data_5ZR1
# 
_entry.id   5ZR1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.295 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZR1         
WWPDB D_1300007513 
EMDB  EMD-6941     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Origin Recognition Complex Bound to the Essential Elements of ARS DNA'                                         EMD-6941 
'associated EM volume' 
EMDB 'Saccharomyces Cerevisiae Origin Recognition Complex Bound to a 72-bp Origin DNA containing ACS and B1 element' EMD-6942 
'other EM volume'      
EMDB 'Saccharomyces Cerevisiae Origin Recognition Complex'                                                           EMD-6943 
'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZR1 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, N.'    1 ? 
'Lam, W.H.' 2 ? 
'Zhai, Y.'  3 ? 
'Cheng, J.' 4 ? 
'Cheng, E.' 5 ? 
'Zhao, Y.'  6 ? 
'Gao, N.'   7 ? 
'Tye, B.K.' 8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            559 
_citation.language                  ? 
_citation.page_first                217 
_citation.page_last                 222 
_citation.title                     'Structure of the origin recognition complex bound to DNA replication origin.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-018-0293-x 
_citation.pdbx_database_id_PubMed   29973722 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, N.'    1 
primary 'Lam, W.H.' 2 
primary 'Zhai, Y.'  3 
primary 'Cheng, J.' 4 
primary 'Cheng, E.' 5 
primary 'Zhao, Y.'  6 
primary 'Gao, N.'   7 
primary 'Tye, B.K.' 8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Origin recognition complex subunit 1'       104546.164 1 ? ? ? ? 
2  polymer     man 'Origin recognition complex subunit 2'       71342.180  1 ? ? ? ? 
3  polymer     man 'Origin recognition complex subunit 3'       72161.766  1 ? ? ? ? 
4  polymer     man 'Origin recognition complex subunit 4'       60772.152  1 ? ? ? ? 
5  polymer     man 'Origin recognition complex subunit 5'       55347.168  1 ? ? ? ? 
6  polymer     man 'Origin recognition complex subunit 6'       50369.531  1 ? ? ? ? 
7  polymer     syn '72bp-oring DNA, ACS305, T-rich'             22203.266  1 ? ? ? ? 
8  polymer     syn '72bp-oring DNA, ACS305, A-rich'             22174.412  1 ? ? ? ? 
9  non-polymer syn 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 523.247    3 ? ? ? ? 
10 non-polymer syn 'MAGNESIUM ION'                              24.305     3 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Origin recognition complex 120 kDa subunit'                         
2 'Origin recognition complex 71 kDa subunit'                          
3 'Origin recognition complex 62 kDa subunit'                          
4 'Origin recognition complex 56 kDa subunit'                          
5 'Origin recognition complex 53 kDa subunit'                          
6 'ACS-associated protein 1,Origin recognition complex 50 kDa subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLN
NVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEV
LKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAE
TRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEARHTNSPRKRGRKIKLGKDDID
ASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSE
LMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGT
PGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLEFYFKRVPKNKKKT
IVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRL
KGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKH
YMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTRLSFT
AKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNKFVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILF
KQTMKNDRICCVKLNISVEEAKRAMNEDETLRNL
;
;MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLN
NVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEV
LKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAE
TRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEARHTNSPRKRGRKIKLGKDDID
ASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSE
LMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGT
PGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLEFYFKRVPKNKKKT
IVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRL
KGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKH
YMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTRLSFT
AKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNKFVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILF
KQTMKNDRICCVKLNISVEEAKRAMNEDETLRNL
;
A ? 
2 'polypeptide(L)'        no no 
;MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGR
PRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDD
NFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVG
SKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHV
ILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFN
HLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL
;
;MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGR
PRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDD
NFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVG
SKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHV
ILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFN
HLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL
;
B ? 
3 'polypeptide(L)'        no no 
;MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWELYHQLHSHFHDQVDHIIDNIE
ADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKDESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHP
TIKYEDINDEDGDFTEQNNDVSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNI
NTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVEFILSKMANNTNHNLQLLTKM
LDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVREN
PINGHAKFVARFLEEELNITNFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIF
PSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIAFRETLPKEEILNFIRKD
PSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTKSYDLVEKCVWRGI
;
;MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWELYHQLHSHFHDQVDHIIDNIE
ADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKDESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHP
TIKYEDINDEDGDFTEQNNDVSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNI
NTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVEFILSKMANNTNHNLQLLTKM
LDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVREN
PINGHAKFVARFLEEELNITNFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIF
PSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIAFRETLPKEEILNFIRKD
PSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTKSYDLVEKCVWRGI
;
C ? 
4 'polypeptide(L)'        no no 
;MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQLYGTLPTDEKIIFTYLQDCQQ
EIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGS
EEKIDDTSLETISSGSLTEVFEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNL
NRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALR
AKDGSFNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
;
;MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQLYGTLPTDEKIIFTYLQDCQQ
EIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGS
EEKIDDTSLETISSGSLTEVFEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNL
NRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALR
AKDGSFNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
;
D ? 
5 'polypeptide(L)'        no no 
;MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIART
VQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDS
KINIKFIYTMLETSFLQRYSTHCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFI
HLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGESAITTNRDDLENSQ
TYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKA
ESGSLSALREESLMKANIEVFQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE
;
;MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIART
VQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDS
KINIKFIYTMLETSFLQRYSTHCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFI
HLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGESAITTNRDDLENSQ
TYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKA
ESGSLSALREESLMKANIEVFQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE
;
E ? 
6 'polypeptide(L)'        no no 
;MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYY
IDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFV
IPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRS
GRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLV
CGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFR
KLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL
;
;MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYY
IDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFV
IPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRS
GRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLV
CGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFR
KLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL
;
F ? 
7 polydeoxyribonucleotide no no 
;(DT)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DA)(DT)(DA)(DT)(DG)(DT)(DT)(DT)(DT)(DG)(DT)(DT)
(DA)(DT)(DG)(DT)(DA)(DT)(DT)(DG)(DT)(DT)(DT)(DA)(DT)(DT)(DT)(DT)(DC)(DC)(DC)(DT)
(DT)(DT)(DA)(DA)(DT)(DT)(DT)(DT)(DA)(DG)(DG)(DA)(DT)(DA)(DT)(DG)(DA)(DA)(DA)(DA)
(DC)(DA)(DA)(DG)(DA)(DA)(DT)(DT)(DT)(DA)(DT)(DC)
;
TGGTTTTTATATGTTTTGTTATGTATTGTTTATTTTCCCTTTAATTTTAGGATATGAAAACAAGAATTTATC G ? 
8 polydeoxyribonucleotide no no 
;(DG)(DA)(DT)(DA)(DA)(DA)(DT)(DT)(DC)(DT)(DT)(DG)(DT)(DT)(DT)(DT)(DC)(DA)(DT)(DA)
(DT)(DC)(DC)(DT)(DA)(DA)(DA)(DA)(DT)(DT)(DA)(DA)(DA)(DG)(DG)(DG)(DA)(DA)(DA)(DA)
(DT)(DA)(DA)(DA)(DC)(DA)(DA)(DT)(DA)(DC)(DA)(DT)(DA)(DA)(DC)(DA)(DA)(DA)(DA)(DC)
(DA)(DT)(DA)(DT)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DA)
;
GATAAATTCTTGTTTTCATATCCTAAAATTAAAGGGAAAATAAACAATACATAACAAAACATATAAAAACCA H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   THR n 
1 5   LEU n 
1 6   LYS n 
1 7   ASP n 
1 8   LEU n 
1 9   GLN n 
1 10  GLY n 
1 11  TRP n 
1 12  GLU n 
1 13  ILE n 
1 14  ILE n 
1 15  THR n 
1 16  THR n 
1 17  ASP n 
1 18  GLU n 
1 19  GLN n 
1 20  GLY n 
1 21  ASN n 
1 22  ILE n 
1 23  ILE n 
1 24  ASP n 
1 25  GLY n 
1 26  GLY n 
1 27  GLN n 
1 28  LYS n 
1 29  ARG n 
1 30  LEU n 
1 31  ARG n 
1 32  ARG n 
1 33  ARG n 
1 34  GLY n 
1 35  ALA n 
1 36  LYS n 
1 37  THR n 
1 38  GLU n 
1 39  HIS n 
1 40  TYR n 
1 41  LEU n 
1 42  LYS n 
1 43  ARG n 
1 44  SER n 
1 45  SER n 
1 46  ASP n 
1 47  GLY n 
1 48  ILE n 
1 49  LYS n 
1 50  LEU n 
1 51  GLY n 
1 52  ARG n 
1 53  GLY n 
1 54  ASP n 
1 55  SER n 
1 56  VAL n 
1 57  VAL n 
1 58  MET n 
1 59  HIS n 
1 60  ASN n 
1 61  GLU n 
1 62  ALA n 
1 63  ALA n 
1 64  GLY n 
1 65  THR n 
1 66  TYR n 
1 67  SER n 
1 68  VAL n 
1 69  TYR n 
1 70  MET n 
1 71  ILE n 
1 72  GLN n 
1 73  GLU n 
1 74  LEU n 
1 75  ARG n 
1 76  LEU n 
1 77  ASN n 
1 78  THR n 
1 79  LEU n 
1 80  ASN n 
1 81  ASN n 
1 82  VAL n 
1 83  VAL n 
1 84  GLU n 
1 85  LEU n 
1 86  TRP n 
1 87  ALA n 
1 88  LEU n 
1 89  THR n 
1 90  TYR n 
1 91  LEU n 
1 92  ARG n 
1 93  TRP n 
1 94  PHE n 
1 95  GLU n 
1 96  VAL n 
1 97  ASN n 
1 98  PRO n 
1 99  LEU n 
1 100 ALA n 
1 101 HIS n 
1 102 TYR n 
1 103 ARG n 
1 104 GLN n 
1 105 PHE n 
1 106 ASN n 
1 107 PRO n 
1 108 ASP n 
1 109 ALA n 
1 110 ASN n 
1 111 ILE n 
1 112 LEU n 
1 113 ASN n 
1 114 ARG n 
1 115 PRO n 
1 116 LEU n 
1 117 ASN n 
1 118 TYR n 
1 119 TYR n 
1 120 ASN n 
1 121 LYS n 
1 122 LEU n 
1 123 PHE n 
1 124 SER n 
1 125 GLU n 
1 126 THR n 
1 127 ALA n 
1 128 ASN n 
1 129 LYS n 
1 130 ASN n 
1 131 GLU n 
1 132 LEU n 
1 133 TYR n 
1 134 LEU n 
1 135 THR n 
1 136 ALA n 
1 137 GLU n 
1 138 LEU n 
1 139 ALA n 
1 140 GLU n 
1 141 LEU n 
1 142 GLN n 
1 143 LEU n 
1 144 PHE n 
1 145 ASN n 
1 146 PHE n 
1 147 ILE n 
1 148 ARG n 
1 149 VAL n 
1 150 ALA n 
1 151 ASN n 
1 152 VAL n 
1 153 MET n 
1 154 ASP n 
1 155 GLY n 
1 156 SER n 
1 157 LYS n 
1 158 TRP n 
1 159 GLU n 
1 160 VAL n 
1 161 LEU n 
1 162 LYS n 
1 163 GLY n 
1 164 ASN n 
1 165 VAL n 
1 166 ASP n 
1 167 PRO n 
1 168 GLU n 
1 169 ARG n 
1 170 ASP n 
1 171 PHE n 
1 172 THR n 
1 173 VAL n 
1 174 ARG n 
1 175 TYR n 
1 176 ILE n 
1 177 CYS n 
1 178 GLU n 
1 179 PRO n 
1 180 THR n 
1 181 GLY n 
1 182 GLU n 
1 183 LYS n 
1 184 PHE n 
1 185 VAL n 
1 186 ASP n 
1 187 ILE n 
1 188 ASN n 
1 189 ILE n 
1 190 GLU n 
1 191 ASP n 
1 192 VAL n 
1 193 LYS n 
1 194 ALA n 
1 195 TYR n 
1 196 ILE n 
1 197 LYS n 
1 198 LYS n 
1 199 VAL n 
1 200 GLU n 
1 201 PRO n 
1 202 ARG n 
1 203 GLU n 
1 204 ALA n 
1 205 GLN n 
1 206 GLU n 
1 207 TYR n 
1 208 LEU n 
1 209 LYS n 
1 210 ASP n 
1 211 LEU n 
1 212 THR n 
1 213 LEU n 
1 214 PRO n 
1 215 SER n 
1 216 LYS n 
1 217 LYS n 
1 218 LYS n 
1 219 GLU n 
1 220 ILE n 
1 221 LYS n 
1 222 ARG n 
1 223 GLY n 
1 224 PRO n 
1 225 GLN n 
1 226 LYS n 
1 227 LYS n 
1 228 ASP n 
1 229 LYS n 
1 230 ALA n 
1 231 THR n 
1 232 GLN n 
1 233 THR n 
1 234 ALA n 
1 235 GLN n 
1 236 ILE n 
1 237 SER n 
1 238 ASP n 
1 239 ALA n 
1 240 GLU n 
1 241 THR n 
1 242 ARG n 
1 243 ALA n 
1 244 THR n 
1 245 ASP n 
1 246 ILE n 
1 247 THR n 
1 248 ASP n 
1 249 ASN n 
1 250 GLU n 
1 251 ASP n 
1 252 GLY n 
1 253 ASN n 
1 254 GLU n 
1 255 ASP n 
1 256 GLU n 
1 257 SER n 
1 258 SER n 
1 259 ASP n 
1 260 TYR n 
1 261 GLU n 
1 262 SER n 
1 263 PRO n 
1 264 SER n 
1 265 ASP n 
1 266 ILE n 
1 267 ASP n 
1 268 VAL n 
1 269 SER n 
1 270 GLU n 
1 271 ASP n 
1 272 MET n 
1 273 ASP n 
1 274 SER n 
1 275 GLY n 
1 276 GLU n 
1 277 ILE n 
1 278 SER n 
1 279 ALA n 
1 280 ASP n 
1 281 GLU n 
1 282 LEU n 
1 283 GLU n 
1 284 GLU n 
1 285 GLU n 
1 286 GLU n 
1 287 ASP n 
1 288 GLU n 
1 289 GLU n 
1 290 GLU n 
1 291 ASP n 
1 292 GLU n 
1 293 ASP n 
1 294 GLU n 
1 295 GLU n 
1 296 GLU n 
1 297 LYS n 
1 298 GLU n 
1 299 ALA n 
1 300 ARG n 
1 301 HIS n 
1 302 THR n 
1 303 ASN n 
1 304 SER n 
1 305 PRO n 
1 306 ARG n 
1 307 LYS n 
1 308 ARG n 
1 309 GLY n 
1 310 ARG n 
1 311 LYS n 
1 312 ILE n 
1 313 LYS n 
1 314 LEU n 
1 315 GLY n 
1 316 LYS n 
1 317 ASP n 
1 318 ASP n 
1 319 ILE n 
1 320 ASP n 
1 321 ALA n 
1 322 SER n 
1 323 VAL n 
1 324 GLN n 
1 325 PRO n 
1 326 PRO n 
1 327 PRO n 
1 328 LYS n 
1 329 LYS n 
1 330 ARG n 
1 331 GLY n 
1 332 ARG n 
1 333 LYS n 
1 334 PRO n 
1 335 LYS n 
1 336 ASP n 
1 337 PRO n 
1 338 SER n 
1 339 LYS n 
1 340 PRO n 
1 341 ARG n 
1 342 GLN n 
1 343 MET n 
1 344 LEU n 
1 345 LEU n 
1 346 ILE n 
1 347 SER n 
1 348 SER n 
1 349 CYS n 
1 350 ARG n 
1 351 ALA n 
1 352 ASN n 
1 353 ASN n 
1 354 THR n 
1 355 PRO n 
1 356 VAL n 
1 357 ILE n 
1 358 ARG n 
1 359 LYS n 
1 360 PHE n 
1 361 THR n 
1 362 LYS n 
1 363 LYS n 
1 364 ASN n 
1 365 VAL n 
1 366 ALA n 
1 367 ARG n 
1 368 ALA n 
1 369 LYS n 
1 370 LYS n 
1 371 LYS n 
1 372 TYR n 
1 373 THR n 
1 374 PRO n 
1 375 PHE n 
1 376 SER n 
1 377 LYS n 
1 378 ARG n 
1 379 PHE n 
1 380 LYS n 
1 381 SER n 
1 382 ILE n 
1 383 ALA n 
1 384 ALA n 
1 385 ILE n 
1 386 PRO n 
1 387 ASP n 
1 388 LEU n 
1 389 THR n 
1 390 SER n 
1 391 LEU n 
1 392 PRO n 
1 393 GLU n 
1 394 PHE n 
1 395 TYR n 
1 396 GLY n 
1 397 ASN n 
1 398 SER n 
1 399 SER n 
1 400 GLU n 
1 401 LEU n 
1 402 MET n 
1 403 ALA n 
1 404 SER n 
1 405 ARG n 
1 406 PHE n 
1 407 GLU n 
1 408 ASN n 
1 409 LYS n 
1 410 LEU n 
1 411 LYS n 
1 412 THR n 
1 413 THR n 
1 414 GLN n 
1 415 LYS n 
1 416 HIS n 
1 417 GLN n 
1 418 ILE n 
1 419 VAL n 
1 420 GLU n 
1 421 THR n 
1 422 ILE n 
1 423 PHE n 
1 424 SER n 
1 425 LYS n 
1 426 VAL n 
1 427 LYS n 
1 428 LYS n 
1 429 GLN n 
1 430 LEU n 
1 431 ASN n 
1 432 SER n 
1 433 SER n 
1 434 TYR n 
1 435 VAL n 
1 436 LYS n 
1 437 GLU n 
1 438 GLU n 
1 439 ILE n 
1 440 LEU n 
1 441 LYS n 
1 442 SER n 
1 443 ALA n 
1 444 ASN n 
1 445 PHE n 
1 446 GLN n 
1 447 ASP n 
1 448 TYR n 
1 449 LEU n 
1 450 PRO n 
1 451 ALA n 
1 452 ARG n 
1 453 GLU n 
1 454 ASN n 
1 455 GLU n 
1 456 PHE n 
1 457 ALA n 
1 458 SER n 
1 459 ILE n 
1 460 TYR n 
1 461 LEU n 
1 462 SER n 
1 463 ALA n 
1 464 TYR n 
1 465 SER n 
1 466 ALA n 
1 467 ILE n 
1 468 GLU n 
1 469 SER n 
1 470 ASP n 
1 471 SER n 
1 472 ALA n 
1 473 THR n 
1 474 THR n 
1 475 ILE n 
1 476 TYR n 
1 477 VAL n 
1 478 ALA n 
1 479 GLY n 
1 480 THR n 
1 481 PRO n 
1 482 GLY n 
1 483 VAL n 
1 484 GLY n 
1 485 LYS n 
1 486 THR n 
1 487 LEU n 
1 488 THR n 
1 489 VAL n 
1 490 ARG n 
1 491 GLU n 
1 492 VAL n 
1 493 VAL n 
1 494 LYS n 
1 495 GLU n 
1 496 LEU n 
1 497 LEU n 
1 498 SER n 
1 499 SER n 
1 500 SER n 
1 501 ALA n 
1 502 GLN n 
1 503 ARG n 
1 504 GLU n 
1 505 ILE n 
1 506 PRO n 
1 507 ASP n 
1 508 PHE n 
1 509 LEU n 
1 510 TYR n 
1 511 VAL n 
1 512 GLU n 
1 513 ILE n 
1 514 ASN n 
1 515 GLY n 
1 516 LEU n 
1 517 LYS n 
1 518 MET n 
1 519 VAL n 
1 520 LYS n 
1 521 PRO n 
1 522 THR n 
1 523 ASP n 
1 524 CYS n 
1 525 TYR n 
1 526 GLU n 
1 527 THR n 
1 528 LEU n 
1 529 TRP n 
1 530 ASN n 
1 531 LYS n 
1 532 VAL n 
1 533 SER n 
1 534 GLY n 
1 535 GLU n 
1 536 ARG n 
1 537 LEU n 
1 538 THR n 
1 539 TRP n 
1 540 ALA n 
1 541 ALA n 
1 542 SER n 
1 543 MET n 
1 544 GLU n 
1 545 SER n 
1 546 LEU n 
1 547 GLU n 
1 548 PHE n 
1 549 TYR n 
1 550 PHE n 
1 551 LYS n 
1 552 ARG n 
1 553 VAL n 
1 554 PRO n 
1 555 LYS n 
1 556 ASN n 
1 557 LYS n 
1 558 LYS n 
1 559 LYS n 
1 560 THR n 
1 561 ILE n 
1 562 VAL n 
1 563 VAL n 
1 564 LEU n 
1 565 LEU n 
1 566 ASP n 
1 567 GLU n 
1 568 LEU n 
1 569 ASP n 
1 570 ALA n 
1 571 MET n 
1 572 VAL n 
1 573 THR n 
1 574 LYS n 
1 575 SER n 
1 576 GLN n 
1 577 ASP n 
1 578 ILE n 
1 579 MET n 
1 580 TYR n 
1 581 ASN n 
1 582 PHE n 
1 583 PHE n 
1 584 ASN n 
1 585 TRP n 
1 586 THR n 
1 587 THR n 
1 588 TYR n 
1 589 GLU n 
1 590 ASN n 
1 591 ALA n 
1 592 LYS n 
1 593 LEU n 
1 594 ILE n 
1 595 VAL n 
1 596 ILE n 
1 597 ALA n 
1 598 VAL n 
1 599 ALA n 
1 600 ASN n 
1 601 THR n 
1 602 MET n 
1 603 ASP n 
1 604 LEU n 
1 605 PRO n 
1 606 GLU n 
1 607 ARG n 
1 608 GLN n 
1 609 LEU n 
1 610 GLY n 
1 611 ASN n 
1 612 LYS n 
1 613 ILE n 
1 614 THR n 
1 615 SER n 
1 616 ARG n 
1 617 ILE n 
1 618 GLY n 
1 619 PHE n 
1 620 THR n 
1 621 ARG n 
1 622 ILE n 
1 623 MET n 
1 624 PHE n 
1 625 THR n 
1 626 GLY n 
1 627 TYR n 
1 628 THR n 
1 629 HIS n 
1 630 GLU n 
1 631 GLU n 
1 632 LEU n 
1 633 LYS n 
1 634 ASN n 
1 635 ILE n 
1 636 ILE n 
1 637 ASP n 
1 638 LEU n 
1 639 ARG n 
1 640 LEU n 
1 641 LYS n 
1 642 GLY n 
1 643 LEU n 
1 644 ASN n 
1 645 ASP n 
1 646 SER n 
1 647 PHE n 
1 648 PHE n 
1 649 TYR n 
1 650 VAL n 
1 651 ASP n 
1 652 THR n 
1 653 LYS n 
1 654 THR n 
1 655 GLY n 
1 656 ASN n 
1 657 ALA n 
1 658 ILE n 
1 659 LEU n 
1 660 ILE n 
1 661 ASP n 
1 662 ALA n 
1 663 ALA n 
1 664 GLY n 
1 665 ASN n 
1 666 ASP n 
1 667 THR n 
1 668 THR n 
1 669 VAL n 
1 670 LYS n 
1 671 GLN n 
1 672 THR n 
1 673 LEU n 
1 674 PRO n 
1 675 GLU n 
1 676 ASP n 
1 677 VAL n 
1 678 ARG n 
1 679 LYS n 
1 680 VAL n 
1 681 ARG n 
1 682 LEU n 
1 683 ARG n 
1 684 MET n 
1 685 SER n 
1 686 ALA n 
1 687 ASP n 
1 688 ALA n 
1 689 ILE n 
1 690 GLU n 
1 691 ILE n 
1 692 ALA n 
1 693 SER n 
1 694 ARG n 
1 695 LYS n 
1 696 VAL n 
1 697 ALA n 
1 698 SER n 
1 699 VAL n 
1 700 SER n 
1 701 GLY n 
1 702 ASP n 
1 703 ALA n 
1 704 ARG n 
1 705 ARG n 
1 706 ALA n 
1 707 LEU n 
1 708 LYS n 
1 709 VAL n 
1 710 CYS n 
1 711 LYS n 
1 712 ARG n 
1 713 ALA n 
1 714 ALA n 
1 715 GLU n 
1 716 ILE n 
1 717 ALA n 
1 718 GLU n 
1 719 LYS n 
1 720 HIS n 
1 721 TYR n 
1 722 MET n 
1 723 ALA n 
1 724 LYS n 
1 725 HIS n 
1 726 GLY n 
1 727 TYR n 
1 728 GLY n 
1 729 TYR n 
1 730 ASP n 
1 731 GLY n 
1 732 LYS n 
1 733 THR n 
1 734 VAL n 
1 735 ILE n 
1 736 GLU n 
1 737 ASP n 
1 738 GLU n 
1 739 ASN n 
1 740 GLU n 
1 741 GLU n 
1 742 GLN n 
1 743 ILE n 
1 744 TYR n 
1 745 ASP n 
1 746 ASP n 
1 747 GLU n 
1 748 ASP n 
1 749 LYS n 
1 750 ASP n 
1 751 LEU n 
1 752 ILE n 
1 753 GLU n 
1 754 SER n 
1 755 ASN n 
1 756 LYS n 
1 757 ALA n 
1 758 LYS n 
1 759 ASP n 
1 760 ASP n 
1 761 ASN n 
1 762 ASP n 
1 763 ASP n 
1 764 ASP n 
1 765 ASP n 
1 766 ASP n 
1 767 ASN n 
1 768 ASP n 
1 769 GLY n 
1 770 VAL n 
1 771 GLN n 
1 772 THR n 
1 773 VAL n 
1 774 HIS n 
1 775 ILE n 
1 776 THR n 
1 777 HIS n 
1 778 VAL n 
1 779 MET n 
1 780 LYS n 
1 781 ALA n 
1 782 LEU n 
1 783 ASN n 
1 784 GLU n 
1 785 THR n 
1 786 LEU n 
1 787 ASN n 
1 788 SER n 
1 789 HIS n 
1 790 VAL n 
1 791 ILE n 
1 792 THR n 
1 793 PHE n 
1 794 MET n 
1 795 THR n 
1 796 ARG n 
1 797 LEU n 
1 798 SER n 
1 799 PHE n 
1 800 THR n 
1 801 ALA n 
1 802 LYS n 
1 803 LEU n 
1 804 PHE n 
1 805 ILE n 
1 806 TYR n 
1 807 ALA n 
1 808 LEU n 
1 809 LEU n 
1 810 ASN n 
1 811 LEU n 
1 812 MET n 
1 813 LYS n 
1 814 LYS n 
1 815 ASN n 
1 816 GLY n 
1 817 SER n 
1 818 GLN n 
1 819 GLU n 
1 820 GLN n 
1 821 GLU n 
1 822 LEU n 
1 823 GLY n 
1 824 ASP n 
1 825 ILE n 
1 826 VAL n 
1 827 ASP n 
1 828 GLU n 
1 829 ILE n 
1 830 LYS n 
1 831 LEU n 
1 832 LEU n 
1 833 ILE n 
1 834 GLU n 
1 835 VAL n 
1 836 ASN n 
1 837 GLY n 
1 838 SER n 
1 839 ASN n 
1 840 LYS n 
1 841 PHE n 
1 842 VAL n 
1 843 MET n 
1 844 GLU n 
1 845 ILE n 
1 846 ALA n 
1 847 LYS n 
1 848 THR n 
1 849 LEU n 
1 850 PHE n 
1 851 GLN n 
1 852 GLN n 
1 853 GLY n 
1 854 SER n 
1 855 ASP n 
1 856 ASN n 
1 857 ILE n 
1 858 SER n 
1 859 GLU n 
1 860 GLN n 
1 861 LEU n 
1 862 ARG n 
1 863 ILE n 
1 864 ILE n 
1 865 SER n 
1 866 TRP n 
1 867 ASP n 
1 868 PHE n 
1 869 VAL n 
1 870 LEU n 
1 871 ASN n 
1 872 GLN n 
1 873 LEU n 
1 874 LEU n 
1 875 ASP n 
1 876 ALA n 
1 877 GLY n 
1 878 ILE n 
1 879 LEU n 
1 880 PHE n 
1 881 LYS n 
1 882 GLN n 
1 883 THR n 
1 884 MET n 
1 885 LYS n 
1 886 ASN n 
1 887 ASP n 
1 888 ARG n 
1 889 ILE n 
1 890 CYS n 
1 891 CYS n 
1 892 VAL n 
1 893 LYS n 
1 894 LEU n 
1 895 ASN n 
1 896 ILE n 
1 897 SER n 
1 898 VAL n 
1 899 GLU n 
1 900 GLU n 
1 901 ALA n 
1 902 LYS n 
1 903 ARG n 
1 904 ALA n 
1 905 MET n 
1 906 ASN n 
1 907 GLU n 
1 908 ASP n 
1 909 GLU n 
1 910 THR n 
1 911 LEU n 
1 912 ARG n 
1 913 ASN n 
1 914 LEU n 
2 1   MET n 
2 2   LEU n 
2 3   ASN n 
2 4   GLY n 
2 5   GLU n 
2 6   ASP n 
2 7   PHE n 
2 8   VAL n 
2 9   GLU n 
2 10  HIS n 
2 11  ASN n 
2 12  ASP n 
2 13  ILE n 
2 14  LEU n 
2 15  SER n 
2 16  SER n 
2 17  PRO n 
2 18  ALA n 
2 19  LYS n 
2 20  SER n 
2 21  ARG n 
2 22  ASN n 
2 23  VAL n 
2 24  THR n 
2 25  PRO n 
2 26  LYS n 
2 27  ARG n 
2 28  VAL n 
2 29  ASP n 
2 30  PRO n 
2 31  HIS n 
2 32  GLY n 
2 33  GLU n 
2 34  ARG n 
2 35  GLN n 
2 36  LEU n 
2 37  ARG n 
2 38  ARG n 
2 39  ILE n 
2 40  HIS n 
2 41  SER n 
2 42  SER n 
2 43  LYS n 
2 44  LYS n 
2 45  ASN n 
2 46  LEU n 
2 47  LEU n 
2 48  GLU n 
2 49  ARG n 
2 50  ILE n 
2 51  SER n 
2 52  LEU n 
2 53  VAL n 
2 54  GLY n 
2 55  ASN n 
2 56  GLU n 
2 57  ARG n 
2 58  LYS n 
2 59  ASN n 
2 60  THR n 
2 61  SER n 
2 62  PRO n 
2 63  ASP n 
2 64  PRO n 
2 65  ALA n 
2 66  LEU n 
2 67  LYS n 
2 68  PRO n 
2 69  LYS n 
2 70  THR n 
2 71  PRO n 
2 72  SER n 
2 73  LYS n 
2 74  ALA n 
2 75  PRO n 
2 76  ARG n 
2 77  LYS n 
2 78  ARG n 
2 79  GLY n 
2 80  ARG n 
2 81  PRO n 
2 82  ARG n 
2 83  LYS n 
2 84  ILE n 
2 85  GLN n 
2 86  GLU n 
2 87  GLU n 
2 88  LEU n 
2 89  THR n 
2 90  ASP n 
2 91  ARG n 
2 92  ILE n 
2 93  LYS n 
2 94  LYS n 
2 95  ASP n 
2 96  GLU n 
2 97  LYS n 
2 98  ASP n 
2 99  THR n 
2 100 ILE n 
2 101 SER n 
2 102 SER n 
2 103 LYS n 
2 104 LYS n 
2 105 LYS n 
2 106 ARG n 
2 107 LYS n 
2 108 LEU n 
2 109 ASP n 
2 110 LYS n 
2 111 ASP n 
2 112 THR n 
2 113 SER n 
2 114 GLY n 
2 115 ASN n 
2 116 VAL n 
2 117 ASN n 
2 118 GLU n 
2 119 GLU n 
2 120 SER n 
2 121 LYS n 
2 122 THR n 
2 123 SER n 
2 124 ASN n 
2 125 ASN n 
2 126 LYS n 
2 127 GLN n 
2 128 VAL n 
2 129 MET n 
2 130 GLU n 
2 131 LYS n 
2 132 THR n 
2 133 GLY n 
2 134 ILE n 
2 135 LYS n 
2 136 GLU n 
2 137 LYS n 
2 138 ARG n 
2 139 GLU n 
2 140 ARG n 
2 141 GLU n 
2 142 LYS n 
2 143 ILE n 
2 144 GLN n 
2 145 VAL n 
2 146 ALA n 
2 147 THR n 
2 148 THR n 
2 149 THR n 
2 150 TYR n 
2 151 GLU n 
2 152 ASP n 
2 153 ASN n 
2 154 VAL n 
2 155 THR n 
2 156 PRO n 
2 157 GLN n 
2 158 THR n 
2 159 ASP n 
2 160 ASP n 
2 161 ASN n 
2 162 PHE n 
2 163 VAL n 
2 164 SER n 
2 165 ASN n 
2 166 SER n 
2 167 PRO n 
2 168 GLU n 
2 169 PRO n 
2 170 PRO n 
2 171 GLU n 
2 172 PRO n 
2 173 ALA n 
2 174 THR n 
2 175 PRO n 
2 176 SER n 
2 177 LYS n 
2 178 LYS n 
2 179 SER n 
2 180 LEU n 
2 181 THR n 
2 182 THR n 
2 183 ASN n 
2 184 HIS n 
2 185 ASP n 
2 186 PHE n 
2 187 THR n 
2 188 SER n 
2 189 PRO n 
2 190 LEU n 
2 191 LYS n 
2 192 GLN n 
2 193 ILE n 
2 194 ILE n 
2 195 MET n 
2 196 ASN n 
2 197 ASN n 
2 198 LEU n 
2 199 LYS n 
2 200 GLU n 
2 201 TYR n 
2 202 LYS n 
2 203 ASP n 
2 204 SER n 
2 205 THR n 
2 206 SER n 
2 207 PRO n 
2 208 GLY n 
2 209 LYS n 
2 210 LEU n 
2 211 THR n 
2 212 LEU n 
2 213 SER n 
2 214 ARG n 
2 215 ASN n 
2 216 PHE n 
2 217 THR n 
2 218 PRO n 
2 219 THR n 
2 220 PRO n 
2 221 VAL n 
2 222 PRO n 
2 223 LYS n 
2 224 ASN n 
2 225 LYS n 
2 226 LYS n 
2 227 LEU n 
2 228 TYR n 
2 229 GLN n 
2 230 THR n 
2 231 SER n 
2 232 GLU n 
2 233 THR n 
2 234 LYS n 
2 235 SER n 
2 236 ALA n 
2 237 SER n 
2 238 SER n 
2 239 PHE n 
2 240 LEU n 
2 241 ASP n 
2 242 THR n 
2 243 PHE n 
2 244 GLU n 
2 245 GLY n 
2 246 TYR n 
2 247 PHE n 
2 248 ASP n 
2 249 GLN n 
2 250 ARG n 
2 251 LYS n 
2 252 ILE n 
2 253 VAL n 
2 254 ARG n 
2 255 THR n 
2 256 ASN n 
2 257 ALA n 
2 258 LYS n 
2 259 SER n 
2 260 ARG n 
2 261 HIS n 
2 262 THR n 
2 263 MET n 
2 264 SER n 
2 265 MET n 
2 266 ALA n 
2 267 PRO n 
2 268 ASP n 
2 269 VAL n 
2 270 THR n 
2 271 ARG n 
2 272 GLU n 
2 273 GLU n 
2 274 PHE n 
2 275 SER n 
2 276 LEU n 
2 277 VAL n 
2 278 SER n 
2 279 ASN n 
2 280 PHE n 
2 281 PHE n 
2 282 ASN n 
2 283 GLU n 
2 284 ASN n 
2 285 PHE n 
2 286 GLN n 
2 287 LYS n 
2 288 ARG n 
2 289 PRO n 
2 290 ARG n 
2 291 GLN n 
2 292 LYS n 
2 293 LEU n 
2 294 PHE n 
2 295 GLU n 
2 296 ILE n 
2 297 GLN n 
2 298 LYS n 
2 299 LYS n 
2 300 MET n 
2 301 PHE n 
2 302 PRO n 
2 303 GLN n 
2 304 TYR n 
2 305 TRP n 
2 306 PHE n 
2 307 GLU n 
2 308 LEU n 
2 309 THR n 
2 310 GLN n 
2 311 GLY n 
2 312 PHE n 
2 313 SER n 
2 314 LEU n 
2 315 LEU n 
2 316 PHE n 
2 317 TYR n 
2 318 GLY n 
2 319 VAL n 
2 320 GLY n 
2 321 SER n 
2 322 LYS n 
2 323 ARG n 
2 324 ASN n 
2 325 PHE n 
2 326 LEU n 
2 327 GLU n 
2 328 GLU n 
2 329 PHE n 
2 330 ALA n 
2 331 ILE n 
2 332 ASP n 
2 333 TYR n 
2 334 LEU n 
2 335 SER n 
2 336 PRO n 
2 337 LYS n 
2 338 ILE n 
2 339 ALA n 
2 340 TYR n 
2 341 SER n 
2 342 GLN n 
2 343 LEU n 
2 344 ALA n 
2 345 TYR n 
2 346 GLU n 
2 347 ASN n 
2 348 GLU n 
2 349 LEU n 
2 350 GLN n 
2 351 GLN n 
2 352 ASN n 
2 353 LYS n 
2 354 PRO n 
2 355 VAL n 
2 356 ASN n 
2 357 SER n 
2 358 ILE n 
2 359 PRO n 
2 360 CYS n 
2 361 LEU n 
2 362 ILE n 
2 363 LEU n 
2 364 ASN n 
2 365 GLY n 
2 366 TYR n 
2 367 ASN n 
2 368 PRO n 
2 369 SER n 
2 370 CYS n 
2 371 ASN n 
2 372 TYR n 
2 373 ARG n 
2 374 ASP n 
2 375 VAL n 
2 376 PHE n 
2 377 LYS n 
2 378 GLU n 
2 379 ILE n 
2 380 THR n 
2 381 ASP n 
2 382 LEU n 
2 383 LEU n 
2 384 VAL n 
2 385 PRO n 
2 386 ALA n 
2 387 GLU n 
2 388 LEU n 
2 389 THR n 
2 390 ARG n 
2 391 SER n 
2 392 GLU n 
2 393 THR n 
2 394 LYS n 
2 395 TYR n 
2 396 TRP n 
2 397 GLY n 
2 398 ASN n 
2 399 HIS n 
2 400 VAL n 
2 401 ILE n 
2 402 LEU n 
2 403 GLN n 
2 404 ILE n 
2 405 GLN n 
2 406 LYS n 
2 407 MET n 
2 408 ILE n 
2 409 ASP n 
2 410 PHE n 
2 411 TYR n 
2 412 LYS n 
2 413 ASN n 
2 414 GLN n 
2 415 PRO n 
2 416 LEU n 
2 417 ASP n 
2 418 ILE n 
2 419 LYS n 
2 420 LEU n 
2 421 ILE n 
2 422 LEU n 
2 423 VAL n 
2 424 VAL n 
2 425 HIS n 
2 426 ASN n 
2 427 LEU n 
2 428 ASP n 
2 429 GLY n 
2 430 PRO n 
2 431 SER n 
2 432 ILE n 
2 433 ARG n 
2 434 LYS n 
2 435 ASN n 
2 436 THR n 
2 437 PHE n 
2 438 GLN n 
2 439 THR n 
2 440 MET n 
2 441 LEU n 
2 442 SER n 
2 443 PHE n 
2 444 LEU n 
2 445 SER n 
2 446 VAL n 
2 447 ILE n 
2 448 ARG n 
2 449 GLN n 
2 450 ILE n 
2 451 ALA n 
2 452 ILE n 
2 453 VAL n 
2 454 ALA n 
2 455 SER n 
2 456 THR n 
2 457 ASP n 
2 458 HIS n 
2 459 ILE n 
2 460 TYR n 
2 461 ALA n 
2 462 PRO n 
2 463 LEU n 
2 464 LEU n 
2 465 TRP n 
2 466 ASP n 
2 467 ASN n 
2 468 MET n 
2 469 LYS n 
2 470 ALA n 
2 471 GLN n 
2 472 ASN n 
2 473 TYR n 
2 474 ASN n 
2 475 PHE n 
2 476 VAL n 
2 477 PHE n 
2 478 HIS n 
2 479 ASP n 
2 480 ILE n 
2 481 SER n 
2 482 ASN n 
2 483 PHE n 
2 484 GLU n 
2 485 PRO n 
2 486 SER n 
2 487 THR n 
2 488 VAL n 
2 489 GLU n 
2 490 SER n 
2 491 THR n 
2 492 PHE n 
2 493 GLN n 
2 494 ASP n 
2 495 VAL n 
2 496 MET n 
2 497 LYS n 
2 498 MET n 
2 499 GLY n 
2 500 LYS n 
2 501 SER n 
2 502 ASP n 
2 503 THR n 
2 504 SER n 
2 505 SER n 
2 506 GLY n 
2 507 ALA n 
2 508 GLU n 
2 509 GLY n 
2 510 ALA n 
2 511 LYS n 
2 512 TYR n 
2 513 VAL n 
2 514 LEU n 
2 515 GLN n 
2 516 SER n 
2 517 LEU n 
2 518 THR n 
2 519 VAL n 
2 520 ASN n 
2 521 SER n 
2 522 LYS n 
2 523 LYS n 
2 524 MET n 
2 525 TYR n 
2 526 LYS n 
2 527 LEU n 
2 528 LEU n 
2 529 ILE n 
2 530 GLU n 
2 531 THR n 
2 532 GLN n 
2 533 MET n 
2 534 GLN n 
2 535 ASN n 
2 536 MET n 
2 537 GLY n 
2 538 ASN n 
2 539 LEU n 
2 540 SER n 
2 541 ALA n 
2 542 ASN n 
2 543 THR n 
2 544 GLY n 
2 545 PRO n 
2 546 LYS n 
2 547 ARG n 
2 548 GLY n 
2 549 THR n 
2 550 GLN n 
2 551 ARG n 
2 552 THR n 
2 553 GLY n 
2 554 VAL n 
2 555 GLU n 
2 556 LEU n 
2 557 LYS n 
2 558 LEU n 
2 559 PHE n 
2 560 ASN n 
2 561 HIS n 
2 562 LEU n 
2 563 CYS n 
2 564 ALA n 
2 565 ALA n 
2 566 ASP n 
2 567 PHE n 
2 568 ILE n 
2 569 ALA n 
2 570 SER n 
2 571 ASN n 
2 572 GLU n 
2 573 ILE n 
2 574 ALA n 
2 575 LEU n 
2 576 ARG n 
2 577 SER n 
2 578 MET n 
2 579 LEU n 
2 580 ARG n 
2 581 GLU n 
2 582 PHE n 
2 583 ILE n 
2 584 GLU n 
2 585 HIS n 
2 586 LYS n 
2 587 MET n 
2 588 ALA n 
2 589 ASN n 
2 590 ILE n 
2 591 THR n 
2 592 LYS n 
2 593 ASN n 
2 594 ASN n 
2 595 SER n 
2 596 GLY n 
2 597 MET n 
2 598 GLU n 
2 599 ILE n 
2 600 ILE n 
2 601 TRP n 
2 602 VAL n 
2 603 PRO n 
2 604 TYR n 
2 605 THR n 
2 606 TYR n 
2 607 ALA n 
2 608 GLU n 
2 609 LEU n 
2 610 GLU n 
2 611 LYS n 
2 612 LEU n 
2 613 LEU n 
2 614 LYS n 
2 615 THR n 
2 616 VAL n 
2 617 LEU n 
2 618 ASN n 
2 619 THR n 
2 620 LEU n 
3 1   MET n 
3 2   SER n 
3 3   ASP n 
3 4   LEU n 
3 5   ASN n 
3 6   GLN n 
3 7   SER n 
3 8   LYS n 
3 9   LYS n 
3 10  MET n 
3 11  ASN n 
3 12  VAL n 
3 13  SER n 
3 14  GLU n 
3 15  PHE n 
3 16  ALA n 
3 17  ASP n 
3 18  ALA n 
3 19  GLN n 
3 20  ARG n 
3 21  SER n 
3 22  HIS n 
3 23  TYR n 
3 24  THR n 
3 25  VAL n 
3 26  TYR n 
3 27  PRO n 
3 28  SER n 
3 29  LEU n 
3 30  PRO n 
3 31  GLN n 
3 32  SER n 
3 33  ASN n 
3 34  LYS n 
3 35  ASN n 
3 36  ASP n 
3 37  LYS n 
3 38  HIS n 
3 39  ILE n 
3 40  PRO n 
3 41  PHE n 
3 42  VAL n 
3 43  LYS n 
3 44  LEU n 
3 45  LEU n 
3 46  SER n 
3 47  GLY n 
3 48  LYS n 
3 49  GLU n 
3 50  SER n 
3 51  GLU n 
3 52  VAL n 
3 53  ASN n 
3 54  VAL n 
3 55  GLU n 
3 56  LYS n 
3 57  ARG n 
3 58  TRP n 
3 59  GLU n 
3 60  LEU n 
3 61  TYR n 
3 62  HIS n 
3 63  GLN n 
3 64  LEU n 
3 65  HIS n 
3 66  SER n 
3 67  HIS n 
3 68  PHE n 
3 69  HIS n 
3 70  ASP n 
3 71  GLN n 
3 72  VAL n 
3 73  ASP n 
3 74  HIS n 
3 75  ILE n 
3 76  ILE n 
3 77  ASP n 
3 78  ASN n 
3 79  ILE n 
3 80  GLU n 
3 81  ALA n 
3 82  ASP n 
3 83  LEU n 
3 84  LYS n 
3 85  ALA n 
3 86  GLU n 
3 87  ILE n 
3 88  SER n 
3 89  ASP n 
3 90  LEU n 
3 91  LEU n 
3 92  TYR n 
3 93  SER n 
3 94  GLU n 
3 95  THR n 
3 96  THR n 
3 97  GLN n 
3 98  LYS n 
3 99  ARG n 
3 100 ARG n 
3 101 CYS n 
3 102 PHE n 
3 103 ASN n 
3 104 THR n 
3 105 ILE n 
3 106 PHE n 
3 107 LEU n 
3 108 LEU n 
3 109 GLY n 
3 110 SER n 
3 111 ASP n 
3 112 SER n 
3 113 THR n 
3 114 THR n 
3 115 LYS n 
3 116 ILE n 
3 117 GLU n 
3 118 LEU n 
3 119 LYS n 
3 120 ASP n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 ARG n 
3 125 TYR n 
3 126 ASN n 
3 127 VAL n 
3 128 LEU n 
3 129 ILE n 
3 130 GLU n 
3 131 LEU n 
3 132 THR n 
3 133 PRO n 
3 134 LYS n 
3 135 GLU n 
3 136 SER n 
3 137 PRO n 
3 138 ASN n 
3 139 VAL n 
3 140 ARG n 
3 141 MET n 
3 142 MET n 
3 143 LEU n 
3 144 ARG n 
3 145 ARG n 
3 146 SER n 
3 147 MET n 
3 148 TYR n 
3 149 LYS n 
3 150 LEU n 
3 151 TYR n 
3 152 SER n 
3 153 ALA n 
3 154 ALA n 
3 155 ASP n 
3 156 ALA n 
3 157 GLU n 
3 158 GLU n 
3 159 HIS n 
3 160 PRO n 
3 161 THR n 
3 162 ILE n 
3 163 LYS n 
3 164 TYR n 
3 165 GLU n 
3 166 ASP n 
3 167 ILE n 
3 168 ASN n 
3 169 ASP n 
3 170 GLU n 
3 171 ASP n 
3 172 GLY n 
3 173 ASP n 
3 174 PHE n 
3 175 THR n 
3 176 GLU n 
3 177 GLN n 
3 178 ASN n 
3 179 ASN n 
3 180 ASP n 
3 181 VAL n 
3 182 SER n 
3 183 TYR n 
3 184 ASP n 
3 185 LEU n 
3 186 SER n 
3 187 LEU n 
3 188 VAL n 
3 189 GLU n 
3 190 ASN n 
3 191 PHE n 
3 192 LYS n 
3 193 ARG n 
3 194 LEU n 
3 195 PHE n 
3 196 GLY n 
3 197 LYS n 
3 198 ASP n 
3 199 LEU n 
3 200 ALA n 
3 201 MET n 
3 202 VAL n 
3 203 PHE n 
3 204 ASN n 
3 205 PHE n 
3 206 LYS n 
3 207 ASP n 
3 208 VAL n 
3 209 ASP n 
3 210 SER n 
3 211 ILE n 
3 212 ASN n 
3 213 PHE n 
3 214 ASN n 
3 215 THR n 
3 216 LEU n 
3 217 ASP n 
3 218 ASN n 
3 219 PHE n 
3 220 ILE n 
3 221 ILE n 
3 222 LEU n 
3 223 LEU n 
3 224 LYS n 
3 225 SER n 
3 226 ALA n 
3 227 PHE n 
3 228 LYS n 
3 229 TYR n 
3 230 ASP n 
3 231 HIS n 
3 232 VAL n 
3 233 LYS n 
3 234 ILE n 
3 235 SER n 
3 236 LEU n 
3 237 ILE n 
3 238 PHE n 
3 239 ASN n 
3 240 ILE n 
3 241 ASN n 
3 242 THR n 
3 243 ASN n 
3 244 LEU n 
3 245 SER n 
3 246 ASN n 
3 247 ILE n 
3 248 GLU n 
3 249 LYS n 
3 250 ASN n 
3 251 LEU n 
3 252 ARG n 
3 253 GLN n 
3 254 SER n 
3 255 THR n 
3 256 ILE n 
3 257 ARG n 
3 258 LEU n 
3 259 LEU n 
3 260 LYS n 
3 261 ARG n 
3 262 ASN n 
3 263 TYR n 
3 264 HIS n 
3 265 LYS n 
3 266 LEU n 
3 267 ASP n 
3 268 VAL n 
3 269 SER n 
3 270 SER n 
3 271 ASN n 
3 272 LYS n 
3 273 GLY n 
3 274 PHE n 
3 275 LYS n 
3 276 TYR n 
3 277 GLY n 
3 278 ASN n 
3 279 GLN n 
3 280 ILE n 
3 281 PHE n 
3 282 GLN n 
3 283 SER n 
3 284 PHE n 
3 285 LEU n 
3 286 ASP n 
3 287 THR n 
3 288 VAL n 
3 289 ASP n 
3 290 GLY n 
3 291 LYS n 
3 292 LEU n 
3 293 ASN n 
3 294 LEU n 
3 295 SER n 
3 296 ASP n 
3 297 ARG n 
3 298 PHE n 
3 299 VAL n 
3 300 GLU n 
3 301 PHE n 
3 302 ILE n 
3 303 LEU n 
3 304 SER n 
3 305 LYS n 
3 306 MET n 
3 307 ALA n 
3 308 ASN n 
3 309 ASN n 
3 310 THR n 
3 311 ASN n 
3 312 HIS n 
3 313 ASN n 
3 314 LEU n 
3 315 GLN n 
3 316 LEU n 
3 317 LEU n 
3 318 THR n 
3 319 LYS n 
3 320 MET n 
3 321 LEU n 
3 322 ASP n 
3 323 TYR n 
3 324 SER n 
3 325 LEU n 
3 326 MET n 
3 327 SER n 
3 328 TYR n 
3 329 PHE n 
3 330 PHE n 
3 331 GLN n 
3 332 ASN n 
3 333 ALA n 
3 334 PHE n 
3 335 SER n 
3 336 VAL n 
3 337 PHE n 
3 338 ILE n 
3 339 ASP n 
3 340 PRO n 
3 341 VAL n 
3 342 ASN n 
3 343 VAL n 
3 344 ASP n 
3 345 PHE n 
3 346 LEU n 
3 347 ASN n 
3 348 ASP n 
3 349 ASP n 
3 350 TYR n 
3 351 LEU n 
3 352 LYS n 
3 353 ILE n 
3 354 LEU n 
3 355 SER n 
3 356 ARG n 
3 357 CYS n 
3 358 PRO n 
3 359 THR n 
3 360 PHE n 
3 361 MET n 
3 362 PHE n 
3 363 PHE n 
3 364 VAL n 
3 365 GLU n 
3 366 GLY n 
3 367 LEU n 
3 368 ILE n 
3 369 LYS n 
3 370 GLN n 
3 371 HIS n 
3 372 ALA n 
3 373 PRO n 
3 374 ALA n 
3 375 ASP n 
3 376 GLU n 
3 377 ILE n 
3 378 LEU n 
3 379 SER n 
3 380 LEU n 
3 381 LEU n 
3 382 THR n 
3 383 ASN n 
3 384 LYS n 
3 385 ASN n 
3 386 ARG n 
3 387 GLY n 
3 388 LEU n 
3 389 GLU n 
3 390 GLU n 
3 391 PHE n 
3 392 PHE n 
3 393 VAL n 
3 394 GLU n 
3 395 PHE n 
3 396 LEU n 
3 397 VAL n 
3 398 ARG n 
3 399 GLU n 
3 400 ASN n 
3 401 PRO n 
3 402 ILE n 
3 403 ASN n 
3 404 GLY n 
3 405 HIS n 
3 406 ALA n 
3 407 LYS n 
3 408 PHE n 
3 409 VAL n 
3 410 ALA n 
3 411 ARG n 
3 412 PHE n 
3 413 LEU n 
3 414 GLU n 
3 415 GLU n 
3 416 GLU n 
3 417 LEU n 
3 418 ASN n 
3 419 ILE n 
3 420 THR n 
3 421 ASN n 
3 422 PHE n 
3 423 ASN n 
3 424 LEU n 
3 425 ILE n 
3 426 GLU n 
3 427 LEU n 
3 428 TYR n 
3 429 HIS n 
3 430 ASN n 
3 431 LEU n 
3 432 LEU n 
3 433 ILE n 
3 434 GLY n 
3 435 LYS n 
3 436 LEU n 
3 437 ASP n 
3 438 SER n 
3 439 TYR n 
3 440 LEU n 
3 441 ASP n 
3 442 ARG n 
3 443 TRP n 
3 444 SER n 
3 445 ALA n 
3 446 CYS n 
3 447 LYS n 
3 448 GLU n 
3 449 TYR n 
3 450 LYS n 
3 451 ASP n 
3 452 ARG n 
3 453 LEU n 
3 454 HIS n 
3 455 PHE n 
3 456 GLU n 
3 457 PRO n 
3 458 ILE n 
3 459 ASP n 
3 460 THR n 
3 461 ILE n 
3 462 PHE n 
3 463 GLN n 
3 464 GLU n 
3 465 LEU n 
3 466 PHE n 
3 467 THR n 
3 468 LEU n 
3 469 ASP n 
3 470 ASN n 
3 471 ARG n 
3 472 SER n 
3 473 GLY n 
3 474 LEU n 
3 475 LEU n 
3 476 THR n 
3 477 GLN n 
3 478 SER n 
3 479 ILE n 
3 480 PHE n 
3 481 PRO n 
3 482 SER n 
3 483 TYR n 
3 484 LYS n 
3 485 SER n 
3 486 ASN n 
3 487 ILE n 
3 488 GLU n 
3 489 ASP n 
3 490 ASN n 
3 491 LEU n 
3 492 LEU n 
3 493 SER n 
3 494 TRP n 
3 495 GLU n 
3 496 GLN n 
3 497 VAL n 
3 498 LEU n 
3 499 PRO n 
3 500 SER n 
3 501 LEU n 
3 502 ASP n 
3 503 LYS n 
3 504 GLU n 
3 505 ASN n 
3 506 TYR n 
3 507 ASP n 
3 508 THR n 
3 509 LEU n 
3 510 SER n 
3 511 GLY n 
3 512 ASP n 
3 513 LEU n 
3 514 ASP n 
3 515 LYS n 
3 516 ILE n 
3 517 MET n 
3 518 ALA n 
3 519 PRO n 
3 520 VAL n 
3 521 LEU n 
3 522 GLY n 
3 523 GLN n 
3 524 LEU n 
3 525 PHE n 
3 526 LYS n 
3 527 LEU n 
3 528 TYR n 
3 529 ARG n 
3 530 GLU n 
3 531 ALA n 
3 532 ASN n 
3 533 MET n 
3 534 THR n 
3 535 ILE n 
3 536 ASN n 
3 537 ILE n 
3 538 TYR n 
3 539 ASP n 
3 540 PHE n 
3 541 TYR n 
3 542 ILE n 
3 543 ALA n 
3 544 PHE n 
3 545 ARG n 
3 546 GLU n 
3 547 THR n 
3 548 LEU n 
3 549 PRO n 
3 550 LYS n 
3 551 GLU n 
3 552 GLU n 
3 553 ILE n 
3 554 LEU n 
3 555 ASN n 
3 556 PHE n 
3 557 ILE n 
3 558 ARG n 
3 559 LYS n 
3 560 ASP n 
3 561 PRO n 
3 562 SER n 
3 563 ASN n 
3 564 THR n 
3 565 LYS n 
3 566 LEU n 
3 567 LEU n 
3 568 GLU n 
3 569 LEU n 
3 570 ALA n 
3 571 GLU n 
3 572 THR n 
3 573 PRO n 
3 574 ASP n 
3 575 ALA n 
3 576 PHE n 
3 577 ASP n 
3 578 LYS n 
3 579 VAL n 
3 580 ALA n 
3 581 LEU n 
3 582 ILE n 
3 583 LEU n 
3 584 PHE n 
3 585 MET n 
3 586 GLN n 
3 587 ALA n 
3 588 ILE n 
3 589 PHE n 
3 590 ALA n 
3 591 PHE n 
3 592 GLU n 
3 593 ASN n 
3 594 MET n 
3 595 GLY n 
3 596 LEU n 
3 597 ILE n 
3 598 LYS n 
3 599 PHE n 
3 600 GLN n 
3 601 SER n 
3 602 THR n 
3 603 LYS n 
3 604 SER n 
3 605 TYR n 
3 606 ASP n 
3 607 LEU n 
3 608 VAL n 
3 609 GLU n 
3 610 LYS n 
3 611 CYS n 
3 612 VAL n 
3 613 TRP n 
3 614 ARG n 
3 615 GLY n 
3 616 ILE n 
4 1   MET n 
4 2   THR n 
4 3   ILE n 
4 4   SER n 
4 5   GLU n 
4 6   ALA n 
4 7   ARG n 
4 8   LEU n 
4 9   SER n 
4 10  PRO n 
4 11  GLN n 
4 12  VAL n 
4 13  ASN n 
4 14  LEU n 
4 15  LEU n 
4 16  PRO n 
4 17  ILE n 
4 18  LYS n 
4 19  ARG n 
4 20  HIS n 
4 21  SER n 
4 22  ASN n 
4 23  GLU n 
4 24  GLU n 
4 25  VAL n 
4 26  GLU n 
4 27  GLU n 
4 28  THR n 
4 29  ALA n 
4 30  ALA n 
4 31  ILE n 
4 32  LEU n 
4 33  LYS n 
4 34  LYS n 
4 35  ARG n 
4 36  THR n 
4 37  ILE n 
4 38  ASP n 
4 39  ASN n 
4 40  GLU n 
4 41  LYS n 
4 42  CYS n 
4 43  LYS n 
4 44  ASP n 
4 45  SER n 
4 46  ASP n 
4 47  PRO n 
4 48  GLY n 
4 49  PHE n 
4 50  GLY n 
4 51  SER n 
4 52  LEU n 
4 53  GLN n 
4 54  ARG n 
4 55  ARG n 
4 56  LEU n 
4 57  LEU n 
4 58  GLN n 
4 59  GLN n 
4 60  LEU n 
4 61  TYR n 
4 62  GLY n 
4 63  THR n 
4 64  LEU n 
4 65  PRO n 
4 66  THR n 
4 67  ASP n 
4 68  GLU n 
4 69  LYS n 
4 70  ILE n 
4 71  ILE n 
4 72  PHE n 
4 73  THR n 
4 74  TYR n 
4 75  LEU n 
4 76  GLN n 
4 77  ASP n 
4 78  CYS n 
4 79  GLN n 
4 80  GLN n 
4 81  GLU n 
4 82  ILE n 
4 83  ASP n 
4 84  ARG n 
4 85  ILE n 
4 86  ILE n 
4 87  LYS n 
4 88  GLN n 
4 89  SER n 
4 90  ILE n 
4 91  ILE n 
4 92  GLN n 
4 93  LYS n 
4 94  GLU n 
4 95  SER n 
4 96  HIS n 
4 97  SER n 
4 98  VAL n 
4 99  ILE n 
4 100 LEU n 
4 101 VAL n 
4 102 GLY n 
4 103 PRO n 
4 104 ARG n 
4 105 GLN n 
4 106 SER n 
4 107 TYR n 
4 108 LYS n 
4 109 THR n 
4 110 TYR n 
4 111 LEU n 
4 112 LEU n 
4 113 ASP n 
4 114 TYR n 
4 115 GLU n 
4 116 LEU n 
4 117 SER n 
4 118 LEU n 
4 119 LEU n 
4 120 GLN n 
4 121 GLN n 
4 122 SER n 
4 123 TYR n 
4 124 LYS n 
4 125 GLU n 
4 126 GLN n 
4 127 PHE n 
4 128 ILE n 
4 129 THR n 
4 130 ILE n 
4 131 ARG n 
4 132 LEU n 
4 133 ASN n 
4 134 GLY n 
4 135 PHE n 
4 136 ILE n 
4 137 HIS n 
4 138 SER n 
4 139 GLU n 
4 140 GLN n 
4 141 THR n 
4 142 ALA n 
4 143 ILE n 
4 144 ASN n 
4 145 GLY n 
4 146 ILE n 
4 147 ALA n 
4 148 THR n 
4 149 GLN n 
4 150 LEU n 
4 151 GLU n 
4 152 GLN n 
4 153 GLN n 
4 154 LEU n 
4 155 GLN n 
4 156 LYS n 
4 157 ILE n 
4 158 HIS n 
4 159 GLY n 
4 160 SER n 
4 161 GLU n 
4 162 GLU n 
4 163 LYS n 
4 164 ILE n 
4 165 ASP n 
4 166 ASP n 
4 167 THR n 
4 168 SER n 
4 169 LEU n 
4 170 GLU n 
4 171 THR n 
4 172 ILE n 
4 173 SER n 
4 174 SER n 
4 175 GLY n 
4 176 SER n 
4 177 LEU n 
4 178 THR n 
4 179 GLU n 
4 180 VAL n 
4 181 PHE n 
4 182 GLU n 
4 183 LYS n 
4 184 ILE n 
4 185 LEU n 
4 186 LEU n 
4 187 LEU n 
4 188 LEU n 
4 189 ASP n 
4 190 SER n 
4 191 THR n 
4 192 THR n 
4 193 LYS n 
4 194 THR n 
4 195 ARG n 
4 196 ASN n 
4 197 GLU n 
4 198 ASP n 
4 199 SER n 
4 200 GLY n 
4 201 GLU n 
4 202 VAL n 
4 203 ASP n 
4 204 ARG n 
4 205 GLU n 
4 206 SER n 
4 207 ILE n 
4 208 THR n 
4 209 LYS n 
4 210 ILE n 
4 211 THR n 
4 212 VAL n 
4 213 VAL n 
4 214 PHE n 
4 215 ILE n 
4 216 PHE n 
4 217 ASP n 
4 218 GLU n 
4 219 ILE n 
4 220 ASP n 
4 221 THR n 
4 222 PHE n 
4 223 ALA n 
4 224 GLY n 
4 225 PRO n 
4 226 VAL n 
4 227 ARG n 
4 228 GLN n 
4 229 THR n 
4 230 LEU n 
4 231 LEU n 
4 232 TYR n 
4 233 ASN n 
4 234 LEU n 
4 235 PHE n 
4 236 ASP n 
4 237 MET n 
4 238 VAL n 
4 239 GLU n 
4 240 HIS n 
4 241 SER n 
4 242 ARG n 
4 243 VAL n 
4 244 PRO n 
4 245 VAL n 
4 246 CYS n 
4 247 ILE n 
4 248 PHE n 
4 249 GLY n 
4 250 CYS n 
4 251 THR n 
4 252 THR n 
4 253 LYS n 
4 254 LEU n 
4 255 ASN n 
4 256 ILE n 
4 257 LEU n 
4 258 GLU n 
4 259 TYR n 
4 260 LEU n 
4 261 GLU n 
4 262 LYS n 
4 263 ARG n 
4 264 VAL n 
4 265 LYS n 
4 266 SER n 
4 267 ARG n 
4 268 PHE n 
4 269 SER n 
4 270 GLN n 
4 271 ARG n 
4 272 VAL n 
4 273 ILE n 
4 274 TYR n 
4 275 MET n 
4 276 PRO n 
4 277 GLN n 
4 278 ILE n 
4 279 GLN n 
4 280 ASN n 
4 281 LEU n 
4 282 ASP n 
4 283 ASP n 
4 284 MET n 
4 285 VAL n 
4 286 ASP n 
4 287 ALA n 
4 288 VAL n 
4 289 ARG n 
4 290 ASN n 
4 291 LEU n 
4 292 LEU n 
4 293 THR n 
4 294 VAL n 
4 295 ARG n 
4 296 SER n 
4 297 GLU n 
4 298 ILE n 
4 299 SER n 
4 300 PRO n 
4 301 TRP n 
4 302 VAL n 
4 303 SER n 
4 304 GLN n 
4 305 TRP n 
4 306 ASN n 
4 307 GLU n 
4 308 THR n 
4 309 LEU n 
4 310 GLU n 
4 311 LYS n 
4 312 GLU n 
4 313 LEU n 
4 314 SER n 
4 315 ASP n 
4 316 PRO n 
4 317 ARG n 
4 318 SER n 
4 319 ASN n 
4 320 LEU n 
4 321 ASN n 
4 322 ARG n 
4 323 HIS n 
4 324 ILE n 
4 325 ARG n 
4 326 MET n 
4 327 ASN n 
4 328 PHE n 
4 329 GLU n 
4 330 THR n 
4 331 PHE n 
4 332 ARG n 
4 333 SER n 
4 334 LEU n 
4 335 PRO n 
4 336 THR n 
4 337 LEU n 
4 338 LYS n 
4 339 ASN n 
4 340 SER n 
4 341 ILE n 
4 342 ILE n 
4 343 PRO n 
4 344 LEU n 
4 345 VAL n 
4 346 ALA n 
4 347 THR n 
4 348 SER n 
4 349 LYS n 
4 350 ASN n 
4 351 PHE n 
4 352 GLY n 
4 353 SER n 
4 354 LEU n 
4 355 CYS n 
4 356 THR n 
4 357 ALA n 
4 358 ILE n 
4 359 LYS n 
4 360 SER n 
4 361 CYS n 
4 362 SER n 
4 363 PHE n 
4 364 LEU n 
4 365 ASP n 
4 366 ILE n 
4 367 TYR n 
4 368 ASN n 
4 369 LYS n 
4 370 ASN n 
4 371 GLN n 
4 372 LEU n 
4 373 SER n 
4 374 ASN n 
4 375 ASN n 
4 376 LEU n 
4 377 THR n 
4 378 GLY n 
4 379 ARG n 
4 380 LEU n 
4 381 GLN n 
4 382 SER n 
4 383 LEU n 
4 384 SER n 
4 385 ASP n 
4 386 LEU n 
4 387 GLU n 
4 388 LEU n 
4 389 ALA n 
4 390 ILE n 
4 391 LEU n 
4 392 ILE n 
4 393 SER n 
4 394 ALA n 
4 395 ALA n 
4 396 ARG n 
4 397 VAL n 
4 398 ALA n 
4 399 LEU n 
4 400 ARG n 
4 401 ALA n 
4 402 LYS n 
4 403 ASP n 
4 404 GLY n 
4 405 SER n 
4 406 PHE n 
4 407 ASN n 
4 408 PHE n 
4 409 ASN n 
4 410 LEU n 
4 411 ALA n 
4 412 TYR n 
4 413 ALA n 
4 414 GLU n 
4 415 TYR n 
4 416 GLU n 
4 417 LYS n 
4 418 MET n 
4 419 ILE n 
4 420 LYS n 
4 421 ALA n 
4 422 ILE n 
4 423 ASN n 
4 424 SER n 
4 425 ARG n 
4 426 ILE n 
4 427 PRO n 
4 428 THR n 
4 429 VAL n 
4 430 ALA n 
4 431 PRO n 
4 432 THR n 
4 433 THR n 
4 434 ASN n 
4 435 VAL n 
4 436 GLY n 
4 437 THR n 
4 438 GLY n 
4 439 GLN n 
4 440 SER n 
4 441 THR n 
4 442 PHE n 
4 443 SER n 
4 444 ILE n 
4 445 ASP n 
4 446 ASN n 
4 447 THR n 
4 448 ILE n 
4 449 LYS n 
4 450 LEU n 
4 451 TRP n 
4 452 LEU n 
4 453 LYS n 
4 454 LYS n 
4 455 ASP n 
4 456 VAL n 
4 457 LYS n 
4 458 ASN n 
4 459 VAL n 
4 460 TRP n 
4 461 GLU n 
4 462 ASN n 
4 463 LEU n 
4 464 VAL n 
4 465 GLN n 
4 466 LEU n 
4 467 ASP n 
4 468 PHE n 
4 469 PHE n 
4 470 THR n 
4 471 GLU n 
4 472 LYS n 
4 473 SER n 
4 474 ALA n 
4 475 VAL n 
4 476 GLY n 
4 477 LEU n 
4 478 ARG n 
4 479 ASP n 
4 480 ASN n 
4 481 ALA n 
4 482 THR n 
4 483 ALA n 
4 484 ALA n 
4 485 PHE n 
4 486 TYR n 
4 487 ALA n 
4 488 SER n 
4 489 ASN n 
4 490 TYR n 
4 491 GLN n 
4 492 PHE n 
4 493 GLN n 
4 494 GLY n 
4 495 THR n 
4 496 MET n 
4 497 ILE n 
4 498 PRO n 
4 499 PHE n 
4 500 ASP n 
4 501 LEU n 
4 502 ARG n 
4 503 SER n 
4 504 TYR n 
4 505 GLN n 
4 506 MET n 
4 507 GLN n 
4 508 ILE n 
4 509 ILE n 
4 510 LEU n 
4 511 GLN n 
4 512 GLU n 
4 513 LEU n 
4 514 ARG n 
4 515 ARG n 
4 516 ILE n 
4 517 ILE n 
4 518 PRO n 
4 519 LYS n 
4 520 SER n 
4 521 ASN n 
4 522 MET n 
4 523 TYR n 
4 524 TYR n 
4 525 SER n 
4 526 TRP n 
4 527 THR n 
4 528 GLN n 
4 529 LEU n 
5 1   MET n 
5 2   ASN n 
5 3   VAL n 
5 4   THR n 
5 5   THR n 
5 6   PRO n 
5 7   GLU n 
5 8   VAL n 
5 9   ALA n 
5 10  PHE n 
5 11  ARG n 
5 12  GLU n 
5 13  TYR n 
5 14  GLN n 
5 15  THR n 
5 16  ASN n 
5 17  CYS n 
5 18  LEU n 
5 19  ALA n 
5 20  SER n 
5 21  TYR n 
5 22  ILE n 
5 23  SER n 
5 24  ALA n 
5 25  ASP n 
5 26  PRO n 
5 27  ASP n 
5 28  ILE n 
5 29  THR n 
5 30  PRO n 
5 31  SER n 
5 32  ASN n 
5 33  LEU n 
5 34  ILE n 
5 35  LEU n 
5 36  GLN n 
5 37  GLY n 
5 38  TYR n 
5 39  SER n 
5 40  GLY n 
5 41  THR n 
5 42  GLY n 
5 43  LYS n 
5 44  THR n 
5 45  TYR n 
5 46  THR n 
5 47  LEU n 
5 48  LYS n 
5 49  LYS n 
5 50  TYR n 
5 51  PHE n 
5 52  ASN n 
5 53  ALA n 
5 54  ASN n 
5 55  PRO n 
5 56  ASN n 
5 57  LEU n 
5 58  HIS n 
5 59  ALA n 
5 60  VAL n 
5 61  TRP n 
5 62  LEU n 
5 63  GLU n 
5 64  PRO n 
5 65  VAL n 
5 66  GLU n 
5 67  LEU n 
5 68  VAL n 
5 69  SER n 
5 70  TRP n 
5 71  LYS n 
5 72  PRO n 
5 73  LEU n 
5 74  LEU n 
5 75  GLN n 
5 76  ALA n 
5 77  ILE n 
5 78  ALA n 
5 79  ARG n 
5 80  THR n 
5 81  VAL n 
5 82  GLN n 
5 83  TYR n 
5 84  LYS n 
5 85  LEU n 
5 86  LYS n 
5 87  THR n 
5 88  LEU n 
5 89  TYR n 
5 90  PRO n 
5 91  ASN n 
5 92  ILE n 
5 93  PRO n 
5 94  THR n 
5 95  THR n 
5 96  ASP n 
5 97  TYR n 
5 98  ASP n 
5 99  PRO n 
5 100 LEU n 
5 101 GLN n 
5 102 VAL n 
5 103 GLU n 
5 104 GLU n 
5 105 PRO n 
5 106 PHE n 
5 107 LEU n 
5 108 LEU n 
5 109 VAL n 
5 110 LYS n 
5 111 THR n 
5 112 LEU n 
5 113 HIS n 
5 114 ASN n 
5 115 ILE n 
5 116 PHE n 
5 117 VAL n 
5 118 GLN n 
5 119 TYR n 
5 120 GLU n 
5 121 SER n 
5 122 LEU n 
5 123 GLN n 
5 124 GLU n 
5 125 LYS n 
5 126 THR n 
5 127 CYS n 
5 128 LEU n 
5 129 PHE n 
5 130 LEU n 
5 131 ILE n 
5 132 LEU n 
5 133 ASP n 
5 134 GLY n 
5 135 PHE n 
5 136 ASP n 
5 137 SER n 
5 138 LEU n 
5 139 GLN n 
5 140 ASP n 
5 141 LEU n 
5 142 ASP n 
5 143 ALA n 
5 144 ALA n 
5 145 LEU n 
5 146 PHE n 
5 147 ASN n 
5 148 LYS n 
5 149 TYR n 
5 150 ILE n 
5 151 LYS n 
5 152 LEU n 
5 153 ASN n 
5 154 GLU n 
5 155 LEU n 
5 156 LEU n 
5 157 PRO n 
5 158 LYS n 
5 159 ASP n 
5 160 SER n 
5 161 LYS n 
5 162 ILE n 
5 163 ASN n 
5 164 ILE n 
5 165 LYS n 
5 166 PHE n 
5 167 ILE n 
5 168 TYR n 
5 169 THR n 
5 170 MET n 
5 171 LEU n 
5 172 GLU n 
5 173 THR n 
5 174 SER n 
5 175 PHE n 
5 176 LEU n 
5 177 GLN n 
5 178 ARG n 
5 179 TYR n 
5 180 SER n 
5 181 THR n 
5 182 HIS n 
5 183 CYS n 
5 184 ILE n 
5 185 PRO n 
5 186 THR n 
5 187 VAL n 
5 188 MET n 
5 189 PHE n 
5 190 PRO n 
5 191 ARG n 
5 192 TYR n 
5 193 ASN n 
5 194 VAL n 
5 195 ASP n 
5 196 GLU n 
5 197 VAL n 
5 198 SER n 
5 199 THR n 
5 200 ILE n 
5 201 LEU n 
5 202 VAL n 
5 203 MET n 
5 204 SER n 
5 205 ARG n 
5 206 CYS n 
5 207 GLY n 
5 208 GLU n 
5 209 LEU n 
5 210 MET n 
5 211 GLU n 
5 212 ASP n 
5 213 SER n 
5 214 CYS n 
5 215 LEU n 
5 216 ARG n 
5 217 LYS n 
5 218 ARG n 
5 219 ILE n 
5 220 ILE n 
5 221 GLU n 
5 222 GLU n 
5 223 GLN n 
5 224 ILE n 
5 225 THR n 
5 226 ASP n 
5 227 CYS n 
5 228 THR n 
5 229 ASP n 
5 230 ASP n 
5 231 GLN n 
5 232 PHE n 
5 233 GLN n 
5 234 ASN n 
5 235 VAL n 
5 236 ALA n 
5 237 ALA n 
5 238 ASN n 
5 239 PHE n 
5 240 ILE n 
5 241 HIS n 
5 242 LEU n 
5 243 ILE n 
5 244 VAL n 
5 245 GLN n 
5 246 ALA n 
5 247 PHE n 
5 248 HIS n 
5 249 SER n 
5 250 TYR n 
5 251 THR n 
5 252 GLY n 
5 253 ASN n 
5 254 ASP n 
5 255 ILE n 
5 256 PHE n 
5 257 ALA n 
5 258 LEU n 
5 259 ASN n 
5 260 ASP n 
5 261 LEU n 
5 262 ILE n 
5 263 ASP n 
5 264 PHE n 
5 265 LYS n 
5 266 TRP n 
5 267 PRO n 
5 268 LYS n 
5 269 TYR n 
5 270 VAL n 
5 271 SER n 
5 272 ARG n 
5 273 ILE n 
5 274 THR n 
5 275 LYS n 
5 276 GLU n 
5 277 ASN n 
5 278 ILE n 
5 279 PHE n 
5 280 GLU n 
5 281 PRO n 
5 282 LEU n 
5 283 ALA n 
5 284 LEU n 
5 285 TYR n 
5 286 LYS n 
5 287 SER n 
5 288 ALA n 
5 289 ILE n 
5 290 LYS n 
5 291 LEU n 
5 292 PHE n 
5 293 LEU n 
5 294 SER n 
5 295 THR n 
5 296 ASP n 
5 297 ASP n 
5 298 ASN n 
5 299 LEU n 
5 300 SER n 
5 301 GLU n 
5 302 ASN n 
5 303 GLY n 
5 304 GLN n 
5 305 GLY n 
5 306 GLU n 
5 307 SER n 
5 308 ALA n 
5 309 ILE n 
5 310 THR n 
5 311 THR n 
5 312 ASN n 
5 313 ARG n 
5 314 ASP n 
5 315 ASP n 
5 316 LEU n 
5 317 GLU n 
5 318 ASN n 
5 319 SER n 
5 320 GLN n 
5 321 THR n 
5 322 TYR n 
5 323 ASP n 
5 324 LEU n 
5 325 SER n 
5 326 ILE n 
5 327 ILE n 
5 328 SER n 
5 329 LYS n 
5 330 TYR n 
5 331 LEU n 
5 332 LEU n 
5 333 ILE n 
5 334 ALA n 
5 335 SER n 
5 336 TYR n 
5 337 ILE n 
5 338 CYS n 
5 339 SER n 
5 340 TYR n 
5 341 LEU n 
5 342 GLU n 
5 343 PRO n 
5 344 ARG n 
5 345 TYR n 
5 346 ASP n 
5 347 ALA n 
5 348 SER n 
5 349 ILE n 
5 350 PHE n 
5 351 SER n 
5 352 ARG n 
5 353 LYS n 
5 354 THR n 
5 355 ARG n 
5 356 ILE n 
5 357 ILE n 
5 358 GLN n 
5 359 GLY n 
5 360 ARG n 
5 361 ALA n 
5 362 ALA n 
5 363 TYR n 
5 364 GLY n 
5 365 ARG n 
5 366 ARG n 
5 367 LYS n 
5 368 LYS n 
5 369 LYS n 
5 370 GLU n 
5 371 VAL n 
5 372 ASN n 
5 373 PRO n 
5 374 ARG n 
5 375 TYR n 
5 376 LEU n 
5 377 GLN n 
5 378 PRO n 
5 379 SER n 
5 380 LEU n 
5 381 PHE n 
5 382 ALA n 
5 383 ILE n 
5 384 GLU n 
5 385 ARG n 
5 386 LEU n 
5 387 LEU n 
5 388 ALA n 
5 389 ILE n 
5 390 PHE n 
5 391 GLN n 
5 392 ALA n 
5 393 ILE n 
5 394 PHE n 
5 395 PRO n 
5 396 ILE n 
5 397 GLN n 
5 398 GLY n 
5 399 LYS n 
5 400 ALA n 
5 401 GLU n 
5 402 SER n 
5 403 GLY n 
5 404 SER n 
5 405 LEU n 
5 406 SER n 
5 407 ALA n 
5 408 LEU n 
5 409 ARG n 
5 410 GLU n 
5 411 GLU n 
5 412 SER n 
5 413 LEU n 
5 414 MET n 
5 415 LYS n 
5 416 ALA n 
5 417 ASN n 
5 418 ILE n 
5 419 GLU n 
5 420 VAL n 
5 421 PHE n 
5 422 GLN n 
5 423 ASN n 
5 424 LEU n 
5 425 SER n 
5 426 GLU n 
5 427 LEU n 
5 428 HIS n 
5 429 THR n 
5 430 LEU n 
5 431 LYS n 
5 432 LEU n 
5 433 ILE n 
5 434 ALA n 
5 435 THR n 
5 436 THR n 
5 437 MET n 
5 438 ASN n 
5 439 LYS n 
5 440 ASN n 
5 441 ILE n 
5 442 ASP n 
5 443 TYR n 
5 444 LEU n 
5 445 SER n 
5 446 PRO n 
5 447 LYS n 
5 448 VAL n 
5 449 ARG n 
5 450 TRP n 
5 451 LYS n 
5 452 VAL n 
5 453 ASN n 
5 454 VAL n 
5 455 PRO n 
5 456 TRP n 
5 457 GLU n 
5 458 ILE n 
5 459 ILE n 
5 460 LYS n 
5 461 GLU n 
5 462 ILE n 
5 463 SER n 
5 464 GLU n 
5 465 SER n 
5 466 VAL n 
5 467 HIS n 
5 468 PHE n 
5 469 ASN n 
5 470 ILE n 
5 471 SER n 
5 472 ASP n 
5 473 TYR n 
5 474 PHE n 
5 475 SER n 
5 476 ASP n 
5 477 ILE n 
5 478 HIS n 
5 479 GLU n 
6 1   MET n 
6 2   SER n 
6 3   MET n 
6 4   GLN n 
6 5   GLN n 
6 6   VAL n 
6 7   GLN n 
6 8   HIS n 
6 9   CYS n 
6 10  VAL n 
6 11  ALA n 
6 12  GLU n 
6 13  VAL n 
6 14  LEU n 
6 15  ARG n 
6 16  LEU n 
6 17  ASP n 
6 18  PRO n 
6 19  GLN n 
6 20  GLU n 
6 21  LYS n 
6 22  PRO n 
6 23  ASP n 
6 24  TRP n 
6 25  SER n 
6 26  SER n 
6 27  GLY n 
6 28  TYR n 
6 29  LEU n 
6 30  LYS n 
6 31  LYS n 
6 32  LEU n 
6 33  THR n 
6 34  ASN n 
6 35  ALA n 
6 36  THR n 
6 37  SER n 
6 38  ILE n 
6 39  LEU n 
6 40  TYR n 
6 41  ASN n 
6 42  THR n 
6 43  SER n 
6 44  LEU n 
6 45  ASN n 
6 46  LYS n 
6 47  VAL n 
6 48  MET n 
6 49  LEU n 
6 50  LYS n 
6 51  GLN n 
6 52  ASP n 
6 53  GLU n 
6 54  GLU n 
6 55  VAL n 
6 56  ALA n 
6 57  ARG n 
6 58  CYS n 
6 59  HIS n 
6 60  ILE n 
6 61  CYS n 
6 62  ALA n 
6 63  TYR n 
6 64  ILE n 
6 65  ALA n 
6 66  SER n 
6 67  GLN n 
6 68  LYS n 
6 69  MET n 
6 70  ASN n 
6 71  GLU n 
6 72  LYS n 
6 73  HIS n 
6 74  MET n 
6 75  PRO n 
6 76  ASP n 
6 77  LEU n 
6 78  CYS n 
6 79  TYR n 
6 80  TYR n 
6 81  ILE n 
6 82  ASP n 
6 83  SER n 
6 84  ILE n 
6 85  PRO n 
6 86  LEU n 
6 87  GLU n 
6 88  PRO n 
6 89  LYS n 
6 90  LYS n 
6 91  ALA n 
6 92  LYS n 
6 93  HIS n 
6 94  LEU n 
6 95  MET n 
6 96  ASN n 
6 97  LEU n 
6 98  PHE n 
6 99  ARG n 
6 100 GLN n 
6 101 SER n 
6 102 LEU n 
6 103 SER n 
6 104 ASN n 
6 105 SER n 
6 106 SER n 
6 107 PRO n 
6 108 MET n 
6 109 LYS n 
6 110 GLN n 
6 111 PHE n 
6 112 ALA n 
6 113 TRP n 
6 114 THR n 
6 115 PRO n 
6 116 SER n 
6 117 PRO n 
6 118 LYS n 
6 119 LYS n 
6 120 ASN n 
6 121 LYS n 
6 122 ARG n 
6 123 SER n 
6 124 PRO n 
6 125 VAL n 
6 126 LYS n 
6 127 ASN n 
6 128 GLY n 
6 129 GLY n 
6 130 ARG n 
6 131 PHE n 
6 132 THR n 
6 133 SER n 
6 134 SER n 
6 135 ASP n 
6 136 PRO n 
6 137 LYS n 
6 138 GLU n 
6 139 LEU n 
6 140 ARG n 
6 141 ASN n 
6 142 GLN n 
6 143 LEU n 
6 144 PHE n 
6 145 GLY n 
6 146 THR n 
6 147 PRO n 
6 148 THR n 
6 149 LYS n 
6 150 VAL n 
6 151 ARG n 
6 152 LYS n 
6 153 SER n 
6 154 GLN n 
6 155 ASN n 
6 156 ASN n 
6 157 ASP n 
6 158 SER n 
6 159 PHE n 
6 160 VAL n 
6 161 ILE n 
6 162 PRO n 
6 163 GLU n 
6 164 LEU n 
6 165 PRO n 
6 166 PRO n 
6 167 MET n 
6 168 GLN n 
6 169 THR n 
6 170 ASN n 
6 171 GLU n 
6 172 SER n 
6 173 PRO n 
6 174 SER n 
6 175 ILE n 
6 176 THR n 
6 177 ARG n 
6 178 ARG n 
6 179 LYS n 
6 180 LEU n 
6 181 ALA n 
6 182 PHE n 
6 183 GLU n 
6 184 GLU n 
6 185 ASP n 
6 186 GLU n 
6 187 ASP n 
6 188 GLU n 
6 189 ASP n 
6 190 GLU n 
6 191 GLU n 
6 192 GLU n 
6 193 PRO n 
6 194 GLY n 
6 195 ASN n 
6 196 ASP n 
6 197 GLY n 
6 198 LEU n 
6 199 SER n 
6 200 LEU n 
6 201 LYS n 
6 202 SER n 
6 203 HIS n 
6 204 SER n 
6 205 ASN n 
6 206 LYS n 
6 207 SER n 
6 208 ILE n 
6 209 THR n 
6 210 GLY n 
6 211 THR n 
6 212 ARG n 
6 213 ASN n 
6 214 VAL n 
6 215 ASP n 
6 216 SER n 
6 217 ASP n 
6 218 GLU n 
6 219 TYR n 
6 220 GLU n 
6 221 ASN n 
6 222 HIS n 
6 223 GLU n 
6 224 SER n 
6 225 ASP n 
6 226 PRO n 
6 227 THR n 
6 228 SER n 
6 229 GLU n 
6 230 GLU n 
6 231 GLU n 
6 232 PRO n 
6 233 LEU n 
6 234 GLY n 
6 235 VAL n 
6 236 GLN n 
6 237 GLU n 
6 238 SER n 
6 239 ARG n 
6 240 SER n 
6 241 GLY n 
6 242 ARG n 
6 243 THR n 
6 244 LYS n 
6 245 GLN n 
6 246 ASN n 
6 247 LYS n 
6 248 ALA n 
6 249 VAL n 
6 250 GLY n 
6 251 LYS n 
6 252 PRO n 
6 253 GLN n 
6 254 SER n 
6 255 GLU n 
6 256 LEU n 
6 257 LYS n 
6 258 THR n 
6 259 ALA n 
6 260 LYS n 
6 261 ALA n 
6 262 LEU n 
6 263 ARG n 
6 264 LYS n 
6 265 ARG n 
6 266 GLY n 
6 267 ARG n 
6 268 ILE n 
6 269 PRO n 
6 270 ASN n 
6 271 SER n 
6 272 LEU n 
6 273 LEU n 
6 274 VAL n 
6 275 LYS n 
6 276 LYS n 
6 277 TYR n 
6 278 CYS n 
6 279 LYS n 
6 280 MET n 
6 281 THR n 
6 282 THR n 
6 283 GLU n 
6 284 GLU n 
6 285 ILE n 
6 286 ILE n 
6 287 ARG n 
6 288 LEU n 
6 289 CYS n 
6 290 ASN n 
6 291 ASP n 
6 292 PHE n 
6 293 GLU n 
6 294 LEU n 
6 295 PRO n 
6 296 ARG n 
6 297 GLU n 
6 298 VAL n 
6 299 ALA n 
6 300 TYR n 
6 301 LYS n 
6 302 ILE n 
6 303 VAL n 
6 304 ASP n 
6 305 GLU n 
6 306 TYR n 
6 307 ASN n 
6 308 ILE n 
6 309 ASN n 
6 310 ALA n 
6 311 SER n 
6 312 ARG n 
6 313 LEU n 
6 314 VAL n 
6 315 CYS n 
6 316 PRO n 
6 317 TRP n 
6 318 GLN n 
6 319 LEU n 
6 320 VAL n 
6 321 CYS n 
6 322 GLY n 
6 323 LEU n 
6 324 VAL n 
6 325 LEU n 
6 326 ASN n 
6 327 CYS n 
6 328 THR n 
6 329 PHE n 
6 330 ILE n 
6 331 VAL n 
6 332 PHE n 
6 333 ASN n 
6 334 GLU n 
6 335 ARG n 
6 336 ARG n 
6 337 ARG n 
6 338 LYS n 
6 339 ASP n 
6 340 PRO n 
6 341 ARG n 
6 342 ILE n 
6 343 ASP n 
6 344 HIS n 
6 345 PHE n 
6 346 ILE n 
6 347 VAL n 
6 348 SER n 
6 349 LYS n 
6 350 MET n 
6 351 CYS n 
6 352 SER n 
6 353 LEU n 
6 354 MET n 
6 355 LEU n 
6 356 THR n 
6 357 SER n 
6 358 LYS n 
6 359 VAL n 
6 360 ASP n 
6 361 ASP n 
6 362 VAL n 
6 363 ILE n 
6 364 GLU n 
6 365 CYS n 
6 366 VAL n 
6 367 LYS n 
6 368 LEU n 
6 369 VAL n 
6 370 LYS n 
6 371 GLU n 
6 372 LEU n 
6 373 ILE n 
6 374 ILE n 
6 375 GLY n 
6 376 GLU n 
6 377 LYS n 
6 378 TRP n 
6 379 PHE n 
6 380 ARG n 
6 381 ASP n 
6 382 LEU n 
6 383 GLN n 
6 384 ILE n 
6 385 ARG n 
6 386 TYR n 
6 387 ASP n 
6 388 ASP n 
6 389 PHE n 
6 390 ASP n 
6 391 GLY n 
6 392 ILE n 
6 393 ARG n 
6 394 TYR n 
6 395 ASP n 
6 396 GLU n 
6 397 ILE n 
6 398 ILE n 
6 399 PHE n 
6 400 ARG n 
6 401 LYS n 
6 402 LEU n 
6 403 GLY n 
6 404 SER n 
6 405 MET n 
6 406 LEU n 
6 407 GLN n 
6 408 THR n 
6 409 THR n 
6 410 ASN n 
6 411 ILE n 
6 412 LEU n 
6 413 VAL n 
6 414 THR n 
6 415 ASP n 
6 416 ASP n 
6 417 GLN n 
6 418 TYR n 
6 419 ASN n 
6 420 ILE n 
6 421 TRP n 
6 422 LYS n 
6 423 LYS n 
6 424 ARG n 
6 425 ILE n 
6 426 GLU n 
6 427 MET n 
6 428 ASP n 
6 429 LEU n 
6 430 ALA n 
6 431 LEU n 
6 432 THR n 
6 433 GLU n 
6 434 PRO n 
6 435 LEU n 
7 1   DT  n 
7 2   DG  n 
7 3   DG  n 
7 4   DT  n 
7 5   DT  n 
7 6   DT  n 
7 7   DT  n 
7 8   DT  n 
7 9   DA  n 
7 10  DT  n 
7 11  DA  n 
7 12  DT  n 
7 13  DG  n 
7 14  DT  n 
7 15  DT  n 
7 16  DT  n 
7 17  DT  n 
7 18  DG  n 
7 19  DT  n 
7 20  DT  n 
7 21  DA  n 
7 22  DT  n 
7 23  DG  n 
7 24  DT  n 
7 25  DA  n 
7 26  DT  n 
7 27  DT  n 
7 28  DG  n 
7 29  DT  n 
7 30  DT  n 
7 31  DT  n 
7 32  DA  n 
7 33  DT  n 
7 34  DT  n 
7 35  DT  n 
7 36  DT  n 
7 37  DC  n 
7 38  DC  n 
7 39  DC  n 
7 40  DT  n 
7 41  DT  n 
7 42  DT  n 
7 43  DA  n 
7 44  DA  n 
7 45  DT  n 
7 46  DT  n 
7 47  DT  n 
7 48  DT  n 
7 49  DA  n 
7 50  DG  n 
7 51  DG  n 
7 52  DA  n 
7 53  DT  n 
7 54  DA  n 
7 55  DT  n 
7 56  DG  n 
7 57  DA  n 
7 58  DA  n 
7 59  DA  n 
7 60  DA  n 
7 61  DC  n 
7 62  DA  n 
7 63  DA  n 
7 64  DG  n 
7 65  DA  n 
7 66  DA  n 
7 67  DT  n 
7 68  DT  n 
7 69  DT  n 
7 70  DA  n 
7 71  DT  n 
7 72  DC  n 
8 1   DG  n 
8 2   DA  n 
8 3   DT  n 
8 4   DA  n 
8 5   DA  n 
8 6   DA  n 
8 7   DT  n 
8 8   DT  n 
8 9   DC  n 
8 10  DT  n 
8 11  DT  n 
8 12  DG  n 
8 13  DT  n 
8 14  DT  n 
8 15  DT  n 
8 16  DT  n 
8 17  DC  n 
8 18  DA  n 
8 19  DT  n 
8 20  DA  n 
8 21  DT  n 
8 22  DC  n 
8 23  DC  n 
8 24  DT  n 
8 25  DA  n 
8 26  DA  n 
8 27  DA  n 
8 28  DA  n 
8 29  DT  n 
8 30  DT  n 
8 31  DA  n 
8 32  DA  n 
8 33  DA  n 
8 34  DG  n 
8 35  DG  n 
8 36  DG  n 
8 37  DA  n 
8 38  DA  n 
8 39  DA  n 
8 40  DA  n 
8 41  DT  n 
8 42  DA  n 
8 43  DA  n 
8 44  DA  n 
8 45  DC  n 
8 46  DA  n 
8 47  DA  n 
8 48  DT  n 
8 49  DA  n 
8 50  DC  n 
8 51  DA  n 
8 52  DT  n 
8 53  DA  n 
8 54  DA  n 
8 55  DC  n 
8 56  DA  n 
8 57  DA  n 
8 58  DA  n 
8 59  DA  n 
8 60  DC  n 
8 61  DA  n 
8 62  DT  n 
8 63  DA  n 
8 64  DT  n 
8 65  DA  n 
8 66  DA  n 
8 67  DA  n 
8 68  DA  n 
8 69  DA  n 
8 70  DC  n 
8 71  DC  n 
8 72  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 914 
;Baker's yeast
;
? 'ORC1, YML065W'                      ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 620 
;Baker's yeast
;
? 'ORC2, RRR1, SIR5, YBR060C, YBR0523' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 616 
;Baker's yeast
;
? 'ORC3, OAF1, OIF1, YLL004W, L1365'   ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 529 
;Baker's yeast
;
? 'ORC4, YPR162C, P9325.5'             ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 479 
;Baker's yeast
;
? 'ORC5, YNL261W, N0834'               ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 435 
;Baker's yeast
;
? 'ORC6, AAP1, YHR118C'                ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
7 1 sample 1 72 'Saccharomyces cerevisiae' ? 4932 ? 
8 1 sample 1 72 'Saccharomyces cerevisiae' ? 4932 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ORC1_YEAST P54784 ? 1 
;MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLN
NVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEV
LKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAE
TRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEARHTNSPRKRGRKIKLGKDDID
ASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSE
LMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGT
PGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLEFYFKRVPKNKKKT
IVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRL
KGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKH
YMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTRLSFT
AKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNKFVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILF
KQTMKNDRICCVKLNISVEEAKRAMNEDETLRNL
;
1 
2 UNP ORC2_YEAST P32833 ? 2 
;MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGR
PRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDD
NFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVG
SKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHV
ILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFN
HLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL
;
1 
3 UNP ORC3_YEAST P54790 ? 3 
;MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWELYHQLHSHFHDQVDHIIDNIE
ADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKDESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHP
TIKYEDINDEDGDFTEQNNDVSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNI
NTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVEFILSKMANNTNHNLQLLTKM
LDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVREN
PINGHAKFVARFLEEELNITNFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIF
PSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIAFRETLPKEEILNFIRKD
PSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTKSYDLVEKCVWRGI
;
1 
4 UNP ORC4_YEAST P54791 ? 4 
;MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQLYGTLPTDEKIIFTYLQDCQQ
EIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGS
EEKIDDTSLETISSGSLTEVFEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNL
NRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALR
AKDGSFNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
;
1 
5 UNP ORC5_YEAST P50874 ? 5 
;MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIART
VQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDS
KINIKFIYTMLETSFLQRYSTHCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFI
HLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGESAITTNRDDLENSQ
TYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKA
ESGSLSALREESLMKANIEVFQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE
;
1 
6 UNP ORC6_YEAST P38826 ? 6 
;MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYY
IDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFV
IPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRS
GRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLV
CGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFR
KLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL
;
1 
7 PDB 5ZR1       5ZR1   ? 7 ? 1 
8 PDB 5ZR1       5ZR1   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ZR1 A 1 ? 914 ? P54784 1 ? 914 ? 1 914 
2 2 5ZR1 B 1 ? 620 ? P32833 1 ? 620 ? 1 620 
3 3 5ZR1 C 1 ? 616 ? P54790 1 ? 616 ? 1 616 
4 4 5ZR1 D 1 ? 529 ? P54791 1 ? 529 ? 1 529 
5 5 5ZR1 E 1 ? 479 ? P50874 1 ? 479 ? 1 479 
6 6 5ZR1 F 1 ? 435 ? P38826 1 ? 435 ? 1 435 
7 7 5ZR1 G 1 ? 72  ? 5ZR1   1 ? 72  ? 1 72  
8 8 5ZR1 H 1 ? 72  ? 5ZR1   1 ? 72  ? 1 72  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AGS non-polymer         . 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 
;ATP-GAMMA-S; ADENOSINE 5'-(3-THIOTRIPHOSPHATE); ADENOSINE 5'-(GAMMA-THIOTRIPHOSPHATE); ADENOSINE-5'-DIPHOSPHATE MONOTHIOPHOSPHATE
;
'C10 H16 N5 O12 P3 S' 523.247 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'        121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O6 P'     331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O7 P'      307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P'     347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                 ? 'C10 H15 N2 O8 P'     322.208 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'      156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                              ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZR1 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ZR1 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.006  ? 22869 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.023  ? 31269 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 14.043 ? 13539 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.058  ? 3547  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.012  ? 3692  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5ZR1 
_struct.title                        
'Saccharomyces Cerevisiae Origin Recognition Complex Bound to a 72-bp Origin DNA containing ACS and B1 element' 
_struct.pdbx_descriptor              
;Origin recognition complex subunit 1, Origin recognition complex subunit 2, Origin recognition complex subunit 3, Origin recognition complex subunit 4, Origin recognition complex subunit 5, Origin recognition complex subunit 6/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZR1 
_struct_keywords.text            
'Origin Recognition Complex, DNA replication initiation, 72-bp origin DNA, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 9  ? 
L N N 10 ? 
M N N 9  ? 
N N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 374 ? ARG A 378 ? PRO A 374 ARG A 378 5 ? 5  
HELX_P HELX_P2   AA2 SER A 404 ? ASN A 408 ? SER A 404 ASN A 408 5 ? 5  
HELX_P HELX_P3   AA3 THR A 421 ? LEU A 430 ? THR A 421 LEU A 430 1 ? 10 
HELX_P HELX_P4   AA4 GLU A 455 ? SER A 469 ? GLU A 455 SER A 469 1 ? 15 
HELX_P HELX_P5   AA5 GLY A 484 ? GLN A 502 ? GLY A 484 GLN A 502 1 ? 19 
HELX_P HELX_P6   AA6 LEU A 516 ? MET A 518 ? LEU A 516 MET A 518 5 ? 3  
HELX_P HELX_P7   AA7 THR A 522 ? GLY A 534 ? THR A 522 GLY A 534 1 ? 13 
HELX_P HELX_P8   AA8 THR A 538 ? ARG A 552 ? THR A 538 ARG A 552 1 ? 15 
HELX_P HELX_P9   AA9 ILE A 578 ? TRP A 585 ? ILE A 578 TRP A 585 1 ? 8  
HELX_P HELX_P10  AB1 THR A 586 ? TYR A 588 ? THR A 586 TYR A 588 5 ? 3  
HELX_P HELX_P11  AB2 ASP A 603 ? LEU A 609 ? ASP A 603 LEU A 609 1 ? 7  
HELX_P HELX_P12  AB3 GLY A 610 ? GLY A 618 ? GLY A 610 GLY A 618 1 ? 9  
HELX_P HELX_P13  AB4 THR A 628 ? ASP A 637 ? THR A 628 ASP A 637 1 ? 10 
HELX_P HELX_P14  AB5 LEU A 638 ? LYS A 641 ? LEU A 638 LYS A 641 5 ? 4  
HELX_P HELX_P15  AB6 SER A 685 ? SER A 698 ? SER A 685 SER A 698 1 ? 14 
HELX_P HELX_P16  AB7 ASP A 702 ? GLY A 726 ? ASP A 702 GLY A 726 1 ? 25 
HELX_P HELX_P17  AB8 HIS A 774 ? ASN A 787 ? HIS A 774 ASN A 787 1 ? 14 
HELX_P HELX_P18  AB9 HIS A 789 ? THR A 795 ? HIS A 789 THR A 795 1 ? 7  
HELX_P HELX_P19  AC1 SER A 798 ? ASN A 815 ? SER A 798 ASN A 815 1 ? 18 
HELX_P HELX_P20  AC2 LEU A 822 ? ASN A 836 ? LEU A 822 ASN A 836 1 ? 15 
HELX_P HELX_P21  AC3 ASN A 839 ? ALA A 846 ? ASN A 839 ALA A 846 1 ? 8  
HELX_P HELX_P22  AC4 ALA A 846 ? GLN A 851 ? ALA A 846 GLN A 851 1 ? 6  
HELX_P HELX_P23  AC5 SER A 865 ? ALA A 876 ? SER A 865 ALA A 876 1 ? 12 
HELX_P HELX_P24  AC6 VAL A 898 ? ASN A 906 ? VAL A 898 ASN A 906 1 ? 9  
HELX_P HELX_P25  AC7 ASP A 908 ? LEU A 914 ? ASP A 908 LEU A 914 1 ? 7  
HELX_P HELX_P26  AC8 THR B 242 ? ARG B 250 ? THR B 242 ARG B 250 1 ? 9  
HELX_P HELX_P27  AC9 THR B 270 ? PHE B 285 ? THR B 270 PHE B 285 1 ? 16 
HELX_P HELX_P28  AD1 GLN B 286 ? GLN B 297 ? GLN B 286 GLN B 297 1 ? 12 
HELX_P HELX_P29  AD2 MET B 300 ? THR B 309 ? MET B 300 THR B 309 1 ? 10 
HELX_P HELX_P30  AD3 LYS B 322 ? ASP B 332 ? LYS B 322 ASP B 332 1 ? 11 
HELX_P HELX_P31  AD4 TYR B 333 ? GLN B 342 ? TYR B 333 GLN B 342 1 ? 10 
HELX_P HELX_P32  AD5 ASN B 371 ? VAL B 384 ? ASN B 371 VAL B 384 1 ? 14 
HELX_P HELX_P33  AD6 ASN B 398 ? LYS B 412 ? ASN B 398 LYS B 412 1 ? 15 
HELX_P HELX_P34  AD7 LYS B 434 ? VAL B 446 ? LYS B 434 VAL B 446 1 ? 13 
HELX_P HELX_P35  AD8 TYR B 460 ? TRP B 465 ? TYR B 460 TRP B 465 5 ? 6  
HELX_P HELX_P36  AD9 ASP B 466 ? ASN B 474 ? ASP B 466 ASN B 474 1 ? 9  
HELX_P HELX_P37  AE1 GLY B 506 ? GLN B 515 ? GLY B 506 GLN B 515 1 ? 10 
HELX_P HELX_P38  AE2 THR B 518 ? SER B 540 ? THR B 518 SER B 540 1 ? 23 
HELX_P HELX_P39  AE3 THR B 549 ? GLY B 553 ? THR B 549 GLY B 553 5 ? 5  
HELX_P HELX_P40  AE4 LEU B 556 ? ASP B 566 ? LEU B 556 ASP B 566 1 ? 11 
HELX_P HELX_P41  AE5 ASN B 571 ? GLU B 584 ? ASN B 571 GLU B 584 1 ? 14 
HELX_P HELX_P42  AE6 THR B 605 ? VAL B 616 ? THR B 605 VAL B 616 1 ? 12 
HELX_P HELX_P43  AE7 SER C 50  ? TYR C 92  ? SER C 50  TYR C 92  1 ? 43 
HELX_P HELX_P44  AE8 ASN C 138 ? ALA C 156 ? ASN C 138 ALA C 156 1 ? 19 
HELX_P HELX_P45  AE9 LEU C 185 ? ASN C 190 ? LEU C 185 ASN C 190 1 ? 6  
HELX_P HELX_P46  AF1 PHE C 191 ? GLY C 196 ? PHE C 191 GLY C 196 1 ? 6  
HELX_P HELX_P47  AF2 ASN C 212 ? SER C 225 ? ASN C 212 SER C 225 1 ? 14 
HELX_P HELX_P48  AF3 ARG C 252 ? ARG C 257 ? ARG C 252 ARG C 257 1 ? 6  
HELX_P HELX_P49  AF4 ASN C 271 ? LYS C 275 ? ASN C 271 LYS C 275 5 ? 5  
HELX_P HELX_P50  AF5 TYR C 276 ? VAL C 288 ? TYR C 276 VAL C 288 1 ? 13 
HELX_P HELX_P51  AF6 SER C 295 ? MET C 306 ? SER C 295 MET C 306 1 ? 12 
HELX_P HELX_P52  AF7 ASN C 313 ? ASN C 332 ? ASN C 313 ASN C 332 1 ? 20 
HELX_P HELX_P53  AF8 ALA C 333 ? LEU C 346 ? ALA C 333 LEU C 346 5 ? 14 
HELX_P HELX_P54  AF9 ASN C 347 ? SER C 355 ? ASN C 347 SER C 355 1 ? 9  
HELX_P HELX_P55  AG1 CYS C 357 ? HIS C 371 ? CYS C 357 HIS C 371 1 ? 15 
HELX_P HELX_P56  AG2 ALA C 374 ? LEU C 381 ? ALA C 374 LEU C 381 1 ? 8  
HELX_P HELX_P57  AG3 ARG C 386 ? VAL C 393 ? ARG C 386 VAL C 393 1 ? 8  
HELX_P HELX_P58  AG4 PRO C 401 ? GLU C 416 ? PRO C 401 GLU C 416 1 ? 16 
HELX_P HELX_P59  AG5 LEU C 424 ? GLY C 434 ? LEU C 424 GLY C 434 1 ? 11 
HELX_P HELX_P60  AG6 LEU C 436 ? ASP C 441 ? LEU C 436 ASP C 441 1 ? 6  
HELX_P HELX_P61  AG7 LEU C 474 ? ILE C 479 ? LEU C 474 ILE C 479 1 ? 6  
HELX_P HELX_P62  AG8 SER C 482 ? SER C 493 ? SER C 482 SER C 493 1 ? 12 
HELX_P HELX_P63  AG9 SER C 510 ? LYS C 515 ? SER C 510 LYS C 515 1 ? 6  
HELX_P HELX_P64  AH1 PRO C 519 ? GLU C 530 ? PRO C 519 GLU C 530 1 ? 12 
HELX_P HELX_P65  AH2 ILE C 537 ? GLU C 546 ? ILE C 537 GLU C 546 1 ? 10 
HELX_P HELX_P66  AH3 PRO C 549 ? LYS C 559 ? PRO C 549 LYS C 559 1 ? 11 
HELX_P HELX_P67  AH4 ASN C 563 ? THR C 572 ? ASN C 563 THR C 572 1 ? 10 
HELX_P HELX_P68  AH5 ASP C 574 ? MET C 585 ? ASP C 574 MET C 585 1 ? 12 
HELX_P HELX_P69  AH6 GLN C 586 ? MET C 594 ? GLN C 586 MET C 594 1 ? 9  
HELX_P HELX_P70  AH7 PRO D 47  ? GLN D 59  ? PRO D 47  GLN D 59  1 ? 13 
HELX_P HELX_P71  AH8 PHE D 72  ? TYR D 74  ? PHE D 72  TYR D 74  5 ? 3  
HELX_P HELX_P72  AH9 LEU D 75  ? GLN D 88  ? LEU D 75  GLN D 88  1 ? 14 
HELX_P HELX_P73  AI1 TYR D 107 ? GLN D 121 ? TYR D 107 GLN D 121 1 ? 15 
HELX_P HELX_P74  AI2 GLN D 140 ? HIS D 158 ? GLN D 140 HIS D 158 1 ? 19 
HELX_P HELX_P75  AI3 SER D 176 ? ASP D 189 ? SER D 176 ASP D 189 1 ? 14 
HELX_P HELX_P76  AI4 ILE D 219 ? PHE D 222 ? ILE D 219 PHE D 222 5 ? 4  
HELX_P HELX_P77  AI5 THR D 229 ? SER D 241 ? THR D 229 SER D 241 1 ? 13 
HELX_P HELX_P78  AI6 GLU D 261 ? PHE D 268 ? GLU D 261 PHE D 268 1 ? 8  
HELX_P HELX_P79  AI7 ASN D 280 ? THR D 293 ? ASN D 280 THR D 293 1 ? 14 
HELX_P HELX_P80  AI8 TRP D 301 ? ASP D 315 ? TRP D 301 ASP D 315 1 ? 15 
HELX_P HELX_P81  AI9 SER D 318 ? PHE D 331 ? SER D 318 PHE D 331 1 ? 14 
HELX_P HELX_P82  AJ1 SER D 333 ? THR D 347 ? SER D 333 THR D 347 1 ? 15 
HELX_P HELX_P83  AJ2 ASN D 350 ? CYS D 361 ? ASN D 350 CYS D 361 1 ? 12 
HELX_P HELX_P84  AJ3 CYS D 361 ? GLN D 371 ? CYS D 361 GLN D 371 1 ? 11 
HELX_P HELX_P85  AJ4 LEU D 376 ? GLN D 381 ? LEU D 376 GLN D 381 1 ? 6  
HELX_P HELX_P86  AJ5 SER D 384 ? ALA D 401 ? SER D 384 ALA D 401 1 ? 18 
HELX_P HELX_P87  AJ6 ASN D 407 ? ILE D 426 ? ASN D 407 ILE D 426 1 ? 20 
HELX_P HELX_P88  AJ7 LEU D 452 ? LEU D 466 ? LEU D 452 LEU D 466 1 ? 15 
HELX_P HELX_P89  AJ8 ASN D 480 ? TYR D 490 ? ASN D 480 TYR D 490 1 ? 11 
HELX_P HELX_P90  AJ9 PHE D 492 ? ILE D 497 ? PHE D 492 ILE D 497 1 ? 6  
HELX_P HELX_P91  AK1 PRO D 498 ? ARG D 502 ? PRO D 498 ARG D 502 5 ? 5  
HELX_P HELX_P92  AK2 ILE D 509 ? ILE D 517 ? ILE D 509 ILE D 517 1 ? 9  
HELX_P HELX_P93  AK3 TYR D 523 ? THR D 527 ? TYR D 523 THR D 527 5 ? 5  
HELX_P HELX_P94  AK4 ARG E 11  ? ILE E 22  ? ARG E 11  ILE E 22  1 ? 12 
HELX_P HELX_P95  AK5 ASP E 25  ? THR E 29  ? ASP E 25  THR E 29  5 ? 5  
HELX_P HELX_P96  AK6 THR E 44  ? ALA E 53  ? THR E 44  ALA E 53  1 ? 10 
HELX_P HELX_P97  AK7 SER E 69  ? TYR E 89  ? SER E 69  TYR E 89  1 ? 21 
HELX_P HELX_P98  AK8 ASP E 98  ? VAL E 102 ? ASP E 98  VAL E 102 5 ? 5  
HELX_P HELX_P99  AK9 GLU E 104 ? VAL E 117 ? GLU E 104 VAL E 117 1 ? 14 
HELX_P HELX_P100 AL1 GLN E 118 ? GLU E 120 ? GLN E 118 GLU E 120 5 ? 3  
HELX_P HELX_P101 AL2 LEU E 145 ? ILE E 150 ? LEU E 145 ILE E 150 1 ? 6  
HELX_P HELX_P102 AL3 LYS E 151 ? ASN E 153 ? LYS E 151 ASN E 153 5 ? 3  
HELX_P HELX_P103 AL4 PHE E 175 ? CYS E 183 ? PHE E 175 CYS E 183 5 ? 9  
HELX_P HELX_P104 AL5 ASN E 193 ? CYS E 206 ? ASN E 193 CYS E 206 1 ? 14 
HELX_P HELX_P105 AL6 GLY E 207 ? ASP E 212 ? GLY E 207 ASP E 212 1 ? 6  
HELX_P HELX_P106 AL7 ASP E 212 ? GLU E 222 ? ASP E 212 GLU E 222 1 ? 11 
HELX_P HELX_P107 AL8 THR E 228 ? GLY E 252 ? THR E 228 GLY E 252 1 ? 25 
HELX_P HELX_P108 AL9 ILE E 255 ? PHE E 264 ? ILE E 255 PHE E 264 1 ? 10 
HELX_P HELX_P109 AM1 LYS E 265 ? SER E 271 ? LYS E 265 SER E 271 1 ? 7  
HELX_P HELX_P110 AM2 THR E 274 ? PHE E 279 ? THR E 274 PHE E 279 1 ? 6  
HELX_P HELX_P111 AM3 GLU E 280 ? SER E 287 ? GLU E 280 SER E 287 1 ? 8  
HELX_P HELX_P112 AM4 ALA E 288 ? PHE E 292 ? ALA E 288 PHE E 292 5 ? 5  
HELX_P HELX_P113 AM5 SER E 325 ? SER E 339 ? SER E 325 SER E 339 1 ? 15 
HELX_P HELX_P114 AM6 GLU E 342 ? ARG E 344 ? GLU E 342 ARG E 344 5 ? 3  
HELX_P HELX_P115 AM7 TYR E 345 ? SER E 351 ? TYR E 345 SER E 351 1 ? 7  
HELX_P HELX_P116 AM8 ASN E 372 ? LEU E 376 ? ASN E 372 LEU E 376 5 ? 5  
HELX_P HELX_P117 AM9 ALA E 382 ? PHE E 394 ? ALA E 382 PHE E 394 1 ? 13 
HELX_P HELX_P118 AN1 GLY E 403 ? LEU E 408 ? GLY E 403 LEU E 408 1 ? 6  
HELX_P HELX_P119 AN2 ASN E 417 ? LEU E 430 ? ASN E 417 LEU E 430 1 ? 14 
HELX_P HELX_P120 AN3 PRO E 455 ? VAL E 466 ? PRO E 455 VAL E 466 1 ? 12 
HELX_P HELX_P121 AN4 ILE E 470 ? ASP E 476 ? ILE E 470 ASP E 476 1 ? 7  
HELX_P HELX_P122 AN5 THR F 281 ? ASP F 291 ? THR F 281 ASP F 291 1 ? 11 
HELX_P HELX_P123 AN6 PRO F 295 ? ALA F 310 ? PRO F 295 ALA F 310 1 ? 16 
HELX_P HELX_P124 AN7 CYS F 315 ? PHE F 332 ? CYS F 315 PHE F 332 1 ? 18 
HELX_P HELX_P125 AN8 PHE F 332 ? ASP F 339 ? PHE F 332 ASP F 339 1 ? 8  
HELX_P HELX_P126 AN9 PRO F 340 ? MET F 354 ? PRO F 340 MET F 354 1 ? 15 
HELX_P HELX_P127 AO1 VAL F 359 ? ILE F 373 ? VAL F 359 ILE F 373 1 ? 15 
HELX_P HELX_P128 AO2 GLU F 376 ? TYR F 386 ? GLU F 376 TYR F 386 1 ? 11 
HELX_P HELX_P129 AO3 ARG F 393 ? GLY F 403 ? ARG F 393 GLY F 403 1 ? 11 
HELX_P HELX_P130 AO4 THR F 414 ? ALA F 430 ? THR F 414 ALA F 430 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 486 OG1 ? ? ? 1_555 J MG .  MG ? ? A THR 486  A MG 2002 1_555 ? ? ? ? ? ? ?            2.110 ? 
metalc2  metalc ? ? D THR 109 OG1 ? ? ? 1_555 L MG .  MG ? ? D THR 109  D MG 2002 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc3  metalc ? ? I AGS .   O3G ? ? ? 1_555 J MG .  MG ? ? A AGS 2001 A MG 2002 1_555 ? ? ? ? ? ? ?            2.622 ? 
metalc4  metalc ? ? I AGS .   O2B ? ? ? 1_555 J MG .  MG ? ? A AGS 2001 A MG 2002 1_555 ? ? ? ? ? ? ?            2.128 ? 
metalc5  metalc ? ? K AGS .   O2G ? ? ? 1_555 L MG .  MG ? ? D AGS 2001 D MG 2002 1_555 ? ? ? ? ? ? ?            2.078 ? 
metalc6  metalc ? ? K AGS .   O2B ? ? ? 1_555 L MG .  MG ? ? D AGS 2001 D MG 2002 1_555 ? ? ? ? ? ? ?            2.866 ? 
metalc7  metalc ? ? M AGS .   O3G ? ? ? 1_555 N MG .  MG ? ? E AGS 2001 E MG 2002 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc8  metalc ? ? M AGS .   O2B ? ? ? 1_555 N MG .  MG ? ? E AGS 2001 E MG 2002 1_555 ? ? ? ? ? ? ?            2.203 ? 
hydrog1  hydrog ? ? G DT  1   N3  ? ? ? 1_555 H DA 72 N1 ? ? G DT  1    H DA 72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DT  1   O4  ? ? ? 1_555 H DA 72 N6 ? ? G DT  1    H DA 72   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  2   N1  ? ? ? 1_555 H DC 71 N3 ? ? G DG  2    H DC 71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DG  2   N2  ? ? ? 1_555 H DC 71 O2 ? ? G DG  2    H DC 71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DG  2   O6  ? ? ? 1_555 H DC 71 N4 ? ? G DG  2    H DC 71   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DG  3   N1  ? ? ? 1_555 H DC 70 N3 ? ? G DG  3    H DC 70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DG  3   N2  ? ? ? 1_555 H DC 70 O2 ? ? G DG  3    H DC 70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DG  3   O6  ? ? ? 1_555 H DC 70 N4 ? ? G DG  3    H DC 70   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DT  4   N3  ? ? ? 1_555 H DA 69 N1 ? ? G DT  4    H DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DT  4   O4  ? ? ? 1_555 H DA 69 N6 ? ? G DT  4    H DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DT  5   N3  ? ? ? 1_555 H DA 68 N1 ? ? G DT  5    H DA 68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DT  5   O4  ? ? ? 1_555 H DA 68 N6 ? ? G DT  5    H DA 68   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DT  6   N3  ? ? ? 1_555 H DA 67 N1 ? ? G DT  6    H DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DT  6   O4  ? ? ? 1_555 H DA 67 N6 ? ? G DT  6    H DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DT  7   N3  ? ? ? 1_555 H DA 66 N1 ? ? G DT  7    H DA 66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DT  7   O4  ? ? ? 1_555 H DA 66 N6 ? ? G DT  7    H DA 66   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DT  8   N3  ? ? ? 1_555 H DA 65 N1 ? ? G DT  8    H DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DT  8   O4  ? ? ? 1_555 H DA 65 N6 ? ? G DT  8    H DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DA  9   N1  ? ? ? 1_555 H DT 64 N3 ? ? G DA  9    H DT 64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DA  9   N6  ? ? ? 1_555 H DT 64 O4 ? ? G DA  9    H DT 64   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DT  10  N3  ? ? ? 1_555 H DA 63 N1 ? ? G DT  10   H DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DT  10  O4  ? ? ? 1_555 H DA 63 N6 ? ? G DT  10   H DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DA  11  N1  ? ? ? 1_555 H DT 62 N3 ? ? G DA  11   H DT 62   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G DA  11  N6  ? ? ? 1_555 H DT 62 O4 ? ? G DA  11   H DT 62   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DT  12  N3  ? ? ? 1_555 H DA 61 N1 ? ? G DT  12   H DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DT  12  O4  ? ? ? 1_555 H DA 61 N6 ? ? G DT  12   H DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G DG  13  N1  ? ? ? 1_555 H DC 60 N3 ? ? G DG  13   H DC 60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G DG  13  N2  ? ? ? 1_555 H DC 60 O2 ? ? G DG  13   H DC 60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G DG  13  O6  ? ? ? 1_555 H DC 60 N4 ? ? G DG  13   H DC 60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G DT  14  N3  ? ? ? 1_555 H DA 59 N1 ? ? G DT  14   H DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G DT  14  O4  ? ? ? 1_555 H DA 59 N6 ? ? G DT  14   H DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G DT  15  N3  ? ? ? 1_555 H DA 58 N1 ? ? G DT  15   H DA 58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G DT  15  O4  ? ? ? 1_555 H DA 58 N6 ? ? G DT  15   H DA 58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G DT  16  N3  ? ? ? 1_555 H DA 57 N1 ? ? G DT  16   H DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? G DT  16  O4  ? ? ? 1_555 H DA 57 N6 ? ? G DT  16   H DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? G DT  17  N3  ? ? ? 1_555 H DA 56 N1 ? ? G DT  17   H DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? G DT  17  O4  ? ? ? 1_555 H DA 56 N6 ? ? G DT  17   H DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? G DG  18  N1  ? ? ? 1_555 H DC 55 N3 ? ? G DG  18   H DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? G DG  18  N2  ? ? ? 1_555 H DC 55 O2 ? ? G DG  18   H DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? G DG  18  O6  ? ? ? 1_555 H DC 55 N4 ? ? G DG  18   H DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? G DT  19  N3  ? ? ? 1_555 H DA 54 N1 ? ? G DT  19   H DA 54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? G DT  19  O4  ? ? ? 1_555 H DA 54 N6 ? ? G DT  19   H DA 54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? G DT  20  N3  ? ? ? 1_555 H DA 53 N1 ? ? G DT  20   H DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? G DT  20  O4  ? ? ? 1_555 H DA 53 N6 ? ? G DT  20   H DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? G DA  21  N1  ? ? ? 1_555 H DT 52 N3 ? ? G DA  21   H DT 52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? G DA  21  N6  ? ? ? 1_555 H DT 52 O4 ? ? G DA  21   H DT 52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? G DT  22  N3  ? ? ? 1_555 H DA 51 N1 ? ? G DT  22   H DA 51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? G DT  22  O4  ? ? ? 1_555 H DA 51 N6 ? ? G DT  22   H DA 51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? G DG  23  N1  ? ? ? 1_555 H DC 50 N3 ? ? G DG  23   H DC 50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? G DG  23  N2  ? ? ? 1_555 H DC 50 O2 ? ? G DG  23   H DC 50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? G DG  23  O6  ? ? ? 1_555 H DC 50 N4 ? ? G DG  23   H DC 50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? G DT  24  N3  ? ? ? 1_555 H DA 49 N1 ? ? G DT  24   H DA 49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? G DT  24  O4  ? ? ? 1_555 H DA 49 N6 ? ? G DT  24   H DA 49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? G DA  25  N1  ? ? ? 1_555 H DT 48 N3 ? ? G DA  25   H DT 48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? G DA  25  N6  ? ? ? 1_555 H DT 48 O4 ? ? G DA  25   H DT 48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? G DT  26  N3  ? ? ? 1_555 H DA 47 N1 ? ? G DT  26   H DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? G DT  26  O4  ? ? ? 1_555 H DA 47 N6 ? ? G DT  26   H DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? G DT  27  N3  ? ? ? 1_555 H DA 46 N1 ? ? G DT  27   H DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? G DT  27  O4  ? ? ? 1_555 H DA 46 N6 ? ? G DT  27   H DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? G DG  28  N1  ? ? ? 1_555 H DC 45 N3 ? ? G DG  28   H DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? G DG  28  N2  ? ? ? 1_555 H DC 45 O2 ? ? G DG  28   H DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? G DG  28  O6  ? ? ? 1_555 H DC 45 N4 ? ? G DG  28   H DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? G DT  29  N3  ? ? ? 1_555 H DA 44 N1 ? ? G DT  29   H DA 44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? G DT  29  O4  ? ? ? 1_555 H DA 44 N6 ? ? G DT  29   H DA 44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? G DT  30  N3  ? ? ? 1_555 H DA 43 N1 ? ? G DT  30   H DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? G DT  30  O4  ? ? ? 1_555 H DA 43 N6 ? ? G DT  30   H DA 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? G DT  31  N3  ? ? ? 1_555 H DA 42 N1 ? ? G DT  31   H DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? G DT  31  O4  ? ? ? 1_555 H DA 42 N6 ? ? G DT  31   H DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? G DA  32  N1  ? ? ? 1_555 H DT 41 N3 ? ? G DA  32   H DT 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? G DA  32  N6  ? ? ? 1_555 H DT 41 O4 ? ? G DA  32   H DT 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? G DT  33  N3  ? ? ? 1_555 H DA 40 N1 ? ? G DT  33   H DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? G DT  33  O4  ? ? ? 1_555 H DA 40 N6 ? ? G DT  33   H DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? G DT  34  N3  ? ? ? 1_555 H DA 39 N1 ? ? G DT  34   H DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? G DT  34  O4  ? ? ? 1_555 H DA 39 N6 ? ? G DT  34   H DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? G DT  35  N3  ? ? ? 1_555 H DA 38 N1 ? ? G DT  35   H DA 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? G DT  35  O4  ? ? ? 1_555 H DA 38 N6 ? ? G DT  35   H DA 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ? ? G DT  36  N3  ? ? ? 1_555 H DA 37 N1 ? ? G DT  36   H DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ? ? G DT  36  O4  ? ? ? 1_555 H DA 37 N6 ? ? G DT  36   H DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79 hydrog ? ? G DC  37  N3  ? ? ? 1_555 H DG 36 N1 ? ? G DC  37   H DG 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80 hydrog ? ? G DC  37  N4  ? ? ? 1_555 H DG 36 O6 ? ? G DC  37   H DG 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81 hydrog ? ? G DC  37  O2  ? ? ? 1_555 H DG 36 N2 ? ? G DC  37   H DG 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82 hydrog ? ? G DC  38  N3  ? ? ? 1_555 H DG 35 N1 ? ? G DC  38   H DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83 hydrog ? ? G DC  38  N4  ? ? ? 1_555 H DG 35 O6 ? ? G DC  38   H DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84 hydrog ? ? G DC  38  O2  ? ? ? 1_555 H DG 35 N2 ? ? G DC  38   H DG 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85 hydrog ? ? G DC  39  N3  ? ? ? 1_555 H DG 34 N1 ? ? G DC  39   H DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86 hydrog ? ? G DC  39  N4  ? ? ? 1_555 H DG 34 O6 ? ? G DC  39   H DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87 hydrog ? ? G DC  39  O2  ? ? ? 1_555 H DG 34 N2 ? ? G DC  39   H DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88 hydrog ? ? G DT  40  N3  ? ? ? 1_555 H DA 33 N1 ? ? G DT  40   H DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89 hydrog ? ? G DT  40  O4  ? ? ? 1_555 H DA 33 N6 ? ? G DT  40   H DA 33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90 hydrog ? ? G DT  41  N3  ? ? ? 1_555 H DA 32 N1 ? ? G DT  41   H DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91 hydrog ? ? G DT  41  O4  ? ? ? 1_555 H DA 32 N6 ? ? G DT  41   H DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 6 ? 
AA6 ? 3 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 5 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
AB4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? parallel      
AB1 3 4 ? parallel      
AB1 4 5 ? parallel      
AB2 1 2 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
AB4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 411 ? THR A 412 ? LYS A 411 THR A 412 
AA1 2 THR D 208 ? LYS D 209 ? THR D 208 LYS D 209 
AA2 1 PHE A 508 ? ASN A 514 ? PHE A 508 ASN A 514 
AA2 2 THR A 560 ? ASP A 566 ? THR A 560 ASP A 566 
AA2 3 LEU A 593 ? VAL A 598 ? LEU A 593 VAL A 598 
AA2 4 THR A 473 ? GLY A 479 ? THR A 473 GLY A 479 
AA2 5 THR A 620 ? PHE A 624 ? THR A 620 PHE A 624 
AA3 1 ALA A 657 ? LEU A 659 ? ALA A 657 LEU A 659 
AA3 2 SER A 646 ? ASP A 651 ? SER A 646 ASP A 651 
AA3 3 VAL A 677 ? MET A 684 ? VAL A 677 MET A 684 
AA3 4 VAL A 770 ? VAL A 773 ? VAL A 770 VAL A 773 
AA4 1 GLN A 820 ? GLU A 821 ? GLN A 820 GLU A 821 
AA4 2 CYS A 891 ? LEU A 894 ? CYS A 891 LEU A 894 
AA4 3 LEU A 879 ? LYS A 881 ? LEU A 879 LYS A 881 
AA5 1 PHE B 475 ? ASP B 479 ? PHE B 475 ASP B 479 
AA5 2 SER B 313 ? TYR B 317 ? SER B 313 TYR B 317 
AA5 3 ILE B 450 ? SER B 455 ? ILE B 450 SER B 455 
AA5 4 LEU B 420 ? HIS B 425 ? LEU B 420 HIS B 425 
AA5 5 CYS B 360 ? ASN B 364 ? CYS B 360 ASN B 364 
AA5 6 TYR C 23  ? VAL C 25  ? TYR C 23  VAL C 25  
AA6 1 VAL B 554 ? GLU B 555 ? VAL B 554 GLU B 555 
AA6 2 GLU B 598 ? TRP B 601 ? GLU B 598 TRP B 601 
AA6 3 ASN B 589 ? LYS B 592 ? ASN B 589 LYS B 592 
AA7 1 TYR C 125 ? LEU C 131 ? TYR C 125 LEU C 131 
AA7 2 LEU C 199 ? PHE C 205 ? LEU C 199 PHE C 205 
AA7 3 ILE C 234 ? PHE C 238 ? ILE C 234 PHE C 238 
AA7 4 ASN C 103 ? LEU C 108 ? ASN C 103 LEU C 108 
AA7 5 TYR C 263 ? ASP C 267 ? TYR C 263 ASP C 267 
AA8 1 ASN C 293 ? LEU C 294 ? ASN C 293 LEU C 294 
AA8 2 THR C 467 ? LEU C 468 ? THR C 467 LEU C 468 
AA9 1 THR C 534 ? ASN C 536 ? THR C 534 ASN C 536 
AA9 2 LEU C 607 ? LYS C 610 ? LEU C 607 LYS C 610 
AA9 3 ILE C 597 ? LYS C 598 ? ILE C 597 LYS C 598 
AB1 1 PHE D 127 ? ASN D 133 ? PHE D 127 ASN D 133 
AB1 2 THR D 211 ? ASP D 217 ? THR D 211 ASP D 217 
AB1 3 VAL D 245 ? THR D 251 ? VAL D 245 THR D 251 
AB1 4 SER D 97  ? VAL D 101 ? SER D 97  VAL D 101 
AB1 5 VAL D 272 ? TYR D 274 ? VAL D 272 TYR D 274 
AB2 1 PHE D 469 ? GLU D 471 ? PHE D 469 GLU D 471 
AB2 2 TYR D 504 ? MET D 506 ? TYR D 504 MET D 506 
AB3 1 HIS E 58  ? LEU E 62  ? HIS E 58  LEU E 62  
AB3 2 THR E 126 ? ASP E 133 ? THR E 126 ASP E 133 
AB3 3 ILE E 162 ? MET E 170 ? ILE E 162 MET E 170 
AB3 4 ASN E 32  ? GLY E 37  ? ASN E 32  GLY E 37  
AB3 5 THR E 186 ? PHE E 189 ? THR E 186 PHE E 189 
AB4 1 ILE E 433 ? THR E 435 ? ILE E 433 THR E 435 
AB4 2 TRP E 450 ? VAL E 452 ? TRP E 450 VAL E 452 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 412 ? N THR A 412 O THR D 208 ? O THR D 208 
AA2 1 2 N ILE A 513 ? N ILE A 513 O ASP A 566 ? O ASP A 566 
AA2 2 3 N ILE A 561 ? N ILE A 561 O ILE A 594 ? O ILE A 594 
AA2 3 4 O ALA A 597 ? O ALA A 597 N ILE A 475 ? N ILE A 475 
AA2 4 5 N TYR A 476 ? N TYR A 476 O ILE A 622 ? O ILE A 622 
AA3 1 2 O ILE A 658 ? O ILE A 658 N TYR A 649 ? N TYR A 649 
AA3 2 3 N PHE A 648 ? N PHE A 648 O VAL A 680 ? O VAL A 680 
AA3 3 4 N ARG A 681 ? N ARG A 681 O GLN A 771 ? O GLN A 771 
AA4 1 2 N GLN A 820 ? N GLN A 820 O VAL A 892 ? O VAL A 892 
AA4 2 3 O LYS A 893 ? O LYS A 893 N PHE A 880 ? N PHE A 880 
AA5 1 2 O HIS B 478 ? O HIS B 478 N TYR B 317 ? N TYR B 317 
AA5 2 3 N LEU B 314 ? N LEU B 314 O ALA B 454 ? O ALA B 454 
AA5 3 4 O ALA B 451 ? O ALA B 451 N LEU B 420 ? N LEU B 420 
AA5 4 5 O VAL B 423 ? O VAL B 423 N LEU B 363 ? N LEU B 363 
AA5 5 6 N CYS B 360 ? N CYS B 360 O VAL C 25  ? O VAL C 25  
AA6 1 2 N VAL B 554 ? N VAL B 554 O ILE B 600 ? O ILE B 600 
AA6 2 3 O TRP B 601 ? O TRP B 601 N ASN B 589 ? N ASN B 589 
AA7 1 2 N ILE C 129 ? N ILE C 129 O VAL C 202 ? O VAL C 202 
AA7 2 3 N PHE C 203 ? N PHE C 203 O SER C 235 ? O SER C 235 
AA7 3 4 O PHE C 238 ? O PHE C 238 N LEU C 107 ? N LEU C 107 
AA7 4 5 N PHE C 106 ? N PHE C 106 O LEU C 266 ? O LEU C 266 
AA8 1 2 N ASN C 293 ? N ASN C 293 O LEU C 468 ? O LEU C 468 
AA9 1 2 N ILE C 535 ? N ILE C 535 O VAL C 608 ? O VAL C 608 
AA9 2 3 O GLU C 609 ? O GLU C 609 N LYS C 598 ? N LYS C 598 
AB1 1 2 N ILE D 130 ? N ILE D 130 O VAL D 213 ? O VAL D 213 
AB1 2 3 N PHE D 216 ? N PHE D 216 O CYS D 250 ? O CYS D 250 
AB1 3 4 O THR D 251 ? O THR D 251 N LEU D 100 ? N LEU D 100 
AB1 4 5 N VAL D 101 ? N VAL D 101 O ILE D 273 ? O ILE D 273 
AB2 1 2 N THR D 470 ? N THR D 470 O GLN D 505 ? O GLN D 505 
AB3 1 2 N VAL E 60  ? N VAL E 60  O PHE E 129 ? O PHE E 129 
AB3 2 3 N LEU E 130 ? N LEU E 130 O LYS E 165 ? O LYS E 165 
AB3 3 4 O TYR E 168 ? O TYR E 168 N LEU E 33  ? N LEU E 33  
AB3 4 5 N GLN E 36  ? N GLN E 36  O PHE E 189 ? O PHE E 189 
AB4 1 2 N ALA E 434 ? N ALA E 434 O LYS E 451 ? O LYS E 451 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A AGS 2001 ? 18 'binding site for residue AGS A 2001' 
AC2 Software A MG  2002 ? 3  'binding site for residue MG A 2002'  
AC3 Software D AGS 2001 ? 13 'binding site for residue AGS D 2001' 
AC4 Software D MG  2002 ? 3  'binding site for residue MG D 2002'  
AC5 Software E AGS 2001 ? 13 'binding site for residue AGS E 2001' 
AC6 Software E MG  2002 ? 2  'binding site for residue MG E 2002'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 SER A 432 ? SER A 432  . ? 1_555 ? 
