATOM   6299  C C   . THR E  1 32  ? 16.341  -56.076 124.228 1.00 37.81  ? 56  THR E C   1 
ATOM   6300  O O   . THR E  1 32  ? 15.352  -56.719 123.963 1.00 40.28  ? 56  THR E O   1 
ATOM   6301  C CB  . THR E  1 32  ? 15.666  -55.085 126.341 1.00 36.29  ? 56  THR E CB  1 
ATOM   6302  O OG1 . THR E  1 32  ? 15.495  -53.842 127.039 1.00 37.49  ? 56  THR E OG1 1 
ATOM   6303  C CG2 . THR E  1 32  ? 16.670  -55.927 127.092 1.00 36.71  ? 56  THR E CG2 1 
ATOM   6304  N N   . ILE E  1 33  ? 17.570  -56.459 123.895 1.00 37.87  ? 57  ILE E N   1 
ATOM   6305  C CA  . ILE E  1 33  ? 17.829  -57.839 123.504 1.00 39.85  ? 57  ILE E CA  1 
ATOM   6306  C C   . ILE E  1 33  ? 18.214  -58.574 124.772 1.00 39.45  ? 57  ILE E C   1 
ATOM   6307  O O   . ILE E  1 33  ? 19.243  -58.252 125.351 1.00 39.84  ? 57  ILE E O   1 
ATOM   6308  C CB  . ILE E  1 33  ? 18.923  -57.890 122.444 1.00 42.29  ? 57  ILE E CB  1 
ATOM   6309  C CG1 . ILE E  1 33  ? 18.364  -57.349 121.138 1.00 43.26  ? 57  ILE E CG1 1 
ATOM   6310  C CG2 . ILE E  1 33  ? 19.403  -59.321 122.191 1.00 45.60  ? 57  ILE E CG2 1 
ATOM   6311  C CD1 . ILE E  1 33  ? 19.263  -56.320 120.554 1.00 44.53  ? 57  ILE E CD1 1 
ATOM   6312  N N   . LYS E  1 34  ? 17.387  -59.512 125.235 1.00 41.16  ? 58  LYS E N   1 
ATOM   6313  C CA  . LYS E  1 34  ? 17.685  -60.223 126.476 1.00 45.56  ? 58  LYS E CA  1 
ATOM   6314  C C   . LYS E  1 34  ? 18.882  -61.155 126.282 1.00 43.18  ? 58  LYS E C   1 
ATOM   6315  O O   . LYS E  1 34  ? 19.199  -61.544 125.174 1.00 40.54  ? 58  LYS E O   1 
ATOM   6316  C CB  . LYS E  1 34  ? 16.470  -60.964 127.002 1.00 53.37  ? 58  LYS E CB  1 
ATOM   6317  C CG  . LYS E  1 34  ? 15.372  -60.057 127.559 1.00 63.68  ? 58  LYS E CG  1 
ATOM   6318  C CD  . LYS E  1 34  ? 14.339  -60.831 128.412 1.00 72.03  ? 58  LYS E CD  1 
ATOM   6319  C CE  . LYS E  1 34  ? 13.041  -60.010 128.661 1.00 79.19  ? 58  LYS E CE  1 
ATOM   6320  N NZ  . LYS E  1 34  ? 11.744  -60.789 128.836 1.00 79.22  ? 58  LYS E NZ  1 
ATOM   6321  N N   . ARG E  1 35  ? 19.604  -61.453 127.348 1.00 43.44  ? 59  ARG E N   1 
ATOM   6322  C CA  . ARG E  1 35  ? 20.833  -62.230 127.215 1.00 44.11  ? 59  ARG E CA  1 
ATOM   6323  C C   . ARG E  1 35  ? 20.518  -63.667 126.871 1.00 42.82  ? 59  ARG E C   1 
ATOM   6324  O O   . ARG E  1 35  ? 19.397  -64.070 127.022 1.00 42.12  ? 59  ARG E O   1 
ATOM   6325  C CB  . ARG E  1 35  ? 21.684  -62.140 128.468 1.00 46.95  ? 59  ARG E CB  1 
ATOM   6326  C CG  . ARG E  1 35  ? 21.536  -63.251 129.492 1.00 49.37  ? 59  ARG E CG  1 
ATOM   6327  C CD  . ARG E  1 35  ? 20.742  -62.855 130.703 1.00 50.61  ? 59  ARG E CD  1 
ATOM   6328  N NE  . ARG E  1 35  ? 21.439  -61.876 131.529 1.00 54.49  ? 59  ARG E NE  1 
ATOM   6329  C CZ  . ARG E  1 35  ? 20.841  -61.189 132.509 1.00 62.55  ? 59  ARG E CZ  1 
ATOM   6330  N NH1 . ARG E  1 35  ? 19.541  -61.402 132.816 1.00 69.34  ? 59  ARG E NH1 1 
ATOM   6331  N NH2 . ARG E  1 35  ? 21.518  -60.279 133.196 1.00 59.35  ? 59  ARG E NH2 1 
ATOM   6332  N N   . THR E  1 36  ? 21.502  -64.419 126.393 1.00 42.90  ? 60  THR E N   1 
ATOM   6333  C CA  . THR E  1 36  ? 21.302  -65.791 125.970 1.00 44.86  ? 60  THR E CA  1 
ATOM   6334  C C   . THR E  1 36  ? 22.514  -66.618 126.294 1.00 45.79  ? 60  THR E C   1 
ATOM   6335  O O   . THR E  1 36  ? 23.621  -66.105 126.566 1.00 42.75  ? 60  THR E O   1 
ATOM   6336  C CB  . THR E  1 36  ? 21.012  -65.961 124.431 1.00 48.97  ? 60  THR E CB  1 
ATOM   6337  O OG1 . THR E  1 36  ? 22.112  -65.465 123.645 1.00 48.17  ? 60  THR E OG1 1 
ATOM   6338  C CG2 . THR E  1 36  ? 19.651  -65.249 124.007 1.00 50.78  ? 60  THR E CG2 1 
ATOM   6339  N N   . THR E  1 37  ? 22.259  -67.927 126.230 1.00 48.80  ? 61  THR E N   1 
ATOM   6340  C CA  . THR E  1 37  ? 23.206  -68.978 126.576 1.00 46.06  ? 61  THR E CA  1 
ATOM   6341  C C   . THR E  1 37  ? 23.547  -69.865 125.374 1.00 45.19  ? 61  THR E C   1 
ATOM   6342  O O   . THR E  1 37  ? 24.319  -70.785 125.547 1.00 47.19  ? 61  THR E O   1 
ATOM   6343  C CB  . THR E  1 37  ? 22.703  -69.806 127.819 1.00 44.84  ? 61  THR E CB  1 
ATOM   6344  O OG1 . THR E  1 37  ? 21.262  -69.859 127.909 1.00 42.05  ? 61  THR E OG1 1 
ATOM   6345  C CG2 . THR E  1 37  ? 23.199  -69.144 129.094 1.00 45.36  ? 61  THR E CG2 1 
ATOM   6346  N N   . VAL E  1 38  ? 23.030  -69.565 124.176 1.00 44.90  ? 62  VAL E N   1 
ATOM   6347  C CA  . VAL E  1 38  ? 23.379  -70.303 122.953 1.00 47.65  ? 62  VAL E CA  1 
ATOM   6348  C C   . VAL E  1 38  ? 24.852  -70.062 122.640 1.00 50.80  ? 62  VAL E C   1 
ATOM   6349  O O   . VAL E  1 38  ? 25.289  -68.918 122.666 1.00 50.92  ? 62  VAL E O   1 
ATOM   6350  C CB  . VAL E  1 38  ? 22.561  -69.849 121.698 1.00 49.52  ? 62  VAL E CB  1 
ATOM   6351  C CG1 . VAL E  1 38  ? 22.915  -70.707 120.469 1.00 48.79  ? 62  VAL E CG1 1 
ATOM   6352  C CG2 . VAL E  1 38  ? 21.029  -69.851 121.946 1.00 48.21  ? 62  VAL E CG2 1 
ATOM   6353  N N   . LYS E  1 39  ? 25.611  -71.135 122.353 1.00 57.98  ? 63  LYS E N   1 
ATOM   6354  C CA  . LYS E  1 39  ? 27.112  -71.069 122.200 1.00 60.55  ? 63  LYS E CA  1 
ATOM   6355  C C   . LYS E  1 39  ? 27.470  -70.476 120.827 1.00 54.95  ? 63  LYS E C   1 
ATOM   6356  O O   . LYS E  1 39  ? 28.193  -69.480 120.691 1.00 52.74  ? 63  LYS E O   1 
ATOM   6357  C CB  . LYS E  1 39  ? 27.813  -72.458 122.367 1.00 67.68  ? 63  LYS E CB  1 
ATOM   6358  C CG  . LYS E  1 39  ? 27.293  -73.421 123.441 1.00 74.15  ? 63  LYS E CG  1 
ATOM   6359  C CD  . LYS E  1 39  ? 26.492  -74.587 122.819 1.00 84.74  ? 63  LYS E CD  1 
ATOM   6360  C CE  . LYS E  1 39  ? 25.473  -75.203 123.789 1.00 90.60  ? 63  LYS E CE  1 
ATOM   6361  N NZ  . LYS E  1 39  ? 26.076  -75.679 125.080 1.00 90.06  ? 63  LYS E NZ  1 
ATOM   6362  N N   . THR E  1 40  ? 26.884  -71.088 119.816 1.00 50.58  ? 64  THR E N   1 
ATOM   6363  C CA  . THR E  1 40  ? 26.974  -70.623 118.448 1.00 48.05  ? 64  THR E CA  1 
ATOM   6364  C C   . THR E  1 40  ? 26.319  -69.240 118.261 1.00 43.67  ? 64  THR E C   1 
ATOM   6365  O O   . THR E  1 40  ? 25.312  -68.936 118.895 1.00 40.26  ? 64  THR E O   1 
ATOM   6366  C CB  . THR E  1 40  ? 26.274  -71.619 117.497 1.00 48.01  ? 64  THR E CB  1 
ATOM   6367  O OG1 . THR E  1 40  ? 24.931  -71.820 117.981 1.00 48.21  ? 64  THR E OG1 1 
ATOM   6368  C CG2 . THR E  1 40  ? 27.060  -72.980 117.424 1.00 46.80  ? 64  THR E CG2 1 
ATOM   6369  N N   . PRO E  1 41  ? 26.886  -68.423 117.357 1.00 41.01  ? 65  PRO E N   1 
ATOM   6370  C CA  . PRO E  1 41  ? 26.302  -67.153 116.979 1.00 38.71  ? 65  PRO E CA  1 
ATOM   6371  C C   . PRO E  1 41  ? 24.846  -67.279 116.547 1.00 35.53  ? 65  PRO E C   1 
ATOM   6372  O O   . PRO E  1 41  ? 24.527  -68.134 115.762 1.00 35.97  ? 65  PRO E O   1 
ATOM   6373  C CB  . PRO E  1 41  ? 27.164  -66.731 115.781 1.00 39.79  ? 65  PRO E CB  1 
ATOM   6374  C CG  . PRO E  1 41  ? 28.495  -67.326 116.074 1.00 40.61  ? 65  PRO E CG  1 
ATOM   6375  C CD  . PRO E  1 41  ? 28.141  -68.673 116.618 1.00 40.57  ? 65  PRO E CD  1 
ATOM   6376  N N   . SER E  1 42  ? 23.990  -66.421 117.078 1.00 33.49  ? 66  SER E N   1 
ATOM   6377  C CA  . SER E  1 42  ? 22.595  -66.318 116.668 1.00 32.29  ? 66  SER E CA  1 
ATOM   6378  C C   . SER E  1 42  ? 22.196  -64.853 116.632 1.00 31.35  ? 66  SER E C   1 
ATOM   6379  O O   . SER E  1 42  ? 22.909  -63.999 117.132 1.00 29.02  ? 66  SER E O   1 
ATOM   6380  C CB  . SER E  1 42  ? 21.658  -67.077 117.624 1.00 32.26  ? 66  SER E CB  1 
ATOM   6381  O OG  . SER E  1 42  ? 21.800  -66.648 118.981 1.00 31.90  ? 66  SER E OG  1 
ATOM   6382  N N   . TRP E  1 43  ? 21.041  -64.582 116.046 1.00 31.23  ? 67  TRP E N   1 
ATOM   6383  C CA  . TRP E  1 43  ? 20.630  -63.232 115.847 1.00 32.19  ? 67  TRP E CA  1 
ATOM   6384  C C   . TRP E  1 43  ? 19.206  -63.050 116.302 1.00 32.86  ? 67  TRP E C   1 
ATOM   6385  O O   . TRP E  1 43  ? 18.360  -63.894 116.010 1.00 33.85  ? 67  TRP E O   1 
ATOM   6386  C CB  . TRP E  1 43  ? 20.765  -62.884 114.374 1.00 33.55  ? 67  TRP E CB  1 
ATOM   6387  C CG  . TRP E  1 43  ? 22.164  -62.538 114.047 1.00 34.41  ? 67  TRP E CG  1 
ATOM   6388  C CD1 . TRP E  1 43  ? 22.717  -61.295 114.090 1.00 35.14  ? 67  TRP E CD1 1 
ATOM   6389  C CD2 . TRP E  1 43  ? 23.200  -63.428 113.678 1.00 34.13  ? 67  TRP E CD2 1 
ATOM   6390  N NE1 . TRP E  1 43  ? 24.045  -61.374 113.820 1.00 36.02  ? 67  TRP E NE1 1 
ATOM   6391  C CE2 . TRP E  1 43  ? 24.363  -62.680 113.547 1.00 35.12  ? 67  TRP E CE2 1 
ATOM   6392  C CE3 . TRP E  1 43  ? 23.264  -64.793 113.462 1.00 35.50  ? 67  TRP E CE3 1 
ATOM   6393  C CZ2 . TRP E  1 43  ? 25.588  -63.250 113.166 1.00 35.17  ? 67  TRP E CZ2 1 
ATOM   6394  C CZ3 . TRP E  1 43  ? 24.504  -65.362 113.105 1.00 35.54  ? 67  TRP E CZ3 1 
ATOM   6395  C CH2 . TRP E  1 43  ? 25.624  -64.593 112.936 1.00 34.14  ? 67  TRP E CH2 1 
ATOM   6396  N N   . ALA E  1 44  ? 18.949  -61.949 117.016 1.00 32.12  ? 68  ALA E N   1 
ATOM   6397  C CA  . ALA E  1 44  ? 17.591  -61.549 117.422 1.00 30.56  ? 68  ALA E CA  1 
ATOM   6398  C C   . ALA E  1 44  ? 17.017  -60.773 116.268 1.00 29.78  ? 68  ALA E C   1 
ATOM   6399  O O   . ALA E  1 44  ? 17.520  -59.715 115.933 1.00 30.05  ? 68  ALA E O   1 
ATOM   6400  C CB  . ALA E  1 44  ? 17.657  -60.677 118.644 1.00 30.36  ? 68  ALA E CB  1 
ATOM   6401  N N   . VAL E  1 45  ? 16.009  -61.311 115.612 1.00 28.83  ? 69  VAL E N   1 
ATOM   6402  C CA  . VAL E  1 45  ? 15.410  -60.652 114.453 1.00 28.61  ? 69  VAL E CA  1 
ATOM   6403  C C   . VAL E  1 45  ? 14.065  -59.962 114.818 1.00 29.29  ? 69  VAL E C   1 
ATOM   6404  O O   . VAL E  1 45  ? 13.206  -60.536 115.509 1.00 27.89  ? 69  VAL E O   1 
ATOM   6405  C CB  . VAL E  1 45  ? 15.144  -61.693 113.346 1.00 28.24  ? 69  VAL E CB  1 
ATOM   6406  C CG1 . VAL E  1 45  ? 14.400  -61.068 112.160 1.00 28.27  ? 69  VAL E CG1 1 
ATOM   6407  C CG2 . VAL E  1 45  ? 16.435  -62.394 112.918 1.00 27.75  ? 69  VAL E CG2 1 
ATOM   6408  N N   . ASP E  1 46  ? 13.868  -58.747 114.316 1.00 30.05  ? 70  ASP E N   1 
ATOM   6409  C CA  . ASP E  1 46  ? 12.624  -58.044 114.544 1.00 30.66  ? 70  ASP E CA  1 
ATOM   6410  C C   . ASP E  1 46  ? 12.447  -56.953 113.491 1.00 31.41  ? 70  ASP E C   1 
ATOM   6411  O O   . ASP E  1 46  ? 13.162  -56.917 112.493 1.00 31.28  ? 70  ASP E O   1 
ATOM   6412  C CB  . ASP E  1 46  ? 12.635  -57.462 115.973 1.00 31.54  ? 70  ASP E CB  1 
ATOM   6413  C CG  . ASP E  1 46  ? 11.263  -57.498 116.644 1.00 31.89  ? 70  ASP E CG  1 
ATOM   6414  O OD1 . ASP E  1 46  ? 10.226  -57.338 115.924 1.00 30.17  ? 70  ASP E OD1 1 
ATOM   6415  O OD2 . ASP E  1 46  ? 11.245  -57.679 117.897 1.00 33.01  ? 70  ASP E OD2 1 
ATOM   6416  N N   . MET E  1 47  ? 11.494  -56.060 113.726 1.00 33.35  ? 71  MET E N   1 
ATOM   6417  C CA  . MET E  1 47  ? 11.040  -55.137 112.732 1.00 34.57  ? 71  MET E CA  1 
ATOM   6418  C C   . MET E  1 47  ? 10.525  -53.885 113.345 1.00 34.26  ? 71  MET E C   1 
ATOM   6419  O O   . MET E  1 47  ? 10.264  -53.846 114.527 1.00 33.39  ? 71  MET E O   1 
ATOM   6420  C CB  . MET E  1 47  ? 9.918   -55.748 111.935 1.00 36.47  ? 71  MET E CB  1 
ATOM   6421  C CG  . MET E  1 47  ? 8.676   -56.052 112.754 1.00 38.72  ? 71  MET E CG  1 
ATOM   6422  S SD  . MET E  1 47  ? 7.682   -57.342 111.932 1.00 42.86  ? 71  MET E SD  1 
ATOM   6423  C CE  . MET E  1 47  ? 8.725   -58.783 112.305 1.00 39.78  ? 71  MET E CE  1 
ATOM   6424  N N   . MET E  1 48  ? 10.381  -52.886 112.476 1.00 35.46  ? 72  MET E N   1 
ATOM   6425  C CA  . MET E  1 48  ? 9.960   -51.562 112.798 1.00 36.42  ? 72  MET E CA  1 
ATOM   6426  C C   . MET E  1 48  ? 9.028   -50.988 111.754 1.00 35.30  ? 72  MET E C   1 
ATOM   6427  O O   . MET E  1 48  ? 9.332   -51.043 110.563 1.00 36.57  ? 72  MET E O   1 
ATOM   6428  C CB  . MET E  1 48  ? 11.192  -50.693 112.876 1.00 40.39  ? 72  MET E CB  1 
ATOM   6429  C CG  . MET E  1 48  ? 11.537  -50.340 114.314 1.00 44.07  ? 72  MET E CG  1 
ATOM   6430  S SD  . MET E  1 48  ? 12.824  -49.100 114.492 1.00 45.75  ? 72  MET E SD  1 
ATOM   6431  C CE  . MET E  1 48  ? 14.100  -50.219 113.912 1.00 44.08  ? 72  MET E CE  1 
ATOM   6432  N N   . ARG E  1 49  ? 7.895   -50.465 112.220 1.00 34.13  ? 73  ARG E N   1 
ATOM   6433  C CA  . ARG E  1 49  ? 7.006   -49.631 111.442 1.00 34.06  ? 73  ARG E CA  1 
ATOM   6434  C C   . ARG E  1 49  ? 6.893   -48.250 112.070 1.00 32.50  ? 73  ARG E C   1 
ATOM   6435  O O   . ARG E  1 49  ? 7.303   -47.998 113.231 1.00 32.40  ? 73  ARG E O   1 
ATOM   6436  C CB  . ARG E  1 49  ? 5.621   -50.236 111.365 1.00 36.36  ? 73  ARG E CB  1 
ATOM   6437  C CG  . ARG E  1 49  ? 5.584   -51.682 110.886 1.00 39.28  ? 73  ARG E CG  1 
ATOM   6438  C CD  . ARG E  1 49  ? 4.172   -52.147 110.544 1.00 39.06  ? 73  ARG E CD  1 
ATOM   6439  N NE  . ARG E  1 49  ? 4.138   -53.456 109.897 1.00 38.89  ? 73  ARG E NE  1 
ATOM   6440  C CZ  . ARG E  1 49  ? 4.317   -54.613 110.544 1.00 40.65  ? 73  ARG E CZ  1 
ATOM   6441  N NH1 . ARG E  1 49  ? 4.245   -55.757 109.878 1.00 43.32  ? 73  ARG E NH1 1 
ATOM   6442  N NH2 . ARG E  1 49  ? 4.652   -54.656 111.834 1.00 40.36  ? 73  ARG E NH2 1 
ATOM   6443  N N   . PHE E  1 50  ? 6.339   -47.351 111.269 1.00 31.20  ? 74  PHE E N   1 
ATOM   6444  C CA  . PHE E  1 50  ? 6.213   -45.944 111.619 1.00 30.45  ? 74  PHE E CA  1 
ATOM   6445  C C   . PHE E  1 50  ? 4.787   -45.519 111.365 1.00 29.48  ? 74  PHE E C   1 
ATOM   6446  O O   . PHE E  1 50  ? 4.315   -45.516 110.229 1.00 29.73  ? 74  PHE E O   1 
ATOM   6447  C CB  . PHE E  1 50  ? 7.235   -45.106 110.835 1.00 29.86  ? 74  PHE E CB  1 
ATOM   6448  C CG  . PHE E  1 50  ? 8.546   -45.782 110.721 1.00 28.50  ? 74  PHE E CG  1 
ATOM   6449  C CD1 . PHE E  1 50  ? 9.310   -46.009 111.837 1.00 27.92  ? 74  PHE E CD1 1 
ATOM   6450  C CD2 . PHE E  1 50  ? 8.955   -46.309 109.512 1.00 29.53  ? 74  PHE E CD2 1 
ATOM   6451  C CE1 . PHE E  1 50  ? 10.512  -46.721 111.757 1.00 28.66  ? 74  PHE E CE1 1 
ATOM   6452  C CE2 . PHE E  1 50  ? 10.163  -47.025 109.399 1.00 29.79  ? 74  PHE E CE2 1 
ATOM   6453  C CZ  . PHE E  1 50  ? 10.955  -47.233 110.518 1.00 29.21  ? 74  PHE E CZ  1 
ATOM   6454  N N   . ASN E  1 51  ? 4.087   -45.243 112.441 1.00 28.81  ? 75  ASN E N   1 
ATOM   6455  C CA  . ASN E  1 51  ? 2.739   -44.708 112.349 1.00 29.68  ? 75  ASN E CA  1 
ATOM   6456  C C   . ASN E  1 51  ? 2.704   -43.301 113.000 1.00 30.65  ? 75  ASN E C   1 
ATOM   6457  O O   . ASN E  1 51  ? 3.112   -43.155 114.162 1.00 30.89  ? 75  ASN E O   1 
ATOM   6458  C CB  . ASN E  1 51  ? 1.691   -45.647 112.979 1.00 27.83  ? 75  ASN E CB  1 
ATOM   6459  C CG  . ASN E  1 51  ? 0.285   -45.389 112.440 1.00 27.19  ? 75  ASN E CG  1 
ATOM   6460  O OD1 . ASN E  1 51  ? -0.309  -44.383 112.758 1.00 26.68  ? 75  ASN E OD1 1 
ATOM   6461  N ND2 . ASN E  1 51  ? -0.240  -46.288 111.614 1.00 26.19  ? 75  ASN E ND2 1 
ATOM   6462  N N   . ILE E  1 52  ? 2.211   -42.302 112.242 1.00 30.46  ? 76  ILE E N   1 
ATOM   6463  C CA  . ILE E  1 52  ? 2.043   -40.935 112.741 1.00 31.21  ? 76  ILE E CA  1 
ATOM   6464  C C   . ILE E  1 52  ? 1.163   -40.811 113.980 1.00 32.61  ? 76  ILE E C   1 
ATOM   6465  O O   . ILE E  1 52  ? 1.344   -39.878 114.727 1.00 31.78  ? 76  ILE E O   1 
ATOM   6466  C CB  . ILE E  1 52  ? 1.525   -39.951 111.646 1.00 31.18  ? 76  ILE E CB  1 
ATOM   6467  C CG1 . ILE E  1 52  ? 1.879   -38.499 111.989 1.00 30.41  ? 76  ILE E CG1 1 
ATOM   6468  C CG2 . ILE E  1 52  ? 0.028   -40.048 111.463 1.00 31.57  ? 76  ILE E CG2 1 
ATOM   6469  C CD1 . ILE E  1 52  ? 2.221   -37.643 110.787 1.00 30.36  ? 76  ILE E CD1 1 
ATOM   6470  N N   . ASN E  1 53  ? 0.245   -41.741 114.232 1.00 34.46  ? 77  ASN E N   1 
ATOM   6471  C CA  . ASN E  1 53  ? -0.428  -41.755 115.548 1.00 37.02  ? 77  ASN E CA  1 
ATOM   6472  C C   . ASN E  1 53  ? 0.551   -41.709 116.704 1.00 35.78  ? 77  ASN E C   1 
ATOM   6473  O O   . ASN E  1 53  ? 0.246   -41.116 117.702 1.00 40.73  ? 77  ASN E O   1 
ATOM   6474  C CB  . ASN E  1 53  ? -1.283  -43.020 115.826 1.00 40.02  ? 77  ASN E CB  1 
ATOM   6475  C CG  . ASN E  1 53  ? -2.365  -43.263 114.810 1.00 41.09  ? 77  ASN E CG  1 
ATOM   6476  O OD1 . ASN E  1 53  ? -3.042  -42.312 114.341 1.00 41.49  ? 77  ASN E OD1 1 
ATOM   6477  N ND2 . ASN E  1 53  ? -2.538  -44.569 114.445 1.00 40.21  ? 77  ASN E ND2 1 
ATOM   6478  N N   . ASP E  1 54  ? 1.692   -42.361 116.604 1.00 33.76  ? 78  ASP E N   1 
ATOM   6479  C CA  . ASP E  1 54  ? 2.662   -42.320 117.690 1.00 34.28  ? 78  ASP E CA  1 
ATOM   6480  C C   . ASP E  1 54  ? 3.441   -40.992 117.837 1.00 33.83  ? 78  ASP E C   1 
ATOM   6481  O O   . ASP E  1 54  ? 4.199   -40.813 118.752 1.00 33.95  ? 78  ASP E O   1 
ATOM   6482  C CB  . ASP E  1 54  ? 3.623   -43.502 117.534 1.00 35.63  ? 78  ASP E CB  1 
ATOM   6483  C CG  . ASP E  1 54  ? 2.873   -44.816 117.390 1.00 36.58  ? 78  ASP E CG  1 
ATOM   6484  O OD1 . ASP E  1 54  ? 1.983   -44.999 118.239 1.00 37.12  ? 78  ASP E OD1 1 
ATOM   6485  O OD2 . ASP E  1 54  ? 3.074   -45.584 116.404 1.00 35.64  ? 78  ASP E OD2 1 
ATOM   6486  N N   . PHE E  1 55  ? 3.291   -40.072 116.917 1.00 33.18  ? 79  PHE E N   1 
ATOM   6487  C CA  . PHE E  1 55  ? 4.080   -38.862 116.924 1.00 33.11  ? 79  PHE E CA  1 
ATOM   6488  C C   . PHE E  1 55  ? 3.239   -37.639 117.157 1.00 33.88  ? 79  PHE E C   1 
ATOM   6489  O O   . PHE E  1 55  ? 3.729   -36.601 117.488 1.00 33.16  ? 79  PHE E O   1 
ATOM   6490  C CB  . PHE E  1 55  ? 4.787   -38.742 115.562 1.00 32.08  ? 79  PHE E CB  1 
ATOM   6491  C CG  . PHE E  1 55  ? 5.824   -39.806 115.335 1.00 30.98  ? 79  PHE E CG  1 
ATOM   6492  C CD1 . PHE E  1 55  ? 5.456   -41.054 114.924 1.00 30.06  ? 79  PHE E CD1 1 
ATOM   6493  C CD2 . PHE E  1 55  ? 7.155   -39.567 115.590 1.00 30.24  ? 79  PHE E CD2 1 
ATOM   6494  C CE1 . PHE E  1 55  ? 6.395   -42.040 114.761 1.00 29.65  ? 79  PHE E CE1 1 
ATOM   6495  C CE2 . PHE E  1 55  ? 8.093   -40.556 115.390 1.00 29.58  ? 79  PHE E CE2 1 
ATOM   6496  C CZ  . PHE E  1 55  ? 7.720   -41.792 114.984 1.00 28.73  ? 79  PHE E CZ  1 
ATOM   6497  N N   . LEU E  1 56  ? 1.954   -37.765 116.967 1.00 37.12  ? 80  LEU E N   1 
ATOM   6498  C CA  . LEU E  1 56  ? 1.114   -36.624 116.801 1.00 39.47  ? 80  LEU E CA  1 
ATOM   6499  C C   . LEU E  1 56  ? -0.168  -36.896 117.574 1.00 39.94  ? 80  LEU E C   1 
ATOM   6500  O O   . LEU E  1 56  ? -1.089  -37.542 117.047 1.00 36.84  ? 80  LEU E O   1 
ATOM   6501  C CB  . LEU E  1 56  ? 0.868   -36.437 115.321 1.00 41.24  ? 80  LEU E CB  1 
ATOM   6502  C CG  . LEU E  1 56  ? 0.404   -35.067 114.916 1.00 43.07  ? 80  LEU E CG  1 
ATOM   6503  C CD1 . LEU E  1 56  ? 1.557   -34.099 115.215 1.00 45.84  ? 80  LEU E CD1 1 
ATOM   6504  C CD2 . LEU E  1 56  ? 0.021   -35.111 113.438 1.00 42.31  ? 80  LEU E CD2 1 
ATOM   6505  N N   . PRO E  1 57  ? -0.217  -36.412 118.846 1.00 41.47  ? 81  PRO E N   1 
ATOM   6506  C CA  . PRO E  1 57  ? -1.370  -36.683 119.724 1.00 42.49  ? 81  PRO E CA  1 
ATOM   6507  C C   . PRO E  1 57  ? -2.657  -36.082 119.254 1.00 46.36  ? 81  PRO E C   1 
ATOM   6508  O O   . PRO E  1 57  ? -2.684  -35.266 118.303 1.00 50.10  ? 81  PRO E O   1 
ATOM   6509  C CB  . PRO E  1 57  ? -0.993  -36.052 121.047 1.00 41.74  ? 81  PRO E CB  1 
ATOM   6510  C CG  . PRO E  1 57  ? 0.212   -35.258 120.801 1.00 41.57  ? 81  PRO E CG  1 
ATOM   6511  C CD  . PRO E  1 57  ? 0.751   -35.479 119.441 1.00 39.75  ? 81  PRO E CD  1 
ATOM   6512  N N   . PRO E  1 58  ? -3.750  -36.497 119.879 1.00 52.05  ? 82  PRO E N   1 
ATOM   6513  C CA  . PRO E  1 58  ? -4.977  -35.754 119.536 1.00 53.49  ? 82  PRO E CA  1 
ATOM   6514  C C   . PRO E  1 58  ? -4.971  -34.254 119.961 1.00 53.16  ? 82  PRO E C   1 
ATOM   6515  O O   . PRO E  1 58  ? -4.212  -33.844 120.859 1.00 54.53  ? 82  PRO E O   1 
ATOM   6516  C CB  . PRO E  1 58  ? -6.059  -36.599 120.225 1.00 52.94  ? 82  PRO E CB  1 
ATOM   6517  C CG  . PRO E  1 58  ? -5.523  -37.998 120.023 1.00 51.97  ? 82  PRO E CG  1 
ATOM   6518  C CD  . PRO E  1 58  ? -4.082  -37.812 120.467 1.00 52.32  ? 82  PRO E CD  1 
ATOM   6519  N N   . GLY E  1 59  ? -5.751  -33.439 119.249 1.00 52.40  ? 83  GLY E N   1 
ATOM   6520  C CA  . GLY E  1 59  ? -6.028  -32.051 119.646 1.00 50.42  ? 83  GLY E CA  1 
ATOM   6521  C C   . GLY E  1 59  ? -7.334  -31.993 120.432 1.00 48.71  ? 83  GLY E C   1 
ATOM   6522  O O   . GLY E  1 59  ? -7.646  -32.846 121.238 1.00 44.86  ? 83  GLY E O   1 
ATOM   6523  N N   . GLY E  1 60  ? -8.143  -30.990 120.172 1.00 51.20  ? 84  GLY E N   1 
ATOM   6524  C CA  . GLY E  1 60  ? -9.301  -30.755 121.019 1.00 50.24  ? 84  GLY E CA  1 
ATOM   6525  C C   . GLY E  1 60  ? -10.320 -29.862 120.386 1.00 48.51  ? 84  GLY E C   1 
ATOM   6526  O O   . GLY E  1 60  ? -9.988  -29.002 119.550 1.00 49.67  ? 84  GLY E O   1 
ATOM   6527  N N   . GLY E  1 61  ? -11.556 -30.063 120.818 1.00 47.83  ? 85  GLY E N   1 
ATOM   6528  C CA  . GLY E  1 61  ? -12.710 -29.360 120.290 1.00 48.92  ? 85  GLY E CA  1 
ATOM   6529  C C   . GLY E  1 61  ? -12.893 -29.742 118.845 1.00 50.20  ? 85  GLY E C   1 
ATOM   6530  O O   . GLY E  1 61  ? -12.865 -30.945 118.466 1.00 50.50  ? 85  GLY E O   1 
ATOM   6531  N N   . SER E  1 62  ? -12.981 -28.691 118.039 1.00 52.50  ? 86  SER E N   1 
ATOM   6532  C CA  . SER E  1 62  ? -13.182 -28.787 116.606 1.00 53.90  ? 86  SER E CA  1 
ATOM   6533  C C   . SER E  1 62  ? -11.886 -28.997 115.793 1.00 51.77  ? 86  SER E C   1 
ATOM   6534  O O   . SER E  1 62  ? -11.944 -29.093 114.554 1.00 50.87  ? 86  SER E O   1 
ATOM   6535  C CB  . SER E  1 62  ? -13.936 -27.532 116.136 1.00 58.51  ? 86  SER E CB  1 
ATOM   6536  O OG  . SER E  1 62  ? -15.165 -27.346 116.877 1.00 63.86  ? 86  SER E OG  1 
ATOM   6537  N N   . ASN E  1 63  ? -10.739 -29.067 116.484 1.00 50.18  ? 87  ASN E N   1 
ATOM   6538  C CA  . ASN E  1 63  ? -9.435  -29.396 115.877 1.00 49.22  ? 87  ASN E CA  1 
ATOM   6539  C C   . ASN E  1 63  ? -8.940  -30.731 116.415 1.00 51.19  ? 87  ASN E C   1 
ATOM   6540  O O   . ASN E  1 63  ? -8.315  -30.787 117.482 1.00 48.99  ? 87  ASN E O   1 
ATOM   6541  C CB  . ASN E  1 63  ? -8.420  -28.290 116.131 1.00 46.83  ? 87  ASN E CB  1 
ATOM   6542  C CG  . ASN E  1 63  ? -8.855  -26.999 115.508 1.00 44.95  ? 87  ASN E CG  1 
ATOM   6543  O OD1 . ASN E  1 63  ? -9.114  -26.951 114.313 1.00 43.92  ? 87  ASN E OD1 1 
ATOM   6544  N ND2 . ASN E  1 63  ? -9.046  -25.974 116.328 1.00 44.40  ? 87  ASN E ND2 1 
ATOM   6545  N N   . PRO E  1 64  ? -9.205  -31.811 115.658 1.00 55.06  ? 88  PRO E N   1 
ATOM   6546  C CA  . PRO E  1 64  ? -8.962  -33.147 116.174 1.00 55.86  ? 88  PRO E CA  1 
ATOM   6547  C C   . PRO E  1 64  ? -7.499  -33.513 116.288 1.00 53.63  ? 88  PRO E C   1 
ATOM   6548  O O   . PRO E  1 64  ? -7.144  -34.408 117.043 1.00 51.43  ? 88  PRO E O   1 
ATOM   6549  C CB  . PRO E  1 64  ? -9.663  -34.074 115.153 1.00 59.18  ? 88  PRO E CB  1 
ATOM   6550  C CG  . PRO E  1 64  ? -10.216 -33.217 114.052 1.00 58.29  ? 88  PRO E CG  1 
ATOM   6551  C CD  . PRO E  1 64  ? -9.696  -31.832 114.260 1.00 58.05  ? 88  PRO E CD  1 
ATOM   6552  N N   . ARG E  1 65  ? -6.638  -32.860 115.534 1.00 55.99  ? 89  ARG E N   1 
ATOM   6553  C CA  . ARG E  1 65  ? -5.229  -33.184 115.625 1.00 57.66  ? 89  ARG E CA  1 
ATOM   6554  C C   . ARG E  1 65  ? -4.478  -31.924 116.037 1.00 53.53  ? 89  ARG E C   1 
ATOM   6555  O O   . ARG E  1 65  ? -4.804  -30.802 115.615 1.00 55.38  ? 89  ARG E O   1 
ATOM   6556  C CB  . ARG E  1 65  ? -4.759  -33.769 114.320 1.00 63.30  ? 89  ARG E CB  1 
ATOM   6557  C CG  . ARG E  1 65  ? -5.757  -34.791 113.808 1.00 76.14  ? 89  ARG E CG  1 
ATOM   6558  C CD  . ARG E  1 65  ? -5.931  -34.823 112.288 1.00 88.07  ? 89  ARG E CD  1 
ATOM   6559  N NE  . ARG E  1 65  ? -6.619  -33.723 111.544 1.00 90.37  ? 89  ARG E NE  1 
ATOM   6560  C CZ  . ARG E  1 65  ? -7.871  -33.765 111.073 1.00 89.30  ? 89  ARG E CZ  1 
ATOM   6561  N NH1 . ARG E  1 65  ? -8.284  -32.735 110.340 1.00 90.00  ? 89  ARG E NH1 1 
ATOM   6562  N NH2 . ARG E  1 65  ? -8.704  -34.798 111.338 1.00 81.20  ? 89  ARG E NH2 1 
ATOM   6563  N N   . SER E  1 66  ? -3.498  -32.143 116.903 1.00 46.90  ? 90  SER E N   1 
ATOM   6564  C CA  . SER E  1 66  ? -2.618  -31.134 117.412 1.00 43.33  ? 90  SER E CA  1 
ATOM   6565  C C   . SER E  1 66  ? -1.853  -30.337 116.359 1.00 39.68  ? 90  SER E C   1 
ATOM   6566  O O   . SER E  1 66  ? -1.415  -29.238 116.686 1.00 39.66  ? 90  SER E O   1 
ATOM   6567  C CB  . SER E  1 66  ? -1.626  -31.787 118.386 1.00 44.26  ? 90  SER E CB  1 
ATOM   6568  O OG  . SER E  1 66  ? -1.086  -33.016 117.919 1.00 43.13  ? 90  SER E OG  1 
ATOM   6569  N N   . VAL E  1 67  ? -1.650  -30.875 115.150 1.00 36.96  ? 91  VAL E N   1 
ATOM   6570  C CA  . VAL E  1 67  ? -1.342  -30.007 113.995 1.00 37.94  ? 91  VAL E CA  1 
ATOM   6571  C C   . VAL E  1 67  ? -2.588  -29.815 113.103 1.00 37.54  ? 91  VAL E C   1 
ATOM   6572  O O   . VAL E  1 67  ? -3.252  -30.762 112.692 1.00 36.87  ? 91  VAL E O   1 
ATOM   6573  C CB  . VAL E  1 67  ? -0.003  -30.275 113.176 1.00 38.08  ? 91  VAL E CB  1 
ATOM   6574  C CG1 . VAL E  1 67  ? 1.046   -30.970 114.001 1.00 39.33  ? 91  VAL E CG1 1 
ATOM   6575  C CG2 . VAL E  1 67  ? -0.191  -31.019 111.900 1.00 37.44  ? 91  VAL E CG2 1 
ATOM   6576  N N   . PRO E  1 68  ? -2.921  -28.573 112.805 1.00 37.36  ? 92  PRO E N   1 
ATOM   6577  C CA  . PRO E  1 68  ? -4.173  -28.385 112.152 1.00 36.92  ? 92  PRO E CA  1 
ATOM   6578  C C   . PRO E  1 68  ? -4.004  -28.342 110.676 1.00 35.57  ? 92  PRO E C   1 
ATOM   6579  O O   . PRO E  1 68  ? -4.192  -27.284 110.056 1.00 37.34  ? 92  PRO E O   1 
ATOM   6580  C CB  . PRO E  1 68  ? -4.635  -27.066 112.722 1.00 37.78  ? 92  PRO E CB  1 
ATOM   6581  C CG  . PRO E  1 68  ? -3.373  -26.308 112.859 1.00 39.17  ? 92  PRO E CG  1 
ATOM   6582  C CD  . PRO E  1 68  ? -2.345  -27.302 113.263 1.00 38.70  ? 92  PRO E CD  1 
ATOM   6583  N N   . PHE E  1 69  ? -3.680  -29.494 110.105 1.00 33.74  ? 93  PHE E N   1 
ATOM   6584  C CA  . PHE E  1 69  ? -3.558  -29.603 108.651 1.00 33.12  ? 93  PHE E CA  1 
ATOM   6585  C C   . PHE E  1 69  ? -4.368  -30.758 108.186 1.00 32.83  ? 93  PHE E C   1 
ATOM   6586  O O   . PHE E  1 69  ? -4.688  -31.652 108.997 1.00 35.24  ? 93  PHE E O   1 
ATOM   6587  C CB  . PHE E  1 69  ? -2.117  -29.778 108.253 1.00 32.50  ? 93  PHE E CB  1 
ATOM   6588  C CG  . PHE E  1 69  ? -1.319  -28.539 108.365 1.00 31.46  ? 93  PHE E CG  1 
ATOM   6589  C CD1 . PHE E  1 69  ? -0.731  -28.187 109.540 1.00 32.29  ? 93  PHE E CD1 1 
ATOM   6590  C CD2 . PHE E  1 69  ? -1.147  -27.740 107.291 1.00 32.20  ? 93  PHE E CD2 1 
ATOM   6591  C CE1 . PHE E  1 69  ? 0.006   -27.008 109.651 1.00 33.13  ? 93  PHE E CE1 1 
ATOM   6592  C CE2 . PHE E  1 69  ? -0.399  -26.571 107.371 1.00 33.35  ? 93  PHE E CE2 1 
ATOM   6593  C CZ  . PHE E  1 69  ? 0.184   -26.196 108.560 1.00 32.74  ? 93  PHE E CZ  1 
ATOM   6594  N N   . GLU E  1 70  ? -4.742  -30.734 106.908 1.00 31.22  ? 94  GLU E N   1 
ATOM   6595  C CA  . GLU E  1 70  ? -5.648  -31.776 106.385 1.00 31.02  ? 94  GLU E CA  1 
ATOM   6596  C C   . GLU E  1 70  ? -4.934  -32.981 105.761 1.00 28.94  ? 94  GLU E C   1 
ATOM   6597  O O   . GLU E  1 70  ? -5.425  -34.117 105.821 1.00 26.56  ? 94  GLU E O   1 
ATOM   6598  C CB  . GLU E  1 70  ? -6.573  -31.165 105.362 1.00 32.98  ? 94  GLU E CB  1 
ATOM   6599  C CG  . GLU E  1 70  ? -7.681  -32.069 104.830 1.00 35.19  ? 94  GLU E CG  1 
ATOM   6600  C CD  . GLU E  1 70  ? -8.654  -32.554 105.903 1.00 36.99  ? 94  GLU E CD  1 
ATOM   6601  O OE1 . GLU E  1 70  ? -8.826  -33.824 105.996 1.00 38.19  ? 94  GLU E OE1 1 
ATOM   6602  O OE2 . GLU E  1 70  ? -9.237  -31.659 106.607 1.00 36.52  ? 94  GLU E OE2 1 
ATOM   6603  N N   . TYR E  1 71  ? -3.806  -32.715 105.123 1.00 27.36  ? 95  TYR E N   1 
ATOM   6604  C CA  . TYR E  1 71  ? -3.068  -33.756 104.449 1.00 27.66  ? 95  TYR E CA  1 
ATOM   6605  C C   . TYR E  1 71  ? -1.625  -33.796 104.945 1.00 26.75  ? 95  TYR E C   1 
ATOM   6606  O O   . TYR E  1 71  ? -1.123  -32.780 105.441 1.00 24.97  ? 95  TYR E O   1 
ATOM   6607  C CB  . TYR E  1 71  ? -3.054  -33.565 102.906 1.00 29.18  ? 95  TYR E CB  1 
ATOM   6608  C CG  . TYR E  1 71  ? -4.270  -32.916 102.252 1.00 29.04  ? 95  TYR E CG  1 
ATOM   6609  C CD1 . TYR E  1 71  ? -5.525  -33.561 102.262 1.00 28.82  ? 95  TYR E CD1 1 
ATOM   6610  C CD2 . TYR E  1 71  ? -4.123  -31.684 101.557 1.00 28.77  ? 95  TYR E CD2 1 
ATOM   6611  C CE1 . TYR E  1 71  ? -6.602  -32.975 101.620 1.00 30.35  ? 95  TYR E CE1 1 
ATOM   6612  C CE2 . TYR E  1 71  ? -5.185  -31.106 100.872 1.00 29.48  ? 95  TYR E CE2 1 
ATOM   6613  C CZ  . TYR E  1 71  ? -6.427  -31.734 100.925 1.00 30.47  ? 95  TYR E CZ  1 
ATOM   6614  O OH  . TYR E  1 71  ? -7.499  -31.126 100.357 1.00 29.69  ? 95  TYR E OH  1 
ATOM   6615  N N   . TYR E  1 72  ? -0.994  -34.983 104.823 1.00 26.43  ? 96  TYR E N   1 
ATOM   6616  C CA  . TYR E  1 72  ? 0.438   -35.149 105.105 1.00 26.61  ? 96  TYR E CA  1 
ATOM   6617  C C   . TYR E  1 72  ? 1.121   -36.169 104.251 1.00 26.82  ? 96  TYR E C   1 
ATOM   6618  O O   . TYR E  1 72  ? 0.496   -37.017 103.679 1.00 26.95  ? 96  TYR E O   1 
ATOM   6619  C CB  . TYR E  1 72  ? 0.659   -35.560 106.544 1.00 25.99  ? 96  TYR E CB  1 
ATOM   6620  C CG  . TYR E  1 72  ? 0.424   -37.034 106.793 1.00 25.45  ? 96  TYR E CG  1 
ATOM   6621  C CD1 . TYR E  1 72  ? -0.877  -37.575 106.840 1.00 25.19  ? 96  TYR E CD1 1 
ATOM   6622  C CD2 . TYR E  1 72  ? 1.491   -37.871 106.972 1.00 24.68  ? 96  TYR E CD2 1 
ATOM   6623  C CE1 . TYR E  1 72  ? -1.083  -38.934 107.080 1.00 24.45  ? 96  TYR E CE1 1 
ATOM   6624  C CE2 . TYR E  1 72  ? 1.317   -39.218 107.184 1.00 25.48  ? 96  TYR E CE2 1 
ATOM   6625  C CZ  . TYR E  1 72  ? 0.025   -39.778 107.272 1.00 24.99  ? 96  TYR E CZ  1 
ATOM   6626  O OH  . TYR E  1 72  ? -0.058  -41.166 107.524 1.00 23.50  ? 96  TYR E OH  1 
ATOM   6627  N N   . ARG E  1 73  ? 2.433   -36.093 104.213 1.00 27.95  ? 97  ARG E N   1 
ATOM   6628  C CA  . ARG E  1 73  ? 3.228   -37.166 103.664 1.00 28.75  ? 97  ARG E CA  1 
ATOM   6629  C C   . ARG E  1 73  ? 4.594   -37.189 104.300 1.00 28.92  ? 97  ARG E C   1 
ATOM   6630  O O   . ARG E  1 73  ? 5.171   -36.147 104.578 1.00 28.75  ? 97  ARG E O   1 
ATOM   6631  C CB  . ARG E  1 73  ? 3.362   -37.035 102.172 1.00 30.01  ? 97  ARG E CB  1 
ATOM   6632  C CG  . ARG E  1 73  ? 3.916   -35.695 101.675 1.00 30.80  ? 97  ARG E CG  1 
ATOM   6633  C CD  . ARG E  1 73  ? 3.734   -35.601 100.139 1.00 31.03  ? 97  ARG E CD  1 
ATOM   6634  N NE  . ARG E  1 73  ? 4.431   -34.426 99.646  1.00 30.70  ? 97  ARG E NE  1 
ATOM   6635  C CZ  . ARG E  1 73  ? 4.475   -34.038 98.379  1.00 29.56  ? 97  ARG E CZ  1 
ATOM   6636  N NH1 . ARG E  1 73  ? 5.168   -32.969 98.075  1.00 28.54  ? 97  ARG E NH1 1 
ATOM   6637  N NH2 . ARG E  1 73  ? 3.851   -34.710 97.432  1.00 29.27  ? 97  ARG E NH2 1 
ATOM   6638  N N   . ILE E  1 74  ? 5.101   -38.397 104.528 1.00 29.58  ? 98  ILE E N   1 
ATOM   6639  C CA  . ILE E  1 74  ? 6.326   -38.581 105.260 1.00 29.88  ? 98  ILE E CA  1 
ATOM   6640  C C   . ILE E  1 74  ? 7.417   -38.547 104.262 1.00 29.86  ? 98  ILE E C   1 
ATOM   6641  O O   . ILE E  1 74  ? 7.457   -39.349 103.363 1.00 28.30  ? 98  ILE E O   1 
ATOM   6642  C CB  . ILE E  1 74  ? 6.365   -39.890 106.006 1.00 30.27  ? 98  ILE E CB  1 
ATOM   6643  C CG1 . ILE E  1 74  ? 5.097   -39.993 106.880 1.00 31.36  ? 98  ILE E CG1 1 
ATOM   6644  C CG2 . ILE E  1 74  ? 7.690   -39.963 106.757 1.00 30.56  ? 98  ILE E CG2 1 
ATOM   6645  C CD1 . ILE E  1 74  ? 5.078   -41.172 107.831 1.00 31.45  ? 98  ILE E CD1 1 
ATOM   6646  N N   . ARG E  1 75  ? 8.276   -37.571 104.436 1.00 32.67  ? 99  ARG E N   1 
ATOM   6647  C CA  . ARG E  1 75  ? 9.305   -37.256 103.480 1.00 35.43  ? 99  ARG E CA  1 
ATOM   6648  C C   . ARG E  1 75  ? 10.462  -38.207 103.646 1.00 34.42  ? 99  ARG E C   1 
ATOM   6649  O O   . ARG E  1 75  ? 10.970  -38.751 102.666 1.00 33.70  ? 99  ARG E O   1 
ATOM   6650  C CB  . ARG E  1 75  ? 9.756   -35.821 103.663 1.00 38.74  ? 99  ARG E CB  1 
ATOM   6651  C CG  . ARG E  1 75  ? 9.721   -35.054 102.369 1.00 44.53  ? 99  ARG E CG  1 
ATOM   6652  C CD  . ARG E  1 75  ? 8.290   -34.856 101.904 1.00 50.43  ? 99  ARG E CD  1 
ATOM   6653  N NE  . ARG E  1 75  ? 8.110   -35.125 100.443 1.00 58.90  ? 99  ARG E NE  1 
ATOM   6654  C CZ  . ARG E  1 75  ? 8.380   -34.268 99.433  1.00 62.06  ? 99  ARG E CZ  1 
ATOM   6655  N NH1 . ARG E  1 75  ? 8.140   -34.633 98.198  1.00 62.02  ? 99  ARG E NH1 1 
ATOM   6656  N NH2 . ARG E  1 75  ? 8.889   -33.041 99.632  1.00 66.73  ? 99  ARG E NH2 1 
ATOM   6657  N N   . LYS E  1 76  ? 10.770  -38.462 104.916 1.00 35.08  ? 100 LYS E N   1 
ATOM   6658  C CA  . LYS E  1 76  ? 11.980  -39.113 105.390 1.00 34.32  ? 100 LYS E CA  1 
ATOM   6659  C C   . LYS E  1 76  ? 11.785  -39.607 106.861 1.00 33.49  ? 100 LYS E C   1 
ATOM   6660  O O   . LYS E  1 76  ? 10.990  -39.056 107.619 1.00 33.00  ? 100 LYS E O   1 
ATOM   6661  C CB  . LYS E  1 76  ? 13.108  -38.078 105.324 1.00 34.61  ? 100 LYS E CB  1 
ATOM   6662  C CG  . LYS E  1 76  ? 14.329  -38.484 104.543 1.00 35.12  ? 100 LYS E CG  1 
ATOM   6663  C CD  . LYS E  1 76  ? 14.189  -38.426 103.063 1.00 35.40  ? 100 LYS E CD  1 
ATOM   6664  C CE  . LYS E  1 76  ? 15.317  -39.217 102.449 1.00 38.06  ? 100 LYS E CE  1 
ATOM   6665  N NZ  . LYS E  1 76  ? 15.107  -39.386 100.987 1.00 40.57  ? 100 LYS E NZ  1 
ATOM   6666  N N   . VAL E  1 77  ? 12.489  -40.676 107.227 1.00 33.81  ? 101 VAL E N   1 
ATOM   6667  C CA  . VAL E  1 77  ? 12.525  -41.194 108.593 1.00 33.04  ? 101 VAL E CA  1 
ATOM   6668  C C   . VAL E  1 77  ? 13.952  -41.389 108.974 1.00 32.25  ? 101 VAL E C   1 
ATOM   6669  O O   . VAL E  1 77  ? 14.692  -41.983 108.200 1.00 31.56  ? 101 VAL E O   1 
ATOM   6670  C CB  . VAL E  1 77  ? 11.966  -42.606 108.776 1.00 33.92  ? 101 VAL E CB  1 
ATOM   6671  C CG1 . VAL E  1 77  ? 11.791  -42.860 110.238 1.00 35.09  ? 101 VAL E CG1 1 
ATOM   6672  C CG2 . VAL E  1 77  ? 10.620  -42.721 108.226 1.00 36.07  ? 101 VAL E CG2 1 
ATOM   6673  N N   . LYS E  1 78  ? 14.285  -40.969 110.200 1.00 31.77  ? 102 LYS E N   1 
ATOM   6674  C CA  . LYS E  1 78  ? 15.530  -41.309 110.846 1.00 31.99  ? 102 LYS E CA  1 
ATOM   6675  C C   . LYS E  1 78  ? 15.249  -42.288 111.978 1.00 30.38  ? 102 LYS E C   1 
ATOM   6676  O O   . LYS E  1 78  ? 14.334  -42.071 112.731 1.00 29.78  ? 102 LYS E O   1 
ATOM   6677  C CB  . LYS E  1 78  ? 16.207  -40.082 111.378 1.00 33.39  ? 102 LYS E CB  1 
ATOM   6678  C CG  . LYS E  1 78  ? 17.677  -40.297 111.643 1.00 35.95  ? 102 LYS E CG  1 
ATOM   6679  C CD  . LYS E  1 78  ? 18.367  -38.997 112.058 1.00 38.51  ? 102 LYS E CD  1 
ATOM   6680  C CE  . LYS E  1 78  ? 19.768  -39.011 111.461 1.00 41.98  ? 102 LYS E CE  1 
ATOM   6681  N NZ  . LYS E  1 78  ? 20.726  -38.179 112.223 1.00 45.75  ? 102 LYS E NZ  1 
ATOM   6682  N N   . VAL E  1 79  ? 15.995  -43.385 112.020 1.00 29.21  ? 103 VAL E N   1 
ATOM   6683  C CA  . VAL E  1 79  ? 15.932  -44.336 113.099 1.00 30.43  ? 103 VAL E CA  1 
ATOM   6684  C C   . VAL E  1 79  ? 17.305  -44.336 113.760 1.00 29.90  ? 103 VAL E C   1 
ATOM   6685  O O   . VAL E  1 79  ? 18.294  -44.629 113.113 1.00 31.29  ? 103 VAL E O   1 
ATOM   6686  C CB  . VAL E  1 79  ? 15.525  -45.768 112.590 1.00 31.66  ? 103 VAL E CB  1 
ATOM   6687  C CG1 . VAL E  1 79  ? 15.396  -46.780 113.705 1.00 30.60  ? 103 VAL E CG1 1 
ATOM   6688  C CG2 . VAL E  1 79  ? 14.177  -45.720 111.901 1.00 32.41  ? 103 VAL E CG2 1 
ATOM   6689  N N   . GLU E  1 80  ? 17.358  -44.001 115.044 1.00 29.33  ? 104 GLU E N   1 
ATOM   6690  C CA  . GLU E  1 80  ? 18.588  -43.990 115.803 1.00 29.16  ? 104 GLU E CA  1 
ATOM   6691  C C   . GLU E  1 80  ? 18.521  -45.017 116.948 1.00 28.40  ? 104 GLU E C   1 
ATOM   6692  O O   . GLU E  1 80  ? 17.576  -44.996 117.766 1.00 28.03  ? 104 GLU E O   1 
ATOM   6693  C CB  . GLU E  1 80  ? 18.798  -42.598 116.375 1.00 29.80  ? 104 GLU E CB  1 
ATOM   6694  C CG  . GLU E  1 80  ? 19.141  -41.559 115.338 1.00 30.40  ? 104 GLU E CG  1 
ATOM   6695  C CD  . GLU E  1 80  ? 19.102  -40.160 115.916 1.00 31.83  ? 104 GLU E CD  1 
ATOM   6696  O OE1 . GLU E  1 80  ? 18.099  -39.734 116.566 1.00 34.84  ? 104 GLU E OE1 1 
ATOM   6697  O OE2 . GLU E  1 80  ? 20.065  -39.462 115.707 1.00 31.81  ? 104 GLU E OE2 1 
ATOM   6698  N N   . PHE E  1 81  ? 19.496  -45.913 116.967 1.00 27.39  ? 105 PHE E N   1 
ATOM   6699  C CA  . PHE E  1 81  ? 19.736  -46.834 118.069 1.00 28.65  ? 105 PHE E CA  1 
ATOM   6700  C C   . PHE E  1 81  ? 20.828  -46.228 118.900 1.00 30.27  ? 105 PHE E C   1 
ATOM   6701  O O   . PHE E  1 81  ? 22.035  -46.208 118.503 1.00 30.76  ? 105 PHE E O   1 
ATOM   6702  C CB  . PHE E  1 81  ? 20.217  -48.177 117.550 1.00 28.18  ? 105 PHE E CB  1 
ATOM   6703  C CG  . PHE E  1 81  ? 19.185  -48.884 116.730 1.00 28.14  ? 105 PHE E CG  1 
ATOM   6704  C CD1 . PHE E  1 81  ? 19.122  -48.715 115.370 1.00 28.36  ? 105 PHE E CD1 1 
ATOM   6705  C CD2 . PHE E  1 81  ? 18.244  -49.686 117.333 1.00 28.05  ? 105 PHE E CD2 1 
ATOM   6706  C CE1 . PHE E  1 81  ? 18.142  -49.354 114.613 1.00 28.44  ? 105 PHE E CE1 1 
ATOM   6707  C CE2 . PHE E  1 81  ? 17.294  -50.346 116.594 1.00 28.37  ? 105 PHE E CE2 1 
ATOM   6708  C CZ  . PHE E  1 81  ? 17.231  -50.170 115.230 1.00 28.19  ? 105 PHE E CZ  1 
ATOM   6709  N N   . TRP E  1 82  ? 20.403  -45.691 120.037 1.00 31.89  ? 106 TRP E N   1 
ATOM   6710  C CA  . TRP E  1 82  ? 21.302  -45.063 121.000 1.00 32.35  ? 106 TRP E CA  1 
ATOM   6711  C C   . TRP E  1 82  ? 21.539  -46.133 122.071 1.00 33.96  ? 106 TRP E C   1 
ATOM   6712  O O   . TRP E  1 82  ? 20.572  -46.499 122.832 1.00 33.50  ? 106 TRP E O   1 
ATOM   6713  C CB  . TRP E  1 82  ? 20.675  -43.865 121.658 1.00 33.19  ? 106 TRP E CB  1 
ATOM   6714  C CG  . TRP E  1 82  ? 20.371  -42.710 120.802 1.00 33.06  ? 106 TRP E CG  1 
ATOM   6715  C CD1 . TRP E  1 82  ? 19.164  -42.399 120.226 1.00 33.89  ? 106 TRP E CD1 1 
ATOM   6716  C CD2 . TRP E  1 82  ? 21.251  -41.651 120.495 1.00 33.21  ? 106 TRP E CD2 1 
ATOM   6717  N NE1 . TRP E  1 82  ? 19.264  -41.205 119.524 1.00 34.18  ? 106 TRP E NE1 1 
ATOM   6718  C CE2 . TRP E  1 82  ? 20.542  -40.730 119.678 1.00 33.95  ? 106 TRP E CE2 1 
ATOM   6719  C CE3 . TRP E  1 82  ? 22.588  -41.383 120.813 1.00 34.25  ? 106 TRP E CE3 1 
ATOM   6720  C CZ2 . TRP E  1 82  ? 21.135  -39.555 119.181 1.00 34.21  ? 106 TRP E CZ2 1 
ATOM   6721  C CZ3 . TRP E  1 82  ? 23.175  -40.178 120.341 1.00 34.76  ? 106 TRP E CZ3 1 
ATOM   6722  C CH2 . TRP E  1 82  ? 22.439  -39.284 119.541 1.00 34.11  ? 106 TRP E CH2 1 
ATOM   6723  N N   . PRO E  1 83  ? 22.785  -46.669 122.108 1.00 33.73  ? 107 PRO E N   1 
ATOM   6724  C CA  . PRO E  1 83  ? 23.101  -47.725 123.014 1.00 33.80  ? 107 PRO E CA  1 
ATOM   6725  C C   . PRO E  1 83  ? 23.017  -47.310 124.469 1.00 33.81  ? 107 PRO E C   1 
ATOM   6726  O O   . PRO E  1 83  ? 23.511  -46.260 124.810 1.00 35.81  ? 107 PRO E O   1 
ATOM   6727  C CB  . PRO E  1 83  ? 24.575  -48.017 122.687 1.00 34.77  ? 107 PRO E CB  1 
ATOM   6728  C CG  . PRO E  1 83  ? 25.088  -46.808 122.036 1.00 34.20  ? 107 PRO E CG  1 
ATOM   6729  C CD  . PRO E  1 83  ? 23.930  -46.376 121.221 1.00 34.09  ? 107 PRO E CD  1 
ATOM   6730  N N   . CYS E  1 84  ? 22.443  -48.155 125.306 1.00 32.90  ? 108 CYS E N   1 
ATOM   6731  C CA  . CYS E  1 84  ? 22.631  -48.057 126.761 1.00 33.41  ? 108 CYS E CA  1 
ATOM   6732  C C   . CYS E  1 84  ? 23.952  -48.671 127.357 1.00 31.53  ? 108 CYS E C   1 
ATOM   6733  O O   . CYS E  1 84  ? 24.506  -48.176 128.358 1.00 30.55  ? 108 CYS E O   1 
ATOM   6734  C CB  . CYS E  1 84  ? 21.410  -48.677 127.474 1.00 34.59  ? 108 CYS E CB  1 
ATOM   6735  S SG  . CYS E  1 84  ? 19.852  -47.935 126.948 1.00 34.29  ? 108 CYS E SG  1 
ATOM   6736  N N   . SER E  1 85  ? 24.425  -49.743 126.758 1.00 30.12  ? 109 SER E N   1 
ATOM   6737  C CA  . SER E  1 85  ? 25.550  -50.478 127.286 1.00 31.25  ? 109 SER E CA  1 
ATOM   6738  C C   . SER E  1 85  ? 26.854  -49.654 127.301 1.00 32.06  ? 109 SER E C   1 
ATOM   6739  O O   . SER E  1 85  ? 27.155  -48.894 126.381 1.00 32.40  ? 109 SER E O   1 
ATOM   6740  C CB  . SER E  1 85  ? 25.721  -51.800 126.485 1.00 31.82  ? 109 SER E CB  1 
ATOM   6741  O OG  . SER E  1 85  ? 24.478  -52.478 126.364 1.00 32.21  ? 109 SER E OG  1 
ATOM   6742  N N   . PRO E  1 86  ? 27.664  -49.822 128.346 1.00 33.90  ? 110 PRO E N   1 
ATOM   6743  C CA  . PRO E  1 86  ? 28.896  -49.043 128.359 1.00 33.54  ? 110 PRO E CA  1 
ATOM   6744  C C   . PRO E  1 86  ? 29.960  -49.562 127.402 1.00 35.08  ? 110 PRO E C   1 
ATOM   6745  O O   . PRO E  1 86  ? 30.006  -50.748 127.036 1.00 31.58  ? 110 PRO E O   1 
ATOM   6746  C CB  . PRO E  1 86  ? 29.388  -49.255 129.792 1.00 33.46  ? 110 PRO E CB  1 
ATOM   6747  C CG  . PRO E  1 86  ? 28.959  -50.636 130.140 1.00 33.20  ? 110 PRO E CG  1 
ATOM   6748  C CD  . PRO E  1 86  ? 27.559  -50.712 129.535 1.00 33.66  ? 110 PRO E CD  1 
ATOM   6749  N N   . ILE E  1 87  ? 30.909  -48.690 127.112 1.00 39.55  ? 111 ILE E N   1 
ATOM   6750  C CA  . ILE E  1 87  ? 32.063  -49.079 126.282 1.00 42.98  ? 111 ILE E CA  1 
ATOM   6751  C C   . ILE E  1 87  ? 32.984  -50.228 126.905 1.00 44.07  ? 111 ILE E C   1 
ATOM   6752  O O   . ILE E  1 87  ? 33.809  -50.875 126.182 1.00 48.61  ? 111 ILE E O   1 
ATOM   6753  C CB  . ILE E  1 87  ? 32.836  -47.831 125.883 1.00 45.95  ? 111 ILE E CB  1 
ATOM   6754  C CG1 . ILE E  1 87  ? 33.694  -47.373 127.063 1.00 51.37  ? 111 ILE E CG1 1 
ATOM   6755  C CG2 . ILE E  1 87  ? 31.880  -46.710 125.387 1.00 46.76  ? 111 ILE E CG2 1 
ATOM   6756  C CD1 . ILE E  1 87  ? 34.291  -45.994 126.852 1.00 55.54  ? 111 ILE E CD1 1 
ATOM   6757  N N   . THR E  1 88  ? 32.802  -50.519 128.197 1.00 40.38  ? 112 THR E N   1 
ATOM   6758  C CA  . THR E  1 88  ? 33.419  -51.683 128.861 1.00 39.81  ? 112 THR E CA  1 
ATOM   6759  C C   . THR E  1 88  ? 32.749  -53.037 128.604 1.00 39.31  ? 112 THR E C   1 
ATOM   6760  O O   . THR E  1 88  ? 33.211  -54.054 129.112 1.00 42.14  ? 112 THR E O   1 
ATOM   6761  C CB  . THR E  1 88  ? 33.483  -51.483 130.426 1.00 40.59  ? 112 THR E CB  1 
ATOM   6762  O OG1 . THR E  1 88  ? 32.185  -51.610 131.050 1.00 38.94  ? 112 THR E OG1 1 
ATOM   6763  C CG2 . THR E  1 88  ? 34.040  -50.072 130.752 1.00 41.08  ? 112 THR E CG2 1 
ATOM   6764  N N   . GLN E  1 89  ? 31.637  -53.088 127.885 1.00 37.42  ? 113 GLN E N   1 
ATOM   6765  C CA  . GLN E  1 89  ? 30.932  -54.361 127.764 1.00 36.01  ? 113 GLN E CA  1 
ATOM   6766  C C   . GLN E  1 89  ? 31.545  -55.188 126.640 1.00 35.41  ? 113 GLN E C   1 
ATOM   6767  O O   . GLN E  1 89  ? 31.904  -54.687 125.613 1.00 37.53  ? 113 GLN E O   1 
ATOM   6768  C CB  . GLN E  1 89  ? 29.432  -54.141 127.586 1.00 35.05  ? 113 GLN E CB  1 
ATOM   6769  C CG  . GLN E  1 89  ? 28.602  -55.403 127.380 1.00 33.87  ? 113 GLN E CG  1 
ATOM   6770  C CD  . GLN E  1 89  ? 27.104  -55.158 127.582 1.00 33.50  ? 113 GLN E CD  1 
ATOM   6771  O OE1 . GLN E  1 89  ? 26.685  -54.524 128.554 1.00 33.79  ? 113 GLN E OE1 1 
ATOM   6772  N NE2 . GLN E  1 89  ? 26.290  -55.667 126.662 1.00 32.42  ? 113 GLN E NE2 1 
ATOM   6773  N N   . GLY E  1 90  ? 31.729  -56.456 126.891 1.00 35.92  ? 114 GLY E N   1 
ATOM   6774  C CA  . GLY E  1 90  ? 32.374  -57.360 125.967 1.00 36.30  ? 114 GLY E CA  1 
ATOM   6775  C C   . GLY E  1 90  ? 31.327  -58.223 125.315 1.00 35.80  ? 114 GLY E C   1 
ATOM   6776  O O   . GLY E  1 90  ? 30.161  -57.837 125.275 1.00 35.00  ? 114 GLY E O   1 
ATOM   6777  N N   . ASP E  1 91  ? 31.743  -59.395 124.830 1.00 35.61  ? 115 ASP E N   1 
ATOM   6778  C CA  . ASP E  1 91  ? 30.908  -60.213 123.917 1.00 36.84  ? 115 ASP E CA  1 
ATOM   6779  C C   . ASP E  1 91  ? 30.236  -59.392 122.822 1.00 36.30  ? 115 ASP E C   1 
ATOM   6780  O O   . ASP E  1 91  ? 29.061  -59.539 122.510 1.00 33.94  ? 115 ASP E O   1 
ATOM   6781  C CB  . ASP E  1 91  ? 29.839  -61.025 124.648 1.00 37.60  ? 115 ASP E CB  1 
ATOM   6782  C CG  . ASP E  1 91  ? 29.439  -62.279 123.886 1.00 37.63  ? 115 ASP E CG  1 
ATOM   6783  O OD1 . ASP E  1 91  ? 30.273  -62.848 123.170 1.00 40.31  ? 115 ASP E OD1 1 
ATOM   6784  O OD2 . ASP E  1 91  ? 28.304  -62.749 124.023 1.00 38.53  ? 115 ASP E OD2 1 
ATOM   6785  N N   . ARG E  1 92  ? 31.059  -58.546 122.247 1.00 36.30  ? 116 ARG E N   1 
ATOM   6786  C CA  . ARG E  1 92  ? 30.666  -57.713 121.170 1.00 36.84  ? 116 ARG E CA  1 
ATOM   6787  C C   . ARG E  1 92  ? 30.284  -58.521 119.911 1.00 34.46  ? 116 ARG E C   1 
ATOM   6788  O O   . ARG E  1 92  ? 30.866  -59.553 119.619 1.00 34.23  ? 116 ARG E O   1 
ATOM   6789  C CB  . ARG E  1 92  ? 31.817  -56.801 120.813 1.00 38.67  ? 116 ARG E CB  1 
ATOM   6790  C CG  . ARG E  1 92  ? 32.222  -55.804 121.880 1.00 40.13  ? 116 ARG E CG  1 
ATOM   6791  C CD  . ARG E  1 92  ? 32.830  -54.641 121.138 1.00 42.38  ? 116 ARG E CD  1 
ATOM   6792  N NE  . ARG E  1 92  ? 34.281  -54.561 121.155 1.00 43.92  ? 116 ARG E NE  1 
ATOM   6793  C CZ  . ARG E  1 92  ? 35.014  -53.887 120.265 1.00 43.65  ? 116 ARG E CZ  1 
ATOM   6794  N NH1 . ARG E  1 92  ? 36.325  -53.885 120.403 1.00 46.10  ? 116 ARG E NH1 1 
ATOM   6795  N NH2 . ARG E  1 92  ? 34.469  -53.250 119.234 1.00 41.40  ? 116 ARG E NH2 1 
ATOM   6796  N N   . GLY E  1 93  ? 29.344  -57.963 119.159 1.00 32.03  ? 117 GLY E N   1 
ATOM   6797  C CA  . GLY E  1 93  ? 28.730  -58.606 118.037 1.00 31.66  ? 117 GLY E CA  1 
ATOM   6798  C C   . GLY E  1 93  ? 28.498  -57.648 116.855 1.00 31.71  ? 117 GLY E C   1 
ATOM   6799  O O   . GLY E  1 93  ? 28.858  -56.437 116.877 1.00 30.28  ? 117 GLY E O   1 
ATOM   6800  N N   . VAL E  1 94  ? 27.899  -58.234 115.816 1.00 30.97  ? 118 VAL E N   1 
ATOM   6801  C CA  . VAL E  1 94  ? 27.702  -57.572 114.597 1.00 31.38  ? 118 VAL E CA  1 
ATOM   6802  C C   . VAL E  1 94  ? 26.436  -58.092 113.963 1.00 29.90  ? 118 VAL E C   1 
ATOM   6803  O O   . VAL E  1 94  ? 26.210  -59.273 113.906 1.00 30.36  ? 118 VAL E O   1 
ATOM   6804  C CB  . VAL E  1 94  ? 28.954  -57.677 113.702 1.00 34.27  ? 118 VAL E CB  1 
ATOM   6805  C CG1 . VAL E  1 94  ? 29.392  -59.106 113.509 1.00 36.41  ? 118 VAL E CG1 1 
ATOM   6806  C CG2 . VAL E  1 94  ? 28.685  -57.080 112.326 1.00 36.32  ? 118 VAL E CG2 1 
ATOM   6807  N N   . GLY E  1 95  ? 25.612  -57.164 113.501 1.00 29.29  ? 119 GLY E N   1 
ATOM   6808  C CA  . GLY E  1 95  ? 24.310  -57.429 112.928 1.00 28.91  ? 119 GLY E CA  1 
ATOM   6809  C C   . GLY E  1 95  ? 23.953  -56.537 111.761 1.00 28.36  ? 119 GLY E C   1 
ATOM   6810  O O   . GLY E  1 95  ? 24.810  -56.002 111.121 1.00 29.34  ? 119 GLY E O   1 
ATOM   6811  N N   . SER E  1 96  ? 22.670  -56.384 111.471 1.00 29.40  ? 120 SER E N   1 
ATOM   6812  C CA  . SER E  1 96  ? 22.215  -55.708 110.236 1.00 29.35  ? 120 SER E CA  1 
ATOM   6813  C C   . SER E  1 96  ? 20.916  -54.940 110.333 1.00 28.87  ? 120 SER E C   1 
ATOM   6814  O O   . SER E  1 96  ? 19.968  -55.343 111.018 1.00 30.12  ? 120 SER E O   1 
ATOM   6815  C CB  . SER E  1 96  ? 22.104  -56.745 109.143 1.00 29.06  ? 120 SER E CB  1 
ATOM   6816  O OG  . SER E  1 96  ? 23.397  -57.320 108.953 1.00 30.20  ? 120 SER E OG  1 
ATOM   6817  N N   . SER E  1 97  ? 20.863  -53.813 109.658 1.00 28.34  ? 121 SER E N   1 
ATOM   6818  C CA  . SER E  1 97  ? 19.575  -53.170 109.435 1.00 27.96  ? 121 SER E CA  1 
ATOM   6819  C C   . SER E  1 97  ? 19.400  -53.107 107.960 1.00 28.44  ? 121 SER E C   1 
ATOM   6820  O O   . SER E  1 97  ? 20.361  -52.868 107.251 1.00 28.83  ? 121 SER E O   1 
ATOM   6821  C CB  . SER E  1 97  ? 19.488  -51.780 110.027 1.00 27.10  ? 121 SER E CB  1 
ATOM   6822  O OG  . SER E  1 97  ? 20.491  -50.956 109.560 1.00 26.38  ? 121 SER E OG  1 
ATOM   6823  N N   . ALA E  1 98  ? 18.184  -53.393 107.515 1.00 28.90  ? 122 ALA E N   1 
ATOM   6824  C CA  . ALA E  1 98  ? 17.795  -53.331 106.134 1.00 28.78  ? 122 ALA E CA  1 
ATOM   6825  C C   . ALA E  1 98  ? 16.461  -52.567 106.015 1.00 28.95  ? 122 ALA E C   1 
ATOM   6826  O O   . ALA E  1 98  ? 15.599  -52.654 106.893 1.00 30.49  ? 122 ALA E O   1 
ATOM   6827  C CB  . ALA E  1 98  ? 17.638  -54.740 105.625 1.00 28.91  ? 122 ALA E CB  1 
ATOM   6828  N N   . VAL E  1 99  ? 16.319  -51.801 104.937 1.00 28.96  ? 123 VAL E N   1 
ATOM   6829  C CA  . VAL E  1 99  ? 15.093  -51.072 104.594 1.00 27.55  ? 123 VAL E CA  1 
ATOM   6830  C C   . VAL E  1 99  ? 14.110  -51.980 103.851 1.00 27.71  ? 123 VAL E C   1 
ATOM   6831  O O   . VAL E  1 99  ? 14.391  -52.477 102.753 1.00 29.56  ? 123 VAL E O   1 
ATOM   6832  C CB  . VAL E  1 99  ? 15.395  -49.859 103.717 1.00 26.33  ? 123 VAL E CB  1 
ATOM   6833  C CG1 . VAL E  1 99  ? 14.131  -49.102 103.395 1.00 25.93  ? 123 VAL E CG1 1 
ATOM   6834  C CG2 . VAL E  1 99  ? 16.301  -48.905 104.450 1.00 27.31  ? 123 VAL E CG2 1 
ATOM   6835  N N   . ILE E  1 100 ? 12.937  -52.131 104.439 1.00 27.71  ? 124 ILE E N   1 
ATOM   6836  C CA  . ILE E  1 100 ? 11.921  -53.011 103.975 1.00 28.96  ? 124 ILE E CA  1 
ATOM   6837  C C   . ILE E  1 100 ? 10.735  -52.178 103.552 1.00 29.18  ? 124 ILE E C   1 
ATOM   6838  O O   . ILE E  1 100 ? 9.855   -51.920 104.348 1.00 30.04  ? 124 ILE E O   1 
ATOM   6839  C CB  . ILE E  1 100 ? 11.532  -54.028 105.080 1.00 29.77  ? 124 ILE E CB  1 
ATOM   6840  C CG1 . ILE E  1 100 ? 12.758  -54.848 105.546 1.00 30.61  ? 124 ILE E CG1 1 
ATOM   6841  C CG2 . ILE E  1 100 ? 10.480  -55.002 104.576 1.00 30.20  ? 124 ILE E CG2 1 
ATOM   6842  C CD1 . ILE E  1 100 ? 13.652  -55.459 104.445 1.00 30.88  ? 124 ILE E CD1 1 
ATOM   6843  N N   . LEU E  1 101 ? 10.679  -51.826 102.269 1.00 28.59  ? 125 LEU E N   1 
ATOM   6844  C CA  . LEU E  1 101 ? 9.692   -50.859 101.799 1.00 27.89  ? 125 LEU E CA  1 
ATOM   6845  C C   . LEU E  1 101 ? 8.328   -51.457 101.464 1.00 28.79  ? 125 LEU E C   1 
ATOM   6846  O O   . LEU E  1 101 ? 7.433   -50.687 101.060 1.00 27.85  ? 125 LEU E O   1 
ATOM   6847  C CB  . LEU E  1 101 ? 10.201  -50.156 100.562 1.00 26.86  ? 125 LEU E CB  1 
ATOM   6848  C CG  . LEU E  1 101 ? 11.528  -49.451 100.684 1.00 25.61  ? 125 LEU E CG  1 
ATOM   6849  C CD1 . LEU E  1 101 ? 11.887  -49.003 99.283  1.00 25.77  ? 125 LEU E CD1 1 
ATOM   6850  C CD2 . LEU E  1 101 ? 11.517  -48.263 101.645 1.00 25.15  ? 125 LEU E CD2 1 
ATOM   6851  N N   . ASP E  1 102 ? 8.182   -52.788 101.619 1.00 29.19  ? 126 ASP E N   1 
ATOM   6852  C CA  . ASP E  1 102 ? 7.002   -53.493 101.170 1.00 30.69  ? 126 ASP E CA  1 
ATOM   6853  C C   . ASP E  1 102 ? 6.351   -54.336 102.231 1.00 32.02  ? 126 ASP E C   1 
ATOM   6854  O O   . ASP E  1 102 ? 5.601   -55.228 101.871 1.00 30.99  ? 126 ASP E O   1 
ATOM   6855  C CB  . ASP E  1 102 ? 7.353   -54.405 100.006 1.00 31.66  ? 126 ASP E CB  1 
ATOM   6856  C CG  . ASP E  1 102 ? 8.159   -55.639 100.430 1.00 32.71  ? 126 ASP E CG  1 
ATOM   6857  O OD1 . ASP E  1 102 ? 8.765   -55.748 101.541 1.00 34.37  ? 126 ASP E OD1 1 
ATOM   6858  O OD2 . ASP E  1 102 ? 8.243   -56.492 99.564  1.00 32.61  ? 126 ASP E OD2 1 
ATOM   6859  N N   . ASP E  1 103 ? 6.673   -54.075 103.508 1.00 34.57  ? 127 ASP E N   1 
ATOM   6860  C CA  . ASP E  1 103 ? 5.956   -54.618 104.668 1.00 36.35  ? 127 ASP E CA  1 
ATOM   6861  C C   . ASP E  1 103 ? 6.100   -56.109 104.789 1.00 36.93  ? 127 ASP E C   1 
ATOM   6862  O O   . ASP E  1 103 ? 5.211   -56.801 105.226 1.00 39.55  ? 127 ASP E O   1 
ATOM   6863  C CB  . ASP E  1 103 ? 4.466   -54.220 104.591 1.00 38.51  ? 127 ASP E CB  1 
ATOM   6864  C CG  . ASP E  1 103 ? 3.677   -54.553 105.885 1.00 40.91  ? 127 ASP E CG  1 
ATOM   6865  O OD1 . ASP E  1 103 ? 4.221   -54.459 107.041 1.00 38.30  ? 127 ASP E OD1 1 
ATOM   6866  O OD2 . ASP E  1 103 ? 2.483   -54.917 105.679 1.00 45.48  ? 127 ASP E OD2 1 
ATOM   6867  N N   . ASN E  1 104 ? 7.224   -56.621 104.352 1.00 38.41  ? 128 ASN E N   1 
ATOM   6868  C CA  . ASN E  1 104 ? 7.459   -58.045 104.353 1.00 38.45  ? 128 ASN E CA  1 
ATOM   6869  C C   . ASN E  1 104 ? 8.788   -58.332 105.013 1.00 35.59  ? 128 ASN E C   1 
ATOM   6870  O O   . ASN E  1 104 ? 9.736   -58.730 104.377 1.00 33.08  ? 128 ASN E O   1 
ATOM   6871  C CB  . ASN E  1 104 ? 7.461   -58.549 102.927 1.00 41.09  ? 128 ASN E CB  1 
ATOM   6872  C CG  . ASN E  1 104 ? 7.827   -60.030 102.820 1.00 41.67  ? 128 ASN E CG  1 
ATOM   6873  O OD1 . ASN E  1 104 ? 7.328   -60.841 103.591 1.00 42.18  ? 128 ASN E OD1 1 
ATOM   6874  N ND2 . ASN E  1 104 ? 8.690   -60.384 101.833 1.00 42.28  ? 128 ASN E ND2 1 