2  AC1 18 PRO A 481 ? PRO A 481  . ? 1_555 ? 
3  AC1 18 GLY A 482 ? GLY A 482  . ? 1_555 ? 
4  AC1 18 VAL A 483 ? VAL A 483  . ? 1_555 ? 
5  AC1 18 GLY A 484 ? GLY A 484  . ? 1_555 ? 
6  AC1 18 LYS A 485 ? LYS A 485  . ? 1_555 ? 
7  AC1 18 THR A 486 ? THR A 486  . ? 1_555 ? 
8  AC1 18 LEU A 487 ? LEU A 487  . ? 1_555 ? 
9  AC1 18 GLU A 567 ? GLU A 567  . ? 1_555 ? 
10 AC1 18 ASN A 600 ? ASN A 600  . ? 1_555 ? 
11 AC1 18 TYR A 627 ? TYR A 627  . ? 1_555 ? 
12 AC1 18 ARG A 639 ? ARG A 639  . ? 1_555 ? 
13 AC1 18 ALA A 703 ? ALA A 703  . ? 1_555 ? 
14 AC1 18 ARG A 704 ? ARG A 704  . ? 1_555 ? 
15 AC1 18 MG  J .   ? MG  A 2002 . ? 1_555 ? 
16 AC1 18 HIS D 240 ? HIS D 240  . ? 1_555 ? 
17 AC1 18 ARG D 263 ? ARG D 263  . ? 1_555 ? 
18 AC1 18 ARG D 267 ? ARG D 267  . ? 1_555 ? 
19 AC2 3  THR A 486 ? THR A 486  . ? 1_555 ? 
20 AC2 3  AGS I .   ? AGS A 2001 . ? 1_555 ? 
21 AC2 3  ARG D 267 ? ARG D 267  . ? 1_555 ? 
22 AC3 13 TYR D 61  ? TYR D 61   . ? 1_555 ? 
23 AC3 13 GLY D 62  ? GLY D 62   . ? 1_555 ? 
24 AC3 13 LYS D 69  ? LYS D 69   . ? 1_555 ? 
25 AC3 13 ARG D 104 ? ARG D 104  . ? 1_555 ? 
26 AC3 13 GLN D 105 ? GLN D 105  . ? 1_555 ? 
27 AC3 13 SER D 106 ? SER D 106  . ? 1_555 ? 
28 AC3 13 TYR D 107 ? TYR D 107  . ? 1_555 ? 
29 AC3 13 LYS D 108 ? LYS D 108  . ? 1_555 ? 
30 AC3 13 THR D 109 ? THR D 109  . ? 1_555 ? 
31 AC3 13 TYR D 110 ? TYR D 110  . ? 1_555 ? 
32 AC3 13 ASP D 113 ? ASP D 113  . ? 1_555 ? 
33 AC3 13 MG  L .   ? MG  D 2002 . ? 1_555 ? 
34 AC3 13 LYS E 151 ? LYS E 151  . ? 1_555 ? 
35 AC4 3  THR D 109 ? THR D 109  . ? 1_555 ? 
36 AC4 3  AGS K .   ? AGS D 2001 . ? 1_555 ? 
37 AC4 3  GLU E 154 ? GLU E 154  . ? 1_555 ? 
38 AC5 13 SER E 39  ? SER E 39   . ? 1_555 ? 
39 AC5 13 GLY E 40  ? GLY E 40   . ? 1_555 ? 
40 AC5 13 THR E 41  ? THR E 41   . ? 1_555 ? 
41 AC5 13 GLY E 42  ? GLY E 42   . ? 1_555 ? 
42 AC5 13 LYS E 43  ? LYS E 43   . ? 1_555 ? 
43 AC5 13 THR E 44  ? THR E 44   . ? 1_555 ? 
44 AC5 13 TYR E 45  ? TYR E 45   . ? 1_555 ? 
45 AC5 13 LEU E 171 ? LEU E 171  . ? 1_555 ? 
46 AC5 13 TYR E 192 ? TYR E 192  . ? 1_555 ? 
47 AC5 13 ILE E 200 ? ILE E 200  . ? 1_555 ? 
48 AC5 13 ILE E 255 ? ILE E 255  . ? 1_555 ? 
49 AC5 13 PHE E 256 ? PHE E 256  . ? 1_555 ? 
50 AC5 13 MG  N .   ? MG  E 2002 . ? 1_555 ? 
51 AC6 2  THR E 44  ? THR E 44   . ? 1_555 ? 
52 AC6 2  AGS M .   ? AGS E 2001 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5ZR1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  355 ? 101.721 128.508 120.623 1.00 30.00  ? 355  PRO A N     1 
ATOM   2     C  CA    . PRO A 1  355 ? 102.516 127.527 121.368 1.00 30.00  ? 355  PRO A CA    1 
ATOM   3     C  C     . PRO A 1  355 ? 103.339 128.173 122.476 1.00 30.00  ? 355  PRO A C     1 
ATOM   4     O  O     . PRO A 1  355 ? 102.918 129.171 123.058 1.00 30.00  ? 355  PRO A O     1 
ATOM   5     C  CB    . PRO A 1  355 ? 103.430 126.930 120.294 1.00 30.00  ? 355  PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  355 ? 102.712 127.164 119.011 1.00 30.00  ? 355  PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  355 ? 102.023 128.480 119.182 1.00 30.00  ? 355  PRO A CD    1 
ATOM   8     N  N     . VAL A 1  356 ? 104.503 127.597 122.765 1.00 33.66  ? 356  VAL A N     1 
ATOM   9     C  CA    . VAL A 1  356 ? 105.418 128.200 123.721 1.00 33.66  ? 356  VAL A CA    1 
ATOM   10    C  C     . VAL A 1  356 ? 106.194 129.324 123.044 1.00 33.66  ? 356  VAL A C     1 
ATOM   11    O  O     . VAL A 1  356 ? 106.285 129.407 121.817 1.00 33.66  ? 356  VAL A O     1 
ATOM   12    C  CB    . VAL A 1  356 ? 106.369 127.148 124.316 1.00 33.66  ? 356  VAL A CB    1 
ATOM   13    C  CG1   . VAL A 1  356 ? 105.582 126.083 125.054 1.00 33.66  ? 356  VAL A CG1   1 
ATOM   14    C  CG2   . VAL A 1  356 ? 107.223 126.524 123.223 1.00 33.66  ? 356  VAL A CG2   1 
ATOM   15    N  N     . ILE A 1  357 ? 106.756 130.206 123.859 1.00 30.50  ? 357  ILE A N     1 
ATOM   16    C  CA    . ILE A 1  357 ? 107.604 131.280 123.360 1.00 30.50  ? 357  ILE A CA    1 
ATOM   17    C  C     . ILE A 1  357 ? 109.025 130.745 123.270 1.00 30.50  ? 357  ILE A C     1 
ATOM   18    O  O     . ILE A 1  357 ? 109.635 130.396 124.286 1.00 30.50  ? 357  ILE A O     1 
ATOM   19    C  CB    . ILE A 1  357 ? 107.527 132.528 124.253 1.00 30.50  ? 357  ILE A CB    1 
ATOM   20    C  CG1   . ILE A 1  357 ? 106.143 133.179 124.180 1.00 30.50  ? 357  ILE A CG1   1 
ATOM   21    C  CG2   . ILE A 1  357 ? 108.574 133.537 123.854 1.00 30.50  ? 357  ILE A CG2   1 
ATOM   22    C  CD1   . ILE A 1  357 ? 105.195 132.781 125.291 1.00 30.50  ? 357  ILE A CD1   1 
ATOM   23    N  N     . ARG A 1  358 ? 109.546 130.669 122.053 1.00 26.48  ? 358  ARG A N     1 
ATOM   24    C  CA    . ARG A 1  358 ? 110.857 130.091 121.813 1.00 26.48  ? 358  ARG A CA    1 
ATOM   25    C  C     . ARG A 1  358 ? 111.966 131.070 122.154 1.00 26.48  ? 358  ARG A C     1 
ATOM   26    O  O     . ARG A 1  358 ? 111.843 132.275 121.929 1.00 26.48  ? 358  ARG A O     1 
ATOM   27    C  CB    . ARG A 1  358 ? 110.969 129.659 120.358 1.00 26.48  ? 358  ARG A CB    1 
ATOM   28    C  CG    . ARG A 1  358 ? 110.233 128.387 120.075 1.00 26.48  ? 358  ARG A CG    1 
ATOM   29    C  CD    . ARG A 1  358 ? 110.362 128.023 118.642 1.00 26.48  ? 358  ARG A CD    1 
ATOM   30    N  NE    . ARG A 1  358 ? 109.538 128.866 117.791 1.00 26.48  ? 358  ARG A NE    1 
ATOM   31    C  CZ    . ARG A 1  358 ? 108.292 128.562 117.447 1.00 26.48  ? 358  ARG A CZ    1 
ATOM   32    N  NH1   . ARG A 1  358 ? 107.747 127.434 117.875 1.00 26.48  ? 358  ARG A NH1   1 
ATOM   33    N  NH2   . ARG A 1  358 ? 107.596 129.376 116.667 1.00 26.48  ? 358  ARG A NH2   1 
ATOM   34    N  N     . LYS A 1  359 ? 113.062 130.540 122.697 1.00 26.74  ? 359  LYS A N     1 
ATOM   35    C  CA    . LYS A 1  359 ? 114.169 131.395 123.096 1.00 26.74  ? 359  LYS A CA    1 
ATOM   36    C  C     . LYS A 1  359 ? 115.032 131.798 121.909 1.00 26.74  ? 359  LYS A C     1 
ATOM   37    O  O     . LYS A 1  359 ? 115.629 132.878 121.927 1.00 26.74  ? 359  LYS A O     1 
ATOM   38    C  CB    . LYS A 1  359 ? 115.002 130.698 124.168 1.00 26.74  ? 359  LYS A CB    1 
ATOM   39    C  CG    . LYS A 1  359 ? 114.215 130.441 125.434 1.00 26.74  ? 359  LYS A CG    1 
ATOM   40    C  CD    . LYS A 1  359 ? 115.075 129.887 126.536 1.00 26.74  ? 359  LYS A CD    1 
ATOM   41    C  CE    . LYS A 1  359 ? 114.258 129.649 127.785 1.00 26.74  ? 359  LYS A CE    1 
ATOM   42    N  NZ    . LYS A 1  359 ? 113.348 128.500 127.618 1.00 26.74  ? 359  LYS A NZ    1 
ATOM   43    N  N     . PHE A 1  360 ? 115.108 130.958 120.879 1.00 29.30  ? 360  PHE A N     1 
ATOM   44    C  CA    . PHE A 1  360 ? 115.675 131.344 119.595 1.00 29.30  ? 360  PHE A CA    1 
ATOM   45    C  C     . PHE A 1  360 ? 115.048 130.458 118.530 1.00 29.30  ? 360  PHE A C     1 
ATOM   46    O  O     . PHE A 1  360 ? 114.434 129.438 118.836 1.00 29.30  ? 360  PHE A O     1 
ATOM   47    C  CB    . PHE A 1  360 ? 117.210 131.253 119.582 1.00 29.30  ? 360  PHE A CB    1 
ATOM   48    C  CG    . PHE A 1  360 ? 117.755 129.854 119.656 1.00 29.30  ? 360  PHE A CG    1 
ATOM   49    C  CD1   . PHE A 1  360 ? 117.898 129.215 120.872 1.00 29.30  ? 360  PHE A CD1   1 
ATOM   50    C  CD2   . PHE A 1  360 ? 118.190 129.207 118.511 1.00 29.30  ? 360  PHE A CD2   1 
ATOM   51    C  CE1   . PHE A 1  360 ? 118.415 127.942 120.938 1.00 29.30  ? 360  PHE A CE1   1 
ATOM   52    C  CE2   . PHE A 1  360 ? 118.710 127.936 118.573 1.00 29.30  ? 360  PHE A CE2   1 
ATOM   53    C  CZ    . PHE A 1  360 ? 118.822 127.304 119.786 1.00 29.30  ? 360  PHE A CZ    1 
ATOM   54    N  N     . THR A 1  361 ? 115.190 130.860 117.274 1.00 25.20  ? 361  THR A N     1 
ATOM   55    C  CA    . THR A 1  361 ? 114.530 130.173 116.175 1.00 25.20  ? 361  THR A CA    1 
ATOM   56    C  C     . THR A 1  361 ? 115.551 129.624 115.191 1.00 25.20  ? 361  THR A C     1 
ATOM   57    O  O     . THR A 1  361 ? 116.591 130.237 114.940 1.00 25.20  ? 361  THR A O     1 
ATOM   58    C  CB    . THR A 1  361 ? 113.570 131.099 115.421 1.00 25.20  ? 361  THR A CB    1 
ATOM   59    O  OG1   . THR A 1  361 ? 114.311 132.165 114.818 1.00 25.20  ? 361  THR A OG1   1 
ATOM   60    C  CG2   . THR A 1  361 ? 112.540 131.685 116.359 1.00 25.20  ? 361  THR A CG2   1 
ATOM   61    N  N     . LYS A 1  362 ? 115.237 128.463 114.628 1.00 23.22  ? 362  LYS A N     1 
ATOM   62    C  CA    . LYS A 1  362 ? 115.980 127.900 113.506 1.00 23.22  ? 362  LYS A CA    1 
ATOM   63    C  C     . LYS A 1  362 ? 114.981 127.675 112.379 1.00 23.22  ? 362  LYS A C     1 
ATOM   64    O  O     . LYS A 1  362 ? 114.294 126.651 112.344 1.00 23.22  ? 362  LYS A O     1 
ATOM   65    C  CB    . LYS A 1  362 ? 116.690 126.609 113.889 1.00 23.22  ? 362  LYS A CB    1 
ATOM   66    C  CG    . LYS A 1  362 ? 117.792 126.783 114.900 1.00 23.22  ? 362  LYS A CG    1 
ATOM   67    C  CD    . LYS A 1  362 ? 118.654 125.547 114.968 1.00 23.22  ? 362  LYS A CD    1 
ATOM   68    C  CE    . LYS A 1  362 ? 117.939 124.418 115.647 1.00 23.22  ? 362  LYS A CE    1 
ATOM   69    N  NZ    . LYS A 1  362 ? 118.838 123.248 115.776 1.00 23.22  ? 362  LYS A NZ    1 
ATOM   70    N  N     . LYS A 1  363 ? 114.903 128.630 111.458 1.00 17.92  ? 363  LYS A N     1 
ATOM   71    C  CA    . LYS A 1  363 ? 113.920 128.598 110.388 1.00 17.92  ? 363  LYS A CA    1 
ATOM   72    C  C     . LYS A 1  363 ? 114.519 128.210 109.046 1.00 17.92  ? 363  LYS A C     1 
ATOM   73    O  O     . LYS A 1  363 ? 113.865 128.383 108.015 1.00 17.92  ? 363  LYS A O     1 
ATOM   74    C  CB    . LYS A 1  363 ? 113.219 129.951 110.287 1.00 17.92  ? 363  LYS A CB    1 
ATOM   75    C  CG    . LYS A 1  363 ? 112.337 130.233 111.478 1.00 17.92  ? 363  LYS A CG    1 
ATOM   76    C  CD    . LYS A 1  363 ? 111.542 131.500 111.324 1.00 17.92  ? 363  LYS A CD    1 
ATOM   77    C  CE    . LYS A 1  363 ? 110.685 131.714 112.549 1.00 17.92  ? 363  LYS A CE    1 
ATOM   78    N  NZ    . LYS A 1  363 ? 109.656 130.645 112.665 1.00 17.92  ? 363  LYS A NZ    1 
ATOM   79    N  N     . ASN A 1  364 ? 115.735 127.674 109.035 1.00 20.71  ? 364  ASN A N     1 
ATOM   80    C  CA    . ASN A 1  364 ? 116.385 127.251 107.803 1.00 20.71  ? 364  ASN A CA    1 
ATOM   81    C  C     . ASN A 1  364 ? 116.912 125.831 107.923 1.00 20.71  ? 364  ASN A C     1 
ATOM   82    O  O     . ASN A 1  364 ? 117.866 125.456 107.239 1.00 20.71  ? 364  ASN A O     1 
ATOM   83    C  CB    . ASN A 1  364 ? 117.506 128.215 107.431 1.00 20.71  ? 364  ASN A CB    1 
ATOM   84    C  CG    . ASN A 1  364 ? 116.981 129.535 106.948 1.00 20.71  ? 364  ASN A CG    1 
ATOM   85    O  OD1   . ASN A 1  364 ? 116.116 129.589 106.078 1.00 20.71  ? 364  ASN A OD1   1 
ATOM   86    N  ND2   . ASN A 1  364 ? 117.454 130.610 107.550 1.00 20.71  ? 364  ASN A ND2   1 
ATOM   87    N  N     . VAL A 1  365 ? 116.301 125.033 108.786 1.00 19.10  ? 365  VAL A N     1 
ATOM   88    C  CA    . VAL A 1  365 ? 116.692 123.639 108.934 1.00 19.10  ? 365  VAL A CA    1 
ATOM   89    C  C     . VAL A 1  365 ? 116.132 122.852 107.761 1.00 19.10  ? 365  VAL A C     1 
ATOM   90    O  O     . VAL A 1  365 ? 114.927 122.890 107.489 1.00 19.10  ? 365  VAL A O     1 
ATOM   91    C  CB    . VAL A 1  365 ? 116.195 123.072 110.272 1.00 19.10  ? 365  VAL A CB    1 
ATOM   92    C  CG1   . VAL A 1  365 ? 116.558 121.610 110.386 1.00 19.10  ? 365  VAL A CG1   1 
ATOM   93    C  CG2   . VAL A 1  365 ? 116.787 123.848 111.416 1.00 19.10  ? 365  VAL A CG2   1 
ATOM   94    N  N     . ALA A 1  366 ? 117.010 122.154 107.051 1.00 14.82  ? 366  ALA A N     1 
ATOM   95    C  CA    . ALA A 1  366 ? 116.619 121.266 105.964 1.00 14.82  ? 366  ALA A CA    1 
ATOM   96    C  C     . ALA A 1  366 ? 117.231 119.906 106.250 1.00 14.82  ? 366  ALA A C     1 
ATOM   97    O  O     . ALA A 1  366 ? 118.453 119.746 106.185 1.00 14.82  ? 366  ALA A O     1 
ATOM   98    C  CB    . ALA A 1  366 ? 117.072 121.809 104.613 1.00 14.82  ? 366  ALA A CB    1 
ATOM   99    N  N     . ARG A 1  367 ? 116.387 118.936 106.573 1.00 20.78  ? 367  ARG A N     1 
ATOM   100   C  CA    . ARG A 1  367 ? 116.820 117.635 107.051 1.00 20.78  ? 367  ARG A CA    1 
ATOM   101   C  C     . ARG A 1  367 ? 116.653 116.602 105.946 1.00 20.78  ? 367  ARG A C     1 
ATOM   102   O  O     . ARG A 1  367 ? 115.646 116.600 105.234 1.00 20.78  ? 367  ARG A O     1 
ATOM   103   C  CB    . ARG A 1  367 ? 116.019 117.228 108.287 1.00 20.78  ? 367  ARG A CB    1 
ATOM   104   C  CG    . ARG A 1  367 ? 116.521 115.999 109.001 1.00 20.78  ? 367  ARG A CG    1 
ATOM   105   C  CD    . ARG A 1  367 ? 115.704 115.762 110.249 1.00 20.78  ? 367  ARG A CD    1 
ATOM   106   N  NE    . ARG A 1  367 ? 116.109 114.555 110.952 1.00 20.78  ? 367  ARG A NE    1 
ATOM   107   C  CZ    . ARG A 1  367 ? 117.074 114.514 111.860 1.00 20.78  ? 367  ARG A CZ    1 
ATOM   108   N  NH1   . ARG A 1  367 ? 117.739 115.613 112.179 1.00 20.78  ? 367  ARG A NH1   1 
ATOM   109   N  NH2   . ARG A 1  367 ? 117.375 113.371 112.452 1.00 20.78  ? 367  ARG A NH2   1 
ATOM   110   N  N     . ALA A 1  368 ? 117.643 115.728 105.809 1.00 18.74  ? 368  ALA A N     1 
ATOM   111   C  CA    . ALA A 1  368 ? 117.644 114.734 104.750 1.00 18.74  ? 368  ALA A CA    1 
ATOM   112   C  C     . ALA A 1  368 ? 116.767 113.543 105.116 1.00 18.74  ? 368  ALA A C     1 
ATOM   113   O  O     . ALA A 1  368 ? 116.672 113.147 106.280 1.00 18.74  ? 368  ALA A O     1 
ATOM   114   C  CB    . ALA A 1  368 ? 119.070 114.263 104.473 1.00 18.74  ? 368  ALA A CB    1 
ATOM   115   N  N     . LYS A 1  369 ? 116.131 112.959 104.100 1.00 23.09  ? 369  LYS A N     1 
ATOM   116   C  CA    . LYS A 1  369 ? 115.293 111.775 104.292 1.00 23.09  ? 369  LYS A CA    1 
ATOM   117   C  C     . LYS A 1  369 ? 116.189 110.542 104.341 1.00 23.09  ? 369  LYS A C     1 
ATOM   118   O  O     . LYS A 1  369 ? 116.328 109.787 103.377 1.00 23.09  ? 369  LYS A O     1 
ATOM   119   C  CB    . LYS A 1  369 ? 114.246 111.667 103.194 1.00 23.09  ? 369  LYS A CB    1 
ATOM   120   C  CG    . LYS A 1  369 ? 113.190 112.747 103.261 1.00 23.09  ? 369  LYS A CG    1 
ATOM   121   C  CD    . LYS A 1  369 ? 112.096 112.524 102.239 1.00 23.09  ? 369  LYS A CD    1 
ATOM   122   C  CE    . LYS A 1  369 ? 111.095 113.661 102.272 1.00 23.09  ? 369  LYS A CE    1 
ATOM   123   N  NZ    . LYS A 1  369 ? 110.348 113.700 103.558 1.00 23.09  ? 369  LYS A NZ    1 
ATOM   124   N  N     . LYS A 1  370 ? 116.798 110.335 105.505 1.00 20.24  ? 370  LYS A N     1 
ATOM   125   C  CA    . LYS A 1  370 ? 117.719 109.233 105.741 1.00 20.24  ? 370  LYS A CA    1 
ATOM   126   C  C     . LYS A 1  370 ? 117.227 108.415 106.923 1.00 20.24  ? 370  LYS A C     1 
ATOM   127   O  O     . LYS A 1  370 ? 116.891 108.974 107.970 1.00 20.24  ? 370  LYS A O     1 
ATOM   128   C  CB    . LYS A 1  370 ? 119.128 109.752 106.011 1.00 20.24  ? 370  LYS A CB    1 
ATOM   129   C  CG    . LYS A 1  370 ? 119.758 110.446 104.827 1.00 20.24  ? 370  LYS A CG    1 
ATOM   130   C  CD    . LYS A 1  370 ? 121.157 110.904 105.152 1.00 20.24  ? 370  LYS A CD    1 
ATOM   131   C  CE    . LYS A 1  370 ? 121.763 111.650 103.985 1.00 20.24  ? 370  LYS A CE    1 
ATOM   132   N  NZ    . LYS A 1  370 ? 122.006 110.746 102.830 1.00 20.24  ? 370  LYS A NZ    1 
ATOM   133   N  N     . LYS A 1  371 ? 117.202 107.097 106.759 1.00 20.97  ? 371  LYS A N     1 
ATOM   134   C  CA    . LYS A 1  371 ? 116.667 106.200 107.770 1.00 20.97  ? 371  LYS A CA    1 
ATOM   135   C  C     . LYS A 1  371 ? 117.638 106.048 108.938 1.00 20.97  ? 371  LYS A C     1 
ATOM   136   O  O     . LYS A 1  371 ? 118.829 106.347 108.833 1.00 20.97  ? 371  LYS A O     1 
ATOM   137   C  CB    . LYS A 1  371 ? 116.363 104.839 107.151 1.00 20.97  ? 371  LYS A CB    1 
ATOM   138   C  CG    . LYS A 1  371 ? 115.381 104.907 105.999 1.00 20.97  ? 371  LYS A CG    1 
ATOM   139   C  CD    . LYS A 1  371 ? 114.002 105.313 106.473 1.00 20.97  ? 371  LYS A CD    1 
ATOM   140   C  CE    . LYS A 1  371 ? 112.988 105.280 105.344 1.00 20.97  ? 371  LYS A CE    1 
ATOM   141   N  NZ    . LYS A 1  371 ? 113.215 106.380 104.367 1.00 20.97  ? 371  LYS A NZ    1 
ATOM   142   N  N     . TYR A 1  372 ? 117.114 105.558 110.060 1.00 21.89  ? 372  TYR A N     1 
ATOM   143   C  CA    . TYR A 1  372 ? 117.877 105.475 111.299 1.00 21.89  ? 372  TYR A CA    1 
ATOM   144   C  C     . TYR A 1  372 ? 118.290 104.061 111.667 1.00 21.89  ? 372  TYR A C     1 
ATOM   145   O  O     . TYR A 1  372 ? 119.286 103.889 112.368 1.00 21.89  ? 372  TYR A O     1 
ATOM   146   C  CB    . TYR A 1  372 ? 117.074 106.044 112.477 1.00 21.89  ? 372  TYR A CB    1 
ATOM   147   C  CG    . TYR A 1  372 ? 116.705 107.511 112.411 1.00 21.89  ? 372  TYR A CG    1 
ATOM   148   C  CD1   . TYR A 1  372 ? 117.330 108.385 111.534 1.00 21.89  ? 372  TYR A CD1   1 
ATOM   149   C  CD2   . TYR A 1  372 ? 115.706 108.014 113.231 1.00 21.89  ? 372  TYR A CD2   1 
ATOM   150   C  CE1   . TYR A 1  372 ? 116.968 109.713 111.480 1.00 21.89  ? 372  TYR A CE1   1 
ATOM   151   C  CE2   . TYR A 1  372 ? 115.345 109.336 113.185 1.00 21.89  ? 372  TYR A CE2   1 
ATOM   152   C  CZ    . TYR A 1  372 ? 115.976 110.180 112.311 1.00 21.89  ? 372  TYR A CZ    1 
ATOM   153   O  OH    . TYR A 1  372 ? 115.607 111.501 112.273 1.00 21.89  ? 372  TYR A OH    1 
ATOM   154   N  N     . THR A 1  373 ? 117.541 103.056 111.241 1.00 23.92  ? 373  THR A N     1 
ATOM   155   C  CA    . THR A 1  373 ? 117.828 101.684 111.642 1.00 23.92  ? 373  THR A CA    1 
ATOM   156   C  C     . THR A 1  373 ? 118.903 101.082 110.746 1.00 23.92  ? 373  THR A C     1 
ATOM   157   O  O     . THR A 1  373 ? 118.795 101.164 109.520 1.00 23.92  ? 373  THR A O     1 
ATOM   158   C  CB    . THR A 1  373 ? 116.570 100.828 111.581 1.00 23.92  ? 373  THR A CB    1 
ATOM   159   O  OG1   . THR A 1  373 ? 116.030 100.872 110.256 1.00 23.92  ? 373  THR A OG1   1 
ATOM   160   C  CG2   . THR A 1  373 ? 115.535 101.328 112.568 1.00 23.92  ? 373  THR A CG2   1 
ATOM   161   N  N     . PRO A 1  374 ? 119.930 100.453 111.314 1.00 22.96  ? 374  PRO A N     1 
ATOM   162   C  CA    . PRO A 1  374 ? 121.002 99.890  110.486 1.00 22.96  ? 374  PRO A CA    1 
ATOM   163   C  C     . PRO A 1  374 ? 120.603 98.616  109.757 1.00 22.96  ? 374  PRO A C     1 
ATOM   164   O  O     . PRO A 1  374 ? 119.452 98.177  109.823 1.00 22.96  ? 374  PRO A O     1 
ATOM   165   C  CB    . PRO A 1  374 ? 122.118 99.628  111.502 1.00 22.96  ? 374  PRO A CB    1 
ATOM   166   C  CG    . PRO A 1  374 ? 121.414 99.426  112.778 1.00 22.96  ? 374  PRO A CG    1 
ATOM   167   C  CD    . PRO A 1  374 ? 120.217 100.321 112.751 1.00 22.96  ? 374  PRO A CD    1 
ATOM   168   N  N     . PHE A 1  375 ? 121.561 98.017  109.052 1.00 25.27  ? 375  PHE A N     1 
ATOM   169   C  CA    . PHE A 1  375 ? 121.295 96.844  108.231 1.00 25.27  ? 375  PHE A CA    1 
ATOM   170   C  C     . PHE A 1  375 ? 121.218 95.568  109.050 1.00 25.27  ? 375  PHE A C     1 
ATOM   171   O  O     . PHE A 1  375 ? 120.642 94.578  108.587 1.00 25.27  ? 375  PHE A O     1 
ATOM   172   C  CB    . PHE A 1  375 ? 122.381 96.732  107.163 1.00 25.27  ? 375  PHE A CB    1 
ATOM   173   C  CG    . PHE A 1  375 ? 122.168 95.636  106.167 1.00 25.27  ? 375  PHE A CG    1 
ATOM   174   C  CD1   . PHE A 1  375 ? 121.165 95.727  105.219 1.00 25.27  ? 375  PHE A CD1   1 
ATOM   175   C  CD2   . PHE A 1  375 ? 123.012 94.541  106.144 1.00 25.27  ? 375  PHE A CD2   1 
ATOM   176   C  CE1   . PHE A 1  375 ? 120.985 94.726  104.289 1.00 25.27  ? 375  PHE A CE1   1 
ATOM   177   C  CE2   . PHE A 1  375 ? 122.840 93.537  105.216 1.00 25.27  ? 375  PHE A CE2   1 
ATOM   178   C  CZ    . PHE A 1  375 ? 121.826 93.629  104.287 1.00 25.27  ? 375  PHE A CZ    1 
ATOM   179   N  N     . SER A 1  376 ? 121.737 95.579  110.268 1.00 25.58  ? 376  SER A N     1 
ATOM   180   C  CA    . SER A 1  376 ? 121.711 94.408  111.137 1.00 25.58  ? 376  SER A CA    1 
ATOM   181   C  C     . SER A 1  376 ? 120.332 94.108  111.713 1.00 25.58  ? 376  SER A C     1 
ATOM   182   O  O     . SER A 1  376 ? 120.263 93.220  112.568 1.00 25.58  ? 376  SER A O     1 
ATOM   183   C  CB    . SER A 1  376 ? 122.713 94.591  112.276 1.00 25.58  ? 376  SER A CB    1 
ATOM   184   O  OG    . SER A 1  376 ? 122.326 95.650  113.129 1.00 25.58  ? 376  SER A OG    1 
ATOM   185   N  N     . LYS A 1  377 ? 119.243 94.776  111.315 1.00 28.24  ? 377  LYS A N     1 
ATOM   186   C  CA    . LYS A 1  377 ? 117.947 94.605  111.957 1.00 28.24  ? 377  LYS A CA    1 
ATOM   187   C  C     . LYS A 1  377 ? 116.806 94.529  110.952 1.00 28.24  ? 377  LYS A C     1 
ATOM   188   O  O     . LYS A 1  377 ? 115.684 94.940  111.263 1.00 28.24  ? 377  LYS A O     1 
ATOM   189   C  CB    . LYS A 1  377 ? 117.660 95.746  112.932 1.00 28.24  ? 377  LYS A CB    1 
ATOM   190   C  CG    . LYS A 1  377 ? 118.529 95.770  114.163 1.00 28.24  ? 377  LYS A CG    1 
ATOM   191   C  CD    . LYS A 1  377 ? 118.186 96.947  115.038 1.00 28.24  ? 377  LYS A CD    1 
ATOM   192   C  CE    . LYS A 1  377 ? 118.990 96.905  116.315 1.00 28.24  ? 377  LYS A CE    1 
ATOM   193   N  NZ    . LYS A 1  377 ? 120.443 97.057  116.042 1.00 28.24  ? 377  LYS A NZ    1 
ATOM   194   N  N     . ARG A 1  378 ? 117.051 94.011  109.750 1.00 31.38  ? 378  ARG A N     1 
ATOM   195   C  CA    . ARG A 1  378 ? 115.980 93.935  108.770 1.00 31.38  ? 378  ARG A CA    1 
ATOM   196   C  C     . ARG A 1  378 ? 115.809 92.559  108.143 1.00 31.38  ? 378  ARG A C     1 
ATOM   197   O  O     . ARG A 1  378 ? 114.954 92.405  107.263 1.00 31.38  ? 378  ARG A O     1 
ATOM   198   C  CB    . ARG A 1  378 ? 116.185 94.980  107.663 1.00 31.38  ? 378  ARG A CB    1 
ATOM   199   C  CG    . ARG A 1  378 ? 117.249 94.661  106.639 1.00 31.38  ? 378  ARG A CG    1 
ATOM   200   C  CD    . ARG A 1  378 ? 117.447 95.836  105.703 1.00 31.38  ? 378  ARG A CD    1 
ATOM   201   N  NE    . ARG A 1  378 ? 118.167 96.922  106.363 1.00 31.38  ? 378  ARG A NE    1 
ATOM   202   C  CZ    . ARG A 1  378 ? 117.615 98.053  106.788 1.00 31.38  ? 378  ARG A CZ    1 
ATOM   203   N  NH1   . ARG A 1  378 ? 116.315 98.256  106.641 1.00 31.38  ? 378  ARG A NH1   1 
ATOM   204   N  NH2   . ARG A 1  378 ? 118.363 98.973  107.376 1.00 31.38  ? 378  ARG A NH2   1 
ATOM   205   N  N     . PHE A 1  379 ? 116.571 91.555  108.572 1.00 38.83  ? 379  PHE A N     1 
ATOM   206   C  CA    . PHE A 1  379 ? 116.359 90.202  108.089 1.00 38.83  ? 379  PHE A CA    1 
ATOM   207   C  C     . PHE A 1  379 ? 116.177 89.167  109.186 1.00 38.83  ? 379  PHE A C     1 
ATOM   208   O  O     . PHE A 1  379 ? 115.835 88.024  108.865 1.00 38.83  ? 379  PHE A O     1 
ATOM   209   C  CB    . PHE A 1  379 ? 117.512 89.761  107.176 1.00 38.83  ? 379  PHE A CB    1 
ATOM   210   C  CG    . PHE A 1  379 ? 117.575 90.520  105.889 1.00 38.83  ? 379  PHE A CG    1 
ATOM   211   C  CD1   . PHE A 1  379 ? 116.614 90.322  104.914 1.00 38.83  ? 379  PHE A CD1   1 
ATOM   212   C  CD2   . PHE A 1  379 ? 118.607 91.406  105.638 1.00 38.83  ? 379  PHE A CD2   1 
ATOM   213   C  CE1   . PHE A 1  379 ? 116.661 91.017  103.724 1.00 38.83  ? 379  PHE A CE1   1 
ATOM   214   C  CE2   . PHE A 1  379 ? 118.665 92.097  104.444 1.00 38.83  ? 379  PHE A CE2   1 
ATOM   215   C  CZ    . PHE A 1  379 ? 117.691 91.901  103.486 1.00 38.83  ? 379  PHE A CZ    1 
ATOM   216   N  N     . LYS A 1  380 ? 116.439 89.512  110.451 1.00 44.90  ? 380  LYS A N     1 
ATOM   217   C  CA    . LYS A 1  380 ? 116.191 88.745  111.677 1.00 44.90  ? 380  LYS A CA    1 
ATOM   218   C  C     . LYS A 1  380 ? 117.069 87.506  111.822 1.00 44.90  ? 380  LYS A C     1 
ATOM   219   O  O     . LYS A 1  380 ? 117.008 86.850  112.869 1.00 44.90  ? 380  LYS A O     1 
ATOM   220   C  CB    . LYS A 1  380 ? 114.723 88.315  111.819 1.00 44.90  ? 380  LYS A CB    1 
ATOM   221   C  CG    . LYS A 1  380 ? 113.740 89.465  111.832 1.00 44.90  ? 380  LYS A CG    1 
ATOM   222   C  CD    . LYS A 1  380 ? 112.323 88.954  111.956 1.00 44.90  ? 380  LYS A CD    1 
ATOM   223   C  CE    . LYS A 1  380 ? 111.926 88.197  110.702 1.00 44.90  ? 380  LYS A CE    1 
ATOM   224   N  NZ    . LYS A 1  380 ? 111.923 89.081  109.504 1.00 44.90  ? 380  LYS A NZ    1 
ATOM   225   N  N     . SER A 1  381 ? 117.897 87.178  110.833 1.00 45.70  ? 381  SER A N     1 
ATOM   226   C  CA    . SER A 1  381 ? 118.737 85.990  110.853 1.00 45.70  ? 381  SER A CA    1 
ATOM   227   C  C     . SER A 1  381 ? 119.801 86.130  109.777 1.00 45.70  ? 381  SER A C     1 
ATOM   228   O  O     . SER A 1  381 ? 119.554 86.708  108.716 1.00 45.70  ? 381  SER A O     1 
ATOM   229   C  CB    . SER A 1  381 ? 117.926 84.710  110.617 1.00 45.70  ? 381  SER A CB    1 
ATOM   230   O  OG    . SER A 1  381 ? 118.768 83.572  110.573 1.00 45.70  ? 381  SER A OG    1 
ATOM   231   N  N     . ILE A 1  382 ? 120.989 85.597  110.068 1.00 45.09  ? 382  ILE A N     1 
ATOM   232   C  CA    . ILE A 1  382 ? 122.034 85.521  109.053 1.00 45.09  ? 382  ILE A CA    1 
ATOM   233   C  C     . ILE A 1  382 ? 121.632 84.525  107.970 1.00 45.09  ? 382  ILE A C     1 
ATOM   234   O  O     . ILE A 1  382 ? 121.872 84.755  106.776 1.00 45.09  ? 382  ILE A O     1 
ATOM   235   C  CB    . ILE A 1  382 ? 123.393 85.181  109.708 1.00 45.09  ? 382  ILE A CB    1 
ATOM   236   C  CG1   . ILE A 1  382 ? 123.906 86.349  110.564 1.00 45.09  ? 382  ILE A CG1   1 
ATOM   237   C  CG2   . ILE A 1  382 ? 124.456 84.821  108.680 1.00 45.09  ? 382  ILE A CG2   1 
ATOM   238   C  CD1   . ILE A 1  382 ? 123.580 86.265  112.045 1.00 45.09  ? 382  ILE A CD1   1 
ATOM   239   N  N     . ALA A 1  383 ? 120.940 83.449  108.353 1.00 44.26  ? 383  ALA A N     1 
ATOM   240   C  CA    . ALA A 1  383 ? 120.438 82.488  107.379 1.00 44.26  ? 383  ALA A CA    1 
ATOM   241   C  C     . ALA A 1  383 ? 119.268 83.028  106.568 1.00 44.26  ? 383  ALA A C     1 
ATOM   242   O  O     . ALA A 1  383 ? 118.930 82.445  105.533 1.00 44.26  ? 383  ALA A O     1 
ATOM   243   C  CB    . ALA A 1  383 ? 120.022 81.197  108.082 1.00 44.26  ? 383  ALA A CB    1 
ATOM   244   N  N     . ALA A 1  384 ? 118.639 84.115  107.009 1.00 44.44  ? 384  ALA A N     1 
ATOM   245   C  CA    . ALA A 1  384 ? 117.551 84.731  106.265 1.00 44.44  ? 384  ALA A CA    1 
ATOM   246   C  C     . ALA A 1  384 ? 118.012 85.873  105.374 1.00 44.44  ? 384  ALA A C     1 
ATOM   247   O  O     . ALA A 1  384 ? 117.183 86.471  104.682 1.00 44.44  ? 384  ALA A O     1 
ATOM   248   C  CB    . ALA A 1  384 ? 116.467 85.229  107.220 1.00 44.44  ? 384  ALA A CB    1 
ATOM   249   N  N     . ILE A 1  385 ? 119.299 86.195  105.380 1.00 42.56  ? 385  ILE A N     1 
ATOM   250   C  CA    . ILE A 1  385 ? 119.832 87.166  104.419 1.00 42.56  ? 385  ILE A CA    1 
ATOM   251   C  C     . ILE A 1  385 ? 119.841 86.531  103.033 1.00 42.56  ? 385  ILE A C     1 
ATOM   252   O  O     . ILE A 1  385 ? 120.414 85.443  102.861 1.00 42.56  ? 385  ILE A O     1 
ATOM   253   C  CB    . ILE A 1  385 ? 121.237 87.604  104.828 1.00 42.56  ? 385  ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  385 ? 121.217 88.300  106.187 1.00 42.56  ? 385  ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  385 ? 121.824 88.535  103.788 1.00 42.56  ? 385  ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  385 ? 122.594 88.521  106.763 1.00 42.56  ? 385  ILE A CD1   1 
ATOM   257   N  N     . PRO A 1  386 ? 119.225 87.142  102.031 1.00 42.63  ? 386  PRO A N     1 
ATOM   258   C  CA    . PRO A 1  386 ? 119.215 86.561  100.687 1.00 42.63  ? 386  PRO A CA    1 
ATOM   259   C  C     . PRO A 1  386 ? 120.555 86.784  99.995  1.00 42.63  ? 386  PRO A C     1 
ATOM   260   O  O     . PRO A 1  386 ? 121.461 87.421  100.525 1.00 42.63  ? 386  PRO A O     1 
ATOM   261   C  CB    . PRO A 1  386 ? 118.088 87.322  99.991  1.00 42.63  ? 386  PRO A CB    1 
ATOM   262   C  CG    . PRO A 1  386 ? 118.062 88.632  100.674 1.00 42.63  ? 386  PRO A CG    1 
ATOM   263   C  CD    . PRO A 1  386 ? 118.429 88.375  102.103 1.00 42.63  ? 386  PRO A CD    1 
ATOM   264   N  N     . ASP A 1  387 ? 120.670 86.234  98.789  1.00 44.93  ? 387  ASP A N     1 
ATOM   265   C  CA    . ASP A 1  387 ? 121.871 86.424  97.983  1.00 44.93  ? 387  ASP A CA    1 
ATOM   266   C  C     . ASP A 1  387 ? 121.901 87.862  97.486  1.00 44.93  ? 387  ASP A C     1 
ATOM   267   O  O     . ASP A 1  387 ? 121.087 88.252  96.643  1.00 44.93  ? 387  ASP A O     1 
ATOM   268   C  CB    . ASP A 1  387 ? 121.891 85.436  96.823  1.00 30.00  ? 387  ASP A CB    1 
ATOM   269   C  CG    . ASP A 1  387 ? 123.200 85.456  96.069  1.00 30.00  ? 387  ASP A CG    1 
ATOM   270   O  OD1   . ASP A 1  387 ? 124.201 84.938  96.604  1.00 30.00  ? 387  ASP A OD1   1 
ATOM   271   O  OD2   . ASP A 1  387 ? 123.227 85.988  94.942  1.00 30.00  ? 387  ASP A OD2   1 
ATOM   272   N  N     . LEU A 1  388 ? 122.839 88.655  98.011  1.00 41.56  ? 388  LEU A N     1 
ATOM   273   C  CA    . LEU A 1  388 ? 122.803 90.097  97.802  1.00 41.56  ? 388  LEU A CA    1 
ATOM   274   C  C     . LEU A 1  388 ? 123.223 90.500  96.398  1.00 41.56  ? 388  LEU A C     1 
ATOM   275   O  O     . LEU A 1  388 ? 122.918 91.618  95.975  1.00 41.56  ? 388  LEU A O     1 
ATOM   276   C  CB    . LEU A 1  388 ? 123.694 90.797  98.824  1.00 41.56  ? 388  LEU A CB    1 
ATOM   277   C  CG    . LEU A 1  388 ? 123.313 90.573  100.287 1.00 41.56  ? 388  LEU A CG    1 
ATOM   278   C  CD1   . LEU A 1  388 ? 124.291 91.287  101.196 1.00 41.56  ? 388  LEU A CD1   1 
ATOM   279   C  CD2   . LEU A 1  388 ? 121.884 90.999  100.569 1.00 41.56  ? 388  LEU A CD2   1 
ATOM   280   N  N     . THR A 1  389 ? 123.916 89.625  95.667  1.00 43.16  ? 389  THR A N     1 
ATOM   281   C  CA    . THR A 1  389 ? 124.301 89.961  94.302  1.00 43.16  ? 389  THR A CA    1 
ATOM   282   C  C     . THR A 1  389 ? 123.120 89.848  93.348  1.00 43.16  ? 389  THR A C     1 
ATOM   283   O  O     . THR A 1  389 ? 122.993 90.650  92.417  1.00 43.16  ? 389  THR A O     1 
ATOM   284   C  CB    . THR A 1  389 ? 125.445 89.064  93.837  1.00 43.16  ? 389  THR A CB    1 
ATOM   285   O  OG1   . THR A 1  389 ? 125.009 87.700  93.819  1.00 43.16  ? 389  THR A OG1   1 
ATOM   286   C  CG2   . THR A 1  389 ? 126.625 89.191  94.778  1.00 43.16  ? 389  THR A CG2   1 
ATOM   287   N  N     . SER A 1  390 ? 122.252 88.865  93.560  1.00 51.65  ? 390  SER A N     1 
ATOM   288   C  CA    . SER A 1  390 ? 121.036 88.707  92.762  1.00 51.65  ? 390  SER A CA    1 
ATOM   289   C  C     . SER A 1  390 ? 119.852 89.370  93.466  1.00 51.65  ? 390  SER A C     1 
ATOM   290   O  O     . SER A 1  390 ? 118.844 88.745  93.794  1.00 51.65  ? 390  SER A O     1 
ATOM   291   C  CB    . SER A 1  390 ? 120.770 87.229  92.494  1.00 51.65  ? 390  SER A CB    1 
ATOM   292   O  OG    . SER A 1  390 ? 120.484 86.537  93.696  1.00 51.65  ? 390  SER A OG    1 
ATOM   293   N  N     . LEU A 1  391 ? 119.997 90.675  93.692  1.00 55.80  ? 391  LEU A N     1 
ATOM   294   C  CA    . LEU A 1  391 ? 119.044 91.478  94.431  1.00 55.80  ? 391  LEU A CA    1 
ATOM   295   C  C     . LEU A 1  391 ? 119.051 92.840  93.756  1.00 55.80  ? 391  LEU A C     1 
ATOM   296   O  O     . LEU A 1  391 ? 120.134 93.342  93.419  1.00 55.80  ? 391  LEU A O     1 
ATOM   297   C  CB    . LEU A 1  391 ? 119.435 91.573  95.911  1.00 55.80  ? 391  LEU A CB    1 
ATOM   298   C  CG    . LEU A 1  391 ? 118.511 92.152  96.979  1.00 55.80  ? 391  LEU A CG    1 
ATOM   299   C  CD1   . LEU A 1  391 ? 118.723 91.426  98.284  1.00 55.80  ? 391  LEU A CD1   1 
ATOM   300   C  CD2   . LEU A 1  391 ? 118.805 93.613  97.173  1.00 55.80  ? 391  LEU A CD2   1 
ATOM   301   N  N     . PRO A 1  392 ? 117.882 93.452  93.528  1.00 59.19  ? 392  PRO A N     1 
ATOM   302   C  CA    . PRO A 1  392 ? 117.833 94.574  92.573  1.00 59.19  ? 392  PRO A CA    1 
ATOM   303   C  C     . PRO A 1  392 ? 118.442 95.871  93.077  1.00 59.19  ? 392  PRO A C     1 
ATOM   304   O  O     . PRO A 1  392 ? 119.153 96.535  92.315  1.00 59.19  ? 392  PRO A O     1 
ATOM   305   C  CB    . PRO A 1  392 ? 116.332 94.721  92.291  1.00 59.19  ? 392  PRO A CB    1 
ATOM   306   C  CG    . PRO A 1  392 ? 115.665 94.173  93.497  1.00 59.19  ? 392  PRO A CG    1 
ATOM   307   C  CD    . PRO A 1  392 ? 116.539 93.058  93.987  1.00 59.19  ? 392  PRO A CD    1 
ATOM   308   N  N     . GLU A 1  393 ? 118.198 96.265  94.324  1.00 55.80  ? 393  GLU A N     1 
ATOM   309   C  CA    . GLU A 1  393 ? 118.652 97.579  94.761  1.00 55.80  ? 393  GLU A CA    1 
ATOM   310   C  C     . GLU A 1  393 ? 120.083 97.591  95.281  1.00 55.80  ? 393  GLU A C     1 
ATOM   311   O  O     . GLU A 1  393 ? 120.590 98.670  95.603  1.00 55.80  ? 393  GLU A O     1 
ATOM   312   C  CB    . GLU A 1  393 ? 117.712 98.156  95.828  1.00 55.80  ? 393  GLU A CB    1 
ATOM   313   C  CG    . GLU A 1  393 ? 117.717 97.438  97.165  1.00 55.80  ? 393  GLU A CG    1 
ATOM   314   C  CD    . GLU A 1  393 ? 116.638 96.378  97.261  1.00 55.80  ? 393  GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1  393 ? 116.063 96.014  96.216  1.00 55.80  ? 393  GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1  393 ? 116.369 95.904  98.384  1.00 55.80  ? 393  GLU A OE2   1 
ATOM   317   N  N     . PHE A 1  394 ? 120.757 96.445  95.364  1.00 42.89  ? 394  PHE A N     1 
ATOM   318   C  CA    . PHE A 1  394 ? 122.160 96.487  95.752  1.00 42.89  ? 394  PHE A CA    1 
ATOM   319   C  C     . PHE A 1  394 ? 123.061 96.687  94.540  1.00 42.89  ? 394  PHE A C     1 
ATOM   320   O  O     . PHE A 1  394 ? 122.688 96.405  93.398  1.00 42.89  ? 394  PHE A O     1 
ATOM   321   C  CB    . PHE A 1  394 ? 122.634 95.229  96.488  1.00 42.89  ? 394  PHE A CB    1 
ATOM   322   C  CG    . PHE A 1  394 ? 122.270 95.172  97.947  1.00 42.89  ? 394  PHE A CG    1 
ATOM   323   C  CD1   . PHE A 1  394 ? 121.255 95.946  98.480  1.00 42.89  ? 394  PHE A CD1   1 
ATOM   324   C  CD2   . PHE A 1  394 ? 123.084 94.471  98.819  1.00 42.89  ? 394  PHE A CD2   1 
ATOM   325   C  CE1   . PHE A 1  394 ? 120.972 95.907  99.832  1.00 42.89  ? 394  PHE A CE1   1 
ATOM   326   C  CE2   . PHE A 1  394 ? 122.824 94.448  100.170 1.00 42.89  ? 394  PHE A CE2   1 
ATOM   327   C  CZ    . PHE A 1  394 ? 121.766 95.163  100.677 1.00 42.89  ? 394  PHE A CZ    1 
ATOM   328   N  N     . TYR A 1  395 ? 124.261 97.202  94.824  1.00 34.78  ? 395  TYR A N     1 
ATOM   329   C  CA    . TYR A 1  395 ? 125.395 97.299  93.897  1.00 34.78  ? 395  TYR A CA    1 
ATOM   330   C  C     . TYR A 1  395 ? 125.088 98.153  92.668  1.00 34.78  ? 395  TYR A C     1 
ATOM   331   O  O     . TYR A 1  395 ? 125.665 97.945  91.599  1.00 34.78  ? 395  TYR A O     1 
ATOM   332   C  CB    . TYR A 1  395 ? 125.899 95.915  93.481  1.00 34.78  ? 395  TYR A CB    1 
ATOM   333   C  CG    . TYR A 1  395 ? 126.326 95.064  94.654  1.00 34.78  ? 395  TYR A CG    1 
ATOM   334   C  CD1   . TYR A 1  395 ? 127.457 95.381  95.394  1.00 34.78  ? 395  TYR A CD1   1 
ATOM   335   C  CD2   . TYR A 1  395 ? 125.620 93.921  94.995  1.00 34.78  ? 395  TYR A CD2   1 
ATOM   336   C  CE1   . TYR A 1  395 ? 127.849 94.604  96.466  1.00 34.78  ? 395  TYR A CE1   1 
ATOM   337   C  CE2   . TYR A 1  395 ? 126.008 93.136  96.059  1.00 34.78  ? 395  TYR A CE2   1 
ATOM   338   C  CZ    . TYR A 1  395 ? 127.121 93.482  96.789  1.00 34.78  ? 395  TYR A CZ    1 
ATOM   339   O  OH    . TYR A 1  395 ? 127.504 92.698  97.847  1.00 34.78  ? 395  TYR A OH    1 
ATOM   340   N  N     . GLY A 1  396 ? 124.183 99.119  92.818  1.00 46.23  ? 396  GLY A N     1 
ATOM   341   C  CA    . GLY A 1  396 ? 123.921 100.119 91.801  1.00 46.23  ? 396  GLY A CA    1 
ATOM   342   C  C     . GLY A 1  396 ? 123.306 99.614  90.512  1.00 46.23  ? 396  GLY A C     1 
ATOM   343   O  O     . GLY A 1  396 ? 123.785 99.951  89.425  1.00 46.23  ? 396  GLY A O     1 
ATOM   344   N  N     . ASN A 1  397 ? 122.245 98.816  90.609  1.00 52.46  ? 397  ASN A N     1 
ATOM   345   C  CA    . ASN A 1  397 ? 121.602 98.273  89.420  1.00 52.46  ? 397  ASN A CA    1 
ATOM   346   C  C     . ASN A 1  397 ? 120.453 99.135  88.914  1.00 52.46  ? 397  ASN A C     1 
ATOM   347   O  O     . ASN A 1  397 ? 119.912 98.847  87.841  1.00 52.46  ? 397  ASN A O     1 
ATOM   348   C  CB    . ASN A 1  397 ? 121.092 96.854  89.692  1.00 52.46  ? 397  ASN A CB    1 
ATOM   349   C  CG    . ASN A 1  397 ? 122.216 95.859  89.891  1.00 52.46  ? 397  ASN A CG    1 
ATOM   350   O  OD1   . ASN A 1  397 ? 123.224 95.898  89.190  1.00 52.46  ? 397  ASN A OD1   1 
ATOM   351   N  ND2   . ASN A 1  397 ? 122.046 94.957  90.848  1.00 52.46  ? 397  ASN A ND2   1 
ATOM   352   N  N     . SER A 1  398 ? 120.068 100.178 89.650  1.00 67.13  ? 398  SER A N     1 
ATOM   353   C  CA    . SER A 1  398 ? 119.021 101.088 89.209  1.00 67.13  ? 398  SER A CA    1 
ATOM   354   C  C     . SER A 1  398 ? 119.433 102.553 89.273  1.00 67.13  ? 398  SER A C     1 
ATOM   355   O  O     . SER A 1  398 ? 118.662 103.414 88.837  1.00 67.13  ? 398  SER A O     1 
ATOM   356   C  CB    . SER A 1  398 ? 117.745 100.888 90.041  1.00 67.13  ? 398  SER A CB    1 
ATOM   357   O  OG    . SER A 1  398 ? 117.939 101.290 91.386  1.00 67.13  ? 398  SER A OG    1 
ATOM   358   N  N     . SER A 1  399 ? 120.625 102.858 89.785  1.00 73.38  ? 399  SER A N     1 
ATOM   359   C  CA    . SER A 1  399 ? 121.072 104.230 89.995  1.00 73.38  ? 399  SER A CA    1 
ATOM   360   C  C     . SER A 1  399 ? 121.611 104.896 88.734  1.00 73.38  ? 399  SER A C     1 
ATOM   361   O  O     . SER A 1  399 ? 122.027 106.057 88.800  1.00 73.38  ? 399  SER A O     1 
ATOM   362   C  CB    . SER A 1  399 ? 122.147 104.259 91.083  1.00 73.38  ? 399  SER A CB    1 
ATOM   363   O  OG    . SER A 1  399 ? 123.310 103.570 90.656  1.00 73.38  ? 399  SER A OG    1 
ATOM   364   N  N     . GLU A 1  400 ? 121.608 104.207 87.595  1.00 85.82  ? 400  GLU A N     1 
ATOM   365   C  CA    . GLU A 1  400 ? 122.170 104.736 86.357  1.00 85.82  ? 400  GLU A CA    1 
ATOM   366   C  C     . GLU A 1  400 ? 121.202 105.635 85.590  1.00 85.82  ? 400  GLU A C     1 
ATOM   367   O  O     . GLU A 1  400 ? 121.483 105.982 84.438  1.00 85.82  ? 400  GLU A O     1 
ATOM   368   C  CB    . GLU A 1  400 ? 122.637 103.581 85.462  1.00 85.82  ? 400  GLU A CB    1 
ATOM   369   C  CG    . GLU A 1  400 ? 121.515 102.704 84.908  1.00 85.82  ? 400  GLU A CG    1 
ATOM   370   C  CD    . GLU A 1  400 ? 121.140 101.550 85.826  1.00 85.82  ? 400  GLU A CD    1 
ATOM   371   O  OE1   . GLU A 1  400 ? 121.533 101.563 87.011  1.00 85.82  ? 400  GLU A OE1   1 
ATOM   372   O  OE2   . GLU A 1  400 ? 120.447 100.624 85.356  1.00 85.82  ? 400  GLU A OE2   1 
ATOM   373   N  N     . LEU A 1  401 ? 120.081 106.022 86.194  1.00 76.43  ? 401  LEU A N     1 
ATOM   374   C  CA    . LEU A 1  401 ? 119.119 106.915 85.564  1.00 76.43  ? 401  LEU A CA    1 
ATOM   375   C  C     . LEU A 1  401 ? 119.236 108.347 86.063  1.00 76.43  ? 401  LEU A C     1 
ATOM   376   O  O     . LEU A 1  401 ? 119.104 109.286 85.271  1.00 76.43  ? 401  LEU A O     1 
ATOM   377   C  CB    . LEU A 1  401 ? 117.694 106.385 85.796  1.00 76.43  ? 401  LEU A CB    1 
ATOM   378   C  CG    . LEU A 1  401 ? 116.456 106.931 85.062  1.00 76.43  ? 401  LEU A CG    1 
ATOM   379   C  CD1   . LEU A 1  401 ? 115.809 108.160 85.716  1.00 76.43  ? 401  LEU A CD1   1 
ATOM   380   C  CD2   . LEU A 1  401 ? 116.808 107.226 83.607  1.00 76.43  ? 401  LEU A CD2   1 
ATOM   381   N  N     . MET A 1  402 ? 119.490 108.538 87.356  1.00 78.88  ? 402  MET A N     1 
ATOM   382   C  CA    . MET A 1  402 ? 119.459 109.875 87.930  1.00 78.88  ? 402  MET A CA    1 
ATOM   383   C  C     . MET A 1  402 ? 120.790 110.599 87.775  1.00 78.88  ? 402  MET A C     1 
ATOM   384   O  O     . MET A 1  402 ? 120.807 111.830 87.663  1.00 78.88  ? 402  MET A O     1 
ATOM   385   C  CB    . MET A 1  402 ? 119.056 109.792 89.410  1.00 78.88  ? 402  MET A CB    1 
ATOM   386   C  CG    . MET A 1  402 ? 118.652 111.122 90.052  1.00 78.88  ? 402  MET A CG    1 
ATOM   387   S  SD    . MET A 1  402 ? 119.986 112.083 90.797  1.00 78.88  ? 402  MET A SD    1 
ATOM   388   C  CE    . MET A 1  402 ? 119.130 113.610 91.179  1.00 78.88  ? 402  MET A CE    1 
ATOM   389   N  N     . ALA A 1  403 ? 121.906 109.866 87.740  1.00 70.20  ? 403  ALA A N     1 
ATOM   390   C  CA    . ALA A 1  403 ? 123.210 110.492 87.542  1.00 70.20  ? 403  ALA A CA    1 
ATOM   391   C  C     . ALA A 1  403 ? 123.377 111.058 86.137  1.00 70.20  ? 403  ALA A C     1 
ATOM   392   O  O     . ALA A 1  403 ? 124.195 111.963 85.939  1.00 70.20  ? 403  ALA A O     1 
ATOM   393   C  CB    . ALA A 1  403 ? 124.326 109.488 87.837  1.00 70.20  ? 403  ALA A CB    1 
ATOM   394   N  N     . SER A 1  404 ? 122.617 110.553 85.165  1.00 73.99  ? 404  SER A N     1 
ATOM   395   C  CA    . SER A 1  404 ? 122.645 111.042 83.794  1.00 73.99  ? 404  SER A CA    1 
ATOM   396   C  C     . SER A 1  404 ? 121.539 112.054 83.512  1.00 73.99  ? 404  SER A C     1 
ATOM   397   O  O     . SER A 1  404 ? 121.307 112.399 82.349  1.00 73.99  ? 404  SER A O     1 
ATOM   398   C  CB    . SER A 1  404 ? 122.544 109.871 82.818  1.00 73.99  ? 404  SER A CB    1 
ATOM   399   O  OG    . SER A 1  404 ? 121.284 109.232 82.930  1.00 73.99  ? 404  SER A OG    1 
ATOM   400   N  N     . ARG A 1  405 ? 120.845 112.526 84.546  1.00 68.63  ? 405  ARG A N     1 
ATOM   401   C  CA    . ARG A 1  405 ? 119.795 113.519 84.372  1.00 68.63  ? 405  ARG A CA    1 
ATOM   402   C  C     . ARG A 1  405 ? 120.344 114.902 84.055  1.00 68.63  ? 405  ARG A C     1 
ATOM   403   O  O     . ARG A 1  405 ? 119.744 115.624 83.251  1.00 68.63  ? 405  ARG A O     1 
ATOM   404   C  CB    . ARG A 1  405 ? 118.913 113.569 85.636  1.00 68.63  ? 405  ARG A CB    1 
ATOM   405   C  CG    . ARG A 1  405 ? 117.724 114.540 85.615  1.00 68.63  ? 405  ARG A CG    1 
ATOM   406   C  CD    . ARG A 1  405 ? 118.005 115.823 86.396  1.00 68.63  ? 405  ARG A CD    1 
ATOM   407   N  NE    . ARG A 1  405 ? 116.875 116.746 86.383  1.00 68.63  ? 405  ARG A NE    1 
ATOM   408   C  CZ    . ARG A 1  405 ? 115.890 116.741 87.276  1.00 68.63  ? 405  ARG A CZ    1 
ATOM   409   N  NH1   . ARG A 1  405 ? 115.889 115.860 88.266  1.00 68.63  ? 405  ARG A NH1   1 
ATOM   410   N  NH2   . ARG A 1  405 ? 114.906 117.624 87.178  1.00 68.63  ? 405  ARG A NH2   1 
ATOM   411   N  N     . PHE A 1  406 ? 121.480 115.270 84.639  1.00 59.65  ? 406  PHE A N     1 
ATOM   412   C  CA    . PHE A 1  406 ? 121.970 116.638 84.615  1.00 59.65  ? 406  PHE A CA    1 
ATOM   413   C  C     . PHE A 1  406 ? 122.797 116.983 83.385  1.00 59.65  ? 406  PHE A C     1 
ATOM   414   O  O     . PHE A 1  406 ? 123.330 118.095 83.315  1.00 59.65  ? 406  PHE A O     1 
ATOM   415   C  CB    . PHE A 1  406 ? 122.781 116.912 85.884  1.00 59.65  ? 406  PHE A CB    1 
ATOM   416   C  CG    . PHE A 1  406 ? 121.945 116.983 87.128  1.00 59.65  ? 406  PHE A CG    1 
ATOM   417   C  CD1   . PHE A 1  406 ? 121.298 118.156 87.474  1.00 59.65  ? 406  PHE A CD1   1 
ATOM   418   C  CD2   . PHE A 1  406 ? 121.790 115.877 87.938  1.00 59.65  ? 406  PHE A CD2   1 
ATOM   419   C  CE1   . PHE A 1  406 ? 120.526 118.229 88.617  1.00 59.65  ? 406  PHE A CE1   1 
ATOM   420   C  CE2   . PHE A 1  406 ? 121.022 115.942 89.084  1.00 59.65  ? 406  PHE A CE2   1 
ATOM   421   C  CZ    . PHE A 1  406 ? 120.387 117.120 89.423  1.00 59.65  ? 406  PHE A CZ    1 
ATOM   422   N  N     . GLU A 1  407 ? 122.914 116.079 82.408  1.00 68.96  ? 407  GLU A N     1 
ATOM   423   C  CA    . GLU A 1  407 ? 123.545 116.464 81.148  1.00 68.96  ? 407  GLU A CA    1 
ATOM   424   C  C     . GLU A 1  407 ? 122.650 117.363 80.313  1.00 68.96  ? 407  GLU A C     1 
ATOM   425   O  O     . GLU A 1  407 ? 123.156 118.147 79.506  1.00 68.96  ? 407  GLU A O     1 
ATOM   426   C  CB    . GLU A 1  407 ? 123.933 115.234 80.327  1.00 68.96  ? 407  GLU A CB    1 
ATOM   427   C  CG    . GLU A 1  407 ? 125.295 114.645 80.643  1.00 68.96  ? 407  GLU A CG    1 
ATOM   428   C  CD    . GLU A 1  407 ? 126.432 115.540 80.157  1.00 68.96  ? 407  GLU A CD    1 
ATOM   429   O  OE1   . GLU A 1  407 ? 126.237 116.274 79.163  1.00 68.96  ? 407  GLU A OE1   1 
ATOM   430   O  OE2   . GLU A 1  407 ? 127.528 115.497 80.752  1.00 68.96  ? 407  GLU A OE2   1 
ATOM   431   N  N     . ASN A 1  408 ? 121.334 117.283 80.496  1.00 59.26  ? 408  ASN A N     1 
ATOM   432   C  CA    . ASN A 1  408 ? 120.415 118.070 79.687  1.00 59.26  ? 408  ASN A CA    1 
ATOM   433   C  C     . ASN A 1  408 ? 120.266 119.506 80.168  1.00 59.26  ? 408  ASN A C     1 
ATOM   434   O  O     . ASN A 1  408 ? 119.700 120.325 79.437  1.00 59.26  ? 408  ASN A O     1 
ATOM   435   C  CB    . ASN A 1  408 ? 119.043 117.393 79.649  1.00 59.26  ? 408  ASN A CB    1 
ATOM   436   C  CG    . ASN A 1  408 ? 119.037 116.137 78.798  1.00 59.26  ? 408  ASN A CG    1 
ATOM   437   O  OD1   . ASN A 1  408 ? 119.611 116.111 77.710  1.00 59.26  ? 408  ASN A OD1   1 
ATOM   438   N  ND2   . ASN A 1  408 ? 118.391 115.088 79.290  1.00 59.26  ? 408  ASN A ND2   1 
ATOM   439   N  N     . LYS A 1  409 ? 120.759 119.835 81.363  1.00 48.70  ? 409  LYS A N     1 
ATOM   440   C  CA    . LYS A 1  409 ? 120.586 121.186 81.887  1.00 48.70  ? 409  LYS A CA    1 
ATOM   441   C  C     . LYS A 1  409 ? 121.524 122.197 81.250  1.00 48.70  ? 409  LYS A C     1 
ATOM   442   O  O     . LYS A 1  409 ? 121.180 123.379 81.159  1.00 48.70  ? 409  LYS A O     1 
ATOM   443   C  CB    . LYS A 1  409 ? 120.786 121.211 83.400  1.00 48.70  ? 409  LYS A CB    1 
ATOM   444   C  CG    . LYS A 1  409 ? 119.600 120.731 84.191  1.00 48.70  ? 409  LYS A CG    1 
ATOM   445   C  CD    . LYS A 1  409 ? 119.849 120.933 85.667  1.00 48.70  ? 409  LYS A CD    1 
ATOM   446   C  CE    . LYS A 1  409 ? 118.640 120.549 86.484  1.00 48.70  ? 409  LYS A CE    1 
ATOM   447   N  NZ    . LYS A 1  409 ? 117.526 121.514 86.268  1.00 48.70  ? 409  LYS A NZ    1 
ATOM   448   N  N     . LEU A 1  410 ? 122.711 121.776 80.828  1.00 38.39  ? 410  LEU A N     1 
ATOM   449   C  CA    . LEU A 1  410 ? 123.701 122.703 80.304  1.00 38.39  ? 410  LEU A CA    1 
ATOM   450   C  C     . LEU A 1  410 ? 123.816 122.624 78.787  1.00 38.39  ? 410  LEU A C     1 
ATOM   451   O  O     . LEU A 1  410 ? 124.872 122.920 78.228  1.00 38.39  ? 410  LEU A O     1 
ATOM   452   C  CB    . LEU A 1  410 ? 125.046 122.450 80.980  1.00 38.39  ? 410  LEU A CB    1 
ATOM   453   C  CG    . LEU A 1  410 ? 125.004 122.703 82.492  1.00 38.39  ? 410  LEU A CG    1 
ATOM   454   C  CD1   . LEU A 1  410 ? 126.294 122.290 83.146  1.00 38.39  ? 410  LEU A CD1   1 
ATOM   455   C  CD2   . LEU A 1  410 ? 124.697 124.153 82.818  1.00 38.39  ? 410  LEU A CD2   1 
ATOM   456   N  N     . LYS A 1  411 ? 122.735 122.243 78.111  1.00 43.94  ? 411  LYS A N     1 
ATOM   457   C  CA    . LYS A 1  411 ? 122.688 122.152 76.658  1.00 43.94  ? 411  LYS A CA    1 
ATOM   458   C  C     . LYS A 1  411 ? 121.965 123.363 76.085  1.00 43.94  ? 411  LYS A C     1 
ATOM   459   O  O     . LYS A 1  411 ? 120.871 123.705 76.544  1.00 43.94  ? 411  LYS A O     1 
ATOM   460   C  CB    . LYS A 1  411 ? 121.952 120.886 76.216  1.00 43.94  ? 411  LYS A CB    1 
ATOM   461   C  CG    . LYS A 1  411 ? 122.528 119.550 76.655  1.00 43.94  ? 411  LYS A CG    1 
ATOM   462   C  CD    . LYS A 1  411 ? 123.723 119.095 75.831  1.00 43.94  ? 411  LYS A CD    1 
ATOM   463   C  CE    . LYS A 1  411 ? 125.041 119.346 76.532  1.00 43.94  ? 411  LYS A CE    1 
ATOM   464   N  NZ    . LYS A 1  411 ? 126.168 118.757 75.769  1.00 43.94  ? 411  LYS A NZ    1 
ATOM   465   N  N     . THR A 1  412 ? 122.564 123.995 75.075  1.00 48.63  ? 412  THR A N     1 
ATOM   466   C  CA    . THR A 1  412 ? 121.878 124.987 74.255  1.00 48.63  ? 412  THR A CA    1 
ATOM   467   C  C     . THR A 1  412 ? 122.219 124.789 72.788  1.00 48.63  ? 412  THR A C     1 
ATOM   468   O  O     . THR A 1  412 ? 123.323 124.369 72.436  1.00 48.63  ? 412  THR A O     1 
ATOM   469   C  CB    . THR A 1  412 ? 122.199 126.433 74.641  1.00 48.63  ? 412  THR A CB    1 
ATOM   470   O  OG1   . THR A 1  412 ? 123.609 126.589 74.861  1.00 48.63  ? 412  THR A OG1   1 
ATOM   471   C  CG2   . THR A 1  412 ? 121.381 126.871 75.831  1.00 48.63  ? 412  THR A CG2   1 
ATOM   472   N  N     . THR A 1  413 ? 121.263 125.153 71.940  1.00 60.08  ? 413  THR A N     1 
ATOM   473   C  CA    . THR A 1  413 ? 121.242 124.774 70.537  1.00 60.08  ? 413  THR A CA    1 
ATOM   474   C  C     . THR A 1  413 ? 121.984 125.739 69.625  1.00 60.08  ? 413  THR A C     1 
ATOM   475   O  O     . THR A 1  413 ? 122.084 125.472 68.423  1.00 60.08  ? 413  THR A O     1 
ATOM   476   C  CB    . THR A 1  413 ? 119.792 124.650 70.064  1.00 60.08  ? 413  THR A CB    1 
ATOM   477   O  OG1   . THR A 1  413 ? 119.140 125.918 70.199  1.00 60.08  ? 413  THR A OG1   1 
ATOM   478   C  CG2   . THR A 1  413 ? 119.051 123.620 70.900  1.00 60.08  ? 413  THR A CG2   1 
ATOM   479   N  N     . GLN A 1  414 ? 122.500 126.848 70.143  1.00 62.17  ? 414  GLN A N     1 
ATOM   480   C  CA    . GLN A 1  414 ? 123.183 127.815 69.297  1.00 62.17  ? 414  GLN A CA    1 
ATOM   481   C  C     . GLN A 1  414 ? 124.657 127.448 69.194  1.00 62.17  ? 414  GLN A C     1 
ATOM   482   O  O     . GLN A 1  414 ? 125.313 127.185 70.206  1.00 62.17  ? 414  GLN A O     1 
ATOM   483   C  CB    . GLN A 1  414 ? 123.024 129.238 69.838  1.00 62.17  ? 414  GLN A CB    1 
ATOM   484   C  CG    . GLN A 1  414 ? 123.391 130.332 68.831  1.00 62.17  ? 414  GLN A CG    1 
ATOM   485   C  CD    . GLN A 1  414 ? 124.863 130.713 68.850  1.00 62.17  ? 414  GLN A CD    1 
ATOM   486   O  OE1   . GLN A 1  414 ? 125.522 130.642 69.886  1.00 62.17  ? 414  GLN A OE1   1 
ATOM   487   N  NE2   . GLN A 1  414 ? 125.386 131.107 67.696  1.00 62.17  ? 414  GLN A NE2   1 
ATOM   488   N  N     . LYS A 1  415 ? 125.167 127.437 67.967  1.00 61.47  ? 415  LYS A N     1 
ATOM   489   C  CA    . LYS A 1  415 ? 126.587 127.225 67.712  1.00 61.47  ? 415  LYS A CA    1 
ATOM   490   C  C     . LYS A 1  415 ? 126.898 127.863 66.371  1.00 61.47  ? 415  LYS A C     1 
ATOM   491   O  O     . LYS A 1  415 ? 126.281 127.505 65.362  1.00 61.47  ? 415  LYS A O     1 
ATOM   492   C  CB    . LYS A 1  415 ? 126.929 125.729 67.721  1.00 61.47  ? 415  LYS A CB    1 
ATOM   493   C  CG    . LYS A 1  415 ? 128.414 125.391 67.610  1.00 61.47  ? 415  LYS A CG    1 
ATOM   494   C  CD    . LYS A 1  415 ? 128.794 124.976 66.194  1.00 61.47  ? 415  LYS A CD    1 
ATOM   495   C  CE    . LYS A 1  415 ? 130.230 124.512 66.119  1.00 61.47  ? 415  LYS A CE    1 
ATOM   496   N  NZ    . LYS A 1  415 ? 131.151 125.640 66.377  1.00 61.47  ? 415  LYS A NZ    1 
ATOM   497   N  N     . HIS A 1  416 ? 127.837 128.810 66.354  1.00 66.46  ? 416  HIS A N     1 
ATOM   498   C  CA    . HIS A 1  416 ? 128.192 129.531 65.132  1.00 66.46  ? 416  HIS A CA    1 
ATOM   499   C  C     . HIS A 1  416 ? 129.701 129.437 64.928  1.00 66.46  ? 416  HIS A C     1 
ATOM   500   O  O     . HIS A 1  416 ? 130.419 130.374 65.288  1.00 66.46  ? 416  HIS A O     1 
ATOM   501   C  CB    . HIS A 1  416 ? 127.717 130.985 65.212  1.00 66.46  ? 416  HIS A CB    1 
ATOM   502   C  CG    . HIS A 1  416 ? 127.984 131.782 63.973  1.00 66.46  ? 416  HIS A CG    1 
ATOM   503   N  ND1   . HIS A 1  416 ? 127.237 131.645 62.823  1.00 66.46  ? 416  HIS A ND1   1 
ATOM   504   C  CD2   . HIS A 1  416 ? 128.919 132.724 63.705  1.00 66.46  ? 416  HIS A CD2   1 
ATOM   505   C  CE1   . HIS A 1  416 ? 127.697 132.471 61.901  1.00 66.46  ? 416  HIS A CE1   1 
ATOM   506   N  NE2   . HIS A 1  416 ? 128.718 133.137 62.410  1.00 66.46  ? 416  HIS A NE2   1 
ATOM   507   N  N     . GLN A 1  417 ? 130.136 128.302 64.366  1.00 63.13  ? 417  GLN A N     1 
ATOM   508   C  CA    . GLN A 1  417 ? 131.418 128.087 63.672  1.00 63.13  ? 417  GLN A CA    1 
ATOM   509   C  C     . GLN A 1  417 ? 132.626 128.641 64.430  1.00 63.13  ? 417  GLN A C     1 
ATOM   510   O  O     . GLN A 1  417 ? 133.286 129.583 63.987  1.00 63.13  ? 417  GLN A O     1 
ATOM   511   C  CB    . GLN A 1  417 ? 131.367 128.667 62.255  1.00 63.13  ? 417  GLN A CB    1 
ATOM   512   C  CG    . GLN A 1  417 ? 130.595 127.829 61.237  1.00 63.13  ? 417  GLN A CG    1 
ATOM   513   C  CD    . GLN A 1  417 ? 129.091 127.898 61.418  1.00 63.13  ? 417  GLN A CD    1 
ATOM   514   O  OE1   . GLN A 1  417 ? 128.436 126.886 61.667  1.00 63.13  ? 417  GLN A OE1   1 
ATOM   515   N  NE2   . GLN A 1  417 ? 128.535 129.097 61.292  1.00 63.13  ? 417  GLN A NE2   1 
ATOM   516   N  N     . ILE A 1  418 ? 132.894 128.062 65.602  1.00 56.04  ? 418  ILE A N     1 
ATOM   517   C  CA    . ILE A 1  418 ? 134.017 128.535 66.401  1.00 56.04  ? 418  ILE A CA    1 
ATOM   518   C  C     . ILE A 1  418 ? 135.322 128.121 65.734  1.00 56.04  ? 418  ILE A C     1 
ATOM   519   O  O     . ILE A 1  418 ? 135.449 127.016 65.187  1.00 56.04  ? 418  ILE A O     1 
ATOM   520   C  CB    . ILE A 1  418 ? 133.917 128.044 67.859  1.00 56.04  ? 418  ILE A CB    1 
ATOM   521   C  CG1   . ILE A 1  418 ? 133.966 126.519 67.972  1.00 56.04  ? 418  ILE A CG1   1 
ATOM   522   C  CG2   . ILE A 1  418 ? 132.642 128.565 68.498  1.00 56.04  ? 418  ILE A CG2   1 
ATOM   523   C  CD1   . ILE A 1  418 ? 134.098 126.020 69.394  1.00 56.04  ? 418  ILE A CD1   1 
ATOM   524   N  N     . VAL A 1  419 ? 136.276 129.039 65.709  1.00 54.71  ? 419  VAL A N     1 
ATOM   525   C  CA    . VAL A 1  419 ? 137.504 128.823 64.959  1.00 54.71  ? 419  VAL A CA    1 
ATOM   526   C  C     . VAL A 1  419 ? 138.461 127.981 65.798  1.00 54.71  ? 419  VAL A C     1 
ATOM   527   O  O     . VAL A 1  419 ? 138.652 128.224 66.995  1.00 54.71  ? 419  VAL A O     1 
ATOM   528   C  CB    . VAL A 1  419 ? 138.111 130.167 64.508  1.00 54.71  ? 419  VAL A CB    1 
ATOM   529   C  CG1   . VAL A 1  419 ? 138.357 131.124 65.676  1.00 54.71  ? 419  VAL A CG1   1 
ATOM   530   C  CG2   . VAL A 1  419 ? 139.385 129.948 63.714  1.00 54.71  ? 419  VAL A CG2   1 
ATOM   531   N  N     . GLU A 1  420 ? 139.005 126.938 65.183  1.00 59.38  ? 420  GLU A N     1 
ATOM   532   C  CA    . GLU A 1  420 ? 139.891 125.981 65.838  1.00 59.38  ? 420  GLU A CA    1 
ATOM   533   C  C     . GLU A 1  420 ? 141.232 126.075 65.123  1.00 59.38  ? 420  GLU A C     1 
ATOM   534   O  O     . GLU A 1  420 ? 141.465 125.398 64.120  1.00 59.38  ? 420  GLU A O     1 
ATOM   535   C  CB    . GLU A 1  420 ? 139.300 124.569 65.776  1.00 59.38  ? 420  GLU A CB    1 
ATOM   536   C  CG    . GLU A 1  420 ? 140.116 123.482 66.462  1.00 59.38  ? 420  GLU A CG    1 
ATOM   537   C  CD    . GLU A 1  420 ? 140.135 123.604 67.973  1.00 59.38  ? 420  GLU A CD    1 
ATOM   538   O  OE1   . GLU A 1  420 ? 139.190 124.189 68.544  1.00 59.38  ? 420  GLU A OE1   1 
ATOM   539   O  OE2   . GLU A 1  420 ? 141.092 123.093 68.591  1.00 59.38  ? 420  GLU A OE2   1 
ATOM   540   N  N     . THR A 1  421 ? 142.117 126.918 65.639  1.00 53.23  ? 421  THR A N     1 
ATOM   541   C  CA    . THR A 1  421 ? 143.376 127.198 64.965  1.00 53.23  ? 421  THR A CA    1 
ATOM   542   C  C     . THR A 1  421 ? 144.396 126.100 65.258  1.00 53.23  ? 421  THR A C     1 
ATOM   543   O  O     . THR A 1  421 ? 144.075 125.035 65.791  1.00 53.23  ? 421  THR A O     1 
ATOM   544   C  CB    . THR A 1  421 ? 143.894 128.578 65.358  1.00 53.23  ? 421  THR A CB    1 
ATOM   545   O  OG1   . THR A 1  421 ? 145.100 128.857 64.638  1.00 53.23  ? 421  THR A OG1   1 
ATOM   546   C  CG2   . THR A 1  421 ? 144.167 128.646 66.843  1.00 53.23  ? 421  THR A CG2   1 
ATOM   547   N  N     . ILE A 1  422 ? 145.648 126.362 64.879  1.00 53.52  ? 422  ILE A N     1 
ATOM   548   C  CA    . ILE A 1  422 ? 146.729 125.396 65.033  1.00 53.52  ? 422  ILE A CA    1 
ATOM   549   C  C     . ILE A 1  422 ? 147.039 125.166 66.504  1.00 53.52  ? 422  ILE A C     1 
ATOM   550   O  O     . ILE A 1  422 ? 147.206 124.025 66.951  1.00 53.52  ? 422  ILE A O     1 
ATOM   551   C  CB    . ILE A 1  422 ? 147.967 125.901 64.275  1.00 53.52  ? 422  ILE A CB    1 
ATOM   552   C  CG1   . ILE A 1  422 ? 147.629 126.124 62.806  1.00 53.52  ? 422  ILE A CG1   1 
ATOM   553   C  CG2   . ILE A 1  422 ? 149.118 124.933 64.408  1.00 53.52  ? 422  ILE A CG2   1 
ATOM   554   C  CD1   . ILE A 1  422 ? 148.650 126.962 62.095  1.00 53.52  ? 422  ILE A CD1   1 
ATOM   555   N  N     . PHE A 1  423 ? 147.098 126.243 67.283  1.00 48.18  ? 423  PHE A N     1 
ATOM   556   C  CA    . PHE A 1  423 ? 147.498 126.145 68.677  1.00 48.18  ? 423  PHE A CA    1 
ATOM   557   C  C     . PHE A 1  423 ? 146.349 125.755 69.591  1.00 48.18  ? 423  PHE A C     1 
ATOM   558   O  O     . PHE A 1  423 ? 146.594 125.372 70.739  1.00 48.18  ? 423  PHE A O     1 
ATOM   559   C  CB    . PHE A 1  423 ? 148.103 127.472 69.126  1.00 48.18  ? 423  PHE A CB    1 
ATOM   560   C  CG    . PHE A 1  423 ? 149.357 127.833 68.392  1.00 48.18  ? 423  PHE A CG    1 
ATOM   561   C  CD1   . PHE A 1  423 ? 150.577 127.300 68.774  1.00 48.18  ? 423  PHE A CD1   1 
ATOM   562   C  CD2   . PHE A 1  423 ? 149.313 128.687 67.301  1.00 48.18  ? 423  PHE A CD2   1 
ATOM   563   C  CE1   . PHE A 1  423 ? 151.730 127.624 68.095  1.00 48.18  ? 423  PHE A CE1   1 
ATOM   564   C  CE2   . PHE A 1  423 ? 150.463 129.014 66.616  1.00 48.18  ? 423  PHE A CE2   1 
ATOM   565   C  CZ    . PHE A 1  423 ? 151.673 128.482 67.015  1.00 48.18  ? 423  PHE A CZ    1 
ATOM   566   N  N     . SER A 1  424 ? 145.106 125.846 69.114  1.00 50.08  ? 424  SER A N     1 
ATOM   567   C  CA    . SER A 1  424 ? 143.981 125.383 69.915  1.00 50.08  ? 424  SER A CA    1 
ATOM   568   C  C     . SER A 1  424 ? 143.953 123.867 70.009  1.00 50.08  ? 424  SER A C     1 
ATOM   569   O  O     . SER A 1  424 ? 143.470 123.318 71.003  1.00 50.08  ? 424  SER A O     1 
ATOM   570   C  CB    . SER A 1  424 ? 142.666 125.902 69.337  1.00 50.08  ? 424  SER A CB    1 
ATOM   571   O  OG    . SER A 1  424 ? 142.573 127.309 69.454  1.00 50.08  ? 424  SER A OG    1 
ATOM   572   N  N     . LYS A 1  425 ? 144.472 123.177 68.995  1.00 51.78  ? 425  LYS A N     1 
ATOM   573   C  CA    . LYS A 1  425 ? 144.495 121.721 69.026  1.00 51.78  ? 425  LYS A CA    1 
ATOM   574   C  C     . LYS A 1  425 ? 145.561 121.202 69.980  1.00 51.78  ? 425  LYS A C     1 
ATOM   575   O  O     . LYS A 1  425 ? 145.420 120.103 70.528  1.00 51.78  ? 425  LYS A O     1 
ATOM   576   C  CB    . LYS A 1  425 ? 144.737 121.187 67.618  1.00 51.78  ? 425  LYS A CB    1 
ATOM   577   C  CG    . LYS A 1  425 ? 143.674 121.597 66.625  1.00 51.78  ? 425  LYS A CG    1 
ATOM   578   C  CD    . LYS A 1  425 ? 143.965 121.046 65.248  1.00 51.78  ? 425  LYS A CD    1 
ATOM   579   C  CE    . LYS A 1  425 ? 142.988 121.599 64.233  1.00 51.78  ? 425  LYS A CE    1 
ATOM   580   N  NZ    . LYS A 1  425 ? 141.603 121.118 64.473  1.00 51.78  ? 425  LYS A NZ    1 
ATOM   581   N  N     . VAL A 1  426 ? 146.628 121.973 70.186  1.00 44.43  ? 426  VAL A N     1 
ATOM   582   C  CA    . VAL A 1  426 ? 147.695 121.564 71.091  1.00 44.43  ? 426  VAL A CA    1 
ATOM   583   C  C     . VAL A 1  426 ? 147.276 121.770 72.539  1.00 44.43  ? 426  VAL A C     1 
ATOM   584   O  O     . VAL A 1  426 ? 147.583 120.948 73.410  1.00 44.43  ? 426  VAL A O     1 
ATOM   585   C  CB    . VAL A 1  426 ? 148.981 122.336 70.747  1.00 44.43  ? 426  VAL A CB    1 
ATOM   586   C  CG1   . VAL A 1  426 ? 150.125 121.958 71.669  1.00 44.43  ? 426  VAL A CG1   1 
ATOM   587   C  CG2   . VAL A 1  426 ? 149.355 122.084 69.320  1.00 44.43  ? 426  VAL A CG2   1 
ATOM   588   N  N     . LYS A 1  427 ? 146.547 122.854 72.816  1.00 42.41  ? 427  LYS A N     1 
ATOM   589   C  CA    . LYS A 1  427 ? 146.087 123.105 74.176  1.00 42.41  ? 427  LYS A CA    1 
ATOM   590   C  C     . LYS A 1  427 ? 144.987 122.140 74.586  1.00 42.41  ? 427  LYS A C     1 
ATOM   591   O  O     . LYS A 1  427 ? 144.840 121.846 75.777  1.00 42.41  ? 427  LYS A O     1 
ATOM   592   C  CB    . LYS A 1  427 ? 145.586 124.537 74.310  1.00 42.41  ? 427  LYS A CB    1 
ATOM   593   C  CG    . LYS A 1  427 ? 146.647 125.582 74.099  1.00 42.41  ? 427  LYS A CG    1 
ATOM   594   C  CD    . LYS A 1  427 ? 146.119 126.953 74.442  1.00 42.41  ? 427  LYS A CD    1 
ATOM   595   C  CE    . LYS A 1  427 ? 145.595 127.672 73.222  1.00 42.41  ? 427  LYS A CE    1 
ATOM   596   N  NZ    . LYS A 1  427 ? 144.245 127.223 72.785  1.00 42.41  ? 427  LYS A NZ    1 
ATOM   597   N  N     . LYS A 1  428 ? 144.200 121.649 73.623  1.00 42.93  ? 428  LYS A N     1 
ATOM   598   C  CA    . LYS A 1  428 ? 143.204 120.629 73.930  1.00 42.93  ? 428  LYS A CA    1 
ATOM   599   C  C     . LYS A 1  428 ? 143.852 119.312 74.318  1.00 42.93  ? 428  LYS A C     1 
ATOM   600   O  O     . LYS A 1  428 ? 143.263 118.531 75.072  1.00 42.93  ? 428  LYS A O     1 
ATOM   601   C  CB    . LYS A 1  428 ? 142.273 120.404 72.741  1.00 42.93  ? 428  LYS A CB    1 
ATOM   602   C  CG    . LYS A 1  428 ? 141.226 121.470 72.545  1.00 42.93  ? 428  LYS A CG    1 
ATOM   603   C  CD    . LYS A 1  428 ? 140.403 121.176 71.306  1.00 42.93  ? 428  LYS A CD    1 
ATOM   604   C  CE    . LYS A 1  428 ? 139.565 119.924 71.495  1.00 42.93  ? 428  LYS A CE    1 
ATOM   605   N  NZ    . LYS A 1  428 ? 138.514 120.104 72.533  1.00 42.93  ? 428  LYS A NZ    1 
ATOM   606   N  N     . GLN A 1  429 ? 145.054 119.051 73.821  1.00 43.49  ? 429  GLN A N     1 
ATOM   607   C  CA    . GLN A 1  429 ? 145.687 117.761 74.015  1.00 43.49  ? 429  GLN A CA    1 
ATOM   608   C  C     . GLN A 1  429 ? 146.634 117.760 75.209  1.00 43.49  ? 429  GLN A C     1 
ATOM   609   O  O     . GLN A 1  429 ? 147.054 116.687 75.650  1.00 43.49  ? 429  GLN A O     1 
ATOM   610   C  CB    . GLN A 1  429 ? 146.422 117.371 72.728  1.00 43.49  ? 429  GLN A CB    1 
ATOM   611   C  CG    . GLN A 1  429 ? 146.664 115.890 72.536  1.00 43.49  ? 429  GLN A CG    1 
ATOM   612   C  CD    . GLN A 1  429 ? 147.391 115.599 71.244  1.00 43.49  ? 429  GLN A CD    1 
ATOM   613   O  OE1   . GLN A 1  429 ? 147.817 116.516 70.551  1.00 43.49  ? 429  GLN A OE1   1 
ATOM   614   N  NE2   . GLN A 1  429 ? 147.527 114.321 70.909  1.00 43.49  ? 429  GLN A NE2   1 
ATOM   615   N  N     . LEU A 1  430 ? 146.954 118.931 75.757  1.00 37.57  ? 430  LEU A N     1 
ATOM   616   C  CA    . LEU A 1  430 ? 147.762 119.048 76.963  1.00 37.57  ? 430  LEU A CA    1 
ATOM   617   C  C     . LEU A 1  430 ? 146.921 119.223 78.219  1.00 37.57  ? 430  LEU A C     1 
ATOM   618   O  O     . LEU A 1  430 ? 147.469 119.539 79.278  1.00 37.57  ? 430  LEU A O     1 
ATOM   619   C  CB    . LEU A 1  430 ? 148.740 120.214 76.832  1.00 37.57  ? 430  LEU A CB    1 
ATOM   620   C  CG    . LEU A 1  430 ? 149.875 120.031 75.831  1.00 37.57  ? 430  LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1  430 ? 150.632 121.327 75.655  1.00 37.57  ? 430  LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1  430 ? 150.802 118.939 76.316  1.00 37.57  ? 430  LEU A CD2   1 
ATOM   623   N  N     . ASN A 1  431 ? 145.608 119.039 78.125  1.00 45.95  ? 431  ASN A N     1 
ATOM   624   C  CA    . ASN A 1  431 ? 144.769 119.075 79.311  1.00 45.95  ? 431  ASN A CA    1 
ATOM   625   C  C     . ASN A 1  431 ? 144.980 117.824 80.148  1.00 45.95  ? 431  ASN A C     1 
ATOM   626   O  O     . ASN A 1  431 ? 145.322 116.757 79.635  1.00 45.95  ? 431  ASN A O     1 
ATOM   627   C  CB    . ASN A 1  431 ? 143.294 119.196 78.937  1.00 45.95  ? 431  ASN A CB    1 
ATOM   628   C  CG    . ASN A 1  431 ? 142.960 120.531 78.322  1.00 45.95  ? 431  ASN A CG    1 
ATOM   629   O  OD1   . ASN A 1  431 ? 142.559 120.609 77.167  1.00 45.95  ? 431  ASN A OD1   1 
ATOM   630   N  ND2   . ASN A 1  431 ? 143.124 121.595 79.096  1.00 45.95  ? 431  ASN A ND2   1 
ATOM   631   N  N     . SER A 1  432 ? 144.757 117.965 81.453  1.00 50.50  ? 432  SER A N     1 
ATOM   632   C  CA    . SER A 1  432 ? 144.964 116.853 82.370  1.00 50.50  ? 432  SER A CA    1 
ATOM   633   C  C     . SER A 1  432 ? 143.903 115.771 82.227  1.00 50.50  ? 432  SER A C     1 
ATOM   634   O  O     . SER A 1  432 ? 144.141 114.632 82.641  1.00 50.50  ? 432  SER A O     1 
ATOM   635   C  CB    . SER A 1  432 ? 144.996 117.366 83.807  1.00 50.50  ? 432  SER A CB    1 
ATOM   636   O  OG    . SER A 1  432 ? 146.082 118.255 84.001  1.00 50.50  ? 432  SER A OG    1 
ATOM   637   N  N     . SER A 1  433 ? 142.745 116.091 81.649  1.00 62.33  ? 433  SER A N     1 
ATOM   638   C  CA    . SER A 1  433 ? 141.697 115.095 81.475  1.00 62.33  ? 433  SER A CA    1 
ATOM   639   C  C     . SER A 1  433 ? 141.906 114.229 80.242  1.00 62.33  ? 433  SER A C     1 
ATOM   640   O  O     . SER A 1  433 ? 141.272 113.174 80.132  1.00 62.33  ? 433  SER A O     1 
ATOM   641   C  CB    . SER A 1  433 ? 140.328 115.774 81.386  1.00 62.33  ? 433  SER A CB    1 
ATOM   642   O  OG    . SER A 1  433 ? 140.217 116.543 80.201  1.00 62.33  ? 433  SER A OG    1 
ATOM   643   N  N     . TYR A 1  434 ? 142.771 114.638 79.323  1.00 77.23  ? 434  TYR A N     1 
ATOM   644   C  CA    . TYR A 1  434 ? 142.950 113.907 78.076  1.00 77.23  ? 434  TYR A CA    1 
ATOM   645   C  C     . TYR A 1  434 ? 143.803 112.660 78.286  1.00 77.23  ? 434  TYR A C     1 
ATOM   646   O  O     . TYR A 1  434 ? 143.425 111.562 77.878  1.00 77.23  ? 434  TYR A O     1 
ATOM   647   C  CB    . TYR A 1  434 ? 143.585 114.804 77.018  1.00 77.23  ? 434  TYR A CB    1 
ATOM   648   C  CG    . TYR A 1  434 ? 143.649 114.173 75.650  1.00 77.23  ? 434  TYR A CG    1 
ATOM   649   C  CD1   . TYR A 1  434 ? 142.511 114.088 74.856  1.00 77.23  ? 434  TYR A CD1   1 
ATOM   650   C  CD2   . TYR A 1  434 ? 144.842 113.662 75.149  1.00 77.23  ? 434  TYR A CD2   1 
ATOM   651   C  CE1   . TYR A 1  434 ? 142.557 113.513 73.602  1.00 77.23  ? 434  TYR A CE1   1 
ATOM   652   C  CE2   . TYR A 1  434 ? 144.897 113.083 73.897  1.00 77.23  ? 434  TYR A CE2   1 
ATOM   653   C  CZ    . TYR A 1  434 ? 143.752 113.014 73.127  1.00 77.23  ? 434  TYR A CZ    1 
ATOM   654   O  OH    . TYR A 1  434 ? 143.800 112.441 71.877  1.00 77.23  ? 434  TYR A OH    1 
ATOM   655   N  N     . TYR A 1  448 ? 147.346 103.433 79.534  1.00 77.56  ? 448  TYR A N     1 
ATOM   656   C  CA    . TYR A 1  448 ? 148.657 103.640 78.932  1.00 77.56  ? 448  TYR A CA    1 
ATOM   657   C  C     . TYR A 1  448 ? 149.350 104.873 79.503  1.00 77.56  ? 448  TYR A C     1 
ATOM   658   O  O     . TYR A 1  448 ? 149.037 106.005 79.137  1.00 77.56  ? 448  TYR A O     1 
ATOM   659   C  CB    . TYR A 1  448 ? 148.536 103.764 77.413  1.00 77.56  ? 448  TYR A CB    1 
ATOM   660   C  CG    . TYR A 1  448 ? 149.859 103.971 76.716  1.00 77.56  ? 448  TYR A CG    1 
ATOM   661   C  CD1   . TYR A 1  448 ? 150.774 102.932 76.602  1.00 77.56  ? 448  TYR A CD1   1 
ATOM   662   C  CD2   . TYR A 1  448 ? 150.188 105.200 76.160  1.00 77.56  ? 448  TYR A CD2   1 
ATOM   663   C  CE1   . TYR A 1  448 ? 151.987 103.116 75.962  1.00 77.56  ? 448  TYR A CE1   1 
ATOM   664   C  CE2   . TYR A 1  448 ? 151.395 105.392 75.517  1.00 77.56  ? 448  TYR A CE2   1 
ATOM   665   C  CZ    . TYR A 1  448 ? 152.290 104.348 75.421  1.00 77.56  ? 448  TYR A CZ    1 
ATOM   666   O  OH    . TYR A 1  448 ? 153.491 104.542 74.781  1.00 77.56  ? 448  TYR A OH    1 
ATOM   667   N  N     . LEU A 1  449 ? 150.305 104.636 80.404  1.00 58.46  ? 449  LEU A N     1 
ATOM   668   C  CA    . LEU A 1  449 ? 151.052 105.695 81.053  1.00 58.46  ? 449  LEU A CA    1 
ATOM   669   C  C     . LEU A 1  449 ? 152.489 105.230 81.273  1.00 58.46  ? 449  LEU A C     1 
ATOM   670   O  O     . LEU A 1  449 ? 152.710 104.114 81.779  1.00 58.46  ? 449  LEU A O     1 
ATOM   671   C  CB    . LEU A 1  449 ? 150.364 106.110 82.360  1.00 58.46  ? 449  LEU A CB    1 
ATOM   672   C  CG    . LEU A 1  449 ? 149.915 105.079 83.400  1.00 58.46  ? 449  LEU A CG    1 
ATOM   673   C  CD1   . LEU A 1  449 ? 150.954 104.832 84.447  1.00 58.46  ? 449  LEU A CD1   1 
ATOM   674   C  CD2   . LEU A 1  449 ? 148.615 105.520 84.044  1.00 58.46  ? 449  LEU A CD2   1 
ATOM   675   N  N     . PRO A 1  450 ? 153.479 106.027 80.866  1.00 52.37  ? 450  PRO A N     1 
ATOM   676   C  CA    . PRO A 1  450 ? 154.834 105.490 80.687  1.00 52.37  ? 450  PRO A CA    1 
ATOM   677   C  C     . PRO A 1  450 ? 155.685 105.369 81.944  1.00 52.37  ? 450  PRO A C     1 
ATOM   678   O  O     . PRO A 1  450 ? 156.444 104.405 82.078  1.00 52.37  ? 450  PRO A O     1 
ATOM   679   C  CB    . PRO A 1  450 ? 155.461 106.485 79.703  1.00 52.37  ? 450  PRO A CB    1 
ATOM   680   C  CG    . PRO A 1  450 ? 154.757 107.772 79.981  1.00 52.37  ? 450  PRO A CG    1 
ATOM   681   C  CD    . PRO A 1  450 ? 153.355 107.410 80.372  1.00 52.37  ? 450  PRO A CD    1 
ATOM   682   N  N     . ALA A 1  451 ? 155.584 106.318 82.869  1.00 45.81  ? 451  ALA A N     1 
ATOM   683   C  CA    . ALA A 1  451 ? 156.590 106.460 83.911  1.00 45.81  ? 451  ALA A CA    1 
ATOM   684   C  C     . ALA A 1  451 ? 156.168 105.878 85.250  1.00 45.81  ? 451  ALA A C     1 
ATOM   685   O  O     . ALA A 1  451 ? 156.920 105.995 86.222  1.00 45.81  ? 451  ALA A O     1 
ATOM   686   C  CB    . ALA A 1  451 ? 156.964 107.932 84.079  1.00 45.81  ? 451  ALA A CB    1 
ATOM   687   N  N     . ARG A 1  452 ? 154.992 105.266 85.331  1.00 43.45  ? 452  ARG A N     1 
ATOM   688   C  CA    . ARG A 1  452 ? 154.574 104.502 86.503  1.00 43.45  ? 452  ARG A CA    1 
ATOM   689   C  C     . ARG A 1  452 ? 154.243 103.099 86.018  1.00 43.45  ? 452  ARG A C     1 
ATOM   690   O  O     . ARG A 1  452 ? 153.080 102.751 85.819  1.00 43.45  ? 452  ARG A O     1 
ATOM   691   C  CB    . ARG A 1  452 ? 153.393 105.148 87.185  1.00 43.45  ? 452  ARG A CB    1 
ATOM   692   C  CG    . ARG A 1  452 ? 153.679 106.480 87.827  1.00 43.45  ? 452  ARG A CG    1 
ATOM   693   C  CD    . ARG A 1  452 ? 154.454 106.295 89.107  1.00 43.45  ? 452  ARG A CD    1 
ATOM   694   N  NE    . ARG A 1  452 ? 154.616 107.551 89.821  1.00 43.45  ? 452  ARG A NE    1 
ATOM   695   C  CZ    . ARG A 1  452 ? 155.685 108.330 89.726  1.00 43.45  ? 452  ARG A CZ    1 
ATOM   696   N  NH1   . ARG A 1  452 ? 155.743 109.460 90.413  1.00 43.45  ? 452  ARG A NH1   1 
ATOM   697   N  NH2   . ARG A 1  452 ? 156.703 107.969 88.960  1.00 43.45  ? 452  ARG A NH2   1 
ATOM   698   N  N     . GLU A 1  453 ? 155.275 102.279 85.855  1.00 53.24  ? 453  GLU A N     1 
ATOM   699   C  CA    . GLU A 1  453 ? 155.102 100.907 85.402  1.00 53.24  ? 453  GLU A CA    1 
ATOM   700   C  C     . GLU A 1  453 ? 155.285 99.910  86.530  1.00 53.24  ? 453  GLU A C     1 
ATOM   701   O  O     . GLU A 1  453 ? 154.515 98.953  86.637  1.00 53.24  ? 453  GLU A O     1 
ATOM   702   C  CB    . GLU A 1  453 ? 156.084 100.600 84.265  1.00 53.24  ? 453  GLU A CB    1 
ATOM   703   C  CG    . GLU A 1  453 ? 155.810 99.315  83.486  1.00 53.24  ? 453  GLU A CG    1 
ATOM   704   C  CD    . GLU A 1  453 ? 156.493 98.094  84.076  1.00 53.24  ? 453  GLU A CD    1 
ATOM   705   O  OE1   . GLU A 1  453 ? 157.550 98.256  84.721  1.00 53.24  ? 453  GLU A OE1   1 
ATOM   706   O  OE2   . GLU A 1  453 ? 155.973 96.974  83.895  1.00 53.24  ? 453  GLU A OE2   1 
ATOM   707   N  N     . ASN A 1  454 ? 156.293 100.118 87.372  1.00 47.46  ? 454  ASN A N     1 
ATOM   708   C  CA    . ASN A 1  454 ? 156.485 99.280  88.544  1.00 47.46  ? 454  ASN A CA    1 
ATOM   709   C  C     . ASN A 1  454 ? 155.452 99.564  89.619  1.00 47.46  ? 454  ASN A C     1 
ATOM   710   O  O     . ASN A 1  454 ? 155.195 98.698  90.461  1.00 47.46  ? 454  ASN A O     1 
ATOM   711   C  CB    . ASN A 1  454 ? 157.888 99.490  89.107  1.00 47.46  ? 454  ASN A CB    1 
ATOM   712   C  CG    . ASN A 1  454 ? 158.965 99.012  88.162  1.00 47.46  ? 454  ASN A CG    1 
ATOM   713   O  OD1   . ASN A 1  454 ? 158.836 97.960  87.539  1.00 47.46  ? 454  ASN A OD1   1 
ATOM   714   N  ND2   . ASN A 1  454 ? 160.032 99.791  88.041  1.00 47.46  ? 454  ASN A ND2   1 
ATOM   715   N  N     . GLU A 1  455 ? 154.860 100.755 89.603  1.00 42.19  ? 455  GLU A N     1 
ATOM   716   C  CA    . GLU A 1  455 ? 153.814 101.096 90.555  1.00 42.19  ? 455  GLU A CA    1 
ATOM   717   C  C     . GLU A 1  455 ? 152.448 100.623 90.084  1.00 42.19  ? 455  GLU A C     1 
ATOM   718   O  O     . GLU A 1  455 ? 151.589 100.304 90.912  1.00 42.19  ? 455  GLU A O     1 
ATOM   719   C  CB    . GLU A 1  455 ? 153.803 102.602 90.788  1.00 42.19  ? 455  GLU A CB    1 
ATOM   720   C  CG    . GLU A 1  455 ? 155.021 103.133 91.532  1.00 42.19  ? 455  GLU A CG    1 
ATOM   721   C  CD    . GLU A 1  455 ? 156.186 103.466 90.625  1.00 42.19  ? 455  GLU A CD    1 
ATOM   722   O  OE1   . GLU A 1  455 ? 156.055 103.298 89.396  1.00 42.19  ? 455  GLU A OE1   1 
ATOM   723   O  OE2   . GLU A 1  455 ? 157.231 103.913 91.144  1.00 42.19  ? 455  GLU A OE2   1 
ATOM   724   N  N     . PHE A 1  456 ? 152.228 100.590 88.769  1.00 36.49  ? 456  PHE A N     1 
ATOM   725   C  CA    . PHE A 1  456 ? 151.069 99.894  88.225  1.00 36.49  ? 456  PHE A CA    1 
ATOM   726   C  C     . PHE A 1  456 ? 151.142 98.410  88.548  1.00 36.49  ? 456  PHE A C     1 
ATOM   727   O  O     . PHE A 1  456 ? 150.165 97.815  89.010  1.00 36.49  ? 456  PHE A O     1 
ATOM   728   C  CB    . PHE A 1  456 ? 150.992 100.107 86.713  1.00 36.49  ? 456  PHE A CB    1 
ATOM   729   C  CG    . PHE A 1  456 ? 149.784 99.487  86.068  1.00 36.49  ? 456  PHE A CG    1 
ATOM   730   C  CD1   . PHE A 1  456 ? 148.565 100.135 86.093  1.00 36.49  ? 456  PHE A CD1   1 
ATOM   731   C  CD2   . PHE A 1  456 ? 149.868 98.253  85.438  1.00 36.49  ? 456  PHE A CD2   1 
ATOM   732   C  CE1   . PHE A 1  456 ? 147.454 99.572  85.498  1.00 36.49  ? 456  PHE A CE1   1 
ATOM   733   C  CE2   . PHE A 1  456 ? 148.759 97.682  84.853  1.00 36.49  ? 456  PHE A CE2   1 
ATOM   734   C  CZ    . PHE A 1  456 ? 147.552 98.342  84.882  1.00 36.49  ? 456  PHE A CZ    1 
ATOM   735   N  N     . ALA A 1  457 ? 152.313 97.802  88.339  1.00 36.95  ? 457  ALA A N     1 
ATOM   736   C  CA    . ALA A 1  457 ? 152.473 96.367  88.536  1.00 36.95  ? 457  ALA A CA    1 
ATOM   737   C  C     . ALA A 1  457 ? 152.479 95.964  90.004  1.00 36.95  ? 457  ALA A C     1 
ATOM   738   O  O     . ALA A 1  457 ? 152.375 94.773  90.298  1.00 36.95  ? 457  ALA A O     1 
ATOM   739   C  CB    . ALA A 1  457 ? 153.760 95.887  87.868  1.00 36.95  ? 457  ALA A CB    1 
ATOM   740   N  N     . SER A 1  458 ? 152.612 96.915  90.927  1.00 36.37  ? 458  SER A N     1 
ATOM   741   C  CA    . SER A 1  458 ? 152.498 96.608  92.348  1.00 36.37  ? 458  SER A CA    1 
ATOM   742   C  C     . SER A 1  458 ? 151.058 96.687  92.835  1.00 36.37  ? 458  SER A C     1 
ATOM   743   O  O     . SER A 1  458 ? 150.625 95.844  93.627  1.00 36.37  ? 458  SER A O     1 
ATOM   744   C  CB    . SER A 1  458 ? 153.374 97.558  93.168  1.00 36.37  ? 458  SER A CB    1 
ATOM   745   O  OG    . SER A 1  458 ? 154.745 97.383  92.862  1.00 36.37  ? 458  SER A OG    1 
ATOM   746   N  N     . ILE A 1  459 ? 150.305 97.688  92.375  1.00 31.59  ? 459  ILE A N     1 
ATOM   747   C  CA    . ILE A 1  459 ? 148.914 97.827  92.790  1.00 31.59  ? 459  ILE A CA    1 
ATOM   748   C  C     . ILE A 1  459 ? 148.044 96.787  92.095  1.00 31.59  ? 459  ILE A C     1 
ATOM   749   O  O     . ILE A 1  459 ? 147.141 96.205  92.708  1.00 31.59  ? 459  ILE A O     1 
ATOM   750   C  CB    . ILE A 1  459 ? 148.427 99.263  92.520  1.00 31.59  ? 459  ILE A CB    1 
ATOM   751   C  CG1   . ILE A 1  459 ? 149.261 100.259 93.317  1.00 31.59  ? 459  ILE A CG1   1 
ATOM   752   C  CG2   . ILE A 1  459 ? 146.972 99.437  92.896  1.00 31.59  ? 459  ILE A CG2   1 
ATOM   753   C  CD1   . ILE A 1  459 ? 149.046 101.691 92.912  1.00 31.59  ? 459  ILE A CD1   1 
ATOM   754   N  N     . TYR A 1  460 ? 148.315 96.519  90.813  1.00 32.46  ? 460  TYR A N     1 
ATOM   755   C  CA    . TYR A 1  460 ? 147.525 95.537  90.076  1.00 32.46  ? 460  TYR A CA    1 
ATOM   756   C  C     . TYR A 1  460 ? 147.773 94.121  90.569  1.00 32.46  ? 460  TYR A C     1 
ATOM   757   O  O     . TYR A 1  460 ? 146.842 93.315  90.591  1.00 32.46  ? 460  TYR A O     1 
ATOM   758   C  CB    . TYR A 1  460 ? 147.824 95.627  88.581  1.00 32.46  ? 460  TYR A CB    1 
ATOM   759   C  CG    . TYR A 1  460 ? 147.097 94.620  87.723  1.00 32.46  ? 460  TYR A CG    1 
ATOM   760   C  CD1   . TYR A 1  460 ? 145.756 94.780  87.416  1.00 32.46  ? 460  TYR A CD1   1 
ATOM   761   C  CD2   . TYR A 1  460 ? 147.759 93.515  87.205  1.00 32.46  ? 460  TYR A CD2   1 
ATOM   762   C  CE1   . TYR A 1  460 ? 145.089 93.862  86.627  1.00 32.46  ? 460  TYR A CE1   1 
ATOM   763   C  CE2   . TYR A 1  460 ? 147.102 92.594  86.416  1.00 32.46  ? 460  TYR A CE2   1 
ATOM   764   C  CZ    . TYR A 1  460 ? 145.767 92.774  86.130  1.00 32.46  ? 460  TYR A CZ    1 
ATOM   765   O  OH    . TYR A 1  460 ? 145.107 91.862  85.343  1.00 32.46  ? 460  TYR A OH    1 
ATOM   766   N  N     . LEU A 1  461 ? 149.005 93.797  90.969  1.00 37.56  ? 461  LEU A N     1 
ATOM   767   C  CA    . LEU A 1  461 ? 149.287 92.452  91.463  1.00 37.56  ? 461  LEU A CA    1 
ATOM   768   C  C     . LEU A 1  461 ? 148.655 92.220  92.827  1.00 37.56  ? 461  LEU A C     1 
ATOM   769   O  O     . LEU A 1  461 ? 148.172 91.118  93.114  1.00 37.56  ? 461  LEU A O     1 
ATOM   770   C  CB    . LEU A 1  461 ? 150.792 92.217  91.538  1.00 37.56  ? 461  LEU A CB    1 
ATOM   771   C  CG    . LEU A 1  461 ? 151.266 90.833  91.983  1.00 37.56  ? 461  LEU A CG    1 
ATOM   772   C  CD1   . LEU A 1  461 ? 150.871 89.773  90.965  1.00 37.56  ? 461  LEU A CD1   1 
ATOM   773   C  CD2   . LEU A 1  461 ? 152.765 90.827  92.229  1.00 37.56  ? 461  LEU A CD2   1 
ATOM   774   N  N     . SER A 1  462 ? 148.642 93.247  93.677  1.00 34.36  ? 462  SER A N     1 
ATOM   775   C  CA    . SER A 1  462 ? 148.073 93.094  95.009  1.00 34.36  ? 462  SER A CA    1 
ATOM   776   C  C     . SER A 1  462 ? 146.555 93.007  94.965  1.00 34.36  ? 462  SER A C     1 
ATOM   777   O  O     . SER A 1  462 ? 145.949 92.368  95.831  1.00 34.36  ? 462  SER A O     1 
ATOM   778   C  CB    . SER A 1  462 ? 148.508 94.254  95.900  1.00 34.36  ? 462  SER A CB    1 
ATOM   779   O  OG    . SER A 1  462 ? 149.914 94.269  96.064  1.00 34.36  ? 462  SER A OG    1 
ATOM   780   N  N     . ALA A 1  463 ? 145.926 93.631  93.973  1.00 33.86  ? 463  ALA A N     1 
ATOM   781   C  CA    . ALA A 1  463 ? 144.476 93.602  93.868  1.00 33.86  ? 463  ALA A CA    1 
ATOM   782   C  C     . ALA A 1  463 ? 143.968 92.445  93.023  1.00 33.86  ? 463  ALA A C     1 
ATOM   783   O  O     . ALA A 1  463 ? 142.832 92.008  93.220  1.00 33.86  ? 463  ALA A O     1 
ATOM   784   C  CB    . ALA A 1  463 ? 143.960 94.924  93.296  1.00 33.86  ? 463  ALA A CB    1 
ATOM   785   N  N     . TYR A 1  464 ? 144.773 91.938  92.086  1.00 37.94  ? 464  TYR A N     1 
ATOM   786   C  CA    . TYR A 1  464 ? 144.368 90.758  91.326  1.00 37.94  ? 464  TYR A CA    1 
ATOM   787   C  C     . TYR A 1  464 ? 144.348 89.517  92.202  1.00 37.94  ? 464  TYR A C     1 
ATOM   788   O  O     . TYR A 1  464 ? 143.524 88.624  91.989  1.00 37.94  ? 464  TYR A O     1 
ATOM   789   C  CB    . TYR A 1  464 ? 145.317 90.531  90.151  1.00 37.94  ? 464  TYR A CB    1 
ATOM   790   C  CG    . TYR A 1  464 ? 144.933 89.418  89.207  1.00 37.94  ? 464  TYR A CG    1 
ATOM   791   C  CD1   . TYR A 1  464 ? 143.999 89.629  88.204  1.00 37.94  ? 464  TYR A CD1   1 
ATOM   792   C  CD2   . TYR A 1  464 ? 145.507 88.157  89.316  1.00 37.94  ? 464  TYR A CD2   1 
ATOM   793   C  CE1   . TYR A 1  464 ? 143.655 88.621  87.328  1.00 37.94  ? 464  TYR A CE1   1 
ATOM   794   C  CE2   . TYR A 1  464 ? 145.158 87.138  88.454  1.00 37.94  ? 464  TYR A CE2   1 
ATOM   795   C  CZ    . TYR A 1  464 ? 144.230 87.375  87.465  1.00 37.94  ? 464  TYR A CZ    1 
ATOM   796   O  OH    . TYR A 1  464 ? 143.884 86.361  86.603  1.00 37.94  ? 464  TYR A OH    1 
ATOM   797   N  N     . SER A 1  465 ? 145.251 89.442  93.180  1.00 41.55  ? 465  SER A N     1 
ATOM   798   C  CA    . SER A 1  465 ? 145.338 88.252  94.016  1.00 41.55  ? 465  SER A CA    1 
ATOM   799   C  C     . SER A 1  465 ? 144.195 88.196  95.018  1.00 41.55  ? 465  SER A C     1 
ATOM   800   O  O     . SER A 1  465 ? 143.672 87.114  95.310  1.00 41.55  ? 465  SER A O     1 
ATOM   801   C  CB    . SER A 1  465 ? 146.680 88.222  94.741  1.00 41.55  ? 465  SER A CB    1 
ATOM   802   O  OG    . SER A 1  465 ? 146.769 89.285  95.671  1.00 41.55  ? 465  SER A OG    1 
ATOM   803   N  N     . ALA A 1  466 ? 143.790 89.348  95.551  1.00 35.59  ? 466  ALA A N     1 
ATOM   804   C  CA    . ALA A 1  466 ? 142.746 89.367  96.566  1.00 35.59  ? 466  ALA A CA    1 
ATOM   805   C  C     . ALA A 1  466 ? 141.356 89.192  95.969  1.00 35.59  ? 466  ALA A C     1 
ATOM   806   O  O     . ALA A 1  466 ? 140.475 88.633  96.629  1.00 35.59  ? 466  ALA A O     1 
ATOM   807   C  CB    . ALA A 1  466 ? 142.824 90.662  97.369  1.00 35.59  ? 466  ALA A CB    1 
ATOM   808   N  N     . ILE A 1  467 ? 141.136 89.650  94.736  1.00 37.36  ? 467  ILE A N     1 
ATOM   809   C  CA    . ILE A 1  467 ? 139.848 89.426  94.085  1.00 37.36  ? 467  ILE A CA    1 
ATOM   810   C  C     . ILE A 1  467 ? 139.724 87.972  93.644  1.00 37.36  ? 467  ILE A C     1 
ATOM   811   O  O     . ILE A 1  467 ? 138.651 87.364  93.757  1.00 37.36  ? 467  ILE A O     1 
ATOM   812   C  CB    . ILE A 1  467 ? 139.666 90.407  92.909  1.00 37.36  ? 467  ILE A CB    1 
ATOM   813   C  CG1   . ILE A 1  467 ? 139.594 91.836  93.422  1.00 37.36  ? 467  ILE A CG1   1 
ATOM   814   C  CG2   . ILE A 1  467 ? 138.380 90.149  92.153  1.00 37.36  ? 467  ILE A CG2   1 
ATOM   815   C  CD1   . ILE A 1  467 ? 139.705 92.880  92.350  1.00 37.36  ? 467  ILE A CD1   1 
ATOM   816   N  N     . GLU A 1  468 ? 140.824 87.378  93.174  1.00 43.19  ? 468  GLU A N     1 
ATOM   817   C  CA    . GLU A 1  468 ? 140.759 86.016  92.658  1.00 43.19  ? 468  GLU A CA    1 
ATOM   818   C  C     . GLU A 1  468 ? 140.614 84.998  93.784  1.00 43.19  ? 468  GLU A C     1 
ATOM   819   O  O     . GLU A 1  468 ? 140.040 83.924  93.578  1.00 43.19  ? 468  GLU A O     1 
ATOM   820   C  CB    . GLU A 1  468 ? 142.003 85.714  91.820  1.00 43.19  ? 468  GLU A CB    1 
ATOM   821   C  CG    . GLU A 1  468 ? 141.824 84.624  90.763  1.00 43.19  ? 468  GLU A CG    1 
ATOM   822   C  CD    . GLU A 1  468 ? 142.010 83.216  91.288  1.00 43.19  ? 468  GLU A CD    1 
ATOM   823   O  OE1   . GLU A 1  468 ? 142.773 83.031  92.257  1.00 43.19  ? 468  GLU A OE1   1 
ATOM   824   O  OE2   . GLU A 1  468 ? 141.385 82.291  90.726  1.00 43.19  ? 468  GLU A OE2   1 
ATOM   825   N  N     . SER A 1  469 ? 141.093 85.326  94.982  1.00 42.63  ? 469  SER A N     1 
ATOM   826   C  CA    . SER A 1  469 ? 141.063 84.415  96.116  1.00 42.63  ? 469  SER A CA    1 
ATOM   827   C  C     . SER A 1  469 ? 139.909 84.682  97.075  1.00 42.63  ? 469  SER A C     1 
ATOM   828   O  O     . SER A 1  469 ? 139.830 84.015  98.113  1.00 42.63  ? 469  SER A O     1 
ATOM   829   C  CB    . SER A 1  469 ? 142.387 84.487  96.877  1.00 42.63  ? 469  SER A CB    1 
ATOM   830   O  OG    . SER A 1  469 ? 142.352 83.678  98.038  1.00 42.63  ? 469  SER A OG    1 
ATOM   831   N  N     . ASP A 1  470 ? 139.014 85.621  96.737  1.00 41.88  ? 470  ASP A N     1 
ATOM   832   C  CA    . ASP A 1  470 ? 137.945 86.122  97.617  1.00 41.88  ? 470  ASP A CA    1 
ATOM   833   C  C     . ASP A 1  470 ? 138.495 86.578  98.966  1.00 41.88  ? 470  ASP A C     1 
ATOM   834   O  O     . ASP A 1  470 ? 137.965 86.250  100.028 1.00 41.88  ? 470  ASP A O     1 
ATOM   835   C  CB    . ASP A 1  470 ? 136.827 85.091  97.804  1.00 41.88  ? 470  ASP A CB    1 
ATOM   836   C  CG    . ASP A 1  470 ? 135.924 84.981  96.594  1.00 41.88  ? 470  ASP A CG    1 
ATOM   837   O  OD1   . ASP A 1  470 ? 135.758 85.992  95.880  1.00 41.88  ? 470  ASP A OD1   1 
ATOM   838   O  OD2   . ASP A 1  470 ? 135.371 83.886  96.362  1.00 41.88  ? 470  ASP A OD2   1 
ATOM   839   N  N     . SER A 1  471 ? 139.575 87.342  98.916  1.00 34.13  ? 471  SER A N     1 
ATOM   840   C  CA    . SER A 1  471 ? 140.257 87.809  100.109 1.00 34.13  ? 471  SER A CA    1 
ATOM   841   C  C     . SER A 1  471 ? 139.981 89.293  100.322 1.00 34.13  ? 471  SER A C     1 
ATOM   842   O  O     . SER A 1  471 ? 139.201 89.921  99.602  1.00 34.13  ? 471  SER A O     1 
ATOM   843   C  CB    . SER A 1  471 ? 141.756 87.535  100.008 1.00 34.13  ? 471  SER A CB    1 
ATOM   844   O  OG    . SER A 1  471 ? 142.433 88.025  101.149 1.00 34.13  ? 471  SER A OG    1 
ATOM   845   N  N     . ALA A 1  472 ? 140.630 89.851  101.337 1.00 25.67  ? 472  ALA A N     1 
ATOM   846   C  CA    . ALA A 1  472 ? 140.503 91.260  101.668 1.00 25.67  ? 472  ALA A CA    1 
ATOM   847   C  C     . ALA A 1  472 ? 141.873 91.799  102.031 1.00 25.67  ? 472  ALA A C     1 
ATOM   848   O  O     . ALA A 1  472 ? 142.657 91.119  102.697 1.00 25.67  ? 472  ALA A O     1 
ATOM   849   C  CB    . ALA A 1  472 ? 139.531 91.484  102.828 1.00 25.67  ? 472  ALA A CB    1 
ATOM   850   N  N     . THR A 1  473 ? 142.158 93.020  101.593 1.00 23.15  ? 473  THR A N     1 
ATOM   851   C  CA    . THR A 1  473 ? 143.465 93.615  101.811 1.00 23.15  ? 473  THR A CA    1 
ATOM   852   C  C     . THR A 1  473 ? 143.330 95.129  101.825 1.00 23.15  ? 473  THR A C     1 
ATOM   853   O  O     . THR A 1  473 ? 142.243 95.682  101.650 1.00 23.15  ? 473  THR A O     1 
ATOM   854   C  CB    . THR A 1  473 ? 144.460 93.174  100.736 1.00 23.15  ? 473  THR A CB    1 
ATOM   855   O  OG1   . THR A 1  473 ? 145.759 93.685  101.052 1.00 23.15  ? 473  THR A OG1   1 
ATOM   856   C  CG2   . THR A 1  473 ? 144.035 93.691  99.377  1.00 23.15  ? 473  THR A CG2   1 
ATOM   857   N  N     . THR A 1  474 ? 144.457 95.795  102.040 1.00 23.47  ? 474  THR A N     1 
ATOM   858   C  CA    . THR A 1  474 ? 144.544 97.242  101.976 1.00 23.47  ? 474  THR A CA    1 
ATOM   859   C  C     . THR A 1  474 ? 145.846 97.598  101.279 1.00 23.47  ? 474  THR A C     1 
ATOM   860   O  O     . THR A 1  474 ? 146.886 97.000  101.560 1.00 23.47  ? 474  THR A O     1 
ATOM   861   C  CB    . THR A 1  474 ? 144.492 97.870  103.374 1.00 23.47  ? 474  THR A CB    1 
ATOM   862   O  OG1   . THR A 1  474 ? 143.288 97.473  104.034 1.00 23.47  ? 474  THR A OG1   1 
ATOM   863   C  CG2   . THR A 1  474 ? 144.523 99.379  103.296 1.00 23.47  ? 474  THR A CG2   1 
ATOM   864   N  N     . ILE A 1  475 ? 145.781 98.539  100.344 1.00 23.64  ? 475  ILE A N     1 
ATOM   865   C  CA    . ILE A 1  475 ? 146.954 99.034  99.642  1.00 23.64  ? 475  ILE A CA    1 
ATOM   866   C  C     . ILE A 1  475 ? 147.094 100.505 99.986  1.00 23.64  ? 475  ILE A C     1 
ATOM   867   O  O     . ILE A 1  475 ? 146.164 101.288 99.763  1.00 23.64  ? 475  ILE A O     1 
ATOM   868   C  CB    . ILE A 1  475 ? 146.833 98.832  98.126  1.00 23.64  ? 475  ILE A CB    1 
ATOM   869   C  CG1   . ILE A 1  475 ? 146.627 97.352  97.814  1.00 23.64  ? 475  ILE A CG1   1 
ATOM   870   C  CG2   . ILE A 1  475 ? 148.075 99.347  97.426  1.00 23.64  ? 475  ILE A CG2   1 
ATOM   871   C  CD1   . ILE A 1  475 ? 146.152 97.092  96.416  1.00 23.64  ? 475  ILE A CD1   1 
ATOM   872   N  N     . TYR A 1  476 ? 148.237 100.881 100.544 1.00 28.69  ? 476  TYR A N     1 
ATOM   873   C  CA    . TYR A 1  476 ? 148.499 102.264 100.908 1.00 28.69  ? 476  TYR A CA    1 
ATOM   874   C  C     . TYR A 1  476 ? 149.502 102.856 99.931  1.00 28.69  ? 476  TYR A C     1 
ATOM   875   O  O     . TYR A 1  476 ? 150.568 102.278 99.700  1.00 28.69  ? 476  TYR A O     1 
ATOM   876   C  CB    . TYR A 1  476 ? 149.022 102.374 102.339 1.00 28.69  ? 476  TYR A CB    1 
ATOM   877   C  CG    . TYR A 1  476 ? 149.179 103.799 102.801 1.00 28.69  ? 476  TYR A CG    1 
ATOM   878   C  CD1   . TYR A 1  476 ? 148.069 104.558 103.133 1.00 28.69  ? 476  TYR A CD1   1 
ATOM   879   C  CD2   . TYR A 1  476 ? 150.430 104.386 102.903 1.00 28.69  ? 476  TYR A CD2   1 
ATOM   880   C  CE1   . TYR A 1  476 ? 148.197 105.862 103.553 1.00 28.69  ? 476  TYR A CE1   1 
ATOM   881   C  CE2   . TYR A 1  476 ? 150.569 105.691 103.322 1.00 28.69  ? 476  TYR A CE2   1 
ATOM   882   C  CZ    . TYR A 1  476 ? 149.448 106.422 103.647 1.00 28.69  ? 476  TYR A CZ    1 
ATOM   883   O  OH    . TYR A 1  476 ? 149.578 107.721 104.068 1.00 28.69  ? 476  TYR A OH    1 
ATOM   884   N  N     . VAL A 1  477 ? 149.156 104.007 99.366  1.00 26.48  ? 477  VAL A N     1 
ATOM   885   C  CA    . VAL A 1  477 ? 149.968 104.677 98.359  1.00 26.48  ? 477  VAL A CA    1 
ATOM   886   C  C     . VAL A 1  477 ? 150.035 106.162 98.701  1.00 26.48  ? 477  VAL A C     1 
ATOM   887   O  O     . VAL A 1  477 ? 149.016 106.775 99.023  1.00 26.48  ? 477  VAL A O     1 
ATOM   888   C  CB    . VAL A 1  477 ? 149.420 104.404 96.940  1.00 26.48  ? 477  VAL A CB    1 
ATOM   889   C  CG1   . VAL A 1  477 ? 147.928 104.554 96.896  1.00 26.48  ? 477  VAL A CG1   1 
ATOM   890   C  CG2   . VAL A 1  477 ? 150.034 105.340 95.933  1.00 26.48  ? 477  VAL A CG2   1 
ATOM   891   N  N     . ALA A 1  478 ? 151.241 106.731 98.698  1.00 27.54  ? 478  ALA A N     1 
ATOM   892   C  CA    . ALA A 1  478 ? 151.418 108.127 99.066  1.00 27.54  ? 478  ALA A CA    1 
ATOM   893   C  C     . ALA A 1  478 ? 152.381 108.795 98.097  1.00 27.54  ? 478  ALA A C     1 
ATOM   894   O  O     . ALA A 1  478 ? 152.877 108.179 97.151  1.00 27.54  ? 478  ALA A O     1 
ATOM   895   C  CB    . ALA A 1  478 ? 151.909 108.260 100.509 1.00 27.54  ? 478  ALA A CB    1 
ATOM   896   N  N     . GLY A 1  479 ? 152.630 110.071 98.334  1.00 29.33  ? 479  GLY A N     1 
ATOM   897   C  CA    . GLY A 1  479 ? 153.516 110.853 97.494  1.00 29.33  ? 479  GLY A CA    1 
ATOM   898   C  C     . GLY A 1  479 ? 153.115 112.312 97.495  1.00 29.33  ? 479  GLY A C     1 
ATOM   899   O  O     . GLY A 1  479 ? 152.035 112.691 97.937  1.00 29.33  ? 479  GLY A O     1 
ATOM   900   N  N     . THR A 1  480 ? 154.025 113.137 96.981  1.00 27.30  ? 480  THR A N     1 
ATOM   901   C  CA    . THR A 1  480 ? 153.796 114.567 96.839  1.00 27.30  ? 480  THR A CA    1 
ATOM   902   C  C     . THR A 1  480 ? 152.743 114.805 95.747  1.00 27.30  ? 480  THR A C     1 
ATOM   903   O  O     . THR A 1  480 ? 152.534 113.937 94.898  1.00 27.30  ? 480  THR A O     1 
ATOM   904   C  CB    . THR A 1  480 ? 155.141 115.249 96.544  1.00 27.30  ? 480  THR A CB    1 
ATOM   905   O  OG1   . THR A 1  480 ? 155.012 116.675 96.514  1.00 27.30  ? 480  THR A OG1   1 
ATOM   906   C  CG2   . THR A 1  480 ? 155.733 114.770 95.244  1.00 27.30  ? 480  THR A CG2   1 
ATOM   907   N  N     . PRO A 1  481 ? 152.009 115.931 95.800  1.00 27.28  ? 481  PRO A N     1 
ATOM   908   C  CA    . PRO A 1  481 ? 150.917 116.154 94.836  1.00 27.28  ? 481  PRO A CA    1 
ATOM   909   C  C     . PRO A 1  481 ? 151.344 116.192 93.374  1.00 27.28  ? 481  PRO A C     1 
ATOM   910   O  O     . PRO A 1  481 ? 152.385 116.744 93.021  1.00 27.28  ? 481  PRO A O     1 
ATOM   911   C  CB    . PRO A 1  481 ? 150.346 117.508 95.268  1.00 27.28  ? 481  PRO A CB    1 
ATOM   912   C  CG    . PRO A 1  481 ? 150.564 117.536 96.705  1.00 27.28  ? 481  PRO A CG    1 
ATOM   913   C  CD    . PRO A 1  481 ? 151.874 116.850 96.948  1.00 27.28  ? 481  PRO A CD    1 
ATOM   914   N  N     . GLY A 1  482 ? 150.518 115.571 92.533  1.00 28.57  ? 482  GLY A N     1 
ATOM   915   C  CA    . GLY A 1  482 ? 150.638 115.669 91.095  1.00 28.57  ? 482  GLY A CA    1 
ATOM   916   C  C     . GLY A 1  482 ? 151.492 114.624 90.419  1.00 28.57  ? 482  GLY A C     1 
ATOM   917   O  O     . GLY A 1  482 ? 151.925 114.847 89.285  1.00 28.57  ? 482  GLY A O     1 
ATOM   918   N  N     . VAL A 1  483 ? 151.725 113.475 91.051  1.00 26.27  ? 483  VAL A N     1 
ATOM   919   C  CA    . VAL A 1  483 ? 152.703 112.516 90.554  1.00 26.27  ? 483  VAL A CA    1 
ATOM   920   C  C     . VAL A 1  483 ? 152.055 111.311 89.886  1.00 26.27  ? 483  VAL A C     1 
ATOM   921   O  O     . VAL A 1  483 ? 152.727 110.303 89.655  1.00 26.27  ? 483  VAL A O     1 
ATOM   922   C  CB    . VAL A 1  483 ? 153.646 112.065 91.673  1.00 26.27  ? 483  VAL A CB    1 
ATOM   923   C  CG1   . VAL A 1  483 ? 154.403 113.245 92.190  1.00 26.27  ? 483  VAL A CG1   1 
ATOM   924   C  CG2   . VAL A 1  483 ? 152.863 111.405 92.785  1.00 26.27  ? 483  VAL A CG2   1 
ATOM   925   N  N     . GLY A 1  484 ? 150.771 111.385 89.567  1.00 28.41  ? 484  GLY A N     1 
ATOM   926   C  CA    . GLY A 1  484 ? 150.141 110.330 88.808  1.00 28.41  ? 484  GLY A CA    1 
ATOM   927   C  C     . GLY A 1  484 ? 149.529 109.212 89.613  1.00 28.41  ? 484  GLY A C     1 
ATOM   928   O  O     . GLY A 1  484 ? 149.323 108.128 89.062  1.00 28.41  ? 484  GLY A O     1 
ATOM   929   N  N     . LYS A 1  485 ? 149.216 109.428 90.889  1.00 24.46  ? 485  LYS A N     1 
ATOM   930   C  CA    . LYS A 1  485 ? 148.715 108.323 91.696  1.00 24.46  ? 485  LYS A CA    1 
ATOM   931   C  C     . LYS A 1  485 ? 147.203 108.189 91.688  1.00 24.46  ? 485  LYS A C     1 
ATOM   932   O  O     . LYS A 1  485 ? 146.702 107.065 91.761  1.00 24.46  ? 485  LYS A O     1 
ATOM   933   C  CB    . LYS A 1  485 ? 149.229 108.427 93.133  1.00 24.46  ? 485  LYS A CB    1 
ATOM   934   C  CG    . LYS A 1  485 ? 148.912 109.666 93.886  1.00 24.46  ? 485  LYS A CG    1 
ATOM   935   C  CD    . LYS A 1  485 ? 149.675 109.641 95.181  1.00 24.46  ? 485  LYS A CD    1 
ATOM   936   C  CE    . LYS A 1  485 ? 149.392 110.862 95.999  1.00 24.46  ? 485  LYS A CE    1 
ATOM   937   N  NZ    . LYS A 1  485 ? 149.923 112.084 95.358  1.00 24.46  ? 485  LYS A NZ    1 
ATOM   938   N  N     . THR A 1  486 ? 146.453 109.285 91.594  1.00 23.94  ? 486  THR A N     1 
ATOM   939   C  CA    . THR A 1  486 ? 145.020 109.139 91.368  1.00 23.94  ? 486  THR A CA    1 
ATOM   940   C  C     . THR A 1  486 ? 144.755 108.645 89.950  1.00 23.94  ? 486  THR A C     1 
ATOM   941   O  O     . THR A 1  486 ? 143.782 107.924 89.711  1.00 23.94  ? 486  THR A O     1 
ATOM   942   C  CB    . THR A 1  486 ? 144.310 110.468 91.647  1.00 23.94  ? 486  THR A CB    1 
ATOM   943   O  OG1   . THR A 1  486 ? 144.666 110.927 92.955  1.00 23.94  ? 486  THR A OG1   1 
ATOM   944   C  CG2   . THR A 1  486 ? 142.801 110.312 91.612  1.00 23.94  ? 486  THR A CG2   1 
ATOM   945   N  N     . LEU A 1  487 ? 145.647 108.973 89.014  1.00 23.78  ? 487  LEU A N     1 
ATOM   946   C  CA    . LEU A 1  487 ? 145.505 108.505 87.641  1.00 23.78  ? 487  LEU A CA    1 
ATOM   947   C  C     . LEU A 1  487 ? 145.765 107.009 87.527  1.00 23.78  ? 487  LEU A C     1 
ATOM   948   O  O     . LEU A 1  487 ? 144.999 106.288 86.878  1.00 23.78  ? 487  LEU A O     1 
ATOM   949   C  CB    . LEU A 1  487 ? 146.457 109.270 86.727  1.00 23.78  ? 487  LEU A CB    1 
ATOM   950   C  CG    . LEU A 1  487 ? 146.387 108.844 85.262  1.00 23.78  ? 487  LEU A CG    1 
ATOM   951   C  CD1   . LEU A 1  487 ? 145.034 109.186 84.664  1.00 23.78  ? 487  LEU A CD1   1 
ATOM   952   C  CD2   . LEU A 1  487 ? 147.505 109.463 84.466  1.00 23.78  ? 487  LEU A CD2   1 
ATOM   953   N  N     . THR A 1  488 ? 146.835 106.516 88.150  1.00 25.37  ? 488  THR A N     1 
ATOM   954   C  CA    . THR A 1  488 ? 147.217 105.133 87.908  1.00 25.37  ? 488  THR A CA    1 
ATOM   955   C  C     . THR A 1  488 ? 146.469 104.141 88.785  1.00 25.37  ? 488  THR A C     1 
ATOM   956   O  O     . THR A 1  488 ? 146.457 102.954 88.458  1.00 25.37  ? 488  THR A O     1 
ATOM   957   C  CB    . THR A 1  488 ? 148.728 104.937 88.082  1.00 25.37  ? 488  THR A CB    1 
ATOM   958   O  OG1   . THR A 1  488 ? 149.107 103.684 87.507  1.00 25.37  ? 488  THR A OG1   1 
ATOM   959   C  CG2   . THR A 1  488 ? 149.101 104.896 89.525  1.00 25.37  ? 488  THR A CG2   1 
ATOM   960   N  N     . VAL A 1  489 ? 145.838 104.584 89.874  1.00 22.71  ? 489  VAL A N     1 
ATOM   961   C  CA    . VAL A 1  489 ? 144.945 103.695 90.608  1.00 22.71  ? 489  VAL A CA    1 
ATOM   962   C  C     . VAL A 1  489 ? 143.669 103.467 89.810  1.00 22.71  ? 489  VAL A C     1 
ATOM   963   O  O     . VAL A 1  489 ? 143.170 102.339 89.714  1.00 22.71  ? 489  VAL A O     1 
ATOM   964   C  CB    . VAL A 1  489 ? 144.664 104.259 92.013  1.00 22.71  ? 489  VAL A CB    1 
ATOM   965   C  CG1   . VAL A 1  489 ? 143.527 103.525 92.668  1.00 22.71  ? 489  VAL A CG1   1 
ATOM   966   C  CG2   . VAL A 1  489 ? 145.894 104.117 92.880  1.00 22.71  ? 489  VAL A CG2   1 
ATOM   967   N  N     . ARG A 1  490 ? 143.152 104.525 89.181  1.00 24.44  ? 490  ARG A N     1 
ATOM   968   C  CA    . ARG A 1  490 ? 142.023 104.384 88.270  1.00 24.44  ? 490  ARG A CA    1 
ATOM   969   C  C     . ARG A 1  490 ? 142.389 103.578 87.035  1.00 24.44  ? 490  ARG A C     1 
ATOM   970   O  O     . ARG A 1  490 ? 141.511 102.988 86.400  1.00 24.44  ? 490  ARG A O     1 
ATOM   971   C  CB    . ARG A 1  490 ? 141.514 105.755 87.845  1.00 24.44  ? 490  ARG A CB    1 
ATOM   972   C  CG    . ARG A 1  490 ? 140.872 106.551 88.945  1.00 24.44  ? 490  ARG A CG    1 
ATOM   973   C  CD    . ARG A 1  490 ? 140.454 107.904 88.422  1.00 24.44  ? 490  ARG A CD    1 
ATOM   974   N  NE    . ARG A 1  490 ? 139.886 108.738 89.470  1.00 24.44  ? 490  ARG A NE    1 
ATOM   975   C  CZ    . ARG A 1  490 ? 139.526 110.002 89.295  1.00 24.44  ? 490  ARG A CZ    1 
ATOM   976   N  NH1   . ARG A 1  490 ? 139.679 110.574 88.111  1.00 24.44  ? 490  ARG A NH1   1 
ATOM   977   N  NH2   . ARG A 1  490 ? 139.015 110.693 90.302  1.00 24.44  ? 490  ARG A NH2   1 
ATOM   978   N  N     . GLU A 1  491 ? 143.669 103.551 86.672  1.00 34.67  ? 491  GLU A N     1 
ATOM   979   C  CA    . GLU A 1  491 ? 144.103 102.732 85.553  1.00 34.67  ? 491  GLU A CA    1 
ATOM   980   C  C     . GLU A 1  491 ? 144.327 101.287 85.984  1.00 34.67  ? 491  GLU A C     1 
ATOM   981   O  O     . GLU A 1  491 ? 144.226 100.376 85.155  1.00 34.67  ? 491  GLU A O     1 
ATOM   982   C  CB    . GLU A 1  491 ? 145.371 103.332 84.943  1.00 34.67  ? 491  GLU A CB    1 
ATOM   983   C  CG    . GLU A 1  491 ? 145.764 102.774 83.587  1.00 34.67  ? 491  GLU A CG    1 
ATOM   984   C  CD    . GLU A 1  491 ? 144.782 103.152 82.490  1.00 34.67  ? 491  GLU A CD    1 
ATOM   985   O  OE1   . GLU A 1  491 ? 144.126 104.209 82.606  1.00 34.67  ? 491  GLU A OE1   1 
ATOM   986   O  OE2   . GLU A 1  491 ? 144.667 102.390 81.506  1.00 34.67  ? 491  GLU A OE2   1 
ATOM   987   N  N     . VAL A 1  492 ? 144.623 101.060 87.267  1.00 28.02  ? 492  VAL A N     1 
ATOM   988   C  CA    . VAL A 1  492 ? 144.648 99.699  87.800  1.00 28.02  ? 492  VAL A CA    1 
ATOM   989   C  C     . VAL A 1  492 ? 143.254 99.093  87.769  1.00 28.02  ? 492  VAL A C     1 
ATOM   990   O  O     . VAL A 1  492 ? 143.047 98.009  87.212  1.00 28.02  ? 492  VAL A O     1 
ATOM   991   C  CB    . VAL A 1  492 ? 145.241 99.673  89.222  1.00 28.02  ? 492  VAL A CB    1 
ATOM   992   C  CG1   . VAL A 1  492 ? 144.946 98.356  89.889  1.00 28.02  ? 492  VAL A CG1   1 
ATOM   993   C  CG2   . VAL A 1  492 ? 146.731 99.821  89.165  1.00 28.02  ? 492  VAL A CG2   1 
ATOM   994   N  N     . VAL A 1  493 ? 142.269 99.799  88.334  1.00 26.41  ? 493  VAL A N     1 
ATOM   995   C  CA    . VAL A 1  493 ? 140.930 99.235  88.439  1.00 26.41  ? 493  VAL A CA    1 
ATOM   996   C  C     . VAL A 1  493 ? 140.221 99.197  87.095  1.00 26.41  ? 493  VAL A C     1 
ATOM   997   O  O     . VAL A 1  493 ? 139.243 98.464  86.947  1.00 26.41  ? 493  VAL A O     1 
ATOM   998   C  CB    . VAL A 1  493 ? 140.082 100.001 89.471  1.00 26.41  ? 493  VAL A CB    1 
ATOM   999   C  CG1   . VAL A 1  493 ? 140.749 99.966  90.834  1.00 26.41  ? 493  VAL A CG1   1 
ATOM   1000  C  CG2   . VAL A 1  493 ? 139.841 101.421 89.027  1.00 26.41  ? 493  VAL A CG2   1 
ATOM   1001  N  N     . LYS A 1  494 ? 140.689 99.951  86.100  1.00 35.33  ? 494  LYS A N     1 
ATOM   1002  C  CA    . LYS A 1  494 ? 140.131 99.806  84.763  1.00 35.33  ? 494  LYS A CA    1 
ATOM   1003  C  C     . LYS A 1  494 ? 140.700 98.582  84.059  1.00 35.33  ? 494  LYS A C     1 
ATOM   1004  O  O     . LYS A 1  494 ? 140.000 97.944  83.263  1.00 35.33  ? 494  LYS A O     1 
ATOM   1005  C  CB    . LYS A 1  494 ? 140.391 101.070 83.942  1.00 35.33  ? 494  LYS A CB    1 
ATOM   1006  C  CG    . LYS A 1  494 ? 139.688 101.092 82.597  1.00 35.33  ? 494  LYS A CG    1 
ATOM   1007  C  CD    . LYS A 1  494 ? 139.905 102.393 81.850  1.00 35.33  ? 494  LYS A CD    1 
ATOM   1008  C  CE    . LYS A 1  494 ? 139.174 102.367 80.515  1.00 35.33  ? 494  LYS A CE    1 
ATOM   1009  N  NZ    . LYS A 1  494 ? 139.350 103.627 79.745  1.00 35.33  ? 494  LYS A NZ    1 
ATOM   1010  N  N     . GLU A 1  495 ? 141.952 98.228  84.356  1.00 43.74  ? 495  GLU A N     1 
ATOM   1011  C  CA    . GLU A 1  495 ? 142.533 97.011  83.802  1.00 43.74  ? 495  GLU A CA    1 
ATOM   1012  C  C     . GLU A 1  495 ? 141.883 95.767  84.392  1.00 43.74  ? 495  GLU A C     1 
ATOM   1013  O  O     . GLU A 1  495 ? 141.625 94.796  83.672  1.00 43.74  ? 495  GLU A O     1 
ATOM   1014  C  CB    . GLU A 1  495 ? 144.043 96.996  84.042  1.00 43.74  ? 495  GLU A CB    1 
ATOM   1015  C  CG    . GLU A 1  495 ? 144.751 95.740  83.549  1.00 43.74  ? 495  GLU A CG    1 
ATOM   1016  C  CD    . GLU A 1  495 ? 144.721 95.582  82.042  1.00 43.74  ? 495  GLU A CD    1 
ATOM   1017  O  OE1   . GLU A 1  495 ? 144.691 96.604  81.326  1.00 43.74  ? 495  GLU A OE1   1 
ATOM   1018  O  OE2   . GLU A 1  495 ? 144.715 94.425  81.572  1.00 43.74  ? 495  GLU A OE2   1 
ATOM   1019  N  N     . LEU A 1  496 ? 141.591 95.778  85.689  1.00 35.17  ? 496  LEU A N     1 
ATOM   1020  C  CA    . LEU A 1  496 ? 140.983 94.615  86.316  1.00 35.17  ? 496  LEU A CA    1 
ATOM   1021  C  C     . LEU A 1  496 ? 139.458 94.672  86.351  1.00 35.17  ? 496  LEU A C     1 
ATOM   1022  O  O     . LEU A 1  496 ? 138.837 93.717  86.821  1.00 35.17  ? 496  LEU A O     1 
ATOM   1023  C  CB    . LEU A 1  496 ? 141.583 94.392  87.715  1.00 35.17  ? 496  LEU A CB    1 
ATOM   1024  C  CG    . LEU A 1  496 ? 141.705 95.441  88.822  1.00 35.17  ? 496  LEU A CG    1 
ATOM   1025  C  CD1   . LEU A 1  496 ? 140.492 95.493  89.691  1.00 35.17  ? 496  LEU A CD1   1 
ATOM   1026  C  CD2   . LEU A 1  496 ? 142.924 95.141  89.667  1.00 35.17  ? 496  LEU A CD2   1 
ATOM   1027  N  N     . LEU A 1  497 ? 138.838 95.748  85.851  1.00 33.83  ? 497  LEU A N     1 
ATOM   1028  C  CA    . LEU A 1  497 ? 137.464 95.633  85.361  1.00 33.83  ? 497  LEU A CA    1 
ATOM   1029  C  C     . LEU A 1  497 ? 137.416 94.866  84.049  1.00 33.83  ? 497  LEU A C     1 
ATOM   1030  O  O     . LEU A 1  497 ? 136.516 94.048  83.833  1.00 33.83  ? 497  LEU A O     1 
ATOM   1031  C  CB    . LEU A 1  497 ? 136.816 97.007  85.169  1.00 33.83  ? 497  LEU A CB    1 
ATOM   1032  C  CG    . LEU A 1  497 ? 136.127 97.753  86.307  1.00 33.83  ? 497  LEU A CG    1 
ATOM   1033  C  CD1   . LEU A 1  497 ? 135.833 99.178  85.904  1.00 33.83  ? 497  LEU A CD1   1 
ATOM   1034  C  CD2   . LEU A 1  497 ? 134.837 97.042  86.658  1.00 33.83  ? 497  LEU A CD2   1 
ATOM   1035  N  N     . SER A 1  498 ? 138.366 95.138  83.151  1.00 41.39  ? 498  SER A N     1 
ATOM   1036  C  CA    . SER A 1  498 ? 138.416 94.435  81.875  1.00 41.39  ? 498  SER A CA    1 
ATOM   1037  C  C     . SER A 1  498 ? 138.832 92.984  82.052  1.00 41.39  ? 498  SER A C     1 
ATOM   1038  O  O     . SER A 1  498 ? 138.463 92.129  81.240  1.00 41.39  ? 498  SER A O     1 
ATOM   1039  C  CB    . SER A 1  498 ? 139.376 95.147  80.925  1.00 41.39  ? 498  SER A CB    1 
ATOM   1040  O  OG    . SER A 1  498 ? 139.508 94.436  79.709  1.00 41.39  ? 498  SER A OG    1 
ATOM   1041  N  N     . SER A 1  499 ? 139.603 92.691  83.097  1.00 44.18  ? 499  SER A N     1 
ATOM   1042  C  CA    . SER A 1  499 ? 139.943 91.314  83.422  1.00 44.18  ? 499  SER A CA    1 
ATOM   1043  C  C     . SER A 1  499 ? 138.761 90.594  84.057  1.00 44.18  ? 499  SER A C     1 
ATOM   1044  O  O     . SER A 1  499 ? 138.564 89.395  83.834  1.00 44.18  ? 499  SER A O     1 
ATOM   1045  C  CB    . SER A 1  499 ? 141.158 91.297  84.348  1.00 44.18  ? 499  SER A CB    1 
ATOM   1046  O  OG    . SER A 1  499 ? 141.511 89.985  84.724  1.00 44.18  ? 499  SER A OG    1 
ATOM   1047  N  N     . SER A 1  500 ? 137.958 91.316  84.839  1.00 44.88  ? 500  SER A N     1 
ATOM   1048  C  CA    . SER A 1  500 ? 136.777 90.720  85.452  1.00 44.88  ? 500  SER A CA    1 
ATOM   1049  C  C     . SER A 1  500 ? 135.647 90.542  84.452  1.00 44.88  ? 500  SER A C     1 
ATOM   1050  O  O     . SER A 1  500 ? 134.857 89.601  84.577  1.00 44.88  ? 500  SER A O     1 
ATOM   1051  C  CB    . SER A 1  500 ? 136.308 91.577  86.624  1.00 44.88  ? 500  SER A CB    1 
ATOM   1052  O  OG    . SER A 1  500 ? 135.137 91.038  87.198  1.00 44.88  ? 500  SER A OG    1 
ATOM   1053  N  N     . ALA A 1  501 ? 135.545 91.435  83.465  1.00 50.04  ? 501  ALA A N     1 
ATOM   1054  C  CA    . ALA A 1  501 ? 134.506 91.316  82.450  1.00 50.04  ? 501  ALA A CA    1 
ATOM   1055  C  C     . ALA A 1  501 ? 134.758 90.154  81.500  1.00 50.04  ? 501  ALA A C     1 
ATOM   1056  O  O     . ALA A 1  501 ? 133.820 89.695  80.841  1.00 50.04  ? 501  ALA A O     1 
ATOM   1057  C  CB    . ALA A 1  501 ? 134.390 92.618  81.659  1.00 50.04  ? 501  ALA A CB    1 
ATOM   1058  N  N     . GLN A 1  502 ? 135.995 89.673  81.420  1.00 62.24  ? 502  GLN A N     1 
ATOM   1059  C  CA    . GLN A 1  502 ? 136.355 88.499  80.638  1.00 62.24  ? 502  GLN A CA    1 
ATOM   1060  C  C     . GLN A 1  502 ? 136.229 87.218  81.465  1.00 62.24  ? 502  GLN A C     1 
ATOM   1061  O  O     . GLN A 1  502 ? 136.502 86.126  80.952  1.00 62.24  ? 502  GLN A O     1 
ATOM   1062  C  CB    . GLN A 1  502 ? 137.786 88.684  80.099  1.00 62.24  ? 502  GLN A CB    1 
ATOM   1063  C  CG    . GLN A 1  502 ? 138.204 87.824  78.906  1.00 62.24  ? 502  GLN A CG    1 
ATOM   1064  C  CD    . GLN A 1  502 ? 139.638 88.066  78.495  1.00 62.24  ? 502  GLN A CD    1 
ATOM   1065  O  OE1   . GLN A 1  502 ? 140.346 88.863  79.111  1.00 62.24  ? 502  GLN A OE1   1 
ATOM   1066  N  NE2   . GLN A 1  502 ? 140.083 87.368  77.456  1.00 62.24  ? 502  GLN A NE2   1 
ATOM   1067  N  N     . ARG A 1  503 ? 135.802 87.349  82.729  1.00 67.24  ? 503  ARG A N     1 
ATOM   1068  C  CA    . ARG A 1  503 ? 135.600 86.247  83.680  1.00 67.24  ? 503  ARG A CA    1 
ATOM   1069  C  C     . ARG A 1  503 ? 136.891 85.476  83.959  1.00 67.24  ? 503  ARG A C     1 
ATOM   1070  O  O     . ARG A 1  503 ? 136.925 84.247  83.885  1.00 67.24  ? 503  ARG A O     1 
ATOM   1071  C  CB    . ARG A 1  503 ? 134.489 85.283  83.234  1.00 67.24  ? 503  ARG A CB    1 
ATOM   1072  C  CG    . ARG A 1  503 ? 133.066 85.710  83.555  1.00 67.24  ? 503  ARG A CG    1 
ATOM   1073  C  CD    . ARG A 1  503 ? 132.512 86.637  82.494  1.00 67.24  ? 503  ARG A CD    1 
ATOM   1074  N  NE    . ARG A 1  503 ? 132.433 85.987  81.190  1.00 67.24  ? 503  ARG A NE    1 
ATOM   1075  C  CZ    . ARG A 1  503 ? 132.221 86.633  80.050  1.00 67.24  ? 503  ARG A CZ    1 
ATOM   1076  N  NH1   . ARG A 1  503 ? 132.062 87.948  80.054  1.00 67.24  ? 503  ARG A NH1   1 
ATOM   1077  N  NH2   . ARG A 1  503 ? 132.166 85.967  78.905  1.00 67.24  ? 503  ARG A NH2   1 
ATOM   1078  N  N     . GLU A 1  504 ? 137.964 86.196  84.298  1.00 55.11  ? 504  GLU A N     1 
ATOM   1079  C  CA    . GLU A 1  504 ? 139.033 85.441  84.940  1.00 55.11  ? 504  GLU A CA    1 
ATOM   1080  C  C     . GLU A 1  504 ? 139.185 85.799  86.419  1.00 55.11  ? 504  GLU A C     1 
ATOM   1081  O  O     . GLU A 1  504 ? 139.815 85.051  87.171  1.00 55.11  ? 504  GLU A O     1 
ATOM   1082  C  CB    . GLU A 1  504 ? 140.375 85.543  84.181  1.00 55.11  ? 504  GLU A CB    1 
ATOM   1083  C  CG    . GLU A 1  504 ? 141.197 86.822  84.114  1.00 55.11  ? 504  GLU A CG    1 
ATOM   1084  C  CD    . GLU A 1  504 ? 141.205 87.481  82.749  1.00 55.11  ? 504  GLU A CD    1 
ATOM   1085  O  OE1   . GLU A 1  504 ? 140.245 87.299  82.009  1.00 55.11  ? 504  GLU A OE1   1 
ATOM   1086  O  OE2   . GLU A 1  504 ? 142.209 88.119  82.374  1.00 55.11  ? 504  GLU A OE2   1 
ATOM   1087  N  N     . ILE A 1  505 ? 138.598 86.903  86.859  1.00 44.70  ? 505  ILE A N     1 
ATOM   1088  C  CA    . ILE A 1  505 ? 138.332 87.133  88.279  1.00 44.70  ? 505  ILE A CA    1 
ATOM   1089  C  C     . ILE A 1  505 ? 136.844 87.422  88.418  1.00 44.70  ? 505  ILE A C     1 
ATOM   1090  O  O     . ILE A 1  505 ? 136.195 87.836  87.443  1.00 44.70  ? 505  ILE A O     1 
ATOM   1091  C  CB    . ILE A 1  505 ? 139.218 88.263  88.857  1.00 44.70  ? 505  ILE A CB    1 
ATOM   1092  C  CG1   . ILE A 1  505 ? 139.100 89.545  88.044  1.00 44.70  ? 505  ILE A CG1   1 
ATOM   1093  C  CG2   . ILE A 1  505 ? 140.641 87.795  89.011  1.00 44.70  ? 505  ILE A CG2   1 
ATOM   1094  C  CD1   . ILE A 1  505 ? 139.775 90.726  88.690  1.00 44.70  ? 505  ILE A CD1   1 
ATOM   1095  N  N     . PRO A 1  506 ? 136.253 87.175  89.594  1.00 38.36  ? 506  PRO A N     1 
ATOM   1096  C  CA    . PRO A 1  506 ? 134.823 87.455  89.762  1.00 38.36  ? 506  PRO A CA    1 
ATOM   1097  C  C     . PRO A 1  506 ? 134.509 88.942  89.721  1.00 38.36  ? 506  PRO A C     1 
ATOM   1098  O  O     . PRO A 1  506 ? 135.387 89.801  89.819  1.00 38.36  ? 506  PRO A O     1 
ATOM   1099  C  CB    . PRO A 1  506 ? 134.499 86.863  91.137  1.00 38.36  ? 506  PRO A CB    1 
ATOM   1100  C  CG    . PRO A 1  506 ? 135.790 86.795  91.838  1.00 38.36  ? 506  PRO A CG    1 
ATOM   1101  C  CD    . PRO A 1  506 ? 136.788 86.474  90.777  1.00 38.36  ? 506  PRO A CD    1 
ATOM   1102  N  N     . ASP A 1  507 ? 133.218 89.224  89.557  1.00 34.82  ? 507  ASP A N     1 
ATOM   1103  C  CA    . ASP A 1  507 ? 132.733 90.588  89.414  1.00 34.82  ? 507  ASP A CA    1 
ATOM   1104  C  C     . ASP A 1  507 ? 132.941 91.365  90.706  1.00 34.82  ? 507  ASP A C     1 
ATOM   1105  O  O     . ASP A 1  507 ? 132.905 90.804  91.802  1.00 34.82  ? 507  ASP A O     1 
ATOM   1106  C  CB    . ASP A 1  507 ? 131.251 90.577  89.046  1.00 34.82  ? 507  ASP A CB    1 
ATOM   1107  C  CG    . ASP A 1  507 ? 130.989 89.914  87.711  1.00 34.82  ? 507  ASP A CG    1 
ATOM   1108  O  OD1   . ASP A 1  507 ? 131.872 89.976  86.830  1.00 34.82  ? 507  ASP A OD1   1 
ATOM   1109  O  OD2   . ASP A 1  507 ? 129.903 89.319  87.546  1.00 34.82  ? 507  ASP A OD2   1 
ATOM   1110  N  N     . PHE A 1  508 ? 133.193 92.664  90.574  1.00 26.07  ? 508  PHE A N     1 
ATOM   1111  C  CA    . PHE A 1  508 ? 133.353 93.502  91.749  1.00 26.07  ? 508  PHE A CA    1 
ATOM   1112  C  C     . PHE A 1  508 ? 132.629 94.820  91.542  1.00 26.07  ? 508  PHE A C     1 
ATOM   1113  O  O     . PHE A 1  508 ? 132.127 95.125  90.459  1.00 26.07  ? 508  PHE A O     1 
ATOM   1114  C  CB    . PHE A 1  508 ? 134.832 93.737  92.103  1.00 26.07  ? 508  PHE A CB    1 
ATOM   1115  C  CG    . PHE A 1  508 ? 135.587 94.565  91.120  1.00 26.07  ? 508  PHE A CG    1 
ATOM   1116  C  CD1   . PHE A 1  508 ? 136.155 93.983  90.006  1.00 26.07  ? 508  PHE A CD1   1 
ATOM   1117  C  CD2   . PHE A 1  508 ? 135.793 95.918  91.346  1.00 26.07  ? 508  PHE A CD2   1 
ATOM   1118  C  CE1   . PHE A 1  508 ? 136.862 94.739  89.114  1.00 26.07  ? 508  PHE A CE1   1 
ATOM   1119  C  CE2   . PHE A 1  508 ? 136.503 96.676  90.454  1.00 26.07  ? 508  PHE A CE2   1 
ATOM   1120  C  CZ    . PHE A 1  508 ? 137.033 96.086  89.340  1.00 26.07  ? 508  PHE A CZ    1 
ATOM   1121  N  N     . LEU A 1  509 ? 132.590 95.602  92.613  1.00 21.13  ? 509  LEU A N     1 
ATOM   1122  C  CA    . LEU A 1  509 ? 131.946 96.903  92.645  1.00 21.13  ? 509  LEU A CA    1 
ATOM   1123  C  C     . LEU A 1  509 ? 132.969 97.927  93.115  1.00 21.13  ? 509  LEU A C     1 
ATOM   1124  O  O     . LEU A 1  509 ? 133.713 97.679  94.067  1.00 21.13  ? 509  LEU A O     1 
ATOM   1125  C  CB    . LEU A 1  509 ? 130.708 96.854  93.555  1.00 21.13  ? 509  LEU A CB    1 
ATOM   1126  C  CG    . LEU A 1  509 ? 129.678 97.978  93.668  1.00 21.13  ? 509  LEU A CG    1 
ATOM   1127  C  CD1   . LEU A 1  509 ? 130.052 98.983  94.722  1.00 21.13  ? 509  LEU A CD1   1 
ATOM   1128  C  CD2   . LEU A 1  509 ? 129.512 98.668  92.327  1.00 21.13  ? 509  LEU A CD2   1 
ATOM   1129  N  N     . TYR A 1  510 ? 133.014 99.068  92.435  1.00 19.23  ? 510  TYR A N     1 
ATOM   1130  C  CA    . TYR A 1  510 ? 134.063 100.062 92.617  1.00 19.23  ? 510  TYR A CA    1 
ATOM   1131  C  C     . TYR A 1  510 ? 133.468 101.370 93.116  1.00 19.23  ? 510  TYR A C     1 
ATOM   1132  O  O     . TYR A 1  510 ? 132.514 101.885 92.526  1.00 19.23  ? 510  TYR A O     1 
ATOM   1133  C  CB    . TYR A 1  510 ? 134.818 100.275 91.306  1.00 19.23  ? 510  TYR A CB    1 
ATOM   1134  C  CG    . TYR A 1  510 ? 135.826 101.391 91.348  1.00 19.23  ? 510  TYR A CG    1 
ATOM   1135  C  CD1   . TYR A 1  510 ? 136.992 101.272 92.088  1.00 19.23  ? 510  TYR A CD1   1 
ATOM   1136  C  CD2   . TYR A 1  510 ? 135.624 102.554 90.620  1.00 19.23  ? 510  TYR A CD2   1 
ATOM   1137  C  CE1   . TYR A 1  510 ? 137.919 102.294 92.125  1.00 19.23  ? 510  TYR A CE1   1 
ATOM   1138  C  CE2   . TYR A 1  510 ? 136.544 103.578 90.646  1.00 19.23  ? 510  TYR A CE2   1 
ATOM   1139  C  CZ    . TYR A 1  510 ? 137.688 103.442 91.400  1.00 19.23  ? 510  TYR A CZ    1 
ATOM   1140  O  OH    . TYR A 1  510 ? 138.606 104.462 91.426  1.00 19.23  ? 510  TYR A OH    1 
ATOM   1141  N  N     . VAL A 1  511 ? 134.030 101.906 94.198  1.00 18.50  ? 511  VAL A N     1 
ATOM   1142  C  CA    . VAL A 1  511 ? 133.517 103.110 94.845  1.00 18.50  ? 511  VAL A CA    1 
ATOM   1143  C  C     . VAL A 1  511 ? 134.633 104.142 94.939  1.00 18.50  ? 511  VAL A C     1 
ATOM   1144  O  O     . VAL A 1  511 ? 135.666 103.893 95.569  1.00 18.50  ? 511  VAL A O     1 
ATOM   1145  C  CB    . VAL A 1  511 ? 132.950 102.816 96.242  1.00 18.50  ? 511  VAL A CB    1 
ATOM   1146  C  CG1   . VAL A 1  511 ? 132.520 104.099 96.908  1.00 18.50  ? 511  VAL A CG1   1 
ATOM   1147  C  CG2   . VAL A 1  511 ? 131.781 101.882 96.156  1.00 18.50  ? 511  VAL A CG2   1 
ATOM   1148  N  N     . GLU A 1  512 ? 134.412 105.302 94.329  1.00 20.31  ? 512  GLU A N     1 
ATOM   1149  C  CA    . GLU A 1  512 ? 135.234 106.483 94.561  1.00 20.31  ? 512  GLU A CA    1 
ATOM   1150  C  C     . GLU A 1  512 ? 134.809 107.150 95.862  1.00 20.31  ? 512  GLU A C     1 
ATOM   1151  O  O     . GLU A 1  512 ? 133.641 107.513 96.022  1.00 20.31  ? 512  GLU A O     1 
ATOM   1152  C  CB    . GLU A 1  512 ? 135.078 107.469 93.407  1.00 20.31  ? 512  GLU A CB    1 
ATOM   1153  C  CG    . GLU A 1  512 ? 135.794 107.122 92.123  1.00 20.31  ? 512  GLU A CG    1 
ATOM   1154  C  CD    . GLU A 1  512 ? 137.261 107.472 92.172  1.00 20.31  ? 512  GLU A CD    1 
ATOM   1155  O  OE1   . GLU A 1  512 ? 137.613 108.445 92.873  1.00 20.31  ? 512  GLU A OE1   1 
ATOM   1156  O  OE2   . GLU A 1  512 ? 138.056 106.800 91.486  1.00 20.31  ? 512  GLU A OE2   1 
ATOM   1157  N  N     . ILE A 1  513 ? 135.748 107.317 96.786  1.00 18.82  ? 513  ILE A N     1 
ATOM   1158  C  CA    . ILE A 1  513 ? 135.554 108.143 97.971  1.00 18.82  ? 513  ILE A CA    1 
ATOM   1159  C  C     . ILE A 1  513 ? 136.642 109.201 97.965  1.00 18.82  ? 513  ILE A C     1 
ATOM   1160  O  O     . ILE A 1  513 ? 137.830 108.875 98.062  1.00 18.82  ? 513  ILE A O     1 
ATOM   1161  C  CB    . ILE A 1  513 ? 135.603 107.327 99.273  1.00 18.82  ? 513  ILE A CB    1 
ATOM   1162  C  CG1   . ILE A 1  513 ? 134.486 106.290 99.312  1.00 18.82  ? 513  ILE A CG1   1 
ATOM   1163  C  CG2   . ILE A 1  513 ? 135.508 108.246 100.477 1.00 18.82  ? 513  ILE A CG2   1 
ATOM   1164  C  CD1   . ILE A 1  513 ? 133.118 106.885 99.306  1.00 18.82  ? 513  ILE A CD1   1 
ATOM   1165  N  N     . ASN A 1  514 ? 136.247 110.459 97.848  1.00 16.81  ? 514  ASN A N     1 
ATOM   1166  C  CA    . ASN A 1  514 ? 137.186 111.565 97.912  1.00 16.81  ? 514  ASN A CA    1 
ATOM   1167  C  C     . ASN A 1  514 ? 136.910 112.346 99.186  1.00 16.81  ? 514  ASN A C     1 
ATOM   1168  O  O     . ASN A 1  514 ? 135.768 112.729 99.448  1.00 16.81  ? 514  ASN A O     1 
ATOM   1169  C  CB    . ASN A 1  514 ? 137.072 112.456 96.675  1.00 16.81  ? 514  ASN A CB    1 
ATOM   1170  C  CG    . ASN A 1  514 ? 138.248 113.397 96.520  1.00 16.81  ? 514  ASN A CG    1 
ATOM   1171  O  OD1   . ASN A 1  514 ? 139.118 113.473 97.380  1.00 16.81  ? 514  ASN A OD1   1 
ATOM   1172  N  ND2   . ASN A 1  514 ? 138.298 114.092 95.397  1.00 16.81  ? 514  ASN A ND2   1 
ATOM   1173  N  N     . GLY A 1  515 ? 137.957 112.557 99.982  1.00 15.10  ? 515  GLY A N     1 
ATOM   1174  C  CA    . GLY A 1  515 ? 137.781 113.191 101.274 1.00 15.10  ? 515  GLY A CA    1 
ATOM   1175  C  C     . GLY A 1  515 ? 137.504 114.674 101.183 1.00 15.10  ? 515  GLY A C     1 
ATOM   1176  O  O     . GLY A 1  515 ? 136.865 115.243 102.071 1.00 15.10  ? 515  GLY A O     1 
ATOM   1177  N  N     . LEU A 1  516 ? 137.973 115.318 100.124 1.00 15.85  ? 516  LEU A N     1 
ATOM   1178  C  CA    . LEU A 1  516 ? 137.710 116.729 99.899  1.00 15.85  ? 516  LEU A CA    1 
ATOM   1179  C  C     . LEU A 1  516 ? 136.495 116.973 99.020  1.00 15.85  ? 516  LEU A C     1 
ATOM   1180  O  O     . LEU A 1  516 ? 136.174 118.131 98.745  1.00 15.85  ? 516  LEU A O     1 
ATOM   1181  C  CB    . LEU A 1  516 ? 138.939 117.401 99.292  1.00 15.85  ? 516  LEU A CB    1 
ATOM   1182  C  CG    . LEU A 1  516 ? 140.090 117.647 100.258 1.00 15.85  ? 516  LEU A CG    1 
ATOM   1183  C  CD1   . LEU A 1  516 ? 141.322 118.098 99.529  1.00 15.85  ? 516  LEU A CD1   1 
ATOM   1184  C  CD2   . LEU A 1  516 ? 139.669 118.708 101.248 1.00 15.85  ? 516  LEU A CD2   1 
ATOM   1185  N  N     . LYS A 1  517 ? 135.812 115.921 98.573  1.00 16.08  ? 517  LYS A N     1 
ATOM   1186  C  CA    . LYS A 1  517 ? 134.511 116.060 97.939  1.00 16.08  ? 517  LYS A CA    1 
ATOM   1187  C  C     . LYS A 1  517 ? 133.375 115.786 98.908  1.00 16.08  ? 517  LYS A C     1 
ATOM   1188  O  O     . LYS A 1  517 ? 132.239 115.566 98.481  1.00 16.08  ? 517  LYS A O     1 
ATOM   1189  C  CB    . LYS A 1  517 ? 134.402 115.146 96.722  1.00 16.08  ? 517  LYS A CB    1 
ATOM   1190  C  CG    . LYS A 1  517 ? 135.235 115.606 95.559  1.00 16.08  ? 517  LYS A CG    1 
ATOM   1191  C  CD    . LYS A 1  517 ? 135.013 114.756 94.334  1.00 16.08  ? 517  LYS A CD    1 
ATOM   1192  C  CE    . LYS A 1  517 ? 135.853 115.269 93.183  1.00 16.08  ? 517  LYS A CE    1 
ATOM   1193  N  NZ    . LYS A 1  517 ? 135.681 114.455 91.956  1.00 16.08  ? 517  LYS A NZ    1 
ATOM   1194  N  N     . MET A 1  518 ? 133.660 115.799 100.203 1.00 21.65  ? 518  MET A N     1 
ATOM   1195  C  CA    . MET A 1  518 ? 132.666 115.598 101.241 1.00 21.65  ? 518  MET A CA    1 
ATOM   1196  C  C     . MET A 1  518 ? 132.513 116.888 102.031 1.00 21.65  ? 518  MET A C     1 
ATOM   1197  O  O     . MET A 1  518 ? 133.490 117.612 102.243 1.00 21.65  ? 518  MET A O     1 
ATOM   1198  C  CB    . MET A 1  518 ? 133.076 114.468 102.187 1.00 21.65  ? 518  MET A CB    1 
ATOM   1199  C  CG    . MET A 1  518 ? 133.277 113.111 101.551 1.00 21.65  ? 518  MET A CG    1 
ATOM   1200  S  SD    . MET A 1  518 ? 131.796 112.444 100.783 1.00 21.65  ? 518  MET A SD    1 
ATOM   1201  C  CE    . MET A 1  518 ? 132.478 111.022 99.935  1.00 21.65  ? 518  MET A CE    1 
ATOM   1202  N  N     . VAL A 1  519 ? 131.288 117.177 102.464 1.00 20.97  ? 519  VAL A N     1 
ATOM   1203  C  CA    . VAL A 1  519 ? 131.065 118.319 103.347 1.00 20.97  ? 519  VAL A CA    1 
ATOM   1204  C  C     . VAL A 1  519 ? 131.594 118.017 104.742 1.00 20.97  ? 519  VAL A C     1 
ATOM   1205  O  O     . VAL A 1  519 ? 132.445 118.738 105.274 1.00 20.97  ? 519  VAL A O     1 
ATOM   1206  C  CB    . VAL A 1  519 ? 129.574 118.689 103.383 1.00 20.97  ? 519  VAL A CB    1 
ATOM   1207  C  CG1   . VAL A 1  519 ? 129.317 119.706 104.471 1.00 20.97  ? 519  VAL A CG1   1 
ATOM   1208  C  CG2   . VAL A 1  519 ? 129.153 119.235 102.046 1.00 20.97  ? 519  VAL A CG2   1 
ATOM   1209  N  N     . LYS A 1  520 ? 131.102 116.965 105.342 1.00 23.87  ? 520  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1  520 ? 131.475 116.372 106.609 1.00 23.87  ? 520  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1  520 ? 132.467 115.246 106.376 1.00 23.87  ? 520  LYS A C     1 
ATOM   1212  O  O     . LYS A 1  520 ? 132.430 114.599 105.330 1.00 23.87  ? 520  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1  520 ? 130.250 115.796 107.317 1.00 23.87  ? 520  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1  520 ? 129.216 116.789 107.751 1.00 23.87  ? 520  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1  520 ? 128.085 116.036 108.406 1.00 23.87  ? 520  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1  520 ? 126.964 116.947 108.824 1.00 23.87  ? 520  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1  520 ? 125.856 116.166 109.441 1.00 23.87  ? 520  LYS A NZ    1 