ATOM   6875  N N   . PHE E  1 105 ? 8.786   -58.171 106.326 1.00 34.11  ? 129 PHE E N   1 
ATOM   6876  C CA  . PHE E  1 105 ? 9.950   -58.436 107.163 1.00 31.96  ? 129 PHE E CA  1 
ATOM   6877  C C   . PHE E  1 105 ? 10.212  -59.933 107.363 1.00 30.06  ? 129 PHE E C   1 
ATOM   6878  O O   . PHE E  1 105 ? 9.347   -60.772 107.243 1.00 28.22  ? 129 PHE E O   1 
ATOM   6879  C CB  . PHE E  1 105 ? 9.741   -57.809 108.523 1.00 32.20  ? 129 PHE E CB  1 
ATOM   6880  C CG  . PHE E  1 105 ? 9.419   -56.361 108.456 1.00 32.97  ? 129 PHE E CG  1 
ATOM   6881  C CD1 . PHE E  1 105 ? 10.428  -55.437 108.416 1.00 33.75  ? 129 PHE E CD1 1 
ATOM   6882  C CD2 . PHE E  1 105 ? 8.125   -55.939 108.395 1.00 34.11  ? 129 PHE E CD2 1 
ATOM   6883  C CE1 . PHE E  1 105 ? 10.153  -54.115 108.324 1.00 34.25  ? 129 PHE E CE1 1 
ATOM   6884  C CE2 . PHE E  1 105 ? 7.817   -54.609 108.310 1.00 35.12  ? 129 PHE E CE2 1 
ATOM   6885  C CZ  . PHE E  1 105 ? 8.838   -53.696 108.273 1.00 35.91  ? 129 PHE E CZ  1 
ATOM   6886  N N   . VAL E  1 106 ? 11.438  -60.239 107.729 1.00 29.55  ? 130 VAL E N   1 
ATOM   6887  C CA  . VAL E  1 106 ? 11.805  -61.566 108.197 1.00 28.90  ? 130 VAL E CA  1 
ATOM   6888  C C   . VAL E  1 106 ? 11.072  -61.723 109.505 1.00 28.53  ? 130 VAL E C   1 
ATOM   6889  O O   . VAL E  1 106 ? 11.032  -60.794 110.332 1.00 29.58  ? 130 VAL E O   1 
ATOM   6890  C CB  . VAL E  1 106 ? 13.333  -61.719 108.325 1.00 28.76  ? 130 VAL E CB  1 
ATOM   6891  C CG1 . VAL E  1 106 ? 13.717  -63.075 108.899 1.00 28.97  ? 130 VAL E CG1 1 
ATOM   6892  C CG2 . VAL E  1 106 ? 13.959  -61.552 106.944 1.00 28.94  ? 130 VAL E CG2 1 
ATOM   6893  N N   . THR E  1 107 ? 10.417  -62.860 109.637 1.00 28.48  ? 131 THR E N   1 
ATOM   6894  C CA  . THR E  1 107 ? 9.719   -63.278 110.857 1.00 28.61  ? 131 THR E CA  1 
ATOM   6895  C C   . THR E  1 107 ? 10.535  -63.119 112.098 1.00 29.15  ? 131 THR E C   1 
ATOM   6896  O O   . THR E  1 107 ? 11.690  -63.563 112.147 1.00 32.21  ? 131 THR E O   1 
ATOM   6897  C CB  . THR E  1 107 ? 9.325   -64.745 110.701 1.00 28.29  ? 131 THR E CB  1 
ATOM   6898  O OG1 . THR E  1 107 ? 8.145   -64.782 109.842 1.00 28.13  ? 131 THR E OG1 1 
ATOM   6899  C CG2 . THR E  1 107 ? 9.097   -65.423 112.049 1.00 27.70  ? 131 THR E CG2 1 
ATOM   6900  N N   . LYS E  1 108 ? 9.941   -62.459 113.074 1.00 29.37  ? 132 LYS E N   1 
ATOM   6901  C CA  . LYS E  1 108 ? 10.567  -62.198 114.402 1.00 29.73  ? 132 LYS E CA  1 
ATOM   6902  C C   . LYS E  1 108 ? 11.215  -63.446 115.010 1.00 29.60  ? 132 LYS E C   1 
ATOM   6903  O O   . LYS E  1 108 ? 10.610  -64.484 115.060 1.00 28.45  ? 132 LYS E O   1 
ATOM   6904  C CB  . LYS E  1 108 ? 9.469   -61.717 115.370 1.00 30.27  ? 132 LYS E CB  1 
ATOM   6905  C CG  . LYS E  1 108 ? 9.916   -61.064 116.656 1.00 31.42  ? 132 LYS E CG  1 
ATOM   6906  C CD  . LYS E  1 108 ? 8.883   -61.257 117.759 1.00 32.60  ? 132 LYS E CD  1 
ATOM   6907  C CE  . LYS E  1 108 ? 9.347   -60.714 119.091 1.00 32.56  ? 132 LYS E CE  1 
ATOM   6908  N NZ  . LYS E  1 108 ? 8.299   -60.927 120.147 1.00 33.92  ? 132 LYS E NZ  1 
ATOM   6909  N N   . ALA E  1 109 ? 12.424  -63.344 115.519 1.00 29.86  ? 133 ALA E N   1 
ATOM   6910  C CA  . ALA E  1 109 ? 13.078  -64.529 116.011 1.00 30.92  ? 133 ALA E CA  1 
ATOM   6911  C C   . ALA E  1 109 ? 14.003  -64.242 117.230 1.00 32.12  ? 133 ALA E C   1 
ATOM   6912  O O   . ALA E  1 109 ? 14.851  -63.346 117.192 1.00 34.50  ? 133 ALA E O   1 
ATOM   6913  C CB  . ALA E  1 109 ? 13.847  -65.162 114.858 1.00 30.19  ? 133 ALA E CB  1 
ATOM   6914  N N   . THR E  1 110 ? 13.842  -64.999 118.305 1.00 31.76  ? 134 THR E N   1 
ATOM   6915  C CA  . THR E  1 110 ? 14.742  -64.883 119.427 1.00 31.50  ? 134 THR E CA  1 
ATOM   6916  C C   . THR E  1 110 ? 16.214  -65.214 119.102 1.00 30.61  ? 134 THR E C   1 
ATOM   6917  O O   . THR E  1 110 ? 17.130  -64.508 119.530 1.00 28.35  ? 134 THR E O   1 
ATOM   6918  C CB  . THR E  1 110 ? 14.269  -65.753 120.621 1.00 32.32  ? 134 THR E CB  1 
ATOM   6919  O OG1 . THR E  1 110 ? 12.917  -65.409 121.004 1.00 31.26  ? 134 THR E OG1 1 
ATOM   6920  C CG2 . THR E  1 110 ? 15.242  -65.520 121.789 1.00 32.06  ? 134 THR E CG2 1 
ATOM   6921  N N   . ALA E  1 111 ? 16.421  -66.310 118.357 1.00 31.57  ? 135 ALA E N   1 
ATOM   6922  C CA  . ALA E  1 111 ? 17.805  -66.780 117.995 1.00 30.51  ? 135 ALA E CA  1 
ATOM   6923  C C   . ALA E  1 111 ? 17.996  -67.586 116.677 1.00 28.64  ? 135 ALA E C   1 
ATOM   6924  O O   . ALA E  1 111 ? 18.374  -68.718 116.650 1.00 28.77  ? 135 ALA E O   1 
ATOM   6925  C CB  . ALA E  1 111 ? 18.415  -67.492 119.182 1.00 30.82  ? 135 ALA E CB  1 
ATOM   6926  N N   . LEU E  1 112 ? 17.816  -66.923 115.564 1.00 28.52  ? 136 LEU E N   1 
ATOM   6927  C CA  . LEU E  1 112 ? 18.145  -67.477 114.251 1.00 28.48  ? 136 LEU E CA  1 
ATOM   6928  C C   . LEU E  1 112 ? 19.642  -67.736 114.135 1.00 29.87  ? 136 LEU E C   1 
ATOM   6929  O O   . LEU E  1 112 ? 20.456  -67.031 114.747 1.00 30.23  ? 136 LEU E O   1 
ATOM   6930  C CB  . LEU E  1 112 ? 17.703  -66.509 113.178 1.00 27.34  ? 136 LEU E CB  1 
ATOM   6931  C CG  . LEU E  1 112 ? 17.295  -67.031 111.819 1.00 27.44  ? 136 LEU E CG  1 
ATOM   6932  C CD1 . LEU E  1 112 ? 15.967  -67.752 111.885 1.00 27.26  ? 136 LEU E CD1 1 
ATOM   6933  C CD2 . LEU E  1 112 ? 17.185  -65.837 110.877 1.00 27.82  ? 136 LEU E CD2 1 
ATOM   6934  N N   . THR E  1 113 ? 19.999  -68.751 113.360 1.00 31.59  ? 137 THR E N   1 
ATOM   6935  C CA  . THR E  1 113 ? 21.370  -69.260 113.314 1.00 32.44  ? 137 THR E CA  1 
ATOM   6936  C C   . THR E  1 113 ? 22.232  -68.588 112.232 1.00 35.18  ? 137 THR E C   1 
ATOM   6937  O O   . THR E  1 113 ? 23.374  -69.016 111.987 1.00 37.91  ? 137 THR E O   1 
ATOM   6938  C CB  . THR E  1 113 ? 21.337  -70.771 113.072 1.00 32.60  ? 137 THR E CB  1 
ATOM   6939  O OG1 . THR E  1 113 ? 20.620  -71.039 111.849 1.00 31.55  ? 137 THR E OG1 1 
ATOM   6940  C CG2 . THR E  1 113 ? 20.682  -71.501 114.317 1.00 31.87  ? 137 THR E CG2 1 
ATOM   6941  N N   . TYR E  1 114 ? 21.693  -67.545 111.585 1.00 35.02  ? 138 TYR E N   1 
ATOM   6942  C CA  . TYR E  1 114 ? 22.453  -66.663 110.687 1.00 33.94  ? 138 TYR E CA  1 
ATOM   6943  C C   . TYR E  1 114 ? 21.794  -65.285 110.769 1.00 33.59  ? 138 TYR E C   1 
ATOM   6944  O O   . TYR E  1 114 ? 20.749  -65.168 111.365 1.00 33.59  ? 138 TYR E O   1 
ATOM   6945  C CB  . TYR E  1 114 ? 22.411  -67.191 109.255 1.00 34.56  ? 138 TYR E CB  1 
ATOM   6946  C CG  . TYR E  1 114 ? 20.996  -67.325 108.693 1.00 33.90  ? 138 TYR E CG  1 
ATOM   6947  C CD1 . TYR E  1 114 ? 20.101  -68.307 109.181 1.00 33.58  ? 138 TYR E CD1 1 
ATOM   6948  C CD2 . TYR E  1 114 ? 20.545  -66.482 107.714 1.00 32.27  ? 138 TYR E CD2 1 
ATOM   6949  C CE1 . TYR E  1 114 ? 18.809  -68.422 108.674 1.00 33.23  ? 138 TYR E CE1 1 
ATOM   6950  C CE2 . TYR E  1 114 ? 19.234  -66.601 107.221 1.00 33.24  ? 138 TYR E CE2 1 
ATOM   6951  C CZ  . TYR E  1 114 ? 18.373  -67.576 107.694 1.00 32.60  ? 138 TYR E CZ  1 
ATOM   6952  O OH  . TYR E  1 114 ? 17.082  -67.678 107.224 1.00 31.04  ? 138 TYR E OH  1 
ATOM   6953  N N   . ASP E  1 115 ? 22.427  -64.254 110.208 1.00 33.85  ? 139 ASP E N   1 
ATOM   6954  C CA  . ASP E  1 115 ? 21.866  -62.877 110.072 1.00 32.16  ? 139 ASP E CA  1 
ATOM   6955  C C   . ASP E  1 115 ? 21.037  -62.882 108.792 1.00 30.18  ? 139 ASP E C   1 
ATOM   6956  O O   . ASP E  1 115 ? 21.621  -62.846 107.677 1.00 30.13  ? 139 ASP E O   1 
ATOM   6957  C CB  . ASP E  1 115 ? 23.008  -61.830 109.969 1.00 32.44  ? 139 ASP E CB  1 
ATOM   6958  C CG  . ASP E  1 115 ? 22.508  -60.373 109.814 1.00 34.11  ? 139 ASP E CG  1 
ATOM   6959  O OD1 . ASP E  1 115 ? 21.332  -60.081 109.397 1.00 33.68  ? 139 ASP E OD1 1 
ATOM   6960  O OD2 . ASP E  1 115 ? 23.351  -59.491 110.132 1.00 36.20  ? 139 ASP E OD2 1 
ATOM   6961  N N   . PRO E  1 116 ? 19.711  -62.910 108.917 1.00 28.17  ? 140 PRO E N   1 
ATOM   6962  C CA  . PRO E  1 116 ? 18.952  -63.005 107.710 1.00 28.69  ? 140 PRO E CA  1 
ATOM   6963  C C   . PRO E  1 116 ? 19.065  -61.782 106.788 1.00 28.36  ? 140 PRO E C   1 
ATOM   6964  O O   . PRO E  1 116 ? 18.829  -61.901 105.553 1.00 28.21  ? 140 PRO E O   1 
ATOM   6965  C CB  . PRO E  1 116 ? 17.511  -63.244 108.201 1.00 29.09  ? 140 PRO E CB  1 
ATOM   6966  C CG  . PRO E  1 116 ? 17.447  -62.597 109.508 1.00 29.31  ? 140 PRO E CG  1 
ATOM   6967  C CD  . PRO E  1 116 ? 18.869  -62.491 110.033 1.00 29.44  ? 140 PRO E CD  1 
ATOM   6968  N N   . TYR E  1 117 ? 19.453  -60.630 107.340 1.00 27.56  ? 141 TYR E N   1 
ATOM   6969  C CA  . TYR E  1 117 ? 19.464  -59.400 106.527 1.00 26.79  ? 141 TYR E CA  1 
ATOM   6970  C C   . TYR E  1 117 ? 20.801  -59.013 105.911 1.00 26.49  ? 141 TYR E C   1 
ATOM   6971  O O   . TYR E  1 117 ? 20.890  -58.034 105.182 1.00 25.42  ? 141 TYR E O   1 
ATOM   6972  C CB  . TYR E  1 117 ? 18.908  -58.233 107.343 1.00 25.44  ? 141 TYR E CB  1 
ATOM   6973  C CG  . TYR E  1 117 ? 17.417  -58.296 107.555 1.00 24.73  ? 141 TYR E CG  1 
ATOM   6974  C CD1 . TYR E  1 117 ? 16.526  -58.266 106.471 1.00 24.83  ? 141 TYR E CD1 1 
ATOM   6975  C CD2 . TYR E  1 117 ? 16.883  -58.300 108.834 1.00 23.90  ? 141 TYR E CD2 1 
ATOM   6976  C CE1 . TYR E  1 117 ? 15.154  -58.264 106.683 1.00 24.48  ? 141 TYR E CE1 1 
ATOM   6977  C CE2 . TYR E  1 117 ? 15.541  -58.309 109.052 1.00 23.58  ? 141 TYR E CE2 1 
ATOM   6978  C CZ  . TYR E  1 117 ? 14.691  -58.286 108.006 1.00 24.08  ? 141 TYR E CZ  1 
ATOM   6979  O OH  . TYR E  1 117 ? 13.373  -58.264 108.311 1.00 24.41  ? 141 TYR E OH  1 
ATOM   6980  N N   . VAL E  1 118 ? 21.831  -59.764 106.195 1.00 27.22  ? 142 VAL E N   1 
ATOM   6981  C CA  . VAL E  1 118 ? 23.155  -59.359 105.772 1.00 29.26  ? 142 VAL E CA  1 
ATOM   6982  C C   . VAL E  1 118 ? 23.423  -59.231 104.220 1.00 28.67  ? 142 VAL E C   1 
ATOM   6983  O O   . VAL E  1 118 ? 24.286  -58.474 103.791 1.00 28.75  ? 142 VAL E O   1 
ATOM   6984  C CB  . VAL E  1 118 ? 24.176  -60.323 106.412 1.00 32.07  ? 142 VAL E CB  1 
ATOM   6985  C CG1 . VAL E  1 118 ? 24.147  -61.703 105.746 1.00 33.02  ? 142 VAL E CG1 1 
ATOM   6986  C CG2 . VAL E  1 118 ? 25.600  -59.731 106.397 1.00 34.39  ? 142 VAL E CG2 1 
ATOM   6987  N N   . ASN E  1 119 ? 22.716  -59.979 103.388 1.00 27.64  ? 143 ASN E N   1 
ATOM   6988  C CA  . ASN E  1 119 ? 22.947  -59.924 101.960 1.00 27.50  ? 143 ASN E CA  1 
ATOM   6989  C C   . ASN E  1 119 ? 22.041  -58.864 101.285 1.00 28.40  ? 143 ASN E C   1 
ATOM   6990  O O   . ASN E  1 119 ? 22.244  -58.551 100.056 1.00 29.29  ? 143 ASN E O   1 
ATOM   6991  C CB  . ASN E  1 119 ? 22.772  -61.314 101.325 1.00 26.98  ? 143 ASN E CB  1 
ATOM   6992  C CG  . ASN E  1 119 ? 23.881  -62.286 101.719 1.00 26.07  ? 143 ASN E CG  1 
ATOM   6993  O OD1 . ASN E  1 119 ? 24.991  -61.897 101.852 1.00 25.53  ? 143 ASN E OD1 1 
ATOM   6994  N ND2 . ASN E  1 119 ? 23.559  -63.544 101.891 1.00 25.97  ? 143 ASN E ND2 1 
ATOM   6995  N N   . TYR E  1 120 ? 21.106  -58.289 102.068 1.00 27.25  ? 144 TYR E N   1 
ATOM   6996  C CA  . TYR E  1 120 ? 20.152  -57.303 101.571 1.00 27.39  ? 144 TYR E CA  1 
ATOM   6997  C C   . TYR E  1 120 ? 20.903  -56.102 100.930 1.00 28.73  ? 144 TYR E C   1 
ATOM   6998  O O   . TYR E  1 120 ? 21.880  -55.545 101.493 1.00 29.74  ? 144 TYR E O   1 
ATOM   6999  C CB  . TYR E  1 120 ? 19.198  -56.817 102.684 1.00 26.73  ? 144 TYR E CB  1 
ATOM   7000  C CG  . TYR E  1 120 ? 17.998  -57.717 102.913 1.00 26.80  ? 144 TYR E CG  1 
ATOM   7001  C CD1 . TYR E  1 120 ? 18.147  -59.065 103.286 1.00 26.92  ? 144 TYR E CD1 1 
ATOM   7002  C CD2 . TYR E  1 120 ? 16.705  -57.240 102.711 1.00 26.48  ? 144 TYR E CD2 1 
ATOM   7003  C CE1 . TYR E  1 120 ? 17.040  -59.888 103.483 1.00 26.70  ? 144 TYR E CE1 1 
ATOM   7004  C CE2 . TYR E  1 120 ? 15.602  -58.067 102.865 1.00 26.91  ? 144 TYR E CE2 1 
ATOM   7005  C CZ  . TYR E  1 120 ? 15.765  -59.385 103.262 1.00 26.35  ? 144 TYR E CZ  1 
ATOM   7006  O OH  . TYR E  1 120 ? 14.654  -60.148 103.431 1.00 25.11  ? 144 TYR E OH  1 
ATOM   7007  N N   . SER E  1 121 ? 20.458  -55.706 99.752  1.00 28.99  ? 145 SER E N   1 
ATOM   7008  C CA  . SER E  1 121 ? 21.038  -54.582 99.045  1.00 29.23  ? 145 SER E CA  1 
ATOM   7009  C C   . SER E  1 121 ? 21.120  -53.352 99.963  1.00 31.37  ? 145 SER E C   1 
ATOM   7010  O O   . SER E  1 121 ? 22.155  -52.707 99.970  1.00 34.45  ? 145 SER E O   1 
ATOM   7011  C CB  . SER E  1 121 ? 20.247  -54.312 97.741  1.00 28.96  ? 145 SER E CB  1 
ATOM   7012  O OG  . SER E  1 121 ? 20.433  -55.405 96.799  1.00 28.52  ? 145 SER E OG  1 
ATOM   7013  N N   . SER E  1 122 ? 20.081  -53.078 100.783 1.00 32.24  ? 146 SER E N   1 
ATOM   7014  C CA  . SER E  1 122 ? 19.971  -51.896 101.693 1.00 31.39  ? 146 SER E CA  1 
ATOM   7015  C C   . SER E  1 122 ? 20.518  -52.136 103.106 1.00 31.97  ? 146 SER E C   1 
ATOM   7016  O O   . SER E  1 122 ? 20.222  -51.355 104.035 1.00 31.64  ? 146 SER E O   1 
ATOM   7017  C CB  . SER E  1 122 ? 18.482  -51.552 101.870 1.00 31.20  ? 146 SER E CB  1 
ATOM   7018  O OG  . SER E  1 122 ? 17.779  -52.655 102.455 1.00 29.42  ? 146 SER E OG  1 
ATOM   7019  N N   . ARG E  1 123 ? 21.282  -53.202 103.291 1.00 31.69  ? 147 ARG E N   1 
ATOM   7020  C CA  . ARG E  1 123 ? 21.796  -53.505 104.605 1.00 32.98  ? 147 ARG E CA  1 
ATOM   7021  C C   . ARG E  1 123 ? 22.809  -52.457 105.032 1.00 32.87  ? 147 ARG E C   1 
ATOM   7022  O O   . ARG E  1 123 ? 23.553  -51.994 104.218 1.00 33.71  ? 147 ARG E O   1 
ATOM   7023  C CB  . ARG E  1 123 ? 22.492  -54.876 104.596 1.00 34.10  ? 147 ARG E CB  1 
ATOM   7024  C CG  . ARG E  1 123 ? 23.044  -55.370 105.933 1.00 33.95  ? 147 ARG E CG  1 
ATOM   7025  C CD  . ARG E  1 123 ? 24.541  -55.191 106.049 1.00 34.39  ? 147 ARG E CD  1 
ATOM   7026  N NE  . ARG E  1 123 ? 25.265  -56.153 105.223 1.00 34.90  ? 147 ARG E NE  1 
ATOM   7027  C CZ  . ARG E  1 123 ? 26.513  -56.005 104.775 1.00 34.74  ? 147 ARG E CZ  1 
ATOM   7028  N NH1 . ARG E  1 123 ? 27.039  -56.939 104.005 1.00 35.07  ? 147 ARG E NH1 1 
ATOM   7029  N NH2 . ARG E  1 123 ? 27.239  -54.934 105.071 1.00 35.56  ? 147 ARG E NH2 1 
ATOM   7030  N N   . HIS E  1 124 ? 22.843  -52.123 106.309 1.00 32.41  ? 148 HIS E N   1 
ATOM   7031  C CA  . HIS E  1 124 ? 23.963  -51.409 106.919 1.00 32.35  ? 148 HIS E CA  1 
ATOM   7032  C C   . HIS E  1 124 ? 24.350  -52.232 108.131 1.00 31.62  ? 148 HIS E C   1 
ATOM   7033  O O   . HIS E  1 124 ? 23.471  -52.786 108.785 1.00 29.93  ? 148 HIS E O   1 
ATOM   7034  C CB  . HIS E  1 124 ? 23.524  -50.037 107.422 1.00 32.16  ? 148 HIS E CB  1 
ATOM   7035  C CG  . HIS E  1 124 ? 23.445  -49.012 106.362 1.00 31.88  ? 148 HIS E CG  1 
ATOM   7036  N ND1 . HIS E  1 124 ? 23.398  -47.665 106.650 1.00 32.43  ? 148 HIS E ND1 1 
ATOM   7037  C CD2 . HIS E  1 124 ? 23.432  -49.125 105.010 1.00 31.68  ? 148 HIS E CD2 1 
ATOM   7038  C CE1 . HIS E  1 124 ? 23.340  -46.991 105.509 1.00 34.08  ? 148 HIS E CE1 1 
ATOM   7039  N NE2 . HIS E  1 124 ? 23.368  -47.855 104.498 1.00 32.92  ? 148 HIS E NE2 1 
ATOM   7040  N N   . THR E  1 125 ? 25.648  -52.266 108.436 1.00 31.89  ? 149 THR E N   1 
ATOM   7041  C CA  . THR E  1 125 ? 26.196  -53.070 109.561 1.00 32.51  ? 149 THR E CA  1 
ATOM   7042  C C   . THR E  1 125 ? 25.921  -52.400 110.896 1.00 30.64  ? 149 THR E C   1 
ATOM   7043  O O   . THR E  1 125 ? 25.983  -51.203 110.992 1.00 29.57  ? 149 THR E O   1 
ATOM   7044  C CB  . THR E  1 125 ? 27.739  -53.270 109.427 1.00 33.30  ? 149 THR E CB  1 
ATOM   7045  O OG1 . THR E  1 125 ? 28.030  -53.945 108.200 1.00 35.41  ? 149 THR E OG1 1 
ATOM   7046  C CG2 . THR E  1 125 ? 28.285  -54.072 110.576 1.00 33.22  ? 149 THR E CG2 1 
ATOM   7047  N N   . ILE E  1 126 ? 25.557  -53.185 111.892 1.00 30.72  ? 150 ILE E N   1 
ATOM   7048  C CA  . ILE E  1 126 ? 25.319  -52.682 113.239 1.00 31.06  ? 150 ILE E CA  1 
ATOM   7049  C C   . ILE E  1 126 ? 26.401  -53.288 114.082 1.00 31.39  ? 150 ILE E C   1 
ATOM   7050  O O   . ILE E  1 126 ? 26.698  -54.466 113.969 1.00 29.66  ? 150 ILE E O   1 
ATOM   7051  C CB  . ILE E  1 126 ? 24.018  -53.153 113.880 1.00 30.59  ? 150 ILE E CB  1 
ATOM   7052  C CG1 . ILE E  1 126 ? 22.807  -52.793 113.050 1.00 31.07  ? 150 ILE E CG1 1 
ATOM   7053  C CG2 . ILE E  1 126 ? 23.881  -52.562 115.266 1.00 31.31  ? 150 ILE E CG2 1 
ATOM   7054  C CD1 . ILE E  1 126 ? 21.584  -53.649 113.389 1.00 31.55  ? 150 ILE E CD1 1 
ATOM   7055  N N   . THR E  1 127 ? 26.925  -52.478 114.985 1.00 31.88  ? 151 THR E N   1 
ATOM   7056  C CA  . THR E  1 127 ? 28.091  -52.815 115.739 1.00 31.77  ? 151 THR E CA  1 
ATOM   7057  C C   . THR E  1 127 ? 27.588  -52.818 117.190 1.00 32.63  ? 151 THR E C   1 
ATOM   7058  O O   . THR E  1 127 ? 26.843  -51.927 117.611 1.00 32.50  ? 151 THR E O   1 
ATOM   7059  C CB  . THR E  1 127 ? 29.168  -51.818 115.259 1.00 32.33  ? 151 THR E CB  1 
ATOM   7060  O OG1 . THR E  1 127 ? 30.172  -52.550 114.557 1.00 34.03  ? 151 THR E OG1 1 
ATOM   7061  C CG2 . THR E  1 127 ? 29.808  -51.123 116.281 1.00 33.00  ? 151 THR E CG2 1 
ATOM   7062  N N   . GLN E  1 128 ? 27.882  -53.883 117.922 1.00 33.43  ? 152 GLN E N   1 
ATOM   7063  C CA  . GLN E  1 128 ? 27.193  -54.154 119.184 1.00 32.94  ? 152 GLN E CA  1 
ATOM   7064  C C   . GLN E  1 128 ? 28.197  -54.355 120.312 1.00 34.35  ? 152 GLN E C   1 
ATOM   7065  O O   . GLN E  1 128 ? 29.289  -54.901 120.100 1.00 34.61  ? 152 GLN E O   1 
ATOM   7066  C CB  . GLN E  1 128 ? 26.323  -55.377 119.037 1.00 32.41  ? 152 GLN E CB  1 
ATOM   7067  C CG  . GLN E  1 128 ? 25.208  -55.232 117.989 1.00 32.99  ? 152 GLN E CG  1 
ATOM   7068  C CD  . GLN E  1 128 ? 24.397  -56.528 117.808 1.00 33.36  ? 152 GLN E CD  1 
ATOM   7069  O OE1 . GLN E  1 128 ? 24.272  -57.030 116.694 1.00 32.53  ? 152 GLN E OE1 1 
ATOM   7070  N NE2 . GLN E  1 128 ? 23.882  -57.096 118.916 1.00 33.15  ? 152 GLN E NE2 1 
ATOM   7071  N N   . PRO E  1 129 ? 27.862  -53.935 121.523 1.00 35.75  ? 153 PRO E N   1 
ATOM   7072  C CA  . PRO E  1 129 ? 26.539  -53.442 121.932 1.00 36.24  ? 153 PRO E CA  1 
ATOM   7073  C C   . PRO E  1 129 ? 26.584  -51.957 122.325 1.00 34.55  ? 153 PRO E C   1 
ATOM   7074  O O   . PRO E  1 129 ? 25.598  -51.417 122.894 1.00 30.33  ? 153 PRO E O   1 
ATOM   7075  C CB  . PRO E  1 129 ? 26.298  -54.266 123.198 1.00 37.43  ? 153 PRO E CB  1 
ATOM   7076  C CG  . PRO E  1 129 ? 27.686  -54.234 123.846 1.00 37.93  ? 153 PRO E CG  1 
ATOM   7077  C CD  . PRO E  1 129 ? 28.677  -54.294 122.696 1.00 36.67  ? 153 PRO E CD  1 
ATOM   7078  N N   . PHE E  1 130 ? 27.757  -51.342 122.108 1.00 33.81  ? 154 PHE E N   1 
ATOM   7079  C CA  . PHE E  1 130 ? 27.989  -50.040 122.703 1.00 34.72  ? 154 PHE E CA  1 
ATOM   7080  C C   . PHE E  1 130 ? 28.030  -48.963 121.677 1.00 32.58  ? 154 PHE E C   1 
ATOM   7081  O O   . PHE E  1 130 ? 28.417  -47.868 122.011 1.00 31.53  ? 154 PHE E O   1 
ATOM   7082  C CB  . PHE E  1 130 ? 29.185  -49.985 123.674 1.00 36.59  ? 154 PHE E CB  1 
ATOM   7083  C CG  . PHE E  1 130 ? 30.505  -50.445 123.089 1.00 39.98  ? 154 PHE E CG  1 
ATOM   7084  C CD1 . PHE E  1 130 ? 31.189  -49.696 122.112 1.00 42.52  ? 154 PHE E CD1 1 
ATOM   7085  C CD2 . PHE E  1 130 ? 31.112  -51.580 123.561 1.00 40.98  ? 154 PHE E CD2 1 
ATOM   7086  C CE1 . PHE E  1 130 ? 32.411  -50.113 121.606 1.00 41.47  ? 154 PHE E CE1 1 
ATOM   7087  C CE2 . PHE E  1 130 ? 32.350  -51.995 123.062 1.00 42.03  ? 154 PHE E CE2 1 
ATOM   7088  C CZ  . PHE E  1 130 ? 32.978  -51.271 122.059 1.00 41.84  ? 154 PHE E CZ  1 
ATOM   7089  N N   . SER E  1 131 ? 27.527  -49.241 120.472 1.00 32.13  ? 155 SER E N   1 
ATOM   7090  C CA  . SER E  1 131 ? 27.658  -48.313 119.349 1.00 31.50  ? 155 SER E CA  1 
ATOM   7091  C C   . SER E  1 131 ? 26.358  -47.777 118.840 1.00 30.89  ? 155 SER E C   1 
ATOM   7092  O O   . SER E  1 131 ? 25.290  -48.396 118.989 1.00 28.28  ? 155 SER E O   1 
ATOM   7093  C CB  . SER E  1 131 ? 28.451  -48.955 118.269 1.00 30.78  ? 155 SER E CB  1 
ATOM   7094  O OG  . SER E  1 131 ? 29.817  -48.868 118.674 1.00 32.21  ? 155 SER E OG  1 
ATOM   7095  N N   . TYR E  1 132 ? 26.460  -46.556 118.338 1.00 30.75  ? 156 TYR E N   1 
ATOM   7096  C CA  . TYR E  1 132 ? 25.292  -45.882 117.819 1.00 31.33  ? 156 TYR E CA  1 
ATOM   7097  C C   . TYR E  1 132 ? 24.993  -46.467 116.417 1.00 31.62  ? 156 TYR E C   1 
ATOM   7098  O O   . TYR E  1 132 ? 25.939  -46.755 115.702 1.00 32.51  ? 156 TYR E O   1 
ATOM   7099  C CB  . TYR E  1 132 ? 25.610  -44.409 117.740 1.00 30.42  ? 156 TYR E CB  1 
ATOM   7100  C CG  . TYR E  1 132 ? 24.684  -43.520 116.906 1.00 30.31  ? 156 TYR E CG  1 
ATOM   7101  C CD1 . TYR E  1 132 ? 23.511  -43.001 117.455 1.00 31.15  ? 156 TYR E CD1 1 
ATOM   7102  C CD2 . TYR E  1 132 ? 25.030  -43.134 115.605 1.00 29.53  ? 156 TYR E CD2 1 
ATOM   7103  C CE1 . TYR E  1 132 ? 22.681  -42.124 116.724 1.00 32.22  ? 156 TYR E CE1 1 
ATOM   7104  C CE2 . TYR E  1 132 ? 24.244  -42.268 114.867 1.00 30.26  ? 156 TYR E CE2 1 
ATOM   7105  C CZ  . TYR E  1 132 ? 23.053  -41.761 115.414 1.00 31.29  ? 156 TYR E CZ  1 
ATOM   7106  O OH  . TYR E  1 132 ? 22.244  -40.911 114.700 1.00 30.15  ? 156 TYR E OH  1 
ATOM   7107  N N   . HIS E  1 133 ? 23.724  -46.646 116.038 1.00 30.38  ? 157 HIS E N   1 
ATOM   7108  C CA  . HIS E  1 133 ? 23.397  -46.966 114.650 1.00 31.19  ? 157 HIS E CA  1 
ATOM   7109  C C   . HIS E  1 133 ? 22.280  -46.060 114.159 1.00 32.81  ? 157 HIS E C   1 
ATOM   7110  O O   . HIS E  1 133 ? 21.342  -45.743 114.893 1.00 35.63  ? 157 HIS E O   1 
ATOM   7111  C CB  . HIS E  1 133 ? 22.965  -48.438 114.559 1.00 30.94  ? 157 HIS E CB  1 
ATOM   7112  C CG  . HIS E  1 133 ? 22.773  -48.954 113.160 1.00 30.24  ? 157 HIS E CG  1 
ATOM   7113  N ND1 . HIS E  1 133 ? 23.821  -49.156 112.278 1.00 29.85  ? 157 HIS E ND1 1 
ATOM   7114  C CD2 . HIS E  1 133 ? 21.645  -49.329 112.501 1.00 29.43  ? 157 HIS E CD2 1 
ATOM   7115  C CE1 . HIS E  1 133 ? 23.331  -49.604 111.130 1.00 29.51  ? 157 HIS E CE1 1 
ATOM   7116  N NE2 . HIS E  1 133 ? 22.016  -49.724 111.238 1.00 28.20  ? 157 HIS E NE2 1 
ATOM   7117  N N   . SER E  1 134 ? 22.351  -45.589 112.927 1.00 33.00  ? 158 SER E N   1 
ATOM   7118  C CA  . SER E  1 134 ? 21.174  -44.922 112.400 1.00 31.71  ? 158 SER E CA  1 
ATOM   7119  C C   . SER E  1 134 ? 20.998  -45.216 110.968 1.00 31.27  ? 158 SER E C   1 
ATOM   7120  O O   . SER E  1 134 ? 21.931  -45.670 110.285 1.00 28.96  ? 158 SER E O   1 
ATOM   7121  C CB  . SER E  1 134 ? 21.231  -43.419 112.575 1.00 33.60  ? 158 SER E CB  1 
ATOM   7122  O OG  . SER E  1 134 ? 21.975  -42.744 111.540 1.00 33.41  ? 158 SER E OG  1 
ATOM   7123  N N   . ARG E  1 135 ? 19.767  -44.962 110.544 1.00 31.91  ? 159 ARG E N   1 
ATOM   7124  C CA  . ARG E  1 135 ? 19.313  -45.178 109.170 1.00 32.29  ? 159 ARG E CA  1 
ATOM   7125  C C   . ARG E  1 135 ? 18.396  -44.020 108.833 1.00 33.02  ? 159 ARG E C   1 
ATOM   7126  O O   . ARG E  1 135 ? 17.589  -43.573 109.677 1.00 33.37  ? 159 ARG E O   1 
ATOM   7127  C CB  . ARG E  1 135 ? 18.539  -46.503 109.027 1.00 30.74  ? 159 ARG E CB  1 
ATOM   7128  C CG  . ARG E  1 135 ? 19.364  -47.759 109.252 1.00 30.19  ? 159 ARG E CG  1 
ATOM   7129  C CD  . ARG E  1 135 ? 20.614  -47.874 108.389 1.00 29.85  ? 159 ARG E CD  1 
ATOM   7130  N NE  . ARG E  1 135 ? 20.361  -47.803 106.961 1.00 29.53  ? 159 ARG E NE  1 
ATOM   7131  C CZ  . ARG E  1 135 ? 20.169  -48.824 106.147 1.00 30.38  ? 159 ARG E CZ  1 
ATOM   7132  N NH1 . ARG E  1 135 ? 19.967  -48.619 104.861 1.00 32.17  ? 159 ARG E NH1 1 
ATOM   7133  N NH2 . ARG E  1 135 ? 20.164  -50.052 106.573 1.00 31.76  ? 159 ARG E NH2 1 
ATOM   7134  N N   . TYR E  1 136 ? 18.500  -43.569 107.588 1.00 33.00  ? 160 TYR E N   1 
ATOM   7135  C CA  . TYR E  1 136 ? 17.747  -42.389 107.120 1.00 33.02  ? 160 TYR E CA  1 
ATOM   7136  C C   . TYR E  1 136 ? 17.255  -42.676 105.723 1.00 31.45  ? 160 TYR E C   1 
ATOM   7137  O O   . TYR E  1 136 ? 18.049  -42.874 104.852 1.00 30.23  ? 160 TYR E O   1 
ATOM   7138  C CB  . TYR E  1 136 ? 18.650  -41.181 107.155 1.00 33.02  ? 160 TYR E CB  1 
ATOM   7139  C CG  . TYR E  1 136 ? 18.063  -39.876 106.745 1.00 33.62  ? 160 TYR E CG  1 
ATOM   7140  C CD1 . TYR E  1 136 ? 17.174  -39.195 107.564 1.00 34.45  ? 160 TYR E CD1 1 
ATOM   7141  C CD2 . TYR E  1 136 ? 18.459  -39.256 105.553 1.00 33.00  ? 160 TYR E CD2 1 
ATOM   7142  C CE1 . TYR E  1 136 ? 16.686  -37.931 107.170 1.00 34.04  ? 160 TYR E CE1 1 
ATOM   7143  C CE2 . TYR E  1 136 ? 17.930  -38.052 105.158 1.00 31.06  ? 160 TYR E CE2 1 
ATOM   7144  C CZ  . TYR E  1 136 ? 17.099  -37.399 105.981 1.00 31.01  ? 160 TYR E CZ  1 
ATOM   7145  O OH  . TYR E  1 136 ? 16.590  -36.249 105.592 1.00 30.25  ? 160 TYR E OH  1 
ATOM   7146  N N   . PHE E  1 137 ? 15.942  -42.747 105.539 1.00 31.57  ? 161 PHE E N   1 
ATOM   7147  C CA  . PHE E  1 137 ? 15.373  -43.225 104.285 1.00 31.68  ? 161 PHE E CA  1 
ATOM   7148  C C   . PHE E  1 137 ? 13.921  -42.827 104.168 1.00 31.81  ? 161 PHE E C   1 
ATOM   7149  O O   . PHE E  1 137 ? 13.230  -42.596 105.179 1.00 32.69  ? 161 PHE E O   1 
ATOM   7150  C CB  . PHE E  1 137 ? 15.511  -44.749 104.208 1.00 32.07  ? 161 PHE E CB  1 
ATOM   7151  C CG  . PHE E  1 137 ? 14.659  -45.504 105.208 1.00 31.51  ? 161 PHE E CG  1 
ATOM   7152  C CD1 . PHE E  1 137 ? 15.092  -45.678 106.482 1.00 30.38  ? 161 PHE E CD1 1 
ATOM   7153  C CD2 . PHE E  1 137 ? 13.390  -45.993 104.851 1.00 31.93  ? 161 PHE E CD2 1 
ATOM   7154  C CE1 . PHE E  1 137 ? 14.296  -46.345 107.417 1.00 31.90  ? 161 PHE E CE1 1 
ATOM   7155  C CE2 . PHE E  1 137 ? 12.596  -46.662 105.780 1.00 32.86  ? 161 PHE E CE2 1 
ATOM   7156  C CZ  . PHE E  1 137 ? 13.052  -46.831 107.088 1.00 32.22  ? 161 PHE E CZ  1 
ATOM   7157  N N   . THR E  1 138 ? 13.449  -42.782 102.935 1.00 32.05  ? 162 THR E N   1 
ATOM   7158  C CA  . THR E  1 138 ? 12.020  -42.496 102.670 1.00 31.21  ? 162 THR E CA  1 
ATOM   7159  C C   . THR E  1 138 ? 11.149  -43.721 102.898 1.00 29.39  ? 162 THR E C   1 
ATOM   7160  O O   . THR E  1 138 ? 11.229  -44.680 102.156 1.00 29.99  ? 162 THR E O   1 
ATOM   7161  C CB  . THR E  1 138 ? 11.826  -42.072 101.209 1.00 30.80  ? 162 THR E CB  1 
ATOM   7162  O OG1 . THR E  1 138 ? 12.747  -41.024 100.901 1.00 28.18  ? 162 THR E OG1 1 
ATOM   7163  C CG2 . THR E  1 138 ? 10.366  -41.648 100.990 1.00 31.56  ? 162 THR E CG2 1 
ATOM   7164  N N   . PRO E  1 139 ? 10.313  -43.705 103.917 1.00 28.78  ? 163 PRO E N   1 
ATOM   7165  C CA  . PRO E  1 139 ? 9.488   -44.906 104.118 1.00 28.53  ? 163 PRO E CA  1 
ATOM   7166  C C   . PRO E  1 139 ? 8.363   -44.885 103.078 1.00 27.78  ? 163 PRO E C   1 
ATOM   7167  O O   . PRO E  1 139 ? 8.349   -43.971 102.265 1.00 28.11  ? 163 PRO E O   1 
ATOM   7168  C CB  . PRO E  1 139 ? 8.954   -44.702 105.541 1.00 27.99  ? 163 PRO E CB  1 
ATOM   7169  C CG  . PRO E  1 139 ? 8.669   -43.240 105.546 1.00 28.08  ? 163 PRO E CG  1 
ATOM   7170  C CD  . PRO E  1 139 ? 9.837   -42.599 104.759 1.00 28.53  ? 163 PRO E CD  1 
ATOM   7171  N N   . LYS E  1 140 ? 7.462   -45.874 103.119 1.00 27.09  ? 164 LYS E N   1 
ATOM   7172  C CA  . LYS E  1 140 ? 6.268   -45.965 102.278 1.00 26.91  ? 164 LYS E CA  1 
ATOM   7173  C C   . LYS E  1 140 ? 5.006   -46.368 103.065 1.00 27.85  ? 164 LYS E C   1 
ATOM   7174  O O   . LYS E  1 140 ? 5.082   -47.229 103.986 1.00 29.52  ? 164 LYS E O   1 
ATOM   7175  C CB  . LYS E  1 140 ? 6.485   -47.050 101.221 1.00 27.16  ? 164 LYS E CB  1 
ATOM   7176  C CG  . LYS E  1 140 ? 7.735   -46.930 100.361 1.00 27.53  ? 164 LYS E CG  1 
ATOM   7177  C CD  . LYS E  1 140 ? 7.733   -45.630 99.496  1.00 27.23  ? 164 LYS E CD  1 
ATOM   7178  C CE  . LYS E  1 140 ? 9.157   -45.265 99.175  1.00 27.08  ? 164 LYS E CE  1 
ATOM   7179  N NZ  . LYS E  1 140 ? 9.313   -44.141 98.246  1.00 27.30  ? 164 LYS E NZ  1 
ATOM   7180  N N   . PRO E  1 141 ? 3.824   -45.818 102.685 1.00 27.97  ? 165 PRO E N   1 
ATOM   7181  C CA  . PRO E  1 141 ? 2.612   -46.300 103.313 1.00 28.50  ? 165 PRO E CA  1 
ATOM   7182  C C   . PRO E  1 141 ? 2.239   -47.722 102.857 1.00 30.17  ? 165 PRO E C   1 
ATOM   7183  O O   . PRO E  1 141 ? 2.569   -48.160 101.742 1.00 30.82  ? 165 PRO E O   1 
ATOM   7184  C CB  . PRO E  1 141 ? 1.561   -45.291 102.860 1.00 28.29  ? 165 PRO E CB  1 
ATOM   7185  C CG  . PRO E  1 141 ? 2.042   -44.722 101.580 1.00 27.80  ? 165 PRO E CG  1 
ATOM   7186  C CD  . PRO E  1 141 ? 3.539   -44.786 101.666 1.00 27.98  ? 165 PRO E CD  1 
ATOM   7187  N N   . VAL E  1 142 ? 1.580   -48.447 103.742 1.00 31.19  ? 166 VAL E N   1 
ATOM   7188  C CA  . VAL E  1 142 ? 1.059   -49.744 103.406 1.00 32.62  ? 166 VAL E CA  1 
ATOM   7189  C C   . VAL E  1 142 ? -0.330  -49.407 102.891 1.00 36.16  ? 166 VAL E C   1 
ATOM   7190  O O   . VAL E  1 142 ? -1.264  -49.143 103.673 1.00 39.56  ? 166 VAL E O   1 
ATOM   7191  C CB  . VAL E  1 142 ? 1.011   -50.655 104.647 1.00 30.64  ? 166 VAL E CB  1 
ATOM   7192  C CG1 . VAL E  1 142 ? 0.500   -52.017 104.313 1.00 29.23  ? 166 VAL E CG1 1 
ATOM   7193  C CG2 . VAL E  1 142 ? 2.399   -50.788 105.203 1.00 31.45  ? 166 VAL E CG2 1 
ATOM   7194  N N   . LEU E  1 143 ? -0.472  -49.369 101.577 1.00 38.01  ? 167 LEU E N   1 
ATOM   7195  C CA  . LEU E  1 143 ? -1.762  -49.008 100.956 1.00 38.59  ? 167 LEU E CA  1 
ATOM   7196  C C   . LEU E  1 143 ? -2.619  -50.232 100.661 1.00 39.13  ? 167 LEU E C   1 
ATOM   7197  O O   . LEU E  1 143 ? -3.817  -50.118 100.655 1.00 38.61  ? 167 LEU E O   1 
ATOM   7198  C CB  . LEU E  1 143 ? -1.506  -48.260 99.645  1.00 39.15  ? 167 LEU E CB  1 
ATOM   7199  C CG  . LEU E  1 143 ? -1.458  -46.747 99.614  1.00 40.71  ? 167 LEU E CG  1 
ATOM   7200  C CD1 . LEU E  1 143 ? -1.293  -46.108 100.986 1.00 42.22  ? 167 LEU E CD1 1 
ATOM   7201  C CD2 . LEU E  1 143 ? -0.393  -46.245 98.639  1.00 41.33  ? 167 LEU E CD2 1 
ATOM   7202  N N   . ASP E  1 144 ? -2.007  -51.369 100.355 1.00 40.07  ? 168 ASP E N   1 
ATOM   7203  C CA  . ASP E  1 144 ? -2.718  -52.584 100.100 1.00 43.67  ? 168 ASP E CA  1 
ATOM   7204  C C   . ASP E  1 144 ? -1.851  -53.713 100.657 1.00 46.10  ? 168 ASP E C   1 
ATOM   7205  O O   . ASP E  1 144 ? -0.752  -53.897 100.179 1.00 52.58  ? 168 ASP E O   1 
ATOM   7206  C CB  . ASP E  1 144 ? -2.914  -52.689 98.592  1.00 44.74  ? 168 ASP E CB  1 
ATOM   7207  C CG  . ASP E  1 144 ? -3.821  -53.866 98.179  1.00 47.16  ? 168 ASP E CG  1 
ATOM   7208  O OD1 . ASP E  1 144 ? -3.531  -55.013 98.564  1.00 46.15  ? 168 ASP E OD1 1 
ATOM   7209  O OD2 . ASP E  1 144 ? -4.817  -53.634 97.445  1.00 51.56  ? 168 ASP E OD2 1 
ATOM   7210  N N   . SER E  1 145 ? -2.275  -54.458 101.664 1.00 46.30  ? 169 SER E N   1 
ATOM   7211  C CA  . SER E  1 145 ? -1.312  -55.392 102.271 1.00 50.20  ? 169 SER E CA  1 
ATOM   7212  C C   . SER E  1 145 ? -1.246  -56.739 101.578 1.00 50.12  ? 169 SER E C   1 
ATOM   7213  O O   . SER E  1 145 ? -0.346  -57.495 101.846 1.00 55.74  ? 169 SER E O   1 
ATOM   7214  C CB  . SER E  1 145 ? -1.495  -55.549 103.788 1.00 52.72  ? 169 SER E CB  1 
ATOM   7215  O OG  . SER E  1 145 ? -2.801  -55.134 104.145 1.00 56.27  ? 169 SER E OG  1 
ATOM   7216  N N   . THR E  1 146 ? -2.172  -57.029 100.677 1.00 48.15  ? 170 THR E N   1 
ATOM   7217  C CA  . THR E  1 146 ? -2.088  -58.209 99.794  1.00 43.23  ? 170 THR E CA  1 
ATOM   7218  C C   . THR E  1 146 ? -1.088  -57.983 98.666  1.00 41.87  ? 170 THR E C   1 
ATOM   7219  O O   . THR E  1 146 ? -0.372  -58.878 98.348  1.00 43.10  ? 170 THR E O   1 
ATOM   7220  C CB  . THR E  1 146 ? -3.456  -58.488 99.165  1.00 41.33  ? 170 THR E CB  1 
ATOM   7221  O OG1 . THR E  1 146 ? -4.385  -58.656 100.223 1.00 41.13  ? 170 THR E OG1 1 
ATOM   7222  C CG2 . THR E  1 146 ? -3.450  -59.702 98.240  1.00 41.26  ? 170 THR E CG2 1 
ATOM   7223  N N   . ILE E  1 147 ? -1.069  -56.809 98.049  1.00 39.10  ? 171 ILE E N   1 
ATOM   7224  C CA  . ILE E  1 147 ? -0.237  -56.572 96.905  1.00 39.56  ? 171 ILE E CA  1 
ATOM   7225  C C   . ILE E  1 147 ? 1.101   -55.923 97.232  1.00 39.48  ? 171 ILE E C   1 
ATOM   7226  O O   . ILE E  1 147 ? 2.109   -56.201 96.569  1.00 39.54  ? 171 ILE E O   1 
ATOM   7227  C CB  . ILE E  1 147 ? -0.952  -55.718 95.874  1.00 40.79  ? 171 ILE E CB  1 
ATOM   7228  C CG1 . ILE E  1 147 ? -2.247  -56.411 95.429  1.00 40.20  ? 171 ILE E CG1 1 
ATOM   7229  C CG2 . ILE E  1 147 ? -0.033  -55.495 94.662  1.00 41.99  ? 171 ILE E CG2 1 
ATOM   7230  C CD1 . ILE E  1 147 ? -3.231  -55.489 94.741  1.00 40.13  ? 171 ILE E CD1 1 
ATOM   7231  N N   . ASP E  1 148 ? 1.087   -55.055 98.220  1.00 40.32  ? 172 ASP E N   1 
ATOM   7232  C CA  . ASP E  1 148 ? 2.295   -54.457 98.800  1.00 43.57  ? 172 ASP E CA  1 
ATOM   7233  C C   . ASP E  1 148 ? 3.042   -53.664 97.760  1.00 42.01  ? 172 ASP E C   1 
ATOM   7234  O O   . ASP E  1 148 ? 4.209   -53.905 97.511  1.00 44.18  ? 172 ASP E O   1 
ATOM   7235  C CB  . ASP E  1 148 ? 3.240   -55.506 99.467  1.00 46.10  ? 172 ASP E CB  1 
ATOM   7236  C CG  . ASP E  1 148 ? 2.872   -55.846 100.937 1.00 49.12  ? 172 ASP E CG  1 
ATOM   7237  O OD1 . ASP E  1 148 ? 2.327   -54.996 101.727 1.00 53.45  ? 172 ASP E OD1 1 
ATOM   7238  O OD2 . ASP E  1 148 ? 3.207   -56.996 101.317 1.00 47.43  ? 172 ASP E OD2 1 
ATOM   7239  N N   . TYR E  1 149 ? 2.355   -52.720 97.149  1.00 40.08  ? 173 TYR E N   1 
ATOM   7240  C CA  . TYR E  1 149 ? 2.981   -51.823 96.195  1.00 37.47  ? 173 TYR E CA  1 
ATOM   7241  C C   . TYR E  1 149 ? 3.403   -50.492 96.806  1.00 35.68  ? 173 TYR E C   1 
ATOM   7242  O O   . TYR E  1 149 ? 2.849   -50.018 97.782  1.00 34.30  ? 173 TYR E O   1 
ATOM   7243  C CB  . TYR E  1 149 ? 2.074   -51.601 95.015  1.00 37.14  ? 173 TYR E CB  1 
ATOM   7244  C CG  . TYR E  1 149 ? 0.793   -50.891 95.282  1.00 38.03  ? 173 TYR E CG  1 
ATOM   7245  C CD1 . TYR E  1 149 ? 0.737   -49.523 95.236  1.00 38.67  ? 173 TYR E CD1 1 
ATOM   7246  C CD2 . TYR E  1 149 ? -0.404  -51.590 95.544  1.00 40.03  ? 173 TYR E CD2 1 
ATOM   7247  C CE1 . TYR E  1 149 ? -0.447  -48.846 95.451  1.00 39.89  ? 173 TYR E CE1 1 
ATOM   7248  C CE2 . TYR E  1 149 ? -1.606  -50.909 95.777  1.00 39.72  ? 173 TYR E CE2 1 
ATOM   7249  C CZ  . TYR E  1 149 ? -1.608  -49.532 95.720  1.00 41.55  ? 173 TYR E CZ  1 
ATOM   7250  O OH  . TYR E  1 149 ? -2.749  -48.752 95.930  1.00 47.76  ? 173 TYR E OH  1 
ATOM   7251  N N   . PHE E  1 150 ? 4.417   -49.893 96.222  1.00 35.03  ? 174 PHE E N   1 
ATOM   7252  C CA  . PHE E  1 150 ? 4.830   -48.570 96.652  1.00 33.66  ? 174 PHE E CA  1 
ATOM   7253  C C   . PHE E  1 150 ? 5.443   -47.784 95.522  1.00 33.05  ? 174 PHE E C   1 
ATOM   7254  O O   . PHE E  1 150 ? 5.883   -48.356 94.476  1.00 33.17  ? 174 PHE E O   1 
ATOM   7255  C CB  . PHE E  1 150 ? 5.820   -48.696 97.785  1.00 33.79  ? 174 PHE E CB  1 
ATOM   7256  C CG  . PHE E  1 150 ? 7.088   -49.460 97.432  1.00 34.41  ? 174 PHE E CG  1 
ATOM   7257  C CD1 . PHE E  1 150 ? 8.234   -48.794 97.009  1.00 34.47  ? 174 PHE E CD1 1 
ATOM   7258  C CD2 . PHE E  1 150 ? 7.159   -50.821 97.584  1.00 34.81  ? 174 PHE E CD2 1 
ATOM   7259  C CE1 . PHE E  1 150 ? 9.398   -49.470 96.698  1.00 34.79  ? 174 PHE E CE1 1 
ATOM   7260  C CE2 . PHE E  1 150 ? 8.330   -51.504 97.288  1.00 35.12  ? 174 PHE E CE2 1 
ATOM   7261  C CZ  . PHE E  1 150 ? 9.452   -50.832 96.843  1.00 35.09  ? 174 PHE E CZ  1 
ATOM   7262  N N   . GLN E  1 151 ? 5.498   -46.484 95.757  1.00 31.90  ? 175 GLN E N   1 
ATOM   7263  C CA  . GLN E  1 151 ? 6.017   -45.548 94.780  1.00 32.38  ? 175 GLN E CA  1 
ATOM   7264  C C   . GLN E  1 151 ? 7.541   -45.492 94.832  1.00 32.48  ? 175 GLN E C   1 
ATOM   7265  O O   . GLN E  1 151 ? 8.116   -45.537 95.907  1.00 30.04  ? 175 GLN E O   1 
ATOM   7266  C CB  . GLN E  1 151 ? 5.528   -44.144 95.042  1.00 32.62  ? 175 GLN E CB  1 
ATOM   7267  C CG  . GLN E  1 151 ? 4.057   -43.855 94.889  1.00 34.31  ? 175 GLN E CG  1 
ATOM   7268  C CD  . GLN E  1 151 ? 3.814   -42.399 95.210  1.00 36.14  ? 175 GLN E CD  1 
ATOM   7269  O OE1 . GLN E  1 151 ? 4.109   -41.929 96.304  1.00 41.11  ? 175 GLN E OE1 1 
ATOM   7270  N NE2 . GLN E  1 151 ? 3.319   -41.679 94.271  1.00 36.06  ? 175 GLN E NE2 1 
ATOM   7271  N N   . PRO E  1 152 ? 8.200   -45.366 93.664  1.00 35.41  ? 176 PRO E N   1 
ATOM   7272  C CA  . PRO E  1 152 ? 9.628   -45.080 93.633  1.00 38.14  ? 176 PRO E CA  1 
ATOM   7273  C C   . PRO E  1 152 ? 9.907   -43.779 94.272  1.00 42.60  ? 176 PRO E C   1 
ATOM   7274  O O   . PRO E  1 152 ? 9.105   -42.861 94.263  1.00 37.20  ? 176 PRO E O   1 
ATOM   7275  C CB  . PRO E  1 152 ? 9.984   -44.966 92.180  1.00 36.30  ? 176 PRO E CB  1 
ATOM   7276  C CG  . PRO E  1 152 ? 8.905   -45.653 91.498  1.00 37.59  ? 176 PRO E CG  1 
ATOM   7277  C CD  . PRO E  1 152 ? 7.704   -45.780 92.360  1.00 35.80  ? 176 PRO E CD  1 
ATOM   7278  N N   . ASN E  1 153 ? 11.136  -43.731 94.759  1.00 55.98  ? 177 ASN E N   1 
ATOM   7279  C CA  . ASN E  1 153 ? 11.520  -42.857 95.879  1.00 61.00  ? 177 ASN E CA  1 
ATOM   7280  C C   . ASN E  1 153 ? 11.544  -41.434 95.146  1.00 68.43  ? 177 ASN E C   1 
ATOM   7281  O O   . ASN E  1 153 ? 12.330  -41.182 94.227  1.00 63.50  ? 177 ASN E O   1 
ATOM   7282  C CB  . ASN E  1 153 ? 12.797  -43.417 96.725  1.00 52.67  ? 177 ASN E CB  1 
ATOM   7283  C CG  . ASN E  1 153 ? 12.927  -45.040 96.849  1.00 47.60  ? 177 ASN E CG  1 
ATOM   7284  O OD1 . ASN E  1 153 ? 14.013  -45.520 97.024  1.00 43.45  ? 177 ASN E OD1 1 
ATOM   7285  N ND2 . ASN E  1 153 ? 11.862  -45.818 96.757  1.00 42.37  ? 177 ASN E ND2 1 
ATOM   7286  N N   . ASN E  1 154 ? 10.532  -40.604 95.431  1.00 83.79  ? 178 ASN E N   1 
ATOM   7287  C CA  . ASN E  1 154 ? 10.308  -39.335 94.670  1.00 95.79  ? 178 ASN E CA  1 
ATOM   7288  C C   . ASN E  1 154 ? 9.957   -38.158 95.605  1.00 103.69 ? 178 ASN E C   1 
ATOM   7289  O O   . ASN E  1 154 ? 9.844   -38.322 96.863  1.00 103.91 ? 178 ASN E O   1 
ATOM   7290  C CB  . ASN E  1 154 ? 9.233   -39.500 93.553  1.00 93.49  ? 178 ASN E CB  1 
ATOM   7291  C CG  . ASN E  1 154 ? 9.433   -38.534 92.383  1.00 86.64  ? 178 ASN E CG  1 
ATOM   7292  O OD1 . ASN E  1 154 ? 9.385   -37.328 92.564  1.00 82.18  ? 178 ASN E OD1 1 
ATOM   7293  N ND2 . ASN E  1 154 ? 9.658   -39.066 91.188  1.00 76.58  ? 178 ASN E ND2 1 
ATOM   7294  N N   . LYS E  1 155 ? 9.868   -36.978 94.972  1.00 96.67  ? 179 LYS E N   1 
ATOM   7295  C CA  . LYS E  1 155 ? 9.442   -35.752 95.611  1.00 93.29  ? 179 LYS E CA  1 
ATOM   7296  C C   . LYS E  1 155 ? 8.142   -35.164 94.977  1.00 80.18  ? 179 LYS E C   1 
ATOM   7297  O O   . LYS E  1 155 ? 7.069   -35.330 95.521  1.00 67.87  ? 179 LYS E O   1 
ATOM   7298  C CB  . LYS E  1 155 ? 10.620  -34.743 95.656  1.00 102.89 ? 179 LYS E CB  1 
ATOM   7299  C CG  . LYS E  1 155 ? 11.664  -35.001 96.758  1.00 108.54 ? 179 LYS E CG  1 
ATOM   7300  C CD  . LYS E  1 155 ? 13.121  -35.152 96.257  1.00 116.59 ? 179 LYS E CD  1 
ATOM   7301  C CE  . LYS E  1 155 ? 13.461  -36.526 95.634  1.00 115.48 ? 179 LYS E CE  1 
ATOM   7302  N NZ  . LYS E  1 155 ? 13.692  -36.471 94.150  1.00 110.80 ? 179 LYS E NZ  1 
ATOM   7303  N N   . ARG E  1 156 ? 8.219   -34.481 93.846  1.00 78.57  ? 180 ARG E N   1 
ATOM   7304  C CA  . ARG E  1 156 ? 7.022   -33.824 93.297  1.00 78.97  ? 180 ARG E CA  1 
ATOM   7305  C C   . ARG E  1 156 ? 5.777   -34.737 93.139  1.00 71.00  ? 180 ARG E C   1 
ATOM   7306  O O   . ARG E  1 156 ? 4.692   -34.221 93.301  1.00 70.92  ? 180 ARG E O   1 
ATOM   7307  C CB  . ARG E  1 156 ? 7.315   -32.994 91.987  1.00 90.08  ? 180 ARG E CB  1 
ATOM   7308  C CG  . ARG E  1 156 ? 8.004   -33.699 90.792  1.00 98.11  ? 180 ARG E CG  1 
ATOM   7309  C CD  . ARG E  1 156 ? 7.520   -33.281 89.370  1.00 105.42 ? 180 ARG E CD  1 
ATOM   7310  N NE  . ARG E  1 156 ? 7.256   -34.465 88.471  1.00 113.35 ? 180 ARG E NE  1 
ATOM   7311  C CZ  . ARG E  1 156 ? 7.910   -34.832 87.338  1.00 104.76 ? 180 ARG E CZ  1 
ATOM   7312  N NH1 . ARG E  1 156 ? 7.553   -35.956 86.682  1.00 88.07  ? 180 ARG E NH1 1 
ATOM   7313  N NH2 . ARG E  1 156 ? 8.914   -34.101 86.843  1.00 108.63 ? 180 ARG E NH2 1 
ATOM   7314  N N   . ASN E  1 157 ? 5.930   -36.060 92.883  1.00 64.08  ? 181 ASN E N   1 
ATOM   7315  C CA  . ASN E  1 157 ? 4.788   -37.062 92.712  1.00 55.03  ? 181 ASN E CA  1 
ATOM   7316  C C   . ASN E  1 157 ? 4.363   -38.008 93.871  1.00 46.30  ? 181 ASN E C   1 
ATOM   7317  O O   . ASN E  1 157 ? 3.581   -38.927 93.642  1.00 40.99  ? 181 ASN E O   1 
ATOM   7318  C CB  . ASN E  1 157 ? 5.100   -37.992 91.561  1.00 59.03  ? 181 ASN E CB  1 
ATOM   7319  C CG  . ASN E  1 157 ? 5.514   -37.243 90.317  1.00 68.72  ? 181 ASN E CG  1 
ATOM   7320  O OD1 . ASN E  1 157 ? 4.719   -36.500 89.717  1.00 71.14  ? 181 ASN E OD1 1 
ATOM   7321  N ND2 . ASN E  1 157 ? 6.779   -37.421 89.922  1.00 75.80  ? 181 ASN E ND2 1 
ATOM   7322  N N   . GLN E  1 158 ? 4.864   -37.789 95.088  1.00 40.99  ? 182 GLN E N   1 
ATOM   7323  C CA  . GLN E  1 158 ? 4.611   -38.651 96.222  1.00 38.56  ? 182 GLN E CA  1 
ATOM   7324  C C   . GLN E  1 158 ? 3.177   -38.467 96.712  1.00 37.06  ? 182 GLN E C   1 
ATOM   7325  O O   . GLN E  1 158 ? 2.724   -37.327 96.942  1.00 35.45  ? 182 GLN E O   1 
ATOM   7326  C CB  . GLN E  1 158 ? 5.562   -38.331 97.370  1.00 38.79  ? 182 GLN E CB  1 
ATOM   7327  C CG  . GLN E  1 158 ? 5.246   -39.075 98.681  1.00 39.53  ? 182 GLN E CG  1 
ATOM   7328  C CD  . GLN E  1 158 ? 6.307   -38.889 99.752  1.00 39.51  ? 182 GLN E CD  1 
ATOM   7329  O OE1 . GLN E  1 158 ? 7.122   -37.990 99.679  1.00 39.62  ? 182 GLN E OE1 1 
ATOM   7330  N NE2 . GLN E  1 158 ? 6.273   -39.740 100.763 1.00 40.90  ? 182 GLN E NE2 1 
ATOM   7331  N N   . LEU E  1 159 ? 2.486   -39.580 96.924  1.00 33.72  ? 183 LEU E N   1 
ATOM   7332  C CA  . LEU E  1 159 ? 1.103   -39.507 97.312  1.00 33.29  ? 183 LEU E CA  1 
ATOM   7333  C C   . LEU E  1 159 ? 0.885   -38.620 98.614  1.00 34.08  ? 183 LEU E C   1 
ATOM   7334  O O   . LEU E  1 159 ? 1.751   -38.588 99.560  1.00 33.87  ? 183 LEU E O   1 
ATOM   7335  C CB  . LEU E  1 159 ? 0.570   -40.916 97.501  1.00 33.04  ? 183 LEU E CB  1 
ATOM   7336  C CG  . LEU E  1 159 ? -0.186  -41.693 96.422  1.00 33.48  ? 183 LEU E CG  1 
ATOM   7337  C CD1 . LEU E  1 159 ? -0.204  -41.116 95.025  1.00 33.88  ? 183 LEU E CD1 1 
ATOM   7338  C CD2 . LEU E  1 159 ? 0.358   -43.108 96.370  1.00 34.76  ? 183 LEU E CD2 1 
ATOM   7339  N N   . TRP E  1 160 ? -0.212  -37.840 98.605  1.00 32.19  ? 184 TRP E N   1 
ATOM   7340  C CA  . TRP E  1 160 ? -0.715  -37.151 99.820  1.00 30.92  ? 184 TRP E CA  1 
ATOM   7341  C C   . TRP E  1 160 ? -1.680  -38.135 100.519 1.00 29.53  ? 184 TRP E C   1 
ATOM   7342  O O   . TRP E  1 160 ? -2.359  -38.894 99.865  1.00 27.01  ? 184 TRP E O   1 
ATOM   7343  C CB  . TRP E  1 160 ? -1.426  -35.814 99.514  1.00 30.18  ? 184 TRP E CB  1 
ATOM   7344  C CG  . TRP E  1 160 ? -0.537  -34.722 99.038  1.00 30.87  ? 184 TRP E CG  1 
ATOM   7345  C CD1 . TRP E  1 160 ? -0.358  -34.283 97.725  1.00 31.01  ? 184 TRP E CD1 1 
ATOM   7346  C CD2 . TRP E  1 160 ? 0.338   -33.905 99.841  1.00 30.82  ? 184 TRP E CD2 1 
ATOM   7347  N NE1 . TRP E  1 160 ? 0.569   -33.242 97.686  1.00 30.07  ? 184 TRP E NE1 1 
ATOM   7348  C CE2 . TRP E  1 160 ? 1.022   -33.011 98.959  1.00 29.80  ? 184 TRP E CE2 1 
ATOM   7349  C CE3 . TRP E  1 160 ? 0.647   -33.872 101.207 1.00 30.83  ? 184 TRP E CE3 1 
ATOM   7350  C CZ2 . TRP E  1 160 ? 1.941   -32.097 99.403  1.00 29.07  ? 184 TRP E CZ2 1 
ATOM   7351  C CZ3 . TRP E  1 160 ? 1.602   -32.960 101.644 1.00 30.50  ? 184 TRP E CZ3 1 
ATOM   7352  C CH2 . TRP E  1 160 ? 2.224   -32.075 100.731 1.00 29.59  ? 184 TRP E CH2 1 
ATOM   7353  N N   . LEU E  1 161 ? -1.724  -38.062 101.842 1.00 29.31  ? 185 LEU E N   1 
ATOM   7354  C CA  . LEU E  1 161 ? -2.507  -38.935 102.692 1.00 29.98  ? 185 LEU E CA  1 
ATOM   7355  C C   . LEU E  1 161 ? -3.293  -38.010 103.558 1.00 30.83  ? 185 LEU E C   1 
ATOM   7356  O O   . LEU E  1 161 ? -2.736  -36.996 103.931 1.00 32.12  ? 185 LEU E O   1 
ATOM   7357  C CB  . LEU E  1 161 ? -1.575  -39.740 103.580 1.00 29.85  ? 185 LEU E CB  1 
ATOM   7358  C CG  . LEU E  1 161 ? -0.570  -40.662 102.861 1.00 30.54  ? 185 LEU E CG  1 
ATOM   7359  C CD1 . LEU E  1 161 ? 0.431   -41.411 103.722 1.00 30.20  ? 185 LEU E CD1 1 
ATOM   7360  C CD2 . LEU E  1 161 ? -1.355  -41.692 102.123 1.00 31.97  ? 185 LEU E CD2 1 
ATOM   7361  N N   . ARG E  1 162 ? -4.561  -38.322 103.848 1.00 31.85  ? 186 ARG E N   1 
ATOM   7362  C CA  . ARG E  1 162 ? -5.378  -37.598 104.835 1.00 33.99  ? 186 ARG E CA  1 
ATOM   7363  C C   . ARG E  1 162 ? -4.768  -37.765 106.190 1.00 35.77  ? 186 ARG E C   1 
ATOM   7364  O O   . ARG E  1 162 ? -4.336  -38.816 106.514 1.00 40.93  ? 186 ARG E O   1 
ATOM   7365  C CB  . ARG E  1 162 ? -6.797  -38.119 104.848 1.00 35.15  ? 186 ARG E CB  1 
ATOM   7366  C CG  . ARG E  1 162 ? -7.592  -37.791 106.087 1.00 38.93  ? 186 ARG E CG  1 
ATOM   7367  C CD  . ARG E  1 162 ? -9.087  -37.902 105.820 1.00 43.52  ? 186 ARG E CD  1 
ATOM   7368  N NE  . ARG E  1 162 ? -9.819  -38.892 106.620 1.00 47.53  ? 186 ARG E NE  1 
ATOM   7369  C CZ  . ARG E  1 162 ? -10.294 -38.676 107.862 1.00 53.99  ? 186 ARG E CZ  1 
ATOM   7370  N NH1 . ARG E  1 162 ? -10.944 -39.653 108.509 1.00 56.42  ? 186 ARG E NH1 1 
ATOM   7371  N NH2 . ARG E  1 162 ? -10.046 -37.522 108.517 1.00 55.24  ? 186 ARG E NH2 1 
ATOM   7372  N N   . LEU E  1 163 ? -4.692  -36.713 106.968 1.00 39.05  ? 187 LEU E N   1 
ATOM   7373  C CA  . LEU E  1 163 ? -4.251  -36.773 108.376 1.00 40.81  ? 187 LEU E CA  1 
ATOM   7374  C C   . LEU E  1 163 ? -5.436  -37.182 109.233 1.00 40.39  ? 187 LEU E C   1 
ATOM   7375  O O   . LEU E  1 163 ? -6.271  -36.373 109.552 1.00 38.15  ? 187 LEU E O   1 
ATOM   7376  C CB  . LEU E  1 163 ? -3.786  -35.390 108.854 1.00 41.14  ? 187 LEU E CB  1 
ATOM   7377  C CG  . LEU E  1 163 ? -2.623  -35.271 109.813 1.00 41.13  ? 187 LEU E CG  1 
ATOM   7378  C CD1 . LEU E  1 163 ? -2.704  -33.939 110.576 1.00 39.14  ? 187 LEU E CD1 1 
ATOM   7379  C CD2 . LEU E  1 163 ? -2.500  -36.481 110.704 1.00 41.48  ? 187 LEU E CD2 1 
ATOM   7380  N N   . GLN E  1 164 ? -5.520  -38.439 109.571 1.00 42.86  ? 188 GLN E N   1 
ATOM   7381  C CA  . GLN E  1 164 ? -6.647  -38.920 110.322 1.00 46.74  ? 188 GLN E CA  1 
ATOM   7382  C C   . GLN E  1 164 ? -6.478  -38.678 111.804 1.00 50.49  ? 188 GLN E C   1 
ATOM   7383  O O   . GLN E  1 164 ? -5.345  -38.450 112.303 1.00 43.13  ? 188 GLN E O   1 
ATOM   7384  C CB  . GLN E  1 164 ? -6.800  -40.390 110.061 1.00 48.23  ? 188 GLN E CB  1 
ATOM   7385  C CG  . GLN E  1 164 ? -7.327  -40.634 108.686 1.00 48.19  ? 188 GLN E CG  1 
ATOM   7386  C CD  . GLN E  1 164 ? -7.546  -42.075 108.430 1.00 49.61  ? 188 GLN E CD  1 
ATOM   7387  O OE1 . GLN E  1 164 ? -7.256  -42.543 107.335 1.00 51.19  ? 188 GLN E OE1 1 
ATOM   7388  N NE2 . GLN E  1 164 ? -8.024  -42.815 109.444 1.00 50.18  ? 188 GLN E NE2 1 
ATOM   7389  N N   . THR E  1 165 ? -7.605  -38.727 112.523 1.00 58.92  ? 189 THR E N   1 
ATOM   7390  C CA  . THR E  1 165 ? -7.546  -38.454 113.986 1.00 67.44  ? 189 THR E CA  1 
ATOM   7391  C C   . THR E  1 165 ? -6.757  -39.542 114.722 1.00 68.71  ? 189 THR E C   1 
ATOM   7392  O O   . THR E  1 165 ? -5.807  -39.280 115.515 1.00 57.82  ? 189 THR E O   1 
ATOM   7393  C CB  . THR E  1 165 ? -8.951  -38.408 114.620 1.00 72.31  ? 189 THR E CB  1 
ATOM   7394  O OG1 . THR E  1 165 ? -9.923  -37.848 113.686 1.00 72.25  ? 189 THR E OG1 1 
ATOM   7395  C CG2 . THR E  1 165 ? -8.854  -37.638 115.997 1.00 71.85  ? 189 THR E CG2 1 
ATOM   7396  N N   . ALA E  1 166 ? -7.188  -40.764 114.370 1.00 71.95  ? 190 ALA E N   1 
ATOM   7397  C CA  . ALA E  1 166 ? -6.918  -41.973 115.111 1.00 74.54  ? 190 ALA E CA  1 
ATOM   7398  C C   . ALA E  1 166 ? -6.309  -43.039 114.252 1.00 66.68  ? 190 ALA E C   1 
ATOM   7399  O O   . ALA E  1 166 ? -5.374  -43.674 114.706 1.00 82.77  ? 190 ALA E O   1 
ATOM   7400  C CB  . ALA E  1 166 ? -8.208  -42.526 115.792 1.00 79.16  ? 190 ALA E CB  1 
ATOM   7401  N N   . GLY E  1 167 ? -6.843  -43.325 113.081 1.00 53.31  ? 191 GLY E N   1 
ATOM   7402  C CA  . GLY E  1 167 ? -6.498  -44.610 112.478 1.00 47.28  ? 191 GLY E CA  1 
ATOM   7403  C C   . GLY E  1 167 ? -5.572  -44.443 111.325 1.00 45.07  ? 191 GLY E C   1 
ATOM   7404  O O   . GLY E  1 167 ? -5.911  -44.761 110.231 1.00 46.98  ? 191 GLY E O   1 
ATOM   7405  N N   . ASN E  1 168 ? -4.390  -43.911 111.534 1.00 44.01  ? 192 ASN E N   1 
ATOM   7406  C CA  . ASN E  1 168 ? -3.506  -43.619 110.391 1.00 40.74  ? 192 ASN E CA  1 
ATOM   7407  C C   . ASN E  1 168 ? -2.796  -44.830 109.896 1.00 39.77  ? 192 ASN E C   1 
ATOM   7408  O O   . ASN E  1 168 ? -2.756  -45.848 110.536 1.00 41.25  ? 192 ASN E O   1 
ATOM   7409  C CB  . ASN E  1 168 ? -2.501  -42.552 110.748 1.00 39.45  ? 192 ASN E CB  1 
ATOM   7410  C CG  . ASN E  1 168 ? -3.090  -41.176 110.640 1.00 38.16  ? 192 ASN E CG  1 
ATOM   7411  O OD1 . ASN E  1 168 ? -3.336  -40.686 109.529 1.00 35.42  ? 192 ASN E OD1 1 
ATOM   7412  N ND2 . ASN E  1 168 ? -3.340  -40.551 111.791 1.00 35.11  ? 192 ASN E ND2 1 
ATOM   7413  N N   . VAL E  1 169 ? -2.196  -44.683 108.746 1.00 39.66  ? 193 VAL E N   1 
ATOM   7414  C CA  . VAL E  1 169 ? -1.701  -45.815 108.015 1.00 38.24  ? 193 VAL E CA  1 
ATOM   7415  C C   . VAL E  1 169 ? -0.251  -46.032 108.368 1.00 36.49  ? 193 VAL E C   1 
ATOM   7416  O O   . VAL E  1 169 ? 0.547   -45.083 108.426 1.00 34.22  ? 193 VAL E O   1 
ATOM   7417  C CB  . VAL E  1 169 ? -1.906  -45.619 106.506 1.00 38.73  ? 193 VAL E CB  1 
ATOM   7418  C CG1 . VAL E  1 169 ? -0.917  -44.645 105.876 1.00 38.76  ? 193 VAL E CG1 1 
ATOM   7419  C CG2 . VAL E  1 169 ? -1.795  -46.945 105.835 1.00 41.86  ? 193 VAL E CG2 1 
ATOM   7420  N N   . ASP E  1 170 ? 0.050   -47.291 108.667 1.00 35.89  ? 194 ASP E N   1 
ATOM   7421  C CA  . ASP E  1 170 ? 1.413   -47.743 108.930 1.00 36.11  ? 194 ASP E CA  1 
ATOM   7422  C C   . ASP E  1 170 ? 2.286   -47.325 107.771 1.00 36.45  ? 194 ASP E C   1 
ATOM   7423  O O   . ASP E  1 170 ? 1.851   -47.381 106.602 1.00 37.67  ? 194 ASP E O   1 
ATOM   7424  C CB  . ASP E  1 170 ? 1.478   -49.293 109.048 1.00 36.33  ? 194 ASP E CB  1 
ATOM   7425  C CG  . ASP E  1 170 ? 1.219   -49.803 110.446 1.00 35.78  ? 194 ASP E CG  1 
ATOM   7426  O OD1 . ASP E  1 170 ? 1.153   -48.992 111.382 1.00 36.99  ? 194 ASP E OD1 1 
ATOM   7427  O OD2 . ASP E  1 170 ? 1.129   -51.027 110.620 1.00 34.94  ? 194 ASP E OD2 1 
ATOM   7428  N N   . HIS E  1 171 ? 3.500   -46.875 108.081 1.00 36.47  ? 195 HIS E N   1 
ATOM   7429  C CA  . HIS E  1 171 ? 4.546   -46.709 107.052 1.00 34.49  ? 195 HIS E CA  1 
ATOM   7430  C C   . HIS E  1 171 ? 5.615   -47.678 107.383 1.00 32.66  ? 195 HIS E C   1 
ATOM   7431  O O   . HIS E  1 171 ? 5.708   -48.175 108.513 1.00 30.87  ? 195 HIS E O   1 
ATOM   7432  C CB  . HIS E  1 171 ? 5.141   -45.328 107.030 1.00 34.02  ? 195 HIS E CB  1 
ATOM   7433  C CG  . HIS E  1 171 ? 4.286   -44.313 106.368 1.00 34.50  ? 195 HIS E CG  1 
ATOM   7434  N ND1 . HIS E  1 171 ? 3.025   -43.989 106.829 1.00 33.55  ? 195 HIS E ND1 1 
ATOM   7435  C CD2 . HIS E  1 171 ? 4.542   -43.491 105.314 1.00 35.03  ? 195 HIS E CD2 1 
ATOM   7436  C CE1 . HIS E  1 171 ? 2.530   -43.025 106.072 1.00 34.94  ? 195 HIS E CE1 1 
ATOM   7437  N NE2 . HIS E  1 171 ? 3.432   -42.702 105.147 1.00 35.52  ? 195 HIS E NE2 1 
ATOM   7438  N N   . VAL E  1 172 ? 6.440   -47.932 106.390 1.00 31.17  ? 196 VAL E N   1 
ATOM   7439  C CA  . VAL E  1 172 ? 7.148   -49.142 106.422 1.00 31.51  ? 196 VAL E CA  1 
ATOM   7440  C C   . VAL E  1 172 ? 8.530   -49.002 105.993 1.00 32.39  ? 196 VAL E C   1 
ATOM   7441  O O   . VAL E  1 172 ? 8.892   -48.206 105.118 1.00 30.48  ? 196 VAL E O   1 
ATOM   7442  C CB  . VAL E  1 172 ? 6.387   -50.219 105.665 1.00 31.66  ? 196 VAL E CB  1 
ATOM   7443  C CG1 . VAL E  1 172 ? 7.059   -50.691 104.411 1.00 31.07  ? 196 VAL E CG1 1 
ATOM   7444  C CG2 . VAL E  1 172 ? 6.146   -51.364 106.595 1.00 32.47  ? 196 VAL E CG2 1 
ATOM   7445  N N   . GLY E  1 173 ? 9.283   -49.894 106.617 1.00 33.87  ? 197 GLY E N   1 
ATOM   7446  C CA  . GLY E  1 173 ? 10.482  -49.491 107.238 1.00 33.53  ? 197 GLY E CA  1 
ATOM   7447  C C   . GLY E  1 173 ? 11.655  -50.370 107.406 1.00 32.73  ? 197 GLY E C   1 
ATOM   7448  O O   . GLY E  1 173 ? 12.441  -50.434 106.479 1.00 35.39  ? 197 GLY E O   1 
ATOM   7449  N N   . LEU E  1 174 ? 11.859  -50.929 108.609 1.00 30.91  ? 198 LEU E N   1 