ATOM   1218  N  N     . PRO A 1  521 ? 133.370 114.966 107.319 1.00 24.30  ? 521  PRO A N     1 
ATOM   1219  C  CA    . PRO A 1  521 ? 134.206 113.768 107.170 1.00 24.30  ? 521  PRO A CA    1 
ATOM   1220  C  C     . PRO A 1  521 ? 133.414 112.481 107.281 1.00 24.30  ? 521  PRO A C     1 
ATOM   1221  O  O     . PRO A 1  521 ? 133.769 111.490 106.636 1.00 24.30  ? 521  PRO A O     1 
ATOM   1222  C  CB    . PRO A 1  521 ? 135.229 113.911 108.302 1.00 24.30  ? 521  PRO A CB    1 
ATOM   1223  C  CG    . PRO A 1  521 ? 134.556 114.765 109.308 1.00 24.30  ? 521  PRO A CG    1 
ATOM   1224  C  CD    . PRO A 1  521 ? 133.709 115.726 108.533 1.00 24.30  ? 521  PRO A CD    1 
ATOM   1225  N  N     . THR A 1  522 ? 132.314 112.484 108.029 1.00 22.65  ? 522  THR A N     1 
ATOM   1226  C  CA    . THR A 1  522 ? 131.499 111.295 108.238 1.00 22.65  ? 522  THR A CA    1 
ATOM   1227  C  C     . THR A 1  522 ? 130.580 110.971 107.067 1.00 22.65  ? 522  THR A C     1 
ATOM   1228  O  O     . THR A 1  522 ? 129.793 110.027 107.171 1.00 22.65  ? 522  THR A O     1 
ATOM   1229  C  CB    . THR A 1  522 ? 130.663 111.459 109.505 1.00 22.65  ? 522  THR A CB    1 
ATOM   1230  O  OG1   . THR A 1  522 ? 129.817 112.606 109.373 1.00 22.65  ? 522  THR A OG1   1 
ATOM   1231  C  CG2   . THR A 1  522 ? 131.564 111.649 110.698 1.00 22.65  ? 522  THR A CG2   1 
ATOM   1232  N  N     . ASP A 1  523 ? 130.655 111.710 105.963 1.00 25.76  ? 523  ASP A N     1 
ATOM   1233  C  CA    . ASP A 1  523 ? 129.828 111.419 104.802 1.00 25.76  ? 523  ASP A CA    1 
ATOM   1234  C  C     . ASP A 1  523 ? 130.360 110.269 103.966 1.00 25.76  ? 523  ASP A C     1 
ATOM   1235  O  O     . ASP A 1  523 ? 129.686 109.859 103.019 1.00 25.76  ? 523  ASP A O     1 
ATOM   1236  C  CB    . ASP A 1  523 ? 129.703 112.650 103.911 1.00 25.76  ? 523  ASP A CB    1 
ATOM   1237  C  CG    . ASP A 1  523 ? 128.934 113.761 104.564 1.00 25.76  ? 523  ASP A CG    1 
ATOM   1238  O  OD1   . ASP A 1  523 ? 128.059 113.469 105.403 1.00 25.76  ? 523  ASP A OD1   1 
ATOM   1239  O  OD2   . ASP A 1  523 ? 129.210 114.931 104.237 1.00 25.76  ? 523  ASP A OD2   1 
ATOM   1240  N  N     . CYS A 1  524 ? 131.552 109.754 104.271 1.00 26.96  ? 524  CYS A N     1 
ATOM   1241  C  CA    . CYS A 1  524 ? 132.066 108.615 103.524 1.00 26.96  ? 524  CYS A CA    1 
ATOM   1242  C  C     . CYS A 1  524 ? 131.337 107.341 103.905 1.00 26.96  ? 524  CYS A C     1 
ATOM   1243  O  O     . CYS A 1  524 ? 131.224 106.424 103.084 1.00 26.96  ? 524  CYS A O     1 
ATOM   1244  C  CB    . CYS A 1  524 ? 133.542 108.415 103.804 1.00 26.96  ? 524  CYS A CB    1 
ATOM   1245  S  SG    . CYS A 1  524 ? 133.719 107.640 105.388 1.00 26.96  ? 524  CYS A SG    1 
ATOM   1246  N  N     . TYR A 1  525 ? 130.884 107.250 105.158 1.00 24.34  ? 525  TYR A N     1 
ATOM   1247  C  CA    . TYR A 1  525 ? 130.071 106.117 105.577 1.00 24.34  ? 525  TYR A CA    1 
ATOM   1248  C  C     . TYR A 1  525 ? 128.738 106.111 104.851 1.00 24.34  ? 525  TYR A C     1 
ATOM   1249  O  O     . TYR A 1  525 ? 128.254 105.051 104.441 1.00 24.34  ? 525  TYR A O     1 
ATOM   1250  C  CB    . TYR A 1  525 ? 129.829 106.156 107.081 1.00 24.34  ? 525  TYR A CB    1 
ATOM   1251  C  CG    . TYR A 1  525 ? 131.054 105.992 107.931 1.00 24.34  ? 525  TYR A CG    1 
ATOM   1252  C  CD1   . TYR A 1  525 ? 131.690 104.767 108.021 1.00 24.34  ? 525  TYR A CD1   1 
ATOM   1253  C  CD2   . TYR A 1  525 ? 131.534 107.042 108.696 1.00 24.34  ? 525  TYR A CD2   1 
ATOM   1254  C  CE1   . TYR A 1  525 ? 132.798 104.600 108.814 1.00 24.34  ? 525  TYR A CE1   1 
ATOM   1255  C  CE2   . TYR A 1  525 ? 132.640 106.885 109.497 1.00 24.34  ? 525  TYR A CE2   1 
ATOM   1256  C  CZ    . TYR A 1  525 ? 133.267 105.662 109.552 1.00 24.34  ? 525  TYR A CZ    1 
ATOM   1257  O  OH    . TYR A 1  525 ? 134.370 105.500 110.350 1.00 24.34  ? 525  TYR A OH    1 
ATOM   1258  N  N     . GLU A 1  526 ? 128.138 107.292 104.689 1.00 23.58  ? 526  GLU A N     1 
ATOM   1259  C  CA    . GLU A 1  526 ? 126.869 107.405 103.984 1.00 23.58  ? 526  GLU A CA    1 
ATOM   1260  C  C     . GLU A 1  526 ? 127.024 107.057 102.514 1.00 23.58  ? 526  GLU A C     1 
ATOM   1261  O  O     . GLU A 1  526 ? 126.202 106.324 101.957 1.00 23.58  ? 526  GLU A O     1 
ATOM   1262  C  CB    . GLU A 1  526 ? 126.318 108.820 104.112 1.00 23.58  ? 526  GLU A CB    1 
ATOM   1263  C  CG    . GLU A 1  526 ? 126.004 109.262 105.509 1.00 23.58  ? 526  GLU A CG    1 
ATOM   1264  C  CD    . GLU A 1  526 ? 125.447 110.664 105.535 1.00 23.58  ? 526  GLU A CD    1 
ATOM   1265  O  OE1   . GLU A 1  526 ? 125.402 111.300 104.463 1.00 23.58  ? 526  GLU A OE1   1 
ATOM   1266  O  OE2   . GLU A 1  526 ? 125.059 111.139 106.620 1.00 23.58  ? 526  GLU A OE2   1 
ATOM   1267  N  N     . THR A 1  527 ? 128.076 107.564 101.874 1.00 22.53  ? 527  THR A N     1 
ATOM   1268  C  CA    . THR A 1  527 ? 128.234 107.369 100.441 1.00 22.53  ? 527  THR A CA    1 
ATOM   1269  C  C     . THR A 1  527 ? 128.701 105.967 100.090 1.00 22.53  ? 527  THR A C     1 
ATOM   1270  O  O     . THR A 1  527 ? 128.342 105.465 99.024  1.00 22.53  ? 527  THR A O     1 
ATOM   1271  C  CB    . THR A 1  527 ? 129.204 108.397 99.863  1.00 22.53  ? 527  THR A CB    1 
ATOM   1272  O  OG1   . THR A 1  527 ? 130.435 108.354 100.589 1.00 22.53  ? 527  THR A OG1   1 
ATOM   1273  C  CG2   . THR A 1  527 ? 128.607 109.796 99.923  1.00 22.53  ? 527  THR A CG2   1 
ATOM   1274  N  N     . LEU A 1  528 ? 129.489 105.316 100.949 1.00 20.03  ? 528  LEU A N     1 
ATOM   1275  C  CA    . LEU A 1  528 ? 129.883 103.940 100.662 1.00 20.03  ? 528  LEU A CA    1 
ATOM   1276  C  C     . LEU A 1  528 ? 128.701 102.994 100.803 1.00 20.03  ? 528  LEU A C     1 
ATOM   1277  O  O     . LEU A 1  528 ? 128.449 102.171 99.918  1.00 20.03  ? 528  LEU A O     1 
ATOM   1278  C  CB    . LEU A 1  528 ? 131.027 103.492 101.568 1.00 20.03  ? 528  LEU A CB    1 
ATOM   1279  C  CG    . LEU A 1  528 ? 131.454 102.044 101.304 1.00 20.03  ? 528  LEU A CG    1 
ATOM   1280  C  CD1   . LEU A 1  528 ? 131.957 101.873 99.889  1.00 20.03  ? 528  LEU A CD1   1 
ATOM   1281  C  CD2   . LEU A 1  528 ? 132.498 101.584 102.287 1.00 20.03  ? 528  LEU A CD2   1 
ATOM   1282  N  N     . TRP A 1  529 ? 127.952 103.115 101.900 1.00 20.92  ? 529  TRP A N     1 
ATOM   1283  C  CA    . TRP A 1  529 ? 126.802 102.246 102.116 1.00 20.92  ? 529  TRP A CA    1 
ATOM   1284  C  C     . TRP A 1  529 ? 125.685 102.517 101.113 1.00 20.92  ? 529  TRP A C     1 
ATOM   1285  O  O     . TRP A 1  529 ? 124.915 101.608 100.789 1.00 20.92  ? 529  TRP A O     1 
ATOM   1286  C  CB    . TRP A 1  529 ? 126.311 102.394 103.558 1.00 20.92  ? 529  TRP A CB    1 
ATOM   1287  C  CG    . TRP A 1  529 ? 125.081 101.618 103.843 1.00 20.92  ? 529  TRP A CG    1 
ATOM   1288  C  CD1   . TRP A 1  529 ? 123.840 102.119 104.071 1.00 20.92  ? 529  TRP A CD1   1 
ATOM   1289  C  CD2   . TRP A 1  529 ? 124.949 100.194 103.855 1.00 20.92  ? 529  TRP A CD2   1 
ATOM   1290  N  NE1   . TRP A 1  529 ? 122.945 101.101 104.257 1.00 20.92  ? 529  TRP A NE1   1 
ATOM   1291  C  CE2   . TRP A 1  529 ? 123.602 99.907  104.124 1.00 20.92  ? 529  TRP A CE2   1 
ATOM   1292  C  CE3   . TRP A 1  529 ? 125.840 99.134  103.672 1.00 20.92  ? 529  TRP A CE3   1 
ATOM   1293  C  CZ2   . TRP A 1  529 ? 123.127 98.611  104.220 1.00 20.92  ? 529  TRP A CZ2   1 
ATOM   1294  C  CZ3   . TRP A 1  529 ? 125.365 97.849  103.767 1.00 20.92  ? 529  TRP A CZ3   1 
ATOM   1295  C  CH2   . TRP A 1  529 ? 124.023 97.597  104.038 1.00 20.92  ? 529  TRP A CH2   1 
ATOM   1296  N  N     . ASN A 1  530 ? 125.606 103.736 100.580 1.00 24.77  ? 530  ASN A N     1 
ATOM   1297  C  CA    . ASN A 1  530 ? 124.649 104.012 99.514  1.00 24.77  ? 530  ASN A CA    1 
ATOM   1298  C  C     . ASN A 1  530 ? 125.059 103.326 98.215  1.00 24.77  ? 530  ASN A C     1 
ATOM   1299  O  O     . ASN A 1  530 ? 124.202 102.853 97.465  1.00 24.77  ? 530  ASN A O     1 
ATOM   1300  C  CB    . ASN A 1  530 ? 124.522 105.517 99.298  1.00 24.77  ? 530  ASN A CB    1 
ATOM   1301  C  CG    . ASN A 1  530 ? 123.294 105.895 98.504  1.00 24.77  ? 530  ASN A CG    1 
ATOM   1302  O  OD1   . ASN A 1  530 ? 122.465 105.053 98.175  1.00 24.77  ? 530  ASN A OD1   1 
ATOM   1303  N  ND2   . ASN A 1  530 ? 123.181 107.173 98.175  1.00 24.77  ? 530  ASN A ND2   1 
ATOM   1304  N  N     . LYS A 1  531 ? 126.361 103.270 97.923  1.00 23.55  ? 531  LYS A N     1 
ATOM   1305  C  CA    . LYS A 1  531 ? 126.798 102.605 96.699  1.00 23.55  ? 531  LYS A CA    1 
ATOM   1306  C  C     . LYS A 1  531 ? 126.705 101.093 96.821  1.00 23.55  ? 531  LYS A C     1 
ATOM   1307  O  O     . LYS A 1  531 ? 126.444 100.410 95.824  1.00 23.55  ? 531  LYS A O     1 
ATOM   1308  C  CB    . LYS A 1  531 ? 128.226 103.007 96.338  1.00 23.55  ? 531  LYS A CB    1 
ATOM   1309  C  CG    . LYS A 1  531 ? 128.411 104.465 95.983  1.00 23.55  ? 531  LYS A CG    1 
ATOM   1310  C  CD    . LYS A 1  531 ? 127.698 104.843 94.712  1.00 23.55  ? 531  LYS A CD    1 
ATOM   1311  C  CE    . LYS A 1  531 ? 127.974 106.289 94.366  1.00 23.55  ? 531  LYS A CE    1 
ATOM   1312  N  NZ    . LYS A 1  531 ? 127.244 106.705 93.144  1.00 23.55  ? 531  LYS A NZ    1 
ATOM   1313  N  N     . VAL A 1  532 ? 126.923 100.555 98.021  1.00 26.43  ? 532  VAL A N     1 
ATOM   1314  C  CA    . VAL A 1  532 ? 126.780 99.119  98.236  1.00 26.43  ? 532  VAL A CA    1 
ATOM   1315  C  C     . VAL A 1  532 ? 125.318 98.709  98.139  1.00 26.43  ? 532  VAL A C     1 
ATOM   1316  O  O     . VAL A 1  532 ? 124.962 97.790  97.394  1.00 26.43  ? 532  VAL A O     1 
ATOM   1317  C  CB    . VAL A 1  532 ? 127.381 98.717  99.595  1.00 26.43  ? 532  VAL A CB    1 
ATOM   1318  C  CG1   . VAL A 1  532 ? 127.077 97.268  99.897  1.00 26.43  ? 532  VAL A CG1   1 
ATOM   1319  C  CG2   . VAL A 1  532 ? 128.872 98.934  99.601  1.00 26.43  ? 532  VAL A CG2   1 
ATOM   1320  N  N     . SER A 1  533 ? 124.447 99.401  98.868  1.00 29.18  ? 533  SER A N     1 
ATOM   1321  C  CA    . SER A 1  533 ? 123.113 98.893  99.133  1.00 29.18  ? 533  SER A CA    1 
ATOM   1322  C  C     . SER A 1  533 ? 121.985 99.678  98.482  1.00 29.18  ? 533  SER A C     1 
ATOM   1323  O  O     . SER A 1  533 ? 120.853 99.185  98.465  1.00 29.18  ? 533  SER A O     1 
ATOM   1324  C  CB    . SER A 1  533 ? 122.863 98.854  100.641 1.00 29.18  ? 533  SER A CB    1 
ATOM   1325  O  OG    . SER A 1  533 ? 122.782 100.166 101.154 1.00 29.18  ? 533  SER A OG    1 
ATOM   1326  N  N     . GLY A 1  534 ? 122.240 100.877 97.968  1.00 34.47  ? 534  GLY A N     1 
ATOM   1327  C  CA    . GLY A 1  534 ? 121.153 101.680 97.447  1.00 34.47  ? 534  GLY A CA    1 
ATOM   1328  C  C     . GLY A 1  534 ? 120.262 102.300 98.495  1.00 34.47  ? 534  GLY A C     1 
ATOM   1329  O  O     . GLY A 1  534 ? 119.197 102.820 98.154  1.00 34.47  ? 534  GLY A O     1 
ATOM   1330  N  N     . GLU A 1  535 ? 120.670 102.272 99.758  1.00 34.55  ? 535  GLU A N     1 
ATOM   1331  C  CA    . GLU A 1  535 ? 119.864 102.748 100.869 1.00 34.55  ? 535  GLU A CA    1 
ATOM   1332  C  C     . GLU A 1  535 ? 120.460 104.030 101.425 1.00 34.55  ? 535  GLU A C     1 
ATOM   1333  O  O     . GLU A 1  535 ? 121.681 104.164 101.530 1.00 34.55  ? 535  GLU A O     1 
ATOM   1334  C  CB    . GLU A 1  535 ? 119.786 101.692 101.969 1.00 34.55  ? 535  GLU A CB    1 
ATOM   1335  C  CG    . GLU A 1  535 ? 119.069 100.424 101.556 1.00 34.55  ? 535  GLU A CG    1 
ATOM   1336  C  CD    . GLU A 1  535 ? 119.063 99.382  102.652 1.00 34.55  ? 535  GLU A CD    1 
ATOM   1337  O  OE1   . GLU A 1  535 ? 119.705 99.618  103.696 1.00 34.55  ? 535  GLU A OE1   1 
ATOM   1338  O  OE2   . GLU A 1  535 ? 118.428 98.324  102.463 1.00 34.55  ? 535  GLU A OE2   1 
ATOM   1339  N  N     . ARG A 1  536 ? 119.595 104.966 101.788 1.00 29.00  ? 536  ARG A N     1 
ATOM   1340  C  CA    . ARG A 1  536 ? 120.012 106.252 102.329 1.00 29.00  ? 536  ARG A CA    1 
ATOM   1341  C  C     . ARG A 1  536 ? 119.805 106.227 103.834 1.00 29.00  ? 536  ARG A C     1 
ATOM   1342  O  O     . ARG A 1  536 ? 118.669 106.284 104.313 1.00 29.00  ? 536  ARG A O     1 
ATOM   1343  C  CB    . ARG A 1  536 ? 119.229 107.388 101.686 1.00 29.00  ? 536  ARG A CB    1 
ATOM   1344  C  CG    . ARG A 1  536 ? 119.532 107.590 100.222 1.00 29.00  ? 536  ARG A CG    1 
ATOM   1345  C  CD    . ARG A 1  536 ? 118.648 108.679 99.685  1.00 29.00  ? 536  ARG A CD    1 
ATOM   1346  N  NE    . ARG A 1  536 ? 118.951 109.955 100.318 1.00 29.00  ? 536  ARG A NE    1 
ATOM   1347  C  CZ    . ARG A 1  536 ? 118.162 111.021 100.263 1.00 29.00  ? 536  ARG A CZ    1 
ATOM   1348  N  NH1   . ARG A 1  536 ? 117.007 110.965 99.619  1.00 29.00  ? 536  ARG A NH1   1 
ATOM   1349  N  NH2   . ARG A 1  536 ? 118.522 112.137 100.871 1.00 29.00  ? 536  ARG A NH2   1 
ATOM   1350  N  N     . LEU A 1  537 ? 120.902 106.131 104.573 1.00 22.82  ? 537  LEU A N     1 
ATOM   1351  C  CA    . LEU A 1  537 ? 120.882 106.107 106.025 1.00 22.82  ? 537  LEU A CA    1 
ATOM   1352  C  C     . LEU A 1  537 ? 121.792 107.209 106.536 1.00 22.82  ? 537  LEU A C     1 
ATOM   1353  O  O     . LEU A 1  537 ? 122.605 107.759 105.793 1.00 22.82  ? 537  LEU A O     1 
ATOM   1354  C  CB    . LEU A 1  537 ? 121.336 104.747 106.574 1.00 22.82  ? 537  LEU A CB    1 
ATOM   1355  C  CG    . LEU A 1  537 ? 120.373 103.569 106.729 1.00 22.82  ? 537  LEU A CG    1 
ATOM   1356  C  CD1   . LEU A 1  537 ? 119.881 103.038 105.414 1.00 22.82  ? 537  LEU A CD1   1 
ATOM   1357  C  CD2   . LEU A 1  537 ? 121.084 102.467 107.461 1.00 22.82  ? 537  LEU A CD2   1 
ATOM   1358  N  N     . THR A 1  538 ? 121.657 107.523 107.821 1.00 20.35  ? 538  THR A N     1 
ATOM   1359  C  CA    . THR A 1  538 ? 122.568 108.465 108.450 1.00 20.35  ? 538  THR A CA    1 
ATOM   1360  C  C     . THR A 1  538 ? 123.926 107.800 108.645 1.00 20.35  ? 538  THR A C     1 
ATOM   1361  O  O     . THR A 1  538 ? 124.096 106.603 108.415 1.00 20.35  ? 538  THR A O     1 
ATOM   1362  C  CB    . THR A 1  538 ? 121.999 108.956 109.774 1.00 20.35  ? 538  THR A CB    1 
ATOM   1363  O  OG1   . THR A 1  538 ? 121.882 107.856 110.682 1.00 20.35  ? 538  THR A OG1   1 
ATOM   1364  C  CG2   . THR A 1  538 ? 120.634 109.561 109.559 1.00 20.35  ? 538  THR A CG2   1 
ATOM   1365  N  N     . TRP A 1  539 ? 124.915 108.576 109.087 1.00 21.52  ? 539  TRP A N     1 
ATOM   1366  C  CA    . TRP A 1  539 ? 126.264 108.028 109.113 1.00 21.52  ? 539  TRP A CA    1 
ATOM   1367  C  C     . TRP A 1  539 ? 126.459 107.067 110.276 1.00 21.52  ? 539  TRP A C     1 
ATOM   1368  O  O     . TRP A 1  539 ? 127.204 106.091 110.148 1.00 21.52  ? 539  TRP A O     1 
ATOM   1369  C  CB    . TRP A 1  539 ? 127.309 109.146 109.163 1.00 21.52  ? 539  TRP A CB    1 
ATOM   1370  C  CG    . TRP A 1  539 ? 127.419 109.847 110.466 1.00 21.52  ? 539  TRP A CG    1 
ATOM   1371  C  CD1   . TRP A 1  539 ? 126.763 110.968 110.856 1.00 21.52  ? 539  TRP A CD1   1 
ATOM   1372  C  CD2   . TRP A 1  539 ? 128.247 109.461 111.563 1.00 21.52  ? 539  TRP A CD2   1 
ATOM   1373  N  NE1   . TRP A 1  539 ? 127.130 111.307 112.135 1.00 21.52  ? 539  TRP A NE1   1 
ATOM   1374  C  CE2   . TRP A 1  539 ? 128.037 110.388 112.589 1.00 21.52  ? 539  TRP A CE2   1 
ATOM   1375  C  CE3   . TRP A 1  539 ? 129.139 108.406 111.777 1.00 21.52  ? 539  TRP A CE3   1 
ATOM   1376  C  CZ2   . TRP A 1  539 ? 128.688 110.299 113.804 1.00 21.52  ? 539  TRP A CZ2   1 
ATOM   1377  C  CZ3   . TRP A 1  539 ? 129.772 108.318 112.975 1.00 21.52  ? 539  TRP A CZ3   1 
ATOM   1378  C  CH2   . TRP A 1  539 ? 129.546 109.255 113.976 1.00 21.52  ? 539  TRP A CH2   1 
ATOM   1379  N  N     . ALA A 1  540 ? 125.814 107.329 111.414 1.00 18.83  ? 540  ALA A N     1 
ATOM   1380  C  CA    . ALA A 1  540 ? 125.905 106.428 112.553 1.00 18.83  ? 540  ALA A CA    1 
ATOM   1381  C  C     . ALA A 1  540 ? 125.150 105.137 112.307 1.00 18.83  ? 540  ALA A C     1 
ATOM   1382  O  O     . ALA A 1  540 ? 125.442 104.130 112.952 1.00 18.83  ? 540  ALA A O     1 
ATOM   1383  C  CB    . ALA A 1  540 ? 125.372 107.112 113.809 1.00 18.83  ? 540  ALA A CB    1 
ATOM   1384  N  N     . ALA A 1  541 ? 124.181 105.152 111.400 1.00 18.68  ? 541  ALA A N     1 
ATOM   1385  C  CA    . ALA A 1  541 ? 123.522 103.940 110.952 1.00 18.68  ? 541  ALA A CA    1 
ATOM   1386  C  C     . ALA A 1  541 ? 124.206 103.309 109.754 1.00 18.68  ? 541  ALA A C     1 
ATOM   1387  O  O     . ALA A 1  541 ? 123.953 102.138 109.464 1.00 18.68  ? 541  ALA A O     1 
ATOM   1388  C  CB    . ALA A 1  541 ? 122.066 104.235 110.600 1.00 18.68  ? 541  ALA A CB    1 
ATOM   1389  N  N     . SER A 1  542 ? 125.059 104.055 109.049 1.00 19.57  ? 542  SER A N     1 
ATOM   1390  C  CA    . SER A 1  542 ? 125.755 103.494 107.899 1.00 19.57  ? 542  SER A CA    1 
ATOM   1391  C  C     . SER A 1  542 ? 126.991 102.713 108.300 1.00 19.57  ? 542  SER A C     1 
ATOM   1392  O  O     . SER A 1  542 ? 127.331 101.730 107.637 1.00 19.57  ? 542  SER A O     1 
ATOM   1393  C  CB    . SER A 1  542 ? 126.154 104.594 106.923 1.00 19.57  ? 542  SER A CB    1 
ATOM   1394  O  OG    . SER A 1  542 ? 125.015 105.218 106.369 1.00 19.57  ? 542  SER A OG    1 
ATOM   1395  N  N     . MET A 1  543 ? 127.683 103.126 109.359 1.00 24.33  ? 543  MET A N     1 
ATOM   1396  C  CA    . MET A 1  543 ? 128.854 102.365 109.765 1.00 24.33  ? 543  MET A CA    1 
ATOM   1397  C  C     . MET A 1  543 ? 128.474 101.091 110.502 1.00 24.33  ? 543  MET A C     1 
ATOM   1398  O  O     . MET A 1  543 ? 129.241 100.127 110.481 1.00 24.33  ? 543  MET A O     1 
ATOM   1399  C  CB    . MET A 1  543 ? 129.788 103.216 110.621 1.00 24.33  ? 543  MET A CB    1 
ATOM   1400  C  CG    . MET A 1  543 ? 129.237 103.668 111.943 1.00 24.33  ? 543  MET A CG    1 
ATOM   1401  S  SD    . MET A 1  543 ? 130.492 104.562 112.861 1.00 24.33  ? 543  MET A SD    1 
ATOM   1402  C  CE    . MET A 1  543 ? 131.574 103.212 113.307 1.00 24.33  ? 543  MET A CE    1 
ATOM   1403  N  N     . GLU A 1  544 ? 127.305 101.051 111.141 1.00 25.87  ? 544  GLU A N     1 
ATOM   1404  C  CA    . GLU A 1  544 ? 126.850 99.791  111.707 1.00 25.87  ? 544  GLU A CA    1 
ATOM   1405  C  C     . GLU A 1  544 ? 126.289 98.893  110.623 1.00 25.87  ? 544  GLU A C     1 
ATOM   1406  O  O     . GLU A 1  544 ? 126.308 97.666  110.759 1.00 25.87  ? 544  GLU A O     1 
ATOM   1407  C  CB    . GLU A 1  544 ? 125.789 100.033 112.777 1.00 25.87  ? 544  GLU A CB    1 
ATOM   1408  C  CG    . GLU A 1  544 ? 126.182 101.093 113.775 1.00 25.87  ? 544  GLU A CG    1 
ATOM   1409  C  CD    . GLU A 1  544 ? 127.481 100.809 114.488 1.00 25.87  ? 544  GLU A CD    1 
ATOM   1410  O  OE1   . GLU A 1  544 ? 127.746 99.647  114.864 1.00 25.87  ? 544  GLU A OE1   1 
ATOM   1411  O  OE2   . GLU A 1  544 ? 128.267 101.766 114.628 1.00 25.87  ? 544  GLU A OE2   1 
ATOM   1412  N  N     . SER A 1  545 ? 125.783 99.497  109.552 1.00 22.20  ? 545  SER A N     1 
ATOM   1413  C  CA    . SER A 1  545 ? 125.344 98.734  108.396 1.00 22.20  ? 545  SER A CA    1 
ATOM   1414  C  C     . SER A 1  545 ? 126.526 98.116  107.672 1.00 22.20  ? 545  SER A C     1 
ATOM   1415  O  O     . SER A 1  545 ? 126.458 96.963  107.239 1.00 22.20  ? 545  SER A O     1 
ATOM   1416  C  CB    . SER A 1  545 ? 124.559 99.638  107.458 1.00 22.20  ? 545  SER A CB    1 
ATOM   1417  O  OG    . SER A 1  545 ? 123.403 100.127 108.107 1.00 22.20  ? 545  SER A OG    1 
ATOM   1418  N  N     . LEU A 1  546 ? 127.620 98.867  107.538 1.00 20.86  ? 546  LEU A N     1 
ATOM   1419  C  CA    . LEU A 1  546 ? 128.807 98.344  106.873 1.00 20.86  ? 546  LEU A CA    1 
ATOM   1420  C  C     . LEU A 1  546 ? 129.526 97.318  107.736 1.00 20.86  ? 546  LEU A C     1 
ATOM   1421  O  O     . LEU A 1  546 ? 130.022 96.313  107.220 1.00 20.86  ? 546  LEU A O     1 
ATOM   1422  C  CB    . LEU A 1  546 ? 129.748 99.488  106.502 1.00 20.86  ? 546  LEU A CB    1 
ATOM   1423  C  CG    . LEU A 1  546 ? 129.333 100.381 105.339 1.00 20.86  ? 546  LEU A CG    1 
ATOM   1424  C  CD1   . LEU A 1  546 ? 130.220 101.597 105.267 1.00 20.86  ? 546  LEU A CD1   1 
ATOM   1425  C  CD2   . LEU A 1  546 ? 129.425 99.600  104.053 1.00 20.86  ? 546  LEU A CD2   1 
ATOM   1426  N  N     . GLU A 1  547 ? 129.586 97.541  109.051 1.00 26.71  ? 547  GLU A N     1 
ATOM   1427  C  CA    . GLU A 1  547 ? 130.309 96.615  109.920 1.00 26.71  ? 547  GLU A CA    1 
ATOM   1428  C  C     . GLU A 1  547 ? 129.584 95.280  110.039 1.00 26.71  ? 547  GLU A C     1 
ATOM   1429  O  O     . GLU A 1  547 ? 130.224 94.224  110.084 1.00 26.71  ? 547  GLU A O     1 
ATOM   1430  C  CB    . GLU A 1  547 ? 130.520 97.243  111.293 1.00 26.71  ? 547  GLU A CB    1 
ATOM   1431  C  CG    . GLU A 1  547 ? 131.303 96.388  112.252 1.00 26.71  ? 547  GLU A CG    1 
ATOM   1432  C  CD    . GLU A 1  547 ? 131.578 97.096  113.549 1.00 26.71  ? 547  GLU A CD    1 
ATOM   1433  O  OE1   . GLU A 1  547 ? 131.231 98.291  113.662 1.00 26.71  ? 547  GLU A OE1   1 
ATOM   1434  O  OE2   . GLU A 1  547 ? 132.119 96.449  114.467 1.00 26.71  ? 547  GLU A OE2   1 
ATOM   1435  N  N     . PHE A 1  548 ? 128.251 95.302  110.063 1.00 23.73  ? 548  PHE A N     1 
ATOM   1436  C  CA    . PHE A 1  548 ? 127.497 94.058  109.961 1.00 23.73  ? 548  PHE A CA    1 
ATOM   1437  C  C     . PHE A 1  548 ? 127.635 93.438  108.577 1.00 23.73  ? 548  PHE A C     1 
ATOM   1438  O  O     . PHE A 1  548 ? 127.552 92.213  108.438 1.00 23.73  ? 548  PHE A O     1 
ATOM   1439  C  CB    . PHE A 1  548 ? 126.025 94.307  110.286 1.00 23.73  ? 548  PHE A CB    1 
ATOM   1440  C  CG    . PHE A 1  548 ? 125.174 93.069  110.239 1.00 23.73  ? 548  PHE A CG    1 
ATOM   1441  C  CD1   . PHE A 1  548 ? 125.201 92.157  111.278 1.00 23.73  ? 548  PHE A CD1   1 
ATOM   1442  C  CD2   . PHE A 1  548 ? 124.350 92.817  109.152 1.00 23.73  ? 548  PHE A CD2   1 
ATOM   1443  C  CE1   . PHE A 1  548 ? 124.419 91.021  111.236 1.00 23.73  ? 548  PHE A CE1   1 
ATOM   1444  C  CE2   . PHE A 1  548 ? 123.572 91.683  109.103 1.00 23.73  ? 548  PHE A CE2   1 
ATOM   1445  C  CZ    . PHE A 1  548 ? 123.607 90.783  110.146 1.00 23.73  ? 548  PHE A CZ    1 
ATOM   1446  N  N     . TYR A 1  549 ? 127.848 94.261  107.549 1.00 23.95  ? 549  TYR A N     1 
ATOM   1447  C  CA    . TYR A 1  549 ? 127.971 93.745  106.191 1.00 23.95  ? 549  TYR A CA    1 
ATOM   1448  C  C     . TYR A 1  549 ? 129.270 92.984  105.993 1.00 23.95  ? 549  TYR A C     1 
ATOM   1449  O  O     . TYR A 1  549 ? 129.297 91.966  105.295 1.00 23.95  ? 549  TYR A O     1 
ATOM   1450  C  CB    . TYR A 1  549 ? 127.879 94.887  105.186 1.00 23.95  ? 549  TYR A CB    1 
ATOM   1451  C  CG    . TYR A 1  549 ? 128.057 94.479  103.749 1.00 23.95  ? 549  TYR A CG    1 
ATOM   1452  C  CD1   . TYR A 1  549 ? 127.043 93.832  103.061 1.00 23.95  ? 549  TYR A CD1   1 
ATOM   1453  C  CD2   . TYR A 1  549 ? 129.237 94.756  103.074 1.00 23.95  ? 549  TYR A CD2   1 
ATOM   1454  C  CE1   . TYR A 1  549 ? 127.202 93.466  101.744 1.00 23.95  ? 549  TYR A CE1   1 
ATOM   1455  C  CE2   . TYR A 1  549 ? 129.405 94.391  101.763 1.00 23.95  ? 549  TYR A CE2   1 
ATOM   1456  C  CZ    . TYR A 1  549 ? 128.386 93.748  101.101 1.00 23.95  ? 549  TYR A CZ    1 
ATOM   1457  O  OH    . TYR A 1  549 ? 128.555 93.389  99.788  1.00 23.95  ? 549  TYR A OH    1 
ATOM   1458  N  N     . PHE A 1  550 ? 130.360 93.460  106.583 1.00 22.87  ? 550  PHE A N     1 
ATOM   1459  C  CA    . PHE A 1  550 ? 131.642 92.855  106.262 1.00 22.87  ? 550  PHE A CA    1 
ATOM   1460  C  C     . PHE A 1  550 ? 131.998 91.667  107.147 1.00 22.87  ? 550  PHE A C     1 
ATOM   1461  O  O     . PHE A 1  550 ? 132.634 90.730  106.659 1.00 22.87  ? 550  PHE A O     1 
ATOM   1462  C  CB    . PHE A 1  550 ? 132.761 93.901  106.304 1.00 22.87  ? 550  PHE A CB    1 
ATOM   1463  C  CG    . PHE A 1  550 ? 132.690 94.912  105.187 1.00 22.87  ? 550  PHE A CG    1 
ATOM   1464  C  CD1   . PHE A 1  550 ? 132.818 94.512  103.870 1.00 22.87  ? 550  PHE A CD1   1 
ATOM   1465  C  CD2   . PHE A 1  550 ? 132.589 96.264  105.456 1.00 22.87  ? 550  PHE A CD2   1 
ATOM   1466  C  CE1   . PHE A 1  550 ? 132.765 95.434  102.842 1.00 22.87  ? 550  PHE A CE1   1 
ATOM   1467  C  CE2   . PHE A 1  550 ? 132.542 97.191  104.430 1.00 22.87  ? 550  PHE A CE2   1 
ATOM   1468  C  CZ    . PHE A 1  550 ? 132.634 96.775  103.125 1.00 22.87  ? 550  PHE A CZ    1 
ATOM   1469  N  N     . LYS A 1  551 ? 131.599 91.639  108.417 1.00 29.93  ? 551  LYS A N     1 
ATOM   1470  C  CA    . LYS A 1  551 ? 132.023 90.521  109.254 1.00 29.93  ? 551  LYS A CA    1 
ATOM   1471  C  C     . LYS A 1  551 ? 130.974 89.430  109.408 1.00 29.93  ? 551  LYS A C     1 
ATOM   1472  O  O     . LYS A 1  551 ? 131.339 88.278  109.653 1.00 29.93  ? 551  LYS A O     1 
ATOM   1473  C  CB    . LYS A 1  551 ? 132.459 91.012  110.641 1.00 29.93  ? 551  LYS A CB    1 
ATOM   1474  C  CG    . LYS A 1  551 ? 131.370 91.485  111.571 1.00 29.93  ? 551  LYS A CG    1 
ATOM   1475  C  CD    . LYS A 1  551 ? 131.991 92.165  112.779 1.00 29.93  ? 551  LYS A CD    1 
ATOM   1476  C  CE    . LYS A 1  551 ? 132.786 91.185  113.621 1.00 29.93  ? 551  LYS A CE    1 
ATOM   1477  N  NZ    . LYS A 1  551 ? 133.337 91.816  114.851 1.00 29.93  ? 551  LYS A NZ    1 
ATOM   1478  N  N     . ARG A 1  552 ? 129.690 89.741  109.244 1.00 29.37  ? 552  ARG A N     1 
ATOM   1479  C  CA    . ARG A 1  552 ? 128.634 88.769  109.497 1.00 29.37  ? 552  ARG A CA    1 
ATOM   1480  C  C     . ARG A 1  552 ? 128.058 88.143  108.237 1.00 29.37  ? 552  ARG A C     1 
ATOM   1481  O  O     . ARG A 1  552 ? 127.725 86.955  108.249 1.00 29.37  ? 552  ARG A O     1 
ATOM   1482  C  CB    . ARG A 1  552 ? 127.506 89.419  110.297 1.00 30.00  ? 552  ARG A CB    1 
ATOM   1483  C  CG    . ARG A 1  552 ? 127.897 89.770  111.713 1.00 30.00  ? 552  ARG A CG    1 
ATOM   1484  C  CD    . ARG A 1  552 ? 128.003 88.529  112.572 1.00 30.00  ? 552  ARG A CD    1 
ATOM   1485  N  NE    . ARG A 1  552 ? 128.331 88.868  113.950 1.00 30.00  ? 552  ARG A NE    1 
ATOM   1486  C  CZ    . ARG A 1  552 ? 129.569 88.904  114.428 1.00 30.00  ? 552  ARG A CZ    1 
ATOM   1487  N  NH1   . ARG A 1  552 ? 130.589 88.605  113.638 1.00 30.00  ? 552  ARG A NH1   1 
ATOM   1488  N  NH2   . ARG A 1  552 ? 129.789 89.227  115.695 1.00 30.00  ? 552  ARG A NH2   1 
ATOM   1489  N  N     . VAL A 1  553 ? 127.918 88.906  107.162 1.00 30.92  ? 553  VAL A N     1 
ATOM   1490  C  CA    . VAL A 1  553 ? 127.293 88.382  105.942 1.00 30.92  ? 553  VAL A CA    1 
ATOM   1491  C  C     . VAL A 1  553 ? 128.261 87.414  105.270 1.00 30.92  ? 553  VAL A C     1 
ATOM   1492  O  O     . VAL A 1  553 ? 129.463 87.717  105.180 1.00 30.92  ? 553  VAL A O     1 
ATOM   1493  C  CB    . VAL A 1  553 ? 126.913 89.535  105.009 1.00 30.92  ? 553  VAL A CB    1 
ATOM   1494  C  CG1   . VAL A 1  553 ? 126.196 89.032  103.775 1.00 30.92  ? 553  VAL A CG1   1 
ATOM   1495  C  CG2   . VAL A 1  553 ? 126.049 90.538  105.740 1.00 30.92  ? 553  VAL A CG2   1 
ATOM   1496  N  N     . PRO A 1  554 ? 127.814 86.232  104.842 1.00 34.79  ? 554  PRO A N     1 
ATOM   1497  C  CA    . PRO A 1  554 ? 128.749 85.234  104.309 1.00 34.79  ? 554  PRO A CA    1 
ATOM   1498  C  C     . PRO A 1  554 ? 129.330 85.626  102.958 1.00 34.79  ? 554  PRO A C     1 
ATOM   1499  O  O     . PRO A 1  554 ? 128.814 86.486  102.244 1.00 34.79  ? 554  PRO A O     1 
ATOM   1500  C  CB    . PRO A 1  554 ? 127.889 83.973  104.188 1.00 34.79  ? 554  PRO A CB    1 
ATOM   1501  C  CG    . PRO A 1  554 ? 126.793 84.174  105.166 1.00 34.79  ? 554  PRO A CG    1 
ATOM   1502  C  CD    . PRO A 1  554 ? 126.498 85.638  105.133 1.00 34.79  ? 554  PRO A CD    1 
ATOM   1503  N  N     . LYS A 1  555 ? 130.435 84.959  102.618 1.00 37.73  ? 555  LYS A N     1 
ATOM   1504  C  CA    . LYS A 1  555 ? 131.182 85.268  101.405 1.00 37.73  ? 555  LYS A CA    1 
ATOM   1505  C  C     . LYS A 1  555 ? 130.472 84.800  100.145 1.00 37.73  ? 555  LYS A C     1 
ATOM   1506  O  O     . LYS A 1  555 ? 130.784 85.290  99.056  1.00 37.73  ? 555  LYS A O     1 
ATOM   1507  C  CB    . LYS A 1  555 ? 132.569 84.635  101.488 1.00 37.73  ? 555  LYS A CB    1 
ATOM   1508  C  CG    . LYS A 1  555 ? 133.447 85.259  102.547 1.00 37.73  ? 555  LYS A CG    1 
ATOM   1509  C  CD    . LYS A 1  555 ? 134.691 84.439  102.813 1.00 37.73  ? 555  LYS A CD    1 
ATOM   1510  C  CE    . LYS A 1  555 ? 135.659 84.505  101.656 1.00 37.73  ? 555  LYS A CE    1 
ATOM   1511  N  NZ    . LYS A 1  555 ? 136.935 83.806  101.968 1.00 37.73  ? 555  LYS A NZ    1 
ATOM   1512  N  N     . ASN A 1  556 ? 129.536 83.861  100.264 1.00 40.01  ? 556  ASN A N     1 
ATOM   1513  C  CA    . ASN A 1  556 ? 128.763 83.419  99.113  1.00 40.01  ? 556  ASN A CA    1 
ATOM   1514  C  C     . ASN A 1  556 ? 127.690 84.418  98.722  1.00 40.01  ? 556  ASN A C     1 
ATOM   1515  O  O     . ASN A 1  556 ? 127.260 84.428  97.564  1.00 40.01  ? 556  ASN A O     1 
ATOM   1516  C  CB    . ASN A 1  556 ? 128.112 82.069  99.410  1.00 40.01  ? 556  ASN A CB    1 
ATOM   1517  C  CG    . ASN A 1  556 ? 129.126 80.990  99.705  1.00 40.01  ? 556  ASN A CG    1 
ATOM   1518  O  OD1   . ASN A 1  556 ? 129.207 80.490  100.826 1.00 40.01  ? 556  ASN A OD1   1 
ATOM   1519  N  ND2   . ASN A 1  556 ? 129.906 80.620  98.698  1.00 40.01  ? 556  ASN A ND2   1 
ATOM   1520  N  N     . LYS A 1  557 ? 127.256 85.257  99.656  1.00 39.28  ? 557  LYS A N     1 
ATOM   1521  C  CA    . LYS A 1  557 ? 126.163 86.183  99.411  1.00 39.28  ? 557  LYS A CA    1 
ATOM   1522  C  C     . LYS A 1  557 ? 126.637 87.553  98.956  1.00 39.28  ? 557  LYS A C     1 
ATOM   1523  O  O     . LYS A 1  557 ? 125.844 88.312  98.390  1.00 39.28  ? 557  LYS A O     1 
ATOM   1524  C  CB    . LYS A 1  557 ? 125.324 86.327  100.680 1.00 39.28  ? 557  LYS A CB    1 
ATOM   1525  C  CG    . LYS A 1  557 ? 124.707 85.020  101.124 1.00 39.28  ? 557  LYS A CG    1 
ATOM   1526  C  CD    . LYS A 1  557 ? 123.937 85.171  102.416 1.00 39.28  ? 557  LYS A CD    1 
ATOM   1527  C  CE    . LYS A 1  557 ? 123.293 83.853  102.806 1.00 39.28  ? 557  LYS A CE    1 
ATOM   1528  N  NZ    . LYS A 1  557 ? 124.309 82.818  103.134 1.00 39.28  ? 557  LYS A NZ    1 
ATOM   1529  N  N     . LYS A 1  558 ? 127.905 87.877  99.173  1.00 30.24  ? 558  LYS A N     1 
ATOM   1530  C  CA    . LYS A 1  558 ? 128.424 89.200  98.884  1.00 30.24  ? 558  LYS A CA    1 
ATOM   1531  C  C     . LYS A 1  558 ? 129.135 89.245  97.541  1.00 30.24  ? 558  LYS A C     1 
ATOM   1532  O  O     . LYS A 1  558 ? 129.293 88.243  96.842  1.00 30.24  ? 558  LYS A O     1 
ATOM   1533  C  CB    . LYS A 1  558 ? 129.383 89.652  99.978  1.00 30.24  ? 558  LYS A CB    1 
ATOM   1534  C  CG    . LYS A 1  558 ? 128.704 89.985  101.266 1.00 30.24  ? 558  LYS A CG    1 
ATOM   1535  C  CD    . LYS A 1  558 ? 129.649 90.655  102.226 1.00 30.24  ? 558  LYS A CD    1 
ATOM   1536  C  CE    . LYS A 1  558 ? 130.612 89.668  102.801 1.00 30.24  ? 558  LYS A CE    1 
ATOM   1537  N  NZ    . LYS A 1  558 ? 131.449 90.294  103.855 1.00 30.24  ? 558  LYS A NZ    1 
ATOM   1538  N  N     . LYS A 1  559 ? 129.564 90.449  97.192  1.00 27.23  ? 559  LYS A N     1 
ATOM   1539  C  CA    . LYS A 1  559 ? 130.423 90.715  96.056  1.00 27.23  ? 559  LYS A CA    1 
ATOM   1540  C  C     . LYS A 1  559 ? 131.657 91.435  96.582  1.00 27.23  ? 559  LYS A C     1 
ATOM   1541  O  O     . LYS A 1  559 ? 131.585 92.147  97.587  1.00 27.23  ? 559  LYS A O     1 
ATOM   1542  C  CB    . LYS A 1  559 ? 129.684 91.565  95.015  1.00 27.23  ? 559  LYS A CB    1 
ATOM   1543  C  CG    . LYS A 1  559 ? 130.385 91.727  93.691  1.00 27.23  ? 559  LYS A CG    1 
ATOM   1544  C  CD    . LYS A 1  559 ? 129.640 92.692  92.786  1.00 27.23  ? 559  LYS A CD    1 
ATOM   1545  C  CE    . LYS A 1  559 ? 128.385 92.074  92.214  1.00 27.23  ? 559  LYS A CE    1 
ATOM   1546  N  NZ    . LYS A 1  559 ? 127.749 92.980  91.224  1.00 27.23  ? 559  LYS A NZ    1 
ATOM   1547  N  N     . THR A 1  560 ? 132.798 91.209  95.934  1.00 23.50  ? 560  THR A N     1 
ATOM   1548  C  CA    . THR A 1  560 ? 134.012 91.933  96.286  1.00 23.50  ? 560  THR A CA    1 
ATOM   1549  C  C     . THR A 1  560 ? 133.845 93.418  95.988  1.00 23.50  ? 560  THR A C     1 
ATOM   1550  O  O     . THR A 1  560 ? 133.197 93.804  95.016  1.00 23.50  ? 560  THR A O     1 
ATOM   1551  C  CB    . THR A 1  560 ? 135.212 91.367  95.527  1.00 23.50  ? 560  THR A CB    1 
ATOM   1552  O  OG1   . THR A 1  560 ? 134.893 91.281  94.140  1.00 23.50  ? 560  THR A OG1   1 
ATOM   1553  C  CG2   . THR A 1  560 ? 135.568 89.990  96.007  1.00 23.50  ? 560  THR A CG2   1 
ATOM   1554  N  N     . ILE A 1  561 ? 134.396 94.256  96.862  1.00 18.94  ? 561  ILE A N     1 
ATOM   1555  C  CA    . ILE A 1  561 ? 134.238 95.702  96.777  1.00 18.94  ? 561  ILE A CA    1 
ATOM   1556  C  C     . ILE A 1  561 ? 135.620 96.327  96.812  1.00 18.94  ? 561  ILE A C     1 
ATOM   1557  O  O     . ILE A 1  561 ? 136.392 96.075  97.744  1.00 18.94  ? 561  ILE A O     1 
ATOM   1558  C  CB    . ILE A 1  561 ? 133.369 96.258  97.917  1.00 18.94  ? 561  ILE A CB    1 
ATOM   1559  C  CG1   . ILE A 1  561 ? 131.942 95.737  97.805  1.00 18.94  ? 561  ILE A CG1   1 
ATOM   1560  C  CG2   . ILE A 1  561 ? 133.370 97.775  97.916  1.00 18.94  ? 561  ILE A CG2   1 
ATOM   1561  C  CD1   . ILE A 1  561 ? 131.127 96.010  99.017  1.00 18.94  ? 561  ILE A CD1   1 
ATOM   1562  N  N     . VAL A 1  562 ? 135.932 97.134  95.809  1.00 16.65  ? 562  VAL A N     1 
ATOM   1563  C  CA    . VAL A 1  562 ? 137.194 97.855  95.740  1.00 16.65  ? 562  VAL A CA    1 
ATOM   1564  C  C     . VAL A 1  562 ? 136.867 99.324  95.957  1.00 16.65  ? 562  VAL A C     1 
ATOM   1565  O  O     . VAL A 1  562 ? 136.415 100.013 95.038  1.00 16.65  ? 562  VAL A O     1 
ATOM   1566  C  CB    . VAL A 1  562 ? 137.909 97.631  94.406  1.00 16.65  ? 562  VAL A CB    1 
ATOM   1567  C  CG1   . VAL A 1  562 ? 139.224 98.384  94.381  1.00 16.65  ? 562  VAL A CG1   1 
ATOM   1568  C  CG2   . VAL A 1  562 ? 138.123 96.153  94.162  1.00 16.65  ? 562  VAL A CG2   1 
ATOM   1569  N  N     . VAL A 1  563 ? 137.074 99.812  97.171  1.00 15.49  ? 563  VAL A N     1 
ATOM   1570  C  CA    . VAL A 1  563 ? 136.811 101.207 97.495  1.00 15.49  ? 563  VAL A CA    1 
ATOM   1571  C  C     . VAL A 1  563 ? 138.126 101.975 97.447  1.00 15.49  ? 563  VAL A C     1 
ATOM   1572  O  O     . VAL A 1  563 ? 139.182 101.464 97.839  1.00 15.49  ? 563  VAL A O     1 
ATOM   1573  C  CB    . VAL A 1  563 ? 136.086 101.341 98.856  1.00 15.49  ? 563  VAL A CB    1 
ATOM   1574  C  CG1   . VAL A 1  563 ? 136.914 100.824 100.006 1.00 15.49  ? 563  VAL A CG1   1 
ATOM   1575  C  CG2   . VAL A 1  563 ? 135.657 102.771 99.117  1.00 15.49  ? 563  VAL A CG2   1 
ATOM   1576  N  N     . LEU A 1  564 ? 138.076 103.176 96.884  1.00 17.09  ? 564  LEU A N     1 
ATOM   1577  C  CA    . LEU A 1  564 ? 139.218 104.074 96.787  1.00 17.09  ? 564  LEU A CA    1 
ATOM   1578  C  C     . LEU A 1  564 ? 139.013 105.218 97.767  1.00 17.09  ? 564  LEU A C     1 
ATOM   1579  O  O     . LEU A 1  564 ? 138.157 106.077 97.545  1.00 17.09  ? 564  LEU A O     1 
ATOM   1580  C  CB    . LEU A 1  564 ? 139.367 104.597 95.361  1.00 17.09  ? 564  LEU A CB    1 
ATOM   1581  C  CG    . LEU A 1  564 ? 140.429 105.669 95.124  1.00 17.09  ? 564  LEU A CG    1 
ATOM   1582  C  CD1   . LEU A 1  564 ? 141.776 105.150 95.480  1.00 17.09  ? 564  LEU A CD1   1 
ATOM   1583  C  CD2   . LEU A 1  564 ? 140.424 106.127 93.686  1.00 17.09  ? 564  LEU A CD2   1 
ATOM   1584  N  N     . LEU A 1  565 ? 139.790 105.235 98.848  1.00 19.02  ? 565  LEU A N     1 
ATOM   1585  C  CA    . LEU A 1  565 ? 139.730 106.336 99.808  1.00 19.02  ? 565  LEU A CA    1 
ATOM   1586  C  C     . LEU A 1  565 ? 140.720 107.396 99.362  1.00 19.02  ? 565  LEU A C     1 
ATOM   1587  O  O     . LEU A 1  565 ? 141.871 107.421 99.793  1.00 19.02  ? 565  LEU A O     1 
ATOM   1588  C  CB    . LEU A 1  565 ? 140.040 105.871 101.221 1.00 19.02  ? 565  LEU A CB    1 
ATOM   1589  C  CG    . LEU A 1  565 ? 139.101 104.904 101.922 1.00 19.02  ? 565  LEU A CG    1 
ATOM   1590  C  CD1   . LEU A 1  565 ? 139.667 104.646 103.292 1.00 19.02  ? 565  LEU A CD1   1 
ATOM   1591  C  CD2   . LEU A 1  565 ? 137.696 105.453 102.006 1.00 19.02  ? 565  LEU A CD2   1 
ATOM   1592  N  N     . ASP A 1  566 ? 140.268 108.291 98.497  1.00 23.56  ? 566  ASP A N     1 
ATOM   1593  C  CA    . ASP A 1  566 ? 141.151 109.298 97.940  1.00 23.56  ? 566  ASP A CA    1 
ATOM   1594  C  C     . ASP A 1  566 ? 141.235 110.489 98.879  1.00 23.56  ? 566  ASP A C     1 
ATOM   1595  O  O     . ASP A 1  566 ? 140.230 110.903 99.464  1.00 23.56  ? 566  ASP A O     1 
ATOM   1596  C  CB    . ASP A 1  566 ? 140.677 109.738 96.557  1.00 23.56  ? 566  ASP A CB    1 
ATOM   1597  C  CG    . ASP A 1  566 ? 141.749 110.480 95.779  1.00 23.56  ? 566  ASP A CG    1 
ATOM   1598  O  OD1   . ASP A 1  566 ? 142.866 110.669 96.302  1.00 23.56  ? 566  ASP A OD1   1 
ATOM   1599  O  OD2   . ASP A 1  566 ? 141.473 110.871 94.629  1.00 23.56  ? 566  ASP A OD2   1 
ATOM   1600  N  N     . GLU A 1  567 ? 142.451 111.022 99.006  1.00 28.81  ? 567  GLU A N     1 
ATOM   1601  C  CA    . GLU A 1  567 ? 142.797 112.166 99.850  1.00 28.81  ? 567  GLU A CA    1 
ATOM   1602  C  C     . GLU A 1  567 ? 142.379 111.922 101.299 1.00 28.81  ? 567  GLU A C     1 
ATOM   1603  O  O     . GLU A 1  567 ? 141.525 112.591 101.875 1.00 28.81  ? 567  GLU A O     1 
ATOM   1604  C  CB    . GLU A 1  567 ? 142.223 113.446 99.254  1.00 28.81  ? 567  GLU A CB    1 
ATOM   1605  C  CG    . GLU A 1  567 ? 142.962 113.766 97.981  1.00 28.81  ? 567  GLU A CG    1 
ATOM   1606  C  CD    . GLU A 1  567 ? 142.374 114.913 97.238  1.00 28.81  ? 567  GLU A CD    1 
ATOM   1607  O  OE1   . GLU A 1  567 ? 141.292 115.380 97.637  1.00 28.81  ? 567  GLU A OE1   1 
ATOM   1608  O  OE2   . GLU A 1  567 ? 142.981 115.344 96.237  1.00 28.81  ? 567  GLU A OE2   1 
ATOM   1609  N  N     . LEU A 1  568 ? 143.040 110.912 101.856 1.00 29.72  ? 568  LEU A N     1 
ATOM   1610  C  CA    . LEU A 1  568 ? 142.763 110.401 103.187 1.00 29.72  ? 568  LEU A CA    1 
ATOM   1611  C  C     . LEU A 1  568 ? 143.233 111.346 104.286 1.00 29.72  ? 568  LEU A C     1 
ATOM   1612  O  O     . LEU A 1  568 ? 142.850 111.159 105.445 1.00 29.72  ? 568  LEU A O     1 
ATOM   1613  C  CB    . LEU A 1  568 ? 143.425 109.029 103.312 1.00 29.72  ? 568  LEU A CB    1 
ATOM   1614  C  CG    . LEU A 1  568 ? 143.248 108.070 104.480 1.00 29.72  ? 568  LEU A CG    1 
ATOM   1615  C  CD1   . LEU A 1  568 ? 141.819 107.591 104.604 1.00 29.72  ? 568  LEU A CD1   1 
ATOM   1616  C  CD2   . LEU A 1  568 ? 144.169 106.915 104.243 1.00 29.72  ? 568  LEU A CD2   1 
ATOM   1617  N  N     . ASP A 1  569 ? 144.056 112.344 103.942 1.00 34.66  ? 569  ASP A N     1 
ATOM   1618  C  CA    . ASP A 1  569 ? 144.426 113.401 104.880 1.00 34.66  ? 569  ASP A CA    1 
ATOM   1619  C  C     . ASP A 1  569 ? 143.207 114.158 105.385 1.00 34.66  ? 569  ASP A C     1 
ATOM   1620  O  O     . ASP A 1  569 ? 143.113 114.469 106.575 1.00 34.66  ? 569  ASP A O     1 
ATOM   1621  C  CB    . ASP A 1  569 ? 145.379 114.385 104.206 1.00 34.66  ? 569  ASP A CB    1 
ATOM   1622  C  CG    . ASP A 1  569 ? 146.764 113.829 104.021 1.00 34.66  ? 569  ASP A CG    1 
ATOM   1623  O  OD1   . ASP A 1  569 ? 147.211 113.054 104.880 1.00 34.66  ? 569  ASP A OD1   1 
ATOM   1624  O  OD2   . ASP A 1  569 ? 147.412 114.174 103.016 1.00 34.66  ? 569  ASP A OD2   1 
ATOM   1625  N  N     . ALA A 1  570 ? 142.262 114.456 104.492 1.00 31.14  ? 570  ALA A N     1 
ATOM   1626  C  CA    . ALA A 1  570 ? 141.185 115.378 104.824 1.00 31.14  ? 570  ALA A CA    1 
ATOM   1627  C  C     . ALA A 1  570 ? 140.147 114.747 105.737 1.00 31.14  ? 570  ALA A C     1 
ATOM   1628  O  O     . ALA A 1  570 ? 139.455 115.461 106.471 1.00 31.14  ? 570  ALA A O     1 
ATOM   1629  C  CB    . ALA A 1  570 ? 140.523 115.875 103.545 1.00 31.14  ? 570  ALA A CB    1 
ATOM   1630  N  N     . MET A 1  571 ? 140.025 113.426 105.714 1.00 33.83  ? 571  MET A N     1 
ATOM   1631  C  CA    . MET A 1  571 ? 139.016 112.767 106.526 1.00 33.83  ? 571  MET A CA    1 
ATOM   1632  C  C     . MET A 1  571 ? 139.439 112.593 107.978 1.00 33.83  ? 571  MET A C     1 
ATOM   1633  O  O     . MET A 1  571 ? 138.571 112.471 108.847 1.00 33.83  ? 571  MET A O     1 
ATOM   1634  C  CB    . MET A 1  571 ? 138.667 111.414 105.907 1.00 33.83  ? 571  MET A CB    1 
ATOM   1635  C  CG    . MET A 1  571 ? 137.888 111.543 104.608 1.00 33.83  ? 571  MET A CG    1 
ATOM   1636  S  SD    . MET A 1  571 ? 137.378 109.993 103.850 1.00 33.83  ? 571  MET A SD    1 
ATOM   1637  C  CE    . MET A 1  571 ? 138.907 109.448 103.106 1.00 33.83  ? 571  MET A CE    1 
ATOM   1638  N  N     . VAL A 1  572 ? 140.738 112.631 108.270 1.00 41.87  ? 572  VAL A N     1 
ATOM   1639  C  CA    . VAL A 1  572 ? 141.265 112.195 109.557 1.00 41.87  ? 572  VAL A CA    1 
ATOM   1640  C  C     . VAL A 1  572 ? 141.787 113.354 110.395 1.00 41.87  ? 572  VAL A C     1 
ATOM   1641  O  O     . VAL A 1  572 ? 142.479 113.124 111.391 1.00 41.87  ? 572  VAL A O     1 
ATOM   1642  C  CB    . VAL A 1  572 ? 142.361 111.137 109.364 1.00 41.87  ? 572  VAL A CB    1 
ATOM   1643  C  CG1   . VAL A 1  572 ? 141.809 109.969 108.601 1.00 41.87  ? 572  VAL A CG1   1 
ATOM   1644  C  CG2   . VAL A 1  572 ? 143.550 111.727 108.629 1.00 41.87  ? 572  VAL A CG2   1 
ATOM   1645  N  N     . THR A 1  573 ? 141.460 114.596 110.034 1.00 52.23  ? 573  THR A N     1 
ATOM   1646  C  CA    . THR A 1  573 ? 142.066 115.738 110.716 1.00 52.23  ? 573  THR A CA    1 
ATOM   1647  C  C     . THR A 1  573 ? 141.517 115.941 112.121 1.00 52.23  ? 573  THR A C     1 
ATOM   1648  O  O     . THR A 1  573 ? 142.248 116.408 113.002 1.00 52.23  ? 573  THR A O     1 
ATOM   1649  C  CB    . THR A 1  573 ? 141.869 117.018 109.909 1.00 52.23  ? 573  THR A CB    1 
ATOM   1650  O  OG1   . THR A 1  573 ? 140.476 117.199 109.627 1.00 52.23  ? 573  THR A OG1   1 
ATOM   1651  C  CG2   . THR A 1  573 ? 142.664 116.982 108.622 1.00 52.23  ? 573  THR A CG2   1 
ATOM   1652  N  N     . LYS A 1  574 ? 140.253 115.606 112.361 1.00 54.36  ? 574  LYS A N     1 
ATOM   1653  C  CA    . LYS A 1  574 ? 139.649 115.956 113.639 1.00 54.36  ? 574  LYS A CA    1 
ATOM   1654  C  C     . LYS A 1  574 ? 139.615 114.816 114.651 1.00 54.36  ? 574  LYS A C     1 
ATOM   1655  O  O     . LYS A 1  574 ? 139.878 115.056 115.833 1.00 54.36  ? 574  LYS A O     1 
ATOM   1656  C  CB    . LYS A 1  574 ? 138.235 116.519 113.431 1.00 54.36  ? 574  LYS A CB    1 
ATOM   1657  C  CG    . LYS A 1  574 ? 137.254 115.632 112.678 1.00 54.36  ? 574  LYS A CG    1 
ATOM   1658  C  CD    . LYS A 1  574 ? 135.851 116.225 112.710 1.00 54.36  ? 574  LYS A CD    1 
ATOM   1659  C  CE    . LYS A 1  574 ? 135.727 117.467 111.844 1.00 54.36  ? 574  LYS A CE    1 
ATOM   1660  N  NZ    . LYS A 1  574 ? 134.317 117.942 111.789 1.00 54.36  ? 574  LYS A NZ    1 
ATOM   1661  N  N     . SER A 1  575 ? 139.305 113.582 114.248 1.00 55.15  ? 575  SER A N     1 
ATOM   1662  C  CA    . SER A 1  575 ? 139.040 112.565 115.254 1.00 55.15  ? 575  SER A CA    1 
ATOM   1663  C  C     . SER A 1  575 ? 139.618 111.185 114.971 1.00 55.15  ? 575  SER A C     1 
ATOM   1664  O  O     . SER A 1  575 ? 139.470 110.310 115.831 1.00 55.15  ? 575  SER A O     1 
ATOM   1665  C  CB    . SER A 1  575 ? 137.524 112.433 115.474 1.00 55.15  ? 575  SER A CB    1 
ATOM   1666  O  OG    . SER A 1  575 ? 137.236 111.487 116.487 1.00 55.15  ? 575  SER A OG    1 
ATOM   1667  N  N     . GLN A 1  576 ? 140.245 110.958 113.802 1.00 53.96  ? 576  GLN A N     1 
ATOM   1668  C  CA    . GLN A 1  576 ? 140.918 109.701 113.364 1.00 53.96  ? 576  GLN A CA    1 
ATOM   1669  C  C     . GLN A 1  576 ? 140.099 108.423 113.599 1.00 53.96  ? 576  GLN A C     1 
ATOM   1670  O  O     . GLN A 1  576 ? 140.647 107.323 113.671 1.00 53.96  ? 576  GLN A O     1 
ATOM   1671  C  CB    . GLN A 1  576 ? 142.341 109.559 113.952 1.00 53.96  ? 576  GLN A CB    1 
ATOM   1672  C  CG    . GLN A 1  576 ? 142.548 109.518 115.478 1.00 53.96  ? 576  GLN A CG    1 
ATOM   1673  C  CD    . GLN A 1  576 ? 142.439 108.134 116.089 1.00 53.96  ? 576  GLN A CD    1 
ATOM   1674  O  OE1   . GLN A 1  576 ? 142.833 107.137 115.486 1.00 53.96  ? 576  GLN A OE1   1 
ATOM   1675  N  NE2   . GLN A 1  576 ? 141.891 108.068 117.296 1.00 53.96  ? 576  GLN A NE2   1 
ATOM   1676  N  N     . ASP A 1  577 ? 138.776 108.541 113.650 1.00 41.96  ? 577  ASP A N     1 
ATOM   1677  C  CA    . ASP A 1  577 ? 137.900 107.400 113.861 1.00 41.96  ? 577  ASP A CA    1 
ATOM   1678  C  C     . ASP A 1  577 ? 137.513 106.726 112.559 1.00 41.96  ? 577  ASP A C     1 
ATOM   1679  O  O     . ASP A 1  577 ? 136.808 105.713 112.581 1.00 41.96  ? 577  ASP A O     1 
ATOM   1680  C  CB    . ASP A 1  577 ? 136.632 107.852 114.588 1.00 41.96  ? 577  ASP A CB    1 
ATOM   1681  C  CG    . ASP A 1  577 ? 136.919 108.429 115.958 1.00 41.96  ? 577  ASP A CG    1 
ATOM   1682  O  OD1   . ASP A 1  577 ? 137.876 107.978 116.618 1.00 41.96  ? 577  ASP A OD1   1 
ATOM   1683  O  OD2   . ASP A 1  577 ? 136.201 109.365 116.365 1.00 41.96  ? 577  ASP A OD2   1 
ATOM   1684  N  N     . ILE A 1  578 ? 137.971 107.263 111.438 1.00 34.83  ? 578  ILE A N     1 
ATOM   1685  C  CA    . ILE A 1  578 ? 137.466 106.942 110.114 1.00 34.83  ? 578  ILE A CA    1 
ATOM   1686  C  C     . ILE A 1  578 ? 138.509 106.134 109.356 1.00 34.83  ? 578  ILE A C     1 
ATOM   1687  O  O     . ILE A 1  578 ? 138.176 105.281 108.526 1.00 34.83  ? 578  ILE A O     1 
ATOM   1688  C  CB    . ILE A 1  578 ? 137.087 108.256 109.403 1.00 34.83  ? 578  ILE A CB    1 
ATOM   1689  C  CG1   . ILE A 1  578 ? 136.552 108.042 107.999 1.00 34.83  ? 578  ILE A CG1   1 
ATOM   1690  C  CG2   . ILE A 1  578 ? 138.225 109.266 109.447 1.00 34.83  ? 578  ILE A CG2   1 
ATOM   1691  C  CD1   . ILE A 1  578 ? 136.054 109.317 107.454 1.00 34.83  ? 578  ILE A CD1   1 
ATOM   1692  N  N     . MET A 1  579 ? 139.780 106.370 109.672 1.00 34.42  ? 579  MET A N     1 
ATOM   1693  C  CA    . MET A 1  579 ? 140.865 105.615 109.068 1.00 34.42  ? 579  MET A CA    1 
ATOM   1694  C  C     . MET A 1  579 ? 140.996 104.247 109.706 1.00 34.42  ? 579  MET A C     1 
ATOM   1695  O  O     . MET A 1  579 ? 141.440 103.298 109.053 1.00 34.42  ? 579  MET A O     1 
ATOM   1696  C  CB    . MET A 1  579 ? 142.166 106.395 109.218 1.00 34.42  ? 579  MET A CB    1 
ATOM   1697  C  CG    . MET A 1  579 ? 143.317 105.913 108.387 1.00 34.42  ? 579  MET A CG    1 
ATOM   1698  S  SD    . MET A 1  579 ? 144.673 107.068 108.578 1.00 34.42  ? 579  MET A SD    1 
ATOM   1699  C  CE    . MET A 1  579 ? 145.864 106.337 107.480 1.00 34.42  ? 579  MET A CE    1 
ATOM   1700  N  N     . TYR A 1  580 ? 140.615 104.136 110.979 1.00 33.48  ? 580  TYR A N     1 
ATOM   1701  C  CA    . TYR A 1  580 ? 140.653 102.848 111.652 1.00 33.48  ? 580  TYR A CA    1 
ATOM   1702  C  C     . TYR A 1  580 ? 139.600 101.900 111.102 1.00 33.48  ? 580  TYR A C     1 
ATOM   1703  O  O     . TYR A 1  580 ? 139.875 100.710 110.926 1.00 33.48  ? 580  TYR A O     1 
ATOM   1704  C  CB    . TYR A 1  580 ? 140.460 103.020 113.155 1.00 33.48  ? 580  TYR A CB    1 
ATOM   1705  C  CG    . TYR A 1  580 ? 140.473 101.701 113.889 1.00 33.48  ? 580  TYR A CG    1 
ATOM   1706  C  CD1   . TYR A 1  580 ? 141.658 101.008 114.078 1.00 33.48  ? 580  TYR A CD1   1 
ATOM   1707  C  CD2   . TYR A 1  580 ? 139.301 101.142 114.381 1.00 33.48  ? 580  TYR A CD2   1 
ATOM   1708  C  CE1   . TYR A 1  580 ? 141.676 99.802  114.736 1.00 33.48  ? 580  TYR A CE1   1 
ATOM   1709  C  CE2   . TYR A 1  580 ? 139.310 99.938  115.040 1.00 33.48  ? 580  TYR A CE2   1 
ATOM   1710  C  CZ    . TYR A 1  580 ? 140.501 99.274  115.216 1.00 33.48  ? 580  TYR A CZ    1 
ATOM   1711  O  OH    . TYR A 1  580 ? 140.517 98.070  115.875 1.00 33.48  ? 580  TYR A OH    1 
ATOM   1712  N  N     . ASN A 1  581 ? 138.392 102.405 110.834 1.00 28.01  ? 581  ASN A N     1 
ATOM   1713  C  CA    . ASN A 1  581 ? 137.279 101.528 110.483 1.00 28.01  ? 581  ASN A CA    1 
ATOM   1714  C  C     . ASN A 1  581 ? 137.472 100.893 109.115 1.00 28.01  ? 581  ASN A C     1 
ATOM   1715  O  O     . ASN A 1  581 ? 137.239 99.692  108.953 1.00 28.01  ? 581  ASN A O     1 
ATOM   1716  C  CB    . ASN A 1  581 ? 135.959 102.293 110.526 1.00 28.01  ? 581  ASN A CB    1 
ATOM   1717  C  CG    . ASN A 1  581 ? 135.528 102.634 111.933 1.00 28.01  ? 581  ASN A CG    1 
ATOM   1718  O  OD1   . ASN A 1  581 ? 135.671 101.830 112.850 1.00 28.01  ? 581  ASN A OD1   1 
ATOM   1719  N  ND2   . ASN A 1  581 ? 134.979 103.827 112.109 1.00 28.01  ? 581  ASN A ND2   1 
ATOM   1720  N  N     . PHE A 1  582 ? 137.914 101.674 108.127 1.00 24.52  ? 582  PHE A N     1 
ATOM   1721  C  CA    . PHE A 1  582 ? 138.146 101.135 106.790 1.00 24.52  ? 582  PHE A CA    1 
ATOM   1722  C  C     . PHE A 1  582 ? 139.292 100.139 106.755 1.00 24.52  ? 582  PHE A C     1 
ATOM   1723  O  O     . PHE A 1  582 ? 139.278 99.213  105.938 1.00 24.52  ? 582  PHE A O     1 
ATOM   1724  C  CB    . PHE A 1  582 ? 138.420 102.267 105.812 1.00 24.52  ? 582  PHE A CB    1 
ATOM   1725  C  CG    . PHE A 1  582 ? 137.189 102.943 105.324 1.00 24.52  ? 582  PHE A CG    1 
ATOM   1726  C  CD1   . PHE A 1  582 ? 136.531 102.460 104.211 1.00 24.52  ? 582  PHE A CD1   1 
ATOM   1727  C  CD2   . PHE A 1  582 ? 136.663 104.030 105.992 1.00 24.52  ? 582  PHE A CD2   1 
ATOM   1728  C  CE1   . PHE A 1  582 ? 135.392 103.071 103.753 1.00 24.52  ? 582  PHE A CE1   1 
ATOM   1729  C  CE2   . PHE A 1  582 ? 135.518 104.637 105.542 1.00 24.52  ? 582  PHE A CE2   1 
ATOM   1730  C  CZ    . PHE A 1  582 ? 134.879 104.159 104.420 1.00 24.52  ? 582  PHE A CZ    1 
ATOM   1731  N  N     . PHE A 1  583 ? 140.284 100.302 107.621 1.00 29.16  ? 583  PHE A N     1 
ATOM   1732  C  CA    . PHE A 1  583 ? 141.397 99.366  107.618 1.00 29.16  ? 583  PHE A CA    1 
ATOM   1733  C  C     . PHE A 1  583 ? 141.086 98.130  108.452 1.00 29.16  ? 583  PHE A C     1 
ATOM   1734  O  O     . PHE A 1  583 ? 141.554 97.035  108.125 1.00 29.16  ? 583  PHE A O     1 
ATOM   1735  C  CB    . PHE A 1  583 ? 142.667 100.047 108.129 1.00 29.16  ? 583  PHE A CB    1 
ATOM   1736  C  CG    . PHE A 1  583 ? 143.225 101.112 107.210 1.00 29.16  ? 583  PHE A CG    1 
ATOM   1737  C  CD1   . PHE A 1  583 ? 142.782 101.253 105.902 1.00 29.16  ? 583  PHE A CD1   1 
ATOM   1738  C  CD2   . PHE A 1  583 ? 144.221 101.963 107.660 1.00 29.16  ? 583  PHE A CD2   1 
ATOM   1739  C  CE1   . PHE A 1  583 ? 143.299 102.237 105.079 1.00 29.16  ? 583  PHE A CE1   1 
ATOM   1740  C  CE2   . PHE A 1  583 ? 144.749 102.939 106.835 1.00 29.16  ? 583  PHE A CE2   1 
ATOM   1741  C  CZ    . PHE A 1  583 ? 144.286 103.074 105.544 1.00 29.16  ? 583  PHE A CZ    1 
ATOM   1742  N  N     . ASN A 1  584 ? 140.295 98.283  109.519 1.00 30.25  ? 584  ASN A N     1 
ATOM   1743  C  CA    . ASN A 1  584 ? 139.922 97.143  110.350 1.00 30.25  ? 584  ASN A CA    1 
ATOM   1744  C  C     . ASN A 1  584 ? 138.914 96.249  109.643 1.00 30.25  ? 584  ASN A C     1 
ATOM   1745  O  O     . ASN A 1  584 ? 138.876 95.042  109.899 1.00 30.25  ? 584  ASN A O     1 
ATOM   1746  C  CB    . ASN A 1  584 ? 139.344 97.629  111.679 1.00 30.25  ? 584  ASN A CB    1 
ATOM   1747  C  CG    . ASN A 1  584 ? 139.327 96.558  112.745 1.00 30.25  ? 584  ASN A CG    1 
ATOM   1748  O  OD1   . ASN A 1  584 ? 139.832 95.457  112.550 1.00 30.25  ? 584  ASN A OD1   1 
ATOM   1749  N  ND2   . ASN A 1  584 ? 138.731 96.876  113.885 1.00 30.25  ? 584  ASN A ND2   1 
ATOM   1750  N  N     . TRP A 1  585 ? 138.093 96.819  108.756 1.00 25.62  ? 585  TRP A N     1 
ATOM   1751  C  CA    . TRP A 1  585 ? 137.153 96.023  107.973 1.00 25.62  ? 585  TRP A CA    1 
ATOM   1752  C  C     . TRP A 1  585 ? 137.855 95.089  107.002 1.00 25.62  ? 585  TRP A C     1 
ATOM   1753  O  O     . TRP A 1  585 ? 137.268 94.083  106.603 1.00 25.62  ? 585  TRP A O     1 
ATOM   1754  C  CB    . TRP A 1  585 ? 136.206 96.934  107.192 1.00 25.62  ? 585  TRP A CB    1 
ATOM   1755  C  CG    . TRP A 1  585 ? 135.194 97.642  108.026 1.00 25.62  ? 585  TRP A CG    1 
ATOM   1756  C  CD1   . TRP A 1  585 ? 134.804 97.321  109.287 1.00 25.62  ? 585  TRP A CD1   1 
ATOM   1757  C  CD2   . TRP A 1  585 ? 134.504 98.849  107.686 1.00 25.62  ? 585  TRP A CD2   1 
ATOM   1758  N  NE1   . TRP A 1  585 ? 133.878 98.225  109.740 1.00 25.62  ? 585  TRP A NE1   1 
ATOM   1759  C  CE2   . TRP A 1  585 ? 133.681 99.178  108.777 1.00 25.62  ? 585  TRP A CE2   1 
ATOM   1760  C  CE3   . TRP A 1  585 ? 134.491 99.675  106.559 1.00 25.62  ? 585  TRP A CE3   1 
ATOM   1761  C  CZ2   . TRP A 1  585 ? 132.854 100.294 108.775 1.00 25.62  ? 585  TRP A CZ2   1 
ATOM   1762  C  CZ3   . TRP A 1  585 ? 133.669 100.780 106.560 1.00 25.62  ? 585  TRP A CZ3   1 
ATOM   1763  C  CH2   . TRP A 1  585 ? 132.864 101.081 107.660 1.00 25.62  ? 585  TRP A CH2   1 
ATOM   1764  N  N     . THR A 1  586 ? 139.088 95.394  106.612 1.00 26.81  ? 586  THR A N     1 
ATOM   1765  C  CA    . THR A 1  586 ? 139.822 94.539  105.694 1.00 26.81  ? 586  THR A CA    1 
ATOM   1766  C  C     . THR A 1  586 ? 140.508 93.370  106.382 1.00 26.81  ? 586  THR A C     1 
ATOM   1767  O  O     . THR A 1  586 ? 140.967 92.452  105.695 1.00 26.81  ? 586  THR A O     1 
ATOM   1768  C  CB    . THR A 1  586 ? 140.856 95.362  104.939 1.00 26.81  ? 586  THR A CB    1 
ATOM   1769  O  OG1   . THR A 1  586 ? 141.767 95.951  105.874 1.00 26.81  ? 586  THR A OG1   1 
ATOM   1770  C  CG2   . THR A 1  586 ? 140.162 96.448  104.167 1.00 26.81  ? 586  THR A CG2   1 
ATOM   1771  N  N     . THR A 1  587 ? 140.596 93.378  107.709 1.00 32.87  ? 587  THR A N     1 
ATOM   1772  C  CA    . THR A 1  587 ? 141.173 92.250  108.423 1.00 32.87  ? 587  THR A CA    1 
ATOM   1773  C  C     . THR A 1  587 ? 140.186 91.111  108.618 1.00 32.87  ? 587  THR A C     1 
ATOM   1774  O  O     . THR A 1  587 ? 140.593 90.030  109.055 1.00 32.87  ? 587  THR A O     1 
ATOM   1775  C  CB    . THR A 1  587 ? 141.692 92.696  109.786 1.00 32.87  ? 587  THR A CB    1 
ATOM   1776  O  OG1   . THR A 1  587 ? 140.595 93.146  110.586 1.00 32.87  ? 587  THR A OG1   1 
ATOM   1777  C  CG2   . THR A 1  587 ? 142.680 93.830  109.622 1.00 32.87  ? 587  THR A CG2   1 
ATOM   1778  N  N     . TYR A 1  588 ? 138.912 91.326  108.305 1.00 31.47  ? 588  TYR A N     1 
ATOM   1779  C  CA    . TYR A 1  588 ? 137.890 90.323  108.553 1.00 31.47  ? 588  TYR A CA    1 
ATOM   1780  C  C     . TYR A 1  588 ? 137.990 89.197  107.532 1.00 31.47  ? 588  TYR A C     1 
ATOM   1781  O  O     . TYR A 1  588 ? 138.425 89.396  106.395 1.00 31.47  ? 588  TYR A O     1 
ATOM   1782  C  CB    . TYR A 1  588 ? 136.503 90.956  108.493 1.00 31.47  ? 588  TYR A CB    1 
ATOM   1783  C  CG    . TYR A 1  588 ? 136.211 91.949  109.595 1.00 31.47  ? 588  TYR A CG    1 
ATOM   1784  C  CD1   . TYR A 1  588 ? 136.940 91.949  110.777 1.00 31.47  ? 588  TYR A CD1   1 
ATOM   1785  C  CD2   . TYR A 1  588 ? 135.219 92.905  109.440 1.00 31.47  ? 588  TYR A CD2   1 
ATOM   1786  C  CE1   . TYR A 1  588 ? 136.678 92.859  111.775 1.00 31.47  ? 588  TYR A CE1   1 
ATOM   1787  C  CE2   . TYR A 1  588 ? 134.946 93.817  110.438 1.00 31.47  ? 588  TYR A CE2   1 
ATOM   1788  C  CZ    . TYR A 1  588 ? 135.682 93.790  111.600 1.00 31.47  ? 588  TYR A CZ    1 
ATOM   1789  O  OH    . TYR A 1  588 ? 135.421 94.700  112.596 1.00 31.47  ? 588  TYR A OH    1 
ATOM   1790  N  N     . GLU A 1  589 ? 137.588 87.997  107.952 1.00 41.58  ? 589  GLU A N     1 
ATOM   1791  C  CA    . GLU A 1  589 ? 137.625 86.859  107.041 1.00 41.58  ? 589  GLU A CA    1 
ATOM   1792  C  C     . GLU A 1  589 ? 136.491 86.933  106.030 1.00 41.58  ? 589  GLU A C     1 
ATOM   1793  O  O     . GLU A 1  589 ? 136.705 86.747  104.827 1.00 41.58  ? 589  GLU A O     1 
ATOM   1794  C  CB    . GLU A 1  589 ? 137.546 85.547  107.815 1.00 41.58  ? 589  GLU A CB    1 
ATOM   1795  C  CG    . GLU A 1  589 ? 137.680 84.328  106.914 1.00 41.58  ? 589  GLU A CG    1 
ATOM   1796  C  CD    . GLU A 1  589 ? 137.498 83.020  107.654 1.00 41.58  ? 589  GLU A CD    1 
ATOM   1797  O  OE1   . GLU A 1  589 ? 137.185 83.056  108.863 1.00 41.58  ? 589  GLU A OE1   1 
ATOM   1798  O  OE2   . GLU A 1  589 ? 137.670 81.954  107.026 1.00 41.58  ? 589  GLU A OE2   1 
ATOM   1799  N  N     . ASN A 1  590 ? 135.271 87.195  106.506 1.00 37.12  ? 590  ASN A N     1 
ATOM   1800  C  CA    . ASN A 1  590 ? 134.114 87.232  105.621 1.00 37.12  ? 590  ASN A CA    1 
ATOM   1801  C  C     . ASN A 1  590 ? 134.114 88.446  104.712 1.00 37.12  ? 590  ASN A C     1 
ATOM   1802  O  O     . ASN A 1  590 ? 133.464 88.410  103.665 1.00 37.12  ? 590  ASN A O     1 
ATOM   1803  C  CB    . ASN A 1  590 ? 132.817 87.204  106.427 1.00 37.12  ? 590  ASN A CB    1 
ATOM   1804  C  CG    . ASN A 1  590 ? 132.509 85.835  106.981 1.00 37.12  ? 590  ASN A CG    1 
ATOM   1805  O  OD1   . ASN A 1  590 ? 132.656 84.828  106.291 1.00 37.12  ? 590  ASN A OD1   1 
ATOM   1806  N  ND2   . ASN A 1  590 ? 132.079 85.787  108.234 1.00 37.12  ? 590  ASN A ND2   1 
ATOM   1807  N  N     . ALA A 1  591 ? 134.823 89.506  105.084 1.00 31.40  ? 591  ALA A N     1 
ATOM   1808  C  CA    . ALA A 1  591 ? 134.857 90.710  104.271 1.00 31.40  ? 591  ALA A CA    1 
ATOM   1809  C  C     . ALA A 1  591 ? 135.596 90.468  102.970 1.00 31.40  ? 591  ALA A C     1 
ATOM   1810  O  O     . ALA A 1  591 ? 136.632 89.801  102.934 1.00 31.40  ? 591  ALA A O     1 
ATOM   1811  C  CB    . ALA A 1  591 ? 135.531 91.843  105.027 1.00 31.40  ? 591  ALA A CB    1 
ATOM   1812  N  N     . LYS A 1  592 ? 135.040 91.001  101.892 1.00 24.39  ? 592  LYS A N     1 
ATOM   1813  C  CA    . LYS A 1  592 ? 135.705 91.021  100.601 1.00 24.39  ? 592  LYS A CA    1 
ATOM   1814  C  C     . LYS A 1  592 ? 135.824 92.492  100.238 1.00 24.39  ? 592  LYS A C     1 
ATOM   1815  O  O     . LYS A 1  592 ? 135.017 93.038  99.488  1.00 24.39  ? 592  LYS A O     1 
ATOM   1816  C  CB    . LYS A 1  592 ? 134.932 90.235  99.602  1.00 24.39  ? 592  LYS A CB    1 
ATOM   1817  C  CG    . LYS A 1  592 ? 134.834 88.764  99.957  1.00 24.39  ? 592  LYS A CG    1 
ATOM   1818  C  CD    . LYS A 1  592 ? 134.295 87.943  98.814  1.00 24.39  ? 592  LYS A CD    1 
ATOM   1819  C  CE    . LYS A 1  592 ? 132.820 88.170  98.605  1.00 24.39  ? 592  LYS A CE    1 
ATOM   1820  N  NZ    . LYS A 1  592 ? 132.316 87.266  97.544  1.00 24.39  ? 592  LYS A NZ    1 
ATOM   1821  N  N     . LEU A 1  593 ? 136.852 93.131  100.788 1.00 19.21  ? 593  LEU A N     1 
ATOM   1822  C  CA    . LEU A 1  593 ? 137.020 94.572  100.712 1.00 19.21  ? 593  LEU A CA    1 
ATOM   1823  C  C     . LEU A 1  593 ? 138.474 94.878  100.418 1.00 19.21  ? 593  LEU A C     1 
ATOM   1824  O  O     . LEU A 1  593 ? 139.363 94.411  101.133 1.00 19.21  ? 593  LEU A O     1 
ATOM   1825  C  CB    . LEU A 1  593 ? 136.613 95.254  102.020 1.00 19.21  ? 593  LEU A CB    1 
ATOM   1826  C  CG    . LEU A 1  593 ? 136.746 96.774  102.014 1.00 19.21  ? 593  LEU A CG    1 
ATOM   1827  C  CD1   . LEU A 1  593 ? 135.759 97.377  101.039 1.00 19.21  ? 593  LEU A CD1   1 
ATOM   1828  C  CD2   . LEU A 1  593 ? 136.565 97.346  103.402 1.00 19.21  ? 593  LEU A CD2   1 
ATOM   1829  N  N     . ILE A 1  594 ? 138.714 95.669  99.382  1.00 17.54  ? 594  ILE A N     1 
ATOM   1830  C  CA    . ILE A 1  594 ? 140.048 96.136  99.047  1.00 17.54  ? 594  ILE A CA    1 
ATOM   1831  C  C     . ILE A 1  594 ? 140.039 97.650  99.146  1.00 17.54  ? 594  ILE A C     1 
ATOM   1832  O  O     . ILE A 1  594 ? 139.397 98.330  98.338  1.00 17.54  ? 594  ILE A O     1 
ATOM   1833  C  CB    . ILE A 1  594 ? 140.488 95.671  97.660  1.00 17.54  ? 594  ILE A CB    1 
ATOM   1834  C  CG1   . ILE A 1  594 ? 140.610 94.158  97.663  1.00 17.54  ? 594  ILE A CG1   1 
ATOM   1835  C  CG2   . ILE A 1  594 ? 141.806 96.304  97.273  1.00 17.54  ? 594  ILE A CG2   1 
ATOM   1836  C  CD1   . ILE A 1  594 ? 140.818 93.608  96.331  1.00 17.54  ? 594  ILE A CD1   1 
ATOM   1837  N  N     . VAL A 1  595 ? 140.733 98.175  100.144 1.00 16.18  ? 595  VAL A N     1 
ATOM   1838  C  CA    . VAL A 1  595 ? 140.843 99.609  100.356 1.00 16.18  ? 595  VAL A CA    1 
ATOM   1839  C  C     . VAL A 1  595 ? 142.143 100.057 99.716  1.00 16.18  ? 595  VAL A C     1 
ATOM   1840  O  O     . VAL A 1  595 ? 143.231 99.719  100.189 1.00 16.18  ? 595  VAL A O     1 
ATOM   1841  C  CB    . VAL A 1  595 ? 140.807 99.972  101.844 1.00 16.18  ? 595  VAL A CB    1 
ATOM   1842  C  CG1   . VAL A 1  595 ? 141.078 101.441 102.025 1.00 16.18  ? 595  VAL A CG1   1 
ATOM   1843  C  CG2   . VAL A 1  595 ? 139.468 99.632  102.432 1.00 16.18  ? 595  VAL A CG2   1 
ATOM   1844  N  N     . ILE A 1  596 ? 142.043 100.803 98.626  1.00 16.18  ? 596  ILE A N     1 
ATOM   1845  C  CA    . ILE A 1  596 ? 143.194 101.503 98.081  1.00 16.18  ? 596  ILE A CA    1 
ATOM   1846  C  C     . ILE A 1  596 ? 143.169 102.895 98.691  1.00 16.18  ? 596  ILE A C     1 
ATOM   1847  O  O     . ILE A 1  596 ? 142.322 103.719 98.349  1.00 16.18  ? 596  ILE A O     1 
ATOM   1848  C  CB    . ILE A 1  596 ? 143.168 101.547 96.552  1.00 16.18  ? 596  ILE A CB    1 
ATOM   1849  C  CG1   . ILE A 1  596 ? 143.182 100.126 95.991  1.00 16.18  ? 596  ILE A CG1   1 
ATOM   1850  C  CG2   . ILE A 1  596 ? 144.376 102.284 96.053  1.00 16.18  ? 596  ILE A CG2   1 
ATOM   1851  C  CD1   . ILE A 1  596 ? 142.916 100.045 94.513  1.00 16.18  ? 596  ILE A CD1   1 
ATOM   1852  N  N     . ALA A 1  597 ? 144.068 103.143 99.629  1.00 18.58  ? 597  ALA A N     1 
ATOM   1853  C  CA    . ALA A 1  597 ? 144.074 104.377 100.398 1.00 18.58  ? 597  ALA A CA    1 
ATOM   1854  C  C     . ALA A 1  597 ? 145.210 105.253 99.896  1.00 18.58  ? 597  ALA A C     1 
ATOM   1855  O  O     . ALA A 1  597 ? 146.380 104.984 100.177 1.00 18.58  ? 597  ALA A O     1 
ATOM   1856  C  CB    . ALA A 1  597 ? 144.222 104.079 101.886 1.00 18.58  ? 597  ALA A CB    1 
ATOM   1857  N  N     . VAL A 1  598 ? 144.869 106.297 99.152  1.00 20.66  ? 598  VAL A N     1 
ATOM   1858  C  CA    . VAL A 1  598 ? 145.852 107.212 98.591  1.00 20.66  ? 598  VAL A CA    1 
ATOM   1859  C  C     . VAL A 1  598 ? 145.850 108.505 99.401  1.00 20.66  ? 598  VAL A C     1 
ATOM   1860  O  O     . VAL A 1  598 ? 144.805 109.139 99.587  1.00 20.66  ? 598  VAL A O     1 
ATOM   1861  C  CB    . VAL A 1  598 ? 145.622 107.437 97.085  1.00 20.66  ? 598  VAL A CB    1 
ATOM   1862  C  CG1   . VAL A 1  598 ? 144.185 107.644 96.771  1.00 20.66  ? 598  VAL A CG1   1 
ATOM   1863  C  CG2   . VAL A 1  598 ? 146.414 108.622 96.602  1.00 20.66  ? 598  VAL A CG2   1 
ATOM   1864  N  N     . ALA A 1  599 ? 147.023 108.865 99.920  1.00 27.22  ? 599  ALA A N     1 
ATOM   1865  C  CA    . ALA A 1  599 ? 147.210 110.055 100.740 1.00 27.22  ? 599  ALA A CA    1 
ATOM   1866  C  C     . ALA A 1  599 ? 148.479 110.751 100.265 1.00 27.22  ? 599  ALA A C     1 
ATOM   1867  O  O     . ALA A 1  599 ? 149.031 110.417 99.216  1.00 27.22  ? 599  ALA A O     1 
ATOM   1868  C  CB    . ALA A 1  599 ? 147.268 109.689 102.228 1.00 27.22  ? 599  ALA A CB    1 
ATOM   1869  N  N     . ASN A 1  600 ? 148.949 111.732 101.033 1.00 40.32  ? 600  ASN A N     1 
ATOM   1870  C  CA    . ASN A 1  600 ? 150.142 112.488 100.662 1.00 40.32  ? 600  ASN A CA    1 
ATOM   1871  C  C     . ASN A 1  600 ? 151.402 112.012 101.370 1.00 40.32  ? 600  ASN A C     1 
ATOM   1872  O  O     . ASN A 1  600 ? 152.414 111.748 100.716 1.00 40.32  ? 600  ASN A O     1 
ATOM   1873  C  CB    . ASN A 1  600 ? 149.940 113.983 100.931 1.00 40.32  ? 600  ASN A CB    1 
ATOM   1874  C  CG    . ASN A 1  600 ? 148.994 114.629 99.944  1.00 40.32  ? 600  ASN A CG    1 
ATOM   1875  O  OD1   . ASN A 1  600 ? 147.906 115.068 100.303 1.00 40.32  ? 600  ASN A OD1   1 
ATOM   1876  N  ND2   . ASN A 1  600 ? 149.412 114.698 98.688  1.00 40.32  ? 600  ASN A ND2   1 
ATOM   1877  N  N     . THR A 1  601 ? 151.371 111.902 102.691 1.00 48.03  ? 601  THR A N     1 
ATOM   1878  C  CA    . THR A 1  601 ? 152.548 111.525 103.455 1.00 48.03  ? 601  THR A CA    1 
ATOM   1879  C  C     . THR A 1  601 ? 152.546 110.031 103.765 1.00 48.03  ? 601  THR A C     1 
ATOM   1880  O  O     . THR A 1  601 ? 151.517 109.355 103.710 1.00 48.03  ? 601  THR A O     1 
ATOM   1881  C  CB    . THR A 1  601 ? 152.634 112.338 104.747 1.00 48.03  ? 601  THR A CB    1 
ATOM   1882  O  OG1   . THR A 1  601 ? 153.856 112.029 105.429 1.00 48.03  ? 601  THR A OG1   1 
ATOM   1883  C  CG2   . THR A 1  601 ? 151.459 112.033 105.641 1.00 48.03  ? 601  THR A CG2   1 
ATOM   1884  N  N     . MET A 1  602 ? 153.733 109.523 104.085 1.00 53.53  ? 602  MET A N     1 
ATOM   1885  C  CA    . MET A 1  602 ? 153.951 108.098 104.289 1.00 53.53  ? 602  MET A CA    1 
ATOM   1886  C  C     . MET A 1  602 ? 153.725 107.641 105.719 1.00 53.53  ? 602  MET A C     1 
ATOM   1887  O  O     . MET A 1  602 ? 153.534 106.442 105.949 1.00 53.53  ? 602  MET A O     1 
ATOM   1888  C  CB    . MET A 1  602 ? 155.373 107.737 103.865 1.00 53.53  ? 602  MET A CB    1 
ATOM   1889  C  CG    . MET A 1  602 ? 155.534 107.668 102.376 1.00 53.53  ? 602  MET A CG    1 
ATOM   1890  S  SD    . MET A 1  602 ? 154.700 106.194 101.790 1.00 53.53  ? 602  MET A SD    1 
ATOM   1891  C  CE    . MET A 1  602 ? 155.879 104.980 102.365 1.00 53.53  ? 602  MET A CE    1 
ATOM   1892  N  N     . ASP A 1  603 ? 153.747 108.556 106.680 1.00 54.24  ? 603  ASP A N     1 
ATOM   1893  C  CA    . ASP A 1  603 ? 153.603 108.210 108.083 1.00 54.24  ? 603  ASP A CA    1 
ATOM   1894  C  C     . ASP A 1  603 ? 152.215 108.509 108.632 1.00 54.24  ? 603  ASP A C     1 
ATOM   1895  O  O     . ASP A 1  603 ? 152.020 108.437 109.846 1.00 54.24  ? 603  ASP A O     1 
ATOM   1896  C  CB    . ASP A 1  603 ? 154.675 108.928 108.904 1.00 54.24  ? 603  ASP A CB    1 
ATOM   1897  C  CG    . ASP A 1  603 ? 154.695 110.426 108.661 1.00 54.24  ? 603  ASP A CG    1 
ATOM   1898  O  OD1   . ASP A 1  603 ? 153.937 110.914 107.796 1.00 54.24  ? 603  ASP A OD1   1 
ATOM   1899  O  OD2   . ASP A 1  603 ? 155.485 111.120 109.334 1.00 54.24  ? 603  ASP A OD2   1 
ATOM   1900  N  N     . LEU A 1  604 ? 151.260 108.853 107.768 1.00 47.51  ? 604  LEU A N     1 
ATOM   1901  C  CA    . LEU A 1  604 ? 149.885 109.060 108.215 1.00 47.51  ? 604  LEU A CA    1 
ATOM   1902  C  C     . LEU A 1  604 ? 149.222 107.849 108.887 1.00 47.51  ? 604  LEU A C     1 
ATOM   1903  O  O     . LEU A 1  604 ? 148.444 108.080 109.829 1.00 47.51  ? 604  LEU A O     1 
ATOM   1904  C  CB    . LEU A 1  604 ? 149.031 109.553 107.033 1.00 47.51  ? 604  LEU A CB    1 
ATOM   1905  C  CG    . LEU A 1  604 ? 147.567 109.920 107.291 1.00 47.51  ? 604  LEU A CG    1 
ATOM   1906  C  CD1   . LEU A 1  604 ? 147.436 111.177 108.148 1.00 47.51  ? 604  LEU A CD1   1 
ATOM   1907  C  CD2   . LEU A 1  604 ? 146.812 110.039 105.991 1.00 47.51  ? 604  LEU A CD2   1 
ATOM   1908  N  N     . PRO A 1  605 ? 149.451 106.582 108.490 1.00 47.39  ? 605  PRO A N     1 
ATOM   1909  C  CA    . PRO A 1  605 ? 148.926 105.491 109.334 1.00 47.39  ? 605  PRO A CA    1 
ATOM   1910  C  C     . PRO A 1  605 ? 149.569 105.397 110.705 1.00 47.39  ? 605  PRO A C     1 
ATOM   1911  O  O     . PRO A 1  605 ? 148.852 105.210 111.695 1.00 47.39  ? 605  PRO A O     1 
ATOM   1912  C  CB    . PRO A 1  605 ? 149.198 104.237 108.496 1.00 47.39  ? 605  PRO A CB    1 
ATOM   1913  C  CG    . PRO A 1  605 ? 149.211 104.708 107.129 1.00 47.39  ? 605  PRO A CG    1 
ATOM   1914  C  CD    . PRO A 1  605 ? 149.849 106.046 107.171 1.00 47.39  ? 605  PRO A CD    1 
ATOM   1915  N  N     . GLU A 1  606 ? 150.891 105.530 110.802 1.00 53.77  ? 606  GLU A N     1 
ATOM   1916  C  CA    . GLU A 1  606 ? 151.554 105.289 112.076 1.00 53.77  ? 606  GLU A CA    1 
ATOM   1917  C  C     . GLU A 1  606 ? 151.392 106.444 113.056 1.00 53.77  ? 606  GLU A C     1 
ATOM   1918  O  O     . GLU A 1  606 ? 151.480 106.220 114.266 1.00 53.77  ? 606  GLU A O     1 
ATOM   1919  C  CB    . GLU A 1  606 ? 153.039 104.978 111.849 1.00 53.77  ? 606  GLU A CB    1 
ATOM   1920  C  CG    . GLU A 1  606 ? 153.895 106.119 111.311 1.00 53.77  ? 606  GLU A CG    1 
ATOM   1921  C  CD    . GLU A 1  606 ? 154.604 106.890 112.412 1.00 53.77  ? 606  GLU A CD    1 
ATOM   1922  O  OE1   . GLU A 1  606 ? 154.761 106.333 113.518 1.00 53.77  ? 606  GLU A OE1   1 
ATOM   1923  O  OE2   . GLU A 1  606 ? 154.998 108.050 112.177 1.00 53.77  ? 606  GLU A OE2   1 
ATOM   1924  N  N     . ARG A 1  607 ? 151.156 107.665 112.575 1.00 52.30  ? 607  ARG A N     1 
ATOM   1925  C  CA    . ARG A 1  607 ? 150.929 108.774 113.497 1.00 52.30  ? 607  ARG A CA    1 
ATOM   1926  C  C     . ARG A 1  607 ? 149.520 108.742 114.071 1.00 52.30  ? 607  ARG A C     1 
ATOM   1927  O  O     . ARG A 1  607 ? 149.332 108.952 115.273 1.00 52.30  ? 607  ARG A O     1 
ATOM   1928  C  CB    . ARG A 1  607 ? 151.165 110.114 112.802 1.00 52.30  ? 607  ARG A CB    1 
ATOM   1929  C  CG    . ARG A 1  607 ? 152.586 110.380 112.361 1.00 52.30  ? 607  ARG A CG    1 
ATOM   1930  C  CD    . ARG A 1  607 ? 152.644 111.714 111.649 1.00 52.30  ? 607  ARG A CD    1 
ATOM   1931  N  NE    . ARG A 1  607 ? 151.709 111.738 110.530 1.00 52.30  ? 607  ARG A NE    1 
ATOM   1932  C  CZ    . ARG A 1  607 ? 151.435 112.814 109.802 1.00 52.30  ? 607  ARG A CZ    1 
ATOM   1933  N  NH1   . ARG A 1  607 ? 150.556 112.740 108.814 1.00 52.30  ? 607  ARG A NH1   1 
ATOM   1934  N  NH2   . ARG A 1  607 ? 152.041 113.965 110.057 1.00 52.30  ? 607  ARG A NH2   1 
ATOM   1935  N  N     . GLN A 1  608 ? 148.522 108.485 113.226 1.00 50.99  ? 608  GLN A N     1 
ATOM   1936  C  CA    . GLN A 1  608 ? 147.133 108.561 113.662 1.00 50.99  ? 608  GLN A CA    1 
ATOM   1937  C  C     . GLN A 1  608 ? 146.725 107.323 114.451 1.00 50.99  ? 608  GLN A C     1 
ATOM   1938  O  O     . GLN A 1  608 ? 146.113 107.432 115.518 1.00 50.99  ? 608  GLN A O     1 
ATOM   1939  C  CB    . GLN A 1  608 ? 146.213 108.745 112.454 1.00 50.99  ? 608  GLN A CB    1 
ATOM   1940  C  CG    . GLN A 1  608 ? 146.430 110.032 111.669 1.00 50.99  ? 608  GLN A CG    1 
ATOM   1941  C  CD    . GLN A 1  608 ? 146.044 111.275 112.445 1.00 50.99  ? 608  GLN A CD    1 
ATOM   1942  O  OE1   . GLN A 1  608 ? 145.058 111.283 113.177 1.00 50.99  ? 608  GLN A OE1   1 
ATOM   1943  N  NE2   . GLN A 1  608 ? 146.819 112.339 112.279 1.00 50.99  ? 608  GLN A NE2   1 
ATOM   1944  N  N     . LEU A 1  609 ? 147.053 106.138 113.942 1.00 43.67  ? 609  LEU A N     1 
ATOM   1945  C  CA    . LEU A 1  609 ? 146.581 104.904 114.555 1.00 43.67  ? 609  LEU A CA    1 
ATOM   1946  C  C     . LEU A 1  609 ? 147.498 104.405 115.663 1.00 43.67  ? 609  LEU A C     1 
ATOM   1947  O  O     . LEU A 1  609 ? 147.018 103.999 116.726 1.00 43.67  ? 609  LEU A O     1 
ATOM   1948  C  CB    . LEU A 1  609 ? 146.424 103.816 113.491 1.00 43.67  ? 609  LEU A CB    1 
ATOM   1949  C  CG    . LEU A 1  609 ? 145.337 104.067 112.450 1.00 43.67  ? 609  LEU A CG    1 
ATOM   1950  C  CD1   . LEU A 1  609 ? 145.326 102.967 111.407 1.00 43.67  ? 609  LEU A CD1   1 
ATOM   1951  C  CD2   . LEU A 1  609 ? 143.991 104.183 113.126 1.00 43.67  ? 609  LEU A CD2   1 
ATOM   1952  N  N     . GLY A 1  610 ? 148.801 104.430 115.443 1.00 48.99  ? 610  GLY A N     1 
ATOM   1953  C  CA    . GLY A 1  610 ? 149.759 103.876 116.374 1.00 48.99  ? 610  GLY A CA    1 
ATOM   1954  C  C     . GLY A 1  610 ? 150.561 102.759 115.738 1.00 48.99  ? 610  GLY A C     1 
ATOM   1955  O  O     . GLY A 1  610 ? 150.396 102.421 114.567 1.00 48.99  ? 610  GLY A O     1 
ATOM   1956  N  N     . ASN A 1  611 ? 151.441 102.177 116.547 1.00 52.67  ? 611  ASN A N     1 
ATOM   1957  C  CA    . ASN A 1  611 ? 152.369 101.180 116.035 1.00 52.67  ? 611  ASN A CA    1 
ATOM   1958  C  C     . ASN A 1  611 ? 151.806 99.768  116.085 1.00 52.67  ? 611  ASN A C     1 
ATOM   1959  O  O     . ASN A 1  611 ? 152.094 98.965  115.190 1.00 52.67  ? 611  ASN A O     1 
ATOM   1960  C  CB    . ASN A 1  611 ? 153.679 101.240 116.822 1.00 52.67  ? 611  ASN A CB    1 
ATOM   1961  C  CG    . ASN A 1  611 ? 154.315 102.614 116.783 1.00 52.67  ? 611  ASN A CG    1 
ATOM   1962  O  OD1   . ASN A 1  611 ? 154.471 103.264 117.815 1.00 52.67  ? 611  ASN A OD1   1 
ATOM   1963  N  ND2   . ASN A 1  611 ? 154.665 103.073 115.588 1.00 52.67  ? 611  ASN A ND2   1 
ATOM   1964  N  N     . LYS A 1  612 ? 151.011 99.444  117.106 1.00 50.49  ? 612  LYS A N     1 
ATOM   1965  C  CA    . LYS A 1  612 ? 150.453 98.101  117.213 1.00 50.49  ? 612  LYS A CA    1 
ATOM   1966  C  C     . LYS A 1  612 ? 149.250 97.898  116.301 1.00 50.49  ? 612  LYS A C     1 
ATOM   1967  O  O     . LYS A 1  612 ? 148.962 96.762  115.912 1.00 50.49  ? 612  LYS A O     1 
ATOM   1968  C  CB    . LYS A 1  612 ? 150.071 97.798  118.664 1.00 50.49  ? 612  LYS A CB    1 
ATOM   1969  C  CG    . LYS A 1  612 ? 148.969 98.681  119.234 1.00 50.49  ? 612  LYS A CG    1 
ATOM   1970  C  CD    . LYS A 1  612 ? 148.619 98.283  120.656 1.00 50.49  ? 612  LYS A CD    1 
ATOM   1971  C  CE    . LYS A 1  612 ? 147.888 96.949  120.687 1.00 50.49  ? 612  LYS A CE    1 
ATOM   1972  N  NZ    . LYS A 1  612 ? 146.548 97.029  120.039 1.00 50.49  ? 612  LYS A NZ    1 
ATOM   1973  N  N     . ILE A 1  613 ? 148.541 98.971  115.948 1.00 47.01  ? 613  ILE A N     1 
ATOM   1974  C  CA    . ILE A 1  613 ? 147.394 98.831  115.060 1.00 47.01  ? 613  ILE A CA    1 
ATOM   1975  C  C     . ILE A 1  613 ? 147.852 98.671  113.617 1.00 47.01  ? 613  ILE A C     1 
ATOM   1976  O  O     . ILE A 1  613 ? 147.378 97.784  112.901 1.00 47.01  ? 613  ILE A O     1 
ATOM   1977  C  CB    . ILE A 1  613 ? 146.437 100.025 115.234 1.00 47.01  ? 613  ILE A CB    1 
ATOM   1978  C  CG1   . ILE A 1  613 ? 145.861 100.038 116.648 1.00 47.01  ? 613  ILE A CG1   1 
ATOM   1979  C  CG2   . ILE A 1  613 ? 145.307 99.965  114.229 1.00 47.01  ? 613  ILE A CG2   1 
ATOM   1980  C  CD1   . ILE A 1  613 ? 145.069 101.280 116.971 1.00 47.01  ? 613  ILE A CD1   1 
ATOM   1981  N  N     . THR A 1  614 ? 148.810 99.493  113.180 1.00 46.63  ? 614  THR A N     1 
ATOM   1982  C  CA    . THR A 1  614 ? 149.318 99.417  111.815 1.00 46.63  ? 614  THR A CA    1 
ATOM   1983  C  C     . THR A 1  614 ? 150.158 98.173  111.550 1.00 46.63  ? 614  THR A C     1 
ATOM   1984  O  O     . THR A 1  614 ? 150.407 97.857  110.383 1.00 46.63  ? 614  THR A O     1 
ATOM   1985  C  CB    . THR A 1  614 ? 150.132 100.667 111.486 1.00 46.63  ? 614  THR A CB    1 
ATOM   1986  O  OG1   . THR A 1  614 ? 151.182 100.825 112.446 1.00 46.63  ? 614  THR A OG1   1 
ATOM   1987  C  CG2   . THR A 1  614 ? 149.247 101.891 111.496 1.00 46.63  ? 614  THR A CG2   1 
ATOM   1988  N  N     . SER A 1  615 ? 150.604 97.468  112.589 1.00 47.53  ? 615  SER A N     1 
ATOM   1989  C  CA    . SER A 1  615 ? 151.225 96.164  112.404 1.00 47.53  ? 615  SER A CA    1 
ATOM   1990  C  C     . SER A 1  615 ? 150.205 95.038  112.367 1.00 47.53  ? 615  SER A C     1 
ATOM   1991  O  O     . SER A 1  615 ? 150.491 93.977  111.802 1.00 47.53  ? 615  SER A O     1 
ATOM   1992  C  CB    . SER A 1  615 ? 152.239 95.894  113.520 1.00 47.53  ? 615  SER A CB    1 
ATOM   1993  O  OG    . SER A 1  615 ? 151.589 95.756  114.771 1.00 47.53  ? 615  SER A OG    1 
ATOM   1994  N  N     . ARG A 1  616 ? 149.023 95.254  112.946 1.00 49.19  ? 616  ARG A N     1 
ATOM   1995  C  CA    . ARG A 1  616 ? 147.985 94.231  112.949 1.00 49.19  ? 616  ARG A CA    1 
ATOM   1996  C  C     . ARG A 1  616 ? 147.300 94.139  111.592 1.00 49.19  ? 616  ARG A C     1 
ATOM   1997  O  O     . ARG A 1  616 ? 146.909 93.049  111.158 1.00 49.19  ? 616  ARG A O     1 
ATOM   1998  C  CB    . ARG A 1  616 ? 146.963 94.540  114.042 1.00 49.19  ? 616  ARG A CB    1 
ATOM   1999  C  CG    . ARG A 1  616 ? 145.909 93.471  114.243 1.00 49.19  ? 616  ARG A CG    1 
ATOM   2000  C  CD    . ARG A 1  616 ? 144.902 93.874  115.308 1.00 49.19  ? 616  ARG A CD    1 
ATOM   2001  N  NE    . ARG A 1  616 ? 144.091 95.016  114.896 1.00 49.19  ? 616  ARG A NE    1 
ATOM   2002  C  CZ    . ARG A 1  616 ? 142.991 94.922  114.154 1.00 49.19  ? 616  ARG A CZ    1 
ATOM   2003  N  NH1   . ARG A 1  616 ? 142.318 96.015  113.827 1.00 49.19  ? 616  ARG A NH1   1 
ATOM   2004  N  NH2   . ARG A 1  616 ? 142.561 93.737  113.743 1.00 49.19  ? 616  ARG A NH2   1 
ATOM   2005  N  N     . ILE A 1  617 ? 147.153 95.277  110.911 1.00 43.36  ? 617  ILE A N     1 
ATOM   2006  C  CA    . ILE A 1  617 ? 146.425 95.317  109.647 1.00 43.36  ? 617  ILE A CA    1 
ATOM   2007  C  C     . ILE A 1  617 ? 147.229 94.634  108.549 1.00 43.36  ? 617  ILE A C     1 
ATOM   2008  O  O     . ILE A 1  617 ? 146.709 93.793  107.807 1.00 43.36  ? 617  ILE A O     1 
ATOM   2009  C  CB    . ILE A 1  617 ? 146.093 96.774  109.285 1.00 43.36  ? 617  ILE A CB    1 
ATOM   2010  C  CG1   . ILE A 1  617 ? 145.262 97.403  110.400 1.00 43.36  ? 617  ILE A CG1   1 
ATOM   2011  C  CG2   . ILE A 1  617 ? 145.337 96.832  107.972 1.00 43.36  ? 617  ILE A CG2   1 
ATOM   2012  C  CD1   . ILE A 1  617 ? 145.284 98.902  110.400 1.00 43.36  ? 617  ILE A CD1   1 
ATOM   2013  N  N     . GLY A 1  618 ? 148.511 94.970  108.444 1.00 41.46  ? 618  GLY A N     1 
ATOM   2014  C  CA    . GLY A 1  618 ? 149.384 94.341  107.476 1.00 41.46  ? 618  GLY A CA    1 
ATOM   2015  C  C     . GLY A 1  618 ? 149.081 94.754  106.054 1.00 41.46  ? 618  GLY A C     1 
ATOM   2016  O  O     . GLY A 1  618 ? 148.817 93.908  105.195 1.00 41.46  ? 618  GLY A O     1 
ATOM   2017  N  N     . PHE A 1  619 ? 149.105 96.052  105.797 1.00 34.86  ? 619  PHE A N     1 
ATOM   2018  C  CA    . PHE A 1  619 ? 148.854 96.562  104.462 1.00 34.86  ? 619  PHE A CA    1 
ATOM   2019  C  C     . PHE A 1  619 ? 150.160 96.816  103.723 1.00 34.86  ? 619  PHE A C     1 
ATOM   2020  O  O     . PHE A 1  619 ? 151.217 97.016  104.325 1.00 34.86  ? 619  PHE A O     1 
ATOM   2021  C  CB    . PHE A 1  619 ? 147.997 97.832  104.512 1.00 34.86  ? 619  PHE A CB    1 
ATOM   2022  C  CG    . PHE A 1  619 ? 148.506 98.903  105.438 1.00 34.86  ? 619  PHE A CG    1 
ATOM   2023  C  CD1   . PHE A 1  619 ? 148.044 98.978  106.743 1.00 34.86  ? 619  PHE A CD1   1 
ATOM   2024  C  CD2   . PHE A 1  619 ? 149.408 99.859  105.002 1.00 34.86  ? 619  PHE A CD2   1 
ATOM   2025  C  CE1   . PHE A 1  619 ? 148.487 99.963  107.594 1.00 34.86  ? 619  PHE A CE1   1 
ATOM   2026  C  CE2   . PHE A 1  619 ? 149.855 100.845 105.854 1.00 34.86  ? 619  PHE A CE2   1 
ATOM   2027  C  CZ    . PHE A 1  619 ? 149.395 100.896 107.151 1.00 34.86  ? 619  PHE A CZ    1 
ATOM   2028  N  N     . THR A 1  620 ? 150.075 96.780  102.395 1.00 33.48  ? 620  THR A N     1 
ATOM   2029  C  CA    . THR A 1  620 ? 151.204 97.161  101.567 1.00 33.48  ? 620  THR A CA    1 
ATOM   2030  C  C     . THR A 1  620 ? 151.393 98.670  101.630 1.00 33.48  ? 620  THR A C     1 
ATOM   2031  O  O     . THR A 1  620 ? 150.498 99.417  102.028 1.00 33.48  ? 620  THR A O     1 
ATOM   2032  C  CB    . THR A 1  620 ? 150.995 96.722  100.122 1.00 33.48  ? 620  THR A CB    1 
ATOM   2033  O  OG1   . THR A 1  620 ? 149.894 97.442  99.563  1.00 33.48  ? 620  THR A OG1   1 
ATOM   2034  C  CG2   . THR A 1  620 ? 150.682 95.243  100.067 1.00 33.48  ? 620  THR A CG2   1 
ATOM   2035  N  N     . ARG A 1  621 ? 152.572 99.123  101.224 1.00 41.72  ? 621  ARG A N     1 
ATOM   2036  C  CA    . ARG A 1  621 ? 152.942 100.513 101.466 1.00 41.72  ? 621  ARG A CA    1 
ATOM   2037  C  C     . ARG A 1  621 ? 153.806 100.977 100.299 1.00 41.72  ? 621  ARG A C     1 
ATOM   2038  O  O     . ARG A 1  621 ? 154.996 100.658 100.239 1.00 41.72  ? 621  ARG A O     1 
ATOM   2039  C  CB    . ARG A 1  621 ? 153.670 100.638 102.795 1.00 41.72  ? 621  ARG A CB    1 
ATOM   2040  C  CG    . ARG A 1  621 ? 153.885 102.047 103.265 1.00 41.72  ? 621  ARG A CG    1 
ATOM   2041  C  CD    . ARG A 1  621 ? 154.712 102.053 104.535 1.00 41.72  ? 621  ARG A CD    1 
ATOM   2042  N  NE    . ARG A 1  621 ? 154.012 101.462 105.670 1.00 41.72  ? 621  ARG A NE    1 
ATOM   2043  C  CZ    . ARG A 1  621 ? 153.246 102.151 106.506 1.00 41.72  ? 621  ARG A CZ    1 
ATOM   2044  N  NH1   . ARG A 1  621 ? 153.096 103.456 106.340 1.00 41.72  ? 621  ARG A NH1   1 
ATOM   2045  N  NH2   . ARG A 1  621 ? 152.645 101.541 107.518 1.00 41.72  ? 621  ARG A NH2   1 
ATOM   2046  N  N     . ILE A 1  622 ? 153.204 101.731 99.385  1.00 36.23  ? 622  ILE A N     1 
ATOM   2047  C  CA    . ILE A 1  622 ? 153.871 102.214 98.183  1.00 36.23  ? 622  ILE A CA    1 
ATOM   2048  C  C     . ILE A 1  622 ? 154.035 103.723 98.305  1.00 36.23  ? 622  ILE A C     1 
ATOM   2049  O  O     . ILE A 1  622 ? 153.158 104.406 98.840  1.00 36.23  ? 622  ILE A O     1 
ATOM   2050  C  CB    . ILE A 1  622 ? 153.063 101.822 96.930  1.00 36.23  ? 622  ILE A CB    1 
ATOM   2051  C  CG1   . ILE A 1  622 ? 152.844 100.313 96.919  1.00 36.23  ? 622  ILE A CG1   1 
ATOM   2052  C  CG2   . ILE A 1  622 ? 153.793 102.189 95.660  1.00 36.23  ? 622  ILE A CG2   1 
ATOM   2053  C  CD1   . ILE A 1  622 ? 151.895 99.843  95.861  1.00 36.23  ? 622  ILE A CD1   1 
ATOM   2054  N  N     . MET A 1  623 ? 155.178 104.241 97.864  1.00 44.50  ? 623  MET A N     1 
ATOM   2055  C  CA    . MET A 1  623 ? 155.384 105.678 97.757  1.00 44.50  ? 623  MET A CA    1 
ATOM   2056  C  C     . MET A 1  623 ? 155.707 106.014 96.312  1.00 44.50  ? 623  MET A C     1 
ATOM   2057  O  O     . MET A 1  623 ? 156.509 105.320 95.678  1.00 44.50  ? 623  MET A O     1 
ATOM   2058  C  CB    . MET A 1  623 ? 156.514 106.176 98.660  1.00 44.50  ? 623  MET A CB    1 
ATOM   2059  C  CG    . MET A 1  623 ? 156.613 107.696 98.676  1.00 44.50  ? 623  MET A CG    1 
ATOM   2060  S  SD    . MET A 1  623 ? 157.887 108.426 99.711  1.00 44.50  ? 623  MET A SD    1 
ATOM   2061  C  CE    . MET A 1  623 ? 157.619 110.160 99.347  1.00 44.50  ? 623  MET A CE    1 
ATOM   2062  N  N     . PHE A 1  624 ? 155.092 107.072 95.793  1.00 34.82  ? 624  PHE A N     1 
ATOM   2063  C  CA    . PHE A 1  624 ? 155.392 107.531 94.446  1.00 34.82  ? 624  PHE A CA    1 
ATOM   2064  C  C     . PHE A 1  624 ? 156.335 108.716 94.558  1.00 34.82  ? 624  PHE A C     1 
ATOM   2065  O  O     . PHE A 1  624 ? 155.950 109.774 95.067  1.00 34.82  ? 624  PHE A O     1 
ATOM   2066  C  CB    . PHE A 1  624 ? 154.165 107.961 93.641  1.00 34.82  ? 624  PHE A CB    1 
ATOM   2067  C  CG    . PHE A 1  624 ? 153.222 106.852 93.242  1.00 34.82  ? 624  PHE A CG    1 
ATOM   2068  C  CD1   . PHE A 1  624 ? 153.274 105.576 93.777  1.00 34.82  ? 624  PHE A CD1   1 
ATOM   2069  C  CD2   . PHE A 1  624 ? 152.357 107.079 92.202  1.00 34.82  ? 624  PHE A CD2   1 
ATOM   2070  C  CE1   . PHE A 1  624 ? 152.396 104.607 93.367  1.00 34.82  ? 624  PHE A CE1   1 
ATOM   2071  C  CE2   . PHE A 1  624 ? 151.511 106.104 91.771  1.00 34.82  ? 624  PHE A CE2   1 
ATOM   2072  C  CZ    . PHE A 1  624 ? 151.520 104.872 92.355  1.00 34.82  ? 624  PHE A CZ    1 
ATOM   2073  N  N     . THR A 1  625 ? 157.557 108.541 94.083  1.00 36.88  ? 625  THR A N     1 
ATOM   2074  C  CA    . THR A 1  625 ? 158.495 109.642 94.010  1.00 36.88  ? 625  THR A CA    1 
ATOM   2075  C  C     . THR A 1  625 ? 158.090 110.547 92.852  1.00 36.88  ? 625  THR A C     1 
ATOM   2076  O  O     . THR A 1  625 ? 157.537 110.082 91.852  1.00 36.88  ? 625  THR A O     1 
ATOM   2077  C  CB    . THR A 1  625 ? 159.913 109.097 93.824  1.00 36.88  ? 625  THR A CB    1 
ATOM   2078  O  OG1   . THR A 1  625 ? 160.151 108.086 94.810  1.00 36.88  ? 625  THR A OG1   1 
ATOM   2079  C  CG2   . THR A 1  625 ? 160.965 110.181 94.014  1.00 36.88  ? 625  THR A CG2   1 
ATOM   2080  N  N     . GLY A 1  626 ? 158.309 111.853 93.024  1.00 34.97  ? 626  GLY A N     1 
ATOM   2081  C  CA    . GLY A 1  626 ? 158.072 112.787 91.939  1.00 34.97  ? 626  GLY A CA    1 
ATOM   2082  C  C     . GLY A 1  626 ? 158.951 112.496 90.739  1.00 34.97  ? 626  GLY A C     1 
ATOM   2083  O  O     . GLY A 1  626 ? 160.057 111.968 90.865  1.00 34.97  ? 626  GLY A O     1 
ATOM   2084  N  N     . TYR A 1  627 ? 158.433 112.830 89.561  1.00 35.68  ? 627  TYR A N     1 
ATOM   2085  C  CA    . TYR A 1  627 ? 159.049 112.407 88.313  1.00 35.68  ? 627  TYR A CA    1 
ATOM   2086  C  C     . TYR A 1  627 ? 160.369 113.128 88.067  1.00 35.68  ? 627  TYR A C     1 
ATOM   2087  O  O     . TYR A 1  627 ? 160.580 114.259 88.508  1.00 35.68  ? 627  TYR A O     1 
ATOM   2088  C  CB    . TYR A 1  627 ? 158.127 112.685 87.134  1.00 35.68  ? 627  TYR A CB    1 
ATOM   2089  C  CG    . TYR A 1  627 ? 156.814 111.959 87.109  1.00 35.68  ? 627  TYR A CG    1 
ATOM   2090  C  CD1   . TYR A 1  627 ? 156.739 110.642 86.689  1.00 35.68  ? 627  TYR A CD1   1 
ATOM   2091  C  CD2   . TYR A 1  627 ? 155.640 112.609 87.449  1.00 35.68  ? 627  TYR A CD2   1 
ATOM   2092  C  CE1   . TYR A 1  627 ? 155.537 109.983 86.644  1.00 35.68  ? 627  TYR A CE1   1 
ATOM   2093  C  CE2   . TYR A 1  627 ? 154.432 111.955 87.403  1.00 35.68  ? 627  TYR A CE2   1 
ATOM   2094  C  CZ    . TYR A 1  627 ? 154.391 110.640 87.002  1.00 35.68  ? 627  TYR A CZ    1 
ATOM   2095  O  OH    . TYR A 1  627 ? 153.197 109.970 86.953  1.00 35.68  ? 627  TYR A OH    1 
ATOM   2096  N  N     . THR A 1  628 ? 161.262 112.452 87.350  1.00 43.85  ? 628  THR A N     1 
ATOM   2097  C  CA    . THR A 1  628 ? 162.492 113.069 86.887  1.00 43.85  ? 628  THR A CA    1 
ATOM   2098  C  C     . THR A 1  628 ? 162.219 113.875 85.621  1.00 43.85  ? 628  THR A C     1 
ATOM   2099  O  O     . THR A 1  628 ? 161.133 113.813 85.039  1.00 43.85  ? 628  THR A O     1 
ATOM   2100  C  CB    . THR A 1  628 ? 163.558 112.011 86.616  1.00 43.85  ? 628  THR A CB    1 
ATOM   2101  O  OG1   . THR A 1  628 ? 163.136 111.176 85.533  1.00 43.85  ? 628  THR A OG1   1 
ATOM   2102  C  CG2   . THR A 1  628 ? 163.767 111.148 87.846  1.00 43.85  ? 628  THR A CG2   1 
ATOM   2103  N  N     . HIS A 1  629 ? 163.230 114.636 85.190  1.00 51.15  ? 629  HIS A N     1 
ATOM   2104  C  CA    . HIS A 1  629 ? 163.068 115.495 84.021  1.00 51.15  ? 629  HIS A CA    1 
ATOM   2105  C  C     . HIS A 1  629 ? 162.945 114.690 82.734  1.00 51.15  ? 629  HIS A C     1 
ATOM   2106  O  O     . HIS A 1  629 ? 162.297 115.144 81.784  1.00 51.15  ? 629  HIS A O     1 
ATOM   2107  C  CB    . HIS A 1  629 ? 164.237 116.469 83.908  1.00 51.15  ? 629  HIS A CB    1 
ATOM   2108  C  CG    . HIS A 1  629 ? 165.548 115.807 83.622  1.00 51.15  ? 629  HIS A CG    1 
ATOM   2109  N  ND1   . HIS A 1  629 ? 166.361 115.306 84.614  1.00 51.15  ? 629  HIS A ND1   1 
ATOM   2110  C  CD2   . HIS A 1  629 ? 166.172 115.535 82.451  1.00 51.15  ? 629  HIS A CD2   1 
ATOM   2111  C  CE1   . HIS A 1  629 ? 167.440 114.774 84.069  1.00 51.15  ? 629  HIS A CE1   1 
ATOM   2112  N  NE2   . HIS A 1  629 ? 167.350 114.900 82.758  1.00 51.15  ? 629  HIS A NE2   1 
ATOM   2113  N  N     . GLU A 1  630 ? 163.557 113.507 82.675  1.00 56.01  ? 630  GLU A N     1 
ATOM   2114  C  CA    . GLU A 1  630 ? 163.394 112.651 81.510  1.00 56.01  ? 630  GLU A CA    1 
ATOM   2115  C  C     . GLU A 1  630 ? 162.033 111.977 81.478  1.00 56.01  ? 630  GLU A C     1 
ATOM   2116  O  O     . GLU A 1  630 ? 161.569 111.594 80.401  1.00 56.01  ? 630  GLU A O     1 
ATOM   2117  C  CB    . GLU A 1  630 ? 164.499 111.594 81.466  1.00 56.01  ? 630  GLU A CB    1 
ATOM   2118  C  CG    . GLU A 1  630 ? 165.881 112.167 81.209  1.00 56.01  ? 630  GLU A CG    1 
ATOM   2119  C  CD    . GLU A 1  630 ? 166.013 112.787 79.827  1.00 56.01  ? 630  GLU A CD    1 
ATOM   2120  O  OE1   . GLU A 1  630 ? 165.377 112.283 78.876  1.00 56.01  ? 630  GLU A OE1   1 
ATOM   2121  O  OE2   . GLU A 1  630 ? 166.749 113.786 79.694  1.00 56.01  ? 630  GLU A OE2   1 
ATOM   2122  N  N     . GLU A 1  631 ? 161.386 111.834 82.632  1.00 46.88  ? 631  GLU A N     1 
ATOM   2123  C  CA    . GLU A 1  631 ? 160.033 111.303 82.664  1.00 46.88  ? 631  GLU A CA    1 
ATOM   2124  C  C     . GLU A 1  631 ? 159.004 112.357 82.283  1.00 46.88  ? 631  GLU A C     1 
ATOM   2125  O  O     . GLU A 1  631 ? 157.979 112.016 81.687  1.00 46.88  ? 631  GLU A O     1 
ATOM   2126  C  CB    . GLU A 1  631 ? 159.746 110.721 84.047  1.00 46.88  ? 631  GLU A CB    1 
ATOM   2127  C  CG    . GLU A 1  631 ? 160.553 109.463 84.325  1.00 46.88  ? 631  GLU A CG    1 
ATOM   2128  C  CD    . GLU A 1  631 ? 160.392 108.947 85.736  1.00 46.88  ? 631  GLU A CD    1 
ATOM   2129  O  OE1   . GLU A 1  631 ? 159.787 109.651 86.565  1.00 46.88  ? 631  GLU A OE1   1 
ATOM   2130  O  OE2   . GLU A 1  631 ? 160.874 107.832 86.018  1.00 46.88  ? 631  GLU A OE2   1 
ATOM   2131  N  N     . LEU A 1  632 ? 159.262 113.631 82.608  1.00 41.05  ? 632  LEU A N     1 
ATOM   2132  C  CA    . LEU A 1  632 ? 158.412 114.721 82.132  1.00 41.05  ? 632  LEU A CA    1 
ATOM   2133  C  C     . LEU A 1  632 ? 158.445 114.862 80.616  1.00 41.05  ? 632  LEU A C     1 
ATOM   2134  O  O     . LEU A 1  632 ? 157.436 115.239 80.014  1.00 41.05  ? 632  LEU A O     1 
ATOM   2135  C  CB    . LEU A 1  632 ? 158.819 116.047 82.778  1.00 41.05  ? 632  LEU A CB    1 
ATOM   2136  C  CG    . LEU A 1  632 ? 158.139 116.568 84.048  1.00 41.05  ? 632  LEU A CG    1 
ATOM   2137  C  CD1   . LEU A 1  632 ? 158.412 115.701 85.199  1.00 41.05  ? 632  LEU A CD1   1 
ATOM   2138  C  CD2   . LEU A 1  632 ? 158.665 117.937 84.377  1.00 41.05  ? 632  LEU A CD2   1 
ATOM   2139  N  N     . LYS A 1  633 ? 159.588 114.582 79.983  1.00 42.66  ? 633  LYS A N     1 
ATOM   2140  C  CA    . LYS A 1  633 ? 159.651 114.657 78.526  1.00 42.66  ? 633  LYS A CA    1 
ATOM   2141  C  C     . LYS A 1  633 ? 158.843 113.554 77.863  1.00 42.66  ? 633  LYS A C     1 
ATOM   2142  O  O     . LYS A 1  633 ? 158.274 113.768 76.788  1.00 42.66  ? 633  LYS A O     1 
ATOM   2143  C  CB    . LYS A 1  633 ? 161.093 114.586 78.040  1.00 42.66  ? 633  LYS A CB    1 
ATOM   2144  C  CG    . LYS A 1  633 ? 161.883 115.859 78.211  1.00 42.66  ? 633  LYS A CG    1 
ATOM   2145  C  CD    . LYS A 1  633 ? 163.297 115.687 77.687  1.00 42.66  ? 633  LYS A CD    1 
ATOM   2146  C  CE    . LYS A 1  633 ? 163.418 116.113 76.223  1.00 42.66  ? 633  LYS A CE    1 
ATOM   2147  N  NZ    . LYS A 1  633 ? 162.783 115.183 75.244  1.00 42.66  ? 633  LYS A NZ    1 
ATOM   2148  N  N     . ASN A 1  634 ? 158.778 112.377 78.476  1.00 44.91  ? 634  ASN A N     1 
ATOM   2149  C  CA    . ASN A 1  634 ? 157.987 111.281 77.942  1.00 44.91  ? 634  ASN A CA    1 
ATOM   2150  C  C     . ASN A 1  634 ? 156.533 111.333 78.389  1.00 44.91  ? 634  ASN A C     1 
ATOM   2151  O  O     . ASN A 1  634 ? 155.784 110.390 78.124  1.00 44.91  ? 634  ASN A O     1 
ATOM   2152  C  CB    . ASN A 1  634 ? 158.610 109.940 78.329  1.00 44.91  ? 634  ASN A CB    1 
ATOM   2153  C  CG    . ASN A 1  634 ? 159.963 109.724 77.685  1.00 44.91  ? 634  ASN A CG    1 
ATOM   2154  O  OD1   . ASN A 1  634 ? 160.981 109.622 78.368  1.00 44.91  ? 634  ASN A OD1   1 
ATOM   2155  N  ND2   . ASN A 1  634 ? 159.982 109.661 76.359  1.00 44.91  ? 634  ASN A ND2   1 
ATOM   2156  N  N     . ILE A 1  635 ? 156.128 112.394 79.077  1.00 39.53  ? 635  ILE A N     1 
ATOM   2157  C  CA    . ILE A 1  635 ? 154.722 112.697 79.312  1.00 39.53  ? 635  ILE A CA    1 
ATOM   2158  C  C     . ILE A 1  635 ? 154.233 113.775 78.357  1.00 39.53  ? 635  ILE A C     1 
ATOM   2159  O  O     . ILE A 1  635 ? 153.166 113.646 77.755  1.00 39.53  ? 635  ILE A O     1 
ATOM   2160  C  CB    . ILE A 1  635 ? 154.502 113.105 80.787  1.00 39.53  ? 635  ILE A CB    1 
ATOM   2161  C  CG1   . ILE A 1  635 ? 154.727 111.916 81.718  1.00 39.53  ? 635  ILE A CG1   1 
ATOM   2162  C  CG2   . ILE A 1  635 ? 153.110 113.664 81.008  1.00 39.53  ? 635  ILE A CG2   1 
ATOM   2163  C  CD1   . ILE A 1  635 ? 154.793 112.300 83.169  1.00 39.53  ? 635  ILE A CD1   1 
ATOM   2164  N  N     . ILE A 1  636 ? 155.031 114.833 78.187  1.00 38.51  ? 636  ILE A N     1 
ATOM   2165  C  CA    . ILE A 1  636 ? 154.652 115.947 77.324  1.00 38.51  ? 636  ILE A CA    1 
ATOM   2166  C  C     . ILE A 1  636 ? 154.668 115.523 75.861  1.00 38.51  ? 636  ILE A C     1 
ATOM   2167  O  O     . ILE A 1  636 ? 153.705 115.753 75.121  1.00 38.51  ? 636  ILE A O     1 
ATOM   2168  C  CB    . ILE A 1  636 ? 155.579 117.150 77.571  1.00 38.51  ? 636  ILE A CB    1 
ATOM   2169  C  CG1   . ILE A 1  636 ? 155.436 117.656 79.005  1.00 38.51  ? 636  ILE A CG1   1 
ATOM   2170  C  CG2   . ILE A 1  636 ? 155.274 118.267 76.596  1.00 38.51  ? 636  ILE A CG2   1 
ATOM   2171  C  CD1   . ILE A 1  636 ? 156.504 118.643 79.405  1.00 38.51  ? 636  ILE A CD1   1 
ATOM   2172  N  N     . ASP A 1  637 ? 155.751 114.879 75.424  1.00 45.05  ? 637  ASP A N     1 
ATOM   2173  C  CA    . ASP A 1  637 ? 155.852 114.459 74.033  1.00 45.05  ? 637  ASP A CA    1 
ATOM   2174  C  C     . ASP A 1  637 ? 155.015 113.218 73.744  1.00 45.05  ? 637  ASP A C     1 
ATOM   2175  O  O     . ASP A 1  637 ? 154.791 112.892 72.574  1.00 45.05  ? 637  ASP A O     1 
ATOM   2176  C  CB    . ASP A 1  637 ? 157.320 114.209 73.669  1.00 45.05  ? 637  ASP A CB    1 
ATOM   2177  C  CG    . ASP A 1  637 ? 157.594 114.336 72.174  1.00 45.05  ? 637  ASP A CG    1 
ATOM   2178  O  OD1   . ASP A 1  637 ? 156.666 114.671 71.409  1.00 45.05  ? 637  ASP A OD1   1 
ATOM   2179  O  OD2   . ASP A 1  637 ? 158.752 114.109 71.762  1.00 45.05  ? 637  ASP A OD2   1 
ATOM   2180  N  N     . LEU A 1  638 ? 154.542 112.520 74.779  1.00 44.74  ? 638  LEU A N     1 
ATOM   2181  C  CA    . LEU A 1  638 ? 153.591 111.438 74.556  1.00 44.74  ? 638  LEU A CA    1 
ATOM   2182  C  C     . LEU A 1  638 ? 152.212 111.980 74.216  1.00 44.74  ? 638  LEU A C     1 
ATOM   2183  O  O     . LEU A 1  638 ? 151.493 111.385 73.406  1.00 44.74  ? 638  LEU A O     1 
ATOM   2184  C  CB    . LEU A 1  638 ? 153.513 110.539 75.785  1.00 44.74  ? 638  LEU A CB    1 
ATOM   2185  C  CG    . LEU A 1  638 ? 152.664 109.280 75.636  1.00 44.74  ? 638  LEU A CG    1 
ATOM   2186  C  CD1   . LEU A 1  638 ? 153.286 108.370 74.599  1.00 44.74  ? 638  LEU A CD1   1 
ATOM   2187  C  CD2   . LEU A 1  638 ? 152.512 108.570 76.960  1.00 44.74  ? 638  LEU A CD2   1 
ATOM   2188  N  N     . ARG A 1  639 ? 151.836 113.114 74.801  1.00 42.08  ? 639  ARG A N     1 
ATOM   2189  C  CA    . ARG A 1  639 ? 150.586 113.780 74.466  1.00 42.08  ? 639  ARG A CA    1 
ATOM   2190  C  C     . ARG A 1  639 ? 150.706 114.697 73.268  1.00 42.08  ? 639  ARG A C     1 
ATOM   2191  O  O     . ARG A 1  639 ? 149.882 115.601 73.118  1.00 42.08  ? 639  ARG A O     1 
ATOM   2192  C  CB    . ARG A 1  639 ? 150.066 114.580 75.659  1.00 42.08  ? 639  ARG A CB    1 
ATOM   2193  C  CG    . ARG A 1  639 ? 149.546 113.734 76.780  1.00 42.08  ? 639  ARG A CG    1 
ATOM   2194  C  CD    . ARG A 1  639 ? 148.894 114.599 77.815  1.00 42.08  ? 639  ARG A CD    1 
ATOM   2195  N  NE    . ARG A 1  639 ? 148.285 113.789 78.853  1.00 42.08  ? 639  ARG A NE    1 
ATOM   2196  C  CZ    . ARG A 1  639 ? 147.566 114.286 79.846  1.00 42.08  ? 639  ARG A CZ    1 
ATOM   2197  N  NH1   . ARG A 1  639 ? 147.357 115.588 79.919  1.00 42.08  ? 639  ARG A NH1   1 
ATOM   2198  N  NH2   . ARG A 1  639 ? 147.039 113.479 80.749  1.00 42.08  ? 639  ARG A NH2   1 
ATOM   2199  N  N     . LEU A 1  640 ? 151.723 114.514 72.428  1.00 49.22  ? 640  LEU A N     1 
ATOM   2200  C  CA    . LEU A 1  640 ? 151.890 115.311 71.222  1.00 49.22  ? 640  LEU A CA    1 
ATOM   2201  C  C     . LEU A 1  640 ? 152.251 114.442 70.023  1.00 49.22  ? 640  LEU A C     1 
ATOM   2202  O  O     . LEU A 1  640 ? 152.690 114.969 69.000  1.00 49.22  ? 640  LEU A O     1 
ATOM   2203  C  CB    . LEU A 1  640 ? 152.950 116.397 71.430  1.00 49.22  ? 640  LEU A CB    1 
ATOM   2204  C  CG    . LEU A 1  640 ? 152.621 117.514 72.424  1.00 49.22  ? 640  LEU A CG    1 
ATOM   2205  C  CD1   . LEU A 1  640 ? 153.825 118.394 72.677  1.00 49.22  ? 640  LEU A CD1   1 
ATOM   2206  C  CD2   . LEU A 1  640 ? 151.452 118.341 71.923  1.00 49.22  ? 640  LEU A CD2   1 
ATOM   2207  N  N     . LYS A 1  641 ? 152.069 113.122 70.127  1.00 53.79  ? 641  LYS A N     1 
ATOM   2208  C  CA    . LYS A 1  641 ? 152.447 112.231 69.033  1.00 53.79  ? 641  LYS A CA    1 
ATOM   2209  C  C     . LYS A 1  641 ? 151.542 112.391 67.818  1.00 53.79  ? 641  LYS A C     1 
ATOM   2210  O  O     . LYS A 1  641 ? 151.988 112.175 66.686  1.00 53.79  ? 641  LYS A O     1 
ATOM   2211  C  CB    . LYS A 1  641 ? 152.431 110.778 69.501  1.00 53.79  ? 641  LYS A CB    1 
ATOM   2212  C  CG    . LYS A 1  641 ? 153.588 110.396 70.400  1.00 53.79  ? 641  LYS A CG    1 
ATOM   2213  C  CD    . LYS A 1  641 ? 153.408 108.984 70.924  1.00 53.79  ? 641  LYS A CD    1 
ATOM   2214  C  CE    . LYS A 1  641 ? 153.553 107.956 69.815  1.00 53.79  ? 641  LYS A CE    1 
ATOM   2215  N  NZ    . LYS A 1  641 ? 153.471 106.564 70.339  1.00 53.79  ? 641  LYS A NZ    1 
ATOM   2216  N  N     . GLY A 1  642 ? 150.284 112.769 68.022  1.00 54.44  ? 642  GLY A N     1 
ATOM   2217  C  CA    . GLY A 1  642 ? 149.391 112.950 66.894  1.00 54.44  ? 642  GLY A CA    1 
ATOM   2218  C  C     . GLY A 1  642 ? 149.454 114.307 66.231  1.00 54.44  ? 642  GLY A C     1 
ATOM   2219  O  O     . GLY A 1  642 ? 148.887 114.478 65.148  1.00 54.44  ? 642  GLY A O     1 
ATOM   2220  N  N     . LEU A 1  643 ? 150.129 115.272 66.848  1.00 55.78  ? 643  LEU A N     1 
ATOM   2221  C  CA    . LEU A 1  643 ? 150.141 116.647 66.367  1.00 55.78  ? 643  LEU A CA    1 
ATOM   2222  C  C     . LEU A 1  643 ? 151.520 117.203 66.057  1.00 55.78  ? 643  LEU A C     1 
ATOM   2223  O  O     . LEU A 1  643 ? 151.625 118.079 65.196  1.00 55.78  ? 643  LEU A O     1 
ATOM   2224  C  CB    . LEU A 1  643 ? 149.459 117.573 67.384  1.00 55.78  ? 643  LEU A CB    1 
ATOM   2225  C  CG    . LEU A 1  643 ? 147.970 117.866 67.201  1.00 55.78  ? 643  LEU A CG    1 
ATOM   2226  C  CD1   . LEU A 1  643 ? 147.062 116.657 67.368  1.00 55.78  ? 643  LEU A CD1   1 
ATOM   2227  C  CD2   . LEU A 1  643 ? 147.604 118.932 68.195  1.00 55.78  ? 643  LEU A CD2   1 
ATOM   2228  N  N     . ASN A 1  644 ? 152.570 116.744 66.731  1.00 59.76  ? 644  ASN A N     1 
ATOM   2229  C  CA    . ASN A 1  644 ? 153.904 117.249 66.439  1.00 59.76  ? 644  ASN A CA    1 
ATOM   2230  C  C     . ASN A 1  644 ? 154.379 116.688 65.106  1.00 59.76  ? 644  ASN A C     1 
ATOM   2231  O  O     . ASN A 1  644 ? 154.110 115.527 64.780  1.00 59.76  ? 644  ASN A O     1 
ATOM   2232  C  CB    . ASN A 1  644 ? 154.875 116.874 67.560  1.00 59.76  ? 644  ASN A CB    1 
ATOM   2233  C  CG    . ASN A 1  644 ? 156.166 117.667 67.515  1.00 59.76  ? 644  ASN A CG    1 
ATOM   2234  O  OD1   . ASN A 1  644 ? 156.374 118.490 66.629  1.00 59.76  ? 644  ASN A OD1   1 
ATOM   2235  N  ND2   . ASN A 1  644 ? 157.036 117.430 68.488  1.00 59.76  ? 644  ASN A ND2   1 
ATOM   2236  N  N     . ASP A 1  645 ? 155.062 117.545 64.331  1.00 63.39  ? 645  ASP A N     1 
ATOM   2237  C  CA    . ASP A 1  645 ? 155.587 117.233 62.993  1.00 63.39  ? 645  ASP A CA    1 
ATOM   2238  C  C     . ASP A 1  645 ? 154.477 116.802 62.033  1.00 63.39  ? 645  ASP A C     1 
ATOM   2239  O  O     . ASP A 1  645 ? 154.654 115.890 61.224  1.00 63.39  ? 645  ASP A O     1 
ATOM   2240  C  CB    . ASP A 1  645 ? 156.694 116.172 63.048  1.00 63.39  ? 645  ASP A CB    1 
ATOM   2241  C  CG    . ASP A 1  645 ? 157.945 116.664 63.742  1.00 63.39  ? 645  ASP A CG    1 
ATOM   2242  O  OD1   . ASP A 1  645 ? 158.230 117.875 63.670  1.00 63.39  ? 645  ASP A OD1   1 
ATOM   2243  O  OD2   . ASP A 1  645 ? 158.643 115.837 64.365  1.00 63.39  ? 645  ASP A OD2   1 
ATOM   2244  N  N     . SER A 1  646 ? 153.325 117.465 62.117  1.00 62.50  ? 646  SER A N     1 
ATOM   2245  C  CA    . SER A 1  646 ? 152.156 117.080 61.341  1.00 62.50  ? 646  SER A CA    1 
ATOM   2246  C  C     . SER A 1  646 ? 151.628 118.275 60.558  1.00 62.50  ? 646  SER A C     1 
ATOM   2247  O  O     . SER A 1  646 ? 151.962 119.425 60.844  1.00 62.50  ? 646  SER A O     1 
ATOM   2248  C  CB    . SER A 1  646 ? 151.052 116.516 62.237  1.00 62.50  ? 646  SER A CB    1 
ATOM   2249  O  OG    . SER A 1  646 ? 149.927 116.149 61.465  1.00 62.50  ? 646  SER A OG    1 
ATOM   2250  N  N     . PHE A 1  647 ? 150.773 117.986 59.579  1.00 69.17  ? 647  PHE A N     1 
ATOM   2251  C  CA    . PHE A 1  647 ? 150.300 118.967 58.610  1.00 69.17  ? 647  PHE A CA    1 
ATOM   2252  C  C     . PHE A 1  647 ? 148.848 119.335 58.884  1.00 69.17  ? 647  PHE A C     1 
ATOM   2253  O  O     . PHE A 1  647 ? 148.014 118.455 59.115  1.00 69.17  ? 647  PHE A O     1 
ATOM   2254  C  CB    . PHE A 1  647 ? 150.429 118.420 57.187  1.00 69.17  ? 647  PHE A CB    1 
ATOM   2255  C  CG    . PHE A 1  647 ? 151.845 118.262 56.723  1.00 69.17  ? 647  PHE A CG    1 
ATOM   2256  C  CD1   . PHE A 1  647 ? 152.516 119.320 56.131  1.00 69.17  ? 647  PHE A CD1   1 
ATOM   2257  C  CD2   . PHE A 1  647 ? 152.513 117.059 56.898  1.00 69.17  ? 647  PHE A CD2   1 
ATOM   2258  C  CE1   . PHE A 1  647 ? 153.821 119.176 55.704  1.00 69.17  ? 647  PHE A CE1   1 
ATOM   2259  C  CE2   . PHE A 1  647 ? 153.819 116.911 56.480  1.00 69.17  ? 647  PHE A CE2   1 
ATOM   2260  C  CZ    . PHE A 1  647 ? 154.475 117.971 55.881  1.00 69.17  ? 647  PHE A CZ    1 
ATOM   2261  N  N     . PHE A 1  648 ? 148.548 120.631 58.832  1.00 65.93  ? 648  PHE A N     1 
ATOM   2262  C  CA    . PHE A 1  648 ? 147.195 121.143 58.982  1.00 65.93  ? 648  PHE A CA    1 
ATOM   2263  C  C     . PHE A 1  648 ? 146.756 121.841 57.700  1.00 65.93  ? 648  PHE A C     1 
ATOM   2264  O  O     . PHE A 1  648 ? 147.574 122.186 56.844  1.00 65.93  ? 648  PHE A O     1 
ATOM   2265  C  CB    . PHE A 1  648 ? 147.090 122.127 60.159  1.00 65.93  ? 648  PHE A CB    1 
ATOM   2266  C  CG    . PHE A 1  648 ? 147.176 121.483 61.518  1.00 65.93  ? 648  PHE A CG    1 
ATOM   2267  C  CD1   . PHE A 1  648 ? 146.988 120.123 61.684  1.00 65.93  ? 648  PHE A CD1   1 
ATOM   2268  C  CD2   . PHE A 1  648 ? 147.442 122.253 62.636  1.00 65.93  ? 648  PHE A CD2   1 
ATOM   2269  C  CE1   . PHE A 1  648 ? 147.069 119.546 62.940  1.00 65.93  ? 648  PHE A CE1   1 
ATOM   2270  C  CE2   . PHE A 1  648 ? 147.523 121.677 63.892  1.00 65.93  ? 648  PHE A CE2   1 
ATOM   2271  C  CZ    . PHE A 1  648 ? 147.337 120.322 64.040  1.00 65.93  ? 648  PHE A CZ    1 
ATOM   2272  N  N     . TYR A 1  649 ? 145.446 122.047 57.573  1.00 65.87  ? 649  TYR A N     1 
ATOM   2273  C  CA    . TYR A 1  649 ? 144.863 122.824 56.479  1.00 65.87  ? 649  TYR A CA    1 
ATOM   2274  C  C     . TYR A 1  649 ? 144.279 124.104 57.063  1.00 65.87  ? 649  TYR A C     1 
ATOM   2275  O  O     . TYR A 1  649 ? 143.200 124.087 57.662  1.00 65.87  ? 649  TYR A O     1 
ATOM   2276  C  CB    . TYR A 1  649 ? 143.791 122.039 55.729  1.00 65.87  ? 649  TYR A CB    1 
ATOM   2277  C  CG    . TYR A 1  649 ? 144.310 120.934 54.842  1.00 65.87  ? 649  TYR A CG    1 
ATOM   2278  C  CD1   . TYR A 1  649 ? 144.898 121.225 53.616  1.00 65.87  ? 649  TYR A CD1   1 
ATOM   2279  C  CD2   . TYR A 1  649 ? 144.172 119.601 55.205  1.00 65.87  ? 649  TYR A CD2   1 
ATOM   2280  C  CE1   . TYR A 1  649 ? 145.362 120.220 52.792  1.00 65.87  ? 649  TYR A CE1   1 
ATOM   2281  C  CE2   . TYR A 1  649 ? 144.628 118.589 54.385  1.00 65.87  ? 649  TYR A CE2   1 
ATOM   2282  C  CZ    . TYR A 1  649 ? 145.224 118.904 53.181  1.00 65.87  ? 649  TYR A CZ    1 
ATOM   2283  O  OH    . TYR A 1  649 ? 145.683 117.900 52.361  1.00 65.87  ? 649  TYR A OH    1 
ATOM   2284  N  N     . VAL A 1  650 ? 144.982 125.214 56.876  1.00 61.24  ? 650  VAL A N     1 
ATOM   2285  C  CA    . VAL A 1  650 ? 144.568 126.507 57.401  1.00 61.24  ? 650  VAL A CA    1 
ATOM   2286  C  C     . VAL A 1  650 ? 144.124 127.380 56.240  1.00 61.24  ? 650  VAL A C     1 
ATOM   2287  O  O     . VAL A 1  650 ? 144.918 127.679 55.339  1.00 61.24  ? 650  VAL A O     1 
ATOM   2288  C  CB    . VAL A 1  650 ? 145.696 127.185 58.190  1.00 61.24  ? 650  VAL A CB    1 
ATOM   2289  C  CG1   . VAL A 1  650 ? 145.298 128.595 58.575  1.00 61.24  ? 650  VAL A CG1   1 
ATOM   2290  C  CG2   . VAL A 1  650 ? 146.009 126.385 59.422  1.00 61.24  ? 650  VAL A CG2   1 
ATOM   2291  N  N     . ASP A 1  651 ? 142.861 127.788 56.259  1.00 62.10  ? 651  ASP A N     1 
ATOM   2292  C  CA    . ASP A 1  651 ? 142.409 128.833 55.359  1.00 62.10  ? 651  ASP A CA    1 
ATOM   2293  C  C     . ASP A 1  651 ? 142.842 130.199 55.880  1.00 62.10  ? 651  ASP A C     1 
ATOM   2294  O  O     . ASP A 1  651 ? 142.927 130.432 57.089  1.00 62.10  ? 651  ASP A O     1 
ATOM   2295  C  CB    . ASP A 1  651 ? 140.894 128.770 55.169  1.00 62.10  ? 651  ASP A CB    1 
ATOM   2296  C  CG    . ASP A 1  651 ? 140.139 128.727 56.478  1.00 62.10  ? 651  ASP A CG    1 
ATOM   2297  O  OD1   . ASP A 1  651 ? 140.775 128.583 57.542  1.00 62.10  ? 651  ASP A OD1   1 
ATOM   2298  O  OD2   . ASP A 1  651 ? 138.896 128.848 56.444  1.00 62.10  ? 651  ASP A OD2   1 
ATOM   2299  N  N     . THR A 1  652 ? 143.132 131.103 54.951  1.00 58.42  ? 652  THR A N     1 
ATOM   2300  C  CA    . THR A 1  652 ? 143.778 132.363 55.284  1.00 58.42  ? 652  THR A CA    1 
ATOM   2301  C  C     . THR A 1  652 ? 142.791 133.483 55.585  1.00 58.42  ? 652  THR A C     1 
ATOM   2302  O  O     . THR A 1  652 ? 143.213 134.630 55.755  1.00 58.42  ? 652  THR A O     1 
ATOM   2303  C  CB    . THR A 1  652 ? 144.708 132.789 54.147  1.00 58.42  ? 652  THR A CB    1 
ATOM   2304  O  OG1   . THR A 1  652 ? 143.936 133.054 52.969  1.00 58.42  ? 652  THR A OG1   1 
ATOM   2305  C  CG2   . THR A 1  652 ? 145.704 131.682 53.843  1.00 58.42  ? 652  THR A CG2   1 
ATOM   2306  N  N     . LYS A 1  653 ? 141.493 133.185 55.657  1.00 64.07  ? 653  LYS A N     1 
ATOM   2307  C  CA    . LYS A 1  653 ? 140.498 134.210 55.928  1.00 64.07  ? 653  LYS A CA    1 
ATOM   2308  C  C     . LYS A 1  653 ? 139.718 134.002 57.216  1.00 64.07  ? 653  LYS A C     1 
ATOM   2309  O  O     . LYS A 1  653 ? 139.082 134.952 57.684  1.00 64.07  ? 653  LYS A O     1 
ATOM   2310  C  CB    . LYS A 1  653 ? 139.507 134.326 54.758  1.00 64.07  ? 653  LYS A CB    1 
ATOM   2311  C  CG    . LYS A 1  653 ? 138.597 133.128 54.554  1.00 64.07  ? 653  LYS A CG    1 
ATOM   2312  C  CD    . LYS A 1  653 ? 137.727 133.334 53.321  1.00 64.07  ? 653  LYS A CD    1 
ATOM   2313  C  CE    . LYS A 1  653 ? 136.699 134.432 53.556  1.00 64.07  ? 653  LYS A CE    1 
ATOM   2314  N  NZ    . LYS A 1  653 ? 135.780 134.605 52.398  1.00 64.07  ? 653  LYS A NZ    1 
ATOM   2315  N  N     . THR A 1  654 ? 139.737 132.804 57.798  1.00 59.56  ? 654  THR A N     1 
ATOM   2316  C  CA    . THR A 1  654 ? 139.136 132.577 59.106  1.00 59.56  ? 654  THR A CA    1 
ATOM   2317  C  C     . THR A 1  654 ? 140.129 132.113 60.156  1.00 59.56  ? 654  THR A C     1 
ATOM   2318  O  O     . THR A 1  654 ? 139.980 132.475 61.325  1.00 59.56  ? 654  THR A O     1 
ATOM   2319  C  CB    . THR A 1  654 ? 138.002 131.541 59.025  1.00 59.56  ? 654  THR A CB    1 
ATOM   2320  O  OG1   . THR A 1  654 ? 138.536 130.271 58.642  1.00 59.56  ? 654  THR A OG1   1 
ATOM   2321  C  CG2   . THR A 1  654 ? 136.946 131.968 58.017  1.00 59.56  ? 654  THR A CG2   1 
ATOM   2322  N  N     . GLY A 1  655 ? 141.138 131.332 59.776  1.00 56.36  ? 655  GLY A N     1 
ATOM   2323  C  CA    . GLY A 1  655 ? 142.123 130.827 60.707  1.00 56.36  ? 655  GLY A CA    1 
ATOM   2324  C  C     . GLY A 1  655 ? 141.885 129.414 61.184  1.00 56.36  ? 655  GLY A C     1 
ATOM   2325  O  O     . GLY A 1  655 ? 142.663 128.919 62.007  1.00 56.36  ? 655  GLY A O     1 
ATOM   2326  N  N     . ASN A 1  656 ? 140.838 128.754 60.696  1.00 58.99  ? 656  ASN A N     1 
ATOM   2327  C  CA    . ASN A 1  656 ? 140.504 127.413 61.156  1.00 58.99  ? 656  ASN A CA    1 
ATOM   2328  C  C     . ASN A 1  656 ? 141.472 126.399 60.561  1.00 58.99  ? 656  ASN A C     1 
ATOM   2329  O  O     . ASN A 1  656 ? 141.698 126.375 59.348  1.00 58.99  ? 656  ASN A O     1 
ATOM   2330  C  CB    . ASN A 1  656 ? 139.064 127.078 60.768  1.00 58.99  ? 656  ASN A CB    1 
ATOM   2331  C  CG    . ASN A 1  656 ? 138.521 125.856 61.490  1.00 58.99  ? 656  ASN A CG    1 
ATOM   2332  O  OD1   . ASN A 1  656 ? 139.209 125.228 62.292  1.00 58.99  ? 656  ASN A OD1   1 
ATOM   2333  N  ND2   . ASN A 1  656 ? 137.269 125.518 61.208  1.00 58.99  ? 656  ASN A ND2   1 
ATOM   2334  N  N     . ALA A 1  657 ? 142.047 125.566 61.419  1.00 56.25  ? 657  ALA A N     1 
ATOM   2335  C  CA    . ALA A 1  657 ? 142.939 124.495 61.004  1.00 56.25  ? 657  ALA A CA    1 
ATOM   2336  C  C     . ALA A 1  657 ? 142.184 123.174 60.961  1.00 56.25  ? 657  ALA A C     1 
ATOM   2337  O  O     . ALA A 1  657 ? 141.263 122.939 61.745  1.00 56.25  ? 657  ALA A O     1 
ATOM   2338  C  CB    . ALA A 1  657 ? 144.134 124.377 61.951  1.00 56.25  ? 657  ALA A CB    1 
ATOM   2339  N  N     . ILE A 1  658 ? 142.571 122.321 60.016  1.00 63.50  ? 658  ILE A N     1 
ATOM   2340  C  CA    . ILE A 1  658 ? 142.011 120.980 59.877  1.00 63.50  ? 658  ILE A CA    1 
ATOM   2341  C  C     . ILE A 1  658 ? 143.172 120.016 59.688  1.00 63.50  ? 658  ILE A C     1 
ATOM   2342  O  O     . ILE A 1  658 ? 143.979 120.187 58.766  1.00 63.50  ? 658  ILE A O     1 
ATOM   2343  C  CB    . ILE A 1  658 ? 141.019 120.860 58.702  1.00 63.50  ? 658  ILE A CB    1 
ATOM   2344  C  CG1   . ILE A 1  658 ? 139.782 121.746 58.895  1.00 63.50  ? 658  ILE A CG1   1 
ATOM   2345  C  CG2   . ILE A 1  658 ? 140.575 119.418 58.524  1.00 63.50  ? 658  ILE A CG2   1 
ATOM   2346  C  CD1   . ILE A 1  658 ? 139.861 123.093 58.200  1.00 63.50  ? 658  ILE A CD1   1 
ATOM   2347  N  N     . LEU A 1  659 ? 143.264 119.018 60.562  1.00 64.56  ? 659  LEU A N     1 
ATOM   2348  C  CA    . LEU A 1  659 ? 144.262 117.969 60.423  1.00 64.56  ? 659  LEU A CA    1 
ATOM   2349  C  C     . LEU A 1  659 ? 143.954 117.091 59.211  1.00 64.56  ? 659  LEU A C     1 
ATOM   2350  O  O     . LEU A 1  659 ? 142.794 116.904 58.833  1.00 64.56  ? 659  LEU A O     1 
ATOM   2351  C  CB    . LEU A 1  659 ? 144.315 117.136 61.707  1.00 64.56  ? 659  LEU A CB    1 
ATOM   2352  C  CG    . LEU A 1  659 ? 145.224 115.916 61.854  1.00 64.56  ? 659  LEU A CG    1 
ATOM   2353  C  CD1   . LEU A 1  659 ? 146.656 116.279 61.575  1.00 64.56  ? 659  LEU A CD1   1 
ATOM   2354  C  CD2   . LEU A 1  659 ? 145.094 115.343 63.252  1.00 64.56  ? 659  LEU A CD2   1 
ATOM   2355  N  N     . ILE A 1  660 ? 145.016 116.580 58.588  1.00 66.07  ? 660  ILE A N     1 
ATOM   2356  C  CA    . ILE A 1  660 ? 144.929 115.696 57.425  1.00 66.07  ? 660  ILE A CA    1 
ATOM   2357  C  C     . ILE A 1  660 ? 144.148 114.413 57.722  1.00 66.07  ? 660  ILE A C     1 
ATOM   2358  O  O     . ILE A 1  660 ? 144.100 113.499 56.900  1.00 66.07  ? 660  ILE A O     1 
ATOM   2359  C  CB    . ILE A 1  660 ? 146.354 115.374 56.887  1.00 66.07  ? 660  ILE A CB    1 
ATOM   2360  C  CG1   . ILE A 1  660 ? 147.279 114.841 57.993  1.00 66.07  ? 660  ILE A CG1   1 
ATOM   2361  C  CG2   . ILE A 1  660 ? 146.977 116.597 56.244  1.00 66.07  ? 660  ILE A CG2   1 
ATOM   2362  C  CD1   . ILE A 1  660 ? 147.383 113.318 58.100  1.00 66.07  ? 660  ILE A CD1   1 
ATOM   2363  N  N     . ASP A 1  676 ? 143.170 129.464 48.706  1.00 56.53  ? 676  ASP A N     1 
ATOM   2364  C  CA    . ASP A 1  676 ? 142.570 130.004 49.920  1.00 56.53  ? 676  ASP A CA    1 
ATOM   2365  C  C     . ASP A 1  676 ? 143.164 129.348 51.161  1.00 56.53  ? 676  ASP A C     1 
ATOM   2366  O  O     . ASP A 1  676 ? 143.126 129.912 52.251  1.00 56.53  ? 676  ASP A O     1 
ATOM   2367  C  CB    . ASP A 1  676 ? 141.051 129.806 49.904  1.00 30.00  ? 676  ASP A CB    1 
ATOM   2368  C  CG    . ASP A 1  676 ? 140.363 130.644 48.844  1.00 30.00  ? 676  ASP A CG    1 
ATOM   2369  O  OD1   . ASP A 1  676 ? 140.890 131.722 48.498  1.00 30.00  ? 676  ASP A OD1   1 
ATOM   2370  O  OD2   . ASP A 1  676 ? 139.290 130.228 48.359  1.00 30.00  ? 676  ASP A OD2   1 
ATOM   2371  N  N     . VAL A 1  677 ? 143.718 128.152 50.978  1.00 58.64  ? 677  VAL A N     1 
ATOM   2372  C  CA    . VAL A 1  677 ? 144.206 127.313 52.066  1.00 58.64  ? 677  VAL A CA    1 
ATOM   2373  C  C     . VAL A 1  677 ? 145.677 127.005 51.823  1.00 58.64  ? 677  VAL A C     1 
ATOM   2374  O  O     . VAL A 1  677 ? 146.043 126.527 50.743  1.00 58.64  ? 677  VAL A O     1 
ATOM   2375  C  CB    . VAL A 1  677 ? 143.391 126.009 52.174  1.00 58.64  ? 677  VAL A CB    1 
ATOM   2376  C  CG1   . VAL A 1  677 ? 144.007 125.066 53.191  1.00 58.64  ? 677  VAL A CG1   1 
ATOM   2377  C  CG2   . VAL A 1  677 ? 141.946 126.307 52.533  1.00 58.64  ? 677  VAL A CG2   1 
ATOM   2378  N  N     . ARG A 1  678 ? 146.515 127.275 52.820  1.00 66.03  ? 678  ARG A N     1 
ATOM   2379  C  CA    . ARG A 1  678 ? 147.898 126.824 52.804  1.00 66.03  ? 678  ARG A CA    1 
ATOM   2380  C  C     . ARG A 1  678 ? 148.037 125.531 53.595  1.00 66.03  ? 678  ARG A C     1 
ATOM   2381  O  O     . ARG A 1  678 ? 147.313 125.290 54.564  1.00 66.03  ? 678  ARG A O     1 
ATOM   2382  C  CB    . ARG A 1  678 ? 148.850 127.869 53.387  1.00 66.03  ? 678  ARG A CB    1 
ATOM   2383  C  CG    . ARG A 1  678 ? 149.012 129.135 52.571  1.00 66.03  ? 678  ARG A CG    1 
ATOM   2384  C  CD    . ARG A 1  678 ? 150.128 129.987 53.157  1.00 66.03  ? 678  ARG A CD    1 
ATOM   2385  N  NE    . ARG A 1  678 ? 150.297 131.254 52.453  1.00 66.03  ? 678  ARG A NE    1 
ATOM   2386  C  CZ    . ARG A 1  678 ? 149.756 132.400 52.850  1.00 66.03  ? 678  ARG A CZ    1 
ATOM   2387  N  NH1   . ARG A 1  678 ? 149.028 132.440 53.957  1.00 66.03  ? 678  ARG A NH1   1 
ATOM   2388  N  NH2   . ARG A 1  678 ? 149.956 133.508 52.150  1.00 66.03  ? 678  ARG A NH2   1 
ATOM   2389  N  N     . LYS A 1  679 ? 148.987 124.698 53.169  1.00 69.71  ? 679  LYS A N     1 
ATOM   2390  C  CA    . LYS A 1  679 ? 149.322 123.468 53.884  1.00 69.71  ? 679  LYS A CA    1 
ATOM   2391  C  C     . LYS A 1  679 ? 150.471 123.787 54.835  1.00 69.71  ? 679  LYS A C     1 
ATOM   2392  O  O     . LYS A 1  679 ? 151.651 123.589 54.538  1.00 69.71  ? 679  LYS A O     1 
ATOM   2393  C  CB    . LYS A 1  679 ? 149.674 122.354 52.909  1.00 69.71  ? 679  LYS A CB    1 
ATOM   2394  C  CG    . LYS A 1  679 ? 149.906 121.001 53.556  1.00 69.71  ? 679  LYS A CG    1 
ATOM   2395  C  CD    . LYS A 1  679 ? 150.252 119.957 52.512  1.00 69.71  ? 679  LYS A CD    1 
ATOM   2396  C  CE    . LYS A 1  679 ? 150.517 118.608 53.147  1.00 69.71  ? 679  LYS A CE    1 
ATOM   2397  N  NZ    . LYS A 1  679 ? 150.865 117.585 52.125  1.00 69.71  ? 679  LYS A NZ    1 
ATOM   2398  N  N     . VAL A 1  680 ? 150.109 124.322 55.990  1.00 63.09  ? 680  VAL A N     1 
ATOM   2399  C  CA    . VAL A 1  680 ? 151.076 124.665 57.017  1.00 63.09  ? 680  VAL A CA    1 
ATOM   2400  C  C     . VAL A 1  680 ? 151.327 123.418 57.857  1.00 63.09  ? 680  VAL A C     1 
ATOM   2401  O  O     . VAL A 1  680 ? 150.563 122.450 57.820  1.00 63.09  ? 680  VAL A O     1 
ATOM   2402  C  CB    . VAL A 1  680 ? 150.565 125.848 57.874  1.00 63.09  ? 680  VAL A CB    1 
ATOM   2403  C  CG1   . VAL A 1  680 ? 149.515 125.381 58.857  1.00 63.09  ? 680  VAL A CG1   1 
ATOM   2404  C  CG2   . VAL A 1  680 ? 151.700 126.624 58.556  1.00 63.09  ? 680  VAL A CG2   1 
ATOM   2405  N  N     . ARG A 1  681 ? 152.425 123.421 58.605  1.00 63.68  ? 681  ARG A N     1 
ATOM   2406  C  CA    . ARG A 1  681 ? 152.743 122.320 59.494  1.00 63.68  ? 681  ARG A CA    1 
ATOM   2407  C  C     . ARG A 1  681 ? 153.236 122.881 60.819  1.00 63.68  ? 681  ARG A C     1 
ATOM   2408  O  O     . ARG A 1  681 ? 153.457 124.085 60.967  1.00 63.68  ? 681  ARG A O     1 
ATOM   2409  C  CB    . ARG A 1  681 ? 153.769 121.382 58.861  1.00 63.68  ? 681  ARG A CB    1 
ATOM   2410  C  CG    . ARG A 1  681 ? 155.103 122.023 58.593  1.00 63.68  ? 681  ARG A CG    1 
ATOM   2411  C  CD    . ARG A 1  681 ? 155.996 121.046 57.864  1.00 63.68  ? 681  ARG A CD    1 
ATOM   2412  N  NE    . ARG A 1  681 ? 156.251 119.858 58.669  1.00 63.68  ? 681  ARG A NE    1 
ATOM   2413  C  CZ    . ARG A 1  681 ? 157.211 119.782 59.579  1.00 63.68  ? 681  ARG A CZ    1 
ATOM   2414  N  NH1   . ARG A 1  681 ? 157.998 120.827 59.779  1.00 63.68  ? 681  ARG A NH1   1 
ATOM   2415  N  NH2   . ARG A 1  681 ? 157.391 118.672 60.283  1.00 63.68  ? 681  ARG A NH2   1 
ATOM   2416  N  N     . LEU A 1  682 ? 153.413 121.987 61.790  1.00 62.49  ? 682  LEU A N     1 
ATOM   2417  C  CA    . LEU A 1  682 ? 153.627 122.383 63.176  1.00 62.49  ? 682  LEU A CA    1 
ATOM   2418  C  C     . LEU A 1  682 ? 154.658 121.475 63.823  1.00 62.49  ? 682  LEU A C     1 
ATOM   2419  O  O     . LEU A 1  682 ? 154.409 120.280 63.996  1.00 62.49  ? 682  LEU A O     1 
ATOM   2420  C  CB    . LEU A 1  682 ? 152.320 122.317 63.961  1.00 62.49  ? 682  LEU A CB    1 
ATOM   2421  C  CG    . LEU A 1  682 ? 152.419 122.711 65.431  1.00 62.49  ? 682  LEU A CG    1 
ATOM   2422  C  CD1   . LEU A 1  682 ? 152.710 124.191 65.594  1.00 62.49  ? 682  LEU A CD1   1 
ATOM   2423  C  CD2   . LEU A 1  682 ? 151.151 122.324 66.134  1.00 62.49  ? 682  LEU A CD2   1 
ATOM   2424  N  N     . ARG A 1  683 ? 155.801 122.040 64.192  1.00 65.90  ? 683  ARG A N     1 
ATOM   2425  C  CA    . ARG A 1  683 ? 156.774 121.357 65.031  1.00 65.90  ? 683  ARG A CA    1 
ATOM   2426  C  C     . ARG A 1  683 ? 157.003 122.179 66.291  1.00 65.90  ? 683  ARG A C     1 
ATOM   2427  O  O     . ARG A 1  683 ? 157.036 123.410 66.242  1.00 65.90  ? 683  ARG A O     1 
ATOM   2428  C  CB    . ARG A 1  683 ? 158.106 121.101 64.284  1.00 65.90  ? 683  ARG A CB    1 
ATOM   2429  C  CG    . ARG A 1  683 ? 158.834 122.342 63.783  1.00 65.90  ? 683  ARG A CG    1 
ATOM   2430  C  CD    . ARG A 1  683 ? 160.172 122.036 63.107  1.00 65.90  ? 683  ARG A CD    1 
ATOM   2431  N  NE    . ARG A 1  683 ? 160.037 121.168 61.940  1.00 65.90  ? 683  ARG A NE    1 
ATOM   2432  C  CZ    . ARG A 1  683 ? 160.634 119.987 61.799  1.00 65.90  ? 683  ARG A CZ    1 
ATOM   2433  N  NH1   . ARG A 1  683 ? 160.436 119.266 60.704  1.00 65.90  ? 683  ARG A NH1   1 
ATOM   2434  N  NH2   . ARG A 1  683 ? 161.466 119.544 62.729  1.00 65.90  ? 683  ARG A NH2   1 
ATOM   2435  N  N     . MET A 1  684 ? 157.110 121.500 67.425  1.00 66.52  ? 684  MET A N     1 
ATOM   2436  C  CA    . MET A 1  684 ? 157.488 122.138 68.675  1.00 66.52  ? 684  MET A CA    1 
ATOM   2437  C  C     . MET A 1  684 ? 158.929 121.773 68.989  1.00 66.52  ? 684  MET A C     1 
ATOM   2438  O  O     . MET A 1  684 ? 159.355 120.638 68.753  1.00 66.52  ? 684  MET A O     1 
ATOM   2439  C  CB    . MET A 1  684 ? 156.568 121.723 69.822  1.00 66.52  ? 684  MET A CB    1 
ATOM   2440  C  CG    . MET A 1  684 ? 155.147 122.226 69.672  1.00 66.52  ? 684  MET A CG    1 
ATOM   2441  S  SD    . MET A 1  684 ? 154.080 121.722 71.032  1.00 66.52  ? 684  MET A SD    1 
ATOM   2442  C  CE    . MET A 1  684 ? 154.734 122.722 72.369  1.00 66.52  ? 684  MET A CE    1 
ATOM   2443  N  N     . SER A 1  685 ? 159.678 122.743 69.501  1.00 60.66  ? 685  SER A N     1 
ATOM   2444  C  CA    . SER A 1  685 ? 161.108 122.556 69.688  1.00 60.66  ? 685  SER A CA    1 
ATOM   2445  C  C     . SER A 1  685 ? 161.371 121.621 70.862  1.00 60.66  ? 685  SER A C     1 
ATOM   2446  O  O     . SER A 1  685 ? 160.740 121.726 71.915  1.00 60.66  ? 685  SER A O     1 
ATOM   2447  C  CB    . SER A 1  685 ? 161.791 123.903 69.910  1.00 60.66  ? 685  SER A CB    1 
ATOM   2448  O  OG    . SER A 1  685 ? 163.192 123.747 70.018  1.00 60.66  ? 685  SER A OG    1 
ATOM   2449  N  N     . ALA A 1  686 ? 162.300 120.684 70.662  1.00 55.80  ? 686  ALA A N     1 
ATOM   2450  C  CA    . ALA A 1  686 ? 162.561 119.670 71.676  1.00 55.80  ? 686  ALA A CA    1 
ATOM   2451  C  C     . ALA A 1  686 ? 163.330 120.228 72.865  1.00 55.80  ? 686  ALA A C     1 
ATOM   2452  O  O     . ALA A 1  686 ? 163.159 119.740 73.987  1.00 55.80  ? 686  ALA A O     1 
ATOM   2453  C  CB    . ALA A 1  686 ? 163.322 118.496 71.061  1.00 55.80  ? 686  ALA A CB    1 
ATOM   2454  N  N     . ASP A 1  687 ? 164.171 121.243 72.650  1.00 56.83  ? 687  ASP A N     1 
ATOM   2455  C  CA    . ASP A 1  687 ? 164.849 121.878 73.774  1.00 56.83  ? 687  ASP A CA    1 
ATOM   2456  C  C     . ASP A 1  687 ? 163.918 122.785 74.567  1.00 56.83  ? 687  ASP A C     1 
ATOM   2457  O  O     . ASP A 1  687 ? 164.231 123.131 75.710  1.00 56.83  ? 687  ASP A O     1 
ATOM   2458  C  CB    . ASP A 1  687 ? 166.085 122.649 73.293  1.00 56.83  ? 687  ASP A CB    1 
ATOM   2459  C  CG    . ASP A 1  687 ? 165.766 123.706 72.244  1.00 56.83  ? 687  ASP A CG    1 
ATOM   2460  O  OD1   . ASP A 1  687 ? 164.610 123.796 71.786  1.00 56.83  ? 687  ASP A OD1   1 