ATOM   7450  C CA  . LEU E  1 174 ? 13.224  -51.320 108.992 1.00 29.85  ? 198 LEU E CA  1 
ATOM   7451  C C   . LEU E  1 174 ? 13.298  -52.666 109.644 1.00 29.21  ? 198 LEU E C   1 
ATOM   7452  O O   . LEU E  1 174 ? 12.761  -52.840 110.734 1.00 29.74  ? 198 LEU E O   1 
ATOM   7453  C CB  . LEU E  1 174 ? 13.845  -50.283 109.932 1.00 29.59  ? 198 LEU E CB  1 
ATOM   7454  C CG  . LEU E  1 174 ? 15.381  -50.419 110.035 1.00 29.71  ? 198 LEU E CG  1 
ATOM   7455  C CD1 . LEU E  1 174 ? 15.951  -49.876 108.781 1.00 30.30  ? 198 LEU E CD1 1 
ATOM   7456  C CD2 . LEU E  1 174 ? 16.059  -49.678 111.172 1.00 29.60  ? 198 LEU E CD2 1 
ATOM   7457  N N   . GLY E  1 175 ? 13.976  -53.593 108.985 1.00 27.76  ? 199 GLY E N   1 
ATOM   7458  C CA  . GLY E  1 175 ? 14.272  -54.889 109.564 1.00 27.50  ? 199 GLY E CA  1 
ATOM   7459  C C   . GLY E  1 175 ? 15.574  -54.803 110.349 1.00 27.44  ? 199 GLY E C   1 
ATOM   7460  O O   . GLY E  1 175 ? 16.584  -54.189 109.906 1.00 25.85  ? 199 GLY E O   1 
ATOM   7461  N N   . THR E  1 176 ? 15.567  -55.447 111.521 1.00 27.10  ? 200 THR E N   1 
ATOM   7462  C CA  . THR E  1 176 ? 16.773  -55.514 112.349 1.00 27.31  ? 200 THR E CA  1 
ATOM   7463  C C   . THR E  1 176 ? 17.179  -56.896 112.647 1.00 26.60  ? 200 THR E C   1 
ATOM   7464  O O   . THR E  1 176 ? 16.348  -57.759 112.779 1.00 26.02  ? 200 THR E O   1 
ATOM   7465  C CB  . THR E  1 176 ? 16.617  -54.759 113.667 1.00 27.67  ? 200 THR E CB  1 
ATOM   7466  O OG1 . THR E  1 176 ? 15.341  -55.052 114.255 1.00 28.33  ? 200 THR E OG1 1 
ATOM   7467  C CG2 . THR E  1 176 ? 16.699  -53.289 113.371 1.00 27.77  ? 200 THR E CG2 1 
ATOM   7468  N N   . ALA E  1 177 ? 18.482  -57.100 112.738 1.00 26.95  ? 201 ALA E N   1 
ATOM   7469  C CA  . ALA E  1 177 ? 18.989  -58.361 113.258 1.00 27.93  ? 201 ALA E CA  1 
ATOM   7470  C C   . ALA E  1 177 ? 20.215  -58.084 114.097 1.00 27.61  ? 201 ALA E C   1 
ATOM   7471  O O   . ALA E  1 177 ? 21.260  -57.820 113.564 1.00 27.05  ? 201 ALA E O   1 
ATOM   7472  C CB  . ALA E  1 177 ? 19.294  -59.365 112.143 1.00 28.64  ? 201 ALA E CB  1 
ATOM   7473  N N   . PHE E  1 178 ? 20.044  -58.162 115.416 1.00 28.05  ? 202 PHE E N   1 
ATOM   7474  C CA  . PHE E  1 178 ? 21.113  -57.982 116.418 1.00 28.30  ? 202 PHE E CA  1 
ATOM   7475  C C   . PHE E  1 178 ? 21.742  -59.320 116.870 1.00 28.41  ? 202 PHE E C   1 
ATOM   7476  O O   . PHE E  1 178 ? 21.023  -60.290 117.224 1.00 27.24  ? 202 PHE E O   1 
ATOM   7477  C CB  . PHE E  1 178 ? 20.536  -57.274 117.631 1.00 28.11  ? 202 PHE E CB  1 
ATOM   7478  C CG  . PHE E  1 178 ? 20.255  -55.821 117.401 1.00 28.61  ? 202 PHE E CG  1 
ATOM   7479  C CD1 . PHE E  1 178 ? 19.107  -55.409 116.757 1.00 27.53  ? 202 PHE E CD1 1 
ATOM   7480  C CD2 . PHE E  1 178 ? 21.149  -54.831 117.880 1.00 29.92  ? 202 PHE E CD2 1 
ATOM   7481  C CE1 . PHE E  1 178 ? 18.852  -54.068 116.564 1.00 27.59  ? 202 PHE E CE1 1 
ATOM   7482  C CE2 . PHE E  1 178 ? 20.872  -53.460 117.674 1.00 29.19  ? 202 PHE E CE2 1 
ATOM   7483  C CZ  . PHE E  1 178 ? 19.723  -53.097 117.010 1.00 27.89  ? 202 PHE E CZ  1 
ATOM   7484  N N   . GLU E  1 179 ? 23.070  -59.394 116.854 1.00 29.43  ? 203 GLU E N   1 
ATOM   7485  C CA  . GLU E  1 179 ? 23.731  -60.606 117.346 1.00 31.78  ? 203 GLU E CA  1 
ATOM   7486  C C   . GLU E  1 179 ? 23.459  -60.745 118.836 1.00 32.11  ? 203 GLU E C   1 
ATOM   7487  O O   . GLU E  1 179 ? 23.518  -59.722 119.575 1.00 34.28  ? 203 GLU E O   1 
ATOM   7488  C CB  . GLU E  1 179 ? 25.230  -60.639 117.056 1.00 33.72  ? 203 GLU E CB  1 
ATOM   7489  C CG  . GLU E  1 179 ? 25.908  -61.963 117.402 1.00 35.53  ? 203 GLU E CG  1 
ATOM   7490  C CD  . GLU E  1 179 ? 27.268  -62.175 116.716 1.00 37.12  ? 203 GLU E CD  1 
ATOM   7491  O OE1 . GLU E  1 179 ? 27.727  -63.344 116.759 1.00 40.26  ? 203 GLU E OE1 1 
ATOM   7492  O OE2 . GLU E  1 179 ? 27.871  -61.225 116.144 1.00 36.06  ? 203 GLU E OE2 1 
ATOM   7493  N N   . ASN E  1 180 ? 23.091  -61.974 119.254 1.00 30.25  ? 204 ASN E N   1 
ATOM   7494  C CA  . ASN E  1 180 ? 22.817  -62.237 120.651 1.00 28.51  ? 204 ASN E CA  1 
ATOM   7495  C C   . ASN E  1 180 ? 24.130  -62.237 121.390 1.00 29.00  ? 204 ASN E C   1 
ATOM   7496  O O   . ASN E  1 180 ? 25.174  -62.425 120.800 1.00 26.18  ? 204 ASN E O   1 
ATOM   7497  C CB  . ASN E  1 180 ? 22.124  -63.560 120.874 1.00 27.01  ? 204 ASN E CB  1 
ATOM   7498  C CG  . ASN E  1 180 ? 20.681  -63.523 120.518 1.00 26.80  ? 204 ASN E CG  1 
ATOM   7499  O OD1 . ASN E  1 180 ? 19.934  -62.558 120.954 1.00 26.73  ? 204 ASN E OD1 1 
ATOM   7500  N ND2 . ASN E  1 180 ? 20.221  -64.562 119.720 1.00 24.65  ? 204 ASN E ND2 1 
ATOM   7501  N N   . SER E  1 181 ? 24.010  -62.012 122.701 1.00 30.99  ? 205 SER E N   1 
ATOM   7502  C CA  . SER E  1 181 ? 25.115  -61.889 123.621 1.00 31.04  ? 205 SER E CA  1 
ATOM   7503  C C   . SER E  1 181 ? 24.778  -62.641 124.946 1.00 32.67  ? 205 SER E C   1 
ATOM   7504  O O   . SER E  1 181 ? 23.639  -62.982 125.219 1.00 30.41  ? 205 SER E O   1 
ATOM   7505  C CB  . SER E  1 181 ? 25.369  -60.405 123.853 1.00 30.53  ? 205 SER E CB  1 
ATOM   7506  O OG  . SER E  1 181 ? 26.396  -60.151 124.782 1.00 29.79  ? 205 SER E OG  1 
ATOM   7507  N N   . ILE E  1 182 ? 25.856  -62.965 125.659 1.00 35.98  ? 206 ILE E N   1 
ATOM   7508  C CA  . ILE E  1 182 ? 25.961  -63.415 127.063 1.00 36.21  ? 206 ILE E CA  1 
ATOM   7509  C C   . ILE E  1 182 ? 25.403  -62.357 128.037 1.00 34.98  ? 206 ILE E C   1 
ATOM   7510  O O   . ILE E  1 182 ? 24.881  -62.720 129.089 1.00 36.34  ? 206 ILE E O   1 
ATOM   7511  C CB  . ILE E  1 182 ? 27.482  -63.879 127.323 1.00 38.11  ? 206 ILE E CB  1 
ATOM   7512  C CG1 . ILE E  1 182 ? 27.528  -65.345 127.517 1.00 40.25  ? 206 ILE E CG1 1 
ATOM   7513  C CG2 . ILE E  1 182 ? 28.350  -63.141 128.349 1.00 37.82  ? 206 ILE E CG2 1 
ATOM   7514  C CD1 . ILE E  1 182 ? 27.299  -65.992 126.149 1.00 43.90  ? 206 ILE E CD1 1 
ATOM   7515  N N   . TYR E  1 183 ? 25.466  -61.081 127.659 1.00 34.20  ? 207 TYR E N   1 
ATOM   7516  C CA  . TYR E  1 183 ? 24.946  -59.936 128.443 1.00 34.64  ? 207 TYR E CA  1 
ATOM   7517  C C   . TYR E  1 183 ? 23.670  -59.377 127.792 1.00 33.99  ? 207 TYR E C   1 
ATOM   7518  O O   . TYR E  1 183 ? 23.466  -59.556 126.608 1.00 32.98  ? 207 TYR E O   1 
ATOM   7519  C CB  . TYR E  1 183 ? 25.998  -58.790 128.510 1.00 35.02  ? 207 TYR E CB  1 
ATOM   7520  C CG  . TYR E  1 183 ? 27.395  -59.252 128.867 1.00 35.97  ? 207 TYR E CG  1 
ATOM   7521  C CD1 . TYR E  1 183 ? 27.651  -59.765 130.122 1.00 36.73  ? 207 TYR E CD1 1 
ATOM   7522  C CD2 . TYR E  1 183 ? 28.459  -59.181 127.959 1.00 37.44  ? 207 TYR E CD2 1 
ATOM   7523  C CE1 . TYR E  1 183 ? 28.913  -60.225 130.496 1.00 37.94  ? 207 TYR E CE1 1 
ATOM   7524  C CE2 . TYR E  1 183 ? 29.732  -59.648 128.310 1.00 40.47  ? 207 TYR E CE2 1 
ATOM   7525  C CZ  . TYR E  1 183 ? 29.947  -60.182 129.607 1.00 40.30  ? 207 TYR E CZ  1 
ATOM   7526  O OH  . TYR E  1 183 ? 31.145  -60.691 130.052 1.00 37.82  ? 207 TYR E OH  1 
ATOM   7527  N N   . ASP E  1 184 ? 22.832  -58.687 128.558 1.00 34.19  ? 208 ASP E N   1 
ATOM   7528  C CA  . ASP E  1 184 ? 21.702  -57.975 127.989 1.00 35.51  ? 208 ASP E CA  1 
ATOM   7529  C C   . ASP E  1 184 ? 22.209  -56.836 127.169 1.00 34.81  ? 208 ASP E C   1 
ATOM   7530  O O   . ASP E  1 184 ? 23.208  -56.262 127.492 1.00 36.58  ? 208 ASP E O   1 
ATOM   7531  C CB  . ASP E  1 184 ? 20.821  -57.406 129.093 1.00 38.14  ? 208 ASP E CB  1 
ATOM   7532  C CG  . ASP E  1 184 ? 20.018  -58.476 129.811 1.00 40.49  ? 208 ASP E CG  1 
ATOM   7533  O OD1 . ASP E  1 184 ? 19.613  -59.496 129.184 1.00 39.84  ? 208 ASP E OD1 1 
ATOM   7534  O OD2 . ASP E  1 184 ? 19.806  -58.283 131.007 1.00 41.40  ? 208 ASP E OD2 1 
ATOM   7535  N N   . GLN E  1 185 ? 21.540  -56.503 126.087 1.00 34.73  ? 209 GLN E N   1 
ATOM   7536  C CA  . GLN E  1 185 ? 21.939  -55.351 125.254 1.00 33.68  ? 209 GLN E CA  1 
ATOM   7537  C C   . GLN E  1 185 ? 20.759  -54.401 125.113 1.00 33.81  ? 209 GLN E C   1 
ATOM   7538  O O   . GLN E  1 185 ? 19.868  -54.652 124.352 1.00 31.96  ? 209 GLN E O   1 
ATOM   7539  C CB  . GLN E  1 185 ? 22.347  -55.857 123.882 1.00 33.48  ? 209 GLN E CB  1 
ATOM   7540  C CG  . GLN E  1 185 ? 23.570  -56.786 123.794 1.00 33.91  ? 209 GLN E CG  1 
ATOM   7541  C CD  . GLN E  1 185 ? 23.722  -57.335 122.374 1.00 33.83  ? 209 GLN E CD  1 
ATOM   7542  O OE1 . GLN E  1 185 ? 24.312  -56.664 121.539 1.00 35.72  ? 209 GLN E OE1 1 
ATOM   7543  N NE2 . GLN E  1 185 ? 23.105  -58.493 122.068 1.00 32.76  ? 209 GLN E NE2 1 
ATOM   7544  N N   . GLU E  1 186 ? 20.720  -53.328 125.882 1.00 37.54  ? 210 GLU E N   1 
ATOM   7545  C CA  . GLU E  1 186 ? 19.589  -52.389 125.827 1.00 38.84  ? 210 GLU E CA  1 
ATOM   7546  C C   . GLU E  1 186 ? 19.935  -51.171 124.971 1.00 35.56  ? 210 GLU E C   1 
ATOM   7547  O O   . GLU E  1 186 ? 21.083  -50.703 124.959 1.00 34.23  ? 210 GLU E O   1 
ATOM   7548  C CB  . GLU E  1 186 ? 19.214  -51.960 127.232 1.00 44.72  ? 210 GLU E CB  1 
ATOM   7549  C CG  . GLU E  1 186 ? 17.830  -51.302 127.353 1.00 53.04  ? 210 GLU E CG  1 
ATOM   7550  C CD  . GLU E  1 186 ? 17.558  -50.543 128.708 1.00 60.83  ? 210 GLU E CD  1 
ATOM   7551  O OE1 . GLU E  1 186 ? 16.631  -49.632 128.758 1.00 56.59  ? 210 GLU E OE1 1 
ATOM   7552  O OE2 . GLU E  1 186 ? 18.272  -50.878 129.710 1.00 65.11  ? 210 GLU E OE2 1 
ATOM   7553  N N   . TYR E  1 187 ? 18.930  -50.696 124.244 1.00 33.39  ? 211 TYR E N   1 
ATOM   7554  C CA  . TYR E  1 187 ? 18.960  -49.434 123.483 1.00 32.80  ? 211 TYR E CA  1 
ATOM   7555  C C   . TYR E  1 187 ? 17.802  -48.479 123.844 1.00 32.15  ? 211 TYR E C   1 
ATOM   7556  O O   . TYR E  1 187 ? 16.705  -48.924 124.209 1.00 30.34  ? 211 TYR E O   1 
ATOM   7557  C CB  . TYR E  1 187 ? 18.895  -49.763 121.969 1.00 32.93  ? 211 TYR E CB  1 
ATOM   7558  C CG  . TYR E  1 187 ? 20.147  -50.503 121.479 1.00 32.59  ? 211 TYR E CG  1 
ATOM   7559  C CD1 . TYR E  1 187 ? 20.246  -51.897 121.549 1.00 30.64  ? 211 TYR E CD1 1 
ATOM   7560  C CD2 . TYR E  1 187 ? 21.262  -49.785 121.022 1.00 31.37  ? 211 TYR E CD2 1 
ATOM   7561  C CE1 . TYR E  1 187 ? 21.394  -52.550 121.140 1.00 30.00  ? 211 TYR E CE1 1 
ATOM   7562  C CE2 . TYR E  1 187 ? 22.421  -50.443 120.655 1.00 30.51  ? 211 TYR E CE2 1 
ATOM   7563  C CZ  . TYR E  1 187 ? 22.486  -51.830 120.696 1.00 29.34  ? 211 TYR E CZ  1 
ATOM   7564  O OH  . TYR E  1 187 ? 23.640  -52.455 120.287 1.00 27.13  ? 211 TYR E OH  1 
ATOM   7565  N N   . ASN E  1 188 ? 18.044  -47.172 123.709 1.00 32.67  ? 212 ASN E N   1 
ATOM   7566  C CA  . ASN E  1 188 ? 16.938  -46.195 123.532 1.00 33.28  ? 212 ASN E CA  1 
ATOM   7567  C C   . ASN E  1 188 ? 16.803  -45.982 122.066 1.00 33.83  ? 212 ASN E C   1 
ATOM   7568  O O   . ASN E  1 188 ? 17.774  -45.594 121.425 1.00 37.90  ? 212 ASN E O   1 
ATOM   7569  C CB  . ASN E  1 188 ? 17.175  -44.864 124.272 1.00 33.05  ? 212 ASN E CB  1 
ATOM   7570  C CG  . ASN E  1 188 ? 16.990  -45.018 125.775 1.00 33.77  ? 212 ASN E CG  1 
ATOM   7571  O OD1 . ASN E  1 188 ? 17.951  -45.259 126.504 1.00 34.80  ? 212 ASN E OD1 1 
ATOM   7572  N ND2 . ASN E  1 188 ? 15.748  -45.021 126.224 1.00 33.39  ? 212 ASN E ND2 1 
ATOM   7573  N N   . ILE E  1 189 ? 15.653  -46.288 121.494 1.00 33.22  ? 213 ILE E N   1 
ATOM   7574  C CA  . ILE E  1 189 ? 15.481  -46.047 120.058 1.00 33.56  ? 213 ILE E CA  1 
ATOM   7575  C C   . ILE E  1 189 ? 14.796  -44.735 119.846 1.00 32.43  ? 213 ILE E C   1 
ATOM   7576  O O   . ILE E  1 189 ? 13.740  -44.537 120.383 1.00 31.43  ? 213 ILE E O   1 
ATOM   7577  C CB  . ILE E  1 189 ? 14.656  -47.134 119.385 1.00 33.93  ? 213 ILE E CB  1 
ATOM   7578  C CG1 . ILE E  1 189 ? 15.513  -48.381 119.258 1.00 34.43  ? 213 ILE E CG1 1 
ATOM   7579  C CG2 . ILE E  1 189 ? 14.191  -46.683 117.995 1.00 34.14  ? 213 ILE E CG2 1 
ATOM   7580  C CD1 . ILE E  1 189 ? 14.735  -49.636 118.883 1.00 35.63  ? 213 ILE E CD1 1 
ATOM   7581  N N   . ARG E  1 190 ? 15.376  -43.853 119.047 1.00 33.30  ? 214 ARG E N   1 
ATOM   7582  C CA  . ARG E  1 190 ? 14.677  -42.591 118.697 1.00 34.49  ? 214 ARG E CA  1 
ATOM   7583  C C   . ARG E  1 190 ? 14.367  -42.612 117.205 1.00 34.04  ? 214 ARG E C   1 
ATOM   7584  O O   . ARG E  1 190 ? 15.276  -42.713 116.390 1.00 33.15  ? 214 ARG E O   1 
ATOM   7585  C CB  . ARG E  1 190 ? 15.486  -41.357 119.071 1.00 35.73  ? 214 ARG E CB  1 
ATOM   7586  C CG  . ARG E  1 190 ? 14.717  -40.067 118.910 1.00 37.11  ? 214 ARG E CG  1 
ATOM   7587  C CD  . ARG E  1 190 ? 15.629  -38.855 118.974 1.00 39.58  ? 214 ARG E CD  1 
ATOM   7588  N NE  . ARG E  1 190 ? 15.778  -38.258 120.315 1.00 41.86  ? 214 ARG E NE  1 
ATOM   7589  C CZ  . ARG E  1 190 ? 16.621  -37.234 120.589 1.00 47.42  ? 214 ARG E CZ  1 
ATOM   7590  N NH1 . ARG E  1 190 ? 16.696  -36.718 121.822 1.00 48.41  ? 214 ARG E NH1 1 
ATOM   7591  N NH2 . ARG E  1 190 ? 17.428  -36.692 119.638 1.00 49.18  ? 214 ARG E NH2 1 
ATOM   7592  N N   . VAL E  1 191 ? 13.064  -42.561 116.898 1.00 34.40  ? 215 VAL E N   1 
ATOM   7593  C CA  . VAL E  1 191 ? 12.520  -42.491 115.552 1.00 34.64  ? 215 VAL E CA  1 
ATOM   7594  C C   . VAL E  1 191 ? 12.067  -41.045 115.356 1.00 34.34  ? 215 VAL E C   1 
ATOM   7595  O O   . VAL E  1 191 ? 11.431  -40.456 116.224 1.00 32.00  ? 215 VAL E O   1 
ATOM   7596  C CB  . VAL E  1 191 ? 11.311  -43.431 115.389 1.00 36.07  ? 215 VAL E CB  1 
ATOM   7597  C CG1 . VAL E  1 191 ? 10.763  -43.446 113.966 1.00 35.85  ? 215 VAL E CG1 1 
ATOM   7598  C CG2 . VAL E  1 191 ? 11.717  -44.829 115.767 1.00 36.39  ? 215 VAL E CG2 1 
ATOM   7599  N N   . THR E  1 192 ? 12.463  -40.484 114.220 1.00 35.66  ? 216 THR E N   1 
ATOM   7600  C CA  . THR E  1 192 ? 12.141  -39.132 113.846 1.00 36.87  ? 216 THR E CA  1 
ATOM   7601  C C   . THR E  1 192 ? 11.534  -39.172 112.446 1.00 37.40  ? 216 THR E C   1 
ATOM   7602  O O   . THR E  1 192 ? 12.174  -39.708 111.539 1.00 36.32  ? 216 THR E O   1 
ATOM   7603  C CB  . THR E  1 192 ? 13.388  -38.257 113.856 1.00 37.59  ? 216 THR E CB  1 
ATOM   7604  O OG1 . THR E  1 192 ? 13.908  -38.164 115.196 1.00 39.88  ? 216 THR E OG1 1 
ATOM   7605  C CG2 . THR E  1 192 ? 13.065  -36.891 113.353 1.00 38.03  ? 216 THR E CG2 1 
ATOM   7606  N N   . MET E  1 193 ? 10.297  -38.636 112.315 1.00 38.07  ? 217 MET E N   1 
ATOM   7607  C CA  . MET E  1 193 ? 9.564   -38.515 111.044 1.00 38.54  ? 217 MET E CA  1 
ATOM   7608  C C   . MET E  1 193 ? 9.730   -37.113 110.490 1.00 37.13  ? 217 MET E C   1 
ATOM   7609  O O   . MET E  1 193 ? 9.423   -36.165 111.182 1.00 36.82  ? 217 MET E O   1 
ATOM   7610  C CB  . MET E  1 193 ? 8.079   -38.772 111.263 1.00 41.22  ? 217 MET E CB  1 
ATOM   7611  C CG  . MET E  1 193 ? 7.796   -40.200 111.690 1.00 45.90  ? 217 MET E CG  1 
ATOM   7612  S SD  . MET E  1 193 ? 6.272   -41.020 111.167 1.00 50.05  ? 217 MET E SD  1 
ATOM   7613  C CE  . MET E  1 193 ? 5.226   -39.596 111.398 1.00 43.80  ? 217 MET E CE  1 
ATOM   7614  N N   . TYR E  1 194 ? 10.240  -36.975 109.267 1.00 35.73  ? 218 TYR E N   1 
ATOM   7615  C CA  . TYR E  1 194 ? 10.262  -35.669 108.573 1.00 34.71  ? 218 TYR E CA  1 
ATOM   7616  C C   . TYR E  1 194 ? 9.028   -35.595 107.678 1.00 32.47  ? 218 TYR E C   1 
ATOM   7617  O O   . TYR E  1 194 ? 8.971   -36.160 106.621 1.00 31.08  ? 218 TYR E O   1 
ATOM   7618  C CB  . TYR E  1 194 ? 11.577  -35.433 107.800 1.00 34.89  ? 218 TYR E CB  1 
ATOM   7619  C CG  . TYR E  1 194 ? 12.812  -35.406 108.719 1.00 36.12  ? 218 TYR E CG  1 
ATOM   7620  C CD1 . TYR E  1 194 ? 13.454  -36.579 109.088 1.00 37.25  ? 218 TYR E CD1 1 
ATOM   7621  C CD2 . TYR E  1 194 ? 13.320  -34.240 109.202 1.00 35.90  ? 218 TYR E CD2 1 
ATOM   7622  C CE1 . TYR E  1 194 ? 14.560  -36.579 109.909 1.00 37.10  ? 218 TYR E CE1 1 
ATOM   7623  C CE2 . TYR E  1 194 ? 14.438  -34.234 110.007 1.00 37.97  ? 218 TYR E CE2 1 
ATOM   7624  C CZ  . TYR E  1 194 ? 15.043  -35.425 110.373 1.00 38.83  ? 218 TYR E CZ  1 
ATOM   7625  O OH  . TYR E  1 194 ? 16.138  -35.463 111.233 1.00 41.64  ? 218 TYR E OH  1 
ATOM   7626  N N   . VAL E  1 195 ? 8.029   -34.898 108.151 1.00 32.07  ? 219 VAL E N   1 
ATOM   7627  C CA  . VAL E  1 195 ? 6.717   -34.898 107.538 1.00 33.88  ? 219 VAL E CA  1 
ATOM   7628  C C   . VAL E  1 195 ? 6.438   -33.586 106.850 1.00 34.34  ? 219 VAL E C   1 
ATOM   7629  O O   . VAL E  1 195 ? 6.724   -32.527 107.386 1.00 35.16  ? 219 VAL E O   1 
ATOM   7630  C CB  . VAL E  1 195 ? 5.645   -35.052 108.638 1.00 33.45  ? 219 VAL E CB  1 
ATOM   7631  C CG1 . VAL E  1 195 ? 4.232   -35.023 108.068 1.00 32.77  ? 219 VAL E CG1 1 
ATOM   7632  C CG2 . VAL E  1 195 ? 5.970   -36.308 109.425 1.00 33.67  ? 219 VAL E CG2 1 
ATOM   7633  N N   . GLN E  1 196 ? 5.778   -33.665 105.715 1.00 34.55  ? 220 GLN E N   1 
ATOM   7634  C CA  . GLN E  1 196 ? 5.240   -32.489 105.064 1.00 35.18  ? 220 GLN E CA  1 
ATOM   7635  C C   . GLN E  1 196 ? 3.723   -32.439 105.171 1.00 33.47  ? 220 GLN E C   1 
ATOM   7636  O O   . GLN E  1 196 ? 3.034   -33.385 104.825 1.00 31.87  ? 220 GLN E O   1 
ATOM   7637  C CB  . GLN E  1 196 ? 5.655   -32.553 103.641 1.00 37.41  ? 220 GLN E CB  1 
ATOM   7638  C CG  . GLN E  1 196 ? 5.596   -31.260 102.928 1.00 39.37  ? 220 GLN E CG  1 
ATOM   7639  C CD  . GLN E  1 196 ? 6.255   -31.427 101.589 1.00 40.29  ? 220 GLN E CD  1 
ATOM   7640  O OE1 . GLN E  1 196 ? 5.730   -32.177 100.737 1.00 39.33  ? 220 GLN E OE1 1 
ATOM   7641  N NE2 . GLN E  1 196 ? 7.437   -30.783 101.401 1.00 41.13  ? 220 GLN E NE2 1 
ATOM   7642  N N   . PHE E  1 197 ? 3.227   -31.330 105.702 1.00 33.19  ? 221 PHE E N   1 
ATOM   7643  C CA  . PHE E  1 197 ? 1.790   -31.119 105.928 1.00 32.01  ? 221 PHE E CA  1 
ATOM   7644  C C   . PHE E  1 197 ? 1.267   -30.157 104.869 1.00 32.04  ? 221 PHE E C   1 
ATOM   7645  O O   . PHE E  1 197 ? 2.007   -29.312 104.383 1.00 32.61  ? 221 PHE E O   1 
ATOM   7646  C CB  . PHE E  1 197 ? 1.558   -30.550 107.316 1.00 31.57  ? 221 PHE E CB  1 
ATOM   7647  C CG  . PHE E  1 197 ? 1.786   -31.523 108.410 1.00 31.12  ? 221 PHE E CG  1 
ATOM   7648  C CD1 . PHE E  1 197 ? 0.877   -32.514 108.654 1.00 31.10  ? 221 PHE E CD1 1 
ATOM   7649  C CD2 . PHE E  1 197 ? 2.886   -31.442 109.205 1.00 31.67  ? 221 PHE E CD2 1 
ATOM   7650  C CE1 . PHE E  1 197 ? 1.083   -33.435 109.688 1.00 32.03  ? 221 PHE E CE1 1 
ATOM   7651  C CE2 . PHE E  1 197 ? 3.103   -32.357 110.237 1.00 31.63  ? 221 PHE E CE2 1 
ATOM   7652  C CZ  . PHE E  1 197 ? 2.212   -33.361 110.480 1.00 31.64  ? 221 PHE E CZ  1 
ATOM   7653  N N   . ARG E  1 198 ? -0.000  -30.298 104.499 1.00 31.84  ? 222 ARG E N   1 
ATOM   7654  C CA  . ARG E  1 198 ? -0.651  -29.458 103.472 1.00 31.27  ? 222 ARG E CA  1 
ATOM   7655  C C   . ARG E  1 198 ? -2.135  -29.157 103.810 1.00 31.77  ? 222 ARG E C   1 
ATOM   7656  O O   . ARG E  1 198 ? -2.850  -30.006 104.308 1.00 33.16  ? 222 ARG E O   1 
ATOM   7657  C CB  . ARG E  1 198 ? -0.545  -30.098 102.104 1.00 30.63  ? 222 ARG E CB  1 
ATOM   7658  C CG  . ARG E  1 198 ? -1.146  -29.280 100.986 1.00 31.70  ? 222 ARG E CG  1 
ATOM   7659  C CD  . ARG E  1 198 ? -1.175  -30.035 99.671  1.00 32.45  ? 222 ARG E CD  1 
ATOM   7660  N NE  . ARG E  1 198 ? -2.178  -29.496 98.729  1.00 33.41  ? 222 ARG E NE  1 
ATOM   7661  C CZ  . ARG E  1 198 ? -2.456  -30.007 97.525  1.00 34.72  ? 222 ARG E CZ  1 
ATOM   7662  N NH1 . ARG E  1 198 ? -3.382  -29.450 96.743  1.00 33.00  ? 222 ARG E NH1 1 
ATOM   7663  N NH2 . ARG E  1 198 ? -1.821  -31.116 97.088  1.00 38.50  ? 222 ARG E NH2 1 
ATOM   7664  N N   . GLU E  1 199 ? -2.556  -27.917 103.563 1.00 32.57  ? 223 GLU E N   1 
ATOM   7665  C CA  . GLU E  1 199 ? -3.912  -27.418 103.762 1.00 31.81  ? 223 GLU E CA  1 
ATOM   7666  C C   . GLU E  1 199 ? -4.160  -27.160 105.215 1.00 32.15  ? 223 GLU E C   1 
ATOM   7667  O O   . GLU E  1 199 ? -4.690  -28.045 105.975 1.00 33.59  ? 223 GLU E O   1 
ATOM   7668  C CB  . GLU E  1 199 ? -4.939  -28.352 103.153 1.00 33.34  ? 223 GLU E CB  1 
ATOM   7669  C CG  . GLU E  1 199 ? -6.366  -27.817 102.984 1.00 34.94  ? 223 GLU E CG  1 
ATOM   7670  C CD  . GLU E  1 199 ? -6.525  -26.794 101.870 1.00 35.76  ? 223 GLU E CD  1 
ATOM   7671  O OE1 . GLU E  1 199 ? -5.702  -26.819 100.913 1.00 36.52  ? 223 GLU E OE1 1 
ATOM   7672  O OE2 . GLU E  1 199 ? -7.478  -25.975 101.976 1.00 36.03  ? 223 GLU E OE2 1 
ATOM   7673  N N   . PHE E  1 200 ? -3.770  -25.949 105.628 1.00 30.95  ? 224 PHE E N   1 
ATOM   7674  C CA  . PHE E  1 200 ? -4.168  -25.451 106.943 1.00 31.00  ? 224 PHE E CA  1 
ATOM   7675  C C   . PHE E  1 200 ? -5.695  -25.580 107.091 1.00 30.82  ? 224 PHE E C   1 
ATOM   7676  O O   . PHE E  1 200 ? -6.442  -25.302 106.146 1.00 29.86  ? 224 PHE E O   1 
ATOM   7677  C CB  . PHE E  1 200 ? -3.745  -23.999 107.067 1.00 31.26  ? 224 PHE E CB  1 
ATOM   7678  C CG  . PHE E  1 200 ? -3.781  -23.439 108.483 1.00 31.20  ? 224 PHE E CG  1 
ATOM   7679  C CD1 . PHE E  1 200 ? -2.939  -23.943 109.478 1.00 30.64  ? 224 PHE E CD1 1 
ATOM   7680  C CD2 . PHE E  1 200 ? -4.629  -22.370 108.804 1.00 30.49  ? 224 PHE E CD2 1 
ATOM   7681  C CE1 . PHE E  1 200 ? -2.973  -23.416 110.775 1.00 30.78  ? 224 PHE E CE1 1 
ATOM   7682  C CE2 . PHE E  1 200 ? -4.645  -21.857 110.097 1.00 31.36  ? 224 PHE E CE2 1 
ATOM   7683  C CZ  . PHE E  1 200 ? -3.822  -22.383 111.083 1.00 30.87  ? 224 PHE E CZ  1 
ATOM   7684  N N   . ASN E  1 201 ? -6.160  -26.034 108.242 1.00 31.35  ? 225 ASN E N   1 
ATOM   7685  C CA  . ASN E  1 201 ? -7.603  -26.281 108.387 1.00 34.40  ? 225 ASN E CA  1 
ATOM   7686  C C   . ASN E  1 201 ? -8.232  -25.900 109.713 1.00 33.88  ? 225 ASN E C   1 
ATOM   7687  O O   . ASN E  1 201 ? -9.338  -26.336 110.001 1.00 31.71  ? 225 ASN E O   1 
ATOM   7688  C CB  . ASN E  1 201 ? -7.930  -27.757 108.063 1.00 37.12  ? 225 ASN E CB  1 
ATOM   7689  C CG  . ASN E  1 201 ? -7.467  -28.737 109.142 1.00 38.05  ? 225 ASN E CG  1 
ATOM   7690  O OD1 . ASN E  1 201 ? -6.942  -28.360 110.199 1.00 38.32  ? 225 ASN E OD1 1 
ATOM   7691  N ND2 . ASN E  1 201 ? -7.695  -30.019 108.876 1.00 41.60  ? 225 ASN E ND2 1 
ATOM   7692  N N   . LEU E  1 202 ? -7.548  -25.023 110.451 1.00 34.87  ? 226 LEU E N   1 
ATOM   7693  C CA  . LEU E  1 202 ? -7.923  -24.627 111.808 1.00 34.26  ? 226 LEU E CA  1 
ATOM   7694  C C   . LEU E  1 202 ? -9.356  -24.089 111.915 1.00 33.73  ? 226 LEU E C   1 
ATOM   7695  O O   . LEU E  1 202 ? -9.758  -23.152 111.255 1.00 33.21  ? 226 LEU E O   1 
ATOM   7696  C CB  . LEU E  1 202 ? -6.908  -23.620 112.367 1.00 34.40  ? 226 LEU E CB  1 
ATOM   7697  C CG  . LEU E  1 202 ? -7.184  -23.316 113.837 1.00 35.34  ? 226 LEU E CG  1 
ATOM   7698  C CD1 . LEU E  1 202 ? -6.304  -24.128 114.773 1.00 35.27  ? 226 LEU E CD1 1 
ATOM   7699  C CD2 . LEU E  1 202 ? -6.995  -21.849 114.092 1.00 37.60  ? 226 LEU E CD2 1 
ATOM   7700  N N   . LYS E  1 203 ? -10.121 -24.749 112.755 1.00 33.75  ? 227 LYS E N   1 
ATOM   7701  C CA  . LYS E  1 203 ? -11.460 -24.313 113.082 1.00 34.09  ? 227 LYS E CA  1 
ATOM   7702  C C   . LYS E  1 203 ? -11.363 -23.352 114.248 1.00 34.52  ? 227 LYS E C   1 
ATOM   7703  O O   . LYS E  1 203 ? -10.564 -23.580 115.163 1.00 33.31  ? 227 LYS E O   1 
ATOM   7704  C CB  . LYS E  1 203 ? -12.316 -25.517 113.489 1.00 33.06  ? 227 LYS E CB  1 
ATOM   7705  C CG  . LYS E  1 203 ? -12.211 -26.674 112.541 1.00 32.10  ? 227 LYS E CG  1 
ATOM   7706  C CD  . LYS E  1 203 ? -12.510 -26.203 111.145 1.00 31.67  ? 227 LYS E CD  1 
ATOM   7707  C CE  . LYS E  1 203 ? -12.815 -27.366 110.232 1.00 31.84  ? 227 LYS E CE  1 
ATOM   7708  N NZ  . LYS E  1 203 ? -11.623 -28.203 110.017 1.00 31.76  ? 227 LYS E NZ  1 
ATOM   7709  N N   . ASP E  1 204 ? -12.217 -22.330 114.248 1.00 36.01  ? 228 ASP E N   1 
ATOM   7710  C CA  . ASP E  1 204 ? -12.307 -21.390 115.378 1.00 38.36  ? 228 ASP E CA  1 
ATOM   7711  C C   . ASP E  1 204 ? -13.758 -21.044 115.788 1.00 38.88  ? 228 ASP E C   1 
ATOM   7712  O O   . ASP E  1 204 ? -14.245 -19.978 115.425 1.00 41.24  ? 228 ASP E O   1 
ATOM   7713  C CB  . ASP E  1 204 ? -11.490 -20.138 114.982 1.00 39.08  ? 228 ASP E CB  1 
ATOM   7714  C CG  . ASP E  1 204 ? -11.481 -19.069 116.033 1.00 39.03  ? 228 ASP E CG  1 
ATOM   7715  O OD1 . ASP E  1 204 ? -11.294 -19.405 117.212 1.00 40.17  ? 228 ASP E OD1 1 
ATOM   7716  O OD2 . ASP E  1 204 ? -11.608 -17.883 115.655 1.00 40.60  ? 228 ASP E OD2 1 
ATOM   7717  N N   . PRO E  1 205 ? -14.446 -21.924 116.554 1.00 40.47  ? 229 PRO E N   1 
ATOM   7718  C CA  . PRO E  1 205 ? -15.734 -21.586 117.207 1.00 43.46  ? 229 PRO E CA  1 
ATOM   7719  C C   . PRO E  1 205 ? -15.634 -20.441 118.231 1.00 47.13  ? 229 PRO E C   1 
ATOM   7720  O O   . PRO E  1 205 ? -14.580 -20.216 118.823 1.00 46.64  ? 229 PRO E O   1 
ATOM   7721  C CB  . PRO E  1 205 ? -16.142 -22.859 117.948 1.00 42.42  ? 229 PRO E CB  1 
ATOM   7722  C CG  . PRO E  1 205 ? -15.254 -23.927 117.453 1.00 41.69  ? 229 PRO E CG  1 
ATOM   7723  C CD  . PRO E  1 205 ? -14.039 -23.299 116.851 1.00 41.47  ? 229 PRO E CD  1 
ATOM   7724  N N   . PRO E  1 206 ? -16.735 -19.734 118.465 1.00 53.01  ? 230 PRO E N   1 
ATOM   7725  C CA  . PRO E  1 206 ? -16.603 -18.453 119.209 1.00 56.44  ? 230 PRO E CA  1 
ATOM   7726  C C   . PRO E  1 206 ? -16.094 -18.522 120.677 1.00 54.59  ? 230 PRO E C   1 
ATOM   7727  O O   . PRO E  1 206 ? -16.620 -19.318 121.434 1.00 53.29  ? 230 PRO E O   1 
ATOM   7728  C CB  . PRO E  1 206 ? -18.040 -17.874 119.129 1.00 56.95  ? 230 PRO E CB  1 
ATOM   7729  C CG  . PRO E  1 206 ? -18.664 -18.534 117.928 1.00 54.89  ? 230 PRO E CG  1 
ATOM   7730  C CD  . PRO E  1 206 ? -18.099 -19.927 117.927 1.00 54.68  ? 230 PRO E CD  1 
ATOM   7731  N N   . SER F  1 19  ? 11.641  -23.443 112.021 1.00 67.84  ? 43  SER F N   1 
ATOM   7732  C CA  . SER F  1 19  ? 11.323  -22.395 113.064 1.00 68.95  ? 43  SER F CA  1 
ATOM   7733  C C   . SER F  1 19  ? 10.015  -21.563 112.808 1.00 65.16  ? 43  SER F C   1 
ATOM   7734  O O   . SER F  1 19  ? 9.209   -21.410 113.743 1.00 58.67  ? 43  SER F O   1 
ATOM   7735  C CB  . SER F  1 19  ? 12.566  -21.476 113.396 1.00 71.13  ? 43  SER F CB  1 
ATOM   7736  O OG  . SER F  1 19  ? 13.319  -21.072 112.238 1.00 72.90  ? 43  SER F OG  1 
ATOM   7737  N N   . HIS F  1 20  ? 9.797   -21.052 111.580 1.00 61.11  ? 44  HIS F N   1 