ATOM   2461  O  OD2   . ASP A 1  687 ? 166.691 124.459 71.875  1.00 56.83  ? 687  ASP A OD2   1 
ATOM   2462  N  N     . ALA A 1  688 ? 162.789 123.179 73.978  1.00 52.84  ? 688  ALA A N     1 
ATOM   2463  C  CA    . ALA A 1  688 ? 161.771 123.902 74.728  1.00 52.84  ? 688  ALA A CA    1 
ATOM   2464  C  C     . ALA A 1  688 ? 161.090 122.991 75.741  1.00 52.84  ? 688  ALA A C     1 
ATOM   2465  O  O     . ALA A 1  688 ? 160.803 123.409 76.868  1.00 52.84  ? 688  ALA A O     1 
ATOM   2466  C  CB    . ALA A 1  688 ? 160.751 124.499 73.763  1.00 52.84  ? 688  ALA A CB    1 
ATOM   2467  N  N     . ILE A 1  689 ? 160.832 121.740 75.353  1.00 51.39  ? 689  ILE A N     1 
ATOM   2468  C  CA    . ILE A 1  689 ? 160.287 120.752 76.277  1.00 51.39  ? 689  ILE A CA    1 
ATOM   2469  C  C     . ILE A 1  689 ? 161.352 120.332 77.286  1.00 51.39  ? 689  ILE A C     1 
ATOM   2470  O  O     . ILE A 1  689 ? 161.032 119.977 78.428  1.00 51.39  ? 689  ILE A O     1 
ATOM   2471  C  CB    . ILE A 1  689 ? 159.732 119.561 75.469  1.00 51.39  ? 689  ILE A CB    1 
ATOM   2472  C  CG1   . ILE A 1  689 ? 158.688 120.053 74.469  1.00 51.39  ? 689  ILE A CG1   1 
ATOM   2473  C  CG2   . ILE A 1  689 ? 159.065 118.525 76.355  1.00 51.39  ? 689  ILE A CG2   1 
ATOM   2474  C  CD1   . ILE A 1  689 ? 158.265 119.004 73.469  1.00 51.39  ? 689  ILE A CD1   1 
ATOM   2475  N  N     . GLU A 1  690 ? 162.629 120.398 76.890  1.00 51.74  ? 690  GLU A N     1 
ATOM   2476  C  CA    . GLU A 1  690 ? 163.736 120.078 77.789  1.00 51.74  ? 690  GLU A CA    1 
ATOM   2477  C  C     . GLU A 1  690 ? 163.796 121.037 78.973  1.00 51.74  ? 690  GLU A C     1 
ATOM   2478  O  O     . GLU A 1  690 ? 163.780 120.606 80.130  1.00 51.74  ? 690  GLU A O     1 
ATOM   2479  C  CB    . GLU A 1  690 ? 165.056 120.107 77.016  1.00 51.74  ? 690  GLU A CB    1 
ATOM   2480  C  CG    . GLU A 1  690 ? 166.313 119.905 77.858  1.00 51.74  ? 690  GLU A CG    1 
ATOM   2481  C  CD    . GLU A 1  690 ? 166.496 118.483 78.346  1.00 51.74  ? 690  GLU A CD    1 
ATOM   2482  O  OE1   . GLU A 1  690 ? 166.016 117.554 77.668  1.00 51.74  ? 690  GLU A OE1   1 
ATOM   2483  O  OE2   . GLU A 1  690 ? 167.134 118.292 79.404  1.00 51.74  ? 690  GLU A OE2   1 
ATOM   2484  N  N     . ILE A 1  691 ? 163.836 122.346 78.705  1.00 48.21  ? 691  ILE A N     1 
ATOM   2485  C  CA    . ILE A 1  691 ? 163.972 123.309 79.794  1.00 48.21  ? 691  ILE A CA    1 
ATOM   2486  C  C     . ILE A 1  691 ? 162.665 123.471 80.565  1.00 48.21  ? 691  ILE A C     1 
ATOM   2487  O  O     . ILE A 1  691 ? 162.684 123.916 81.719  1.00 48.21  ? 691  ILE A O     1 
ATOM   2488  C  CB    . ILE A 1  691 ? 164.494 124.657 79.259  1.00 48.21  ? 691  ILE A CB    1 
ATOM   2489  C  CG1   . ILE A 1  691 ? 165.179 125.460 80.368  1.00 48.21  ? 691  ILE A CG1   1 
ATOM   2490  C  CG2   . ILE A 1  691 ? 163.375 125.496 78.676  1.00 48.21  ? 691  ILE A CG2   1 
ATOM   2491  C  CD1   . ILE A 1  691 ? 166.442 124.815 80.899  1.00 48.21  ? 691  ILE A CD1   1 
ATOM   2492  N  N     . ALA A 1  692 ? 161.528 123.088 79.977  1.00 44.79  ? 692  ALA A N     1 
ATOM   2493  C  CA    . ALA A 1  692 ? 160.297 123.026 80.754  1.00 44.79  ? 692  ALA A CA    1 
ATOM   2494  C  C     . ALA A 1  692 ? 160.299 121.817 81.672  1.00 44.79  ? 692  ALA A C     1 
ATOM   2495  O  O     . ALA A 1  692 ? 159.628 121.823 82.708  1.00 44.79  ? 692  ALA A O     1 
ATOM   2496  C  CB    . ALA A 1  692 ? 159.083 122.986 79.829  1.00 44.79  ? 692  ALA A CB    1 
ATOM   2497  N  N     . SER A 1  693 ? 161.053 120.779 81.315  1.00 44.77  ? 693  SER A N     1 
ATOM   2498  C  CA    . SER A 1  693 ? 161.142 119.599 82.159  1.00 44.77  ? 693  SER A CA    1 
ATOM   2499  C  C     . SER A 1  693 ? 162.239 119.736 83.206  1.00 44.77  ? 693  SER A C     1 
ATOM   2500  O  O     . SER A 1  693 ? 162.084 119.245 84.326  1.00 44.77  ? 693  SER A O     1 
ATOM   2501  C  CB    . SER A 1  693 ? 161.376 118.361 81.300  1.00 44.77  ? 693  SER A CB    1 
ATOM   2502  O  OG    . SER A 1  693 ? 160.279 118.141 80.433  1.00 44.77  ? 693  SER A OG    1 
ATOM   2503  N  N     . ARG A 1  694 ? 163.355 120.389 82.860  1.00 48.46  ? 694  ARG A N     1 
ATOM   2504  C  CA    . ARG A 1  694 ? 164.448 120.553 83.816  1.00 48.46  ? 694  ARG A CA    1 
ATOM   2505  C  C     . ARG A 1  694 ? 164.066 121.481 84.958  1.00 48.46  ? 694  ARG A C     1 
ATOM   2506  O  O     . ARG A 1  694 ? 164.538 121.301 86.084  1.00 48.46  ? 694  ARG A O     1 
ATOM   2507  C  CB    . ARG A 1  694 ? 165.703 121.089 83.120  1.00 48.46  ? 694  ARG A CB    1 
ATOM   2508  C  CG    . ARG A 1  694 ? 166.317 120.161 82.083  1.00 48.46  ? 694  ARG A CG    1 
ATOM   2509  C  CD    . ARG A 1  694 ? 166.893 118.915 82.712  1.00 48.46  ? 694  ARG A CD    1 
ATOM   2510  N  NE    . ARG A 1  694 ? 168.052 119.169 83.560  1.00 48.46  ? 694  ARG A NE    1 
ATOM   2511  C  CZ    . ARG A 1  694 ? 169.307 119.133 83.127  1.00 48.46  ? 694  ARG A CZ    1 
ATOM   2512  N  NH1   . ARG A 1  694 ? 169.558 118.845 81.858  1.00 48.46  ? 694  ARG A NH1   1 
ATOM   2513  N  NH2   . ARG A 1  694 ? 170.308 119.373 83.962  1.00 48.46  ? 694  ARG A NH2   1 
ATOM   2514  N  N     . LYS A 1  695 ? 163.214 122.468 84.694  1.00 42.68  ? 695  LYS A N     1 
ATOM   2515  C  CA    . LYS A 1  695 ? 162.864 123.458 85.703  1.00 42.68  ? 695  LYS A CA    1 
ATOM   2516  C  C     . LYS A 1  695 ? 161.732 122.987 86.606  1.00 42.68  ? 695  LYS A C     1 
ATOM   2517  O  O     . LYS A 1  695 ? 161.765 123.236 87.815  1.00 42.68  ? 695  LYS A O     1 
ATOM   2518  C  CB    . LYS A 1  695 ? 162.482 124.775 85.025  1.00 42.68  ? 695  LYS A CB    1 
ATOM   2519  C  CG    . LYS A 1  695 ? 162.234 125.931 85.976  1.00 42.68  ? 695  LYS A CG    1 
ATOM   2520  C  CD    . LYS A 1  695 ? 163.501 126.303 86.724  1.00 42.68  ? 695  LYS A CD    1 
ATOM   2521  C  CE    . LYS A 1  695 ? 164.566 126.845 85.782  1.00 42.68  ? 695  LYS A CE    1 
ATOM   2522  N  NZ    . LYS A 1  695 ? 164.194 128.171 85.216  1.00 42.68  ? 695  LYS A NZ    1 
ATOM   2523  N  N     . VAL A 1  696 ? 160.734 122.300 86.045  1.00 40.54  ? 696  VAL A N     1 
ATOM   2524  C  CA    . VAL A 1  696 ? 159.599 121.844 86.842  1.00 40.54  ? 696  VAL A CA    1 
ATOM   2525  C  C     . VAL A 1  696 ? 159.997 120.674 87.733  1.00 40.54  ? 696  VAL A C     1 
ATOM   2526  O  O     . VAL A 1  696 ? 159.674 120.651 88.928  1.00 40.54  ? 696  VAL A O     1 
ATOM   2527  C  CB    . VAL A 1  696 ? 158.413 121.495 85.923  1.00 40.54  ? 696  VAL A CB    1 
ATOM   2528  C  CG1   . VAL A 1  696 ? 157.314 120.803 86.695  1.00 40.54  ? 696  VAL A CG1   1 
ATOM   2529  C  CG2   . VAL A 1  696 ? 157.859 122.756 85.294  1.00 40.54  ? 696  VAL A CG2   1 
ATOM   2530  N  N     . ALA A 1  697 ? 160.730 119.700 87.182  1.00 41.92  ? 697  ALA A N     1 
ATOM   2531  C  CA    . ALA A 1  697 ? 161.117 118.520 87.949  1.00 41.92  ? 697  ALA A CA    1 
ATOM   2532  C  C     . ALA A 1  697 ? 162.138 118.827 89.034  1.00 41.92  ? 697  ALA A C     1 
ATOM   2533  O  O     . ALA A 1  697 ? 162.244 118.064 89.998  1.00 41.92  ? 697  ALA A O     1 
ATOM   2534  C  CB    . ALA A 1  697 ? 161.672 117.439 87.027  1.00 41.92  ? 697  ALA A CB    1 
ATOM   2535  N  N     . SER A 1  698 ? 162.888 119.920 88.904  1.00 45.96  ? 698  SER A N     1 
ATOM   2536  C  CA    . SER A 1  698 ? 163.836 120.301 89.939  1.00 45.96  ? 698  SER A CA    1 
ATOM   2537  C  C     . SER A 1  698 ? 163.165 120.916 91.159  1.00 45.96  ? 698  SER A C     1 
ATOM   2538  O  O     . SER A 1  698 ? 163.789 120.983 92.222  1.00 45.96  ? 698  SER A O     1 
ATOM   2539  C  CB    . SER A 1  698 ? 164.863 121.282 89.375  1.00 45.96  ? 698  SER A CB    1 
ATOM   2540  O  OG    . SER A 1  698 ? 165.767 121.707 90.378  1.00 45.96  ? 698  SER A OG    1 
ATOM   2541  N  N     . VAL A 1  699 ? 161.916 121.361 91.037  1.00 49.04  ? 699  VAL A N     1 
ATOM   2542  C  CA    . VAL A 1  699 ? 161.240 122.044 92.134  1.00 49.04  ? 699  VAL A CA    1 
ATOM   2543  C  C     . VAL A 1  699 ? 160.296 121.086 92.845  1.00 49.04  ? 699  VAL A C     1 
ATOM   2544  O  O     . VAL A 1  699 ? 160.470 120.791 94.032  1.00 49.04  ? 699  VAL A O     1 
ATOM   2545  C  CB    . VAL A 1  699 ? 160.481 123.283 91.627  1.00 49.04  ? 699  VAL A CB    1 
ATOM   2546  C  CG1   . VAL A 1  699 ? 159.703 123.928 92.762  1.00 49.04  ? 699  VAL A CG1   1 
ATOM   2547  C  CG2   . VAL A 1  699 ? 161.447 124.275 91.005  1.00 49.04  ? 699  VAL A CG2   1 
ATOM   2548  N  N     . SER A 1  700 ? 159.290 120.594 92.128  1.00 47.50  ? 700  SER A N     1 
ATOM   2549  C  CA    . SER A 1  700 ? 158.296 119.695 92.697  1.00 47.50  ? 700  SER A CA    1 
ATOM   2550  C  C     . SER A 1  700 ? 158.273 118.343 92.005  1.00 47.50  ? 700  SER A C     1 
ATOM   2551  O  O     . SER A 1  700 ? 158.228 117.306 92.677  1.00 47.50  ? 700  SER A O     1 
ATOM   2552  C  CB    . SER A 1  700 ? 156.906 120.343 92.630  1.00 47.50  ? 700  SER A CB    1 
ATOM   2553  O  OG    . SER A 1  700 ? 156.491 120.513 91.288  1.00 47.50  ? 700  SER A OG    1 
ATOM   2554  N  N     . GLY A 1  701 ? 158.301 118.323 90.678  1.00 40.22  ? 701  GLY A N     1 
ATOM   2555  C  CA    . GLY A 1  701 ? 158.293 117.078 89.946  1.00 40.22  ? 701  GLY A CA    1 
ATOM   2556  C  C     . GLY A 1  701 ? 156.925 116.556 89.592  1.00 40.22  ? 701  GLY A C     1 
ATOM   2557  O  O     . GLY A 1  701 ? 156.788 115.358 89.328  1.00 40.22  ? 701  GLY A O     1 
ATOM   2558  N  N     . ASP A 1  702 ? 155.908 117.406 89.578  1.00 35.61  ? 702  ASP A N     1 
ATOM   2559  C  CA    . ASP A 1  702 ? 154.567 116.953 89.256  1.00 35.61  ? 702  ASP A CA    1 
ATOM   2560  C  C     . ASP A 1  702 ? 154.261 117.152 87.780  1.00 35.61  ? 702  ASP A C     1 
ATOM   2561  O  O     . ASP A 1  702 ? 154.802 118.042 87.124  1.00 35.61  ? 702  ASP A O     1 
ATOM   2562  C  CB    . ASP A 1  702 ? 153.525 117.665 90.118  1.00 35.61  ? 702  ASP A CB    1 
ATOM   2563  C  CG    . ASP A 1  702 ? 153.627 119.167 90.062  1.00 35.61  ? 702  ASP A CG    1 
ATOM   2564  O  OD1   . ASP A 1  702 ? 154.608 119.693 89.498  1.00 35.61  ? 702  ASP A OD1   1 
ATOM   2565  O  OD2   . ASP A 1  702 ? 152.705 119.825 90.589  1.00 35.61  ? 702  ASP A OD2   1 
ATOM   2566  N  N     . ALA A 1  703 ? 153.383 116.301 87.260  1.00 27.59  ? 703  ALA A N     1 
ATOM   2567  C  CA    . ALA A 1  703 ? 153.069 116.342 85.842  1.00 27.59  ? 703  ALA A CA    1 
ATOM   2568  C  C     . ALA A 1  703 ? 152.061 117.419 85.486  1.00 27.59  ? 703  ALA A C     1 
ATOM   2569  O  O     . ALA A 1  703 ? 151.927 117.741 84.305  1.00 27.59  ? 703  ALA A O     1 
ATOM   2570  C  CB    . ALA A 1  703 ? 152.550 114.984 85.377  1.00 27.59  ? 703  ALA A CB    1 
ATOM   2571  N  N     . ARG A 1  704 ? 151.354 117.984 86.465  1.00 27.19  ? 704  ARG A N     1 
ATOM   2572  C  CA    . ARG A 1  704 ? 150.403 119.048 86.162  1.00 27.19  ? 704  ARG A CA    1 
ATOM   2573  C  C     . ARG A 1  704 ? 151.113 120.348 85.814  1.00 27.19  ? 704  ARG A C     1 
ATOM   2574  O  O     . ARG A 1  704 ? 150.760 121.000 84.828  1.00 27.19  ? 704  ARG A O     1 
ATOM   2575  C  CB    . ARG A 1  704 ? 149.453 119.255 87.334  1.00 27.19  ? 704  ARG A CB    1 
ATOM   2576  C  CG    . ARG A 1  704 ? 148.402 118.187 87.469  1.00 27.19  ? 704  ARG A CG    1 
ATOM   2577  C  CD    . ARG A 1  704 ? 147.669 118.352 88.769  1.00 27.19  ? 704  ARG A CD    1 
ATOM   2578  N  NE    . ARG A 1  704 ? 146.670 117.320 88.980  1.00 27.19  ? 704  ARG A NE    1 
ATOM   2579  C  CZ    . ARG A 1  704 ? 146.139 117.050 90.159  1.00 27.19  ? 704  ARG A CZ    1 
ATOM   2580  N  NH1   . ARG A 1  704 ? 146.546 117.718 91.224  1.00 27.19  ? 704  ARG A NH1   1 
ATOM   2581  N  NH2   . ARG A 1  704 ? 145.230 116.097 90.279  1.00 27.19  ? 704  ARG A NH2   1 
ATOM   2582  N  N     . ARG A 1  705 ? 152.129 120.728 86.595  1.00 29.79  ? 705  ARG A N     1 
ATOM   2583  C  CA    . ARG A 1  705 ? 152.851 121.977 86.367  1.00 29.79  ? 705  ARG A CA    1 
ATOM   2584  C  C     . ARG A 1  705 ? 153.663 121.970 85.079  1.00 29.79  ? 705  ARG A C     1 
ATOM   2585  O  O     . ARG A 1  705 ? 154.017 123.043 84.585  1.00 29.79  ? 705  ARG A O     1 
ATOM   2586  C  CB    . ARG A 1  705 ? 153.772 122.268 87.550  1.00 29.79  ? 705  ARG A CB    1 
ATOM   2587  C  CG    . ARG A 1  705 ? 153.035 122.568 88.840  1.00 29.79  ? 705  ARG A CG    1 
ATOM   2588  C  CD    . ARG A 1  705 ? 152.482 123.980 88.883  1.00 29.79  ? 705  ARG A CD    1 
ATOM   2589  N  NE    . ARG A 1  705 ? 153.548 124.973 88.987  1.00 29.79  ? 705  ARG A NE    1 
ATOM   2590  C  CZ    . ARG A 1  705 ? 154.081 125.370 90.140  1.00 29.79  ? 705  ARG A CZ    1 
ATOM   2591  N  NH1   . ARG A 1  705 ? 153.647 124.860 91.285  1.00 29.79  ? 705  ARG A NH1   1 
ATOM   2592  N  NH2   . ARG A 1  705 ? 155.046 126.278 90.152  1.00 29.79  ? 705  ARG A NH2   1 
ATOM   2593  N  N     . ALA A 1  706 ? 153.966 120.798 84.525  1.00 29.24  ? 706  ALA A N     1 
ATOM   2594  C  CA    . ALA A 1  706 ? 154.665 120.724 83.251  1.00 29.24  ? 706  ALA A CA    1 
ATOM   2595  C  C     . ALA A 1  706 ? 153.719 120.693 82.066  1.00 29.24  ? 706  ALA A C     1 
ATOM   2596  O  O     . ALA A 1  706 ? 154.087 121.145 80.977  1.00 29.24  ? 706  ALA A O     1 
ATOM   2597  C  CB    . ALA A 1  706 ? 155.554 119.485 83.205  1.00 29.24  ? 706  ALA A CB    1 
ATOM   2598  N  N     . LEU A 1  707 ? 152.518 120.150 82.244  1.00 27.84  ? 707  LEU A N     1 
ATOM   2599  C  CA    . LEU A 1  707 ? 151.533 120.191 81.175  1.00 27.84  ? 707  LEU A CA    1 
ATOM   2600  C  C     . LEU A 1  707 ? 150.893 121.563 81.046  1.00 27.84  ? 707  LEU A C     1 
ATOM   2601  O  O     . LEU A 1  707 ? 150.418 121.912 79.963  1.00 27.84  ? 707  LEU A O     1 
ATOM   2602  C  CB    . LEU A 1  707 ? 150.463 119.130 81.409  1.00 27.84  ? 707  LEU A CB    1 
ATOM   2603  C  CG    . LEU A 1  707 ? 150.924 117.690 81.209  1.00 27.84  ? 707  LEU A CG    1 
ATOM   2604  C  CD1   . LEU A 1  707 ? 149.892 116.748 81.781  1.00 27.84  ? 707  LEU A CD1   1 
ATOM   2605  C  CD2   . LEU A 1  707 ? 151.160 117.396 79.745  1.00 27.84  ? 707  LEU A CD2   1 
ATOM   2606  N  N     . LYS A 1  708 ? 150.873 122.355 82.116  1.00 27.82  ? 708  LYS A N     1 
ATOM   2607  C  CA    . LYS A 1  708 ? 150.328 123.702 82.036  1.00 27.82  ? 708  LYS A CA    1 
ATOM   2608  C  C     . LYS A 1  708 ? 151.405 124.772 81.960  1.00 27.82  ? 708  LYS A C     1 
ATOM   2609  O  O     . LYS A 1  708 ? 151.073 125.959 81.965  1.00 27.82  ? 708  LYS A O     1 
ATOM   2610  C  CB    . LYS A 1  708 ? 149.396 123.989 83.216  1.00 27.82  ? 708  LYS A CB    1 
ATOM   2611  C  CG    . LYS A 1  708 ? 150.075 124.140 84.550  1.00 27.82  ? 708  LYS A CG    1 
ATOM   2612  C  CD    . LYS A 1  708 ? 149.043 124.355 85.629  1.00 27.82  ? 708  LYS A CD    1 
ATOM   2613  C  CE    . LYS A 1  708 ? 148.241 123.089 85.854  1.00 27.82  ? 708  LYS A CE    1 
ATOM   2614  N  NZ    . LYS A 1  708 ? 147.297 123.215 86.989  1.00 27.82  ? 708  LYS A NZ    1 
ATOM   2615  N  N     . VAL A 1  709 ? 152.680 124.392 81.897  1.00 28.63  ? 709  VAL A N     1 
ATOM   2616  C  CA    . VAL A 1  709 ? 153.691 125.336 81.440  1.00 28.63  ? 709  VAL A CA    1 
ATOM   2617  C  C     . VAL A 1  709 ? 153.902 125.184 79.938  1.00 28.63  ? 709  VAL A C     1 
ATOM   2618  O  O     . VAL A 1  709 ? 154.385 126.121 79.286  1.00 28.63  ? 709  VAL A O     1 
ATOM   2619  C  CB    . VAL A 1  709 ? 155.010 125.177 82.225  1.00 28.63  ? 709  VAL A CB    1 
ATOM   2620  C  CG1   . VAL A 1  709 ? 155.791 123.958 81.779  1.00 28.63  ? 709  VAL A CG1   1 
ATOM   2621  C  CG2   . VAL A 1  709 ? 155.857 126.437 82.156  1.00 28.63  ? 709  VAL A CG2   1 
ATOM   2622  N  N     . CYS A 1  710 ? 153.512 124.047 79.363  1.00 33.13  ? 710  CYS A N     1 
ATOM   2623  C  CA    . CYS A 1  710 ? 153.479 123.879 77.920  1.00 33.13  ? 710  CYS A CA    1 
ATOM   2624  C  C     . CYS A 1  710 ? 152.135 124.258 77.325  1.00 33.13  ? 710  CYS A C     1 
ATOM   2625  O  O     . CYS A 1  710 ? 152.070 124.584 76.137  1.00 33.13  ? 710  CYS A O     1 
ATOM   2626  C  CB    . CYS A 1  710 ? 153.809 122.433 77.547  1.00 33.13  ? 710  CYS A CB    1 
ATOM   2627  S  SG    . CYS A 1  710 ? 155.497 121.944 77.937  1.00 33.13  ? 710  CYS A SG    1 
ATOM   2628  N  N     . LYS A 1  711 ? 151.064 124.212 78.118  1.00 32.56  ? 711  LYS A N     1 
ATOM   2629  C  CA    . LYS A 1  711 ? 149.800 124.793 77.683  1.00 32.56  ? 711  LYS A CA    1 
ATOM   2630  C  C     . LYS A 1  711 ? 149.870 126.313 77.707  1.00 32.56  ? 711  LYS A C     1 
ATOM   2631  O  O     . LYS A 1  711 ? 149.324 126.979 76.820  1.00 32.56  ? 711  LYS A O     1 
ATOM   2632  C  CB    . LYS A 1  711 ? 148.659 124.296 78.568  1.00 32.56  ? 711  LYS A CB    1 
ATOM   2633  C  CG    . LYS A 1  711 ? 147.287 124.774 78.145  1.00 32.56  ? 711  LYS A CG    1 
ATOM   2634  C  CD    . LYS A 1  711 ? 146.222 124.306 79.116  1.00 32.56  ? 711  LYS A CD    1 
ATOM   2635  C  CE    . LYS A 1  711 ? 144.865 124.882 78.752  1.00 32.56  ? 711  LYS A CE    1 
ATOM   2636  N  NZ    . LYS A 1  711 ? 143.810 124.518 79.738  1.00 32.56  ? 711  LYS A NZ    1 
ATOM   2637  N  N     . ARG A 1  712 ? 150.540 126.875 78.718  1.00 33.08  ? 712  ARG A N     1 
ATOM   2638  C  CA    . ARG A 1  712 ? 150.713 128.322 78.799  1.00 33.08  ? 712  ARG A CA    1 
ATOM   2639  C  C     . ARG A 1  712 ? 151.603 128.830 77.675  1.00 33.08  ? 712  ARG A C     1 
ATOM   2640  O  O     . ARG A 1  712 ? 151.358 129.904 77.119  1.00 33.08  ? 712  ARG A O     1 
ATOM   2641  C  CB    . ARG A 1  712 ? 151.307 128.704 80.154  1.00 33.08  ? 712  ARG A CB    1 
ATOM   2642  C  CG    . ARG A 1  712 ? 151.458 130.196 80.385  1.00 33.08  ? 712  ARG A CG    1 
ATOM   2643  C  CD    . ARG A 1  712 ? 150.135 130.868 80.667  1.00 33.08  ? 712  ARG A CD    1 
ATOM   2644  N  NE    . ARG A 1  712 ? 150.301 132.309 80.821  1.00 33.08  ? 712  ARG A NE    1 
ATOM   2645  C  CZ    . ARG A 1  712 ? 150.142 133.184 79.837  1.00 33.08  ? 712  ARG A CZ    1 
ATOM   2646  N  NH1   . ARG A 1  712 ? 149.773 132.768 78.637  1.00 33.08  ? 712  ARG A NH1   1 
ATOM   2647  N  NH2   . ARG A 1  712 ? 150.323 134.477 80.057  1.00 33.08  ? 712  ARG A NH2   1 
ATOM   2648  N  N     . ALA A 1  713 ? 152.637 128.066 77.322  1.00 32.42  ? 713  ALA A N     1 
ATOM   2649  C  CA    . ALA A 1  713 ? 153.490 128.436 76.199  1.00 32.42  ? 713  ALA A CA    1 
ATOM   2650  C  C     . ALA A 1  713 ? 152.763 128.310 74.870  1.00 32.42  ? 713  ALA A C     1 
ATOM   2651  O  O     . ALA A 1  713 ? 153.074 129.037 73.923  1.00 32.42  ? 713  ALA A O     1 
ATOM   2652  C  CB    . ALA A 1  713 ? 154.743 127.571 76.189  1.00 32.42  ? 713  ALA A CB    1 
ATOM   2653  N  N     . ALA A 1  714 ? 151.799 127.398 74.778  1.00 33.11  ? 714  ALA A N     1 
ATOM   2654  C  CA    . ALA A 1  714 ? 151.059 127.227 73.540  1.00 33.11  ? 714  ALA A CA    1 
ATOM   2655  C  C     . ALA A 1  714 ? 150.041 128.333 73.305  1.00 33.11  ? 714  ALA A C     1 
ATOM   2656  O  O     . ALA A 1  714 ? 149.638 128.544 72.158  1.00 33.11  ? 714  ALA A O     1 
ATOM   2657  C  CB    . ALA A 1  714 ? 150.359 125.870 73.530  1.00 33.11  ? 714  ALA A CB    1 
ATOM   2658  N  N     . GLU A 1  715 ? 149.610 129.040 74.351  1.00 36.63  ? 715  GLU A N     1 
ATOM   2659  C  CA    . GLU A 1  715 ? 148.703 130.162 74.154  1.00 36.63  ? 715  GLU A CA    1 
ATOM   2660  C  C     . GLU A 1  715 ? 149.426 131.498 74.080  1.00 36.63  ? 715  GLU A C     1 
ATOM   2661  O  O     . GLU A 1  715 ? 148.854 132.464 73.564  1.00 36.63  ? 715  GLU A O     1 
ATOM   2662  C  CB    . GLU A 1  715 ? 147.645 130.214 75.260  1.00 36.63  ? 715  GLU A CB    1 
ATOM   2663  C  CG    . GLU A 1  715 ? 148.162 130.564 76.629  1.00 36.63  ? 715  GLU A CG    1 
ATOM   2664  C  CD    . GLU A 1  715 ? 147.070 130.556 77.677  1.00 36.63  ? 715  GLU A CD    1 
ATOM   2665  O  OE1   . GLU A 1  715 ? 145.924 130.192 77.342  1.00 36.63  ? 715  GLU A OE1   1 
ATOM   2666  O  OE2   . GLU A 1  715 ? 147.350 130.931 78.834  1.00 36.63  ? 715  GLU A OE2   1 
ATOM   2667  N  N     . ILE A 1  716 ? 150.658 131.580 74.588  1.00 35.40  ? 716  ILE A N     1 
ATOM   2668  C  CA    . ILE A 1  716 ? 151.510 132.723 74.275  1.00 35.40  ? 716  ILE A CA    1 
ATOM   2669  C  C     . ILE A 1  716 ? 151.827 132.743 72.787  1.00 35.40  ? 716  ILE A C     1 
ATOM   2670  O  O     . ILE A 1  716 ? 151.761 133.791 72.132  1.00 35.40  ? 716  ILE A O     1 
ATOM   2671  C  CB    . ILE A 1  716 ? 152.790 132.691 75.132  1.00 35.40  ? 716  ILE A CB    1 
ATOM   2672  C  CG1   . ILE A 1  716 ? 152.457 132.946 76.598  1.00 35.40  ? 716  ILE A CG1   1 
ATOM   2673  C  CG2   . ILE A 1  716 ? 153.805 133.711 74.659  1.00 35.40  ? 716  ILE A CG2   1 
ATOM   2674  C  CD1   . ILE A 1  716 ? 153.618 132.720 77.515  1.00 35.40  ? 716  ILE A CD1   1 
ATOM   2675  N  N     . ALA A 1  717 ? 152.135 131.575 72.220  1.00 38.17  ? 717  ALA A N     1 
ATOM   2676  C  CA    . ALA A 1  717 ? 152.368 131.477 70.788  1.00 38.17  ? 717  ALA A CA    1 
ATOM   2677  C  C     . ALA A 1  717 ? 151.095 131.653 69.975  1.00 38.17  ? 717  ALA A C     1 
ATOM   2678  O  O     . ALA A 1  717 ? 151.179 132.019 68.800  1.00 38.17  ? 717  ALA A O     1 
ATOM   2679  C  CB    . ALA A 1  717 ? 153.012 130.135 70.451  1.00 38.17  ? 717  ALA A CB    1 
ATOM   2680  N  N     . GLU A 1  718 ? 149.922 131.405 70.563  1.00 43.40  ? 718  GLU A N     1 
ATOM   2681  C  CA    . GLU A 1  718 ? 148.688 131.595 69.811  1.00 43.40  ? 718  GLU A CA    1 
ATOM   2682  C  C     . GLU A 1  718 ? 148.344 133.069 69.667  1.00 43.40  ? 718  GLU A C     1 
ATOM   2683  O  O     . GLU A 1  718 ? 147.942 133.507 68.585  1.00 43.40  ? 718  GLU A O     1 
ATOM   2684  C  CB    . GLU A 1  718 ? 147.514 130.886 70.479  1.00 43.40  ? 718  GLU A CB    1 
ATOM   2685  C  CG    . GLU A 1  718 ? 146.281 130.858 69.586  1.00 43.40  ? 718  GLU A CG    1 
ATOM   2686  C  CD    . GLU A 1  718 ? 145.026 130.484 70.326  1.00 43.40  ? 718  GLU A CD    1 
ATOM   2687  O  OE1   . GLU A 1  718 ? 145.083 130.384 71.564  1.00 43.40  ? 718  GLU A OE1   1 
ATOM   2688  O  OE2   . GLU A 1  718 ? 143.975 130.307 69.677  1.00 43.40  ? 718  GLU A OE2   1 
ATOM   2689  N  N     . LYS A 1  719 ? 148.483 133.844 70.748  1.00 45.12  ? 719  LYS A N     1 
ATOM   2690  C  CA    . LYS A 1  719 ? 148.061 135.240 70.728  1.00 45.12  ? 719  LYS A CA    1 
ATOM   2691  C  C     . LYS A 1  719 ? 148.946 136.101 69.843  1.00 45.12  ? 719  LYS A C     1 
ATOM   2692  O  O     . LYS A 1  719 ? 148.500 137.158 69.394  1.00 45.12  ? 719  LYS A O     1 
ATOM   2693  C  CB    . LYS A 1  719 ? 148.026 135.820 72.145  1.00 45.12  ? 719  LYS A CB    1 
ATOM   2694  C  CG    . LYS A 1  719 ? 149.380 136.042 72.789  1.00 45.12  ? 719  LYS A CG    1 
ATOM   2695  C  CD    . LYS A 1  719 ? 149.230 136.609 74.186  1.00 45.12  ? 719  LYS A CD    1 
ATOM   2696  C  CE    . LYS A 1  719 ? 148.677 138.024 74.149  1.00 45.12  ? 719  LYS A CE    1 
ATOM   2697  N  NZ    . LYS A 1  719 ? 149.624 138.990 73.534  1.00 45.12  ? 719  LYS A NZ    1 
ATOM   2698  N  N     . HIS A 1  720 ? 150.179 135.673 69.575  1.00 54.09  ? 720  HIS A N     1 
ATOM   2699  C  CA    . HIS A 1  720 ? 150.997 136.366 68.592  1.00 54.09  ? 720  HIS A CA    1 
ATOM   2700  C  C     . HIS A 1  720 ? 150.625 135.935 67.182  1.00 54.09  ? 720  HIS A C     1 
ATOM   2701  O  O     . HIS A 1  720 ? 150.660 136.748 66.254  1.00 54.09  ? 720  HIS A O     1 
ATOM   2702  C  CB    . HIS A 1  720 ? 152.474 136.112 68.873  1.00 54.09  ? 720  HIS A CB    1 
ATOM   2703  C  CG    . HIS A 1  720 ? 152.935 136.674 70.181  1.00 54.09  ? 720  HIS A CG    1 
ATOM   2704  N  ND1   . HIS A 1  720 ? 152.844 135.975 71.364  1.00 54.09  ? 720  HIS A ND1   1 
ATOM   2705  C  CD2   . HIS A 1  720 ? 153.485 137.871 70.493  1.00 54.09  ? 720  HIS A CD2   1 
ATOM   2706  C  CE1   . HIS A 1  720 ? 153.321 136.715 72.348  1.00 54.09  ? 720  HIS A CE1   1 
ATOM   2707  N  NE2   . HIS A 1  720 ? 153.717 137.870 71.847  1.00 54.09  ? 720  HIS A NE2   1 
ATOM   2708  N  N     . TYR A 1  721 ? 150.263 134.662 67.006  1.00 53.78  ? 721  TYR A N     1 
ATOM   2709  C  CA    . TYR A 1  721 ? 149.666 134.222 65.750  1.00 53.78  ? 721  TYR A CA    1 
ATOM   2710  C  C     . TYR A 1  721 ? 148.305 134.864 65.528  1.00 53.78  ? 721  TYR A C     1 
ATOM   2711  O  O     . TYR A 1  721 ? 147.929 135.143 64.385  1.00 53.78  ? 721  TYR A O     1 
ATOM   2712  C  CB    . TYR A 1  721 ? 149.542 132.699 65.737  1.00 53.78  ? 721  TYR A CB    1 
ATOM   2713  C  CG    . TYR A 1  721 ? 148.888 132.138 64.495  1.00 53.78  ? 721  TYR A CG    1 
ATOM   2714  C  CD1   . TYR A 1  721 ? 149.576 132.078 63.291  1.00 53.78  ? 721  TYR A CD1   1 
ATOM   2715  C  CD2   . TYR A 1  721 ? 147.583 131.662 64.530  1.00 53.78  ? 721  TYR A CD2   1 
ATOM   2716  C  CE1   . TYR A 1  721 ? 148.983 131.564 62.156  1.00 53.78  ? 721  TYR A CE1   1 
ATOM   2717  C  CE2   . TYR A 1  721 ? 146.982 131.151 63.400  1.00 53.78  ? 721  TYR A CE2   1 
ATOM   2718  C  CZ    . TYR A 1  721 ? 147.685 131.104 62.217  1.00 53.78  ? 721  TYR A CZ    1 
ATOM   2719  O  OH    . TYR A 1  721 ? 147.088 130.592 61.089  1.00 53.78  ? 721  TYR A OH    1 
ATOM   2720  N  N     . MET A 1  722 ? 147.560 135.110 66.603  1.00 53.24  ? 722  MET A N     1 
ATOM   2721  C  CA    . MET A 1  722 ? 146.246 135.726 66.486  1.00 53.24  ? 722  MET A CA    1 
ATOM   2722  C  C     . MET A 1  722 ? 146.351 137.227 66.245  1.00 53.24  ? 722  MET A C     1 
ATOM   2723  O  O     . MET A 1  722 ? 145.434 137.824 65.674  1.00 53.24  ? 722  MET A O     1 
ATOM   2724  C  CB    . MET A 1  722 ? 145.433 135.439 67.752  1.00 53.24  ? 722  MET A CB    1 
ATOM   2725  C  CG    . MET A 1  722 ? 143.949 135.737 67.666  1.00 53.24  ? 722  MET A CG    1 
ATOM   2726  S  SD    . MET A 1  722 ? 143.114 134.621 66.532  1.00 53.24  ? 722  MET A SD    1 
ATOM   2727  C  CE    . MET A 1  722 ? 143.140 133.114 67.492  1.00 53.24  ? 722  MET A CE    1 
ATOM   2728  N  N     . ALA A 1  723 ? 147.453 137.852 66.658  1.00 52.46  ? 723  ALA A N     1 
ATOM   2729  C  CA    . ALA A 1  723 ? 147.618 139.288 66.467  1.00 52.46  ? 723  ALA A CA    1 
ATOM   2730  C  C     . ALA A 1  723 ? 148.258 139.643 65.134  1.00 52.46  ? 723  ALA A C     1 
ATOM   2731  O  O     . ALA A 1  723 ? 147.973 140.719 64.595  1.00 52.46  ? 723  ALA A O     1 
ATOM   2732  C  CB    . ALA A 1  723 ? 148.455 139.891 67.597  1.00 52.46  ? 723  ALA A CB    1 
ATOM   2733  N  N     . LYS A 1  724 ? 149.129 138.777 64.605  1.00 55.83  ? 724  LYS A N     1 
ATOM   2734  C  CA    . LYS A 1  724 ? 149.742 139.033 63.304  1.00 55.83  ? 724  LYS A CA    1 
ATOM   2735  C  C     . LYS A 1  724 ? 148.707 139.000 62.189  1.00 55.83  ? 724  LYS A C     1 
ATOM   2736  O  O     . LYS A 1  724 ? 148.638 139.916 61.363  1.00 55.83  ? 724  LYS A O     1 
ATOM   2737  C  CB    . LYS A 1  724 ? 150.846 138.015 63.022  1.00 55.83  ? 724  LYS A CB    1 
ATOM   2738  C  CG    . LYS A 1  724 ? 152.143 138.249 63.770  1.00 55.83  ? 724  LYS A CG    1 
ATOM   2739  C  CD    . LYS A 1  724 ? 153.121 137.110 63.516  1.00 55.83  ? 724  LYS A CD    1 
ATOM   2740  C  CE    . LYS A 1  724 ? 153.620 137.129 62.078  1.00 55.83  ? 724  LYS A CE    1 
ATOM   2741  N  NZ    . LYS A 1  724 ? 154.650 136.085 61.820  1.00 55.83  ? 724  LYS A NZ    1 
ATOM   2742  N  N     . HIS A 1  725 ? 147.887 137.958 62.158  1.00 61.49  ? 725  HIS A N     1 
ATOM   2743  C  CA    . HIS A 1  725 ? 146.943 137.785 61.068  1.00 61.49  ? 725  HIS A CA    1 
ATOM   2744  C  C     . HIS A 1  725 ? 145.571 138.354 61.381  1.00 61.49  ? 725  HIS A C     1 
ATOM   2745  O  O     . HIS A 1  725 ? 144.801 138.620 60.451  1.00 61.49  ? 725  HIS A O     1 
ATOM   2746  C  CB    . HIS A 1  725 ? 146.823 136.303 60.728  1.00 61.49  ? 725  HIS A CB    1 
ATOM   2747  C  CG    . HIS A 1  725 ? 148.122 135.672 60.338  1.00 61.49  ? 725  HIS A CG    1 
ATOM   2748  N  ND1   . HIS A 1  725 ? 148.702 135.866 59.104  1.00 61.49  ? 725  HIS A ND1   1 
ATOM   2749  C  CD2   . HIS A 1  725 ? 148.962 134.864 61.027  1.00 61.49  ? 725  HIS A CD2   1 
ATOM   2750  C  CE1   . HIS A 1  725 ? 149.840 135.197 59.046  1.00 61.49  ? 725  HIS A CE1   1 
ATOM   2751  N  NE2   . HIS A 1  725 ? 150.021 134.581 60.200  1.00 61.49  ? 725  HIS A NE2   1 
ATOM   2752  N  N     . GLY A 1  726 ? 145.254 138.553 62.658  1.00 58.39  ? 726  GLY A N     1 
ATOM   2753  C  CA    . GLY A 1  726 ? 144.005 139.168 63.057  1.00 58.39  ? 726  GLY A CA    1 
ATOM   2754  C  C     . GLY A 1  726 ? 142.776 138.336 62.763  1.00 58.39  ? 726  GLY A C     1 
ATOM   2755  O  O     . GLY A 1  726 ? 141.828 138.834 62.149  1.00 58.39  ? 726  GLY A O     1 
ATOM   2756  N  N     . TYR A 1  727 ? 142.771 137.071 63.184  1.00 54.31  ? 727  TYR A N     1 
ATOM   2757  C  CA    . TYR A 1  727 ? 141.602 136.243 62.919  1.00 54.31  ? 727  TYR A CA    1 
ATOM   2758  C  C     . TYR A 1  727 ? 140.480 136.540 63.903  1.00 54.31  ? 727  TYR A C     1 
ATOM   2759  O  O     . TYR A 1  727 ? 139.324 136.720 63.505  1.00 54.31  ? 727  TYR A O     1 
ATOM   2760  C  CB    . TYR A 1  727 ? 141.958 134.757 62.968  1.00 54.31  ? 727  TYR A CB    1 
ATOM   2761  C  CG    . TYR A 1  727 ? 142.953 134.318 61.926  1.00 54.31  ? 727  TYR A CG    1 
ATOM   2762  C  CD1   . TYR A 1  727 ? 142.647 134.395 60.573  1.00 54.31  ? 727  TYR A CD1   1 
ATOM   2763  C  CD2   . TYR A 1  727 ? 144.164 133.749 62.294  1.00 54.31  ? 727  TYR A CD2   1 
ATOM   2764  C  CE1   . TYR A 1  727 ? 143.545 133.976 59.614  1.00 54.31  ? 727  TYR A CE1   1 
ATOM   2765  C  CE2   . TYR A 1  727 ? 145.063 133.315 61.343  1.00 54.31  ? 727  TYR A CE2   1 
ATOM   2766  C  CZ    . TYR A 1  727 ? 144.750 133.437 60.004  1.00 54.31  ? 727  TYR A CZ    1 
ATOM   2767  O  OH    . TYR A 1  727 ? 145.644 133.011 59.050  1.00 54.31  ? 727  TYR A OH    1 
ATOM   2768  N  N     . GLY A 1  728 ? 140.800 136.594 65.188  1.00 45.94  ? 728  GLY A N     1 
ATOM   2769  C  CA    . GLY A 1  728 ? 139.778 136.813 66.183  1.00 45.94  ? 728  GLY A CA    1 
ATOM   2770  C  C     . GLY A 1  728 ? 138.977 135.554 66.468  1.00 45.94  ? 728  GLY A C     1 
ATOM   2771  O  O     . GLY A 1  728 ? 139.419 134.422 66.249  1.00 45.94  ? 728  GLY A O     1 
ATOM   2772  N  N     . TYR A 1  729 ? 137.764 135.774 66.960  1.00 39.69  ? 729  TYR A N     1 
ATOM   2773  C  CA    . TYR A 1  729 ? 136.893 134.716 67.446  1.00 39.69  ? 729  TYR A CA    1 
ATOM   2774  C  C     . TYR A 1  729 ? 135.581 134.766 66.680  1.00 39.69  ? 729  TYR A C     1 
ATOM   2775  O  O     . TYR A 1  729 ? 135.097 135.848 66.334  1.00 39.69  ? 729  TYR A O     1 
ATOM   2776  C  CB    . TYR A 1  729 ? 136.633 134.883 68.945  1.00 39.69  ? 729  TYR A CB    1 
ATOM   2777  C  CG    . TYR A 1  729 ? 137.879 134.788 69.794  1.00 39.69  ? 729  TYR A CG    1 
ATOM   2778  C  CD1   . TYR A 1  729 ? 138.330 133.568 70.267  1.00 39.69  ? 729  TYR A CD1   1 
ATOM   2779  C  CD2   . TYR A 1  729 ? 138.625 135.923 70.093  1.00 39.69  ? 729  TYR A CD2   1 
ATOM   2780  C  CE1   . TYR A 1  729 ? 139.474 133.481 71.036  1.00 39.69  ? 729  TYR A CE1   1 
ATOM   2781  C  CE2   . TYR A 1  729 ? 139.766 135.846 70.857  1.00 39.69  ? 729  TYR A CE2   1 
ATOM   2782  C  CZ    . TYR A 1  729 ? 140.185 134.626 71.325  1.00 39.69  ? 729  TYR A CZ    1 
ATOM   2783  O  OH    . TYR A 1  729 ? 141.326 134.551 72.083  1.00 39.69  ? 729  TYR A OH    1 
ATOM   2784  N  N     . ASP A 1  730 ? 135.005 133.599 66.415  1.00 30.00  ? 730  ASP A N     1 
ATOM   2785  C  CA    . ASP A 1  730 ? 133.739 133.547 65.695  1.00 30.00  ? 730  ASP A CA    1 
ATOM   2786  C  C     . ASP A 1  730 ? 132.864 132.418 66.219  1.00 30.00  ? 730  ASP A C     1 
ATOM   2787  O  O     . ASP A 1  730 ? 132.172 132.577 67.223  1.00 30.00  ? 730  ASP A O     1 
ATOM   2788  C  CB    . ASP A 1  730 ? 133.978 133.380 64.193  1.00 30.00  ? 730  ASP A CB    1 
ATOM   2789  C  CG    . ASP A 1  730 ? 132.713 133.551 63.380  1.00 30.00  ? 730  ASP A CG    1 
ATOM   2790  O  OD1   . ASP A 1  730 ? 132.273 134.706 63.205  1.00 30.00  ? 730  ASP A OD1   1 
ATOM   2791  O  OD2   . ASP A 1  730 ? 132.152 132.534 62.923  1.00 30.00  ? 730  ASP A OD2   1 
ATOM   2792  N  N     . GLY A 1  769 ? 154.808 129.990 56.891  1.00 58.19  ? 769  GLY A N     1 
ATOM   2793  C  CA    . GLY A 1  769 ? 155.157 128.717 56.288  1.00 58.19  ? 769  GLY A CA    1 
ATOM   2794  C  C     . GLY A 1  769 ? 155.117 127.557 57.262  1.00 58.19  ? 769  GLY A C     1 
ATOM   2795  O  O     . GLY A 1  769 ? 154.640 126.471 56.934  1.00 58.19  ? 769  GLY A O     1 
ATOM   2796  N  N     . VAL A 1  770 ? 155.629 127.787 58.467  1.00 59.06  ? 770  VAL A N     1 
ATOM   2797  C  CA    . VAL A 1  770 ? 155.628 126.777 59.521  1.00 59.06  ? 770  VAL A CA    1 
ATOM   2798  C  C     . VAL A 1  770 ? 155.474 127.485 60.863  1.00 59.06  ? 770  VAL A C     1 
ATOM   2799  O  O     . VAL A 1  770 ? 156.076 128.537 61.100  1.00 59.06  ? 770  VAL A O     1 
ATOM   2800  C  CB    . VAL A 1  770 ? 156.892 125.882 59.449  1.00 59.06  ? 770  VAL A CB    1 
ATOM   2801  C  CG1   . VAL A 1  770 ? 158.184 126.693 59.540  1.00 59.06  ? 770  VAL A CG1   1 
ATOM   2802  C  CG2   . VAL A 1  770 ? 156.864 124.797 60.519  1.00 59.06  ? 770  VAL A CG2   1 
ATOM   2803  N  N     . GLN A 1  771 ? 154.608 126.947 61.714  1.00 60.58  ? 771  GLN A N     1 
ATOM   2804  C  CA    . GLN A 1  771 ? 154.397 127.483 63.048  1.00 60.58  ? 771  GLN A CA    1 
ATOM   2805  C  C     . GLN A 1  771 ? 155.169 126.657 64.064  1.00 60.58  ? 771  GLN A C     1 
ATOM   2806  O  O     . GLN A 1  771 ? 155.363 125.452 63.891  1.00 60.58  ? 771  GLN A O     1 
ATOM   2807  C  CB    . GLN A 1  771 ? 152.913 127.494 63.407  1.00 60.58  ? 771  GLN A CB    1 
ATOM   2808  C  CG    . GLN A 1  771 ? 152.083 128.394 62.523  1.00 60.58  ? 771  GLN A CG    1 
ATOM   2809  C  CD    . GLN A 1  771 ? 152.555 129.829 62.555  1.00 60.58  ? 771  GLN A CD    1 
ATOM   2810  O  OE1   . GLN A 1  771 ? 153.063 130.348 61.563  1.00 60.58  ? 771  GLN A OE1   1 
ATOM   2811  N  NE2   . GLN A 1  771 ? 152.409 130.473 63.704  1.00 60.58  ? 771  GLN A NE2   1 
ATOM   2812  N  N     . THR A 1  772 ? 155.610 127.318 65.130  1.00 57.21  ? 772  THR A N     1 
ATOM   2813  C  CA    . THR A 1  772 ? 156.407 126.643 66.141  1.00 57.21  ? 772  THR A CA    1 
ATOM   2814  C  C     . THR A 1  772 ? 156.253 127.363 67.470  1.00 57.21  ? 772  THR A C     1 
ATOM   2815  O  O     . THR A 1  772 ? 155.855 128.529 67.528  1.00 57.21  ? 772  THR A O     1 
ATOM   2816  C  CB    . THR A 1  772 ? 157.885 126.562 65.731  1.00 57.21  ? 772  THR A CB    1 
ATOM   2817  O  OG1   . THR A 1  772 ? 158.613 125.786 66.691  1.00 57.21  ? 772  THR A OG1   1 
ATOM   2818  C  CG2   . THR A 1  772 ? 158.494 127.939 65.624  1.00 57.21  ? 772  THR A CG2   1 
ATOM   2819  N  N     . VAL A 1  773 ? 156.556 126.637 68.539  1.00 54.38  ? 773  VAL A N     1 
ATOM   2820  C  CA    . VAL A 1  773 ? 156.619 127.184 69.887  1.00 54.38  ? 773  VAL A CA    1 
ATOM   2821  C  C     . VAL A 1  773 ? 158.094 127.253 70.252  1.00 54.38  ? 773  VAL A C     1 
ATOM   2822  O  O     . VAL A 1  773 ? 158.727 126.221 70.506  1.00 54.38  ? 773  VAL A O     1 
ATOM   2823  C  CB    . VAL A 1  773 ? 155.829 126.332 70.889  1.00 54.38  ? 773  VAL A CB    1 
ATOM   2824  C  CG1   . VAL A 1  773 ? 155.949 126.910 72.286  1.00 54.38  ? 773  VAL A CG1   1 
ATOM   2825  C  CG2   . VAL A 1  773 ? 154.374 126.233 70.470  1.00 54.38  ? 773  VAL A CG2   1 
ATOM   2826  N  N     . HIS A 1  774 ? 158.647 128.464 70.273  1.00 55.86  ? 774  HIS A N     1 
ATOM   2827  C  CA    . HIS A 1  774 ? 160.085 128.640 70.410  1.00 55.86  ? 774  HIS A CA    1 
ATOM   2828  C  C     . HIS A 1  774 ? 160.539 128.366 71.841  1.00 55.86  ? 774  HIS A C     1 
ATOM   2829  O  O     . HIS A 1  774 ? 159.750 128.061 72.739  1.00 55.86  ? 774  HIS A O     1 
ATOM   2830  C  CB    . HIS A 1  774 ? 160.503 130.055 70.016  1.00 55.86  ? 774  HIS A CB    1 
ATOM   2831  C  CG    . HIS A 1  774 ? 160.317 130.375 68.567  1.00 55.86  ? 774  HIS A CG    1 
ATOM   2832  N  ND1   . HIS A 1  774 ? 159.176 130.971 68.076  1.00 55.86  ? 774  HIS A ND1   1 
ATOM   2833  C  CD2   . HIS A 1  774 ? 161.135 130.196 67.503  1.00 55.86  ? 774  HIS A CD2   1 
ATOM   2834  C  CE1   . HIS A 1  774 ? 159.299 131.147 66.773  1.00 55.86  ? 774  HIS A CE1   1 
ATOM   2835  N  NE2   . HIS A 1  774 ? 160.476 130.679 66.399  1.00 55.86  ? 774  HIS A NE2   1 
ATOM   2836  N  N     . ILE A 1  775 ? 161.851 128.496 72.045  1.00 51.45  ? 775  ILE A N     1 
ATOM   2837  C  CA    . ILE A 1  775 ? 162.410 128.472 73.389  1.00 51.45  ? 775  ILE A CA    1 
ATOM   2838  C  C     . ILE A 1  775 ? 161.991 129.717 74.167  1.00 51.45  ? 775  ILE A C     1 
ATOM   2839  O  O     . ILE A 1  775 ? 161.843 129.671 75.394  1.00 51.45  ? 775  ILE A O     1 
ATOM   2840  C  CB    . ILE A 1  775 ? 163.944 128.304 73.302  1.00 51.45  ? 775  ILE A CB    1 
ATOM   2841  C  CG1   . ILE A 1  775 ? 164.568 128.086 74.681  1.00 51.45  ? 775  ILE A CG1   1 
ATOM   2842  C  CG2   . ILE A 1  775 ? 164.606 129.459 72.543  1.00 51.45  ? 775  ILE A CG2   1 
ATOM   2843  C  CD1   . ILE A 1  775 ? 164.166 126.797 75.310  1.00 51.45  ? 775  ILE A CD1   1 
ATOM   2844  N  N     . THR A 1  776 ? 161.741 130.831 73.475  1.00 50.07  ? 776  THR A N     1 
ATOM   2845  C  CA    . THR A 1  776 ? 161.365 132.065 74.149  1.00 50.07  ? 776  THR A CA    1 
ATOM   2846  C  C     . THR A 1  776 ? 159.902 132.087 74.571  1.00 50.07  ? 776  THR A C     1 
ATOM   2847  O  O     . THR A 1  776 ? 159.546 132.862 75.462  1.00 50.07  ? 776  THR A O     1 
ATOM   2848  C  CB    . THR A 1  776 ? 161.680 133.272 73.258  1.00 50.07  ? 776  THR A CB    1 
ATOM   2849  O  OG1   . THR A 1  776 ? 161.396 134.481 73.970  1.00 50.07  ? 776  THR A OG1   1 
ATOM   2850  C  CG2   . THR A 1  776 ? 160.875 133.236 71.968  1.00 50.07  ? 776  THR A CG2   1 
ATOM   2851  N  N     . HIS A 1  777 ? 159.050 131.256 73.967  1.00 47.10  ? 777  HIS A N     1 
ATOM   2852  C  CA    . HIS A 1  777 ? 157.672 131.161 74.435  1.00 47.10  ? 777  HIS A CA    1 
ATOM   2853  C  C     . HIS A 1  777 ? 157.577 130.337 75.710  1.00 47.10  ? 777  HIS A C     1 
ATOM   2854  O  O     . HIS A 1  777 ? 156.757 130.634 76.585  1.00 47.10  ? 777  HIS A O     1 
ATOM   2855  C  CB    . HIS A 1  777 ? 156.778 130.554 73.356  1.00 47.10  ? 777  HIS A CB    1 
ATOM   2856  C  CG    . HIS A 1  777 ? 156.580 131.435 72.165  1.00 47.10  ? 777  HIS A CG    1 
ATOM   2857  N  ND1   . HIS A 1  777 ? 157.399 131.389 71.058  1.00 47.10  ? 777  HIS A ND1   1 
ATOM   2858  C  CD2   . HIS A 1  777 ? 155.655 132.388 71.908  1.00 47.10  ? 777  HIS A CD2   1 
ATOM   2859  C  CE1   . HIS A 1  777 ? 156.985 132.274 70.170  1.00 47.10  ? 777  HIS A CE1   1 
ATOM   2860  N  NE2   . HIS A 1  777 ? 155.928 132.894 70.661  1.00 47.10  ? 777  HIS A NE2   1 
ATOM   2861  N  N     . VAL A 1  778 ? 158.399 129.297 75.826  1.00 46.13  ? 778  VAL A N     1 
ATOM   2862  C  CA    . VAL A 1  778 ? 158.365 128.454 77.014  1.00 46.13  ? 778  VAL A CA    1 
ATOM   2863  C  C     . VAL A 1  778 ? 159.030 129.157 78.188  1.00 46.13  ? 778  VAL A C     1 
ATOM   2864  O  O     . VAL A 1  778 ? 158.551 129.071 79.324  1.00 46.13  ? 778  VAL A O     1 
ATOM   2865  C  CB    . VAL A 1  778 ? 159.011 127.093 76.700  1.00 46.13  ? 778  VAL A CB    1 
ATOM   2866  C  CG1   . VAL A 1  778 ? 159.100 126.219 77.936  1.00 46.13  ? 778  VAL A CG1   1 
ATOM   2867  C  CG2   . VAL A 1  778 ? 158.208 126.387 75.633  1.00 46.13  ? 778  VAL A CG2   1 
ATOM   2868  N  N     . MET A 1  779 ? 160.118 129.891 77.929  1.00 51.11  ? 779  MET A N     1 
ATOM   2869  C  CA    . MET A 1  779 ? 160.760 130.673 78.982  1.00 51.11  ? 779  MET A CA    1 
ATOM   2870  C  C     . MET A 1  779 ? 159.855 131.789 79.484  1.00 51.11  ? 779  MET A C     1 
ATOM   2871  O  O     . MET A 1  779 ? 159.845 132.086 80.681  1.00 51.11  ? 779  MET A O     1 
ATOM   2872  C  CB    . MET A 1  779 ? 162.084 131.254 78.488  1.00 51.11  ? 779  MET A CB    1 
ATOM   2873  C  CG    . MET A 1  779 ? 163.195 130.240 78.337  1.00 51.11  ? 779  MET A CG    1 
ATOM   2874  S  SD    . MET A 1  779 ? 163.604 129.456 79.907  1.00 51.11  ? 779  MET A SD    1 
ATOM   2875  C  CE    . MET A 1  779 ? 164.316 130.836 80.796  1.00 51.11  ? 779  MET A CE    1 
ATOM   2876  N  N     . LYS A 1  780 ? 159.079 132.406 78.590  1.00 45.94  ? 780  LYS A N     1 
ATOM   2877  C  CA    . LYS A 1  780 ? 158.139 133.443 79.007  1.00 45.94  ? 780  LYS A CA    1 
ATOM   2878  C  C     . LYS A 1  780 ? 156.991 132.851 79.815  1.00 45.94  ? 780  LYS A C     1 
ATOM   2879  O  O     . LYS A 1  780 ? 156.502 133.478 80.762  1.00 45.94  ? 780  LYS A O     1 
ATOM   2880  C  CB    . LYS A 1  780 ? 157.614 134.185 77.779  1.00 45.94  ? 780  LYS A CB    1 
ATOM   2881  C  CG    . LYS A 1  780 ? 156.728 135.378 78.071  1.00 45.94  ? 780  LYS A CG    1 
ATOM   2882  C  CD    . LYS A 1  780 ? 156.350 136.084 76.780  1.00 45.94  ? 780  LYS A CD    1 
ATOM   2883  C  CE    . LYS A 1  780 ? 155.447 137.277 77.038  1.00 45.94  ? 780  LYS A CE    1 
ATOM   2884  N  NZ    . LYS A 1  780 ? 155.077 137.971 75.775  1.00 45.94  ? 780  LYS A NZ    1 
ATOM   2885  N  N     . ALA A 1  781 ? 156.564 131.635 79.468  1.00 40.17  ? 781  ALA A N     1 
ATOM   2886  C  CA    . ALA A 1  781 ? 155.518 130.954 80.222  1.00 40.17  ? 781  ALA A CA    1 
ATOM   2887  C  C     . ALA A 1  781 ? 156.014 130.483 81.579  1.00 40.17  ? 781  ALA A C     1 
ATOM   2888  O  O     . ALA A 1  781 ? 155.221 130.325 82.512  1.00 40.17  ? 781  ALA A O     1 
ATOM   2889  C  CB    . ALA A 1  781 ? 154.993 129.765 79.423  1.00 40.17  ? 781  ALA A CB    1 
ATOM   2890  N  N     . LEU A 1  782 ? 157.315 130.255 81.702  1.00 42.94  ? 782  LEU A N     1 
ATOM   2891  C  CA    . LEU A 1  782 ? 157.906 129.704 82.911  1.00 42.94  ? 782  LEU A CA    1 
ATOM   2892  C  C     . LEU A 1  782 ? 158.422 130.783 83.846  1.00 42.94  ? 782  LEU A C     1 
ATOM   2893  O  O     . LEU A 1  782 ? 158.492 130.562 85.060  1.00 42.94  ? 782  LEU A O     1 
ATOM   2894  C  CB    . LEU A 1  782 ? 159.042 128.758 82.522  1.00 42.94  ? 782  LEU A CB    1 
ATOM   2895  C  CG    . LEU A 1  782 ? 159.854 127.954 83.522  1.00 42.94  ? 782  LEU A CG    1 
ATOM   2896  C  CD1   . LEU A 1  782 ? 158.967 126.990 84.271  1.00 42.94  ? 782  LEU A CD1   1 
ATOM   2897  C  CD2   . LEU A 1  782 ? 160.912 127.218 82.739  1.00 42.94  ? 782  LEU A CD2   1 
ATOM   2898  N  N     . ASN A 1  783 ? 158.770 131.950 83.306  1.00 51.47  ? 783  ASN A N     1 
ATOM   2899  C  CA    . ASN A 1  783 ? 159.324 133.018 84.124  1.00 51.47  ? 783  ASN A CA    1 
ATOM   2900  C  C     . ASN A 1  783 ? 158.242 133.721 84.928  1.00 51.47  ? 783  ASN A C     1 
ATOM   2901  O  O     . ASN A 1  783 ? 158.505 134.190 86.040  1.00 51.47  ? 783  ASN A O     1 
ATOM   2902  C  CB    . ASN A 1  783 ? 160.056 134.023 83.233  1.00 51.47  ? 783  ASN A CB    1 
ATOM   2903  C  CG    . ASN A 1  783 ? 161.068 134.846 83.983  1.00 51.47  ? 783  ASN A CG    1 
ATOM   2904  O  OD1   . ASN A 1  783 ? 161.262 134.669 85.184  1.00 51.47  ? 783  ASN A OD1   1 
ATOM   2905  N  ND2   . ASN A 1  783 ? 161.729 135.755 83.276  1.00 51.47  ? 783  ASN A ND2   1 
ATOM   2906  N  N     . GLU A 1  784 ? 157.021 133.781 84.398  1.00 50.90  ? 784  GLU A N     1 
ATOM   2907  C  CA    . GLU A 1  784 ? 155.952 134.525 85.048  1.00 50.90  ? 784  GLU A CA    1 
ATOM   2908  C  C     . GLU A 1  784 ? 155.361 133.792 86.242  1.00 50.90  ? 784  GLU A C     1 
ATOM   2909  O  O     . GLU A 1  784 ? 154.690 134.423 87.064  1.00 50.90  ? 784  GLU A O     1 
ATOM   2910  C  CB    . GLU A 1  784 ? 154.848 134.846 84.041  1.00 50.90  ? 784  GLU A CB    1 
ATOM   2911  C  CG    . GLU A 1  784 ? 154.102 133.632 83.539  1.00 50.90  ? 784  GLU A CG    1 
ATOM   2912  C  CD    . GLU A 1  784 ? 153.086 133.978 82.478  1.00 50.90  ? 784  GLU A CD    1 
ATOM   2913  O  OE1   . GLU A 1  784 ? 153.018 135.158 82.079  1.00 50.90  ? 784  GLU A OE1   1 
ATOM   2914  O  OE2   . GLU A 1  784 ? 152.344 133.071 82.051  1.00 50.90  ? 784  GLU A OE2   1 
ATOM   2915  N  N     . THR A 1  785 ? 155.580 132.486 86.356  1.00 57.79  ? 785  THR A N     1 
ATOM   2916  C  CA    . THR A 1  785 ? 155.155 131.753 87.538  1.00 57.79  ? 785  THR A CA    1 
ATOM   2917  C  C     . THR A 1  785 ? 156.256 131.646 88.580  1.00 57.79  ? 785  THR A C     1 
ATOM   2918  O  O     . THR A 1  785 ? 155.975 131.259 89.719  1.00 57.79  ? 785  THR A O     1 
ATOM   2919  C  CB    . THR A 1  785 ? 154.676 130.349 87.159  1.00 57.79  ? 785  THR A CB    1 
ATOM   2920  O  OG1   . THR A 1  785 ? 155.765 129.604 86.600  1.00 57.79  ? 785  THR A OG1   1 
ATOM   2921  C  CG2   . THR A 1  785 ? 153.557 130.431 86.139  1.00 57.79  ? 785  THR A CG2   1 
ATOM   2922  N  N     . LEU A 1  786 ? 157.493 131.987 88.221  1.00 63.15  ? 786  LEU A N     1 
ATOM   2923  C  CA    . LEU A 1  786 ? 158.616 131.938 89.145  1.00 63.15  ? 786  LEU A CA    1 
ATOM   2924  C  C     . LEU A 1  786 ? 159.049 133.311 89.634  1.00 63.15  ? 786  LEU A C     1 
ATOM   2925  O  O     . LEU A 1  786 ? 159.704 133.398 90.679  1.00 63.15  ? 786  LEU A O     1 
ATOM   2926  C  CB    . LEU A 1  786 ? 159.821 131.238 88.499  1.00 63.15  ? 786  LEU A CB    1 
ATOM   2927  C  CG    . LEU A 1  786 ? 159.972 129.714 88.626  1.00 63.15  ? 786  LEU A CG    1 
ATOM   2928  C  CD1   . LEU A 1  786 ? 160.128 129.319 90.086  1.00 63.15  ? 786  LEU A CD1   1 
ATOM   2929  C  CD2   . LEU A 1  786 ? 158.833 128.936 87.978  1.00 63.15  ? 786  LEU A CD2   1 
ATOM   2930  N  N     . ASN A 1  787 ? 158.713 134.374 88.911  1.00 62.04  ? 787  ASN A N     1 
ATOM   2931  C  CA    . ASN A 1  787 ? 159.009 135.714 89.390  1.00 62.04  ? 787  ASN A CA    1 
ATOM   2932  C  C     . ASN A 1  787 ? 158.080 136.093 90.534  1.00 62.04  ? 787  ASN A C     1 
ATOM   2933  O  O     . ASN A 1  787 ? 156.954 135.602 90.644  1.00 62.04  ? 787  ASN A O     1 
ATOM   2934  C  CB    . ASN A 1  787 ? 158.863 136.746 88.271  1.00 62.04  ? 787  ASN A CB    1 
ATOM   2935  C  CG    . ASN A 1  787 ? 159.975 136.670 87.254  1.00 62.04  ? 787  ASN A CG    1 
ATOM   2936  O  OD1   . ASN A 1  787 ? 161.135 136.451 87.597  1.00 62.04  ? 787  ASN A OD1   1 
ATOM   2937  N  ND2   . ASN A 1  787 ? 159.630 136.879 85.991  1.00 62.04  ? 787  ASN A ND2   1 
ATOM   2938  N  N     . SER A 1  788 ? 158.570 136.975 91.392  1.00 46.55  ? 788  SER A N     1 
ATOM   2939  C  CA    . SER A 1  788 ? 157.737 137.673 92.354  1.00 46.55  ? 788  SER A CA    1 
ATOM   2940  C  C     . SER A 1  788 ? 157.386 139.048 91.801  1.00 46.55  ? 788  SER A C     1 
ATOM   2941  O  O     . SER A 1  788 ? 158.076 139.590 90.934  1.00 46.55  ? 788  SER A O     1 
ATOM   2942  C  CB    . SER A 1  788 ? 158.446 137.803 93.702  1.00 46.55  ? 788  SER A CB    1 
ATOM   2943  O  OG    . SER A 1  788 ? 157.635 138.487 94.636  1.00 46.55  ? 788  SER A OG    1 
ATOM   2944  N  N     . HIS A 1  789 ? 156.291 139.605 92.305  1.00 28.04  ? 789  HIS A N     1 
ATOM   2945  C  CA    . HIS A 1  789 ? 155.806 140.893 91.838  1.00 28.04  ? 789  HIS A CA    1 
ATOM   2946  C  C     . HIS A 1  789 ? 155.916 141.972 92.907  1.00 28.04  ? 789  HIS A C     1 
ATOM   2947  O  O     . HIS A 1  789 ? 155.577 143.127 92.643  1.00 28.04  ? 789  HIS A O     1 
ATOM   2948  C  CB    . HIS A 1  789 ? 154.359 140.746 91.348  1.00 28.04  ? 789  HIS A CB    1 
ATOM   2949  C  CG    . HIS A 1  789 ? 153.872 141.887 90.509  1.00 28.04  ? 789  HIS A CG    1 
ATOM   2950  N  ND1   . HIS A 1  789 ? 153.251 142.993 91.046  1.00 28.04  ? 789  HIS A ND1   1 
ATOM   2951  C  CD2   . HIS A 1  789 ? 153.929 142.100 89.174  1.00 28.04  ? 789  HIS A CD2   1 
ATOM   2952  C  CE1   . HIS A 1  789 ? 152.936 143.833 90.077  1.00 28.04  ? 789  HIS A CE1   1 
ATOM   2953  N  NE2   . HIS A 1  789 ? 153.340 143.316 88.931  1.00 28.04  ? 789  HIS A NE2   1 
ATOM   2954  N  N     . VAL A 1  790 ? 156.436 141.641 94.093  1.00 30.20  ? 790  VAL A N     1 
ATOM   2955  C  CA    . VAL A 1  790 ? 156.585 142.643 95.140  1.00 30.20  ? 790  VAL A CA    1 
ATOM   2956  C  C     . VAL A 1  790 ? 157.678 143.650 94.812  1.00 30.20  ? 790  VAL A C     1 
ATOM   2957  O  O     . VAL A 1  790 ? 157.699 144.740 95.390  1.00 30.20  ? 790  VAL A O     1 
ATOM   2958  C  CB    . VAL A 1  790 ? 156.854 141.979 96.503  1.00 30.20  ? 790  VAL A CB    1 
ATOM   2959  C  CG1   . VAL A 1  790 ? 155.710 141.058 96.877  1.00 30.20  ? 790  VAL A CG1   1 
ATOM   2960  C  CG2   . VAL A 1  790 ? 158.164 141.221 96.485  1.00 30.20  ? 790  VAL A CG2   1 
ATOM   2961  N  N     . ILE A 1  791 ? 158.585 143.324 93.890  1.00 29.74  ? 791  ILE A N     1 
ATOM   2962  C  CA    . ILE A 1  791 ? 159.522 144.321 93.385  1.00 29.74  ? 791  ILE A CA    1 
ATOM   2963  C  C     . ILE A 1  791 ? 158.803 145.308 92.482  1.00 29.74  ? 791  ILE A C     1 
ATOM   2964  O  O     . ILE A 1  791 ? 158.895 146.526 92.665  1.00 29.74  ? 791  ILE A O     1 
ATOM   2965  C  CB    . ILE A 1  791 ? 160.680 143.636 92.642  1.00 29.74  ? 791  ILE A CB    1 
ATOM   2966  C  CG1   . ILE A 1  791 ? 161.480 142.778 93.607  1.00 29.74  ? 791  ILE A CG1   1 
ATOM   2967  C  CG2   . ILE A 1  791 ? 161.565 144.676 91.967  1.00 29.74  ? 791  ILE A CG2   1 
ATOM   2968  C  CD1   . ILE A 1  791 ? 162.169 143.585 94.641  1.00 29.74  ? 791  ILE A CD1   1 
ATOM   2969  N  N     . THR A 1  792 ? 158.073 144.790 91.495  1.00 26.43  ? 792  THR A N     1 
ATOM   2970  C  CA    . THR A 1  792 ? 157.419 145.622 90.494  1.00 26.43  ? 792  THR A CA    1 
ATOM   2971  C  C     . THR A 1  792 ? 156.271 146.421 91.101  1.00 26.43  ? 792  THR A C     1 
ATOM   2972  O  O     . THR A 1  792 ? 155.976 147.533 90.647  1.00 26.43  ? 792  THR A O     1 
ATOM   2973  C  CB    . THR A 1  792 ? 156.933 144.721 89.358  1.00 26.43  ? 792  THR A CB    1 
ATOM   2974  O  OG1   . THR A 1  792 ? 158.018 143.899 88.918  1.00 26.43  ? 792  THR A OG1   1 
ATOM   2975  C  CG2   . THR A 1  792 ? 156.473 145.519 88.177  1.00 26.43  ? 792  THR A CG2   1 
ATOM   2976  N  N     . PHE A 1  793 ? 155.643 145.888 92.151  1.00 22.99  ? 793  PHE A N     1 
ATOM   2977  C  CA    . PHE A 1  793 ? 154.565 146.596 92.829  1.00 22.99  ? 793  PHE A CA    1 
ATOM   2978  C  C     . PHE A 1  793 ? 155.088 147.819 93.571  1.00 22.99  ? 793  PHE A C     1 
ATOM   2979  O  O     . PHE A 1  793 ? 154.483 148.894 93.504  1.00 22.99  ? 793  PHE A O     1 
ATOM   2980  C  CB    . PHE A 1  793 ? 153.865 145.643 93.798  1.00 22.99  ? 793  PHE A CB    1 
ATOM   2981  C  CG    . PHE A 1  793 ? 152.647 146.212 94.470  1.00 22.99  ? 793  PHE A CG    1 
ATOM   2982  C  CD1   . PHE A 1  793 ? 151.421 146.208 93.836  1.00 22.99  ? 793  PHE A CD1   1 
ATOM   2983  C  CD2   . PHE A 1  793 ? 152.729 146.731 95.746  1.00 22.99  ? 793  PHE A CD2   1 
ATOM   2984  C  CE1   . PHE A 1  793 ? 150.301 146.704 94.471  1.00 22.99  ? 793  PHE A CE1   1 
ATOM   2985  C  CE2   . PHE A 1  793 ? 151.616 147.241 96.378  1.00 22.99  ? 793  PHE A CE2   1 
ATOM   2986  C  CZ    . PHE A 1  793 ? 150.404 147.232 95.737  1.00 22.99  ? 793  PHE A CZ    1 
ATOM   2987  N  N     . MET A 1  794 ? 156.212 147.682 94.276  1.00 25.59  ? 794  MET A N     1 
ATOM   2988  C  CA    . MET A 1  794 ? 156.677 148.757 95.143  1.00 25.59  ? 794  MET A CA    1 
ATOM   2989  C  C     . MET A 1  794 ? 157.473 149.830 94.419  1.00 25.59  ? 794  MET A C     1 
ATOM   2990  O  O     . MET A 1  794 ? 157.673 150.906 94.989  1.00 25.59  ? 794  MET A O     1 
ATOM   2991  C  CB    . MET A 1  794 ? 157.534 148.215 96.282  1.00 25.59  ? 794  MET A CB    1 
ATOM   2992  C  CG    . MET A 1  794 ? 156.799 147.352 97.271  1.00 25.59  ? 794  MET A CG    1 
ATOM   2993  S  SD    . MET A 1  794 ? 157.840 147.098 98.711  1.00 25.59  ? 794  MET A SD    1 
ATOM   2994  C  CE    . MET A 1  794 ? 159.165 146.173 97.959  1.00 25.59  ? 794  MET A CE    1 
ATOM   2995  N  N     . THR A 1  795 ? 157.947 149.578 93.204  1.00 27.35  ? 795  THR A N     1 
ATOM   2996  C  CA    . THR A 1  795 ? 158.597 150.654 92.469  1.00 27.35  ? 795  THR A CA    1 
ATOM   2997  C  C     . THR A 1  795 ? 157.601 151.611 91.842  1.00 27.35  ? 795  THR A C     1 
ATOM   2998  O  O     . THR A 1  795 ? 157.996 152.698 91.409  1.00 27.35  ? 795  THR A O     1 
ATOM   2999  C  CB    . THR A 1  795 ? 159.507 150.102 91.374  1.00 27.35  ? 795  THR A CB    1 
ATOM   3000  O  OG1   . THR A 1  795 ? 158.735 149.326 90.453  1.00 27.35  ? 795  THR A OG1   1 
ATOM   3001  C  CG2   . THR A 1  795 ? 160.595 149.245 91.977  1.00 27.35  ? 795  THR A CG2   1 
ATOM   3002  N  N     . ARG A 1  796 ? 156.327 151.242 91.791  1.00 22.56  ? 796  ARG A N     1 
ATOM   3003  C  CA    . ARG A 1  796 ? 155.314 152.042 91.126  1.00 22.56  ? 796  ARG A CA    1 
ATOM   3004  C  C     . ARG A 1  796 ? 154.230 152.485 92.098  1.00 22.56  ? 796  ARG A C     1 
ATOM   3005  O  O     . ARG A 1  796 ? 153.084 152.698 91.705  1.00 22.56  ? 796  ARG A O     1 
ATOM   3006  C  CB    . ARG A 1  796 ? 154.707 151.268 89.963  1.00 22.56  ? 796  ARG A CB    1 
ATOM   3007  C  CG    . ARG A 1  796 ? 155.717 150.850 88.921  1.00 22.56  ? 796  ARG A CG    1 
ATOM   3008  C  CD    . ARG A 1  796 ? 155.005 150.554 87.638  1.00 22.56  ? 796  ARG A CD    1 
ATOM   3009  N  NE    . ARG A 1  796 ? 154.147 149.380 87.664  1.00 22.56  ? 796  ARG A NE    1 
ATOM   3010  C  CZ    . ARG A 1  796 ? 154.448 148.236 87.065  1.00 22.56  ? 796  ARG A CZ    1 
ATOM   3011  N  NH1   . ARG A 1  796 ? 153.613 147.210 87.137  1.00 22.56  ? 796  ARG A NH1   1 
ATOM   3012  N  NH2   . ARG A 1  796 ? 155.558 148.144 86.345  1.00 22.56  ? 796  ARG A NH2   1 
ATOM   3013  N  N     . LEU A 1  797 ? 154.576 152.614 93.372  1.00 18.10  ? 797  LEU A N     1 
ATOM   3014  C  CA    . LEU A 1  797 ? 153.662 153.152 94.364  1.00 18.10  ? 797  LEU A CA    1 
ATOM   3015  C  C     . LEU A 1  797 ? 153.770 154.672 94.364  1.00 18.10  ? 797  LEU A C     1 
ATOM   3016  O  O     . LEU A 1  797 ? 154.493 155.262 93.559  1.00 18.10  ? 797  LEU A O     1 
ATOM   3017  C  CB    . LEU A 1  797 ? 153.962 152.569 95.739  1.00 18.10  ? 797  LEU A CB    1 
ATOM   3018  C  CG    . LEU A 1  797 ? 153.694 151.083 95.932  1.00 18.10  ? 797  LEU A CG    1 
ATOM   3019  C  CD1   . LEU A 1  797 ? 154.153 150.646 97.304  1.00 18.10  ? 797  LEU A CD1   1 
ATOM   3020  C  CD2   . LEU A 1  797 ? 152.227 150.800 95.750  1.00 18.10  ? 797  LEU A CD2   1 
ATOM   3021  N  N     . SER A 1  798 ? 153.070 155.323 95.288  1.00 16.80  ? 798  SER A N     1 
ATOM   3022  C  CA    . SER A 1  798 ? 153.141 156.767 95.420  1.00 16.80  ? 798  SER A CA    1 
ATOM   3023  C  C     . SER A 1  798 ? 154.498 157.181 95.974  1.00 16.80  ? 798  SER A C     1 
ATOM   3024  O  O     . SER A 1  798 ? 155.298 156.352 96.413  1.00 16.80  ? 798  SER A O     1 
ATOM   3025  C  CB    . SER A 1  798 ? 152.039 157.270 96.347  1.00 16.80  ? 798  SER A CB    1 
ATOM   3026  O  OG    . SER A 1  798 ? 150.766 156.923 95.850  1.00 16.80  ? 798  SER A OG    1 
ATOM   3027  N  N     . PHE A 1  799 ? 154.761 158.488 95.960  1.00 19.41  ? 799  PHE A N     1 
ATOM   3028  C  CA    . PHE A 1  799 ? 155.871 158.977 96.764  1.00 19.41  ? 799  PHE A CA    1 
ATOM   3029  C  C     . PHE A 1  799 ? 155.592 158.784 98.243  1.00 19.41  ? 799  PHE A C     1 
ATOM   3030  O  O     . PHE A 1  799 ? 156.510 158.493 99.009  1.00 19.41  ? 799  PHE A O     1 
ATOM   3031  C  CB    . PHE A 1  799 ? 156.159 160.449 96.484  1.00 19.41  ? 799  PHE A CB    1 
ATOM   3032  C  CG    . PHE A 1  799 ? 157.266 161.010 97.332  1.00 19.41  ? 799  PHE A CG    1 
ATOM   3033  C  CD1   . PHE A 1  799 ? 158.584 160.679 97.074  1.00 19.41  ? 799  PHE A CD1   1 
ATOM   3034  C  CD2   . PHE A 1  799 ? 156.987 161.849 98.400  1.00 19.41  ? 799  PHE A CD2   1 
ATOM   3035  C  CE1   . PHE A 1  799 ? 159.601 161.179 97.858  1.00 19.41  ? 799  PHE A CE1   1 
ATOM   3036  C  CE2   . PHE A 1  799 ? 157.998 162.350 99.184  1.00 19.41  ? 799  PHE A CE2   1 
ATOM   3037  C  CZ    . PHE A 1  799 ? 159.306 162.018 98.912  1.00 19.41  ? 799  PHE A CZ    1 
ATOM   3038  N  N     . THR A 1  800 ? 154.330 158.927 98.644  1.00 15.54  ? 800  THR A N     1 
ATOM   3039  C  CA    . THR A 1  800 ? 153.931 158.745 100.034 1.00 15.54  ? 800  THR A CA    1 
ATOM   3040  C  C     . THR A 1  800 ? 154.092 157.296 100.481 1.00 15.54  ? 800  THR A C     1 
ATOM   3041  O  O     . THR A 1  800 ? 154.589 157.034 101.583 1.00 15.54  ? 800  THR A O     1 
ATOM   3042  C  CB    . THR A 1  800 ? 152.489 159.222 100.191 1.00 15.54  ? 800  THR A CB    1 
ATOM   3043  O  OG1   . THR A 1  800 ? 152.434 160.632 99.955  1.00 15.54  ? 800  THR A OG1   1 
ATOM   3044  C  CG2   . THR A 1  800 ? 151.947 158.928 101.558 1.00 15.54  ? 800  THR A CG2   1 
ATOM   3045  N  N     . ALA A 1  801 ? 153.701 156.342 99.634  1.00 14.88  ? 801  ALA A N     1 
ATOM   3046  C  CA    . ALA A 1  801 ? 153.835 154.933 99.987  1.00 14.88  ? 801  ALA A CA    1 
ATOM   3047  C  C     . ALA A 1  801 ? 155.292 154.495 99.982  1.00 14.88  ? 801  ALA A C     1 
ATOM   3048  O  O     . ALA A 1  801 ? 155.696 153.658 100.795 1.00 14.88  ? 801  ALA A O     1 
ATOM   3049  C  CB    . ALA A 1  801 ? 153.016 154.074 99.030  1.00 14.88  ? 801  ALA A CB    1 
ATOM   3050  N  N     . LYS A 1  802 ? 156.097 155.045 99.073  1.00 18.82  ? 802  LYS A N     1 
ATOM   3051  C  CA    . LYS A 1  802 ? 157.521 154.733 99.072  1.00 18.82  ? 802  LYS A CA    1 
ATOM   3052  C  C     . LYS A 1  802 ? 158.256 155.453 100.195 1.00 18.82  ? 802  LYS A C     1 
ATOM   3053  O  O     . LYS A 1  802 ? 159.283 154.959 100.669 1.00 18.82  ? 802  LYS A O     1 
ATOM   3054  C  CB    . LYS A 1  802 ? 158.131 155.073 97.714  1.00 18.82  ? 802  LYS A CB    1 
ATOM   3055  C  CG    . LYS A 1  802 ? 157.733 154.119 96.609  1.00 18.82  ? 802  LYS A CG    1 
ATOM   3056  C  CD    . LYS A 1  802 ? 158.493 154.383 95.322  1.00 18.82  ? 802  LYS A CD    1 
ATOM   3057  C  CE    . LYS A 1  802 ? 157.939 155.590 94.592  1.00 18.82  ? 802  LYS A CE    1 
ATOM   3058  N  NZ    . LYS A 1  802 ? 158.559 155.771 93.254  1.00 18.82  ? 802  LYS A NZ    1 
ATOM   3059  N  N     . LEU A 1  803 ? 157.753 156.607 100.642 1.00 17.38  ? 803  LEU A N     1 
ATOM   3060  C  CA    . LEU A 1  803 ? 158.329 157.264 101.810 1.00 17.38  ? 803  LEU A CA    1 
ATOM   3061  C  C     . LEU A 1  803 ? 158.008 156.515 103.093 1.00 17.38  ? 803  LEU A C     1 
ATOM   3062  O  O     . LEU A 1  803 ? 158.764 156.615 104.064 1.00 17.38  ? 803  LEU A O     1 
ATOM   3063  C  CB    . LEU A 1  803 ? 157.829 158.706 101.911 1.00 17.38  ? 803  LEU A CB    1 
ATOM   3064  C  CG    . LEU A 1  803 ? 158.430 159.665 102.930 1.00 17.38  ? 803  LEU A CG    1 
ATOM   3065  C  CD1   . LEU A 1  803 ? 159.892 159.829 102.626 1.00 17.38  ? 803  LEU A CD1   1 
ATOM   3066  C  CD2   . LEU A 1  803 ? 157.721 160.995 102.863 1.00 17.38  ? 803  LEU A CD2   1 
ATOM   3067  N  N     . PHE A 1  804 ? 156.912 155.756 103.113 1.00 15.92  ? 804  PHE A N     1 
ATOM   3068  C  CA    . PHE A 1  804 ? 156.600 154.952 104.285 1.00 15.92  ? 804  PHE A CA    1 
ATOM   3069  C  C     . PHE A 1  804 ? 157.563 153.781 104.412 1.00 15.92  ? 804  PHE A C     1 
ATOM   3070  O  O     . PHE A 1  804 ? 157.999 153.449 105.518 1.00 15.92  ? 804  PHE A O     1 
ATOM   3071  C  CB    . PHE A 1  804 ? 155.163 154.444 104.208 1.00 15.92  ? 804  PHE A CB    1 
ATOM   3072  C  CG    . PHE A 1  804 ? 154.671 153.828 105.483 1.00 15.92  ? 804  PHE A CG    1 
ATOM   3073  C  CD1   . PHE A 1  804 ? 154.156 154.625 106.484 1.00 15.92  ? 804  PHE A CD1   1 
ATOM   3074  C  CD2   . PHE A 1  804 ? 154.756 152.464 105.697 1.00 15.92  ? 804  PHE A CD2   1 
ATOM   3075  C  CE1   . PHE A 1  804 ? 153.709 154.071 107.661 1.00 15.92  ? 804  PHE A CE1   1 
ATOM   3076  C  CE2   . PHE A 1  804 ? 154.327 151.912 106.875 1.00 15.92  ? 804  PHE A CE2   1 
ATOM   3077  C  CZ    . PHE A 1  804 ? 153.799 152.712 107.855 1.00 15.92  ? 804  PHE A CZ    1 
ATOM   3078  N  N     . ILE A 1  805 ? 157.886 153.133 103.293 1.00 18.53  ? 805  ILE A N     1 
ATOM   3079  C  CA    . ILE A 1  805 ? 158.812 152.007 103.323 1.00 18.53  ? 805  ILE A CA    1 
ATOM   3080  C  C     . ILE A 1  805 ? 160.228 152.492 103.591 1.00 18.53  ? 805  ILE A C     1 
ATOM   3081  O  O     . ILE A 1  805 ? 160.972 151.873 104.361 1.00 18.53  ? 805  ILE A O     1 
ATOM   3082  C  CB    . ILE A 1  805 ? 158.712 151.210 102.010 1.00 18.53  ? 805  ILE A CB    1 
ATOM   3083  C  CG1   . ILE A 1  805 ? 157.301 150.651 101.832 1.00 18.53  ? 805  ILE A CG1   1 
ATOM   3084  C  CG2   . ILE A 1  805 ? 159.720 150.077 101.965 1.00 18.53  ? 805  ILE A CG2   1 
ATOM   3085  C  CD1   . ILE A 1  805 ? 156.896 149.693 102.919 1.00 18.53  ? 805  ILE A CD1   1 
ATOM   3086  N  N     . TYR A 1  806 ? 160.608 153.629 102.999 1.00 23.50  ? 806  TYR A N     1 
ATOM   3087  C  CA    . TYR A 1  806 ? 161.959 154.153 103.173 1.00 23.50  ? 806  TYR A CA    1 
ATOM   3088  C  C     . TYR A 1  806 ? 162.202 154.631 104.597 1.00 23.50  ? 806  TYR A C     1 
ATOM   3089  O  O     . TYR A 1  806 ? 163.339 154.584 105.076 1.00 23.50  ? 806  TYR A O     1 
ATOM   3090  C  CB    . TYR A 1  806 ? 162.211 155.292 102.189 1.00 23.50  ? 806  TYR A CB    1 
ATOM   3091  C  CG    . TYR A 1  806 ? 163.629 155.809 102.197 1.00 23.50  ? 806  TYR A CG    1 
ATOM   3092  C  CD1   . TYR A 1  806 ? 164.643 155.113 101.556 1.00 23.50  ? 806  TYR A CD1   1 
ATOM   3093  C  CD2   . TYR A 1  806 ? 163.955 156.987 102.851 1.00 23.50  ? 806  TYR A CD2   1 
ATOM   3094  C  CE1   . TYR A 1  806 ? 165.941 155.581 101.560 1.00 23.50  ? 806  TYR A CE1   1 
ATOM   3095  C  CE2   . TYR A 1  806 ? 165.249 157.461 102.865 1.00 23.50  ? 806  TYR A CE2   1 
ATOM   3096  C  CZ    . TYR A 1  806 ? 166.237 156.754 102.217 1.00 23.50  ? 806  TYR A CZ    1 
ATOM   3097  O  OH    . TYR A 1  806 ? 167.529 157.223 102.226 1.00 23.50  ? 806  TYR A OH    1 
ATOM   3098  N  N     . ALA A 1  807 ? 161.160 155.088 105.288 1.00 19.64  ? 807  ALA A N     1 
ATOM   3099  C  CA    . ALA A 1  807 ? 161.309 155.412 106.699 1.00 19.64  ? 807  ALA A CA    1 
ATOM   3100  C  C     . ALA A 1  807 ? 161.324 154.162 107.561 1.00 19.64  ? 807  ALA A C     1 
ATOM   3101  O  O     . ALA A 1  807 ? 161.948 154.155 108.625 1.00 19.64  ? 807  ALA A O     1 
ATOM   3102  C  CB    . ALA A 1  807 ? 160.188 156.338 107.152 1.00 19.64  ? 807  ALA A CB    1 
ATOM   3103  N  N     . LEU A 1  808 ? 160.646 153.103 107.121 1.00 19.74  ? 808  LEU A N     1 
ATOM   3104  C  CA    . LEU A 1  808 ? 160.646 151.851 107.866 1.00 19.74  ? 808  LEU A CA    1 
ATOM   3105  C  C     . LEU A 1  808 ? 161.966 151.109 107.711 1.00 19.74  ? 808  LEU A C     1 
ATOM   3106  O  O     . LEU A 1  808 ? 162.384 150.395 108.627 1.00 19.74  ? 808  LEU A O     1 
ATOM   3107  C  CB    . LEU A 1  808 ? 159.476 150.986 107.400 1.00 19.74  ? 808  LEU A CB    1 
ATOM   3108  C  CG    . LEU A 1  808 ? 159.214 149.612 108.012 1.00 19.74  ? 808  LEU A CG    1 
ATOM   3109  C  CD1   . LEU A 1  808 ? 158.909 149.712 109.480 1.00 19.74  ? 808  LEU A CD1   1 
ATOM   3110  C  CD2   . LEU A 1  808 ? 158.067 148.968 107.284 1.00 19.74  ? 808  LEU A CD2   1 
ATOM   3111  N  N     . LEU A 1  809 ? 162.641 151.273 106.575 1.00 22.57  ? 809  LEU A N     1 
ATOM   3112  C  CA    . LEU A 1  809 ? 163.925 150.612 106.377 1.00 22.57  ? 809  LEU A CA    1 
ATOM   3113  C  C     . LEU A 1  809 ? 165.055 151.327 107.107 1.00 22.57  ? 809  LEU A C     1 
ATOM   3114  O  O     . LEU A 1  809 ? 166.044 150.687 107.477 1.00 22.57  ? 809  LEU A O     1 
ATOM   3115  C  CB    . LEU A 1  809 ? 164.241 150.509 104.886 1.00 22.57  ? 809  LEU A CB    1 
ATOM   3116  C  CG    . LEU A 1  809 ? 163.344 149.601 104.045 1.00 22.57  ? 809  LEU A CG    1 
ATOM   3117  C  CD1   . LEU A 1  809 ? 163.670 149.779 102.580 1.00 22.57  ? 809  LEU A CD1   1 
ATOM   3118  C  CD2   . LEU A 1  809 ? 163.503 148.154 104.445 1.00 22.57  ? 809  LEU A CD2   1 
ATOM   3119  N  N     . ASN A 1  810 ? 164.940 152.642 107.311 1.00 22.95  ? 810  ASN A N     1 
ATOM   3120  C  CA    . ASN A 1  810 ? 165.913 153.348 108.138 1.00 22.95  ? 810  ASN A CA    1 
ATOM   3121  C  C     . ASN A 1  810 ? 165.799 152.944 109.598 1.00 22.95  ? 810  ASN A C     1 
ATOM   3122  O  O     . ASN A 1  810 ? 166.810 152.890 110.304 1.00 22.95  ? 810  ASN A O     1 
ATOM   3123  C  CB    . ASN A 1  810 ? 165.737 154.858 108.004 1.00 22.95  ? 810  ASN A CB    1 
ATOM   3124  C  CG    . ASN A 1  810 ? 166.232 155.386 106.680 1.00 22.95  ? 810  ASN A CG    1 
ATOM   3125  O  OD1   . ASN A 1  810 ? 167.273 154.963 106.182 1.00 22.95  ? 810  ASN A OD1   1 
ATOM   3126  N  ND2   . ASN A 1  810 ? 165.495 156.325 106.106 1.00 22.95  ? 810  ASN A ND2   1 
ATOM   3127  N  N     . LEU A 1  811 ? 164.585 152.656 110.066 1.00 24.69  ? 811  LEU A N     1 
ATOM   3128  C  CA    . LEU A 1  811 ? 164.404 152.243 111.453 1.00 24.69  ? 811  LEU A CA    1 
ATOM   3129  C  C     . LEU A 1  811 ? 164.906 150.829 111.697 1.00 24.69  ? 811  LEU A C     1 
ATOM   3130  O  O     . LEU A 1  811 ? 165.313 150.507 112.816 1.00 24.69  ? 811  LEU A O     1 
ATOM   3131  C  CB    . LEU A 1  811 ? 162.936 152.347 111.853 1.00 24.69  ? 811  LEU A CB    1 
ATOM   3132  C  CG    . LEU A 1  811 ? 162.417 153.582 112.583 1.00 24.69  ? 811  LEU A CG    1 
ATOM   3133  C  CD1   . LEU A 1  811 ? 163.052 153.673 113.950 1.00 24.69  ? 811  LEU A CD1   1 
ATOM   3134  C  CD2   . LEU A 1  811 ? 162.717 154.814 111.815 1.00 24.69  ? 811  LEU A CD2   1 
ATOM   3135  N  N     . MET A 1  812 ? 164.881 149.971 110.683 1.00 28.81  ? 812  MET A N     1 
ATOM   3136  C  CA    . MET A 1  812 ? 165.366 148.609 110.834 1.00 28.81  ? 812  MET A CA    1 
ATOM   3137  C  C     . MET A 1  812 ? 166.863 148.487 110.593 1.00 28.81  ? 812  MET A C     1 
ATOM   3138  O  O     . MET A 1  812 ? 167.386 147.369 110.576 1.00 28.81  ? 812  MET A O     1 
ATOM   3139  C  CB    . MET A 1  812 ? 164.601 147.664 109.906 1.00 28.81  ? 812  MET A CB    1 
ATOM   3140  C  CG    . MET A 1  812 ? 163.163 147.438 110.325 1.00 28.81  ? 812  MET A CG    1 
ATOM   3141  S  SD    . MET A 1  812 ? 162.350 146.204 109.309 1.00 28.81  ? 812  MET A SD    1 
ATOM   3142  C  CE    . MET A 1  812 ? 162.178 147.140 107.807 1.00 28.81  ? 812  MET A CE    1 
ATOM   3143  N  N     . LYS A 1  813 ? 167.562 149.605 110.397 1.00 32.00  ? 813  LYS A N     1 
ATOM   3144  C  CA    . LYS A 1  813 ? 169.012 149.629 110.478 1.00 32.00  ? 813  LYS A CA    1 
ATOM   3145  C  C     . LYS A 1  813 ? 169.534 150.565 111.556 1.00 32.00  ? 813  LYS A C     1 
ATOM   3146  O  O     . LYS A 1  813 ? 170.747 150.597 111.785 1.00 32.00  ? 813  LYS A O     1 
ATOM   3147  C  CB    . LYS A 1  813 ? 169.636 150.002 109.124 1.00 32.00  ? 813  LYS A CB    1 
ATOM   3148  C  CG    . LYS A 1  813 ? 169.291 151.371 108.600 1.00 32.00  ? 813  LYS A CG    1 
ATOM   3149  C  CD    . LYS A 1  813 ? 170.049 151.630 107.312 1.00 32.00  ? 813  LYS A CD    1 
ATOM   3150  C  CE    . LYS A 1  813 ? 169.553 150.741 106.181 1.00 32.00  ? 813  LYS A CE    1 
ATOM   3151  N  NZ    . LYS A 1  813 ? 168.171 151.069 105.748 1.00 32.00  ? 813  LYS A NZ    1 
ATOM   3152  N  N     . LYS A 1  814 ? 168.663 151.328 112.218 1.00 33.51  ? 814  LYS A N     1 
ATOM   3153  C  CA    . LYS A 1  814 ? 169.041 151.969 113.470 1.00 33.51  ? 814  LYS A CA    1 
ATOM   3154  C  C     . LYS A 1  814 ? 168.948 150.999 114.636 1.00 33.51  ? 814  LYS A C     1 
ATOM   3155  O  O     . LYS A 1  814 ? 169.684 151.142 115.618 1.00 33.51  ? 814  LYS A O     1 
ATOM   3156  C  CB    . LYS A 1  814 ? 168.145 153.175 113.755 1.00 33.51  ? 814  LYS A CB    1 
ATOM   3157  C  CG    . LYS A 1  814 ? 168.322 154.360 112.834 1.00 33.51  ? 814  LYS A CG    1 
ATOM   3158  C  CD    . LYS A 1  814 ? 167.341 155.453 113.221 1.00 33.51  ? 814  LYS A CD    1 
ATOM   3159  C  CE    . LYS A 1  814 ? 167.425 156.648 112.291 1.00 33.51  ? 814  LYS A CE    1 
ATOM   3160  N  NZ    . LYS A 1  814 ? 166.420 157.685 112.648 1.00 33.51  ? 814  LYS A NZ    1 
ATOM   3161  N  N     . ASN A 1  815 ? 168.053 150.023 114.550 1.00 39.24  ? 815  ASN A N     1 
ATOM   3162  C  CA    . ASN A 1  815 ? 167.823 149.055 115.613 1.00 39.24  ? 815  ASN A CA    1 
ATOM   3163  C  C     . ASN A 1  815 ? 167.962 147.615 115.159 1.00 39.24  ? 815  ASN A C     1 
ATOM   3164  O  O     . ASN A 1  815 ? 168.506 146.792 115.896 1.00 39.24  ? 815  ASN A O     1 
ATOM   3165  C  CB    . ASN A 1  815 ? 166.420 149.242 116.202 1.00 39.24  ? 815  ASN A CB    1 
ATOM   3166  C  CG    . ASN A 1  815 ? 166.265 150.549 116.924 1.00 39.24  ? 815  ASN A CG    1 
ATOM   3167  O  OD1   . ASN A 1  815 ? 167.166 150.988 117.634 1.00 39.24  ? 815  ASN A OD1   1 
ATOM   3168  N  ND2   . ASN A 1  815 ? 165.113 151.184 116.753 1.00 39.24  ? 815  ASN A ND2   1 
ATOM   3169  N  N     . GLY A 1  816 ? 167.476 147.286 113.966 1.00 42.88  ? 816  GLY A N     1 
ATOM   3170  C  CA    . GLY A 1  816 ? 167.366 145.895 113.582 1.00 42.88  ? 816  GLY A CA    1 
ATOM   3171  C  C     . GLY A 1  816 ? 166.292 145.136 114.324 1.00 42.88  ? 816  GLY A C     1 
ATOM   3172  O  O     . GLY A 1  816 ? 166.327 143.904 114.358 1.00 42.88  ? 816  GLY A O     1 
ATOM   3173  N  N     . SER A 1  817 ? 165.330 145.842 114.920 1.00 45.48  ? 817  SER A N     1 
ATOM   3174  C  CA    . SER A 1  817 ? 164.303 145.218 115.740 1.00 45.48  ? 817  SER A CA    1 
ATOM   3175  C  C     . SER A 1  817 ? 163.204 144.561 114.921 1.00 45.48  ? 817  SER A C     1 
ATOM   3176  O  O     . SER A 1  817 ? 162.385 143.838 115.497 1.00 45.48  ? 817  SER A O     1 
ATOM   3177  C  CB    . SER A 1  817 ? 163.686 146.252 116.680 1.00 45.48  ? 817  SER A CB    1 
ATOM   3178  O  OG    . SER A 1  817 ? 162.993 147.244 115.948 1.00 45.48  ? 817  SER A OG    1 
ATOM   3179  N  N     . GLN A 1  818 ? 163.125 144.865 113.622 1.00 42.68  ? 818  GLN A N     1 
ATOM   3180  C  CA    . GLN A 1  818 ? 162.306 144.259 112.564 1.00 42.68  ? 818  GLN A CA    1 
ATOM   3181  C  C     . GLN A 1  818 ? 160.798 144.268 112.848 1.00 42.68  ? 818  GLN A C     1 
ATOM   3182  O  O     . GLN A 1  818 ? 160.028 143.690 112.074 1.00 42.68  ? 818  GLN A O     1 
ATOM   3183  C  CB    . GLN A 1  818 ? 162.789 142.838 112.188 1.00 42.68  ? 818  GLN A CB    1 
ATOM   3184  C  CG    . GLN A 1  818 ? 162.537 141.673 113.142 1.00 42.68  ? 818  GLN A CG    1 
ATOM   3185  C  CD    . GLN A 1  818 ? 161.248 140.937 112.848 1.00 42.68  ? 818  GLN A CD    1 
ATOM   3186  O  OE1   . GLN A 1  818 ? 160.817 140.857 111.699 1.00 42.68  ? 818  GLN A OE1   1 
ATOM   3187  N  NE2   . GLN A 1  818 ? 160.622 140.399 113.888 1.00 42.68  ? 818  GLN A NE2   1 
ATOM   3188  N  N     . GLU A 1  819 ? 160.352 144.936 113.910 1.00 36.38  ? 819  GLU A N     1 
ATOM   3189  C  CA    . GLU A 1  819 ? 158.972 145.389 114.051 1.00 36.38  ? 819  GLU A CA    1 
ATOM   3190  C  C     . GLU A 1  819 ? 159.031 146.761 114.708 1.00 36.38  ? 819  GLU A C     1 
ATOM   3191  O  O     . GLU A 1  819 ? 159.444 146.901 115.862 1.00 36.38  ? 819  GLU A O     1 
ATOM   3192  C  CB    . GLU A 1  819 ? 158.088 144.396 114.822 1.00 36.38  ? 819  GLU A CB    1 
ATOM   3193  C  CG    . GLU A 1  819 ? 158.540 143.908 116.193 1.00 36.38  ? 819  GLU A CG    1 
ATOM   3194  C  CD    . GLU A 1  819 ? 157.515 142.996 116.836 1.00 36.38  ? 819  GLU A CD    1 
ATOM   3195  O  OE1   . GLU A 1  819 ? 156.463 142.753 116.208 1.00 36.38  ? 819  GLU A OE1   1 
ATOM   3196  O  OE2   . GLU A 1  819 ? 157.756 142.527 117.969 1.00 36.38  ? 819  GLU A OE2   1 
ATOM   3197  N  N     . GLN A 1  820 ? 158.690 147.786 113.948 1.00 28.18  ? 820  GLN A N     1 
ATOM   3198  C  CA    . GLN A 1  820 ? 158.890 149.146 114.407 1.00 28.18  ? 820  GLN A CA    1 
ATOM   3199  C  C     . GLN A 1  820 ? 157.590 149.715 114.944 1.00 28.18  ? 820  GLN A C     1 
ATOM   3200  O  O     . GLN A 1  820 ? 156.504 149.395 114.459 1.00 28.18  ? 820  GLN A O     1 
ATOM   3201  C  CB    . GLN A 1  820 ? 159.420 150.028 113.282 1.00 28.18  ? 820  GLN A CB    1 
ATOM   3202  C  CG    . GLN A 1  820 ? 160.738 149.561 112.707 1.00 28.18  ? 820  GLN A CG    1 
ATOM   3203  C  CD    . GLN A 1  820 ? 161.804 149.392 113.761 1.00 28.18  ? 820  GLN A CD    1 
ATOM   3204  O  OE1   . GLN A 1  820 ? 162.332 148.299 113.949 1.00 28.18  ? 820  GLN A OE1   1 
ATOM   3205  N  NE2   . GLN A 1  820 ? 162.087 150.457 114.495 1.00 28.18  ? 820  GLN A NE2   1 
ATOM   3206  N  N     . GLU A 1  821 ? 157.716 150.540 115.977 1.00 25.38  ? 821  GLU A N     1 
ATOM   3207  C  CA    . GLU A 1  821 ? 156.583 151.288 116.494 1.00 25.38  ? 821  GLU A CA    1 
ATOM   3208  C  C     . GLU A 1  821 ? 156.095 152.267 115.438 1.00 25.38  ? 821  GLU A C     1 
ATOM   3209  O  O     . GLU A 1  821 ? 156.894 152.905 114.749 1.00 25.38  ? 821  GLU A O     1 
ATOM   3210  C  CB    . GLU A 1  821 ? 156.988 152.022 117.770 1.00 25.38  ? 821  GLU A CB    1 
ATOM   3211  C  CG    . GLU A 1  821 ? 155.897 152.845 118.399 1.00 25.38  ? 821  GLU A CG    1 
ATOM   3212  C  CD    . GLU A 1  821 ? 156.348 153.559 119.656 1.00 25.38  ? 821  GLU A CD    1 
ATOM   3213  O  OE1   . GLU A 1  821 ? 157.509 153.366 120.070 1.00 25.38  ? 821  GLU A OE1   1 
ATOM   3214  O  OE2   . GLU A 1  821 ? 155.547 154.335 120.217 1.00 25.38  ? 821  GLU A OE2   1 
ATOM   3215  N  N     . LEU A 1  822 ? 154.773 152.358 115.283 1.00 19.93  ? 822  LEU A N     1 
ATOM   3216  C  CA    . LEU A 1  822 ? 154.211 153.150 114.197 1.00 19.93  ? 822  LEU A CA    1 
ATOM   3217  C  C     . LEU A 1  822 ? 154.362 154.643 114.445 1.00 19.93  ? 822  LEU A C     1 
ATOM   3218  O  O     . LEU A 1  822 ? 154.382 155.416 113.485 1.00 19.93  ? 822  LEU A O     1 
ATOM   3219  C  CB    . LEU A 1  822 ? 152.744 152.770 113.987 1.00 19.93  ? 822  LEU A CB    1 
ATOM   3220  C  CG    . LEU A 1  822 ? 151.963 153.262 112.774 1.00 19.93  ? 822  LEU A CG    1 
ATOM   3221  C  CD1   . LEU A 1  822 ? 152.642 152.804 111.512 1.00 19.93  ? 822  LEU A CD1   1 
ATOM   3222  C  CD2   . LEU A 1  822 ? 150.564 152.700 112.833 1.00 19.93  ? 822  LEU A CD2   1 
ATOM   3223  N  N     . GLY A 1  823 ? 154.494 155.063 115.704 1.00 19.95  ? 823  GLY A N     1 
ATOM   3224  C  CA    . GLY A 1  823 ? 154.832 156.445 115.983 1.00 19.95  ? 823  GLY A CA    1 
ATOM   3225  C  C     . GLY A 1  823 ? 156.289 156.779 115.770 1.00 19.95  ? 823  GLY A C     1 
ATOM   3226  O  O     . GLY A 1  823 ? 156.627 157.957 115.627 1.00 19.95  ? 823  GLY A O     1 
ATOM   3227  N  N     . ASP A 1  824 ? 157.163 155.772 115.758 1.00 24.17  ? 824  ASP A N     1 
ATOM   3228  C  CA    . ASP A 1  824 ? 158.547 155.999 115.369 1.00 24.17  ? 824  ASP A CA    1 
ATOM   3229  C  C     . ASP A 1  824 ? 158.676 156.172 113.865 1.00 24.17  ? 824  ASP A C     1 
ATOM   3230  O  O     . ASP A 1  824 ? 159.618 156.818 113.396 1.00 24.17  ? 824  ASP A O     1 
ATOM   3231  C  CB    . ASP A 1  824 ? 159.433 154.845 115.834 1.00 24.17  ? 824  ASP A CB    1 
ATOM   3232  C  CG    . ASP A 1  824 ? 159.535 154.758 117.341 1.00 24.17  ? 824  ASP A CG    1 
ATOM   3233  O  OD1   . ASP A 1  824 ? 159.316 155.786 118.014 1.00 24.17  ? 824  ASP A OD1   1 
ATOM   3234  O  OD2   . ASP A 1  824 ? 159.862 153.667 117.851 1.00 24.17  ? 824  ASP A OD2   1 
ATOM   3235  N  N     . ILE A 1  825 ? 157.742 155.605 113.103 1.00 19.55  ? 825  ILE A N     1 
ATOM   3236  C  CA    . ILE A 1  825 ? 157.745 155.777 111.656 1.00 19.55  ? 825  ILE A CA    1 
ATOM   3237  C  C     . ILE A 1  825 ? 157.266 157.176 111.291 1.00 19.55  ? 825  ILE A C     1 
ATOM   3238  O  O     . ILE A 1  825 ? 157.799 157.807 110.373 1.00 19.55  ? 825  ILE A O     1 
ATOM   3239  C  CB    . ILE A 1  825 ? 156.883 154.683 110.999 1.00 19.55  ? 825  ILE A CB    1 
ATOM   3240  C  CG1   . ILE A 1  825 ? 157.433 153.305 111.346 1.00 19.55  ? 825  ILE A CG1   1 
ATOM   3241  C  CG2   . ILE A 1  825 ? 156.850 154.829 109.494 1.00 19.55  ? 825  ILE A CG2   1 
ATOM   3242  C  CD1   . ILE A 1  825 ? 156.522 152.187 110.950 1.00 19.55  ? 825  ILE A CD1   1 
ATOM   3243  N  N     . VAL A 1  826 ? 156.275 157.690 112.025 1.00 19.17  ? 826  VAL A N     1 
ATOM   3244  C  CA    . VAL A 1  826 ? 155.718 159.014 111.754 1.00 19.17  ? 826  VAL A CA    1 
ATOM   3245  C  C     . VAL A 1  826 ? 156.745 160.103 112.038 1.00 19.17  ? 826  VAL A C     1 
ATOM   3246  O  O     . VAL A 1  826 ? 156.905 161.044 111.253 1.00 19.17  ? 826  VAL A O     1 
ATOM   3247  C  CB    . VAL A 1  826 ? 154.433 159.214 112.577 1.00 19.17  ? 826  VAL A CB    1 
ATOM   3248  C  CG1   . VAL A 1  826 ? 153.921 160.634 112.463 1.00 19.17  ? 826  VAL A CG1   1 
ATOM   3249  C  CG2   . VAL A 1  826 ? 153.370 158.250 112.115 1.00 19.17  ? 826  VAL A CG2   1 
ATOM   3250  N  N     . ASP A 1  827 ? 157.477 159.978 113.146 1.00 23.00  ? 827  ASP A N     1 
ATOM   3251  C  CA    . ASP A 1  827 ? 158.514 160.948 113.470 1.00 23.00  ? 827  ASP A CA    1 
ATOM   3252  C  C     . ASP A 1  827 ? 159.711 160.843 112.540 1.00 23.00  ? 827  ASP A C     1 
ATOM   3253  O  O     . ASP A 1  827 ? 160.430 161.829 112.364 1.00 23.00  ? 827  ASP A O     1 
ATOM   3254  C  CB    . ASP A 1  827 ? 158.958 160.763 114.915 1.00 23.00  ? 827  ASP A CB    1 
ATOM   3255  C  CG    . ASP A 1  827 ? 157.867 161.103 115.902 1.00 23.00  ? 827  ASP A CG    1 
ATOM   3256  O  OD1   . ASP A 1  827 ? 157.030 161.974 115.587 1.00 23.00  ? 827  ASP A OD1   1 
ATOM   3257  O  OD2   . ASP A 1  827 ? 157.836 160.496 116.993 1.00 23.00  ? 827  ASP A OD2   1 
ATOM   3258  N  N     . GLU A 1  828 ? 159.935 159.673 111.941 1.00 27.05  ? 828  GLU A N     1 
ATOM   3259  C  CA    . GLU A 1  828 ? 161.006 159.530 110.962 1.00 27.05  ? 828  GLU A CA    1 
ATOM   3260  C  C     . GLU A 1  828 ? 160.644 160.197 109.646 1.00 27.05  ? 828  GLU A C     1 
ATOM   3261  O  O     . GLU A 1  828 ? 161.503 160.815 109.009 1.00 27.05  ? 828  GLU A O     1 
ATOM   3262  C  CB    . GLU A 1  828 ? 161.317 158.056 110.730 1.00 27.05  ? 828  GLU A CB    1 
ATOM   3263  C  CG    . GLU A 1  828 ? 162.452 157.805 109.751 1.00 27.05  ? 828  GLU A CG    1 
ATOM   3264  C  CD    . GLU A 1  828 ? 163.808 158.199 110.299 1.00 27.05  ? 828  GLU A CD    1 
ATOM   3265  O  OE1   . GLU A 1  828 ? 163.985 158.183 111.535 1.00 27.05  ? 828  GLU A OE1   1 
ATOM   3266  O  OE2   . GLU A 1  828 ? 164.705 158.516 109.490 1.00 27.05  ? 828  GLU A OE2   1 
ATOM   3267  N  N     . ILE A 1  829 ? 159.383 160.067 109.218 1.00 23.62  ? 829  ILE A N     1 
ATOM   3268  C  CA    . ILE A 1  829 ? 158.919 160.731 108.001 1.00 23.62  ? 829  ILE A CA    1 
ATOM   3269  C  C     . ILE A 1  829 ? 159.008 162.243 108.156 1.00 23.62  ? 829  ILE A C     1 
ATOM   3270  O  O     . ILE A 1  829 ? 159.417 162.955 107.232 1.00 23.62  ? 829  ILE A O     1 
ATOM   3271  C  CB    . ILE A 1  829 ? 157.486 160.276 107.656 1.00 23.62  ? 829  ILE A CB    1 
ATOM   3272  C  CG1   . ILE A 1  829 ? 157.453 158.799 107.289 1.00 23.62  ? 829  ILE A CG1   1 
ATOM   3273  C  CG2   . ILE A 1  829 ? 156.923 161.053 106.495 1.00 23.62  ? 829  ILE A CG2   1 
ATOM   3274  C  CD1   . ILE A 1  829 ? 156.059 158.238 107.176 1.00 23.62  ? 829  ILE A CD1   1 
ATOM   3275  N  N     . LYS A 1  830 ? 158.688 162.748 109.346 1.00 29.40  ? 830  LYS A N     1 
ATOM   3276  C  CA    . LYS A 1  830 ? 158.784 164.181 109.582 1.00 29.40  ? 830  LYS A CA    1 
ATOM   3277  C  C     . LYS A 1  830 ? 160.238 164.630 109.668 1.00 29.40  ? 830  LYS A C     1 
ATOM   3278  O  O     . LYS A 1  830 ? 160.586 165.701 109.164 1.00 29.40  ? 830  LYS A O     1 
ATOM   3279  C  CB    . LYS A 1  830 ? 158.015 164.551 110.849 1.00 29.40  ? 830  LYS A CB    1 
ATOM   3280  C  CG    . LYS A 1  830 ? 157.956 166.034 111.119 1.00 29.40  ? 830  LYS A CG    1 
ATOM   3281  C  CD    . LYS A 1  830 ? 157.235 166.732 109.987 1.00 29.40  ? 830  LYS A CD    1 
ATOM   3282  C  CE    . LYS A 1  830 ? 157.159 168.227 110.198 1.00 29.40  ? 830  LYS A CE    1 
ATOM   3283  N  NZ    . LYS A 1  830 ? 156.258 168.551 111.324 1.00 29.40  ? 830  LYS A NZ    1 
ATOM   3284  N  N     . LEU A 1  831 ? 161.105 163.811 110.274 1.00 32.42  ? 831  LEU A N     1 
ATOM   3285  C  CA    . LEU A 1  831 ? 162.528 164.136 110.346 1.00 32.42  ? 831  LEU A CA    1 
ATOM   3286  C  C     . LEU A 1  831 ? 163.197 164.051 108.981 1.00 32.42  ? 831  LEU A C     1 
ATOM   3287  O  O     . LEU A 1  831 ? 164.202 164.723 108.739 1.00 32.42  ? 831  LEU A O     1 
ATOM   3288  C  CB    . LEU A 1  831 ? 163.233 163.212 111.347 1.00 32.42  ? 831  LEU A CB    1 
ATOM   3289  C  CG    . LEU A 1  831 ? 164.700 163.429 111.745 1.00 32.42  ? 831  LEU A CG    1 
ATOM   3290  C  CD1   . LEU A 1  831 ? 164.881 163.066 113.198 1.00 32.42  ? 831  LEU A CD1   1 
ATOM   3291  C  CD2   . LEU A 1  831 ? 165.666 162.594 110.911 1.00 32.42  ? 831  LEU A CD2   1 
ATOM   3292  N  N     . LEU A 1  832 ? 162.686 163.213 108.093 1.00 32.68  ? 832  LEU A N     1 
ATOM   3293  C  CA    . LEU A 1  832 ? 163.338 163.045 106.806 1.00 32.68  ? 832  LEU A CA    1 
ATOM   3294  C  C     . LEU A 1  832 ? 162.991 164.183 105.851 1.00 32.68  ? 832  LEU A C     1 
ATOM   3295  O  O     . LEU A 1  832 ? 163.757 164.464 104.924 1.00 32.68  ? 832  LEU A O     1 
ATOM   3296  C  CB    . LEU A 1  832 ? 162.958 161.679 106.245 1.00 32.68  ? 832  LEU A CB    1 
ATOM   3297  C  CG    . LEU A 1  832 ? 163.717 161.013 105.117 1.00 32.68  ? 832  LEU A CG    1 
ATOM   3298  C  CD1   . LEU A 1  832 ? 163.647 159.530 105.366 1.00 32.68  ? 832  LEU A CD1   1 
ATOM   3299  C  CD2   . LEU A 1  832 ? 163.054 161.349 103.817 1.00 32.68  ? 832  LEU A CD2   1 
ATOM   3300  N  N     . ILE A 1  833 ? 161.848 164.839 106.060 1.00 35.91  ? 833  ILE A N     1 
ATOM   3301  C  CA    . ILE A 1  833 ? 161.500 166.046 105.315 1.00 35.91  ? 833  ILE A CA    1 
ATOM   3302  C  C     . ILE A 1  833 ? 162.099 167.280 105.998 1.00 35.91  ? 833  ILE A C     1 
ATOM   3303  O  O     . ILE A 1  833 ? 162.412 168.277 105.332 1.00 35.91  ? 833  ILE A O     1 
ATOM   3304  C  CB    . ILE A 1  833 ? 159.967 166.126 105.177 1.00 35.91  ? 833  ILE A CB    1 
ATOM   3305  C  CG1   . ILE A 1  833 ? 159.422 164.841 104.552 1.00 35.91  ? 833  ILE A CG1   1 
ATOM   3306  C  CG2   . ILE A 1  833 ? 159.527 167.286 104.308 1.00 35.91  ? 833  ILE A CG2   1 
ATOM   3307  C  CD1   . ILE A 1  833 ? 159.938 164.558 103.160 1.00 35.91  ? 833  ILE A CD1   1 
ATOM   3308  N  N     . GLU A 1  834 ? 162.269 167.212 107.325 1.00 42.35  ? 834  GLU A N     1 
ATOM   3309  C  CA    . GLU A 1  834 ? 163.042 168.187 108.102 1.00 42.35  ? 834  GLU A CA    1 
ATOM   3310  C  C     . GLU A 1  834 ? 164.443 168.390 107.550 1.00 42.35  ? 834  GLU A C     1 
ATOM   3311  O  O     . GLU A 1  834 ? 164.826 169.509 107.191 1.00 42.35  ? 834  GLU A O     1 
ATOM   3312  C  CB    . GLU A 1  834 ? 163.149 167.670 109.537 1.00 42.35  ? 834  GLU A CB    1 
ATOM   3313  C  CG    . GLU A 1  834 ? 162.226 168.163 110.603 1.00 42.35  ? 834  GLU A CG    1 
ATOM   3314  C  CD    . GLU A 1  834 ? 162.989 168.904 111.667 1.00 42.35  ? 834  GLU A CD    1 
ATOM   3315  O  OE1   . GLU A 1  834 ? 164.115 168.463 111.941 1.00 42.35  ? 834  GLU A OE1   1 
ATOM   3316  O  OE2   . GLU A 1  834 ? 162.487 169.869 112.261 1.00 42.35  ? 834  GLU A OE2   1 
ATOM   3317  N  N     . VAL A 1  835 ? 165.218 167.309 107.474 1.00 48.27  ? 835  VAL A N     1 
ATOM   3318  C  CA    . VAL A 1  835 ? 166.650 167.419 107.228 1.00 48.27  ? 835  VAL A CA    1 
ATOM   3319  C  C     . VAL A 1  835 ? 166.920 167.760 105.770 1.00 48.27  ? 835  VAL A C     1 
ATOM   3320  O  O     . VAL A 1  835 ? 167.721 168.649 105.459 1.00 48.27  ? 835  VAL A O     1 
ATOM   3321  C  CB    . VAL A 1  835 ? 167.355 166.119 107.652 1.00 48.27  ? 835  VAL A CB    1 
ATOM   3322  C  CG1   . VAL A 1  835 ? 168.812 166.131 107.243 1.00 48.27  ? 835  VAL A CG1   1 
ATOM   3323  C  CG2   . VAL A 1  835 ? 167.241 165.932 109.155 1.00 48.27  ? 835  VAL A CG2   1 
ATOM   3324  N  N     . ASN A 1  836 ? 166.225 167.094 104.856 1.00 55.60  ? 836  ASN A N     1 
ATOM   3325  C  CA    . ASN A 1  836 ? 166.441 167.295 103.425 1.00 55.60  ? 836  ASN A CA    1 
ATOM   3326  C  C     . ASN A 1  836 ? 165.625 168.466 102.884 1.00 55.60  ? 836  ASN A C     1 
ATOM   3327  O  O     . ASN A 1  836 ? 164.941 168.355 101.872 1.00 55.60  ? 836  ASN A O     1 
ATOM   3328  C  CB    . ASN A 1  836 ? 166.115 166.006 102.686 1.00 55.60  ? 836  ASN A CB    1 
ATOM   3329  C  CG    . ASN A 1  836 ? 167.096 164.898 103.000 1.00 55.60  ? 836  ASN A CG    1 
ATOM   3330  O  OD1   . ASN A 1  836 ? 168.308 165.104 102.983 1.00 55.60  ? 836  ASN A OD1   1 
ATOM   3331  N  ND2   . ASN A 1  836 ? 166.575 163.725 103.334 1.00 55.60  ? 836  ASN A ND2   1 
ATOM   3332  N  N     . GLY A 1  837 ? 165.717 169.615 103.552 1.00 54.01  ? 837  GLY A N     1 
ATOM   3333  C  CA    . GLY A 1  837 ? 165.011 170.808 103.132 1.00 54.01  ? 837  GLY A CA    1 
ATOM   3334  C  C     . GLY A 1  837 ? 165.708 171.618 102.069 1.00 54.01  ? 837  GLY A C     1 
ATOM   3335  O  O     . GLY A 1  837 ? 165.122 172.570 101.548 1.00 54.01  ? 837  GLY A O     1 
ATOM   3336  N  N     . SER A 1  838 ? 166.954 171.279 101.750 1.00 56.18  ? 838  SER A N     1 
ATOM   3337  C  CA    . SER A 1  838 ? 167.642 171.890 100.623 1.00 56.18  ? 838  SER A CA    1 
ATOM   3338  C  C     . SER A 1  838 ? 167.332 171.193 99.310  1.00 56.18  ? 838  SER A C     1 
ATOM   3339  O  O     . SER A 1  838 ? 167.685 171.720 98.250  1.00 56.18  ? 838  SER A O     1 
ATOM   3340  C  CB    . SER A 1  838 ? 169.153 171.876 100.860 1.00 56.18  ? 838  SER A CB    1 
ATOM   3341  O  OG    . SER A 1  838 ? 169.652 170.549 100.858 1.00 56.18  ? 838  SER A OG    1 
ATOM   3342  N  N     . ASN A 1  839 ? 166.683 170.032 99.362  1.00 54.52  ? 839  ASN A N     1 
ATOM   3343  C  CA    . ASN A 1  839 ? 166.443 169.230 98.172  1.00 54.52  ? 839  ASN A CA    1 
ATOM   3344  C  C     . ASN A 1  839 ? 165.391 169.892 97.292  1.00 54.52  ? 839  ASN A C     1 
ATOM   3345  O  O     . ASN A 1  839 ? 164.448 170.513 97.786  1.00 54.52  ? 839  ASN A O     1 
ATOM   3346  C  CB    . ASN A 1  839 ? 166.002 167.824 98.579  1.00 54.52  ? 839  ASN A CB    1 
ATOM   3347  C  CG    . ASN A 1  839 ? 166.068 166.827 97.438  1.00 54.52  ? 839  ASN A CG    1 
ATOM   3348  O  OD1   . ASN A 1  839 ? 166.435 167.166 96.314  1.00 54.52  ? 839  ASN A OD1   1 
ATOM   3349  N  ND2   . ASN A 1  839 ? 165.718 165.581 97.728  1.00 54.52  ? 839  ASN A ND2   1 
ATOM   3350  N  N     . LYS A 1  840 ? 165.570 169.762 95.976  1.00 52.33  ? 840  LYS A N     1 
ATOM   3351  C  CA    . LYS A 1  840 ? 164.685 170.434 95.030  1.00 52.33  ? 840  LYS A CA    1 
ATOM   3352  C  C     . LYS A 1  840 ? 163.304 169.791 95.014  1.00 52.33  ? 840  LYS A C     1 
ATOM   3353  O  O     . LYS A 1  840 ? 162.292 170.486 94.874  1.00 52.33  ? 840  LYS A O     1 
ATOM   3354  C  CB    . LYS A 1  840 ? 165.322 170.421 93.637  1.00 52.33  ? 840  LYS A CB    1 
ATOM   3355  C  CG    . LYS A 1  840 ? 164.630 171.277 92.575  1.00 52.33  ? 840  LYS A CG    1 
ATOM   3356  C  CD    . LYS A 1  840 ? 163.721 170.461 91.660  1.00 52.33  ? 840  LYS A CD    1 
ATOM   3357  C  CE    . LYS A 1  840 ? 163.177 171.305 90.523  1.00 52.33  ? 840  LYS A CE    1 
ATOM   3358  N  NZ    . LYS A 1  840 ? 162.273 172.380 91.014  1.00 52.33  ? 840  LYS A NZ    1 
ATOM   3359  N  N     . PHE A 1  841 ? 163.245 168.469 95.156  1.00 47.43  ? 841  PHE A N     1 
ATOM   3360  C  CA    . PHE A 1  841 ? 161.967 167.771 95.139  1.00 47.43  ? 841  PHE A CA    1 
ATOM   3361  C  C     . PHE A 1  841 ? 161.216 167.926 96.453  1.00 47.43  ? 841  PHE A C     1 
ATOM   3362  O  O     . PHE A 1  841 ? 159.982 167.921 96.463  1.00 47.43  ? 841  PHE A O     1 
ATOM   3363  C  CB    . PHE A 1  841 ? 162.198 166.291 94.832  1.00 47.43  ? 841  PHE A CB    1 
ATOM   3364  C  CG    . PHE A 1  841 ? 160.939 165.487 94.713  1.00 47.43  ? 841  PHE A CG    1 
ATOM   3365  C  CD1   . PHE A 1  841 ? 160.164 165.558 93.568  1.00 47.43  ? 841  PHE A CD1   1 
ATOM   3366  C  CD2   . PHE A 1  841 ? 160.535 164.654 95.743  1.00 47.43  ? 841  PHE A CD2   1 
ATOM   3367  C  CE1   . PHE A 1  841 ? 159.006 164.815 93.455  1.00 47.43  ? 841  PHE A CE1   1 
ATOM   3368  C  CE2   . PHE A 1  841 ? 159.381 163.911 95.635  1.00 47.43  ? 841  PHE A CE2   1 
ATOM   3369  C  CZ    . PHE A 1  841 ? 158.616 163.991 94.489  1.00 47.43  ? 841  PHE A CZ    1 
ATOM   3370  N  N     . VAL A 1  842 ? 161.937 168.081 97.562  1.00 50.51  ? 842  VAL A N     1 
ATOM   3371  C  CA    . VAL A 1  842 ? 161.300 168.059 98.872  1.00 50.51  ? 842  VAL A CA    1 
ATOM   3372  C  C     . VAL A 1  842 ? 160.743 169.438 99.235  1.00 50.51  ? 842  VAL A C     1 
ATOM   3373  O  O     . VAL A 1  842 ? 159.753 169.533 99.972  1.00 50.51  ? 842  VAL A O     1 
ATOM   3374  C  CB    . VAL A 1  842 ? 162.315 167.517 99.898  1.00 50.51  ? 842  VAL A CB    1 
ATOM   3375  C  CG1   . VAL A 1  842 ? 161.751 167.444 101.304 1.00 50.51  ? 842  VAL A CG1   1 
ATOM   3376  C  CG2   . VAL A 1  842 ? 162.788 166.140 99.471  1.00 50.51  ? 842  VAL A CG2   1 
ATOM   3377  N  N     . MET A 1  843 ? 161.322 170.518 98.696  1.00 55.73  ? 843  MET A N     1 
ATOM   3378  C  CA    . MET A 1  843 ? 160.770 171.852 98.933  1.00 55.73  ? 843  MET A CA    1 
ATOM   3379  C  C     . MET A 1  843 ? 159.398 172.013 98.296  1.00 55.73  ? 843  MET A C     1 
ATOM   3380  O  O     . MET A 1  843 ? 158.500 172.623 98.888  1.00 55.73  ? 843  MET A O     1 
ATOM   3381  C  CB    . MET A 1  843 ? 161.697 172.939 98.393  1.00 55.73  ? 843  MET A CB    1 
ATOM   3382  C  CG    . MET A 1  843 ? 162.999 173.118 99.125  1.00 55.73  ? 843  MET A CG    1 
ATOM   3383  S  SD    . MET A 1  843 ? 163.849 174.612 98.582  1.00 55.73  ? 843  MET A SD    1 
ATOM   3384  C  CE    . MET A 1  843 ? 164.305 174.169 96.910  1.00 55.73  ? 843  MET A CE    1 
ATOM   3385  N  N     . GLU A 1  844 ? 159.216 171.474 97.094  1.00 48.57  ? 844  GLU A N     1 
ATOM   3386  C  CA    . GLU A 1  844 ? 157.956 171.637 96.388  1.00 48.57  ? 844  GLU A CA    1 
ATOM   3387  C  C     . GLU A 1  844 ? 156.904 170.616 96.793  1.00 48.57  ? 844  GLU A C     1 
ATOM   3388  O  O     . GLU A 1  844 ? 155.725 170.820 96.491  1.00 48.57  ? 844  GLU A O     1 
ATOM   3389  C  CB    . GLU A 1  844 ? 158.198 171.573 94.880  1.00 48.57  ? 844  GLU A CB    1 
ATOM   3390  C  CG    . GLU A 1  844 ? 158.875 170.301 94.420  1.00 48.57  ? 844  GLU A CG    1 
ATOM   3391  C  CD    . GLU A 1  844 ? 159.132 170.290 92.929  1.00 48.57  ? 844  GLU A CD    1 
ATOM   3392  O  OE1   . GLU A 1  844 ? 158.698 171.241 92.246  1.00 48.57  ? 844  GLU A OE1   1 
ATOM   3393  O  OE2   . GLU A 1  844 ? 159.792 169.347 92.444  1.00 48.57  ? 844  GLU A OE2   1 
ATOM   3394  N  N     . ILE A 1  845 ? 157.284 169.536 97.474  1.00 38.13  ? 845  ILE A N     1 
ATOM   3395  C  CA    . ILE A 1  845 ? 156.280 168.549 97.848  1.00 38.13  ? 845  ILE A CA    1 
ATOM   3396  C  C     . ILE A 1  845 ? 155.823 168.710 99.296  1.00 38.13  ? 845  ILE A C     1 
ATOM   3397  O  O     . ILE A 1  845 ? 154.683 168.346 99.610  1.00 38.13  ? 845  ILE A O     1 
ATOM   3398  C  CB    . ILE A 1  845 ? 156.780 167.117 97.560  1.00 38.13  ? 845  ILE A CB    1 
ATOM   3399  C  CG1   . ILE A 1  845 ? 155.598 166.154 97.451  1.00 38.13  ? 845  ILE A CG1   1 
ATOM   3400  C  CG2   . ILE A 1  845 ? 157.744 166.617 98.629  1.00 38.13  ? 845  ILE A CG2   1 
ATOM   3401  C  CD1   . ILE A 1  845 ? 155.922 164.869 96.775  1.00 38.13  ? 845  ILE A CD1   1 
ATOM   3402  N  N     . ALA A 1  846 ? 156.638 169.320 100.166 1.00 30.92  ? 846  ALA A N     1 
ATOM   3403  C  CA    . ALA A 1  846 ? 156.278 169.440 101.575 1.00 30.92  ? 846  ALA A CA    1 
ATOM   3404  C  C     . ALA A 1  846 ? 155.136 170.419 101.805 1.00 30.92  ? 846  ALA A C     1 
ATOM   3405  O  O     . ALA A 1  846 ? 154.497 170.372 102.859 1.00 30.92  ? 846  ALA A O     1 
ATOM   3406  C  CB    . ALA A 1  846 ? 157.491 169.864 102.398 1.00 30.92  ? 846  ALA A CB    1 
ATOM   3407  N  N     . LYS A 1  847 ? 154.874 171.305 100.846 1.00 30.45  ? 847  LYS A N     1 
ATOM   3408  C  CA    . LYS A 1  847 ? 153.664 172.114 100.896 1.00 30.45  ? 847  LYS A CA    1 
ATOM   3409  C  C     . LYS A 1  847 ? 152.438 171.275 100.563 1.00 30.45  ? 847  LYS A C     1 
ATOM   3410  O  O     . LYS A 1  847 ? 151.372 171.460 101.158 1.00 30.45  ? 847  LYS A O     1 
ATOM   3411  C  CB    . LYS A 1  847 ? 153.794 173.291 99.930  1.00 30.45  ? 847  LYS A CB    1 
ATOM   3412  C  CG    . LYS A 1  847 ? 152.614 174.240 99.904  1.00 30.45  ? 847  LYS A CG    1 
ATOM   3413  C  CD    . LYS A 1  847 ? 152.506 174.999 101.205 1.00 30.45  ? 847  LYS A CD    1 
ATOM   3414  C  CE    . LYS A 1  847 ? 151.486 176.109 101.102 1.00 30.45  ? 847  LYS A CE    1 
ATOM   3415  N  NZ    . LYS A 1  847 ? 150.117 175.576 100.906 1.00 30.45  ? 847  LYS A NZ    1 
ATOM   3416  N  N     . THR A 1  848 ? 152.577 170.335 99.626  1.00 27.16  ? 848  THR A N     1 
ATOM   3417  C  CA    . THR A 1  848 ? 151.471 169.513 99.158  1.00 27.16  ? 848  THR A CA    1 
ATOM   3418  C  C     . THR A 1  848 ? 151.344 168.210 99.926  1.00 27.16  ? 848  THR A C     1 
ATOM   3419  O  O     . THR A 1  848 ? 150.671 167.287 99.460  1.00 27.16  ? 848  THR A O     1 
ATOM   3420  C  CB    . THR A 1  848 ? 151.626 169.210 97.670  1.00 27.16  ? 848  THR A CB    1 
ATOM   3421  O  OG1   . THR A 1  848 ? 152.754 168.352 97.478  1.00 27.16  ? 848  THR A OG1   1 
ATOM   3422  C  CG2   . THR A 1  848 ? 151.851 170.497 96.897  1.00 27.16  ? 848  THR A CG2   1 
ATOM   3423  N  N     . LEU A 1  849 ? 151.971 168.120 101.091 1.00 23.25  ? 849  LEU A N     1 
ATOM   3424  C  CA    . LEU A 1  849 ? 152.017 166.886 101.857 1.00 23.25  ? 849  LEU A CA    1 
ATOM   3425  C  C     . LEU A 1  849 ? 151.740 167.097 103.334 1.00 23.25  ? 849  LEU A C     1 
ATOM   3426  O  O     . LEU A 1  849 ? 151.523 166.116 104.049 1.00 23.25  ? 849  LEU A O     1 
ATOM   3427  C  CB    . LEU A 1  849 ? 153.386 166.219 101.645 1.00 23.25  ? 849  LEU A CB    1 
ATOM   3428  C  CG    . LEU A 1  849 ? 153.887 164.875 102.143 1.00 23.25  ? 849  LEU A CG    1 
ATOM   3429  C  CD1   . LEU A 1  849 ? 154.704 164.221 101.060 1.00 23.25  ? 849  LEU A CD1   1 
ATOM   3430  C  CD2   . LEU A 1  849 ? 154.781 165.154 103.308 1.00 23.25  ? 849  LEU A CD2   1 
ATOM   3431  N  N     . PHE A 1  850 ? 151.708 168.335 103.806 1.00 24.96  ? 850  PHE A N     1 
ATOM   3432  C  CA    . PHE A 1  850 ? 151.335 168.696 105.165 1.00 24.96  ? 850  PHE A CA    1 
ATOM   3433  C  C     . PHE A 1  850 ? 150.096 169.570 105.221 1.00 24.96  ? 850  PHE A C     1 
ATOM   3434  O  O     . PHE A 1  850 ? 149.277 169.407 106.125 1.00 24.96  ? 850  PHE A O     1 
ATOM   3435  C  CB    . PHE A 1  850 ? 152.505 169.410 105.847 1.00 24.96  ? 850  PHE A CB    1 
ATOM   3436  C  CG    . PHE A 1  850 ? 153.647 168.503 106.179 1.00 24.96  ? 850  PHE A CG    1 
ATOM   3437  C  CD1   . PHE A 1  850 ? 153.428 167.164 106.442 1.00 24.96  ? 850  PHE A CD1   1 
ATOM   3438  C  CD2   . PHE A 1  850 ? 154.947 168.972 106.157 1.00 24.96  ? 850  PHE A CD2   1 
ATOM   3439  C  CE1   . PHE A 1  850 ? 154.477 166.325 106.734 1.00 24.96  ? 850  PHE A CE1   1 
ATOM   3440  C  CE2   . PHE A 1  850 ? 156.002 168.131 106.436 1.00 24.96  ? 850  PHE A CE2   1 
ATOM   3441  C  CZ    . PHE A 1  850 ? 155.763 166.804 106.720 1.00 24.96  ? 850  PHE A CZ    1 
ATOM   3442  N  N     . GLN A 1  851 ? 149.936 170.501 104.279 1.00 25.93  ? 851  GLN A N     1 
ATOM   3443  C  CA    . GLN A 1  851 ? 148.710 171.275 104.147 1.00 25.93  ? 851  GLN A CA    1 
ATOM   3444  C  C     . GLN A 1  851 ? 147.833 170.794 103.002 1.00 25.93  ? 851  GLN A C     1 
ATOM   3445  O  O     . GLN A 1  851 ? 146.725 171.312 102.840 1.00 25.93  ? 851  GLN A O     1 
ATOM   3446  C  CB    . GLN A 1  851 ? 149.016 172.767 103.944 1.00 25.93  ? 851  GLN A CB    1 
ATOM   3447  C  CG    . GLN A 1  851 ? 149.599 173.500 105.139 1.00 25.93  ? 851  GLN A CG    1 
ATOM   3448  C  CD    . GLN A 1  851 ? 151.106 173.506 105.144 1.00 25.93  ? 851  GLN A CD    1 
ATOM   3449  O  OE1   . GLN A 1  851 ? 151.741 173.298 104.113 1.00 25.93  ? 851  GLN A OE1   1 
ATOM   3450  N  NE2   . GLN A 1  851 ? 151.692 173.748 106.306 1.00 25.93  ? 851  GLN A NE2   1 
ATOM   3451  N  N     . GLN A 1  852 ? 148.292 169.801 102.241 1.00 22.45  ? 852  GLN A N     1 
ATOM   3452  C  CA    . GLN A 1  852 ? 147.714 169.358 100.968 1.00 22.45  ? 852  GLN A CA    1 
ATOM   3453  C  C     . GLN A 1  852 ? 147.496 170.545 100.029 1.00 22.45  ? 852  GLN A C     1 
ATOM   3454  O  O     . GLN A 1  852 ? 146.378 170.928 99.686  1.00 22.45  ? 852  GLN A O     1 
ATOM   3455  C  CB    . GLN A 1  852 ? 146.429 168.549 101.161 1.00 22.45  ? 852  GLN A CB    1 
ATOM   3456  C  CG    . GLN A 1  852 ? 146.051 167.737 99.922  1.00 22.45  ? 852  GLN A CG    1 
ATOM   3457  C  CD    . GLN A 1  852 ? 144.847 166.858 100.132 1.00 22.45  ? 852  GLN A CD    1 
ATOM   3458  O  OE1   . GLN A 1  852 ? 144.216 166.894 101.183 1.00 22.45  ? 852  GLN A OE1   1 
ATOM   3459  N  NE2   . GLN A 1  852 ? 144.529 166.046 99.135  1.00 22.45  ? 852  GLN A NE2   1 
ATOM   3460  N  N     . GLY A 1  853 ? 148.612 171.158 99.666  1.00 25.29  ? 853  GLY A N     1 
ATOM   3461  C  CA    . GLY A 1  853 ? 148.659 172.093 98.569  1.00 25.29  ? 853  GLY A CA    1 
ATOM   3462  C  C     . GLY A 1  853 ? 148.455 173.549 98.899  1.00 25.29  ? 853  GLY A C     1 
ATOM   3463  O  O     . GLY A 1  853 ? 149.403 174.335 98.844  1.00 25.29  ? 853  GLY A O     1 
ATOM   3464  N  N     . SER A 1  854 ? 147.235 173.930 99.236  1.00 34.62  ? 854  SER A N     1 
ATOM   3465  C  CA    . SER A 1  854 ? 146.892 175.332 99.387  1.00 34.62  ? 854  SER A CA    1 
ATOM   3466  C  C     . SER A 1  854 ? 146.854 175.704 100.861 1.00 34.62  ? 854  SER A C     1 
ATOM   3467  O  O     . SER A 1  854 ? 147.123 174.891 101.747 1.00 34.62  ? 854  SER A O     1 
ATOM   3468  C  CB    . SER A 1  854 ? 145.555 175.635 98.707  1.00 34.62  ? 854  SER A CB    1 
ATOM   3469  O  OG    . SER A 1  854 ? 145.206 177.002 98.852  1.00 34.62  ? 854  SER A OG    1 
ATOM   3470  N  N     . ASP A 1  855 ? 146.491 176.959 101.114 1.00 46.44  ? 855  ASP A N     1 
ATOM   3471  C  CA    . ASP A 1  855 ? 146.314 177.460 102.467 1.00 46.44  ? 855  ASP A CA    1 
ATOM   3472  C  C     . ASP A 1  855 ? 144.938 177.029 102.970 1.00 46.44  ? 855  ASP A C     1 
ATOM   3473  O  O     . ASP A 1  855 ? 144.294 176.145 102.396 1.00 46.44  ? 855  ASP A O     1 
ATOM   3474  C  CB    . ASP A 1  855 ? 146.505 178.971 102.494 1.00 46.44  ? 855  ASP A CB    1 
ATOM   3475  C  CG    . ASP A 1  855 ? 147.913 179.383 102.114 1.00 46.44  ? 855  ASP A CG    1 
ATOM   3476  O  OD1   . ASP A 1  855 ? 148.845 178.580 102.322 1.00 46.44  ? 855  ASP A OD1   1 
ATOM   3477  O  OD2   . ASP A 1  855 ? 148.091 180.510 101.611 1.00 46.44  ? 855  ASP A OD2   1 
ATOM   3478  N  N     . ASN A 1  856 ? 144.510 177.596 104.102 1.00 43.67  ? 856  ASN A N     1 
ATOM   3479  C  CA    . ASN A 1  856 ? 143.251 177.356 104.818 1.00 43.67  ? 856  ASN A CA    1 
ATOM   3480  C  C     . ASN A 1  856 ? 143.155 175.948 105.407 1.00 43.67  ? 856  ASN A C     1 
ATOM   3481  O  O     . ASN A 1  856 ? 142.185 175.656 106.111 1.00 43.67  ? 856  ASN A O     1 
ATOM   3482  C  CB    . ASN A 1  856 ? 142.006 177.624 103.957 1.00 43.67  ? 856  ASN A CB    1 
ATOM   3483  C  CG    . ASN A 1  856 ? 141.981 179.024 103.393 1.00 43.67  ? 856  ASN A CG    1 
ATOM   3484  O  OD1   . ASN A 1  856 ? 142.074 179.217 102.181 1.00 43.67  ? 856  ASN A OD1   1 
ATOM   3485  N  ND2   . ASN A 1  856 ? 141.860 180.014 104.268 1.00 43.67  ? 856  ASN A ND2   1 
ATOM   3486  N  N     . ILE A 1  857 ? 144.125 175.076 105.151 1.00 25.61  ? 857  ILE A N     1 
ATOM   3487  C  CA    . ILE A 1  857 ? 144.268 173.791 105.815 1.00 25.61  ? 857  ILE A CA    1 
ATOM   3488  C  C     . ILE A 1  857 ? 145.504 173.895 106.690 1.00 25.61  ? 857  ILE A C     1 
ATOM   3489  O  O     . ILE A 1  857 ? 146.556 174.349 106.227 1.00 25.61  ? 857  ILE A O     1 
ATOM   3490  C  CB    . ILE A 1  857 ? 144.400 172.642 104.800 1.00 25.61  ? 857  ILE A CB    1 
ATOM   3491  C  CG1   . ILE A 1  857 ? 143.156 172.542 103.927 1.00 25.61  ? 857  ILE A CG1   1 
ATOM   3492  C  CG2   . ILE A 1  857 ? 144.636 171.326 105.497 1.00 25.61  ? 857  ILE A CG2   1 
ATOM   3493  C  CD1   . ILE A 1  857 ? 143.308 171.582 102.784 1.00 25.61  ? 857  ILE A CD1   1 
ATOM   3494  N  N     . SER A 1  858 ? 145.376 173.508 107.952 1.00 25.34  ? 858  SER A N     1 
ATOM   3495  C  CA    . SER A 1  858 ? 146.471 173.685 108.888 1.00 25.34  ? 858  SER A CA    1 
ATOM   3496  C  C     . SER A 1  858 ? 147.571 172.657 108.642 1.00 25.34  ? 858  SER A C     1 
ATOM   3497  O  O     . SER A 1  858 ? 147.374 171.645 107.968 1.00 25.34  ? 858  SER A O     1 
ATOM   3498  C  CB    . SER A 1  858 ? 145.959 173.585 110.320 1.00 25.34  ? 858  SER A CB    1 
ATOM   3499  O  OG    . SER A 1  858 ? 145.022 174.615 110.583 1.00 25.34  ? 858  SER A OG    1 
ATOM   3500  N  N     . GLU A 1  859 ? 148.753 172.949 109.179 1.00 27.31  ? 859  GLU A N     1 
ATOM   3501  C  CA    . GLU A 1  859 ? 149.861 172.005 109.132 1.00 27.31  ? 859  GLU A CA    1 
ATOM   3502  C  C     . GLU A 1  859 ? 149.574 170.866 110.095 1.00 27.31  ? 859  GLU A C     1 
ATOM   3503  O  O     . GLU A 1  859 ? 149.178 171.100 111.238 1.00 27.31  ? 859  GLU A O     1 
ATOM   3504  C  CB    . GLU A 1  859 ? 151.169 172.712 109.487 1.00 27.31  ? 859  GLU A CB    1 
ATOM   3505  C  CG    . GLU A 1  859 ? 152.441 171.912 109.242 1.00 27.31  ? 859  GLU A CG    1 
ATOM   3506  C  CD    . GLU A 1  859 ? 152.887 171.116 110.452 1.00 27.31  ? 859  GLU A CD    1 
ATOM   3507  O  OE1   . GLU A 1  859 ? 152.591 171.543 111.587 1.00 27.31  ? 859  GLU A OE1   1 
ATOM   3508  O  OE2   . GLU A 1  859 ? 153.545 170.070 110.272 1.00 27.31  ? 859  GLU A OE2   1 
ATOM   3509  N  N     . GLN A 1  860 ? 149.754 169.633 109.638 1.00 21.46  ? 860  GLN A N     1 
ATOM   3510  C  CA    . GLN A 1  860 ? 149.164 168.504 110.335 1.00 21.46  ? 860  GLN A CA    1 
ATOM   3511  C  C     . GLN A 1  860 ? 150.185 167.462 110.758 1.00 21.46  ? 860  GLN A C     1 
ATOM   3512  O  O     . GLN A 1  860 ? 151.364 167.509 110.403 1.00 21.46  ? 860  GLN A O     1 
ATOM   3513  C  CB    . GLN A 1  860 ? 148.085 167.853 109.479 1.00 21.46  ? 860  GLN A CB    1 
ATOM   3514  C  CG    . GLN A 1  860 ? 146.890 168.735 109.397 1.00 21.46  ? 860  GLN A CG    1 
ATOM   3515  C  CD    . GLN A 1  860 ? 145.788 168.126 108.634 1.00 21.46  ? 860  GLN A CD    1 
ATOM   3516  O  OE1   . GLN A 1  860 ? 145.936 167.046 108.075 1.00 21.46  ? 860  GLN A OE1   1 
ATOM   3517  N  NE2   . GLN A 1  860 ? 144.650 168.795 108.625 1.00 21.46  ? 860  GLN A NE2   1 
ATOM   3518  N  N     . LEU A 1  861 ? 149.676 166.504 111.531 1.00 18.54  ? 861  LEU A N     1 
ATOM   3519  C  CA    . LEU A 1  861 ? 150.517 165.559 112.248 1.00 18.54  ? 861  LEU A CA    1 
ATOM   3520  C  C     . LEU A 1  861 ? 150.960 164.416 111.357 1.00 18.54  ? 861  LEU A C     1 
ATOM   3521  O  O     . LEU A 1  861 ? 152.128 164.018 111.385 1.00 18.54  ? 861  LEU A O     1 
ATOM   3522  C  CB    . LEU A 1  861 ? 149.755 165.026 113.452 1.00 18.54  ? 861  LEU A CB    1 
ATOM   3523  C  CG    . LEU A 1  861 ? 149.389 166.138 114.420 1.00 18.54  ? 861  LEU A CG    1 
ATOM   3524  C  CD1   . LEU A 1  861 ? 148.490 165.604 115.499 1.00 18.54  ? 861  LEU A CD1   1 
ATOM   3525  C  CD2   . LEU A 1  861 ? 150.652 166.700 114.995 1.00 18.54  ? 861  LEU A CD2   1 
ATOM   3526  N  N     . ARG A 1  862 ? 150.041 163.876 110.574 1.00 17.56  ? 862  ARG A N     1 
ATOM   3527  C  CA    . ARG A 1  862 ? 150.344 162.830 109.619 1.00 17.56  ? 862  ARG A CA    1 
ATOM   3528  C  C     . ARG A 1  862 ? 150.428 163.445 108.234 1.00 17.56  ? 862  ARG A C     1 
ATOM   3529  O  O     . ARG A 1  862 ? 149.793 164.464 107.953 1.00 17.56  ? 862  ARG A O     1 
ATOM   3530  C  CB    . ARG A 1  862 ? 149.275 161.743 109.635 1.00 17.56  ? 862  ARG A CB    1 
ATOM   3531  C  CG    . ARG A 1  862 ? 149.040 161.115 110.989 1.00 17.56  ? 862  ARG A CG    1 
ATOM   3532  C  CD    . ARG A 1  862 ? 150.235 160.339 111.476 1.00 17.56  ? 862  ARG A CD    1 
ATOM   3533  N  NE    . ARG A 1  862 ? 149.899 159.544 112.649 1.00 17.56  ? 862  ARG A NE    1 
ATOM   3534  C  CZ    . ARG A 1  862 ? 150.006 159.966 113.903 1.00 17.56  ? 862  ARG A CZ    1 
ATOM   3535  N  NH1   . ARG A 1  862 ? 149.673 159.160 114.900 1.00 17.56  ? 862  ARG A NH1   1 
ATOM   3536  N  NH2   . ARG A 1  862 ? 150.440 161.189 114.162 1.00 17.56  ? 862  ARG A NH2   1 
ATOM   3537  N  N     . ILE A 1  863 ? 151.223 162.821 107.371 1.00 16.98  ? 863  ILE A N     1 
ATOM   3538  C  CA    . ILE A 1  863 ? 151.293 163.256 105.987 1.00 16.98  ? 863  ILE A CA    1 
ATOM   3539  C  C     . ILE A 1  863 ? 149.974 162.942 105.292 1.00 16.98  ? 863  ILE A C     1 
ATOM   3540  O  O     . ILE A 1  863 ? 149.189 162.103 105.753 1.00 16.98  ? 863  ILE A O     1 
ATOM   3541  C  CB    . ILE A 1  863 ? 152.492 162.592 105.291 1.00 16.98  ? 863  ILE A CB    1 
ATOM   3542  C  CG1   . ILE A 1  863 ? 152.346 161.077 105.274 1.00 16.98  ? 863  ILE A CG1   1 
ATOM   3543  C  CG2   . ILE A 1  863 ? 153.745 162.910 106.043 1.00 16.98  ? 863  ILE A CG2   1 
ATOM   3544  C  CD1   . ILE A 1  863 ? 153.466 160.383 104.552 1.00 16.98  ? 863  ILE A CD1   1 
ATOM   3545  N  N     . ILE A 1  864 ? 149.701 163.668 104.203 1.00 15.44  ? 864  ILE A N     1 
ATOM   3546  C  CA    . ILE A 1  864 ? 148.471 163.462 103.447 1.00 15.44  ? 864  ILE A CA    1 
ATOM   3547  C  C     . ILE A 1  864 ? 148.493 162.068 102.847 1.00 15.44  ? 864  ILE A C     1 
ATOM   3548  O  O     . ILE A 1  864 ? 149.523 161.626 102.321 1.00 15.44  ? 864  ILE A O     1 
ATOM   3549  C  CB    . ILE A 1  864 ? 148.326 164.545 102.368 1.00 15.44  ? 864  ILE A CB    1 
ATOM   3550  C  CG1   . ILE A 1  864 ? 148.370 165.933 103.001 1.00 15.44  ? 864  ILE A CG1   1 
ATOM   3551  C  CG2   . ILE A 1  864 ? 147.031 164.386 101.604 1.00 15.44  ? 864  ILE A CG2   1 
ATOM   3552  C  CD1   . ILE A 1  864 ? 147.280 166.193 103.991 1.00 15.44  ? 864  ILE A CD1   1 
ATOM   3553  N  N     . SER A 1  865 ? 147.361 161.362 102.965 1.00 13.10  ? 865  SER A N     1 
ATOM   3554  C  CA    . SER A 1  865 ? 147.213 159.937 102.646 1.00 13.10  ? 865  SER A CA    1 
ATOM   3555  C  C     . SER A 1  865 ? 148.161 159.079 103.475 1.00 13.10  ? 865  SER A C     1 
ATOM   3556  O  O     . SER A 1  865 ? 148.903 158.259 102.946 1.00 13.10  ? 865  SER A O     1 
ATOM   3557  C  CB    . SER A 1  865 ? 147.397 159.647 101.153 1.00 13.10  ? 865  SER A CB    1 
ATOM   3558  O  OG    . SER A 1  865 ? 148.742 159.832 100.754 1.00 13.10  ? 865  SER A OG    1 
ATOM   3559  N  N     . TRP A 1  866 ? 148.139 159.281 104.790 1.00 12.87  ? 866  TRP A N     1 
ATOM   3560  C  CA    . TRP A 1  866 ? 148.840 158.357 105.669 1.00 12.87  ? 866  TRP A CA    1 
ATOM   3561  C  C     . TRP A 1  866 ? 147.978 157.153 106.006 1.00 12.87  ? 866  TRP A C     1 
ATOM   3562  O  O     . TRP A 1  866 ? 148.483 156.033 106.084 1.00 12.87  ? 866  TRP A O     1 
ATOM   3563  C  CB    . TRP A 1  866 ? 149.262 159.042 106.966 1.00 12.87  ? 866  TRP A CB    1 
ATOM   3564  C  CG    . TRP A 1  866 ? 150.084 158.151 107.828 1.00 12.87  ? 866  TRP A CG    1 
ATOM   3565  C  CD1   . TRP A 1  866 ? 151.390 157.809 107.643 1.00 12.87  ? 866  TRP A CD1   1 
ATOM   3566  C  CD2   . TRP A 1  866 ? 149.638 157.428 108.972 1.00 12.87  ? 866  TRP A CD2   1 
ATOM   3567  N  NE1   . TRP A 1  866 ? 151.797 156.945 108.627 1.00 12.87  ? 866  TRP A NE1   1 
ATOM   3568  C  CE2   . TRP A 1  866 ? 150.736 156.692 109.454 1.00 12.87  ? 866  TRP A CE2   1 
ATOM   3569  C  CE3   . TRP A 1  866 ? 148.420 157.342 109.646 1.00 12.87  ? 866  TRP A CE3   1 
ATOM   3570  C  CZ2   . TRP A 1  866 ? 150.652 155.882 110.578 1.00 12.87  ? 866  TRP A CZ2   1 
ATOM   3571  C  CZ3   . TRP A 1  866 ? 148.337 156.539 110.761 1.00 12.87  ? 866  TRP A CZ3   1 
ATOM   3572  C  CH2   . TRP A 1  866 ? 149.445 155.818 111.217 1.00 12.87  ? 866  TRP A CH2   1 
ATOM   3573  N  N     . ASP A 1  867 ? 146.682 157.371 106.219 1.00 13.69  ? 867  ASP A N     1 
ATOM   3574  C  CA    . ASP A 1  867 ? 145.755 156.269 106.427 1.00 13.69  ? 867  ASP A CA    1 
ATOM   3575  C  C     . ASP A 1  867 ? 145.462 155.515 105.140 1.00 13.69  ? 867  ASP A C     1 
ATOM   3576  O  O     . ASP A 1  867 ? 145.063 154.349 105.196 1.00 13.69  ? 867  ASP A O     1 
ATOM   3577  C  CB    . ASP A 1  867 ? 144.462 156.793 107.054 1.00 13.69  ? 867  ASP A CB    1 
ATOM   3578  C  CG    . ASP A 1  867 ? 143.839 157.939 106.260 1.00 13.69  ? 867  ASP A CG    1 
ATOM   3579  O  OD1   . ASP A 1  867 ? 144.442 158.405 105.273 1.00 13.69  ? 867  ASP A OD1   1 
ATOM   3580  O  OD2   . ASP A 1  867 ? 142.735 158.386 106.628 1.00 13.69  ? 867  ASP A OD2   1 
ATOM   3581  N  N     . PHE A 1  868 ? 145.656 156.152 103.986 1.00 11.44  ? 868  PHE A N     1 
ATOM   3582  C  CA    . PHE A 1  868 ? 145.436 155.472 102.718 1.00 11.44  ? 868  PHE A CA    1 
ATOM   3583  C  C     . PHE A 1  868 ? 146.575 154.506 102.419 1.00 11.44  ? 868  PHE A C     1 
ATOM   3584  O  O     . PHE A 1  868 ? 146.338 153.344 102.078 1.00 11.44  ? 868  PHE A O     1 
ATOM   3585  C  CB    . PHE A 1  868 ? 145.292 156.495 101.591 1.00 11.44  ? 868  PHE A CB    1 
ATOM   3586  C  CG    . PHE A 1  868 ? 144.860 155.903 100.281 1.00 11.44  ? 868  PHE A CG    1 
ATOM   3587  C  CD1   . PHE A 1  868 ? 143.527 155.633 100.043 1.00 11.44  ? 868  PHE A CD1   1 
ATOM   3588  C  CD2   . PHE A 1  868 ? 145.783 155.612 99.291  1.00 11.44  ? 868  PHE A CD2   1 
ATOM   3589  C  CE1   . PHE A 1  868 ? 143.120 155.092 98.846  1.00 11.44  ? 868  PHE A CE1   1 
ATOM   3590  C  CE2   . PHE A 1  868 ? 145.381 155.063 98.091  1.00 11.44  ? 868  PHE A CE2   1 
ATOM   3591  C  CZ    . PHE A 1  868 ? 144.049 154.804 97.870  1.00 11.44  ? 868  PHE A CZ    1 
ATOM   3592  N  N     . VAL A 1  869 ? 147.824 154.963 102.547 1.00 10.74  ? 869  VAL A N     1 
ATOM   3593  C  CA    . VAL A 1  869 ? 148.949 154.119 102.164 1.00 10.74  ? 869  VAL A CA    1 
ATOM   3594  C  C     . VAL A 1  869 ? 149.309 153.109 103.242 1.00 10.74  ? 869  VAL A C     1 
ATOM   3595  O  O     . VAL A 1  869 ? 149.950 152.102 102.932 1.00 10.74  ? 869  VAL A O     1 
ATOM   3596  C  CB    . VAL A 1  869 ? 150.201 154.938 101.804 1.00 10.74  ? 869  VAL A CB    1 
ATOM   3597  C  CG1   . VAL A 1  869 ? 149.881 155.923 100.700 1.00 10.74  ? 869  VAL A CG1   1 
ATOM   3598  C  CG2   . VAL A 1  869 ? 150.796 155.626 103.018 1.00 10.74  ? 869  VAL A CG2   1 
ATOM   3599  N  N     . LEU A 1  870 ? 148.924 153.338 104.496 1.00 10.65  ? 870  LEU A N     1 
ATOM   3600  C  CA    . LEU A 1  870 ? 149.128 152.313 105.508 1.00 10.65  ? 870  LEU A CA    1 
ATOM   3601  C  C     . LEU A 1  870 ? 148.154 151.165 105.298 1.00 10.65  ? 870  LEU A C     1 
ATOM   3602  O  O     . LEU A 1  870 ? 148.511 149.999 105.480 1.00 10.65  ? 870  LEU A O     1 
ATOM   3603  C  CB    . LEU A 1  870 ? 148.989 152.932 106.905 1.00 10.65  ? 870  LEU A CB    1 
ATOM   3604  C  CG    . LEU A 1  870 ? 149.288 152.235 108.238 1.00 10.65  ? 870  LEU A CG    1 
ATOM   3605  C  CD1   . LEU A 1  870 ? 148.110 151.448 108.773 1.00 10.65  ? 870  LEU A CD1   1 
ATOM   3606  C  CD2   . LEU A 1  870 ? 150.482 151.322 108.094 1.00 10.65  ? 870  LEU A CD2   1 
ATOM   3607  N  N     . ASN A 1  871 ? 146.927 151.478 104.884 1.00 11.40  ? 871  ASN A N     1 
ATOM   3608  C  CA    . ASN A 1  871 ? 145.955 150.447 104.548 1.00 11.40  ? 871  ASN A CA    1 
ATOM   3609  C  C     . ASN A 1  871 ? 146.216 149.840 103.179 1.00 11.40  ? 871  ASN A C     1 
ATOM   3610  O  O     . ASN A 1  871 ? 145.809 148.704 102.928 1.00 11.40  ? 871  ASN A O     1 
ATOM   3611  C  CB    . ASN A 1  871 ? 144.547 151.026 104.604 1.00 11.40  ? 871  ASN A CB    1 
ATOM   3612  C  CG    . ASN A 1  871 ? 144.109 151.352 106.010 1.00 11.40  ? 871  ASN A CG    1 
ATOM   3613  O  OD1   . ASN A 1  871 ? 144.301 150.560 106.928 1.00 11.40  ? 871  ASN A OD1   1 
ATOM   3614  N  ND2   . ASN A 1  871 ? 143.535 152.530 106.191 1.00 11.40  ? 871  ASN A ND2   1 
ATOM   3615  N  N     . GLN A 1  872 ? 146.876 150.577 102.284 1.00 11.84  ? 872  GLN A N     1 
ATOM   3616  C  CA    . GLN A 1  872 ? 147.223 150.022 100.980 1.00 11.84  ? 872  GLN A CA    1 
ATOM   3617  C  C     . GLN A 1  872 ? 148.295 148.952 101.101 1.00 11.84  ? 872  GLN A C     1 
ATOM   3618  O  O     . GLN A 1  872 ? 148.275 147.968 100.356 1.00 11.84  ? 872  GLN A O     1 
ATOM   3619  C  CB    . GLN A 1  872 ? 147.703 151.128 100.045 1.00 11.84  ? 872  GLN A CB    1 
ATOM   3620  C  CG    . GLN A 1  872 ? 147.890 150.679 98.617  1.00 11.84  ? 872  GLN A CG    1 
ATOM   3621  C  CD    . GLN A 1  872 ? 148.520 151.738 97.755  1.00 11.84  ? 872  GLN A CD    1 
ATOM   3622  O  OE1   . GLN A 1  872 ? 148.924 152.791 98.242  1.00 11.84  ? 872  GLN A OE1   1 
ATOM   3623  N  NE2   . GLN A 1  872 ? 148.609 151.467 96.459  1.00 11.84  ? 872  GLN A NE2   1 
ATOM   3624  N  N     . LEU A 1  873 ? 149.226 149.117 102.040 1.00 7.81   ? 873  LEU A N     1 
ATOM   3625  C  CA    . LEU A 1  873 ? 150.297 148.147 102.218 1.00 7.81   ? 873  LEU A CA    1 
ATOM   3626  C  C     . LEU A 1  873 ? 149.869 146.972 103.087 1.00 7.81   ? 873  LEU A C     1 
ATOM   3627  O  O     . LEU A 1  873 ? 150.443 145.888 102.970 1.00 7.81   ? 873  LEU A O     1 
ATOM   3628  C  CB    . LEU A 1  873 ? 151.521 148.825 102.826 1.00 7.81   ? 873  LEU A CB    1 
ATOM   3629  C  CG    . LEU A 1  873 ? 152.194 149.907 101.985 1.00 7.81   ? 873  LEU A CG    1 
ATOM   3630  C  CD1   . LEU A 1  873 ? 153.259 150.604 102.798 1.00 7.81   ? 873  LEU A CD1   1 
ATOM   3631  C  CD2   . LEU A 1  873 ? 152.770 149.332 100.714 1.00 7.81   ? 873  LEU A CD2   1 
ATOM   3632  N  N     . LEU A 1  874 ? 148.883 147.161 103.966 1.00 12.48  ? 874  LEU A N     1 
ATOM   3633  C  CA    . LEU A 1  874 ? 148.325 146.028 104.700 1.00 12.48  ? 874  LEU A CA    1 
ATOM   3634  C  C     . LEU A 1  874 ? 147.433 145.166 103.820 1.00 12.48  ? 874  LEU A C     1 
ATOM   3635  O  O     . LEU A 1  874 ? 147.401 143.941 103.980 1.00 12.48  ? 874  LEU A O     1 
ATOM   3636  C  CB    . LEU A 1  874 ? 147.544 146.505 105.918 1.00 12.48  ? 874  LEU A CB    1 
ATOM   3637  C  CG    . LEU A 1  874 ? 148.222 146.512 107.282 1.00 12.48  ? 874  LEU A CG    1 
ATOM   3638  C  CD1   . LEU A 1  874 ? 149.392 147.442 107.344 1.00 12.48  ? 874  LEU A CD1   1 
ATOM   3639  C  CD2   . LEU A 1  874 ? 147.177 146.933 108.280 1.00 12.48  ? 874  LEU A CD2   1 
ATOM   3640  N  N     . ASP A 1  875 ? 146.678 145.785 102.909 1.00 14.69  ? 875  ASP A N     1 
ATOM   3641  C  CA    . ASP A 1  875 ? 145.836 145.010 102.005 1.00 14.69  ? 875  ASP A CA    1 
ATOM   3642  C  C     . ASP A 1  875 ? 146.663 144.217 101.008 1.00 14.69  ? 875  ASP A C     1 
ATOM   3643  O  O     . ASP A 1  875 ? 146.265 143.118 100.614 1.00 14.69  ? 875  ASP A O     1 
ATOM   3644  C  CB    . ASP A 1  875 ? 144.865 145.922 101.255 1.00 14.69  ? 875  ASP A CB    1 
ATOM   3645  C  CG    . ASP A 1  875 ? 143.766 146.466 102.142 1.00 14.69  ? 875  ASP A CG    1 
ATOM   3646  O  OD1   . ASP A 1  875 ? 143.431 145.817 103.152 1.00 14.69  ? 875  ASP A OD1   1 
ATOM   3647  O  OD2   . ASP A 1  875 ? 143.221 147.539 101.816 1.00 14.69  ? 875  ASP A OD2   1 
ATOM   3648  N  N     . ALA A 1  876 ? 147.814 144.746 100.602 1.00 12.23  ? 876  ALA A N     1 
ATOM   3649  C  CA    . ALA A 1  876 ? 148.650 144.075 99.618  1.00 12.23  ? 876  ALA A CA    1 
ATOM   3650  C  C     . ALA A 1  876 ? 149.418 142.899 100.196 1.00 12.23  ? 876  ALA A C     1 
ATOM   3651  O  O     . ALA A 1  876 ? 149.933 142.080 99.432  1.00 12.23  ? 876  ALA A O     1 
ATOM   3652  C  CB    . ALA A 1  876 ? 149.635 145.065 99.000  1.00 12.23  ? 876  ALA A CB    1 
ATOM   3653  N  N     . GLY A 1  877 ? 149.506 142.794 101.516 1.00 12.62  ? 877  GLY A N     1 
ATOM   3654  C  CA    . GLY A 1  877 ? 150.272 141.742 102.142 1.00 12.62  ? 877  GLY A CA    1 
ATOM   3655  C  C     . GLY A 1  877 ? 151.727 142.069 102.370 1.00 12.62  ? 877  GLY A C     1 
ATOM   3656  O  O     . GLY A 1  877 ? 152.450 141.238 102.930 1.00 12.62  ? 877  GLY A O     1 
ATOM   3657  N  N     . ILE A 1  878 ? 152.177 143.251 101.944 1.00 14.84  ? 878  ILE A N     1 
ATOM   3658  C  CA    . ILE A 1  878 ? 153.549 143.688 102.172 1.00 14.84  ? 878  ILE A CA    1 
ATOM   3659  C  C     . ILE A 1  878 ? 153.798 143.924 103.651 1.00 14.84  ? 878  ILE A C     1 
ATOM   3660  O  O     . ILE A 1  878 ? 154.890 143.651 104.163 1.00 14.84  ? 878  ILE A O     1 
ATOM   3661  C  CB    . ILE A 1  878 ? 153.816 144.954 101.337 1.00 14.84  ? 878  ILE A CB    1 
ATOM   3662  C  CG1   . ILE A 1  878 ? 153.706 144.632 99.858  1.00 14.84  ? 878  ILE A CG1   1 
ATOM   3663  C  CG2   . ILE A 1  878 ? 155.178 145.565 101.618 1.00 14.84  ? 878  ILE A CG2   1 
ATOM   3664  C  CD1   . ILE A 1  878 ? 153.770 145.845 99.016  1.00 14.84  ? 878  ILE A CD1   1 
ATOM   3665  N  N     . LEU A 1  879 ? 152.786 144.358 104.374 1.00 14.53  ? 879  LEU A N     1 
ATOM   3666  C  CA    . LEU A 1  879 ? 152.995 144.959 105.673 1.00 14.53  ? 879  LEU A CA    1 
ATOM   3667  C  C     . LEU A 1  879 ? 152.090 144.267 106.678 1.00 14.53  ? 879  LEU A C     1 
ATOM   3668  O  O     . LEU A 1  879 ? 150.919 144.015 106.390 1.00 14.53  ? 879  LEU A O     1 
ATOM   3669  C  CB    . LEU A 1  879 ? 152.688 146.445 105.577 1.00 14.53  ? 879  LEU A CB    1 
ATOM   3670  C  CG    . LEU A 1  879 ? 153.336 147.411 106.540 1.00 14.53  ? 879  LEU A CG    1 
ATOM   3671  C  CD1   . LEU A 1  879 ? 154.803 147.464 106.221 1.00 14.53  ? 879  LEU A CD1   1 
ATOM   3672  C  CD2   . LEU A 1  879 ? 152.721 148.762 106.373 1.00 14.53  ? 879  LEU A CD2   1 
ATOM   3673  N  N     . PHE A 1  880 ? 152.632 143.938 107.843 1.00 16.27  ? 880  PHE A N     1 
ATOM   3674  C  CA    . PHE A 1  880 ? 151.859 143.337 108.922 1.00 16.27  ? 880  PHE A CA    1 
ATOM   3675  C  C     . PHE A 1  880 ? 151.749 144.332 110.062 1.00 16.27  ? 880  PHE A C     1 
ATOM   3676  O  O     . PHE A 1  880 ? 152.742 144.959 110.436 1.00 16.27  ? 880  PHE A O     1 
ATOM   3677  C  CB    . PHE A 1  880 ? 152.497 142.043 109.423 1.00 16.27  ? 880  PHE A CB    1 
ATOM   3678  C  CG    . PHE A 1  880 ? 151.757 141.409 110.565 1.00 16.27  ? 880  PHE A CG    1 
ATOM   3679  C  CD1   . PHE A 1  880 ? 150.561 140.746 110.350 1.00 16.27  ? 880  PHE A CD1   1 
ATOM   3680  C  CD2   . PHE A 1  880 ? 152.261 141.474 111.857 1.00 16.27  ? 880  PHE A CD2   1 
ATOM   3681  C  CE1   . PHE A 1  880 ? 149.878 140.162 111.400 1.00 16.27  ? 880  PHE A CE1   1 
ATOM   3682  C  CE2   . PHE A 1  880 ? 151.580 140.896 112.912 1.00 16.27  ? 880  PHE A CE2   1 
ATOM   3683  C  CZ    . PHE A 1  880 ? 150.389 140.239 112.682 1.00 16.27  ? 880  PHE A CZ    1 
ATOM   3684  N  N     . LYS A 1  881 ? 150.552 144.473 110.613 1.00 17.54  ? 881  LYS A N     1 
ATOM   3685  C  CA    . LYS A 1  881 ? 150.311 145.430 111.679 1.00 17.54  ? 881  LYS A CA    1 
ATOM   3686  C  C     . LYS A 1  881 ? 149.536 144.742 112.786 1.00 17.54  ? 881  LYS A C     1 
ATOM   3687  O  O     . LYS A 1  881 ? 148.529 144.080 112.520 1.00 17.54  ? 881  LYS A O     1 
ATOM   3688  C  CB    . LYS A 1  881 ? 149.536 146.645 111.168 1.00 17.54  ? 881  LYS A CB    1 
ATOM   3689  C  CG    . LYS A 1  881 ? 149.430 147.757 112.176 1.00 17.54  ? 881  LYS A CG    1 
ATOM   3690  C  CD    . LYS A 1  881 ? 148.729 148.968 111.615 1.00 17.54  ? 881  LYS A CD    1 
ATOM   3691  C  CE    . LYS A 1  881 ? 147.243 148.721 111.522 1.00 17.54  ? 881  LYS A CE    1 
ATOM   3692  N  NZ    . LYS A 1  881 ? 146.642 148.580 112.872 1.00 17.54  ? 881  LYS A NZ    1 
ATOM   3693  N  N     . GLN A 1  882 ? 150.001 144.894 114.022 1.00 22.41  ? 882  GLN A N     1 
ATOM   3694  C  CA    . GLN A 1  882 ? 149.336 144.229 115.126 1.00 22.41  ? 882  GLN A CA    1 
ATOM   3695  C  C     . GLN A 1  882 ? 148.074 144.994 115.510 1.00 22.41  ? 882  GLN A C     1 
ATOM   3696  O  O     . GLN A 1  882 ? 147.792 146.079 115.001 1.00 22.41  ? 882  GLN A O     1 
ATOM   3697  C  CB    . GLN A 1  882 ? 150.271 144.095 116.324 1.00 22.41  ? 882  GLN A CB    1 
ATOM   3698  C  CG    . GLN A 1  882 ? 150.570 145.391 117.022 1.00 22.41  ? 882  GLN A CG    1 
ATOM   3699  C  CD    . GLN A 1  882 ? 151.546 145.215 118.159 1.00 22.41  ? 882  GLN A CD    1 
ATOM   3700  O  OE1   . GLN A 1  882 ? 152.018 144.111 118.417 1.00 22.41  ? 882  GLN A OE1   1 
ATOM   3701  N  NE2   . GLN A 1  882 ? 151.840 146.300 118.860 1.00 22.41  ? 882  GLN A NE2   1 
ATOM   3702  N  N     . THR A 1  883 ? 147.296 144.414 116.409 1.00 22.81  ? 883  THR A N     1 
ATOM   3703  C  CA    . THR A 1  883 ? 145.983 144.958 116.730 1.00 22.81  ? 883  THR A CA    1 
ATOM   3704  C  C     . THR A 1  883 ? 146.092 145.737 118.036 1.00 22.81  ? 883  THR A C     1 
ATOM   3705  O  O     . THR A 1  883 ? 146.123 145.157 119.123 1.00 22.81  ? 883  THR A O     1 
ATOM   3706  C  CB    . THR A 1  883 ? 144.943 143.851 116.810 1.00 22.81  ? 883  THR A CB    1 
ATOM   3707  O  OG1   . THR A 1  883 ? 145.038 143.036 115.638 1.00 22.81  ? 883  THR A OG1   1 
ATOM   3708  C  CG2   . THR A 1  883 ? 143.566 144.460 116.822 1.00 22.81  ? 883  THR A CG2   1 
ATOM   3709  N  N     . MET A 1  884 ? 146.167 147.057 117.912 1.00 26.87  ? 884  MET A N     1 
ATOM   3710  C  CA    . MET A 1  884 ? 146.192 147.993 119.025 1.00 26.87  ? 884  MET A CA    1 
ATOM   3711  C  C     . MET A 1  884 ? 145.305 149.166 118.652 1.00 26.87  ? 884  MET A C     1 
ATOM   3712  O  O     . MET A 1  884 ? 145.288 149.577 117.490 1.00 26.87  ? 884  MET A O     1 
ATOM   3713  C  CB    . MET A 1  884 ? 147.615 148.492 119.313 1.00 26.87  ? 884  MET A CB    1 
ATOM   3714  C  CG    . MET A 1  884 ? 148.575 147.476 119.908 1.00 26.87  ? 884  MET A CG    1 
ATOM   3715  S  SD    . MET A 1  884 ? 148.169 147.053 121.610 1.00 26.87  ? 884  MET A SD    1 
ATOM   3716  C  CE    . MET A 1  884 ? 149.359 145.757 121.933 1.00 26.87  ? 884  MET A CE    1 
ATOM   3717  N  N     . LYS A 1  885 ? 144.565 149.710 119.616 1.00 24.88  ? 885  LYS A N     1 
ATOM   3718  C  CA    . LYS A 1  885 ? 143.767 150.880 119.279 1.00 24.88  ? 885  LYS A CA    1 
ATOM   3719  C  C     . LYS A 1  885 ? 144.525 152.180 119.478 1.00 24.88  ? 885  LYS A C     1 
ATOM   3720  O  O     . LYS A 1  885 ? 144.103 153.210 118.943 1.00 24.88  ? 885  LYS A O     1 
ATOM   3721  C  CB    . LYS A 1  885 ? 142.465 150.933 120.080 1.00 24.88  ? 885  LYS A CB    1 
ATOM   3722  C  CG    . LYS A 1  885 ? 142.582 151.375 121.514 1.00 24.88  ? 885  LYS A CG    1 
ATOM   3723  C  CD    . LYS A 1  885 ? 141.204 151.402 122.147 1.00 24.88  ? 885  LYS A CD    1 
ATOM   3724  C  CE    . LYS A 1  885 ? 140.357 152.509 121.544 1.00 24.88  ? 885  LYS A CE    1 
ATOM   3725  N  NZ    . LYS A 1  885 ? 139.027 152.624 122.199 1.00 24.88  ? 885  LYS A NZ    1 
ATOM   3726  N  N     . ASN A 1  886 ? 145.622 152.163 120.225 1.00 26.51  ? 886  ASN A N     1 
ATOM   3727  C  CA    . ASN A 1  886 ? 146.528 153.301 120.271 1.00 26.51  ? 886  ASN A CA    1 
ATOM   3728  C  C     . ASN A 1  886 ? 147.296 153.304 118.960 1.00 26.51  ? 886  ASN A C     1 
ATOM   3729  O  O     . ASN A 1  886 ? 148.168 152.459 118.742 1.00 26.51  ? 886  ASN A O     1 
ATOM   3730  C  CB    . ASN A 1  886 ? 147.461 153.199 121.475 1.00 26.51  ? 886  ASN A CB    1 
ATOM   3731  C  CG    . ASN A 1  886 ? 148.226 154.485 121.745 1.00 26.51  ? 886  ASN A CG    1 
ATOM   3732  O  OD1   . ASN A 1  886 ? 148.086 155.474 121.035 1.00 26.51  ? 886  ASN A OD1   1 
ATOM   3733  N  ND2   . ASN A 1  886 ? 149.047 154.468 122.780 1.00 26.51  ? 886  ASN A ND2   1 
ATOM   3734  N  N     . ASP A 1  887 ? 146.974 154.253 118.083 1.00 32.42  ? 887  ASP A N     1 
ATOM   3735  C  CA    . ASP A 1  887 ? 147.538 154.297 116.739 1.00 32.42  ? 887  ASP A CA    1 
ATOM   3736  C  C     . ASP A 1  887 ? 149.004 154.694 116.712 1.00 32.42  ? 887  ASP A C     1 
ATOM   3737  O  O     . ASP A 1  887 ? 149.596 154.703 115.629 1.00 32.42  ? 887  ASP A O     1 
ATOM   3738  C  CB    . ASP A 1  887 ? 146.739 155.267 115.866 1.00 32.42  ? 887  ASP A CB    1 
ATOM   3739  C  CG    . ASP A 1  887 ? 145.349 154.754 115.541 1.00 32.42  ? 887  ASP A CG    1 
ATOM   3740  O  OD1   . ASP A 1  887 ? 145.172 153.520 115.451 1.00 32.42  ? 887  ASP A OD1   1 
ATOM   3741  O  OD2   . ASP A 1  887 ? 144.432 155.586 115.376 1.00 32.42  ? 887  ASP A OD2   1 
ATOM   3742  N  N     . ARG A 1  888 ? 149.604 155.020 117.852 1.00 23.55  ? 888  ARG A N     1 
ATOM   3743  C  CA    . ARG A 1  888 ? 150.976 155.491 117.890 1.00 23.55  ? 888  ARG A CA    1 
ATOM   3744  C  C     . ARG A 1  888 ? 151.957 154.440 118.388 1.00 23.55  ? 888  ARG A C     1 
ATOM   3745  O  O     . ARG A 1  888 ? 153.054 154.331 117.841 1.00 23.55  ? 888  ARG A O     1 
ATOM   3746  C  CB    . ARG A 1  888 ? 151.073 156.747 118.756 1.00 23.55  ? 888  ARG A CB    1 
ATOM   3747  C  CG    . ARG A 1  888 ? 152.396 157.424 118.618 1.00 23.55  ? 888  ARG A CG    1 
ATOM   3748  C  CD    . ARG A 1  888 ? 152.415 158.808 119.188 1.00 23.55  ? 888  ARG A CD    1 
ATOM   3749  N  NE    . ARG A 1  888 ? 153.718 159.401 118.929 1.00 23.55  ? 888  ARG A NE    1 
ATOM   3750  C  CZ    . ARG A 1  888 ? 154.035 160.029 117.805 1.00 23.55  ? 888  ARG A CZ    1 
ATOM   3751  N  NH1   . ARG A 1  888 ? 155.248 160.526 117.646 1.00 23.55  ? 888  ARG A NH1   1 
ATOM   3752  N  NH2   . ARG A 1  888 ? 153.142 160.167 116.839 1.00 23.55  ? 888  ARG A NH2   1 
ATOM   3753  N  N     . ILE A 1  889 ? 151.592 153.641 119.398 1.00 23.15  ? 889  ILE A N     1 
ATOM   3754  C  CA    . ILE A 1  889 ? 152.505 152.621 119.907 1.00 23.15  ? 889  ILE A CA    1 
ATOM   3755  C  C     . ILE A 1  889 ? 152.367 151.294 119.180 1.00 23.15  ? 889  ILE A C     1 
ATOM   3756  O  O     . ILE A 1  889 ? 153.059 150.330 119.536 1.00 23.15  ? 889  ILE A O     1 
ATOM   3757  C  CB    . ILE A 1  889 ? 152.315 152.340 121.409 1.00 23.15  ? 889  ILE A CB    1 
ATOM   3758  C  CG1   . ILE A 1  889 ? 150.975 151.651 121.647 1.00 23.15  ? 889  ILE A CG1   1 
ATOM   3759  C  CG2   . ILE A 1  889 ? 152.388 153.628 122.197 1.00 23.15  ? 889  ILE A CG2   1 
ATOM   3760  C  CD1   . ILE A 1  889 ? 150.922 150.888 122.933 1.00 23.15  ? 889  ILE A CD1   1 
ATOM   3761  N  N     . CYS A 1  890 ? 151.490 151.211 118.186 1.00 26.84  ? 890  CYS A N     1 
ATOM   3762  C  CA    . CYS A 1  890 ? 151.263 149.975 117.453 1.00 26.84  ? 890  CYS A CA    1 
ATOM   3763  C  C     . CYS A 1  890 ? 152.494 149.594 116.638 1.00 26.84  ? 890  CYS A C     1 
ATOM   3764  O  O     . CYS A 1  890 ? 153.242 150.451 116.170 1.00 26.84  ? 890  CYS A O     1 
ATOM   3765  C  CB    . CYS A 1  890 ? 150.053 150.140 116.542 1.00 26.84  ? 890  CYS A CB    1 
ATOM   3766  S  SG    . CYS A 1  890 ? 149.582 148.670 115.665 1.00 26.84  ? 890  CYS A SG    1 
ATOM   3767  N  N     . CYS A 1  891 ? 152.719 148.293 116.490 1.00 24.94  ? 891  CYS A N     1 
ATOM   3768  C  CA    . CYS A 1  891 ? 153.922 147.797 115.839 1.00 24.94  ? 891  CYS A CA    1 
ATOM   3769  C  C     . CYS A 1  891 ? 153.632 147.344 114.414 1.00 24.94  ? 891  CYS A C     1 
ATOM   3770  O  O     . CYS A 1  891 ? 152.509 146.968 114.077 1.00 24.94  ? 891  CYS A O     1 
ATOM   3771  C  CB    . CYS A 1  891 ? 154.544 146.651 116.636 1.00 24.94  ? 891  CYS A CB    1 
ATOM   3772  S  SG    . CYS A 1  891 ? 155.270 147.159 118.209 1.00 24.94  ? 891  CYS A SG    1 
ATOM   3773  N  N     . VAL A 1  892 ? 154.666 147.402 113.573 1.00 20.69  ? 892  VAL A N     1 
ATOM   3774  C  CA    . VAL A 1  892 ? 154.555 147.163 112.135 1.00 20.69  ? 892  VAL A CA    1 
ATOM   3775  C  C     . VAL A 1  892 ? 155.761 146.350 111.674 1.00 20.69  ? 892  VAL A C     1 
ATOM   3776  O  O     . VAL A 1  892 ? 156.904 146.797 111.814 1.00 20.69  ? 892  VAL A O     1 
ATOM   3777  C  CB    . VAL A 1  892 ? 154.463 148.476 111.334 1.00 20.69  ? 892  VAL A CB    1 
ATOM   3778  C  CG1   . VAL A 1  892 ? 154.679 148.222 109.875 1.00 20.69  ? 892  VAL A CG1   1 
ATOM   3779  C  CG2   . VAL A 1  892 ? 153.102 149.118 111.498 1.00 20.69  ? 892  VAL A CG2   1 
ATOM   3780  N  N     . LYS A 1  893 ? 155.512 145.163 111.129 1.00 20.56  ? 893  LYS A N     1 
ATOM   3781  C  CA    . LYS A 1  893 ? 156.526 144.353 110.471 1.00 20.56  ? 893  LYS A CA    1 
ATOM   3782  C  C     . LYS A 1  893 ? 156.477 144.560 108.966 1.00 20.56  ? 893  LYS A C     1 
ATOM   3783  O  O     . LYS A 1  893 ? 155.561 145.174 108.428 1.00 20.56  ? 893  LYS A O     1 
ATOM   3784  C  CB    . LYS A 1  893 ? 156.317 142.864 110.755 1.00 20.56  ? 893  LYS A CB    1 
ATOM   3785  C  CG    . LYS A 1  893 ? 156.638 142.393 112.138 1.00 20.56  ? 893  LYS A CG    1 
ATOM   3786  C  CD    . LYS A 1  893 ? 156.234 140.941 112.279 1.00 20.56  ? 893  LYS A CD    1 
ATOM   3787  C  CE    . LYS A 1  893 ? 157.097 140.050 111.403 1.00 20.56  ? 893  LYS A CE    1 
ATOM   3788  N  NZ    . LYS A 1  893 ? 156.769 138.608 111.574 1.00 20.56  ? 893  LYS A NZ    1 
ATOM   3789  N  N     . LEU A 1  894 ? 157.477 144.017 108.286 1.00 22.91  ? 894  LEU A N     1 
ATOM   3790  C  CA    . LEU A 1  894 ? 157.328 143.668 106.886 1.00 22.91  ? 894  LEU A CA    1 
ATOM   3791  C  C     . LEU A 1  894 ? 156.929 142.202 106.771 1.00 22.91  ? 894  LEU A C     1 
ATOM   3792  O  O     . LEU A 1  894 ? 157.045 141.425 107.718 1.00 22.91  ? 894  LEU A O     1 
ATOM   3793  C  CB    . LEU A 1  894 ? 158.618 143.916 106.109 1.00 22.91  ? 894  LEU A CB    1 
ATOM   3794  C  CG    . LEU A 1  894 ? 159.053 145.342 105.816 1.00 22.91  ? 894  LEU A CG    1 
ATOM   3795  C  CD1   . LEU A 1  894 ? 160.391 145.315 105.121 1.00 22.91  ? 894  LEU A CD1   1 
ATOM   3796  C  CD2   . LEU A 1  894 ? 158.027 146.009 104.939 1.00 22.91  ? 894  LEU A CD2   1 
ATOM   3797  N  N     . ASN A 1  895 ? 156.452 141.822 105.591 1.00 27.24  ? 895  ASN A N     1 
ATOM   3798  C  CA    . ASN A 1  895 ? 156.213 140.420 105.296 1.00 27.24  ? 895  ASN A CA    1 
ATOM   3799  C  C     . ASN A 1  895 ? 156.957 139.928 104.070 1.00 27.24  ? 895  ASN A C     1 
ATOM   3800  O  O     . ASN A 1  895 ? 156.777 138.767 103.687 1.00 27.24  ? 895  ASN A O     1 
ATOM   3801  C  CB    . ASN A 1  895 ? 154.718 140.137 105.106 1.00 27.24  ? 895  ASN A CB    1 
ATOM   3802  C  CG    . ASN A 1  895 ? 153.953 140.148 106.403 1.00 27.24  ? 895  ASN A CG    1 
ATOM   3803  O  OD1   . ASN A 1  895 ? 154.459 139.722 107.438 1.00 27.24  ? 895  ASN A OD1   1 
ATOM   3804  N  ND2   . ASN A 1  895 ? 152.709 140.599 106.348 1.00 27.24  ? 895  ASN A ND2   1 
ATOM   3805  N  N     . ILE A 1  896 ? 157.785 140.758 103.441 1.00 30.96  ? 896  ILE A N     1 
ATOM   3806  C  CA    . ILE A 1  896 ? 158.389 140.343 102.183 1.00 30.96  ? 896  ILE A CA    1 
ATOM   3807  C  C     . ILE A 1  896 ? 159.852 139.922 102.345 1.00 30.96  ? 896  ILE A C     1 
ATOM   3808  O  O     . ILE A 1  896 ? 160.156 138.730 102.221 1.00 30.96  ? 896  ILE A O     1 
ATOM   3809  C  CB    . ILE A 1  896 ? 158.185 141.452 101.131 1.00 30.96  ? 896  ILE A CB    1 
ATOM   3810  C  CG1   . ILE A 1  896 ? 158.379 142.842 101.744 1.00 30.96  ? 896  ILE A CG1   1 
ATOM   3811  C  CG2   . ILE A 1  896 ? 156.799 141.353 100.527 1.00 30.96  ? 896  ILE A CG2   1 
ATOM   3812  C  CD1   . ILE A 1  896 ? 158.438 143.924 100.749 1.00 30.96  ? 896  ILE A CD1   1 
ATOM   3813  N  N     . SER A 1  897 ? 160.746 140.868 102.653 1.00 43.98  ? 897  SER A N     1 
ATOM   3814  C  CA    . SER A 1  897 ? 162.151 140.749 103.058 1.00 43.98  ? 897  SER A CA    1 
ATOM   3815  C  C     . SER A 1  897 ? 162.699 142.160 103.195 1.00 43.98  ? 897  SER A C     1 
ATOM   3816  O  O     . SER A 1  897 ? 162.153 143.111 102.630 1.00 43.98  ? 897  SER A O     1 
ATOM   3817  C  CB    . SER A 1  897 ? 163.038 139.970 102.076 1.00 43.98  ? 897  SER A CB    1 
ATOM   3818  O  OG    . SER A 1  897 ? 162.644 138.613 101.986 1.00 43.98  ? 897  SER A OG    1 
ATOM   3819  N  N     . VAL A 1  898 ? 163.807 142.281 103.922 1.00 46.40  ? 898  VAL A N     1 
ATOM   3820  C  CA    . VAL A 1  898 ? 164.469 143.574 104.013 1.00 46.40  ? 898  VAL A CA    1 
ATOM   3821  C  C     . VAL A 1  898 ? 165.285 143.832 102.748 1.00 46.40  ? 898  VAL A C     1 
ATOM   3822  O  O     . VAL A 1  898 ? 165.446 144.985 102.331 1.00 46.40  ? 898  VAL A O     1 
ATOM   3823  C  CB    . VAL A 1  898 ? 165.324 143.622 105.292 1.00 46.40  ? 898  VAL A CB    1 
ATOM   3824  C  CG1   . VAL A 1  898 ? 165.962 144.992 105.504 1.00 46.40  ? 898  VAL A CG1   1 
ATOM   3825  C  CG2   . VAL A 1  898 ? 164.485 143.231 106.495 1.00 46.40  ? 898  VAL A CG2   1 
ATOM   3826  N  N     . GLU A 1  899 ? 165.764 142.770 102.093 1.00 56.75  ? 899  GLU A N     1 
ATOM   3827  C  CA    . GLU A 1  899 ? 166.566 142.926 100.881 1.00 56.75  ? 899  GLU A CA    1 
ATOM   3828  C  C     . GLU A 1  899 ? 165.733 143.421 99.707  1.00 56.75  ? 899  GLU A C     1 
ATOM   3829  O  O     . GLU A 1  899 ? 166.085 144.415 99.062  1.00 56.75  ? 899  GLU A O     1 
ATOM   3830  C  CB    . GLU A 1  899 ? 167.247 141.606 100.525 1.00 56.75  ? 899  GLU A CB    1 
ATOM   3831  C  CG    . GLU A 1  899 ? 167.901 141.599 99.143  1.00 56.75  ? 899  GLU A CG    1 
ATOM   3832  C  CD    . GLU A 1  899 ? 169.055 142.579 98.998  1.00 56.75  ? 899  GLU A CD    1 
ATOM   3833  O  OE1   . GLU A 1  899 ? 169.735 142.874 100.004 1.00 56.75  ? 899  GLU A OE1   1 
ATOM   3834  O  OE2   . GLU A 1  899 ? 169.277 143.061 97.866  1.00 56.75  ? 899  GLU A OE2   1 
ATOM   3835  N  N     . GLU A 1  900 ? 164.626 142.744 99.409  1.00 48.83  ? 900  GLU A N     1 
ATOM   3836  C  CA    . GLU A 1  900 ? 163.802 143.149 98.279  1.00 48.83  ? 900  GLU A CA    1 
ATOM   3837  C  C     . GLU A 1  900 ? 162.952 144.381 98.562  1.00 48.83  ? 900  GLU A C     1 
ATOM   3838  O  O     . GLU A 1  900 ? 162.329 144.907 97.636  1.00 48.83  ? 900  GLU A O     1 
ATOM   3839  C  CB    . GLU A 1  900 ? 162.934 141.975 97.816  1.00 48.83  ? 900  GLU A CB    1 
ATOM   3840  C  CG    . GLU A 1  900 ? 162.070 141.337 98.865  1.00 48.83  ? 900  GLU A CG    1 
ATOM   3841  C  CD    . GLU A 1  900 ? 161.313 140.139 98.326  1.00 48.83  ? 900  GLU A CD    1 
ATOM   3842  O  OE1   . GLU A 1  900 ? 161.328 139.934 97.095  1.00 48.83  ? 900  GLU A OE1   1 
ATOM   3843  O  OE2   . GLU A 1  900 ? 160.752 139.368 99.131  1.00 48.83  ? 900  GLU A OE2   1 
ATOM   3844  N  N     . ALA A 1  901 ? 162.921 144.868 99.802  1.00 43.33  ? 901  ALA A N     1 
ATOM   3845  C  CA    . ALA A 1  901 ? 162.381 146.199 100.043 1.00 43.33  ? 901  ALA A CA    1 
ATOM   3846  C  C     . ALA A 1  901 ? 163.419 147.270 99.733  1.00 43.33  ? 901  ALA A C     1 
ATOM   3847  O  O     . ALA A 1  901 ? 163.085 148.313 99.163  1.00 43.33  ? 901  ALA A O     1 
ATOM   3848  C  CB    . ALA A 1  901 ? 161.897 146.323 101.484 1.00 43.33  ? 901  ALA A CB    1 
ATOM   3849  N  N     . LYS A 1  902 ? 164.684 147.021 100.089 1.00 45.13  ? 902  LYS A N     1 
ATOM   3850  C  CA    . LYS A 1  902 ? 165.750 147.966 99.771  1.00 45.13  ? 902  LYS A CA    1 
ATOM   3851  C  C     . LYS A 1  902 ? 166.065 147.981 98.283  1.00 45.13  ? 902  LYS A C     1 
ATOM   3852  O  O     . LYS A 1  902 ? 166.472 149.018 97.754  1.00 45.13  ? 902  LYS A O     1 
ATOM   3853  C  CB    . LYS A 1  902 ? 167.009 147.638 100.576 1.00 45.13  ? 902  LYS A CB    1 
ATOM   3854  C  CG    . LYS A 1  902 ? 166.896 147.942 102.062 1.00 45.13  ? 902  LYS A CG    1 
ATOM   3855  C  CD    . LYS A 1  902 ? 168.212 147.733 102.793 1.00 45.13  ? 902  LYS A CD    1 
ATOM   3856  C  CE    . LYS A 1  902 ? 168.503 146.256 102.992 1.00 45.13  ? 902  LYS A CE    1 
ATOM   3857  N  NZ    . LYS A 1  902 ? 169.723 146.027 103.816 1.00 45.13  ? 902  LYS A NZ    1 
ATOM   3858  N  N     . ARG A 1  903 ? 165.882 146.851 97.595  1.00 46.57  ? 903  ARG A N     1 
ATOM   3859  C  CA    . ARG A 1  903 ? 166.117 146.806 96.154  1.00 46.57  ? 903  ARG A CA    1 
ATOM   3860  C  C     . ARG A 1  903 ? 165.102 147.654 95.399  1.00 46.57  ? 903  ARG A C     1 
ATOM   3861  O  O     . ARG A 1  903 ? 165.440 148.294 94.396  1.00 46.57  ? 903  ARG A O     1 
ATOM   3862  C  CB    . ARG A 1  903 ? 166.093 145.354 95.670  1.00 46.57  ? 903  ARG A CB    1 
ATOM   3863  C  CG    . ARG A 1  903 ? 166.282 145.167 94.171  1.00 46.57  ? 903  ARG A CG    1 
ATOM   3864  C  CD    . ARG A 1  903 ? 166.479 143.702 93.812  1.00 46.57  ? 903  ARG A CD    1 
ATOM   3865  N  NE    . ARG A 1  903 ? 166.616 143.504 92.370  1.00 46.57  ? 903  ARG A NE    1 
ATOM   3866  C  CZ    . ARG A 1  903 ? 165.629 143.111 91.573  1.00 46.57  ? 903  ARG A CZ    1 
ATOM   3867  N  NH1   . ARG A 1  903 ? 164.441 142.835 92.081  1.00 46.57  ? 903  ARG A NH1   1 
ATOM   3868  N  NH2   . ARG A 1  903 ? 165.836 142.963 90.273  1.00 46.57  ? 903  ARG A NH2   1 
ATOM   3869  N  N     . ALA A 1  904 ? 163.865 147.708 95.888  1.00 44.95  ? 904  ALA A N     1 
ATOM   3870  C  CA    . ALA A 1  904 ? 162.844 148.524 95.250  1.00 44.95  ? 904  ALA A CA    1 
ATOM   3871  C  C     . ALA A 1  904 ? 162.996 150.010 95.546  1.00 44.95  ? 904  ALA A C     1 
ATOM   3872  O  O     . ALA A 1  904 ? 162.498 150.831 94.770  1.00 44.95  ? 904  ALA A O     1 
ATOM   3873  C  CB    . ALA A 1  904 ? 161.456 148.057 95.682  1.00 44.95  ? 904  ALA A CB    1 
ATOM   3874  N  N     . MET A 1  905 ? 163.666 150.379 96.639  1.00 47.29  ? 905  MET A N     1 
ATOM   3875  C  CA    . MET A 1  905 ? 163.788 151.782 97.011  1.00 47.29  ? 905  MET A CA    1 
ATOM   3876  C  C     . MET A 1  905 ? 165.096 152.417 96.570  1.00 47.29  ? 905  MET A C     1 
ATOM   3877  O  O     . MET A 1  905 ? 165.190 153.648 96.547  1.00 47.29  ? 905  MET A O     1 
ATOM   3878  C  CB    . MET A 1  905 ? 163.621 151.947 98.525  1.00 47.29  ? 905  MET A CB    1 
ATOM   3879  C  CG    . MET A 1  905 ? 162.256 151.505 98.978  1.00 47.29  ? 905  MET A CG    1 
ATOM   3880  S  SD    . MET A 1  905 ? 160.989 152.435 98.106  1.00 47.29  ? 905  MET A SD    1 
ATOM   3881  C  CE    . MET A 1  905 ? 159.563 151.408 98.410  1.00 47.29  ? 905  MET A CE    1 
ATOM   3882  N  N     . ASN A 1  906 ? 166.097 151.618 96.221  1.00 57.43  ? 906  ASN A N     1 
ATOM   3883  C  CA    . ASN A 1  906 ? 167.303 152.113 95.573  1.00 57.43  ? 906  ASN A CA    1 
ATOM   3884  C  C     . ASN A 1  906 ? 167.146 152.249 94.066  1.00 57.43  ? 906  ASN A C     1 
ATOM   3885  O  O     . ASN A 1  906 ? 168.089 152.679 93.395  1.00 57.43  ? 906  ASN A O     1 
ATOM   3886  C  CB    . ASN A 1  906 ? 168.479 151.194 95.907  1.00 57.43  ? 906  ASN A CB    1 
ATOM   3887  C  CG    . ASN A 1  906 ? 169.011 151.421 97.308  1.00 57.43  ? 906  ASN A CG    1 
ATOM   3888  O  OD1   . ASN A 1  906 ? 168.695 150.703 98.236  1.00 57.43  ? 906  ASN A OD1   1 
ATOM   3889  N  ND2   . ASN A 1  906 ? 169.888 152.381 97.442  1.00 57.43  ? 906  ASN A ND2   1 
ATOM   3890  N  N     . GLU A 1  907 ? 165.985 151.894 93.520  1.00 62.18  ? 907  GLU A N     1 
ATOM   3891  C  CA    . GLU A 1  907 ? 165.677 152.133 92.116  1.00 62.18  ? 907  GLU A CA    1 
ATOM   3892  C  C     . GLU A 1  907 ? 165.039 153.498 91.898  1.00 62.18  ? 907  GLU A C     1 
ATOM   3893  O  O     . GLU A 1  907 ? 165.346 154.173 90.908  1.00 62.18  ? 907  GLU A O     1 
ATOM   3894  C  CB    . GLU A 1  907 ? 164.761 151.025 91.587  1.00 62.18  ? 907  GLU A CB    1 
ATOM   3895  C  CG    . GLU A 1  907 ? 164.333 151.194 90.139  1.00 62.18  ? 907  GLU A CG    1 
ATOM   3896  C  CD    . GLU A 1  907 ? 163.581 149.998 89.607  1.00 62.18  ? 907  GLU A CD    1 
ATOM   3897  O  OE1   . GLU A 1  907 ? 163.456 149.002 90.345  1.00 62.18  ? 907  GLU A OE1   1 
ATOM   3898  O  OE2   . GLU A 1  907 ? 163.108 150.057 88.452  1.00 62.18  ? 907  GLU A OE2   1 
ATOM   3899  N  N     . ASP A 1  908 ? 164.167 153.913 92.816  1.00 60.99  ? 908  ASP A N     1 
ATOM   3900  C  CA    . ASP A 1  908 ? 163.514 155.213 92.734  1.00 60.99  ? 908  ASP A CA    1 
ATOM   3901  C  C     . ASP A 1  908 ? 164.523 156.345 92.858  1.00 60.99  ? 908  ASP A C     1 
ATOM   3902  O  O     . ASP A 1  908 ? 165.414 156.312 93.708  1.00 60.99  ? 908  ASP A O     1 
ATOM   3903  C  CB    . ASP A 1  908 ? 162.456 155.330 93.828  1.00 60.99  ? 908  ASP A CB    1 
ATOM   3904  C  CG    . ASP A 1  908 ? 161.779 156.677 93.837  1.00 60.99  ? 908  ASP A CG    1 
ATOM   3905  O  OD1   . ASP A 1  908 ? 160.987 156.961 92.914  1.00 60.99  ? 908  ASP A OD1   1 
ATOM   3906  O  OD2   . ASP A 1  908 ? 162.037 157.449 94.780  1.00 60.99  ? 908  ASP A OD2   1 
ATOM   3907  N  N     . GLU A 1  909 ? 164.367 157.357 92.003  1.00 61.57  ? 909  GLU A N     1 
ATOM   3908  C  CA    . GLU A 1  909 ? 165.407 158.368 91.843  1.00 61.57  ? 909  GLU A CA    1 
ATOM   3909  C  C     . GLU A 1  909 ? 165.453 159.325 93.027  1.00 61.57  ? 909  GLU A C     1 
ATOM   3910  O  O     . GLU A 1  909 ? 166.532 159.618 93.554  1.00 61.57  ? 909  GLU A O     1 
ATOM   3911  C  CB    . GLU A 1  909 ? 165.193 159.140 90.540  1.00 61.57  ? 909  GLU A CB    1 
ATOM   3912  C  CG    . GLU A 1  909 ? 166.223 160.236 90.283  1.00 61.57  ? 909  GLU A CG    1 
ATOM   3913  C  CD    . GLU A 1  909 ? 167.615 159.697 90.013  1.00 61.57  ? 909  GLU A CD    1 
ATOM   3914  O  OE1   . GLU A 1  909 ? 167.733 158.568 89.493  1.00 61.57  ? 909  GLU A OE1   1 
ATOM   3915  O  OE2   . GLU A 1  909 ? 168.597 160.405 90.325  1.00 61.57  ? 909  GLU A OE2   1 
ATOM   3916  N  N     . THR A 1  910 ? 164.296 159.824 93.464  1.00 58.47  ? 910  THR A N     1 
ATOM   3917  C  CA    . THR A 1  910 ? 164.309 160.877 94.471  1.00 58.47  ? 910  THR A CA    1 
ATOM   3918  C  C     . THR A 1  910 ? 164.628 160.367 95.871  1.00 58.47  ? 910  THR A C     1 
ATOM   3919  O  O     . THR A 1  910 ? 165.183 161.122 96.671  1.00 58.47  ? 910  THR A O     1 
ATOM   3920  C  CB    . THR A 1  910 ? 162.983 161.645 94.477  1.00 58.47  ? 910  THR A CB    1 
ATOM   3921  O  OG1   . THR A 1  910 ? 163.028 162.653 95.493  1.00 58.47  ? 910  THR A OG1   1 
ATOM   3922  C  CG2   . THR A 1  910 ? 161.794 160.731 94.709  1.00 58.47  ? 910  THR A CG2   1 
ATOM   3923  N  N     . LEU A 1  911 ? 164.326 159.106 96.188  1.00 52.53  ? 911  LEU A N     1 
ATOM   3924  C  CA    . LEU A 1  911 ? 164.580 158.635 97.546  1.00 52.53  ? 911  LEU A CA    1 
ATOM   3925  C  C     . LEU A 1  911 ? 166.021 158.192 97.760  1.00 52.53  ? 911  LEU A C     1 
ATOM   3926  O  O     . LEU A 1  911 ? 166.526 158.284 98.884  1.00 52.53  ? 911  LEU A O     1 
ATOM   3927  C  CB    . LEU A 1  911 ? 163.644 157.484 97.907  1.00 52.53  ? 911  LEU A CB    1 
ATOM   3928  C  CG    . LEU A 1  911 ? 162.174 157.801 98.138  1.00 52.53  ? 911  LEU A CG    1 
ATOM   3929  C  CD1   . LEU A 1  911 ? 161.449 156.515 98.430  1.00 52.53  ? 911  LEU A CD1   1 
ATOM   3930  C  CD2   . LEU A 1  911 ? 162.014 158.778 99.284  1.00 52.53  ? 911  LEU A CD2   1 
ATOM   3931  N  N     . ARG A 1  912 ? 166.697 157.704 96.720  1.00 61.43  ? 912  ARG A N     1 
ATOM   3932  C  CA    . ARG A 1  912 ? 168.047 157.189 96.905  1.00 61.43  ? 912  ARG A CA    1 
ATOM   3933  C  C     . ARG A 1  912 ? 169.085 158.294 97.047  1.00 61.43  ? 912  ARG A C     1 
ATOM   3934  O  O     . ARG A 1  912 ? 170.164 158.041 97.592  1.00 61.43  ? 912  ARG A O     1 
ATOM   3935  C  CB    . ARG A 1  912 ? 168.421 156.263 95.748  1.00 61.43  ? 912  ARG A CB    1 
ATOM   3936  C  CG    . ARG A 1  912 ? 168.551 156.951 94.410  1.00 61.43  ? 912  ARG A CG    1 
ATOM   3937  C  CD    . ARG A 1  912 ? 168.720 155.929 93.312  1.00 61.43  ? 912  ARG A CD    1 
ATOM   3938  N  NE    . ARG A 1  912 ? 168.803 156.544 91.994  1.00 61.43  ? 912  ARG A NE    1 
ATOM   3939  C  CZ    . ARG A 1  912 ? 168.866 155.854 90.862  1.00 61.43  ? 912  ARG A CZ    1 
ATOM   3940  N  NH1   . ARG A 1  912 ? 168.940 156.486 89.700  1.00 61.43  ? 912  ARG A NH1   1 
ATOM   3941  N  NH2   . ARG A 1  912 ? 168.837 154.529 90.892  1.00 61.43  ? 912  ARG A NH2   1 
ATOM   3942  N  N     . ASN A 1  913 ? 168.785 159.509 96.585  1.00 66.18  ? 913  ASN A N     1 
ATOM   3943  C  CA    . ASN A 1  913 ? 169.713 160.613 96.788  1.00 66.18  ? 913  ASN A CA    1 
ATOM   3944  C  C     . ASN A 1  913 ? 169.597 161.185 98.195  1.00 66.18  ? 913  ASN A C     1 
ATOM   3945  O  O     . ASN A 1  913 ? 170.613 161.502 98.822  1.00 66.18  ? 913  ASN A O     1 
ATOM   3946  C  CB    . ASN A 1  913 ? 169.484 161.704 95.743  1.00 66.18  ? 913  ASN A CB    1 
ATOM   3947  C  CG    . ASN A 1  913 ? 169.809 161.239 94.338  1.00 66.18  ? 913  ASN A CG    1 
ATOM   3948  O  OD1   . ASN A 1  913 ? 168.947 161.219 93.462  1.00 66.18  ? 913  ASN A OD1   1 
ATOM   3949  N  ND2   . ASN A 1  913 ? 171.057 160.844 94.122  1.00 66.18  ? 913  ASN A ND2   1 
ATOM   3950  N  N     . LEU A 1  914 ? 168.379 161.321 98.708  1.00 58.53  ? 914  LEU A N     1 
ATOM   3951  C  CA    . LEU A 1  914 ? 168.194 161.773 100.081 1.00 58.53  ? 914  LEU A CA    1 
ATOM   3952  C  C     . LEU A 1  914 ? 168.457 160.643 101.074 1.00 58.53  ? 914  LEU A C     1 
ATOM   3953  O  O     . LEU A 1  914 ? 168.462 160.858 102.285 1.00 58.53  ? 914  LEU A O     1 
ATOM   3954  C  CB    . LEU A 1  914 ? 166.788 162.363 100.279 1.00 58.53  ? 914  LEU A CB    1 
ATOM   3955  C  CG    . LEU A 1  914 ? 165.496 161.644 99.870  1.00 58.53  ? 914  LEU A CG    1 
ATOM   3956  C  CD1   . LEU A 1  914 ? 165.023 160.584 100.841 1.00 58.53  ? 914  LEU A CD1   1 
ATOM   3957  C  CD2   . LEU A 1  914 ? 164.395 162.674 99.664  1.00 58.53  ? 914  LEU A CD2   1 
ATOM   3958  O  OXT   . LEU A 1  914 ? 168.658 159.492 100.690 1.00 58.53  ? 914  LEU A OXT   1 
ATOM   3959  N  N     . ALA B 2  236 ? 166.123 133.352 168.165 1.00 30.00  ? 236  ALA B N     1 
ATOM   3960  C  CA    . ALA B 2  236 ? 166.256 134.135 166.942 1.00 30.00  ? 236  ALA B CA    1 
ATOM   3961  C  C     . ALA B 2  236 ? 165.554 135.481 167.079 1.00 30.00  ? 236  ALA B C     1 
ATOM   3962  O  O     . ALA B 2  236 ? 166.199 136.520 167.207 1.00 30.00  ? 236  ALA B O     1 
ATOM   3963  C  CB    . ALA B 2  236 ? 165.698 133.364 165.757 1.00 30.00  ? 236  ALA B CB    1 
ATOM   3964  N  N     . SER B 2  237 ? 164.227 135.451 167.052 1.00 36.00  ? 237  SER B N     1 
ATOM   3965  C  CA    . SER B 2  237 ? 163.423 136.656 167.167 1.00 36.00  ? 237  SER B CA    1 
ATOM   3966  C  C     . SER B 2  237 ? 163.003 136.875 168.613 1.00 36.00  ? 237  SER B C     1 
ATOM   3967  O  O     . SER B 2  237 ? 162.921 135.934 169.406 1.00 36.00  ? 237  SER B O     1 
ATOM   3968  C  CB    . SER B 2  237 ? 162.185 136.566 166.276 1.00 30.00  ? 237  SER B CB    1 
ATOM   3969  O  OG    . SER B 2  237 ? 161.310 135.550 166.728 1.00 30.00  ? 237  SER B OG    1 
ATOM   3970  N  N     . SER B 2  238 ? 162.733 138.136 168.950 1.00 39.07  ? 238  SER B N     1 
ATOM   3971  C  CA    . SER B 2  238 ? 162.331 138.463 170.312 1.00 39.07  ? 238  SER B CA    1 
ATOM   3972  C  C     . SER B 2  238 ? 160.844 138.220 170.530 1.00 39.07  ? 238  SER B C     1 
ATOM   3973  O  O     . SER B 2  238 ? 160.440 137.764 171.605 1.00 39.07  ? 238  SER B O     1 
ATOM   3974  C  CB    . SER B 2  238 ? 162.691 139.913 170.630 1.00 39.07  ? 238  SER B CB    1 
ATOM   3975  O  OG    . SER B 2  238 ? 161.933 140.807 169.840 1.00 39.07  ? 238  SER B OG    1 
ATOM   3976  N  N     . PHE B 2  239 ? 160.020 138.506 169.527 1.00 31.95  ? 239  PHE B N     1 
ATOM   3977  C  CA    . PHE B 2  239 ? 158.588 138.272 169.606 1.00 31.95  ? 239  PHE B CA    1 
ATOM   3978  C  C     . PHE B 2  239 ? 158.235 137.006 168.840 1.00 31.95  ? 239  PHE B C     1 
ATOM   3979  O  O     . PHE B 2  239 ? 158.848 136.689 167.819 1.00 31.95  ? 239  PHE B O     1 
ATOM   3980  C  CB    . PHE B 2  239 ? 157.800 139.449 169.034 1.00 31.95  ? 239  PHE B CB    1 
ATOM   3981  C  CG    . PHE B 2  239 ? 158.121 140.765 169.675 1.00 31.95  ? 239  PHE B CG    1 
ATOM   3982  C  CD1   . PHE B 2  239 ? 157.724 141.037 170.971 1.00 31.95  ? 239  PHE B CD1   1 
ATOM   3983  C  CD2   . PHE B 2  239 ? 158.778 141.751 168.959 1.00 31.95  ? 239  PHE B CD2   1 
ATOM   3984  C  CE1   . PHE B 2  239 ? 158.013 142.252 171.554 1.00 31.95  ? 239  PHE B CE1   1 
ATOM   3985  C  CE2   . PHE B 2  239 ? 159.059 142.970 169.533 1.00 31.95  ? 239  PHE B CE2   1 
ATOM   3986  C  CZ    . PHE B 2  239 ? 158.675 143.219 170.830 1.00 31.95  ? 239  PHE B CZ    1 
ATOM   3987  N  N     . LEU B 2  240 ? 157.239 136.281 169.342 1.00 27.07  ? 240  LEU B N     1 
ATOM   3988  C  CA    . LEU B 2  240 ? 156.802 135.036 168.722 1.00 27.07  ? 240  LEU B CA    1 
ATOM   3989  C  C     . LEU B 2  240 ? 155.390 135.092 168.172 1.00 27.07  ? 240  LEU B C     1 
ATOM   3990  O  O     . LEU B 2  240 ? 155.153 134.621 167.059 1.00 27.07  ? 240  LEU B O     1 
ATOM   3991  C  CB    . LEU B 2  240 ? 156.906 133.875 169.713 1.00 27.07  ? 240  LEU B CB    1 
ATOM   3992  C  CG    . LEU B 2  240 ? 158.328 133.436 170.041 1.00 27.07  ? 240  LEU B CG    1 
ATOM   3993  C  CD1   . LEU B 2  240 ? 158.317 132.346 171.086 1.00 27.07  ? 240  LEU B CD1   1 
ATOM   3994  C  CD2   . LEU B 2  240 ? 159.014 132.956 168.783 1.00 27.07  ? 240  LEU B CD2   1 
ATOM   3995  N  N     . ASP B 2  241 ? 154.435 135.650 168.911 1.00 28.85  ? 241  ASP B N     1 
ATOM   3996  C  CA    . ASP B 2  241 ? 153.083 135.767 168.389 1.00 28.85  ? 241  ASP B CA    1 
ATOM   3997  C  C     . ASP B 2  241 ? 152.468 137.110 168.752 1.00 28.85  ? 241  ASP B C     1 
ATOM   3998  O  O     . ASP B 2  241 ? 152.365 137.449 169.932 1.00 28.85  ? 241  ASP B O     1 
ATOM   3999  C  CB    . ASP B 2  241 ? 152.184 134.609 168.867 1.00 28.85  ? 241  ASP B CB    1 
ATOM   4000  C  CG    . ASP B 2  241 ? 152.082 134.483 170.374 1.00 28.85  ? 241  ASP B CG    1 
ATOM   4001  O  OD1   . ASP B 2  241 ? 152.930 135.017 171.102 1.00 28.85  ? 241  ASP B OD1   1 
ATOM   4002  O  OD2   . ASP B 2  241 ? 151.092 133.891 170.842 1.00 28.85  ? 241  ASP B OD2   1 
ATOM   4003  N  N     . THR B 2  242 ? 152.222 137.938 167.735 1.00 25.26  ? 242  THR B N     1 
ATOM   4004  C  CA    . THR B 2  242 ? 151.154 138.938 167.629 1.00 25.26  ? 242  THR B CA    1 
ATOM   4005  C  C     . THR B 2  242 ? 151.371 139.449 166.207 1.00 25.26  ? 242  THR B C     1 
ATOM   4006  O  O     . THR B 2  242 ? 152.061 138.789 165.427 1.00 25.26  ? 242  THR B O     1 
ATOM   4007  C  CB    . THR B 2  242 ? 151.181 140.096 168.662 1.00 25.26  ? 242  THR B CB    1 
ATOM   4008  O  OG1   . THR B 2  242 ? 151.536 139.625 169.964 1.00 25.26  ? 242  THR B OG1   1 
ATOM   4009  C  CG2   . THR B 2  242 ? 149.782 140.614 168.880 1.00 25.26  ? 242  THR B CG2   1 
ATOM   4010  N  N     . PHE B 2  243 ? 150.791 140.595 165.838 1.00 21.72  ? 243  PHE B N     1 
ATOM   4011  C  CA    . PHE B 2  243 ? 151.354 141.388 164.753 1.00 21.72  ? 243  PHE B CA    1 
ATOM   4012  C  C     . PHE B 2  243 ? 152.791 141.799 165.054 1.00 21.72  ? 243  PHE B C     1 
ATOM   4013  O  O     . PHE B 2  243 ? 153.568 142.043 164.125 1.00 21.72  ? 243  PHE B O     1 
ATOM   4014  C  CB    . PHE B 2  243 ? 150.492 142.629 164.493 1.00 21.72  ? 243  PHE B CB    1 
ATOM   4015  C  CG    . PHE B 2  243 ? 150.585 143.693 165.561 1.00 21.72  ? 243  PHE B CG    1 
ATOM   4016  C  CD1   . PHE B 2  243 ? 149.821 143.614 166.709 1.00 21.72  ? 243  PHE B CD1   1 
ATOM   4017  C  CD2   . PHE B 2  243 ? 151.395 144.808 165.382 1.00 21.72  ? 243  PHE B CD2   1 
ATOM   4018  C  CE1   . PHE B 2  243 ? 149.900 144.595 167.675 1.00 21.72  ? 243  PHE B CE1   1 
ATOM   4019  C  CE2   . PHE B 2  243 ? 151.473 145.785 166.346 1.00 21.72  ? 243  PHE B CE2   1 
ATOM   4020  C  CZ    . PHE B 2  243 ? 150.721 145.679 167.491 1.00 21.72  ? 243  PHE B CZ    1 
ATOM   4021  N  N     . GLU B 2  244 ? 153.139 141.938 166.341 1.00 26.64  ? 244  GLU B N     1 
ATOM   4022  C  CA    . GLU B 2  244 ? 154.529 142.099 166.753 1.00 26.64  ? 244  GLU B CA    1 
ATOM   4023  C  C     . GLU B 2  244 ? 155.386 140.941 166.271 1.00 26.64  ? 244  GLU B C     1 
ATOM   4024  O  O     . GLU B 2  244 ? 156.482 141.150 165.747 1.00 26.64  ? 244  GLU B O     1 
ATOM   4025  C  CB    . GLU B 2  244 ? 154.613 142.202 168.275 1.00 26.64  ? 244  GLU B CB    1 
ATOM   4026  C  CG    . GLU B 2  244 ? 153.920 143.403 168.882 1.00 26.64  ? 244  GLU B CG    1 
ATOM   4027  C  CD    . GLU B 2  244 ? 154.597 144.713 168.539 1.00 26.64  ? 244  GLU B CD    1 
ATOM   4028  O  OE1   . GLU B 2  244 ? 155.830 144.723 168.346 1.00 26.64  ? 244  GLU B OE1   1 
ATOM   4029  O  OE2   . GLU B 2  244 ? 153.894 145.740 168.479 1.00 26.64  ? 244  GLU B OE2   1 
ATOM   4030  N  N     . GLY B 2  245 ? 154.898 139.711 166.433 1.00 20.77  ? 245  GLY B N     1 
ATOM   4031  C  CA    . GLY B 2  245 ? 155.647 138.561 165.960 1.00 20.77  ? 245  GLY B CA    1 
ATOM   4032  C  C     . GLY B 2  245 ? 155.645 138.428 164.454 1.00 20.77  ? 245  GLY B C     1 
ATOM   4033  O  O     . GLY B 2  245 ? 156.563 137.837 163.882 1.00 20.77  ? 245  GLY B O     1 
ATOM   4034  N  N     . TYR B 2  246 ? 154.614 138.956 163.793 1.00 19.31  ? 246  TYR B N     1 
ATOM   4035  C  CA    . TYR B 2  246 ? 154.584 138.969 162.335 1.00 19.31  ? 246  TYR B CA    1 
ATOM   4036  C  C     . TYR B 2  246 ? 155.632 139.922 161.781 1.00 19.31  ? 246  TYR B C     1 
ATOM   4037  O  O     . TYR B 2  246 ? 156.366 139.583 160.848 1.00 19.31  ? 246  TYR B O     1 
ATOM   4038  C  CB    . TYR B 2  246 ? 153.193 139.371 161.848 1.00 19.31  ? 246  TYR B CB    1 
ATOM   4039  C  CG    . TYR B 2  246 ? 153.024 139.348 160.347 1.00 19.31  ? 246  TYR B CG    1 
ATOM   4040  C  CD1   . TYR B 2  246 ? 152.795 138.162 159.684 1.00 19.31  ? 246  TYR B CD1   1 
ATOM   4041  C  CD2   . TYR B 2  246 ? 153.100 140.510 159.594 1.00 19.31  ? 246  TYR B CD2   1 
ATOM   4042  C  CE1   . TYR B 2  246 ? 152.645 138.123 158.317 1.00 19.31  ? 246  TYR B CE1   1 
ATOM   4043  C  CE2   . TYR B 2  246 ? 152.953 140.482 158.226 1.00 19.31  ? 246  TYR B CE2   1 
ATOM   4044  C  CZ    . TYR B 2  246 ? 152.719 139.286 157.597 1.00 19.31  ? 246  TYR B CZ    1 
ATOM   4045  O  OH    . TYR B 2  246 ? 152.572 139.236 156.233 1.00 19.31  ? 246  TYR B OH    1 
ATOM   4046  N  N     . PHE B 2  247 ? 155.710 141.126 162.348 1.00 20.85  ? 247  PHE B N     1 
ATOM   4047  C  CA    . PHE B 2  247 ? 156.611 142.150 161.835 1.00 20.85  ? 247  PHE B CA    1 
ATOM   4048  C  C     . PHE B 2  247 ? 158.063 141.853 162.180 1.00 20.85  ? 247  PHE B C     1 
ATOM   4049  O  O     . PHE B 2  247 ? 158.970 142.282 161.458 1.00 20.85  ? 247  PHE B O     1 
ATOM   4050  C  CB    . PHE B 2  247 ? 156.201 143.510 162.394 1.00 20.85  ? 247  PHE B CB    1 
ATOM   4051  C  CG    . PHE B 2  247 ? 154.890 144.015 161.866 1.00 20.85  ? 247  PHE B CG    1 
ATOM   4052  C  CD1   . PHE B 2  247 ? 154.407 143.590 160.643 1.00 20.85  ? 247  PHE B CD1   1 
ATOM   4053  C  CD2   . PHE B 2  247 ? 154.120 144.886 162.617 1.00 20.85  ? 247  PHE B CD2   1 
ATOM   4054  C  CE1   . PHE B 2  247 ? 153.200 144.045 160.165 1.00 20.85  ? 247  PHE B CE1   1 
ATOM   4055  C  CE2   . PHE B 2  247 ? 152.907 145.338 162.145 1.00 20.85  ? 247  PHE B CE2   1 
ATOM   4056  C  CZ    . PHE B 2  247 ? 152.451 144.919 160.921 1.00 20.85  ? 247  PHE B CZ    1 
ATOM   4057  N  N     . ASP B 2  248 ? 158.306 141.124 163.266 1.00 25.05  ? 248  ASP B N     1 
ATOM   4058  C  CA    . ASP B 2  248 ? 159.663 140.888 163.734 1.00 25.05  ? 248  ASP B CA    1 
ATOM   4059  C  C     . ASP B 2  248 ? 160.283 139.625 163.152 1.00 25.05  ? 248  ASP B C     1 
ATOM   4060  O  O     . ASP B 2  248 ? 161.512 139.527 163.094 1.00 25.05  ? 248  ASP B O     1 
ATOM   4061  C  CB    . ASP B 2  248 ? 159.676 140.819 165.264 1.00 25.05  ? 248  ASP B CB    1 
ATOM   4062  C  CG    . ASP B 2  248 ? 161.069 140.847 165.841 1.00 25.05  ? 248  ASP B CG    1 
ATOM   4063  O  OD1   . ASP B 2  248 ? 161.699 141.924 165.833 1.00 25.05  ? 248  ASP B OD1   1 
ATOM   4064  O  OD2   . ASP B 2  248 ? 161.532 139.790 166.310 1.00 25.05  ? 248  ASP B OD2   1 
ATOM   4065  N  N     . GLN B 2  249 ? 159.479 138.664 162.709 1.00 22.90  ? 249  GLN B N     1 
ATOM   4066  C  CA    . GLN B 2  249 ? 160.030 137.450 162.128 1.00 22.90  ? 249  GLN B CA    1 
ATOM   4067  C  C     . GLN B 2  249 ? 160.227 137.535 160.623 1.00 22.90  ? 249  GLN B C     1 
ATOM   4068  O  O     . GLN B 2  249 ? 160.847 136.637 160.048 1.00 22.90  ? 249  GLN B O     1 
ATOM   4069  C  CB    . GLN B 2  249 ? 159.146 136.242 162.452 1.00 22.90  ? 249  GLN B CB    1 
ATOM   4070  C  CG    . GLN B 2  249 ? 159.211 135.806 163.901 1.00 22.90  ? 249  GLN B CG    1 
ATOM   4071  C  CD    . GLN B 2  249 ? 158.429 134.542 164.162 1.00 22.90  ? 249  GLN B CD    1 
ATOM   4072  O  OE1   . GLN B 2  249 ? 157.763 134.017 163.273 1.00 22.90  ? 249  GLN B OE1   1 
ATOM   4073  N  NE2   . GLN B 2  249 ? 158.516 134.035 165.383 1.00 22.90  ? 249  GLN B NE2   1 
ATOM   4074  N  N     . ARG B 2  250 ? 159.726 138.575 159.972 1.00 28.26  ? 250  ARG B N     1 
ATOM   4075  C  CA    . ARG B 2  250 ? 159.888 138.723 158.527 1.00 28.26  ? 250  ARG B CA    1 
ATOM   4076  C  C     . ARG B 2  250 ? 161.047 139.666 158.216 1.00 28.26  ? 250  ARG B C     1 
ATOM   4077  O  O     . ARG B 2  250 ? 160.887 140.728 157.620 1.00 28.26  ? 250  ARG B O     1 
ATOM   4078  C  CB    . ARG B 2  250 ? 158.587 139.207 157.903 1.00 28.26  ? 250  ARG B CB    1 
ATOM   4079  C  CG    . ARG B 2  250 ? 157.462 138.212 158.059 1.00 28.26  ? 250  ARG B CG    1 
ATOM   4080  C  CD    . ARG B 2  250 ? 156.160 138.756 157.541 1.00 28.26  ? 250  ARG B CD    1 
ATOM   4081  N  NE    . ARG B 2  250 ? 156.147 138.903 156.091 1.00 28.26  ? 250  ARG B NE    1 
ATOM   4082  C  CZ    . ARG B 2  250 ? 155.788 137.938 155.252 1.00 28.26  ? 250  ARG B CZ    1 
ATOM   4083  N  NH1   . ARG B 2  250 ? 155.428 136.752 155.722 1.00 28.26  ? 250  ARG B NH1   1 
ATOM   4084  N  NH2   . ARG B 2  250 ? 155.804 138.151 153.945 1.00 28.26  ? 250  ARG B NH2   1 
ATOM   4085  N  N     . LYS B 2  251 ? 162.234 139.251 158.638 1.00 38.40  ? 251  LYS B N     1 
ATOM   4086  C  CA    . LYS B 2  251 ? 163.449 140.022 158.437 1.00 38.40  ? 251  LYS B CA    1 
ATOM   4087  C  C     . LYS B 2  251 ? 164.205 139.519 157.216 1.00 38.40  ? 251  LYS B C     1 
ATOM   4088  O  O     . LYS B 2  251 ? 163.975 138.413 156.720 1.00 38.40  ? 251  LYS B O     1 
ATOM   4089  C  CB    . LYS B 2  251 ? 164.355 139.950 159.667 1.00 38.40  ? 251  LYS B CB    1 
ATOM   4090  C  CG    . LYS B 2  251 ? 163.761 140.538 160.924 1.00 38.40  ? 251  LYS B CG    1 
ATOM   4091  C  CD    . LYS B 2  251 ? 163.579 142.037 160.807 1.00 38.40  ? 251  LYS B CD    1 
ATOM   4092  C  CE    . LYS B 2  251 ? 163.076 142.625 162.111 1.00 38.40  ? 251  LYS B CE    1 
ATOM   4093  N  NZ    . LYS B 2  251 ? 162.835 144.085 162.006 1.00 38.40  ? 251  LYS B NZ    1 
ATOM   4094  N  N     . ILE B 2  252 ? 165.119 140.352 156.739 1.00 47.01  ? 252  ILE B N     1 
ATOM   4095  C  CA    . ILE B 2  252 ? 166.004 139.971 155.648 1.00 47.01  ? 252  ILE B CA    1 
ATOM   4096  C  C     . ILE B 2  252 ? 167.122 139.112 156.218 1.00 47.01  ? 252  ILE B C     1 
ATOM   4097  O  O     . ILE B 2  252 ? 167.772 139.491 157.198 1.00 47.01  ? 252  ILE B O     1 
ATOM   4098  C  CB    . ILE B 2  252 ? 166.561 141.217 154.941 1.00 47.01  ? 252  ILE B CB    1 
ATOM   4099  C  CG1   . ILE B 2  252 ? 165.420 142.116 154.466 1.00 47.01  ? 252  ILE B CG1   1 
ATOM   4100  C  CG2   . ILE B 2  252 ? 167.436 140.823 153.764 1.00 47.01  ? 252  ILE B CG2   1 
ATOM   4101  C  CD1   . ILE B 2  252 ? 164.487 141.451 153.478 1.00 47.01  ? 252  ILE B CD1   1 
ATOM   4102  N  N     . VAL B 2  253 ? 167.338 137.946 155.621 1.00 55.14  ? 253  VAL B N     1 
ATOM   4103  C  CA    . VAL B 2  253 ? 168.440 137.069 155.997 1.00 55.14  ? 253  VAL B CA    1 
ATOM   4104  C  C     . VAL B 2  253 ? 169.565 137.236 154.984 1.00 55.14  ? 253  VAL B C     1 
ATOM   4105  O  O     . VAL B 2  253 ? 169.321 137.312 153.773 1.00 55.14  ? 253  VAL B O     1 
ATOM   4106  C  CB    . VAL B 2  253 ? 167.978 135.606 156.117 1.00 55.14  ? 253  VAL B CB    1 
ATOM   4107  C  CG1   . VAL B 2  253 ? 167.135 135.439 157.367 1.00 55.14  ? 253  VAL B CG1   1 
ATOM   4108  C  CG2   . VAL B 2  253 ? 167.149 135.195 154.913 1.00 55.14  ? 253  VAL B CG2   1 
ATOM   4109  N  N     . ARG B 2  254 ? 170.793 137.341 155.481 1.00 64.00  ? 254  ARG B N     1 
ATOM   4110  C  CA    . ARG B 2  254 ? 171.928 137.578 154.607 1.00 64.00  ? 254  ARG B CA    1 
ATOM   4111  C  C     . ARG B 2  254 ? 172.317 136.291 153.888 1.00 64.00  ? 254  ARG B C     1 
ATOM   4112  O  O     . ARG B 2  254 ? 171.901 135.192 154.264 1.00 64.00  ? 254  ARG B O     1 
ATOM   4113  C  CB    . ARG B 2  254 ? 173.109 138.136 155.399 1.00 64.00  ? 254  ARG B CB    1 
ATOM   4114  C  CG    . ARG B 2  254 ? 172.837 139.506 155.999 1.00 64.00  ? 254  ARG B CG    1 
ATOM   4115  C  CD    . ARG B 2  254 ? 174.032 140.040 156.771 1.00 64.00  ? 254  ARG B CD    1 
ATOM   4116  N  NE    . ARG B 2  254 ? 175.150 140.366 155.891 1.00 64.00  ? 254  ARG B NE    1 
ATOM   4117  C  CZ    . ARG B 2  254 ? 176.363 140.701 156.318 1.00 64.00  ? 254  ARG B CZ    1 
ATOM   4118  N  NH1   . ARG B 2  254 ? 176.620 140.753 157.618 1.00 64.00  ? 254  ARG B NH1   1 
ATOM   4119  N  NH2   . ARG B 2  254 ? 177.320 140.982 155.445 1.00 64.00  ? 254  ARG B NH2   1 
ATOM   4120  N  N     . THR B 2  255 ? 173.124 136.445 152.834 1.00 66.95  ? 255  THR B N     1 
ATOM   4121  C  CA    . THR B 2  255 ? 173.451 135.317 151.966 1.00 66.95  ? 255  THR B CA    1 
ATOM   4122  C  C     . THR B 2  255 ? 174.339 134.304 152.684 1.00 66.95  ? 255  THR B C     1 
ATOM   4123  O  O     . THR B 2  255 ? 174.150 133.090 152.538 1.00 66.95  ? 255  THR B O     1 
ATOM   4124  C  CB    . THR B 2  255 ? 174.120 135.826 150.687 1.00 66.95  ? 255  THR B CB    1 
ATOM   4125  O  OG1   . THR B 2  255 ? 173.272 136.797 150.064 1.00 66.95  ? 255  THR B OG1   1 
ATOM   4126  C  CG2   . THR B 2  255 ? 174.347 134.689 149.700 1.00 66.95  ? 255  THR B CG2   1 
ATOM   4127  N  N     . ASN B 2  256 ? 175.289 134.783 153.489 1.00 68.50  ? 256  ASN B N     1 
ATOM   4128  C  CA    . ASN B 2  256 ? 176.070 133.872 154.320 1.00 68.50  ? 256  ASN B CA    1 
ATOM   4129  C  C     . ASN B 2  256 ? 175.238 133.291 155.459 1.00 68.50  ? 256  ASN B C     1 
ATOM   4130  O  O     . ASN B 2  256 ? 175.504 132.171 155.911 1.00 68.50  ? 256  ASN B O     1 
ATOM   4131  C  CB    . ASN B 2  256 ? 177.316 134.583 154.858 1.00 68.50  ? 256  ASN B CB    1 
ATOM   4132  C  CG    . ASN B 2  256 ? 176.996 135.867 155.622 1.00 68.50  ? 256  ASN B CG    1 
ATOM   4133  O  OD1   . ASN B 2  256 ? 175.838 136.249 155.787 1.00 68.50  ? 256  ASN B OD1   1 
ATOM   4134  N  ND2   . ASN B 2  256 ? 178.040 136.532 156.102 1.00 68.50  ? 256  ASN B ND2   1 
ATOM   4135  N  N     . ALA B 2  257 ? 174.230 134.032 155.928 1.00 62.98  ? 257  ALA B N     1 
ATOM   4136  C  CA    . ALA B 2  257 ? 173.373 133.548 157.003 1.00 62.98  ? 257  ALA B CA    1 
ATOM   4137  C  C     . ALA B 2  257 ? 172.389 132.488 156.527 1.00 62.98  ? 257  ALA B C     1 
ATOM   4138  O  O     . ALA B 2  257 ? 171.863 131.736 157.354 1.00 62.98  ? 257  ALA B O     1 
ATOM   4139  C  CB    . ALA B 2  257 ? 172.615 134.713 157.639 1.00 62.98  ? 257  ALA B CB    1 
ATOM   4140  N  N     . LYS B 2  258 ? 172.125 132.417 155.225 1.00 61.03  ? 258  LYS B N     1 
ATOM   4141  C  CA    . LYS B 2  258 ? 171.316 131.334 154.682 1.00 61.03  ? 258  LYS B CA    1 
ATOM   4142  C  C     . LYS B 2  258 ? 172.121 130.041 154.679 1.00 61.03  ? 258  LYS B C     1 
ATOM   4143  O  O     . LYS B 2  258 ? 173.207 129.975 154.095 1.00 61.03  ? 258  LYS B O     1 
ATOM   4144  C  CB    . LYS B 2  258 ? 170.858 131.668 153.264 1.00 61.03  ? 258  LYS B CB    1 
ATOM   4145  C  CG    . LYS B 2  258 ? 169.872 132.819 153.164 1.00 61.03  ? 258  LYS B CG    1 
ATOM   4146  C  CD    . LYS B 2  258 ? 169.501 133.091 151.714 1.00 61.03  ? 258  LYS B CD    1 
ATOM   4147  C  CE    . LYS B 2  258 ? 168.580 134.290 151.591 1.00 61.03  ? 258  LYS B CE    1 
ATOM   4148  N  NZ    . LYS B 2  258 ? 168.236 134.585 150.174 1.00 61.03  ? 258  LYS B NZ    1 
ATOM   4149  N  N     . SER B 2  259 ? 171.595 129.015 155.339 1.00 55.25  ? 259  SER B N     1 
ATOM   4150  C  CA    . SER B 2  259 ? 172.211 127.690 155.349 1.00 55.25  ? 259  SER B CA    1 
ATOM   4151  C  C     . SER B 2  259 ? 171.418 126.823 154.382 1.00 55.25  ? 259  SER B C     1 
ATOM   4152  O  O     . SER B 2  259 ? 170.414 126.216 154.759 1.00 55.25  ? 259  SER B O     1 
ATOM   4153  C  CB    . SER B 2  259 ? 172.220 127.097 156.753 1.00 55.25  ? 259  SER B CB    1 
ATOM   4154  O  OG    . SER B 2  259 ? 170.904 126.803 157.184 1.00 55.25  ? 259  SER B OG    1 
ATOM   4155  N  N     . ARG B 2  260 ? 171.864 126.767 153.130 1.00 54.83  ? 260  ARG B N     1 
ATOM   4156  C  CA    . ARG B 2  260 ? 171.097 126.094 152.088 1.00 54.83  ? 260  ARG B CA    1 
ATOM   4157  C  C     . ARG B 2  260 ? 171.487 124.624 152.062 1.00 54.83  ? 260  ARG B C     1 
ATOM   4158  O  O     . ARG B 2  260 ? 172.537 124.249 151.533 1.00 54.83  ? 260  ARG B O     1 
ATOM   4159  C  CB    . ARG B 2  260 ? 171.298 126.756 150.732 1.00 54.83  ? 260  ARG B CB    1 
ATOM   4160  C  CG    . ARG B 2  260 ? 170.448 126.111 149.650 1.00 54.83  ? 260  ARG B CG    1 
ATOM   4161  C  CD    . ARG B 2  260 ? 168.977 126.191 150.047 1.00 54.83  ? 260  ARG B CD    1 
ATOM   4162  N  NE    . ARG B 2  260 ? 168.076 125.570 149.082 1.00 54.83  ? 260  ARG B NE    1 
ATOM   4163  C  CZ    . ARG B 2  260 ? 167.450 126.232 148.118 1.00 54.83  ? 260  ARG B CZ    1 
ATOM   4164  N  NH1   . ARG B 2  260 ? 166.644 125.591 147.283 1.00 54.83  ? 260  ARG B NH1   1 
ATOM   4165  N  NH2   . ARG B 2  260 ? 167.619 127.541 147.996 1.00 54.83  ? 260  ARG B NH2   1 
ATOM   4166  N  N     . HIS B 2  261 ? 170.630 123.794 152.642 1.00 52.07  ? 261  HIS B N     1 
ATOM   4167  C  CA    . HIS B 2  261 ? 170.751 122.346 152.608 1.00 52.07  ? 261  HIS B CA    1 
ATOM   4168  C  C     . HIS B 2  261 ? 169.633 121.809 151.731 1.00 52.07  ? 261  HIS B C     1 
ATOM   4169  O  O     . HIS B 2  261 ? 168.459 122.111 151.965 1.00 52.07  ? 261  HIS B O     1 
ATOM   4170  C  CB    . HIS B 2  261 ? 170.642 121.752 154.010 1.00 52.07  ? 261  HIS B CB    1 
ATOM   4171  C  CG    . HIS B 2  261 ? 171.749 122.150 154.931 1.00 52.07  ? 261  HIS B CG    1 
ATOM   4172  N  ND1   . HIS B 2  261 ? 171.709 121.899 156.286 1.00 52.07  ? 261  HIS B ND1   1 
ATOM   4173  C  CD2   . HIS B 2  261 ? 172.925 122.776 154.699 1.00 52.07  ? 261  HIS B CD2   1 
ATOM   4174  C  CE1   . HIS B 2  261 ? 172.813 122.356 156.848 1.00 52.07  ? 261  HIS B CE1   1 
ATOM   4175  N  NE2   . HIS B 2  261 ? 173.568 122.893 155.907 1.00 52.07  ? 261  HIS B NE2   1 
ATOM   4176  N  N     . THR B 2  262 ? 169.995 121.029 150.723 1.00 52.91  ? 262  THR B N     1 
ATOM   4177  C  CA    . THR B 2  262 ? 168.993 120.339 149.932 1.00 52.91  ? 262  THR B CA    1 
ATOM   4178  C  C     . THR B 2  262 ? 168.412 119.201 150.766 1.00 52.91  ? 262  THR B C     1 
ATOM   4179  O  O     . THR B 2  262 ? 169.091 118.618 151.614 1.00 52.91  ? 262  THR B O     1 
ATOM   4180  C  CB    . THR B 2  262 ? 169.626 119.822 148.632 1.00 52.91  ? 262  THR B CB    1 
ATOM   4181  O  OG1   . THR B 2  262 ? 170.330 120.897 147.999 1.00 52.91  ? 262  THR B OG1   1 
ATOM   4182  C  CG2   . THR B 2  262 ? 168.581 119.315 147.637 1.00 52.91  ? 262  THR B CG2   1 
ATOM   4183  N  N     . MET B 2  263 ? 167.135 118.887 150.530 1.00 51.08  ? 263  MET B N     1 
ATOM   4184  C  CA    . MET B 2  263 ? 166.482 117.758 151.186 1.00 51.08  ? 263  MET B CA    1 
ATOM   4185  C  C     . MET B 2  263 ? 166.954 116.404 150.631 1.00 51.08  ? 263  MET B C     1 
ATOM   4186  O  O     . MET B 2  263 ? 166.524 115.351 151.112 1.00 51.08  ? 263  MET B O     1 
ATOM   4187  C  CB    . MET B 2  263 ? 164.963 117.948 151.064 1.00 51.08  ? 263  MET B CB    1 
ATOM   4188  C  CG    . MET B 2  263 ? 164.107 117.148 152.036 1.00 51.08  ? 263  MET B CG    1 
ATOM   4189  S  SD    . MET B 2  263 ? 164.589 117.488 153.733 1.00 51.08  ? 263  MET B SD    1 
ATOM   4190  C  CE    . MET B 2  263 ? 163.985 116.018 154.547 1.00 51.08  ? 263  MET B CE    1 
ATOM   4191  N  N     . SER B 2  264 ? 167.872 116.402 149.658 1.00 52.02  ? 264  SER B N     1 
ATOM   4192  C  CA    . SER B 2  264 ? 168.551 115.184 149.233 1.00 52.02  ? 264  SER B CA    1 
ATOM   4193  C  C     . SER B 2  264 ? 169.485 114.623 150.301 1.00 52.02  ? 264  SER B C     1 
ATOM   4194  O  O     . SER B 2  264 ? 169.894 113.463 150.195 1.00 52.02  ? 264  SER B O     1 
ATOM   4195  C  CB    . SER B 2  264 ? 169.342 115.452 147.955 1.00 52.02  ? 264  SER B CB    1 
ATOM   4196  O  OG    . SER B 2  264 ? 168.482 115.815 146.891 1.00 52.02  ? 264  SER B OG    1 
ATOM   4197  N  N     . MET B 2  265 ? 169.823 115.405 151.330 1.00 48.83  ? 265  MET B N     1 
ATOM   4198  C  CA    . MET B 2  265 ? 170.684 114.938 152.412 1.00 48.83  ? 265  MET B CA    1 
ATOM   4199  C  C     . MET B 2  265 ? 169.904 114.169 153.472 1.00 48.83  ? 265  MET B C     1 
ATOM   4200  O  O     . MET B 2  265 ? 170.148 114.348 154.667 1.00 48.83  ? 265  MET B O     1 
ATOM   4201  C  CB    . MET B 2  265 ? 171.359 116.138 153.075 1.00 48.83  ? 265  MET B CB    1 
ATOM   4202  C  CG    . MET B 2  265 ? 172.302 116.920 152.196 1.00 48.83  ? 265  MET B CG    1 
ATOM   4203  S  SD    . MET B 2  265 ? 172.697 118.505 152.957 1.00 48.83  ? 265  MET B SD    1 
ATOM   4204  C  CE    . MET B 2  265 ? 173.598 117.977 154.406 1.00 48.83  ? 265  MET B CE    1 
ATOM   4205  N  N     . ALA B 2  266 ? 169.040 113.257 153.062 1.00 47.33  ? 266  ALA B N     1 
ATOM   4206  C  CA    . ALA B 2  266 ? 168.052 112.647 153.934 1.00 47.33  ? 266  ALA B CA    1 
ATOM   4207  C  C     . ALA B 2  266 ? 168.060 111.146 153.708 1.00 47.33  ? 266  ALA B C     1 
ATOM   4208  O  O     . ALA B 2  266 ? 168.563 110.676 152.682 1.00 47.33  ? 266  ALA B O     1 
ATOM   4209  C  CB    . ALA B 2  266 ? 166.656 113.226 153.653 1.00 47.33  ? 266  ALA B CB    1 
ATOM   4210  N  N     . PRO B 2  267 ? 167.559 110.362 154.665 1.00 46.39  ? 267  PRO B N     1 
ATOM   4211  C  CA    . PRO B 2  267 ? 167.379 108.927 154.409 1.00 46.39  ? 267  PRO B CA    1 
ATOM   4212  C  C     . PRO B 2  267 ? 166.367 108.686 153.299 1.00 46.39  ? 267  PRO B C     1 
ATOM   4213  O  O     . PRO B 2  267 ? 165.240 109.180 153.342 1.00 46.39  ? 267  PRO B O     1 
ATOM   4214  C  CB    . PRO B 2  267 ? 166.886 108.390 155.754 1.00 46.39  ? 267  PRO B CB    1 
ATOM   4215  C  CG    . PRO B 2  267 ? 167.426 109.333 156.748 1.00 46.39  ? 267  PRO B CG    1 
ATOM   4216  C  CD    . PRO B 2  267 ? 167.383 110.675 156.095 1.00 46.39  ? 267  PRO B CD    1 
ATOM   4217  N  N     . ASP B 2  268 ? 166.791 107.939 152.285 1.00 53.40  ? 268  ASP B N     1 
ATOM   4218  C  CA    . ASP B 2  268 ? 165.955 107.687 151.115 1.00 53.40  ? 268  ASP B CA    1 
ATOM   4219  C  C     . ASP B 2  268 ? 164.941 106.619 151.501 1.00 53.40  ? 268  ASP B C     1 
ATOM   4220  O  O     . ASP B 2  268 ? 165.271 105.435 151.601 1.00 53.40  ? 268  ASP B O     1 
ATOM   4221  C  CB    . ASP B 2  268 ? 166.812 107.265 149.928 1.00 53.40  ? 268  ASP B CB    1 
ATOM   4222  C  CG    . ASP B 2  268 ? 166.075 107.364 148.604 1.00 53.40  ? 268  ASP B CG    1 
ATOM   4223  O  OD1   . ASP B 2  268 ? 164.885 107.743 148.598 1.00 53.40  ? 268  ASP B OD1   1 
ATOM   4224  O  OD2   . ASP B 2  268 ? 166.695 107.071 147.561 1.00 53.40  ? 268  ASP B OD2   1 
ATOM   4225  N  N     . VAL B 2  269 ? 163.699 107.038 151.721 1.00 48.79  ? 269  VAL B N     1 
ATOM   4226  C  CA    . VAL B 2  269 ? 162.668 106.189 152.302 1.00 48.79  ? 269  VAL B CA    1 
ATOM   4227  C  C     . VAL B 2  269 ? 161.783 105.635 151.195 1.00 48.79  ? 269  VAL B C     1 
ATOM   4228  O  O     . VAL B 2  269 ? 161.237 106.393 150.384 1.00 48.79  ? 269  VAL B O     1 
ATOM   4229  C  CB    . VAL B 2  269 ? 161.839 106.962 153.340 1.00 48.79  ? 269  VAL B CB    1 
ATOM   4230  C  CG1   . VAL B 2  269 ? 160.673 106.130 153.802 1.00 48.79  ? 269  VAL B CG1   1 
ATOM   4231  C  CG2   . VAL B 2  269 ? 162.707 107.337 154.524 1.00 48.79  ? 269  VAL B CG2   1 
ATOM   4232  N  N     . THR B 2  270 ? 161.652 104.311 151.161 1.00 52.72  ? 270  THR B N     1 
ATOM   4233  C  CA    . THR B 2  270 ? 160.779 103.629 150.219 1.00 52.72  ? 270  THR B CA    1 
ATOM   4234  C  C     . THR B 2  270 ? 159.317 103.914 150.571 1.00 52.72  ? 270  THR B C     1 
ATOM   4235  O  O     . THR B 2  270 ? 158.979 104.171 151.729 1.00 52.72  ? 270  THR B O     1 
ATOM   4236  C  CB    . THR B 2  270 ? 161.085 102.123 150.259 1.00 52.72  ? 270  THR B CB    1 
ATOM   4237  O  OG1   . THR B 2  270 ? 162.501 101.936 150.149 1.00 52.72  ? 270  THR B OG1   1 
ATOM   4238  C  CG2   . THR B 2  270 ? 160.430 101.353 149.111 1.00 52.72  ? 270  THR B CG2   1 
ATOM   4239  N  N     . ARG B 2  271 ? 158.451 103.904 149.550 1.00 54.39  ? 271  ARG B N     1 
ATOM   4240  C  CA    . ARG B 2  271 ? 157.025 104.142 149.763 1.00 54.39  ? 271  ARG B CA    1 
ATOM   4241  C  C     . ARG B 2  271 ? 156.373 103.050 150.609 1.00 54.39  ? 271  ARG B C     1 
ATOM   4242  O  O     . ARG B 2  271 ? 155.457 103.338 151.387 1.00 54.39  ? 271  ARG B O     1 
ATOM   4243  C  CB    . ARG B 2  271 ? 156.316 104.267 148.412 1.00 54.39  ? 271  ARG B CB    1 
ATOM   4244  C  CG    . ARG B 2  271 ? 154.848 104.663 148.492 1.00 54.39  ? 271  ARG B CG    1 
ATOM   4245  C  CD    . ARG B 2  271 ? 154.211 104.737 147.115 1.00 54.39  ? 271  ARG B CD    1 
ATOM   4246  N  NE    . ARG B 2  271 ? 154.745 105.830 146.310 1.00 54.39  ? 271  ARG B NE    1 
ATOM   4247  C  CZ    . ARG B 2  271 ? 154.282 107.076 146.344 1.00 54.39  ? 271  ARG B CZ    1 
ATOM   4248  N  NH1   . ARG B 2  271 ? 153.272 107.387 147.145 1.00 54.39  ? 271  ARG B NH1   1 
ATOM   4249  N  NH2   . ARG B 2  271 ? 154.824 108.010 145.575 1.00 54.39  ? 271  ARG B NH2   1 
ATOM   4250  N  N     . GLU B 2  272 ? 156.836 101.802 150.498 1.00 56.75  ? 272  GLU B N     1 
ATOM   4251  C  CA    . GLU B 2  272 ? 156.163 100.729 151.222 1.00 56.75  ? 272  GLU B CA    1 
ATOM   4252  C  C     . GLU B 2  272 ? 156.541 100.712 152.699 1.00 56.75  ? 272  GLU B C     1 
ATOM   4253  O  O     . GLU B 2  272 ? 155.745 100.258 153.529 1.00 56.75  ? 272  GLU B O     1 
ATOM   4254  C  CB    . GLU B 2  272 ? 156.450 99.372  150.566 1.00 56.75  ? 272  GLU B CB    1 
ATOM   4255  C  CG    . GLU B 2  272 ? 157.878 98.843  150.666 1.00 56.75  ? 272  GLU B CG    1 
ATOM   4256  C  CD    . GLU B 2  272 ? 158.077 97.933  151.869 1.00 56.75  ? 272  GLU B CD    1 
ATOM   4257  O  OE1   . GLU B 2  272 ? 157.066 97.429  152.401 1.00 56.75  ? 272  GLU B OE1   1 
ATOM   4258  O  OE2   . GLU B 2  272 ? 159.236 97.725  152.284 1.00 56.75  ? 272  GLU B OE2   1 
ATOM   4259  N  N     . GLU B 2  273 ? 157.735 101.190 153.048 1.00 49.10  ? 273  GLU B N     1 
ATOM   4260  C  CA    . GLU B 2  273 ? 158.098 101.364 154.446 1.00 49.10  ? 273  GLU B CA    1 
ATOM   4261  C  C     . GLU B 2  273 ? 157.684 102.722 154.983 1.00 49.10  ? 273  GLU B C     1 
ATOM   4262  O  O     . GLU B 2  273 ? 157.693 102.916 156.202 1.00 49.10  ? 273  GLU B O     1 
ATOM   4263  C  CB    . GLU B 2  273 ? 159.602 101.164 154.646 1.00 49.10  ? 273  GLU B CB    1 
ATOM   4264  C  CG    . GLU B 2  273 ? 160.456 102.168 153.916 1.00 49.10  ? 273  GLU B CG    1 
ATOM   4265  C  CD    . GLU B 2  273 ? 161.939 101.909 154.078 1.00 49.10  ? 273  GLU B CD    1 
ATOM   4266  O  OE1   . GLU B 2  273 ? 162.308 100.990 154.838 1.00 49.10  ? 273  GLU B OE1   1 
ATOM   4267  O  OE2   . GLU B 2  273 ? 162.737 102.604 153.417 1.00 49.10  ? 273  GLU B OE2   1 
ATOM   4268  N  N     . PHE B 2  274 ? 157.336 103.664 154.104 1.00 42.65  ? 274  PHE B N     1 
ATOM   4269  C  CA    . PHE B 2  274 ? 156.604 104.845 154.545 1.00 42.65  ? 274  PHE B CA    1 
ATOM   4270  C  C     . PHE B 2  274 ? 155.234 104.454 155.073 1.00 42.65  ? 274  PHE B C     1 
ATOM   4271  O  O     . PHE B 2  274 ? 154.812 104.915 156.137 1.00 42.65  ? 274  PHE B O     1 
ATOM   4272  C  CB    . PHE B 2  274 ? 156.460 105.847 153.399 1.00 42.65  ? 274  PHE B CB    1 
ATOM   4273  C  CG    . PHE B 2  274 ? 155.675 107.071 153.770 1.00 42.65  ? 274  PHE B CG    1 
ATOM   4274  C  CD1   . PHE B 2  274 ? 156.252 108.063 154.536 1.00 42.65  ? 274  PHE B CD1   1 
ATOM   4275  C  CD2   . PHE B 2  274 ? 154.355 107.223 153.369 1.00 42.65  ? 274  PHE B CD2   1 
ATOM   4276  C  CE1   . PHE B 2  274 ? 155.542 109.188 154.892 1.00 42.65  ? 274  PHE B CE1   1 
ATOM   4277  C  CE2   . PHE B 2  274 ? 153.637 108.345 153.728 1.00 42.65  ? 274  PHE B CE2   1 
ATOM   4278  C  CZ    . PHE B 2  274 ? 154.235 109.327 154.493 1.00 42.65  ? 274  PHE B CZ    1 
ATOM   4279  N  N     . SER B 2  275 ? 154.522 103.606 154.329 1.00 40.80  ? 275  SER B N     1 
ATOM   4280  C  CA    . SER B 2  275 ? 153.213 103.136 154.763 1.00 40.80  ? 275  SER B CA    1 
ATOM   4281  C  C     . SER B 2  275 ? 153.322 102.206 155.962 1.00 40.80  ? 275  SER B C     1 
ATOM   4282  O  O     . SER B 2  275 ? 152.381 102.106 156.751 1.00 40.80  ? 275  SER B O     1 
ATOM   4283  C  CB    . SER B 2  275 ? 152.504 102.424 153.614 1.00 40.80  ? 275  SER B CB    1 
ATOM   4284  O  OG    . SER B 2  275 ? 152.277 103.303 152.527 1.00 40.80  ? 275  SER B OG    1 
ATOM   4285  N  N     . LEU B 2  276 ? 154.456 101.528 156.117 1.00 41.14  ? 276  LEU B N     1 
ATOM   4286  C  CA    . LEU B 2  276 ? 154.624 100.601 157.228 1.00 41.14  ? 276  LEU B CA    1 
ATOM   4287  C  C     . LEU B 2  276 ? 154.764 101.338 158.553 1.00 41.14  ? 276  LEU B C     1 
ATOM   4288  O  O     . LEU B 2  276 ? 154.111 100.985 159.541 1.00 41.14  ? 276  LEU B O     1 
ATOM   4289  C  CB    . LEU B 2  276 ? 155.838 99.715  156.972 1.00 41.14  ? 276  LEU B CB    1 
ATOM   4290  C  CG    . LEU B 2  276 ? 156.185 98.702  158.055 1.00 41.14  ? 276  LEU B CG    1 
ATOM   4291  C  CD1   . LEU B 2  276 ? 155.077 97.681  158.227 1.00 41.14  ? 276  LEU B CD1   1 
ATOM   4292  C  CD2   . LEU B 2  276 ? 157.497 98.034  157.719 1.00 41.14  ? 276  LEU B CD2   1 
ATOM   4293  N  N     . VAL B 2  277 ? 155.611 102.365 158.594 1.00 36.87  ? 277  VAL B N     1 
ATOM   4294  C  CA    . VAL B 2  277 ? 155.845 103.087 159.840 1.00 36.87  ? 277  VAL B CA    1 
ATOM   4295  C  C     . VAL B 2  277 ? 154.672 104.007 160.161 1.00 36.87  ? 277  VAL B C     1 
ATOM   4296  O  O     . VAL B 2  277 ? 154.300 104.167 161.330 1.00 36.87  ? 277  VAL B O     1 
ATOM   4297  C  CB    . VAL B 2  277 ? 157.181 103.848 159.750 1.00 36.87  ? 277  VAL B CB    1 
ATOM   4298  C  CG1   . VAL B 2  277 ? 157.454 104.671 161.002 1.00 36.87  ? 277  VAL B CG1   1 
ATOM   4299  C  CG2   . VAL B 2  277 ? 158.311 102.870 159.514 1.00 36.87  ? 277  VAL B CG2   1 
ATOM   4300  N  N     . SER B 2  278 ? 154.051 104.595 159.131 1.00 37.92  ? 278  SER B N     1 
ATOM   4301  C  CA    . SER B 2  278 ? 152.924 105.494 159.362 1.00 37.92  ? 278  SER B CA    1 
ATOM   4302  C  C     . SER B 2  278 ? 151.710 104.747 159.894 1.00 37.92  ? 278  SER B C     1 
ATOM   4303  O  O     . SER B 2  278 ? 151.090 105.191 160.862 1.00 37.92  ? 278  SER B O     1 
ATOM   4304  C  CB    . SER B 2  278 ? 152.563 106.240 158.082 1.00 37.92  ? 278  SER B CB    1 
ATOM   4305  O  OG    . SER B 2  278 ? 152.038 105.351 157.116 1.00 37.92  ? 278  SER B OG    1 
ATOM   4306  N  N     . ASN B 2  279 ? 151.379 103.590 159.310 1.00 37.70  ? 279  ASN B N     1 
ATOM   4307  C  CA    . ASN B 2  279 ? 150.257 102.809 159.822 1.00 37.70  ? 279  ASN B CA    1 
ATOM   4308  C  C     . ASN B 2  279 ? 150.526 102.208 161.194 1.00 37.70  ? 279  ASN B C     1 
ATOM   4309  O  O     . ASN B 2  279 ? 149.573 101.844 161.885 1.00 37.70  ? 279  ASN B O     1 
ATOM   4310  C  CB    . ASN B 2  279 ? 149.863 101.689 158.858 1.00 37.70  ? 279  ASN B CB    1 
ATOM   4311  C  CG    . ASN B 2  279 ? 149.129 102.198 157.634 1.00 37.70  ? 279  ASN B CG    1 
ATOM   4312  O  OD1   . ASN B 2  279 ? 149.566 102.008 156.503 1.00 37.70  ? 279  ASN B OD1   1 
ATOM   4313  N  ND2   . ASN B 2  279 ? 148.000 102.856 157.860 1.00 37.70  ? 279  ASN B ND2   1 
ATOM   4314  N  N     . PHE B 2  280 ? 151.783 102.099 161.614 1.00 40.63  ? 280  PHE B N     1 
ATOM   4315  C  CA    . PHE B 2  280 ? 152.025 101.630 162.970 1.00 40.63  ? 280  PHE B CA    1 
ATOM   4316  C  C     . PHE B 2  280 ? 151.863 102.754 163.985 1.00 40.63  ? 280  PHE B C     1 
ATOM   4317  O  O     . PHE B 2  280 ? 151.306 102.538 165.064 1.00 40.63  ? 280  PHE B O     1 
ATOM   4318  C  CB    . PHE B 2  280 ? 153.411 101.005 163.082 1.00 40.63  ? 280  PHE B CB    1 
ATOM   4319  C  CG    . PHE B 2  280 ? 153.691 100.418 164.431 1.00 40.63  ? 280  PHE B CG    1 
ATOM   4320  C  CD1   . PHE B 2  280 ? 153.099 99.228  164.818 1.00 40.63  ? 280  PHE B CD1   1 
ATOM   4321  C  CD2   . PHE B 2  280 ? 154.542 101.054 165.312 1.00 40.63  ? 280  PHE B CD2   1 
ATOM   4322  C  CE1   . PHE B 2  280 ? 153.355 98.687  166.061 1.00 40.63  ? 280  PHE B CE1   1 
ATOM   4323  C  CE2   . PHE B 2  280 ? 154.806 100.513 166.546 1.00 40.63  ? 280  PHE B CE2   1 
ATOM   4324  C  CZ    . PHE B 2  280 ? 154.208 99.333  166.925 1.00 40.63  ? 280  PHE B CZ    1 
ATOM   4325  N  N     . PHE B 2  281 ? 152.344 103.956 163.663 1.00 39.75  ? 281  PHE B N     1 
ATOM   4326  C  CA    . PHE B 2  281 ? 152.155 105.088 164.565 1.00 39.75  ? 281  PHE B CA    1 
ATOM   4327  C  C     . PHE B 2  281 ? 150.722 105.597 164.567 1.00 39.75  ? 281  PHE B C     1 
ATOM   4328  O  O     . PHE B 2  281 ? 150.244 106.077 165.596 1.00 39.75  ? 281  PHE B O     1 
ATOM   4329  C  CB    . PHE B 2  281 ? 153.117 106.217 164.210 1.00 39.75  ? 281  PHE B CB    1 
ATOM   4330  C  CG    . PHE B 2  281 ? 154.467 106.076 164.835 1.00 39.75  ? 281  PHE B CG    1 
ATOM   4331  C  CD1   . PHE B 2  281 ? 154.699 106.582 166.101 1.00 39.75  ? 281  PHE B CD1   1 
ATOM   4332  C  CD2   . PHE B 2  281 ? 155.490 105.415 164.182 1.00 39.75  ? 281  PHE B CD2   1 
ATOM   4333  C  CE1   . PHE B 2  281 ? 155.936 106.463 166.695 1.00 39.75  ? 281  PHE B CE1   1 
ATOM   4334  C  CE2   . PHE B 2  281 ? 156.730 105.284 164.776 1.00 39.75  ? 281  PHE B CE2   1 
ATOM   4335  C  CZ    . PHE B 2  281 ? 156.951 105.811 166.035 1.00 39.75  ? 281  PHE B CZ    1 
ATOM   4336  N  N     . ASN B 2  282 ? 150.014 105.508 163.448 1.00 43.21  ? 282  ASN B N     1 
ATOM   4337  C  CA    . ASN B 2  282 ? 148.642 105.995 163.452 1.00 43.21  ? 282  ASN B CA    1 
ATOM   4338  C  C     . ASN B 2  282 ? 147.690 105.031 164.143 1.00 43.21  ? 282  ASN B C     1 
ATOM   4339  O  O     . ASN B 2  282 ? 146.583 105.433 164.509 1.00 43.21  ? 282  ASN B O     1 
ATOM   4340  C  CB    . ASN B 2  282 ? 148.177 106.258 162.024 1.00 43.21  ? 282  ASN B CB    1 
ATOM   4341  C  CG    . ASN B 2  282 ? 148.991 107.334 161.345 1.00 43.21  ? 282  ASN B CG    1 
ATOM   4342  O  OD1   . ASN B 2  282 ? 149.385 108.318 161.967 1.00 43.21  ? 282  ASN B OD1   1 
ATOM   4343  N  ND2   . ASN B 2  282 ? 149.227 107.165 160.053 1.00 43.21  ? 282  ASN B ND2   1 
ATOM   4344  N  N     . GLU B 2  283 ? 148.100 103.781 164.341 1.00 49.13  ? 283  GLU B N     1 
ATOM   4345  C  CA    . GLU B 2  283 ? 147.277 102.778 164.997 1.00 49.13  ? 283  GLU B CA    1 
ATOM   4346  C  C     . GLU B 2  283 ? 147.757 102.424 166.396 1.00 49.13  ? 283  GLU B C     1 
ATOM   4347  O  O     . GLU B 2  283 ? 147.117 101.602 167.055 1.00 49.13  ? 283  GLU B O     1 
ATOM   4348  C  CB    . GLU B 2  283 ? 147.223 101.499 164.155 1.00 49.13  ? 283  GLU B CB    1 
ATOM   4349  C  CG    . GLU B 2  283 ? 146.452 101.605 162.848 1.00 49.13  ? 283  GLU B CG    1 
ATOM   4350  C  CD    . GLU B 2  283 ? 146.539 100.330 162.024 1.00 49.13  ? 283  GLU B CD    1 
ATOM   4351  O  OE1   . GLU B 2  283 ? 147.308 99.423  162.409 1.00 49.13  ? 283  GLU B OE1   1 
ATOM   4352  O  OE2   . GLU B 2  283 ? 145.845 100.232 160.991 1.00 49.13  ? 283  GLU B OE2   1 
ATOM   4353  N  N     . ASN B 2  284 ? 148.890 102.966 166.850 1.00 47.69  ? 284  ASN B N     1 
ATOM   4354  C  CA    . ASN B 2  284 ? 149.390 102.584 168.168 1.00 47.69  ? 284  ASN B CA    1 
ATOM   4355  C  C     . ASN B 2  284 ? 149.960 103.701 169.031 1.00 47.69  ? 284  ASN B C     1 
ATOM   4356  O  O     . ASN B 2  284 ? 150.152 103.449 170.223 1.00 47.69  ? 284  ASN B O     1 
ATOM   4357  C  CB    . ASN B 2  284 ? 150.467 101.495 168.042 1.00 47.69  ? 284  ASN B CB    1 
ATOM   4358  C  CG    . ASN B 2  284 ? 149.915 100.178 167.550 1.00 47.69  ? 284  ASN B CG    1 
ATOM   4359  O  OD1   . ASN B 2  284 ? 150.250 99.719  166.460 1.00 47.69  ? 284  ASN B OD1   1 
ATOM   4360  N  ND2   . ASN B 2  284 ? 149.067 99.557  168.358 1.00 47.69  ? 284  ASN B ND2   1 
ATOM   4361  N  N     . PHE B 2  285 ? 150.248 104.898 168.506 1.00 47.77  ? 285  PHE B N     1 
ATOM   4362  C  CA    . PHE B 2  285 ? 151.009 105.881 169.281 1.00 47.77  ? 285  PHE B CA    1 
ATOM   4363  C  C     . PHE B 2  285 ? 150.185 106.469 170.419 1.00 47.77  ? 285  PHE B C     1 
ATOM   4364  O  O     . PHE B 2  285 ? 150.496 106.257 171.591 1.00 47.77  ? 285  PHE B O     1 
ATOM   4365  C  CB    . PHE B 2  285 ? 151.556 106.975 168.359 1.00 47.77  ? 285  PHE B CB    1 
ATOM   4366  C  CG    . PHE B 2  285 ? 152.223 108.112 169.074 1.00 47.77  ? 285  PHE B CG    1 
ATOM   4367  C  CD1   . PHE B 2  285 ? 153.310 107.891 169.896 1.00 47.77  ? 285  PHE B CD1   1 
ATOM   4368  C  CD2   . PHE B 2  285 ? 151.822 109.416 168.843 1.00 47.77  ? 285  PHE B CD2   1 
ATOM   4369  C  CE1   . PHE B 2  285 ? 153.929 108.942 170.539 1.00 47.77  ? 285  PHE B CE1   1 
ATOM   4370  C  CE2   . PHE B 2  285 ? 152.449 110.472 169.471 1.00 47.77  ? 285  PHE B CE2   1 
ATOM   4371  C  CZ    . PHE B 2  285 ? 153.503 110.233 170.319 1.00 47.77  ? 285  PHE B CZ    1 
ATOM   4372  N  N     . GLN B 2  286 ? 149.109 107.172 170.109 1.00 39.07  ? 286  GLN B N     1 
ATOM   4373  C  CA    . GLN B 2  286 ? 148.254 107.717 171.160 1.00 39.07  ? 286  GLN B CA    1 
ATOM   4374  C  C     . GLN B 2  286 ? 146.810 107.326 170.933 1.00 39.07  ? 286  GLN B C     1 
ATOM   4375  O  O     . GLN B 2  286 ? 145.920 108.173 170.889 1.00 39.07  ? 286  GLN B O     1 
ATOM   4376  C  CB    . GLN B 2  286 ? 148.404 109.227 171.289 1.00 39.07  ? 286  GLN B CB    1 
ATOM   4377  C  CG    . GLN B 2  286 ? 149.612 109.623 172.104 1.00 39.07  ? 286  GLN B CG    1 
ATOM   4378  C  CD    . GLN B 2  286 ? 149.802 111.111 172.194 1.00 39.07  ? 286  GLN B CD    1 
ATOM   4379  O  OE1   . GLN B 2  286 ? 149.176 111.868 171.464 1.00 39.07  ? 286  GLN B OE1   1 
ATOM   4380  N  NE2   . GLN B 2  286 ? 150.639 111.545 173.125 1.00 39.07  ? 286  GLN B NE2   1 
ATOM   4381  N  N     . LYS B 2  287 ? 146.569 106.026 170.745 1.00 39.22  ? 287  LYS B N     1 
ATOM   4382  C  CA    . LYS B 2  287 ? 145.200 105.520 170.710 1.00 39.22  ? 287  LYS B CA    1 
ATOM   4383  C  C     . LYS B 2  287 ? 144.482 105.783 172.024 1.00 39.22  ? 287  LYS B C     1 
ATOM   4384  O  O     . LYS B 2  287 ? 143.390 106.360 172.038 1.00 39.22  ? 287  LYS B O     1 
ATOM   4385  C  CB    . LYS B 2  287 ? 145.188 104.027 170.397 1.00 39.22  ? 287  LYS B CB    1 
ATOM   4386  C  CG    . LYS B 2  287 ? 145.600 103.695 168.997 1.00 39.22  ? 287  LYS B CG    1 
ATOM   4387  C  CD    . LYS B 2  287 ? 144.618 104.260 167.983 1.00 39.22  ? 287  LYS B CD    1 
ATOM   4388  C  CE    . LYS B 2  287 ? 143.291 103.530 168.008 1.00 39.22  ? 287  LYS B CE    1 
ATOM   4389  N  NZ    . LYS B 2  287 ? 142.377 104.049 166.956 1.00 39.22  ? 287  LYS B NZ    1 
ATOM   4390  N  N     . ARG B 2  288 ? 145.098 105.398 173.137 1.00 43.41  ? 288  ARG B N     1 
ATOM   4391  C  CA    . ARG B 2  288 ? 144.470 105.436 174.454 1.00 43.41  ? 288  ARG B CA    1 
ATOM   4392  C  C     . ARG B 2  288 ? 144.143 106.857 174.936 1.00 43.41  ? 288  ARG B C     1 
ATOM   4393  O  O     . ARG B 2  288 ? 143.126 107.026 175.618 1.00 43.41  ? 288  ARG B O     1 
ATOM   4394  C  CB    . ARG B 2  288 ? 145.348 104.676 175.459 1.00 43.41  ? 288  ARG B CB    1 
ATOM   4395  C  CG    . ARG B 2  288 ? 144.705 104.446 176.811 1.00 43.41  ? 288  ARG B CG    1 
ATOM   4396  C  CD    . ARG B 2  288 ? 143.429 103.642 176.631 1.00 43.41  ? 288  ARG B CD    1 
ATOM   4397  N  NE    . ARG B 2  288 ? 142.781 103.298 177.892 1.00 43.41  ? 288  ARG B NE    1 
ATOM   4398  C  CZ    . ARG B 2  288 ? 141.550 102.807 177.983 1.00 43.41  ? 288  ARG B CZ    1 
ATOM   4399  N  NH1   . ARG B 2  288 ? 140.825 102.624 176.889 1.00 43.41  ? 288  ARG B NH1   1 
ATOM   4400  N  NH2   . ARG B 2  288 ? 141.038 102.511 179.169 1.00 43.41  ? 288  ARG B NH2   1 
ATOM   4401  N  N     . PRO B 2  289 ? 144.918 107.907 174.614 1.00 32.59  ? 289  PRO B N     1 
ATOM   4402  C  CA    . PRO B 2  289 ? 144.344 109.252 174.789 1.00 32.59  ? 289  PRO B CA    1 
ATOM   4403  C  C     . PRO B 2  289 ? 143.267 109.600 173.776 1.00 32.59  ? 289  PRO B C     1 
ATOM   4404  O  O     . PRO B 2  289 ? 142.278 110.241 174.145 1.00 32.59  ? 289  PRO B O     1 
ATOM   4405  C  CB    . PRO B 2  289 ? 145.560 110.177 174.666 1.00 32.59  ? 289  PRO B CB    1 
ATOM   4406  C  CG    . PRO B 2  289 ? 146.679 109.358 175.083 1.00 32.59  ? 289  PRO B CG    1 
ATOM   4407  C  CD    . PRO B 2  289 ? 146.392 107.996 174.553 1.00 32.59  ? 289  PRO B CD    1 
ATOM   4408  N  N     . ARG B 2  290 ? 143.423 109.210 172.509 1.00 30.00  ? 290  ARG B N     1 
ATOM   4409  C  CA    . ARG B 2  290 ? 142.426 109.581 171.509 1.00 30.00  ? 290  ARG B CA    1 
ATOM   4410  C  C     . ARG B 2  290 ? 141.145 108.776 171.645 1.00 30.00  ? 290  ARG B C     1 
ATOM   4411  O  O     . ARG B 2  290 ? 140.076 109.260 171.261 1.00 30.00  ? 290  ARG B O     1 
ATOM   4412  C  CB    . ARG B 2  290 ? 142.975 109.413 170.099 1.00 30.00  ? 290  ARG B CB    1 
ATOM   4413  C  CG    . ARG B 2  290 ? 143.962 110.461 169.660 1.00 30.00  ? 290  ARG B CG    1 
ATOM   4414  C  CD    . ARG B 2  290 ? 144.409 110.118 168.271 1.00 30.00  ? 290  ARG B CD    1 
ATOM   4415  N  NE    . ARG B 2  290 ? 145.226 108.915 168.288 1.00 30.00  ? 290  ARG B NE    1 
ATOM   4416  C  CZ    . ARG B 2  290 ? 145.529 108.202 167.213 1.00 30.00  ? 290  ARG B CZ    1 
ATOM   4417  N  NH1   . ARG B 2  290 ? 145.059 108.551 166.029 1.00 30.00  ? 290  ARG B NH1   1 
ATOM   4418  N  NH2   . ARG B 2  290 ? 146.289 107.126 167.327 1.00 30.00  ? 290  ARG B NH2   1 
ATOM   4419  N  N     . GLN B 2  291 ? 141.223 107.550 172.162 1.00 33.65  ? 291  GLN B N     1 
ATOM   4420  C  CA    . GLN B 2  291 ? 139.998 106.798 172.402 1.00 33.65  ? 291  GLN B CA    1 
ATOM   4421  C  C     . GLN B 2  291 ? 139.241 107.359 173.592 1.00 33.65  ? 291  GLN B C     1 
ATOM   4422  O  O     . GLN B 2  291 ? 138.013 107.459 173.552 1.00 33.65  ? 291  GLN B O     1 
ATOM   4423  C  CB    . GLN B 2  291 ? 140.303 105.319 172.612 1.00 33.65  ? 291  GLN B CB    1 
ATOM   4424  C  CG    . GLN B 2  291 ? 140.723 104.589 171.357 1.00 33.65  ? 291  GLN B CG    1 
ATOM   4425  C  CD    . GLN B 2  291 ? 141.025 103.137 171.619 1.00 33.65  ? 291  GLN B CD    1 
ATOM   4426  O  OE1   . GLN B 2  291 ? 140.989 102.682 172.762 1.00 33.65  ? 291  GLN B OE1   1 
ATOM   4427  N  NE2   . GLN B 2  291 ? 141.326 102.395 170.563 1.00 33.65  ? 291  GLN B NE2   1 
ATOM   4428  N  N     . LYS B 2  292 ? 139.955 107.749 174.649 1.00 29.44  ? 292  LYS B N     1 
ATOM   4429  C  CA    . LYS B 2  292 ? 139.297 108.343 175.808 1.00 29.44  ? 292  LYS B CA    1 
ATOM   4430  C  C     . LYS B 2  292 ? 138.752 109.731 175.492 1.00 29.44  ? 292  LYS B C     1 
ATOM   4431  O  O     . LYS B 2  292 ? 137.703 110.115 176.021 1.00 29.44  ? 292  LYS B O     1 
ATOM   4432  C  CB    . LYS B 2  292 ? 140.269 108.394 176.988 1.00 29.44  ? 292  LYS B CB    1 
ATOM   4433  C  CG    . LYS B 2  292 ? 139.664 108.922 178.277 1.00 29.44  ? 292  LYS B CG    1 
ATOM   4434  C  CD    . LYS B 2  292 ? 138.598 107.970 178.793 1.00 29.44  ? 292  LYS B CD    1 
ATOM   4435  C  CE    . LYS B 2  292 ? 138.019 108.437 180.116 1.00 29.44  ? 292  LYS B CE    1 
ATOM   4436  N  NZ    . LYS B 2  292 ? 137.224 109.685 179.958 1.00 29.44  ? 292  LYS B NZ    1 
ATOM   4437  N  N     . LEU B 2  293 ? 139.431 110.481 174.620 1.00 21.11  ? 293  LEU B N     1 
ATOM   4438  C  CA    . LEU B 2  293 ? 138.907 111.768 174.170 1.00 21.11  ? 293  LEU B CA    1 
ATOM   4439  C  C     . LEU B 2  293 ? 137.643 111.594 173.344 1.00 21.11  ? 293  LEU B C     1 
ATOM   4440  O  O     . LEU B 2  293 ? 136.706 112.394 173.455 1.00 21.11  ? 293  LEU B O     1 
ATOM   4441  C  CB    . LEU B 2  293 ? 139.964 112.515 173.362 1.00 21.11  ? 293  LEU B CB    1 
ATOM   4442  C  CG    . LEU B 2  293 ? 139.546 113.848 172.740 1.00 21.11  ? 293  LEU B CG    1 
ATOM   4443  C  CD1   . LEU B 2  293 ? 139.119 114.826 173.809 1.00 21.11  ? 293  LEU B CD1   1 
ATOM   4444  C  CD2   . LEU B 2  293 ? 140.657 114.427 171.913 1.00 21.11  ? 293  LEU B CD2   1 
ATOM   4445  N  N     . PHE B 2  294 ? 137.589 110.544 172.526 1.00 19.36  ? 294  PHE B N     1 
ATOM   4446  C  CA    . PHE B 2  294 ? 136.403 110.298 171.718 1.00 19.36  ? 294  PHE B CA    1 
ATOM   4447  C  C     . PHE B 2  294 ? 135.227 109.842 172.572 1.00 19.36  ? 294  PHE B C     1 
ATOM   4448  O  O     . PHE B 2  294 ? 134.074 110.057 172.192 1.00 19.36  ? 294  PHE B O     1 
ATOM   4449  C  CB    . PHE B 2  294 ? 136.723 109.271 170.634 1.00 19.36  ? 294  PHE B CB    1 
ATOM   4450  C  CG    . PHE B 2  294 ? 135.589 109.006 169.695 1.00 19.36  ? 294  PHE B CG    1 
ATOM   4451  C  CD1   . PHE B 2  294 ? 135.225 109.944 168.749 1.00 19.36  ? 294  PHE B CD1   1 
ATOM   4452  C  CD2   . PHE B 2  294 ? 134.899 107.810 169.744 1.00 19.36  ? 294  PHE B CD2   1 
ATOM   4453  C  CE1   . PHE B 2  294 ? 134.184 109.699 167.880 1.00 19.36  ? 294  PHE B CE1   1 
ATOM   4454  C  CE2   . PHE B 2  294 ? 133.862 107.563 168.872 1.00 19.36  ? 294  PHE B CE2   1 
ATOM   4455  C  CZ    . PHE B 2  294 ? 133.502 108.513 167.945 1.00 19.36  ? 294  PHE B CZ    1 
ATOM   4456  N  N     . GLU B 2  295 ? 135.490 109.240 173.735 1.00 23.32  ? 295  GLU B N     1 
ATOM   4457  C  CA    . GLU B 2  295 ? 134.393 108.899 174.634 1.00 23.32  ? 295  GLU B CA    1 
ATOM   4458  C  C     . GLU B 2  295 ? 133.856 110.131 175.350 1.00 23.32  ? 295  GLU B C     1 
ATOM   4459  O  O     . GLU B 2  295 ? 132.696 110.140 175.775 1.00 23.32  ? 295  GLU B O     1 
ATOM   4460  C  CB    . GLU B 2  295 ? 134.833 107.861 175.668 1.00 23.32  ? 295  GLU B CB    1 
ATOM   4461  C  CG    . GLU B 2  295 ? 135.352 106.552 175.098 1.00 23.32  ? 295  GLU B CG    1 
ATOM   4462  C  CD    . GLU B 2  295 ? 134.331 105.785 174.286 1.00 23.32  ? 295  GLU B CD    1 
ATOM   4463  O  OE1   . GLU B 2  295 ? 133.128 105.838 174.616 1.00 23.32  ? 295  GLU B OE1   1 
ATOM   4464  O  OE2   . GLU B 2  295 ? 134.738 105.122 173.308 1.00 23.32  ? 295  GLU B OE2   1 
ATOM   4465  N  N     . ILE B 2  296 ? 134.684 111.166 175.507 1.00 18.89  ? 296  ILE B N     1 
ATOM   4466  C  CA    . ILE B 2  296 ? 134.230 112.402 176.138 1.00 18.89  ? 296  ILE B CA    1 
ATOM   4467  C  C     . ILE B 2  296 ? 133.304 113.165 175.203 1.00 18.89  ? 296  ILE B C     1 
ATOM   4468  O  O     . ILE B 2  296 ? 132.199 113.566 175.585 1.00 18.89  ? 296  ILE B O     1 
ATOM   4469  C  CB    . ILE B 2  296 ? 135.430 113.267 176.562 1.00 18.89  ? 296  ILE B CB    1 
ATOM   4470  C  CG1   . ILE B 2  296 ? 136.226 112.587 177.670 1.00 18.89  ? 296  ILE B CG1   1 
ATOM   4471  C  CG2   . ILE B 2  296 ? 134.973 114.637 177.011 1.00 18.89  ? 296  ILE B CG2   1 
ATOM   4472  C  CD1   . ILE B 2  296 ? 137.548 113.257 177.947 1.00 18.89  ? 296  ILE B CD1   1 
ATOM   4473  N  N     . GLN B 2  297 ? 133.727 113.357 173.960 1.00 17.35  ? 297  GLN B N     1 
ATOM   4474  C  CA    . GLN B 2  297 ? 132.948 114.110 172.989 1.00 17.35  ? 297  GLN B CA    1 
ATOM   4475  C  C     . GLN B 2  297 ? 131.878 113.271 172.302 1.00 17.35  ? 297  GLN B C     1 
ATOM   4476  O  O     . GLN B 2  297 ? 131.214 113.771 171.393 1.00 17.35  ? 297  GLN B O     1 
ATOM   4477  C  CB    . GLN B 2  297 ? 133.884 114.750 171.963 1.00 17.35  ? 297  GLN B CB    1 
ATOM   4478  C  CG    . GLN B 2  297 ? 134.678 113.780 171.121 1.00 17.35  ? 297  GLN B CG    1 
ATOM   4479  C  CD    . GLN B 2  297 ? 135.743 114.480 170.302 1.00 17.35  ? 297  GLN B CD    1 
ATOM   4480  O  OE1   . GLN B 2  297 ? 135.901 115.694 170.384 1.00 17.35  ? 297  GLN B OE1   1 
ATOM   4481  N  NE2   . GLN B 2  297 ? 136.472 113.717 169.501 1.00 17.35  ? 297  GLN B NE2   1 
ATOM   4482  N  N     . LYS B 2  298 ? 131.698 112.014 172.709 1.00 16.42  ? 298  LYS B N     1 
ATOM   4483  C  CA    . LYS B 2  298 ? 130.515 111.258 172.325 1.00 16.42  ? 298  LYS B CA    1 
ATOM   4484  C  C     . LYS B 2  298 ? 129.323 111.612 173.203 1.00 16.42  ? 298  LYS B C     1 
ATOM   4485  O  O     . LYS B 2  298 ? 128.176 111.425 172.788 1.00 16.42  ? 298  LYS B O     1 
ATOM   4486  C  CB    . LYS B 2  298 ? 130.802 109.756 172.405 1.00 16.42  ? 298  LYS B CB    1 
ATOM   4487  C  CG    . LYS B 2  298 ? 129.794 108.866 171.707 1.00 16.42  ? 298  LYS B CG    1 
ATOM   4488  C  CD    . LYS B 2  298 ? 130.070 107.405 171.976 1.00 16.42  ? 298  LYS B CD    1 
ATOM   4489  C  CE    . LYS B 2  298 ? 131.294 106.933 171.235 1.00 16.42  ? 298  LYS B CE    1 
ATOM   4490  N  NZ    . LYS B 2  298 ? 131.510 105.471 171.390 1.00 16.42  ? 298  LYS B NZ    1 
ATOM   4491  N  N     . LYS B 2  299 ? 129.573 112.166 174.388 1.00 15.69  ? 299  LYS B N     1 
ATOM   4492  C  CA    . LYS B 2  299 ? 128.531 112.678 175.269 1.00 15.69  ? 299  LYS B CA    1 
ATOM   4493  C  C     . LYS B 2  299 ? 127.966 114.010 174.796 1.00 15.69  ? 299  LYS B C     1 
ATOM   4494  O  O     . LYS B 2  299 ? 127.058 114.547 175.436 1.00 15.69  ? 299  LYS B O     1 
ATOM   4495  C  CB    . LYS B 2  299 ? 129.079 112.825 176.690 1.00 15.69  ? 299  LYS B CB    1 
ATOM   4496  C  CG    . LYS B 2  299 ? 129.434 111.507 177.351 1.00 15.69  ? 299  LYS B CG    1 
ATOM   4497  C  CD    . LYS B 2  299 ? 129.811 111.694 178.811 1.00 15.69  ? 299  LYS B CD    1 
ATOM   4498  C  CE    . LYS B 2  299 ? 131.190 112.310 178.953 1.00 15.69  ? 299  LYS B CE    1 
ATOM   4499  N  NZ    . LYS B 2  299 ? 131.618 112.392 180.376 1.00 15.69  ? 299  LYS B NZ    1 
ATOM   4500  N  N     . MET B 2  300 ? 128.490 114.549 173.704 1.00 14.67  ? 300  MET B N     1 
ATOM   4501  C  CA    . MET B 2  300 ? 128.024 115.769 173.077 1.00 14.67  ? 300  MET B CA    1 
ATOM   4502  C  C     . MET B 2  300 ? 126.954 115.516 172.029 1.00 14.67  ? 300  MET B C     1 
ATOM   4503  O  O     . MET B 2  300 ? 126.370 116.478 171.524 1.00 14.67  ? 300  MET B O     1 
ATOM   4504  C  CB    . MET B 2  300 ? 129.212 116.473 172.428 1.00 14.67  ? 300  MET B CB    1 
ATOM   4505  C  CG    . MET B 2  300 ? 130.274 116.883 173.403 1.00 14.67  ? 300  MET B CG    1 
ATOM   4506  S  SD    . MET B 2  300 ? 129.631 118.190 174.418 1.00 14.67  ? 300  MET B SD    1 
ATOM   4507  C  CE    . MET B 2  300 ? 129.558 119.436 173.152 1.00 14.67  ? 300  MET B CE    1 
ATOM   4508  N  N     . PHE B 2  301 ? 126.694 114.250 171.700 1.00 13.31  ? 301  PHE B N     1 
ATOM   4509  C  CA    . PHE B 2  301 ? 125.791 113.920 170.598 1.00 13.31  ? 301  PHE B CA    1 
ATOM   4510  C  C     . PHE B 2  301 ? 124.327 114.332 170.790 1.00 13.31  ? 301  PHE B C     1 
ATOM   4511  O  O     . PHE B 2  301 ? 123.727 114.773 169.795 1.00 13.31  ? 301  PHE B O     1 
ATOM   4512  C  CB    . PHE B 2  301 ? 125.871 112.421 170.274 1.00 13.31  ? 301  PHE B CB    1 
ATOM   4513  C  CG    . PHE B 2  301 ? 127.123 112.001 169.554 1.00 13.31  ? 301  PHE B CG    1 
ATOM   4514  C  CD1   . PHE B 2  301 ? 128.042 112.929 169.103 1.00 13.31  ? 301  PHE B CD1   1 
ATOM   4515  C  CD2   . PHE B 2  301 ? 127.348 110.665 169.285 1.00 13.31  ? 301  PHE B CD2   1 
ATOM   4516  C  CE1   . PHE B 2  301 ? 129.173 112.529 168.435 1.00 13.31  ? 301  PHE B CE1   1 
ATOM   4517  C  CE2   . PHE B 2  301 ? 128.475 110.264 168.609 1.00 13.31  ? 301  PHE B CE2   1 
ATOM   4518  C  CZ    . PHE B 2  301 ? 129.389 111.198 168.190 1.00 13.31  ? 301  PHE B CZ    1 
ATOM   4519  N  N     . PRO B 2  302 ? 123.677 114.206 171.965 1.00 13.29  ? 302  PRO B N     1 
ATOM   4520  C  CA    . PRO B 2  302 ? 122.329 114.788 172.078 1.00 13.29  ? 302  PRO B CA    1 
ATOM   4521  C  C     . PRO B 2  302 ? 122.322 116.300 172.044 1.00 13.29  ? 302  PRO B C     1 
ATOM   4522  O  O     . PRO B 2  302 ? 121.300 116.891 171.680 1.00 13.29  ? 302  PRO B O     1 
ATOM   4523  C  CB    . PRO B 2  302 ? 121.822 114.263 173.426 1.00 13.29  ? 302  PRO B CB    1 
ATOM   4524  C  CG    . PRO B 2  302 ? 123.014 113.943 174.177 1.00 13.29  ? 302  PRO B CG    1 
ATOM   4525  C  CD    . PRO B 2  302 ? 123.986 113.428 173.184 1.00 13.29  ? 302  PRO B CD    1 
ATOM   4526  N  N     . GLN B 2  303 ? 123.436 116.940 172.390 1.00 12.85  ? 303  GLN B N     1 
ATOM   4527  C  CA    . GLN B 2  303 ? 123.514 118.391 172.340 1.00 12.85  ? 303  GLN B CA    1 
ATOM   4528  C  C     . GLN B 2  303 ? 123.651 118.888 170.906 1.00 12.85  ? 303  GLN B C     1 
ATOM   4529  O  O     . GLN B 2  303 ? 123.240 120.013 170.607 1.00 12.85  ? 303  GLN B O     1 
ATOM   4530  C  CB    . GLN B 2  303 ? 124.676 118.849 173.225 1.00 12.85  ? 303  GLN B CB    1 
ATOM   4531  C  CG    . GLN B 2  303 ? 124.711 120.314 173.622 1.00 12.85  ? 303  GLN B CG    1 
ATOM   4532  C  CD    . GLN B 2  303 ? 125.424 121.191 172.629 1.00 12.85  ? 303  GLN B CD    1 
ATOM   4533  O  OE1   . GLN B 2  303 ? 124.894 122.195 172.179 1.00 12.85  ? 303  GLN B OE1   1 
ATOM   4534  N  NE2   . GLN B 2  303 ? 126.647 120.830 172.303 1.00 12.85  ? 303  GLN B NE2   1 
ATOM   4535  N  N     . TYR B 2  304 ? 124.198 118.065 170.000 1.00 15.95  ? 304  TYR B N     1 
ATOM   4536  C  CA    . TYR B 2  304 ? 124.203 118.448 168.592 1.00 15.95  ? 304  TYR B CA    1 
ATOM   4537  C  C     . TYR B 2  304 ? 122.871 118.160 167.931 1.00 15.95  ? 304  TYR B C     1 
ATOM   4538  O  O     . TYR B 2  304 ? 122.450 118.908 167.044 1.00 15.95  ? 304  TYR B O     1 
ATOM   4539  C  CB    . TYR B 2  304 ? 125.265 117.707 167.784 1.00 15.95  ? 304  TYR B CB    1 
ATOM   4540  C  CG    . TYR B 2  304 ? 126.664 117.772 168.307 1.00 15.95  ? 304  TYR B CG    1 
ATOM   4541  C  CD1   . TYR B 2  304 ? 127.298 118.981 168.500 1.00 15.95  ? 304  TYR B CD1   1 
ATOM   4542  C  CD2   . TYR B 2  304 ? 127.399 116.614 168.478 1.00 15.95  ? 304  TYR B CD2   1 
ATOM   4543  C  CE1   . TYR B 2  304 ? 128.589 119.033 168.957 1.00 15.95  ? 304  TYR B CE1   1 
ATOM   4544  C  CE2   . TYR B 2  304 ? 128.695 116.655 168.914 1.00 15.95  ? 304  TYR B CE2   1 
ATOM   4545  C  CZ    . TYR B 2  304 ? 129.286 117.868 169.157 1.00 15.95  ? 304  TYR B CZ    1 
ATOM   4546  O  OH    . TYR B 2  304 ? 130.584 117.921 169.592 1.00 15.95  ? 304  TYR B OH    1 
ATOM   4547  N  N     . TRP B 2  305 ? 122.220 117.065 168.323 1.00 16.63  ? 305  TRP B N     1 
ATOM   4548  C  CA    . TRP B 2  305 ? 120.943 116.697 167.729 1.00 16.63  ? 305  TRP B CA    1 
ATOM   4549  C  C     . TRP B 2  305 ? 119.838 117.670 168.120 1.00 16.63  ? 305  TRP B C     1 
ATOM   4550  O  O     . TRP B 2  305 ? 118.915 117.893 167.334 1.00 16.63  ? 305  TRP B O     1 
ATOM   4551  C  CB    . TRP B 2  305 ? 120.619 115.248 168.104 1.00 16.63  ? 305  TRP B CB    1 
ATOM   4552  C  CG    . TRP B 2  305 ? 119.236 114.775 167.792 1.00 16.63  ? 305  TRP B CG    1 
ATOM   4553  C  CD1   . TRP B 2  305 ? 118.547 114.952 166.634 1.00 16.63  ? 305  TRP B CD1   1 
ATOM   4554  C  CD2   . TRP B 2  305 ? 118.425 113.931 168.612 1.00 16.63  ? 305  TRP B CD2   1 
ATOM   4555  N  NE1   . TRP B 2  305 ? 117.322 114.349 166.715 1.00 16.63  ? 305  TRP B NE1   1 
ATOM   4556  C  CE2   . TRP B 2  305 ? 117.230 113.700 167.916 1.00 16.63  ? 305  TRP B CE2   1 
ATOM   4557  C  CE3   . TRP B 2  305 ? 118.587 113.369 169.879 1.00 16.63  ? 305  TRP B CE3   1 
ATOM   4558  C  CZ2   . TRP B 2  305 ? 116.201 112.936 168.441 1.00 16.63  ? 305  TRP B CZ2   1 
ATOM   4559  C  CZ3   . TRP B 2  305 ? 117.563 112.608 170.399 1.00 16.63  ? 305  TRP B CZ3   1 
ATOM   4560  C  CH2   . TRP B 2  305 ? 116.386 112.398 169.681 1.00 16.63  ? 305  TRP B CH2   1 
ATOM   4561  N  N     . PHE B 2  306 ? 119.940 118.303 169.288 1.00 16.39  ? 306  PHE B N     1 
ATOM   4562  C  CA    . PHE B 2  306 ? 118.997 119.360 169.636 1.00 16.39  ? 306  PHE B CA    1 
ATOM   4563  C  C     . PHE B 2  306 ? 119.183 120.592 168.761 1.00 16.39  ? 306  PHE B C     1 
ATOM   4564  O  O     . PHE B 2  306 ? 118.225 121.331 168.522 1.00 16.39  ? 306  PHE B O     1 
ATOM   4565  C  CB    . PHE B 2  306 ? 119.140 119.702 171.119 1.00 16.39  ? 306  PHE B CB    1 
ATOM   4566  C  CG    . PHE B 2  306 ? 118.275 120.834 171.574 1.00 16.39  ? 306  PHE B CG    1 
ATOM   4567  C  CD1   . PHE B 2  306 ? 116.901 120.762 171.456 1.00 16.39  ? 306  PHE B CD1   1 
ATOM   4568  C  CD2   . PHE B 2  306 ? 118.830 121.933 172.198 1.00 16.39  ? 306  PHE B CD2   1 
ATOM   4569  C  CE1   . PHE B 2  306 ? 116.105 121.796 171.887 1.00 16.39  ? 306  PHE B CE1   1 
ATOM   4570  C  CE2   . PHE B 2  306 ? 118.035 122.958 172.642 1.00 16.39  ? 306  PHE B CE2   1 
ATOM   4571  C  CZ    . PHE B 2  306 ? 116.675 122.892 172.486 1.00 16.39  ? 306  PHE B CZ    1 
ATOM   4572  N  N     . GLU B 2  307 ? 120.388 120.804 168.243 1.00 15.85  ? 307  GLU B N     1 
ATOM   4573  C  CA    . GLU B 2  307 ? 120.650 121.942 167.372 1.00 15.85  ? 307  GLU B CA    1 
ATOM   4574  C  C     . GLU B 2  307 ? 120.208 121.694 165.937 1.00 15.85  ? 307  GLU B C     1 
ATOM   4575  O  O     . GLU B 2  307 ? 119.788 122.632 165.257 1.00 15.85  ? 307  GLU B O     1 
ATOM   4576  C  CB    . GLU B 2  307 ? 122.133 122.270 167.417 1.00 15.85  ? 307  GLU B CB    1 
ATOM   4577  C  CG    . GLU B 2  307 ? 122.561 122.884 168.722 1.00 15.85  ? 307  GLU B CG    1 
ATOM   4578  C  CD    . GLU B 2  307 ? 124.050 122.907 168.856 1.00 15.85  ? 307  GLU B CD    1 
ATOM   4579  O  OE1   . GLU B 2  307 ? 124.698 122.208 168.062 1.00 15.85  ? 307  GLU B OE1   1 
ATOM   4580  O  OE2   . GLU B 2  307 ? 124.575 123.627 169.724 1.00 15.85  ? 307  GLU B OE2   1 
ATOM   4581  N  N     . LEU B 2  308 ? 120.300 120.455 165.455 1.00 13.19  ? 308  LEU B N     1 
ATOM   4582  C  CA    . LEU B 2  308 ? 119.842 120.151 164.106 1.00 13.19  ? 308  LEU B CA    1 
ATOM   4583  C  C     . LEU B 2  308 ? 118.327 120.142 163.994 1.00 13.19  ? 308  LEU B C     1 
ATOM   4584  O  O     . LEU B 2  308 ? 117.802 120.322 162.891 1.00 13.19  ? 308  LEU B O     1 
ATOM   4585  C  CB    . LEU B 2  308 ? 120.407 118.813 163.646 1.00 13.19  ? 308  LEU B CB    1 
ATOM   4586  C  CG    . LEU B 2  308 ? 121.889 118.832 163.303 1.00 13.19  ? 308  LEU B CG    1 
ATOM   4587  C  CD1   . LEU B 2  308 ? 122.372 117.432 163.125 1.00 13.19  ? 308  LEU B CD1   1 
ATOM   4588  C  CD2   . LEU B 2  308 ? 122.101 119.608 162.031 1.00 13.19  ? 308  LEU B CD2   1 
ATOM   4589  N  N     . THR B 2  309 ? 117.613 119.945 165.098 1.00 15.74  ? 309  THR B N     1 
ATOM   4590  C  CA    . THR B 2  309 ? 116.163 120.049 165.084 1.00 15.74  ? 309  THR B CA    1 
ATOM   4591  C  C     . THR B 2  309 ? 115.672 121.482 165.217 1.00 15.74  ? 309  THR B C     1 
ATOM   4592  O  O     . THR B 2  309 ? 114.459 121.704 165.193 1.00 15.74  ? 309  THR B O     1 
ATOM   4593  C  CB    . THR B 2  309 ? 115.554 119.202 166.202 1.00 15.74  ? 309  THR B CB    1 
ATOM   4594  O  OG1   . THR B 2  309 ? 116.029 119.666 167.470 1.00 15.74  ? 309  THR B OG1   1 
ATOM   4595  C  CG2   . THR B 2  309 ? 115.913 117.742 166.025 1.00 15.74  ? 309  THR B CG2   1 
ATOM   4596  N  N     . GLN B 2  310 ? 116.571 122.456 165.355 1.00 18.24  ? 310  GLN B N     1 
ATOM   4597  C  CA    . GLN B 2  310 ? 116.192 123.858 165.447 1.00 18.24  ? 310  GLN B CA    1 
ATOM   4598  C  C     . GLN B 2  310 ? 116.666 124.661 164.243 1.00 18.24  ? 310  GLN B C     1 
ATOM   4599  O  O     . GLN B 2  310 ? 116.737 125.890 164.310 1.00 18.24  ? 310  GLN B O     1 
ATOM   4600  C  CB    . GLN B 2  310 ? 116.727 124.474 166.737 1.00 18.24  ? 310  GLN B CB    1 
ATOM   4601  C  CG    . GLN B 2  310 ? 116.180 123.848 168.005 1.00 18.24  ? 310  GLN B CG    1 
ATOM   4602  C  CD    . GLN B 2  310 ? 114.682 123.972 168.136 1.00 18.24  ? 310  GLN B CD    1 
ATOM   4603  O  OE1   . GLN B 2  310 ? 113.956 122.985 168.042 1.00 18.24  ? 310  GLN B OE1   1 
ATOM   4604  N  NE2   . GLN B 2  310 ? 114.209 125.187 168.364 1.00 18.24  ? 310  GLN B NE2   1 
ATOM   4605  N  N     . GLY B 2  311 ? 117.001 123.990 163.146 1.00 15.98  ? 311  GLY B N     1 
ATOM   4606  C  CA    . GLY B 2  311 ? 117.337 124.683 161.921 1.00 15.98  ? 311  GLY B CA    1 
ATOM   4607  C  C     . GLY B 2  311 ? 118.759 125.169 161.824 1.00 15.98  ? 311  GLY B C     1 
ATOM   4608  O  O     . GLY B 2  311 ? 119.061 125.994 160.958 1.00 15.98  ? 311  GLY B O     1 
ATOM   4609  N  N     . PHE B 2  312 ? 119.645 124.684 162.681 1.00 14.06  ? 312  PHE B N     1 
ATOM   4610  C  CA    . PHE B 2  312 ? 121.048 125.067 162.654 1.00 14.06  ? 312  PHE B CA    1 
ATOM   4611  C  C     . PHE B 2  312 ? 121.837 124.062 161.833 1.00 14.06  ? 312  PHE B C     1 
ATOM   4612  O  O     . PHE B 2  312 ? 121.801 122.864 162.118 1.00 14.06  ? 312  PHE B O     1 
ATOM   4613  C  CB    . PHE B 2  312 ? 121.610 125.130 164.071 1.00 14.06  ? 312  PHE B CB    1 
ATOM   4614  C  CG    . PHE B 2  312 ? 121.200 126.342 164.834 1.00 14.06  ? 312  PHE B CG    1 
ATOM   4615  C  CD1   . PHE B 2  312 ? 120.859 127.507 164.180 1.00 14.06  ? 312  PHE B CD1   1 
ATOM   4616  C  CD2   . PHE B 2  312 ? 121.128 126.307 166.208 1.00 14.06  ? 312  PHE B CD2   1 
ATOM   4617  C  CE1   . PHE B 2  312 ? 120.482 128.623 164.888 1.00 14.06  ? 312  PHE B CE1   1 
ATOM   4618  C  CE2   . PHE B 2  312 ? 120.753 127.417 166.916 1.00 14.06  ? 312  PHE B CE2   1 
ATOM   4619  C  CZ    . PHE B 2  312 ? 120.423 128.573 166.257 1.00 14.06  ? 312  PHE B CZ    1 
ATOM   4620  N  N     . SER B 2  313 ? 122.562 124.544 160.829 1.00 14.84  ? 313  SER B N     1 
ATOM   4621  C  CA    . SER B 2  313 ? 123.651 123.747 160.296 1.00 14.84  ? 313  SER B CA    1 
ATOM   4622  C  C     . SER B 2  313 ? 124.780 123.704 161.313 1.00 14.84  ? 313  SER B C     1 
ATOM   4623  O  O     . SER B 2  313 ? 124.809 124.458 162.285 1.00 14.84  ? 313  SER B O     1 
ATOM   4624  C  CB    . SER B 2  313 ? 124.147 124.300 158.969 1.00 14.84  ? 313  SER B CB    1 
ATOM   4625  O  OG    . SER B 2  313 ? 125.312 123.628 158.543 1.00 14.84  ? 313  SER B OG    1 
ATOM   4626  N  N     . LEU B 2  314 ? 125.728 122.809 161.097 1.00 17.49  ? 314  LEU B N     1 
ATOM   4627  C  CA    . LEU B 2  314 ? 126.539 122.398 162.232 1.00 17.49  ? 314  LEU B CA    1 
ATOM   4628  C  C     . LEU B 2  314 ? 127.934 122.027 161.742 1.00 17.49  ? 314  LEU B C     1 
ATOM   4629  O  O     . LEU B 2  314 ? 128.136 120.952 161.175 1.00 17.49  ? 314  LEU B O     1 
ATOM   4630  C  CB    . LEU B 2  314 ? 125.810 121.277 162.957 1.00 17.49  ? 314  LEU B CB    1 
ATOM   4631  C  CG    . LEU B 2  314 ? 126.172 120.613 164.265 1.00 17.49  ? 314  LEU B CG    1 
ATOM   4632  C  CD1   . LEU B 2  314 ? 124.974 120.685 165.142 1.00 17.49  ? 314  LEU B CD1   1 
ATOM   4633  C  CD2   . LEU B 2  314 ? 126.335 119.184 163.937 1.00 17.49  ? 314  LEU B CD2   1 
ATOM   4634  N  N     . LEU B 2  315 ? 128.879 122.943 161.954 1.00 29.30  ? 315  LEU B N     1 
ATOM   4635  C  CA    . LEU B 2  315 ? 130.223 122.860 161.401 1.00 29.30  ? 315  LEU B CA    1 
ATOM   4636  C  C     . LEU B 2  315 ? 131.185 122.380 162.474 1.00 29.30  ? 315  LEU B C     1 
ATOM   4637  O  O     . LEU B 2  315 ? 131.156 122.877 163.602 1.00 29.30  ? 315  LEU B O     1 
ATOM   4638  C  CB    . LEU B 2  315 ? 130.690 124.221 160.890 1.00 29.30  ? 315  LEU B CB    1 
ATOM   4639  C  CG    . LEU B 2  315 ? 131.948 124.167 160.027 1.00 29.30  ? 315  LEU B CG    1 
ATOM   4640  C  CD1   . LEU B 2  315 ? 131.608 123.727 158.635 1.00 29.30  ? 315  LEU B CD1   1 
ATOM   4641  C  CD2   . LEU B 2  315 ? 132.689 125.454 160.004 1.00 29.30  ? 315  LEU B CD2   1 
ATOM   4642  N  N     . PHE B 2  316 ? 132.049 121.441 162.119 1.00 29.30  ? 316  PHE B N     1 
ATOM   4643  C  CA    . PHE B 2  316 ? 133.042 120.903 163.037 1.00 29.30  ? 316  PHE B CA    1 
ATOM   4644  C  C     . PHE B 2  316 ? 134.435 121.276 162.556 1.00 29.30  ? 316  PHE B C     1 
ATOM   4645  O  O     . PHE B 2  316 ? 134.830 120.904 161.452 1.00 29.30  ? 316  PHE B O     1 
ATOM   4646  C  CB    . PHE B 2  316 ? 132.925 119.387 163.147 1.00 29.30  ? 316  PHE B CB    1 
ATOM   4647  C  CG    . PHE B 2  316 ? 131.716 118.919 163.883 1.00 29.30  ? 316  PHE B CG    1 
ATOM   4648  C  CD1   . PHE B 2  316 ? 131.647 119.013 165.256 1.00 29.30  ? 316  PHE B CD1   1 
ATOM   4649  C  CD2   . PHE B 2  316 ? 130.671 118.341 163.206 1.00 29.30  ? 316  PHE B CD2   1 
ATOM   4650  C  CE1   . PHE B 2  316 ? 130.538 118.569 165.930 1.00 29.30  ? 316  PHE B CE1   1 
ATOM   4651  C  CE2   . PHE B 2  316 ? 129.576 117.874 163.872 1.00 29.30  ? 316  PHE B CE2   1 
ATOM   4652  C  CZ    . PHE B 2  316 ? 129.501 117.995 165.232 1.00 29.30  ? 316  PHE B CZ    1 
ATOM   4653  N  N     . TYR B 2  317 ? 135.183 121.985 163.384 1.00 20.86  ? 317  TYR B N     1 
ATOM   4654  C  CA    . TYR B 2  317 ? 136.568 122.300 163.079 1.00 20.86  ? 317  TYR B CA    1 
ATOM   4655  C  C     . TYR B 2  317 ? 137.471 121.706 164.148 1.00 20.86  ? 317  TYR B C     1 
ATOM   4656  O  O     . TYR B 2  317 ? 137.017 121.049 165.085 1.00 20.86  ? 317  TYR B O     1 
ATOM   4657  C  CB    . TYR B 2  317 ? 136.777 123.810 162.944 1.00 20.86  ? 317  TYR B CB    1 
ATOM   4658  C  CG    . TYR B 2  317 ? 136.486 124.636 164.178 1.00 20.86  ? 317  TYR B CG    1 
ATOM   4659  C  CD1   . TYR B 2  317 ? 135.201 125.072 164.446 1.00 20.86  ? 317  TYR B CD1   1 
ATOM   4660  C  CD2   . TYR B 2  317 ? 137.502 125.027 165.043 1.00 20.86  ? 317  TYR B CD2   1 
ATOM   4661  C  CE1   . TYR B 2  317 ? 134.924 125.830 165.552 1.00 20.86  ? 317  TYR B CE1   1 
ATOM   4662  C  CE2   . TYR B 2  317 ? 137.230 125.791 166.155 1.00 20.86  ? 317  TYR B CE2   1 
ATOM   4663  C  CZ    . TYR B 2  317 ? 135.939 126.188 166.401 1.00 20.86  ? 317  TYR B CZ    1 
ATOM   4664  O  OH    . TYR B 2  317 ? 135.654 126.952 167.505 1.00 20.86  ? 317  TYR B OH    1 
ATOM   4665  N  N     . GLY B 2  318 ? 138.766 121.937 163.987 1.00 12.48  ? 318  GLY B N     1 
ATOM   4666  C  CA    . GLY B 2  318 ? 139.749 121.390 164.894 1.00 12.48  ? 318  GLY B CA    1 
ATOM   4667  C  C     . GLY B 2  318 ? 140.947 120.833 164.162 1.00 12.48  ? 318  GLY B C     1 
ATOM   4668  O  O     . GLY B 2  318 ? 140.983 120.828 162.929 1.00 12.48  ? 318  GLY B O     1 
ATOM   4669  N  N     . VAL B 2  319 ? 141.934 120.359 164.911 1.00 17.81  ? 319  VAL B N     1 
ATOM   4670  C  CA    . VAL B 2  319 ? 143.145 119.773 164.352 1.00 17.81  ? 319  VAL B CA    1 
ATOM   4671  C  C     . VAL B 2  319 ? 143.035 118.251 164.401 1.00 17.81  ? 319  VAL B C     1 
ATOM   4672  O  O     . VAL B 2  319 ? 142.707 117.671 165.443 1.00 17.81  ? 319  VAL B O     1 
ATOM   4673  C  CB    . VAL B 2  319 ? 144.397 120.303 165.080 1.00 17.81  ? 319  VAL B CB    1 
ATOM   4674  C  CG1   . VAL B 2  319 ? 144.224 120.277 166.582 1.00 17.81  ? 319  VAL B CG1   1 
ATOM   4675  C  CG2   . VAL B 2  319 ? 145.614 119.489 164.715 1.00 17.81  ? 319  VAL B CG2   1 
ATOM   4676  N  N     . GLY B 2  320 ? 143.258 117.610 163.263 1.00 18.06  ? 320  GLY B N     1 
ATOM   4677  C  CA    . GLY B 2  320 ? 143.113 116.175 163.129 1.00 18.06  ? 320  GLY B CA    1 
ATOM   4678  C  C     . GLY B 2  320 ? 141.967 115.811 162.204 1.00 18.06  ? 320  GLY B C     1 
ATOM   4679  O  O     . GLY B 2  320 ? 141.172 116.648 161.786 1.00 18.06  ? 320  GLY B O     1 
ATOM   4680  N  N     . SER B 2  321 ? 141.902 114.520 161.891 1.00 16.73  ? 321  SER B N     1 
ATOM   4681  C  CA    . SER B 2  321 ? 140.840 114.026 161.026 1.00 16.73  ? 321  SER B CA    1 
ATOM   4682  C  C     . SER B 2  321 ? 139.518 114.005 161.769 1.00 16.73  ? 321  SER B C     1 
ATOM   4683  O  O     . SER B 2  321 ? 139.416 113.466 162.874 1.00 16.73  ? 321  SER B O     1 
ATOM   4684  C  CB    . SER B 2  321 ? 141.150 112.628 160.515 1.00 16.73  ? 321  SER B CB    1 
ATOM   4685  O  OG    . SER B 2  321 ? 140.093 112.144 159.708 1.00 16.73  ? 321  SER B OG    1 
ATOM   4686  N  N     . LYS B 2  322 ? 138.502 114.586 161.149 1.00 14.80  ? 322  LYS B N     1 
ATOM   4687  C  CA    . LYS B 2  322 ? 137.160 114.608 161.697 1.00 14.80  ? 322  LYS B CA    1 
ATOM   4688  C  C     . LYS B 2  322 ? 136.240 113.659 160.953 1.00 14.80  ? 322  LYS B C     1 
ATOM   4689  O  O     . LYS B 2  322 ? 135.030 113.697 161.162 1.00 14.80  ? 322  LYS B O     1 
ATOM   4690  C  CB    . LYS B 2  322 ? 136.628 116.036 161.649 1.00 14.80  ? 322  LYS B CB    1 
ATOM   4691  C  CG    . LYS B 2  322 ? 137.435 116.982 162.505 1.00 14.80  ? 322  LYS B CG    1 
ATOM   4692  C  CD    . LYS B 2  322 ? 137.040 118.401 162.250 1.00 14.80  ? 322  LYS B CD    1 
ATOM   4693  C  CE    . LYS B 2  322 ? 137.613 118.840 160.928 1.00 14.80  ? 322  LYS B CE    1 
ATOM   4694  N  NZ    . LYS B 2  322 ? 139.095 118.865 160.994 1.00 14.80  ? 322  LYS B NZ    1 
ATOM   4695  N  N     . ARG B 2  323 ? 136.795 112.798 160.099 1.00 15.44  ? 323  ARG B N     1 
ATOM   4696  C  CA    . ARG B 2  323 ? 135.988 111.956 159.225 1.00 15.44  ? 323  ARG B CA    1 
ATOM   4697  C  C     . ARG B 2  323 ? 135.337 110.804 159.979 1.00 15.44  ? 323  ARG B C     1 
ATOM   4698  O  O     . ARG B 2  323 ? 134.141 110.546 159.811 1.00 15.44  ? 323  ARG B O     1 
ATOM   4699  C  CB    . ARG B 2  323 ? 136.845 111.417 158.086 1.00 15.44  ? 323  ARG B CB    1 
ATOM   4700  C  CG    . ARG B 2  323 ? 136.055 110.567 157.140 1.00 15.44  ? 323  ARG B CG    1 
ATOM   4701  C  CD    . ARG B 2  323 ? 136.874 110.001 156.017 1.00 15.44  ? 323  ARG B CD    1 
ATOM   4702  N  NE    . ARG B 2  323 ? 136.010 109.181 155.185 1.00 15.44  ? 323  ARG B NE    1 
ATOM   4703  C  CZ    . ARG B 2  323 ? 135.764 107.898 155.412 1.00 15.44  ? 323  ARG B CZ    1 
ATOM   4704  N  NH1   . ARG B 2  323 ? 134.947 107.232 154.614 1.00 15.44  ? 323  ARG B NH1   1 
ATOM   4705  N  NH2   . ARG B 2  323 ? 136.333 107.280 156.438 1.00 15.44  ? 323  ARG B NH2   1 
ATOM   4706  N  N     . ASN B 2  324 ? 136.106 110.092 160.805 1.00 13.71  ? 324  ASN B N     1 
ATOM   4707  C  CA    . ASN B 2  324 ? 135.537 108.984 161.568 1.00 13.71  ? 324  ASN B CA    1 
ATOM   4708  C  C     . ASN B 2  324 ? 134.603 109.469 162.667 1.00 13.71  ? 324  ASN B C     1 
ATOM   4709  O  O     . ASN B 2  324 ? 133.720 108.721 163.094 1.00 13.71  ? 324  ASN B O     1 
ATOM   4710  C  CB    . ASN B 2  324 ? 136.648 108.120 162.162 1.00 13.71  ? 324  ASN B CB    1 
ATOM   4711  C  CG    . ASN B 2  324 ? 137.370 107.299 161.116 1.00 13.71  ? 324  ASN B CG    1 
ATOM   4712  O  OD1   . ASN B 2  324 ? 138.543 107.528 160.830 1.00 13.71  ? 324  ASN B OD1   1 
ATOM   4713  N  ND2   . ASN B 2  324 ? 136.675 106.321 160.551 1.00 13.71  ? 324  ASN B ND2   1 
ATOM   4714  N  N     . PHE B 2  325 ? 134.789 110.700 163.144 1.00 14.32  ? 325  PHE B N     1 
ATOM   4715  C  CA    . PHE B 2  325 ? 133.808 111.310 164.035 1.00 14.32  ? 325  PHE B CA    1 
ATOM   4716  C  C     . PHE B 2  325 ? 132.504 111.571 163.302 1.00 14.32  ? 325  PHE B C     1 
ATOM   4717  O  O     . PHE B 2  325 ? 131.420 111.342 163.847 1.00 14.32  ? 325  PHE B O     1 
ATOM   4718  C  CB    . PHE B 2  325 ? 134.354 112.626 164.592 1.00 14.32  ? 325  PHE B CB    1 
ATOM   4719  C  CG    . PHE B 2  325 ? 133.450 113.302 165.599 1.00 14.32  ? 325  PHE B CG    1 
ATOM   4720  C  CD1   . PHE B 2  325 ? 133.506 112.958 166.935 1.00 14.32  ? 325  PHE B CD1   1 
ATOM   4721  C  CD2   . PHE B 2  325 ? 132.536 114.272 165.205 1.00 14.32  ? 325  PHE B CD2   1 
ATOM   4722  C  CE1   . PHE B 2  325 ? 132.686 113.575 167.855 1.00 14.32  ? 325  PHE B CE1   1 
ATOM   4723  C  CE2   . PHE B 2  325 ? 131.716 114.882 166.118 1.00 14.32  ? 325  PHE B CE2   1 
ATOM   4724  C  CZ    . PHE B 2  325 ? 131.794 114.540 167.443 1.00 14.32  ? 325  PHE B CZ    1 
ATOM   4725  N  N     . LEU B 2  326 ? 132.597 112.070 162.073 1.00 13.16  ? 326  LEU B N     1 
ATOM   4726  C  CA    . LEU B 2  326 ? 131.455 112.700 161.429 1.00 13.16  ? 326  LEU B CA    1 
ATOM   4727  C  C     . LEU B 2  326 ? 130.468 111.664 160.924 1.00 13.16  ? 326  LEU B C     1 
ATOM   4728  O  O     . LEU B 2  326 ? 129.254 111.855 161.028 1.00 13.16  ? 326  LEU B O     1 
ATOM   4729  C  CB    . LEU B 2  326 ? 131.941 113.578 160.280 1.00 13.16  ? 326  LEU B CB    1 
ATOM   4730  C  CG    . LEU B 2  326 ? 131.042 114.710 159.831 1.00 13.16  ? 326  LEU B CG    1 
ATOM   4731  C  CD1   . LEU B 2  326 ? 130.997 115.625 160.988 1.00 13.16  ? 326  LEU B CD1   1 
ATOM   4732  C  CD2   . LEU B 2  326 ? 131.626 115.427 158.649 1.00 13.16  ? 326  LEU B CD2   1 
ATOM   4733  N  N     . GLU B 2  327 ? 130.971 110.560 160.386 1.00 14.76  ? 327  GLU B N     1 
ATOM   4734  C  CA    . GLU B 2  327 ? 130.123 109.500 159.872 1.00 14.76  ? 327  GLU B CA    1 
ATOM   4735  C  C     . GLU B 2  327 ? 129.759 108.468 160.928 1.00 14.76  ? 327  GLU B C     1 
ATOM   4736  O  O     . GLU B 2  327 ? 128.954 107.581 160.648 1.00 14.76  ? 327  GLU B O     1 
ATOM   4737  C  CB    . GLU B 2  327 ? 130.807 108.814 158.689 1.00 14.76  ? 327  GLU B CB    1 
ATOM   4738  C  CG    . GLU B 2  327 ? 132.045 108.040 159.062 1.00 14.76  ? 327  GLU B CG    1 
ATOM   4739  C  CD    . GLU B 2  327 ? 132.775 107.520 157.848 1.00 14.76  ? 327  GLU B CD    1 
ATOM   4740  O  OE1   . GLU B 2  327 ? 132.354 107.854 156.722 1.00 14.76  ? 327  GLU B OE1   1 
ATOM   4741  O  OE2   . GLU B 2  327 ? 133.759 106.771 158.017 1.00 14.76  ? 327  GLU B OE2   1 
ATOM   4742  N  N     . GLU B 2  328 ? 130.338 108.547 162.123 1.00 14.72  ? 328  GLU B N     1 
ATOM   4743  C  CA    . GLU B 2  328 ? 129.821 107.755 163.232 1.00 14.72  ? 328  GLU B CA    1 
ATOM   4744  C  C     . GLU B 2  328 ? 128.714 108.502 163.960 1.00 14.72  ? 328  GLU B C     1 
ATOM   4745  O  O     . GLU B 2  328 ? 127.746 107.892 164.419 1.00 14.72  ? 328  GLU B O     1 
ATOM   4746  C  CB    . GLU B 2  328 ? 130.952 107.382 164.187 1.00 14.72  ? 328  GLU B CB    1 
ATOM   4747  C  CG    . GLU B 2  328 ? 130.529 106.554 165.384 1.00 14.72  ? 328  GLU B CG    1 
ATOM   4748  C  CD    . GLU B 2  328 ? 131.707 106.055 166.187 1.00 14.72  ? 328  GLU B CD    1 
ATOM   4749  O  OE1   . GLU B 2  328 ? 132.857 106.291 165.762 1.00 14.72  ? 328  GLU B OE1   1 
ATOM   4750  O  OE2   . GLU B 2  328 ? 131.488 105.433 167.247 1.00 14.72  ? 328  GLU B OE2   1 
ATOM   4751  N  N     . PHE B 2  329 ? 128.831 109.823 164.058 1.00 12.34  ? 329  PHE B N     1 
ATOM   4752  C  CA    . PHE B 2  329 ? 127.738 110.623 164.598 1.00 12.34  ? 329  PHE B CA    1 
ATOM   4753  C  C     . PHE B 2  329 ? 126.516 110.599 163.691 1.00 12.34  ? 329  PHE B C     1 
ATOM   4754  O  O     . PHE B 2  329 ? 125.391 110.427 164.167 1.00 12.34  ? 329  PHE B O     1 
ATOM   4755  C  CB    . PHE B 2  329 ? 128.207 112.057 164.830 1.00 12.34  ? 329  PHE B CB    1 
ATOM   4756  C  CG    . PHE B 2  329 ? 127.086 113.035 164.991 1.00 12.34  ? 329  PHE B CG    1 
ATOM   4757  C  CD1   . PHE B 2  329 ? 126.266 113.006 166.103 1.00 12.34  ? 329  PHE B CD1   1 
ATOM   4758  C  CD2   . PHE B 2  329 ? 126.861 113.994 164.022 1.00 12.34  ? 329  PHE B CD2   1 
ATOM   4759  C  CE1   . PHE B 2  329 ? 125.236 113.902 166.236 1.00 12.34  ? 329  PHE B CE1   1 
ATOM   4760  C  CE2   . PHE B 2  329 ? 125.838 114.892 164.152 1.00 12.34  ? 329  PHE B CE2   1 
ATOM   4761  C  CZ    . PHE B 2  329 ? 125.025 114.849 165.260 1.00 12.34  ? 329  PHE B CZ    1 
ATOM   4762  N  N     . ALA B 2  330 ? 126.712 110.760 162.386 1.00 11.58  ? 330  ALA B N     1 
ATOM   4763  C  CA    . ALA B 2  330 ? 125.579 110.959 161.494 1.00 11.58  ? 330  ALA B CA    1 
ATOM   4764  C  C     . ALA B 2  330 ? 124.890 109.660 161.111 1.00 11.58  ? 330  ALA B C     1 
ATOM   4765  O  O     . ALA B 2  330 ? 123.683 109.663 160.854 1.00 11.58  ? 330  ALA B O     1 
ATOM   4766  C  CB    . ALA B 2  330 ? 126.029 111.690 160.238 1.00 11.58  ? 330  ALA B CB    1 
ATOM   4767  N  N     . ILE B 2  331 ? 125.616 108.551 161.063 1.00 12.59  ? 331  ILE B N     1 
ATOM   4768  C  CA    . ILE B 2  331 ? 125.010 107.277 160.691 1.00 12.59  ? 331  ILE B CA    1 
ATOM   4769  C  C     . ILE B 2  331 ? 124.560 106.495 161.916 1.00 12.59  ? 331  ILE B C     1 
ATOM   4770  O  O     . ILE B 2  331 ? 123.415 106.043 161.986 1.00 12.59  ? 331  ILE B O     1 
ATOM   4771  C  CB    . ILE B 2  331 ? 125.984 106.457 159.821 1.00 12.59  ? 331  ILE B CB    1 
ATOM   4772  C  CG1   . ILE B 2  331 ? 126.243 107.180 158.501 1.00 12.59  ? 331  ILE B CG1   1 
ATOM   4773  C  CG2   . ILE B 2  331 ? 125.438 105.069 159.568 1.00 12.59  ? 331  ILE B CG2   1 
ATOM   4774  C  CD1   . ILE B 2  331 ? 127.354 106.574 157.689 1.00 12.59  ? 331  ILE B CD1   1 
ATOM   4775  N  N     . ASP B 2  332 ? 125.433 106.331 162.909 1.00 13.50  ? 332  ASP B N     1 
ATOM   4776  C  CA    . ASP B 2  332 ? 125.094 105.469 164.035 1.00 13.50  ? 332  ASP B CA    1 
ATOM   4777  C  C     . ASP B 2  332 ? 124.170 106.163 165.029 1.00 13.50  ? 332  ASP B C     1 
ATOM   4778  O  O     . ASP B 2  332 ? 123.236 105.539 165.542 1.00 13.50  ? 332  ASP B O     1 
ATOM   4779  C  CB    . ASP B 2  332 ? 126.362 104.992 164.737 1.00 13.50  ? 332  ASP B CB    1 
ATOM   4780  C  CG    . ASP B 2  332 ? 127.221 104.115 163.853 1.00 13.50  ? 332  ASP B CG    1 
ATOM   4781  O  OD1   . ASP B 2  332 ? 126.667 103.444 162.958 1.00 13.50  ? 332  ASP B OD1   1 
ATOM   4782  O  OD2   . ASP B 2  332 ? 128.453 104.096 164.051 1.00 13.50  ? 332  ASP B OD2   1 
ATOM   4783  N  N     . TYR B 2  333 ? 124.404 107.440 165.319 1.00 13.38  ? 333  TYR B N     1 
ATOM   4784  C  CA    . TYR B 2  333 ? 123.605 108.140 166.317 1.00 13.38  ? 333  TYR B CA    1 
ATOM   4785  C  C     . TYR B 2  333 ? 122.449 108.916 165.705 1.00 13.38  ? 333  TYR B C     1 
ATOM   4786  O  O     . TYR B 2  333 ? 121.305 108.760 166.136 1.00 13.38  ? 333  TYR B O     1 
ATOM   4787  C  CB    . TYR B 2  333 ? 124.471 109.108 167.132 1.00 13.38  ? 333  TYR B CB    1 
ATOM   4788  C  CG    . TYR B 2  333 ? 123.738 109.738 168.298 1.00 13.38  ? 333  TYR B CG    1 
ATOM   4789  C  CD1   . TYR B 2  333 ? 123.588 109.052 169.492 1.00 13.38  ? 333  TYR B CD1   1 
ATOM   4790  C  CD2   . TYR B 2  333 ? 123.175 111.008 168.197 1.00 13.38  ? 333  TYR B CD2   1 
ATOM   4791  C  CE1   . TYR B 2  333 ? 122.923 109.615 170.557 1.00 13.38  ? 333  TYR B CE1   1 
ATOM   4792  C  CE2   . TYR B 2  333 ? 122.493 111.569 169.250 1.00 13.38  ? 333  TYR B CE2   1 
ATOM   4793  C  CZ    . TYR B 2  333 ? 122.370 110.870 170.426 1.00 13.38  ? 333  TYR B CZ    1 
ATOM   4794  O  OH    . TYR B 2  333 ? 121.699 111.436 171.479 1.00 13.38  ? 333  TYR B OH    1 
ATOM   4795  N  N     . LEU B 2  334 ? 122.738 109.768 164.721 1.00 13.91  ? 334  LEU B N     1 
ATOM   4796  C  CA    . LEU B 2  334 ? 121.791 110.802 164.321 1.00 13.91  ? 334  LEU B CA    1 
ATOM   4797  C  C     . LEU B 2  334 ? 120.621 110.227 163.539 1.00 13.91  ? 334  LEU B C     1 
ATOM   4798  O  O     . LEU B 2  334 ? 119.460 110.525 163.836 1.00 13.91  ? 334  LEU B O     1 
ATOM   4799  C  CB    . LEU B 2  334 ? 122.502 111.861 163.491 1.00 13.91  ? 334  LEU B CB    1 
ATOM   4800  C  CG    . LEU B 2  334 ? 121.630 113.034 163.075 1.00 13.91  ? 334  LEU B CG    1 
ATOM   4801  C  CD1   . LEU B 2  334 ? 121.205 113.823 164.296 1.00 13.91  ? 334  LEU B CD1   1 
ATOM   4802  C  CD2   . LEU B 2  334 ? 122.371 113.893 162.089 1.00 13.91  ? 334  LEU B CD2   1 
ATOM   4803  N  N     . SER B 2  335 ? 120.906 109.410 162.539 1.00 16.06  ? 335  SER B N     1 
ATOM   4804  C  CA    . SER B 2  335 ? 119.884 108.903 161.630 1.00 16.06  ? 335  SER B CA    1 
ATOM   4805  C  C     . SER B 2  335 ? 118.861 107.943 162.252 1.00 16.06  ? 335  SER B C     1 
ATOM   4806  O  O     . SER B 2  335 ? 117.685 108.038 161.884 1.00 16.06  ? 335  SER B O     1 
ATOM   4807  C  CB    . SER B 2  335 ? 120.550 108.253 160.415 1.00 16.06  ? 335  SER B CB    1 
ATOM   4808  O  OG    . SER B 2  335 ? 119.573 107.762 159.522 1.00 16.06  ? 335  SER B OG    1 
ATOM   4809  N  N     . PRO B 2  336 ? 119.207 107.012 163.164 1.00 17.06  ? 336  PRO B N     1 
ATOM   4810  C  CA    . PRO B 2  336 ? 118.128 106.260 163.821 1.00 17.06  ? 336  PRO B CA    1 
ATOM   4811  C  C     . PRO B 2  336 ? 117.315 107.085 164.794 1.00 17.06  ? 336  PRO B C     1 
ATOM   4812  O  O     . PRO B 2  336 ? 116.142 106.767 165.019 1.00 17.06  ? 336  PRO B O     1 
ATOM   4813  C  CB    . PRO B 2  336 ? 118.868 105.131 164.547 1.00 17.06  ? 336  PRO B CB    1 
ATOM   4814  C  CG    . PRO B 2  336 ? 120.114 104.991 163.851 1.00 17.06  ? 336  PRO B CG    1 
ATOM   4815  C  CD    . PRO B 2  336 ? 120.501 106.362 163.457 1.00 17.06  ? 336  PRO B CD    1 
ATOM   4816  N  N     . LYS B 2  337 ? 117.886 108.129 165.380 1.00 17.02  ? 337  LYS B N     1 
ATOM   4817  C  CA    . LYS B 2  337 ? 117.188 108.826 166.446 1.00 17.02  ? 337  LYS B CA    1 
ATOM   4818  C  C     . LYS B 2  337 ? 116.319 109.967 165.953 1.00 17.02  ? 337  LYS B C     1 
ATOM   4819  O  O     . LYS B 2  337 ? 115.423 110.397 166.683 1.00 17.02  ? 337  LYS B O     1 
ATOM   4820  C  CB    . LYS B 2  337 ? 118.185 109.328 167.489 1.00 17.02  ? 337  LYS B CB    1 
ATOM   4821  C  CG    . LYS B 2  337 ? 118.808 108.174 168.245 1.00 17.02  ? 337  LYS B CG    1 
ATOM   4822  C  CD    . LYS B 2  337 ? 119.732 108.627 169.329 1.00 17.02  ? 337  LYS B CD    1 
ATOM   4823  C  CE    . LYS B 2  337 ? 118.952 109.176 170.502 1.00 17.02  ? 337  LYS B CE    1 
ATOM   4824  N  NZ    . LYS B 2  337 ? 118.204 108.097 171.195 1.00 17.02  ? 337  LYS B NZ    1 
ATOM   4825  N  N     . ILE B 2  338 ? 116.542 110.462 164.738 1.00 17.80  ? 338  ILE B N     1 
ATOM   4826  C  CA    . ILE B 2  338 ? 115.551 111.347 164.139 1.00 17.80  ? 338  ILE B CA    1 
ATOM   4827  C  C     . ILE B 2  338 ? 114.337 110.541 163.686 1.00 17.80  ? 338  ILE B C     1 
ATOM   4828  O  O     . ILE B 2  338 ? 113.191 110.971 163.860 1.00 17.80  ? 338  ILE B O     1 
ATOM   4829  C  CB    . ILE B 2  338 ? 116.170 112.155 162.984 1.00 17.80  ? 338  ILE B CB    1 
ATOM   4830  C  CG1   . ILE B 2  338 ? 117.299 113.046 163.482 1.00 17.80  ? 338  ILE B CG1   1 
ATOM   4831  C  CG2   . ILE B 2  338 ? 115.146 113.041 162.327 1.00 17.80  ? 338  ILE B CG2   1 
ATOM   4832  C  CD1   . ILE B 2  338 ? 118.020 113.748 162.367 1.00 17.80  ? 338  ILE B CD1   1 
ATOM   4833  N  N     . ALA B 2  339 ? 114.571 109.339 163.144 1.00 23.08  ? 339  ALA B N     1 
ATOM   4834  C  CA    . ALA B 2  339 ? 113.488 108.505 162.621 1.00 23.08  ? 339  ALA B CA    1 
ATOM   4835  C  C     . ALA B 2  339 ? 112.567 108.013 163.727 1.00 23.08  ? 339  ALA B C     1 
ATOM   4836  O  O     . ALA B 2  339 ? 111.350 107.915 163.531 1.00 23.08  ? 339  ALA B O     1 
ATOM   4837  C  CB    . ALA B 2  339 ? 114.065 107.318 161.855 1.00 23.08  ? 339  ALA B CB    1 
ATOM   4838  N  N     . TYR B 2  340 ? 113.126 107.692 164.891 1.00 29.92  ? 340  TYR B N     1 
ATOM   4839  C  CA    . TYR B 2  340 ? 112.296 107.316 166.025 1.00 29.92  ? 340  TYR B CA    1 
ATOM   4840  C  C     . TYR B 2  340 ? 111.533 108.509 166.581 1.00 29.92  ? 340  TYR B C     1 
ATOM   4841  O  O     . TYR B 2  340 ? 110.422 108.347 167.095 1.00 29.92  ? 340  TYR B O     1 
ATOM   4842  C  CB    . TYR B 2  340 ? 113.161 106.696 167.114 1.00 29.92  ? 340  TYR B CB    1 
ATOM   4843  C  CG    . TYR B 2  340 ? 113.705 105.332 166.789 1.00 29.92  ? 340  TYR B CG    1 
ATOM   4844  C  CD1   . TYR B 2  340 ? 113.078 104.515 165.862 1.00 29.92  ? 340  TYR B CD1   1 
ATOM   4845  C  CD2   . TYR B 2  340 ? 114.872 104.874 167.388 1.00 29.92  ? 340  TYR B CD2   1 
ATOM   4846  C  CE1   . TYR B 2  340 ? 113.579 103.269 165.563 1.00 29.92  ? 340  TYR B CE1   1 
ATOM   4847  C  CE2   . TYR B 2  340 ? 115.386 103.631 167.090 1.00 29.92  ? 340  TYR B CE2   1 
ATOM   4848  C  CZ    . TYR B 2  340 ? 114.735 102.834 166.175 1.00 29.92  ? 340  TYR B CZ    1 
ATOM   4849  O  OH    . TYR B 2  340 ? 115.238 101.592 165.872 1.00 29.92  ? 340  TYR B OH    1 
ATOM   4850  N  N     . SER B 2  341 ? 112.105 109.708 166.488 1.00 28.03  ? 341  SER B N     1 
ATOM   4851  C  CA    . SER B 2  341 ? 111.455 110.893 167.026 1.00 28.03  ? 341  SER B CA    1 
ATOM   4852  C  C     . SER B 2  341 ? 110.377 111.443 166.105 1.00 28.03  ? 341  SER B C     1 
ATOM   4853  O  O     . SER B 2  341 ? 109.641 112.348 166.510 1.00 28.03  ? 341  SER B O     1 
ATOM   4854  C  CB    . SER B 2  341 ? 112.489 111.984 167.305 1.00 28.03  ? 341  SER B CB    1 
ATOM   4855  O  OG    . SER B 2  341 ? 113.031 112.487 166.100 1.00 28.03  ? 341  SER B OG    1 
ATOM   4856  N  N     . GLN B 2  342 ? 110.269 110.926 164.885 1.00 31.14  ? 342  GLN B N     1 
ATOM   4857  C  CA    . GLN B 2  342 ? 109.237 111.331 163.944 1.00 31.14  ? 342  GLN B CA    1 
ATOM   4858  C  C     . GLN B 2  342 ? 108.061 110.367 163.913 1.00 31.14  ? 342  GLN B C     1 
ATOM   4859  O  O     . GLN B 2  342 ? 107.204 110.482 163.032 1.00 31.14  ? 342  GLN B O     1 
ATOM   4860  C  CB    . GLN B 2  342 ? 109.831 111.469 162.547 1.00 31.14  ? 342  GLN B CB    1 
ATOM   4861  C  CG    . GLN B 2  342 ? 110.766 112.641 162.405 1.00 31.14  ? 342  GLN B CG    1 
ATOM   4862  C  CD    . GLN B 2  342 ? 111.445 112.674 161.063 1.00 31.14  ? 342  GLN B CD    1 
ATOM   4863  O  OE1   . GLN B 2  342 ? 111.286 111.767 160.247 1.00 31.14  ? 342  GLN B OE1   1 
ATOM   4864  N  NE2   . GLN B 2  342 ? 112.210 113.721 160.824 1.00 31.14  ? 342  GLN B NE2   1 
ATOM   4865  N  N     . LEU B 2  343 ? 108.005 109.419 164.841 1.00 40.31  ? 343  LEU B N     1 
ATOM   4866  C  CA    . LEU B 2  343 ? 106.872 108.512 164.937 1.00 40.31  ? 343  LEU B CA    1 
ATOM   4867  C  C     . LEU B 2  343 ? 105.973 108.906 166.101 1.00 40.31  ? 343  LEU B C     1 
ATOM   4868  O  O     . LEU B 2  343 ? 104.857 109.383 165.901 1.00 40.31  ? 343  LEU B O     1 
ATOM   4869  C  CB    . LEU B 2  343 ? 107.342 107.069 165.100 1.00 40.31  ? 343  LEU B CB    1 
ATOM   4870  C  CG    . LEU B 2  343 ? 108.078 106.467 163.904 1.00 40.31  ? 343  LEU B CG    1 
ATOM   4871  C  CD1   . LEU B 2  343 ? 108.551 105.059 164.221 1.00 40.31  ? 343  LEU B CD1   1 
ATOM   4872  C  CD2   . LEU B 2  343 ? 107.187 106.476 162.675 1.00 40.31  ? 343  LEU B CD2   1 
ATOM   4873  N  N     . VAL B 2  355 ? 109.018 100.890 158.738 1.00 45.65  ? 355  VAL B N     1 
ATOM   4874  C  CA    . VAL B 2  355 ? 109.814 102.036 159.153 1.00 45.65  ? 355  VAL B CA    1 
ATOM   4875  C  C     . VAL B 2  355 ? 111.228 101.880 158.584 1.00 45.65  ? 355  VAL B C     1 
ATOM   4876  O  O     . VAL B 2  355 ? 111.722 100.764 158.411 1.00 45.65  ? 355  VAL B O     1 
ATOM   4877  C  CB    . VAL B 2  355 ? 109.793 102.194 160.709 1.00 45.65  ? 355  VAL B CB    1 
ATOM   4878  C  CG1   . VAL B 2  355 ? 110.493 101.030 161.410 1.00 45.65  ? 355  VAL B CG1   1 
ATOM   4879  C  CG2   . VAL B 2  355 ? 110.359 103.543 161.156 1.00 45.65  ? 355  VAL B CG2   1 
ATOM   4880  N  N     . ASN B 2  356 ? 111.854 103.003 158.237 1.00 42.20  ? 356  ASN B N     1 
ATOM   4881  C  CA    . ASN B 2  356 ? 113.210 102.997 157.714 1.00 42.20  ? 356  ASN B CA    1 
ATOM   4882  C  C     . ASN B 2  356 ? 113.891 104.283 158.162 1.00 42.20  ? 356  ASN B C     1 
ATOM   4883  O  O     . ASN B 2  356 ? 113.231 105.269 158.499 1.00 42.20  ? 356  ASN B O     1 
ATOM   4884  C  CB    . ASN B 2  356 ? 113.216 102.858 156.184 1.00 42.20  ? 356  ASN B CB    1 
ATOM   4885  C  CG    . ASN B 2  356 ? 114.569 102.440 155.634 1.00 42.20  ? 356  ASN B CG    1 
ATOM   4886  O  OD1   . ASN B 2  356 ? 115.537 102.285 156.379 1.00 42.20  ? 356  ASN B OD1   1 
ATOM   4887  N  ND2   . ASN B 2  356 ? 114.637 102.241 154.324 1.00 42.20  ? 356  ASN B ND2   1 
ATOM   4888  N  N     . SER B 2  357 ? 115.221 104.261 158.172 1.00 29.94  ? 357  SER B N     1 
ATOM   4889  C  CA    . SER B 2  357 ? 115.986 105.409 158.626 1.00 29.94  ? 357  SER B CA    1 
ATOM   4890  C  C     . SER B 2  357 ? 115.978 106.522 157.582 1.00 29.94  ? 357  SER B C     1 
ATOM   4891  O  O     . SER B 2  357 ? 115.537 106.351 156.443 1.00 29.94  ? 357  SER B O     1 
ATOM   4892  C  CB    . SER B 2  357 ? 117.426 105.014 158.935 1.00 29.94  ? 357  SER B CB    1 
ATOM   4893  O  OG    . SER B 2  357 ? 117.493 104.129 160.032 1.00 29.94  ? 357  SER B OG    1 
ATOM   4894  N  N     . ILE B 2  358 ? 116.484 107.675 157.992 1.00 21.08  ? 358  ILE B N     1 
ATOM   4895  C  CA    . ILE B 2  358 ? 116.680 108.799 157.073 1.00 21.08  ? 358  ILE B CA    1 
ATOM   4896  C  C     . ILE B 2  358 ? 117.868 108.492 156.170 1.00 21.08  ? 358  ILE B C     1 
ATOM   4897  O  O     . ILE B 2  358 ? 118.908 108.024 156.665 1.00 21.08  ? 358  ILE B O     1 
ATOM   4898  C  CB    . ILE B 2  358 ? 116.897 110.100 157.860 1.00 21.08  ? 358  ILE B CB    1 
ATOM   4899  C  CG1   . ILE B 2  358 ? 115.607 110.558 158.533 1.00 21.08  ? 358  ILE B CG1   1 
ATOM   4900  C  CG2   . ILE B 2  358 ? 117.435 111.212 156.994 1.00 21.08  ? 358  ILE B CG2   1 
ATOM   4901  C  CD1   . ILE B 2  358 ? 115.492 110.160 159.947 1.00 21.08  ? 358  ILE B CD1   1 
ATOM   4902  N  N     . PRO B 2  359 ? 117.753 108.684 154.855 1.00 19.06  ? 359  PRO B N     1 
ATOM   4903  C  CA    . PRO B 2  359 ? 118.920 108.528 153.984 1.00 19.06  ? 359  PRO B CA    1 
ATOM   4904  C  C     . PRO B 2  359 ? 119.983 109.567 154.299 1.00 19.06  ? 359  PRO B C     1 
ATOM   4905  O  O     . PRO B 2  359 ? 119.693 110.749 154.488 1.00 19.06  ? 359  PRO B O     1 
ATOM   4906  C  CB    . PRO B 2  359 ? 118.340 108.721 152.581 1.00 19.06  ? 359  PRO B CB    1 
ATOM   4907  C  CG    . PRO B 2  359 ? 117.116 109.523 152.788 1.00 19.06  ? 359  PRO B CG    1 
ATOM   4908  C  CD    . PRO B 2  359 ? 116.555 109.088 154.102 1.00 19.06  ? 359  PRO B CD    1 
ATOM   4909  N  N     . CYS B 2  360 ? 121.224 109.107 154.368 1.00 15.35  ? 360  CYS B N     1 
ATOM   4910  C  CA    . CYS B 2  360 ? 122.347 109.911 154.828 1.00 15.35  ? 360  CYS B CA    1 
ATOM   4911  C  C     . CYS B 2  360 ? 123.343 110.020 153.680 1.00 15.35  ? 360  CYS B C     1 
ATOM   4912  O  O     . CYS B 2  360 ? 124.286 109.232 153.588 1.00 15.35  ? 360  CYS B O     1 
ATOM   4913  C  CB    . CYS B 2  360 ? 122.960 109.275 156.071 1.00 15.35  ? 360  CYS B CB    1 
ATOM   4914  S  SG    . CYS B 2  360 ? 124.304 110.176 156.830 1.00 15.35  ? 360  CYS B SG    1 
ATOM   4915  N  N     . LEU B 2  361 ? 123.129 110.996 152.804 1.00 12.47  ? 361  LEU B N     1 
ATOM   4916  C  CA    . LEU B 2  361 ? 124.059 111.275 151.716 1.00 12.47  ? 361  LEU B CA    1 
ATOM   4917  C  C     . LEU B 2  361 ? 125.328 111.891 152.280 1.00 12.47  ? 361  LEU B C     1 
ATOM   4918  O  O     . LEU B 2  361 ? 125.339 113.061 152.651 1.00 12.47  ? 361  LEU B O     1 
ATOM   4919  C  CB    . LEU B 2  361 ? 123.414 112.211 150.699 1.00 12.47  ? 361  LEU B CB    1 
ATOM   4920  C  CG    . LEU B 2  361 ? 124.329 112.715 149.581 1.00 12.47  ? 361  LEU B CG    1 
ATOM   4921  C  CD1   . LEU B 2  361 ? 124.921 111.574 148.789 1.00 12.47  ? 361  LEU B CD1   1 
ATOM   4922  C  CD2   . LEU B 2  361 ? 123.594 113.667 148.679 1.00 12.47  ? 361  LEU B CD2   1 
ATOM   4923  N  N     . ILE B 2  362 ? 126.410 111.141 152.344 1.00 12.15  ? 362  ILE B N     1 
ATOM   4924  C  CA    . ILE B 2  362 ? 127.635 111.737 152.816 1.00 12.15  ? 362  ILE B CA    1 
ATOM   4925  C  C     . ILE B 2  362 ? 128.503 112.031 151.605 1.00 12.15  ? 362  ILE B C     1 
ATOM   4926  O  O     . ILE B 2  362 ? 128.332 111.463 150.528 1.00 12.15  ? 362  ILE B O     1 
ATOM   4927  C  CB    . ILE B 2  362 ? 128.371 110.884 153.864 1.00 12.15  ? 362  ILE B CB    1 
ATOM   4928  C  CG1   . ILE B 2  362 ? 129.192 109.783 153.243 1.00 12.15  ? 362  ILE B CG1   1 
ATOM   4929  C  CG2   . ILE B 2  362 ? 127.367 110.230 154.785 1.00 12.15  ? 362  ILE B CG2   1 
ATOM   4930  C  CD1   . ILE B 2  362 ? 130.144 109.249 154.257 1.00 12.15  ? 362  ILE B CD1   1 
ATOM   4931  N  N     . LEU B 2  363 ? 129.441 112.951 151.782 1.00 11.62  ? 363  LEU B N     1 
ATOM   4932  C  CA    . LEU B 2  363 ? 129.990 113.694 150.655 1.00 11.62  ? 363  LEU B CA    1 
ATOM   4933  C  C     . LEU B 2  363 ? 131.462 113.945 150.941 1.00 11.62  ? 363  LEU B C     1 
ATOM   4934  O  O     . LEU B 2  363 ? 131.792 114.757 151.806 1.00 11.62  ? 363  LEU B O     1 
ATOM   4935  C  CB    . LEU B 2  363 ? 129.222 114.997 150.491 1.00 11.62  ? 363  LEU B CB    1 
ATOM   4936  C  CG    . LEU B 2  363 ? 129.206 115.842 149.231 1.00 11.62  ? 363  LEU B CG    1 
ATOM   4937  C  CD1   . LEU B 2  363 ? 127.952 116.676 149.269 1.00 11.62  ? 363  LEU B CD1   1 
ATOM   4938  C  CD2   . LEU B 2  363 ? 130.392 116.727 149.173 1.00 11.62  ? 363  LEU B CD2   1 
ATOM   4939  N  N     . ASN B 2  364 ? 132.337 113.271 150.207 1.00 12.79  ? 364  ASN B N     1 
ATOM   4940  C  CA    . ASN B 2  364 ? 133.772 113.311 150.469 1.00 12.79  ? 364  ASN B CA    1 
ATOM   4941  C  C     . ASN B 2  364 ? 134.367 114.505 149.731 1.00 12.79  ? 364  ASN B C     1 
ATOM   4942  O  O     . ASN B 2  364 ? 134.692 114.418 148.549 1.00 12.79  ? 364  ASN B O     1 
ATOM   4943  C  CB    . ASN B 2  364 ? 134.417 112.000 150.039 1.00 12.79  ? 364  ASN B CB    1 
ATOM   4944  C  CG    . ASN B 2  364 ? 133.860 110.805 150.790 1.00 12.79  ? 364  ASN B CG    1 
ATOM   4945  O  OD1   . ASN B 2  364 ? 133.178 109.961 150.218 1.00 12.79  ? 364  ASN B OD1   1 
ATOM   4946  N  ND2   . ASN B 2  364 ? 134.156 110.725 152.077 1.00 12.79  ? 364  ASN B ND2   1 
ATOM   4947  N  N     . GLY B 2  365 ? 134.507 115.629 150.429 1.00 11.59  ? 365  GLY B N     1 