ATOM   7738  C CA  . HIS F  1 20  ? 8.696   -20.082 111.317 1.00 58.68  ? 44  HIS F CA  1 
ATOM   7739  C C   . HIS F  1 20  ? 7.514   -20.619 110.637 1.00 49.44  ? 44  HIS F C   1 
ATOM   7740  O O   . HIS F  1 20  ? 7.600   -21.394 109.737 1.00 44.74  ? 44  HIS F O   1 
ATOM   7741  C CB  . HIS F  1 20  ? 9.154   -18.911 110.491 1.00 64.96  ? 44  HIS F CB  1 
ATOM   7742  C CG  . HIS F  1 20  ? 10.175  -18.138 111.197 1.00 82.19  ? 44  HIS F CG  1 
ATOM   7743  N ND1 . HIS F  1 20  ? 9.866   -17.358 112.287 1.00 96.37  ? 44  HIS F ND1 1 
ATOM   7744  C CD2 . HIS F  1 20  ? 11.522  -18.134 111.090 1.00 102.86 ? 44  HIS F CD2 1 
ATOM   7745  C CE1 . HIS F  1 20  ? 10.980  -16.840 112.780 1.00 109.96 ? 44  HIS F CE1 1 
ATOM   7746  N NE2 . HIS F  1 20  ? 12.000  -17.292 112.070 1.00 116.04 ? 44  HIS F NE2 1 
ATOM   7747  N N   . PHE F  1 21  ? 6.372   -20.130 111.028 1.00 44.89  ? 45  PHE F N   1 
ATOM   7748  C CA  . PHE F  1 21  ? 5.170   -20.532 110.365 1.00 42.04  ? 45  PHE F CA  1 
ATOM   7749  C C   . PHE F  1 21  ? 4.236   -19.294 110.190 1.00 38.93  ? 45  PHE F C   1 
ATOM   7750  O O   . PHE F  1 21  ? 3.747   -18.701 111.143 1.00 36.84  ? 45  PHE F O   1 
ATOM   7751  C CB  . PHE F  1 21  ? 4.559   -21.755 111.092 1.00 41.98  ? 45  PHE F CB  1 
ATOM   7752  C CG  . PHE F  1 21  ? 3.232   -22.154 110.568 1.00 42.92  ? 45  PHE F CG  1 
ATOM   7753  C CD1 . PHE F  1 21  ? 3.059   -22.366 109.205 1.00 42.56  ? 45  PHE F CD1 1 
ATOM   7754  C CD2 . PHE F  1 21  ? 2.151   -22.289 111.422 1.00 44.94  ? 45  PHE F CD2 1 
ATOM   7755  C CE1 . PHE F  1 21  ? 1.835   -22.695 108.703 1.00 44.71  ? 45  PHE F CE1 1 
ATOM   7756  C CE2 . PHE F  1 21  ? 0.912   -22.643 110.927 1.00 46.66  ? 45  PHE F CE2 1 
ATOM   7757  C CZ  . PHE F  1 21  ? 0.751   -22.838 109.563 1.00 46.75  ? 45  PHE F CZ  1 
ATOM   7758  N N   . ASN F  1 22  ? 4.036   -18.916 108.931 1.00 36.48  ? 46  ASN F N   1 
ATOM   7759  C CA  . ASN F  1 22  ? 3.186   -17.802 108.574 1.00 35.41  ? 46  ASN F CA  1 
ATOM   7760  C C   . ASN F  1 22  ? 1.826   -18.300 108.253 1.00 35.27  ? 46  ASN F C   1 
ATOM   7761  O O   . ASN F  1 22  ? 1.708   -19.200 107.494 1.00 37.46  ? 46  ASN F O   1 
ATOM   7762  C CB  . ASN F  1 22  ? 3.752   -17.165 107.327 1.00 35.21  ? 46  ASN F CB  1 
ATOM   7763  C CG  . ASN F  1 22  ? 5.035   -16.451 107.598 1.00 33.82  ? 46  ASN F CG  1 
ATOM   7764  O OD1 . ASN F  1 22  ? 5.031   -15.512 108.370 1.00 35.47  ? 46  ASN F OD1 1 
ATOM   7765  N ND2 . ASN F  1 22  ? 6.131   -16.919 107.031 1.00 31.37  ? 46  ASN F ND2 1 
ATOM   7766  N N   . THR F  1 23  ? 0.790   -17.712 108.803 1.00 37.06  ? 47  THR F N   1 
ATOM   7767  C CA  . THR F  1 23  ? -0.575  -18.105 108.459 1.00 38.45  ? 47  THR F CA  1 
ATOM   7768  C C   . THR F  1 23  ? -1.589  -16.975 108.709 1.00 37.47  ? 47  THR F C   1 
ATOM   7769  O O   . THR F  1 23  ? -1.226  -15.817 108.930 1.00 38.64  ? 47  THR F O   1 
ATOM   7770  C CB  . THR F  1 23  ? -0.967  -19.445 109.165 1.00 42.13  ? 47  THR F CB  1 
ATOM   7771  O OG1 . THR F  1 23  ? -2.194  -19.997 108.577 1.00 44.87  ? 47  THR F OG1 1 
ATOM   7772  C CG2 . THR F  1 23  ? -1.040  -19.270 110.709 1.00 42.32  ? 47  THR F CG2 1 
ATOM   7773  N N   . ARG F  1 24  ? -2.851  -17.340 108.650 1.00 36.17  ? 48  ARG F N   1 
ATOM   7774  C CA  . ARG F  1 24  ? -3.929  -16.429 108.452 1.00 36.22  ? 48  ARG F CA  1 
ATOM   7775  C C   . ARG F  1 24  ? -5.146  -16.988 109.171 1.00 37.49  ? 48  ARG F C   1 
ATOM   7776  O O   . ARG F  1 24  ? -5.563  -18.134 108.880 1.00 40.67  ? 48  ARG F O   1 
ATOM   7777  C CB  . ARG F  1 24  ? -4.189  -16.336 106.964 1.00 35.73  ? 48  ARG F CB  1 
ATOM   7778  C CG  . ARG F  1 24  ? -5.257  -15.335 106.555 1.00 35.97  ? 48  ARG F CG  1 
ATOM   7779  C CD  . ARG F  1 24  ? -5.784  -15.594 105.145 1.00 35.46  ? 48  ARG F CD  1 
ATOM   7780  N NE  . ARG F  1 24  ? -6.458  -16.889 105.114 1.00 35.17  ? 48  ARG F NE  1 
ATOM   7781  C CZ  . ARG F  1 24  ? -6.838  -17.514 104.025 1.00 33.81  ? 48  ARG F CZ  1 
ATOM   7782  N NH1 . ARG F  1 24  ? -6.640  -16.958 102.865 1.00 34.10  ? 48  ARG F NH1 1 
ATOM   7783  N NH2 . ARG F  1 24  ? -7.433  -18.686 104.111 1.00 34.56  ? 48  ARG F NH2 1 
ATOM   7784  N N   . LEU F  1 25  ? -5.705  -16.181 110.078 1.00 36.12  ? 49  LEU F N   1 
ATOM   7785  C CA  . LEU F  1 25  ? -6.775  -16.609 110.961 1.00 36.72  ? 49  LEU F CA  1 
ATOM   7786  C C   . LEU F  1 25  ? -7.927  -15.637 110.867 1.00 35.02  ? 49  LEU F C   1 
ATOM   7787  O O   . LEU F  1 25  ? -7.723  -14.469 110.931 1.00 34.07  ? 49  LEU F O   1 
ATOM   7788  C CB  . LEU F  1 25  ? -6.275  -16.638 112.390 1.00 38.72  ? 49  LEU F CB  1 
ATOM   7789  C CG  . LEU F  1 25  ? -5.141  -17.649 112.633 1.00 42.12  ? 49  LEU F CG  1 
ATOM   7790  C CD1 . LEU F  1 25  ? -4.358  -17.268 113.872 1.00 41.55  ? 49  LEU F CD1 1 
ATOM   7791  C CD2 . LEU F  1 25  ? -5.703  -19.090 112.765 1.00 45.25  ? 49  LEU F CD2 1 
ATOM   7792  N N   . SER F  1 26  ? -9.151  -16.124 110.756 1.00 34.70  ? 50  SER F N   1 
ATOM   7793  C CA  . SER F  1 26  ? -10.288 -15.247 110.613 1.00 34.53  ? 50  SER F CA  1 
ATOM   7794  C C   . SER F  1 26  ? -11.410 -15.565 111.587 1.00 34.69  ? 50  SER F C   1 
ATOM   7795  O O   . SER F  1 26  ? -11.523 -16.687 112.110 1.00 34.73  ? 50  SER F O   1 
ATOM   7796  C CB  . SER F  1 26  ? -10.778 -15.258 109.179 1.00 35.21  ? 50  SER F CB  1 
ATOM   7797  O OG  . SER F  1 26  ? -9.806  -14.599 108.358 1.00 37.12  ? 50  SER F OG  1 
ATOM   7798  N N   . ARG F  1 27  ? -12.161 -14.515 111.906 1.00 34.52  ? 51  ARG F N   1 
ATOM   7799  C CA  . ARG F  1 27  ? -13.464 -14.640 112.527 1.00 34.60  ? 51  ARG F CA  1 
ATOM   7800  C C   . ARG F  1 27  ? -14.390 -13.606 111.931 1.00 34.01  ? 51  ARG F C   1 
ATOM   7801  O O   . ARG F  1 27  ? -13.931 -12.583 111.331 1.00 31.19  ? 51  ARG F O   1 
ATOM   7802  C CB  . ARG F  1 27  ? -13.407 -14.457 114.046 1.00 35.65  ? 51  ARG F CB  1 
ATOM   7803  C CG  . ARG F  1 27  ? -13.035 -13.048 114.500 1.00 37.27  ? 51  ARG F CG  1 
ATOM   7804  C CD  . ARG F  1 27  ? -12.666 -13.014 115.961 1.00 39.17  ? 51  ARG F CD  1 
ATOM   7805  N NE  . ARG F  1 27  ? -13.889 -13.071 116.765 1.00 40.35  ? 51  ARG F NE  1 
ATOM   7806  C CZ  . ARG F  1 27  ? -14.460 -12.020 117.337 1.00 39.67  ? 51  ARG F CZ  1 
ATOM   7807  N NH1 . ARG F  1 27  ? -15.559 -12.212 118.000 1.00 41.03  ? 51  ARG F NH1 1 
ATOM   7808  N NH2 . ARG F  1 27  ? -13.970 -10.782 117.239 1.00 38.95  ? 51  ARG F NH2 1 
ATOM   7809  N N   . THR F  1 28  ? -15.681 -13.868 112.170 1.00 34.71  ? 52  THR F N   1 
ATOM   7810  C CA  . THR F  1 28  ? -16.750 -12.997 111.750 1.00 36.40  ? 52  THR F CA  1 
ATOM   7811  C C   . THR F  1 28  ? -17.745 -12.703 112.878 1.00 36.28  ? 52  THR F C   1 
ATOM   7812  O O   . THR F  1 28  ? -18.140 -13.595 113.622 1.00 40.62  ? 52  THR F O   1 
ATOM   7813  C CB  . THR F  1 28  ? -17.466 -13.604 110.525 1.00 37.50  ? 52  THR F CB  1 
ATOM   7814  O OG1 . THR F  1 28  ? -16.510 -13.819 109.465 1.00 37.48  ? 52  THR F OG1 1 
ATOM   7815  C CG2 . THR F  1 28  ? -18.497 -12.655 110.026 1.00 37.96  ? 52  THR F CG2 1 
ATOM   7816  N N   . PHE F  1 29  ? -18.152 -11.453 113.008 1.00 34.84  ? 53  PHE F N   1 
ATOM   7817  C CA  . PHE F  1 29  ? -19.244 -11.087 113.916 1.00 33.85  ? 53  PHE F CA  1 
ATOM   7818  C C   . PHE F  1 29  ? -20.178 -10.032 113.337 1.00 32.86  ? 53  PHE F C   1 
ATOM   7819  O O   . PHE F  1 29  ? -19.928 -9.444  112.315 1.00 31.37  ? 53  PHE F O   1 
ATOM   7820  C CB  . PHE F  1 29  ? -18.698 -10.651 115.272 1.00 33.29  ? 53  PHE F CB  1 
ATOM   7821  C CG  . PHE F  1 29  ? -17.683 -9.541  115.210 1.00 35.15  ? 53  PHE F CG  1 
ATOM   7822  C CD1 . PHE F  1 29  ? -18.057 -8.223  115.373 1.00 33.82  ? 53  PHE F CD1 1 
ATOM   7823  C CD2 . PHE F  1 29  ? -16.305 -9.823  114.996 1.00 36.89  ? 53  PHE F CD2 1 
ATOM   7824  C CE1 . PHE F  1 29  ? -17.116 -7.213  115.306 1.00 33.73  ? 53  PHE F CE1 1 
ATOM   7825  C CE2 . PHE F  1 29  ? -15.362 -8.805  114.925 1.00 34.76  ? 53  PHE F CE2 1 
ATOM   7826  C CZ  . PHE F  1 29  ? -15.780 -7.500  115.086 1.00 34.59  ? 53  PHE F CZ  1 
ATOM   7827  N N   . GLY F  1 30  ? -21.291 -9.838  114.014 1.00 34.00  ? 54  GLY F N   1 
ATOM   7828  C CA  . GLY F  1 30  ? -22.337 -8.900  113.605 1.00 33.62  ? 54  GLY F CA  1 
ATOM   7829  C C   . GLY F  1 30  ? -22.052 -7.540  114.178 1.00 33.40  ? 54  GLY F C   1 
ATOM   7830  O O   . GLY F  1 30  ? -21.480 -7.455  115.232 1.00 32.15  ? 54  GLY F O   1 
ATOM   7831  N N   . TYR F  1 31  ? -22.396 -6.482  113.454 1.00 34.21  ? 55  TYR F N   1 
ATOM   7832  C CA  . TYR F  1 31  ? -22.440 -5.143  114.018 1.00 36.04  ? 55  TYR F CA  1 
ATOM   7833  C C   . TYR F  1 31  ? -23.647 -4.402  113.472 1.00 37.27  ? 55  TYR F C   1 
ATOM   7834  O O   . TYR F  1 31  ? -23.715 -4.147  112.266 1.00 37.73  ? 55  TYR F O   1 
ATOM   7835  C CB  . TYR F  1 31  ? -21.181 -4.382  113.644 1.00 37.17  ? 55  TYR F CB  1 
ATOM   7836  C CG  . TYR F  1 31  ? -21.125 -2.898  114.053 1.00 38.94  ? 55  TYR F CG  1 
ATOM   7837  C CD1 . TYR F  1 31  ? -21.280 -2.518  115.371 1.00 39.59  ? 55  TYR F CD1 1 
ATOM   7838  C CD2 . TYR F  1 31  ? -20.850 -1.891  113.111 1.00 39.79  ? 55  TYR F CD2 1 
ATOM   7839  C CE1 . TYR F  1 31  ? -21.191 -1.197  115.753 1.00 41.72  ? 55  TYR F CE1 1 
ATOM   7840  C CE2 . TYR F  1 31  ? -20.755 -0.555  113.485 1.00 40.44  ? 55  TYR F CE2 1 
ATOM   7841  C CZ  . TYR F  1 31  ? -20.942 -0.209  114.809 1.00 42.12  ? 55  TYR F CZ  1 
ATOM   7842  O OH  . TYR F  1 31  ? -20.878 1.106   115.230 1.00 41.10  ? 55  TYR F OH  1 
ATOM   7843  N N   . THR F  1 32  ? -24.580 -4.017  114.335 1.00 37.68  ? 56  THR F N   1 
ATOM   7844  C CA  . THR F  1 32  ? -25.739 -3.240  113.881 1.00 39.57  ? 56  THR F CA  1 
ATOM   7845  C C   . THR F  1 32  ? -25.635 -1.792  114.352 1.00 39.66  ? 56  THR F C   1 
ATOM   7846  O O   . THR F  1 32  ? -25.428 -1.591  115.505 1.00 41.90  ? 56  THR F O   1 
ATOM   7847  C CB  . THR F  1 32  ? -27.001 -3.935  114.423 1.00 41.57  ? 56  THR F CB  1 
ATOM   7848  O OG1 . THR F  1 32  ? -26.891 -5.324  114.119 1.00 44.76  ? 56  THR F OG1 1 
ATOM   7849  C CG2 . THR F  1 32  ? -28.282 -3.475  113.773 1.00 43.14  ? 56  THR F CG2 1 
ATOM   7850  N N   . ILE F  1 33  ? -25.750 -0.800  113.467 1.00 39.33  ? 57  ILE F N   1 
ATOM   7851  C CA  . ILE F  1 33  ? -25.997 0.592   113.868 1.00 39.12  ? 57  ILE F CA  1 
ATOM   7852  C C   . ILE F  1 33  ? -27.481 0.837   113.876 1.00 39.69  ? 57  ILE F C   1 
ATOM   7853  O O   . ILE F  1 33  ? -28.081 0.852   112.844 1.00 41.67  ? 57  ILE F O   1 
ATOM   7854  C CB  . ILE F  1 33  ? -25.335 1.565   112.897 1.00 39.16  ? 57  ILE F CB  1 
ATOM   7855  C CG1 . ILE F  1 33  ? -23.823 1.407   112.968 1.00 38.79  ? 57  ILE F CG1 1 
ATOM   7856  C CG2 . ILE F  1 33  ? -25.651 3.004   113.237 1.00 39.47  ? 57  ILE F CG2 1 
ATOM   7857  C CD1 . ILE F  1 33  ? -23.255 1.545   111.610 1.00 38.92  ? 57  ILE F CD1 1 
ATOM   7858  N N   . LYS F  1 34  ? -28.076 1.008   115.047 1.00 44.04  ? 58  LYS F N   1 
ATOM   7859  C CA  . LYS F  1 34  ? -29.527 1.235   115.186 1.00 46.54  ? 58  LYS F CA  1 
ATOM   7860  C C   . LYS F  1 34  ? -29.938 2.564   114.594 1.00 43.47  ? 58  LYS F C   1 
ATOM   7861  O O   . LYS F  1 34  ? -29.213 3.531   114.693 1.00 42.30  ? 58  LYS F O   1 
ATOM   7862  C CB  . LYS F  1 34  ? -30.014 1.171   116.643 1.00 51.18  ? 58  LYS F CB  1 
ATOM   7863  C CG  . LYS F  1 34  ? -29.954 -0.222  117.271 1.00 58.46  ? 58  LYS F CG  1 
ATOM   7864  C CD  . LYS F  1 34  ? -31.311 -0.763  117.786 1.00 64.56  ? 58  LYS F CD  1 
ATOM   7865  C CE  . LYS F  1 34  ? -32.224 -1.363  116.677 1.00 65.65  ? 58  LYS F CE  1 
ATOM   7866  N NZ  . LYS F  1 34  ? -32.087 -2.852  116.498 1.00 63.92  ? 58  LYS F NZ  1 
ATOM   7867  N N   . ARG F  1 35  ? -31.131 2.567   113.998 1.00 43.95  ? 59  ARG F N   1 
ATOM   7868  C CA  . ARG F  1 35  ? -31.713 3.688   113.281 1.00 44.07  ? 59  ARG F CA  1 
ATOM   7869  C C   . ARG F  1 35  ? -32.016 4.796   114.253 1.00 42.20  ? 59  ARG F C   1 
ATOM   7870  O O   . ARG F  1 35  ? -32.426 4.524   115.350 1.00 37.19  ? 59  ARG F O   1 
ATOM   7871  C CB  . ARG F  1 35  ? -32.956 3.231   112.483 1.00 48.98  ? 59  ARG F CB  1 
ATOM   7872  C CG  . ARG F  1 35  ? -34.382 3.466   113.040 1.00 56.79  ? 59  ARG F CG  1 
ATOM   7873  C CD  . ARG F  1 35  ? -35.035 2.345   113.833 1.00 60.36  ? 59  ARG F CD  1 
ATOM   7874  N NE  . ARG F  1 35  ? -35.492 1.239   112.989 1.00 68.24  ? 59  ARG F NE  1 
ATOM   7875  C CZ  . ARG F  1 35  ? -35.633 -0.043  113.390 1.00 73.53  ? 59  ARG F CZ  1 
ATOM   7876  N NH1 . ARG F  1 35  ? -35.368 -0.436  114.659 1.00 75.29  ? 59  ARG F NH1 1 
ATOM   7877  N NH2 . ARG F  1 35  ? -36.034 -0.966  112.501 1.00 71.83  ? 59  ARG F NH2 1 
ATOM   7878  N N   . THR F  1 36  ? -31.781 6.043   113.862 1.00 45.57  ? 60  THR F N   1 
ATOM   7879  C CA  . THR F  1 36  ? -32.188 7.188   114.659 1.00 49.90  ? 60  THR F CA  1 
ATOM   7880  C C   . THR F  1 36  ? -33.230 8.003   113.979 1.00 49.39  ? 60  THR F C   1 
ATOM   7881  O O   . THR F  1 36  ? -33.532 7.854   112.826 1.00 44.41  ? 60  THR F O   1 
ATOM   7882  C CB  . THR F  1 36  ? -31.027 8.180   114.960 1.00 57.04  ? 60  THR F CB  1 
ATOM   7883  O OG1 . THR F  1 36  ? -30.317 8.502   113.742 1.00 55.62  ? 60  THR F OG1 1 
ATOM   7884  C CG2 . THR F  1 36  ? -30.102 7.627   116.122 1.00 61.62  ? 60  THR F CG2 1 
ATOM   7885  N N   . THR F  1 37  ? -33.768 8.894   114.780 1.00 56.69  ? 61  THR F N   1 
ATOM   7886  C CA  . THR F  1 37  ? -34.683 9.930   114.359 1.00 60.67  ? 61  THR F CA  1 
ATOM   7887  C C   . THR F  1 37  ? -34.088 11.356  114.523 1.00 60.69  ? 61  THR F C   1 
ATOM   7888  O O   . THR F  1 37  ? -34.737 12.317  114.131 1.00 68.63  ? 61  THR F O   1 
ATOM   7889  C CB  . THR F  1 37  ? -36.021 9.737   115.121 1.00 61.42  ? 61  THR F CB  1 
ATOM   7890  O OG1 . THR F  1 37  ? -35.777 9.136   116.421 1.00 58.58  ? 61  THR F OG1 1 
ATOM   7891  C CG2 . THR F  1 37  ? -36.924 8.806   114.289 1.00 62.63  ? 61  THR F CG2 1 
ATOM   7892  N N   . VAL F  1 38  ? -32.870 11.496  115.060 1.00 55.46  ? 62  VAL F N   1 
ATOM   7893  C CA  . VAL F  1 38  ? -32.111 12.743  114.944 1.00 56.73  ? 62  VAL F CA  1 
ATOM   7894  C C   . VAL F  1 38  ? -32.116 13.161  113.439 1.00 61.09  ? 62  VAL F C   1 
ATOM   7895  O O   . VAL F  1 38  ? -31.902 12.326  112.553 1.00 61.95  ? 62  VAL F O   1 
ATOM   7896  C CB  . VAL F  1 38  ? -30.641 12.597  115.438 1.00 56.79  ? 62  VAL F CB  1 
ATOM   7897  C CG1 . VAL F  1 38  ? -30.033 13.955  115.639 1.00 56.81  ? 62  VAL F CG1 1 
ATOM   7898  C CG2 . VAL F  1 38  ? -30.449 11.770  116.727 1.00 54.50  ? 62  VAL F CG2 1 
ATOM   7899  N N   . LYS F  1 39  ? -32.422 14.416  113.122 1.00 65.52  ? 63  LYS F N   1 
ATOM   7900  C CA  . LYS F  1 39  ? -32.691 14.774  111.684 1.00 71.57  ? 63  LYS F CA  1 
ATOM   7901  C C   . LYS F  1 39  ? -31.391 15.220  111.013 1.00 67.02  ? 63  LYS F C   1 
ATOM   7902  O O   . LYS F  1 39  ? -31.068 14.851  109.860 1.00 59.00  ? 63  LYS F O   1 
ATOM   7903  C CB  . LYS F  1 39  ? -33.826 15.839  111.486 1.00 78.54  ? 63  LYS F CB  1 
ATOM   7904  C CG  . LYS F  1 39  ? -34.073 16.844  112.618 1.00 78.54  ? 63  LYS F CG  1 
ATOM   7905  C CD  . LYS F  1 39  ? -35.070 16.280  113.603 1.00 81.76  ? 63  LYS F CD  1 
ATOM   7906  C CE  . LYS F  1 39  ? -34.644 16.514  115.048 1.00 84.69  ? 63  LYS F CE  1 
ATOM   7907  N NZ  . LYS F  1 39  ? -35.564 15.710  115.908 1.00 85.00  ? 63  LYS F NZ  1 
ATOM   7908  N N   . THR F  1 40  ? -30.643 16.008  111.775 1.00 63.07  ? 64  THR F N   1 
ATOM   7909  C CA  . THR F  1 40  ? -29.346 16.484  111.340 1.00 63.38  ? 64  THR F CA  1 
ATOM   7910  C C   . THR F  1 40  ? -28.309 15.349  111.442 1.00 54.66  ? 64  THR F C   1 
ATOM   7911  O O   . THR F  1 40  ? -28.442 14.491  112.320 1.00 54.58  ? 64  THR F O   1 
ATOM   7912  C CB  . THR F  1 40  ? -28.893 17.689  112.207 1.00 66.77  ? 64  THR F CB  1 
ATOM   7913  O OG1 . THR F  1 40  ? -28.642 17.233  113.536 1.00 65.34  ? 64  THR F OG1 1 
ATOM   7914  C CG2 . THR F  1 40  ? -29.993 18.841  112.232 1.00 70.22  ? 64  THR F CG2 1 
ATOM   7915  N N   . PRO F  1 41  ? -27.258 15.379  110.602 1.00 47.88  ? 65  PRO F N   1 
ATOM   7916  C CA  . PRO F  1 41  ? -26.237 14.348  110.595 1.00 45.89  ? 65  PRO F CA  1 
ATOM   7917  C C   . PRO F  1 41  ? -25.588 14.148  111.935 1.00 41.98  ? 65  PRO F C   1 
ATOM   7918  O O   . PRO F  1 41  ? -25.326 15.125  112.623 1.00 43.23  ? 65  PRO F O   1 
ATOM   7919  C CB  . PRO F  1 41  ? -25.172 14.871  109.631 1.00 46.79  ? 65  PRO F CB  1 
ATOM   7920  C CG  . PRO F  1 41  ? -25.828 15.941  108.879 1.00 49.72  ? 65  PRO F CG  1 
ATOM   7921  C CD  . PRO F  1 41  ? -26.800 16.551  109.847 1.00 51.23  ? 65  PRO F CD  1 
ATOM   7922  N N   . SER F  1 42  ? -25.289 12.884  112.225 1.00 38.23  ? 66  SER F N   1 
ATOM   7923  C CA  . SER F  1 42  ? -24.797 12.404  113.483 1.00 37.63  ? 66  SER F CA  1 
ATOM   7924  C C   . SER F  1 42  ? -24.027 11.061  113.256 1.00 36.68  ? 66  SER F C   1 
ATOM   7925  O O   . SER F  1 42  ? -24.270 10.325  112.292 1.00 34.29  ? 66  SER F O   1 
ATOM   7926  C CB  . SER F  1 42  ? -25.963 12.195  114.449 1.00 40.04  ? 66  SER F CB  1 
ATOM   7927  O OG  . SER F  1 42  ? -26.776 11.028  114.154 1.00 41.66  ? 66  SER F OG  1 
ATOM   7928  N N   . TRP F  1 43  ? -23.089 10.747  114.145 1.00 35.21  ? 67  TRP F N   1 
ATOM   7929  C CA  . TRP F  1 43  ? -22.197 9.627   113.903 1.00 34.35  ? 67  TRP F CA  1 
ATOM   7930  C C   . TRP F  1 43  ? -22.198 8.680   115.093 1.00 33.22  ? 67  TRP F C   1 
ATOM   7931  O O   . TRP F  1 43  ? -22.170 9.113   116.255 1.00 31.84  ? 67  TRP F O   1 
ATOM   7932  C CB  . TRP F  1 43  ? -20.784 10.118  113.548 1.00 34.49  ? 67  TRP F CB  1 
ATOM   7933  C CG  . TRP F  1 43  ? -20.669 10.573  112.066 1.00 34.90  ? 67  TRP F CG  1 
ATOM   7934  C CD1 . TRP F  1 43  ? -20.161 9.875   111.048 1.00 33.90  ? 67  TRP F CD1 1 
ATOM   7935  C CD2 . TRP F  1 43  ? -21.102 11.826  111.510 1.00 34.42  ? 67  TRP F CD2 1 
ATOM   7936  N NE1 . TRP F  1 43  ? -20.223 10.607  109.889 1.00 33.44  ? 67  TRP F NE1 1 
ATOM   7937  C CE2 . TRP F  1 43  ? -20.804 11.802  110.152 1.00 33.68  ? 67  TRP F CE2 1 
ATOM   7938  C CE3 . TRP F  1 43  ? -21.687 12.984  112.050 1.00 33.60  ? 67  TRP F CE3 1 
ATOM   7939  C CZ2 . TRP F  1 43  ? -21.093 12.862  109.317 1.00 34.48  ? 67  TRP F CZ2 1 
ATOM   7940  C CZ3 . TRP F  1 43  ? -21.966 14.028  111.230 1.00 32.53  ? 67  TRP F CZ3 1 
ATOM   7941  C CH2 . TRP F  1 43  ? -21.686 13.972  109.881 1.00 33.34  ? 67  TRP F CH2 1 
ATOM   7942  N N   . ALA F  1 44  ? -22.286 7.395   114.780 1.00 31.73  ? 68  ALA F N   1 
ATOM   7943  C CA  . ALA F  1 44  ? -22.076 6.371   115.771 1.00 32.98  ? 68  ALA F CA  1 
ATOM   7944  C C   . ALA F  1 44  ? -20.597 5.955   115.768 1.00 31.70  ? 68  ALA F C   1 
ATOM   7945  O O   . ALA F  1 44  ? -20.113 5.310   114.824 1.00 28.77  ? 68  ALA F O   1 
ATOM   7946  C CB  . ALA F  1 44  ? -22.981 5.158   115.540 1.00 34.14  ? 68  ALA F CB  1 
ATOM   7947  N N   . VAL F  1 45  ? -19.942 6.302   116.885 1.00 31.01  ? 69  VAL F N   1 
ATOM   7948  C CA  . VAL F  1 45  ? -18.539 6.147   117.065 1.00 30.94  ? 69  VAL F CA  1 
ATOM   7949  C C   . VAL F  1 45  ? -18.227 4.899   117.899 1.00 31.38  ? 69  VAL F C   1 
ATOM   7950  O O   . VAL F  1 45  ? -18.812 4.659   118.952 1.00 30.67  ? 69  VAL F O   1 
ATOM   7951  C CB  . VAL F  1 45  ? -17.957 7.395   117.758 1.00 31.25  ? 69  VAL F CB  1 
ATOM   7952  C CG1 . VAL F  1 45  ? -16.462 7.197   117.989 1.00 31.94  ? 69  VAL F CG1 1 
ATOM   7953  C CG2 . VAL F  1 45  ? -18.222 8.687   116.969 1.00 30.44  ? 69  VAL F CG2 1 
ATOM   7954  N N   . ASP F  1 46  ? -17.260 4.121   117.456 1.00 32.20  ? 70  ASP F N   1 
ATOM   7955  C CA  . ASP F  1 46  ? -16.912 2.921   118.160 1.00 33.45  ? 70  ASP F CA  1 
ATOM   7956  C C   . ASP F  1 46  ? -15.476 2.582   117.854 1.00 34.73  ? 70  ASP F C   1 
ATOM   7957  O O   . ASP F  1 46  ? -14.739 3.382   117.322 1.00 33.76  ? 70  ASP F O   1 
ATOM   7958  C CB  . ASP F  1 46  ? -17.882 1.813   117.763 1.00 34.44  ? 70  ASP F CB  1 
ATOM   7959  C CG  . ASP F  1 46  ? -18.299 0.901   118.958 1.00 36.02  ? 70  ASP F CG  1 
ATOM   7960  O OD1 . ASP F  1 46  ? -17.418 0.571   119.800 1.00 34.13  ? 70  ASP F OD1 1 
ATOM   7961  O OD2 . ASP F  1 46  ? -19.515 0.491   119.013 1.00 38.84  ? 70  ASP F OD2 1 
ATOM   7962  N N   . MET F  1 47  ? -15.068 1.387   118.208 1.00 38.83  ? 71  MET F N   1 
ATOM   7963  C CA  . MET F  1 47  ? -13.680 1.016   118.177 1.00 41.05  ? 71  MET F CA  1 
ATOM   7964  C C   . MET F  1 47  ? -13.617 -0.498  118.091 1.00 40.58  ? 71  MET F C   1 
ATOM   7965  O O   . MET F  1 47  ? -14.641 -1.199  118.145 1.00 41.53  ? 71  MET F O   1 
ATOM   7966  C CB  . MET F  1 47  ? -13.041 1.456   119.440 1.00 44.12  ? 71  MET F CB  1 
ATOM   7967  C CG  . MET F  1 47  ? -13.725 0.747   120.563 1.00 48.77  ? 71  MET F CG  1 
ATOM   7968  S SD  . MET F  1 47  ? -12.989 1.343   122.031 1.00 65.38  ? 71  MET F SD  1 
ATOM   7969  C CE  . MET F  1 47  ? -14.024 2.761   122.496 1.00 57.84  ? 71  MET F CE  1 
ATOM   7970  N N   . MET F  1 48  ? -12.393 -0.979  117.956 1.00 40.36  ? 72  MET F N   1 
ATOM   7971  C CA  . MET F  1 48  ? -12.093 -2.359  117.647 1.00 39.45  ? 72  MET F CA  1 
ATOM   7972  C C   . MET F  1 48  ? -10.693 -2.682  118.106 1.00 37.05  ? 72  MET F C   1 
ATOM   7973  O O   . MET F  1 48  ? -9.734  -2.019  117.662 1.00 34.16  ? 72  MET F O   1 
ATOM   7974  C CB  . MET F  1 48  ? -12.143 -2.585  116.121 1.00 42.46  ? 72  MET F CB  1 
ATOM   7975  C CG  . MET F  1 48  ? -13.386 -3.327  115.661 1.00 44.89  ? 72  MET F CG  1 
ATOM   7976  S SD  . MET F  1 48  ? -13.115 -3.970  114.020 1.00 44.44  ? 72  MET F SD  1 
ATOM   7977  C CE  . MET F  1 48  ? -13.586 -2.457  113.239 1.00 47.92  ? 72  MET F CE  1 
ATOM   7978  N N   . ARG F  1 49  ? -10.604 -3.713  118.955 1.00 36.35  ? 73  ARG F N   1 
ATOM   7979  C CA  . ARG F  1 49  ? -9.351  -4.338  119.335 1.00 36.22  ? 73  ARG F CA  1 
ATOM   7980  C C   . ARG F  1 49  ? -9.268  -5.716  118.805 1.00 34.63  ? 73  ARG F C   1 
ATOM   7981  O O   . ARG F  1 49  ? -10.266 -6.321  118.521 1.00 35.67  ? 73  ARG F O   1 
ATOM   7982  C CB  . ARG F  1 49  ? -9.242  -4.342  120.820 1.00 38.52  ? 73  ARG F CB  1 
ATOM   7983  C CG  . ARG F  1 49  ? -9.154  -2.912  121.369 1.00 40.70  ? 73  ARG F CG  1 
ATOM   7984  C CD  . ARG F  1 49  ? -8.482  -2.921  122.726 1.00 41.71  ? 73  ARG F CD  1 
ATOM   7985  N NE  . ARG F  1 49  ? -8.590  -1.661  123.396 1.00 42.67  ? 73  ARG F NE  1 
ATOM   7986  C CZ  . ARG F  1 49  ? -9.718  -1.206  123.944 1.00 42.54  ? 73  ARG F CZ  1 
ATOM   7987  N NH1 . ARG F  1 49  ? -9.736  -0.004  124.526 1.00 44.38  ? 73  ARG F NH1 1 
ATOM   7988  N NH2 . ARG F  1 49  ? -10.832 -1.899  123.859 1.00 40.15  ? 73  ARG F NH2 1 
ATOM   7989  N N   . PHE F  1 50  ? -8.053  -6.207  118.639 1.00 35.62  ? 74  PHE F N   1 
ATOM   7990  C CA  . PHE F  1 50  ? -7.819  -7.566  118.136 1.00 34.90  ? 74  PHE F CA  1 
ATOM   7991  C C   . PHE F  1 50  ? -7.029  -8.398  119.145 1.00 34.23  ? 74  PHE F C   1 
ATOM   7992  O O   . PHE F  1 50  ? -5.973  -7.976  119.609 1.00 35.12  ? 74  PHE F O   1 
ATOM   7993  C CB  . PHE F  1 50  ? -7.073  -7.506  116.857 1.00 35.33  ? 74  PHE F CB  1 
ATOM   7994  C CG  . PHE F  1 50  ? -7.515  -6.423  115.988 1.00 34.99  ? 74  PHE F CG  1 
ATOM   7995  C CD1 . PHE F  1 50  ? -8.699  -6.496  115.368 1.00 35.20  ? 74  PHE F CD1 1 
ATOM   7996  C CD2 . PHE F  1 50  ? -6.728  -5.305  115.825 1.00 36.23  ? 74  PHE F CD2 1 
ATOM   7997  C CE1 . PHE F  1 50  ? -9.124  -5.453  114.568 1.00 37.34  ? 74  PHE F CE1 1 
ATOM   7998  C CE2 . PHE F  1 50  ? -7.138  -4.257  115.040 1.00 35.87  ? 74  PHE F CE2 1 
ATOM   7999  C CZ  . PHE F  1 50  ? -8.336  -4.324  114.391 1.00 35.87  ? 74  PHE F CZ  1 
ATOM   8000  N N   . ASN F  1 51  ? -7.584  -9.554  119.511 1.00 32.58  ? 75  ASN F N   1 
ATOM   8001  C CA  . ASN F  1 51  ? -6.985  -10.462 120.475 1.00 30.71  ? 75  ASN F CA  1 
ATOM   8002  C C   . ASN F  1 51  ? -6.989  -11.908 119.911 1.00 31.25  ? 75  ASN F C   1 
ATOM   8003  O O   . ASN F  1 51  ? -8.022  -12.434 119.451 1.00 28.96  ? 75  ASN F O   1 
ATOM   8004  C CB  . ASN F  1 51  ? -7.715  -10.354 121.812 1.00 28.89  ? 75  ASN F CB  1 
ATOM   8005  C CG  . ASN F  1 51  ? -6.901  -10.919 122.950 1.00 28.28  ? 75  ASN F CG  1 
ATOM   8006  O OD1 . ASN F  1 51  ? -6.797  -12.113 123.087 1.00 28.53  ? 75  ASN F OD1 1 
ATOM   8007  N ND2 . ASN F  1 51  ? -6.306  -10.062 123.757 1.00 27.61  ? 75  ASN F ND2 1 
ATOM   8008  N N   . ILE F  1 52  ? -5.817  -12.548 119.967 1.00 32.80  ? 76  ILE F N   1 
ATOM   8009  C CA  . ILE F  1 52  ? -5.636  -13.860 119.361 1.00 33.45  ? 76  ILE F CA  1 
ATOM   8010  C C   . ILE F  1 52  ? -6.476  -14.918 120.068 1.00 34.72  ? 76  ILE F C   1 
ATOM   8011  O O   . ILE F  1 52  ? -6.730  -15.980 119.481 1.00 33.82  ? 76  ILE F O   1 
ATOM   8012  C CB  . ILE F  1 52  ? -4.161  -14.241 119.273 1.00 34.22  ? 76  ILE F CB  1 
ATOM   8013  C CG1 . ILE F  1 52  ? -3.930  -15.368 118.282 1.00 34.73  ? 76  ILE F CG1 1 
ATOM   8014  C CG2 . ILE F  1 52  ? -3.601  -14.669 120.623 1.00 35.72  ? 76  ILE F CG2 1 
ATOM   8015  C CD1 . ILE F  1 52  ? -2.544  -15.275 117.677 1.00 35.00  ? 76  ILE F CD1 1 
ATOM   8016  N N   . ASN F  1 53  ? -6.956  -14.635 121.292 1.00 36.18  ? 77  ASN F N   1 
ATOM   8017  C CA  . ASN F  1 53  ? -7.915  -15.547 121.988 1.00 37.42  ? 77  ASN F CA  1 
ATOM   8018  C C   . ASN F  1 53  ? -9.125  -15.836 121.118 1.00 36.05  ? 77  ASN F C   1 
ATOM   8019  O O   . ASN F  1 53  ? -9.624  -16.932 121.079 1.00 35.03  ? 77  ASN F O   1 
ATOM   8020  C CB  . ASN F  1 53  ? -8.425  -14.903 123.281 1.00 40.08  ? 77  ASN F CB  1 
ATOM   8021  C CG  . ASN F  1 53  ? -7.347  -14.773 124.354 1.00 41.14  ? 77  ASN F CG  1 
ATOM   8022  O OD1 . ASN F  1 53  ? -6.313  -15.506 124.323 1.00 40.97  ? 77  ASN F OD1 1 
ATOM   8023  N ND2 . ASN F  1 53  ? -7.561  -13.816 125.292 1.00 37.31  ? 77  ASN F ND2 1 
ATOM   8024  N N   . ASP F  1 54  ? -9.562  -14.826 120.391 1.00 34.73  ? 78  ASP F N   1 
ATOM   8025  C CA  . ASP F  1 54  ? -10.712 -14.963 119.567 1.00 34.69  ? 78  ASP F CA  1 