ATOM   4948  C  CA    . GLY B 2  365 ? 135.019 116.837 149.817 1.00 11.59  ? 365  GLY B CA    1 
ATOM   4949  C  C     . GLY B 2  365 ? 136.517 116.953 149.776 1.00 11.59  ? 365  GLY B C     1 
ATOM   4950  O  O     . GLY B 2  365 ? 137.041 117.885 149.164 1.00 11.59  ? 365  GLY B O     1 
ATOM   4951  N  N     . TYR B 2  366 ? 137.226 116.033 150.429 1.00 16.90  ? 366  TYR B N     1 
ATOM   4952  C  CA    . TYR B 2  366 ? 138.662 115.903 150.225 1.00 16.90  ? 366  TYR B CA    1 
ATOM   4953  C  C     . TYR B 2  366 ? 138.991 115.301 148.869 1.00 16.90  ? 366  TYR B C     1 
ATOM   4954  O  O     . TYR B 2  366 ? 140.128 115.433 148.407 1.00 16.90  ? 366  TYR B O     1 
ATOM   4955  C  CB    . TYR B 2  366 ? 139.281 115.074 151.353 1.00 16.90  ? 366  TYR B CB    1 
ATOM   4956  C  CG    . TYR B 2  366 ? 138.589 113.759 151.626 1.00 16.90  ? 366  TYR B CG    1 
ATOM   4957  C  CD1   . TYR B 2  366 ? 137.583 113.673 152.581 1.00 16.90  ? 366  TYR B CD1   1 
ATOM   4958  C  CD2   . TYR B 2  366 ? 138.937 112.606 150.943 1.00 16.90  ? 366  TYR B CD2   1 
ATOM   4959  C  CE1   . TYR B 2  366 ? 136.943 112.487 152.834 1.00 16.90  ? 366  TYR B CE1   1 
ATOM   4960  C  CE2   . TYR B 2  366 ? 138.299 111.412 151.197 1.00 16.90  ? 366  TYR B CE2   1 
ATOM   4961  C  CZ    . TYR B 2  366 ? 137.308 111.361 152.142 1.00 16.90  ? 366  TYR B CZ    1 
ATOM   4962  O  OH    . TYR B 2  366 ? 136.675 110.170 152.392 1.00 16.90  ? 366  TYR B OH    1 
ATOM   4963  N  N     . ASN B 2  367 ? 138.029 114.644 148.235 1.00 19.94  ? 367  ASN B N     1 
ATOM   4964  C  CA    . ASN B 2  367 ? 138.166 114.167 146.868 1.00 19.94  ? 367  ASN B CA    1 
ATOM   4965  C  C     . ASN B 2  367 ? 138.198 115.365 145.929 1.00 19.94  ? 367  ASN B C     1 
ATOM   4966  O  O     . ASN B 2  367 ? 137.245 116.153 145.915 1.00 19.94  ? 367  ASN B O     1 
ATOM   4967  C  CB    . ASN B 2  367 ? 136.998 113.239 146.541 1.00 19.94  ? 367  ASN B CB    1 
ATOM   4968  C  CG    . ASN B 2  367 ? 137.198 112.446 145.268 1.00 19.94  ? 367  ASN B CG    1 
ATOM   4969  O  OD1   . ASN B 2  367 ? 138.178 112.615 144.554 1.00 19.94  ? 367  ASN B OD1   1 
ATOM   4970  N  ND2   . ASN B 2  367 ? 136.267 111.547 144.994 1.00 19.94  ? 367  ASN B ND2   1 
ATOM   4971  N  N     . PRO B 2  368 ? 139.258 115.550 145.137 1.00 21.13  ? 368  PRO B N     1 
ATOM   4972  C  CA    . PRO B 2  368 ? 139.333 116.710 144.242 1.00 21.13  ? 368  PRO B CA    1 
ATOM   4973  C  C     . PRO B 2  368 ? 138.453 116.605 143.008 1.00 21.13  ? 368  PRO B C     1 
ATOM   4974  O  O     . PRO B 2  368 ? 138.435 117.541 142.203 1.00 21.13  ? 368  PRO B O     1 
ATOM   4975  C  CB    . PRO B 2  368 ? 140.816 116.736 143.844 1.00 21.13  ? 368  PRO B CB    1 
ATOM   4976  C  CG    . PRO B 2  368 ? 141.514 115.904 144.860 1.00 21.13  ? 368  PRO B CG    1 
ATOM   4977  C  CD    . PRO B 2  368 ? 140.540 114.837 145.202 1.00 21.13  ? 368  PRO B CD    1 
ATOM   4978  N  N     . SER B 2  369 ? 137.741 115.496 142.828 1.00 20.69  ? 369  SER B N     1 
ATOM   4979  C  CA    . SER B 2  369 ? 136.852 115.294 141.696 1.00 20.69  ? 369  SER B CA    1 
ATOM   4980  C  C     . SER B 2  369 ? 135.388 115.452 142.080 1.00 20.69  ? 369  SER B C     1 
ATOM   4981  O  O     . SER B 2  369 ? 134.508 115.022 141.329 1.00 20.69  ? 369  SER B O     1 
ATOM   4982  C  CB    . SER B 2  369 ? 137.089 113.914 141.085 1.00 20.69  ? 369  SER B CB    1 
ATOM   4983  O  OG    . SER B 2  369 ? 138.414 113.791 140.603 1.00 20.69  ? 369  SER B OG    1 
ATOM   4984  N  N     . CYS B 2  370 ? 135.113 116.048 143.235 1.00 17.62  ? 370  CYS B N     1 
ATOM   4985  C  CA    . CYS B 2  370 ? 133.747 116.215 143.718 1.00 17.62  ? 370  CYS B CA    1 
ATOM   4986  C  C     . CYS B 2  370 ? 133.051 117.297 142.901 1.00 17.62  ? 370  CYS B C     1 
ATOM   4987  O  O     . CYS B 2  370 ? 133.418 118.473 142.972 1.00 17.62  ? 370  CYS B O     1 
ATOM   4988  C  CB    . CYS B 2  370 ? 133.764 116.563 145.202 1.00 17.62  ? 370  CYS B CB    1 
ATOM   4989  S  SG    . CYS B 2  370 ? 132.154 116.636 145.981 1.00 17.62  ? 370  CYS B SG    1 
ATOM   4990  N  N     . ASN B 2  371 ? 132.051 116.897 142.122 1.00 16.58  ? 371  ASN B N     1 
ATOM   4991  C  CA    . ASN B 2  371 ? 131.338 117.776 141.204 1.00 16.58  ? 371  ASN B CA    1 
ATOM   4992  C  C     . ASN B 2  371 ? 129.992 118.151 141.807 1.00 16.58  ? 371  ASN B C     1 
ATOM   4993  O  O     . ASN B 2  371 ? 129.330 117.315 142.422 1.00 16.58  ? 371  ASN B O     1 
ATOM   4994  C  CB    . ASN B 2  371 ? 131.139 117.070 139.861 1.00 16.58  ? 371  ASN B CB    1 
ATOM   4995  C  CG    . ASN B 2  371 ? 130.672 118.001 138.763 1.00 16.58  ? 371  ASN B CG    1 
ATOM   4996  O  OD1   . ASN B 2  371 ? 130.499 119.201 138.968 1.00 16.58  ? 371  ASN B OD1   1 
ATOM   4997  N  ND2   . ASN B 2  371 ? 130.467 117.444 137.578 1.00 16.58  ? 371  ASN B ND2   1 
ATOM   4998  N  N     . TYR B 2  372 ? 129.573 119.406 141.616 1.00 15.57  ? 372  TYR B N     1 
ATOM   4999  C  CA    . TYR B 2  372 ? 128.327 119.834 142.241 1.00 15.57  ? 372  TYR B CA    1 
ATOM   5000  C  C     . TYR B 2  372 ? 127.102 119.426 141.446 1.00 15.57  ? 372  TYR B C     1 
ATOM   5001  O  O     . TYR B 2  372 ? 126.007 119.369 142.012 1.00 15.57  ? 372  TYR B O     1 
ATOM   5002  C  CB    . TYR B 2  372 ? 128.303 121.351 142.476 1.00 15.57  ? 372  TYR B CB    1 
ATOM   5003  C  CG    . TYR B 2  372 ? 128.071 122.249 141.286 1.00 15.57  ? 372  TYR B CG    1 
ATOM   5004  C  CD1   . TYR B 2  372 ? 129.119 122.653 140.476 1.00 15.57  ? 372  TYR B CD1   1 
ATOM   5005  C  CD2   . TYR B 2  372 ? 126.807 122.767 141.029 1.00 15.57  ? 372  TYR B CD2   1 
ATOM   5006  C  CE1   . TYR B 2  372 ? 128.903 123.499 139.405 1.00 15.57  ? 372  TYR B CE1   1 
ATOM   5007  C  CE2   . TYR B 2  372 ? 126.583 123.608 139.965 1.00 15.57  ? 372  TYR B CE2   1 
ATOM   5008  C  CZ    . TYR B 2  372 ? 127.633 123.974 139.159 1.00 15.57  ? 372  TYR B CZ    1 
ATOM   5009  O  OH    . TYR B 2  372 ? 127.412 124.817 138.098 1.00 15.57  ? 372  TYR B OH    1 
ATOM   5010  N  N     . ARG B 2  373 ? 127.253 119.146 140.154 1.00 18.77  ? 373  ARG B N     1 
ATOM   5011  C  CA    . ARG B 2  373 ? 126.108 118.703 139.376 1.00 18.77  ? 373  ARG B CA    1 
ATOM   5012  C  C     . ARG B 2  373 ? 125.817 117.231 139.608 1.00 18.77  ? 373  ARG B C     1 
ATOM   5013  O  O     . ARG B 2  373 ? 124.668 116.803 139.470 1.00 18.77  ? 373  ARG B O     1 
ATOM   5014  C  CB    . ARG B 2  373 ? 126.339 118.975 137.893 1.00 18.77  ? 373  ARG B CB    1 
ATOM   5015  C  CG    . ARG B 2  373 ? 126.444 120.447 137.575 1.00 18.77  ? 373  ARG B CG    1 
ATOM   5016  C  CD    . ARG B 2  373 ? 126.558 120.707 136.089 1.00 18.77  ? 373  ARG B CD    1 
ATOM   5017  N  NE    . ARG B 2  373 ? 126.816 122.117 135.826 1.00 18.77  ? 373  ARG B NE    1 
ATOM   5018  C  CZ    . ARG B 2  373 ? 125.871 123.040 135.705 1.00 18.77  ? 373  ARG B CZ    1 
ATOM   5019  N  NH1   . ARG B 2  373 ? 124.596 122.706 135.822 1.00 18.77  ? 373  ARG B NH1   1 
ATOM   5020  N  NH2   . ARG B 2  373 ? 126.203 124.300 135.471 1.00 18.77  ? 373  ARG B NH2   1 
ATOM   5021  N  N     . ASP B 2  374 ? 126.835 116.450 139.963 1.00 17.66  ? 374  ASP B N     1 
ATOM   5022  C  CA    . ASP B 2  374 ? 126.620 115.051 140.300 1.00 17.66  ? 374  ASP B CA    1 
ATOM   5023  C  C     . ASP B 2  374 ? 126.048 114.891 141.700 1.00 17.66  ? 374  ASP B C     1 
ATOM   5024  O  O     . ASP B 2  374 ? 125.276 113.959 141.944 1.00 17.66  ? 374  ASP B O     1 
ATOM   5025  C  CB    . ASP B 2  374 ? 127.931 114.282 140.182 1.00 17.66  ? 374  ASP B CB    1 
ATOM   5026  C  CG    . ASP B 2  374 ? 128.455 114.247 138.769 1.00 17.66  ? 374  ASP B CG    1 
ATOM   5027  O  OD1   . ASP B 2  374 ? 127.637 114.327 137.830 1.00 17.66  ? 374  ASP B OD1   1 
ATOM   5028  O  OD2   . ASP B 2  374 ? 129.686 114.140 138.599 1.00 17.66  ? 374  ASP B OD2   1 
ATOM   5029  N  N     . VAL B 2  375 ? 126.424 115.778 142.624 1.00 16.68  ? 375  VAL B N     1 
ATOM   5030  C  CA    . VAL B 2  375 ? 125.826 115.785 143.956 1.00 16.68  ? 375  VAL B CA    1 
ATOM   5031  C  C     . VAL B 2  375 ? 124.359 116.182 143.876 1.00 16.68  ? 375  VAL B C     1 
ATOM   5032  O  O     . VAL B 2  375 ? 123.500 115.554 144.503 1.00 16.68  ? 375  VAL B O     1 
ATOM   5033  C  CB    . VAL B 2  375 ? 126.622 116.717 144.888 1.00 16.68  ? 375  VAL B CB    1 
ATOM   5034  C  CG1   . VAL B 2  375 ? 125.900 116.920 146.195 1.00 16.68  ? 375  VAL B CG1   1 
ATOM   5035  C  CG2   . VAL B 2  375 ? 127.988 116.136 145.158 1.00 16.68  ? 375  VAL B CG2   1 
ATOM   5036  N  N     . PHE B 2  376 ? 124.042 117.202 143.076 1.00 18.15  ? 376  PHE B N     1 
ATOM   5037  C  CA    . PHE B 2  376 ? 122.653 117.622 142.932 1.00 18.15  ? 376  PHE B CA    1 
ATOM   5038  C  C     . PHE B 2  376 ? 121.840 116.610 142.134 1.00 18.15  ? 376  PHE B C     1 
ATOM   5039  O  O     . PHE B 2  376 ? 120.618 116.536 142.292 1.00 18.15  ? 376  PHE B O     1 
ATOM   5040  C  CB    . PHE B 2  376 ? 122.584 118.999 142.278 1.00 18.15  ? 376  PHE B CB    1 
ATOM   5041  C  CG    . PHE B 2  376 ? 121.197 119.552 142.191 1.00 18.15  ? 376  PHE B CG    1 
ATOM   5042  C  CD1   . PHE B 2  376 ? 120.559 120.014 143.326 1.00 18.15  ? 376  PHE B CD1   1 
ATOM   5043  C  CD2   . PHE B 2  376 ? 120.528 119.599 140.982 1.00 18.15  ? 376  PHE B CD2   1 
ATOM   5044  C  CE1   . PHE B 2  376 ? 119.280 120.515 143.259 1.00 18.15  ? 376  PHE B CE1   1 
ATOM   5045  C  CE2   . PHE B 2  376 ? 119.248 120.099 140.908 1.00 18.15  ? 376  PHE B CE2   1 
ATOM   5046  C  CZ    . PHE B 2  376 ? 118.626 120.563 142.049 1.00 18.15  ? 376  PHE B CZ    1 
ATOM   5047  N  N     . LYS B 2  377 ? 122.497 115.822 141.282 1.00 22.73  ? 377  LYS B N     1 
ATOM   5048  C  CA    . LYS B 2  377 ? 121.832 114.691 140.646 1.00 22.73  ? 377  LYS B CA    1 
ATOM   5049  C  C     . LYS B 2  377 ? 121.444 113.634 141.673 1.00 22.73  ? 377  LYS B C     1 
ATOM   5050  O  O     . LYS B 2  377 ? 120.418 112.962 141.519 1.00 22.73  ? 377  LYS B O     1 
ATOM   5051  C  CB    . LYS B 2  377 ? 122.747 114.102 139.572 1.00 22.73  ? 377  LYS B CB    1 
ATOM   5052  C  CG    . LYS B 2  377 ? 122.160 112.961 138.771 1.00 22.73  ? 377  LYS B CG    1 
ATOM   5053  C  CD    . LYS B 2  377 ? 121.045 113.443 137.868 1.00 22.73  ? 377  LYS B CD    1 
ATOM   5054  C  CE    . LYS B 2  377 ? 120.522 112.317 136.997 1.00 22.73  ? 377  LYS B CE    1 
ATOM   5055  N  NZ    . LYS B 2  377 ? 119.378 112.762 136.160 1.00 22.73  ? 377  LYS B NZ    1 
ATOM   5056  N  N     . GLU B 2  378 ? 122.230 113.501 142.741 1.00 23.50  ? 378  GLU B N     1 
ATOM   5057  C  CA    . GLU B 2  378 ? 121.945 112.537 143.795 1.00 23.50  ? 378  GLU B CA    1 
ATOM   5058  C  C     . GLU B 2  378 ? 120.823 113.017 144.709 1.00 23.50  ? 378  GLU B C     1 
ATOM   5059  O  O     . GLU B 2  378 ? 120.021 112.208 145.185 1.00 23.50  ? 378  GLU B O     1 
ATOM   5060  C  CB    . GLU B 2  378 ? 123.216 112.281 144.602 1.00 23.50  ? 378  GLU B CB    1 
ATOM   5061  C  CG    . GLU B 2  378 ? 123.099 111.206 145.655 1.00 23.50  ? 378  GLU B CG    1 
ATOM   5062  C  CD    . GLU B 2  378 ? 123.037 109.812 145.080 1.00 23.50  ? 378  GLU B CD    1 
ATOM   5063  O  OE1   . GLU B 2  378 ? 123.593 109.591 143.984 1.00 23.50  ? 378  GLU B OE1   1 
ATOM   5064  O  OE2   . GLU B 2  378 ? 122.432 108.933 145.726 1.00 23.50  ? 378  GLU B OE2   1 
ATOM   5065  N  N     . ILE B 2  379 ? 120.747 114.327 144.954 1.00 22.54  ? 379  ILE B N     1 
ATOM   5066  C  CA    . ILE B 2  379 ? 119.761 114.870 145.886 1.00 22.54  ? 379  ILE B CA    1 
ATOM   5067  C  C     . ILE B 2  379 ? 118.362 114.832 145.280 1.00 22.54  ? 379  ILE B C     1 
ATOM   5068  O  O     . ILE B 2  379 ? 117.383 114.509 145.965 1.00 22.54  ? 379  ILE B O     1 
ATOM   5069  C  CB    . ILE B 2  379 ? 120.176 116.292 146.301 1.00 22.54  ? 379  ILE B CB    1 
ATOM   5070  C  CG1   . ILE B 2  379 ? 121.506 116.233 147.041 1.00 22.54  ? 379  ILE B CG1   1 
ATOM   5071  C  CG2   . ILE B 2  379 ? 119.140 116.939 147.194 1.00 22.54  ? 379  ILE B CG2   1 
ATOM   5072  C  CD1   . ILE B 2  379 ? 122.180 117.549 147.192 1.00 22.54  ? 379  ILE B CD1   1 
ATOM   5073  N  N     . THR B 2  380 ? 118.244 115.125 143.983 1.00 25.64  ? 380  THR B N     1 
ATOM   5074  C  CA    . THR B 2  380 ? 116.946 115.044 143.322 1.00 25.64  ? 380  THR B CA    1 
ATOM   5075  C  C     . THR B 2  380 ? 116.472 113.611 143.132 1.00 25.64  ? 380  THR B C     1 
ATOM   5076  O  O     . THR B 2  380 ? 115.292 113.399 142.846 1.00 25.64  ? 380  THR B O     1 
ATOM   5077  C  CB    . THR B 2  380 ? 116.987 115.745 141.969 1.00 25.64  ? 380  THR B CB    1 
ATOM   5078  O  OG1   . THR B 2  380 ? 117.978 115.126 141.141 1.00 25.64  ? 380  THR B OG1   1 
ATOM   5079  C  CG2   . THR B 2  380 ? 117.316 117.202 142.146 1.00 25.64  ? 380  THR B CG2   1 
ATOM   5080  N  N     . ASP B 2  381 ? 117.356 112.626 143.269 1.00 32.99  ? 381  ASP B N     1 
ATOM   5081  C  CA    . ASP B 2  381 ? 116.902 111.244 143.320 1.00 32.99  ? 381  ASP B CA    1 
ATOM   5082  C  C     . ASP B 2  381 ? 116.321 110.893 144.682 1.00 32.99  ? 381  ASP B C     1 
ATOM   5083  O  O     . ASP B 2  381 ? 115.490 109.986 144.780 1.00 32.99  ? 381  ASP B O     1 
ATOM   5084  C  CB    . ASP B 2  381 ? 118.054 110.300 142.981 1.00 32.99  ? 381  ASP B CB    1 
ATOM   5085  C  CG    . ASP B 2  381 ? 118.460 110.378 141.523 1.00 32.99  ? 381  ASP B CG    1 
ATOM   5086  O  OD1   . ASP B 2  381 ? 117.588 110.667 140.679 1.00 32.99  ? 381  ASP B OD1   1 
ATOM   5087  O  OD2   . ASP B 2  381 ? 119.650 110.152 141.221 1.00 32.99  ? 381  ASP B OD2   1 
ATOM   5088  N  N     . LEU B 2  382 ? 116.734 111.599 145.733 1.00 28.02  ? 382  LEU B N     1 
ATOM   5089  C  CA    . LEU B 2  382 ? 116.267 111.316 147.084 1.00 28.02  ? 382  LEU B CA    1 
ATOM   5090  C  C     . LEU B 2  382 ? 115.031 112.123 147.456 1.00 28.02  ? 382  LEU B C     1 
ATOM   5091  O  O     . LEU B 2  382 ? 114.110 111.586 148.079 1.00 28.02  ? 382  LEU B O     1 
ATOM   5092  C  CB    . LEU B 2  382 ? 117.393 111.577 148.086 1.00 28.02  ? 382  LEU B CB    1 
ATOM   5093  C  CG    . LEU B 2  382 ? 118.542 110.578 147.951 1.00 28.02  ? 382  LEU B CG    1 
ATOM   5094  C  CD1   . LEU B 2  382 ? 119.745 110.975 148.773 1.00 28.02  ? 382  LEU B CD1   1 
ATOM   5095  C  CD2   . LEU B 2  382 ? 118.059 109.209 148.365 1.00 28.02  ? 382  LEU B CD2   1 
ATOM   5096  N  N     . LEU B 2  383 ? 114.985 113.401 147.085 1.00 30.35  ? 383  LEU B N     1 
ATOM   5097  C  CA    . LEU B 2  383 ? 113.826 114.226 147.404 1.00 30.35  ? 383  LEU B CA    1 
ATOM   5098  C  C     . LEU B 2  383 ? 112.714 114.086 146.376 1.00 30.35  ? 383  LEU B C     1 
ATOM   5099  O  O     . LEU B 2  383 ? 111.535 114.164 146.743 1.00 30.35  ? 383  LEU B O     1 
ATOM   5100  C  CB    . LEU B 2  383 ? 114.234 115.695 147.526 1.00 30.35  ? 383  LEU B CB    1 
ATOM   5101  C  CG    . LEU B 2  383 ? 114.682 116.240 148.884 1.00 30.35  ? 383  LEU B CG    1 
ATOM   5102  C  CD1   . LEU B 2  383 ? 115.982 115.657 149.334 1.00 30.35  ? 383  LEU B CD1   1 
ATOM   5103  C  CD2   . LEU B 2  383 ? 114.815 117.741 148.803 1.00 30.35  ? 383  LEU B CD2   1 
ATOM   5104  N  N     . VAL B 2  384 ? 113.077 113.846 145.117 1.00 35.88  ? 384  VAL B N     1 
ATOM   5105  C  CA    . VAL B 2  384 ? 112.213 113.871 143.932 1.00 35.88  ? 384  VAL B CA    1 
ATOM   5106  C  C     . VAL B 2  384 ? 111.444 115.191 143.906 1.00 35.88  ? 384  VAL B C     1 
ATOM   5107  O  O     . VAL B 2  384 ? 110.260 115.228 144.272 1.00 35.88  ? 384  VAL B O     1 
ATOM   5108  C  CB    . VAL B 2  384 ? 111.286 112.642 143.878 1.00 35.88  ? 384  VAL B CB    1 
ATOM   5109  C  CG1   . VAL B 2  384 ? 110.553 112.552 142.532 1.00 35.88  ? 384  VAL B CG1   1 
ATOM   5110  C  CG2   . VAL B 2  384 ? 112.076 111.370 144.140 1.00 35.88  ? 384  VAL B CG2   1 
ATOM   5111  N  N     . PRO B 2  385 ? 112.081 116.307 143.560 1.00 36.09  ? 385  PRO B N     1 
ATOM   5112  C  CA    . PRO B 2  385 ? 111.358 117.576 143.509 1.00 36.09  ? 385  PRO B CA    1 
ATOM   5113  C  C     . PRO B 2  385 ? 110.623 117.726 142.188 1.00 36.09  ? 385  PRO B C     1 
ATOM   5114  O  O     . PRO B 2  385 ? 110.922 117.058 141.197 1.00 36.09  ? 385  PRO B O     1 
ATOM   5115  C  CB    . PRO B 2  385 ? 112.472 118.615 143.636 1.00 36.09  ? 385  PRO B CB    1 
ATOM   5116  C  CG    . PRO B 2  385 ? 113.609 117.968 142.960 1.00 36.09  ? 385  PRO B CG    1 
ATOM   5117  C  CD    . PRO B 2  385 ? 113.506 116.496 143.235 1.00 36.09  ? 385  PRO B CD    1 
ATOM   5118  N  N     . ALA B 2  386 ? 109.635 118.613 142.199 1.00 41.68  ? 386  ALA B N     1 
ATOM   5119  C  CA    . ALA B 2  386 ? 108.935 118.965 140.973 1.00 41.68  ? 386  ALA B CA    1 
ATOM   5120  C  C     . ALA B 2  386 ? 109.891 119.713 140.060 1.00 41.68  ? 386  ALA B C     1 
ATOM   5121  O  O     . ALA B 2  386 ? 110.404 120.775 140.426 1.00 41.68  ? 386  ALA B O     1 
ATOM   5122  C  CB    . ALA B 2  386 ? 107.708 119.816 141.284 1.00 41.68  ? 386  ALA B CB    1 
ATOM   5123  N  N     . GLU B 2  387 ? 110.153 119.149 138.887 1.00 44.14  ? 387  GLU B N     1 
ATOM   5124  C  CA    . GLU B 2  387 ? 111.141 119.753 138.016 1.00 44.14  ? 387  GLU B CA    1 
ATOM   5125  C  C     . GLU B 2  387 ? 110.575 120.993 137.335 1.00 44.14  ? 387  GLU B C     1 
ATOM   5126  O  O     . GLU B 2  387 ? 109.380 121.292 137.393 1.00 44.14  ? 387  GLU B O     1 
ATOM   5127  C  CB    . GLU B 2  387 ? 111.673 118.731 137.014 1.00 44.14  ? 387  GLU B CB    1 
ATOM   5128  C  CG    . GLU B 2  387 ? 110.642 118.034 136.170 1.00 44.14  ? 387  GLU B CG    1 
ATOM   5129  C  CD    . GLU B 2  387 ? 111.269 116.942 135.329 1.00 44.14  ? 387  GLU B CD    1 
ATOM   5130  O  OE1   . GLU B 2  387 ? 112.510 116.802 135.376 1.00 44.14  ? 387  GLU B OE1   1 
ATOM   5131  O  OE2   . GLU B 2  387 ? 110.527 116.206 134.648 1.00 44.14  ? 387  GLU B OE2   1 
ATOM   5132  N  N     . LEU B 2  388 ? 111.469 121.711 136.676 1.00 28.54  ? 388  LEU B N     1 
ATOM   5133  C  CA    . LEU B 2  388 ? 111.361 123.150 136.523 1.00 28.54  ? 388  LEU B CA    1 
ATOM   5134  C  C     . LEU B 2  388 ? 110.585 123.482 135.252 1.00 28.54  ? 388  LEU B C     1 
ATOM   5135  O  O     . LEU B 2  388 ? 110.937 123.015 134.165 1.00 28.54  ? 388  LEU B O     1 
ATOM   5136  C  CB    . LEU B 2  388 ? 112.776 123.727 136.498 1.00 28.54  ? 388  LEU B CB    1 
ATOM   5137  C  CG    . LEU B 2  388 ? 113.133 125.165 136.818 1.00 28.54  ? 388  LEU B CG    1 
ATOM   5138  C  CD1   . LEU B 2  388 ? 112.750 125.428 138.245 1.00 28.54  ? 388  LEU B CD1   1 
ATOM   5139  C  CD2   . LEU B 2  388 ? 114.621 125.326 136.663 1.00 28.54  ? 388  LEU B CD2   1 
ATOM   5140  N  N     . THR B 2  389 ? 109.522 124.274 135.394 1.00 27.55  ? 389  THR B N     1 
ATOM   5141  C  CA    . THR B 2  389 ? 108.687 124.615 134.251 1.00 27.55  ? 389  THR B CA    1 
ATOM   5142  C  C     . THR B 2  389 ? 109.389 125.642 133.364 1.00 27.55  ? 389  THR B C     1 
ATOM   5143  O  O     . THR B 2  389 ? 110.448 126.174 133.701 1.00 27.55  ? 389  THR B O     1 
ATOM   5144  C  CB    . THR B 2  389 ? 107.327 125.150 134.704 1.00 27.55  ? 389  THR B CB    1 
ATOM   5145  O  OG1   . THR B 2  389 ? 107.504 126.361 135.443 1.00 27.55  ? 389  THR B OG1   1 
ATOM   5146  C  CG2   . THR B 2  389 ? 106.621 124.134 135.580 1.00 27.55  ? 389  THR B CG2   1 
ATOM   5147  N  N     . ARG B 2  390 ? 108.768 125.931 132.217 1.00 25.57  ? 390  ARG B N     1 
ATOM   5148  C  CA    . ARG B 2  390 ? 109.432 126.735 131.196 1.00 25.57  ? 390  ARG B CA    1 
ATOM   5149  C  C     . ARG B 2  390 ? 109.527 128.205 131.590 1.00 25.57  ? 390  ARG B C     1 
ATOM   5150  O  O     . ARG B 2  390 ? 110.532 128.860 131.290 1.00 25.57  ? 390  ARG B O     1 
ATOM   5151  C  CB    . ARG B 2  390 ? 108.710 126.587 129.859 1.00 25.57  ? 390  ARG B CB    1 
ATOM   5152  C  CG    . ARG B 2  390 ? 109.425 127.279 128.724 1.00 25.57  ? 390  ARG B CG    1 
ATOM   5153  C  CD    . ARG B 2  390 ? 108.787 127.046 127.385 1.00 25.57  ? 390  ARG B CD    1 
ATOM   5154  N  NE    . ARG B 2  390 ? 109.500 127.788 126.355 1.00 25.57  ? 390  ARG B NE    1 
ATOM   5155  C  CZ    . ARG B 2  390 ? 110.579 127.339 125.728 1.00 25.57  ? 390  ARG B CZ    1 
ATOM   5156  N  NH1   . ARG B 2  390 ? 111.168 128.084 124.809 1.00 25.57  ? 390  ARG B NH1   1 
ATOM   5157  N  NH2   . ARG B 2  390 ? 111.071 126.145 126.022 1.00 25.57  ? 390  ARG B NH2   1 
ATOM   5158  N  N     . SER B 2  391 ? 108.517 128.734 132.285 1.00 27.40  ? 391  SER B N     1 
ATOM   5159  C  CA    . SER B 2  391 ? 108.608 130.105 132.776 1.00 27.40  ? 391  SER B CA    1 
ATOM   5160  C  C     . SER B 2  391 ? 109.650 130.236 133.877 1.00 27.40  ? 391  SER B C     1 
ATOM   5161  O  O     . SER B 2  391 ? 110.187 131.326 134.100 1.00 27.40  ? 391  SER B O     1 
ATOM   5162  C  CB    . SER B 2  391 ? 107.247 130.573 133.284 1.00 27.40  ? 391  SER B CB    1 
ATOM   5163  O  OG    . SER B 2  391 ? 107.328 131.889 133.797 1.00 27.40  ? 391  SER B OG    1 
ATOM   5164  N  N     . GLU B 2  392 ? 109.960 129.133 134.557 1.00 28.69  ? 392  GLU B N     1 
ATOM   5165  C  CA    . GLU B 2  392 ? 110.944 129.136 135.627 1.00 28.69  ? 392  GLU B CA    1 
ATOM   5166  C  C     . GLU B 2  392 ? 112.371 129.015 135.111 1.00 28.69  ? 392  GLU B C     1 
ATOM   5167  O  O     . GLU B 2  392 ? 113.302 129.430 135.804 1.00 28.69  ? 392  GLU B O     1 
ATOM   5168  C  CB    . GLU B 2  392 ? 110.633 128.001 136.597 1.00 28.69  ? 392  GLU B CB    1 
ATOM   5169  C  CG    . GLU B 2  392 ? 109.400 128.227 137.445 1.00 28.69  ? 392  GLU B CG    1 
ATOM   5170  C  CD    . GLU B 2  392 ? 108.979 126.977 138.186 1.00 28.69  ? 392  GLU B CD    1 
ATOM   5171  O  OE1   . GLU B 2  392 ? 109.489 125.889 137.852 1.00 28.69  ? 392  GLU B OE1   1 
ATOM   5172  O  OE2   . GLU B 2  392 ? 108.146 127.076 139.109 1.00 28.69  ? 392  GLU B OE2   1 
ATOM   5173  N  N     . THR B 2  393 ? 112.572 128.451 133.922 1.00 23.92  ? 393  THR B N     1 
ATOM   5174  C  CA    . THR B 2  393 ? 113.889 128.412 133.290 1.00 23.92  ? 393  THR B CA    1 
ATOM   5175  C  C     . THR B 2  393 ? 114.071 129.710 132.513 1.00 23.92  ? 393  THR B C     1 
ATOM   5176  O  O     . THR B 2  393 ? 113.506 129.874 131.428 1.00 23.92  ? 393  THR B O     1 
ATOM   5177  C  CB    . THR B 2  393 ? 114.022 127.209 132.363 1.00 23.92  ? 393  THR B CB    1 
ATOM   5178  O  OG1   . THR B 2  393 ? 113.115 127.350 131.267 1.00 23.92  ? 393  THR B OG1   1 
ATOM   5179  C  CG2   . THR B 2  393 ? 113.698 125.932 133.093 1.00 23.92  ? 393  THR B CG2   1 
ATOM   5180  N  N     . LYS B 2  394 ? 114.857 130.631 133.059 1.00 24.86  ? 394  LYS B N     1 
ATOM   5181  C  CA    . LYS B 2  394 ? 114.802 132.027 132.635 1.00 24.86  ? 394  LYS B CA    1 
ATOM   5182  C  C     . LYS B 2  394 ? 115.938 132.359 131.668 1.00 24.86  ? 394  LYS B C     1 
ATOM   5183  O  O     . LYS B 2  394 ? 116.877 133.080 132.017 1.00 24.86  ? 394  LYS B O     1 
ATOM   5184  C  CB    . LYS B 2  394 ? 114.867 132.939 133.851 1.00 24.86  ? 394  LYS B CB    1 
ATOM   5185  C  CG    . LYS B 2  394 ? 113.788 132.725 134.873 1.00 24.86  ? 394  LYS B CG    1 
ATOM   5186  C  CD    . LYS B 2  394 ? 113.849 133.806 135.936 1.00 24.86  ? 394  LYS B CD    1 
ATOM   5187  C  CE    . LYS B 2  394 ? 114.687 133.392 137.134 1.00 24.86  ? 394  LYS B CE    1 
ATOM   5188  N  NZ    . LYS B 2  394 ? 116.154 133.482 136.889 1.00 24.86  ? 394  LYS B NZ    1 
ATOM   5189  N  N     . TYR B 2  395 ? 115.812 131.852 130.434 1.00 29.30  ? 395  TYR B N     1 
ATOM   5190  C  CA    . TYR B 2  395 ? 116.660 132.215 129.288 1.00 29.30  ? 395  TYR B CA    1 
ATOM   5191  C  C     . TYR B 2  395 ? 118.139 131.940 129.578 1.00 29.30  ? 395  TYR B C     1 
ATOM   5192  O  O     . TYR B 2  395 ? 118.898 132.848 129.917 1.00 29.30  ? 395  TYR B O     1 
ATOM   5193  C  CB    . TYR B 2  395 ? 116.460 133.675 128.865 1.00 29.30  ? 395  TYR B CB    1 
ATOM   5194  C  CG    . TYR B 2  395 ? 117.008 133.972 127.490 1.00 29.30  ? 395  TYR B CG    1 
ATOM   5195  C  CD1   . TYR B 2  395 ? 116.275 133.659 126.356 1.00 29.30  ? 395  TYR B CD1   1 
ATOM   5196  C  CD2   . TYR B 2  395 ? 118.264 134.535 127.320 1.00 29.30  ? 395  TYR B CD2   1 
ATOM   5197  C  CE1   . TYR B 2  395 ? 116.768 133.916 125.099 1.00 29.30  ? 395  TYR B CE1   1 
ATOM   5198  C  CE2   . TYR B 2  395 ? 118.767 134.785 126.067 1.00 29.30  ? 395  TYR B CE2   1 
ATOM   5199  C  CZ    . TYR B 2  395 ? 118.010 134.480 124.962 1.00 29.30  ? 395  TYR B CZ    1 
ATOM   5200  O  OH    . TYR B 2  395 ? 118.505 134.732 123.708 1.00 29.30  ? 395  TYR B OH    1 
ATOM   5201  N  N     . TRP B 2  396 ? 118.481 130.644 129.561 1.00 29.30  ? 396  TRP B N     1 
ATOM   5202  C  CA    . TRP B 2  396 ? 119.804 130.125 129.946 1.00 29.30  ? 396  TRP B CA    1 
ATOM   5203  C  C     . TRP B 2  396 ? 120.097 130.395 131.416 1.00 29.30  ? 396  TRP B C     1 
ATOM   5204  O  O     . TRP B 2  396 ? 121.230 130.687 131.798 1.00 29.30  ? 396  TRP B O     1 
ATOM   5205  C  CB    . TRP B 2  396 ? 120.946 130.654 129.066 1.00 29.30  ? 396  TRP B CB    1 
ATOM   5206  C  CG    . TRP B 2  396 ? 121.195 129.922 127.803 1.00 29.30  ? 396  TRP B CG    1 
ATOM   5207  C  CD1   . TRP B 2  396 ? 122.136 128.966 127.601 1.00 29.30  ? 396  TRP B CD1   1 
ATOM   5208  C  CD2   . TRP B 2  396 ? 120.504 130.074 126.563 1.00 29.30  ? 396  TRP B CD2   1 
ATOM   5209  N  NE1   . TRP B 2  396 ? 122.084 128.513 126.311 1.00 29.30  ? 396  TRP B NE1   1 
ATOM   5210  C  CE2   . TRP B 2  396 ? 121.086 129.178 125.653 1.00 29.30  ? 396  TRP B CE2   1 
ATOM   5211  C  CE3   . TRP B 2  396 ? 119.448 130.875 126.134 1.00 29.30  ? 396  TRP B CE3   1 
ATOM   5212  C  CZ2   . TRP B 2  396 ? 120.650 129.062 124.343 1.00 29.30  ? 396  TRP B CZ2   1 
ATOM   5213  C  CZ3   . TRP B 2  396 ? 119.017 130.758 124.836 1.00 29.30  ? 396  TRP B CZ3   1 
ATOM   5214  C  CH2   . TRP B 2  396 ? 119.617 129.862 123.955 1.00 29.30  ? 396  TRP B CH2   1 
ATOM   5215  N  N     . GLY B 2  397 ? 119.068 130.286 132.247 1.00 23.26  ? 397  GLY B N     1 
ATOM   5216  C  CA    . GLY B 2  397 ? 119.284 130.274 133.674 1.00 23.26  ? 397  GLY B CA    1 
ATOM   5217  C  C     . GLY B 2  397 ? 119.933 128.982 134.128 1.00 23.26  ? 397  GLY B C     1 
ATOM   5218  O  O     . GLY B 2  397 ? 119.909 127.964 133.441 1.00 23.26  ? 397  GLY B O     1 
ATOM   5219  N  N     . ASN B 2  398 ? 120.531 129.029 135.313 1.00 19.98  ? 398  ASN B N     1 
ATOM   5220  C  CA    . ASN B 2  398 ? 121.213 127.867 135.867 1.00 19.98  ? 398  ASN B CA    1 
ATOM   5221  C  C     . ASN B 2  398 ? 120.177 126.948 136.496 1.00 19.98  ? 398  ASN B C     1 
ATOM   5222  O  O     . ASN B 2  398 ? 119.590 127.285 137.525 1.00 19.98  ? 398  ASN B O     1 
ATOM   5223  C  CB    . ASN B 2  398 ? 122.255 128.302 136.890 1.00 19.98  ? 398  ASN B CB    1 
ATOM   5224  C  CG    . ASN B 2  398 ? 123.208 127.187 137.269 1.00 19.98  ? 398  ASN B CG    1 
ATOM   5225  O  OD1   . ASN B 2  398 ? 123.110 126.069 136.767 1.00 19.98  ? 398  ASN B OD1   1 
ATOM   5226  N  ND2   . ASN B 2  398 ? 124.144 127.488 138.154 1.00 19.98  ? 398  ASN B ND2   1 
ATOM   5227  N  N     . HIS B 2  399 ? 119.977 125.769 135.902 1.00 21.43  ? 399  HIS B N     1 
ATOM   5228  C  CA    . HIS B 2  399 ? 118.919 124.873 136.352 1.00 21.43  ? 399  HIS B CA    1 
ATOM   5229  C  C     . HIS B 2  399 ? 119.198 124.246 137.711 1.00 21.43  ? 399  HIS B C     1 
ATOM   5230  O  O     . HIS B 2  399 ? 118.257 123.801 138.369 1.00 21.43  ? 399  HIS B O     1 
ATOM   5231  C  CB    . HIS B 2  399 ? 118.687 123.768 135.326 1.00 21.43  ? 399  HIS B CB    1 
ATOM   5232  C  CG    . HIS B 2  399 ? 118.028 124.240 134.070 1.00 21.43  ? 399  HIS B CG    1 
ATOM   5233  N  ND1   . HIS B 2  399 ? 117.804 123.412 132.992 1.00 21.43  ? 399  HIS B ND1   1 
ATOM   5234  C  CD2   . HIS B 2  399 ? 117.557 125.457 133.714 1.00 21.43  ? 399  HIS B CD2   1 
ATOM   5235  C  CE1   . HIS B 2  399 ? 117.208 124.095 132.033 1.00 21.43  ? 399  HIS B CE1   1 
ATOM   5236  N  NE2   . HIS B 2  399 ? 117.049 125.339 132.444 1.00 21.43  ? 399  HIS B NE2   1 
ATOM   5237  N  N     . VAL B 2  400 ? 120.456 124.190 138.144 1.00 15.77  ? 400  VAL B N     1 
ATOM   5238  C  CA    . VAL B 2  400 ? 120.755 123.657 139.468 1.00 15.77  ? 400  VAL B CA    1 
ATOM   5239  C  C     . VAL B 2  400 ? 120.351 124.653 140.546 1.00 15.77  ? 400  VAL B C     1 
ATOM   5240  O  O     . VAL B 2  400 ? 119.718 124.286 141.540 1.00 15.77  ? 400  VAL B O     1 
ATOM   5241  C  CB    . VAL B 2  400 ? 122.242 123.274 139.561 1.00 15.77  ? 400  VAL B CB    1 
ATOM   5242  C  CG1   . VAL B 2  400 ? 122.614 122.879 140.971 1.00 15.77  ? 400  VAL B CG1   1 
ATOM   5243  C  CG2   . VAL B 2  400 ? 122.542 122.135 138.606 1.00 15.77  ? 400  VAL B CG2   1 
ATOM   5244  N  N     . ILE B 2  401 ? 120.682 125.930 140.354 1.00 16.93  ? 401  ILE B N     1 
ATOM   5245  C  CA    . ILE B 2  401 ? 120.344 126.947 141.345 1.00 16.93  ? 401  ILE B CA    1 
ATOM   5246  C  C     . ILE B 2  401 ? 118.855 127.265 141.306 1.00 16.93  ? 401  ILE B C     1 
ATOM   5247  O  O     . ILE B 2  401 ? 118.212 127.418 142.350 1.00 16.93  ? 401  ILE B O     1 
ATOM   5248  C  CB    . ILE B 2  401 ? 121.206 128.202 141.122 1.00 16.93  ? 401  ILE B CB    1 
ATOM   5249  C  CG1   . ILE B 2  401 ? 122.686 127.845 141.234 1.00 16.93  ? 401  ILE B CG1   1 
ATOM   5250  C  CG2   . ILE B 2  401 ? 120.874 129.282 142.128 1.00 16.93  ? 401  ILE B CG2   1 
ATOM   5251  C  CD1   . ILE B 2  401 ? 123.079 127.297 142.586 1.00 16.93  ? 401  ILE B CD1   1 
ATOM   5252  N  N     . LEU B 2  402 ? 118.275 127.329 140.108 1.00 17.98  ? 402  LEU B N     1 
ATOM   5253  C  CA    . LEU B 2  402 ? 116.872 127.700 139.957 1.00 17.98  ? 402  LEU B CA    1 
ATOM   5254  C  C     . LEU B 2  402 ? 115.916 126.605 140.406 1.00 17.98  ? 402  LEU B C     1 
ATOM   5255  O  O     . LEU B 2  402 ? 114.733 126.887 140.615 1.00 17.98  ? 402  LEU B O     1 
ATOM   5256  C  CB    . LEU B 2  402 ? 116.598 128.079 138.502 1.00 17.98  ? 402  LEU B CB    1 
ATOM   5257  C  CG    . LEU B 2  402 ? 116.743 129.527 138.032 1.00 17.98  ? 402  LEU B CG    1 
ATOM   5258  C  CD1   . LEU B 2  402 ? 118.104 130.121 138.287 1.00 17.98  ? 402  LEU B CD1   1 
ATOM   5259  C  CD2   . LEU B 2  402 ? 116.508 129.516 136.554 1.00 17.98  ? 402  LEU B CD2   1 
ATOM   5260  N  N     . GLN B 2  403 ? 116.393 125.374 140.569 1.00 18.44  ? 403  GLN B N     1 
ATOM   5261  C  CA    . GLN B 2  403 ? 115.548 124.315 141.099 1.00 18.44  ? 403  GLN B CA    1 
ATOM   5262  C  C     . GLN B 2  403 ? 115.641 124.218 142.614 1.00 18.44  ? 403  GLN B C     1 
ATOM   5263  O  O     . GLN B 2  403 ? 114.678 123.788 143.256 1.00 18.44  ? 403  GLN B O     1 
ATOM   5264  C  CB    . GLN B 2  403 ? 115.910 122.981 140.443 1.00 18.44  ? 403  GLN B CB    1 
ATOM   5265  C  CG    . GLN B 2  403 ? 114.960 121.831 140.709 1.00 18.44  ? 403  GLN B CG    1 
ATOM   5266  C  CD    . GLN B 2  403 ? 115.291 120.625 139.863 1.00 18.44  ? 403  GLN B CD    1 
ATOM   5267  O  OE1   . GLN B 2  403 ? 116.240 120.645 139.082 1.00 18.44  ? 403  GLN B OE1   1 
ATOM   5268  N  NE2   . GLN B 2  403 ? 114.508 119.566 140.009 1.00 18.44  ? 403  GLN B NE2   1 
ATOM   5269  N  N     . ILE B 2  404 ? 116.766 124.634 143.203 1.00 17.60  ? 404  ILE B N     1 
ATOM   5270  C  CA    . ILE B 2  404 ? 116.846 124.770 144.656 1.00 17.60  ? 404  ILE B CA    1 
ATOM   5271  C  C     . ILE B 2  404 ? 115.930 125.890 145.134 1.00 17.60  ? 404  ILE B C     1 
ATOM   5272  O  O     . ILE B 2  404 ? 115.271 125.772 146.173 1.00 17.60  ? 404  ILE B O     1 
ATOM   5273  C  CB    . ILE B 2  404 ? 118.304 125.008 145.089 1.00 17.60  ? 404  ILE B CB    1 
ATOM   5274  C  CG1   . ILE B 2  404 ? 119.170 123.811 144.732 1.00 17.60  ? 404  ILE B CG1   1 
ATOM   5275  C  CG2   . ILE B 2  404 ? 118.414 125.227 146.580 1.00 17.60  ? 404  ILE B CG2   1 
ATOM   5276  C  CD1   . ILE B 2  404 ? 120.628 124.074 144.909 1.00 17.60  ? 404  ILE B CD1   1 
ATOM   5277  N  N     . GLN B 2  405 ? 115.852 126.980 144.371 1.00 20.28  ? 405  GLN B N     1 
ATOM   5278  C  CA    . GLN B 2  405 ? 114.998 128.096 144.758 1.00 20.28  ? 405  GLN B CA    1 
ATOM   5279  C  C     . GLN B 2  405 ? 113.524 127.748 144.610 1.00 20.28  ? 405  GLN B C     1 
ATOM   5280  O  O     . GLN B 2  405 ? 112.680 128.313 145.313 1.00 20.28  ? 405  GLN B O     1 
ATOM   5281  C  CB    . GLN B 2  405 ? 115.352 129.321 143.925 1.00 20.28  ? 405  GLN B CB    1 
ATOM   5282  C  CG    . GLN B 2  405 ? 116.764 129.810 144.155 1.00 20.28  ? 405  GLN B CG    1 
ATOM   5283  C  CD    . GLN B 2  405 ? 117.135 130.960 143.246 1.00 20.28  ? 405  GLN B CD    1 
ATOM   5284  O  OE1   . GLN B 2  405 ? 116.346 131.376 142.400 1.00 20.28  ? 405  GLN B OE1   1 
ATOM   5285  N  NE2   . GLN B 2  405 ? 118.347 131.472 143.407 1.00 20.28  ? 405  GLN B NE2   1 
ATOM   5286  N  N     . LYS B 2  406 ? 113.198 126.828 143.704 1.00 21.46  ? 406  LYS B N     1 
ATOM   5287  C  CA    . LYS B 2  406 ? 111.856 126.265 143.660 1.00 21.46  ? 406  LYS B CA    1 
ATOM   5288  C  C     . LYS B 2  406 ? 111.637 125.310 144.821 1.00 21.46  ? 406  LYS B C     1 
ATOM   5289  O  O     . LYS B 2  406 ? 110.521 125.193 145.337 1.00 21.46  ? 406  LYS B O     1 
ATOM   5290  C  CB    . LYS B 2  406 ? 111.650 125.540 142.333 1.00 21.46  ? 406  LYS B CB    1 
ATOM   5291  C  CG    . LYS B 2  406 ? 110.248 125.045 142.088 1.00 21.46  ? 406  LYS B CG    1 
ATOM   5292  C  CD    . LYS B 2  406 ? 110.158 124.359 140.749 1.00 21.46  ? 406  LYS B CD    1 
ATOM   5293  C  CE    . LYS B 2  406 ? 108.777 123.795 140.523 1.00 21.46  ? 406  LYS B CE    1 
ATOM   5294  N  NZ    . LYS B 2  406 ? 107.782 124.889 140.396 1.00 21.46  ? 406  LYS B NZ    1 
ATOM   5295  N  N     . MET B 2  407 ? 112.701 124.640 145.253 1.00 19.92  ? 407  MET B N     1 
ATOM   5296  C  CA    . MET B 2  407 ? 112.633 123.667 146.330 1.00 19.92  ? 407  MET B CA    1 
ATOM   5297  C  C     . MET B 2  407 ? 112.506 124.337 147.691 1.00 19.92  ? 407  MET B C     1 
ATOM   5298  O  O     . MET B 2  407 ? 111.885 123.772 148.594 1.00 19.92  ? 407  MET B O     1 
ATOM   5299  C  CB    . MET B 2  407 ? 113.880 122.791 146.272 1.00 19.92  ? 407  MET B CB    1 
ATOM   5300  C  CG    . MET B 2  407 ? 113.893 121.551 147.105 1.00 19.92  ? 407  MET B CG    1 
ATOM   5301  S  SD    . MET B 2  407 ? 115.517 120.803 146.911 1.00 19.92  ? 407  MET B SD    1 
ATOM   5302  C  CE    . MET B 2  407 ? 115.466 120.345 145.184 1.00 19.92  ? 407  MET B CE    1 
ATOM   5303  N  N     . ILE B 2  408 ? 113.076 125.534 147.857 1.00 19.16  ? 408  ILE B N     1 
ATOM   5304  C  CA    . ILE B 2  408 ? 112.915 126.278 149.104 1.00 19.16  ? 408  ILE B CA    1 
ATOM   5305  C  C     . ILE B 2  408 ? 111.468 126.719 149.275 1.00 19.16  ? 408  ILE B C     1 
ATOM   5306  O  O     . ILE B 2  408 ? 110.871 126.526 150.338 1.00 19.16  ? 408  ILE B O     1 
ATOM   5307  C  CB    . ILE B 2  408 ? 113.879 127.478 149.149 1.00 19.16  ? 408  ILE B CB    1 
ATOM   5308  C  CG1   . ILE B 2  408 ? 115.330 127.015 149.242 1.00 19.16  ? 408  ILE B CG1   1 
ATOM   5309  C  CG2   . ILE B 2  408 ? 113.559 128.399 150.310 1.00 19.16  ? 408  ILE B CG2   1 
ATOM   5310  C  CD1   . ILE B 2  408 ? 116.319 128.128 149.059 1.00 19.16  ? 408  ILE B CD1   1 
ATOM   5311  N  N     . ASP B 2  409 ? 110.873 127.282 148.217 1.00 23.38  ? 409  ASP B N     1 
ATOM   5312  C  CA    . ASP B 2  409 ? 109.484 127.734 148.279 1.00 23.38  ? 409  ASP B CA    1 
ATOM   5313  C  C     . ASP B 2  409 ? 108.506 126.577 148.437 1.00 23.38  ? 409  ASP B C     1 
ATOM   5314  O  O     . ASP B 2  409 ? 107.416 126.763 148.987 1.00 23.38  ? 409  ASP B O     1 
ATOM   5315  C  CB    . ASP B 2  409 ? 109.130 128.537 147.030 1.00 23.38  ? 409  ASP B CB    1 
ATOM   5316  C  CG    . ASP B 2  409 ? 109.778 129.901 147.012 1.00 23.38  ? 409  ASP B CG    1 
ATOM   5317  O  OD1   . ASP B 2  409 ? 110.056 130.440 148.103 1.00 23.38  ? 409  ASP B OD1   1 
ATOM   5318  O  OD2   . ASP B 2  409 ? 109.994 130.444 145.908 1.00 23.38  ? 409  ASP B OD2   1 
ATOM   5319  N  N     . PHE B 2  410 ? 108.872 125.385 147.969 1.00 20.20  ? 410  PHE B N     1 
ATOM   5320  C  CA    . PHE B 2  410 ? 108.051 124.211 148.230 1.00 20.20  ? 410  PHE B CA    1 
ATOM   5321  C  C     . PHE B 2  410 ? 108.135 123.800 149.692 1.00 20.20  ? 410  PHE B C     1 
ATOM   5322  O  O     . PHE B 2  410 ? 107.113 123.534 150.331 1.00 20.20  ? 410  PHE B O     1 
ATOM   5323  C  CB    . PHE B 2  410 ? 108.475 123.056 147.325 1.00 20.20  ? 410  PHE B CB    1 
ATOM   5324  C  CG    . PHE B 2  410 ? 107.733 121.781 147.590 1.00 20.20  ? 410  PHE B CG    1 
ATOM   5325  C  CD1   . PHE B 2  410 ? 106.416 121.634 147.195 1.00 20.20  ? 410  PHE B CD1   1 
ATOM   5326  C  CD2   . PHE B 2  410 ? 108.356 120.725 148.233 1.00 20.20  ? 410  PHE B CD2   1 
ATOM   5327  C  CE1   . PHE B 2  410 ? 105.733 120.459 147.440 1.00 20.20  ? 410  PHE B CE1   1 
ATOM   5328  C  CE2   . PHE B 2  410 ? 107.679 119.548 148.482 1.00 20.20  ? 410  PHE B CE2   1 
ATOM   5329  C  CZ    . PHE B 2  410 ? 106.368 119.415 148.086 1.00 20.20  ? 410  PHE B CZ    1 
ATOM   5330  N  N     . TYR B 2  411 ? 109.342 123.745 150.239 1.00 20.62  ? 411  TYR B N     1 
ATOM   5331  C  CA    . TYR B 2  411 ? 109.549 123.220 151.579 1.00 20.62  ? 411  TYR B CA    1 
ATOM   5332  C  C     . TYR B 2  411 ? 109.347 124.240 152.688 1.00 20.62  ? 411  TYR B C     1 
ATOM   5333  O  O     . TYR B 2  411 ? 109.563 123.902 153.854 1.00 20.62  ? 411  TYR B O     1 
ATOM   5334  C  CB    . TYR B 2  411 ? 110.943 122.615 151.704 1.00 20.62  ? 411  TYR B CB    1 
ATOM   5335  C  CG    . TYR B 2  411 ? 111.057 121.219 151.159 1.00 20.62  ? 411  TYR B CG    1 
ATOM   5336  C  CD1   . TYR B 2  411 ? 110.524 120.144 151.852 1.00 20.62  ? 411  TYR B CD1   1 
ATOM   5337  C  CD2   . TYR B 2  411 ? 111.733 120.967 149.984 1.00 20.62  ? 411  TYR B CD2   1 
ATOM   5338  C  CE1   . TYR B 2  411 ? 110.637 118.861 151.369 1.00 20.62  ? 411  TYR B CE1   1 
ATOM   5339  C  CE2   . TYR B 2  411 ? 111.852 119.693 149.492 1.00 20.62  ? 411  TYR B CE2   1 
ATOM   5340  C  CZ    . TYR B 2  411 ? 111.307 118.643 150.191 1.00 20.62  ? 411  TYR B CZ    1 
ATOM   5341  O  OH    . TYR B 2  411 ? 111.428 117.369 149.698 1.00 20.62  ? 411  TYR B OH    1 
ATOM   5342  N  N     . LYS B 2  412 ? 108.938 125.468 152.376 1.00 24.19  ? 412  LYS B N     1 
ATOM   5343  C  CA    . LYS B 2  412 ? 108.550 126.391 153.435 1.00 24.19  ? 412  LYS B CA    1 
ATOM   5344  C  C     . LYS B 2  412 ? 107.158 126.113 153.975 1.00 24.19  ? 412  LYS B C     1 
ATOM   5345  O  O     . LYS B 2  412 ? 106.780 126.695 154.996 1.00 24.19  ? 412  LYS B O     1 
ATOM   5346  C  CB    . LYS B 2  412 ? 108.623 127.838 152.944 1.00 24.19  ? 412  LYS B CB    1 
ATOM   5347  C  CG    . LYS B 2  412 ? 110.028 128.391 152.860 1.00 24.19  ? 412  LYS B CG    1 
ATOM   5348  C  CD    . LYS B 2  412 ? 110.057 129.743 152.177 1.00 24.19  ? 412  LYS B CD    1 
ATOM   5349  C  CE    . LYS B 2  412 ? 109.430 130.821 153.034 1.00 24.19  ? 412  LYS B CE    1 
ATOM   5350  N  NZ    . LYS B 2  412 ? 109.572 132.153 152.391 1.00 24.19  ? 412  LYS B NZ    1 
ATOM   5351  N  N     . ASN B 2  413 ? 106.395 125.241 153.325 1.00 27.93  ? 413  ASN B N     1 
ATOM   5352  C  CA    . ASN B 2  413 ? 105.041 124.925 153.741 1.00 27.93  ? 413  ASN B CA    1 
ATOM   5353  C  C     . ASN B 2  413 ? 104.870 123.457 154.096 1.00 27.93  ? 413  ASN B C     1 
ATOM   5354  O  O     . ASN B 2  413 ? 103.773 123.053 154.495 1.00 27.93  ? 413  ASN B O     1 
ATOM   5355  C  CB    . ASN B 2  413 ? 104.055 125.320 152.637 1.00 27.93  ? 413  ASN B CB    1 
ATOM   5356  C  CG    . ASN B 2  413 ? 104.017 126.817 152.408 1.00 27.93  ? 413  ASN B CG    1 
ATOM   5357  O  OD1   . ASN B 2  413 ? 104.019 127.601 153.357 1.00 27.93  ? 413  ASN B OD1   1 
ATOM   5358  N  ND2   . ASN B 2  413 ? 104.002 127.222 151.145 1.00 27.93  ? 413  ASN B ND2   1 
ATOM   5359  N  N     . GLN B 2  414 ? 105.916 122.657 153.963 1.00 26.87  ? 414  GLN B N     1 
ATOM   5360  C  CA    . GLN B 2  414 ? 105.901 121.261 154.351 1.00 26.87  ? 414  GLN B CA    1 
ATOM   5361  C  C     . GLN B 2  414 ? 106.062 121.140 155.866 1.00 26.87  ? 414  GLN B C     1 
ATOM   5362  O  O     . GLN B 2  414 ? 106.505 122.086 156.521 1.00 26.87  ? 414  GLN B O     1 
ATOM   5363  C  CB    . GLN B 2  414 ? 107.014 120.521 153.615 1.00 26.87  ? 414  GLN B CB    1 
ATOM   5364  C  CG    . GLN B 2  414 ? 106.794 120.468 152.124 1.00 26.87  ? 414  GLN B CG    1 
ATOM   5365  C  CD    . GLN B 2  414 ? 105.489 119.796 151.767 1.00 26.87  ? 414  GLN B CD    1 
ATOM   5366  O  OE1   . GLN B 2  414 ? 104.554 120.444 151.301 1.00 26.87  ? 414  GLN B OE1   1 
ATOM   5367  N  NE2   . GLN B 2  414 ? 105.414 118.491 151.993 1.00 26.87  ? 414  GLN B NE2   1 
ATOM   5368  N  N     . PRO B 2  415 ? 105.666 120.009 156.457 1.00 25.31  ? 415  PRO B N     1 
ATOM   5369  C  CA    . PRO B 2  415 ? 105.927 119.808 157.886 1.00 25.31  ? 415  PRO B CA    1 
ATOM   5370  C  C     . PRO B 2  415 ? 107.409 119.670 158.194 1.00 25.31  ? 415  PRO B C     1 
ATOM   5371  O  O     . PRO B 2  415 ? 108.191 119.130 157.409 1.00 25.31  ? 415  PRO B O     1 
ATOM   5372  C  CB    . PRO B 2  415 ? 105.169 118.515 158.208 1.00 25.31  ? 415  PRO B CB    1 
ATOM   5373  C  CG    . PRO B 2  415 ? 104.984 117.841 156.908 1.00 25.31  ? 415  PRO B CG    1 
ATOM   5374  C  CD    . PRO B 2  415 ? 104.800 118.942 155.923 1.00 25.31  ? 415  PRO B CD    1 
ATOM   5375  N  N     . LEU B 2  416 ? 107.779 120.164 159.375 1.00 24.82  ? 416  LEU B N     1 
ATOM   5376  C  CA    . LEU B 2  416 ? 109.172 120.279 159.807 1.00 24.82  ? 416  LEU B CA    1 
ATOM   5377  C  C     . LEU B 2  416 ? 109.688 118.909 160.234 1.00 24.82  ? 416  LEU B C     1 
ATOM   5378  O  O     . LEU B 2  416 ? 109.769 118.575 161.417 1.00 24.82  ? 416  LEU B O     1 
ATOM   5379  C  CB    . LEU B 2  416 ? 109.289 121.288 160.942 1.00 24.82  ? 416  LEU B CB    1 
ATOM   5380  C  CG    . LEU B 2  416 ? 109.434 122.788 160.688 1.00 24.82  ? 416  LEU B CG    1 
ATOM   5381  C  CD1   . LEU B 2  416 ? 108.227 123.407 160.011 1.00 24.82  ? 416  LEU B CD1   1 
ATOM   5382  C  CD2   . LEU B 2  416 ? 109.638 123.436 162.035 1.00 24.82  ? 416  LEU B CD2   1 
ATOM   5383  N  N     . ASP B 2  417 ? 110.063 118.108 159.243 1.00 26.01  ? 417  ASP B N     1 
ATOM   5384  C  CA    . ASP B 2  417 ? 110.604 116.779 159.480 1.00 26.01  ? 417  ASP B CA    1 
ATOM   5385  C  C     . ASP B 2  417 ? 111.882 116.621 158.676 1.00 26.01  ? 417  ASP B C     1 
ATOM   5386  O  O     . ASP B 2  417 ? 111.884 116.864 157.466 1.00 26.01  ? 417  ASP B O     1 
ATOM   5387  C  CB    . ASP B 2  417 ? 109.596 115.691 159.089 1.00 26.01  ? 417  ASP B CB    1 
ATOM   5388  C  CG    . ASP B 2  417 ? 108.399 115.638 160.019 1.00 26.01  ? 417  ASP B CG    1 
ATOM   5389  O  OD1   . ASP B 2  417 ? 108.550 115.961 161.214 1.00 26.01  ? 417  ASP B OD1   1 
ATOM   5390  O  OD2   . ASP B 2  417 ? 107.301 115.272 159.554 1.00 26.01  ? 417  ASP B OD2   1 
ATOM   5391  N  N     . ILE B 2  418 ? 112.963 116.227 159.346 1.00 19.92  ? 418  ILE B N     1 
ATOM   5392  C  CA    . ILE B 2  418 ? 114.211 115.914 158.660 1.00 19.92  ? 418  ILE B CA    1 
ATOM   5393  C  C     . ILE B 2  418 ? 113.998 114.674 157.803 1.00 19.92  ? 418  ILE B C     1 
ATOM   5394  O  O     . ILE B 2  418 ? 113.579 113.623 158.300 1.00 19.92  ? 418  ILE B O     1 
ATOM   5395  C  CB    . ILE B 2  418 ? 115.354 115.693 159.659 1.00 19.92  ? 418  ILE B CB    1 
ATOM   5396  C  CG1   . ILE B 2  418 ? 115.505 116.883 160.604 1.00 19.92  ? 418  ILE B CG1   1 
ATOM   5397  C  CG2   . ILE B 2  418 ? 116.656 115.462 158.920 1.00 19.92  ? 418  ILE B CG2   1 
ATOM   5398  C  CD1   . ILE B 2  418 ? 115.864 118.159 159.925 1.00 19.92  ? 418  ILE B CD1   1 
ATOM   5399  N  N     . LYS B 2  419 ? 114.276 114.791 156.507 1.00 18.81  ? 419  LYS B N     1 
ATOM   5400  C  CA    . LYS B 2  419 ? 114.188 113.652 155.610 1.00 18.81  ? 419  LYS B CA    1 
ATOM   5401  C  C     . LYS B 2  419 ? 115.460 113.416 154.814 1.00 18.81  ? 419  LYS B C     1 
ATOM   5402  O  O     . LYS B 2  419 ? 115.500 112.481 154.009 1.00 18.81  ? 419  LYS B O     1 
ATOM   5403  C  CB    . LYS B 2  419 ? 113.001 113.809 154.653 1.00 18.81  ? 419  LYS B CB    1 
ATOM   5404  C  CG    . LYS B 2  419 ? 113.087 115.005 153.738 1.00 18.81  ? 419  LYS B CG    1 
ATOM   5405  C  CD    . LYS B 2  419 ? 111.875 115.053 152.832 1.00 18.81  ? 419  LYS B CD    1 
ATOM   5406  C  CE    . LYS B 2  419 ? 110.625 115.422 153.609 1.00 18.81  ? 419  LYS B CE    1 
ATOM   5407  N  NZ    . LYS B 2  419 ? 109.447 115.575 152.711 1.00 18.81  ? 419  LYS B NZ    1 
ATOM   5408  N  N     . LEU B 2  420 ? 116.494 114.225 155.017 1.00 16.38  ? 420  LEU B N     1 
ATOM   5409  C  CA    . LEU B 2  420 ? 117.811 113.946 154.471 1.00 16.38  ? 420  LEU B CA    1 
ATOM   5410  C  C     . LEU B 2  420 ? 118.848 114.555 155.400 1.00 16.38  ? 420  LEU B C     1 
ATOM   5411  O  O     . LEU B 2  420 ? 118.614 115.591 156.020 1.00 16.38  ? 420  LEU B O     1 
ATOM   5412  C  CB    . LEU B 2  420 ? 117.950 114.475 153.036 1.00 16.38  ? 420  LEU B CB    1 
ATOM   5413  C  CG    . LEU B 2  420 ? 119.218 114.184 152.232 1.00 16.38  ? 420  LEU B CG    1 
ATOM   5414  C  CD1   . LEU B 2  420 ? 118.866 113.931 150.810 1.00 16.38  ? 420  LEU B CD1   1 
ATOM   5415  C  CD2   . LEU B 2  420 ? 120.152 115.366 152.272 1.00 16.38  ? 420  LEU B CD2   1 
ATOM   5416  N  N     . ILE B 2  421 ? 119.984 113.879 155.515 1.00 13.13  ? 421  ILE B N     1 
ATOM   5417  C  CA    . ILE B 2  421 ? 121.120 114.347 156.296 1.00 13.13  ? 421  ILE B CA    1 
ATOM   5418  C  C     . ILE B 2  421 ? 122.298 114.337 155.336 1.00 13.13  ? 421  ILE B C     1 
ATOM   5419  O  O     . ILE B 2  421 ? 122.838 113.269 155.032 1.00 13.13  ? 421  ILE B O     1 
ATOM   5420  C  CB    . ILE B 2  421 ? 121.396 113.457 157.512 1.00 13.13  ? 421  ILE B CB    1 
ATOM   5421  C  CG1   . ILE B 2  421 ? 120.191 113.428 158.449 1.00 13.13  ? 421  ILE B CG1   1 
ATOM   5422  C  CG2   . ILE B 2  421 ? 122.625 113.931 158.257 1.00 13.13  ? 421  ILE B CG2   1 
ATOM   5423  C  CD1   . ILE B 2  421 ? 120.249 112.324 159.465 1.00 13.13  ? 421  ILE B CD1   1 
ATOM   5424  N  N     . LEU B 2  422 ? 122.696 115.501 154.834 1.00 9.96   ? 422  LEU B N     1 
ATOM   5425  C  CA    . LEU B 2  422 ? 123.859 115.542 153.962 1.00 9.96   ? 422  LEU B CA    1 
ATOM   5426  C  C     . LEU B 2  422 ? 125.087 115.905 154.781 1.00 9.96   ? 422  LEU B C     1 
ATOM   5427  O  O     . LEU B 2  422 ? 125.088 116.897 155.515 1.00 9.96   ? 422  LEU B O     1 
ATOM   5428  C  CB    . LEU B 2  422 ? 123.673 116.463 152.752 1.00 9.96   ? 422  LEU B CB    1 
ATOM   5429  C  CG    . LEU B 2  422 ? 123.457 117.962 152.666 1.00 9.96   ? 422  LEU B CG    1 
ATOM   5430  C  CD1   . LEU B 2  422 ? 124.768 118.678 152.608 1.00 9.96   ? 422  LEU B CD1   1 
ATOM   5431  C  CD2   . LEU B 2  422 ? 122.648 118.282 151.430 1.00 9.96   ? 422  LEU B CD2   1 
ATOM   5432  N  N     . VAL B 2  423 ? 126.113 115.069 154.670 1.00 4.29   ? 423  VAL B N     1 
ATOM   5433  C  CA    . VAL B 2  423 ? 127.255 115.056 155.570 1.00 4.29   ? 423  VAL B CA    1 
ATOM   5434  C  C     . VAL B 2  423 ? 128.468 115.413 154.730 1.00 4.29   ? 423  VAL B C     1 
ATOM   5435  O  O     . VAL B 2  423 ? 128.958 114.590 153.951 1.00 4.29   ? 423  VAL B O     1 
ATOM   5436  C  CB    . VAL B 2  423 ? 127.429 113.694 156.242 1.00 4.29   ? 423  VAL B CB    1 
ATOM   5437  C  CG1   . VAL B 2  423 ? 128.611 113.700 157.168 1.00 4.29   ? 423  VAL B CG1   1 
ATOM   5438  C  CG2   . VAL B 2  423 ? 126.172 113.319 156.961 1.00 4.29   ? 423  VAL B CG2   1 
ATOM   5439  N  N     . VAL B 2  424 ? 128.963 116.631 154.879 1.00 9.32   ? 424  VAL B N     1 
ATOM   5440  C  CA    . VAL B 2  424 ? 130.025 117.147 154.032 1.00 9.32   ? 424  VAL B CA    1 
ATOM   5441  C  C     . VAL B 2  424 ? 131.332 116.993 154.798 1.00 9.32   ? 424  VAL B C     1 
ATOM   5442  O  O     . VAL B 2  424 ? 131.608 117.747 155.731 1.00 9.32   ? 424  VAL B O     1 
ATOM   5443  C  CB    . VAL B 2  424 ? 129.770 118.601 153.637 1.00 9.32   ? 424  VAL B CB    1 
ATOM   5444  C  CG1   . VAL B 2  424 ? 130.867 119.079 152.748 1.00 9.32   ? 424  VAL B CG1   1 
ATOM   5445  C  CG2   . VAL B 2  424 ? 128.441 118.733 152.954 1.00 9.32   ? 424  VAL B CG2   1 
ATOM   5446  N  N     . HIS B 2  425 ? 132.140 116.011 154.421 1.00 11.33  ? 425  HIS B N     1 
ATOM   5447  C  CA    . HIS B 2  425 ? 133.506 115.954 154.912 1.00 11.33  ? 425  HIS B CA    1 
ATOM   5448  C  C     . HIS B 2  425 ? 134.325 116.984 154.162 1.00 11.33  ? 425  HIS B C     1 
ATOM   5449  O  O     . HIS B 2  425 ? 134.280 117.023 152.933 1.00 11.33  ? 425  HIS B O     1 
ATOM   5450  C  CB    . HIS B 2  425 ? 134.117 114.571 154.711 1.00 11.33  ? 425  HIS B CB    1 
ATOM   5451  C  CG    . HIS B 2  425 ? 133.424 113.487 155.466 1.00 11.33  ? 425  HIS B CG    1 
ATOM   5452  N  ND1   . HIS B 2  425 ? 132.450 112.697 154.900 1.00 11.33  ? 425  HIS B ND1   1 
ATOM   5453  C  CD2   . HIS B 2  425 ? 133.545 113.075 156.748 1.00 11.33  ? 425  HIS B CD2   1 
ATOM   5454  C  CE1   . HIS B 2  425 ? 132.012 111.834 155.796 1.00 11.33  ? 425  HIS B CE1   1 
ATOM   5455  N  NE2   . HIS B 2  425 ? 132.656 112.045 156.928 1.00 11.33  ? 425  HIS B NE2   1 
ATOM   5456  N  N     . ASN B 2  426 ? 135.057 117.819 154.905 1.00 12.47  ? 426  ASN B N     1 
ATOM   5457  C  CA    . ASN B 2  426 ? 135.992 118.815 154.375 1.00 12.47  ? 426  ASN B CA    1 
ATOM   5458  C  C     . ASN B 2  426 ? 135.294 119.792 153.426 1.00 12.47  ? 426  ASN B C     1 
ATOM   5459  O  O     . ASN B 2  426 ? 135.523 119.804 152.221 1.00 12.47  ? 426  ASN B O     1 
ATOM   5460  C  CB    . ASN B 2  426 ? 137.197 118.151 153.704 1.00 12.47  ? 426  ASN B CB    1 
ATOM   5461  C  CG    . ASN B 2  426 ? 138.139 117.561 154.704 1.00 12.47  ? 426  ASN B CG    1 
ATOM   5462  O  OD1   . ASN B 2  426 ? 138.380 118.151 155.750 1.00 12.47  ? 426  ASN B OD1   1 
ATOM   5463  N  ND2   . ASN B 2  426 ? 138.677 116.394 154.403 1.00 12.47  ? 426  ASN B ND2   1 
ATOM   5464  N  N     . LEU B 2  427 ? 134.423 120.608 154.023 1.00 11.37  ? 427  LEU B N     1 
ATOM   5465  C  CA    . LEU B 2  427 ? 133.661 121.617 153.293 1.00 11.37  ? 427  LEU B CA    1 
ATOM   5466  C  C     . LEU B 2  427 ? 134.554 122.667 152.634 1.00 11.37  ? 427  LEU B C     1 
ATOM   5467  O  O     . LEU B 2  427 ? 134.111 123.349 151.707 1.00 11.37  ? 427  LEU B O     1 
ATOM   5468  C  CB    . LEU B 2  427 ? 132.650 122.247 154.262 1.00 11.37  ? 427  LEU B CB    1 
ATOM   5469  C  CG    . LEU B 2  427 ? 131.499 123.196 153.914 1.00 11.37  ? 427  LEU B CG    1 
ATOM   5470  C  CD1   . LEU B 2  427 ? 131.926 124.633 153.876 1.00 11.37  ? 427  LEU B CD1   1 
ATOM   5471  C  CD2   . LEU B 2  427 ? 130.918 122.821 152.589 1.00 11.37  ? 427  LEU B CD2   1 
ATOM   5472  N  N     . ASP B 2  428 ? 135.803 122.800 153.081 1.00 14.18  ? 428  ASP B N     1 
ATOM   5473  C  CA    . ASP B 2  428 ? 136.807 123.654 152.464 1.00 14.18  ? 428  ASP B CA    1 
ATOM   5474  C  C     . ASP B 2  428 ? 137.849 122.863 151.676 1.00 14.18  ? 428  ASP B C     1 
ATOM   5475  O  O     . ASP B 2  428 ? 138.982 123.325 151.508 1.00 14.18  ? 428  ASP B O     1 
ATOM   5476  C  CB    . ASP B 2  428 ? 137.475 124.505 153.537 1.00 14.18  ? 428  ASP B CB    1 
ATOM   5477  C  CG    . ASP B 2  428 ? 138.013 123.677 154.683 1.00 14.18  ? 428  ASP B CG    1 
ATOM   5478  O  OD1   . ASP B 2  428 ? 137.832 122.443 154.695 1.00 14.18  ? 428  ASP B OD1   1 
ATOM   5479  O  OD2   . ASP B 2  428 ? 138.611 124.270 155.596 1.00 14.18  ? 428  ASP B OD2   1 
ATOM   5480  N  N     . GLY B 2  429 ? 137.490 121.669 151.203 1.00 14.81  ? 429  GLY B N     1 
ATOM   5481  C  CA    . GLY B 2  429 ? 138.364 120.887 150.378 1.00 14.81  ? 429  GLY B CA    1 
ATOM   5482  C  C     . GLY B 2  429 ? 138.520 121.484 148.992 1.00 14.81  ? 429  GLY B C     1 
ATOM   5483  O  O     . GLY B 2  429 ? 137.861 122.466 148.639 1.00 14.81  ? 429  GLY B O     1 
ATOM   5484  N  N     . PRO B 2  430 ? 139.375 120.853 148.170 1.00 16.95  ? 430  PRO B N     1 
ATOM   5485  C  CA    . PRO B 2  430 ? 139.886 121.516 146.958 1.00 16.95  ? 430  PRO B CA    1 
ATOM   5486  C  C     . PRO B 2  430 ? 138.856 121.810 145.873 1.00 16.95  ? 430  PRO B C     1 
ATOM   5487  O  O     . PRO B 2  430 ? 138.852 122.909 145.314 1.00 16.95  ? 430  PRO B O     1 
ATOM   5488  C  CB    . PRO B 2  430 ? 140.953 120.534 146.458 1.00 16.95  ? 430  PRO B CB    1 
ATOM   5489  C  CG    . PRO B 2  430 ? 140.552 119.221 147.008 1.00 16.95  ? 430  PRO B CG    1 
ATOM   5490  C  CD    . PRO B 2  430 ? 139.919 119.495 148.330 1.00 16.95  ? 430  PRO B CD    1 
ATOM   5491  N  N     . SER B 2  431 ? 137.979 120.860 145.566 1.00 13.44  ? 431  SER B N     1 
ATOM   5492  C  CA    . SER B 2  431 ? 136.959 121.081 144.551 1.00 13.44  ? 431  SER B CA    1 
ATOM   5493  C  C     . SER B 2  431 ? 135.670 121.648 145.118 1.00 13.44  ? 431  SER B C     1 
ATOM   5494  O  O     . SER B 2  431 ? 134.802 122.067 144.347 1.00 13.44  ? 431  SER B O     1 
ATOM   5495  C  CB    . SER B 2  431 ? 136.643 119.779 143.820 1.00 13.44  ? 431  SER B CB    1 
ATOM   5496  O  OG    . SER B 2  431 ? 135.613 119.977 142.870 1.00 13.44  ? 431  SER B OG    1 
ATOM   5497  N  N     . ILE B 2  432 ? 135.531 121.673 146.441 1.00 12.80  ? 432  ILE B N     1 
ATOM   5498  C  CA    . ILE B 2  432 ? 134.289 122.073 147.089 1.00 12.80  ? 432  ILE B CA    1 
ATOM   5499  C  C     . ILE B 2  432 ? 134.387 123.478 147.678 1.00 12.80  ? 432  ILE B C     1 
ATOM   5500  O  O     . ILE B 2  432 ? 133.353 124.082 148.004 1.00 12.80  ? 432  ILE B O     1 
ATOM   5501  C  CB    . ILE B 2  432 ? 133.911 121.018 148.152 1.00 12.80  ? 432  ILE B CB    1 
ATOM   5502  C  CG1   . ILE B 2  432 ? 132.471 121.117 148.616 1.00 12.80  ? 432  ILE B CG1   1 
ATOM   5503  C  CG2   . ILE B 2  432 ? 134.797 121.133 149.321 1.00 12.80  ? 432  ILE B CG2   1 
ATOM   5504  C  CD1   . ILE B 2  432 ? 132.068 119.957 149.396 1.00 12.80  ? 432  ILE B CD1   1 
ATOM   5505  N  N     . ARG B 2  433 ? 135.587 124.049 147.760 1.00 15.67  ? 433  ARG B N     1 
ATOM   5506  C  CA    . ARG B 2  433 ? 135.753 125.432 148.183 1.00 15.67  ? 433  ARG B CA    1 
ATOM   5507  C  C     . ARG B 2  433 ? 135.403 126.438 147.096 1.00 15.67  ? 433  ARG B C     1 
ATOM   5508  O  O     . ARG B 2  433 ? 135.536 127.642 147.329 1.00 15.67  ? 433  ARG B O     1 
ATOM   5509  C  CB    . ARG B 2  433 ? 137.192 125.682 148.636 1.00 15.67  ? 433  ARG B CB    1 
ATOM   5510  C  CG    . ARG B 2  433 ? 138.203 125.585 147.514 1.00 15.67  ? 433  ARG B CG    1 
ATOM   5511  C  CD    . ARG B 2  433 ? 139.626 125.737 148.010 1.00 15.67  ? 433  ARG B CD    1 
ATOM   5512  N  NE    . ARG B 2  433 ? 139.994 124.652 148.907 1.00 15.67  ? 433  ARG B NE    1 
ATOM   5513  C  CZ    . ARG B 2  433 ? 141.174 124.539 149.500 1.00 15.67  ? 433  ARG B CZ    1 
ATOM   5514  N  NH1   . ARG B 2  433 ? 141.414 123.521 150.310 1.00 15.67  ? 433  ARG B NH1   1 
ATOM   5515  N  NH2   . ARG B 2  433 ? 142.125 125.427 149.265 1.00 15.67  ? 433  ARG B NH2   1 
ATOM   5516  N  N     . LYS B 2  434 ? 134.976 125.989 145.920 1.00 17.56  ? 434  LYS B N     1 
ATOM   5517  C  CA    . LYS B 2  434 ? 134.664 126.896 144.833 1.00 17.56  ? 434  LYS B CA    1 
ATOM   5518  C  C     . LYS B 2  434 ? 133.338 127.595 145.100 1.00 17.56  ? 434  LYS B C     1 
ATOM   5519  O  O     . LYS B 2  434 ? 132.546 127.182 145.947 1.00 17.56  ? 434  LYS B O     1 
ATOM   5520  C  CB    . LYS B 2  434 ? 134.625 126.140 143.510 1.00 17.56  ? 434  LYS B CB    1 
ATOM   5521  C  CG    . LYS B 2  434 ? 135.893 125.365 143.252 1.00 17.56  ? 434  LYS B CG    1 
ATOM   5522  C  CD    . LYS B 2  434 ? 137.076 126.290 143.091 1.00 17.56  ? 434  LYS B CD    1 
ATOM   5523  C  CE    . LYS B 2  434 ? 138.362 125.499 142.958 1.00 17.56  ? 434  LYS B CE    1 
ATOM   5524  N  NZ    . LYS B 2  434 ? 138.385 124.708 141.704 1.00 17.56  ? 434  LYS B NZ    1 
ATOM   5525  N  N     . ASN B 2  435 ? 133.094 128.673 144.358 1.00 15.37  ? 435  ASN B N     1 
ATOM   5526  C  CA    . ASN B 2  435 ? 131.965 129.532 144.683 1.00 15.37  ? 435  ASN B CA    1 
ATOM   5527  C  C     . ASN B 2  435 ? 130.643 128.934 144.224 1.00 15.37  ? 435  ASN B C     1 
ATOM   5528  O  O     . ASN B 2  435 ? 129.614 129.163 144.864 1.00 15.37  ? 435  ASN B O     1 
ATOM   5529  C  CB    . ASN B 2  435 ? 132.162 130.914 144.064 1.00 15.37  ? 435  ASN B CB    1 
ATOM   5530  C  CG    . ASN B 2  435 ? 131.299 131.973 144.713 1.00 15.37  ? 435  ASN B CG    1 
ATOM   5531  O  OD1   . ASN B 2  435 ? 130.597 131.710 145.685 1.00 15.37  ? 435  ASN B OD1   1 
ATOM   5532  N  ND2   . ASN B 2  435 ? 131.343 133.181 144.172 1.00 15.37  ? 435  ASN B ND2   1 
ATOM   5533  N  N     . THR B 2  436 ? 130.646 128.163 143.137 1.00 12.72  ? 436  THR B N     1 
ATOM   5534  C  CA    . THR B 2  436 ? 129.407 127.546 142.679 1.00 12.72  ? 436  THR B CA    1 
ATOM   5535  C  C     . THR B 2  436 ? 128.995 126.380 143.565 1.00 12.72  ? 436  THR B C     1 
ATOM   5536  O  O     . THR B 2  436 ? 127.803 126.072 143.659 1.00 12.72  ? 436  THR B O     1 
ATOM   5537  C  CB    . THR B 2  436 ? 129.551 127.085 141.231 1.00 12.72  ? 436  THR B CB    1 
ATOM   5538  O  OG1   . THR B 2  436 ? 130.621 126.138 141.135 1.00 12.72  ? 436  THR B OG1   1 
ATOM   5539  C  CG2   . THR B 2  436 ? 129.844 128.264 140.332 1.00 12.72  ? 436  THR B CG2   1 
ATOM   5540  N  N     . PHE B 2  437 ? 129.954 125.726 144.223 1.00 10.90  ? 437  PHE B N     1 
ATOM   5541  C  CA    . PHE B 2  437 ? 129.601 124.640 145.126 1.00 10.90  ? 437  PHE B CA    1 
ATOM   5542  C  C     . PHE B 2  437 ? 129.059 125.199 146.437 1.00 10.90  ? 437  PHE B C     1 
ATOM   5543  O  O     . PHE B 2  437 ? 128.102 124.656 146.997 1.00 10.90  ? 437  PHE B O     1 
ATOM   5544  C  CB    . PHE B 2  437 ? 130.820 123.768 145.427 1.00 10.90  ? 437  PHE B CB    1 
ATOM   5545  C  CG    . PHE B 2  437 ? 130.500 122.312 145.672 1.00 10.90  ? 437  PHE B CG    1 
ATOM   5546  C  CD1   . PHE B 2  437 ? 130.950 121.342 144.800 1.00 10.90  ? 437  PHE B CD1   1 
ATOM   5547  C  CD2   . PHE B 2  437 ? 129.635 121.927 146.681 1.00 10.90  ? 437  PHE B CD2   1 
ATOM   5548  C  CE1   . PHE B 2  437 ? 130.647 120.015 145.007 1.00 10.90  ? 437  PHE B CE1   1 
ATOM   5549  C  CE2   . PHE B 2  437 ? 129.315 120.611 146.878 1.00 10.90  ? 437  PHE B CE2   1 
ATOM   5550  C  CZ    . PHE B 2  437 ? 129.819 119.656 146.041 1.00 10.90  ? 437  PHE B CZ    1 
ATOM   5551  N  N     . GLN B 2  438 ? 129.680 126.266 146.952 1.00 13.41  ? 438  GLN B N     1 
ATOM   5552  C  CA    . GLN B 2  438 ? 129.241 126.865 148.209 1.00 13.41  ? 438  GLN B CA    1 
ATOM   5553  C  C     . GLN B 2  438 ? 127.885 127.535 148.061 1.00 13.41  ? 438  GLN B C     1 
ATOM   5554  O  O     . GLN B 2  438 ? 127.086 127.538 149.002 1.00 13.41  ? 438  GLN B O     1 
ATOM   5555  C  CB    . GLN B 2  438 ? 130.263 127.885 148.705 1.00 13.41  ? 438  GLN B CB    1 
ATOM   5556  C  CG    . GLN B 2  438 ? 131.602 127.321 149.124 1.00 13.41  ? 438  GLN B CG    1 
ATOM   5557  C  CD    . GLN B 2  438 ? 131.519 126.461 150.359 1.00 13.41  ? 438  GLN B CD    1 
ATOM   5558  O  OE1   . GLN B 2  438 ? 130.763 126.751 151.282 1.00 13.41  ? 438  GLN B OE1   1 
ATOM   5559  N  NE2   . GLN B 2  438 ? 132.311 125.401 150.391 1.00 13.41  ? 438  GLN B NE2   1 
ATOM   5560  N  N     . THR B 2  439 ? 127.623 128.130 146.894 1.00 10.61  ? 439  THR B N     1 
ATOM   5561  C  CA    . THR B 2  439 ? 126.323 128.738 146.629 1.00 10.61  ? 439  THR B CA    1 
ATOM   5562  C  C     . THR B 2  439 ? 125.228 127.684 146.590 1.00 10.61  ? 439  THR B C     1 
ATOM   5563  O  O     . THR B 2  439 ? 124.122 127.917 147.086 1.00 10.61  ? 439  THR B O     1 
ATOM   5564  C  CB    . THR B 2  439 ? 126.376 129.517 145.315 1.00 10.61  ? 439  THR B CB    1 
ATOM   5565  O  OG1   . THR B 2  439 ? 127.425 130.489 145.385 1.00 10.61  ? 439  THR B OG1   1 
ATOM   5566  C  CG2   . THR B 2  439 ? 125.075 130.241 145.043 1.00 10.61  ? 439  THR B CG2   1 
ATOM   5567  N  N     . MET B 2  440 ? 125.537 126.506 146.043 1.00 11.80  ? 440  MET B N     1 
ATOM   5568  C  CA    . MET B 2  440 ? 124.588 125.398 146.057 1.00 11.80  ? 440  MET B CA    1 
ATOM   5569  C  C     . MET B 2  440 ? 124.277 124.959 147.479 1.00 11.80  ? 440  MET B C     1 
ATOM   5570  O  O     . MET B 2  440 ? 123.112 124.916 147.879 1.00 11.80  ? 440  MET B O     1 
ATOM   5571  C  CB    . MET B 2  440 ? 125.130 124.221 145.248 1.00 11.80  ? 440  MET B CB    1 
ATOM   5572  C  CG    . MET B 2  440 ? 124.161 123.057 145.197 1.00 11.80  ? 440  MET B CG    1 
ATOM   5573  S  SD    . MET B 2  440 ? 124.700 121.643 144.232 1.00 11.80  ? 440  MET B SD    1 
ATOM   5574  C  CE    . MET B 2  440 ? 125.912 120.934 145.333 1.00 11.80  ? 440  MET B CE    1 
ATOM   5575  N  N     . LEU B 2  441 ? 125.313 124.682 148.276 1.00 11.52  ? 441  LEU B N     1 
ATOM   5576  C  CA    . LEU B 2  441 ? 125.112 124.164 149.623 1.00 11.52  ? 441  LEU B CA    1 
ATOM   5577  C  C     . LEU B 2  441 ? 124.564 125.202 150.593 1.00 11.52  ? 441  LEU B C     1 
ATOM   5578  O  O     . LEU B 2  441 ? 123.996 124.820 151.620 1.00 11.52  ? 441  LEU B O     1 
ATOM   5579  C  CB    . LEU B 2  441 ? 126.417 123.601 150.177 1.00 11.52  ? 441  LEU B CB    1 
ATOM   5580  C  CG    . LEU B 2  441 ? 126.985 122.372 149.473 1.00 11.52  ? 441  LEU B CG    1 
ATOM   5581  C  CD1   . LEU B 2  441 ? 128.321 122.025 150.072 1.00 11.52  ? 441  LEU B CD1   1 
ATOM   5582  C  CD2   . LEU B 2  441 ? 126.041 121.198 149.578 1.00 11.52  ? 441  LEU B CD2   1 
ATOM   5583  N  N     . SER B 2  442 ? 124.724 126.497 150.314 1.00 12.01  ? 442  SER B N     1 
ATOM   5584  C  CA    . SER B 2  442 ? 124.141 127.504 151.195 1.00 12.01  ? 442  SER B CA    1 
ATOM   5585  C  C     . SER B 2  442 ? 122.637 127.611 150.982 1.00 12.01  ? 442  SER B C     1 
ATOM   5586  O  O     . SER B 2  442 ? 121.869 127.611 151.947 1.00 12.01  ? 442  SER B O     1 
ATOM   5587  C  CB    . SER B 2  442 ? 124.802 128.860 150.971 1.00 12.01  ? 442  SER B CB    1 
ATOM   5588  O  OG    . SER B 2  442 ? 126.158 128.828 151.354 1.00 12.01  ? 442  SER B OG    1 
ATOM   5589  N  N     . PHE B 2  443 ? 122.200 127.713 149.718 1.00 13.24  ? 443  PHE B N     1 
ATOM   5590  C  CA    . PHE B 2  443 ? 120.773 127.741 149.422 1.00 13.24  ? 443  PHE B CA    1 
ATOM   5591  C  C     . PHE B 2  443 ? 120.097 126.435 149.799 1.00 13.24  ? 443  PHE B C     1 
ATOM   5592  O  O     . PHE B 2  443 ? 118.924 126.429 150.184 1.00 13.24  ? 443  PHE B O     1 
ATOM   5593  C  CB    . PHE B 2  443 ? 120.519 128.029 147.941 1.00 13.24  ? 443  PHE B CB    1 
ATOM   5594  C  CG    . PHE B 2  443 ? 120.675 129.471 147.564 1.00 13.24  ? 443  PHE B CG    1 
ATOM   5595  C  CD1   . PHE B 2  443 ? 119.719 130.394 147.940 1.00 13.24  ? 443  PHE B CD1   1 
ATOM   5596  C  CD2   . PHE B 2  443 ? 121.734 129.893 146.787 1.00 13.24  ? 443  PHE B CD2   1 
ATOM   5597  C  CE1   . PHE B 2  443 ? 119.845 131.719 147.587 1.00 13.24  ? 443  PHE B CE1   1 
ATOM   5598  C  CE2   . PHE B 2  443 ? 121.867 131.214 146.429 1.00 13.24  ? 443  PHE B CE2   1 
ATOM   5599  C  CZ    . PHE B 2  443 ? 120.921 132.127 146.829 1.00 13.24  ? 443  PHE B CZ    1 
ATOM   5600  N  N     . LEU B 2  444 ? 120.820 125.331 149.719 1.00 12.19  ? 444  LEU B N     1 
ATOM   5601  C  CA    . LEU B 2  444 ? 120.283 124.045 150.116 1.00 12.19  ? 444  LEU B CA    1 
ATOM   5602  C  C     . LEU B 2  444 ? 120.209 123.902 151.630 1.00 12.19  ? 444  LEU B C     1 
ATOM   5603  O  O     . LEU B 2  444 ? 119.446 123.072 152.124 1.00 12.19  ? 444  LEU B O     1 
ATOM   5604  C  CB    . LEU B 2  444 ? 121.152 122.962 149.488 1.00 12.19  ? 444  LEU B CB    1 
ATOM   5605  C  CG    . LEU B 2  444 ? 120.876 121.483 149.349 1.00 12.19  ? 444  LEU B CG    1 
ATOM   5606  C  CD1   . LEU B 2  444 ? 119.650 121.245 148.498 1.00 12.19  ? 444  LEU B CD1   1 
ATOM   5607  C  CD2   . LEU B 2  444 ? 122.086 120.901 148.689 1.00 12.19  ? 444  LEU B CD2   1 
ATOM   5608  N  N     . SER B 2  445 ? 120.968 124.704 152.374 1.00 11.41  ? 445  SER B N     1 
ATOM   5609  C  CA    . SER B 2  445 ? 120.920 124.688 153.830 1.00 11.41  ? 445  SER B CA    1 
ATOM   5610  C  C     . SER B 2  445 ? 119.741 125.466 154.390 1.00 11.41  ? 445  SER B C     1 
ATOM   5611  O  O     . SER B 2  445 ? 119.446 125.333 155.581 1.00 11.41  ? 445  SER B O     1 
ATOM   5612  C  CB    . SER B 2  445 ? 122.209 125.265 154.409 1.00 11.41  ? 445  SER B CB    1 
ATOM   5613  O  OG    . SER B 2  445 ? 123.332 124.515 153.993 1.00 11.41  ? 445  SER B OG    1 
ATOM   5614  N  N     . VAL B 2  446 ? 119.079 126.284 153.566 1.00 11.20  ? 446  VAL B N     1 
ATOM   5615  C  CA    . VAL B 2  446 ? 117.907 127.031 154.008 1.00 11.20  ? 446  VAL B CA    1 
ATOM   5616  C  C     . VAL B 2  446 ? 116.750 126.080 154.256 1.00 11.20  ? 446  VAL B C     1 
ATOM   5617  O  O     . VAL B 2  446 ? 115.909 126.316 155.133 1.00 11.20  ? 446  VAL B O     1 
ATOM   5618  C  CB    . VAL B 2  446 ? 117.545 128.091 152.954 1.00 11.20  ? 446  VAL B CB    1 
ATOM   5619  C  CG1   . VAL B 2  446 ? 116.450 129.024 153.448 1.00 11.20  ? 446  VAL B CG1   1 
ATOM   5620  C  CG2   . VAL B 2  446 ? 118.759 128.844 152.538 1.00 11.20  ? 446  VAL B CG2   1 
ATOM   5621  N  N     . ILE B 2  447 ? 116.702 124.987 153.498 1.00 14.80  ? 447  ILE B N     1 
ATOM   5622  C  CA    . ILE B 2  447 ? 115.644 123.987 153.582 1.00 14.80  ? 447  ILE B CA    1 
ATOM   5623  C  C     . ILE B 2  447 ? 115.753 123.290 154.931 1.00 14.80  ? 447  ILE B C     1 
ATOM   5624  O  O     . ILE B 2  447 ? 116.733 122.594 155.205 1.00 14.80  ? 447  ILE B O     1 
ATOM   5625  C  CB    . ILE B 2  447 ? 115.740 122.987 152.431 1.00 14.80  ? 447  ILE B CB    1 
ATOM   5626  C  CG1   . ILE B 2  447 ? 115.607 123.726 151.107 1.00 14.80  ? 447  ILE B CG1   1 
ATOM   5627  C  CG2   . ILE B 2  447 ? 114.675 121.926 152.563 1.00 14.80  ? 447  ILE B CG2   1 
ATOM   5628  C  CD1   . ILE B 2  447 ? 115.944 122.895 149.928 1.00 14.80  ? 447  ILE B CD1   1 
ATOM   5629  N  N     . ARG B 2  448 ? 114.749 123.488 155.781 1.00 17.15  ? 448  ARG B N     1 
ATOM   5630  C  CA    . ARG B 2  448 ? 114.800 122.981 157.141 1.00 17.15  ? 448  ARG B CA    1 
ATOM   5631  C  C     . ARG B 2  448 ? 114.577 121.476 157.191 1.00 17.15  ? 448  ARG B C     1 
ATOM   5632  O  O     . ARG B 2  448 ? 114.906 120.837 158.193 1.00 17.15  ? 448  ARG B O     1 
ATOM   5633  C  CB    . ARG B 2  448 ? 113.758 123.714 157.988 1.00 17.15  ? 448  ARG B CB    1 
ATOM   5634  C  CG    . ARG B 2  448 ? 113.942 123.610 159.487 1.00 17.15  ? 448  ARG B CG    1 
ATOM   5635  C  CD    . ARG B 2  448 ? 112.813 124.303 160.190 1.00 17.15  ? 448  ARG B CD    1 
ATOM   5636  N  NE    . ARG B 2  448 ? 112.883 124.166 161.638 1.00 17.15  ? 448  ARG B NE    1 
ATOM   5637  C  CZ    . ARG B 2  448 ? 113.416 125.069 162.447 1.00 17.15  ? 448  ARG B CZ    1 
ATOM   5638  N  NH1   . ARG B 2  448 ? 113.909 126.193 161.955 1.00 17.15  ? 448  ARG B NH1   1 
ATOM   5639  N  NH2   . ARG B 2  448 ? 113.424 124.858 163.752 1.00 17.15  ? 448  ARG B NH2   1 
ATOM   5640  N  N     . GLN B 2  449 ? 114.055 120.896 156.115 1.00 18.25  ? 449  GLN B N     1 
ATOM   5641  C  CA    . GLN B 2  449 ? 113.817 119.465 156.030 1.00 18.25  ? 449  GLN B CA    1 
ATOM   5642  C  C     . GLN B 2  449 ? 115.079 118.660 155.782 1.00 18.25  ? 449  GLN B C     1 
ATOM   5643  O  O     . GLN B 2  449 ? 115.019 117.430 155.829 1.00 18.25  ? 449  GLN B O     1 
ATOM   5644  C  CB    . GLN B 2  449 ? 112.803 119.163 154.926 1.00 18.25  ? 449  GLN B CB    1 
ATOM   5645  C  CG    . GLN B 2  449 ? 111.344 119.313 155.325 1.00 18.25  ? 449  GLN B CG    1 
ATOM   5646  C  CD    . GLN B 2  449 ? 110.966 120.719 155.706 1.00 18.25  ? 449  GLN B CD    1 
ATOM   5647  O  OE1   . GLN B 2  449 ? 110.436 120.958 156.784 1.00 18.25  ? 449  GLN B OE1   1 
ATOM   5648  N  NE2   . GLN B 2  449 ? 111.285 121.664 154.847 1.00 18.25  ? 449  GLN B NE2   1 
ATOM   5649  N  N     . ILE B 2  450 ? 116.208 119.297 155.485 1.00 13.53  ? 450  ILE B N     1 
ATOM   5650  C  CA    . ILE B 2  450 ? 117.477 118.594 155.363 1.00 13.53  ? 450  ILE B CA    1 
ATOM   5651  C  C     . ILE B 2  450 ? 118.473 119.217 156.333 1.00 13.53  ? 450  ILE B C     1 
ATOM   5652  O  O     . ILE B 2  450 ? 118.474 120.433 156.553 1.00 13.53  ? 450  ILE B O     1 
ATOM   5653  C  CB    . ILE B 2  450 ? 118.018 118.572 153.913 1.00 13.53  ? 450  ILE B CB    1 
ATOM   5654  C  CG1   . ILE B 2  450 ? 118.407 119.941 153.393 1.00 13.53  ? 450  ILE B CG1   1 
ATOM   5655  C  CG2   . ILE B 2  450 ? 116.980 118.013 152.950 1.00 13.53  ? 450  ILE B CG2   1 
ATOM   5656  C  CD1   . ILE B 2  450 ? 119.099 119.825 152.088 1.00 13.53  ? 450  ILE B CD1   1 
ATOM   5657  N  N     . ALA B 2  451 ? 119.289 118.369 156.946 1.00 10.24  ? 451  ALA B N     1 
ATOM   5658  C  CA    . ALA B 2  451 ? 120.150 118.755 158.055 1.00 10.24  ? 451  ALA B CA    1 
ATOM   5659  C  C     . ALA B 2  451 ? 121.600 118.680 157.610 1.00 10.24  ? 451  ALA B C     1 
ATOM   5660  O  O     . ALA B 2  451 ? 122.066 117.618 157.192 1.00 10.24  ? 451  ALA B O     1 
ATOM   5661  C  CB    . ALA B 2  451 ? 119.914 117.848 159.260 1.00 10.24  ? 451  ALA B CB    1 
ATOM   5662  N  N     . ILE B 2  452 ? 122.309 119.796 157.704 1.00 8.63   ? 452  ILE B N     1 
ATOM   5663  C  CA    . ILE B 2  452 ? 123.684 119.875 157.229 1.00 8.63   ? 452  ILE B CA    1 
ATOM   5664  C  C     . ILE B 2  452 ? 124.605 119.568 158.397 1.00 8.63   ? 452  ILE B C     1 
ATOM   5665  O  O     . ILE B 2  452 ? 124.447 120.128 159.486 1.00 8.63   ? 452  ILE B O     1 
ATOM   5666  C  CB    . ILE B 2  452 ? 123.994 121.263 156.654 1.00 8.63   ? 452  ILE B CB    1 
ATOM   5667  C  CG1   . ILE B 2  452 ? 122.855 121.772 155.772 1.00 8.63   ? 452  ILE B CG1   1 
ATOM   5668  C  CG2   . ILE B 2  452 ? 125.281 121.215 155.855 1.00 8.63   ? 452  ILE B CG2   1 
ATOM   5669  C  CD1   . ILE B 2  452 ? 122.600 120.988 154.550 1.00 8.63   ? 452  ILE B CD1   1 
ATOM   5670  N  N     . VAL B 2  453 ? 125.555 118.663 158.183 1.00 10.14  ? 453  VAL B N     1 
ATOM   5671  C  CA    . VAL B 2  453 ? 126.585 118.335 159.161 1.00 10.14  ? 453  VAL B CA    1 
ATOM   5672  C  C     . VAL B 2  453 ? 127.905 118.406 158.408 1.00 10.14  ? 453  VAL B C     1 
ATOM   5673  O  O     . VAL B 2  453 ? 128.201 117.524 157.596 1.00 10.14  ? 453  VAL B O     1 
ATOM   5674  C  CB    . VAL B 2  453 ? 126.386 116.947 159.790 1.00 10.14  ? 453  VAL B CB    1 
ATOM   5675  C  CG1   . VAL B 2  453 ? 127.480 116.660 160.765 1.00 10.14  ? 453  VAL B CG1   1 
ATOM   5676  C  CG2   . VAL B 2  453 ? 125.049 116.834 160.488 1.00 10.14  ? 453  VAL B CG2   1 
ATOM   5677  N  N     . ALA B 2  454 ? 128.690 119.449 158.651 1.00 9.73   ? 454  ALA B N     1 
ATOM   5678  C  CA    . ALA B 2  454 ? 129.856 119.723 157.824 1.00 9.73   ? 454  ALA B CA    1 
ATOM   5679  C  C     . ALA B 2  454 ? 131.121 119.806 158.671 1.00 9.73   ? 454  ALA B C     1 
ATOM   5680  O  O     . ALA B 2  454 ? 131.074 119.846 159.900 1.00 9.73   ? 454  ALA B O     1 
ATOM   5681  C  CB    . ALA B 2  454 ? 129.659 121.013 157.021 1.00 9.73   ? 454  ALA B CB    1 
ATOM   5682  N  N     . SER B 2  455 ? 132.267 119.816 157.990 1.00 11.78  ? 455  SER B N     1 
ATOM   5683  C  CA    . SER B 2  455 ? 133.556 119.896 158.662 1.00 11.78  ? 455  SER B CA    1 
ATOM   5684  C  C     . SER B 2  455 ? 134.538 120.656 157.786 1.00 11.78  ? 455  SER B C     1 
ATOM   5685  O  O     . SER B 2  455 ? 134.411 120.667 156.562 1.00 11.78  ? 455  SER B O     1 
ATOM   5686  C  CB    . SER B 2  455 ? 134.126 118.515 158.983 1.00 11.78  ? 455  SER B CB    1 
ATOM   5687  O  OG    . SER B 2  455 ? 134.554 117.856 157.808 1.00 11.78  ? 455  SER B OG    1 
ATOM   5688  N  N     . THR B 2  456 ? 135.516 121.305 158.423 1.00 13.51  ? 456  THR B N     1 
ATOM   5689  C  CA    . THR B 2  456 ? 136.517 122.106 157.725 1.00 13.51  ? 456  THR B CA    1 
ATOM   5690  C  C     . THR B 2  456 ? 137.894 121.894 158.337 1.00 13.51  ? 456  THR B C     1 
ATOM   5691  O  O     . THR B 2  456 ? 138.029 121.816 159.560 1.00 13.51  ? 456  THR B O     1 
ATOM   5692  C  CB    . THR B 2  456 ? 136.189 123.607 157.768 1.00 13.51  ? 456  THR B CB    1 
ATOM   5693  O  OG1   . THR B 2  456 ? 135.975 124.014 159.123 1.00 13.51  ? 456  THR B OG1   1 
ATOM   5694  C  CG2   . THR B 2  456 ? 134.984 123.966 156.907 1.00 13.51  ? 456  THR B CG2   1 
ATOM   5695  N  N     . ASP B 2  457 ? 138.921 121.829 157.484 1.00 15.41  ? 457  ASP B N     1 
ATOM   5696  C  CA    . ASP B 2  457 ? 140.301 121.697 157.940 1.00 15.41  ? 457  ASP B CA    1 
ATOM   5697  C  C     . ASP B 2  457 ? 141.149 122.947 157.788 1.00 15.41  ? 457  ASP B C     1 
ATOM   5698  O  O     . ASP B 2  457 ? 142.044 123.154 158.608 1.00 15.41  ? 457  ASP B O     1 
ATOM   5699  C  CB    . ASP B 2  457 ? 141.022 120.556 157.210 1.00 15.41  ? 457  ASP B CB    1 
ATOM   5700  C  CG    . ASP B 2  457 ? 140.732 119.199 157.809 1.00 15.41  ? 457  ASP B CG    1 
ATOM   5701  O  OD1   . ASP B 2  457 ? 140.403 119.134 159.011 1.00 15.41  ? 457  ASP B OD1   1 
ATOM   5702  O  OD2   . ASP B 2  457 ? 140.884 118.190 157.092 1.00 15.41  ? 457  ASP B OD2   1 
ATOM   5703  N  N     . HIS B 2  458 ? 140.925 123.764 156.762 1.00 14.67  ? 458  HIS B N     1 
ATOM   5704  C  CA    . HIS B 2  458 ? 141.814 124.889 156.504 1.00 14.67  ? 458  HIS B CA    1 
ATOM   5705  C  C     . HIS B 2  458 ? 141.598 125.970 157.554 1.00 14.67  ? 458  HIS B C     1 
ATOM   5706  O  O     . HIS B 2  458 ? 140.500 126.139 158.085 1.00 14.67  ? 458  HIS B O     1 
ATOM   5707  C  CB    . HIS B 2  458 ? 141.573 125.456 155.105 1.00 14.67  ? 458  HIS B CB    1 
ATOM   5708  C  CG    . HIS B 2  458 ? 142.704 126.280 154.578 1.00 14.67  ? 458  HIS B CG    1 
ATOM   5709  N  ND1   . HIS B 2  458 ? 142.949 127.567 154.997 1.00 14.67  ? 458  HIS B ND1   1 
ATOM   5710  C  CD2   . HIS B 2  458 ? 143.618 126.021 153.616 1.00 14.67  ? 458  HIS B CD2   1 
ATOM   5711  C  CE1   . HIS B 2  458 ? 143.991 128.051 154.350 1.00 14.67  ? 458  HIS B CE1   1 
ATOM   5712  N  NE2   . HIS B 2  458 ? 144.411 127.135 153.499 1.00 14.67  ? 458  HIS B NE2   1 
ATOM   5713  N  N     . ILE B 2  459 ? 142.669 126.695 157.869 1.00 14.19  ? 459  ILE B N     1 
ATOM   5714  C  CA    . ILE B 2  459 ? 142.612 127.636 158.978 1.00 14.19  ? 459  ILE B CA    1 
ATOM   5715  C  C     . ILE B 2  459 ? 141.962 128.959 158.572 1.00 14.19  ? 459  ILE B C     1 
ATOM   5716  O  O     . ILE B 2  459 ? 141.436 129.673 159.435 1.00 14.19  ? 459  ILE B O     1 
ATOM   5717  C  CB    . ILE B 2  459 ? 144.029 127.794 159.563 1.00 14.19  ? 459  ILE B CB    1 
ATOM   5718  C  CG1   . ILE B 2  459 ? 143.985 128.434 160.950 1.00 14.19  ? 459  ILE B CG1   1 
ATOM   5719  C  CG2   . ILE B 2  459 ? 144.926 128.566 158.623 1.00 14.19  ? 459  ILE B CG2   1 
ATOM   5720  C  CD1   . ILE B 2  459 ? 145.253 128.309 161.735 1.00 14.19  ? 459  ILE B CD1   1 
ATOM   5721  N  N     . TYR B 2  460 ? 141.927 129.290 157.281 1.00 12.40  ? 460  TYR B N     1 
ATOM   5722  C  CA    . TYR B 2  460 ? 141.185 130.449 156.805 1.00 12.40  ? 460  TYR B CA    1 
ATOM   5723  C  C     . TYR B 2  460 ? 139.841 130.071 156.209 1.00 12.40  ? 460  TYR B C     1 
ATOM   5724  O  O     . TYR B 2  460 ? 139.345 130.782 155.335 1.00 12.40  ? 460  TYR B O     1 
ATOM   5725  C  CB    . TYR B 2  460 ? 141.980 131.235 155.763 1.00 12.40  ? 460  TYR B CB    1 
ATOM   5726  C  CG    . TYR B 2  460 ? 143.285 131.778 156.258 1.00 12.40  ? 460  TYR B CG    1 
ATOM   5727  C  CD1   . TYR B 2  460 ? 143.322 132.768 157.221 1.00 12.40  ? 460  TYR B CD1   1 
ATOM   5728  C  CD2   . TYR B 2  460 ? 144.481 131.347 155.713 1.00 12.40  ? 460  TYR B CD2   1 
ATOM   5729  C  CE1   . TYR B 2  460 ? 144.513 133.278 157.669 1.00 12.40  ? 460  TYR B CE1   1 
ATOM   5730  C  CE2   . TYR B 2  460 ? 145.679 131.854 156.148 1.00 12.40  ? 460  TYR B CE2   1 
ATOM   5731  C  CZ    . TYR B 2  460 ? 145.687 132.819 157.125 1.00 12.40  ? 460  TYR B CZ    1 
ATOM   5732  O  OH    . TYR B 2  460 ? 146.883 133.325 157.557 1.00 12.40  ? 460  TYR B OH    1 
ATOM   5733  N  N     . ALA B 2  461 ? 139.275 128.944 156.612 1.00 10.99  ? 461  ALA B N     1 
ATOM   5734  C  CA    . ALA B 2  461 ? 137.935 128.527 156.202 1.00 10.99  ? 461  ALA B CA    1 
ATOM   5735  C  C     . ALA B 2  461 ? 136.790 129.527 156.427 1.00 10.99  ? 461  ALA B C     1 
ATOM   5736  O  O     . ALA B 2  461 ? 135.882 129.551 155.589 1.00 10.99  ? 461  ALA B O     1 
ATOM   5737  C  CB    . ALA B 2  461 ? 137.581 127.203 156.881 1.00 10.99  ? 461  ALA B CB    1 
ATOM   5738  N  N     . PRO B 2  462 ? 136.745 130.361 157.485 1.00 11.73  ? 462  PRO B N     1 
ATOM   5739  C  CA    . PRO B 2  462 ? 135.635 131.326 157.577 1.00 11.73  ? 462  PRO B CA    1 
ATOM   5740  C  C     . PRO B 2  462 ? 135.706 132.474 156.588 1.00 11.73  ? 462  PRO B C     1 
ATOM   5741  O  O     . PRO B 2  462 ? 134.748 133.251 156.512 1.00 11.73  ? 462  PRO B O     1 
ATOM   5742  C  CB    . PRO B 2  462 ? 135.741 131.847 159.010 1.00 11.73  ? 462  PRO B CB    1 
ATOM   5743  C  CG    . PRO B 2  462 ? 136.485 130.851 159.711 1.00 11.73  ? 462  PRO B CG    1 
ATOM   5744  C  CD    . PRO B 2  462 ? 137.459 130.335 158.776 1.00 11.73  ? 462  PRO B CD    1 
ATOM   5745  N  N     . LEU B 2  463 ? 136.793 132.605 155.824 1.00 10.69  ? 463  LEU B N     1 
ATOM   5746  C  CA    . LEU B 2  463 ? 136.899 133.582 154.747 1.00 10.69  ? 463  LEU B CA    1 
ATOM   5747  C  C     . LEU B 2  463 ? 136.030 133.211 153.555 1.00 10.69  ? 463  LEU B C     1 
ATOM   5748  O  O     . LEU B 2  463 ? 135.837 134.027 152.650 1.00 10.69  ? 463  LEU B O     1 
ATOM   5749  C  CB    . LEU B 2  463 ? 138.368 133.697 154.327 1.00 10.69  ? 463  LEU B CB    1 
ATOM   5750  C  CG    . LEU B 2  463 ? 138.903 134.750 153.363 1.00 10.69  ? 463  LEU B CG    1 
ATOM   5751  C  CD1   . LEU B 2  463 ? 138.700 136.105 153.971 1.00 10.69  ? 463  LEU B CD1   1 
ATOM   5752  C  CD2   . LEU B 2  463 ? 140.365 134.512 153.061 1.00 10.69  ? 463  LEU B CD2   1 
ATOM   5753  N  N     . LEU B 2  464 ? 135.487 132.006 153.552 1.00 10.67  ? 464  LEU B N     1 
ATOM   5754  C  CA    . LEU B 2  464 ? 134.773 131.439 152.429 1.00 10.67  ? 464  LEU B CA    1 
ATOM   5755  C  C     . LEU B 2  464 ? 133.283 131.750 152.458 1.00 10.67  ? 464  LEU B C     1 
ATOM   5756  O  O     . LEU B 2  464 ? 132.587 131.467 151.478 1.00 10.67  ? 464  LEU B O     1 
ATOM   5757  C  CB    . LEU B 2  464 ? 135.039 129.932 152.428 1.00 10.67  ? 464  LEU B CB    1 
ATOM   5758  C  CG    . LEU B 2  464 ? 134.689 128.996 151.292 1.00 10.67  ? 464  LEU B CG    1 
ATOM   5759  C  CD1   . LEU B 2  464 ? 135.321 129.515 150.030 1.00 10.67  ? 464  LEU B CD1   1 
ATOM   5760  C  CD2   . LEU B 2  464 ? 135.248 127.641 151.636 1.00 10.67  ? 464  LEU B CD2   1 
ATOM   5761  N  N     . TRP B 2  465 ? 132.774 132.360 153.530 1.00 13.14  ? 465  TRP B N     1 
ATOM   5762  C  CA    . TRP B 2  465 ? 131.351 132.666 153.635 1.00 13.14  ? 465  TRP B CA    1 
ATOM   5763  C  C     . TRP B 2  465 ? 131.188 134.129 154.016 1.00 13.14  ? 465  TRP B C     1 
ATOM   5764  O  O     . TRP B 2  465 ? 131.663 134.552 155.074 1.00 13.14  ? 465  TRP B O     1 
ATOM   5765  C  CB    . TRP B 2  465 ? 130.657 131.781 154.674 1.00 13.14  ? 465  TRP B CB    1 
ATOM   5766  C  CG    . TRP B 2  465 ? 131.107 130.363 154.653 1.00 13.14  ? 465  TRP B CG    1 
ATOM   5767  C  CD1   . TRP B 2  465 ? 130.913 129.448 153.669 1.00 13.14  ? 465  TRP B CD1   1 
ATOM   5768  C  CD2   . TRP B 2  465 ? 131.743 129.670 155.724 1.00 13.14  ? 465  TRP B CD2   1 
ATOM   5769  N  NE1   . TRP B 2  465 ? 131.454 128.240 154.038 1.00 13.14  ? 465  TRP B NE1   1 
ATOM   5770  C  CE2   . TRP B 2  465 ? 131.960 128.353 155.302 1.00 13.14  ? 465  TRP B CE2   1 
ATOM   5771  C  CE3   . TRP B 2  465 ? 132.178 130.049 156.998 1.00 13.14  ? 465  TRP B CE3   1 
ATOM   5772  C  CZ2   . TRP B 2  465 ? 132.583 127.413 156.100 1.00 13.14  ? 465  TRP B CZ2   1 
ATOM   5773  C  CZ3   . TRP B 2  465 ? 132.788 129.114 157.789 1.00 13.14  ? 465  TRP B CZ3   1 
ATOM   5774  C  CH2   . TRP B 2  465 ? 132.992 127.813 157.337 1.00 13.14  ? 465  TRP B CH2   1 
ATOM   5775  N  N     . ASP B 2  466 ? 130.496 134.891 153.170 1.00 18.83  ? 466  ASP B N     1 
ATOM   5776  C  CA    . ASP B 2  466 ? 130.147 136.280 153.450 1.00 18.83  ? 466  ASP B CA    1 
ATOM   5777  C  C     . ASP B 2  466 ? 128.895 136.368 154.315 1.00 18.83  ? 466  ASP B C     1 
ATOM   5778  O  O     . ASP B 2  466 ? 128.486 135.364 154.900 1.00 18.83  ? 466  ASP B O     1 
ATOM   5779  C  CB    . ASP B 2  466 ? 129.959 137.060 152.148 1.00 18.83  ? 466  ASP B CB    1 
ATOM   5780  C  CG    . ASP B 2  466 ? 128.954 136.417 151.215 1.00 18.83  ? 466  ASP B CG    1 
ATOM   5781  O  OD1   . ASP B 2  466 ? 128.502 135.290 151.486 1.00 18.83  ? 466  ASP B OD1   1 
ATOM   5782  O  OD2   . ASP B 2  466 ? 128.602 137.047 150.200 1.00 18.83  ? 466  ASP B OD2   1 
ATOM   5783  N  N     . ASN B 2  467 ? 128.278 137.552 154.406 1.00 19.35  ? 467  ASN B N     1 
ATOM   5784  C  CA    . ASN B 2  467 ? 127.086 137.692 155.239 1.00 19.35  ? 467  ASN B CA    1 
ATOM   5785  C  C     . ASN B 2  467 ? 125.883 136.954 154.668 1.00 19.35  ? 467  ASN B C     1 
ATOM   5786  O  O     . ASN B 2  467 ? 125.029 136.497 155.433 1.00 19.35  ? 467  ASN B O     1 
ATOM   5787  C  CB    . ASN B 2  467 ? 126.720 139.162 155.449 1.00 19.35  ? 467  ASN B CB    1 
ATOM   5788  C  CG    . ASN B 2  467 ? 127.622 139.853 156.440 1.00 19.35  ? 467  ASN B CG    1 
ATOM   5789  O  OD1   . ASN B 2  467 ? 128.091 139.242 157.395 1.00 19.35  ? 467  ASN B OD1   1 
ATOM   5790  N  ND2   . ASN B 2  467 ? 127.820 141.147 156.257 1.00 19.35  ? 467  ASN B ND2   1 
ATOM   5791  N  N     . MET B 2  468 ? 125.783 136.829 153.346 1.00 19.07  ? 468  MET B N     1 
ATOM   5792  C  CA    . MET B 2  468 ? 124.628 136.136 152.787 1.00 19.07  ? 468  MET B CA    1 
ATOM   5793  C  C     . MET B 2  468 ? 124.759 134.628 152.945 1.00 19.07  ? 468  MET B C     1 
ATOM   5794  O  O     . MET B 2  468 ? 123.780 133.955 153.278 1.00 19.07  ? 468  MET B O     1 
ATOM   5795  C  CB    . MET B 2  468 ? 124.439 136.499 151.316 1.00 19.07  ? 468  MET B CB    1 
ATOM   5796  C  CG    . MET B 2  468 ? 123.101 136.050 150.751 1.00 19.07  ? 468  MET B CG    1 
ATOM   5797  S  SD    . MET B 2  468 ? 121.741 136.965 151.507 1.00 19.07  ? 468  MET B SD    1 
ATOM   5798  C  CE    . MET B 2  468 ? 120.377 135.832 151.269 1.00 19.07  ? 468  MET B CE    1 
ATOM   5799  N  N     . LYS B 2  469 ? 125.959 134.083 152.736 1.00 13.70  ? 469  LYS B N     1 
ATOM   5800  C  CA    . LYS B 2  469 ? 126.146 132.646 152.884 1.00 13.70  ? 469  LYS B CA    1 
ATOM   5801  C  C     . LYS B 2  469 ? 126.153 132.212 154.340 1.00 13.70  ? 469  LYS B C     1 
ATOM   5802  O  O     . LYS B 2  469 ? 125.745 131.089 154.643 1.00 13.70  ? 469  LYS B O     1 
ATOM   5803  C  CB    . LYS B 2  469 ? 127.436 132.202 152.208 1.00 13.70  ? 469  LYS B CB    1 
ATOM   5804  C  CG    . LYS B 2  469 ? 127.359 132.214 150.709 1.00 13.70  ? 469  LYS B CG    1 
ATOM   5805  C  CD    . LYS B 2  469 ? 128.630 131.692 150.104 1.00 13.70  ? 469  LYS B CD    1 
ATOM   5806  C  CE    . LYS B 2  469 ? 128.543 131.727 148.600 1.00 13.70  ? 469  LYS B CE    1 
ATOM   5807  N  NZ    . LYS B 2  469 ? 129.813 131.290 147.979 1.00 13.70  ? 469  LYS B NZ    1 
ATOM   5808  N  N     . ALA B 2  470 ? 126.614 133.064 155.253 1.00 13.06  ? 470  ALA B N     1 
ATOM   5809  C  CA    . ALA B 2  470 ? 126.558 132.702 156.662 1.00 13.06  ? 470  ALA B CA    1 
ATOM   5810  C  C     . ALA B 2  470 ? 125.147 132.794 157.216 1.00 13.06  ? 470  ALA B C     1 
ATOM   5811  O  O     . ALA B 2  470 ? 124.851 132.157 158.229 1.00 13.06  ? 470  ALA B O     1 
ATOM   5812  C  CB    . ALA B 2  470 ? 127.492 133.586 157.480 1.00 13.06  ? 470  ALA B CB    1 
ATOM   5813  N  N     . GLN B 2  471 ? 124.281 133.584 156.583 1.00 15.07  ? 471  GLN B N     1 
ATOM   5814  C  CA    . GLN B 2  471 ? 122.875 133.613 156.965 1.00 15.07  ? 471  GLN B CA    1 
ATOM   5815  C  C     . GLN B 2  471 ? 122.167 132.332 156.555 1.00 15.07  ? 471  GLN B C     1 
ATOM   5816  O  O     . GLN B 2  471 ? 121.425 131.740 157.347 1.00 15.07  ? 471  GLN B O     1 
ATOM   5817  C  CB    . GLN B 2  471 ? 122.186 134.811 156.326 1.00 15.07  ? 471  GLN B CB    1 
ATOM   5818  C  CG    . GLN B 2  471 ? 120.715 134.880 156.634 1.00 15.07  ? 471  GLN B CG    1 
ATOM   5819  C  CD    . GLN B 2  471 ? 120.021 135.995 155.901 1.00 15.07  ? 471  GLN B CD    1 
ATOM   5820  O  OE1   . GLN B 2  471 ? 120.641 136.726 155.132 1.00 15.07  ? 471  GLN B OE1   1 
ATOM   5821  N  NE2   . GLN B 2  471 ? 118.721 136.125 156.120 1.00 15.07  ? 471  GLN B NE2   1 
ATOM   5822  N  N     . ASN B 2  472 ? 122.374 131.899 155.307 1.00 14.44  ? 472  ASN B N     1 
ATOM   5823  C  CA    . ASN B 2  472 ? 121.703 130.710 154.796 1.00 14.44  ? 472  ASN B CA    1 
ATOM   5824  C  C     . ASN B 2  472 ? 122.207 129.448 155.476 1.00 14.44  ? 472  ASN B C     1 
ATOM   5825  O  O     . ASN B 2  472 ? 121.436 128.515 155.721 1.00 14.44  ? 472  ASN B O     1 
ATOM   5826  C  CB    . ASN B 2  472 ? 121.894 130.603 153.286 1.00 14.44  ? 472  ASN B CB    1 
ATOM   5827  C  CG    . ASN B 2  472 ? 121.241 131.736 152.530 1.00 14.44  ? 472  ASN B CG    1 
ATOM   5828  O  OD1   . ASN B 2  472 ? 121.890 132.430 151.755 1.00 14.44  ? 472  ASN B OD1   1 
ATOM   5829  N  ND2   . ASN B 2  472 ? 119.961 131.953 152.777 1.00 14.44  ? 472  ASN B ND2   1 
ATOM   5830  N  N     . TYR B 2  473 ? 123.502 129.399 155.770 1.00 16.11  ? 473  TYR B N     1 
ATOM   5831  C  CA    . TYR B 2  473 ? 124.067 128.294 156.531 1.00 16.11  ? 473  TYR B CA    1 
ATOM   5832  C  C     . TYR B 2  473 ? 123.579 128.294 157.974 1.00 16.11  ? 473  TYR B C     1 
ATOM   5833  O  O     . TYR B 2  473 ? 123.104 127.268 158.459 1.00 16.11  ? 473  TYR B O     1 
ATOM   5834  C  CB    . TYR B 2  473 ? 125.585 128.381 156.477 1.00 16.11  ? 473  TYR B CB    1 
ATOM   5835  C  CG    . TYR B 2  473 ? 126.246 127.701 155.302 1.00 16.11  ? 473  TYR B CG    1 
ATOM   5836  C  CD1   . TYR B 2  473 ? 125.750 126.515 154.783 1.00 16.11  ? 473  TYR B CD1   1 
ATOM   5837  C  CD2   . TYR B 2  473 ? 127.353 128.270 154.684 1.00 16.11  ? 473  TYR B CD2   1 
ATOM   5838  C  CE1   . TYR B 2  473 ? 126.377 125.889 153.719 1.00 16.11  ? 473  TYR B CE1   1 
ATOM   5839  C  CE2   . TYR B 2  473 ? 127.981 127.651 153.635 1.00 16.11  ? 473  TYR B CE2   1 
ATOM   5840  C  CZ    . TYR B 2  473 ? 127.483 126.472 153.147 1.00 16.11  ? 473  TYR B CZ    1 
ATOM   5841  O  OH    . TYR B 2  473 ? 128.117 125.883 152.083 1.00 16.11  ? 473  TYR B OH    1 
ATOM   5842  N  N     . ASN B 2  474 ? 123.695 129.446 158.657 1.00 18.68  ? 474  ASN B N     1 
ATOM   5843  C  CA    . ASN B 2  474 ? 123.630 129.704 160.105 1.00 18.68  ? 474  ASN B CA    1 
ATOM   5844  C  C     . ASN B 2  474 ? 124.199 128.546 160.925 1.00 18.68  ? 474  ASN B C     1 
ATOM   5845  O  O     . ASN B 2  474 ? 123.494 127.871 161.681 1.00 18.68  ? 474  ASN B O     1 
ATOM   5846  C  CB    . ASN B 2  474 ? 122.247 130.236 160.599 1.00 18.68  ? 474  ASN B CB    1 
ATOM   5847  C  CG    . ASN B 2  474 ? 121.059 129.281 160.478 1.00 18.68  ? 474  ASN B CG    1 
ATOM   5848  O  OD1   . ASN B 2  474 ? 121.166 128.116 160.167 1.00 18.68  ? 474  ASN B OD1   1 
ATOM   5849  N  ND2   . ASN B 2  474 ? 119.885 129.820 160.773 1.00 18.68  ? 474  ASN B ND2   1 
ATOM   5850  N  N     . PHE B 2  475 ? 125.496 128.312 160.730 1.00 29.30  ? 475  PHE B N     1 
ATOM   5851  C  CA    . PHE B 2  475 ? 126.231 127.312 161.485 1.00 29.30  ? 475  PHE B CA    1 
ATOM   5852  C  C     . PHE B 2  475 ? 126.191 127.591 162.978 1.00 29.30  ? 475  PHE B C     1 
ATOM   5853  O  O     . PHE B 2  475 ? 126.110 128.738 163.422 1.00 29.30  ? 475  PHE B O     1 
ATOM   5854  C  CB    . PHE B 2  475 ? 127.703 127.287 161.096 1.00 29.30  ? 475  PHE B CB    1 
ATOM   5855  C  CG    . PHE B 2  475 ? 127.975 126.881 159.699 1.00 29.30  ? 475  PHE B CG    1 
ATOM   5856  C  CD1   . PHE B 2  475 ? 127.763 125.583 159.281 1.00 29.30  ? 475  PHE B CD1   1 
ATOM   5857  C  CD2   . PHE B 2  475 ? 128.555 127.774 158.831 1.00 29.30  ? 475  PHE B CD2   1 
ATOM   5858  C  CE1   . PHE B 2  475 ? 128.060 125.206 157.995 1.00 29.30  ? 475  PHE B CE1   1 
ATOM   5859  C  CE2   . PHE B 2  475 ? 128.870 127.402 157.570 1.00 29.30  ? 475  PHE B CE2   1 
ATOM   5860  C  CZ    . PHE B 2  475 ? 128.613 126.118 157.141 1.00 29.30  ? 475  PHE B CZ    1 
ATOM   5861  N  N     . VAL B 2  476 ? 126.268 126.518 163.750 1.00 29.30  ? 476  VAL B N     1 
ATOM   5862  C  CA    . VAL B 2  476 ? 126.787 126.562 165.105 1.00 29.30  ? 476  VAL B CA    1 
ATOM   5863  C  C     . VAL B 2  476 ? 128.096 125.780 165.105 1.00 29.30  ? 476  VAL B C     1 
ATOM   5864  O  O     . VAL B 2  476 ? 128.160 124.649 164.613 1.00 29.30  ? 476  VAL B O     1 
ATOM   5865  C  CB    . VAL B 2  476 ? 125.756 126.057 166.134 1.00 29.30  ? 476  VAL B CB    1 
ATOM   5866  C  CG1   . VAL B 2  476 ? 125.197 124.695 165.777 1.00 29.30  ? 476  VAL B CG1   1 
ATOM   5867  C  CG2   . VAL B 2  476 ? 126.361 126.027 167.512 1.00 29.30  ? 476  VAL B CG2   1 
ATOM   5868  N  N     . PHE B 2  477 ? 129.158 126.422 165.572 1.00 29.30  ? 477  PHE B N     1 
ATOM   5869  C  CA    . PHE B 2  477 ? 130.509 125.915 165.391 1.00 29.30  ? 477  PHE B CA    1 
ATOM   5870  C  C     . PHE B 2  477 ? 130.913 125.064 166.580 1.00 29.30  ? 477  PHE B C     1 
ATOM   5871  O  O     . PHE B 2  477 ? 130.628 125.410 167.727 1.00 29.30  ? 477  PHE B O     1 
ATOM   5872  C  CB    . PHE B 2  477 ? 131.489 127.074 165.233 1.00 29.30  ? 477  PHE B CB    1 
ATOM   5873  C  CG    . PHE B 2  477 ? 131.235 127.920 164.026 1.00 29.30  ? 477  PHE B CG    1 
ATOM   5874  C  CD1   . PHE B 2  477 ? 131.749 127.570 162.798 1.00 29.30  ? 477  PHE B CD1   1 
ATOM   5875  C  CD2   . PHE B 2  477 ? 130.455 129.055 164.119 1.00 29.30  ? 477  PHE B CD2   1 
ATOM   5876  C  CE1   . PHE B 2  477 ? 131.507 128.353 161.696 1.00 29.30  ? 477  PHE B CE1   1 
ATOM   5877  C  CE2   . PHE B 2  477 ? 130.210 129.832 163.020 1.00 29.30  ? 477  PHE B CE2   1 
ATOM   5878  C  CZ    . PHE B 2  477 ? 130.731 129.479 161.808 1.00 29.30  ? 477  PHE B CZ    1 
ATOM   5879  N  N     . HIS B 2  478 ? 131.584 123.950 166.308 1.00 27.34  ? 478  HIS B N     1 
ATOM   5880  C  CA    . HIS B 2  478 ? 132.071 123.083 167.371 1.00 27.34  ? 478  HIS B CA    1 
ATOM   5881  C  C     . HIS B 2  478 ? 133.511 122.680 167.124 1.00 27.34  ? 478  HIS B C     1 
ATOM   5882  O  O     . HIS B 2  478 ? 133.844 122.162 166.056 1.00 27.34  ? 478  HIS B O     1 
ATOM   5883  C  CB    . HIS B 2  478 ? 131.215 121.834 167.526 1.00 27.34  ? 478  HIS B CB    1 
ATOM   5884  C  CG    . HIS B 2  478 ? 129.878 122.100 168.131 1.00 27.34  ? 478  HIS B CG    1 
ATOM   5885  N  ND1   . HIS B 2  478 ? 128.739 122.265 167.377 1.00 27.34  ? 478  HIS B ND1   1 
ATOM   5886  C  CD2   . HIS B 2  478 ? 129.507 122.269 169.421 1.00 27.34  ? 478  HIS B CD2   1 
ATOM   5887  C  CE1   . HIS B 2  478 ? 127.718 122.500 168.179 1.00 27.34  ? 478  HIS B CE1   1 
ATOM   5888  N  NE2   . HIS B 2  478 ? 128.157 122.508 169.424 1.00 27.34  ? 478  HIS B NE2   1 
ATOM   5889  N  N     . ASP B 2  479 ? 134.348 122.901 168.129 1.00 18.20  ? 479  ASP B N     1 
ATOM   5890  C  CA    . ASP B 2  479 ? 135.753 122.530 168.082 1.00 18.20  ? 479  ASP B CA    1 
ATOM   5891  C  C     . ASP B 2  479 ? 135.889 121.076 168.502 1.00 18.20  ? 479  ASP B C     1 
ATOM   5892  O  O     . ASP B 2  479 ? 135.648 120.736 169.664 1.00 18.20  ? 479  ASP B O     1 
ATOM   5893  C  CB    . ASP B 2  479 ? 136.556 123.446 169.000 1.00 18.20  ? 479  ASP B CB    1 
ATOM   5894  C  CG    . ASP B 2  479 ? 138.040 123.172 168.954 1.00 18.20  ? 479  ASP B CG    1 
ATOM   5895  O  OD1   . ASP B 2  479 ? 138.686 123.546 167.956 1.00 18.20  ? 479  ASP B OD1   1 
ATOM   5896  O  OD2   . ASP B 2  479 ? 138.567 122.594 169.925 1.00 18.20  ? 479  ASP B OD2   1 
ATOM   5897  N  N     . ILE B 2  480 ? 136.270 120.211 167.575 1.00 18.55  ? 480  ILE B N     1 
ATOM   5898  C  CA    . ILE B 2  480 ? 136.618 118.833 167.908 1.00 18.55  ? 480  ILE B CA    1 
ATOM   5899  C  C     . ILE B 2  480 ? 138.058 118.598 167.457 1.00 18.55  ? 480  ILE B C     1 
ATOM   5900  O  O     . ILE B 2  480 ? 138.358 118.067 166.384 1.00 18.55  ? 480  ILE B O     1 
ATOM   5901  C  CB    . ILE B 2  480 ? 135.637 117.817 167.317 1.00 18.55  ? 480  ILE B CB    1 
ATOM   5902  C  CG1   . ILE B 2  480 ? 135.291 118.130 165.861 1.00 18.55  ? 480  ILE B CG1   1 
ATOM   5903  C  CG2   . ILE B 2  480 ? 134.365 117.800 168.134 1.00 18.55  ? 480  ILE B CG2   1 
ATOM   5904  C  CD1   . ILE B 2  480 ? 134.800 116.954 165.125 1.00 18.55  ? 480  ILE B CD1   1 
ATOM   5905  N  N     . SER B 2  481 ? 138.991 118.938 168.328 1.00 18.42  ? 481  SER B N     1 
ATOM   5906  C  CA    . SER B 2  481 ? 140.385 118.623 168.095 1.00 18.42  ? 481  SER B CA    1 
ATOM   5907  C  C     . SER B 2  481 ? 140.633 117.230 168.646 1.00 18.42  ? 481  SER B C     1 
ATOM   5908  O  O     . SER B 2  481 ? 140.267 116.941 169.787 1.00 18.42  ? 481  SER B O     1 
ATOM   5909  C  CB    . SER B 2  481 ? 141.292 119.651 168.765 1.00 18.42  ? 481  SER B CB    1 
ATOM   5910  O  OG    . SER B 2  481 ? 141.081 120.940 168.219 1.00 18.42  ? 481  SER B OG    1 
ATOM   5911  N  N     . ASN B 2  482 ? 141.176 116.351 167.820 1.00 19.16  ? 482  ASN B N     1 
ATOM   5912  C  CA    . ASN B 2  482 ? 141.427 114.993 168.269 1.00 19.16  ? 482  ASN B CA    1 
ATOM   5913  C  C     . ASN B 2  482 ? 142.741 114.398 167.788 1.00 19.16  ? 482  ASN B C     1 
ATOM   5914  O  O     . ASN B 2  482 ? 143.048 113.269 168.179 1.00 19.16  ? 482  ASN B O     1 
ATOM   5915  C  CB    . ASN B 2  482 ? 140.251 114.087 167.871 1.00 19.16  ? 482  ASN B CB    1 
ATOM   5916  C  CG    . ASN B 2  482 ? 139.881 114.212 166.410 1.00 19.16  ? 482  ASN B CG    1 
ATOM   5917  O  OD1   . ASN B 2  482 ? 140.566 114.872 165.635 1.00 19.16  ? 482  ASN B OD1   1 
ATOM   5918  N  ND2   . ASN B 2  482 ? 138.777 113.586 166.029 1.00 19.16  ? 482  ASN B ND2   1 
ATOM   5919  N  N     . PHE B 2  483 ? 143.517 115.116 166.967 1.00 18.73  ? 483  PHE B N     1 
ATOM   5920  C  CA    . PHE B 2  483 ? 144.862 114.729 166.513 1.00 18.73  ? 483  PHE B CA    1 
ATOM   5921  C  C     . PHE B 2  483 ? 144.870 113.394 165.772 1.00 18.73  ? 483  PHE B C     1 
ATOM   5922  O  O     . PHE B 2  483 ? 145.832 112.629 165.854 1.00 18.73  ? 483  PHE B O     1 
ATOM   5923  C  CB    . PHE B 2  483 ? 145.856 114.719 167.676 1.00 18.73  ? 483  PHE B CB    1 
ATOM   5924  C  CG    . PHE B 2  483 ? 146.083 116.073 168.272 1.00 18.73  ? 483  PHE B CG    1 
ATOM   5925  C  CD1   . PHE B 2  483 ? 146.991 116.946 167.706 1.00 18.73  ? 483  PHE B CD1   1 
ATOM   5926  C  CD2   . PHE B 2  483 ? 145.355 116.487 169.373 1.00 18.73  ? 483  PHE B CD2   1 
ATOM   5927  C  CE1   . PHE B 2  483 ? 147.189 118.196 168.242 1.00 18.73  ? 483  PHE B CE1   1 
ATOM   5928  C  CE2   . PHE B 2  483 ? 145.549 117.736 169.911 1.00 18.73  ? 483  PHE B CE2   1 
ATOM   5929  C  CZ    . PHE B 2  483 ? 146.463 118.590 169.343 1.00 18.73  ? 483  PHE B CZ    1 
ATOM   5930  N  N     . GLU B 2  484 ? 143.789 113.116 165.049 1.00 27.06  ? 484  GLU B N     1 
ATOM   5931  C  CA    . GLU B 2  484 ? 143.659 111.911 164.252 1.00 27.06  ? 484  GLU B CA    1 
ATOM   5932  C  C     . GLU B 2  484 ? 144.550 112.005 163.007 1.00 27.06  ? 484  GLU B C     1 
ATOM   5933  O  O     . GLU B 2  484 ? 144.913 113.105 162.585 1.00 27.06  ? 484  GLU B O     1 
ATOM   5934  C  CB    . GLU B 2  484 ? 142.187 111.717 163.892 1.00 27.06  ? 484  GLU B CB    1 
ATOM   5935  C  CG    . GLU B 2  484 ? 141.307 111.344 165.057 1.00 27.06  ? 484  GLU B CG    1 
ATOM   5936  C  CD    . GLU B 2  484 ? 141.569 109.948 165.569 1.00 27.06  ? 484  GLU B CD    1 
ATOM   5937  O  OE1   . GLU B 2  484 ? 141.928 109.071 164.758 1.00 27.06  ? 484  GLU B OE1   1 
ATOM   5938  O  OE2   . GLU B 2  484 ? 141.406 109.724 166.785 1.00 27.06  ? 484  GLU B OE2   1 
ATOM   5939  N  N     . PRO B 2  485 ? 144.936 110.864 162.412 1.00 28.07  ? 485  PRO B N     1 
ATOM   5940  C  CA    . PRO B 2  485 ? 145.969 110.908 161.361 1.00 28.07  ? 485  PRO B CA    1 
ATOM   5941  C  C     . PRO B 2  485 ? 145.554 111.511 160.031 1.00 28.07  ? 485  PRO B C     1 
ATOM   5942  O  O     . PRO B 2  485 ? 146.423 112.084 159.360 1.00 28.07  ? 485  PRO B O     1 
ATOM   5943  C  CB    . PRO B 2  485 ? 146.329 109.434 161.179 1.00 28.07  ? 485  PRO B CB    1 
ATOM   5944  C  CG    . PRO B 2  485 ? 145.175 108.688 161.665 1.00 28.07  ? 485  PRO B CG    1 
ATOM   5945  C  CD    . PRO B 2  485 ? 144.665 109.470 162.809 1.00 28.07  ? 485  PRO B CD    1 
ATOM   5946  N  N     . SER B 2  486 ? 144.286 111.375 159.625 1.00 26.64  ? 486  SER B N     1 
ATOM   5947  C  CA    . SER B 2  486 ? 143.805 111.640 158.260 1.00 26.64  ? 486  SER B CA    1 
ATOM   5948  C  C     . SER B 2  486 ? 144.570 110.803 157.237 1.00 26.64  ? 486  SER B C     1 
ATOM   5949  O  O     . SER B 2  486 ? 145.294 111.315 156.386 1.00 26.64  ? 486  SER B O     1 
ATOM   5950  C  CB    . SER B 2  486 ? 143.845 113.133 157.897 1.00 26.64  ? 486  SER B CB    1 
ATOM   5951  O  OG    . SER B 2  486 ? 145.176 113.592 157.754 1.00 26.64  ? 486  SER B OG    1 
ATOM   5952  N  N     . THR B 2  487 ? 144.393 109.489 157.344 1.00 31.54  ? 487  THR B N     1 
ATOM   5953  C  CA    . THR B 2  487 ? 145.000 108.557 156.407 1.00 31.54  ? 487  THR B CA    1 
ATOM   5954  C  C     . THR B 2  487 ? 144.149 108.325 155.167 1.00 31.54  ? 487  THR B C     1 
ATOM   5955  O  O     . THR B 2  487 ? 144.664 107.814 154.167 1.00 31.54  ? 487  THR B O     1 
ATOM   5956  C  CB    . THR B 2  487 ? 145.283 107.220 157.102 1.00 31.54  ? 487  THR B CB    1 
ATOM   5957  O  OG1   . THR B 2  487 ? 145.973 106.344 156.203 1.00 31.54  ? 487  THR B OG1   1 
ATOM   5958  C  CG2   . THR B 2  487 ? 143.994 106.562 157.573 1.00 31.54  ? 487  THR B CG2   1 
ATOM   5959  N  N     . VAL B 2  488 ? 142.870 108.689 155.207 1.00 30.55  ? 488  VAL B N     1 
ATOM   5960  C  CA    . VAL B 2  488 ? 142.014 108.597 154.031 1.00 30.55  ? 488  VAL B CA    1 
ATOM   5961  C  C     . VAL B 2  488 ? 142.053 109.896 153.227 1.00 30.55  ? 488  VAL B C     1 
ATOM   5962  O  O     . VAL B 2  488 ? 141.999 109.868 151.994 1.00 30.55  ? 488  VAL B O     1 
ATOM   5963  C  CB    . VAL B 2  488 ? 140.586 108.230 154.475 1.00 30.55  ? 488  VAL B CB    1 
ATOM   5964  C  CG1   . VAL B 2  488 ? 139.623 108.165 153.307 1.00 30.55  ? 488  VAL B CG1   1 
ATOM   5965  C  CG2   . VAL B 2  488 ? 140.599 106.901 155.202 1.00 30.55  ? 488  VAL B CG2   1 
ATOM   5966  N  N     . GLU B 2  489 ? 142.193 111.038 153.898 1.00 30.46  ? 489  GLU B N     1 
ATOM   5967  C  CA    . GLU B 2  489 ? 142.409 112.292 153.188 1.00 30.46  ? 489  GLU B CA    1 
ATOM   5968  C  C     . GLU B 2  489 ? 143.797 112.355 152.562 1.00 30.46  ? 489  GLU B C     1 
ATOM   5969  O  O     . GLU B 2  489 ? 143.999 113.082 151.584 1.00 30.46  ? 489  GLU B O     1 
ATOM   5970  C  CB    . GLU B 2  489 ? 142.207 113.474 154.134 1.00 30.46  ? 489  GLU B CB    1 
ATOM   5971  C  CG    . GLU B 2  489 ? 140.772 113.725 154.560 1.00 30.46  ? 489  GLU B CG    1 
ATOM   5972  C  CD    . GLU B 2  489 ? 140.328 112.881 155.737 1.00 30.46  ? 489  GLU B CD    1 
ATOM   5973  O  OE1   . GLU B 2  489 ? 141.131 112.075 156.243 1.00 30.46  ? 489  GLU B OE1   1 
ATOM   5974  O  OE2   . GLU B 2  489 ? 139.171 113.040 156.172 1.00 30.46  ? 489  GLU B OE2   1 
ATOM   5975  N  N     . SER B 2  490 ? 144.758 111.610 153.104 1.00 38.37  ? 490  SER B N     1 
ATOM   5976  C  CA    . SER B 2  490 ? 146.111 111.548 152.547 1.00 38.37  ? 490  SER B CA    1 
ATOM   5977  C  C     . SER B 2  490 ? 146.247 110.395 151.559 1.00 38.37  ? 490  SER B C     1 
ATOM   5978  O  O     . SER B 2  490 ? 147.191 109.609 151.602 1.00 38.37  ? 490  SER B O     1 
ATOM   5979  C  CB    . SER B 2  490 ? 147.127 111.411 153.673 1.00 38.37  ? 490  SER B CB    1 
ATOM   5980  O  OG    . SER B 2  490 ? 147.034 112.489 154.582 1.00 38.37  ? 490  SER B OG    1 
ATOM   5981  N  N     . THR B 2  491 ? 145.298 110.299 150.667 1.00 38.28  ? 491  THR B N     1 
ATOM   5982  C  CA    . THR B 2  491 ? 145.220 109.282 149.631 1.00 38.28  ? 491  THR B CA    1 
ATOM   5983  C  C     . THR B 2  491 ? 145.019 109.897 148.258 1.00 38.28  ? 491  THR B C     1 
ATOM   5984  O  O     . THR B 2  491 ? 145.623 109.443 147.283 1.00 38.28  ? 491  THR B O     1 
ATOM   5985  C  CB    . THR B 2  491 ? 144.077 108.315 149.979 1.00 38.28  ? 491  THR B CB    1 
ATOM   5986  O  OG1   . THR B 2  491 ? 144.356 107.681 151.233 1.00 38.28  ? 491  THR B OG1   1 
ATOM   5987  C  CG2   . THR B 2  491 ? 143.912 107.262 148.936 1.00 38.28  ? 491  THR B CG2   1 
ATOM   5988  N  N     . PHE B 2  492 ? 144.239 110.969 148.175 1.00 35.80  ? 492  PHE B N     1 
ATOM   5989  C  CA    . PHE B 2  492 ? 144.060 111.750 146.962 1.00 35.80  ? 492  PHE B CA    1 
ATOM   5990  C  C     . PHE B 2  492 ? 145.186 112.739 146.728 1.00 35.80  ? 492  PHE B C     1 
ATOM   5991  O  O     . PHE B 2  492 ? 145.075 113.586 145.837 1.00 35.80  ? 492  PHE B O     1 
ATOM   5992  C  CB    . PHE B 2  492 ? 142.737 112.504 147.028 1.00 35.80  ? 492  PHE B CB    1 
ATOM   5993  C  CG    . PHE B 2  492 ? 141.546 111.613 147.042 1.00 35.80  ? 492  PHE B CG    1 
ATOM   5994  C  CD1   . PHE B 2  492 ? 141.047 111.091 145.866 1.00 35.80  ? 492  PHE B CD1   1 
ATOM   5995  C  CD2   . PHE B 2  492 ? 140.934 111.283 148.234 1.00 35.80  ? 492  PHE B CD2   1 
ATOM   5996  C  CE1   . PHE B 2  492 ? 139.952 110.264 145.879 1.00 35.80  ? 492  PHE B CE1   1 
ATOM   5997  C  CE2   . PHE B 2  492 ? 139.842 110.454 148.251 1.00 35.80  ? 492  PHE B CE2   1 
ATOM   5998  C  CZ    . PHE B 2  492 ? 139.349 109.947 147.073 1.00 35.80  ? 492  PHE B CZ    1 
ATOM   5999  N  N     . GLN B 2  493 ? 146.261 112.649 147.501 1.00 44.62  ? 493  GLN B N     1 
ATOM   6000  C  CA    . GLN B 2  493 ? 147.284 113.682 147.521 1.00 44.62  ? 493  GLN B CA    1 
ATOM   6001  C  C     . GLN B 2  493 ? 148.560 113.025 148.014 1.00 44.62  ? 493  GLN B C     1 
ATOM   6002  O  O     . GLN B 2  493 ? 148.556 112.405 149.081 1.00 44.62  ? 493  GLN B O     1 
ATOM   6003  C  CB    . GLN B 2  493 ? 146.845 114.819 148.433 1.00 44.62  ? 493  GLN B CB    1 
ATOM   6004  C  CG    . GLN B 2  493 ? 147.629 116.096 148.329 1.00 44.62  ? 493  GLN B CG    1 
ATOM   6005  C  CD    . GLN B 2  493 ? 147.047 117.169 149.224 1.00 44.62  ? 493  GLN B CD    1 
ATOM   6006  O  OE1   . GLN B 2  493 ? 146.075 116.929 149.940 1.00 44.62  ? 493  GLN B OE1   1 
ATOM   6007  N  NE2   . GLN B 2  493 ? 147.642 118.353 149.199 1.00 44.62  ? 493  GLN B NE2   1 
ATOM   6008  N  N     . ASP B 2  494 ? 149.634 113.136 147.237 1.00 58.76  ? 494  ASP B N     1 
ATOM   6009  C  CA    . ASP B 2  494 ? 150.841 112.367 147.509 1.00 58.76  ? 494  ASP B CA    1 
ATOM   6010  C  C     . ASP B 2  494 ? 151.579 112.916 148.724 1.00 58.76  ? 494  ASP B C     1 
ATOM   6011  O  O     . ASP B 2  494 ? 151.852 114.117 148.813 1.00 58.76  ? 494  ASP B O     1 
ATOM   6012  C  CB    . ASP B 2  494 ? 151.760 112.374 146.293 1.00 58.76  ? 494  ASP B CB    1 
ATOM   6013  C  CG    . ASP B 2  494 ? 152.915 111.413 146.441 1.00 58.76  ? 494  ASP B CG    1 
ATOM   6014  O  OD1   . ASP B 2  494 ? 152.695 110.194 146.296 1.00 58.76  ? 494  ASP B OD1   1 
ATOM   6015  O  OD2   . ASP B 2  494 ? 154.039 111.871 146.718 1.00 58.76  ? 494  ASP B OD2   1 
ATOM   6016  N  N     . VAL B 2  495 ? 151.907 112.024 149.656 1.00 57.35  ? 495  VAL B N     1 
ATOM   6017  C  CA    . VAL B 2  495 ? 152.541 112.415 150.908 1.00 57.35  ? 495  VAL B CA    1 
ATOM   6018  C  C     . VAL B 2  495 ? 154.060 112.260 150.830 1.00 57.35  ? 495  VAL B C     1 
ATOM   6019  O  O     . VAL B 2  495 ? 154.783 112.935 151.581 1.00 57.35  ? 495  VAL B O     1 
ATOM   6020  C  CB    . VAL B 2  495 ? 151.946 111.589 152.071 1.00 57.35  ? 495  VAL B CB    1 
ATOM   6021  C  CG1   . VAL B 2  495 ? 152.304 112.169 153.440 1.00 57.35  ? 495  VAL B CG1   1 
ATOM   6022  C  CG2   . VAL B 2  495 ? 150.443 111.467 151.910 1.00 57.35  ? 495  VAL B CG2   1 
ATOM   6023  N  N     . MET B 2  496 ? 154.563 111.418 149.920 1.00 66.43  ? 496  MET B N     1 
ATOM   6024  C  CA    . MET B 2  496 ? 156.001 111.303 149.687 1.00 66.43  ? 496  MET B CA    1 
ATOM   6025  C  C     . MET B 2  496 ? 156.597 112.608 149.171 1.00 66.43  ? 496  MET B C     1 
ATOM   6026  O  O     . MET B 2  496 ? 157.739 112.947 149.502 1.00 66.43  ? 496  MET B O     1 
ATOM   6027  C  CB    . MET B 2  496 ? 156.264 110.161 148.703 1.00 66.43  ? 496  MET B CB    1 
ATOM   6028  C  CG    . MET B 2  496 ? 157.727 109.865 148.422 1.00 66.43  ? 496  MET B CG    1 
ATOM   6029  S  SD    . MET B 2  496 ? 158.628 109.364 149.897 1.00 66.43  ? 496  MET B SD    1 
ATOM   6030  C  CE    . MET B 2  496 ? 157.906 107.757 150.187 1.00 66.43  ? 496  MET B CE    1 
ATOM   6031  N  N     . LYS B 2  497 ? 155.832 113.365 148.390 1.00 66.81  ? 497  LYS B N     1 
ATOM   6032  C  CA    . LYS B 2  497 ? 156.249 114.672 147.907 1.00 66.81  ? 497  LYS B CA    1 
ATOM   6033  C  C     . LYS B 2  497 ? 155.928 115.795 148.886 1.00 66.81  ? 497  LYS B C     1 
ATOM   6034  O  O     . LYS B 2  497 ? 156.073 116.964 148.522 1.00 66.81  ? 497  LYS B O     1 
ATOM   6035  C  CB    . LYS B 2  497 ? 155.592 114.962 146.556 1.00 66.81  ? 497  LYS B CB    1 
ATOM   6036  C  CG    . LYS B 2  497 ? 156.103 114.093 145.422 1.00 66.81  ? 497  LYS B CG    1 
ATOM   6037  C  CD    . LYS B 2  497 ? 155.257 114.258 144.172 1.00 66.81  ? 497  LYS B CD    1 
ATOM   6038  C  CE    . LYS B 2  497 ? 155.464 115.616 143.530 1.00 66.81  ? 497  LYS B CE    1 
ATOM   6039  N  NZ    . LYS B 2  497 ? 154.722 115.729 142.245 1.00 66.81  ? 497  LYS B NZ    1 
ATOM   6040  N  N     . MET B 2  498 ? 155.456 115.464 150.095 1.00 60.00  ? 498  MET B N     1 
ATOM   6041  C  CA    . MET B 2  498 ? 155.173 116.395 151.195 1.00 60.00  ? 498  MET B CA    1 
ATOM   6042  C  C     . MET B 2  498 ? 154.113 117.442 150.851 1.00 60.00  ? 498  MET B C     1 
ATOM   6043  O  O     . MET B 2  498 ? 154.036 118.481 151.512 1.00 60.00  ? 498  MET B O     1 
ATOM   6044  C  CB    . MET B 2  498 ? 156.444 117.101 151.686 1.00 60.00  ? 498  MET B CB    1 
ATOM   6045  C  CG    . MET B 2  498 ? 157.500 116.194 152.277 1.00 60.00  ? 498  MET B CG    1 
ATOM   6046  S  SD    . MET B 2  498 ? 158.956 117.135 152.766 1.00 60.00  ? 498  MET B SD    1 
ATOM   6047  C  CE    . MET B 2  498 ? 160.077 115.824 153.235 1.00 60.00  ? 498  MET B CE    1 
ATOM   6048  N  N     . GLY B 2  499 ? 153.293 117.214 149.824 1.00 59.00  ? 499  GLY B N     1 
ATOM   6049  C  CA    . GLY B 2  499 ? 152.160 118.074 149.540 1.00 59.00  ? 499  GLY B CA    1 
ATOM   6050  C  C     . GLY B 2  499 ? 152.277 118.974 148.330 1.00 59.00  ? 499  GLY B C     1 
ATOM   6051  O  O     . GLY B 2  499 ? 151.362 119.771 148.090 1.00 59.00  ? 499  GLY B O     1 
ATOM   6052  N  N     . LYS B 2  500 ? 153.357 118.882 147.554 1.00 66.39  ? 500  LYS B N     1 
ATOM   6053  C  CA    . LYS B 2  500 ? 153.484 119.636 146.314 1.00 66.39  ? 500  LYS B CA    1 
ATOM   6054  C  C     . LYS B 2  500 ? 152.990 118.849 145.102 1.00 66.39  ? 500  LYS B C     1 
ATOM   6055  O  O     . LYS B 2  500 ? 153.419 119.105 143.968 1.00 66.39  ? 500  LYS B O     1 
ATOM   6056  C  CB    . LYS B 2  500 ? 154.933 120.088 146.141 1.00 66.39  ? 500  LYS B CB    1 
ATOM   6057  C  CG    . LYS B 2  500 ? 155.921 118.960 146.003 1.00 66.39  ? 500  LYS B CG    1 
ATOM   6058  C  CD    . LYS B 2  500 ? 157.308 119.496 146.136 1.00 66.39  ? 500  LYS B CD    1 
ATOM   6059  C  CE    . LYS B 2  500 ? 157.569 119.856 147.589 1.00 66.39  ? 500  LYS B CE    1 
ATOM   6060  N  NZ    . LYS B 2  500 ? 157.717 118.671 148.471 1.00 66.39  ? 500  LYS B NZ    1 
ATOM   6061  N  N     . SER B 2  501 ? 152.065 117.914 145.318 1.00 69.08  ? 501  SER B N     1 
ATOM   6062  C  CA    . SER B 2  501 ? 151.455 117.113 144.268 1.00 69.08  ? 501  SER B CA    1 
ATOM   6063  C  C     . SER B 2  501 ? 150.247 117.800 143.628 1.00 69.08  ? 501  SER B C     1 
ATOM   6064  O  O     . SER B 2  501 ? 149.372 117.110 143.090 1.00 69.08  ? 501  SER B O     1 
ATOM   6065  C  CB    . SER B 2  501 ? 151.057 115.745 144.831 1.00 69.08  ? 501  SER B CB    1 
ATOM   6066  O  OG    . SER B 2  501 ? 150.440 114.933 143.850 1.00 69.08  ? 501  SER B OG    1 
ATOM   6067  N  N     . ASP B 2  502 ? 150.154 119.131 143.762 1.00 69.06  ? 502  ASP B N     1 
ATOM   6068  C  CA    . ASP B 2  502 ? 149.287 120.077 143.051 1.00 69.06  ? 502  ASP B CA    1 
ATOM   6069  C  C     . ASP B 2  502 ? 147.822 120.018 143.499 1.00 69.06  ? 502  ASP B C     1 
ATOM   6070  O  O     . ASP B 2  502 ? 147.025 120.883 143.114 1.00 69.06  ? 502  ASP B O     1 
ATOM   6071  C  CB    . ASP B 2  502 ? 149.417 119.868 141.528 1.00 69.06  ? 502  ASP B CB    1 
ATOM   6072  C  CG    . ASP B 2  502 ? 148.861 121.028 140.713 1.00 69.06  ? 502  ASP B CG    1 
ATOM   6073  O  OD1   . ASP B 2  502 ? 149.508 122.095 140.679 1.00 69.06  ? 502  ASP B OD1   1 
ATOM   6074  O  OD2   . ASP B 2  502 ? 147.784 120.870 140.101 1.00 69.06  ? 502  ASP B OD2   1 
ATOM   6075  N  N     . THR B 2  503 ? 147.444 118.995 144.281 1.00 65.93  ? 503  THR B N     1 
ATOM   6076  C  CA    . THR B 2  503 ? 146.282 118.943 145.180 1.00 65.93  ? 503  THR B CA    1 
ATOM   6077  C  C     . THR B 2  503 ? 144.927 118.903 144.450 1.00 65.93  ? 503  THR B C     1 
ATOM   6078  O  O     . THR B 2  503 ? 143.914 118.482 145.021 1.00 65.93  ? 503  THR B O     1 
ATOM   6079  C  CB    . THR B 2  503 ? 146.376 120.132 146.166 1.00 65.93  ? 503  THR B CB    1 
ATOM   6080  O  OG1   . THR B 2  503 ? 147.686 120.148 146.746 1.00 65.93  ? 503  THR B OG1   1 
ATOM   6081  C  CG2   . THR B 2  503 ? 145.372 120.051 147.322 1.00 65.93  ? 503  THR B CG2   1 
ATOM   6082  N  N     . SER B 2  504 ? 144.909 119.190 143.149 1.00 58.52  ? 504  SER B N     1 
ATOM   6083  C  CA    . SER B 2  504 ? 143.673 119.254 142.380 1.00 58.52  ? 504  SER B CA    1 
ATOM   6084  C  C     . SER B 2  504 ? 143.726 118.365 141.149 1.00 58.52  ? 504  SER B C     1 
ATOM   6085  O  O     . SER B 2  504 ? 142.837 118.452 140.293 1.00 58.52  ? 504  SER B O     1 
ATOM   6086  C  CB    . SER B 2  504 ? 143.368 120.697 141.971 1.00 58.52  ? 504  SER B CB    1 
ATOM   6087  O  OG    . SER B 2  504 ? 143.113 121.501 143.108 1.00 58.52  ? 504  SER B OG    1 
ATOM   6088  N  N     . SER B 2  505 ? 144.753 117.523 141.040 1.00 58.09  ? 505  SER B N     1 
ATOM   6089  C  CA    . SER B 2  505 ? 144.864 116.617 139.906 1.00 58.09  ? 505  SER B CA    1 
ATOM   6090  C  C     . SER B 2  505 ? 143.797 115.534 139.964 1.00 58.09  ? 505  SER B C     1 
ATOM   6091  O  O     . SER B 2  505 ? 143.069 115.310 138.991 1.00 58.09  ? 505  SER B O     1 
ATOM   6092  C  CB    . SER B 2  505 ? 146.256 115.988 139.879 1.00 58.09  ? 505  SER B CB    1 
ATOM   6093  O  OG    . SER B 2  505 ? 147.258 116.966 139.665 1.00 58.09  ? 505  SER B OG    1 
ATOM   6094  N  N     . GLY B 2  506 ? 143.688 114.852 141.103 1.00 51.04  ? 506  GLY B N     1 
ATOM   6095  C  CA    . GLY B 2  506 ? 142.862 113.673 141.211 1.00 51.04  ? 506  GLY B CA    1 
ATOM   6096  C  C     . GLY B 2  506 ? 143.488 112.413 140.661 1.00 51.04  ? 506  GLY B C     1 
ATOM   6097  O  O     . GLY B 2  506 ? 142.933 111.326 140.864 1.00 51.04  ? 506  GLY B O     1 
ATOM   6098  N  N     . ALA B 2  507 ? 144.628 112.520 139.975 1.00 47.86  ? 507  ALA B N     1 
ATOM   6099  C  CA    . ALA B 2  507 ? 145.309 111.369 139.405 1.00 47.86  ? 507  ALA B CA    1 
ATOM   6100  C  C     . ALA B 2  507 ? 146.112 110.599 140.438 1.00 47.86  ? 507  ALA B C     1 
ATOM   6101  O  O     . ALA B 2  507 ? 146.356 109.404 140.246 1.00 47.86  ? 507  ALA B O     1 
ATOM   6102  C  CB    . ALA B 2  507 ? 146.232 111.813 138.272 1.00 47.86  ? 507  ALA B CB    1 
ATOM   6103  N  N     . GLU B 2  508 ? 146.537 111.260 141.515 1.00 52.60  ? 508  GLU B N     1 
ATOM   6104  C  CA    . GLU B 2  508 ? 147.207 110.551 142.597 1.00 52.60  ? 508  GLU B CA    1 
ATOM   6105  C  C     . GLU B 2  508 ? 146.221 109.678 143.359 1.00 52.60  ? 508  GLU B C     1 
ATOM   6106  O  O     . GLU B 2  508 ? 146.561 108.567 143.784 1.00 52.60  ? 508  GLU B O     1 
ATOM   6107  C  CB    . GLU B 2  508 ? 147.889 111.552 143.529 1.00 52.60  ? 508  GLU B CB    1 
ATOM   6108  C  CG    . GLU B 2  508 ? 148.698 110.922 144.646 1.00 52.60  ? 508  GLU B CG    1 
ATOM   6109  C  CD    . GLU B 2  508 ? 149.922 110.173 144.146 1.00 52.60  ? 508  GLU B CD    1 
ATOM   6110  O  OE1   . GLU B 2  508 ? 150.462 110.530 143.076 1.00 52.60  ? 508  GLU B OE1   1 
ATOM   6111  O  OE2   . GLU B 2  508 ? 150.349 109.223 144.832 1.00 52.60  ? 508  GLU B OE2   1 
ATOM   6112  N  N     . GLY B 2  509 ? 144.989 110.158 143.527 1.00 48.09  ? 509  GLY B N     1 
ATOM   6113  C  CA    . GLY B 2  509 ? 143.936 109.325 144.074 1.00 48.09  ? 509  GLY B CA    1 
ATOM   6114  C  C     . GLY B 2  509 ? 143.485 108.233 143.134 1.00 48.09  ? 509  GLY B C     1 
ATOM   6115  O  O     . GLY B 2  509 ? 142.939 107.226 143.591 1.00 48.09  ? 509  GLY B O     1 
ATOM   6116  N  N     . ALA B 2  510 ? 143.700 108.409 141.829 1.00 50.06  ? 510  ALA B N     1 
ATOM   6117  C  CA    . ALA B 2  510 ? 143.432 107.332 140.885 1.00 50.06  ? 510  ALA B CA    1 
ATOM   6118  C  C     . ALA B 2  510 ? 144.472 106.231 140.986 1.00 50.06  ? 510  ALA B C     1 
ATOM   6119  O  O     . ALA B 2  510 ? 144.161 105.068 140.711 1.00 50.06  ? 510  ALA B O     1 
ATOM   6120  C  CB    . ALA B 2  510 ? 143.392 107.872 139.460 1.00 50.06  ? 510  ALA B CB    1 
ATOM   6121  N  N     . LYS B 2  511 ? 145.704 106.580 141.374 1.00 53.10  ? 511  LYS B N     1 
ATOM   6122  C  CA    . LYS B 2  511 ? 146.755 105.584 141.567 1.00 53.10  ? 511  LYS B CA    1 
ATOM   6123  C  C     . LYS B 2  511 ? 146.399 104.621 142.691 1.00 53.10  ? 511  LYS B C     1 
ATOM   6124  O  O     . LYS B 2  511 ? 146.753 103.439 142.631 1.00 53.10  ? 511  LYS B O     1 
ATOM   6125  C  CB    . LYS B 2  511 ? 148.086 106.291 141.857 1.00 53.10  ? 511  LYS B CB    1 
ATOM   6126  C  CG    . LYS B 2  511 ? 149.335 105.405 141.843 1.00 53.10  ? 511  LYS B CG    1 
ATOM   6127  C  CD    . LYS B 2  511 ? 149.779 104.915 143.220 1.00 53.10  ? 511  LYS B CD    1 
ATOM   6128  C  CE    . LYS B 2  511 ? 150.371 106.023 144.061 1.00 53.10  ? 511  LYS B CE    1 
ATOM   6129  N  NZ    . LYS B 2  511 ? 150.810 105.524 145.394 1.00 53.10  ? 511  LYS B NZ    1 
ATOM   6130  N  N     . TYR B 2  512 ? 145.695 105.109 143.713 1.00 50.81  ? 512  TYR B N     1 
ATOM   6131  C  CA    . TYR B 2  512 ? 145.261 104.245 144.801 1.00 50.81  ? 512  TYR B CA    1 
ATOM   6132  C  C     . TYR B 2  512 ? 144.149 103.304 144.360 1.00 50.81  ? 512  TYR B C     1 
ATOM   6133  O  O     . TYR B 2  512 ? 144.036 102.192 144.888 1.00 50.81  ? 512  TYR B O     1 
ATOM   6134  C  CB    . TYR B 2  512 ? 144.792 105.094 145.981 1.00 50.81  ? 512  TYR B CB    1 
ATOM   6135  C  CG    . TYR B 2  512 ? 144.451 104.299 147.219 1.00 50.81  ? 512  TYR B CG    1 
ATOM   6136  C  CD1   . TYR B 2  512 ? 145.450 103.855 148.075 1.00 50.81  ? 512  TYR B CD1   1 
ATOM   6137  C  CD2   . TYR B 2  512 ? 143.132 104.000 147.538 1.00 50.81  ? 512  TYR B CD2   1 
ATOM   6138  C  CE1   . TYR B 2  512 ? 145.147 103.131 149.210 1.00 50.81  ? 512  TYR B CE1   1 
ATOM   6139  C  CE2   . TYR B 2  512 ? 142.821 103.275 148.667 1.00 50.81  ? 512  TYR B CE2   1 
ATOM   6140  C  CZ    . TYR B 2  512 ? 143.832 102.846 149.500 1.00 50.81  ? 512  TYR B CZ    1 
ATOM   6141  O  OH    . TYR B 2  512 ? 143.527 102.123 150.628 1.00 50.81  ? 512  TYR B OH    1 
ATOM   6142  N  N     . VAL B 2  513 ? 143.321 103.728 143.403 1.00 49.87  ? 513  VAL B N     1 
ATOM   6143  C  CA    . VAL B 2  513 ? 142.180 102.915 142.998 1.00 49.87  ? 513  VAL B CA    1 
ATOM   6144  C  C     . VAL B 2  513 ? 142.641 101.733 142.150 1.00 49.87  ? 513  VAL B C     1 
ATOM   6145  O  O     . VAL B 2  513 ? 142.120 100.620 142.290 1.00 49.87  ? 513  VAL B O     1 
ATOM   6146  C  CB    . VAL B 2  513 ? 141.138 103.786 142.270 1.00 49.87  ? 513  VAL B CB    1 
ATOM   6147  C  CG1   . VAL B 2  513 ? 139.949 102.959 141.811 1.00 49.87  ? 513  VAL B CG1   1 
ATOM   6148  C  CG2   . VAL B 2  513 ? 140.660 104.897 143.180 1.00 49.87  ? 513  VAL B CG2   1 
ATOM   6149  N  N     . LEU B 2  514 ? 143.659 101.938 141.300 1.00 51.30  ? 514  LEU B N     1 
ATOM   6150  C  CA    . LEU B 2  514 ? 144.169 100.863 140.450 1.00 51.30  ? 514  LEU B CA    1 
ATOM   6151  C  C     . LEU B 2  514 ? 144.809 99.721  141.230 1.00 51.30  ? 514  LEU B C     1 
ATOM   6152  O  O     . LEU B 2  514 ? 144.899 98.611  140.699 1.00 51.30  ? 514  LEU B O     1 
ATOM   6153  C  CB    . LEU B 2  514 ? 145.222 101.363 139.456 1.00 51.30  ? 514  LEU B CB    1 
ATOM   6154  C  CG    . LEU B 2  514 ? 144.961 101.894 138.041 1.00 51.30  ? 514  LEU B CG    1 
ATOM   6155  C  CD1   . LEU B 2  514 ? 144.071 100.950 137.240 1.00 51.30  ? 514  LEU B CD1   1 
ATOM   6156  C  CD2   . LEU B 2  514 ? 144.471 103.310 137.988 1.00 51.30  ? 514  LEU B CD2   1 
ATOM   6157  N  N     . GLN B 2  515 ? 145.263 99.965  142.463 1.00 55.49  ? 515  GLN B N     1 
ATOM   6158  C  CA    . GLN B 2  515 ? 146.062 98.967  143.168 1.00 55.49  ? 515  GLN B CA    1 
ATOM   6159  C  C     . GLN B 2  515 ? 145.239 97.759  143.595 1.00 55.49  ? 515  GLN B C     1 
ATOM   6160  O  O     . GLN B 2  515 ? 145.784 96.658  143.723 1.00 55.49  ? 515  GLN B O     1 
ATOM   6161  C  CB    . GLN B 2  515 ? 146.732 99.596  144.386 1.00 55.49  ? 515  GLN B CB    1 
ATOM   6162  C  CG    . GLN B 2  515 ? 147.785 100.629 144.054 1.00 55.49  ? 515  GLN B CG    1 
ATOM   6163  C  CD    . GLN B 2  515 ? 148.408 101.228 145.295 1.00 55.49  ? 515  GLN B CD    1 
ATOM   6164  O  OE1   . GLN B 2  515 ? 148.015 100.903 146.416 1.00 55.49  ? 515  GLN B OE1   1 
ATOM   6165  N  NE2   . GLN B 2  515 ? 149.381 102.109 145.104 1.00 55.49  ? 515  GLN B NE2   1 
ATOM   6166  N  N     . SER B 2  516 ? 143.940 97.933  143.819 1.00 56.74  ? 516  SER B N     1 
ATOM   6167  C  CA    . SER B 2  516 ? 143.052 96.822  144.150 1.00 56.74  ? 516  SER B CA    1 
ATOM   6168  C  C     . SER B 2  516 ? 141.909 96.808  143.144 1.00 56.74  ? 516  SER B C     1 
ATOM   6169  O  O     . SER B 2  516 ? 140.811 97.291  143.429 1.00 56.74  ? 516  SER B O     1 
ATOM   6170  C  CB    . SER B 2  516 ? 142.537 96.942  145.586 1.00 56.74  ? 516  SER B CB    1 
ATOM   6171  O  OG    . SER B 2  516 ? 141.617 95.905  145.884 1.00 56.74  ? 516  SER B OG    1 
ATOM   6172  N  N     . LEU B 2  517 ? 142.162 96.217  141.979 1.00 60.08  ? 517  LEU B N     1 
ATOM   6173  C  CA    . LEU B 2  517 ? 141.142 96.019  140.959 1.00 60.08  ? 517  LEU B CA    1 
ATOM   6174  C  C     . LEU B 2  517 ? 141.268 94.601  140.426 1.00 60.08  ? 517  LEU B C     1 
ATOM   6175  O  O     . LEU B 2  517 ? 141.993 93.767  140.975 1.00 60.08  ? 517  LEU B O     1 
ATOM   6176  C  CB    . LEU B 2  517 ? 141.264 97.023  139.805 1.00 60.08  ? 517  LEU B CB    1 
ATOM   6177  C  CG    . LEU B 2  517 ? 141.016 98.503  140.054 1.00 60.08  ? 517  LEU B CG    1 
ATOM   6178  C  CD1   . LEU B 2  517 ? 141.124 99.281  138.765 1.00 60.08  ? 517  LEU B CD1   1 
ATOM   6179  C  CD2   . LEU B 2  517 ? 139.674 98.703  140.684 1.00 60.08  ? 517  LEU B CD2   1 
ATOM   6180  N  N     . THR B 2  518 ? 140.555 94.338  139.341 1.00 59.76  ? 518  THR B N     1 
ATOM   6181  C  CA    . THR B 2  518 ? 140.709 93.110  138.584 1.00 59.76  ? 518  THR B CA    1 
ATOM   6182  C  C     . THR B 2  518 ? 141.822 93.324  137.562 1.00 59.76  ? 518  THR B C     1 
ATOM   6183  O  O     . THR B 2  518 ? 142.065 94.451  137.122 1.00 59.76  ? 518  THR B O     1 
ATOM   6184  C  CB    . THR B 2  518 ? 139.384 92.755  137.900 1.00 59.76  ? 518  THR B CB    1 
ATOM   6185  O  OG1   . THR B 2  518 ? 138.324 92.873  138.855 1.00 59.76  ? 518  THR B OG1   1 
ATOM   6186  C  CG2   . THR B 2  518 ? 139.377 91.316  137.390 1.00 59.76  ? 518  THR B CG2   1 
ATOM   6187  N  N     . VAL B 2  519 ? 142.525 92.242  137.214 1.00 58.99  ? 519  VAL B N     1 
ATOM   6188  C  CA    . VAL B 2  519 ? 143.533 92.329  136.160 1.00 58.99  ? 519  VAL B CA    1 
ATOM   6189  C  C     . VAL B 2  519 ? 142.886 92.610  134.808 1.00 58.99  ? 519  VAL B C     1 
ATOM   6190  O  O     . VAL B 2  519 ? 143.499 93.243  133.942 1.00 58.99  ? 519  VAL B O     1 