ATOM   8026  C C   . ASP F  1 54  ? -10.444 -15.651 118.251 1.00 32.16  ? 78  ASP F C   1 
ATOM   8027  O O   . ASP F  1 54  ? -11.339 -15.811 117.446 1.00 30.06  ? 78  ASP F O   1 
ATOM   8028  C CB  . ASP F  1 54  ? -11.318 -13.568 119.298 1.00 38.10  ? 78  ASP F CB  1 
ATOM   8029  C CG  . ASP F  1 54  ? -11.709 -12.808 120.600 1.00 39.63  ? 78  ASP F CG  1 
ATOM   8030  O OD1 . ASP F  1 54  ? -12.540 -13.343 121.363 1.00 42.90  ? 78  ASP F OD1 1 
ATOM   8031  O OD2 . ASP F  1 54  ? -11.204 -11.674 120.842 1.00 39.48  ? 78  ASP F OD2 1 
ATOM   8032  N N   . PHE F  1 55  ? -9.212  -16.012 117.981 1.00 32.41  ? 79  PHE F N   1 
ATOM   8033  C CA  . PHE F  1 55  ? -8.843  -16.536 116.641 1.00 33.10  ? 79  PHE F CA  1 
ATOM   8034  C C   . PHE F  1 55  ? -8.307  -17.937 116.690 1.00 33.13  ? 79  PHE F C   1 
ATOM   8035  O O   . PHE F  1 55  ? -8.440  -18.662 115.771 1.00 32.72  ? 79  PHE F O   1 
ATOM   8036  C CB  . PHE F  1 55  ? -7.824  -15.599 115.920 1.00 32.43  ? 79  PHE F CB  1 
ATOM   8037  C CG  . PHE F  1 55  ? -8.369  -14.226 115.585 1.00 30.39  ? 79  PHE F CG  1 
ATOM   8038  C CD1 . PHE F  1 55  ? -8.406  -13.246 116.542 1.00 29.32  ? 79  PHE F CD1 1 
ATOM   8039  C CD2 . PHE F  1 55  ? -8.806  -13.936 114.318 1.00 30.66  ? 79  PHE F CD2 1 
ATOM   8040  C CE1 . PHE F  1 55  ? -8.901  -12.009 116.270 1.00 29.75  ? 79  PHE F CE1 1 
ATOM   8041  C CE2 . PHE F  1 55  ? -9.310  -12.699 114.026 1.00 30.74  ? 79  PHE F CE2 1 
ATOM   8042  C CZ  . PHE F  1 55  ? -9.338  -11.727 115.006 1.00 30.47  ? 79  PHE F CZ  1 
ATOM   8043  N N   . LEU F  1 56  ? -7.730  -18.303 117.792 1.00 37.61  ? 80  LEU F N   1 
ATOM   8044  C CA  . LEU F  1 56  ? -7.167  -19.619 118.028 1.00 42.29  ? 80  LEU F CA  1 
ATOM   8045  C C   . LEU F  1 56  ? -7.866  -20.266 119.237 1.00 43.82  ? 80  LEU F C   1 
ATOM   8046  O O   . LEU F  1 56  ? -7.595  -19.857 120.339 1.00 48.69  ? 80  LEU F O   1 
ATOM   8047  C CB  . LEU F  1 56  ? -5.725  -19.351 118.420 1.00 42.74  ? 80  LEU F CB  1 
ATOM   8048  C CG  . LEU F  1 56  ? -4.602  -20.101 117.859 1.00 44.19  ? 80  LEU F CG  1 
ATOM   8049  C CD1 . LEU F  1 56  ? -4.836  -20.168 116.370 1.00 46.91  ? 80  LEU F CD1 1 
ATOM   8050  C CD2 . LEU F  1 56  ? -3.383  -19.262 118.191 1.00 45.25  ? 80  LEU F CD2 1 
ATOM   8051  N N   . PRO F  1 57  ? -8.717  -21.286 119.071 1.00 44.71  ? 81  PRO F N   1 
ATOM   8052  C CA  . PRO F  1 57  ? -9.230  -21.927 120.287 1.00 45.84  ? 81  PRO F CA  1 
ATOM   8053  C C   . PRO F  1 57  ? -8.168  -22.711 121.069 1.00 46.93  ? 81  PRO F C   1 
ATOM   8054  O O   . PRO F  1 57  ? -7.049  -22.920 120.554 1.00 44.36  ? 81  PRO F O   1 
ATOM   8055  C CB  . PRO F  1 57  ? -10.262 -22.895 119.756 1.00 45.46  ? 81  PRO F CB  1 
ATOM   8056  C CG  . PRO F  1 57  ? -9.648  -23.344 118.497 1.00 46.08  ? 81  PRO F CG  1 
ATOM   8057  C CD  . PRO F  1 57  ? -8.977  -22.123 117.903 1.00 46.65  ? 81  PRO F CD  1 
ATOM   8058  N N   . PRO F  1 58  ? -8.509  -23.097 122.326 1.00 50.91  ? 82  PRO F N   1 
ATOM   8059  C CA  . PRO F  1 58  ? -7.766  -24.032 123.185 1.00 49.62  ? 82  PRO F CA  1 
ATOM   8060  C C   . PRO F  1 58  ? -7.386  -25.295 122.446 1.00 49.95  ? 82  PRO F C   1 
ATOM   8061  O O   . PRO F  1 58  ? -8.010  -25.613 121.449 1.00 50.81  ? 82  PRO F O   1 
ATOM   8062  C CB  . PRO F  1 58  ? -8.782  -24.356 124.261 1.00 49.81  ? 82  PRO F CB  1 
ATOM   8063  C CG  . PRO F  1 58  ? -9.486  -23.039 124.472 1.00 51.11  ? 82  PRO F CG  1 
ATOM   8064  C CD  . PRO F  1 58  ? -9.610  -22.449 123.086 1.00 52.28  ? 82  PRO F CD  1 
ATOM   8065  N N   . GLY F  1 59  ? -6.348  -25.988 122.911 1.00 51.26  ? 83  GLY F N   1 
ATOM   8066  C CA  . GLY F  1 59  ? -5.929  -27.272 122.350 1.00 52.34  ? 83  GLY F CA  1 
ATOM   8067  C C   . GLY F  1 59  ? -6.418  -28.429 123.207 1.00 54.63  ? 83  GLY F C   1 
ATOM   8068  O O   . GLY F  1 59  ? -7.452  -28.332 123.884 1.00 55.52  ? 83  GLY F O   1 
ATOM   8069  N N   . GLY F  1 60  ? -5.683  -29.535 123.165 1.00 57.70  ? 84  GLY F N   1 
ATOM   8070  C CA  . GLY F  1 60  ? -5.944  -30.688 124.037 1.00 56.79  ? 84  GLY F CA  1 
ATOM   8071  C C   . GLY F  1 60  ? -4.687  -31.229 124.684 1.00 56.59  ? 84  GLY F C   1 
ATOM   8072  O O   . GLY F  1 60  ? -3.570  -30.995 124.195 1.00 57.80  ? 84  GLY F O   1 
ATOM   8073  N N   . GLY F  1 61  ? -4.868  -31.963 125.779 1.00 55.42  ? 85  GLY F N   1 
ATOM   8074  C CA  . GLY F  1 61  ? -3.785  -32.716 126.413 1.00 54.57  ? 85  GLY F CA  1 
ATOM   8075  C C   . GLY F  1 61  ? -2.582  -31.837 126.728 1.00 54.80  ? 85  GLY F C   1 
ATOM   8076  O O   . GLY F  1 61  ? -2.725  -30.726 127.270 1.00 51.70  ? 85  GLY F O   1 
ATOM   8077  N N   . SER F  1 62  ? -1.397  -32.300 126.315 1.00 54.97  ? 86  SER F N   1 
ATOM   8078  C CA  . SER F  1 62  ? -0.133  -31.618 126.631 1.00 51.47  ? 86  SER F CA  1 
ATOM   8079  C C   . SER F  1 62  ? 0.188   -30.394 125.709 1.00 49.53  ? 86  SER F C   1 
ATOM   8080  O O   . SER F  1 62  ? 1.229   -29.663 125.910 1.00 45.53  ? 86  SER F O   1 
ATOM   8081  C CB  . SER F  1 62  ? 0.975   -32.662 126.617 1.00 52.63  ? 86  SER F CB  1 
ATOM   8082  O OG  . SER F  1 62  ? 0.760   -33.657 127.628 1.00 55.49  ? 86  SER F OG  1 
ATOM   8083  N N   . ASN F  1 63  ? -0.703  -30.182 124.712 1.00 47.37  ? 87  ASN F N   1 
ATOM   8084  C CA  . ASN F  1 63  ? -0.623  -29.067 123.734 1.00 45.89  ? 87  ASN F CA  1 
ATOM   8085  C C   . ASN F  1 63  ? -1.804  -28.090 123.948 1.00 47.23  ? 87  ASN F C   1 
ATOM   8086  O O   . ASN F  1 63  ? -2.827  -28.215 123.275 1.00 44.05  ? 87  ASN F O   1 
ATOM   8087  C CB  . ASN F  1 63  ? -0.589  -29.603 122.290 1.00 42.01  ? 87  ASN F CB  1 
ATOM   8088  C CG  . ASN F  1 63  ? 0.495   -30.642 122.080 1.00 40.66  ? 87  ASN F CG  1 
ATOM   8089  O OD1 . ASN F  1 63  ? 1.686   -30.341 122.190 1.00 41.53  ? 87  ASN F OD1 1 
ATOM   8090  N ND2 . ASN F  1 63  ? 0.098   -31.865 121.782 1.00 38.82  ? 87  ASN F ND2 1 
ATOM   8091  N N   . PRO F  1 64  ? -1.648  -27.086 124.876 1.00 50.77  ? 88  PRO F N   1 
ATOM   8092  C CA  . PRO F  1 64  ? -2.825  -26.338 125.291 1.00 48.40  ? 88  PRO F CA  1 
ATOM   8093  C C   . PRO F  1 64  ? -3.381  -25.425 124.214 1.00 47.54  ? 88  PRO F C   1 
ATOM   8094  O O   . PRO F  1 64  ? -4.463  -24.850 124.418 1.00 45.15  ? 88  PRO F O   1 
ATOM   8095  C CB  . PRO F  1 64  ? -2.328  -25.542 126.512 1.00 48.86  ? 88  PRO F CB  1 
ATOM   8096  C CG  . PRO F  1 64  ? -0.935  -26.000 126.796 1.00 48.99  ? 88  PRO F CG  1 
ATOM   8097  C CD  . PRO F  1 64  ? -0.437  -26.475 125.475 1.00 51.09  ? 88  PRO F CD  1 
ATOM   8098  N N   . ARG F  1 65  ? -2.669  -25.277 123.087 1.00 48.53  ? 89  ARG F N   1 
ATOM   8099  C CA  . ARG F  1 65  ? -3.114  -24.378 122.009 1.00 48.88  ? 89  ARG F CA  1 
ATOM   8100  C C   . ARG F  1 65  ? -3.212  -25.167 120.700 1.00 45.33  ? 89  ARG F C   1 
ATOM   8101  O O   . ARG F  1 65  ? -2.439  -26.090 120.448 1.00 49.70  ? 89  ARG F O   1 
ATOM   8102  C CB  . ARG F  1 65  ? -2.180  -23.170 121.923 1.00 51.65  ? 89  ARG F CB  1 
ATOM   8103  C CG  . ARG F  1 65  ? -2.066  -22.437 123.265 1.00 59.50  ? 89  ARG F CG  1 
ATOM   8104  C CD  . ARG F  1 65  ? -0.700  -21.842 123.589 1.00 63.10  ? 89  ARG F CD  1 
ATOM   8105  N NE  . ARG F  1 65  ? 0.326   -22.698 124.227 1.00 67.12  ? 89  ARG F NE  1 
ATOM   8106  C CZ  . ARG F  1 65  ? 0.720   -22.683 125.515 1.00 70.76  ? 89  ARG F CZ  1 
ATOM   8107  N NH1 . ARG F  1 65  ? 1.745   -23.450 125.883 1.00 76.21  ? 89  ARG F NH1 1 
ATOM   8108  N NH2 . ARG F  1 65  ? 0.136   -21.933 126.450 1.00 70.86  ? 89  ARG F NH2 1 
ATOM   8109  N N   . SER F  1 66  ? -4.171  -24.801 119.872 1.00 39.53  ? 90  SER F N   1 
ATOM   8110  C CA  . SER F  1 66  ? -4.443  -25.519 118.664 1.00 36.90  ? 90  SER F CA  1 
ATOM   8111  C C   . SER F  1 66  ? -3.374  -25.379 117.602 1.00 35.96  ? 90  SER F C   1 
ATOM   8112  O O   . SER F  1 66  ? -3.346  -26.207 116.671 1.00 35.95  ? 90  SER F O   1 
ATOM   8113  C CB  . SER F  1 66  ? -5.792  -25.088 118.100 1.00 36.76  ? 90  SER F CB  1 
ATOM   8114  O OG  . SER F  1 66  ? -6.039  -23.727 118.361 1.00 35.97  ? 90  SER F OG  1 
ATOM   8115  N N   . VAL F  1 67  ? -2.551  -24.324 117.667 1.00 34.46  ? 91  VAL F N   1 
ATOM   8116  C CA  . VAL F  1 67  ? -1.268  -24.377 116.963 1.00 35.30  ? 91  VAL F CA  1 
ATOM   8117  C C   . VAL F  1 67  ? -0.155  -24.586 117.977 1.00 35.21  ? 91  VAL F C   1 
ATOM   8118  O O   . VAL F  1 67  ? -0.038  -23.823 118.914 1.00 36.30  ? 91  VAL F O   1 
ATOM   8119  C CB  . VAL F  1 67  ? -0.944  -23.213 115.968 1.00 36.08  ? 91  VAL F CB  1 
ATOM   8120  C CG1 . VAL F  1 67  ? -2.201  -22.684 115.330 1.00 36.89  ? 91  VAL F CG1 1 
ATOM   8121  C CG2 . VAL F  1 67  ? -0.144  -22.077 116.571 1.00 36.47  ? 91  VAL F CG2 1 
ATOM   8122  N N   . PRO F  1 68  ? 0.683   -25.606 117.767 1.00 34.17  ? 92  PRO F N   1 
ATOM   8123  C CA  . PRO F  1 68  ? 1.764   -25.923 118.672 1.00 34.12  ? 92  PRO F CA  1 
ATOM   8124  C C   . PRO F  1 68  ? 3.031   -25.046 118.464 1.00 34.59  ? 92  PRO F C   1 
ATOM   8125  O O   . PRO F  1 68  ? 4.072   -25.539 117.981 1.00 37.72  ? 92  PRO F O   1 
ATOM   8126  C CB  . PRO F  1 68  ? 2.069   -27.350 118.270 1.00 34.20  ? 92  PRO F CB  1 
ATOM   8127  C CG  . PRO F  1 68  ? 1.939   -27.278 116.772 1.00 33.36  ? 92  PRO F CG  1 
ATOM   8128  C CD  . PRO F  1 68  ? 0.766   -26.404 116.527 1.00 33.10  ? 92  PRO F CD  1 
ATOM   8129  N N   . PHE F  1 69  ? 2.980   -23.774 118.835 1.00 33.27  ? 93  PHE F N   1 
ATOM   8130  C CA  . PHE F  1 69  ? 4.163   -22.922 118.742 1.00 32.49  ? 93  PHE F CA  1 
ATOM   8131  C C   . PHE F  1 69  ? 4.318   -22.083 119.979 1.00 31.78  ? 93  PHE F C   1 
ATOM   8132  O O   . PHE F  1 69  ? 3.324   -21.750 120.620 1.00 32.22  ? 93  PHE F O   1 
ATOM   8133  C CB  . PHE F  1 69  ? 4.053   -22.001 117.535 1.00 32.56  ? 93  PHE F CB  1 
ATOM   8134  C CG  . PHE F  1 69  ? 4.309   -22.661 116.259 1.00 31.95  ? 93  PHE F CG  1 
ATOM   8135  C CD1 . PHE F  1 69  ? 3.310   -23.267 115.598 1.00 32.05  ? 93  PHE F CD1 1 
ATOM   8136  C CD2 . PHE F  1 69  ? 5.571   -22.622 115.703 1.00 33.45  ? 93  PHE F CD2 1 
ATOM   8137  C CE1 . PHE F  1 69  ? 3.557   -23.877 114.398 1.00 33.69  ? 93  PHE F CE1 1 
ATOM   8138  C CE2 . PHE F  1 69  ? 5.845   -23.232 114.494 1.00 33.53  ? 93  PHE F CE2 1 
ATOM   8139  C CZ  . PHE F  1 69  ? 4.835   -23.868 113.842 1.00 33.54  ? 93  PHE F CZ  1 
ATOM   8140  N N   . GLU F  1 70  ? 5.556   -21.708 120.283 1.00 31.64  ? 94  GLU F N   1 
ATOM   8141  C CA  . GLU F  1 70  ? 5.835   -21.060 121.546 1.00 31.96  ? 94  GLU F CA  1 
ATOM   8142  C C   . GLU F  1 70  ? 5.582   -19.575 121.526 1.00 30.64  ? 94  GLU F C   1 
ATOM   8143  O O   . GLU F  1 70  ? 5.092   -18.994 122.509 1.00 28.41  ? 94  GLU F O   1 
ATOM   8144  C CB  . GLU F  1 70  ? 7.260   -21.347 121.972 1.00 33.01  ? 94  GLU F CB  1 
ATOM   8145  C CG  . GLU F  1 70  ? 7.521   -20.996 123.438 1.00 35.73  ? 94  GLU F CG  1 
ATOM   8146  C CD  . GLU F  1 70  ? 6.472   -21.590 124.427 1.00 38.09  ? 94  GLU F CD  1 
ATOM   8147  O OE1 . GLU F  1 70  ? 5.850   -20.823 125.248 1.00 37.08  ? 94  GLU F OE1 1 
ATOM   8148  O OE2 . GLU F  1 70  ? 6.294   -22.834 124.369 1.00 39.62  ? 94  GLU F OE2 1 
ATOM   8149  N N   . TYR F  1 71  ? 5.971   -18.960 120.418 1.00 30.92  ? 95  TYR F N   1 
ATOM   8150  C CA  . TYR F  1 71  ? 5.938   -17.485 120.272 1.00 31.82  ? 95  TYR F CA  1 
ATOM   8151  C C   . TYR F  1 71  ? 5.168   -17.062 119.048 1.00 31.12  ? 95  TYR F C   1 
ATOM   8152  O O   . TYR F  1 71  ? 5.004   -17.863 118.144 1.00 30.38  ? 95  TYR F O   1 
ATOM   8153  C CB  . TYR F  1 71  ? 7.336   -16.872 120.117 1.00 32.34  ? 95  TYR F CB  1 
ATOM   8154  C CG  . TYR F  1 71  ? 8.508   -17.580 120.809 1.00 32.45  ? 95  TYR F CG  1 
ATOM   8155  C CD1 . TYR F  1 71  ? 8.579   -17.735 122.205 1.00 32.28  ? 95  TYR F CD1 1 
ATOM   8156  C CD2 . TYR F  1 71  ? 9.577   -18.044 120.051 1.00 32.19  ? 95  TYR F CD2 1 
ATOM   8157  C CE1 . TYR F  1 71  ? 9.693   -18.380 122.801 1.00 32.12  ? 95  TYR F CE1 1 
ATOM   8158  C CE2 . TYR F  1 71  ? 10.669  -18.657 120.640 1.00 32.37  ? 95  TYR F CE2 1 
ATOM   8159  C CZ  . TYR F  1 71  ? 10.725  -18.837 122.001 1.00 31.68  ? 95  TYR F CZ  1 
ATOM   8160  O OH  . TYR F  1 71  ? 11.838  -19.480 122.473 1.00 31.60  ? 95  TYR F OH  1 
ATOM   8161  N N   . TYR F  1 72  ? 4.725   -15.801 119.006 1.00 31.01  ? 96  TYR F N   1 
ATOM   8162  C CA  . TYR F  1 72  ? 4.022   -15.280 117.810 1.00 30.78  ? 96  TYR F CA  1 
ATOM   8163  C C   . TYR F  1 72  ? 4.109   -13.772 117.759 1.00 29.79  ? 96  TYR F C   1 
ATOM   8164  O O   . TYR F  1 72  ? 4.409   -13.120 118.718 1.00 30.45  ? 96  TYR F O   1 
ATOM   8165  C CB  . TYR F  1 72  ? 2.529   -15.680 117.750 1.00 30.53  ? 96  TYR F CB  1 
ATOM   8166  C CG  . TYR F  1 72  ? 1.663   -14.752 118.613 1.00 30.97  ? 96  TYR F CG  1 
ATOM   8167  C CD1 . TYR F  1 72  ? 1.620   -14.922 120.000 1.00 31.05  ? 96  TYR F CD1 1 
ATOM   8168  C CD2 . TYR F  1 72  ? 0.937   -13.665 118.064 1.00 30.61  ? 96  TYR F CD2 1 
ATOM   8169  C CE1 . TYR F  1 72  ? 0.834   -14.074 120.823 1.00 31.63  ? 96  TYR F CE1 1 
ATOM   8170  C CE2 . TYR F  1 72  ? 0.161   -12.816 118.889 1.00 31.25  ? 96  TYR F CE2 1 
ATOM   8171  C CZ  . TYR F  1 72  ? 0.104   -13.022 120.275 1.00 31.15  ? 96  TYR F CZ  1 
ATOM   8172  O OH  . TYR F  1 72  ? -0.636  -12.239 121.152 1.00 29.46  ? 96  TYR F OH  1 
ATOM   8173  N N   . ARG F  1 73  ? 3.789   -13.236 116.606 1.00 29.31  ? 97  ARG F N   1 
ATOM   8174  C CA  . ARG F  1 73  ? 3.629   -11.815 116.443 1.00 28.42  ? 97  ARG F CA  1 
ATOM   8175  C C   . ARG F  1 73  ? 2.732   -11.596 115.246 1.00 27.35  ? 97  ARG F C   1 
ATOM   8176  O O   . ARG F  1 73  ? 2.687   -12.462 114.333 1.00 24.52  ? 97  ARG F O   1 
ATOM   8177  C CB  . ARG F  1 73  ? 4.994   -11.119 116.289 1.00 28.68  ? 97  ARG F CB  1 
ATOM   8178  C CG  . ARG F  1 73  ? 5.786   -11.420 115.021 1.00 28.12  ? 97  ARG F CG  1 
ATOM   8179  C CD  . ARG F  1 73  ? 7.244   -10.988 115.155 1.00 27.42  ? 97  ARG F CD  1 
ATOM   8180  N NE  . ARG F  1 73  ? 7.987   -11.402 113.967 1.00 27.21  ? 97  ARG F NE  1 
ATOM   8181  C CZ  . ARG F  1 73  ? 9.264   -11.112 113.698 1.00 26.71  ? 97  ARG F CZ  1 
ATOM   8182  N NH1 . ARG F  1 73  ? 9.774   -11.526 112.576 1.00 26.83  ? 97  ARG F NH1 1 
ATOM   8183  N NH2 . ARG F  1 73  ? 10.042  -10.434 114.516 1.00 26.12  ? 97  ARG F NH2 1 
ATOM   8184  N N   . ILE F  1 74  ? 2.012   -10.470 115.283 1.00 27.18  ? 98  ILE F N   1 
ATOM   8185  C CA  . ILE F  1 74  ? 0.942   -10.255 114.342 1.00 28.30  ? 98  ILE F CA  1 
ATOM   8186  C C   . ILE F  1 74  ? 1.464   -9.282  113.359 1.00 29.82  ? 98  ILE F C   1 
ATOM   8187  O O   . ILE F  1 74  ? 1.787   -8.143  113.707 1.00 30.50  ? 98  ILE F O   1 
ATOM   8188  C CB  . ILE F  1 74  ? -0.318  -9.729  115.007 1.00 28.83  ? 98  ILE F CB  1 
ATOM   8189  C CG1 . ILE F  1 74  ? -0.961  -10.815 115.836 1.00 29.23  ? 98  ILE F CG1 1 
ATOM   8190  C CG2 . ILE F  1 74  ? -1.359  -9.305  113.986 1.00 29.11  ? 98  ILE F CG2 1 
ATOM   8191  C CD1 . ILE F  1 74  ? -1.929  -10.246 116.864 1.00 30.23  ? 98  ILE F CD1 1 
ATOM   8192  N N   . ARG F  1 75  ? 1.518   -9.735  112.110 1.00 33.11  ? 99  ARG F N   1 
ATOM   8193  C CA  . ARG F  1 75  ? 2.225   -9.043  111.015 1.00 34.55  ? 99  ARG F CA  1 
ATOM   8194  C C   . ARG F  1 75  ? 1.340   -7.961  110.411 1.00 33.06  ? 99  ARG F C   1 
ATOM   8195  O O   . ARG F  1 75  ? 1.776   -6.893  110.166 1.00 31.62  ? 99  ARG F O   1 
ATOM   8196  C CB  . ARG F  1 75  ? 2.550   -10.043 109.946 1.00 37.67  ? 99  ARG F CB  1 
ATOM   8197  C CG  . ARG F  1 75  ? 3.998   -10.100 109.606 1.00 42.66  ? 99  ARG F CG  1 
ATOM   8198  C CD  . ARG F  1 75  ? 4.753   -10.938 110.610 1.00 46.21  ? 99  ARG F CD  1 
ATOM   8199  N NE  . ARG F  1 75  ? 5.884   -10.166 111.086 1.00 50.40  ? 99  ARG F NE  1 
ATOM   8200  C CZ  . ARG F  1 75  ? 6.992   -9.888  110.400 1.00 54.55  ? 99  ARG F CZ  1 
ATOM   8201  N NH1 . ARG F  1 75  ? 7.927   -9.156  111.010 1.00 58.89  ? 99  ARG F NH1 1 
ATOM   8202  N NH2 . ARG F  1 75  ? 7.196   -10.340 109.149 1.00 55.35  ? 99  ARG F NH2 1 
ATOM   8203  N N   . LYS F  1 76  ? 0.060   -8.253  110.271 1.00 33.35  ? 100 LYS F N   1 
ATOM   8204  C CA  . LYS F  1 76  ? -0.880  -7.401  109.580 1.00 34.78  ? 100 LYS F CA  1 
ATOM   8205  C C   . LYS F  1 76  ? -2.300  -7.773  110.041 1.00 35.61  ? 100 LYS F C   1 
ATOM   8206  O O   . LYS F  1 76  ? -2.497  -8.939  110.377 1.00 37.24  ? 100 LYS F O   1 
ATOM   8207  C CB  . LYS F  1 76  ? -0.708  -7.704  108.108 1.00 35.73  ? 100 LYS F CB  1 
ATOM   8208  C CG  . LYS F  1 76  ? -0.263  -6.590  107.209 1.00 36.98  ? 100 LYS F CG  1 
ATOM   8209  C CD  . LYS F  1 76  ? 0.903   -5.745  107.625 1.00 38.56  ? 100 LYS F CD  1 
ATOM   8210  C CE  . LYS F  1 76  ? 1.060   -4.741  106.506 1.00 43.42  ? 100 LYS F CE  1 
ATOM   8211  N NZ  . LYS F  1 76  ? 1.869   -3.535  106.737 1.00 45.88  ? 100 LYS F NZ  1 
ATOM   8212  N N   . VAL F  1 77  ? -3.256  -6.819  110.110 1.00 35.19  ? 101 VAL F N   1 
ATOM   8213  C CA  . VAL F  1 77  ? -4.683  -7.145  110.282 1.00 35.14  ? 101 VAL F CA  1 
ATOM   8214  C C   . VAL F  1 77  ? -5.483  -6.589  109.124 1.00 34.67  ? 101 VAL F C   1 
ATOM   8215  O O   . VAL F  1 77  ? -5.133  -5.554  108.562 1.00 34.66  ? 101 VAL F O   1 
ATOM   8216  C CB  . VAL F  1 77  ? -5.241  -6.549  111.540 1.00 38.34  ? 101 VAL F CB  1 
ATOM   8217  C CG1 . VAL F  1 77  ? -6.723  -6.817  111.664 1.00 40.06  ? 101 VAL F CG1 1 
ATOM   8218  C CG2 . VAL F  1 77  ? -4.647  -7.284  112.683 1.00 42.14  ? 101 VAL F CG2 1 
ATOM   8219  N N   . LYS F  1 78  ? -6.547  -7.299  108.753 1.00 34.79  ? 102 LYS F N   1 
ATOM   8220  C CA  . LYS F  1 78  ? -7.489  -6.904  107.700 1.00 33.83  ? 102 LYS F CA  1 
ATOM   8221  C C   . LYS F  1 78  ? -8.813  -6.909  108.380 1.00 32.03  ? 102 LYS F C   1 
ATOM   8222  O O   . LYS F  1 78  ? -9.182  -7.900  109.040 1.00 31.72  ? 102 LYS F O   1 
ATOM   8223  C CB  . LYS F  1 78  ? -7.509  -7.896  106.580 1.00 35.85  ? 102 LYS F CB  1 
ATOM   8224  C CG  . LYS F  1 78  ? -8.067  -7.369  105.278 1.00 40.44  ? 102 LYS F CG  1 
ATOM   8225  C CD  . LYS F  1 78  ? -8.195  -8.515  104.231 1.00 46.46  ? 102 LYS F CD  1 
ATOM   8226  C CE  . LYS F  1 78  ? -7.692  -8.155  102.818 1.00 51.39  ? 102 LYS F CE  1 
ATOM   8227  N NZ  . LYS F  1 78  ? -8.540  -7.132  102.086 1.00 52.86  ? 102 LYS F NZ  1 
ATOM   8228  N N   . VAL F  1 79  ? -9.491  -5.775  108.318 1.00 29.72  ? 103 VAL F N   1 
ATOM   8229  C CA  . VAL F  1 79  ? -10.817 -5.659  108.866 1.00 28.52  ? 103 VAL F CA  1 
ATOM   8230  C C   . VAL F  1 79  ? -11.704 -5.429  107.657 1.00 28.93  ? 103 VAL F C   1 
ATOM   8231  O O   . VAL F  1 79  ? -11.420 -4.532  106.871 1.00 29.52  ? 103 VAL F O   1 
ATOM   8232  C CB  . VAL F  1 79  ? -10.855 -4.490  109.829 1.00 27.77  ? 103 VAL F CB  1 
ATOM   8233  C CG1 . VAL F  1 79  ? -12.252 -4.222  110.348 1.00 27.28  ? 103 VAL F CG1 1 
ATOM   8234  C CG2 . VAL F  1 79  ? -9.887  -4.731  110.970 1.00 27.87  ? 103 VAL F CG2 1 
ATOM   8235  N N   . GLU F  1 80  ? -12.745 -6.242  107.483 1.00 29.12  ? 104 GLU F N   1 
ATOM   8236  C CA  . GLU F  1 80  ? -13.672 -6.102  106.359 1.00 29.17  ? 104 GLU F CA  1 
ATOM   8237  C C   . GLU F  1 80  ? -15.056 -5.874  106.908 1.00 30.17  ? 104 GLU F C   1 
ATOM   8238  O O   . GLU F  1 80  ? -15.520 -6.632  107.811 1.00 32.85  ? 104 GLU F O   1 
ATOM   8239  C CB  . GLU F  1 80  ? -13.672 -7.361  105.525 1.00 29.78  ? 104 GLU F CB  1 
ATOM   8240  C CG  . GLU F  1 80  ? -12.341 -7.564  104.825 1.00 31.09  ? 104 GLU F CG  1 
ATOM   8241  C CD  . GLU F  1 80  ? -12.175 -8.888  104.134 1.00 30.53  ? 104 GLU F CD  1 
ATOM   8242  O OE1 . GLU F  1 80  ? -12.194 -9.965  104.781 1.00 31.59  ? 104 GLU F OE1 1 
ATOM   8243  O OE2 . GLU F  1 80  ? -11.949 -8.777  102.943 1.00 29.55  ? 104 GLU F OE2 1 
ATOM   8244  N N   . PHE F  1 81  ? -15.664 -4.800  106.436 1.00 29.10  ? 105 PHE F N   1 
ATOM   8245  C CA  . PHE F  1 81  ? -17.018 -4.479  106.728 1.00 29.87  ? 105 PHE F CA  1 
ATOM   8246  C C   . PHE F  1 81  ? -17.763 -4.963  105.523 1.00 30.35  ? 105 PHE F C   1 
ATOM   8247  O O   . PHE F  1 81  ? -17.645 -4.344  104.422 1.00 29.99  ? 105 PHE F O   1 
ATOM   8248  C CB  . PHE F  1 81  ? -17.192 -2.964  106.902 1.00 30.02  ? 105 PHE F CB  1 
ATOM   8249  C CG  . PHE F  1 81  ? -16.573 -2.461  108.126 1.00 30.27  ? 105 PHE F CG  1 
ATOM   8250  C CD1 . PHE F  1 81  ? -15.235 -2.082  108.139 1.00 30.35  ? 105 PHE F CD1 1 
ATOM   8251  C CD2 . PHE F  1 81  ? -17.287 -2.461  109.322 1.00 30.95  ? 105 PHE F CD2 1 
ATOM   8252  C CE1 . PHE F  1 81  ? -14.613 -1.654  109.328 1.00 30.40  ? 105 PHE F CE1 1 
ATOM   8253  C CE2 . PHE F  1 81  ? -16.680 -2.004  110.508 1.00 30.95  ? 105 PHE F CE2 1 
ATOM   8254  C CZ  . PHE F  1 81  ? -15.336 -1.596  110.508 1.00 30.00  ? 105 PHE F CZ  1 
ATOM   8255  N N   . TRP F  1 82  ? -18.495 -6.070  105.704 1.00 30.70  ? 106 TRP F N   1 
ATOM   8256  C CA  . TRP F  1 82  ? -19.328 -6.618  104.635 1.00 31.13  ? 106 TRP F CA  1 
ATOM   8257  C C   . TRP F  1 82  ? -20.761 -6.207  104.956 1.00 32.67  ? 106 TRP F C   1 
ATOM   8258  O O   . TRP F  1 82  ? -21.326 -6.654  105.956 1.00 32.55  ? 106 TRP F O   1 
ATOM   8259  C CB  . TRP F  1 82  ? -19.247 -8.107  104.498 1.00 30.62  ? 106 TRP F CB  1 
ATOM   8260  C CG  . TRP F  1 82  ? -17.909 -8.674  104.249 1.00 30.57  ? 106 TRP F CG  1 
ATOM   8261  C CD1 . TRP F  1 82  ? -17.001 -9.098  105.205 1.00 30.88  ? 106 TRP F CD1 1 
ATOM   8262  C CD2 . TRP F  1 82  ? -17.360 -9.021  102.999 1.00 30.56  ? 106 TRP F CD2 1 
ATOM   8263  N NE1 . TRP F  1 82  ? -15.900 -9.641  104.594 1.00 31.11  ? 106 TRP F NE1 1 
ATOM   8264  C CE2 . TRP F  1 82  ? -16.083 -9.597  103.240 1.00 30.85  ? 106 TRP F CE2 1 
ATOM   8265  C CE3 . TRP F  1 82  ? -17.801 -8.889  101.681 1.00 32.26  ? 106 TRP F CE3 1 
ATOM   8266  C CZ2 . TRP F  1 82  ? -15.226 -10.035 102.199 1.00 31.87  ? 106 TRP F CZ2 1 
ATOM   8267  C CZ3 . TRP F  1 82  ? -16.939 -9.339  100.614 1.00 33.09  ? 106 TRP F CZ3 1 
ATOM   8268  C CH2 . TRP F  1 82  ? -15.661 -9.907  100.902 1.00 32.42  ? 106 TRP F CH2 1 
ATOM   8269  N N   . PRO F  1 83  ? -21.330 -5.324  104.112 1.00 33.31  ? 107 PRO F N   1 
ATOM   8270  C CA  . PRO F  1 83  ? -22.624 -4.772  104.344 1.00 32.92  ? 107 PRO F CA  1 
ATOM   8271  C C   . PRO F  1 83  ? -23.731 -5.769  104.191 1.00 33.98  ? 107 PRO F C   1 
ATOM   8272  O O   . PRO F  1 83  ? -23.766 -6.448  103.186 1.00 36.89  ? 107 PRO F O   1 
ATOM   8273  C CB  . PRO F  1 83  ? -22.745 -3.701  103.239 1.00 33.55  ? 107 PRO F CB  1 
ATOM   8274  C CG  . PRO F  1 83  ? -21.828 -4.120  102.150 1.00 34.00  ? 107 PRO F CG  1 
ATOM   8275  C CD  . PRO F  1 83  ? -20.700 -4.774  102.880 1.00 33.99  ? 107 PRO F CD  1 
ATOM   8276  N N   . CYS F  1 84  ? -24.655 -5.813  105.147 1.00 35.12  ? 108 CYS F N   1 
ATOM   8277  C CA  . CYS F  1 84  ? -25.950 -6.537  104.987 1.00 35.94  ? 108 CYS F CA  1 
ATOM   8278  C C   . CYS F  1 84  ? -26.979 -5.775  104.131 1.00 37.06  ? 108 CYS F C   1 
ATOM   8279  O O   . CYS F  1 84  ? -27.748 -6.404  103.379 1.00 38.37  ? 108 CYS F O   1 
ATOM   8280  C CB  . CYS F  1 84  ? -26.574 -6.900  106.337 1.00 35.21  ? 108 CYS F CB  1 
ATOM   8281  S SG  . CYS F  1 84  ? -25.420 -7.812  107.409 1.00 35.03  ? 108 CYS F SG  1 
ATOM   8282  N N   . SER F  1 85  ? -26.982 -4.444  104.195 1.00 36.38  ? 109 SER F N   1 
ATOM   8283  C CA  . SER F  1 85  ? -28.057 -3.678  103.584 1.00 36.01  ? 109 SER F CA  1 
ATOM   8284  C C   . SER F  1 85  ? -28.076 -3.880  102.062 1.00 37.19  ? 109 SER F C   1 
ATOM   8285  O O   . SER F  1 85  ? -27.046 -4.031  101.432 1.00 36.05  ? 109 SER F O   1 
ATOM   8286  C CB  . SER F  1 85  ? -27.962 -2.191  103.954 1.00 36.19  ? 109 SER F CB  1 
ATOM   8287  O OG  . SER F  1 85  ? -28.094 -1.947  105.370 1.00 34.34  ? 109 SER F OG  1 
ATOM   8288  N N   . PRO F  1 86  ? -29.277 -3.905  101.462 1.00 39.66  ? 110 PRO F N   1 
ATOM   8289  C CA  . PRO F  1 86  ? -29.379 -4.139  100.035 1.00 39.79  ? 110 PRO F CA  1 
ATOM   8290  C C   . PRO F  1 86  ? -28.975 -2.878  99.284  1.00 41.44  ? 110 PRO F C   1 
ATOM   8291  O O   . PRO F  1 86  ? -29.072 -1.792  99.853  1.00 39.55  ? 110 PRO F O   1 
ATOM   8292  C CB  . PRO F  1 86  ? -30.858 -4.395  99.865  1.00 38.92  ? 110 PRO F CB  1 
ATOM   8293  C CG  . PRO F  1 86  ? -31.472 -3.522  100.878 1.00 38.22  ? 110 PRO F CG  1 
ATOM   8294  C CD  . PRO F  1 86  ? -30.597 -3.613  102.055 1.00 39.31  ? 110 PRO F CD  1 
ATOM   8295  N N   . ILE F  1 87  ? -28.595 -2.996  98.013  1.00 43.84  ? 111 ILE F N   1 
ATOM   8296  C CA  . ILE F  1 87  ? -28.168 -1.820  97.281  1.00 45.33  ? 111 ILE F CA  1 
ATOM   8297  C C   . ILE F  1 87  ? -29.341 -0.866  97.017  1.00 46.68  ? 111 ILE F C   1 
ATOM   8298  O O   . ILE F  1 87  ? -29.130 0.177   96.455  1.00 55.81  ? 111 ILE F O   1 
ATOM   8299  C CB  . ILE F  1 87  ? -27.463 -2.148  95.952  1.00 47.26  ? 111 ILE F CB  1 
ATOM   8300  C CG1 . ILE F  1 87  ? -28.507 -2.530  94.876  1.00 52.68  ? 111 ILE F CG1 1 
ATOM   8301  C CG2 . ILE F  1 87  ? -26.416 -3.242  96.117  1.00 46.67  ? 111 ILE F CG2 1 
ATOM   8302  C CD1 . ILE F  1 87  ? -27.926 -3.159  93.613  1.00 53.89  ? 111 ILE F CD1 1 
ATOM   8303  N N   . THR F  1 88  ? -30.563 -1.213  97.381  1.00 45.17  ? 112 THR F N   1 
ATOM   8304  C CA  . THR F  1 88  ? -31.736 -0.306  97.275  1.00 45.22  ? 112 THR F CA  1 
ATOM   8305  C C   . THR F  1 88  ? -32.007 0.632   98.449  1.00 43.63  ? 112 THR F C   1 
ATOM   8306  O O   . THR F  1 88  ? -32.978 1.394   98.403  1.00 44.70  ? 112 THR F O   1 
ATOM   8307  C CB  . THR F  1 88  ? -33.102 -1.120  97.097  1.00 46.10  ? 112 THR F CB  1 
ATOM   8308  O OG1 . THR F  1 88  ? -33.539 -1.730  98.329  1.00 39.82  ? 112 THR F OG1 1 
ATOM   8309  C CG2 . THR F  1 88  ? -32.980 -2.198  95.997  1.00 47.41  ? 112 THR F CG2 1 
ATOM   8310  N N   . GLN F  1 89  ? -31.232 0.528   99.526  1.00 42.98  ? 113 GLN F N   1 
ATOM   8311  C CA  . GLN F  1 89  ? -31.537 1.254   100.779 1.00 41.19  ? 113 GLN F CA  1 
ATOM   8312  C C   . GLN F  1 89  ? -31.003 2.671   100.549 1.00 42.21  ? 113 GLN F C   1 
ATOM   8313  O O   . GLN F  1 89  ? -29.885 2.866   99.946  1.00 41.28  ? 113 GLN F O   1 