ATOM   6191  C  CB    . VAL B 2  519 ? 144.400 91.054  136.124 1.00 58.99  ? 519  VAL B CB    1 
ATOM   6192  C  CG1   . VAL B 2  519 ? 145.239 90.951  137.384 1.00 58.99  ? 519  VAL B CG1   1 
ATOM   6193  C  CG2   . VAL B 2  519 ? 143.538 89.804  135.971 1.00 58.99  ? 519  VAL B CG2   1 
ATOM   6194  N  N     . ASN B 2  520 ? 141.640 92.177  134.607 1.00 58.45  ? 520  ASN B N     1 
ATOM   6195  C  CA    . ASN B 2  520 ? 140.947 92.461  133.361 1.00 58.45  ? 520  ASN B CA    1 
ATOM   6196  C  C     . ASN B 2  520 ? 140.390 93.878  133.340 1.00 58.45  ? 520  ASN B C     1 
ATOM   6197  O  O     . ASN B 2  520 ? 140.107 94.409  132.261 1.00 58.45  ? 520  ASN B O     1 
ATOM   6198  C  CB    . ASN B 2  520 ? 139.818 91.449  133.153 1.00 58.45  ? 520  ASN B CB    1 
ATOM   6199  C  CG    . ASN B 2  520 ? 139.417 91.315  131.703 1.00 58.45  ? 520  ASN B CG    1 
ATOM   6200  O  OD1   . ASN B 2  520 ? 140.038 91.902  130.822 1.00 58.45  ? 520  ASN B OD1   1 
ATOM   6201  N  ND2   . ASN B 2  520 ? 138.369 90.542  131.447 1.00 58.45  ? 520  ASN B ND2   1 
ATOM   6202  N  N     . SER B 2  521 ? 140.230 94.498  134.507 1.00 55.57  ? 521  SER B N     1 
ATOM   6203  C  CA    . SER B 2  521 ? 139.856 95.901  134.588 1.00 55.57  ? 521  SER B CA    1 
ATOM   6204  C  C     . SER B 2  521 ? 141.058 96.830  134.545 1.00 55.57  ? 521  SER B C     1 
ATOM   6205  O  O     . SER B 2  521 ? 140.894 98.016  134.241 1.00 55.57  ? 521  SER B O     1 
ATOM   6206  C  CB    . SER B 2  521 ? 139.058 96.166  135.865 1.00 55.57  ? 521  SER B CB    1 
ATOM   6207  O  OG    . SER B 2  521 ? 137.838 95.448  135.859 1.00 55.57  ? 521  SER B OG    1 
ATOM   6208  N  N     . LYS B 2  522 ? 142.255 96.326  134.845 1.00 51.83  ? 522  LYS B N     1 
ATOM   6209  C  CA    . LYS B 2  522 ? 143.452 97.137  134.667 1.00 51.83  ? 522  LYS B CA    1 
ATOM   6210  C  C     . LYS B 2  522 ? 143.992 97.048  133.250 1.00 51.83  ? 522  LYS B C     1 
ATOM   6211  O  O     . LYS B 2  522 ? 144.595 98.010  132.767 1.00 51.83  ? 522  LYS B O     1 
ATOM   6212  C  CB    . LYS B 2  522 ? 144.539 96.732  135.660 1.00 51.83  ? 522  LYS B CB    1 
ATOM   6213  C  CG    . LYS B 2  522 ? 144.238 97.102  137.092 1.00 51.83  ? 522  LYS B CG    1 
ATOM   6214  C  CD    . LYS B 2  522 ? 145.485 96.992  137.951 1.00 51.83  ? 522  LYS B CD    1 
ATOM   6215  C  CE    . LYS B 2  522 ? 145.845 95.561  138.286 1.00 51.83  ? 522  LYS B CE    1 
ATOM   6216  N  NZ    . LYS B 2  522 ? 147.003 95.515  139.221 1.00 51.83  ? 522  LYS B NZ    1 
ATOM   6217  N  N     . LYS B 2  523 ? 143.796 95.911  132.575 1.00 51.27  ? 523  LYS B N     1 
ATOM   6218  C  CA    . LYS B 2  523 ? 144.188 95.801  131.174 1.00 51.27  ? 523  LYS B CA    1 
ATOM   6219  C  C     . LYS B 2  523 ? 143.339 96.689  130.276 1.00 51.27  ? 523  LYS B C     1 
ATOM   6220  O  O     . LYS B 2  523 ? 143.829 97.172  129.250 1.00 51.27  ? 523  LYS B O     1 
ATOM   6221  C  CB    . LYS B 2  523 ? 144.093 94.351  130.708 1.00 51.27  ? 523  LYS B CB    1 
ATOM   6222  C  CG    . LYS B 2  523 ? 145.223 93.457  131.166 1.00 51.27  ? 523  LYS B CG    1 
ATOM   6223  C  CD    . LYS B 2  523 ? 144.869 92.007  130.904 1.00 51.27  ? 523  LYS B CD    1 
ATOM   6224  C  CE    . LYS B 2  523 ? 144.777 91.715  129.418 1.00 51.27  ? 523  LYS B CE    1 
ATOM   6225  N  NZ    . LYS B 2  523 ? 144.478 90.280  129.163 1.00 51.27  ? 523  LYS B NZ    1 
ATOM   6226  N  N     . MET B 2  524 ? 142.072 96.904  130.635 1.00 47.17  ? 524  MET B N     1 
ATOM   6227  C  CA    . MET B 2  524 ? 141.233 97.814  129.863 1.00 47.17  ? 524  MET B CA    1 
ATOM   6228  C  C     . MET B 2  524 ? 141.667 99.254  130.062 1.00 47.17  ? 524  MET B C     1 
ATOM   6229  O  O     . MET B 2  524 ? 141.788 100.017 129.097 1.00 47.17  ? 524  MET B O     1 
ATOM   6230  C  CB    . MET B 2  524 ? 139.772 97.671  130.262 1.00 47.17  ? 524  MET B CB    1 
ATOM   6231  C  CG    . MET B 2  524 ? 138.866 98.552  129.436 1.00 47.17  ? 524  MET B CG    1 
ATOM   6232  S  SD    . MET B 2  524 ? 137.175 98.529  130.010 1.00 47.17  ? 524  MET B SD    1 
ATOM   6233  C  CE    . MET B 2  524 ? 137.368 99.463  131.516 1.00 47.17  ? 524  MET B CE    1 
ATOM   6234  N  N     . TYR B 2  525 ? 141.887 99.647  131.318 1.00 42.02  ? 525  TYR B N     1 
ATOM   6235  C  CA    . TYR B 2  525 ? 142.249 101.025 131.611 1.00 42.02  ? 525  TYR B CA    1 
ATOM   6236  C  C     . TYR B 2  525 ? 143.647 101.344 131.103 1.00 42.02  ? 525  TYR B C     1 
ATOM   6237  O  O     . TYR B 2  525 ? 143.901 102.476 130.697 1.00 42.02  ? 525  TYR B O     1 
ATOM   6238  C  CB    . TYR B 2  525 ? 142.135 101.283 133.112 1.00 42.02  ? 525  TYR B CB    1 
ATOM   6239  C  CG    . TYR B 2  525 ? 142.232 102.737 133.515 1.00 42.02  ? 525  TYR B CG    1 
ATOM   6240  C  CD1   . TYR B 2  525 ? 141.161 103.601 133.326 1.00 42.02  ? 525  TYR B CD1   1 
ATOM   6241  C  CD2   . TYR B 2  525 ? 143.383 103.240 134.103 1.00 42.02  ? 525  TYR B CD2   1 
ATOM   6242  C  CE1   . TYR B 2  525 ? 141.239 104.926 133.699 1.00 42.02  ? 525  TYR B CE1   1 
ATOM   6243  C  CE2   . TYR B 2  525 ? 143.468 104.564 134.482 1.00 42.02  ? 525  TYR B CE2   1 
ATOM   6244  C  CZ    . TYR B 2  525 ? 142.394 105.400 134.277 1.00 42.02  ? 525  TYR B CZ    1 
ATOM   6245  O  OH    . TYR B 2  525 ? 142.479 106.718 134.651 1.00 42.02  ? 525  TYR B OH    1 
ATOM   6246  N  N     . LYS B 2  526 ? 144.544 100.354 131.073 1.00 43.73  ? 526  LYS B N     1 
ATOM   6247  C  CA    . LYS B 2  526 ? 145.849 100.545 130.444 1.00 43.73  ? 526  LYS B CA    1 
ATOM   6248  C  C     . LYS B 2  526 ? 145.716 100.757 128.941 1.00 43.73  ? 526  LYS B C     1 
ATOM   6249  O  O     . LYS B 2  526 ? 146.413 101.598 128.365 1.00 43.73  ? 526  LYS B O     1 
ATOM   6250  C  CB    . LYS B 2  526 ? 146.750 99.345  130.734 1.00 43.73  ? 526  LYS B CB    1 
ATOM   6251  C  CG    . LYS B 2  526 ? 148.137 99.431  130.140 1.00 43.73  ? 526  LYS B CG    1 
ATOM   6252  C  CD    . LYS B 2  526 ? 148.978 98.246  130.558 1.00 43.73  ? 526  LYS B CD    1 
ATOM   6253  C  CE    . LYS B 2  526 ? 150.294 98.229  129.811 1.00 43.73  ? 526  LYS B CE    1 
ATOM   6254  N  NZ    . LYS B 2  526 ? 151.120 99.421  130.142 1.00 43.73  ? 526  LYS B NZ    1 
ATOM   6255  N  N     . LEU B 2  527 ? 144.824 100.002 128.294 1.00 43.00  ? 527  LEU B N     1 
ATOM   6256  C  CA    . LEU B 2  527 ? 144.552 100.194 126.873 1.00 43.00  ? 527  LEU B CA    1 
ATOM   6257  C  C     . LEU B 2  527 ? 143.907 101.546 126.600 1.00 43.00  ? 527  LEU B C     1 
ATOM   6258  O  O     . LEU B 2  527 ? 144.169 102.161 125.560 1.00 43.00  ? 527  LEU B O     1 
ATOM   6259  C  CB    . LEU B 2  527 ? 143.654 99.067  126.366 1.00 43.00  ? 527  LEU B CB    1 
ATOM   6260  C  CG    . LEU B 2  527 ? 143.272 99.049  124.888 1.00 43.00  ? 527  LEU B CG    1 
ATOM   6261  C  CD1   . LEU B 2  527 ? 144.497 98.860  124.013 1.00 43.00  ? 527  LEU B CD1   1 
ATOM   6262  C  CD2   . LEU B 2  527 ? 142.259 97.965  124.632 1.00 43.00  ? 527  LEU B CD2   1 
ATOM   6263  N  N     . LEU B 2  528 ? 143.069 102.020 127.521 1.00 38.60  ? 528  LEU B N     1 
ATOM   6264  C  CA    . LEU B 2  528 ? 142.449 103.332 127.376 1.00 38.60  ? 528  LEU B CA    1 
ATOM   6265  C  C     . LEU B 2  528 ? 143.467 104.454 127.536 1.00 38.60  ? 528  LEU B C     1 
ATOM   6266  O  O     . LEU B 2  528 ? 143.393 105.466 126.830 1.00 38.60  ? 528  LEU B O     1 
ATOM   6267  C  CB    . LEU B 2  528 ? 141.318 103.480 128.392 1.00 38.60  ? 528  LEU B CB    1 
ATOM   6268  C  CG    . LEU B 2  528 ? 140.586 104.818 128.427 1.00 38.60  ? 528  LEU B CG    1 
ATOM   6269  C  CD1   . LEU B 2  528 ? 139.934 105.095 127.092 1.00 38.60  ? 528  LEU B CD1   1 
ATOM   6270  C  CD2   . LEU B 2  528 ? 139.563 104.840 129.548 1.00 38.60  ? 528  LEU B CD2   1 
ATOM   6271  N  N     . ILE B 2  529 ? 144.419 104.296 128.461 1.00 40.27  ? 529  ILE B N     1 
ATOM   6272  C  CA    . ILE B 2  529 ? 145.446 105.315 128.666 1.00 40.27  ? 529  ILE B CA    1 
ATOM   6273  C  C     . ILE B 2  529 ? 146.382 105.382 127.465 1.00 40.27  ? 529  ILE B C     1 
ATOM   6274  O  O     . ILE B 2  529 ? 146.676 106.470 126.957 1.00 40.27  ? 529  ILE B O     1 
ATOM   6275  C  CB    . ILE B 2  529 ? 146.222 105.056 129.973 1.00 40.27  ? 529  ILE B CB    1 
ATOM   6276  C  CG1   . ILE B 2  529 ? 145.324 105.244 131.195 1.00 40.27  ? 529  ILE B CG1   1 
ATOM   6277  C  CG2   . ILE B 2  529 ? 147.445 105.940 130.083 1.00 40.27  ? 529  ILE B CG2   1 
ATOM   6278  C  CD1   . ILE B 2  529 ? 144.675 106.563 131.282 1.00 40.27  ? 529  ILE B CD1   1 
ATOM   6279  N  N     . GLU B 2  530 ? 146.837 104.222 126.978 1.00 43.12  ? 530  GLU B N     1 
ATOM   6280  C  CA    . GLU B 2  530 ? 147.803 104.184 125.882 1.00 43.12  ? 530  GLU B CA    1 
ATOM   6281  C  C     . GLU B 2  530 ? 147.224 104.702 124.571 1.00 43.12  ? 530  GLU B C     1 
ATOM   6282  O  O     . GLU B 2  530 ? 147.963 105.245 123.744 1.00 43.12  ? 530  GLU B O     1 
ATOM   6283  C  CB    . GLU B 2  530 ? 148.319 102.761 125.680 1.00 43.12  ? 530  GLU B CB    1 
ATOM   6284  C  CG    . GLU B 2  530 ? 149.227 102.252 126.777 1.00 43.12  ? 530  GLU B CG    1 
ATOM   6285  C  CD    . GLU B 2  530 ? 149.683 100.829 126.527 1.00 43.12  ? 530  GLU B CD    1 
ATOM   6286  O  OE1   . GLU B 2  530 ? 149.175 100.200 125.577 1.00 43.12  ? 530  GLU B OE1   1 
ATOM   6287  O  OE2   . GLU B 2  530 ? 150.554 100.341 127.275 1.00 43.12  ? 530  GLU B OE2   1 
ATOM   6288  N  N     . THR B 2  531 ? 145.917 104.552 124.363 1.00 41.46  ? 531  THR B N     1 
ATOM   6289  C  CA    . THR B 2  531 ? 145.317 105.024 123.122 1.00 41.46  ? 531  THR B CA    1 
ATOM   6290  C  C     . THR B 2  531 ? 145.087 106.531 123.163 1.00 41.46  ? 531  THR B C     1 
ATOM   6291  O  O     . THR B 2  531 ? 145.266 107.219 122.152 1.00 41.46  ? 531  THR B O     1 
ATOM   6292  C  CB    . THR B 2  531 ? 144.011 104.277 122.864 1.00 41.46  ? 531  THR B CB    1 
ATOM   6293  O  OG1   . THR B 2  531 ? 144.240 102.872 123.004 1.00 41.46  ? 531  THR B OG1   1 
ATOM   6294  C  CG2   . THR B 2  531 ? 143.531 104.527 121.446 1.00 41.46  ? 531  THR B CG2   1 
ATOM   6295  N  N     . GLN B 2  532 ? 144.704 107.064 124.325 1.00 42.03  ? 532  GLN B N     1 
ATOM   6296  C  CA    . GLN B 2  532 ? 144.598 108.511 124.481 1.00 42.03  ? 532  GLN B CA    1 
ATOM   6297  C  C     . GLN B 2  532 ? 145.971 109.171 124.497 1.00 42.03  ? 532  GLN B C     1 
ATOM   6298  O  O     . GLN B 2  532 ? 146.119 110.305 124.029 1.00 42.03  ? 532  GLN B O     1 
ATOM   6299  C  CB    . GLN B 2  532 ? 143.816 108.835 125.754 1.00 42.03  ? 532  GLN B CB    1 
ATOM   6300  C  CG    . GLN B 2  532 ? 143.597 110.312 126.025 1.00 42.03  ? 532  GLN B CG    1 
ATOM   6301  C  CD    . GLN B 2  532 ? 142.630 110.547 127.149 1.00 42.03  ? 532  GLN B CD    1 
ATOM   6302  O  OE1   . GLN B 2  532 ? 142.106 109.603 127.726 1.00 42.03  ? 532  GLN B OE1   1 
ATOM   6303  N  NE2   . GLN B 2  532 ? 142.378 111.808 127.462 1.00 42.03  ? 532  GLN B NE2   1 
ATOM   6304  N  N     . MET B 2  533 ? 146.987 108.465 125.000 1.00 50.89  ? 533  MET B N     1 
ATOM   6305  C  CA    . MET B 2  533 ? 148.357 108.969 124.963 1.00 50.89  ? 533  MET B CA    1 
ATOM   6306  C  C     . MET B 2  533 ? 148.874 109.068 123.532 1.00 50.89  ? 533  MET B C     1 
ATOM   6307  O  O     . MET B 2  533 ? 149.724 109.915 123.236 1.00 50.89  ? 533  MET B O     1 
ATOM   6308  C  CB    . MET B 2  533 ? 149.248 108.058 125.804 1.00 50.89  ? 533  MET B CB    1 
ATOM   6309  C  CG    . MET B 2  533 ? 150.643 108.548 126.077 1.00 50.89  ? 533  MET B CG    1 
ATOM   6310  S  SD    . MET B 2  533 ? 151.472 107.380 127.157 1.00 50.89  ? 533  MET B SD    1 
ATOM   6311  C  CE    . MET B 2  533 ? 150.475 107.599 128.623 1.00 50.89  ? 533  MET B CE    1 
ATOM   6312  N  N     . GLN B 2  534 ? 148.368 108.215 122.638 1.00 49.32  ? 534  GLN B N     1 
ATOM   6313  C  CA    . GLN B 2  534 ? 148.630 108.371 121.213 1.00 49.32  ? 534  GLN B CA    1 
ATOM   6314  C  C     . GLN B 2  534 ? 147.985 109.642 120.673 1.00 49.32  ? 534  GLN B C     1 
ATOM   6315  O  O     . GLN B 2  534 ? 148.587 110.357 119.865 1.00 49.32  ? 534  GLN B O     1 
ATOM   6316  C  CB    . GLN B 2  534 ? 148.109 107.146 120.460 1.00 49.32  ? 534  GLN B CB    1 
ATOM   6317  C  CG    . GLN B 2  534 ? 148.369 107.145 118.970 1.00 49.32  ? 534  GLN B CG    1 
ATOM   6318  C  CD    . GLN B 2  534 ? 149.824 106.924 118.636 1.00 49.32  ? 534  GLN B CD    1 
ATOM   6319  O  OE1   . GLN B 2  534 ? 150.488 106.081 119.237 1.00 49.32  ? 534  GLN B OE1   1 
ATOM   6320  N  NE2   . GLN B 2  534 ? 150.333 107.683 117.674 1.00 49.32  ? 534  GLN B NE2   1 
ATOM   6321  N  N     . ASN B 2  535 ? 146.764 109.944 121.115 1.00 49.57  ? 535  ASN B N     1 
ATOM   6322  C  CA    . ASN B 2  535 ? 146.035 111.094 120.599 1.00 49.57  ? 535  ASN B CA    1 
ATOM   6323  C  C     . ASN B 2  535 ? 146.485 112.410 121.213 1.00 49.57  ? 535  ASN B C     1 
ATOM   6324  O  O     . ASN B 2  535 ? 146.252 113.464 120.614 1.00 49.57  ? 535  ASN B O     1 
ATOM   6325  C  CB    . ASN B 2  535 ? 144.535 110.918 120.832 1.00 49.57  ? 535  ASN B CB    1 
ATOM   6326  C  CG    . ASN B 2  535 ? 143.940 109.810 119.995 1.00 49.57  ? 535  ASN B CG    1 
ATOM   6327  O  OD1   . ASN B 2  535 ? 144.281 109.648 118.825 1.00 49.57  ? 535  ASN B OD1   1 
ATOM   6328  N  ND2   . ASN B 2  535 ? 143.038 109.041 120.590 1.00 49.57  ? 535  ASN B ND2   1 
ATOM   6329  N  N     . MET B 2  536 ? 147.109 112.386 122.392 1.00 52.23  ? 536  MET B N     1 
ATOM   6330  C  CA    . MET B 2  536 ? 147.618 113.631 122.957 1.00 52.23  ? 536  MET B CA    1 
ATOM   6331  C  C     . MET B 2  536 ? 148.929 114.037 122.297 1.00 52.23  ? 536  MET B C     1 
ATOM   6332  O  O     . MET B 2  536 ? 149.144 115.219 122.020 1.00 52.23  ? 536  MET B O     1 
ATOM   6333  C  CB    . MET B 2  536 ? 147.796 113.511 124.472 1.00 52.23  ? 536  MET B CB    1 
ATOM   6334  C  CG    . MET B 2  536 ? 146.495 113.354 125.235 1.00 52.23  ? 536  MET B CG    1 
ATOM   6335  S  SD    . MET B 2  536 ? 146.661 113.314 127.025 1.00 52.23  ? 536  MET B SD    1 
ATOM   6336  C  CE    . MET B 2  536 ? 146.971 115.042 127.348 1.00 52.23  ? 536  MET B CE    1 
ATOM   6337  N  N     . GLY B 2  537 ? 149.811 113.073 122.027 1.00 56.11  ? 537  GLY B N     1 
ATOM   6338  C  CA    . GLY B 2  537 ? 151.047 113.377 121.328 1.00 56.11  ? 537  GLY B CA    1 
ATOM   6339  C  C     . GLY B 2  537 ? 150.860 113.713 119.863 1.00 56.11  ? 537  GLY B C     1 
ATOM   6340  O  O     . GLY B 2  537 ? 151.759 114.300 119.253 1.00 56.11  ? 537  GLY B O     1 
ATOM   6341  N  N     . ASN B 2  538 ? 149.712 113.356 119.289 1.00 57.50  ? 538  ASN B N     1 
ATOM   6342  C  CA    . ASN B 2  538 ? 149.433 113.664 117.893 1.00 57.50  ? 538  ASN B CA    1 
ATOM   6343  C  C     . ASN B 2  538 ? 148.814 115.049 117.752 1.00 57.50  ? 538  ASN B C     1 
ATOM   6344  O  O     . ASN B 2  538 ? 149.289 115.876 116.967 1.00 57.50  ? 538  ASN B O     1 
ATOM   6345  C  CB    . ASN B 2  538 ? 148.501 112.598 117.312 1.00 57.50  ? 538  ASN B CB    1 
ATOM   6346  C  CG    . ASN B 2  538 ? 148.408 112.649 115.801 1.00 57.50  ? 538  ASN B CG    1 
ATOM   6347  O  OD1   . ASN B 2  538 ? 149.079 113.442 115.140 1.00 57.50  ? 538  ASN B OD1   1 
ATOM   6348  N  ND2   . ASN B 2  538 ? 147.558 111.800 115.244 1.00 57.50  ? 538  ASN B ND2   1 
ATOM   6349  N  N     . LEU B 2  539 ? 147.758 115.319 118.519 1.00 66.02  ? 539  LEU B N     1 
ATOM   6350  C  CA    . LEU B 2  539 ? 146.955 116.519 118.318 1.00 66.02  ? 539  LEU B CA    1 
ATOM   6351  C  C     . LEU B 2  539 ? 147.596 117.761 118.923 1.00 66.02  ? 539  LEU B C     1 
ATOM   6352  O  O     . LEU B 2  539 ? 147.424 118.860 118.387 1.00 66.02  ? 539  LEU B O     1 
ATOM   6353  C  CB    . LEU B 2  539 ? 145.555 116.290 118.902 1.00 66.02  ? 539  LEU B CB    1 
ATOM   6354  C  CG    . LEU B 2  539 ? 144.392 117.267 118.700 1.00 66.02  ? 539  LEU B CG    1 
ATOM   6355  C  CD1   . LEU B 2  539 ? 143.098 116.484 118.601 1.00 66.02  ? 539  LEU B CD1   1 
ATOM   6356  C  CD2   . LEU B 2  539 ? 144.286 118.257 119.847 1.00 66.02  ? 539  LEU B CD2   1 
ATOM   6357  N  N     . SER B 2  540 ? 148.325 117.619 120.027 1.00 70.56  ? 540  SER B N     1 
ATOM   6358  C  CA    . SER B 2  540 ? 148.801 118.794 120.745 1.00 70.56  ? 540  SER B CA    1 
ATOM   6359  C  C     . SER B 2  540 ? 150.097 119.350 120.168 1.00 70.56  ? 540  SER B C     1 
ATOM   6360  O  O     . SER B 2  540 ? 150.242 120.577 120.082 1.00 70.56  ? 540  SER B O     1 
ATOM   6361  C  CB    . SER B 2  540 ? 148.987 118.466 122.228 1.00 70.56  ? 540  SER B CB    1 
ATOM   6362  O  OG    . SER B 2  540 ? 149.418 119.598 122.957 1.00 70.56  ? 540  SER B OG    1 
ATOM   6363  N  N     . ALA B 2  541 ? 151.015 118.462 119.760 1.00 71.20  ? 541  ALA B N     1 
ATOM   6364  C  CA    . ALA B 2  541 ? 152.364 118.799 119.279 1.00 71.20  ? 541  ALA B CA    1 
ATOM   6365  C  C     . ALA B 2  541 ? 153.103 119.683 120.283 1.00 71.20  ? 541  ALA B C     1 
ATOM   6366  O  O     . ALA B 2  541 ? 153.696 120.708 119.939 1.00 71.20  ? 541  ALA B O     1 
ATOM   6367  C  CB    . ALA B 2  541 ? 152.321 119.447 117.890 1.00 71.20  ? 541  ALA B CB    1 
ATOM   6368  N  N     . ASN B 2  542 ? 153.065 119.262 121.545 1.00 73.37  ? 542  ASN B N     1 
ATOM   6369  C  CA    . ASN B 2  542 ? 153.451 120.122 122.656 1.00 73.37  ? 542  ASN B CA    1 
ATOM   6370  C  C     . ASN B 2  542 ? 153.773 119.244 123.856 1.00 73.37  ? 542  ASN B C     1 
ATOM   6371  O  O     . ASN B 2  542 ? 152.976 118.376 124.224 1.00 73.37  ? 542  ASN B O     1 
ATOM   6372  C  CB    . ASN B 2  542 ? 152.315 121.108 122.974 1.00 73.37  ? 542  ASN B CB    1 
ATOM   6373  C  CG    . ASN B 2  542 ? 152.720 122.209 123.941 1.00 73.37  ? 542  ASN B CG    1 
ATOM   6374  O  OD1   . ASN B 2  542 ? 153.844 122.250 124.441 1.00 73.37  ? 542  ASN B OD1   1 
ATOM   6375  N  ND2   . ASN B 2  542 ? 151.792 123.123 124.199 1.00 73.37  ? 542  ASN B ND2   1 
ATOM   6376  N  N     . THR B 2  543 ? 154.940 119.476 124.459 1.00 75.34  ? 543  THR B N     1 
ATOM   6377  C  CA    . THR B 2  543 ? 155.360 118.697 125.619 1.00 75.34  ? 543  THR B CA    1 
ATOM   6378  C  C     . THR B 2  543 ? 154.632 119.148 126.883 1.00 75.34  ? 543  THR B C     1 
ATOM   6379  O  O     . THR B 2  543 ? 154.271 118.313 127.722 1.00 75.34  ? 543  THR B O     1 
ATOM   6380  C  CB    . THR B 2  543 ? 156.880 118.811 125.792 1.00 75.34  ? 543  THR B CB    1 
ATOM   6381  O  OG1   . THR B 2  543 ? 157.529 118.389 124.587 1.00 75.34  ? 543  THR B OG1   1 
ATOM   6382  C  CG2   . THR B 2  543 ? 157.384 117.940 126.940 1.00 75.34  ? 543  THR B CG2   1 
ATOM   6383  N  N     . GLY B 2  544 ? 154.377 120.456 127.003 1.00 67.43  ? 544  GLY B N     1 
ATOM   6384  C  CA    . GLY B 2  544 ? 153.856 121.075 128.204 1.00 67.43  ? 544  GLY B CA    1 
ATOM   6385  C  C     . GLY B 2  544 ? 152.512 120.550 128.672 1.00 67.43  ? 544  GLY B C     1 
ATOM   6386  O  O     . GLY B 2  544 ? 151.731 119.991 127.897 1.00 67.43  ? 544  GLY B O     1 
ATOM   6387  N  N     . PRO B 2  545 ? 152.225 120.715 129.970 1.00 64.22  ? 545  PRO B N     1 
ATOM   6388  C  CA    . PRO B 2  545 ? 151.067 120.029 130.561 1.00 64.22  ? 545  PRO B CA    1 
ATOM   6389  C  C     . PRO B 2  545 ? 149.723 120.633 130.181 1.00 64.22  ? 545  PRO B C     1 
ATOM   6390  O  O     . PRO B 2  545 ? 149.323 121.688 130.682 1.00 64.22  ? 545  PRO B O     1 
ATOM   6391  C  CB    . PRO B 2  545 ? 151.328 120.145 132.069 1.00 64.22  ? 545  PRO B CB    1 
ATOM   6392  C  CG    . PRO B 2  545 ? 152.174 121.368 132.215 1.00 64.22  ? 545  PRO B CG    1 
ATOM   6393  C  CD    . PRO B 2  545 ? 153.024 121.435 130.979 1.00 64.22  ? 545  PRO B CD    1 
ATOM   6394  N  N     . LYS B 2  546 ? 149.016 119.948 129.288 1.00 59.67  ? 546  LYS B N     1 
ATOM   6395  C  CA    . LYS B 2  546 ? 147.619 120.231 129.003 1.00 59.67  ? 546  LYS B CA    1 
ATOM   6396  C  C     . LYS B 2  546 ? 146.797 119.029 129.430 1.00 59.67  ? 546  LYS B C     1 
ATOM   6397  O  O     . LYS B 2  546 ? 147.127 117.890 129.086 1.00 59.67  ? 546  LYS B O     1 
ATOM   6398  C  CB    . LYS B 2  546 ? 147.387 120.533 127.523 1.00 59.67  ? 546  LYS B CB    1 
ATOM   6399  C  CG    . LYS B 2  546 ? 145.958 120.941 127.241 1.00 59.67  ? 546  LYS B CG    1 
ATOM   6400  C  CD    . LYS B 2  546 ? 145.761 121.395 125.818 1.00 59.67  ? 546  LYS B CD    1 
ATOM   6401  C  CE    . LYS B 2  546 ? 144.311 121.768 125.572 1.00 59.67  ? 546  LYS B CE    1 
ATOM   6402  N  NZ    . LYS B 2  546 ? 143.897 123.004 126.287 1.00 59.67  ? 546  LYS B NZ    1 
ATOM   6403  N  N     . ARG B 2  547 ? 145.736 119.285 130.180 1.00 53.33  ? 547  ARG B N     1 
ATOM   6404  C  CA    . ARG B 2  547 ? 144.961 118.225 130.795 1.00 53.33  ? 547  ARG B CA    1 
ATOM   6405  C  C     . ARG B 2  547 ? 143.980 117.638 129.788 1.00 53.33  ? 547  ARG B C     1 
ATOM   6406  O  O     . ARG B 2  547 ? 143.341 118.370 129.028 1.00 53.33  ? 547  ARG B O     1 
ATOM   6407  C  CB    . ARG B 2  547 ? 144.255 118.770 132.038 1.00 53.33  ? 547  ARG B CB    1 
ATOM   6408  C  CG    . ARG B 2  547 ? 143.603 117.723 132.866 1.00 53.33  ? 547  ARG B CG    1 
ATOM   6409  C  CD    . ARG B 2  547 ? 143.237 118.193 134.267 1.00 53.33  ? 547  ARG B CD    1 
ATOM   6410  N  NE    . ARG B 2  547 ? 144.418 118.351 135.116 1.00 53.33  ? 547  ARG B NE    1 
ATOM   6411  C  CZ    . ARG B 2  547 ? 144.760 119.477 135.731 1.00 53.33  ? 547  ARG B CZ    1 
ATOM   6412  N  NH1   . ARG B 2  547 ? 143.990 120.552 135.628 1.00 53.33  ? 547  ARG B NH1   1 
ATOM   6413  N  NH2   . ARG B 2  547 ? 145.856 119.519 136.478 1.00 53.33  ? 547  ARG B NH2   1 
ATOM   6414  N  N     . GLY B 2  548 ? 143.883 116.309 129.785 1.00 41.51  ? 548  GLY B N     1 
ATOM   6415  C  CA    . GLY B 2  548 ? 143.239 115.600 128.688 1.00 41.51  ? 548  GLY B CA    1 
ATOM   6416  C  C     . GLY B 2  548 ? 141.735 115.803 128.665 1.00 41.51  ? 548  GLY B C     1 
ATOM   6417  O  O     . GLY B 2  548 ? 141.060 115.698 129.696 1.00 41.51  ? 548  GLY B O     1 
ATOM   6418  N  N     . THR B 2  549 ? 141.206 116.095 127.482 1.00 37.14  ? 549  THR B N     1 
ATOM   6419  C  CA    . THR B 2  549 ? 139.802 116.447 127.302 1.00 37.14  ? 549  THR B CA    1 
ATOM   6420  C  C     . THR B 2  549 ? 139.220 115.563 126.201 1.00 37.14  ? 549  THR B C     1 
ATOM   6421  O  O     . THR B 2  549 ? 139.782 114.523 125.835 1.00 37.14  ? 549  THR B O     1 
ATOM   6422  C  CB    . THR B 2  549 ? 139.626 117.940 126.991 1.00 37.14  ? 549  THR B CB    1 
ATOM   6423  O  OG1   . THR B 2  549 ? 140.398 118.291 125.836 1.00 37.14  ? 549  THR B OG1   1 
ATOM   6424  C  CG2   . THR B 2  549 ? 140.027 118.813 128.176 1.00 37.14  ? 549  THR B CG2   1 
ATOM   6425  N  N     . GLN B 2  550 ? 138.054 115.969 125.688 1.00 36.28  ? 550  GLN B N     1 
ATOM   6426  C  CA    . GLN B 2  550 ? 137.267 115.151 124.769 1.00 36.28  ? 550  GLN B CA    1 
ATOM   6427  C  C     . GLN B 2  550 ? 137.942 114.957 123.410 1.00 36.28  ? 550  GLN B C     1 
ATOM   6428  O  O     . GLN B 2  550 ? 137.726 113.923 122.768 1.00 36.28  ? 550  GLN B O     1 
ATOM   6429  C  CB    . GLN B 2  550 ? 135.893 115.791 124.581 1.00 36.28  ? 550  GLN B CB    1 
ATOM   6430  C  CG    . GLN B 2  550 ? 134.877 114.928 123.875 1.00 36.28  ? 550  GLN B CG    1 
ATOM   6431  C  CD    . GLN B 2  550 ? 133.585 115.656 123.623 1.00 36.28  ? 550  GLN B CD    1 
ATOM   6432  O  OE1   . GLN B 2  550 ? 133.477 116.854 123.867 1.00 36.28  ? 550  GLN B OE1   1 
ATOM   6433  N  NE2   . GLN B 2  550 ? 132.589 114.932 123.146 1.00 36.28  ? 550  GLN B NE2   1 
ATOM   6434  N  N     . ARG B 2  551 ? 138.746 115.930 122.952 1.00 46.55  ? 551  ARG B N     1 
ATOM   6435  C  CA    . ARG B 2  551 ? 139.404 115.817 121.647 1.00 46.55  ? 551  ARG B CA    1 
ATOM   6436  C  C     . ARG B 2  551 ? 140.377 114.650 121.603 1.00 46.55  ? 551  ARG B C     1 
ATOM   6437  O  O     . ARG B 2  551 ? 140.514 113.981 120.573 1.00 46.55  ? 551  ARG B O     1 
ATOM   6438  C  CB    . ARG B 2  551 ? 140.173 117.091 121.299 1.00 46.55  ? 551  ARG B CB    1 
ATOM   6439  C  CG    . ARG B 2  551 ? 139.368 118.314 120.972 1.00 46.55  ? 551  ARG B CG    1 
ATOM   6440  C  CD    . ARG B 2  551 ? 140.314 119.439 120.597 1.00 46.55  ? 551  ARG B CD    1 
ATOM   6441  N  NE    . ARG B 2  551 ? 141.209 119.778 121.698 1.00 46.55  ? 551  ARG B NE    1 
ATOM   6442  C  CZ    . ARG B 2  551 ? 142.243 120.604 121.589 1.00 46.55  ? 551  ARG B CZ    1 
ATOM   6443  N  NH1   . ARG B 2  551 ? 142.518 121.175 120.427 1.00 46.55  ? 551  ARG B NH1   1 
ATOM   6444  N  NH2   . ARG B 2  551 ? 143.008 120.852 122.639 1.00 46.55  ? 551  ARG B NH2   1 
ATOM   6445  N  N     . THR B 2  552 ? 141.066 114.399 122.704 1.00 44.36  ? 552  THR B N     1 
ATOM   6446  C  CA    . THR B 2  552 ? 142.067 113.352 122.763 1.00 44.36  ? 552  THR B CA    1 
ATOM   6447  C  C     . THR B 2  552 ? 141.482 111.998 123.130 1.00 44.36  ? 552  THR B C     1 
ATOM   6448  O  O     . THR B 2  552 ? 142.213 111.004 123.139 1.00 44.36  ? 552  THR B O     1 
ATOM   6449  C  CB    . THR B 2  552 ? 143.148 113.740 123.765 1.00 44.36  ? 552  THR B CB    1 
ATOM   6450  O  OG1   . THR B 2  552 ? 142.570 113.849 125.069 1.00 44.36  ? 552  THR B OG1   1 
ATOM   6451  C  CG2   . THR B 2  552 ? 143.742 115.082 123.387 1.00 44.36  ? 552  THR B CG2   1 
ATOM   6452  N  N     . GLY B 2  553 ? 140.190 111.928 123.412 1.00 37.77  ? 553  GLY B N     1 
ATOM   6453  C  CA    . GLY B 2  553 ? 139.616 110.699 123.900 1.00 37.77  ? 553  GLY B CA    1 
ATOM   6454  C  C     . GLY B 2  553 ? 139.261 109.719 122.803 1.00 37.77  ? 553  GLY B C     1 
ATOM   6455  O  O     . GLY B 2  553 ? 139.050 110.071 121.644 1.00 37.77  ? 553  GLY B O     1 
ATOM   6456  N  N     . VAL B 2  554 ? 139.194 108.460 123.200 1.00 36.10  ? 554  VAL B N     1 
ATOM   6457  C  CA    . VAL B 2  554 ? 138.803 107.375 122.312 1.00 36.10  ? 554  VAL B CA    1 
ATOM   6458  C  C     . VAL B 2  554 ? 137.286 107.367 122.218 1.00 36.10  ? 554  VAL B C     1 
ATOM   6459  O  O     . VAL B 2  554 ? 136.600 107.640 123.206 1.00 36.10  ? 554  VAL B O     1 
ATOM   6460  C  CB    . VAL B 2  554 ? 139.340 106.043 122.863 1.00 36.10  ? 554  VAL B CB    1 
ATOM   6461  C  CG1   . VAL B 2  554 ? 139.137 104.906 121.879 1.00 36.10  ? 554  VAL B CG1   1 
ATOM   6462  C  CG2   . VAL B 2  554 ? 140.785 106.192 123.262 1.00 36.10  ? 554  VAL B CG2   1 
ATOM   6463  N  N     . GLU B 2  555 ? 136.736 107.080 121.045 1.00 43.07  ? 555  GLU B N     1 
ATOM   6464  C  CA    . GLU B 2  555 ? 135.293 106.921 121.033 1.00 43.07  ? 555  GLU B CA    1 
ATOM   6465  C  C     . GLU B 2  555 ? 134.941 105.489 121.414 1.00 43.07  ? 555  GLU B C     1 
ATOM   6466  O  O     . GLU B 2  555 ? 135.775 104.584 121.357 1.00 43.07  ? 555  GLU B O     1 
ATOM   6467  C  CB    . GLU B 2  555 ? 134.680 107.281 119.684 1.00 43.07  ? 555  GLU B CB    1 
ATOM   6468  C  CG    . GLU B 2  555 ? 134.801 106.255 118.602 1.00 43.07  ? 555  GLU B CG    1 
ATOM   6469  C  CD    . GLU B 2  555 ? 134.176 106.743 117.317 1.00 43.07  ? 555  GLU B CD    1 
ATOM   6470  O  OE1   . GLU B 2  555 ? 133.795 107.927 117.275 1.00 43.07  ? 555  GLU B OE1   1 
ATOM   6471  O  OE2   . GLU B 2  555 ? 134.031 105.946 116.368 1.00 43.07  ? 555  GLU B OE2   1 
ATOM   6472  N  N     . LEU B 2  556 ? 133.681 105.296 121.805 1.00 41.17  ? 556  LEU B N     1 
ATOM   6473  C  CA    . LEU B 2  556 ? 133.299 104.071 122.499 1.00 41.17  ? 556  LEU B CA    1 
ATOM   6474  C  C     . LEU B 2  556 ? 133.215 102.878 121.556 1.00 41.17  ? 556  LEU B C     1 
ATOM   6475  O  O     . LEU B 2  556 ? 133.606 101.765 121.925 1.00 41.17  ? 556  LEU B O     1 
ATOM   6476  C  CB    . LEU B 2  556 ? 131.975 104.287 123.224 1.00 41.17  ? 556  LEU B CB    1 
ATOM   6477  C  CG    . LEU B 2  556 ? 131.401 103.138 124.033 1.00 41.17  ? 556  LEU B CG    1 
ATOM   6478  C  CD1   . LEU B 2  556 ? 132.424 102.643 125.017 1.00 41.17  ? 556  LEU B CD1   1 
ATOM   6479  C  CD2   . LEU B 2  556 ? 130.202 103.666 124.764 1.00 41.17  ? 556  LEU B CD2   1 
ATOM   6480  N  N     . LYS B 2  557 ? 132.710 103.080 120.339 1.00 43.94  ? 557  LYS B N     1 
ATOM   6481  C  CA    . LYS B 2  557 ? 132.619 101.958 119.412 1.00 43.94  ? 557  LYS B CA    1 
ATOM   6482  C  C     . LYS B 2  557 ? 133.974 101.590 118.828 1.00 43.94  ? 557  LYS B C     1 
ATOM   6483  O  O     . LYS B 2  557 ? 134.190 100.431 118.464 1.00 43.94  ? 557  LYS B O     1 
ATOM   6484  C  CB    . LYS B 2  557 ? 131.617 102.263 118.305 1.00 43.94  ? 557  LYS B CB    1 
ATOM   6485  C  CG    . LYS B 2  557 ? 130.183 102.190 118.777 1.00 43.94  ? 557  LYS B CG    1 
ATOM   6486  C  CD    . LYS B 2  557 ? 129.230 102.424 117.638 1.00 43.94  ? 557  LYS B CD    1 
ATOM   6487  C  CE    . LYS B 2  557 ? 127.788 102.332 118.095 1.00 43.94  ? 557  LYS B CE    1 
ATOM   6488  N  NZ    . LYS B 2  557 ? 127.441 100.941 118.501 1.00 43.94  ? 557  LYS B NZ    1 
ATOM   6489  N  N     . LEU B 2  558 ? 134.900 102.545 118.735 1.00 44.22  ? 558  LEU B N     1 
ATOM   6490  C  CA    . LEU B 2  558 ? 136.256 102.184 118.341 1.00 44.22  ? 558  LEU B CA    1 
ATOM   6491  C  C     . LEU B 2  558 ? 136.990 101.511 119.486 1.00 44.22  ? 558  LEU B C     1 
ATOM   6492  O  O     . LEU B 2  558 ? 137.856 100.662 119.250 1.00 44.22  ? 558  LEU B O     1 
ATOM   6493  C  CB    . LEU B 2  558 ? 137.017 103.423 117.861 1.00 44.22  ? 558  LEU B CB    1 
ATOM   6494  C  CG    . LEU B 2  558 ? 138.347 103.285 117.109 1.00 44.22  ? 558  LEU B CG    1 
ATOM   6495  C  CD1   . LEU B 2  558 ? 138.448 104.409 116.103 1.00 44.22  ? 558  LEU B CD1   1 
ATOM   6496  C  CD2   . LEU B 2  558 ? 139.575 103.303 118.013 1.00 44.22  ? 558  LEU B CD2   1 
ATOM   6497  N  N     . PHE B 2  559 ? 136.662 101.877 120.727 1.00 43.83  ? 559  PHE B N     1 
ATOM   6498  C  CA    . PHE B 2  559 ? 137.325 101.276 121.877 1.00 43.83  ? 559  PHE B CA    1 
ATOM   6499  C  C     . PHE B 2  559 ? 136.890 99.835  122.083 1.00 43.83  ? 559  PHE B C     1 
ATOM   6500  O  O     . PHE B 2  559 ? 137.671 99.022  122.590 1.00 43.83  ? 559  PHE B O     1 
ATOM   6501  C  CB    . PHE B 2  559 ? 137.042 102.092 123.134 1.00 43.83  ? 559  PHE B CB    1 
ATOM   6502  C  CG    . PHE B 2  559 ? 137.796 101.623 124.337 1.00 43.83  ? 559  PHE B CG    1 
ATOM   6503  C  CD1   . PHE B 2  559 ? 139.149 101.887 124.459 1.00 43.83  ? 559  PHE B CD1   1 
ATOM   6504  C  CD2   . PHE B 2  559 ? 137.158 100.919 125.342 1.00 43.83  ? 559  PHE B CD2   1 
ATOM   6505  C  CE1   . PHE B 2  559 ? 139.852 101.457 125.562 1.00 43.83  ? 559  PHE B CE1   1 
ATOM   6506  C  CE2   . PHE B 2  559 ? 137.855 100.492 126.450 1.00 43.83  ? 559  PHE B CE2   1 
ATOM   6507  C  CZ    . PHE B 2  559 ? 139.204 100.761 126.559 1.00 43.83  ? 559  PHE B CZ    1 
ATOM   6508  N  N     . ASN B 2  560 ? 135.656 99.505  121.695 1.00 48.08  ? 560  ASN B N     1 
ATOM   6509  C  CA    . ASN B 2  560 ? 135.174 98.134  121.797 1.00 48.08  ? 560  ASN B CA    1 
ATOM   6510  C  C     . ASN B 2  560 ? 135.923 97.214  120.842 1.00 48.08  ? 560  ASN B C     1 
ATOM   6511  O  O     . ASN B 2  560 ? 136.111 96.033  121.143 1.00 48.08  ? 560  ASN B O     1 
ATOM   6512  C  CB    . ASN B 2  560 ? 133.672 98.097  121.514 1.00 48.08  ? 560  ASN B CB    1 
ATOM   6513  C  CG    . ASN B 2  560 ? 133.009 96.829  122.012 1.00 48.08  ? 560  ASN B CG    1 
ATOM   6514  O  OD1   . ASN B 2  560 ? 133.649 95.964  122.607 1.00 48.08  ? 560  ASN B OD1   1 
ATOM   6515  N  ND2   . ASN B 2  560 ? 131.709 96.717  121.773 1.00 48.08  ? 560  ASN B ND2   1 
ATOM   6516  N  N     . HIS B 2  561 ? 136.374 97.739  119.700 1.00 46.28  ? 561  HIS B N     1 
ATOM   6517  C  CA    . HIS B 2  561 ? 137.188 96.945  118.787 1.00 46.28  ? 561  HIS B CA    1 
ATOM   6518  C  C     . HIS B 2  561 ? 138.605 96.768  119.306 1.00 46.28  ? 561  HIS B C     1 
ATOM   6519  O  O     . HIS B 2  561 ? 139.269 95.782  118.969 1.00 46.28  ? 561  HIS B O     1 
ATOM   6520  C  CB    . HIS B 2  561 ? 137.221 97.596  117.406 1.00 46.28  ? 561  HIS B CB    1 
ATOM   6521  C  CG    . HIS B 2  561 ? 135.895 97.614  116.718 1.00 46.28  ? 561  HIS B CG    1 
ATOM   6522  N  ND1   . HIS B 2  561 ? 135.002 98.654  116.849 1.00 46.28  ? 561  HIS B ND1   1 
ATOM   6523  C  CD2   . HIS B 2  561 ? 135.305 96.710  115.903 1.00 46.28  ? 561  HIS B CD2   1 
ATOM   6524  C  CE1   . HIS B 2  561 ? 133.922 98.394  116.135 1.00 46.28  ? 561  HIS B CE1   1 
ATOM   6525  N  NE2   . HIS B 2  561 ? 134.080 97.220  115.554 1.00 46.28  ? 561  HIS B NE2   1 
ATOM   6526  N  N     . LEU B 2  562 ? 139.089 97.709  120.115 1.00 45.42  ? 562  LEU B N     1 
ATOM   6527  C  CA    . LEU B 2  562 ? 140.448 97.613  120.630 1.00 45.42  ? 562  LEU B CA    1 
ATOM   6528  C  C     . LEU B 2  562 ? 140.548 96.597  121.758 1.00 45.42  ? 562  LEU B C     1 
ATOM   6529  O  O     . LEU B 2  562 ? 141.554 95.889  121.871 1.00 45.42  ? 562  LEU B O     1 
ATOM   6530  C  CB    . LEU B 2  562 ? 140.926 98.983  121.107 1.00 45.42  ? 562  LEU B CB    1 
ATOM   6531  C  CG    . LEU B 2  562 ? 141.087 100.067 120.043 1.00 45.42  ? 562  LEU B CG    1 
ATOM   6532  C  CD1   . LEU B 2  562 ? 141.430 101.386 120.706 1.00 45.42  ? 562  LEU B CD1   1 
ATOM   6533  C  CD2   . LEU B 2  562 ? 142.149 99.681  119.031 1.00 45.42  ? 562  LEU B CD2   1 
ATOM   6534  N  N     . CYS B 2  563 ? 139.523 96.507  122.599 1.00 50.55  ? 563  CYS B N     1 
ATOM   6535  C  CA    . CYS B 2  563 ? 139.534 95.584  123.723 1.00 50.55  ? 563  CYS B CA    1 
ATOM   6536  C  C     . CYS B 2  563 ? 138.858 94.255  123.413 1.00 50.55  ? 563  CYS B C     1 
ATOM   6537  O  O     . CYS B 2  563 ? 138.788 93.396  124.296 1.00 50.55  ? 563  CYS B O     1 
ATOM   6538  C  CB    . CYS B 2  563 ? 138.881 96.236  124.946 1.00 50.55  ? 563  CYS B CB    1 
ATOM   6539  S  SG    . CYS B 2  563 ? 137.146 96.636  124.742 1.00 50.55  ? 563  CYS B SG    1 
ATOM   6540  N  N     . ALA B 2  564 ? 138.359 94.062  122.193 1.00 51.31  ? 564  ALA B N     1 
ATOM   6541  C  CA    . ALA B 2  564 ? 137.939 92.735  121.762 1.00 51.31  ? 564  ALA B CA    1 
ATOM   6542  C  C     . ALA B 2  564 ? 139.066 91.976  121.082 1.00 51.31  ? 564  ALA B C     1 
ATOM   6543  O  O     . ALA B 2  564 ? 139.069 90.740  121.096 1.00 51.31  ? 564  ALA B O     1 
ATOM   6544  C  CB    . ALA B 2  564 ? 136.742 92.824  120.814 1.00 51.31  ? 564  ALA B CB    1 
ATOM   6545  N  N     . ALA B 2  565 ? 140.020 92.690  120.483 1.00 51.58  ? 565  ALA B N     1 
ATOM   6546  C  CA    . ALA B 2  565 ? 141.192 92.041  119.914 1.00 51.58  ? 565  ALA B CA    1 
ATOM   6547  C  C     . ALA B 2  565 ? 142.184 91.628  120.990 1.00 51.58  ? 565  ALA B C     1 
ATOM   6548  O  O     . ALA B 2  565 ? 142.869 90.611  120.839 1.00 51.58  ? 565  ALA B O     1 
ATOM   6549  C  CB    . ALA B 2  565 ? 141.869 92.966  118.904 1.00 51.58  ? 565  ALA B CB    1 
ATOM   6550  N  N     . ASP B 2  566 ? 142.279 92.399  122.071 1.00 58.16  ? 566  ASP B N     1 
ATOM   6551  C  CA    . ASP B 2  566 ? 143.095 92.038  123.222 1.00 58.16  ? 566  ASP B CA    1 
ATOM   6552  C  C     . ASP B 2  566 ? 142.302 91.303  124.295 1.00 58.16  ? 566  ASP B C     1 
ATOM   6553  O  O     . ASP B 2  566 ? 142.799 91.153  125.416 1.00 58.16  ? 566  ASP B O     1 
ATOM   6554  C  CB    . ASP B 2  566 ? 143.758 93.283  123.812 1.00 58.16  ? 566  ASP B CB    1 
ATOM   6555  C  CG    . ASP B 2  566 ? 144.879 93.812  122.943 1.00 58.16  ? 566  ASP B CG    1 
ATOM   6556  O  OD1   . ASP B 2  566 ? 145.524 92.998  122.250 1.00 58.16  ? 566  ASP B OD1   1 
ATOM   6557  O  OD2   . ASP B 2  566 ? 145.117 95.037  122.953 1.00 58.16  ? 566  ASP B OD2   1 
ATOM   6558  N  N     . PHE B 2  567 ? 141.071 90.888  123.975 1.00 62.90  ? 567  PHE B N     1 
ATOM   6559  C  CA    . PHE B 2  567 ? 140.272 89.926  124.745 1.00 62.90  ? 567  PHE B CA    1 
ATOM   6560  C  C     . PHE B 2  567 ? 139.886 90.437  126.133 1.00 62.90  ? 567  PHE B C     1 
ATOM   6561  O  O     . PHE B 2  567 ? 139.695 89.644  127.057 1.00 62.90  ? 567  PHE B O     1 
ATOM   6562  C  CB    . PHE B 2  567 ? 140.983 88.572  124.869 1.00 62.90  ? 567  PHE B CB    1 
ATOM   6563  C  CG    . PHE B 2  567 ? 141.221 87.888  123.555 1.00 62.90  ? 567  PHE B CG    1 
ATOM   6564  C  CD1   . PHE B 2  567 ? 140.187 87.239  122.898 1.00 62.90  ? 567  PHE B CD1   1 
ATOM   6565  C  CD2   . PHE B 2  567 ? 142.487 87.877  122.989 1.00 62.90  ? 567  PHE B CD2   1 
ATOM   6566  C  CE1   . PHE B 2  567 ? 140.407 86.604  121.688 1.00 62.90  ? 567  PHE B CE1   1 
ATOM   6567  C  CE2   . PHE B 2  567 ? 142.716 87.243  121.783 1.00 62.90  ? 567  PHE B CE2   1 
ATOM   6568  C  CZ    . PHE B 2  567 ? 141.674 86.605  121.131 1.00 62.90  ? 567  PHE B CZ    1 
ATOM   6569  N  N     . ILE B 2  568 ? 139.752 91.751  126.305 1.00 55.05  ? 568  ILE B N     1 
ATOM   6570  C  CA    . ILE B 2  568 ? 139.254 92.275  127.576 1.00 55.05  ? 568  ILE B CA    1 
ATOM   6571  C  C     . ILE B 2  568 ? 137.737 92.150  127.652 1.00 55.05  ? 568  ILE B C     1 
ATOM   6572  O  O     . ILE B 2  568 ? 137.194 91.539  128.579 1.00 55.05  ? 568  ILE B O     1 
ATOM   6573  C  CB    . ILE B 2  568 ? 139.713 93.729  127.802 1.00 55.05  ? 568  ILE B CB    1 
ATOM   6574  C  CG1   . ILE B 2  568 ? 141.198 93.791  128.165 1.00 55.05  ? 568  ILE B CG1   1 
ATOM   6575  C  CG2   . ILE B 2  568 ? 138.902 94.385  128.904 1.00 55.05  ? 568  ILE B CG2   1 
ATOM   6576  C  CD1   . ILE B 2  568 ? 142.116 94.038  127.015 1.00 55.05  ? 568  ILE B CD1   1 
ATOM   6577  N  N     . ALA B 2  569 ? 137.033 92.711  126.675 1.00 54.44  ? 569  ALA B N     1 
ATOM   6578  C  CA    . ALA B 2  569 ? 135.580 92.730  126.675 1.00 54.44  ? 569  ALA B CA    1 
ATOM   6579  C  C     . ALA B 2  569 ? 135.050 91.827  125.573 1.00 54.44  ? 569  ALA B C     1 
ATOM   6580  O  O     . ALA B 2  569 ? 135.560 91.836  124.449 1.00 54.44  ? 569  ALA B O     1 
ATOM   6581  C  CB    . ALA B 2  569 ? 135.047 94.151  126.487 1.00 54.44  ? 569  ALA B CB    1 
ATOM   6582  N  N     . SER B 2  570 ? 134.025 91.045  125.906 1.00 59.89  ? 570  SER B N     1 
ATOM   6583  C  CA    . SER B 2  570 ? 133.432 90.148  124.923 1.00 59.89  ? 570  SER B CA    1 
ATOM   6584  C  C     . SER B 2  570 ? 132.421 90.862  124.037 1.00 59.89  ? 570  SER B C     1 
ATOM   6585  O  O     . SER B 2  570 ? 132.263 90.494  122.868 1.00 59.89  ? 570  SER B O     1 
ATOM   6586  C  CB    . SER B 2  570 ? 132.771 88.961  125.624 1.00 59.89  ? 570  SER B CB    1 
ATOM   6587  O  OG    . SER B 2  570 ? 133.728 88.178  126.315 1.00 59.89  ? 570  SER B OG    1 
ATOM   6588  N  N     . ASN B 2  571 ? 131.739 91.877  124.560 1.00 58.71  ? 571  ASN B N     1 
ATOM   6589  C  CA    . ASN B 2  571 ? 130.732 92.602  123.799 1.00 58.71  ? 571  ASN B CA    1 
ATOM   6590  C  C     . ASN B 2  571 ? 130.624 94.027  124.339 1.00 58.71  ? 571  ASN B C     1 
ATOM   6591  O  O     . ASN B 2  571 ? 131.470 94.485  125.112 1.00 58.71  ? 571  ASN B O     1 
ATOM   6592  C  CB    . ASN B 2  571 ? 129.394 91.847  123.818 1.00 58.71  ? 571  ASN B CB    1 
ATOM   6593  C  CG    . ASN B 2  571 ? 128.921 91.504  125.223 1.00 58.71  ? 571  ASN B CG    1 
ATOM   6594  O  OD1   . ASN B 2  571 ? 129.563 91.840  126.214 1.00 58.71  ? 571  ASN B OD1   1 
ATOM   6595  N  ND2   . ASN B 2  571 ? 127.782 90.830  125.308 1.00 58.71  ? 571  ASN B ND2   1 
ATOM   6596  N  N     . GLU B 2  572 ? 129.568 94.727  123.919 1.00 56.79  ? 572  GLU B N     1 
ATOM   6597  C  CA    . GLU B 2  572 ? 129.390 96.128  124.290 1.00 56.79  ? 572  GLU B CA    1 
ATOM   6598  C  C     . GLU B 2  572 ? 128.924 96.272  125.734 1.00 56.79  ? 572  GLU B C     1 
ATOM   6599  O  O     . GLU B 2  572 ? 129.333 97.207  126.433 1.00 56.79  ? 572  GLU B O     1 
ATOM   6600  C  CB    . GLU B 2  572 ? 128.392 96.783  123.331 1.00 56.79  ? 572  GLU B CB    1 
ATOM   6601  C  CG    . GLU B 2  572 ? 128.078 98.251  123.598 1.00 56.79  ? 572  GLU B CG    1 
ATOM   6602  C  CD    . GLU B 2  572 ? 129.244 99.179  123.319 1.00 56.79  ? 572  GLU B CD    1 
ATOM   6603  O  OE1   . GLU B 2  572 ? 130.093 98.839  122.469 1.00 56.79  ? 572  GLU B OE1   1 
ATOM   6604  O  OE2   . GLU B 2  572 ? 129.306 100.254 123.949 1.00 56.79  ? 572  GLU B OE2   1 
ATOM   6605  N  N     . ILE B 2  573 ? 128.079 95.351  126.202 1.00 58.66  ? 573  ILE B N     1 
ATOM   6606  C  CA    . ILE B 2  573 ? 127.473 95.489  127.523 1.00 58.66  ? 573  ILE B CA    1 
ATOM   6607  C  C     . ILE B 2  573 ? 128.485 95.178  128.622 1.00 58.66  ? 573  ILE B C     1 
ATOM   6608  O  O     . ILE B 2  573 ? 128.548 95.880  129.640 1.00 58.66  ? 573  ILE B O     1 
ATOM   6609  C  CB    . ILE B 2  573 ? 126.216 94.602  127.614 1.00 58.66  ? 573  ILE B CB    1 
ATOM   6610  C  CG1   . ILE B 2  573 ? 125.149 95.108  126.643 1.00 58.66  ? 573  ILE B CG1   1 
ATOM   6611  C  CG2   . ILE B 2  573 ? 125.654 94.558  129.028 1.00 58.66  ? 573  ILE B CG2   1 
ATOM   6612  C  CD1   . ILE B 2  573 ? 123.969 94.183  126.501 1.00 58.66  ? 573  ILE B CD1   1 
ATOM   6613  N  N     . ALA B 2  574 ? 129.311 94.145  128.426 1.00 53.02  ? 574  ALA B N     1 
ATOM   6614  C  CA    . ALA B 2  574 ? 130.362 93.853  129.398 1.00 53.02  ? 574  ALA B CA    1 
ATOM   6615  C  C     . ALA B 2  574 ? 131.444 94.924  129.393 1.00 53.02  ? 574  ALA B C     1 
ATOM   6616  O  O     . ALA B 2  574 ? 132.102 95.138  130.416 1.00 53.02  ? 574  ALA B O     1 
ATOM   6617  C  CB    . ALA B 2  574 ? 130.977 92.482  129.128 1.00 53.02  ? 574  ALA B CB    1 
ATOM   6618  N  N     . LEU B 2  575 ? 131.641 95.599  128.258 1.00 50.83  ? 575  LEU B N     1 
ATOM   6619  C  CA    . LEU B 2  575 ? 132.502 96.777  128.224 1.00 50.83  ? 575  LEU B CA    1 
ATOM   6620  C  C     . LEU B 2  575 ? 131.910 97.912  129.048 1.00 50.83  ? 575  LEU B C     1 
ATOM   6621  O  O     . LEU B 2  575 ? 132.599 98.515  129.876 1.00 50.83  ? 575  LEU B O     1 
ATOM   6622  C  CB    . LEU B 2  575 ? 132.719 97.226  126.781 1.00 50.83  ? 575  LEU B CB    1 
ATOM   6623  C  CG    . LEU B 2  575 ? 133.524 98.515  126.605 1.00 50.83  ? 575  LEU B CG    1 
ATOM   6624  C  CD1   . LEU B 2  575 ? 134.928 98.349  127.134 1.00 50.83  ? 575  LEU B CD1   1 
ATOM   6625  C  CD2   . LEU B 2  575 ? 133.545 98.943  125.154 1.00 50.83  ? 575  LEU B CD2   1 
ATOM   6626  N  N     . ARG B 2  576 ? 130.627 98.214  128.833 1.00 53.30  ? 576  ARG B N     1 
ATOM   6627  C  CA    . ARG B 2  576 ? 129.968 99.298  129.554 1.00 53.30  ? 576  ARG B CA    1 
ATOM   6628  C  C     . ARG B 2  576 ? 129.779 98.998  131.035 1.00 53.30  ? 576  ARG B C     1 
ATOM   6629  O  O     . ARG B 2  576 ? 129.640 99.934  131.828 1.00 53.30  ? 576  ARG B O     1 
ATOM   6630  C  CB    . ARG B 2  576 ? 128.607 99.596  128.931 1.00 53.30  ? 576  ARG B CB    1 
ATOM   6631  C  CG    . ARG B 2  576 ? 128.636 100.295 127.590 1.00 53.30  ? 576  ARG B CG    1 
ATOM   6632  C  CD    . ARG B 2  576 ? 127.210 100.492 127.120 1.00 53.30  ? 576  ARG B CD    1 
ATOM   6633  N  NE    . ARG B 2  576 ? 127.104 101.172 125.835 1.00 53.30  ? 576  ARG B NE    1 
ATOM   6634  C  CZ    . ARG B 2  576 ? 126.992 102.488 125.706 1.00 53.30  ? 576  ARG B CZ    1 
ATOM   6635  N  NH1   . ARG B 2  576 ? 126.982 103.261 126.782 1.00 53.30  ? 576  ARG B NH1   1 
ATOM   6636  N  NH2   . ARG B 2  576 ? 126.888 103.032 124.502 1.00 53.30  ? 576  ARG B NH2   1 
ATOM   6637  N  N     . SER B 2  577 ? 129.761 97.724  131.426 1.00 55.40  ? 577  SER B N     1 
ATOM   6638  C  CA    . SER B 2  577 ? 129.625 97.392  132.838 1.00 55.40  ? 577  SER B CA    1 
ATOM   6639  C  C     . SER B 2  577 ? 130.931 97.572  133.598 1.00 55.40  ? 577  SER B C     1 
ATOM   6640  O  O     . SER B 2  577 ? 130.906 97.922  134.782 1.00 55.40  ? 577  SER B O     1 
ATOM   6641  C  CB    . SER B 2  577 ? 129.115 95.961  133.001 1.00 55.40  ? 577  SER B CB    1 
ATOM   6642  O  OG    . SER B 2  577 ? 127.800 95.831  132.492 1.00 55.40  ? 577  SER B OG    1 
ATOM   6643  N  N     . MET B 2  578 ? 132.074 97.338  132.952 1.00 54.13  ? 578  MET B N     1 
ATOM   6644  C  CA    . MET B 2  578 ? 133.351 97.603  133.599 1.00 54.13  ? 578  MET B CA    1 
ATOM   6645  C  C     . MET B 2  578 ? 133.909 98.978  133.272 1.00 54.13  ? 578  MET B C     1 
ATOM   6646  O  O     . MET B 2  578 ? 134.960 99.341  133.807 1.00 54.13  ? 578  MET B O     1 
ATOM   6647  C  CB    . MET B 2  578 ? 134.388 96.538  133.235 1.00 54.13  ? 578  MET B CB    1 
ATOM   6648  C  CG    . MET B 2  578 ? 134.770 96.491  131.778 1.00 54.13  ? 578  MET B CG    1 
ATOM   6649  S  SD    . MET B 2  578 ? 136.018 95.230  131.466 1.00 54.13  ? 578  MET B SD    1 
ATOM   6650  C  CE    . MET B 2  578 ? 135.064 93.734  131.698 1.00 54.13  ? 578  MET B CE    1 
ATOM   6651  N  N     . LEU B 2  579 ? 133.252 99.748  132.408 1.00 50.56  ? 579  LEU B N     1 
ATOM   6652  C  CA    . LEU B 2  579 ? 133.610 101.156 132.301 1.00 50.56  ? 579  LEU B CA    1 
ATOM   6653  C  C     . LEU B 2  579 ? 133.035 101.960 133.454 1.00 50.56  ? 579  LEU B C     1 
ATOM   6654  O  O     . LEU B 2  579 ? 133.753 102.753 134.066 1.00 50.56  ? 579  LEU B O     1 
ATOM   6655  C  CB    . LEU B 2  579 ? 133.148 101.750 130.973 1.00 50.56  ? 579  LEU B CB    1 
ATOM   6656  C  CG    . LEU B 2  579 ? 133.997 101.484 129.740 1.00 50.56  ? 579  LEU B CG    1 
ATOM   6657  C  CD1   . LEU B 2  579 ? 133.277 102.022 128.544 1.00 50.56  ? 579  LEU B CD1   1 
ATOM   6658  C  CD2   . LEU B 2  579 ? 135.337 102.164 129.895 1.00 50.56  ? 579  LEU B CD2   1 
ATOM   6659  N  N     . ARG B 2  580 ? 131.755 101.729 133.788 1.00 58.27  ? 580  ARG B N     1 
ATOM   6660  C  CA    . ARG B 2  580 ? 131.001 102.604 134.689 1.00 58.27  ? 580  ARG B CA    1 
ATOM   6661  C  C     . ARG B 2  580 ? 131.582 102.647 136.099 1.00 58.27  ? 580  ARG B C     1 
ATOM   6662  O  O     . ARG B 2  580 ? 131.314 103.597 136.841 1.00 58.27  ? 580  ARG B O     1 
ATOM   6663  C  CB    . ARG B 2  580 ? 129.525 102.167 134.732 1.00 58.27  ? 580  ARG B CB    1 
ATOM   6664  C  CG    . ARG B 2  580 ? 129.226 100.811 135.408 1.00 58.27  ? 580  ARG B CG    1 
ATOM   6665  C  CD    . ARG B 2  580 ? 128.731 100.997 136.850 1.00 58.27  ? 580  ARG B CD    1 
ATOM   6666  N  NE    . ARG B 2  580 ? 128.487 99.752  137.564 1.00 58.27  ? 580  ARG B NE    1 
ATOM   6667  C  CZ    . ARG B 2  580 ? 128.286 99.689  138.875 1.00 58.27  ? 580  ARG B CZ    1 
ATOM   6668  N  NH1   . ARG B 2  580 ? 128.311 100.800 139.599 1.00 58.27  ? 580  ARG B NH1   1 
ATOM   6669  N  NH2   . ARG B 2  580 ? 128.072 98.523  139.466 1.00 58.27  ? 580  ARG B NH2   1 
ATOM   6670  N  N     . GLU B 2  581 ? 132.359 101.634 136.482 1.00 58.67  ? 581  GLU B N     1 
ATOM   6671  C  CA    . GLU B 2  581 ? 133.071 101.670 137.750 1.00 58.67  ? 581  GLU B CA    1 
ATOM   6672  C  C     . GLU B 2  581 ? 134.188 102.710 137.740 1.00 58.67  ? 581  GLU B C     1 
ATOM   6673  O  O     . GLU B 2  581 ? 134.580 103.203 138.802 1.00 58.67  ? 581  GLU B O     1 
ATOM   6674  C  CB    . GLU B 2  581 ? 133.605 100.271 138.061 1.00 58.67  ? 581  GLU B CB    1 
ATOM   6675  C  CG    . GLU B 2  581 ? 134.613 99.744  137.050 1.00 58.67  ? 581  GLU B CG    1 
ATOM   6676  C  CD    . GLU B 2  581 ? 135.003 98.300  137.296 1.00 58.67  ? 581  GLU B CD    1 
ATOM   6677  O  OE1   . GLU B 2  581 ? 134.432 97.677  138.214 1.00 58.67  ? 581  GLU B OE1   1 
ATOM   6678  O  OE2   . GLU B 2  581 ? 135.887 97.789  136.577 1.00 58.67  ? 581  GLU B OE2   1 
ATOM   6679  N  N     . PHE B 2  582 ? 134.709 103.055 136.557 1.00 48.80  ? 582  PHE B N     1 
ATOM   6680  C  CA    . PHE B 2  582 ? 135.633 104.178 136.431 1.00 48.80  ? 582  PHE B CA    1 
ATOM   6681  C  C     . PHE B 2  582 ? 134.894 105.505 136.317 1.00 48.80  ? 582  PHE B C     1 
ATOM   6682  O  O     . PHE B 2  582 ? 135.428 106.540 136.726 1.00 48.80  ? 582  PHE B O     1 
ATOM   6683  C  CB    . PHE B 2  582 ? 136.539 103.994 135.210 1.00 48.80  ? 582  PHE B CB    1 
ATOM   6684  C  CG    . PHE B 2  582 ? 137.507 102.854 135.327 1.00 48.80  ? 582  PHE B CG    1 
ATOM   6685  C  CD1   . PHE B 2  582 ? 138.703 103.014 136.002 1.00 48.80  ? 582  PHE B CD1   1 
ATOM   6686  C  CD2   . PHE B 2  582 ? 137.229 101.626 134.750 1.00 48.80  ? 582  PHE B CD2   1 
ATOM   6687  C  CE1   . PHE B 2  582 ? 139.604 101.970 136.108 1.00 48.80  ? 582  PHE B CE1   1 
ATOM   6688  C  CE2   . PHE B 2  582 ? 138.127 100.577 134.854 1.00 48.80  ? 582  PHE B CE2   1 
ATOM   6689  C  CZ    . PHE B 2  582 ? 139.314 100.751 135.533 1.00 48.80  ? 582  PHE B CZ    1 
ATOM   6690  N  N     . ILE B 2  583 ? 133.683 105.496 135.753 1.00 46.77  ? 583  ILE B N     1 
ATOM   6691  C  CA    . ILE B 2  583 ? 132.901 106.723 135.617 1.00 46.77  ? 583  ILE B CA    1 
ATOM   6692  C  C     . ILE B 2  583 ? 132.395 107.202 136.975 1.00 46.77  ? 583  ILE B C     1 
ATOM   6693  O  O     . ILE B 2  583 ? 132.444 108.402 137.277 1.00 46.77  ? 583  ILE B O     1 
ATOM   6694  C  CB    . ILE B 2  583 ? 131.759 106.518 134.594 1.00 46.77  ? 583  ILE B CB    1 
ATOM   6695  C  CG1   . ILE B 2  583 ? 132.282 106.665 133.161 1.00 46.77  ? 583  ILE B CG1   1 
ATOM   6696  C  CG2   . ILE B 2  583 ? 130.586 107.468 134.820 1.00 46.77  ? 583  ILE B CG2   1 
ATOM   6697  C  CD1   . ILE B 2  583 ? 132.763 105.412 132.522 1.00 46.77  ? 583  ILE B CD1   1 
ATOM   6698  N  N     . GLU B 2  584 ? 131.938 106.276 137.828 1.00 53.91  ? 584  GLU B N     1 
ATOM   6699  C  CA    . GLU B 2  584 ? 131.473 106.641 139.165 1.00 53.91  ? 584  GLU B CA    1 
ATOM   6700  C  C     . GLU B 2  584 ? 132.593 107.179 140.051 1.00 53.91  ? 584  GLU B C     1 
ATOM   6701  O  O     . GLU B 2  584 ? 132.318 107.946 140.979 1.00 53.91  ? 584  GLU B O     1 
ATOM   6702  C  CB    . GLU B 2  584 ? 130.789 105.448 139.839 1.00 53.91  ? 584  GLU B CB    1 
ATOM   6703  C  CG    . GLU B 2  584 ? 131.694 104.268 140.138 1.00 53.91  ? 584  GLU B CG    1 
ATOM   6704  C  CD    . GLU B 2  584 ? 130.948 103.111 140.772 1.00 53.91  ? 584  GLU B CD    1 
ATOM   6705  O  OE1   . GLU B 2  584 ? 129.722 103.233 140.970 1.00 53.91  ? 584  GLU B OE1   1 
ATOM   6706  O  OE2   . GLU B 2  584 ? 131.585 102.078 141.065 1.00 53.91  ? 584  GLU B OE2   1 
ATOM   6707  N  N     . HIS B 2  585 ? 133.840 106.802 139.780 1.00 49.77  ? 585  HIS B N     1 
ATOM   6708  C  CA    . HIS B 2  585 ? 135.009 107.368 140.433 1.00 49.77  ? 585  HIS B CA    1 
ATOM   6709  C  C     . HIS B 2  585 ? 135.680 108.452 139.607 1.00 49.77  ? 585  HIS B C     1 
ATOM   6710  O  O     . HIS B 2  585 ? 136.708 108.987 140.035 1.00 49.77  ? 585  HIS B O     1 
ATOM   6711  C  CB    . HIS B 2  585 ? 135.997 106.251 140.754 1.00 49.77  ? 585  HIS B CB    1 
ATOM   6712  C  CG    . HIS B 2  585 ? 135.598 105.438 141.941 1.00 49.77  ? 585  HIS B CG    1 
ATOM   6713  N  ND1   . HIS B 2  585 ? 136.046 105.716 143.213 1.00 49.77  ? 585  HIS B ND1   1 
ATOM   6714  C  CD2   . HIS B 2  585 ? 134.692 104.443 142.071 1.00 49.77  ? 585  HIS B CD2   1 
ATOM   6715  C  CE1   . HIS B 2  585 ? 135.501 104.866 144.064 1.00 49.77  ? 585  HIS B CE1   1 
ATOM   6716  N  NE2   . HIS B 2  585 ? 134.672 104.084 143.396 1.00 49.77  ? 585  HIS B NE2   1 
ATOM   6717  N  N     . LYS B 2  586 ? 135.117 108.772 138.435 1.00 45.54  ? 586  LYS B N     1 
ATOM   6718  C  CA    . LYS B 2  586 ? 135.526 109.881 137.564 1.00 45.54  ? 586  LYS B CA    1 
ATOM   6719  C  C     . LYS B 2  586 ? 136.978 109.763 137.109 1.00 45.54  ? 586  LYS B C     1 
ATOM   6720  O  O     . LYS B 2  586 ? 137.664 110.765 136.900 1.00 45.54  ? 586  LYS B O     1 
ATOM   6721  C  CB    . LYS B 2  586 ? 135.260 111.236 138.225 1.00 45.54  ? 586  LYS B CB    1 
ATOM   6722  C  CG    . LYS B 2  586 ? 133.780 111.471 138.467 1.00 45.54  ? 586  LYS B CG    1 
ATOM   6723  C  CD    . LYS B 2  586 ? 133.503 112.833 139.054 1.00 45.54  ? 586  LYS B CD    1 
ATOM   6724  C  CE    . LYS B 2  586 ? 133.669 113.904 137.996 1.00 45.54  ? 586  LYS B CE    1 
ATOM   6725  N  NZ    . LYS B 2  586 ? 132.634 113.777 136.929 1.00 45.54  ? 586  LYS B NZ    1 
ATOM   6726  N  N     . MET B 2  587 ? 137.444 108.530 136.956 1.00 43.15  ? 587  MET B N     1 
ATOM   6727  C  CA    . MET B 2  587 ? 138.724 108.221 136.347 1.00 43.15  ? 587  MET B CA    1 
ATOM   6728  C  C     . MET B 2  587 ? 138.633 108.151 134.834 1.00 43.15  ? 587  MET B C     1 
ATOM   6729  O  O     . MET B 2  587 ? 139.665 108.091 134.160 1.00 43.15  ? 587  MET B O     1 
ATOM   6730  C  CB    . MET B 2  587 ? 139.223 106.891 136.890 1.00 43.15  ? 587  MET B CB    1 
ATOM   6731  C  CG    . MET B 2  587 ? 139.512 106.922 138.366 1.00 43.15  ? 587  MET B CG    1 
ATOM   6732  S  SD    . MET B 2  587 ? 139.725 105.250 138.954 1.00 43.15  ? 587  MET B SD    1 
ATOM   6733  C  CE    . MET B 2  587 ? 141.154 104.813 138.003 1.00 43.15  ? 587  MET B CE    1 
ATOM   6734  N  N     . ALA B 2  588 ? 137.416 108.137 134.304 1.00 35.92  ? 588  ALA B N     1 
ATOM   6735  C  CA    . ALA B 2  588 ? 137.140 108.142 132.880 1.00 35.92  ? 588  ALA B CA    1 
ATOM   6736  C  C     . ALA B 2  588 ? 135.791 108.809 132.704 1.00 35.92  ? 588  ALA B C     1 
ATOM   6737  O  O     . ALA B 2  588 ? 134.893 108.614 133.525 1.00 35.92  ? 588  ALA B O     1 
ATOM   6738  C  CB    . ALA B 2  588 ? 137.121 106.727 132.298 1.00 35.92  ? 588  ALA B CB    1 
ATOM   6739  N  N     . ASN B 2  589 ? 135.657 109.614 131.662 1.00 32.10  ? 589  ASN B N     1 
ATOM   6740  C  CA    . ASN B 2  589 ? 134.415 110.318 131.400 1.00 32.10  ? 589  ASN B CA    1 
ATOM   6741  C  C     . ASN B 2  589 ? 133.864 109.887 130.052 1.00 32.10  ? 589  ASN B C     1 
ATOM   6742  O  O     . ASN B 2  589 ? 134.620 109.591 129.127 1.00 32.10  ? 589  ASN B O     1 
ATOM   6743  C  CB    . ASN B 2  589 ? 134.621 111.828 131.424 1.00 32.10  ? 589  ASN B CB    1 
ATOM   6744  C  CG    . ASN B 2  589 ? 134.962 112.340 132.802 1.00 32.10  ? 589  ASN B CG    1 
ATOM   6745  O  OD1   . ASN B 2  589 ? 134.385 111.906 133.796 1.00 32.10  ? 589  ASN B OD1   1 
ATOM   6746  N  ND2   . ASN B 2  589 ? 135.908 113.263 132.873 1.00 32.10  ? 589  ASN B ND2   1 
ATOM   6747  N  N     . ILE B 2  590 ? 132.541 109.839 129.949 1.00 32.66  ? 590  ILE B N     1 
ATOM   6748  C  CA    . ILE B 2  590 ? 131.864 109.517 128.700 1.00 32.66  ? 590  ILE B CA    1 
ATOM   6749  C  C     . ILE B 2  590 ? 130.964 110.686 128.344 1.00 32.66  ? 590  ILE B C     1 
ATOM   6750  O  O     . ILE B 2  590 ? 130.052 111.025 129.107 1.00 32.66  ? 590  ILE B O     1 
ATOM   6751  C  CB    . ILE B 2  590 ? 131.040 108.225 128.793 1.00 32.66  ? 590  ILE B CB    1 
ATOM   6752  C  CG1   . ILE B 2  590 ? 131.915 107.024 129.131 1.00 32.66  ? 590  ILE B CG1   1 
ATOM   6753  C  CG2   . ILE B 2  590 ? 130.334 107.975 127.492 1.00 32.66  ? 590  ILE B CG2   1 
ATOM   6754  C  CD1   . ILE B 2  590 ? 131.128 105.737 129.252 1.00 32.66  ? 590  ILE B CD1   1 
ATOM   6755  N  N     . THR B 2  591 ? 131.211 111.298 127.191 1.00 37.34  ? 591  THR B N     1 
ATOM   6756  C  CA    . THR B 2  591 ? 130.315 112.326 126.689 1.00 37.34  ? 591  THR B CA    1 
ATOM   6757  C  C     . THR B 2  591 ? 130.299 112.263 125.170 1.00 37.34  ? 591  THR B C     1 
ATOM   6758  O  O     . THR B 2  591 ? 131.186 111.678 124.542 1.00 37.34  ? 591  THR B O     1 
ATOM   6759  C  CB    . THR B 2  591 ? 130.713 113.723 127.184 1.00 37.34  ? 591  THR B CB    1 
ATOM   6760  O  OG1   . THR B 2  591 ? 129.687 114.661 126.843 1.00 37.34  ? 591  THR B OG1   1 
ATOM   6761  C  CG2   . THR B 2  591 ? 132.014 114.165 126.555 1.00 37.34  ? 591  THR B CG2   1 
ATOM   6762  N  N     . LYS B 2  592 ? 129.263 112.853 124.586 1.00 38.26  ? 592  LYS B N     1 
ATOM   6763  C  CA    . LYS B 2  592 ? 129.064 112.834 123.146 1.00 38.26  ? 592  LYS B CA    1 
ATOM   6764  C  C     . LYS B 2  592 ? 129.466 114.170 122.536 1.00 38.26  ? 592  LYS B C     1 
ATOM   6765  O  O     . LYS B 2  592 ? 129.313 115.226 123.153 1.00 38.26  ? 592  LYS B O     1 
ATOM   6766  C  CB    . LYS B 2  592 ? 127.607 112.528 122.798 1.00 38.26  ? 592  LYS B CB    1 
ATOM   6767  C  CG    . LYS B 2  592 ? 127.137 111.147 123.209 1.00 38.26  ? 592  LYS B CG    1 
ATOM   6768  C  CD    . LYS B 2  592 ? 125.699 110.919 122.777 1.00 38.26  ? 592  LYS B CD    1 
ATOM   6769  C  CE    . LYS B 2  592 ? 125.218 109.523 123.132 1.00 38.26  ? 592  LYS B CE    1 
ATOM   6770  N  NZ    . LYS B 2  592 ? 125.079 109.343 124.601 1.00 38.26  ? 592  LYS B NZ    1 
ATOM   6771  N  N     . ASN B 2  593 ? 129.982 114.113 121.314 1.00 42.84  ? 593  ASN B N     1 
ATOM   6772  C  CA    . ASN B 2  593 ? 130.399 115.313 120.609 1.00 42.84  ? 593  ASN B CA    1 
ATOM   6773  C  C     . ASN B 2  593 ? 129.251 115.853 119.755 1.00 42.84  ? 593  ASN B C     1 
ATOM   6774  O  O     . ASN B 2  593 ? 128.089 115.469 119.913 1.00 42.84  ? 593  ASN B O     1 
ATOM   6775  C  CB    . ASN B 2  593 ? 131.671 115.044 119.802 1.00 42.84  ? 593  ASN B CB    1 
ATOM   6776  C  CG    . ASN B 2  593 ? 131.523 113.907 118.812 1.00 42.84  ? 593  ASN B CG    1 
ATOM   6777  O  OD1   . ASN B 2  593 ? 130.460 113.311 118.674 1.00 42.84  ? 593  ASN B OD1   1 
ATOM   6778  N  ND2   . ASN B 2  593 ? 132.601 113.615 118.099 1.00 42.84  ? 593  ASN B ND2   1 
ATOM   6779  N  N     . ASN B 2  594 ? 129.575 116.759 118.839 1.00 44.61  ? 594  ASN B N     1 
ATOM   6780  C  CA    . ASN B 2  594 ? 128.592 117.415 117.991 1.00 44.61  ? 594  ASN B CA    1 
ATOM   6781  C  C     . ASN B 2  594 ? 128.169 116.574 116.794 1.00 44.61  ? 594  ASN B C     1 
ATOM   6782  O  O     . ASN B 2  594 ? 127.403 117.060 115.957 1.00 44.61  ? 594  ASN B O     1 
ATOM   6783  C  CB    . ASN B 2  594 ? 129.146 118.758 117.520 1.00 44.61  ? 594  ASN B CB    1 
ATOM   6784  C  CG    . ASN B 2  594 ? 129.253 119.760 118.643 1.00 44.61  ? 594  ASN B CG    1 
ATOM   6785  O  OD1   . ASN B 2  594 ? 128.347 119.878 119.466 1.00 44.61  ? 594  ASN B OD1   1 
ATOM   6786  N  ND2   . ASN B 2  594 ? 130.367 120.479 118.695 1.00 44.61  ? 594  ASN B ND2   1 
ATOM   6787  N  N     . SER B 2  595 ? 128.638 115.334 116.688 1.00 43.02  ? 595  SER B N     1 
ATOM   6788  C  CA    . SER B 2  595 ? 128.209 114.438 115.629 1.00 43.02  ? 595  SER B CA    1 
ATOM   6789  C  C     . SER B 2  595 ? 127.531 113.176 116.138 1.00 43.02  ? 595  SER B C     1 
ATOM   6790  O  O     . SER B 2  595 ? 126.950 112.444 115.332 1.00 43.02  ? 595  SER B O     1 
ATOM   6791  C  CB    . SER B 2  595 ? 129.399 114.041 114.743 1.00 43.02  ? 595  SER B CB    1 
ATOM   6792  O  OG    . SER B 2  595 ? 130.346 113.288 115.473 1.00 43.02  ? 595  SER B OG    1 
ATOM   6793  N  N     . GLY B 2  596 ? 127.566 112.909 117.440 1.00 43.47  ? 596  GLY B N     1 
ATOM   6794  C  CA    . GLY B 2  596 ? 127.001 111.698 117.989 1.00 43.47  ? 596  GLY B CA    1 
ATOM   6795  C  C     . GLY B 2  596 ? 128.010 110.642 118.368 1.00 43.47  ? 596  GLY B C     1 
ATOM   6796  O  O     . GLY B 2  596 ? 127.612 109.586 118.874 1.00 43.47  ? 596  GLY B O     1 
ATOM   6797  N  N     . MET B 2  597 ? 129.294 110.880 118.117 1.00 42.34  ? 597  MET B N     1 
ATOM   6798  C  CA    . MET B 2  597 ? 130.336 109.975 118.577 1.00 42.34  ? 597  MET B CA    1 
ATOM   6799  C  C     . MET B 2  597 ? 130.405 110.025 120.092 1.00 42.34  ? 597  MET B C     1 
ATOM   6800  O  O     . MET B 2  597 ? 130.480 111.105 120.683 1.00 42.34  ? 597  MET B O     1 
ATOM   6801  C  CB    . MET B 2  597 ? 131.683 110.373 117.985 1.00 42.34  ? 597  MET B CB    1 
ATOM   6802  C  CG    . MET B 2  597 ? 131.730 110.327 116.489 1.00 42.34  ? 597  MET B CG    1 
ATOM   6803  S  SD    . MET B 2  597 ? 133.306 110.829 115.788 1.00 42.34  ? 597  MET B SD    1 
ATOM   6804  C  CE    . MET B 2  597 ? 132.947 110.669 114.044 1.00 42.34  ? 597  MET B CE    1 
ATOM   6805  N  N     . GLU B 2  598 ? 130.375 108.864 120.725 1.00 38.40  ? 598  GLU B N     1 
ATOM   6806  C  CA    . GLU B 2  598 ? 130.351 108.784 122.179 1.00 38.40  ? 598  GLU B CA    1 
ATOM   6807  C  C     . GLU B 2  598 ? 131.792 108.569 122.634 1.00 38.40  ? 598  GLU B C     1 
ATOM   6808  O  O     . GLU B 2  598 ? 132.315 107.456 122.584 1.00 38.40  ? 598  GLU B O     1 
ATOM   6809  C  CB    . GLU B 2  598 ? 129.402 107.680 122.630 1.00 38.40  ? 598  GLU B CB    1 
ATOM   6810  C  CG    . GLU B 2  598 ? 129.031 107.746 124.087 1.00 38.40  ? 598  GLU B CG    1 
ATOM   6811  C  CD    . GLU B 2  598 ? 127.941 106.762 124.462 1.00 38.40  ? 598  GLU B CD    1 
ATOM   6812  O  OE1   . GLU B 2  598 ? 127.504 105.992 123.582 1.00 38.40  ? 598  GLU B OE1   1 
ATOM   6813  O  OE2   . GLU B 2  598 ? 127.509 106.769 125.634 1.00 38.40  ? 598  GLU B OE2   1 
ATOM   6814  N  N     . ILE B 2  599 ? 132.437 109.653 123.055 1.00 32.49  ? 599  ILE B N     1 
ATOM   6815  C  CA    . ILE B 2  599 ? 133.872 109.680 123.315 1.00 32.49  ? 599  ILE B CA    1 
ATOM   6816  C  C     . ILE B 2  599 ? 134.112 109.281 124.764 1.00 32.49  ? 599  ILE B C     1 
ATOM   6817  O  O     . ILE B 2  599 ? 133.422 109.764 125.668 1.00 32.49  ? 599  ILE B O     1 
ATOM   6818  C  CB    . ILE B 2  599 ? 134.443 111.084 123.044 1.00 32.49  ? 599  ILE B CB    1 
ATOM   6819  C  CG1   . ILE B 2  599 ? 134.008 111.609 121.673 1.00 32.49  ? 599  ILE B CG1   1 
ATOM   6820  C  CG2   . ILE B 2  599 ? 135.958 111.080 123.127 1.00 32.49  ? 599  ILE B CG2   1 
ATOM   6821  C  CD1   . ILE B 2  599 ? 134.551 110.848 120.507 1.00 32.49  ? 599  ILE B CD1   1 
ATOM   6822  N  N     . ILE B 2  600 ? 135.090 108.408 125.000 1.00 31.77  ? 600  ILE B N     1 
ATOM   6823  C  CA    . ILE B 2  600 ? 135.532 108.086 126.352 1.00 31.77  ? 600  ILE B CA    1 
ATOM   6824  C  C     . ILE B 2  600 ? 136.936 108.654 126.539 1.00 31.77  ? 600  ILE B C     1 
ATOM   6825  O  O     . ILE B 2  600 ? 137.789 108.547 125.651 1.00 31.77  ? 600  ILE B O     1 
ATOM   6826  C  CB    . ILE B 2  600 ? 135.444 106.575 126.652 1.00 31.77  ? 600  ILE B CB    1 
ATOM   6827  C  CG1   . ILE B 2  600 ? 136.391 105.717 125.824 1.00 31.77  ? 600  ILE B CG1   1 
ATOM   6828  C  CG2   . ILE B 2  600 ? 134.057 106.069 126.341 1.00 31.77  ? 600  ILE B CG2   1 
ATOM   6829  C  CD1   . ILE B 2  600 ? 136.399 104.287 126.260 1.00 31.77  ? 600  ILE B CD1   1 
ATOM   6830  N  N     . TRP B 2  601 ? 137.155 109.322 127.668 1.00 29.84  ? 601  TRP B N     1 
ATOM   6831  C  CA    . TRP B 2  601 ? 138.380 110.084 127.846 1.00 29.84  ? 601  TRP B CA    1 
ATOM   6832  C  C     . TRP B 2  601 ? 138.734 110.177 129.320 1.00 29.84  ? 601  TRP B C     1 
ATOM   6833  O  O     . TRP B 2  601 ? 137.879 110.046 130.199 1.00 29.84  ? 601  TRP B O     1 
ATOM   6834  C  CB    . TRP B 2  601 ? 138.262 111.474 127.209 1.00 29.84  ? 601  TRP B CB    1 
ATOM   6835  C  CG    . TRP B 2  601 ? 137.088 112.289 127.638 1.00 29.84  ? 601  TRP B CG    1 
ATOM   6836  C  CD1   . TRP B 2  601 ? 135.832 112.239 127.121 1.00 29.84  ? 601  TRP B CD1   1 
ATOM   6837  C  CD2   . TRP B 2  601 ? 137.073 113.322 128.624 1.00 29.84  ? 601  TRP B CD2   1 
ATOM   6838  N  NE1   . TRP B 2  601 ? 135.026 113.153 127.743 1.00 29.84  ? 601  TRP B NE1   1 
ATOM   6839  C  CE2   . TRP B 2  601 ? 135.765 113.832 128.672 1.00 29.84  ? 601  TRP B CE2   1 
ATOM   6840  C  CE3   . TRP B 2  601 ? 138.035 113.852 129.485 1.00 29.84  ? 601  TRP B CE3   1 
ATOM   6841  C  CZ2   . TRP B 2  601 ? 135.395 114.850 129.541 1.00 29.84  ? 601  TRP B CZ2   1 
ATOM   6842  C  CZ3   . TRP B 2  601 ? 137.666 114.861 130.349 1.00 29.84  ? 601  TRP B CZ3   1 
ATOM   6843  C  CH2   . TRP B 2  601 ? 136.358 115.351 130.370 1.00 29.84  ? 601  TRP B CH2   1 
ATOM   6844  N  N     . VAL B 2  602 ? 140.013 110.401 129.574 1.00 34.50  ? 602  VAL B N     1 
ATOM   6845  C  CA    . VAL B 2  602 ? 140.591 110.370 130.915 1.00 34.50  ? 602  VAL B CA    1 
ATOM   6846  C  C     . VAL B 2  602 ? 141.015 111.786 131.278 1.00 34.50  ? 602  VAL B C     1 
ATOM   6847  O  O     . VAL B 2  602 ? 141.757 112.413 130.514 1.00 34.50  ? 602  VAL B O     1 
ATOM   6848  C  CB    . VAL B 2  602 ? 141.783 109.397 130.991 1.00 34.50  ? 602  VAL B CB    1 
ATOM   6849  C  CG1   . VAL B 2  602 ? 142.422 109.416 132.354 1.00 34.50  ? 602  VAL B CG1   1 
ATOM   6850  C  CG2   . VAL B 2  602 ? 141.312 108.000 130.645 1.00 34.50  ? 602  VAL B CG2   1 
ATOM   6851  N  N     . PRO B 2  603 ? 140.582 112.316 132.417 1.00 35.73  ? 603  PRO B N     1 
ATOM   6852  C  CA    . PRO B 2  603 ? 140.716 113.754 132.681 1.00 35.73  ? 603  PRO B CA    1 
ATOM   6853  C  C     . PRO B 2  603 ? 142.073 114.210 133.192 1.00 35.73  ? 603  PRO B C     1 
ATOM   6854  O  O     . PRO B 2  603 ? 142.104 115.157 133.975 1.00 35.73  ? 603  PRO B O     1 
ATOM   6855  C  CB    . PRO B 2  603 ? 139.635 114.009 133.735 1.00 35.73  ? 603  PRO B CB    1 
ATOM   6856  C  CG    . PRO B 2  603 ? 139.527 112.727 134.454 1.00 35.73  ? 603  PRO B CG    1 
ATOM   6857  C  CD    . PRO B 2  603 ? 139.743 111.656 133.434 1.00 35.73  ? 603  PRO B CD    1 
ATOM   6858  N  N     . TYR B 2  604 ? 143.161 113.504 132.902 1.00 41.36  ? 604  TYR B N     1 
ATOM   6859  C  CA    . TYR B 2  604 ? 144.454 113.796 133.509 1.00 41.36  ? 604  TYR B CA    1 
ATOM   6860  C  C     . TYR B 2  604 ? 145.392 114.410 132.473 1.00 41.36  ? 604  TYR B C     1 
ATOM   6861  O  O     . TYR B 2  604 ? 145.169 114.298 131.266 1.00 41.36  ? 604  TYR B O     1 
ATOM   6862  C  CB    . TYR B 2  604 ? 145.055 112.515 134.105 1.00 41.36  ? 604  TYR B CB    1 
ATOM   6863  C  CG    . TYR B 2  604 ? 144.174 111.880 135.168 1.00 41.36  ? 604  TYR B CG    1 
ATOM   6864  C  CD1   . TYR B 2  604 ? 143.310 112.653 135.941 1.00 41.36  ? 604  TYR B CD1   1 
ATOM   6865  C  CD2   . TYR B 2  604 ? 144.142 110.504 135.338 1.00 41.36  ? 604  TYR B CD2   1 
ATOM   6866  C  CE1   . TYR B 2  604 ? 142.481 112.082 136.870 1.00 41.36  ? 604  TYR B CE1   1 
ATOM   6867  C  CE2   . TYR B 2  604 ? 143.306 109.922 136.272 1.00 41.36  ? 604  TYR B CE2   1 
ATOM   6868  C  CZ    . TYR B 2  604 ? 142.481 110.723 137.033 1.00 41.36  ? 604  TYR B CZ    1 
ATOM   6869  O  OH    . TYR B 2  604 ? 141.642 110.181 137.971 1.00 41.36  ? 604  TYR B OH    1 
ATOM   6870  N  N     . THR B 2  605 ? 146.449 115.074 132.949 1.00 49.29  ? 605  THR B N     1 
ATOM   6871  C  CA    . THR B 2  605 ? 147.411 115.679 132.036 1.00 49.29  ? 605  THR B CA    1 
ATOM   6872  C  C     . THR B 2  605 ? 148.298 114.601 131.424 1.00 49.29  ? 605  THR B C     1 
ATOM   6873  O  O     . THR B 2  605 ? 148.283 113.448 131.845 1.00 49.29  ? 605  THR B O     1 
ATOM   6874  C  CB    . THR B 2  605 ? 148.296 116.708 132.737 1.00 49.29  ? 605  THR B CB    1 
ATOM   6875  O  OG1   . THR B 2  605 ? 149.193 116.037 133.626 1.00 49.29  ? 605  THR B OG1   1 
ATOM   6876  C  CG2   . THR B 2  605 ? 147.464 117.685 133.537 1.00 49.29  ? 605  THR B CG2   1 
ATOM   6877  N  N     . TYR B 2  606 ? 149.105 115.002 130.435 1.00 50.82  ? 606  TYR B N     1 
ATOM   6878  C  CA    . TYR B 2  606 ? 149.937 114.045 129.709 1.00 50.82  ? 606  TYR B CA    1 
ATOM   6879  C  C     . TYR B 2  606 ? 151.059 113.498 130.583 1.00 50.82  ? 606  TYR B C     1 
ATOM   6880  O  O     . TYR B 2  606 ? 151.397 112.312 130.495 1.00 50.82  ? 606  TYR B O     1 
ATOM   6881  C  CB    . TYR B 2  606 ? 150.518 114.702 128.458 1.00 50.82  ? 606  TYR B CB    1 
ATOM   6882  C  CG    . TYR B 2  606 ? 151.305 113.765 127.570 1.00 50.82  ? 606  TYR B CG    1 
ATOM   6883  C  CD1   . TYR B 2  606 ? 150.657 112.876 126.726 1.00 50.82  ? 606  TYR B CD1   1 
ATOM   6884  C  CD2   . TYR B 2  606 ? 152.695 113.773 127.572 1.00 50.82  ? 606  TYR B CD2   1 
ATOM   6885  C  CE1   . TYR B 2  606 ? 151.367 112.025 125.908 1.00 50.82  ? 606  TYR B CE1   1 
ATOM   6886  C  CE2   . TYR B 2  606 ? 153.415 112.917 126.758 1.00 50.82  ? 606  TYR B CE2   1 
ATOM   6887  C  CZ    . TYR B 2  606 ? 152.743 112.044 125.929 1.00 50.82  ? 606  TYR B CZ    1 
ATOM   6888  O  OH    . TYR B 2  606 ? 153.448 111.188 125.114 1.00 50.82  ? 606  TYR B OH    1 
ATOM   6889  N  N     . ALA B 2  607 ? 151.647 114.344 131.431 1.00 47.85  ? 607  ALA B N     1 
ATOM   6890  C  CA    . ALA B 2  607 ? 152.724 113.889 132.303 1.00 47.85  ? 607  ALA B CA    1 
ATOM   6891  C  C     . ALA B 2  607 ? 152.197 113.035 133.446 1.00 47.85  ? 607  ALA B C     1 
ATOM   6892  O  O     . ALA B 2  607 ? 152.882 112.108 133.891 1.00 47.85  ? 607  ALA B O     1 
ATOM   6893  C  CB    . ALA B 2  607 ? 153.501 115.087 132.845 1.00 47.85  ? 607  ALA B CB    1 
ATOM   6894  N  N     . GLU B 2  608 ? 150.987 113.324 133.929 1.00 52.82  ? 608  GLU B N     1 
ATOM   6895  C  CA    . GLU B 2  608 ? 150.356 112.476 134.933 1.00 52.82  ? 608  GLU B CA    1 
ATOM   6896  C  C     . GLU B 2  608 ? 149.834 111.180 134.339 1.00 52.82  ? 608  GLU B C     1 
ATOM   6897  O  O     . GLU B 2  608 ? 149.539 110.242 135.085 1.00 52.82  ? 608  GLU B O     1 
ATOM   6898  C  CB    . GLU B 2  608 ? 149.201 113.217 135.603 1.00 52.82  ? 608  GLU B CB    1 
ATOM   6899  C  CG    . GLU B 2  608 ? 149.608 114.427 136.409 1.00 52.82  ? 608  GLU B CG    1 
ATOM   6900  C  CD    . GLU B 2  608 ? 148.412 115.178 136.949 1.00 52.82  ? 608  GLU B CD    1 
ATOM   6901  O  OE1   . GLU B 2  608 ? 147.269 114.761 136.668 1.00 52.82  ? 608  GLU B OE1   1 
ATOM   6902  O  OE2   . GLU B 2  608 ? 148.615 116.205 137.627 1.00 52.82  ? 608  GLU B OE2   1 
ATOM   6903  N  N     . LEU B 2  609 ? 149.707 111.116 133.017 1.00 50.67  ? 609  LEU B N     1 
ATOM   6904  C  CA    . LEU B 2  609 ? 149.160 109.949 132.347 1.00 50.67  ? 609  LEU B CA    1 
ATOM   6905  C  C     . LEU B 2  609 ? 150.249 108.945 132.017 1.00 50.67  ? 609  LEU B C     1 
ATOM   6906  O  O     . LEU B 2  609 ? 149.989 107.737 131.999 1.00 50.67  ? 609  LEU B O     1 
ATOM   6907  C  CB    . LEU B 2  609 ? 148.458 110.382 131.059 1.00 50.67  ? 609  LEU B CB    1 
ATOM   6908  C  CG    . LEU B 2  609 ? 147.253 109.627 130.539 1.00 50.67  ? 609  LEU B CG    1 
ATOM   6909  C  CD1   . LEU B 2  609 ? 146.148 109.906 131.524 1.00 50.67  ? 609  LEU B CD1   1 
ATOM   6910  C  CD2   . LEU B 2  609 ? 146.872 110.117 129.162 1.00 50.67  ? 609  LEU B CD2   1 
ATOM   6911  N  N     . GLU B 2  610 ? 151.466 109.428 131.753 1.00 56.89  ? 610  GLU B N     1 
ATOM   6912  C  CA    . GLU B 2  610 ? 152.592 108.539 131.507 1.00 56.89  ? 610  GLU B CA    1 
ATOM   6913  C  C     . GLU B 2  610 ? 153.253 108.097 132.803 1.00 56.89  ? 610  GLU B C     1 
ATOM   6914  O  O     . GLU B 2  610 ? 153.849 107.016 132.846 1.00 56.89  ? 610  GLU B O     1 
ATOM   6915  C  CB    . GLU B 2  610 ? 153.600 109.214 130.568 1.00 56.89  ? 610  GLU B CB    1 
ATOM   6916  C  CG    . GLU B 2  610 ? 154.217 110.515 131.074 1.00 56.89  ? 610  GLU B CG    1 
ATOM   6917  C  CD    . GLU B 2  610 ? 155.547 110.310 131.772 1.00 56.89  ? 610  GLU B CD    1 
ATOM   6918  O  OE1   . GLU B 2  610 ? 156.192 109.271 131.524 1.00 56.89  ? 610  GLU B OE1   1 
ATOM   6919  O  OE2   . GLU B 2  610 ? 155.949 111.187 132.565 1.00 56.89  ? 610  GLU B OE2   1 
ATOM   6920  N  N     . LYS B 2  611 ? 153.150 108.900 133.863 1.00 55.27  ? 611  LYS B N     1 
ATOM   6921  C  CA    . LYS B 2  611 ? 153.614 108.447 135.170 1.00 55.27  ? 611  LYS B CA    1 
ATOM   6922  C  C     . LYS B 2  611 ? 152.717 107.343 135.710 1.00 55.27  ? 611  LYS B C     1 
ATOM   6923  O  O     . LYS B 2  611 ? 153.208 106.358 136.269 1.00 55.27  ? 611  LYS B O     1 
ATOM   6924  C  CB    . LYS B 2  611 ? 153.683 109.626 136.146 1.00 55.27  ? 611  LYS B CB    1 
ATOM   6925  C  CG    . LYS B 2  611 ? 154.252 109.278 137.521 1.00 55.27  ? 611  LYS B CG    1 
ATOM   6926  C  CD    . LYS B 2  611 ? 153.175 109.190 138.600 1.00 55.27  ? 611  LYS B CD    1 
ATOM   6927  C  CE    . LYS B 2  611 ? 153.757 108.723 139.925 1.00 55.27  ? 611  LYS B CE    1 
ATOM   6928  N  NZ    . LYS B 2  611 ? 154.747 109.675 140.488 1.00 55.27  ? 611  LYS B NZ    1 
ATOM   6929  N  N     . LEU B 2  612 ? 151.400 107.488 135.538 1.00 51.64  ? 612  LEU B N     1 
ATOM   6930  C  CA    . LEU B 2  612 ? 150.453 106.483 136.010 1.00 51.64  ? 612  LEU B CA    1 
ATOM   6931  C  C     . LEU B 2  612 ? 150.546 105.199 135.198 1.00 51.64  ? 612  LEU B C     1 
ATOM   6932  O  O     . LEU B 2  612 ? 150.250 104.117 135.717 1.00 51.64  ? 612  LEU B O     1 
ATOM   6933  C  CB    . LEU B 2  612 ? 149.036 107.062 135.960 1.00 51.64  ? 612  LEU B CB    1 
ATOM   6934  C  CG    . LEU B 2  612 ? 147.833 106.375 136.611 1.00 51.64  ? 612  LEU B CG    1 
ATOM   6935  C  CD1   . LEU B 2  612 ? 146.871 107.439 137.093 1.00 51.64  ? 612  LEU B CD1   1 
ATOM   6936  C  CD2   . LEU B 2  612 ? 147.112 105.458 135.646 1.00 51.64  ? 612  LEU B CD2   1 
ATOM   6937  N  N     . LEU B 2  613 ? 150.950 105.300 133.930 1.00 54.86  ? 613  LEU B N     1 
ATOM   6938  C  CA    . LEU B 2  613 ? 151.049 104.121 133.079 1.00 54.86  ? 613  LEU B CA    1 
ATOM   6939  C  C     . LEU B 2  613 ? 152.213 103.232 133.492 1.00 54.86  ? 613  LEU B C     1 
ATOM   6940  O  O     . LEU B 2  613 ? 152.142 102.006 133.348 1.00 54.86  ? 613  LEU B O     1 
ATOM   6941  C  CB    . LEU B 2  613 ? 151.196 104.549 131.619 1.00 54.86  ? 613  LEU B CB    1 
ATOM   6942  C  CG    . LEU B 2  613 ? 151.155 103.464 130.546 1.00 54.86  ? 613  LEU B CG    1 
ATOM   6943  C  CD1   . LEU B 2  613 ? 149.783 102.810 130.519 1.00 54.86  ? 613  LEU B CD1   1 
ATOM   6944  C  CD2   . LEU B 2  613 ? 151.516 104.035 129.185 1.00 54.86  ? 613  LEU B CD2   1 
ATOM   6945  N  N     . LYS B 2  614 ? 153.275 103.824 134.030 1.00 54.90  ? 614  LYS B N     1 
ATOM   6946  C  CA    . LYS B 2  614 ? 154.479 103.079 134.363 1.00 54.90  ? 614  LYS B CA    1 
ATOM   6947  C  C     . LYS B 2  614 ? 154.486 102.553 135.791 1.00 54.90  ? 614  LYS B C     1 
ATOM   6948  O  O     . LYS B 2  614 ? 155.067 101.493 136.045 1.00 54.90  ? 614  LYS B O     1 
ATOM   6949  C  CB    . LYS B 2  614 ? 155.710 103.961 134.146 1.00 54.90  ? 614  LYS B CB    1 
ATOM   6950  C  CG    . LYS B 2  614 ? 155.922 104.371 132.702 1.00 54.90  ? 614  LYS B CG    1 
ATOM   6951  C  CD    . LYS B 2  614 ? 157.219 105.137 132.537 1.00 54.90  ? 614  LYS B CD    1 
ATOM   6952  C  CE    . LYS B 2  614 ? 157.108 106.525 133.142 1.00 54.90  ? 614  LYS B CE    1 
ATOM   6953  N  NZ    . LYS B 2  614 ? 158.317 107.355 132.887 1.00 54.90  ? 614  LYS B NZ    1 
ATOM   6954  N  N     . THR B 2  615 ? 153.848 103.251 136.732 1.00 57.74  ? 615  THR B N     1 
ATOM   6955  C  CA    . THR B 2  615 ? 154.055 102.905 138.132 1.00 57.74  ? 615  THR B CA    1 
ATOM   6956  C  C     . THR B 2  615 ? 153.111 101.806 138.620 1.00 57.74  ? 615  THR B C     1 
ATOM   6957  O  O     . THR B 2  615 ? 153.478 101.059 139.534 1.00 57.74  ? 615  THR B O     1 
ATOM   6958  C  CB    . THR B 2  615 ? 153.952 104.161 139.017 1.00 57.74  ? 615  THR B CB    1 
ATOM   6959  O  OG1   . THR B 2  615 ? 154.353 103.843 140.356 1.00 57.74  ? 615  THR B OG1   1 
ATOM   6960  C  CG2   . THR B 2  615 ? 152.542 104.752 139.044 1.00 57.74  ? 615  THR B CG2   1 
ATOM   6961  N  N     . VAL B 2  616 ? 151.903 101.680 138.059 1.00 58.92  ? 616  VAL B N     1 
ATOM   6962  C  CA    . VAL B 2  616 ? 150.976 100.657 138.537 1.00 58.92  ? 616  VAL B CA    1 
ATOM   6963  C  C     . VAL B 2  616 ? 150.558 99.735  137.395 1.00 58.92  ? 616  VAL B C     1 
ATOM   6964  O  O     . VAL B 2  616 ? 150.401 98.522  137.582 1.00 58.92  ? 616  VAL B O     1 
ATOM   6965  C  CB    . VAL B 2  616 ? 149.745 101.308 139.207 1.00 58.92  ? 616  VAL B CB    1 
ATOM   6966  C  CG1   . VAL B 2  616 ? 148.734 100.270 139.668 1.00 58.92  ? 616  VAL B CG1   1 
ATOM   6967  C  CG2   . VAL B 2  616 ? 150.160 102.140 140.396 1.00 58.92  ? 616  VAL B CG2   1 
ATOM   6968  N  N     . LEU B 2  617 ? 150.467 100.277 136.183 1.00 61.84  ? 617  LEU B N     1 
ATOM   6969  C  CA    . LEU B 2  617 ? 149.789 99.556  135.111 1.00 61.84  ? 617  LEU B CA    1 
ATOM   6970  C  C     . LEU B 2  617 ? 150.691 98.623  134.319 1.00 61.84  ? 617  LEU B C     1 
ATOM   6971  O  O     . LEU B 2  617 ? 150.236 97.552  133.902 1.00 61.84  ? 617  LEU B O     1 
ATOM   6972  C  CB    . LEU B 2  617 ? 149.123 100.541 134.149 1.00 61.84  ? 617  LEU B CB    1 
ATOM   6973  C  CG    . LEU B 2  617 ? 147.858 101.202 134.685 1.00 61.84  ? 617  LEU B CG    1 
ATOM   6974  C  CD1   . LEU B 2  617 ? 147.349 102.254 133.721 1.00 61.84  ? 617  LEU B CD1   1 
ATOM   6975  C  CD2   . LEU B 2  617 ? 146.815 100.132 134.899 1.00 61.84  ? 617  LEU B CD2   1 
ATOM   6976  N  N     . ASN B 2  618 ? 151.948 98.988  134.099 1.00 66.73  ? 618  ASN B N     1 
ATOM   6977  C  CA    . ASN B 2  618 ? 152.794 98.253  133.172 1.00 66.73  ? 618  ASN B CA    1 
ATOM   6978  C  C     . ASN B 2  618 ? 153.606 97.157  133.864 1.00 66.73  ? 618  ASN B C     1 
ATOM   6979  O  O     . ASN B 2  618 ? 154.461 96.535  133.227 1.00 66.73  ? 618  ASN B O     1 
ATOM   6980  C  CB    . ASN B 2  618 ? 153.716 99.235  132.436 1.00 66.73  ? 618  ASN B CB    1 
ATOM   6981  C  CG    . ASN B 2  618 ? 154.165 98.726  131.073 1.00 66.73  ? 618  ASN B CG    1 
ATOM   6982  O  OD1   . ASN B 2  618 ? 153.800 97.630  130.650 1.00 66.73  ? 618  ASN B OD1   1 
ATOM   6983  N  ND2   . ASN B 2  618 ? 154.946 99.538  130.371 1.00 66.73  ? 618  ASN B ND2   1 
ATOM   6984  N  N     . THR B 2  619 ? 153.350 96.890  135.146 1.00 69.27  ? 619  THR B N     1 
ATOM   6985  C  CA    . THR B 2  619 ? 154.070 95.815  135.819 1.00 69.27  ? 619  THR B CA    1 
ATOM   6986  C  C     . THR B 2  619 ? 153.458 94.442  135.562 1.00 69.27  ? 619  THR B C     1 
ATOM   6987  O  O     . THR B 2  619 ? 154.164 93.438  135.714 1.00 69.27  ? 619  THR B O     1 
ATOM   6988  C  CB    . THR B 2  619 ? 154.156 96.080  137.329 1.00 69.27  ? 619  THR B CB    1 
ATOM   6989  O  OG1   . THR B 2  619 ? 154.981 95.082  137.947 1.00 69.27  ? 619  THR B OG1   1 
ATOM   6990  C  CG2   . THR B 2  619 ? 152.774 96.086  137.987 1.00 69.27  ? 619  THR B CG2   1 
ATOM   6991  N  N     . LEU B 2  620 ? 152.183 94.390  135.163 1.00 30.00  ? 620  LEU B N     1 
ATOM   6992  C  CA    . LEU B 2  620 ? 151.431 93.163  134.843 1.00 30.00  ? 620  LEU B CA    1 
ATOM   6993  C  C     . LEU B 2  620 ? 151.442 92.104  135.951 1.00 30.00  ? 620  LEU B C     1 
ATOM   6994  O  O     . LEU B 2  620 ? 151.247 90.916  135.692 1.00 30.00  ? 620  LEU B O     1 
ATOM   6995  C  CB    . LEU B 2  620 ? 151.937 92.536  133.533 1.00 30.00  ? 620  LEU B CB    1 
ATOM   6996  C  CG    . LEU B 2  620 ? 151.304 92.971  132.202 1.00 30.00  ? 620  LEU B CG    1 
ATOM   6997  C  CD1   . LEU B 2  620 ? 149.815 92.633  132.173 1.00 30.00  ? 620  LEU B CD1   1 
ATOM   6998  C  CD2   . LEU B 2  620 ? 151.535 94.443  131.877 1.00 30.00  ? 620  LEU B CD2   1 
ATOM   6999  O  OXT   . LEU B 2  620 ? 151.644 92.405  137.126 1.00 30.00  ? 620  LEU B OXT   1 
ATOM   7000  N  N     . PHE C 3  15  ? 136.885 99.015  144.996 1.00 59.84  ? 15   PHE C N     1 
ATOM   7001  C  CA    . PHE C 3  15  ? 136.182 100.292 144.995 1.00 59.84  ? 15   PHE C CA    1 
ATOM   7002  C  C     . PHE C 3  15  ? 135.517 100.581 146.336 1.00 59.84  ? 15   PHE C C     1 
ATOM   7003  O  O     . PHE C 3  15  ? 134.341 100.274 146.531 1.00 59.84  ? 15   PHE C O     1 
ATOM   7004  C  CB    . PHE C 3  15  ? 135.124 100.325 143.893 1.00 59.84  ? 15   PHE C CB    1 
ATOM   7005  C  CG    . PHE C 3  15  ? 135.687 100.360 142.503 1.00 59.84  ? 15   PHE C CG    1 
ATOM   7006  C  CD1   . PHE C 3  15  ? 136.235 101.523 142.003 1.00 59.84  ? 15   PHE C CD1   1 
ATOM   7007  C  CD2   . PHE C 3  15  ? 135.634 99.246  141.687 1.00 59.84  ? 15   PHE C CD2   1 
ATOM   7008  C  CE1   . PHE C 3  15  ? 136.736 101.584 140.722 1.00 59.84  ? 15   PHE C CE1   1 
ATOM   7009  C  CE2   . PHE C 3  15  ? 136.137 99.294  140.404 1.00 59.84  ? 15   PHE C CE2   1 
ATOM   7010  C  CZ    . PHE C 3  15  ? 136.688 100.471 139.919 1.00 59.84  ? 15   PHE C CZ    1 
ATOM   7011  N  N     . ALA C 3  16  ? 136.270 101.175 147.255 1.00 45.65  ? 16   ALA C N     1 
ATOM   7012  C  CA    . ALA C 3  16  ? 135.714 101.532 148.548 1.00 45.65  ? 16   ALA C CA    1 
ATOM   7013  C  C     . ALA C 3  16  ? 134.833 102.770 148.428 1.00 45.65  ? 16   ALA C C     1 
ATOM   7014  O  O     . ALA C 3  16  ? 134.987 103.593 147.522 1.00 45.65  ? 16   ALA C O     1 
ATOM   7015  C  CB    . ALA C 3  16  ? 136.829 101.780 149.564 1.00 45.65  ? 16   ALA C CB    1 
ATOM   7016  N  N     . ASP C 3  17  ? 133.889 102.892 149.362 1.00 32.41  ? 17   ASP C N     1 
ATOM   7017  C  CA    . ASP C 3  17  ? 133.057 104.085 149.414 1.00 32.41  ? 17   ASP C CA    1 
ATOM   7018  C  C     . ASP C 3  17  ? 133.811 105.287 149.965 1.00 32.41  ? 17   ASP C C     1 
ATOM   7019  O  O     . ASP C 3  17  ? 133.458 106.424 149.641 1.00 32.41  ? 17   ASP C O     1 
ATOM   7020  C  CB    . ASP C 3  17  ? 131.791 103.803 150.228 1.00 32.41  ? 17   ASP C CB    1 
ATOM   7021  C  CG    . ASP C 3  17  ? 132.083 103.245 151.612 1.00 32.41  ? 17   ASP C CG    1 
ATOM   7022  O  OD1   . ASP C 3  17  ? 133.264 103.025 151.951 1.00 32.41  ? 17   ASP C OD1   1 
ATOM   7023  O  OD2   . ASP C 3  17  ? 131.115 103.008 152.362 1.00 32.41  ? 17   ASP C OD2   1 
ATOM   7024  N  N     . ALA C 3  18  ? 134.860 105.055 150.759 1.00 29.85  ? 18   ALA C N     1 
ATOM   7025  C  CA    . ALA C 3  18  ? 135.704 106.129 151.269 1.00 29.85  ? 18   ALA C CA    1 
ATOM   7026  C  C     . ALA C 3  18  ? 136.460 106.857 150.168 1.00 29.85  ? 18   ALA C C     1 
ATOM   7027  O  O     . ALA C 3  18  ? 136.842 108.015 150.358 1.00 29.85  ? 18   ALA C O     1 
ATOM   7028  C  CB    . ALA C 3  18  ? 136.705 105.570 152.279 1.00 29.85  ? 18   ALA C CB    1 
ATOM   7029  N  N     . GLN C 3  19  ? 136.684 106.208 149.029 1.00 36.81  ? 19   GLN C N     1 
ATOM   7030  C  CA    . GLN C 3  19  ? 137.403 106.816 147.924 1.00 36.81  ? 19   GLN C CA    1 
ATOM   7031  C  C     . GLN C 3  19  ? 136.470 107.421 146.888 1.00 36.81  ? 19   GLN C C     1 
ATOM   7032  O  O     . GLN C 3  19  ? 136.937 108.118 145.983 1.00 36.81  ? 19   GLN C O     1 
ATOM   7033  C  CB    . GLN C 3  19  ? 138.301 105.776 147.254 1.00 36.81  ? 19   GLN C CB    1 
ATOM   7034  C  CG    . GLN C 3  19  ? 139.142 104.973 148.233 1.00 36.81  ? 19   GLN C CG    1 
ATOM   7035  C  CD    . GLN C 3  19  ? 140.062 105.827 149.079 1.00 36.81  ? 19   GLN C CD    1 
ATOM   7036  O  OE1   . GLN C 3  19  ? 140.635 106.806 148.606 1.00 36.81  ? 19   GLN C OE1   1 
ATOM   7037  N  NE2   . GLN C 3  19  ? 140.212 105.452 150.343 1.00 36.81  ? 19   GLN C NE2   1 
ATOM   7038  N  N     . ARG C 3  20  ? 135.173 107.164 146.997 1.00 31.54  ? 20   ARG C N     1 
ATOM   7039  C  CA    . ARG C 3  20  ? 134.184 107.738 146.106 1.00 31.54  ? 20   ARG C CA    1 
ATOM   7040  C  C     . ARG C 3  20  ? 133.897 109.173 146.547 1.00 31.54  ? 20   ARG C C     1 
ATOM   7041  O  O     . ARG C 3  20  ? 134.308 109.609 147.623 1.00 31.54  ? 20   ARG C O     1 
ATOM   7042  C  CB    . ARG C 3  20  ? 132.920 106.866 146.120 1.00 31.54  ? 20   ARG C CB    1 
ATOM   7043  C  CG    . ARG C 3  20  ? 131.923 107.070 144.977 1.00 31.54  ? 20   ARG C CG    1 
ATOM   7044  C  CD    . ARG C 3  20  ? 130.735 106.135 145.075 1.00 31.54  ? 20   ARG C CD    1 
ATOM   7045  N  NE    . ARG C 3  20  ? 131.126 104.741 144.911 1.00 31.54  ? 20   ARG C NE    1 
ATOM   7046  C  CZ    . ARG C 3  20  ? 131.023 103.819 145.860 1.00 31.54  ? 20   ARG C CZ    1 
ATOM   7047  N  NH1   . ARG C 3  20  ? 130.529 104.136 147.047 1.00 31.54  ? 20   ARG C NH1   1 
ATOM   7048  N  NH2   . ARG C 3  20  ? 131.408 102.575 145.616 1.00 31.54  ? 20   ARG C NH2   1 
ATOM   7049  N  N     . SER C 3  21  ? 133.234 109.933 145.686 1.00 22.55  ? 21   SER C N     1 
ATOM   7050  C  CA    . SER C 3  21  ? 132.568 111.159 146.087 1.00 22.55  ? 21   SER C CA    1 
ATOM   7051  C  C     . SER C 3  21  ? 131.063 110.925 146.101 1.00 22.55  ? 21   SER C C     1 
ATOM   7052  O  O     . SER C 3  21  ? 130.532 110.241 145.222 1.00 22.55  ? 21   SER C O     1 
ATOM   7053  C  CB    . SER C 3  21  ? 132.923 112.302 145.141 1.00 22.55  ? 21   SER C CB    1 
ATOM   7054  O  OG    . SER C 3  21  ? 132.471 112.028 143.829 1.00 22.55  ? 21   SER C OG    1 
ATOM   7055  N  N     . HIS C 3  22  ? 130.394 111.493 147.107 1.00 17.26  ? 22   HIS C N     1 
ATOM   7056  C  CA    . HIS C 3  22  ? 128.931 111.560 147.285 1.00 17.26  ? 22   HIS C CA    1 
ATOM   7057  C  C     . HIS C 3  22  ? 128.245 110.187 147.177 1.00 17.26  ? 22   HIS C C     1 
ATOM   7058  O  O     . HIS C 3  22  ? 127.485 109.889 146.261 1.00 17.26  ? 22   HIS C O     1 
ATOM   7059  C  CB    . HIS C 3  22  ? 128.279 112.631 146.378 1.00 17.26  ? 22   HIS C CB    1 
ATOM   7060  C  CG    . HIS C 3  22  ? 128.353 112.383 144.897 1.00 17.26  ? 22   HIS C CG    1 
ATOM   7061  N  ND1   . HIS C 3  22  ? 129.452 112.713 144.136 1.00 17.26  ? 22   HIS C ND1   1 
ATOM   7062  C  CD2   . HIS C 3  22  ? 127.438 111.881 144.033 1.00 17.26  ? 22   HIS C CD2   1 
ATOM   7063  C  CE1   . HIS C 3  22  ? 129.228 112.388 142.876 1.00 17.26  ? 22   HIS C CE1   1 
ATOM   7064  N  NE2   . HIS C 3  22  ? 128.013 111.880 142.787 1.00 17.26  ? 22   HIS C NE2   1 
ATOM   7065  N  N     . TYR C 3  23  ? 128.497 109.342 148.164 1.00 18.90  ? 23   TYR C N     1 
ATOM   7066  C  CA    . TYR C 3  23  ? 127.709 108.122 148.222 1.00 18.90  ? 23   TYR C CA    1 
ATOM   7067  C  C     . TYR C 3  23  ? 126.627 108.233 149.290 1.00 18.90  ? 23   TYR C C     1 
ATOM   7068  O  O     . TYR C 3  23  ? 126.679 109.084 150.176 1.00 18.90  ? 23   TYR C O     1 
ATOM   7069  C  CB    . TYR C 3  23  ? 128.592 106.899 148.460 1.00 18.90  ? 23   TYR C CB    1 
ATOM   7070  C  CG    . TYR C 3  23  ? 129.208 106.750 149.826 1.00 18.90  ? 23   TYR C CG    1 
ATOM   7071  C  CD1   . TYR C 3  23  ? 130.394 107.387 150.151 1.00 18.90  ? 23   TYR C CD1   1 
ATOM   7072  C  CD2   . TYR C 3  23  ? 128.645 105.898 150.762 1.00 18.90  ? 23   TYR C CD2   1 
ATOM   7073  C  CE1   . TYR C 3  23  ? 130.969 107.221 151.390 1.00 18.90  ? 23   TYR C CE1   1 
ATOM   7074  C  CE2   . TYR C 3  23  ? 129.215 105.724 151.997 1.00 18.90  ? 23   TYR C CE2   1 
ATOM   7075  C  CZ    . TYR C 3  23  ? 130.377 106.380 152.306 1.00 18.90  ? 23   TYR C CZ    1 
ATOM   7076  O  OH    . TYR C 3  23  ? 130.944 106.197 153.545 1.00 18.90  ? 23   TYR C OH    1 
ATOM   7077  N  N     . THR C 3  24  ? 125.629 107.360 149.184 1.00 15.00  ? 24   THR C N     1 
ATOM   7078  C  CA    . THR C 3  24  ? 124.436 107.422 150.015 1.00 15.00  ? 24   THR C CA    1 
ATOM   7079  C  C     . THR C 3  24  ? 124.346 106.175 150.878 1.00 15.00  ? 24   THR C C     1 
ATOM   7080  O  O     . THR C 3  24  ? 124.385 105.054 150.363 1.00 15.00  ? 24   THR C O     1 
ATOM   7081  C  CB    . THR C 3  24  ? 123.174 107.545 149.164 1.00 15.00  ? 24   THR C CB    1 
ATOM   7082  O  OG1   . THR C 3  24  ? 123.286 108.686 148.309 1.00 15.00  ? 24   THR C OG1   1 
ATOM   7083  C  CG2   . THR C 3  24  ? 121.963 107.726 150.045 1.00 15.00  ? 24   THR C CG2   1 
ATOM   7084  N  N     . VAL C 3  25  ? 124.228 106.375 152.184 1.00 18.74  ? 25   VAL C N     1 
ATOM   7085  C  CA    . VAL C 3  25  ? 124.003 105.297 153.135 1.00 18.74  ? 25   VAL C CA    1 
ATOM   7086  C  C     . VAL C 3  25  ? 122.517 105.253 153.448 1.00 18.74  ? 25   VAL C C     1 
ATOM   7087  O  O     . VAL C 3  25  ? 121.902 106.291 153.714 1.00 18.74  ? 25   VAL C O     1 
ATOM   7088  C  CB    . VAL C 3  25  ? 124.834 105.501 154.413 1.00 18.74  ? 25   VAL C CB    1 
ATOM   7089  C  CG1   . VAL C 3  25  ? 124.510 104.444 155.452 1.00 18.74  ? 25   VAL C CG1   1 
ATOM   7090  C  CG2   . VAL C 3  25  ? 126.302 105.469 154.084 1.00 18.74  ? 25   VAL C CG2   1 
ATOM   7091  N  N     . TYR C 3  26  ? 121.933 104.066 153.363 1.00 25.74  ? 26   TYR C N     1 
ATOM   7092  C  CA    . TYR C 3  26  ? 120.619 103.794 153.920 1.00 25.74  ? 26   TYR C CA    1 
ATOM   7093  C  C     . TYR C 3  26  ? 120.852 103.009 155.202 1.00 25.74  ? 26   TYR C C     1 
ATOM   7094  O  O     . TYR C 3  26  ? 120.905 101.774 155.165 1.00 25.74  ? 26   TYR C O     1 
ATOM   7095  C  CB    . TYR C 3  26  ? 119.759 103.004 152.936 1.00 25.74  ? 26   TYR C CB    1 
ATOM   7096  C  CG    . TYR C 3  26  ? 119.340 103.771 151.703 1.00 25.74  ? 26   TYR C CG    1 
ATOM   7097  C  CD1   . TYR C 3  26  ? 119.297 105.156 151.699 1.00 25.74  ? 26   TYR C CD1   1 
ATOM   7098  C  CD2   . TYR C 3  26  ? 119.020 103.104 150.530 1.00 25.74  ? 26   TYR C CD2   1 
ATOM   7099  C  CE1   . TYR C 3  26  ? 118.921 105.851 150.569 1.00 25.74  ? 26   TYR C CE1   1 
ATOM   7100  C  CE2   . TYR C 3  26  ? 118.647 103.795 149.394 1.00 25.74  ? 26   TYR C CE2   1 
ATOM   7101  C  CZ    . TYR C 3  26  ? 118.602 105.170 149.422 1.00 25.74  ? 26   TYR C CZ    1 
ATOM   7102  O  OH    . TYR C 3  26  ? 118.231 105.870 148.298 1.00 25.74  ? 26   TYR C OH    1 
ATOM   7103  N  N     . PRO C 3  27  ? 121.020 103.675 156.340 1.00 27.07  ? 27   PRO C N     1 
ATOM   7104  C  CA    . PRO C 3  27  ? 121.517 102.990 157.534 1.00 27.07  ? 27   PRO C CA    1 
ATOM   7105  C  C     . PRO C 3  27  ? 120.460 102.113 158.185 1.00 27.07  ? 27   PRO C C     1 
ATOM   7106  O  O     . PRO C 3  27  ? 119.254 102.326 158.053 1.00 27.07  ? 27   PRO C O     1 
ATOM   7107  C  CB    . PRO C 3  27  ? 121.922 104.143 158.457 1.00 27.07  ? 27   PRO C CB    1 
ATOM   7108  C  CG    . PRO C 3  27  ? 121.053 105.253 158.047 1.00 27.07  ? 27   PRO C CG    1 
ATOM   7109  C  CD    . PRO C 3  27  ? 120.833 105.116 156.576 1.00 27.07  ? 27   PRO C CD    1 
ATOM   7110  N  N     . SER C 3  28  ? 120.951 101.100 158.892 1.00 36.13  ? 28   SER C N     1 
ATOM   7111  C  CA    . SER C 3  28  ? 120.104 100.108 159.532 1.00 36.13  ? 28   SER C CA    1 
ATOM   7112  C  C     . SER C 3  28  ? 119.660 100.611 160.896 1.00 36.13  ? 28   SER C C     1 
ATOM   7113  O  O     . SER C 3  28  ? 120.490 100.986 161.730 1.00 36.13  ? 28   SER C O     1 
ATOM   7114  C  CB    . SER C 3  28  ? 120.850 98.783  159.675 1.00 36.13  ? 28   SER C CB    1 
ATOM   7115  O  OG    . SER C 3  28  ? 121.942 98.917  160.567 1.00 36.13  ? 28   SER C OG    1 
ATOM   7116  N  N     . LEU C 3  29  ? 118.356 100.617 161.117 1.00 42.30  ? 29   LEU C N     1 
ATOM   7117  C  CA    . LEU C 3  29  ? 117.848 101.028 162.414 1.00 42.30  ? 29   LEU C CA    1 
ATOM   7118  C  C     . LEU C 3  29  ? 117.532 99.804  163.263 1.00 42.30  ? 29   LEU C C     1 
ATOM   7119  O  O     . LEU C 3  29  ? 117.046 98.795  162.738 1.00 42.30  ? 29   LEU C O     1 
ATOM   7120  C  CB    . LEU C 3  29  ? 116.597 101.902 162.259 1.00 42.30  ? 29   LEU C CB    1 
ATOM   7121  C  CG    . LEU C 3  29  ? 115.201 101.392 161.877 1.00 42.30  ? 29   LEU C CG    1 
ATOM   7122  C  CD1   . LEU C 3  29  ? 114.182 102.489 162.109 1.00 42.30  ? 29   LEU C CD1   1 
ATOM   7123  C  CD2   . LEU C 3  29  ? 115.109 100.899 160.440 1.00 42.30  ? 29   LEU C CD2   1 
ATOM   7124  N  N     . PRO C 3  30  ? 117.827 99.840  164.571 1.00 53.86  ? 30   PRO C N     1 
ATOM   7125  C  CA    . PRO C 3  30  ? 117.524 98.683  165.429 1.00 53.86  ? 30   PRO C CA    1 
ATOM   7126  C  C     . PRO C 3  30  ? 116.032 98.471  165.642 1.00 53.86  ? 30   PRO C C     1 
ATOM   7127  O  O     . PRO C 3  30  ? 115.212 99.275  165.187 1.00 53.86  ? 30   PRO C O     1 
ATOM   7128  C  CB    . PRO C 3  30  ? 118.246 99.018  166.740 1.00 53.86  ? 30   PRO C CB    1 
ATOM   7129  C  CG    . PRO C 3  30  ? 118.383 100.500 166.731 1.00 53.86  ? 30   PRO C CG    1 
ATOM   7130  C  CD    . PRO C 3  30  ? 118.566 100.888 165.296 1.00 53.86  ? 30   PRO C CD    1 
ATOM   7131  N  N     . GLN C 3  31  ? 115.680 97.395  166.352 1.00 70.65  ? 31   GLN C N     1 
ATOM   7132  C  CA    . GLN C 3  31  ? 114.320 96.861  166.296 1.00 70.65  ? 31   GLN C CA    1 
ATOM   7133  C  C     . GLN C 3  31  ? 113.321 97.772  167.020 1.00 70.65  ? 31   GLN C C     1 
ATOM   7134  O  O     . GLN C 3  31  ? 112.336 98.219  166.422 1.00 70.65  ? 31   GLN C O     1 
ATOM   7135  C  CB    . GLN C 3  31  ? 114.322 95.404  166.817 1.00 70.65  ? 31   GLN C CB    1 
ATOM   7136  C  CG    . GLN C 3  31  ? 114.723 95.114  168.287 1.00 70.65  ? 31   GLN C CG    1 
ATOM   7137  C  CD    . GLN C 3  31  ? 116.225 95.120  168.540 1.00 70.65  ? 31   GLN C CD    1 
ATOM   7138  O  OE1   . GLN C 3  31  ? 117.012 95.580  167.714 1.00 70.65  ? 31   GLN C OE1   1 
ATOM   7139  N  NE2   . GLN C 3  31  ? 116.623 94.635  169.710 1.00 70.65  ? 31   GLN C NE2   1 
ATOM   7140  N  N     . SER C 3  32  ? 113.585 98.087  168.292 1.00 70.32  ? 32   SER C N     1 
ATOM   7141  C  CA    . SER C 3  32  ? 112.872 99.048  169.124 1.00 70.32  ? 32   SER C CA    1 
ATOM   7142  C  C     . SER C 3  32  ? 113.703 99.204  170.386 1.00 70.32  ? 32   SER C C     1 
ATOM   7143  O  O     . SER C 3  32  ? 114.075 98.199  170.999 1.00 70.32  ? 32   SER C O     1 
ATOM   7144  C  CB    . SER C 3  32  ? 111.450 98.581  169.464 1.00 70.32  ? 32   SER C CB    1 
ATOM   7145  O  OG    . SER C 3  32  ? 110.781 99.521  170.288 1.00 70.32  ? 32   SER C OG    1 
ATOM   7146  N  N     . ASN C 3  33  ? 114.009 100.433 170.801 1.00 76.44  ? 33   ASN C N     1 
ATOM   7147  C  CA    . ASN C 3  33  ? 114.839 100.607 171.987 1.00 76.44  ? 33   ASN C CA    1 
ATOM   7148  C  C     . ASN C 3  33  ? 114.015 100.790 173.255 1.00 76.44  ? 33   ASN C C     1 
ATOM   7149  O  O     . ASN C 3  33  ? 114.433 101.524 174.163 1.00 76.44  ? 33   ASN C O     1 
ATOM   7150  C  CB    . ASN C 3  33  ? 115.821 101.765 171.808 1.00 76.44  ? 33   ASN C CB    1 
ATOM   7151  C  CG    . ASN C 3  33  ? 116.793 101.525 170.671 1.00 76.44  ? 33   ASN C CG    1 
ATOM   7152  O  OD1   . ASN C 3  33  ? 116.941 100.413 170.198 1.00 76.44  ? 33   ASN C OD1   1 
ATOM   7153  N  ND2   . ASN C 3  33  ? 117.550 102.538 170.327 1.00 76.44  ? 33   ASN C ND2   1 
ATOM   7154  N  N     . LYS C 3  34  ? 112.831 100.172 173.306 1.00 70.17  ? 34   LYS C N     1 
ATOM   7155  C  CA    . LYS C 3  34  ? 112.016 99.900  174.492 1.00 70.17  ? 34   LYS C CA    1 
ATOM   7156  C  C     . LYS C 3  34  ? 111.432 101.154 175.124 1.00 70.17  ? 34   LYS C C     1 
ATOM   7157  O  O     . LYS C 3  34  ? 110.834 101.070 176.204 1.00 70.17  ? 34   LYS C O     1 
ATOM   7158  C  CB    . LYS C 3  34  ? 112.788 99.133  175.577 1.00 70.17  ? 34   LYS C CB    1 
ATOM   7159  C  CG    . LYS C 3  34  ? 113.088 97.658  175.292 1.00 70.17  ? 34   LYS C CG    1 
ATOM   7160  C  CD    . LYS C 3  34  ? 114.351 97.495  174.450 1.00 70.17  ? 34   LYS C CD    1 
ATOM   7161  C  CE    . LYS C 3  34  ? 114.722 96.047  174.242 1.00 70.17  ? 34   LYS C CE    1 
ATOM   7162  N  NZ    . LYS C 3  34  ? 115.878 95.936  173.310 1.00 70.17  ? 34   LYS C NZ    1 
ATOM   7163  N  N     . ASN C 3  35  ? 111.573 102.314 174.488 1.00 66.69  ? 35   ASN C N     1 
ATOM   7164  C  CA    . ASN C 3  35  ? 111.372 103.574 175.183 1.00 66.69  ? 35   ASN C CA    1 
ATOM   7165  C  C     . ASN C 3  35  ? 110.785 104.614 174.244 1.00 66.69  ? 35   ASN C C     1 
ATOM   7166  O  O     . ASN C 3  35  ? 111.002 104.578 173.030 1.00 66.69  ? 35   ASN C O     1 
ATOM   7167  C  CB    . ASN C 3  35  ? 112.692 104.094 175.762 1.00 66.69  ? 35   ASN C CB    1 
ATOM   7168  C  CG    . ASN C 3  35  ? 113.148 103.315 176.979 1.00 66.69  ? 35   ASN C CG    1 
ATOM   7169  O  OD1   . ASN C 3  35  ? 112.347 102.983 177.852 1.00 66.69  ? 35   ASN C OD1   1 
ATOM   7170  N  ND2   . ASN C 3  35  ? 114.440 103.016 177.041 1.00 66.69  ? 35   ASN C ND2   1 
ATOM   7171  N  N     . ASP C 3  36  ? 110.034 105.544 174.834 1.00 69.66  ? 36   ASP C N     1 
ATOM   7172  C  CA    . ASP C 3  36  ? 109.628 106.783 174.187 1.00 69.66  ? 36   ASP C CA    1 
ATOM   7173  C  C     . ASP C 3  36  ? 110.543 107.943 174.565 1.00 69.66  ? 36   ASP C C     1 
ATOM   7174  O  O     . ASP C 3  36  ? 110.099 109.093 174.648 1.00 69.66  ? 36   ASP C O     1 
ATOM   7175  C  CB    . ASP C 3  36  ? 108.170 107.099 174.521 1.00 69.66  ? 36   ASP C CB    1 
ATOM   7176  C  CG    . ASP C 3  36  ? 107.893 107.101 176.018 1.00 69.66  ? 36   ASP C CG    1 
ATOM   7177  O  OD1   . ASP C 3  36  ? 108.801 106.771 176.811 1.00 69.66  ? 36   ASP C OD1   1 
ATOM   7178  O  OD2   . ASP C 3  36  ? 106.751 107.427 176.403 1.00 69.66  ? 36   ASP C OD2   1 
ATOM   7179  N  N     . LYS C 3  37  ? 111.823 107.649 174.794 1.00 58.08  ? 37   LYS C N     1 
ATOM   7180  C  CA    . LYS C 3  37  ? 112.840 108.589 175.242 1.00 58.08  ? 37   LYS C CA    1 
ATOM   7181  C  C     . LYS C 3  37  ? 113.471 109.377 174.106 1.00 58.08  ? 37   LYS C C     1 
ATOM   7182  O  O     . LYS C 3  37  ? 114.591 109.870 174.277 1.00 58.08  ? 37   LYS C O     1 
ATOM   7183  C  CB    . LYS C 3  37  ? 113.941 107.838 175.999 1.00 58.08  ? 37   LYS C CB    1 
ATOM   7184  C  CG    . LYS C 3  37  ? 113.541 107.247 177.342 1.00 58.08  ? 37   LYS C CG    1 
ATOM   7185  C  CD    . LYS C 3  37  ? 113.487 108.287 178.436 1.00 58.08  ? 37   LYS C CD    1 
ATOM   7186  C  CE    . LYS C 3  37  ? 114.895 108.680 178.850 1.00 58.08  ? 37   LYS C CE    1 
ATOM   7187  N  NZ    . LYS C 3  37  ? 114.888 109.631 179.988 1.00 58.08  ? 37   LYS C NZ    1 
ATOM   7188  N  N     . HIS C 3  38  ? 112.815 109.510 172.955 1.00 44.54  ? 38   HIS C N     1 
ATOM   7189  C  CA    . HIS C 3  38  ? 113.472 110.084 171.783 1.00 44.54  ? 38   HIS C CA    1 
ATOM   7190  C  C     . HIS C 3  38  ? 113.278 111.600 171.729 1.00 44.54  ? 38   HIS C C     1 
ATOM   7191  O  O     . HIS C 3  38  ? 112.650 112.154 170.829 1.00 44.54  ? 38   HIS C O     1 
ATOM   7192  C  CB    . HIS C 3  38  ? 112.973 109.414 170.512 1.00 44.54  ? 38   HIS C CB    1 
ATOM   7193  C  CG    . HIS C 3  38  ? 113.205 107.938 170.487 1.00 44.54  ? 38   HIS C CG    1 
ATOM   7194  N  ND1   . HIS C 3  38  ? 112.204 107.025 170.740 1.00 44.54  ? 38   HIS C ND1   1 
ATOM   7195  C  CD2   . HIS C 3  38  ? 114.338 107.217 170.315 1.00 44.54  ? 38   HIS C CD2   1 
ATOM   7196  C  CE1   . HIS C 3  38  ? 112.700 105.803 170.670 1.00 44.54  ? 38   HIS C CE1   1 
ATOM   7197  N  NE2   . HIS C 3  38  ? 113.993 105.891 170.416 1.00 44.54  ? 38   HIS C NE2   1 
ATOM   7198  N  N     . ILE C 3  39  ? 113.827 112.264 172.739 1.00 31.55  ? 39   ILE C N     1 
ATOM   7199  C  CA    . ILE C 3  39  ? 114.001 113.712 172.743 1.00 31.55  ? 39   ILE C CA    1 
ATOM   7200  C  C     . ILE C 3  39  ? 115.463 113.979 173.085 1.00 31.55  ? 39   ILE C C     1 
ATOM   7201  O  O     . ILE C 3  39  ? 116.085 113.183 173.801 1.00 31.55  ? 39   ILE C O     1 
ATOM   7202  C  CB    . ILE C 3  39  ? 113.037 114.406 173.722 1.00 31.55  ? 39   ILE C CB    1 
ATOM   7203  C  CG1   . ILE C 3  39  ? 113.202 113.862 175.138 1.00 31.55  ? 39   ILE C CG1   1 
ATOM   7204  C  CG2   . ILE C 3  39  ? 111.596 114.279 173.259 1.00 31.55  ? 39   ILE C CG2   1 
ATOM   7205  C  CD1   . ILE C 3  39  ? 112.456 114.660 176.166 1.00 31.55  ? 39   ILE C CD1   1 
ATOM   7206  N  N     . PRO C 3  40  ? 116.068 115.053 172.570 1.00 23.29  ? 40   PRO C N     1 
ATOM   7207  C  CA    . PRO C 3  40  ? 117.495 115.286 172.826 1.00 23.29  ? 40   PRO C CA    1 
ATOM   7208  C  C     . PRO C 3  40  ? 117.835 115.805 174.212 1.00 23.29  ? 40   PRO C C     1 
ATOM   7209  O  O     . PRO C 3  40  ? 119.029 115.926 174.514 1.00 23.29  ? 40   PRO C O     1 
ATOM   7210  C  CB    . PRO C 3  40  ? 117.874 116.312 171.754 1.00 23.29  ? 40   PRO C CB    1 
ATOM   7211  C  CG    . PRO C 3  40  ? 116.618 116.957 171.380 1.00 23.29  ? 40   PRO C CG    1 
ATOM   7212  C  CD    . PRO C 3  40  ? 115.566 115.915 171.491 1.00 23.29  ? 40   PRO C CD    1 
ATOM   7213  N  N     . PHE C 3  41  ? 116.860 116.110 175.062 1.00 25.90  ? 41   PHE C N     1 
ATOM   7214  C  CA    . PHE C 3  41  ? 117.187 116.573 176.404 1.00 25.90  ? 41   PHE C CA    1 
ATOM   7215  C  C     . PHE C 3  41  ? 117.657 115.410 177.266 1.00 25.90  ? 41   PHE C C     1 
ATOM   7216  O  O     . PHE C 3  41  ? 117.131 114.299 177.179 1.00 25.90  ? 41   PHE C O     1 
ATOM   7217  C  CB    . PHE C 3  41  ? 115.990 117.257 177.064 1.00 25.90  ? 41   PHE C CB    1 
ATOM   7218  C  CG    . PHE C 3  41  ? 115.689 118.630 176.528 1.00 25.90  ? 41   PHE C CG    1 
ATOM   7219  C  CD1   . PHE C 3  41  ? 116.548 119.260 175.649 1.00 25.90  ? 41   PHE C CD1   1 
ATOM   7220  C  CD2   . PHE C 3  41  ? 114.561 119.308 176.946 1.00 25.90  ? 41   PHE C CD2   1 
ATOM   7221  C  CE1   . PHE C 3  41  ? 116.267 120.518 175.171 1.00 25.90  ? 41   PHE C CE1   1 
ATOM   7222  C  CE2   . PHE C 3  41  ? 114.285 120.574 176.474 1.00 25.90  ? 41   PHE C CE2   1 
ATOM   7223  C  CZ    . PHE C 3  41  ? 115.136 121.174 175.586 1.00 25.90  ? 41   PHE C CZ    1 
ATOM   7224  N  N     . VAL C 3  42  ? 118.654 115.672 178.105 1.00 31.24  ? 42   VAL C N     1 
ATOM   7225  C  CA    . VAL C 3  42  ? 119.241 114.652 178.959 1.00 31.24  ? 42   VAL C CA    1 
ATOM   7226  C  C     . VAL C 3  42  ? 118.778 114.874 180.392 1.00 31.24  ? 42   VAL C C     1 
ATOM   7227  O  O     . VAL C 3  42  ? 118.277 115.941 180.757 1.00 31.24  ? 42   VAL C O     1 
ATOM   7228  C  CB    . VAL C 3  42  ? 120.779 114.654 178.875 1.00 31.24  ? 42   VAL C CB    1 
ATOM   7229  C  CG1   . VAL C 3  42  ? 121.222 114.381 177.460 1.00 31.24  ? 42   VAL C CG1   1 
ATOM   7230  C  CG2   . VAL C 3  42  ? 121.331 115.978 179.356 1.00 31.24  ? 42   VAL C CG2   1 
ATOM   7231  N  N     . LYS C 3  43  ? 118.943 113.840 181.213 1.00 39.90  ? 43   LYS C N     1 
ATOM   7232  C  CA    . LYS C 3  43  ? 118.630 113.954 182.631 1.00 39.90  ? 43   LYS C CA    1 
ATOM   7233  C  C     . LYS C 3  43  ? 119.697 114.790 183.322 1.00 39.90  ? 43   LYS C C     1 
ATOM   7234  O  O     . LYS C 3  43  ? 120.890 114.481 183.235 1.00 39.90  ? 43   LYS C O     1 
ATOM   7235  C  CB    . LYS C 3  43  ? 118.540 112.575 183.276 1.00 39.90  ? 43   LYS C CB    1 
ATOM   7236  C  CG    . LYS C 3  43  ? 117.365 111.736 182.828 1.00 39.90  ? 43   LYS C CG    1 
ATOM   7237  C  CD    . LYS C 3  43  ? 117.332 110.428 183.597 1.00 39.90  ? 43   LYS C CD    1 
ATOM   7238  C  CE    . LYS C 3  43  ? 116.220 109.526 183.105 1.00 39.90  ? 43   LYS C CE    1 
ATOM   7239  N  NZ    . LYS C 3  43  ? 114.884 110.106 183.395 1.00 39.90  ? 43   LYS C NZ    1 
ATOM   7240  N  N     . LEU C 3  44  ? 119.274 115.846 184.006 1.00 41.56  ? 44   LEU C N     1 
ATOM   7241  C  CA    . LEU C 3  44  ? 120.205 116.713 184.705 1.00 41.56  ? 44   LEU C CA    1 
ATOM   7242  C  C     . LEU C 3  44  ? 120.368 116.237 186.145 1.00 41.56  ? 44   LEU C C     1 
ATOM   7243  O  O     . LEU C 3  44  ? 119.902 115.156 186.515 1.00 41.56  ? 44   LEU C O     1 
ATOM   7244  C  CB    . LEU C 3  44  ? 119.743 118.163 184.629 1.00 41.56  ? 44   LEU C CB    1 
ATOM   7245  C  CG    . LEU C 3  44  ? 119.786 118.736 183.218 1.00 41.56  ? 44   LEU C CG    1 
ATOM   7246  C  CD1   . LEU C 3  44  ? 119.227 120.128 183.204 1.00 41.56  ? 44   LEU C CD1   1 
ATOM   7247  C  CD2   . LEU C 3  44  ? 121.205 118.731 182.723 1.00 41.56  ? 44   LEU C CD2   1 
ATOM   7248  N  N     . LEU C 3  45  ? 121.059 117.052 186.954 1.00 47.86  ? 45   LEU C N     1 
ATOM   7249  C  CA    . LEU C 3  45  ? 121.419 116.765 188.349 1.00 47.86  ? 45   LEU C CA    1 
ATOM   7250  C  C     . LEU C 3  45  ? 122.242 115.486 188.483 1.00 47.86  ? 45   LEU C C     1 
ATOM   7251  O  O     . LEU C 3  45  ? 122.181 114.820 189.519 1.00 47.86  ? 45   LEU C O     1 
ATOM   7252  C  CB    . LEU C 3  45  ? 120.186 116.702 189.258 1.00 47.86  ? 45   LEU C CB    1 
ATOM   7253  C  CG    . LEU C 3  45  ? 119.402 117.994 189.439 1.00 47.86  ? 45   LEU C CG    1 
ATOM   7254  C  CD1   . LEU C 3  45  ? 118.154 117.712 190.232 1.00 47.86  ? 45   LEU C CD1   1 
ATOM   7255  C  CD2   . LEU C 3  45  ? 120.260 119.016 190.146 1.00 47.86  ? 45   LEU C CD2   1 
ATOM   7256  N  N     . SER C 3  46  ? 123.029 115.174 187.446 1.00 51.55  ? 46   SER C N     1 
ATOM   7257  C  CA    . SER C 3  46  ? 123.811 113.937 187.321 1.00 51.55  ? 46   SER C CA    1 
ATOM   7258  C  C     . SER C 3  46  ? 122.940 112.694 187.506 1.00 51.55  ? 46   SER C C     1 
ATOM   7259  O  O     . SER C 3  46  ? 123.261 111.785 188.273 1.00 51.55  ? 46   SER C O     1 
ATOM   7260  C  CB    . SER C 3  46  ? 125.000 113.925 188.285 1.00 51.55  ? 46   SER C CB    1 
ATOM   7261  O  OG    . SER C 3  46  ? 125.721 112.709 188.183 1.00 51.55  ? 46   SER C OG    1 
ATOM   7262  N  N     . GLY C 3  47  ? 121.817 112.668 186.796 1.00 49.13  ? 47   GLY C N     1 
ATOM   7263  C  CA    . GLY C 3  47  ? 120.956 111.504 186.806 1.00 49.13  ? 47   GLY C CA    1 
ATOM   7264  C  C     . GLY C 3  47  ? 119.987 111.417 187.959 1.00 49.13  ? 47   GLY C C     1 
ATOM   7265  O  O     . GLY C 3  47  ? 119.507 110.322 188.264 1.00 49.13  ? 47   GLY C O     1 
ATOM   7266  N  N     . LYS C 3  48  ? 119.680 112.532 188.615 1.00 55.19  ? 48   LYS C N     1 
ATOM   7267  C  CA    . LYS C 3  48  ? 118.687 112.538 189.679 1.00 55.19  ? 48   LYS C CA    1 
ATOM   7268  C  C     . LYS C 3  48  ? 117.343 113.087 189.231 1.00 55.19  ? 48   LYS C C     1 
ATOM   7269  O  O     . LYS C 3  48  ? 116.382 113.036 190.005 1.00 55.19  ? 48   LYS C O     1 
ATOM   7270  C  CB    . LYS C 3  48  ? 119.187 113.352 190.881 1.00 55.19  ? 48   LYS C CB    1 
ATOM   7271  C  CG    . LYS C 3  48  ? 120.498 112.876 191.527 1.00 55.19  ? 48   LYS C CG    1 
ATOM   7272  C  CD    . LYS C 3  48  ? 120.375 111.584 192.334 1.00 55.19  ? 48   LYS C CD    1 
ATOM   7273  C  CE    . LYS C 3  48  ? 120.928 110.375 191.585 1.00 55.19  ? 48   LYS C CE    1 
ATOM   7274  N  NZ    . LYS C 3  48  ? 120.922 109.150 192.428 1.00 55.19  ? 48   LYS C NZ    1 
ATOM   7275  N  N     . GLU C 3  49  ? 117.250 113.603 188.010 1.00 55.52  ? 49   GLU C N     1 
ATOM   7276  C  CA    . GLU C 3  49  ? 116.026 114.214 187.523 1.00 55.52  ? 49   GLU C CA    1 
ATOM   7277  C  C     . GLU C 3  49  ? 115.135 113.156 186.889 1.00 55.52  ? 49   GLU C C     1 
ATOM   7278  O  O     . GLU C 3  49  ? 115.612 112.277 186.167 1.00 55.52  ? 49   GLU C O     1 
ATOM   7279  C  CB    . GLU C 3  49  ? 116.345 115.308 186.507 1.00 55.52  ? 49   GLU C CB    1 
ATOM   7280  C  CG    . GLU C 3  49  ? 115.157 116.161 186.138 1.00 55.52  ? 49   GLU C CG    1 
ATOM   7281  C  CD    . GLU C 3  49  ? 115.493 117.198 185.102 1.00 55.52  ? 49   GLU C CD    1 
ATOM   7282  O  OE1   . GLU C 3  49  ? 116.626 117.171 184.589 1.00 55.52  ? 49   GLU C OE1   1 
ATOM   7283  O  OE2   . GLU C 3  49  ? 114.633 118.052 184.811 1.00 55.52  ? 49   GLU C OE2   1 
ATOM   7284  N  N     . SER C 3  50  ? 113.838 113.247 187.162 1.00 57.39  ? 50   SER C N     1 
ATOM   7285  C  CA    . SER C 3  50  ? 112.894 112.261 186.668 1.00 57.39  ? 50   SER C CA    1 
ATOM   7286  C  C     . SER C 3  50  ? 112.606 112.475 185.185 1.00 57.39  ? 50   SER C C     1 
ATOM   7287  O  O     . SER C 3  50  ? 112.842 113.548 184.625 1.00 57.39  ? 50   SER C O     1 
ATOM   7288  C  CB    . SER C 3  50  ? 111.598 112.317 187.472 1.00 57.39  ? 50   SER C CB    1 
ATOM   7289  O  OG    . SER C 3  50  ? 110.955 113.567 187.307 1.00 57.39  ? 50   SER C OG    1 
ATOM   7290  N  N     . GLU C 3  51  ? 112.090 111.417 184.552 1.00 58.74  ? 51   GLU C N     1 
ATOM   7291  C  CA    . GLU C 3  51  ? 111.754 111.459 183.132 1.00 58.74  ? 51   GLU C CA    1 
ATOM   7292  C  C     . GLU C 3  51  ? 110.600 112.413 182.851 1.00 58.74  ? 51   GLU C C     1 
ATOM   7293  O  O     . GLU C 3  51  ? 110.561 113.041 181.787 1.00 58.74  ? 51   GLU C O     1 
ATOM   7294  C  CB    . GLU C 3  51  ? 111.410 110.049 182.645 1.00 58.74  ? 51   GLU C CB    1 
ATOM   7295  C  CG    . GLU C 3  51  ? 111.114 109.931 181.156 1.00 58.74  ? 51   GLU C CG    1 
ATOM   7296  C  CD    . GLU C 3  51  ? 110.681 108.538 180.757 1.00 58.74  ? 51   GLU C CD    1 
ATOM   7297  O  OE1   . GLU C 3  51  ? 110.622 107.660 181.642 1.00 58.74  ? 51   GLU C OE1   1 
ATOM   7298  O  OE2   . GLU C 3  51  ? 110.380 108.327 179.564 1.00 58.74  ? 51   GLU C OE2   1 
ATOM   7299  N  N     . VAL C 3  52  ? 109.665 112.548 183.794 1.00 52.87  ? 52   VAL C N     1 
ATOM   7300  C  CA    . VAL C 3  52  ? 108.528 113.436 183.594 1.00 52.87  ? 52   VAL C CA    1 
ATOM   7301  C  C     . VAL C 3  52  ? 108.956 114.902 183.639 1.00 52.87  ? 52   VAL C C     1 
ATOM   7302  O  O     . VAL C 3  52  ? 108.301 115.754 183.030 1.00 52.87  ? 52   VAL C O     1 
ATOM   7303  C  CB    . VAL C 3  52  ? 107.426 113.094 184.624 1.00 52.87  ? 52   VAL C CB    1 
ATOM   7304  C  CG1   . VAL C 3  52  ? 107.854 113.443 186.045 1.00 52.87  ? 52   VAL C CG1   1 
ATOM   7305  C  CG2   . VAL C 3  52  ? 106.088 113.738 184.260 1.00 52.87  ? 52   VAL C CG2   1 
ATOM   7306  N  N     . ASN C 3  53  ? 110.072 115.217 184.301 1.00 52.83  ? 53   ASN C N     1 
ATOM   7307  C  CA    . ASN C 3  53  ? 110.602 116.572 184.250 1.00 52.83  ? 53   ASN C CA    1 
ATOM   7308  C  C     . ASN C 3  53  ? 111.277 116.859 182.921 1.00 52.83  ? 53   ASN C C     1 
ATOM   7309  O  O     . ASN C 3  53  ? 111.262 118.003 182.460 1.00 52.83  ? 53   ASN C O     1 
ATOM   7310  C  CB    . ASN C 3  53  ? 111.617 116.796 185.363 1.00 52.83  ? 53   ASN C CB    1 
ATOM   7311  C  CG    . ASN C 3  53  ? 111.017 116.692 186.731 1.00 52.83  ? 53   ASN C CG    1 
ATOM   7312  O  OD1   . ASN C 3  53  ? 109.920 117.183 186.989 1.00 52.83  ? 53   ASN C OD1   1 
ATOM   7313  N  ND2   . ASN C 3  53  ? 111.744 116.047 187.630 1.00 52.83  ? 53   ASN C ND2   1 
ATOM   7314  N  N     . VAL C 3  54  ? 111.891 115.842 182.315 1.00 44.64  ? 54   VAL C N     1 
ATOM   7315  C  CA    . VAL C 3  54  ? 112.611 116.032 181.062 1.00 44.64  ? 54   VAL C CA    1 
ATOM   7316  C  C     . VAL C 3  54  ? 111.636 116.289 179.920 1.00 44.64  ? 54   VAL C C     1 
ATOM   7317  O  O     . VAL C 3  54  ? 111.846 117.186 179.097 1.00 44.64  ? 54   VAL C O     1 
ATOM   7318  C  CB    . VAL C 3  54  ? 113.511 114.812 180.794 1.00 44.64  ? 54   VAL C CB    1 
ATOM   7319  C  CG1   . VAL C 3  54  ? 114.210 114.931 179.460 1.00 44.64  ? 54   VAL C CG1   1 
ATOM   7320  C  CG2   . VAL C 3  54  ? 114.527 114.663 181.910 1.00 44.64  ? 54   VAL C CG2   1 
ATOM   7321  N  N     . GLU C 3  55  ? 110.543 115.531 179.868 1.00 49.07  ? 55   GLU C N     1 
ATOM   7322  C  CA    . GLU C 3  55  ? 109.539 115.744 178.835 1.00 49.07  ? 55   GLU C CA    1 
ATOM   7323  C  C     . GLU C 3  55  ? 108.681 116.973 179.093 1.00 49.07  ? 55   GLU C C     1 
ATOM   7324  O  O     . GLU C 3  55  ? 108.125 117.531 178.142 1.00 49.07  ? 55   GLU C O     1 
ATOM   7325  C  CB    . GLU C 3  55  ? 108.651 114.509 178.700 1.00 49.07  ? 55   GLU C CB    1 
ATOM   7326  C  CG    . GLU C 3  55  ? 109.374 113.310 178.119 1.00 49.07  ? 55   GLU C CG    1 
ATOM   7327  C  CD    . GLU C 3  55  ? 108.477 112.101 177.977 1.00 49.07  ? 55   GLU C CD    1 
ATOM   7328  O  OE1   . GLU C 3  55  ? 107.329 112.148 178.466 1.00 49.07  ? 55   GLU C OE1   1 
ATOM   7329  O  OE2   . GLU C 3  55  ? 108.917 111.104 177.367 1.00 49.07  ? 55   GLU C OE2   1 
ATOM   7330  N  N     . LYS C 3  56  ? 108.554 117.405 180.348 1.00 45.62  ? 56   LYS C N     1 
ATOM   7331  C  CA    . LYS C 3  56  ? 107.859 118.658 180.614 1.00 45.62  ? 56   LYS C CA    1 
ATOM   7332  C  C     . LYS C 3  56  ? 108.702 119.843 180.177 1.00 45.62  ? 56   LYS C C     1 
ATOM   7333  O  O     . LYS C 3  56  ? 108.189 120.784 179.567 1.00 45.62  ? 56   LYS C O     1 
ATOM   7334  C  CB    . LYS C 3  56  ? 107.514 118.778 182.095 1.00 45.62  ? 56   LYS C CB    1 
ATOM   7335  C  CG    . LYS C 3  56  ? 106.720 120.018 182.423 1.00 45.62  ? 56   LYS C CG    1 
ATOM   7336  C  CD    . LYS C 3  56  ? 105.293 119.903 181.930 1.00 45.62  ? 56   LYS C CD    1 
ATOM   7337  C  CE    . LYS C 3  56  ? 104.518 121.136 182.327 1.00 45.62  ? 56   LYS C CE    1 
ATOM   7338  N  NZ    . LYS C 3  56  ? 103.072 121.044 182.057 1.00 45.62  ? 56   LYS C NZ    1 
ATOM   7339  N  N     . ARG C 3  57  ? 110.007 119.792 180.448 1.00 35.19  ? 57   ARG C N     1 
ATOM   7340  C  CA    . ARG C 3  57  ? 110.938 120.835 180.036 1.00 35.19  ? 57   ARG C CA    1 
ATOM   7341  C  C     . ARG C 3  57  ? 111.106 120.882 178.523 1.00 35.19  ? 57   ARG C C     1 
ATOM   7342  O  O     . ARG C 3  57  ? 111.524 121.909 177.984 1.00 35.19  ? 57   ARG C O     1 
ATOM   7343  C  CB    . ARG C 3  57  ? 112.275 120.580 180.725 1.00 35.19  ? 57   ARG C CB    1 
ATOM   7344  C  CG    . ARG C 3  57  ? 113.294 121.676 180.714 1.00 35.19  ? 57   ARG C CG    1 
ATOM   7345  C  CD    . ARG C 3  57  ? 114.476 121.155 181.484 1.00 35.19  ? 57   ARG C CD    1 
ATOM   7346  N  NE    . ARG C 3  57  ? 115.126 120.082 180.745 1.00 35.19  ? 57   ARG C NE    1 
ATOM   7347  C  CZ    . ARG C 3  57  ? 115.902 119.164 181.299 1.00 35.19  ? 57   ARG C CZ    1 
ATOM   7348  N  NH1   . ARG C 3  57  ? 116.081 119.164 182.608 1.00 35.19  ? 57   ARG C NH1   1 
ATOM   7349  N  NH2   . ARG C 3  57  ? 116.465 118.226 180.555 1.00 35.19  ? 57   ARG C NH2   1 
ATOM   7350  N  N     . TRP C 3  58  ? 110.775 119.791 177.834 1.00 29.82  ? 58   TRP C N     1 
ATOM   7351  C  CA    . TRP C 3  58  ? 110.785 119.743 176.379 1.00 29.82  ? 58   TRP C CA    1 
ATOM   7352  C  C     . TRP C 3  58  ? 109.597 120.485 175.785 1.00 29.82  ? 58   TRP C C     1 
ATOM   7353  O  O     . TRP C 3  58  ? 109.761 121.304 174.877 1.00 29.82  ? 58   TRP C O     1 
ATOM   7354  C  CB    . TRP C 3  58  ? 110.801 118.282 175.930 1.00 29.82  ? 58   TRP C CB    1 
ATOM   7355  C  CG    . TRP C 3  58  ? 110.728 118.048 174.465 1.00 29.82  ? 58   TRP C CG    1 
ATOM   7356  C  CD1   . TRP C 3  58  ? 109.675 117.533 173.773 1.00 29.82  ? 58   TRP C CD1   1 
ATOM   7357  C  CD2   . TRP C 3  58  ? 111.749 118.316 173.502 1.00 29.82  ? 58   TRP C CD2   1 
ATOM   7358  N  NE1   . TRP C 3  58  ? 109.979 117.454 172.438 1.00 29.82  ? 58   TRP C NE1   1 
ATOM   7359  C  CE2   . TRP C 3  58  ? 111.247 117.932 172.246 1.00 29.82  ? 58   TRP C CE2   1 
ATOM   7360  C  CE3   . TRP C 3  58  ? 113.037 118.844 173.578 1.00 29.82  ? 58   TRP C CE3   1 
ATOM   7361  C  CZ2   . TRP C 3  58  ? 111.992 118.049 171.082 1.00 29.82  ? 58   TRP C CZ2   1 
ATOM   7362  C  CZ3   . TRP C 3  58  ? 113.769 118.968 172.421 1.00 29.82  ? 58   TRP C CZ3   1 
ATOM   7363  C  CH2   . TRP C 3  58  ? 113.242 118.584 171.189 1.00 29.82  ? 58   TRP C CH2   1 
ATOM   7364  N  N     . GLU C 3  59  ? 108.392 120.216 176.286 1.00 37.12  ? 59   GLU C N     1 
ATOM   7365  C  CA    . GLU C 3  59  ? 107.205 120.854 175.736 1.00 37.12  ? 59   GLU C CA    1 
ATOM   7366  C  C     . GLU C 3  59  ? 107.002 122.267 176.262 1.00 37.12  ? 59   GLU C C     1 
ATOM   7367  O  O     . GLU C 3  59  ? 106.335 123.069 175.602 1.00 37.12  ? 59   GLU C O     1 
ATOM   7368  C  CB    . GLU C 3  59  ? 105.968 120.003 176.025 1.00 37.12  ? 59   GLU C CB    1 
ATOM   7369  C  CG    . GLU C 3  59  ? 105.628 119.864 177.495 1.00 37.12  ? 59   GLU C CG    1 
ATOM   7370  C  CD    . GLU C 3  59  ? 104.433 118.970 177.728 1.00 37.12  ? 59   GLU C CD    1 
ATOM   7371  O  OE1   . GLU C 3  59  ? 103.890 118.437 176.738 1.00 37.12  ? 59   GLU C OE1   1 
ATOM   7372  O  OE2   . GLU C 3  59  ? 104.036 118.803 178.900 1.00 37.12  ? 59   GLU C OE2   1 
ATOM   7373  N  N     . LEU C 3  60  ? 107.555 122.588 177.430 1.00 31.27  ? 60   LEU C N     1 
ATOM   7374  C  CA    . LEU C 3  60  ? 107.544 123.961 177.912 1.00 31.27  ? 60   LEU C CA    1 
ATOM   7375  C  C     . LEU C 3  60  ? 108.582 124.801 177.181 1.00 31.27  ? 60   LEU C C     1 
ATOM   7376  O  O     . LEU C 3  60  ? 108.446 126.026 177.110 1.00 31.27  ? 60   LEU C O     1 
ATOM   7377  C  CB    . LEU C 3  60  ? 107.748 123.952 179.432 1.00 31.27  ? 60   LEU C CB    1 
ATOM   7378  C  CG    . LEU C 3  60  ? 107.730 125.106 180.433 1.00 31.27  ? 60   LEU C CG    1 
ATOM   7379  C  CD1   . LEU C 3  60  ? 109.088 125.696 180.530 1.00 31.27  ? 60   LEU C CD1   1 
ATOM   7380  C  CD2   . LEU C 3  60  ? 106.741 126.171 180.045 1.00 31.27  ? 60   LEU C CD2   1 
ATOM   7381  N  N     . TYR C 3  61  ? 109.608 124.158 176.621 1.00 25.46  ? 61   TYR C N     1 
ATOM   7382  C  CA    . TYR C 3  61  ? 110.500 124.832 175.683 1.00 25.46  ? 61   TYR C CA    1 
ATOM   7383  C  C     . TYR C 3  61  ? 109.790 125.156 174.376 1.00 25.46  ? 61   TYR C C     1 
ATOM   7384  O  O     . TYR C 3  61  ? 109.843 126.294 173.900 1.00 25.46  ? 61   TYR C O     1 
ATOM   7385  C  CB    . TYR C 3  61  ? 111.733 123.969 175.416 1.00 25.46  ? 61   TYR C CB    1 
ATOM   7386  C  CG    . TYR C 3  61  ? 112.513 124.394 174.197 1.00 25.46  ? 61   TYR C CG    1 
ATOM   7387  C  CD1   . TYR C 3  61  ? 113.274 125.549 174.201 1.00 25.46  ? 61   TYR C CD1   1 
ATOM   7388  C  CD2   . TYR C 3  61  ? 112.485 123.632 173.035 1.00 25.46  ? 61   TYR C CD2   1 
ATOM   7389  C  CE1   . TYR C 3  61  ? 113.976 125.934 173.083 1.00 25.46  ? 61   TYR C CE1   1 
ATOM   7390  C  CE2   . TYR C 3  61  ? 113.184 124.016 171.917 1.00 25.46  ? 61   TYR C CE2   1 
ATOM   7391  C  CZ    . TYR C 3  61  ? 113.924 125.168 171.950 1.00 25.46  ? 61   TYR C CZ    1 
ATOM   7392  O  OH    . TYR C 3  61  ? 114.624 125.559 170.843 1.00 25.46  ? 61   TYR C OH    1 
ATOM   7393  N  N     . HIS C 3  62  ? 109.140 124.159 173.770 1.00 28.67  ? 62   HIS C N     1 
ATOM   7394  C  CA    . HIS C 3  62  ? 108.520 124.352 172.465 1.00 28.67  ? 62   HIS C CA    1 
ATOM   7395  C  C     . HIS C 3  62  ? 107.323 125.282 172.484 1.00 28.67  ? 62   HIS C C     1 
ATOM   7396  O  O     . HIS C 3  62  ? 106.998 125.850 171.440 1.00 28.67  ? 62   HIS C O     1 
ATOM   7397  C  CB    . HIS C 3  62  ? 108.112 123.016 171.855 1.00 28.67  ? 62   HIS C CB    1 
ATOM   7398  C  CG    . HIS C 3  62  ? 109.190 122.383 171.043 1.00 28.67  ? 62   HIS C CG    1 
ATOM   7399  N  ND1   . HIS C 3  62  ? 110.182 121.602 171.590 1.00 28.67  ? 62   HIS C ND1   1 
ATOM   7400  C  CD2   . HIS C 3  62  ? 109.431 122.425 169.713 1.00 28.67  ? 62   HIS C CD2   1 
ATOM   7401  C  CE1   . HIS C 3  62  ? 110.993 121.196 170.630 1.00 28.67  ? 62   HIS C CE1   1 
ATOM   7402  N  NE2   . HIS C 3  62  ? 110.556 121.675 169.481 1.00 28.67  ? 62   HIS C NE2   1 
ATOM   7403  N  N     . GLN C 3  63  ? 106.656 125.464 173.618 1.00 34.23  ? 63   GLN C N     1 
ATOM   7404  C  CA    . GLN C 3  63  ? 105.593 126.454 173.612 1.00 34.23  ? 63   GLN C CA    1 
ATOM   7405  C  C     . GLN C 3  63  ? 106.125 127.852 173.874 1.00 34.23  ? 63   GLN C C     1 
ATOM   7406  O  O     . GLN C 3  63  ? 105.429 128.830 173.589 1.00 34.23  ? 63   GLN C O     1 
ATOM   7407  C  CB    . GLN C 3  63  ? 104.508 126.111 174.631 1.00 34.23  ? 63   GLN C CB    1 
ATOM   7408  C  CG    . GLN C 3  63  ? 104.861 126.369 176.071 1.00 34.23  ? 63   GLN C CG    1 
ATOM   7409  C  CD    . GLN C 3  63  ? 103.730 125.982 176.994 1.00 34.23  ? 63   GLN C CD    1 
ATOM   7410  O  OE1   . GLN C 3  63  ? 102.699 125.484 176.548 1.00 34.23  ? 63   GLN C OE1   1 
ATOM   7411  N  NE2   . GLN C 3  63  ? 103.900 126.236 178.280 1.00 34.23  ? 63   GLN C NE2   1 
ATOM   7412  N  N     . LEU C 3  64  ? 107.341 127.966 174.401 1.00 27.23  ? 64   LEU C N     1 
ATOM   7413  C  CA    . LEU C 3  64  ? 107.990 129.257 174.563 1.00 27.23  ? 64   LEU C CA    1 
ATOM   7414  C  C     . LEU C 3  64  ? 108.871 129.594 173.372 1.00 27.23  ? 64   LEU C C     1 
ATOM   7415  O  O     . LEU C 3  64  ? 109.158 130.771 173.137 1.00 27.23  ? 64   LEU C O     1 
ATOM   7416  C  CB    . LEU C 3  64  ? 108.804 129.257 175.861 1.00 27.23  ? 64   LEU C CB    1 
ATOM   7417  C  CG    . LEU C 3  64  ? 109.219 130.542 176.579 1.00 27.23  ? 64   LEU C CG    1 
ATOM   7418  C  CD1   . LEU C 3  64  ? 109.311 130.233 178.044 1.00 27.23  ? 64   LEU C CD1   1 
ATOM   7419  C  CD2   . LEU C 3  64  ? 110.537 131.089 176.113 1.00 27.23  ? 64   LEU C CD2   1 
ATOM   7420  N  N     . HIS C 3  65  ? 109.287 128.584 172.606 1.00 30.05  ? 65   HIS C N     1 
ATOM   7421  C  CA    . HIS C 3  65  ? 110.008 128.810 171.360 1.00 30.05  ? 65   HIS C CA    1 
ATOM   7422  C  C     . HIS C 3  65  ? 109.065 129.159 170.219 1.00 30.05  ? 65   HIS C C     1 
ATOM   7423  O  O     . HIS C 3  65  ? 109.359 130.056 169.425 1.00 30.05  ? 65   HIS C O     1 
ATOM   7424  C  CB    . HIS C 3  65  ? 110.827 127.571 171.004 1.00 30.05  ? 65   HIS C CB    1 
ATOM   7425  C  CG    . HIS C 3  65  ? 111.615 127.701 169.739 1.00 30.05  ? 65   HIS C CG    1 
ATOM   7426  N  ND1   . HIS C 3  65  ? 111.111 127.337 168.509 1.00 30.05  ? 65   HIS C ND1   1 
ATOM   7427  C  CD2   . HIS C 3  65  ? 112.872 128.149 169.513 1.00 30.05  ? 65   HIS C CD2   1 
ATOM   7428  C  CE1   . HIS C 3  65  ? 112.025 127.554 167.580 1.00 30.05  ? 65   HIS C CE1   1 
ATOM   7429  N  NE2   . HIS C 3  65  ? 113.103 128.044 168.164 1.00 30.05  ? 65   HIS C NE2   1 
ATOM   7430  N  N     . SER C 3  66  ? 107.936 128.455 170.111 1.00 33.78  ? 66   SER C N     1 
ATOM   7431  C  CA    . SER C 3  66  ? 107.015 128.705 169.010 1.00 33.78  ? 66   SER C CA    1 
ATOM   7432  C  C     . SER C 3  66  ? 106.231 129.995 169.197 1.00 33.78  ? 66   SER C C     1 
ATOM   7433  O  O     . SER C 3  66  ? 105.863 130.633 168.206 1.00 33.78  ? 66   SER C O     1 
ATOM   7434  C  CB    . SER C 3  66  ? 106.047 127.537 168.847 1.00 33.78  ? 66   SER C CB    1 