ATOM   8314  C CB  . GLN F  1 89  ? -30.882 0.582   102.001 1.00 40.01  ? 113 GLN F CB  1 
ATOM   8315  C CG  . GLN F  1 89  ? -31.068 1.235   103.389 1.00 39.97  ? 113 GLN F CG  1 
ATOM   8316  C CD  . GLN F  1 89  ? -30.704 0.299   104.588 1.00 38.79  ? 113 GLN F CD  1 
ATOM   8317  O OE1 . GLN F  1 89  ? -31.116 -0.869  104.606 1.00 38.15  ? 113 GLN F OE1 1 
ATOM   8318  N NE2 . GLN F  1 89  ? -29.912 0.806   105.564 1.00 34.54  ? 113 GLN F NE2 1 
ATOM   8319  N N   . GLY F  1 90  ? -31.842 3.628   100.947 1.00 39.94  ? 114 GLY F N   1 
ATOM   8320  C CA  . GLY F  1 90  ? -31.525 5.018   100.898 1.00 39.59  ? 114 GLY F CA  1 
ATOM   8321  C C   . GLY F  1 90  ? -31.109 5.536   102.241 1.00 38.85  ? 114 GLY F C   1 
ATOM   8322  O O   . GLY F  1 90  ? -30.728 4.786   103.140 1.00 40.89  ? 114 GLY F O   1 
ATOM   8323  N N   . ASP F  1 91  ? -31.274 6.825   102.403 1.00 38.21  ? 115 ASP F N   1 
ATOM   8324  C CA  . ASP F  1 91  ? -30.639 7.551   103.478 1.00 38.90  ? 115 ASP F CA  1 
ATOM   8325  C C   . ASP F  1 91  ? -29.213 7.151   103.650 1.00 37.99  ? 115 ASP F C   1 
ATOM   8326  O O   . ASP F  1 91  ? -28.786 6.758   104.749 1.00 37.69  ? 115 ASP F O   1 
ATOM   8327  C CB  . ASP F  1 91  ? -31.362 7.475   104.822 1.00 39.79  ? 115 ASP F CB  1 
ATOM   8328  C CG  . ASP F  1 91  ? -30.991 8.677   105.733 1.00 42.24  ? 115 ASP F CG  1 
ATOM   8329  O OD1 . ASP F  1 91  ? -30.808 9.788   105.141 1.00 41.92  ? 115 ASP F OD1 1 
ATOM   8330  O OD2 . ASP F  1 91  ? -30.874 8.543   107.001 1.00 43.61  ? 115 ASP F OD2 1 
ATOM   8331  N N   . ARG F  1 92  ? -28.487 7.269   102.545 1.00 37.44  ? 116 ARG F N   1 
ATOM   8332  C CA  . ARG F  1 92  ? -27.084 6.877   102.475 1.00 37.04  ? 116 ARG F CA  1 
ATOM   8333  C C   . ARG F  1 92  ? -26.218 7.931   103.086 1.00 35.74  ? 116 ARG F C   1 
ATOM   8334  O O   . ARG F  1 92  ? -26.474 9.100   102.942 1.00 36.49  ? 116 ARG F O   1 
ATOM   8335  C CB  . ARG F  1 92  ? -26.639 6.755   101.038 1.00 38.08  ? 116 ARG F CB  1 
ATOM   8336  C CG  . ARG F  1 92  ? -27.427 5.793   100.149 1.00 39.49  ? 116 ARG F CG  1 
ATOM   8337  C CD  . ARG F  1 92  ? -26.538 5.467   98.955  1.00 41.36  ? 116 ARG F CD  1 
ATOM   8338  N NE  . ARG F  1 92  ? -26.852 6.135   97.701  1.00 42.03  ? 116 ARG F NE  1 
ATOM   8339  C CZ  . ARG F  1 92  ? -26.013 6.315   96.669  1.00 40.01  ? 116 ARG F CZ  1 
ATOM   8340  N NH1 . ARG F  1 92  ? -26.486 6.935   95.599  1.00 42.05  ? 116 ARG F NH1 1 
ATOM   8341  N NH2 . ARG F  1 92  ? -24.754 5.900   96.664  1.00 36.53  ? 116 ARG F NH2 1 
ATOM   8342  N N   . GLY F  1 93  ? -25.150 7.512   103.722 1.00 35.68  ? 117 GLY F N   1 
ATOM   8343  C CA  . GLY F  1 93  ? -24.277 8.419   104.419 1.00 36.14  ? 117 GLY F CA  1 
ATOM   8344  C C   . GLY F  1 93  ? -22.800 8.093   104.219 1.00 37.02  ? 117 GLY F C   1 
ATOM   8345  O O   . GLY F  1 93  ? -22.406 7.260   103.359 1.00 36.95  ? 117 GLY F O   1 
ATOM   8346  N N   . VAL F  1 94  ? -21.984 8.748   105.046 1.00 35.56  ? 118 VAL F N   1 
ATOM   8347  C CA  . VAL F  1 94  ? -20.580 8.803   104.810 1.00 34.23  ? 118 VAL F CA  1 
ATOM   8348  C C   . VAL F  1 94  ? -19.835 9.003   106.148 1.00 33.25  ? 118 VAL F C   1 
ATOM   8349  O O   . VAL F  1 94  ? -20.163 9.871   106.948 1.00 34.31  ? 118 VAL F O   1 
ATOM   8350  C CB  . VAL F  1 94  ? -20.329 9.877   103.779 1.00 35.07  ? 118 VAL F CB  1 
ATOM   8351  C CG1 . VAL F  1 94  ? -20.579 11.243  104.384 1.00 38.46  ? 118 VAL F CG1 1 
ATOM   8352  C CG2 . VAL F  1 94  ? -18.917 9.834   103.317 1.00 36.43  ? 118 VAL F CG2 1 
ATOM   8353  N N   . GLY F  1 95  ? -18.880 8.124   106.405 1.00 31.86  ? 119 GLY F N   1 
ATOM   8354  C CA  . GLY F  1 95  ? -18.131 8.079   107.665 1.00 30.75  ? 119 GLY F CA  1 
ATOM   8355  C C   . GLY F  1 95  ? -16.662 7.689   107.483 1.00 29.12  ? 119 GLY F C   1 
ATOM   8356  O O   . GLY F  1 95  ? -16.096 7.804   106.366 1.00 28.98  ? 119 GLY F O   1 
ATOM   8357  N N   . SER F  1 96  ? -16.048 7.228   108.558 1.00 26.67  ? 120 SER F N   1 
ATOM   8358  C CA  . SER F  1 96  ? -14.624 7.203   108.616 1.00 27.02  ? 120 SER F CA  1 
ATOM   8359  C C   . SER F  1 96  ? -14.054 6.046   109.394 1.00 27.40  ? 120 SER F C   1 
ATOM   8360  O O   . SER F  1 96  ? -14.574 5.621   110.438 1.00 28.62  ? 120 SER F O   1 
ATOM   8361  C CB  . SER F  1 96  ? -14.146 8.532   109.233 1.00 27.29  ? 120 SER F CB  1 
ATOM   8362  O OG  . SER F  1 96  ? -14.337 9.666   108.352 1.00 27.18  ? 120 SER F OG  1 
ATOM   8363  N N   . SER F  1 97  ? -12.946 5.521   108.919 1.00 27.81  ? 121 SER F N   1 
ATOM   8364  C CA  . SER F  1 97  ? -12.176 4.583   109.767 1.00 28.43  ? 121 SER F CA  1 
ATOM   8365  C C   . SER F  1 97  ? -10.789 5.217   110.004 1.00 27.83  ? 121 SER F C   1 
ATOM   8366  O O   . SER F  1 97  ? -10.269 5.947   109.120 1.00 26.21  ? 121 SER F O   1 
ATOM   8367  C CB  . SER F  1 97  ? -12.080 3.177   109.119 1.00 28.71  ? 121 SER F CB  1 
ATOM   8368  O OG  . SER F  1 97  ? -11.254 3.192   107.929 1.00 28.68  ? 121 SER F OG  1 
ATOM   8369  N N   . ALA F  1 98  ? -10.229 4.954   111.188 1.00 27.42  ? 122 ALA F N   1 
ATOM   8370  C CA  . ALA F  1 98  ? -8.861  5.357   111.494 1.00 28.76  ? 122 ALA F CA  1 
ATOM   8371  C C   . ALA F  1 98  ? -8.094  4.297   112.283 1.00 30.15  ? 122 ALA F C   1 
ATOM   8372  O O   . ALA F  1 98  ? -8.634  3.615   113.201 1.00 30.22  ? 122 ALA F O   1 
ATOM   8373  C CB  . ALA F  1 98  ? -8.828  6.678   112.249 1.00 28.86  ? 122 ALA F CB  1 
ATOM   8374  N N   . VAL F  1 99  ? -6.813  4.177   111.917 1.00 30.75  ? 123 VAL F N   1 
ATOM   8375  C CA  . VAL F  1 99  ? -5.896  3.242   112.544 1.00 30.32  ? 123 VAL F CA  1 
ATOM   8376  C C   . VAL F  1 99  ? -5.449  3.914   113.819 1.00 29.08  ? 123 VAL F C   1 
ATOM   8377  O O   . VAL F  1 99  ? -4.988  5.012   113.753 1.00 29.29  ? 123 VAL F O   1 
ATOM   8378  C CB  . VAL F  1 99  ? -4.709  2.953   111.597 1.00 32.31  ? 123 VAL F CB  1 
ATOM   8379  C CG1 . VAL F  1 99  ? -3.638  2.038   112.232 1.00 32.97  ? 123 VAL F CG1 1 
ATOM   8380  C CG2 . VAL F  1 99  ? -5.212  2.257   110.325 1.00 33.07  ? 123 VAL F CG2 1 
ATOM   8381  N N   . ILE F  1 100 ? -5.604  3.238   114.957 1.00 28.79  ? 124 ILE F N   1 
ATOM   8382  C CA  . ILE F  1 100 ? -5.296  3.733   116.294 1.00 29.52  ? 124 ILE F CA  1 
ATOM   8383  C C   . ILE F  1 100 ? -4.307  2.831   116.990 1.00 29.41  ? 124 ILE F C   1 
ATOM   8384  O O   . ILE F  1 100 ? -4.694  1.878   117.556 1.00 29.64  ? 124 ILE F O   1 
ATOM   8385  C CB  . ILE F  1 100 ? -6.577  3.823   117.131 1.00 30.23  ? 124 ILE F CB  1 
ATOM   8386  C CG1 . ILE F  1 100 ? -7.672  4.625   116.364 1.00 31.33  ? 124 ILE F CG1 1 
ATOM   8387  C CG2 . ILE F  1 100 ? -6.326  4.482   118.480 1.00 30.38  ? 124 ILE F CG2 1 
ATOM   8388  C CD1 . ILE F  1 100 ? -7.295  6.010   115.869 1.00 30.64  ? 124 ILE F CD1 1 
ATOM   8389  N N   . LEU F  1 101 ? -3.023  3.179   116.964 1.00 30.87  ? 125 LEU F N   1 
ATOM   8390  C CA  . LEU F  1 101 ? -1.936  2.279   117.375 1.00 31.59  ? 125 LEU F CA  1 
ATOM   8391  C C   . LEU F  1 101 ? -1.589  2.383   118.837 1.00 33.93  ? 125 LEU F C   1 
ATOM   8392  O O   . LEU F  1 101 ? -0.735  1.642   119.306 1.00 34.42  ? 125 LEU F O   1 
ATOM   8393  C CB  . LEU F  1 101 ? -0.689  2.562   116.543 1.00 31.26  ? 125 LEU F CB  1 
ATOM   8394  C CG  . LEU F  1 101 ? -0.893  2.483   114.993 1.00 31.31  ? 125 LEU F CG  1 
ATOM   8395  C CD1 . LEU F  1 101 ? 0.370   2.795   114.216 1.00 30.77  ? 125 LEU F CD1 1 
ATOM   8396  C CD2 . LEU F  1 101 ? -1.410  1.106   114.531 1.00 32.14  ? 125 LEU F CD2 1 
ATOM   8397  N N   . ASP F  1 102 ? -2.248  3.291   119.574 1.00 36.51  ? 126 ASP F N   1 
ATOM   8398  C CA  . ASP F  1 102 ? -1.873  3.587   120.938 1.00 37.24  ? 126 ASP F CA  1 
ATOM   8399  C C   . ASP F  1 102 ? -3.010  3.329   121.934 1.00 37.92  ? 126 ASP F C   1 
ATOM   8400  O O   . ASP F  1 102 ? -2.942  3.792   123.057 1.00 40.81  ? 126 ASP F O   1 
ATOM   8401  C CB  . ASP F  1 102 ? -1.313  5.023   121.015 1.00 38.75  ? 126 ASP F CB  1 
ATOM   8402  C CG  . ASP F  1 102 ? -2.401  6.115   120.912 1.00 43.03  ? 126 ASP F CG  1 
ATOM   8403  O OD1 . ASP F  1 102 ? -3.547  5.758   120.495 1.00 44.77  ? 126 ASP F OD1 1 
ATOM   8404  O OD2 . ASP F  1 102 ? -2.105  7.332   121.247 1.00 43.71  ? 126 ASP F OD2 1 
ATOM   8405  N N   . ASP F  1 103 ? -4.047  2.591   121.546 1.00 37.65  ? 127 ASP F N   1 
ATOM   8406  C CA  . ASP F  1 103 ? -5.120  2.174   122.466 1.00 37.72  ? 127 ASP F CA  1 
ATOM   8407  C C   . ASP F  1 103 ? -5.997  3.337   122.955 1.00 40.13  ? 127 ASP F C   1 
ATOM   8408  O O   . ASP F  1 103 ? -6.786  3.148   123.912 1.00 41.24  ? 127 ASP F O   1 
ATOM   8409  C CB  . ASP F  1 103 ? -4.536  1.367   123.653 1.00 36.22  ? 127 ASP F CB  1 
ATOM   8410  C CG  . ASP F  1 103 ? -5.606  0.576   124.475 1.00 35.81  ? 127 ASP F CG  1 
ATOM   8411  O OD1 . ASP F  1 103 ? -6.678  0.210   123.922 1.00 33.14  ? 127 ASP F OD1 1 
ATOM   8412  O OD2 . ASP F  1 103 ? -5.320  0.311   125.704 1.00 35.40  ? 127 ASP F OD2 1 
ATOM   8413  N N   . ASN F  1 104 ? -5.930  4.494   122.253 1.00 41.68  ? 128 ASN F N   1 
ATOM   8414  C CA  . ASN F  1 104 ? -6.677  5.732   122.613 1.00 41.21  ? 128 ASN F CA  1 
ATOM   8415  C C   . ASN F  1 104 ? -7.751  6.128   121.613 1.00 38.79  ? 128 ASN F C   1 
ATOM   8416  O O   . ASN F  1 104 ? -7.635  7.062   120.815 1.00 37.12  ? 128 ASN F O   1 
ATOM   8417  C CB  . ASN F  1 104 ? -5.721  6.893   122.781 1.00 45.39  ? 128 ASN F CB  1 
ATOM   8418  C CG  . ASN F  1 104 ? -6.312  8.036   123.611 1.00 47.01  ? 128 ASN F CG  1 
ATOM   8419  O OD1 . ASN F  1 104 ? -6.915  7.811   124.675 1.00 48.19  ? 128 ASN F OD1 1 
ATOM   8420  N ND2 . ASN F  1 104 ? -6.079  9.270   123.156 1.00 46.19  ? 128 ASN F ND2 1 
ATOM   8421  N N   . PHE F  1 105 ? -8.850  5.420   121.727 1.00 37.86  ? 129 PHE F N   1 
ATOM   8422  C CA  . PHE F  1 105 ? -9.970  5.602   120.847 1.00 35.29  ? 129 PHE F CA  1 
ATOM   8423  C C   . PHE F  1 105 ? -10.762 6.810   121.302 1.00 33.03  ? 129 PHE F C   1 
ATOM   8424  O O   . PHE F  1 105 ? -10.742 7.124   122.451 1.00 31.81  ? 129 PHE F O   1 
ATOM   8425  C CB  . PHE F  1 105 ? -10.798 4.337   120.868 1.00 34.50  ? 129 PHE F CB  1 
ATOM   8426  C CG  . PHE F  1 105 ? -10.035 3.160   120.413 1.00 34.76  ? 129 PHE F CG  1 
ATOM   8427  C CD1 . PHE F  1 105 ? -9.862  2.942   119.059 1.00 34.47  ? 129 PHE F CD1 1 
ATOM   8428  C CD2 . PHE F  1 105 ? -9.405  2.310   121.344 1.00 35.35  ? 129 PHE F CD2 1 
ATOM   8429  C CE1 . PHE F  1 105 ? -9.117  1.874   118.616 1.00 34.83  ? 129 PHE F CE1 1 
ATOM   8430  C CE2 . PHE F  1 105 ? -8.675  1.206   120.921 1.00 35.59  ? 129 PHE F CE2 1 
ATOM   8431  C CZ  . PHE F  1 105 ? -8.524  0.996   119.547 1.00 36.21  ? 129 PHE F CZ  1 
ATOM   8432  N N   . VAL F  1 106 ? -11.404 7.491   120.363 1.00 31.43  ? 130 VAL F N   1 
ATOM   8433  C CA  . VAL F  1 106 ? -12.429 8.455   120.647 1.00 31.25  ? 130 VAL F CA  1 
ATOM   8434  C C   . VAL F  1 106 ? -13.538 7.725   121.377 1.00 30.77  ? 130 VAL F C   1 
ATOM   8435  O O   . VAL F  1 106 ? -13.983 6.667   120.978 1.00 29.34  ? 130 VAL F O   1 
ATOM   8436  C CB  . VAL F  1 106 ? -13.003 9.060   119.337 1.00 32.43  ? 130 VAL F CB  1 
ATOM   8437  C CG1 . VAL F  1 106 ? -14.230 9.946   119.615 1.00 33.51  ? 130 VAL F CG1 1 
ATOM   8438  C CG2 . VAL F  1 106 ? -11.952 9.844   118.546 1.00 32.17  ? 130 VAL F CG2 1 
ATOM   8439  N N   . THR F  1 107 ? -14.008 8.337   122.434 1.00 33.42  ? 131 THR F N   1 
ATOM   8440  C CA  . THR F  1 107 ? -15.045 7.761   123.305 1.00 35.81  ? 131 THR F CA  1 
ATOM   8441  C C   . THR F  1 107 ? -16.241 7.273   122.509 1.00 37.01  ? 131 THR F C   1 
ATOM   8442  O O   . THR F  1 107 ? -16.684 7.962   121.605 1.00 37.50  ? 131 THR F O   1 
ATOM   8443  C CB  . THR F  1 107 ? -15.551 8.837   124.316 1.00 35.42  ? 131 THR F CB  1 
ATOM   8444  O OG1 . THR F  1 107 ? -14.600 8.970   125.352 1.00 35.09  ? 131 THR F OG1 1 
ATOM   8445  C CG2 . THR F  1 107 ? -16.880 8.477   124.958 1.00 34.73  ? 131 THR F CG2 1 
ATOM   8446  N N   . LYS F  1 108 ? -16.768 6.118   122.897 1.00 38.55  ? 132 LYS F N   1 
ATOM   8447  C CA  . LYS F  1 108 ? -17.947 5.539   122.271 1.00 40.15  ? 132 LYS F CA  1 
ATOM   8448  C C   . LYS F  1 108 ? -19.193 6.452   122.369 1.00 38.30  ? 132 LYS F C   1 
ATOM   8449  O O   . LYS F  1 108 ? -19.387 7.120   123.371 1.00 37.61  ? 132 LYS F O   1 
ATOM   8450  C CB  . LYS F  1 108 ? -18.229 4.199   122.918 1.00 43.79  ? 132 LYS F CB  1 
ATOM   8451  C CG  . LYS F  1 108 ? -19.015 3.341   121.996 1.00 49.63  ? 132 LYS F CG  1 
ATOM   8452  C CD  . LYS F  1 108 ? -19.543 2.041   122.573 1.00 52.96  ? 132 LYS F CD  1 
ATOM   8453  C CE  . LYS F  1 108 ? -20.910 1.773   121.916 1.00 54.73  ? 132 LYS F CE  1 
ATOM   8454  N NZ  . LYS F  1 108 ? -21.199 0.337   122.021 1.00 58.93  ? 132 LYS F NZ  1 
ATOM   8455  N N   . ALA F  1 109 ? -20.011 6.496   121.312 1.00 36.85  ? 133 ALA F N   1 
ATOM   8456  C CA  . ALA F  1 109 ? -21.024 7.532   121.150 1.00 35.32  ? 133 ALA F CA  1 
ATOM   8457  C C   . ALA F  1 109 ? -22.081 7.183   120.171 1.00 34.38  ? 133 ALA F C   1 
ATOM   8458  O O   . ALA F  1 109 ? -21.779 6.853   119.035 1.00 31.94  ? 133 ALA F O   1 
ATOM   8459  C CB  . ALA F  1 109 ? -20.363 8.789   120.672 1.00 35.90  ? 133 ALA F CB  1 
ATOM   8460  N N   . THR F  1 110 ? -23.335 7.338   120.593 1.00 36.37  ? 134 THR F N   1 
ATOM   8461  C CA  . THR F  1 110 ? -24.498 6.956   119.739 1.00 36.59  ? 134 THR F CA  1 
ATOM   8462  C C   . THR F  1 110 ? -24.730 7.938   118.629 1.00 36.80  ? 134 THR F C   1 
ATOM   8463  O O   . THR F  1 110 ? -25.013 7.515   117.499 1.00 38.18  ? 134 THR F O   1 
ATOM   8464  C CB  . THR F  1 110 ? -25.809 6.767   120.546 1.00 34.54  ? 134 THR F CB  1 
ATOM   8465  O OG1 . THR F  1 110 ? -25.677 5.585   121.276 1.00 33.96  ? 134 THR F OG1 1 
ATOM   8466  C CG2 . THR F  1 110 ? -26.968 6.549   119.702 1.00 33.98  ? 134 THR F CG2 1 
ATOM   8467  N N   . ALA F  1 111 ? -24.620 9.230   118.948 1.00 36.97  ? 135 ALA F N   1 
ATOM   8468  C CA  . ALA F  1 111 ? -24.954 10.247  117.974 1.00 36.88  ? 135 ALA F CA  1 
ATOM   8469  C C   . ALA F  1 111 ? -24.111 11.545  118.071 1.00 35.85  ? 135 ALA F C   1 
ATOM   8470  O O   . ALA F  1 111 ? -24.651 12.657  118.234 1.00 35.52  ? 135 ALA F O   1 
ATOM   8471  C CB  . ALA F  1 111 ? -26.456 10.518  118.079 1.00 36.78  ? 135 ALA F CB  1 
ATOM   8472  N N   . LEU F  1 112 ? -22.801 11.418  117.926 1.00 34.28  ? 136 LEU F N   1 
ATOM   8473  C CA  . LEU F  1 112 ? -21.915 12.595  117.956 1.00 33.95  ? 136 LEU F CA  1 
ATOM   8474  C C   . LEU F  1 112 ? -22.276 13.550  116.844 1.00 33.92  ? 136 LEU F C   1 
ATOM   8475  O O   . LEU F  1 112 ? -22.639 13.119  115.773 1.00 36.24  ? 136 LEU F O   1 
ATOM   8476  C CB  . LEU F  1 112 ? -20.486 12.152  117.774 1.00 34.93  ? 136 LEU F CB  1 
ATOM   8477  C CG  . LEU F  1 112 ? -19.394 13.059  118.336 1.00 37.97  ? 136 LEU F CG  1 
ATOM   8478  C CD1 . LEU F  1 112 ? -19.465 13.144  119.880 1.00 37.89  ? 136 LEU F CD1 1 
ATOM   8479  C CD2 . LEU F  1 112 ? -17.986 12.600  117.903 1.00 38.11  ? 136 LEU F CD2 1 
ATOM   8480  N N   . THR F  1 113 ? -22.219 14.852  117.043 1.00 34.21  ? 137 THR F N   1 
ATOM   8481  C CA  . THR F  1 113 ? -22.732 15.760  115.962 1.00 33.28  ? 137 THR F CA  1 
ATOM   8482  C C   . THR F  1 113 ? -21.782 16.010  114.800 1.00 33.71  ? 137 THR F C   1 
ATOM   8483  O O   . THR F  1 113 ? -22.081 16.804  113.890 1.00 33.54  ? 137 THR F O   1 
ATOM   8484  C CB  . THR F  1 113 ? -23.144 17.087  116.538 1.00 32.06  ? 137 THR F CB  1 
ATOM   8485  O OG1 . THR F  1 113 ? -21.974 17.738  117.050 1.00 31.28  ? 137 THR F OG1 1 
ATOM   8486  C CG2 . THR F  1 113 ? -24.130 16.849  117.618 1.00 31.82  ? 137 THR F CG2 1 
ATOM   8487  N N   . TYR F  1 114 ? -20.637 15.333  114.845 1.00 34.19  ? 138 TYR F N   1 
ATOM   8488  C CA  . TYR F  1 114 ? -19.676 15.317  113.733 1.00 34.33  ? 138 TYR F CA  1 
ATOM   8489  C C   . TYR F  1 114 ? -18.901 13.976  113.737 1.00 33.78  ? 138 TYR F C   1 
ATOM   8490  O O   . TYR F  1 114 ? -19.018 13.199  114.656 1.00 35.18  ? 138 TYR F O   1 
ATOM   8491  C CB  . TYR F  1 114 ? -18.689 16.474  113.877 1.00 33.24  ? 138 TYR F CB  1 
ATOM   8492  C CG  . TYR F  1 114 ? -17.836 16.334  115.117 1.00 34.10  ? 138 TYR F CG  1 
ATOM   8493  C CD1 . TYR F  1 114 ? -18.357 16.688  116.388 1.00 34.09  ? 138 TYR F CD1 1 
ATOM   8494  C CD2 . TYR F  1 114 ? -16.544 15.801  115.063 1.00 33.55  ? 138 TYR F CD2 1 
ATOM   8495  C CE1 . TYR F  1 114 ? -17.608 16.566  117.534 1.00 33.79  ? 138 TYR F CE1 1 
ATOM   8496  C CE2 . TYR F  1 114 ? -15.793 15.670  116.230 1.00 33.93  ? 138 TYR F CE2 1 
ATOM   8497  C CZ  . TYR F  1 114 ? -16.328 16.066  117.449 1.00 34.75  ? 138 TYR F CZ  1 
ATOM   8498  O OH  . TYR F  1 114 ? -15.589 15.952  118.599 1.00 36.97  ? 138 TYR F OH  1 
ATOM   8499  N N   . ASP F  1 115 ? -18.082 13.765  112.724 1.00 32.65  ? 139 ASP F N   1 
ATOM   8500  C CA  . ASP F  1 115 ? -17.327 12.562  112.529 1.00 31.54  ? 139 ASP F CA  1 
ATOM   8501  C C   . ASP F  1 115 ? -15.992 12.893  113.143 1.00 31.02  ? 139 ASP F C   1 
ATOM   8502  O O   . ASP F  1 115 ? -15.174 13.613  112.548 1.00 31.92  ? 139 ASP F O   1 
ATOM   8503  C CB  . ASP F  1 115 ? -17.254 12.288  111.004 1.00 32.07  ? 139 ASP F CB  1 
ATOM   8504  C CG  . ASP F  1 115 ? -16.312 11.138  110.609 1.00 31.72  ? 139 ASP F CG  1 
ATOM   8505  O OD1 . ASP F  1 115 ? -15.523 10.689  111.467 1.00 32.61  ? 139 ASP F OD1 1 
ATOM   8506  O OD2 . ASP F  1 115 ? -16.382 10.700  109.422 1.00 30.43  ? 139 ASP F OD2 1 
ATOM   8507  N N   . PRO F  1 116 ? -15.740 12.388  114.328 1.00 30.65  ? 140 PRO F N   1 
ATOM   8508  C CA  . PRO F  1 116 ? -14.470 12.692  114.969 1.00 31.11  ? 140 PRO F CA  1 
ATOM   8509  C C   . PRO F  1 116 ? -13.201 12.128  114.296 1.00 31.38  ? 140 PRO F C   1 
ATOM   8510  O O   . PRO F  1 116 ? -12.107 12.642  114.586 1.00 32.19  ? 140 PRO F O   1 
ATOM   8511  C CB  . PRO F  1 116 ? -14.623 12.019  116.324 1.00 31.56  ? 140 PRO F CB  1 
ATOM   8512  C CG  . PRO F  1 116 ? -15.413 10.781  116.020 1.00 31.44  ? 140 PRO F CG  1 
ATOM   8513  C CD  . PRO F  1 116 ? -16.331 11.170  114.883 1.00 31.39  ? 140 PRO F CD  1 
ATOM   8514  N N   . TYR F  1 117 ? -13.318 11.089  113.450 1.00 29.75  ? 141 TYR F N   1 
ATOM   8515  C CA  . TYR F  1 117 ? -12.143 10.541  112.748 1.00 29.01  ? 141 TYR F CA  1 
ATOM   8516  C C   . TYR F  1 117 ? -11.806 11.122  111.367 1.00 28.53  ? 141 TYR F C   1 
ATOM   8517  O O   . TYR F  1 117 ? -10.764 10.780  110.763 1.00 27.41  ? 141 TYR F O   1 
ATOM   8518  C CB  . TYR F  1 117 ? -12.255 9.024   112.636 1.00 28.63  ? 141 TYR F CB  1 
ATOM   8519  C CG  . TYR F  1 117 ? -12.066 8.356   113.959 1.00 29.37  ? 141 TYR F CG  1 
ATOM   8520  C CD1 . TYR F  1 117 ? -10.858 8.471   114.648 1.00 28.76  ? 141 TYR F CD1 1 
ATOM   8521  C CD2 . TYR F  1 117 ? -13.103 7.603   114.547 1.00 30.32  ? 141 TYR F CD2 1 
ATOM   8522  C CE1 . TYR F  1 117 ? -10.672 7.855   115.852 1.00 28.85  ? 141 TYR F CE1 1 
ATOM   8523  C CE2 . TYR F  1 117 ? -12.907 6.971   115.763 1.00 29.96  ? 141 TYR F CE2 1 
ATOM   8524  C CZ  . TYR F  1 117 ? -11.689 7.101   116.394 1.00 29.64  ? 141 TYR F CZ  1 
ATOM   8525  O OH  . TYR F  1 117 ? -11.500 6.482   117.590 1.00 30.19  ? 141 TYR F OH  1 
ATOM   8526  N N   . VAL F  1 118 ? -12.651 12.009  110.885 1.00 28.65  ? 142 VAL F N   1 
ATOM   8527  C CA  . VAL F  1 118 ? -12.498 12.542  109.545 1.00 29.27  ? 142 VAL F CA  1 
ATOM   8528  C C   . VAL F  1 118 ? -11.159 13.211  109.255 1.00 29.00  ? 142 VAL F C   1 
ATOM   8529  O O   . VAL F  1 118 ? -10.678 13.112  108.132 1.00 30.37  ? 142 VAL F O   1 
ATOM   8530  C CB  . VAL F  1 118 ? -13.637 13.537  109.207 1.00 30.38  ? 142 VAL F CB  1 
ATOM   8531  C CG1 . VAL F  1 118 ? -13.419 14.972  109.776 1.00 30.01  ? 142 VAL F CG1 1 
ATOM   8532  C CG2 . VAL F  1 118 ? -13.831 13.539  107.698 1.00 31.41  ? 142 VAL F CG2 1 
ATOM   8533  N N   . ASN F  1 119 ? -10.555 13.897  110.221 1.00 27.40  ? 143 ASN F N   1 
ATOM   8534  C CA  . ASN F  1 119 ? -9.281  14.499  109.920 1.00 27.68  ? 143 ASN F CA  1 
ATOM   8535  C C   . ASN F  1 119 ? -8.064  13.615  110.216 1.00 28.13  ? 143 ASN F C   1 
ATOM   8536  O O   . ASN F  1 119 ? -6.921  14.062  109.994 1.00 30.22  ? 143 ASN F O   1 
ATOM   8537  C CB  . ASN F  1 119 ? -9.135  15.853  110.622 1.00 27.86  ? 143 ASN F CB  1 
ATOM   8538  C CG  . ASN F  1 119 ? -10.122 16.900  110.101 1.00 26.80  ? 143 ASN F CG  1 
ATOM   8539  O OD1 . ASN F  1 119 ? -10.400 16.944  108.913 1.00 25.35  ? 143 ASN F OD1 1 
ATOM   8540  N ND2 . ASN F  1 119 ? -10.657 17.741  111.015 1.00 26.48  ? 143 ASN F ND2 1 
ATOM   8541  N N   . TYR F  1 120 ? -8.245  12.381  110.682 1.00 26.99  ? 144 TYR F N   1 
ATOM   8542  C CA  . TYR F  1 120 ? -7.068  11.613  111.097 1.00 26.50  ? 144 TYR F CA  1 
ATOM   8543  C C   . TYR F  1 120 ? -6.199  11.383  109.893 1.00 26.27  ? 144 TYR F C   1 
ATOM   8544  O O   . TYR F  1 120 ? -6.695  11.021  108.884 1.00 26.21  ? 144 TYR F O   1 
ATOM   8545  C CB  . TYR F  1 120 ? -7.448  10.272  111.726 1.00 25.86  ? 144 TYR F CB  1 
ATOM   8546  C CG  . TYR F  1 120 ? -7.718  10.373  113.215 1.00 25.34  ? 144 TYR F CG  1 
ATOM   8547  C CD1 . TYR F  1 120 ? -8.677  11.284  113.724 1.00 24.46  ? 144 TYR F CD1 1 
ATOM   8548  C CD2 . TYR F  1 120 ? -7.044  9.563   114.113 1.00 24.61  ? 144 TYR F CD2 1 
ATOM   8549  C CE1 . TYR F  1 120 ? -8.947  11.367  115.055 1.00 24.05  ? 144 TYR F CE1 1 
ATOM   8550  C CE2 . TYR F  1 120 ? -7.306  9.662   115.462 1.00 24.57  ? 144 TYR F CE2 1 
ATOM   8551  C CZ  . TYR F  1 120 ? -8.257  10.557  115.932 1.00 24.40  ? 144 TYR F CZ  1 
ATOM   8552  O OH  . TYR F  1 120 ? -8.467  10.641  117.291 1.00 23.64  ? 144 TYR F OH  1 
ATOM   8553  N N   . SER F  1 121 ? -4.916  11.630  109.988 1.00 26.46  ? 145 SER F N   1 
ATOM   8554  C CA  . SER F  1 121 ? -3.974  11.213  108.957 1.00 26.48  ? 145 SER F CA  1 
ATOM   8555  C C   . SER F  1 121 ? -4.274  9.849   108.441 1.00 26.06  ? 145 SER F C   1 
ATOM   8556  O O   . SER F  1 121 ? -4.181  9.635   107.252 1.00 26.47  ? 145 SER F O   1 
ATOM   8557  C CB  . SER F  1 121 ? -2.520  11.176  109.491 1.00 27.61  ? 145 SER F CB  1 
ATOM   8558  O OG  . SER F  1 121 ? -2.008  12.502  109.775 1.00 28.36  ? 145 SER F OG  1 
ATOM   8559  N N   . SER F  1 122 ? -4.648  8.923   109.299 1.00 26.23  ? 146 SER F N   1 
ATOM   8560  C CA  . SER F  1 122 ? -4.888  7.543   108.850 1.00 27.36  ? 146 SER F CA  1 
ATOM   8561  C C   . SER F  1 122 ? -6.318  7.258   108.357 1.00 29.25  ? 146 SER F C   1 
ATOM   8562  O O   . SER F  1 122 ? -6.707  6.070   108.168 1.00 30.07  ? 146 SER F O   1 
ATOM   8563  C CB  . SER F  1 122 ? -4.506  6.516   109.961 1.00 27.39  ? 146 SER F CB  1 
ATOM   8564  O OG  . SER F  1 122 ? -5.287  6.582   111.176 1.00 25.92  ? 146 SER F OG  1 
ATOM   8565  N N   . ARG F  1 123 ? -7.114  8.298   108.126 1.00 30.45  ? 147 ARG F N   1 
ATOM   8566  C CA  . ARG F  1 123 ? -8.540  8.072   107.880 1.00 31.59  ? 147 ARG F CA  1 
ATOM   8567  C C   . ARG F  1 123 ? -8.774  7.493   106.506 1.00 31.73  ? 147 ARG F C   1 
ATOM   8568  O O   . ARG F  1 123 ? -8.150  7.935   105.546 1.00 33.33  ? 147 ARG F O   1 
ATOM   8569  C CB  . ARG F  1 123 ? -9.309  9.372   108.007 1.00 32.83  ? 147 ARG F CB  1 
ATOM   8570  C CG  . ARG F  1 123 ? -10.800 9.294   107.719 1.00 33.62  ? 147 ARG F CG  1 
ATOM   8571  C CD  . ARG F  1 123 ? -11.103 9.722   106.300 1.00 33.69  ? 147 ARG F CD  1 
ATOM   8572  N NE  . ARG F  1 123 ? -10.979 11.163  106.063 1.00 33.58  ? 147 ARG F NE  1 
ATOM   8573  C CZ  . ARG F  1 123 ? -10.978 11.712  104.854 1.00 34.15  ? 147 ARG F CZ  1 
ATOM   8574  N NH1 . ARG F  1 123 ? -10.844 13.030  104.703 1.00 35.05  ? 147 ARG F NH1 1 
ATOM   8575  N NH2 . ARG F  1 123 ? -11.069 10.935  103.773 1.00 35.31  ? 147 ARG F NH2 1 
ATOM   8576  N N   . HIS F  1 124 ? -9.662  6.520   106.397 1.00 31.50  ? 148 HIS F N   1 
ATOM   8577  C CA  . HIS F  1 124 ? -10.198 6.144   105.086 1.00 32.13  ? 148 HIS F CA  1 
ATOM   8578  C C   . HIS F  1 124 ? -11.696 6.347   105.148 1.00 31.04  ? 148 HIS F C   1 
ATOM   8579  O O   . HIS F  1 124 ? -12.299 6.142   106.235 1.00 31.06  ? 148 HIS F O   1 
ATOM   8580  C CB  . HIS F  1 124 ? -9.934  4.667   104.767 1.00 33.62  ? 148 HIS F CB  1 
ATOM   8581  C CG  . HIS F  1 124 ? -8.565  4.366   104.247 1.00 35.09  ? 148 HIS F CG  1 
ATOM   8582  N ND1 . HIS F  1 124 ? -8.275  3.175   103.620 1.00 35.81  ? 148 HIS F ND1 1 
ATOM   8583  C CD2 . HIS F  1 124 ? -7.414  5.079   104.255 1.00 36.36  ? 148 HIS F CD2 1 
ATOM   8584  C CE1 . HIS F  1 124 ? -6.998  3.166   103.275 1.00 37.19  ? 148 HIS F CE1 1 
ATOM   8585  N NE2 . HIS F  1 124 ? -6.452  4.309   103.645 1.00 36.99  ? 148 HIS F NE2 1 
ATOM   8586  N N   . THR F  1 125 ? -12.306 6.667   103.994 1.00 29.54  ? 149 THR F N   1 
ATOM   8587  C CA  . THR F  1 125 ? -13.731 6.980   103.954 1.00 27.57  ? 149 THR F CA  1 
ATOM   8588  C C   . THR F  1 125 ? -14.603 5.739   103.982 1.00 27.43  ? 149 THR F C   1 
ATOM   8589  O O   . THR F  1 125 ? -14.300 4.730   103.363 1.00 26.50  ? 149 THR F O   1 
ATOM   8590  C CB  . THR F  1 125 ? -14.054 7.788   102.712 1.00 26.94  ? 149 THR F CB  1 
ATOM   8591  O OG1 . THR F  1 125 ? -13.205 8.903   102.606 1.00 25.69  ? 149 THR F OG1 1 
ATOM   8592  C CG2 . THR F  1 125 ? -15.443 8.318   102.766 1.00 27.86  ? 149 THR F CG2 1 
ATOM   8593  N N   . ILE F  1 126 ? -15.700 5.812   104.706 1.00 28.89  ? 150 ILE F N   1 
ATOM   8594  C CA  . ILE F  1 126 ? -16.671 4.701   104.731 1.00 31.18  ? 150 ILE F CA  1 
ATOM   8595  C C   . ILE F  1 126 ? -17.900 5.177   103.980 1.00 32.74  ? 150 ILE F C   1 
ATOM   8596  O O   . ILE F  1 126 ? -18.425 6.216   104.292 1.00 31.52  ? 150 ILE F O   1 
ATOM   8597  C CB  . ILE F  1 126 ? -17.108 4.258   106.147 1.00 31.29  ? 150 ILE F CB  1 
ATOM   8598  C CG1 . ILE F  1 126 ? -15.905 3.667   106.922 1.00 32.96  ? 150 ILE F CG1 1 
ATOM   8599  C CG2 . ILE F  1 126 ? -18.163 3.172   106.026 1.00 30.94  ? 150 ILE F CG2 1 
ATOM   8600  C CD1 . ILE F  1 126 ? -16.090 3.297   108.418 1.00 33.17  ? 150 ILE F CD1 1 
ATOM   8601  N N   . THR F  1 1