ATOM   7435  O  OG    . SER C 3  66  ? 105.209 127.424 169.983 1.00 33.78  ? 66   SER C OG    1 
ATOM   7436  N  N     . HIS C 3  67  ? 105.972 130.397 170.443 1.00 34.64  ? 67   HIS C N     1 
ATOM   7437  C  CA    . HIS C 3  67  ? 105.329 131.681 170.694 1.00 34.64  ? 67   HIS C CA    1 
ATOM   7438  C  C     . HIS C 3  67  ? 106.241 132.846 170.342 1.00 34.64  ? 67   HIS C C     1 
ATOM   7439  O  O     . HIS C 3  67  ? 105.751 133.942 170.054 1.00 34.64  ? 67   HIS C O     1 
ATOM   7440  C  CB    . HIS C 3  67  ? 104.882 131.758 172.157 1.00 34.64  ? 67   HIS C CB    1 
ATOM   7441  C  CG    . HIS C 3  67  ? 104.174 133.028 172.517 1.00 34.64  ? 67   HIS C CG    1 
ATOM   7442  N  ND1   . HIS C 3  67  ? 102.921 133.344 172.040 1.00 34.64  ? 67   HIS C ND1   1 
ATOM   7443  C  CD2   . HIS C 3  67  ? 104.534 134.047 173.331 1.00 34.64  ? 67   HIS C CD2   1 
ATOM   7444  C  CE1   . HIS C 3  67  ? 102.549 134.514 172.528 1.00 34.64  ? 67   HIS C CE1   1 
ATOM   7445  N  NE2   . HIS C 3  67  ? 103.510 134.961 173.315 1.00 34.64  ? 67   HIS C NE2   1 
ATOM   7446  N  N     . PHE C 3  68  ? 107.554 132.626 170.331 1.00 31.98  ? 68   PHE C N     1 
ATOM   7447  C  CA    . PHE C 3  68  ? 108.475 133.655 169.871 1.00 31.98  ? 68   PHE C CA    1 
ATOM   7448  C  C     . PHE C 3  68  ? 108.540 133.723 168.350 1.00 31.98  ? 68   PHE C C     1 
ATOM   7449  O  O     . PHE C 3  68  ? 108.548 134.819 167.786 1.00 31.98  ? 68   PHE C O     1 
ATOM   7450  C  CB    . PHE C 3  68  ? 109.856 133.421 170.482 1.00 31.98  ? 68   PHE C CB    1 
ATOM   7451  C  CG    . PHE C 3  68  ? 110.920 134.319 169.938 1.00 31.98  ? 68   PHE C CG    1 
ATOM   7452  C  CD1   . PHE C 3  68  ? 110.840 135.687 170.101 1.00 31.98  ? 68   PHE C CD1   1 
ATOM   7453  C  CD2   . PHE C 3  68  ? 112.039 133.785 169.320 1.00 31.98  ? 68   PHE C CD2   1 
ATOM   7454  C  CE1   . PHE C 3  68  ? 111.827 136.512 169.604 1.00 31.98  ? 68   PHE C CE1   1 
ATOM   7455  C  CE2   . PHE C 3  68  ? 113.032 134.603 168.833 1.00 31.98  ? 68   PHE C CE2   1 
ATOM   7456  C  CZ    . PHE C 3  68  ? 112.926 135.964 168.978 1.00 31.98  ? 68   PHE C CZ    1 
ATOM   7457  N  N     . HIS C 3  69  ? 108.556 132.583 167.662 1.00 41.75  ? 69   HIS C N     1 
ATOM   7458  C  CA    . HIS C 3  69  ? 108.676 132.601 166.210 1.00 41.75  ? 69   HIS C CA    1 
ATOM   7459  C  C     . HIS C 3  69  ? 107.357 132.780 165.479 1.00 41.75  ? 69   HIS C C     1 
ATOM   7460  O  O     . HIS C 3  69  ? 107.375 133.017 164.268 1.00 41.75  ? 69   HIS C O     1 
ATOM   7461  C  CB    . HIS C 3  69  ? 109.351 131.331 165.704 1.00 41.75  ? 69   HIS C CB    1 
ATOM   7462  C  CG    . HIS C 3  69  ? 110.823 131.312 165.934 1.00 41.75  ? 69   HIS C CG    1 
ATOM   7463  N  ND1   . HIS C 3  69  ? 111.389 130.814 167.084 1.00 41.75  ? 69   HIS C ND1   1 
ATOM   7464  C  CD2   . HIS C 3  69  ? 111.847 131.751 165.167 1.00 41.75  ? 69   HIS C CD2   1 
ATOM   7465  C  CE1   . HIS C 3  69  ? 112.700 130.939 167.012 1.00 41.75  ? 69   HIS C CE1   1 
ATOM   7466  N  NE2   . HIS C 3  69  ? 113.005 131.504 165.860 1.00 41.75  ? 69   HIS C NE2   1 
ATOM   7467  N  N     . ASP C 3  70  ? 106.219 132.670 166.160 1.00 43.12  ? 70   ASP C N     1 
ATOM   7468  C  CA    . ASP C 3  70  ? 104.972 133.050 165.509 1.00 43.12  ? 70   ASP C CA    1 
ATOM   7469  C  C     . ASP C 3  70  ? 104.864 134.559 165.369 1.00 43.12  ? 70   ASP C C     1 
ATOM   7470  O  O     . ASP C 3  70  ? 104.222 135.050 164.435 1.00 43.12  ? 70   ASP C O     1 
ATOM   7471  C  CB    . ASP C 3  70  ? 103.773 132.498 166.275 1.00 43.12  ? 70   ASP C CB    1 
ATOM   7472  C  CG    . ASP C 3  70  ? 103.610 131.004 166.100 1.00 43.12  ? 70   ASP C CG    1 
ATOM   7473  O  OD1   . ASP C 3  70  ? 104.026 130.482 165.045 1.00 43.12  ? 70   ASP C OD1   1 
ATOM   7474  O  OD2   . ASP C 3  70  ? 103.064 130.351 167.014 1.00 43.12  ? 70   ASP C OD2   1 
ATOM   7475  N  N     . GLN C 3  71  ? 105.484 135.307 166.279 1.00 40.90  ? 71   GLN C N     1 
ATOM   7476  C  CA    . GLN C 3  71  ? 105.471 136.758 166.170 1.00 40.90  ? 71   GLN C CA    1 
ATOM   7477  C  C     . GLN C 3  71  ? 106.587 137.277 165.276 1.00 40.90  ? 71   GLN C C     1 
ATOM   7478  O  O     . GLN C 3  71  ? 106.398 138.290 164.602 1.00 40.90  ? 71   GLN C O     1 
ATOM   7479  C  CB    . GLN C 3  71  ? 105.576 137.392 167.553 1.00 40.90  ? 71   GLN C CB    1 
ATOM   7480  C  CG    . GLN C 3  71  ? 104.360 137.192 168.431 1.00 40.90  ? 71   GLN C CG    1 
ATOM   7481  C  CD    . GLN C 3  71  ? 104.540 137.788 169.810 1.00 40.90  ? 71   GLN C CD    1 
ATOM   7482  O  OE1   . GLN C 3  71  ? 105.616 138.271 170.153 1.00 40.90  ? 71   GLN C OE1   1 
ATOM   7483  N  NE2   . GLN C 3  71  ? 103.484 137.760 170.608 1.00 40.90  ? 71   GLN C NE2   1 
ATOM   7484  N  N     . VAL C 3  72  ? 107.743 136.608 165.255 1.00 36.25  ? 72   VAL C N     1 
ATOM   7485  C  CA    . VAL C 3  72  ? 108.845 137.049 164.401 1.00 36.25  ? 72   VAL C CA    1 
ATOM   7486  C  C     . VAL C 3  72  ? 108.512 136.811 162.932 1.00 36.25  ? 72   VAL C C     1 
ATOM   7487  O  O     . VAL C 3  72  ? 108.803 137.653 162.074 1.00 36.25  ? 72   VAL C O     1 
ATOM   7488  C  CB    . VAL C 3  72  ? 110.155 136.361 164.830 1.00 36.25  ? 72   VAL C CB    1 
ATOM   7489  C  CG1   . VAL C 3  72  ? 111.279 136.652 163.862 1.00 36.25  ? 72   VAL C CG1   1 
ATOM   7490  C  CG2   . VAL C 3  72  ? 110.559 136.845 166.196 1.00 36.25  ? 72   VAL C CG2   1 
ATOM   7491  N  N     . ASP C 3  73  ? 107.851 135.690 162.626 1.00 41.58  ? 73   ASP C N     1 
ATOM   7492  C  CA    . ASP C 3  73  ? 107.331 135.480 161.277 1.00 41.58  ? 73   ASP C CA    1 
ATOM   7493  C  C     . ASP C 3  73  ? 106.252 136.493 160.929 1.00 41.58  ? 73   ASP C C     1 
ATOM   7494  O  O     . ASP C 3  73  ? 106.099 136.859 159.759 1.00 41.58  ? 73   ASP C O     1 
ATOM   7495  C  CB    . ASP C 3  73  ? 106.775 134.067 161.134 1.00 41.58  ? 73   ASP C CB    1 
ATOM   7496  C  CG    . ASP C 3  73  ? 107.856 133.013 161.140 1.00 41.58  ? 73   ASP C CG    1 
ATOM   7497  O  OD1   . ASP C 3  73  ? 108.988 133.319 160.714 1.00 41.58  ? 73   ASP C OD1   1 
ATOM   7498  O  OD2   . ASP C 3  73  ? 107.569 131.875 161.565 1.00 41.58  ? 73   ASP C OD2   1 
ATOM   7499  N  N     . HIS C 3  74  ? 105.499 136.957 161.927 1.00 45.15  ? 74   HIS C N     1 
ATOM   7500  C  CA    . HIS C 3  74  ? 104.546 138.032 161.691 1.00 45.15  ? 74   HIS C CA    1 
ATOM   7501  C  C     . HIS C 3  74  ? 105.260 139.354 161.440 1.00 45.15  ? 74   HIS C C     1 
ATOM   7502  O  O     . HIS C 3  74  ? 104.806 140.156 160.620 1.00 45.15  ? 74   HIS C O     1 
ATOM   7503  C  CB    . HIS C 3  74  ? 103.583 138.147 162.870 1.00 45.15  ? 74   HIS C CB    1 
ATOM   7504  C  CG    . HIS C 3  74  ? 102.568 139.235 162.716 1.00 45.15  ? 74   HIS C CG    1 
ATOM   7505  N  ND1   . HIS C 3  74  ? 101.514 139.152 161.833 1.00 45.15  ? 74   HIS C ND1   1 
ATOM   7506  C  CD2   . HIS C 3  74  ? 102.443 140.430 163.339 1.00 45.15  ? 74   HIS C CD2   1 
ATOM   7507  C  CE1   . HIS C 3  74  ? 100.786 140.251 161.914 1.00 45.15  ? 74   HIS C CE1   1 
ATOM   7508  N  NE2   . HIS C 3  74  ? 101.328 141.043 162.821 1.00 45.15  ? 74   HIS C NE2   1 
ATOM   7509  N  N     . ILE C 3  75  ? 106.389 139.588 162.117 1.00 40.45  ? 75   ILE C N     1 
ATOM   7510  C  CA    . ILE C 3  75  ? 107.140 140.830 161.932 1.00 40.45  ? 75   ILE C CA    1 
ATOM   7511  C  C     . ILE C 3  75  ? 107.783 140.873 160.551 1.00 40.45  ? 75   ILE C C     1 
ATOM   7512  O  O     . ILE C 3  75  ? 107.664 141.871 159.833 1.00 40.45  ? 75   ILE C O     1 
ATOM   7513  C  CB    . ILE C 3  75  ? 108.187 140.999 163.049 1.00 40.45  ? 75   ILE C CB    1 
ATOM   7514  C  CG1   . ILE C 3  75  ? 107.506 141.308 164.378 1.00 40.45  ? 75   ILE C CG1   1 
ATOM   7515  C  CG2   . ILE C 3  75  ? 109.175 142.100 162.718 1.00 40.45  ? 75   ILE C CG2   1 
ATOM   7516  C  CD1   . ILE C 3  75  ? 108.419 141.170 165.560 1.00 40.45  ? 75   ILE C CD1   1 
ATOM   7517  N  N     . ILE C 3  76  ? 108.450 139.782 160.155 1.00 41.34  ? 76   ILE C N     1 
ATOM   7518  C  CA    . ILE C 3  76  ? 109.147 139.703 158.869 1.00 41.34  ? 76   ILE C CA    1 
ATOM   7519  C  C     . ILE C 3  76  ? 108.172 139.824 157.701 1.00 41.34  ? 76   ILE C C     1 
ATOM   7520  O  O     . ILE C 3  76  ? 108.493 140.428 156.670 1.00 41.34  ? 76   ILE C O     1 
ATOM   7521  C  CB    . ILE C 3  76  ? 109.970 138.395 158.815 1.00 41.34  ? 76   ILE C CB    1 
ATOM   7522  C  CG1   . ILE C 3  76  ? 111.085 138.423 159.856 1.00 41.34  ? 76   ILE C CG1   1 
ATOM   7523  C  CG2   . ILE C 3  76  ? 110.593 138.150 157.452 1.00 41.34  ? 76   ILE C CG2   1 
ATOM   7524  C  CD1   . ILE C 3  76  ? 111.761 137.088 160.033 1.00 41.34  ? 76   ILE C CD1   1 
ATOM   7525  N  N     . ASP C 3  77  ? 106.948 139.319 157.860 1.00 44.59  ? 77   ASP C N     1 
ATOM   7526  C  CA    . ASP C 3  77  ? 105.941 139.539 156.831 1.00 44.59  ? 77   ASP C CA    1 
ATOM   7527  C  C     . ASP C 3  77  ? 105.452 140.981 156.792 1.00 44.59  ? 77   ASP C C     1 
ATOM   7528  O  O     . ASP C 3  77  ? 104.904 141.402 155.769 1.00 44.59  ? 77   ASP C O     1 
ATOM   7529  C  CB    . ASP C 3  77  ? 104.762 138.589 157.027 1.00 44.59  ? 77   ASP C CB    1 
ATOM   7530  C  CG    . ASP C 3  77  ? 105.109 137.154 156.680 1.00 44.59  ? 77   ASP C CG    1 
ATOM   7531  O  OD1   . ASP C 3  77  ? 106.007 136.944 155.838 1.00 44.59  ? 77   ASP C OD1   1 
ATOM   7532  O  OD2   . ASP C 3  77  ? 104.476 136.233 157.238 1.00 44.59  ? 77   ASP C OD2   1 
ATOM   7533  N  N     . ASN C 3  78  ? 105.642 141.750 157.867 1.00 41.98  ? 78   ASN C N     1 
ATOM   7534  C  CA    . ASN C 3  78  ? 105.341 143.174 157.805 1.00 41.98  ? 78   ASN C CA    1 
ATOM   7535  C  C     . ASN C 3  78  ? 106.492 144.002 157.250 1.00 41.98  ? 78   ASN C C     1 
ATOM   7536  O  O     . ASN C 3  78  ? 106.248 145.117 156.786 1.00 41.98  ? 78   ASN C O     1 
ATOM   7537  C  CB    . ASN C 3  78  ? 104.957 143.734 159.178 1.00 41.98  ? 78   ASN C CB    1 
ATOM   7538  C  CG    . ASN C 3  78  ? 103.628 143.204 159.683 1.00 41.98  ? 78   ASN C CG    1 
ATOM   7539  O  OD1   . ASN C 3  78  ? 103.536 142.668 160.784 1.00 41.98  ? 78   ASN C OD1   1 
ATOM   7540  N  ND2   . ASN C 3  78  ? 102.592 143.336 158.865 1.00 41.98  ? 78   ASN C ND2   1 
ATOM   7541  N  N     . ILE C 3  79  ? 107.735 143.505 157.284 1.00 40.83  ? 79   ILE C N     1 
ATOM   7542  C  CA    . ILE C 3  79  ? 108.821 144.320 156.743 1.00 40.83  ? 79   ILE C CA    1 
ATOM   7543  C  C     . ILE C 3  79  ? 108.829 144.273 155.224 1.00 40.83  ? 79   ILE C C     1 
ATOM   7544  O  O     . ILE C 3  79  ? 109.426 145.150 154.592 1.00 40.83  ? 79   ILE C O     1 
ATOM   7545  C  CB    . ILE C 3  79  ? 110.230 143.935 157.240 1.00 40.83  ? 79   ILE C CB    1 
ATOM   7546  C  CG1   . ILE C 3  79  ? 110.804 142.726 156.510 1.00 40.83  ? 79   ILE C CG1   1 
ATOM   7547  C  CG2   . ILE C 3  79  ? 110.202 143.548 158.679 1.00 40.83  ? 79   ILE C CG2   1 
ATOM   7548  C  CD1   . ILE C 3  79  ? 112.269 142.490 156.798 1.00 40.83  ? 79   ILE C CD1   1 
ATOM   7549  N  N     . GLU C 3  80  ? 108.182 143.276 154.621 1.00 43.98  ? 80   GLU C N     1 
ATOM   7550  C  CA    . GLU C 3  80  ? 108.067 143.215 153.174 1.00 43.98  ? 80   GLU C CA    1 
ATOM   7551  C  C     . GLU C 3  80  ? 106.789 143.870 152.683 1.00 43.98  ? 80   GLU C C     1 
ATOM   7552  O  O     . GLU C 3  80  ? 106.807 144.542 151.651 1.00 43.98  ? 80   GLU C O     1 
ATOM   7553  C  CB    . GLU C 3  80  ? 108.136 141.766 152.693 1.00 43.98  ? 80   GLU C CB    1 
ATOM   7554  C  CG    . GLU C 3  80  ? 109.526 141.174 152.778 1.00 43.98  ? 80   GLU C CG    1 
ATOM   7555  C  CD    . GLU C 3  80  ? 110.478 141.808 151.780 1.00 43.98  ? 80   GLU C CD    1 
ATOM   7556  O  OE1   . GLU C 3  80  ? 110.026 142.160 150.670 1.00 43.98  ? 80   GLU C OE1   1 
ATOM   7557  O  OE2   . GLU C 3  80  ? 111.672 141.965 152.108 1.00 43.98  ? 80   GLU C OE2   1 
ATOM   7558  N  N     . ALA C 3  81  ? 105.686 143.708 153.419 1.00 39.48  ? 81   ALA C N     1 
ATOM   7559  C  CA    . ALA C 3  81  ? 104.439 144.367 153.043 1.00 39.48  ? 81   ALA C CA    1 
ATOM   7560  C  C     . ALA C 3  81  ? 104.534 145.878 153.195 1.00 39.48  ? 81   ALA C C     1 
ATOM   7561  O  O     . ALA C 3  81  ? 103.860 146.614 152.467 1.00 39.48  ? 81   ALA C O     1 
ATOM   7562  C  CB    . ALA C 3  81  ? 103.283 143.821 153.877 1.00 39.48  ? 81   ALA C CB    1 
ATOM   7563  N  N     . ASP C 3  82  ? 105.362 146.358 154.124 1.00 42.26  ? 82   ASP C N     1 
ATOM   7564  C  CA    . ASP C 3  82  ? 105.646 147.787 154.189 1.00 42.26  ? 82   ASP C CA    1 
ATOM   7565  C  C     . ASP C 3  82  ? 106.557 148.207 153.044 1.00 42.26  ? 82   ASP C C     1 
ATOM   7566  O  O     . ASP C 3  82  ? 106.387 149.289 152.473 1.00 42.26  ? 82   ASP C O     1 
ATOM   7567  C  CB    . ASP C 3  82  ? 106.284 148.134 155.534 1.00 42.26  ? 82   ASP C CB    1 
ATOM   7568  C  CG    . ASP C 3  82  ? 106.287 149.628 155.830 1.00 42.26  ? 82   ASP C CG    1 
ATOM   7569  O  OD1   . ASP C 3  82  ? 105.744 150.421 155.031 1.00 42.26  ? 82   ASP C OD1   1 
ATOM   7570  O  OD2   . ASP C 3  82  ? 106.850 150.012 156.877 1.00 42.26  ? 82   ASP C OD2   1 
ATOM   7571  N  N     . LEU C 3  83  ? 107.517 147.358 152.681 1.00 36.92  ? 83   LEU C N     1 
ATOM   7572  C  CA    . LEU C 3  83  ? 108.493 147.751 151.674 1.00 36.92  ? 83   LEU C CA    1 
ATOM   7573  C  C     . LEU C 3  83  ? 107.925 147.641 150.266 1.00 36.92  ? 83   LEU C C     1 
ATOM   7574  O  O     . LEU C 3  83  ? 108.318 148.418 149.393 1.00 36.92  ? 83   LEU C O     1 
ATOM   7575  C  CB    . LEU C 3  83  ? 109.766 146.911 151.830 1.00 36.92  ? 83   LEU C CB    1 
ATOM   7576  C  CG    . LEU C 3  83  ? 111.101 147.369 151.227 1.00 36.92  ? 83   LEU C CG    1 
ATOM   7577  C  CD1   . LEU C 3  83  ? 111.310 146.983 149.767 1.00 36.92  ? 83   LEU C CD1   1 
ATOM   7578  C  CD2   . LEU C 3  83  ? 111.207 148.877 151.389 1.00 36.92  ? 83   LEU C CD2   1 
ATOM   7579  N  N     . LYS C 3  84  ? 107.013 146.691 150.028 1.00 35.02  ? 84   LYS C N     1 
ATOM   7580  C  CA    . LYS C 3  84  ? 106.282 146.651 148.763 1.00 35.02  ? 84   LYS C CA    1 
ATOM   7581  C  C     . LYS C 3  84  ? 105.428 147.894 148.584 1.00 35.02  ? 84   LYS C C     1 
ATOM   7582  O  O     . LYS C 3  84  ? 105.296 148.412 147.473 1.00 35.02  ? 84   LYS C O     1 
ATOM   7583  C  CB    . LYS C 3  84  ? 105.383 145.418 148.702 1.00 35.02  ? 84   LYS C CB    1 
ATOM   7584  C  CG    . LYS C 3  84  ? 106.065 144.081 148.560 1.00 35.02  ? 84   LYS C CG    1 
ATOM   7585  C  CD    . LYS C 3  84  ? 105.017 143.001 148.759 1.00 35.02  ? 84   LYS C CD    1 
ATOM   7586  C  CE    . LYS C 3  84  ? 105.613 141.615 148.838 1.00 35.02  ? 84   LYS C CE    1 
ATOM   7587  N  NZ    . LYS C 3  84  ? 104.559 140.620 149.178 1.00 35.02  ? 84   LYS C NZ    1 
ATOM   7588  N  N     . ALA C 3  85  ? 104.831 148.380 149.669 1.00 32.47  ? 85   ALA C N     1 
ATOM   7589  C  CA    . ALA C 3  85  ? 103.942 149.527 149.573 1.00 32.47  ? 85   ALA C CA    1 
ATOM   7590  C  C     . ALA C 3  85  ? 104.702 150.843 149.571 1.00 32.47  ? 85   ALA C C     1 
ATOM   7591  O  O     . ALA C 3  85  ? 104.243 151.811 148.962 1.00 32.47  ? 85   ALA C O     1 
ATOM   7592  C  CB    . ALA C 3  85  ? 102.935 149.507 150.721 1.00 32.47  ? 85   ALA C CB    1 
ATOM   7593  N  N     . GLU C 3  86  ? 105.852 150.904 150.245 1.00 35.79  ? 86   GLU C N     1 
ATOM   7594  C  CA    . GLU C 3  86  ? 106.635 152.134 150.246 1.00 35.79  ? 86   GLU C CA    1 
ATOM   7595  C  C     . GLU C 3  86  ? 107.309 152.359 148.901 1.00 35.79  ? 86   GLU C C     1 
ATOM   7596  O  O     . GLU C 3  86  ? 107.438 153.504 148.456 1.00 35.79  ? 86   GLU C O     1 
ATOM   7597  C  CB    . GLU C 3  86  ? 107.668 152.096 151.373 1.00 35.79  ? 86   GLU C CB    1 
ATOM   7598  C  CG    . GLU C 3  86  ? 108.423 153.392 151.605 1.00 35.79  ? 86   GLU C CG    1 
ATOM   7599  C  CD    . GLU C 3  86  ? 109.331 153.320 152.819 1.00 35.79  ? 86   GLU C CD    1 
ATOM   7600  O  OE1   . GLU C 3  86  ? 109.406 152.243 153.444 1.00 35.79  ? 86   GLU C OE1   1 
ATOM   7601  O  OE2   . GLU C 3  86  ? 109.959 154.343 153.161 1.00 35.79  ? 86   GLU C OE2   1 
ATOM   7602  N  N     . ILE C 3  87  ? 107.719 151.282 148.229 1.00 31.63  ? 87   ILE C N     1 
ATOM   7603  C  CA    . ILE C 3  87  ? 108.291 151.415 146.897 1.00 31.63  ? 87   ILE C CA    1 
ATOM   7604  C  C     . ILE C 3  87  ? 107.206 151.667 145.855 1.00 31.63  ? 87   ILE C C     1 
ATOM   7605  O  O     . ILE C 3  87  ? 107.495 152.240 144.803 1.00 31.63  ? 87   ILE C O     1 
ATOM   7606  C  CB    . ILE C 3  87  ? 109.140 150.174 146.549 1.00 31.63  ? 87   ILE C CB    1 
ATOM   7607  C  CG1   . ILE C 3  87  ? 110.088 150.448 145.388 1.00 31.63  ? 87   ILE C CG1   1 
ATOM   7608  C  CG2   . ILE C 3  87  ? 108.283 148.982 146.169 1.00 31.63  ? 87   ILE C CG2   1 
ATOM   7609  C  CD1   . ILE C 3  87  ? 111.049 149.332 145.149 1.00 31.63  ? 87   ILE C CD1   1 
ATOM   7610  N  N     . SER C 3  88  ? 105.950 151.316 146.138 1.00 34.65  ? 88   SER C N     1 
ATOM   7611  C  CA    . SER C 3  88  ? 104.892 151.474 145.149 1.00 34.65  ? 88   SER C CA    1 
ATOM   7612  C  C     . SER C 3  88  ? 104.213 152.832 145.224 1.00 34.65  ? 88   SER C C     1 
ATOM   7613  O  O     . SER C 3  88  ? 103.619 153.268 144.233 1.00 34.65  ? 88   SER C O     1 
ATOM   7614  C  CB    . SER C 3  88  ? 103.845 150.372 145.309 1.00 34.65  ? 88   SER C CB    1 
ATOM   7615  O  OG    . SER C 3  88  ? 102.802 150.523 144.366 1.00 34.65  ? 88   SER C OG    1 
ATOM   7616  N  N     . ASP C 3  89  ? 104.278 153.509 146.375 1.00 38.22  ? 89   ASP C N     1 
ATOM   7617  C  CA    . ASP C 3  89  ? 103.883 154.913 146.425 1.00 38.22  ? 89   ASP C CA    1 
ATOM   7618  C  C     . ASP C 3  89  ? 104.826 155.762 145.594 1.00 38.22  ? 89   ASP C C     1 
ATOM   7619  O  O     . ASP C 3  89  ? 104.420 156.773 145.012 1.00 38.22  ? 89   ASP C O     1 
ATOM   7620  C  CB    . ASP C 3  89  ? 103.910 155.434 147.861 1.00 38.22  ? 89   ASP C CB    1 
ATOM   7621  C  CG    . ASP C 3  89  ? 103.030 154.643 148.791 1.00 38.22  ? 89   ASP C CG    1 
ATOM   7622  O  OD1   . ASP C 3  89  ? 102.081 153.991 148.314 1.00 38.22  ? 89   ASP C OD1   1 
ATOM   7623  O  OD2   . ASP C 3  89  ? 103.291 154.678 150.013 1.00 38.22  ? 89   ASP C OD2   1 
ATOM   7624  N  N     . LEU C 3  90  ? 106.085 155.355 145.540 1.00 38.19  ? 90   LEU C N     1 
ATOM   7625  C  CA    . LEU C 3  90  ? 107.173 156.105 144.948 1.00 38.19  ? 90   LEU C CA    1 
ATOM   7626  C  C     . LEU C 3  90  ? 107.445 155.683 143.512 1.00 38.19  ? 90   LEU C C     1 
ATOM   7627  O  O     . LEU C 3  90  ? 108.125 156.400 142.776 1.00 38.19  ? 90   LEU C O     1 
ATOM   7628  C  CB    . LEU C 3  90  ? 108.405 155.915 145.835 1.00 38.19  ? 90   LEU C CB    1 
ATOM   7629  C  CG    . LEU C 3  90  ? 109.696 156.704 145.737 1.00 38.19  ? 90   LEU C CG    1 
ATOM   7630  C  CD1   . LEU C 3  90  ? 110.279 156.828 147.122 1.00 38.19  ? 90   LEU C CD1   1 
ATOM   7631  C  CD2   . LEU C 3  90  ? 110.638 155.933 144.897 1.00 38.19  ? 90   LEU C CD2   1 
ATOM   7632  N  N     . LEU C 3  91  ? 106.933 154.530 143.096 1.00 38.04  ? 91   LEU C N     1 
ATOM   7633  C  CA    . LEU C 3  91  ? 107.093 154.108 141.712 1.00 38.04  ? 91   LEU C CA    1 
ATOM   7634  C  C     . LEU C 3  91  ? 106.041 154.730 140.812 1.00 38.04  ? 91   LEU C C     1 
ATOM   7635  O  O     . LEU C 3  91  ? 106.274 154.892 139.610 1.00 38.04  ? 91   LEU C O     1 
ATOM   7636  C  CB    . LEU C 3  91  ? 107.037 152.584 141.633 1.00 38.04  ? 91   LEU C CB    1 
ATOM   7637  C  CG    . LEU C 3  91  ? 107.158 151.796 140.338 1.00 38.04  ? 91   LEU C CG    1 
ATOM   7638  C  CD1   . LEU C 3  91  ? 108.431 152.136 139.640 1.00 38.04  ? 91   LEU C CD1   1 
ATOM   7639  C  CD2   . LEU C 3  91  ? 107.158 150.340 140.707 1.00 38.04  ? 91   LEU C CD2   1 
ATOM   7640  N  N     . TYR C 3  92  ? 104.900 155.111 141.369 1.00 46.28  ? 92   TYR C N     1 
ATOM   7641  C  CA    . TYR C 3  92  ? 103.783 155.585 140.576 1.00 46.28  ? 92   TYR C CA    1 
ATOM   7642  C  C     . TYR C 3  92  ? 103.488 157.053 140.852 1.00 46.28  ? 92   TYR C C     1 
ATOM   7643  O  O     . TYR C 3  92  ? 103.913 157.628 141.859 1.00 46.28  ? 92   TYR C O     1 
ATOM   7644  C  CB    . TYR C 3  92  ? 102.536 154.744 140.852 1.00 46.28  ? 92   TYR C CB    1 
ATOM   7645  C  CG    . TYR C 3  92  ? 102.668 153.316 140.388 1.00 46.28  ? 92   TYR C CG    1 
ATOM   7646  C  CD1   . TYR C 3  92  ? 102.496 152.984 139.054 1.00 46.28  ? 92   TYR C CD1   1 
ATOM   7647  C  CD2   . TYR C 3  92  ? 102.968 152.301 141.284 1.00 46.28  ? 92   TYR C CD2   1 
ATOM   7648  C  CE1   . TYR C 3  92  ? 102.619 151.683 138.627 1.00 46.28  ? 92   TYR C CE1   1 
ATOM   7649  C  CE2   . TYR C 3  92  ? 103.093 150.998 140.867 1.00 46.28  ? 92   TYR C CE2   1 
ATOM   7650  C  CZ    . TYR C 3  92  ? 102.919 150.698 139.538 1.00 46.28  ? 92   TYR C CZ    1 
ATOM   7651  O  OH    . TYR C 3  92  ? 103.038 149.405 139.108 1.00 46.28  ? 92   TYR C OH    1 
ATOM   7652  N  N     . SER C 3  93  ? 102.767 157.648 139.903 1.00 54.39  ? 93   SER C N     1 
ATOM   7653  C  CA    . SER C 3  93  ? 102.059 158.922 139.917 1.00 54.39  ? 93   SER C CA    1 
ATOM   7654  C  C     . SER C 3  93  ? 102.964 160.155 139.873 1.00 54.39  ? 93   SER C C     1 
ATOM   7655  O  O     . SER C 3  93  ? 102.437 161.266 139.951 1.00 54.39  ? 93   SER C O     1 
ATOM   7656  C  CB    . SER C 3  93  ? 101.108 159.077 141.123 1.00 30.00  ? 93   SER C CB    1 
ATOM   7657  O  OG    . SER C 3  93  ? 101.833 159.273 142.325 1.00 30.00  ? 93   SER C OG    1 
ATOM   7658  N  N     . GLU C 3  94  ? 104.288 160.028 139.727 1.00 65.48  ? 94   GLU C N     1 
ATOM   7659  C  CA    . GLU C 3  94  ? 105.116 161.231 139.572 1.00 65.48  ? 94   GLU C CA    1 
ATOM   7660  C  C     . GLU C 3  94  ? 104.916 161.793 138.168 1.00 65.48  ? 94   GLU C C     1 
ATOM   7661  O  O     . GLU C 3  94  ? 105.707 161.559 137.251 1.00 65.48  ? 94   GLU C O     1 
ATOM   7662  C  CB    . GLU C 3  94  ? 106.607 161.006 139.813 1.00 65.48  ? 94   GLU C CB    1 
ATOM   7663  C  CG    . GLU C 3  94  ? 107.063 160.797 141.238 1.00 65.48  ? 94   GLU C CG    1 
ATOM   7664  C  CD    . GLU C 3  94  ? 107.717 159.463 141.466 1.00 65.48  ? 94   GLU C CD    1 
ATOM   7665  O  OE1   . GLU C 3  94  ? 107.911 158.715 140.487 1.00 65.48  ? 94   GLU C OE1   1 
ATOM   7666  O  OE2   . GLU C 3  94  ? 108.102 159.206 142.623 1.00 65.48  ? 94   GLU C OE2   1 
ATOM   7667  N  N     . THR C 3  95  ? 103.842 162.562 138.007 1.00 68.98  ? 95   THR C N     1 
ATOM   7668  C  CA    . THR C 3  95  ? 103.452 163.067 136.694 1.00 68.98  ? 95   THR C CA    1 
ATOM   7669  C  C     . THR C 3  95  ? 104.412 164.174 136.280 1.00 68.98  ? 95   THR C C     1 
ATOM   7670  O  O     . THR C 3  95  ? 104.280 165.328 136.695 1.00 68.98  ? 95   THR C O     1 
ATOM   7671  C  CB    . THR C 3  95  ? 102.008 163.558 136.716 1.00 68.98  ? 95   THR C CB    1 
ATOM   7672  O  OG1   . THR C 3  95  ? 101.150 162.486 137.126 1.00 68.98  ? 95   THR C OG1   1 
ATOM   7673  C  CG2   . THR C 3  95  ? 101.585 164.012 135.326 1.00 68.98  ? 95   THR C CG2   1 
ATOM   7674  N  N     . THR C 3  96  ? 105.409 163.809 135.479 1.00 71.88  ? 96   THR C N     1 
ATOM   7675  C  CA    . THR C 3  96  ? 106.331 164.770 134.900 1.00 71.88  ? 96   THR C CA    1 
ATOM   7676  C  C     . THR C 3  96  ? 105.701 165.367 133.652 1.00 71.88  ? 96   THR C C     1 
ATOM   7677  O  O     . THR C 3  96  ? 105.005 164.676 132.904 1.00 71.88  ? 96   THR C O     1 
ATOM   7678  C  CB    . THR C 3  96  ? 107.665 164.109 134.545 1.00 30.00  ? 96   THR C CB    1 
ATOM   7679  O  OG1   . THR C 3  96  ? 107.454 163.121 133.529 1.00 30.00  ? 96   THR C OG1   1 
ATOM   7680  C  CG2   . THR C 3  96  ? 108.266 163.439 135.769 1.00 30.00  ? 96   THR C CG2   1 
ATOM   7681  N  N     . GLN C 3  97  ? 105.940 166.656 133.435 1.00 80.81  ? 97   GLN C N     1 
ATOM   7682  C  CA    . GLN C 3  97  ? 105.378 167.320 132.270 1.00 80.81  ? 97   GLN C CA    1 
ATOM   7683  C  C     . GLN C 3  97  ? 106.293 167.245 131.056 1.00 80.81  ? 97   GLN C C     1 
ATOM   7684  O  O     . GLN C 3  97  ? 105.830 167.470 129.932 1.00 80.81  ? 97   GLN C O     1 
ATOM   7685  C  CB    . GLN C 3  97  ? 105.071 168.786 132.590 1.00 80.81  ? 97   GLN C CB    1 
ATOM   7686  C  CG    . GLN C 3  97  ? 104.155 168.980 133.792 1.00 80.81  ? 97   GLN C CG    1 
ATOM   7687  C  CD    . GLN C 3  97  ? 102.786 168.344 133.619 1.00 80.81  ? 97   GLN C CD    1 
ATOM   7688  O  OE1   . GLN C 3  97  ? 102.214 168.346 132.529 1.00 80.81  ? 97   GLN C OE1   1 
ATOM   7689  N  NE2   . GLN C 3  97  ? 102.248 167.804 134.707 1.00 80.81  ? 97   GLN C NE2   1 
ATOM   7690  N  N     . LYS C 3  98  ? 107.572 166.924 131.258 1.00 76.81  ? 98   LYS C N     1 
ATOM   7691  C  CA    . LYS C 3  98  ? 108.507 166.818 130.144 1.00 76.81  ? 98   LYS C CA    1 
ATOM   7692  C  C     . LYS C 3  98  ? 108.399 165.466 129.438 1.00 76.81  ? 98   LYS C C     1 
ATOM   7693  O  O     . LYS C 3  98  ? 108.554 165.400 128.213 1.00 76.81  ? 98   LYS C O     1 
ATOM   7694  C  CB    . LYS C 3  98  ? 109.931 167.095 130.641 1.00 76.81  ? 98   LYS C CB    1 
ATOM   7695  C  CG    . LYS C 3  98  ? 110.412 166.207 131.786 1.00 76.81  ? 98   LYS C CG    1 
ATOM   7696  C  CD    . LYS C 3  98  ? 111.813 166.587 132.242 1.00 76.81  ? 98   LYS C CD    1 
ATOM   7697  C  CE    . LYS C 3  98  ? 111.806 167.893 133.026 1.00 76.81  ? 98   LYS C CE    1 
ATOM   7698  N  NZ    . LYS C 3  98  ? 113.144 168.208 133.605 1.00 76.81  ? 98   LYS C NZ    1 
ATOM   7699  N  N     . ARG C 3  99  ? 108.146 164.391 130.200 1.00 67.27  ? 99   ARG C N     1 
ATOM   7700  C  CA    . ARG C 3  99  ? 107.753 163.065 129.696 1.00 67.27  ? 99   ARG C CA    1 
ATOM   7701  C  C     . ARG C 3  99  ? 108.796 162.405 128.790 1.00 67.27  ? 99   ARG C C     1 
ATOM   7702  O  O     . ARG C 3  99  ? 108.449 161.561 127.962 1.00 67.27  ? 99   ARG C O     1 
ATOM   7703  C  CB    . ARG C 3  99  ? 106.402 163.117 128.970 1.00 67.27  ? 99   ARG C CB    1 
ATOM   7704  C  CG    . ARG C 3  99  ? 105.203 163.350 129.868 1.00 67.27  ? 99   ARG C CG    1 
ATOM   7705  C  CD    . ARG C 3  99  ? 104.929 162.112 130.707 1.00 67.27  ? 99   ARG C CD    1 
ATOM   7706  N  NE    . ARG C 3  99  ? 103.774 162.273 131.584 1.00 67.27  ? 99   ARG C NE    1 
ATOM   7707  C  CZ    . ARG C 3  99  ? 102.529 161.962 131.243 1.00 67.27  ? 99   ARG C CZ    1 
ATOM   7708  N  NH1   . ARG C 3  99  ? 101.538 162.138 132.107 1.00 67.27  ? 99   ARG C NH1   1 
ATOM   7709  N  NH2   . ARG C 3  99  ? 102.272 161.475 130.037 1.00 67.27  ? 99   ARG C NH2   1 
ATOM   7710  N  N     . ARG C 3  100 ? 110.075 162.749 128.924 1.00 62.36  ? 100  ARG C N     1 
ATOM   7711  C  CA    . ARG C 3  100 ? 111.113 162.146 128.085 1.00 62.36  ? 100  ARG C CA    1 
ATOM   7712  C  C     . ARG C 3  100 ? 112.307 161.705 128.919 1.00 62.36  ? 100  ARG C C     1 
ATOM   7713  O  O     . ARG C 3  100 ? 113.463 161.969 128.583 1.00 62.36  ? 100  ARG C O     1 
ATOM   7714  C  CB    . ARG C 3  100 ? 111.576 163.085 126.976 1.00 62.36  ? 100  ARG C CB    1 
ATOM   7715  C  CG    . ARG C 3  100 ? 110.530 163.365 125.918 1.00 62.36  ? 100  ARG C CG    1 
ATOM   7716  C  CD    . ARG C 3  100 ? 110.151 162.081 125.200 1.00 62.36  ? 100  ARG C CD    1 
ATOM   7717  N  NE    . ARG C 3  100 ? 109.250 162.324 124.081 1.00 62.36  ? 100  ARG C NE    1 
ATOM   7718  C  CZ    . ARG C 3  100 ? 108.653 161.367 123.381 1.00 62.36  ? 100  ARG C CZ    1 
ATOM   7719  N  NH1   . ARG C 3  100 ? 107.859 161.690 122.373 1.00 62.36  ? 100  ARG C NH1   1 
ATOM   7720  N  NH2   . ARG C 3  100 ? 108.837 160.092 123.695 1.00 62.36  ? 100  ARG C NH2   1 
ATOM   7721  N  N     . CYS C 3  101 ? 112.036 161.005 130.014 1.00 47.93  ? 101  CYS C N     1 
ATOM   7722  C  CA    . CYS C 3  101 ? 113.081 160.445 130.860 1.00 47.93  ? 101  CYS C CA    1 
ATOM   7723  C  C     . CYS C 3  101 ? 112.493 159.259 131.609 1.00 47.93  ? 101  CYS C C     1 
ATOM   7724  O  O     . CYS C 3  101 ? 111.323 158.910 131.437 1.00 47.93  ? 101  CYS C O     1 
ATOM   7725  C  CB    . CYS C 3  101 ? 113.639 161.497 131.822 1.00 47.93  ? 101  CYS C CB    1 
ATOM   7726  S  SG    . CYS C 3  101 ? 112.426 162.134 132.990 1.00 47.93  ? 101  CYS C SG    1 
ATOM   7727  N  N     . PHE C 3  102 ? 113.314 158.638 132.448 1.00 28.75  ? 102  PHE C N     1 
ATOM   7728  C  CA    . PHE C 3  102 ? 112.874 157.547 133.302 1.00 28.75  ? 102  PHE C CA    1 
ATOM   7729  C  C     . PHE C 3  102 ? 113.013 157.933 134.766 1.00 28.75  ? 102  PHE C C     1 
ATOM   7730  O  O     . PHE C 3  102 ? 113.993 158.569 135.159 1.00 28.75  ? 102  PHE C O     1 
ATOM   7731  C  CB    . PHE C 3  102 ? 113.650 156.246 133.004 1.00 28.75  ? 102  PHE C CB    1 
ATOM   7732  C  CG    . PHE C 3  102 ? 115.136 156.415 132.907 1.00 28.75  ? 102  PHE C CG    1 
ATOM   7733  C  CD1   . PHE C 3  102 ? 115.739 156.549 131.678 1.00 28.75  ? 102  PHE C CD1   1 
ATOM   7734  C  CD2   . PHE C 3  102 ? 115.928 156.419 134.028 1.00 28.75  ? 102  PHE C CD2   1 
ATOM   7735  C  CE1   . PHE C 3  102 ? 117.087 156.702 131.557 1.00 28.75  ? 102  PHE C CE1   1 
ATOM   7736  C  CE2   . PHE C 3  102 ? 117.275 156.592 133.920 1.00 28.75  ? 102  PHE C CE2   1 
ATOM   7737  C  CZ    . PHE C 3  102 ? 117.862 156.723 132.683 1.00 28.75  ? 102  PHE C CZ    1 
ATOM   7738  N  N     . ASN C 3  103 ? 112.021 157.559 135.572 1.00 23.95  ? 103  ASN C N     1 
ATOM   7739  C  CA    . ASN C 3  103 ? 112.113 157.767 137.010 1.00 23.95  ? 103  ASN C CA    1 
ATOM   7740  C  C     . ASN C 3  103 ? 112.957 156.667 137.645 1.00 23.95  ? 103  ASN C C     1 
ATOM   7741  O  O     . ASN C 3  103 ? 112.623 155.481 137.574 1.00 23.95  ? 103  ASN C O     1 
ATOM   7742  C  CB    . ASN C 3  103 ? 110.727 157.859 137.650 1.00 23.95  ? 103  ASN C CB    1 
ATOM   7743  C  CG    . ASN C 3  103 ? 109.786 156.766 137.200 1.00 23.95  ? 103  ASN C CG    1 
ATOM   7744  O  OD1   . ASN C 3  103 ? 110.119 155.949 136.350 1.00 23.95  ? 103  ASN C OD1   1 
ATOM   7745  N  ND2   . ASN C 3  103 ? 108.601 156.737 137.789 1.00 23.95  ? 103  ASN C ND2   1 
ATOM   7746  N  N     . THR C 3  104 ? 114.057 157.071 138.259 1.00 19.26  ? 104  THR C N     1 
ATOM   7747  C  CA    . THR C 3  104 ? 115.036 156.162 138.827 1.00 19.26  ? 104  THR C CA    1 
ATOM   7748  C  C     . THR C 3  104 ? 114.806 156.045 140.327 1.00 19.26  ? 104  THR C C     1 
ATOM   7749  O  O     . THR C 3  104 ? 114.575 157.047 141.005 1.00 19.26  ? 104  THR C O     1 
ATOM   7750  C  CB    . THR C 3  104 ? 116.443 156.683 138.544 1.00 19.26  ? 104  THR C CB    1 
ATOM   7751  O  OG1   . THR C 3  104 ? 116.599 156.878 137.138 1.00 19.26  ? 104  THR C OG1   1 
ATOM   7752  C  CG2   . THR C 3  104 ? 117.467 155.703 138.990 1.00 19.26  ? 104  THR C CG2   1 
ATOM   7753  N  N     . ILE C 3  105 ? 114.847 154.821 140.844 1.00 16.85  ? 105  ILE C N     1 
ATOM   7754  C  CA    . ILE C 3  105 ? 114.631 154.574 142.261 1.00 16.85  ? 105  ILE C CA    1 
ATOM   7755  C  C     . ILE C 3  105 ? 115.878 153.910 142.821 1.00 16.85  ? 105  ILE C C     1 
ATOM   7756  O  O     . ILE C 3  105 ? 116.147 152.738 142.536 1.00 16.85  ? 105  ILE C O     1 
ATOM   7757  C  CB    . ILE C 3  105 ? 113.393 153.709 142.509 1.00 16.85  ? 105  ILE C CB    1 
ATOM   7758  C  CG1   . ILE C 3  105 ? 112.156 154.398 141.951 1.00 16.85  ? 105  ILE C CG1   1 
ATOM   7759  C  CG2   . ILE C 3  105 ? 113.226 153.452 143.985 1.00 16.85  ? 105  ILE C CG2   1 
ATOM   7760  C  CD1   . ILE C 3  105 ? 110.940 153.535 141.983 1.00 16.85  ? 105  ILE C CD1   1 
ATOM   7761  N  N     . PHE C 3  106 ? 116.642 154.654 143.612 1.00 19.83  ? 106  PHE C N     1 
ATOM   7762  C  CA    . PHE C 3  106 ? 117.813 154.114 144.286 1.00 19.83  ? 106  PHE C CA    1 
ATOM   7763  C  C     . PHE C 3  106 ? 117.381 153.580 145.644 1.00 19.83  ? 106  PHE C C     1 
ATOM   7764  O  O     . PHE C 3  106 ? 116.843 154.330 146.464 1.00 19.83  ? 106  PHE C O     1 
ATOM   7765  C  CB    . PHE C 3  106 ? 118.888 155.183 144.457 1.00 19.83  ? 106  PHE C CB    1 
ATOM   7766  C  CG    . PHE C 3  106 ? 119.435 155.707 143.170 1.00 19.83  ? 106  PHE C CG    1 
ATOM   7767  C  CD1   . PHE C 3  106 ? 120.400 155.004 142.471 1.00 19.83  ? 106  PHE C CD1   1 
ATOM   7768  C  CD2   . PHE C 3  106 ? 118.992 156.913 142.665 1.00 19.83  ? 106  PHE C CD2   1 
ATOM   7769  C  CE1   . PHE C 3  106 ? 120.908 155.496 141.286 1.00 19.83  ? 106  PHE C CE1   1 
ATOM   7770  C  CE2   . PHE C 3  106 ? 119.494 157.407 141.485 1.00 19.83  ? 106  PHE C CE2   1 
ATOM   7771  C  CZ    . PHE C 3  106 ? 120.455 156.699 140.795 1.00 19.83  ? 106  PHE C CZ    1 
ATOM   7772  N  N     . LEU C 3  107 ? 117.609 152.295 145.884 1.00 20.92  ? 107  LEU C N     1 
ATOM   7773  C  CA    . LEU C 3  107 ? 117.240 151.669 147.151 1.00 20.92  ? 107  LEU C CA    1 
ATOM   7774  C  C     . LEU C 3  107 ? 118.507 151.516 147.978 1.00 20.92  ? 107  LEU C C     1 
ATOM   7775  O  O     . LEU C 3  107 ? 119.274 150.570 147.791 1.00 20.92  ? 107  LEU C O     1 
ATOM   7776  C  CB    . LEU C 3  107 ? 116.544 150.335 146.925 1.00 20.92  ? 107  LEU C CB    1 
ATOM   7777  C  CG    . LEU C 3  107 ? 115.212 150.435 146.188 1.00 20.92  ? 107  LEU C CG    1 
ATOM   7778  C  CD1   . LEU C 3  107 ? 114.617 149.066 146.031 1.00 20.92  ? 107  LEU C CD1   1 
ATOM   7779  C  CD2   . LEU C 3  107 ? 114.253 151.359 146.900 1.00 20.92  ? 107  LEU C CD2   1 
ATOM   7780  N  N     . LEU C 3  108 ? 118.711 152.453 148.899 1.00 29.36  ? 108  LEU C N     1 
ATOM   7781  C  CA    . LEU C 3  108 ? 119.940 152.533 149.674 1.00 29.36  ? 108  LEU C CA    1 
ATOM   7782  C  C     . LEU C 3  108 ? 120.017 151.383 150.668 1.00 29.36  ? 108  LEU C C     1 
ATOM   7783  O  O     . LEU C 3  108 ? 119.182 151.281 151.570 1.00 29.36  ? 108  LEU C O     1 
ATOM   7784  C  CB    . LEU C 3  108 ? 119.994 153.864 150.415 1.00 29.36  ? 108  LEU C CB    1 
ATOM   7785  C  CG    . LEU C 3  108 ? 120.038 155.167 149.625 1.00 29.36  ? 108  LEU C CG    1 
ATOM   7786  C  CD1   . LEU C 3  108 ? 119.850 156.323 150.580 1.00 29.36  ? 108  LEU C CD1   1 
ATOM   7787  C  CD2   . LEU C 3  108 ? 121.353 155.305 148.915 1.00 29.36  ? 108  LEU C CD2   1 
ATOM   7788  N  N     . GLY C 3  109 ? 121.022 150.528 150.514 1.00 27.00  ? 109  GLY C N     1 
ATOM   7789  C  CA    . GLY C 3  109 ? 121.252 149.474 151.479 1.00 27.00  ? 109  GLY C CA    1 
ATOM   7790  C  C     . GLY C 3  109 ? 120.297 148.312 151.406 1.00 27.00  ? 109  GLY C C     1 
ATOM   7791  O  O     . GLY C 3  109 ? 120.175 147.565 152.381 1.00 27.00  ? 109  GLY C O     1 
ATOM   7792  N  N     . SER C 3  110 ? 119.617 148.126 150.283 1.00 29.57  ? 110  SER C N     1 
ATOM   7793  C  CA    . SER C 3  110 ? 118.581 147.112 150.177 1.00 29.57  ? 110  SER C CA    1 
ATOM   7794  C  C     . SER C 3  110 ? 119.191 145.762 149.840 1.00 29.57  ? 110  SER C C     1 
ATOM   7795  O  O     . SER C 3  110 ? 120.008 145.653 148.922 1.00 29.57  ? 110  SER C O     1 
ATOM   7796  C  CB    . SER C 3  110 ? 117.557 147.488 149.108 1.00 29.57  ? 110  SER C CB    1 
ATOM   7797  O  OG    . SER C 3  110 ? 118.127 147.411 147.817 1.00 29.57  ? 110  SER C OG    1 
ATOM   7798  N  N     . ASP C 3  111 ? 118.800 144.740 150.594 1.00 44.65  ? 111  ASP C N     1 
ATOM   7799  C  CA    . ASP C 3  111 ? 119.032 143.374 150.160 1.00 44.65  ? 111  ASP C CA    1 
ATOM   7800  C  C     . ASP C 3  111 ? 118.127 143.090 148.971 1.00 44.65  ? 111  ASP C C     1 
ATOM   7801  O  O     . ASP C 3  111 ? 116.984 143.550 148.922 1.00 44.65  ? 111  ASP C O     1 
ATOM   7802  C  CB    . ASP C 3  111 ? 118.744 142.394 151.295 1.00 44.65  ? 111  ASP C CB    1 
ATOM   7803  C  CG    . ASP C 3  111 ? 119.285 141.004 151.024 1.00 44.65  ? 111  ASP C CG    1 
ATOM   7804  O  OD1   . ASP C 3  111 ? 119.950 140.805 149.986 1.00 44.65  ? 111  ASP C OD1   1 
ATOM   7805  O  OD2   . ASP C 3  111 ? 119.030 140.101 151.849 1.00 44.65  ? 111  ASP C OD2   1 
ATOM   7806  N  N     . SER C 3  112 ? 118.635 142.330 148.009 1.00 46.67  ? 112  SER C N     1 
ATOM   7807  C  CA    . SER C 3  112 ? 117.893 142.094 146.772 1.00 46.67  ? 112  SER C CA    1 
ATOM   7808  C  C     . SER C 3  112 ? 116.979 140.879 146.884 1.00 46.67  ? 112  SER C C     1 
ATOM   7809  O  O     . SER C 3  112 ? 117.017 139.965 146.063 1.00 46.67  ? 112  SER C O     1 
ATOM   7810  C  CB    . SER C 3  112 ? 118.869 141.945 145.615 1.00 46.67  ? 112  SER C CB    1 
ATOM   7811  O  OG    . SER C 3  112 ? 119.625 143.130 145.464 1.00 46.67  ? 112  SER C OG    1 
ATOM   7812  N  N     . THR C 3  113 ? 116.131 140.872 147.916 1.00 48.19  ? 113  THR C N     1 
ATOM   7813  C  CA    . THR C 3  113 ? 115.235 139.754 148.177 1.00 48.19  ? 113  THR C CA    1 
ATOM   7814  C  C     . THR C 3  113 ? 113.803 140.263 148.349 1.00 48.19  ? 113  THR C C     1 
ATOM   7815  O  O     . THR C 3  113 ? 112.957 139.591 148.947 1.00 48.19  ? 113  THR C O     1 
ATOM   7816  C  CB    . THR C 3  113 ? 115.724 138.972 149.407 1.00 48.19  ? 113  THR C CB    1 
ATOM   7817  O  OG1   . THR C 3  113 ? 117.154 138.939 149.390 1.00 48.19  ? 113  THR C OG1   1 
ATOM   7818  C  CG2   . THR C 3  113 ? 115.290 137.499 149.347 1.00 48.19  ? 113  THR C CG2   1 
ATOM   7819  N  N     . THR C 3  114 ? 113.510 141.449 147.832 1.00 43.58  ? 114  THR C N     1 
ATOM   7820  C  CA    . THR C 3  114 ? 112.165 142.002 147.884 1.00 43.58  ? 114  THR C CA    1 
ATOM   7821  C  C     . THR C 3  114 ? 111.479 141.846 146.532 1.00 43.58  ? 114  THR C C     1 
ATOM   7822  O  O     . THR C 3  114 ? 112.044 142.189 145.489 1.00 43.58  ? 114  THR C O     1 
ATOM   7823  C  CB    . THR C 3  114 ? 112.188 143.467 148.340 1.00 43.58  ? 114  THR C CB    1 
ATOM   7824  O  OG1   . THR C 3  114 ? 110.875 144.034 148.235 1.00 43.58  ? 114  THR C OG1   1 
ATOM   7825  C  CG2   . THR C 3  114 ? 113.221 144.313 147.582 1.00 43.58  ? 114  THR C CG2   1 
ATOM   7826  N  N     . LYS C 3  115 ? 110.284 141.267 146.552 1.00 45.61  ? 115  LYS C N     1 
ATOM   7827  C  CA    . LYS C 3  115 ? 109.466 141.201 145.355 1.00 45.61  ? 115  LYS C CA    1 
ATOM   7828  C  C     . LYS C 3  115 ? 108.774 142.540 145.153 1.00 45.61  ? 115  LYS C C     1 
ATOM   7829  O  O     . LYS C 3  115 ? 108.472 143.255 146.112 1.00 45.61  ? 115  LYS C O     1 
ATOM   7830  C  CB    . LYS C 3  115 ? 108.416 140.090 145.451 1.00 45.61  ? 115  LYS C CB    1 
ATOM   7831  C  CG    . LYS C 3  115 ? 108.899 138.669 145.153 1.00 45.61  ? 115  LYS C CG    1 
ATOM   7832  C  CD    . LYS C 3  115 ? 109.595 138.026 146.345 1.00 45.61  ? 115  LYS C CD    1 
ATOM   7833  C  CE    . LYS C 3  115 ? 109.917 136.567 146.084 1.00 45.61  ? 115  LYS C CE    1 
ATOM   7834  N  NZ    . LYS C 3  115 ? 110.688 135.968 147.207 1.00 45.61  ? 115  LYS C NZ    1 
ATOM   7835  N  N     . ILE C 3  116 ? 108.531 142.882 143.895 1.00 41.81  ? 116  ILE C N     1 
ATOM   7836  C  CA    . ILE C 3  116 ? 107.884 144.137 143.541 1.00 41.81  ? 116  ILE C CA    1 
ATOM   7837  C  C     . ILE C 3  116 ? 106.618 143.811 142.770 1.00 41.81  ? 116  ILE C C     1 
ATOM   7838  O  O     . ILE C 3  116 ? 106.675 143.184 141.705 1.00 41.81  ? 116  ILE C O     1 
ATOM   7839  C  CB    . ILE C 3  116 ? 108.816 145.053 142.736 1.00 41.81  ? 116  ILE C CB    1 
ATOM   7840  C  CG1   . ILE C 3  116 ? 109.971 145.514 143.623 1.00 41.81  ? 116  ILE C CG1   1 
ATOM   7841  C  CG2   . ILE C 3  116 ? 108.059 146.242 142.182 1.00 41.81  ? 116  ILE C CG2   1 
ATOM   7842  C  CD1   . ILE C 3  116 ? 111.047 146.240 142.893 1.00 41.81  ? 116  ILE C CD1   1 
ATOM   7843  N  N     . GLU C 3  117 ? 105.478 144.214 143.317 1.00 47.19  ? 117  GLU C N     1 
ATOM   7844  C  CA    . GLU C 3  117 ? 104.189 144.021 142.674 1.00 47.19  ? 117  GLU C CA    1 
ATOM   7845  C  C     . GLU C 3  117 ? 103.827 145.272 141.895 1.00 47.19  ? 117  GLU C C     1 
ATOM   7846  O  O     . GLU C 3  117 ? 103.807 146.374 142.454 1.00 47.19  ? 117  GLU C O     1 
ATOM   7847  C  CB    . GLU C 3  117 ? 103.103 143.705 143.702 1.00 47.19  ? 117  GLU C CB    1 
ATOM   7848  C  CG    . GLU C 3  117 ? 103.238 142.333 144.330 1.00 47.19  ? 117  GLU C CG    1 
ATOM   7849  C  CD    . GLU C 3  117 ? 102.958 141.216 143.343 1.00 47.19  ? 117  GLU C CD    1 
ATOM   7850  O  OE1   . GLU C 3  117 ? 102.096 141.404 142.458 1.00 47.19  ? 117  GLU C OE1   1 
ATOM   7851  O  OE2   . GLU C 3  117 ? 103.605 140.154 143.445 1.00 47.19  ? 117  GLU C OE2   1 
ATOM   7852  N  N     . LEU C 3  118 ? 103.553 145.103 140.611 1.00 44.00  ? 118  LEU C N     1 
ATOM   7853  C  CA    . LEU C 3  118 ? 103.124 146.207 139.773 1.00 44.00  ? 118  LEU C CA    1 
ATOM   7854  C  C     . LEU C 3  118 ? 101.604 146.240 139.701 1.00 44.00  ? 118  LEU C C     1 
ATOM   7855  O  O     . LEU C 3  118 ? 100.925 145.259 140.012 1.00 44.00  ? 118  LEU C O     1 
ATOM   7856  C  CB    . LEU C 3  118 ? 103.724 146.092 138.371 1.00 44.00  ? 118  LEU C CB    1 
ATOM   7857  C  CG    . LEU C 3  118 ? 105.252 146.124 138.313 1.00 44.00  ? 118  LEU C CG    1 
ATOM   7858  C  CD1   . LEU C 3  118 ? 105.746 145.987 136.889 1.00 44.00  ? 118  LEU C CD1   1 
ATOM   7859  C  CD2   . LEU C 3  118 ? 105.793 147.378 138.947 1.00 44.00  ? 118  LEU C CD2   1 
ATOM   7860  N  N     . LYS C 3  119 ? 101.073 147.391 139.294 1.00 49.36  ? 119  LYS C N     1 
ATOM   7861  C  CA    . LYS C 3  119 ? 99.631  147.556 139.195 1.00 49.36  ? 119  LYS C CA    1 
ATOM   7862  C  C     . LYS C 3  119 ? 99.065  146.742 138.039 1.00 49.36  ? 119  LYS C C     1 
ATOM   7863  O  O     . LYS C 3  119 ? 99.776  146.334 137.117 1.00 49.36  ? 119  LYS C O     1 
ATOM   7864  C  CB    . LYS C 3  119 ? 99.262  149.028 139.016 1.00 49.36  ? 119  LYS C CB    1 
ATOM   7865  C  CG    . LYS C 3  119 ? 99.557  149.902 140.220 1.00 49.36  ? 119  LYS C CG    1 
ATOM   7866  C  CD    . LYS C 3  119 ? 98.675  149.523 141.400 1.00 49.36  ? 119  LYS C CD    1 
ATOM   7867  C  CE    . LYS C 3  119 ? 98.813  150.516 142.540 1.00 49.36  ? 119  LYS C CE    1 
ATOM   7868  N  NZ    . LYS C 3  119 ? 100.150 150.442 143.180 1.00 49.36  ? 119  LYS C NZ    1 
ATOM   7869  N  N     . ASP C 3  120 ? 97.757  146.498 138.104 1.00 54.81  ? 120  ASP C N     1 
ATOM   7870  C  CA    . ASP C 3  120 ? 97.096  145.782 137.021 1.00 54.81  ? 120  ASP C CA    1 
ATOM   7871  C  C     . ASP C 3  120 ? 96.820  146.739 135.868 1.00 54.81  ? 120  ASP C C     1 
ATOM   7872  O  O     . ASP C 3  120 ? 97.396  146.590 134.786 1.00 54.81  ? 120  ASP C O     1 
ATOM   7873  C  CB    . ASP C 3  120 ? 95.807  145.140 137.542 1.00 54.81  ? 120  ASP C CB    1 
ATOM   7874  C  CG    . ASP C 3  120 ? 95.318  144.010 136.664 1.00 54.81  ? 120  ASP C CG    1 
ATOM   7875  O  OD1   . ASP C 3  120 ? 95.976  143.712 135.645 1.00 54.81  ? 120  ASP C OD1   1 
ATOM   7876  O  OD2   . ASP C 3  120 ? 94.275  143.410 137.001 1.00 54.81  ? 120  ASP C OD2   1 
ATOM   7877  N  N     . GLU C 3  121 ? 95.944  147.726 136.106 1.00 52.70  ? 121  GLU C N     1 
ATOM   7878  C  CA    . GLU C 3  121 ? 95.918  149.042 135.450 1.00 52.70  ? 121  GLU C CA    1 
ATOM   7879  C  C     . GLU C 3  121 ? 95.808  148.920 133.925 1.00 52.70  ? 121  GLU C C     1 
ATOM   7880  O  O     . GLU C 3  121 ? 96.765  149.139 133.181 1.00 52.70  ? 121  GLU C O     1 
ATOM   7881  C  CB    . GLU C 3  121 ? 97.130  149.873 135.894 1.00 52.70  ? 121  GLU C CB    1 
ATOM   7882  C  CG    . GLU C 3  121 ? 97.012  151.374 135.640 1.00 52.70  ? 121  GLU C CG    1 
ATOM   7883  C  CD    . GLU C 3  121 ? 97.696  151.812 134.370 1.00 52.70  ? 121  GLU C CD    1 
ATOM   7884  O  OE1   . GLU C 3  121 ? 98.725  151.199 134.034 1.00 52.70  ? 121  GLU C OE1   1 
ATOM   7885  O  OE2   . GLU C 3  121 ? 97.208  152.751 133.706 1.00 52.70  ? 121  GLU C OE2   1 
ATOM   7886  N  N     . SER C 3  122 ? 94.620  148.485 133.496 1.00 50.37  ? 122  SER C N     1 
ATOM   7887  C  CA    . SER C 3  122 ? 94.354  148.073 132.122 1.00 50.37  ? 122  SER C CA    1 
ATOM   7888  C  C     . SER C 3  122 ? 94.559  149.217 131.123 1.00 50.37  ? 122  SER C C     1 
ATOM   7889  O  O     . SER C 3  122 ? 94.712  150.388 131.486 1.00 50.37  ? 122  SER C O     1 
ATOM   7890  C  CB    . SER C 3  122 ? 92.932  147.529 132.001 1.00 30.00  ? 122  SER C CB    1 
ATOM   7891  O  OG    . SER C 3  122 ? 91.975  148.552 132.221 1.00 30.00  ? 122  SER C OG    1 
ATOM   7892  N  N     . SER C 3  123 ? 94.542  148.837 129.837 1.00 48.50  ? 123  SER C N     1 
ATOM   7893  C  CA    . SER C 3  123 ? 94.992  149.660 128.703 1.00 48.50  ? 123  SER C CA    1 
ATOM   7894  C  C     . SER C 3  123 ? 96.425  150.148 128.906 1.00 48.50  ? 123  SER C C     1 
ATOM   7895  O  O     . SER C 3  123 ? 96.766  151.280 128.559 1.00 48.50  ? 123  SER C O     1 
ATOM   7896  C  CB    . SER C 3  123 ? 94.048  150.835 128.420 1.00 48.50  ? 123  SER C CB    1 
ATOM   7897  O  OG    . SER C 3  123 ? 94.118  151.809 129.447 1.00 48.50  ? 123  SER C OG    1 
ATOM   7898  N  N     . ARG C 3  124 ? 97.261  149.272 129.468 1.00 38.19  ? 124  ARG C N     1 
ATOM   7899  C  CA    . ARG C 3  124 ? 98.678  149.465 129.747 1.00 38.19  ? 124  ARG C CA    1 
ATOM   7900  C  C     . ARG C 3  124 ? 99.256  148.127 130.182 1.00 38.19  ? 124  ARG C C     1 
ATOM   7901  O  O     . ARG C 3  124 ? 98.632  147.411 130.966 1.00 38.19  ? 124  ARG C O     1 
ATOM   7902  C  CB    . ARG C 3  124 ? 98.904  150.511 130.849 1.00 38.19  ? 124  ARG C CB    1 
ATOM   7903  C  CG    . ARG C 3  124 ? 100.360 150.748 131.214 1.00 38.19  ? 124  ARG C CG    1 
ATOM   7904  C  CD    . ARG C 3  124 ? 101.117 151.457 130.114 1.00 38.19  ? 124  ARG C CD    1 
ATOM   7905  N  NE    . ARG C 3  124 ? 100.676 152.834 129.941 1.00 38.19  ? 124  ARG C NE    1 
ATOM   7906  C  CZ    . ARG C 3  124 ? 101.183 153.860 130.615 1.00 38.19  ? 124  ARG C CZ    1 
ATOM   7907  N  NH1   . ARG C 3  124 ? 102.153 153.659 131.493 1.00 38.19  ? 124  ARG C NH1   1 
ATOM   7908  N  NH2   . ARG C 3  124 ? 100.729 155.087 130.406 1.00 38.19  ? 124  ARG C NH2   1 
ATOM   7909  N  N     . TYR C 3  125 ? 100.432 147.790 129.667 1.00 35.68  ? 125  TYR C N     1 
ATOM   7910  C  CA    . TYR C 3  125 ? 101.184 146.635 130.136 1.00 35.68  ? 125  TYR C CA    1 
ATOM   7911  C  C     . TYR C 3  125 ? 102.241 147.077 131.138 1.00 35.68  ? 125  TYR C C     1 
ATOM   7912  O  O     . TYR C 3  125 ? 102.992 148.022 130.881 1.00 35.68  ? 125  TYR C O     1 
ATOM   7913  C  CB    . TYR C 3  125 ? 101.829 145.890 128.967 1.00 35.68  ? 125  TYR C CB    1 
ATOM   7914  C  CG    . TYR C 3  125 ? 100.876 144.976 128.232 1.00 35.68  ? 125  TYR C CG    1 
ATOM   7915  C  CD1   . TYR C 3  125 ? 100.683 143.673 128.660 1.00 35.68  ? 125  TYR C CD1   1 
ATOM   7916  C  CD2   . TYR C 3  125 ? 100.148 145.419 127.136 1.00 35.68  ? 125  TYR C CD2   1 
ATOM   7917  C  CE1   . TYR C 3  125 ? 99.809  142.825 128.008 1.00 35.68  ? 125  TYR C CE1   1 
ATOM   7918  C  CE2   . TYR C 3  125 ? 99.266  144.575 126.476 1.00 35.68  ? 125  TYR C CE2   1 
ATOM   7919  C  CZ    . TYR C 3  125 ? 99.102  143.281 126.920 1.00 35.68  ? 125  TYR C CZ    1 
ATOM   7920  O  OH    . TYR C 3  125 ? 98.233  142.436 126.274 1.00 35.68  ? 125  TYR C OH    1 
ATOM   7921  N  N     . ASN C 3  126 ? 102.293 146.391 132.275 1.00 30.61  ? 126  ASN C N     1 
ATOM   7922  C  CA    . ASN C 3  126 ? 103.251 146.654 133.347 1.00 30.61  ? 126  ASN C CA    1 
ATOM   7923  C  C     . ASN C 3  126 ? 104.103 145.403 133.519 1.00 30.61  ? 126  ASN C C     1 
ATOM   7924  O  O     . ASN C 3  126 ? 103.725 144.485 134.249 1.00 30.61  ? 126  ASN C O     1 
ATOM   7925  C  CB    . ASN C 3  126 ? 102.536 147.017 134.646 1.00 30.61  ? 126  ASN C CB    1 
ATOM   7926  C  CG    . ASN C 3  126 ? 101.958 148.413 134.628 1.00 30.61  ? 126  ASN C CG    1 
ATOM   7927  O  OD1   . ASN C 3  126 ? 102.636 149.374 134.281 1.00 30.61  ? 126  ASN C OD1   1 
ATOM   7928  N  ND2   . ASN C 3  126 ? 100.687 148.527 134.978 1.00 30.61  ? 126  ASN C ND2   1 
ATOM   7929  N  N     . VAL C 3  127 ? 105.245 145.356 132.846 1.00 20.54  ? 127  VAL C N     1 
ATOM   7930  C  CA    . VAL C 3  127 ? 106.164 144.232 132.976 1.00 20.54  ? 127  VAL C CA    1 
ATOM   7931  C  C     . VAL C 3  127 ? 107.300 144.623 133.909 1.00 20.54  ? 127  VAL C C     1 
ATOM   7932  O  O     . VAL C 3  127 ? 107.782 145.762 133.892 1.00 20.54  ? 127  VAL C O     1 
ATOM   7933  C  CB    . VAL C 3  127 ? 106.687 143.755 131.605 1.00 20.54  ? 127  VAL C CB    1 
ATOM   7934  C  CG1   . VAL C 3  127 ? 105.559 143.133 130.807 1.00 20.54  ? 127  VAL C CG1   1 
ATOM   7935  C  CG2   . VAL C 3  127 ? 107.292 144.892 130.815 1.00 20.54  ? 127  VAL C CG2   1 
ATOM   7936  N  N     . LEU C 3  128 ? 107.692 143.687 134.763 1.00 16.21  ? 128  LEU C N     1 
ATOM   7937  C  CA    . LEU C 3  128 ? 108.831 143.840 135.657 1.00 16.21  ? 128  LEU C CA    1 
ATOM   7938  C  C     . LEU C 3  128 ? 109.960 142.970 135.134 1.00 16.21  ? 128  LEU C C     1 
ATOM   7939  O  O     . LEU C 3  128 ? 109.782 141.763 134.946 1.00 16.21  ? 128  LEU C O     1 
ATOM   7940  C  CB    . LEU C 3  128 ? 108.471 143.445 137.087 1.00 16.21  ? 128  LEU C CB    1 
ATOM   7941  C  CG    . LEU C 3  128 ? 109.619 143.497 138.094 1.00 16.21  ? 128  LEU C CG    1 
ATOM   7942  C  CD1   . LEU C 3  128 ? 110.150 144.901 138.263 1.00 16.21  ? 128  LEU C CD1   1 
ATOM   7943  C  CD2   . LEU C 3  128 ? 109.183 142.932 139.425 1.00 16.21  ? 128  LEU C CD2   1 
ATOM   7944  N  N     . ILE C 3  129 ? 111.114 143.580 134.898 1.00 14.58  ? 129  ILE C N     1 
ATOM   7945  C  CA    . ILE C 3  129 ? 112.267 142.897 134.333 1.00 14.58  ? 129  ILE C CA    1 
ATOM   7946  C  C     . ILE C 3  129 ? 113.399 142.982 135.343 1.00 14.58  ? 129  ILE C C     1 
ATOM   7947  O  O     . ILE C 3  129 ? 113.888 144.075 135.643 1.00 14.58  ? 129  ILE C O     1 
ATOM   7948  C  CB    . ILE C 3  129 ? 112.671 143.503 132.982 1.00 14.58  ? 129  ILE C CB    1 
ATOM   7949  C  CG1   . ILE C 3  129 ? 111.549 143.287 131.967 1.00 14.58  ? 129  ILE C CG1   1 
ATOM   7950  C  CG2   . ILE C 3  129 ? 113.963 142.895 132.499 1.00 14.58  ? 129  ILE C CG2   1 
ATOM   7951  C  CD1   . ILE C 3  129 ? 111.679 144.109 130.727 1.00 14.58  ? 129  ILE C CD1   1 
ATOM   7952  N  N     . GLU C 3  130 ? 113.806 141.835 135.872 1.00 19.75  ? 130  GLU C N     1 
ATOM   7953  C  CA    . GLU C 3  130 ? 114.797 141.763 136.936 1.00 19.75  ? 130  GLU C CA    1 
ATOM   7954  C  C     . GLU C 3  130 ? 116.100 141.210 136.381 1.00 19.75  ? 130  GLU C C     1 
ATOM   7955  O  O     . GLU C 3  130 ? 116.099 140.190 135.686 1.00 19.75  ? 130  GLU C O     1 
ATOM   7956  C  CB    . GLU C 3  130 ? 114.297 140.886 138.082 1.00 19.75  ? 130  GLU C CB    1 
ATOM   7957  C  CG    . GLU C 3  130 ? 113.081 141.448 138.792 1.00 19.75  ? 130  GLU C CG    1 
ATOM   7958  C  CD    . GLU C 3  130 ? 112.567 140.531 139.879 1.00 19.75  ? 130  GLU C CD    1 
ATOM   7959  O  OE1   . GLU C 3  130 ? 113.079 139.398 139.992 1.00 19.75  ? 130  GLU C OE1   1 
ATOM   7960  O  OE2   . GLU C 3  130 ? 111.649 140.942 140.620 1.00 19.75  ? 130  GLU C OE2   1 
ATOM   7961  N  N     . LEU C 3  131 ? 117.207 141.881 136.690 1.00 18.58  ? 131  LEU C N     1 
ATOM   7962  C  CA    . LEU C 3  131 ? 118.510 141.559 136.119 1.00 18.58  ? 131  LEU C CA    1 
ATOM   7963  C  C     . LEU C 3  131 ? 119.540 141.452 137.233 1.00 18.58  ? 131  LEU C C     1 
ATOM   7964  O  O     . LEU C 3  131 ? 119.858 142.450 137.886 1.00 18.58  ? 131  LEU C O     1 
ATOM   7965  C  CB    . LEU C 3  131 ? 118.928 142.612 135.092 1.00 18.58  ? 131  LEU C CB    1 
ATOM   7966  C  CG    . LEU C 3  131 ? 118.158 142.639 133.772 1.00 18.58  ? 131  LEU C CG    1 
ATOM   7967  C  CD1   . LEU C 3  131 ? 118.512 143.880 132.988 1.00 18.58  ? 131  LEU C CD1   1 
ATOM   7968  C  CD2   . LEU C 3  131 ? 118.484 141.398 132.960 1.00 18.58  ? 131  LEU C CD2   1 
ATOM   7969  N  N     . THR C 3  132 ? 120.056 140.254 137.446 1.00 20.76  ? 132  THR C N     1 
ATOM   7970  C  CA    . THR C 3  132 ? 121.157 139.984 138.353 1.00 20.76  ? 132  THR C CA    1 
ATOM   7971  C  C     . THR C 3  132 ? 122.477 140.188 137.619 1.00 20.76  ? 132  THR C C     1 
ATOM   7972  O  O     . THR C 3  132 ? 122.508 140.184 136.387 1.00 20.76  ? 132  THR C O     1 
ATOM   7973  C  CB    . THR C 3  132 ? 121.046 138.554 138.885 1.00 20.76  ? 132  THR C CB    1 
ATOM   7974  O  OG1   . THR C 3  132 ? 121.269 137.628 137.821 1.00 20.76  ? 132  THR C OG1   1 
ATOM   7975  C  CG2   . THR C 3  132 ? 119.665 138.312 139.450 1.00 20.76  ? 132  THR C CG2   1 
ATOM   7976  N  N     . PRO C 3  133 ? 123.592 140.413 138.331 1.00 21.39  ? 133  PRO C N     1 
ATOM   7977  C  CA    . PRO C 3  133 ? 124.884 140.545 137.633 1.00 21.39  ? 133  PRO C CA    1 
ATOM   7978  C  C     . PRO C 3  133 ? 125.381 139.268 136.976 1.00 21.39  ? 133  PRO C C     1 
ATOM   7979  O  O     . PRO C 3  133 ? 126.245 139.345 136.096 1.00 21.39  ? 133  PRO C O     1 
ATOM   7980  C  CB    . PRO C 3  133 ? 125.838 140.999 138.742 1.00 21.39  ? 133  PRO C CB    1 
ATOM   7981  C  CG    . PRO C 3  133 ? 125.188 140.600 139.994 1.00 21.39  ? 133  PRO C CG    1 
ATOM   7982  C  CD    . PRO C 3  133 ? 123.731 140.767 139.753 1.00 21.39  ? 133  PRO C CD    1 
ATOM   7983  N  N     . LYS C 3  134 ? 124.883 138.099 137.378 1.00 23.66  ? 134  LYS C N     1 
ATOM   7984  C  CA    . LYS C 3  134 ? 125.201 136.884 136.642 1.00 23.66  ? 134  LYS C CA    1 
ATOM   7985  C  C     . LYS C 3  134 ? 124.441 136.833 135.323 1.00 23.66  ? 134  LYS C C     1 
ATOM   7986  O  O     . LYS C 3  134 ? 124.944 136.285 134.335 1.00 23.66  ? 134  LYS C O     1 
ATOM   7987  C  CB    . LYS C 3  134 ? 124.895 135.663 137.510 1.00 23.66  ? 134  LYS C CB    1 
ATOM   7988  C  CG    . LYS C 3  134 ? 125.295 134.332 136.907 1.00 23.66  ? 134  LYS C CG    1 
ATOM   7989  C  CD    . LYS C 3  134 ? 126.791 134.265 136.691 1.00 23.66  ? 134  LYS C CD    1 
ATOM   7990  C  CE    . LYS C 3  134 ? 127.533 134.203 138.009 1.00 23.66  ? 134  LYS C CE    1 
ATOM   7991  N  NZ    . LYS C 3  134 ? 129.002 134.094 137.805 1.00 23.66  ? 134  LYS C NZ    1 
ATOM   7992  N  N     . GLU C 3  135 ? 123.255 137.435 135.274 1.00 22.47  ? 135  GLU C N     1 
ATOM   7993  C  CA    . GLU C 3  135 ? 122.491 137.567 134.041 1.00 22.47  ? 135  GLU C CA    1 
ATOM   7994  C  C     . GLU C 3  135 ? 122.978 138.696 133.148 1.00 22.47  ? 135  GLU C C     1 
ATOM   7995  O  O     . GLU C 3  135 ? 122.359 138.945 132.110 1.00 22.47  ? 135  GLU C O     1 
ATOM   7996  C  CB    . GLU C 3  135 ? 121.011 137.796 134.348 1.00 22.47  ? 135  GLU C CB    1 
ATOM   7997  C  CG    . GLU C 3  135 ? 120.278 136.599 134.894 1.00 22.47  ? 135  GLU C CG    1 
ATOM   7998  C  CD    . GLU C 3  135 ? 118.825 136.910 135.184 1.00 22.47  ? 135  GLU C CD    1 
ATOM   7999  O  OE1   . GLU C 3  135 ? 118.426 138.080 135.021 1.00 22.47  ? 135  GLU C OE1   1 
ATOM   8000  O  OE2   . GLU C 3  135 ? 118.081 135.993 135.585 1.00 22.47  ? 135  GLU C OE2   1 
ATOM   8001  N  N     . SER C 3  136 ? 124.051 139.389 133.513 1.00 16.10  ? 136  SER C N     1 
ATOM   8002  C  CA    . SER C 3  136 ? 124.557 140.523 132.743 1.00 16.10  ? 136  SER C CA    1 
ATOM   8003  C  C     . SER C 3  136 ? 126.047 140.373 132.456 1.00 16.10  ? 136  SER C C     1 
ATOM   8004  O  O     . SER C 3  136 ? 126.868 141.094 133.033 1.00 16.10  ? 136  SER C O     1 
ATOM   8005  C  CB    . SER C 3  136 ? 124.294 141.818 133.507 1.00 16.10  ? 136  SER C CB    1 
ATOM   8006  O  OG    . SER C 3  136 ? 122.909 142.012 133.714 1.00 16.10  ? 136  SER C OG    1 
ATOM   8007  N  N     . PRO C 3  137 ? 126.443 139.456 131.551 1.00 15.12  ? 137  PRO C N     1 
ATOM   8008  C  CA    . PRO C 3  137 ? 127.866 139.379 131.206 1.00 15.12  ? 137  PRO C CA    1 
ATOM   8009  C  C     . PRO C 3  137 ? 128.287 140.495 130.264 1.00 15.12  ? 137  PRO C C     1 
ATOM   8010  O  O     . PRO C 3  137 ? 129.430 140.957 130.309 1.00 15.12  ? 137  PRO C O     1 
ATOM   8011  C  CB    . PRO C 3  137 ? 127.995 138.000 130.551 1.00 15.12  ? 137  PRO C CB    1 
ATOM   8012  C  CG    . PRO C 3  137 ? 126.676 137.735 129.992 1.00 15.12  ? 137  PRO C CG    1 
ATOM   8013  C  CD    . PRO C 3  137 ? 125.685 138.366 130.910 1.00 15.12  ? 137  PRO C CD    1 
ATOM   8014  N  N     . ASN C 3  138 ? 127.363 140.934 129.415 1.00 14.99  ? 138  ASN C N     1 
ATOM   8015  C  CA    . ASN C 3  138 ? 127.600 142.010 128.466 1.00 14.99  ? 138  ASN C CA    1 
ATOM   8016  C  C     . ASN C 3  138 ? 126.255 142.624 128.101 1.00 14.99  ? 138  ASN C C     1 
ATOM   8017  O  O     . ASN C 3  138 ? 125.213 142.240 128.634 1.00 14.99  ? 138  ASN C O     1 
ATOM   8018  C  CB    . ASN C 3  138 ? 128.387 141.518 127.244 1.00 14.99  ? 138  ASN C CB    1 
ATOM   8019  C  CG    . ASN C 3  138 ? 127.773 140.298 126.586 1.00 14.99  ? 138  ASN C CG    1 
ATOM   8020  O  OD1   . ASN C 3  138 ? 126.721 139.820 126.983 1.00 14.99  ? 138  ASN C OD1   1 
ATOM   8021  N  ND2   . ASN C 3  138 ? 128.444 139.788 125.571 1.00 14.99  ? 138  ASN C ND2   1 
ATOM   8022  N  N     . VAL C 3  139 ? 126.287 143.578 127.174 1.00 14.10  ? 139  VAL C N     1 
ATOM   8023  C  CA    . VAL C 3  139 ? 125.116 144.412 126.937 1.00 14.10  ? 139  VAL C CA    1 
ATOM   8024  C  C     . VAL C 3  139 ? 124.066 143.683 126.103 1.00 14.10  ? 139  VAL C C     1 
ATOM   8025  O  O     . VAL C 3  139 ? 122.863 143.871 126.319 1.00 14.10  ? 139  VAL C O     1 
ATOM   8026  C  CB    . VAL C 3  139 ? 125.555 145.733 126.285 1.00 14.10  ? 139  VAL C CB    1 
ATOM   8027  C  CG1   . VAL C 3  139 ? 124.392 146.684 126.123 1.00 14.10  ? 139  VAL C CG1   1 
ATOM   8028  C  CG2   . VAL C 3  139 ? 126.648 146.371 127.106 1.00 14.10  ? 139  VAL C CG2   1 
ATOM   8029  N  N     . ARG C 3  140 ? 124.478 142.824 125.164 1.00 20.24  ? 140  ARG C N     1 
ATOM   8030  C  CA    . ARG C 3  140 ? 123.481 142.103 124.381 1.00 20.24  ? 140  ARG C CA    1 
ATOM   8031  C  C     . ARG C 3  140 ? 122.803 141.012 125.186 1.00 20.24  ? 140  ARG C C     1 
ATOM   8032  O  O     . ARG C 3  140 ? 121.676 140.639 124.859 1.00 20.24  ? 140  ARG C O     1 
ATOM   8033  C  CB    . ARG C 3  140 ? 124.079 141.495 123.111 1.00 20.24  ? 140  ARG C CB    1 
ATOM   8034  C  CG    . ARG C 3  140 ? 125.005 140.322 123.275 1.00 20.24  ? 140  ARG C CG    1 
ATOM   8035  C  CD    . ARG C 3  140 ? 125.482 139.874 121.905 1.00 20.24  ? 140  ARG C CD    1 
ATOM   8036  N  NE    . ARG C 3  140 ? 124.408 139.329 121.080 1.00 20.24  ? 140  ARG C NE    1 
ATOM   8037  C  CZ    . ARG C 3  140 ? 124.058 138.048 121.066 1.00 20.24  ? 140  ARG C CZ    1 
ATOM   8038  N  NH1   . ARG C 3  140 ? 124.704 137.181 121.826 1.00 20.24  ? 140  ARG C NH1   1 
ATOM   8039  N  NH2   . ARG C 3  140 ? 123.077 137.632 120.283 1.00 20.24  ? 140  ARG C NH2   1 
ATOM   8040  N  N     . MET C 3  141 ? 123.439 140.506 126.238 1.00 29.30  ? 141  MET C N     1 
ATOM   8041  C  CA    . MET C 3  141 ? 122.747 139.554 127.090 1.00 29.30  ? 141  MET C CA    1 
ATOM   8042  C  C     . MET C 3  141 ? 121.798 140.231 128.056 1.00 29.30  ? 141  MET C C     1 
ATOM   8043  O  O     . MET C 3  141 ? 120.845 139.601 128.512 1.00 29.30  ? 141  MET C O     1 
ATOM   8044  C  CB    . MET C 3  141 ? 123.738 138.686 127.849 1.00 29.30  ? 141  MET C CB    1 
ATOM   8045  C  CG    . MET C 3  141 ? 124.328 137.564 127.033 1.00 29.30  ? 141  MET C CG    1 
ATOM   8046  S  SD    . MET C 3  141 ? 123.040 136.448 126.462 1.00 29.30  ? 141  MET C SD    1 
ATOM   8047  C  CE    . MET C 3  141 ? 123.067 136.772 124.721 1.00 29.30  ? 141  MET C CE    1 
ATOM   8048  N  N     . MET C 3  142 ? 122.022 141.502 128.374 1.00 19.36  ? 142  MET C N     1 
ATOM   8049  C  CA    . MET C 3  142 ? 121.026 142.225 129.149 1.00 19.36  ? 142  MET C CA    1 
ATOM   8050  C  C     . MET C 3  142 ? 119.788 142.497 128.313 1.00 19.36  ? 142  MET C C     1 
ATOM   8051  O  O     . MET C 3  142 ? 118.669 142.480 128.833 1.00 19.36  ? 142  MET C O     1 
ATOM   8052  C  CB    . MET C 3  142 ? 121.602 143.534 129.669 1.00 19.36  ? 142  MET C CB    1 
ATOM   8053  C  CG    . MET C 3  142 ? 122.753 143.365 130.607 1.00 19.36  ? 142  MET C CG    1 
ATOM   8054  S  SD    . MET C 3  142 ? 123.291 144.928 131.315 1.00 19.36  ? 142  MET C SD    1 
ATOM   8055  C  CE    . MET C 3  142 ? 121.987 145.244 132.490 1.00 19.36  ? 142  MET C CE    1 
ATOM   8056  N  N     . LEU C 3  143 ? 119.963 142.738 127.014 1.00 19.31  ? 143  LEU C N     1 
ATOM   8057  C  CA    . LEU C 3  143 ? 118.824 143.081 126.175 1.00 19.31  ? 143  LEU C CA    1 
ATOM   8058  C  C     . LEU C 3  143 ? 118.048 141.845 125.737 1.00 19.31  ? 143  LEU C C     1 
ATOM   8059  O  O     . LEU C 3  143 ? 116.813 141.861 125.730 1.00 19.31  ? 143  LEU C O     1 
ATOM   8060  C  CB    . LEU C 3  143 ? 119.281 143.879 124.957 1.00 19.31  ? 143  LEU C CB    1 
ATOM   8061  C  CG    . LEU C 3  143 ? 118.106 144.389 124.126 1.00 19.31  ? 143  LEU C CG    1 
ATOM   8062  C  CD1   . LEU C 3  143 ? 117.294 145.358 124.948 1.00 19.31  ? 143  LEU C CD1   1 
ATOM   8063  C  CD2   . LEU C 3  143 ? 118.550 145.035 122.854 1.00 19.31  ? 143  LEU C CD2   1 
ATOM   8064  N  N     . ARG C 3  144 ? 118.743 140.765 125.376 1.00 29.30  ? 144  ARG C N     1 
ATOM   8065  C  CA    . ARG C 3  144 ? 118.046 139.561 124.940 1.00 29.30  ? 144  ARG C CA    1 
ATOM   8066  C  C     . ARG C 3  144 ? 117.304 138.867 126.069 1.00 29.30  ? 144  ARG C C     1 
ATOM   8067  O  O     . ARG C 3  144 ? 116.360 138.123 125.800 1.00 29.30  ? 144  ARG C O     1 
ATOM   8068  C  CB    . ARG C 3  144 ? 119.017 138.580 124.295 1.00 29.30  ? 144  ARG C CB    1 
ATOM   8069  C  CG    . ARG C 3  144 ? 119.561 139.041 122.975 1.00 29.30  ? 144  ARG C CG    1 
ATOM   8070  C  CD    . ARG C 3  144 ? 120.460 137.997 122.376 1.00 29.30  ? 144  ARG C CD    1 
ATOM   8071  N  NE    . ARG C 3  144 ? 119.722 136.780 122.075 1.00 29.30  ? 144  ARG C NE    1 
ATOM   8072  C  CZ    . ARG C 3  144 ? 119.052 136.573 120.949 1.00 29.30  ? 144  ARG C CZ    1 
ATOM   8073  N  NH1   . ARG C 3  144 ? 118.406 135.434 120.764 1.00 29.30  ? 144  ARG C NH1   1 
ATOM   8074  N  NH2   . ARG C 3  144 ? 119.028 137.505 120.008 1.00 29.30  ? 144  ARG C NH2   1 
ATOM   8075  N  N     . ARG C 3  145 ? 117.705 139.086 127.316 1.00 29.30  ? 145  ARG C N     1 
ATOM   8076  C  CA    . ARG C 3  145 ? 116.892 138.626 128.430 1.00 29.30  ? 145  ARG C CA    1 
ATOM   8077  C  C     . ARG C 3  145 ? 115.763 139.593 128.740 1.00 29.30  ? 145  ARG C C     1 
ATOM   8078  O  O     . ARG C 3  145 ? 114.696 139.163 129.176 1.00 29.30  ? 145  ARG C O     1 
ATOM   8079  C  CB    . ARG C 3  145 ? 117.761 138.428 129.666 1.00 29.30  ? 145  ARG C CB    1 
ATOM   8080  C  CG    . ARG C 3  145 ? 118.792 137.348 129.505 1.00 29.30  ? 145  ARG C CG    1 
ATOM   8081  C  CD    . ARG C 3  145 ? 119.708 137.297 130.698 1.00 29.30  ? 145  ARG C CD    1 
ATOM   8082  N  NE    . ARG C 3  145 ? 120.897 136.503 130.426 1.00 29.30  ? 145  ARG C NE    1 
ATOM   8083  C  CZ    . ARG C 3  145 ? 120.996 135.204 130.657 1.00 29.30  ? 145  ARG C CZ    1 
ATOM   8084  N  NH1   . ARG C 3  145 ? 119.981 134.547 131.185 1.00 29.30  ? 145  ARG C NH1   1 
ATOM   8085  N  NH2   . ARG C 3  145 ? 122.115 134.568 130.379 1.00 29.30  ? 145  ARG C NH2   1 
ATOM   8086  N  N     . SER C 3  146 ? 115.971 140.892 128.517 1.00 19.72  ? 146  SER C N     1 
ATOM   8087  C  CA    . SER C 3  146 ? 114.931 141.867 128.824 1.00 19.72  ? 146  SER C CA    1 
ATOM   8088  C  C     . SER C 3  146 ? 113.816 141.816 127.796 1.00 19.72  ? 146  SER C C     1 
ATOM   8089  O  O     . SER C 3  146 ? 112.643 142.005 128.132 1.00 19.72  ? 146  SER C O     1 
ATOM   8090  C  CB    . SER C 3  146 ? 115.529 143.266 128.881 1.00 19.72  ? 146  SER C CB    1 
ATOM   8091  O  OG    . SER C 3  146 ? 116.542 143.330 129.863 1.00 19.72  ? 146  SER C OG    1 
ATOM   8092  N  N     . MET C 3  147 ? 114.165 141.560 126.539 1.00 17.36  ? 147  MET C N     1 
ATOM   8093  C  CA    . MET C 3  147 ? 113.166 141.435 125.493 1.00 17.36  ? 147  MET C CA    1 
ATOM   8094  C  C     . MET C 3  147 ? 112.511 140.069 125.487 1.00 17.36  ? 147  MET C C     1 
ATOM   8095  O  O     . MET C 3  147 ? 111.406 139.928 124.959 1.00 17.36  ? 147  MET C O     1 
ATOM   8096  C  CB    . MET C 3  147 ? 113.795 141.712 124.134 1.00 17.36  ? 147  MET C CB    1 
ATOM   8097  C  CG    . MET C 3  147 ? 114.340 143.111 123.983 1.00 17.36  ? 147  MET C CG    1 
ATOM   8098  S  SD    . MET C 3  147 ? 113.118 144.411 124.201 1.00 17.36  ? 147  MET C SD    1 
ATOM   8099  C  CE    . MET C 3  147 ? 113.665 145.138 125.738 1.00 17.36  ? 147  MET C CE    1 
ATOM   8100  N  N     . TYR C 3  148 ? 113.162 139.062 126.058 1.00 20.44  ? 148  TYR C N     1 
ATOM   8101  C  CA    . TYR C 3  148 ? 112.477 137.797 126.262 1.00 20.44  ? 148  TYR C CA    1 
ATOM   8102  C  C     . TYR C 3  148 ? 111.529 137.876 127.448 1.00 20.44  ? 148  TYR C C     1 
ATOM   8103  O  O     . TYR C 3  148 ? 110.442 137.301 127.405 1.00 20.44  ? 148  TYR C O     1 
ATOM   8104  C  CB    . TYR C 3  148 ? 113.485 136.667 126.449 1.00 20.44  ? 148  TYR C CB    1 
ATOM   8105  C  CG    . TYR C 3  148 ? 112.840 135.335 126.732 1.00 20.44  ? 148  TYR C CG    1 
ATOM   8106  C  CD1   . TYR C 3  148 ? 112.170 134.645 125.737 1.00 20.44  ? 148  TYR C CD1   1 
ATOM   8107  C  CD2   . TYR C 3  148 ? 112.911 134.764 127.993 1.00 20.44  ? 148  TYR C CD2   1 
ATOM   8108  C  CE1   . TYR C 3  148 ? 111.577 133.433 125.992 1.00 20.44  ? 148  TYR C CE1   1 
ATOM   8109  C  CE2   . TYR C 3  148 ? 112.327 133.550 128.255 1.00 20.44  ? 148  TYR C CE2   1 
ATOM   8110  C  CZ    . TYR C 3  148 ? 111.659 132.890 127.250 1.00 20.44  ? 148  TYR C CZ    1 
ATOM   8111  O  OH    . TYR C 3  148 ? 111.071 131.677 127.501 1.00 20.44  ? 148  TYR C OH    1 
ATOM   8112  N  N     . LYS C 3  149 ? 111.907 138.605 128.502 1.00 18.78  ? 149  LYS C N     1 
ATOM   8113  C  CA    . LYS C 3  149 ? 111.048 138.687 129.677 1.00 18.78  ? 149  LYS C CA    1 
ATOM   8114  C  C     . LYS C 3  149 ? 109.817 139.548 129.443 1.00 18.78  ? 149  LYS C C     1 
ATOM   8115  O  O     . LYS C 3  149 ? 108.814 139.361 130.133 1.00 18.78  ? 149  LYS C O     1 
ATOM   8116  C  CB    . LYS C 3  149 ? 111.818 139.213 130.884 1.00 18.78  ? 149  LYS C CB    1 
ATOM   8117  C  CG    . LYS C 3  149 ? 112.741 138.209 131.539 1.00 18.78  ? 149  LYS C CG    1 
ATOM   8118  C  CD    . LYS C 3  149 ? 113.518 138.850 132.679 1.00 18.78  ? 149  LYS C CD    1 
ATOM   8119  C  CE    . LYS C 3  149 ? 114.387 137.834 133.404 1.00 18.78  ? 149  LYS C CE    1 
ATOM   8120  N  NZ    . LYS C 3  149 ? 115.479 137.309 132.539 1.00 18.78  ? 149  LYS C NZ    1 
ATOM   8121  N  N     . LEU C 3  150 ? 109.850 140.493 128.503 1.00 17.82  ? 150  LEU C N     1 
ATOM   8122  C  CA    . LEU C 3  150 ? 108.618 141.231 128.259 1.00 17.82  ? 150  LEU C CA    1 
ATOM   8123  C  C     . LEU C 3  150 ? 107.744 140.538 127.236 1.00 17.82  ? 150  LEU C C     1 
ATOM   8124  O  O     . LEU C 3  150 ? 106.519 140.643 127.314 1.00 17.82  ? 150  LEU C O     1 
ATOM   8125  C  CB    . LEU C 3  150 ? 108.891 142.672 127.809 1.00 17.82  ? 150  LEU C CB    1 
ATOM   8126  C  CG    . LEU C 3  150 ? 109.377 143.121 126.430 1.00 17.82  ? 150  LEU C CG    1 
ATOM   8127  C  CD1   . LEU C 3  150 ? 108.240 143.452 125.485 1.00 17.82  ? 150  LEU C CD1   1 
ATOM   8128  C  CD2   . LEU C 3  150 ? 110.190 144.338 126.610 1.00 17.82  ? 150  LEU C CD2   1 
ATOM   8129  N  N     . TYR C 3  151 ? 108.343 139.848 126.268 1.00 23.10  ? 151  TYR C N     1 
ATOM   8130  C  CA    . TYR C 3  151 ? 107.540 139.143 125.281 1.00 23.10  ? 151  TYR C CA    1 
ATOM   8131  C  C     . TYR C 3  151 ? 106.919 137.887 125.872 1.00 23.10  ? 151  TYR C C     1 
ATOM   8132  O  O     . TYR C 3  151 ? 105.828 137.484 125.457 1.00 23.10  ? 151  TYR C O     1 
ATOM   8133  C  CB    . TYR C 3  151 ? 108.389 138.795 124.064 1.00 23.10  ? 151  TYR C CB    1 
ATOM   8134  C  CG    . TYR C 3  151 ? 107.591 138.215 122.929 1.00 23.10  ? 151  TYR C CG    1 
ATOM   8135  C  CD1   . TYR C 3  151 ? 106.794 139.027 122.139 1.00 23.10  ? 151  TYR C CD1   1 
ATOM   8136  C  CD2   . TYR C 3  151 ? 107.632 136.859 122.645 1.00 23.10  ? 151  TYR C CD2   1 
ATOM   8137  C  CE1   . TYR C 3  151 ? 106.061 138.509 121.101 1.00 23.10  ? 151  TYR C CE1   1 
ATOM   8138  C  CE2   . TYR C 3  151 ? 106.900 136.330 121.606 1.00 23.10  ? 151  TYR C CE2   1 
ATOM   8139  C  CZ    . TYR C 3  151 ? 106.118 137.161 120.838 1.00 23.10  ? 151  TYR C CZ    1 
ATOM   8140  O  OH    . TYR C 3  151 ? 105.383 136.645 119.800 1.00 23.10  ? 151  TYR C OH    1 
ATOM   8141  N  N     . SER C 3  152 ? 107.589 137.260 126.838 1.00 23.68  ? 152  SER C N     1 
ATOM   8142  C  CA    . SER C 3  152 ? 106.996 136.109 127.506 1.00 23.68  ? 152  SER C CA    1 
ATOM   8143  C  C     . SER C 3  152 ? 105.913 136.542 128.482 1.00 23.68  ? 152  SER C C     1 
ATOM   8144  O  O     . SER C 3  152 ? 104.897 135.856 128.631 1.00 23.68  ? 152  SER C O     1 
ATOM   8145  C  CB    . SER C 3  152 ? 108.072 135.299 128.225 1.00 23.68  ? 152  SER C CB    1 
ATOM   8146  O  OG    . SER C 3  152 ? 107.515 134.176 128.879 1.00 23.68  ? 152  SER C OG    1 
ATOM   8147  N  N     . ALA C 3  153 ? 106.102 137.678 129.153 1.00 27.15  ? 153  ALA C N     1 
ATOM   8148  C  CA    . ALA C 3  153 ? 105.111 138.140 130.114 1.00 27.15  ? 153  ALA C CA    1 
ATOM   8149  C  C     . ALA C 3  153 ? 103.970 138.916 129.474 1.00 27.15  ? 153  ALA C C     1 
ATOM   8150  O  O     . ALA C 3  153 ? 103.004 139.240 130.171 1.00 27.15  ? 153  ALA C O     1 
ATOM   8151  C  CB    . ALA C 3  153 ? 105.763 139.008 131.189 1.00 27.15  ? 153  ALA C CB    1 
ATOM   8152  N  N     . ALA C 3  154 ? 104.049 139.232 128.185 1.00 31.36  ? 154  ALA C N     1 
ATOM   8153  C  CA    . ALA C 3  154 ? 102.907 139.826 127.507 1.00 31.36  ? 154  ALA C CA    1 
ATOM   8154  C  C     . ALA C 3  154 ? 102.044 138.794 126.803 1.00 31.36  ? 154  ALA C C     1 
ATOM   8155  O  O     . ALA C 3  154 ? 100.860 139.054 126.565 1.00 31.36  ? 154  ALA C O     1 
ATOM   8156  C  CB    . ALA C 3  154 ? 103.362 140.881 126.502 1.00 31.36  ? 154  ALA C CB    1 
ATOM   8157  N  N     . ASP C 3  155 ? 102.606 137.635 126.461 1.00 36.22  ? 155  ASP C N     1 
ATOM   8158  C  CA    . ASP C 3  155 ? 101.792 136.521 126.002 1.00 36.22  ? 155  ASP C CA    1 
ATOM   8159  C  C     . ASP C 3  155 ? 101.131 135.784 127.154 1.00 36.22  ? 155  ASP C C     1 
ATOM   8160  O  O     . ASP C 3  155 ? 100.146 135.072 126.935 1.00 36.22  ? 155  ASP C O     1 
ATOM   8161  C  CB    . ASP C 3  155 ? 102.637 135.545 125.188 1.00 36.22  ? 155  ASP C CB    1 
ATOM   8162  C  CG    . ASP C 3  155 ? 103.057 136.117 123.860 1.00 36.22  ? 155  ASP C CG    1 
ATOM   8163  O  OD1   . ASP C 3  155 ? 102.321 136.968 123.322 1.00 36.22  ? 155  ASP C OD1   1 
ATOM   8164  O  OD2   . ASP C 3  155 ? 104.122 135.717 123.349 1.00 36.22  ? 155  ASP C OD2   1 
ATOM   8165  N  N     . ALA C 3  156 ? 101.659 135.931 128.369 1.00 46.28  ? 156  ALA C N     1 
ATOM   8166  C  CA    . ALA C 3  156 ? 100.996 135.367 129.538 1.00 46.28  ? 156  ALA C CA    1 
ATOM   8167  C  C     . ALA C 3  156 ? 99.716  136.123 129.859 1.00 46.28  ? 156  ALA C C     1 
ATOM   8168  O  O     . ALA C 3  156 ? 98.741  135.531 130.331 1.00 46.28  ? 156  ALA C O     1 
ATOM   8169  C  CB    . ALA C 3  156 ? 101.943 135.383 130.736 1.00 46.28  ? 156  ALA C CB    1 
ATOM   8170  N  N     . GLU C 3  157 ? 99.698  137.428 129.607 1.00 55.99  ? 157  GLU C N     1 
ATOM   8171  C  CA    . GLU C 3  157 ? 98.510  138.239 129.825 1.00 55.99  ? 157  GLU C CA    1 
ATOM   8172  C  C     . GLU C 3  157 ? 97.617  138.326 128.596 1.00 55.99  ? 157  GLU C C     1 
ATOM   8173  O  O     . GLU C 3  157 ? 96.502  138.847 128.697 1.00 55.99  ? 157  GLU C O     1 
ATOM   8174  C  CB    . GLU C 3  157 ? 98.912  139.647 130.274 1.00 55.99  ? 157  GLU C CB    1 
ATOM   8175  C  CG    . GLU C 3  157 ? 99.475  139.691 131.684 1.00 55.99  ? 157  GLU C CG    1 
ATOM   8176  C  CD    . GLU C 3  157 ? 99.916  141.077 132.094 1.00 55.99  ? 157  GLU C CD    1 
ATOM   8177  O  OE1   . GLU C 3  157 ? 99.976  141.964 131.223 1.00 55.99  ? 157  GLU C OE1   1 
ATOM   8178  O  OE2   . GLU C 3  157 ? 100.187 141.287 133.294 1.00 55.99  ? 157  GLU C OE2   1 
ATOM   8179  N  N     . GLU C 3  158 ? 98.075  137.831 127.448 1.00 58.87  ? 158  GLU C N     1 
ATOM   8180  C  CA    . GLU C 3  158 ? 97.231  137.818 126.259 1.00 58.87  ? 158  GLU C CA    1 
ATOM   8181  C  C     . GLU C 3  158 ? 96.182  136.717 126.344 1.00 58.87  ? 158  GLU C C     1 
ATOM   8182  O  O     . GLU C 3  158 ? 95.019  136.935 125.980 1.00 58.87  ? 158  GLU C O     1 
ATOM   8183  C  CB    . GLU C 3  158 ? 98.096  137.637 125.011 1.00 58.87  ? 158  GLU C CB    1 
ATOM   8184  C  CG    . GLU C 3  158 ? 97.342  137.707 123.694 1.00 58.87  ? 158  GLU C CG    1 
ATOM   8185  C  CD    . GLU C 3  158 ? 96.870  139.109 123.363 1.00 58.87  ? 158  GLU C CD    1 
ATOM   8186  O  OE1   . GLU C 3  158 ? 97.519  140.076 123.812 1.00 58.87  ? 158  GLU C OE1   1 
ATOM   8187  O  OE2   . GLU C 3  158 ? 95.852  139.245 122.652 1.00 58.87  ? 158  GLU C OE2   1 
ATOM   8188  N  N     . HIS C 3  159 ? 96.581  135.543 126.843 1.00 73.86  ? 159  HIS C N     1 
ATOM   8189  C  CA    . HIS C 3  159 ? 95.785  134.307 126.896 1.00 73.86  ? 159  HIS C CA    1 
ATOM   8190  C  C     . HIS C 3  159 ? 95.194  133.923 125.540 1.00 73.86  ? 159  HIS C C     1 
ATOM   8191  O  O     . HIS C 3  159 ? 94.222  133.171 125.468 1.00 73.86  ? 159  HIS C O     1 
ATOM   8192  C  CB    . HIS C 3  159 ? 94.663  134.408 127.936 1.00 73.86  ? 159  HIS C CB    1 
ATOM   8193  C  CG    . HIS C 3  159 ? 95.149  134.516 129.348 1.00 73.86  ? 159  HIS C CG    1 
ATOM   8194  N  ND1   . HIS C 3  159 ? 95.334  135.726 129.981 1.00 73.86  ? 159  HIS C ND1   1 
ATOM   8195  C  CD2   . HIS C 3  159 ? 95.497  133.565 130.246 1.00 73.86  ? 159  HIS C CD2   1 
ATOM   8196  C  CE1   . HIS C 3  159 ? 95.762  135.515 131.213 1.00 73.86  ? 159  HIS C CE1   1 
ATOM   8197  N  NE2   . HIS C 3  159 ? 95.874  134.212 131.397 1.00 73.86  ? 159  HIS C NE2   1 
ATOM   8198  N  N     . ASN C 3  179 ? 103.502 133.586 116.425 1.00 53.02  ? 179  ASN C N     1 
ATOM   8199  C  CA    . ASN C 3  179 ? 104.643 134.131 115.700 1.00 53.02  ? 179  ASN C CA    1 
ATOM   8200  C  C     . ASN C 3  179 ? 105.812 134.461 116.627 1.00 53.02  ? 179  ASN C C     1 
ATOM   8201  O  O     . ASN C 3  179 ? 105.629 134.661 117.825 1.00 53.02  ? 179  ASN C O     1 
ATOM   8202  C  CB    . ASN C 3  179 ? 104.220 135.366 114.893 1.00 53.02  ? 179  ASN C CB    1 
ATOM   8203  C  CG    . ASN C 3  179 ? 103.506 136.414 115.735 1.00 53.02  ? 179  ASN C CG    1 
ATOM   8204  O  OD1   . ASN C 3  179 ? 103.350 136.267 116.947 1.00 53.02  ? 179  ASN C OD1   1 
ATOM   8205  N  ND2   . ASN C 3  179 ? 103.066 137.485 115.086 1.00 53.02  ? 179  ASN C ND2   1 
ATOM   8206  N  N     . ASP C 3  180 ? 107.013 134.505 116.062 1.00 39.37  ? 180  ASP C N     1 
ATOM   8207  C  CA    . ASP C 3  180 ? 108.233 134.738 116.816 1.00 39.37  ? 180  ASP C CA    1 
ATOM   8208  C  C     . ASP C 3  180 ? 108.790 136.118 116.509 1.00 39.37  ? 180  ASP C C     1 
ATOM   8209  O  O     . ASP C 3  180 ? 108.547 136.694 115.446 1.00 39.37  ? 180  ASP C O     1 
ATOM   8210  C  CB    . ASP C 3  180 ? 109.286 133.678 116.499 1.00 39.37  ? 180  ASP C CB    1 
ATOM   8211  C  CG    . ASP C 3  180 ? 108.925 132.324 117.035 1.00 39.37  ? 180  ASP C CG    1 
ATOM   8212  O  OD1   . ASP C 3  180 ? 108.287 132.258 118.106 1.00 39.37  ? 180  ASP C OD1   1 
ATOM   8213  O  OD2   . ASP C 3  180 ? 109.264 131.326 116.371 1.00 39.37  ? 180  ASP C OD2   1 
ATOM   8214  N  N     . VAL C 3  181 ? 109.552 136.641 117.466 1.00 25.60  ? 181  VAL C N     1 
ATOM   8215  C  CA    . VAL C 3  181 ? 110.070 138.002 117.431 1.00 25.60  ? 181  VAL C CA    1 
ATOM   8216  C  C     . VAL C 3  181 ? 111.563 137.955 117.729 1.00 25.60  ? 181  VAL C C     1 
ATOM   8217  O  O     . VAL C 3  181 ? 112.002 137.215 118.616 1.00 25.60  ? 181  VAL C O     1 
ATOM   8218  C  CB    . VAL C 3  181 ? 109.315 138.901 118.443 1.00 25.60  ? 181  VAL C CB    1 
ATOM   8219  C  CG1   . VAL C 3  181 ? 109.957 140.257 118.588 1.00 25.60  ? 181  VAL C CG1   1 
ATOM   8220  C  CG2   . VAL C 3  181 ? 107.873 139.095 118.011 1.00 25.60  ? 181  VAL C CG2   1 
ATOM   8221  N  N     . SER C 3  182 ? 112.347 138.701 116.951 1.00 21.89  ? 182  SER C N     1 
ATOM   8222  C  CA    . SER C 3  182 ? 113.745 138.936 117.287 1.00 21.89  ? 182  SER C CA    1 
ATOM   8223  C  C     . SER C 3  182 ? 113.840 139.723 118.588 1.00 21.89  ? 182  SER C C     1 
ATOM   8224  O  O     . SER C 3  182 ? 113.239 140.792 118.719 1.00 21.89  ? 182  SER C O     1 
ATOM   8225  C  CB    . SER C 3  182 ? 114.433 139.701 116.159 1.00 21.89  ? 182  SER C CB    1 
ATOM   8226  O  OG    . SER C 3  182 ? 115.779 139.991 116.484 1.00 21.89  ? 182  SER C OG    1 
ATOM   8227  N  N     . TYR C 3  183 ? 114.592 139.199 119.555 1.00 20.34  ? 183  TYR C N     1 
ATOM   8228  C  CA    . TYR C 3  183 ? 114.629 139.813 120.882 1.00 20.34  ? 183  TYR C CA    1 
ATOM   8229  C  C     . TYR C 3  183 ? 115.660 140.929 120.879 1.00 20.34  ? 183  TYR C C     1 
ATOM   8230  O  O     . TYR C 3  183 ? 116.843 140.724 121.144 1.00 20.34  ? 183  TYR C O     1 
ATOM   8231  C  CB    . TYR C 3  183 ? 114.930 138.788 121.965 1.00 20.34  ? 183  TYR C CB    1 
ATOM   8232  C  CG    . TYR C 3  183 ? 113.946 137.658 121.991 1.00 20.34  ? 183  TYR C CG    1 
ATOM   8233  C  CD1   . TYR C 3  183 ? 112.601 137.895 122.212 1.00 20.34  ? 183  TYR C CD1   1 
ATOM   8234  C  CD2   . TYR C 3  183 ? 114.371 136.348 121.866 1.00 20.34  ? 183  TYR C CD2   1 
ATOM   8235  C  CE1   . TYR C 3  183 ? 111.698 136.866 122.242 1.00 20.34  ? 183  TYR C CE1   1 
ATOM   8236  C  CE2   . TYR C 3  183 ? 113.477 135.311 121.907 1.00 20.34  ? 183  TYR C CE2   1 
ATOM   8237  C  CZ    . TYR C 3  183 ? 112.144 135.577 122.097 1.00 20.34  ? 183  TYR C CZ    1 
ATOM   8238  O  OH    . TYR C 3  183 ? 111.246 134.544 122.138 1.00 20.34  ? 183  TYR C OH    1 
ATOM   8239  N  N     . ASP C 3  184 ? 115.187 142.131 120.577 1.00 21.92  ? 184  ASP C N     1 
ATOM   8240  C  CA    . ASP C 3  184 ? 115.989 143.340 120.602 1.00 21.92  ? 184  ASP C CA    1 
ATOM   8241  C  C     . ASP C 3  184 ? 115.044 144.512 120.834 1.00 21.92  ? 184  ASP C C     1 
ATOM   8242  O  O     . ASP C 3  184 ? 113.835 144.329 120.996 1.00 21.92  ? 184  ASP C O     1 
ATOM   8243  C  CB    . ASP C 3  184 ? 116.819 143.459 119.317 1.00 21.92  ? 184  ASP C CB    1 
ATOM   8244  C  CG    . ASP C 3  184 ? 115.977 143.379 118.061 1.00 21.92  ? 184  ASP C CG    1 
ATOM   8245  O  OD1   . ASP C 3  184 ? 114.750 143.182 118.136 1.00 21.92  ? 184  ASP C OD1   1 
ATOM   8246  O  OD2   . ASP C 3  184 ? 116.551 143.494 116.970 1.00 21.92  ? 184  ASP C OD2   1 
ATOM   8247  N  N     . LEU C 3  185 ? 115.577 145.727 120.800 1.00 19.63  ? 185  LEU C N     1 
ATOM   8248  C  CA    . LEU C 3  185 ? 114.793 146.879 121.216 1.00 19.63  ? 185  LEU C CA    1 
ATOM   8249  C  C     . LEU C 3  185 ? 113.833 147.361 120.120 1.00 19.63  ? 185  LEU C C     1 
ATOM   8250  O  O     . LEU C 3  185 ? 113.143 148.368 120.298 1.00 19.63  ? 185  LEU C O     1 
ATOM   8251  C  CB    . LEU C 3  185 ? 115.744 147.989 121.676 1.00 19.63  ? 185  LEU C CB    1 
ATOM   8252  C  CG    . LEU C 3  185 ? 115.255 149.066 122.642 1.00 19.63  ? 185  LEU C CG    1 
ATOM   8253  C  CD1   . LEU C 3  185 ? 114.895 148.420 123.957 1.00 19.63  ? 185  LEU C CD1   1 
ATOM   8254  C  CD2   . LEU C 3  185 ? 116.311 150.105 122.855 1.00 19.63  ? 185  LEU C CD2   1 
ATOM   8255  N  N     . SER C 3  186 ? 113.757 146.649 118.995 1.00 22.65  ? 186  SER C N     1 
ATOM   8256  C  CA    . SER C 3  186 ? 112.691 146.844 118.024 1.00 22.65  ? 186  SER C CA    1 
ATOM   8257  C  C     . SER C 3  186 ? 111.387 146.184 118.449 1.00 22.65  ? 186  SER C C     1 
ATOM   8258  O  O     . SER C 3  186 ? 110.363 146.399 117.799 1.00 22.65  ? 186  SER C O     1 
ATOM   8259  C  CB    . SER C 3  186 ? 113.120 146.301 116.662 1.00 22.65  ? 186  SER C CB    1 
ATOM   8260  O  OG    . SER C 3  186 ? 113.286 144.897 116.712 1.00 22.65  ? 186  SER C OG    1 
ATOM   8261  N  N     . LEU C 3  187 ? 111.403 145.372 119.506 1.00 21.38  ? 187  LEU C N     1 
ATOM   8262  C  CA    . LEU C 3  187 ? 110.161 144.884 120.093 1.00 21.38  ? 187  LEU C CA    1 
ATOM   8263  C  C     . LEU C 3  187 ? 109.440 145.986 120.857 1.00 21.38  ? 187  LEU C C     1 
ATOM   8264  O  O     . LEU C 3  187 ? 108.213 145.946 121.001 1.00 21.38  ? 187  LEU C O     1 
ATOM   8265  C  CB    . LEU C 3  187 ? 110.468 143.692 120.999 1.00 21.38  ? 187  LEU C CB    1 
ATOM   8266  C  CG    . LEU C 3  187 ? 109.387 143.033 121.851 1.00 21.38  ? 187  LEU C CG    1 
ATOM   8267  C  CD1   . LEU C 3  187 ? 108.229 142.566 120.998 1.00 21.38  ? 187  LEU C CD1   1 
ATOM   8268  C  CD2   . LEU C 3  187 ? 110.002 141.875 122.596 1.00 21.38  ? 187  LEU C CD2   1 
ATOM   8269  N  N     . VAL C 3  188 ? 110.182 146.987 121.324 1.00 24.10  ? 188  VAL C N     1 
ATOM   8270  C  CA    . VAL C 3  188 ? 109.585 148.094 122.061 1.00 24.10  ? 188  VAL C CA    1 
ATOM   8271  C  C     . VAL C 3  188 ? 108.813 149.018 121.121 1.00 24.10  ? 188  VAL C C     1 
ATOM   8272  O  O     . VAL C 3  188 ? 107.734 149.514 121.469 1.00 24.10  ? 188  VAL C O     1 
ATOM   8273  C  CB    . VAL C 3  188 ? 110.692 148.821 122.849 1.00 24.10  ? 188  VAL C CB    1 
ATOM   8274  C  CG1   . VAL C 3  188 ? 110.209 150.104 123.462 1.00 24.10  ? 188  VAL C CG1   1 
ATOM   8275  C  CG2   . VAL C 3  188 ? 111.210 147.910 123.939 1.00 24.10  ? 188  VAL C CG2   1 
ATOM   8276  N  N     . GLU C 3  189 ? 109.313 149.224 119.900 1.00 30.74  ? 189  GLU C N     1 
ATOM   8277  C  CA    . GLU C 3  189 ? 108.589 150.085 118.970 1.00 30.74  ? 189  GLU C CA    1 
ATOM   8278  C  C     . GLU C 3  189 ? 107.393 149.391 118.336 1.00 30.74  ? 189  GLU C C     1 
ATOM   8279  O  O     . GLU C 3  189 ? 106.418 150.059 117.980 1.00 30.74  ? 189  GLU C O     1 
ATOM   8280  C  CB    . GLU C 3  189 ? 109.516 150.612 117.874 1.00 30.74  ? 189  GLU C CB    1 
ATOM   8281  C  CG    . GLU C 3  189 ? 110.106 149.586 116.936 1.00 30.74  ? 189  GLU C CG    1 
ATOM   8282  C  CD    . GLU C 3  189 ? 110.955 150.225 115.859 1.00 30.74  ? 189  GLU C CD    1 
ATOM   8283  O  OE1   . GLU C 3  189 ? 111.066 151.468 115.853 1.00 30.74  ? 189  GLU C OE1   1 
ATOM   8284  O  OE2   . GLU C 3  189 ? 111.510 149.487 115.019 1.00 30.74  ? 189  GLU C OE2   1 
ATOM   8285  N  N     . ASN C 3  190 ? 107.436 148.071 118.183 1.00 29.38  ? 190  ASN C N     1 
ATOM   8286  C  CA    . ASN C 3  190 ? 106.321 147.335 117.613 1.00 29.38  ? 190  ASN C CA    1 
ATOM   8287  C  C     . ASN C 3  190 ? 105.330 146.872 118.663 1.00 29.38  ? 190  ASN C C     1 
ATOM   8288  O  O     . ASN C 3  190 ? 104.519 145.991 118.377 1.00 29.38  ? 190  ASN C O     1 
ATOM   8289  C  CB    . ASN C 3  190 ? 106.823 146.127 116.819 1.00 29.38  ? 190  ASN C CB    1 
ATOM   8290  C  CG    . ASN C 3  190 ? 107.576 146.520 115.570 1.00 29.38  ? 190  ASN C CG    1 
ATOM   8291  O  OD1   . ASN C 3  190 ? 108.764 146.244 115.430 1.00 29.38  ? 190  ASN C OD1   1 
ATOM   8292  N  ND2   . ASN C 3  190 ? 106.882 147.163 114.647 1.00 29.38  ? 190  ASN C ND2   1 
ATOM   8293  N  N     . PHE C 3  191 ? 105.365 147.443 119.864 1.00 26.50  ? 191  PHE C N     1 
ATOM   8294  C  CA    . PHE C 3  191 ? 104.581 146.875 120.952 1.00 26.50  ? 191  PHE C CA    1 
ATOM   8295  C  C     . PHE C 3  191 ? 103.114 147.266 120.844 1.00 26.50  ? 191  PHE C C     1 
ATOM   8296  O  O     . PHE C 3  191 ? 102.232 146.449 121.122 1.00 26.50  ? 191  PHE C O     1 
ATOM   8297  C  CB    . PHE C 3  191 ? 105.158 147.314 122.291 1.00 26.50  ? 191  PHE C CB    1 
ATOM   8298  C  CG    . PHE C 3  191 ? 104.673 146.505 123.451 1.00 26.50  ? 191  PHE C CG    1 
ATOM   8299  C  CD1   . PHE C 3  191 ? 105.260 145.286 123.745 1.00 26.50  ? 191  PHE C CD1   1 
ATOM   8300  C  CD2   . PHE C 3  191 ? 103.622 146.947 124.234 1.00 26.50  ? 191  PHE C CD2   1 
ATOM   8301  C  CE1   . PHE C 3  191 ? 104.832 144.541 124.820 1.00 26.50  ? 191  PHE C CE1   1 
ATOM   8302  C  CE2   . PHE C 3  191 ? 103.178 146.196 125.300 1.00 26.50  ? 191  PHE C CE2   1 
ATOM   8303  C  CZ    . PHE C 3  191 ? 103.781 144.990 125.592 1.00 26.50  ? 191  PHE C CZ    1 
ATOM   8304  N  N     . LYS C 3  192 ? 102.829 148.503 120.440 1.00 31.60  ? 192  LYS C N     1 
ATOM   8305  C  CA    . LYS C 3  192 ? 101.445 148.886 120.191 1.00 31.60  ? 192  LYS C CA    1 
ATOM   8306  C  C     . LYS C 3  192 ? 100.927 148.300 118.882 1.00 31.60  ? 192  LYS C C     1 
ATOM   8307  O  O     . LYS C 3  192 ? 99.745  147.952 118.786 1.00 31.60  ? 192  LYS C O     1 
ATOM   8308  C  CB    . LYS C 3  192 ? 101.311 150.412 120.196 1.00 31.60  ? 192  LYS C CB    1 
ATOM   8309  C  CG    . LYS C 3  192 ? 99.885  150.918 120.058 1.00 31.60  ? 192  LYS C CG    1 
ATOM   8310  C  CD    . LYS C 3  192 ? 99.803  152.427 120.139 1.00 31.60  ? 192  LYS C CD    1 
ATOM   8311  C  CE    . LYS C 3  192 ? 99.938  152.898 121.570 1.00 31.60  ? 192  LYS C CE    1 
ATOM   8312  N  NZ    . LYS C 3  192 ? 98.756  152.482 122.371 1.00 31.60  ? 192  LYS C NZ    1 
ATOM   8313  N  N     . ARG C 3  193 ? 101.795 148.139 117.885 1.00 35.21  ? 193  ARG C N     1 
ATOM   8314  C  CA    . ARG C 3  193 ? 101.398 147.564 116.604 1.00 35.21  ? 193  ARG C CA    1 
ATOM   8315  C  C     . ARG C 3  193 ? 101.252 146.050 116.635 1.00 35.21  ? 193  ARG C C     1 
ATOM   8316  O  O     . ARG C 3  193 ? 100.925 145.459 115.601 1.00 35.21  ? 193  ARG C O     1 
ATOM   8317  C  CB    . ARG C 3  193 ? 102.399 147.955 115.514 1.00 35.21  ? 193  ARG C CB    1 
ATOM   8318  C  CG    . ARG C 3  193 ? 102.290 149.398 115.068 1.00 35.21  ? 193  ARG C CG    1 
ATOM   8319  C  CD    . ARG C 3  193 ? 103.270 149.729 113.955 1.00 35.21  ? 193  ARG C CD    1 
ATOM   8320  N  NE    . ARG C 3  193 ? 104.648 149.849 114.418 1.00 35.21  ? 193  ARG C NE    1 
ATOM   8321  C  CZ    . ARG C 3  193 ? 105.687 150.030 113.609 1.00 35.21  ? 193  ARG C CZ    1 
ATOM   8322  N  NH1   . ARG C 3  193 ? 105.501 150.102 112.299 1.00 35.21  ? 193  ARG C NH1   1 
ATOM   8323  N  NH2   . ARG C 3  193 ? 106.911 150.142 114.106 1.00 35.21  ? 193  ARG C NH2   1 
ATOM   8324  N  N     . LEU C 3  194 ? 101.476 145.408 117.777 1.00 30.64  ? 194  LEU C N     1 
ATOM   8325  C  CA    . LEU C 3  194 ? 101.356 143.963 117.889 1.00 30.64  ? 194  LEU C CA    1 
ATOM   8326  C  C     . LEU C 3  194 ? 100.524 143.520 119.081 1.00 30.64  ? 194  LEU C C     1 
ATOM   8327  O  O     . LEU C 3  194 ? 100.038 142.384 119.078 1.00 30.64  ? 194  LEU C O     1 
ATOM   8328  C  CB    . LEU C 3  194 ? 102.757 143.337 117.971 1.00 30.64  ? 194  LEU C CB    1 
ATOM   8329  C  CG    . LEU C 3  194 ? 103.121 141.875 117.751 1.00 30.64  ? 194  LEU C CG    1 
ATOM   8330  C  CD1   . LEU C 3  194 ? 104.513 141.849 117.154 1.00 30.64  ? 194  LEU C CD1   1 
ATOM   8331  C  CD2   . LEU C 3  194 ? 103.105 141.092 119.040 1.00 30.64  ? 194  LEU C CD2   1 
ATOM   8332  N  N     . PHE C 3  195 ? 100.322 144.379 120.080 1.00 32.88  ? 195  PHE C N     1 
ATOM   8333  C  CA    . PHE C 3  195 ? 99.550  144.053 121.270 1.00 32.88  ? 195  PHE C CA    1 
ATOM   8334  C  C     . PHE C 3  195 ? 98.420  145.028 121.559 1.00 32.88  ? 195  PHE C C     1 
ATOM   8335  O  O     . PHE C 3  195 ? 97.574  144.722 122.406 1.00 32.88  ? 195  PHE C O     1 
ATOM   8336  C  CB    . PHE C 3  195 ? 100.476 143.977 122.489 1.00 32.88  ? 195  PHE C CB    1 
ATOM   8337  C  CG    . PHE C 3  195 ? 101.274 142.713 122.558 1.00 32.88  ? 195  PHE C CG    1 
ATOM   8338  C  CD1   . PHE C 3  195 ? 100.745 141.517 122.110 1.00 32.88  ? 195  PHE C CD1   1 
ATOM   8339  C  CD2   . PHE C 3  195 ? 102.584 142.736 122.982 1.00 32.88  ? 195  PHE C CD2   1 
ATOM   8340  C  CE1   . PHE C 3  195 ? 101.491 140.352 122.164 1.00 32.88  ? 195  PHE C CE1   1 
ATOM   8341  C  CE2   . PHE C 3  195 ? 103.341 141.584 123.019 1.00 32.88  ? 195  PHE C CE2   1 
ATOM   8342  C  CZ    . PHE C 3  195 ? 102.795 140.391 122.617 1.00 32.88  ? 195  PHE C CZ    1 
ATOM   8343  N  N     . GLY C 3  196 ? 98.378  146.185 120.900 1.00 35.97  ? 196  GLY C N     1 
ATOM   8344  C  CA    . GLY C 3  196 ? 97.256  147.092 121.005 1.00 35.97  ? 196  GLY C CA    1 
ATOM   8345  C  C     . GLY C 3  196 ? 97.240  147.984 122.224 1.00 35.97  ? 196  GLY C C     1 
ATOM   8346  O  O     . GLY C 3  196 ? 96.456  148.940 122.257 1.00 35.97  ? 196  GLY C O     1 
ATOM   8347  N  N     . LYS C 3  197 ? 98.066  147.712 123.226 1.00 35.59  ? 197  LYS C N     1 
ATOM   8348  C  CA    . LYS C 3  197 ? 98.133  148.517 124.432 1.00 35.59  ? 197  LYS C CA    1 
ATOM   8349  C  C     . LYS C 3  197 ? 99.548  149.047 124.595 1.00 35.59  ? 197  LYS C C     1 
ATOM   8350  O  O     . LYS C 3  197 ? 100.513 148.433 124.134 1.00 35.59  ? 197  LYS C O     1 
ATOM   8351  C  CB    . LYS C 3  197 ? 97.740  147.703 125.661 1.00 35.59  ? 197  LYS C CB    1 
ATOM   8352  C  CG    . LYS C 3  197 ? 96.318  147.182 125.632 1.00 35.59  ? 197  LYS C CG    1 
ATOM   8353  C  CD    . LYS C 3  197 ? 96.034  146.323 126.848 1.00 35.59  ? 197  LYS C CD    1 
ATOM   8354  C  CE    . LYS C 3  197 ? 94.648  145.716 126.789 1.00 35.59  ? 197  LYS C CE    1 
ATOM   8355  N  NZ    . LYS C 3  197 ? 94.389  144.866 127.981 1.00 35.59  ? 197  LYS C NZ    1 
ATOM   8356  N  N     . ASP C 3  198 ? 99.669  150.192 125.254 1.00 33.14  ? 198  ASP C N     1 
ATOM   8357  C  CA    . ASP C 3  198 ? 100.979 150.785 125.433 1.00 33.14  ? 198  ASP C CA    1 
ATOM   8358  C  C     . ASP C 3  198 ? 101.715 150.117 126.595 1.00 33.14  ? 198  ASP C C     1 
ATOM   8359  O  O     . ASP C 3  198 ? 101.143 149.354 127.374 1.00 33.14  ? 198  ASP C O     1 
ATOM   8360  C  CB    . ASP C 3  198 ? 100.856 152.299 125.618 1.00 33.14  ? 198  ASP C CB    1 
ATOM   8361  C  CG    . ASP C 3  198 ? 99.931  152.690 126.749 1.00 33.14  ? 198  ASP C CG    1 
ATOM   8362  O  OD1   . ASP C 3  198 ? 99.287  151.805 127.340 1.00 33.14  ? 198  ASP C OD1   1 
ATOM   8363  O  OD2   . ASP C 3  198 ? 99.849  153.900 127.045 1.00 33.14  ? 198  ASP C OD2   1 
ATOM   8364  N  N     . LEU C 3  199 ? 103.002 150.411 126.702 1.00 24.47  ? 199  LEU C N     1 
ATOM   8365  C  CA    . LEU C 3  199 ? 103.907 149.666 127.560 1.00 24.47  ? 199  LEU C CA    1 
ATOM   8366  C  C     . LEU C 3  199 ? 104.381 150.527 128.724 1.00 24.47  ? 199  LEU C C     1 
ATOM   8367  O  O     . LEU C 3  199 ? 104.454 151.753 128.623 1.00 24.47  ? 199  LEU C O     1 
ATOM   8368  C  CB    . LEU C 3  199 ? 105.098 149.154 126.738 1.00 24.47  ? 199  LEU C CB    1 
ATOM   8369  C  CG    . LEU C 3  199 ? 106.227 148.293 127.301 1.00 24.47  ? 199  LEU C CG    1 
ATOM   8370  C  CD1   . LEU C 3  199 ? 106.714 147.341 126.273 1.00 24.47  ? 199  LEU C CD1   1 
ATOM   8371  C  CD2   . LEU C 3  199 ? 107.363 149.190 127.646 1.00 24.47  ? 199  LEU C CD2   1 
ATOM   8372  N  N     . ALA C 3  200 ? 104.708 149.863 129.835 1.00 22.78  ? 200  ALA C N     1 
ATOM   8373  C  CA    . ALA C 3  200 ? 105.377 150.501 130.968 1.00 22.78  ? 200  ALA C CA    1 
ATOM   8374  C  C     . ALA C 3  200 ? 106.277 149.441 131.604 1.00 22.78  ? 200  ALA C C     1 
ATOM   8375  O  O     . ALA C 3  200 ? 105.828 148.651 132.436 1.00 22.78  ? 200  ALA C O     1 
ATOM   8376  C  CB    . ALA C 3  200 ? 104.381 151.066 131.968 1.00 22.78  ? 200  ALA C CB    1 
ATOM   8377  N  N     . MET C 3  201 ? 107.544 149.438 131.211 1.00 18.17  ? 201  MET C N     1 
ATOM   8378  C  CA    . MET C 3  201 ? 108.489 148.422 131.648 1.00 18.17  ? 201  MET C CA    1 
ATOM   8379  C  C     . MET C 3  201 ? 109.319 148.953 132.809 1.00 18.17  ? 201  MET C C     1 
ATOM   8380  O  O     . MET C 3  201 ? 109.632 150.145 132.871 1.00 18.17  ? 201  MET C O     1 
ATOM   8381  C  CB    . MET C 3  201 ? 109.371 147.975 130.476 1.00 18.17  ? 201  MET C CB    1 
ATOM   8382  C  CG    . MET C 3  201 ? 110.333 149.007 129.925 1.00 18.17  ? 201  MET C CG    1 
ATOM   8383  S  SD    . MET C 3  201 ? 110.886 148.625 128.249 1.00 18.17  ? 201  MET C SD    1 
ATOM   8384  C  CE    . MET C 3  201 ? 111.751 147.094 128.478 1.00 18.17  ? 201  MET C CE    1 
ATOM   8385  N  N     . VAL C 3  202 ? 109.621 148.073 133.760 1.00 13.87  ? 202  VAL C N     1 
ATOM   8386  C  CA    . VAL C 3  202 ? 110.327 148.430 134.983 1.00 13.87  ? 202  VAL C CA    1 
ATOM   8387  C  C     . VAL C 3  202 ? 111.538 147.521 135.120 1.00 13.87  ? 202  VAL C C     1 
ATOM   8388  O  O     . VAL C 3  202 ? 111.403 146.295 135.085 1.00 13.87  ? 202  VAL C O     1 
ATOM   8389  C  CB    . VAL C 3  202 ? 109.421 148.312 136.225 1.00 13.87  ? 202  VAL C CB    1 
ATOM   8390  C  CG1   . VAL C 3  202 ? 110.213 148.552 137.487 1.00 13.87  ? 202  VAL C CG1   1 
ATOM   8391  C  CG2   . VAL C 3  202 ? 108.266 149.291 136.145 1.00 13.87  ? 202  VAL C CG2   1 
ATOM   8392  N  N     . PHE C 3  203 ? 112.715 148.117 135.275 1.00 12.70  ? 203  PHE C N     1 
ATOM   8393  C  CA    . PHE C 3  203 ? 113.953 147.369 135.427 1.00 12.70  ? 203  PHE C CA    1 
ATOM   8394  C  C     . PHE C 3  203 ? 114.383 147.343 136.882 1.00 12.70  ? 203  PHE C C     1 
ATOM   8395  O  O     . PHE C 3  203 ? 114.423 148.384 137.542 1.00 12.70  ? 203  PHE C O     1 
ATOM   8396  C  CB    . PHE C 3  203 ? 115.062 147.964 134.570 1.00 12.70  ? 203  PHE C CB    1 
ATOM   8397  C  CG    . PHE C 3  203 ? 114.930 147.649 133.123 1.00 12.70  ? 203  PHE C CG    1 
ATOM   8398  C  CD1   . PHE C 3  203 ? 115.438 146.468 132.617 1.00 12.70  ? 203  PHE C CD1   1 
ATOM   8399  C  CD2   . PHE C 3  203 ? 114.291 148.523 132.271 1.00 12.70  ? 203  PHE C CD2   1 
ATOM   8400  C  CE1   . PHE C 3  203 ? 115.319 146.174 131.285 1.00 12.70  ? 203  PHE C CE1   1 
ATOM   8401  C  CE2   . PHE C 3  203 ? 114.166 148.231 130.942 1.00 12.70  ? 203  PHE C CE2   1 
ATOM   8402  C  CZ    . PHE C 3  203 ? 114.687 147.057 130.449 1.00 12.70  ? 203  PHE C CZ    1 
ATOM   8403  N  N     . ASN C 3  204 ? 114.724 146.154 137.367 1.00 13.06  ? 204  ASN C N     1 
ATOM   8404  C  CA    . ASN C 3  204 ? 115.066 145.919 138.766 1.00 13.06  ? 204  ASN C CA    1 
ATOM   8405  C  C     . ASN C 3  204 ? 116.446 145.271 138.787 1.00 13.06  ? 204  ASN C C     1 
ATOM   8406  O  O     . ASN C 3  204 ? 116.563 144.051 138.661 1.00 13.06  ? 204  ASN C O     1 
ATOM   8407  C  CB    . ASN C 3  204 ? 114.017 145.040 139.421 1.00 13.06  ? 204  ASN C CB    1 
ATOM   8408  C  CG    . ASN C 3  204 ? 114.147 144.992 140.917 1.00 13.06  ? 204  ASN C CG    1 
ATOM   8409  O  OD1   . ASN C 3  204 ? 114.961 145.695 141.502 1.00 13.06  ? 204  ASN C OD1   1 
ATOM   8410  N  ND2   . ASN C 3  204 ? 113.365 144.130 141.546 1.00 13.06  ? 204  ASN C ND2   1 
ATOM   8411  N  N     . PHE C 3  205 ? 117.487 146.082 138.948 1.00 13.03  ? 205  PHE C N     1 
ATOM   8412  C  CA    . PHE C 3  205 ? 118.854 145.575 138.957 1.00 13.03  ? 205  PHE C CA    1 
ATOM   8413  C  C     . PHE C 3  205 ? 119.180 145.056 140.352 1.00 13.03  ? 205  PHE C C     1 
ATOM   8414  O  O     . PHE C 3  205 ? 119.119 145.813 141.324 1.00 13.03  ? 205  PHE C O     1 
ATOM   8415  C  CB    . PHE C 3  205 ? 119.822 146.677 138.541 1.00 13.03  ? 205  PHE C CB    1 
ATOM   8416  C  CG    . PHE C 3  205 ? 119.545 147.234 137.175 1.00 13.03  ? 205  PHE C CG    1 
ATOM   8417  C  CD1   . PHE C 3  205 ? 119.940 146.553 136.037 1.00 13.03  ? 205  PHE C CD1   1 
ATOM   8418  C  CD2   . PHE C 3  205 ? 118.881 148.440 137.033 1.00 13.03  ? 205  PHE C CD2   1 
ATOM   8419  C  CE1   . PHE C 3  205 ? 119.678 147.069 134.784 1.00 13.03  ? 205  PHE C CE1   1 
ATOM   8420  C  CE2   . PHE C 3  205 ? 118.619 148.960 135.786 1.00 13.03  ? 205  PHE C CE2   1 
ATOM   8421  C  CZ    . PHE C 3  205 ? 119.014 148.274 134.662 1.00 13.03  ? 205  PHE C CZ    1 
ATOM   8422  N  N     . LYS C 3  206 ? 119.539 143.775 140.455 1.00 19.18  ? 206  LYS C N     1 
ATOM   8423  C  CA    . LYS C 3  206 ? 119.541 143.113 141.761 1.00 19.18  ? 206  LYS C CA    1 
ATOM   8424  C  C     . LYS C 3  206 ? 120.790 143.412 142.582 1.00 19.18  ? 206  LYS C C     1 
ATOM   8425  O  O     . LYS C 3  206 ? 120.710 144.024 143.649 1.00 19.18  ? 206  LYS C O     1 
ATOM   8426  C  CB    . LYS C 3  206 ? 119.370 141.604 141.584 1.00 19.18  ? 206  LYS C CB    1 
ATOM   8427  C  CG    . LYS C 3  206 ? 118.010 141.198 141.084 1.00 19.18  ? 206  LYS C CG    1 
ATOM   8428  C  CD    . LYS C 3  206 ? 116.966 141.508 142.124 1.00 19.18  ? 206  LYS C CD    1 
ATOM   8429  C  CE    . LYS C 3  206 ? 115.623 140.967 141.711 1.00 19.18  ? 206  LYS C CE    1 
ATOM   8430  N  NZ    . LYS C 3  206 ? 115.633 139.480 141.761 1.00 19.18  ? 206  LYS C NZ    1 
ATOM   8431  N  N     . ASP C 3  207 ? 121.953 142.971 142.128 1.00 27.40  ? 207  ASP C N     1 
ATOM   8432  C  CA    . ASP C 3  207 ? 123.182 143.238 142.864 1.00 27.40  ? 207  ASP C CA    1 
ATOM   8433  C  C     . ASP C 3  207 ? 124.014 144.164 141.989 1.00 27.40  ? 207  ASP C C     1 
ATOM   8434  O  O     . ASP C 3  207 ? 124.927 143.744 141.281 1.00 27.40  ? 207  ASP C O     1 
ATOM   8435  C  CB    . ASP C 3  207 ? 123.917 141.958 143.216 1.00 27.40  ? 207  ASP C CB    1 
ATOM   8436  C  CG    . ASP C 3  207 ? 123.151 141.104 144.207 1.00 27.40  ? 207  ASP C CG    1 
ATOM   8437  O  OD1   . ASP C 3  207 ? 122.397 141.671 145.023 1.00 27.40  ? 207  ASP C OD1   1 
ATOM   8438  O  OD2   . ASP C 3  207 ? 123.295 139.864 144.163 1.00 27.40  ? 207  ASP C OD2   1 
ATOM   8439  N  N     . VAL C 3  208 ? 123.690 145.454 142.064 1.00 25.66  ? 208  VAL C N     1 
ATOM   8440  C  CA    . VAL C 3  208 ? 124.328 146.452 141.215 1.00 25.66  ? 208  VAL C CA    1 
ATOM   8441  C  C     . VAL C 3  208 ? 125.712 146.818 141.729 1.00 25.66  ? 208  VAL C C     1 
ATOM   8442  O  O     . VAL C 3  208 ? 126.526 147.366 140.979 1.00 25.66  ? 208  VAL C O     1 
ATOM   8443  C  CB    . VAL C 3  208 ? 123.313 147.607 141.105 1.00 25.66  ? 208  VAL C CB    1 
ATOM   8444  C  CG1   . VAL C 3  208 ? 123.081 148.186 142.440 1.00 25.66  ? 208  VAL C CG1   1 
ATOM   8445  C  CG2   . VAL C 3  208 ? 123.740 148.681 140.126 1.00 25.66  ? 208  VAL C CG2   1 
ATOM   8446  N  N     . ASP C 3  209 ? 126.032 146.474 142.972 1.00 30.34  ? 209  ASP C N     1 
ATOM   8447  C  CA    . ASP C 3  209 ? 127.407 146.580 143.434 1.00 30.34  ? 209  ASP C CA    1 
ATOM   8448  C  C     . ASP C 3  209 ? 128.274 145.425 142.959 1.00 30.34  ? 209  ASP C C     1 
ATOM   8449  O  O     . ASP C 3  209 ? 129.500 145.499 143.088 1.00 30.34  ? 209  ASP C O     1 
ATOM   8450  C  CB    . ASP C 3  209 ? 127.438 146.660 144.958 1.00 30.34  ? 209  ASP C CB    1 
ATOM   8451  C  CG    . ASP C 3  209 ? 126.879 147.963 145.476 1.00 30.34  ? 209  ASP C CG    1 
ATOM   8452  O  OD1   . ASP C 3  209 ? 127.052 148.995 144.797 1.00 30.34  ? 209  ASP C OD1   1 
ATOM   8453  O  OD2   . ASP C 3  209 ? 126.240 147.954 146.545 1.00 30.34  ? 209  ASP C OD2   1 
ATOM   8454  N  N     . SER C 3  210 ? 127.670 144.372 142.412 1.00 27.82  ? 210  SER C N     1 
ATOM   8455  C  CA    . SER C 3  210 ? 128.403 143.236 141.874 1.00 27.82  ? 210  SER C CA    1 
ATOM   8456  C  C     . SER C 3  210 ? 128.482 143.245 140.355 1.00 27.82  ? 210  SER C C     1 
ATOM   8457  O  O     . SER C 3  210 ? 129.346 142.566 139.793 1.00 27.82  ? 210  SER C O     1 
ATOM   8458  C  CB    . SER C 3  210 ? 127.756 141.926 142.336 1.00 27.82  ? 210  SER C CB    1 
ATOM   8459  O  OG    . SER C 3  210 ? 127.798 141.809 143.746 1.00 27.82  ? 210  SER C OG    1 
ATOM   8460  N  N     . ILE C 3  211 ? 127.600 143.988 139.684 1.00 23.86  ? 211  ILE C N     1 
ATOM   8461  C  CA    . ILE C 3  211 ? 127.696 144.153 138.241 1.00 23.86  ? 211  ILE C CA    1 
ATOM   8462  C  C     . ILE C 3  211 ? 128.868 145.081 137.935 1.00 23.86  ? 211  ILE C C     1 
ATOM   8463  O  O     . ILE C 3  211 ? 129.303 145.869 138.787 1.00 23.86  ? 211  ILE C O     1 
ATOM   8464  C  CB    . ILE C 3  211 ? 126.363 144.695 137.682 1.00 23.86  ? 211  ILE C CB    1 
ATOM   8465  C  CG1   . ILE C 3  211 ? 126.229 144.454 136.179 1.00 23.86  ? 211  ILE C CG1   1 
ATOM   8466  C  CG2   . ILE C 3  211 ? 126.203 146.178 137.945 1.00 23.86  ? 211  ILE C CG2   1 
ATOM   8467  C  CD1   . ILE C 3  211 ? 124.856 144.784 135.651 1.00 23.86  ? 211  ILE C CD1   1 
ATOM   8468  N  N     . ASN C 3  212 ? 129.434 144.952 136.739 1.00 19.73  ? 212  ASN C N     1 
ATOM   8469  C  CA    . ASN C 3  212 ? 130.396 145.947 136.306 1.00 19.73  ? 212  ASN C CA    1 
ATOM   8470  C  C     . ASN C 3  212 ? 129.665 147.121 135.677 1.00 19.73  ? 212  ASN C C     1 
ATOM   8471  O  O     . ASN C 3  212 ? 128.608 146.970 135.064 1.00 19.73  ? 212  ASN C O     1 
ATOM   8472  C  CB    . ASN C 3  212 ? 131.443 145.379 135.342 1.00 19.73  ? 212  ASN C CB    1 
ATOM   8473  C  CG    . ASN C 3  212 ? 130.847 144.702 134.132 1.00 19.73  ? 212  ASN C CG    1 
ATOM   8474  O  OD1   . ASN C 3  212 ? 129.637 144.537 134.013 1.00 19.73  ? 212  ASN C OD1   1 
ATOM   8475  N  ND2   . ASN C 3  212 ? 131.711 144.332 133.196 1.00 19.73  ? 212  ASN C ND2   1 
ATOM   8476  N  N     . PHE C 3  213 ? 130.229 148.303 135.865 1.00 22.18  ? 213  PHE C N     1 
ATOM   8477  C  CA    . PHE C 3  213 ? 129.539 149.528 135.515 1.00 22.18  ? 213  PHE C CA    1 
ATOM   8478  C  C     . PHE C 3  213 ? 129.832 149.990 134.101 1.00 22.18  ? 213  PHE C C     1 
ATOM   8479  O  O     . PHE C 3  213 ? 129.283 151.004 133.680 1.00 22.18  ? 213  PHE C O     1 
ATOM   8480  C  CB    . PHE C 3  213 ? 129.898 150.622 136.514 1.00 22.18  ? 213  PHE C CB    1 
ATOM   8481  C  CG    . PHE C 3  213 ? 129.386 150.359 137.892 1.00 22.18  ? 213  PHE C CG    1 
ATOM   8482  C  CD1   . PHE C 3  213 ? 128.099 150.718 138.245 1.00 22.18  ? 213  PHE C CD1   1 
ATOM   8483  C  CD2   . PHE C 3  213 ? 130.182 149.721 138.828 1.00 22.18  ? 213  PHE C CD2   1 
ATOM   8484  C  CE1   . PHE C 3  213 ? 127.628 150.470 139.511 1.00 22.18  ? 213  PHE C CE1   1 
ATOM   8485  C  CE2   . PHE C 3  213 ? 129.712 149.468 140.092 1.00 22.18  ? 213  PHE C CE2   1 
ATOM   8486  C  CZ    . PHE C 3  213 ? 128.439 149.842 140.431 1.00 22.18  ? 213  PHE C CZ    1 
ATOM   8487  N  N     . ASN C 3  214 ? 130.695 149.288 133.367 1.00 18.51  ? 214  ASN C N     1 
ATOM   8488  C  CA    . ASN C 3  214 ? 130.799 149.534 131.934 1.00 18.51  ? 214  ASN C CA    1 
ATOM   8489  C  C     . ASN C 3  214 ? 129.569 149.006 131.218 1.00 18.51  ? 214  ASN C C     1 
ATOM   8490  O  O     . ASN C 3  214 ? 129.072 149.626 130.274 1.00 18.51  ? 214  ASN C O     1 
ATOM   8491  C  CB    . ASN C 3  214 ? 132.050 148.864 131.373 1.00 18.51  ? 214  ASN C CB    1 
ATOM   8492  C  CG    . ASN C 3  214 ? 132.550 149.510 130.097 1.00 18.51  ? 214  ASN C CG    1 
ATOM   8493  O  OD1   . ASN C 3  214 ? 133.616 149.158 129.597 1.00 18.51  ? 214  ASN C OD1   1 
ATOM   8494  N  ND2   . ASN C 3  214 ? 131.817 150.492 129.592 1.00 18.51  ? 214  ASN C ND2   1 
ATOM   8495  N  N     . THR C 3  215 ? 129.077 147.850 131.654 1.00 16.03  ? 215  THR C N     1 
ATOM   8496  C  CA    . THR C 3  215 ? 127.942 147.210 131.012 1.00 16.03  ? 215  THR C CA    1 
ATOM   8497  C  C     . THR C 3  215 ? 126.640 147.911 131.372 1.00 16.03  ? 215  THR C C     1 
ATOM   8498  O  O     . THR C 3  215 ? 125.784 148.124 130.508 1.00 16.03  ? 215  THR C O     1 
ATOM   8499  C  CB    . THR C 3  215 ? 127.901 145.738 131.418 1.00 16.03  ? 215  THR C CB    1 
ATOM   8500  O  OG1   . THR C 3  215 ? 129.158 145.129 131.108 1.00 16.03  ? 215  THR C OG1   1 
ATOM   8501  C  CG2   . THR C 3  215 ? 126.841 145.014 130.661 1.00 16.03  ? 215  THR C CG2   1 
ATOM   8502  N  N     . LEU C 3  216 ? 126.488 148.295 132.640 1.00 15.77  ? 216  LEU C N     1 
ATOM   8503  C  CA    . LEU C 3  216 ? 125.268 148.956 133.081 1.00 15.77  ? 216  LEU C CA    1 
ATOM   8504  C  C     . LEU C 3  216 ? 125.181 150.382 132.559 1.00 15.77  ? 216  LEU C C     1 
ATOM   8505  O  O     . LEU C 3  216 ? 124.077 150.897 132.366 1.00 15.77  ? 216  LEU C O     1 
ATOM   8506  C  CB    . LEU C 3  216 ? 125.192 148.911 134.606 1.00 15.77  ? 216  LEU C CB    1 
ATOM   8507  C  CG    . LEU C 3  216 ? 123.942 149.406 135.324 1.00 15.77  ? 216  LEU C CG    1 
ATOM   8508  C  CD1   . LEU C 3  216 ? 123.637 148.470 136.448 1.00 15.77  ? 216  LEU C CD1   1 
ATOM   8509  C  CD2   . LEU C 3  216 ? 124.182 150.784 135.892 1.00 15.77  ? 216  LEU C CD2   1 
ATOM   8510  N  N     . ASP C 3  217 ? 126.321 151.032 132.323 1.00 18.09  ? 217  ASP C N     1 
ATOM   8511  C  CA    . ASP C 3  217 ? 126.300 152.340 131.678 1.00 18.09  ? 217  ASP C CA    1 
ATOM   8512  C  C     . ASP C 3  217 ? 125.869 152.218 130.225 1.00 18.09  ? 217  ASP C C     1 
ATOM   8513  O  O     . ASP C 3  217 ? 125.052 153.009 129.748 1.00 18.09  ? 217  ASP C O     1 
ATOM   8514  C  CB    . ASP C 3  217 ? 127.678 152.984 131.774 1.00 18.09  ? 217  ASP C CB    1 
ATOM   8515  C  CG    . ASP C 3  217 ? 127.669 154.461 131.473 1.00 18.09  ? 217  ASP C CG    1 
ATOM   8516  O  OD1   . ASP C 3  217 ? 126.604 155.028 131.164 1.00 18.09  ? 217  ASP C OD1   1 
ATOM   8517  O  OD2   . ASP C 3  217 ? 128.751 155.066 131.559 1.00 18.09  ? 217  ASP C OD2   1 
ATOM   8518  N  N     . ASN C 3  218 ? 126.389 151.216 129.515 1.00 15.33  ? 218  ASN C N     1 
ATOM   8519  C  CA    . ASN C 3  218 ? 126.047 151.038 128.110 1.00 15.33  ? 218  ASN C CA    1 
ATOM   8520  C  C     . ASN C 3  218 ? 124.634 150.516 127.913 1.00 15.33  ? 218  ASN C C     1 
ATOM   8521  O  O     . ASN C 3  218 ? 124.108 150.603 126.801 1.00 15.33  ? 218  ASN C O     1 
ATOM   8522  C  CB    . ASN C 3  218 ? 127.027 150.082 127.440 1.00 15.33  ? 218  ASN C CB    1 
ATOM   8523  C  CG    . ASN C 3  218 ? 128.416 150.651 127.337 1.00 15.33  ? 218  ASN C CG    1 
ATOM   8524  O  OD1   . ASN C 3  218 ? 128.595 151.836 127.073 1.00 15.33  ? 218  ASN C OD1   1 
ATOM   8525  N  ND2   . ASN C 3  218 ? 129.415 149.803 127.527 1.00 15.33  ? 218  ASN C ND2   1 
ATOM   8526  N  N     . PHE C 3  219 ? 124.012 149.968 128.951 1.00 13.86  ? 219  PHE C N     1 
ATOM   8527  C  CA    . PHE C 3  219 ? 122.646 149.488 128.828 1.00 13.86  ? 219  PHE C CA    1 
ATOM   8528  C  C     . PHE C 3  219 ? 121.626 150.575 129.131 1.00 13.86  ? 219  PHE C C     1 
ATOM   8529  O  O     . PHE C 3  219 ? 120.541 150.568 128.545 1.00 13.86  ? 219  PHE C O     1 
ATOM   8530  C  CB    . PHE C 3  219 ? 122.430 148.286 129.747 1.00 13.86  ? 219  PHE C CB    1 
ATOM   8531  C  CG    . PHE C 3  219 ? 121.097 147.628 129.583 1.00 13.86  ? 219  PHE C CG    1 
ATOM   8532  C  CD1   . PHE C 3  219 ? 120.817 146.889 128.450 1.00 13.86  ? 219  PHE C CD1   1 
ATOM   8533  C  CD2   . PHE C 3  219 ? 120.134 147.726 130.570 1.00 13.86  ? 219  PHE C CD2   1 
ATOM   8534  C  CE1   . PHE C 3  219 ? 119.596 146.276 128.297 1.00 13.86  ? 219  PHE C CE1   1 
ATOM   8535  C  CE2   . PHE C 3  219 ? 118.912 147.114 130.422 1.00 13.86  ? 219  PHE C CE2   1 
ATOM   8536  C  CZ    . PHE C 3  219 ? 118.645 146.387 129.285 1.00 13.86  ? 219  PHE C CZ    1 
ATOM   8537  N  N     . ILE C 3  220 ? 121.954 151.515 130.020 1.00 14.52  ? 220  ILE C N     1 
ATOM   8538  C  CA    . ILE C 3  220 ? 121.088 152.670 130.244 1.00 14.52  ? 220  ILE C CA    1 
ATOM   8539  C  C     . ILE C 3  220 ? 121.094 153.580 129.022 1.00 14.52  ? 220  ILE C C     1 
ATOM   8540  O  O     . ILE C 3  220 ? 120.051 154.110 128.618 1.00 14.52  ? 220  ILE C O     1 
ATOM   8541  C  CB    . ILE C 3  220 ? 121.526 153.407 131.523 1.00 14.52  ? 220  ILE C CB    1 
ATOM   8542  C  CG1   . ILE C 3  220 ? 121.276 152.525 132.742 1.00 14.52  ? 220  ILE C CG1   1 
ATOM   8543  C  CG2   . ILE C 3  220 ? 120.798 154.726 131.697 1.00 14.52  ? 220  ILE C CG2   1 
ATOM   8544  C  CD1   . ILE C 3  220 ? 121.924 153.043 133.988 1.00 14.52  ? 220  ILE C CD1   1 
ATOM   8545  N  N     . ILE C 3  221 ? 122.261 153.750 128.398 1.00 13.93  ? 221  ILE C N     1 
ATOM   8546  C  CA    . ILE C 3  221 ? 122.371 154.483 127.139 1.00 13.93  ? 221  ILE C CA    1 
ATOM   8547  C  C     . ILE C 3  221 ? 121.628 153.754 126.022 1.00 13.93  ? 221  ILE C C     1 
ATOM   8548  O  O     . ILE C 3  221 ? 121.039 154.388 125.137 1.00 13.93  ? 221  ILE C O     1 
ATOM   8549  C  CB    . ILE C 3  221 ? 123.865 154.702 126.820 1.00 13.93  ? 221  ILE C CB    1 
ATOM   8550  C  CG1   . ILE C 3  221 ? 124.492 155.615 127.868 1.00 13.93  ? 221  ILE C CG1   1 
ATOM   8551  C  CG2   . ILE C 3  221 ? 124.087 155.311 125.452 1.00 13.93  ? 221  ILE C CG2   1 
ATOM   8552  C  CD1   . ILE C 3  221 ? 125.988 155.690 127.777 1.00 13.93  ? 221  ILE C CD1   1 
ATOM   8553  N  N     . LEU C 3  222 ? 121.597 152.422 126.070 1.00 12.79  ? 222  LEU C N     1 
ATOM   8554  C  CA    . LEU C 3  222 ? 120.816 151.660 125.101 1.00 12.79  ? 222  LEU C CA    1 
ATOM   8555  C  C     . LEU C 3  222 ? 119.322 151.859 125.319 1.00 12.79  ? 222  LEU C C     1 
ATOM   8556  O  O     . LEU C 3  222 ? 118.563 151.980 124.354 1.00 12.79  ? 222  LEU C O     1 
ATOM   8557  C  CB    . LEU C 3  222 ? 121.189 150.182 125.190 1.00 12.79  ? 222  LEU C CB    1 
ATOM   8558  C  CG    . LEU C 3  222 ? 120.716 149.196 124.126 1.00 12.79  ? 222  LEU C CG    1 
ATOM   8559  C  CD1   . LEU C 3  222 ? 121.806 148.191 123.950 1.00 12.79  ? 222  LEU C CD1   1 
ATOM   8560  C  CD2   . LEU C 3  222 ? 119.445 148.474 124.525 1.00 12.79  ? 222  LEU C CD2   1 
ATOM   8561  N  N     . LEU C 3  223 ? 118.884 151.907 126.578 1.00 14.09  ? 223  LEU C N     1 
ATOM   8562  C  CA    . LEU C 3  223 ? 117.476 152.152 126.869 1.00 14.09  ? 223  LEU C CA    1 
ATOM   8563  C  C     . LEU C 3  223 ? 117.076 153.597 126.629 1.00 14.09  ? 223  LEU C C     1 
ATOM   8564  O  O     . LEU C 3  223 ? 115.880 153.883 126.531 1.00 14.09  ? 223  LEU C O     1 
ATOM   8565  C  CB    . LEU C 3  223 ? 117.159 151.785 128.314 1.00 14.09  ? 223  LEU C CB    1 
ATOM   8566  C  CG    . LEU C 3  223 ? 117.254 150.325 128.725 1.00 14.09  ? 223  LEU C CG    1 
ATOM   8567  C  CD1   . LEU C 3  223 ? 117.091 150.251 130.218 1.00 14.09  ? 223  LEU C CD1   1 
ATOM   8568  C  CD2   . LEU C 3  223 ? 116.205 149.496 128.025 1.00 14.09  ? 223  LEU C CD2   1 
ATOM   8569  N  N     . LYS C 3  224 ? 118.050 154.509 126.549 1.00 19.32  ? 224  LYS C N     1 
ATOM   8570  C  CA    . LYS C 3  224 ? 117.768 155.908 126.245 1.00 19.32  ? 224  LYS C CA    1 
ATOM   8571  C  C     . LYS C 3  224 ? 117.201 156.067 124.841 1.00 19.32  ? 224  LYS C C     1 
ATOM   8572  O  O     . LYS C 3  224 ? 116.422 156.990 124.582 1.00 19.32  ? 224  LYS C O     1 
ATOM   8573  C  CB    . LYS C 3  224 ? 119.049 156.730 126.408 1.00 19.32  ? 224  LYS C CB    1 
ATOM   8574  C  CG    . LYS C 3  224 ? 118.895 158.228 126.233 1.00 19.32  ? 224  LYS C CG    1 
ATOM   8575  C  CD    . LYS C 3  224 ? 120.203 158.961 126.458 1.00 19.32  ? 224  LYS C CD    1 
ATOM   8576  C  CE    . LYS C 3  224 ? 121.011 159.079 125.179 1.00 19.32  ? 224  LYS C CE    1 
ATOM   8577  N  NZ    . LYS C 3  224 ? 121.872 157.893 124.936 1.00 19.32  ? 224  LYS C NZ    1 
ATOM   8578  N  N     . SER C 3  225 ? 117.536 155.146 123.938 1.00 21.30  ? 225  SER C N     1 
ATOM   8579  C  CA    . SER C 3  225 ? 117.050 155.138 122.565 1.00 21.30  ? 225  SER C CA    1 
ATOM   8580  C  C     . SER C 3  225 ? 115.591 154.725 122.438 1.00 21.30  ? 225  SER C C     1 
ATOM   8581  O  O     . SER C 3  225 ? 115.094 154.653 121.312 1.00 21.30  ? 225  SER C O     1 
ATOM   8582  C  CB    . SER C 3  225 ? 117.917 154.204 121.726 1.00 21.30  ? 225  SER C CB    1 
ATOM   8583  O  OG    . SER C 3  225 ? 119.256 154.659 121.691 1.00 21.30  ? 225  SER C OG    1 
ATOM   8584  N  N     . ALA C 3  226 ? 114.894 154.442 123.536 1.00 21.87  ? 226  ALA C N     1 
ATOM   8585  C  CA    . ALA C 3  226 ? 113.485 154.089 123.501 1.00 21.87  ? 226  ALA C CA    1 
ATOM   8586  C  C     . ALA C 3  226 ? 112.586 155.243 123.925 1.00 21.87  ? 226  ALA C C     1 
ATOM   8587  O  O     . ALA C 3  226 ? 111.439 155.016 124.309 1.00 21.87  ? 226  ALA C O     1 
ATOM   8588  C  CB    . ALA C 3  226 ? 113.226 152.866 124.380 1.00 21.87  ? 226  ALA C CB    1 
ATOM   8589  N  N     . PHE C 3  227 ? 113.077 156.475 123.855 1.00 28.32  ? 227  PHE C N     1 
ATOM   8590  C  CA    . PHE C 3  227 ? 112.305 157.646 124.244 1.00 28.32  ? 227  PHE C CA    1 
ATOM   8591  C  C     . PHE C 3  227 ? 111.738 158.389 123.054 1.00 28.32  ? 227  PHE C C     1 
ATOM   8592  O  O     . PHE C 3  227 ? 111.310 159.538 123.191 1.00 28.32  ? 227  PHE C O     1 
ATOM   8593  C  CB    . PHE C 3  227 ? 113.169 158.571 125.089 1.00 28.32  ? 227  PHE C CB    1 
ATOM   8594  C  CG    . PHE C 3  227 ? 113.449 158.027 126.441 1.00 28.32  ? 227  PHE C CG    1 
ATOM   8595  C  CD1   . PHE C 3  227 ? 112.590 157.093 127.001 1.00 28.32  ? 227  PHE C CD1   1 
ATOM   8596  C  CD2   . PHE C 3  227 ? 114.585 158.399 127.133 1.00 28.32  ? 227  PHE C CD2   1 
ATOM   8597  C  CE1   . PHE C 3  227 ? 112.833 156.572 128.228 1.00 28.32  ? 227  PHE C CE1   1 
ATOM   8598  C  CE2   . PHE C 3  227 ? 114.832 157.870 128.365 1.00 28.32  ? 227  PHE C CE2   1 
ATOM   8599  C  CZ    . PHE C 3  227 ? 113.944 156.953 128.902 1.00 28.32  ? 227  PHE C CZ    1 
ATOM   8600  N  N     . LYS C 3  228 ? 111.728 157.753 121.891 1.00 29.20  ? 228  LYS C N     1 
ATOM   8601  C  CA    . LYS C 3  228 ? 111.202 158.327 120.669 1.00 29.20  ? 228  LYS C CA    1 
ATOM   8602  C  C     . LYS C 3  228 ? 109.927 157.627 120.225 1.00 29.20  ? 228  LYS C C     1 
ATOM   8603  O  O     . LYS C 3  228 ? 109.443 157.880 119.118 1.00 29.20  ? 228  LYS C O     1 
ATOM   8604  C  CB    . LYS C 3  228 ? 112.273 158.245 119.585 1.00 29.20  ? 228  LYS C CB    1 
ATOM   8605  C  CG    . LYS C 3  228 ? 112.647 156.819 119.268 1.00 29.20  ? 228  LYS C CG    1 
ATOM   8606  C  CD    . LYS C 3  228 ? 113.758 156.695 118.248 1.00 29.20  ? 228  LYS C CD    1 
ATOM   8607  C  CE    . LYS C 3  228 ? 115.113 156.935 118.884 1.00 29.20  ? 228  LYS C CE    1 
ATOM   8608  N  NZ    . LYS C 3  228 ? 116.220 156.649 117.936 1.00 29.20  ? 228  LYS C NZ    1 
ATOM   8609  N  N     . TYR C 3  229 ? 109.365 156.763 121.073 1.00 30.59  ? 229  TYR C N     1 
ATOM   8610  C  CA    . TYR C 3  229 ? 108.328 155.825 120.671 1.00 30.59  ? 229  TYR C CA    1 
ATOM   8611  C  C     . TYR C 3  229 ? 106.937 156.180 121.169 1.00 30.59  ? 229  TYR C C     1 
ATOM   8612  O  O     . TYR C 3  229 ? 105.974 155.514 120.770 1.00 30.59  ? 229  TYR C O     1 
ATOM   8613  C  CB    . TYR C 3  229 ? 108.699 154.414 121.146 1.00 30.59  ? 229  TYR C CB    1 
ATOM   8614  C  CG    . TYR C 3  229 ? 109.850 153.821 120.375 1.00 30.59  ? 229  TYR C CG    1 
ATOM   8615  C  CD1   . TYR C 3  229 ? 110.135 154.249 119.086 1.00 30.59  ? 229  TYR C CD1   1 
ATOM   8616  C  CD2   . TYR C 3  229 ? 110.685 152.876 120.950 1.00 30.59  ? 229  TYR C CD2   1 
ATOM   8617  C  CE1   . TYR C 3  229 ? 111.192 153.725 118.377 1.00 30.59  ? 229  TYR C CE1   1 
ATOM   8618  C  CE2   . TYR C 3  229 ? 111.753 152.349 120.248 1.00 30.59  ? 229  TYR C CE2   1 
ATOM   8619  C  CZ    . TYR C 3  229 ? 112.002 152.784 118.965 1.00 30.59  ? 229  TYR C CZ    1 
ATOM   8620  O  OH    . TYR C 3  229 ? 113.055 152.268 118.253 1.00 30.59  ? 229  TYR C OH    1 
ATOM   8621  N  N     . ASP C 3  230 ? 106.810 157.162 122.063 1.00 33.93  ? 230  ASP C N     1 
ATOM   8622  C  CA    . ASP C 3  230 ? 105.581 157.858 122.454 1.00 33.93  ? 230  ASP C CA    1 
ATOM   8623  C  C     . ASP C 3  230 ? 104.582 156.993 123.216 1.00 33.93  ? 230  ASP C C     1 
ATOM   8624  O  O     . ASP C 3  230 ? 103.546 157.512 123.640 1.00 33.93  ? 230  ASP C O     1 
ATOM   8625  C  CB    . ASP C 3  230 ? 104.851 158.479 121.253 1.00 33.93  ? 230  ASP C CB    1 
ATOM   8626  C  CG    . ASP C 3  230 ? 105.670 159.544 120.566 1.00 33.93  ? 230  ASP C CG    1 
ATOM   8627  O  OD1   . ASP C 3  230 ? 106.509 160.168 121.239 1.00 33.93  ? 230  ASP C OD1   1 
ATOM   8628  O  OD2   . ASP C 3  230 ? 105.482 159.756 119.352 1.00 33.93  ? 230  ASP C OD2   1 
ATOM   8629  N  N     . HIS C 3  231 ? 104.852 155.707 123.413 1.00 27.66  ? 231  HIS C N     1 
ATOM   8630  C  CA    . HIS C 3  231 ? 103.912 154.839 124.106 1.00 27.66  ? 231  HIS C CA    1 
ATOM   8631  C  C     . HIS C 3  231 ? 104.598 153.970 125.146 1.00 27.66  ? 231  HIS C C     1 
ATOM   8632  O  O     . HIS C 3  231 ? 103.994 153.005 125.619 1.00 27.66  ? 231  HIS C O     1 
ATOM   8633  C  CB    . HIS C 3  231 ? 103.168 153.947 123.114 1.00 27.66  ? 231  HIS C CB    1 
ATOM   8634  C  CG    . HIS C 3  231 ? 104.059 153.002 122.374 1.00 27.66  ? 231  HIS C CG    1 
ATOM   8635  N  ND1   . HIS C 3  231 ? 104.772 153.375 121.256 1.00 27.66  ? 231  HIS C ND1   1 
ATOM   8636  C  CD2   . HIS C 3  231 ? 104.365 151.704 122.600 1.00 27.66  ? 231  HIS C CD2   1 
ATOM   8637  C  CE1   . HIS C 3  231 ? 105.473 152.345 120.821 1.00 27.66  ? 231  HIS C CE1   1 
ATOM   8638  N  NE2   . HIS C 3  231 ? 105.246 151.320 121.620 1.00 27.66  ? 231  HIS C NE2   1 
ATOM   8639  N  N     . VAL C 3  232 ? 105.845 154.253 125.493 1.00 22.93  ? 232  VAL C N     1 
ATOM   8640  C  CA    . VAL C 3  232 ? 106.559 153.462 126.480 1.00 22.93  ? 232  VAL C CA    1 
ATOM   8641  C  C     . VAL C 3  232 ? 107.099 154.393 127.552 1.00 22.93  ? 232  VAL C C     1 
ATOM   8642  O  O     . VAL C 3  232 ? 107.335 155.582 127.315 1.00 22.93  ? 232  VAL C O     1 
ATOM   8643  C  CB    . VAL C 3  232 ? 107.700 152.635 125.849 1.00 22.93  ? 232  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C 3  232 ? 107.149 151.631 124.864 1.00 22.93  ? 232  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C 3  232 ? 108.664 153.532 125.147 1.00 22.93  ? 232  VAL C CG2   1 
ATOM   8646  N  N     . LYS C 3  233 ? 107.259 153.850 128.751 1.00 21.26  ? 233  LYS C N     1 
ATOM   8647  C  CA    . LYS C 3  233 ? 108.015 154.526 129.789 1.00 21.26  ? 233  LYS C CA    1 
ATOM   8648  C  C     . LYS C 3  233 ? 108.814 153.483 130.550 1.00 21.26  ? 233  LYS C C     1 
ATOM   8649  O  O     . LYS C 3  233 ? 108.315 152.399 130.861 1.00 21.26  ? 233  LYS C O     1 
ATOM   8650  C  CB    . LYS C 3  233 ? 107.113 155.355 130.719 1.00 21.26  ? 233  LYS C CB    1 
ATOM   8651  C  CG    . LYS C 3  233 ? 106.049 154.600 131.483 1.00 21.26  ? 233  LYS C CG    1 
ATOM   8652  C  CD    . LYS C 3  233 ? 105.262 155.538 132.380 1.00 21.26  ? 233  LYS C CD    1 
ATOM   8653  C  CE    . LYS C 3  233 ? 104.330 156.418 131.570 1.00 21.26  ? 233  LYS C CE    1 
ATOM   8654  N  NZ    . LYS C 3  233 ? 103.451 157.240 132.445 1.00 21.26  ? 233  LYS C NZ    1 
ATOM   8655  N  N     . ILE C 3  234 ? 110.068 153.796 130.784 1.00 18.09  ? 234  ILE C N     1 
ATOM   8656  C  CA    . ILE C 3  234 ? 110.997 152.910 131.465 1.00 18.09  ? 234  ILE C CA    1 
ATOM   8657  C  C     . ILE C 3  234 ? 111.116 153.409 132.896 1.00 18.09  ? 234  ILE C C     1 
ATOM   8658  O  O     . ILE C 3  234 ? 110.901 154.591 133.175 1.00 18.09  ? 234  ILE C O     1 
ATOM   8659  C  CB    . ILE C 3  234 ? 112.347 152.892 130.709 1.00 18.09  ? 234  ILE C CB    1 
ATOM   8660  C  CG1   . ILE C 3  234 ? 112.109 152.488 129.258 1.00 18.09  ? 234  ILE C CG1   1 
ATOM   8661  C  CG2   . ILE C 3  234 ? 113.345 151.907 131.296 1.00 18.09  ? 234  ILE C CG2   1 
ATOM   8662  C  CD1   . ILE C 3  234 ? 113.309 152.665 128.375 1.00 18.09  ? 234  ILE C CD1   1 
ATOM   8663  N  N     . SER C 3  235 ? 111.374 152.496 133.826 1.00 13.96  ? 235  SER C N     1 
ATOM   8664  C  CA    . SER C 3  235 ? 111.606 152.855 135.217 1.00 13.96  ? 235  SER C CA    1 
ATOM   8665  C  C     . SER C 3  235 ? 112.713 151.970 135.753 1.00 13.96  ? 235  SER C C     1 
ATOM   8666  O  O     . SER C 3  235 ? 112.569 150.748 135.775 1.00 13.96  ? 235  SER C O     1 
ATOM   8667  C  CB    . SER C 3  235 ? 110.341 152.689 136.052 1.00 13.96  ? 235  SER C CB    1 
ATOM   8668  O  OG    . SER C 3  235 ? 110.604 153.052 137.389 1.00 13.96  ? 235  SER C OG    1 
ATOM   8669  N  N     . LEU C 3  236 ? 113.812 152.574 136.181 1.00 13.59  ? 236  LEU C N     1 
ATOM   8670  C  CA    . LEU C 3  236 ? 114.944 151.820 136.689 1.00 13.59  ? 236  LEU C CA    1 
ATOM   8671  C  C     . LEU C 3  236 ? 114.880 151.760 138.208 1.00 13.59  ? 236  LEU C C     1 
ATOM   8672  O  O     . LEU C 3  236 ? 114.490 152.731 138.860 1.00 13.59  ? 236  LEU C O     1 
ATOM   8673  C  CB    . LEU C 3  236 ? 116.266 152.448 136.253 1.00 13.59  ? 236  LEU C CB    1 
ATOM   8674  C  CG    . LEU C 3  236 ? 116.531 152.647 134.759 1.00 13.59  ? 236  LEU C CG    1 
ATOM   8675  C  CD1   . LEU C 3  236 ? 117.936 153.156 134.556 1.00 13.59  ? 236  LEU C CD1   1 
ATOM   8676  C  CD2   . LEU C 3  236 ? 116.288 151.399 133.946 1.00 13.59  ? 236  LEU C CD2   1 
ATOM   8677  N  N     . ILE C 3  237 ? 115.256 150.616 138.768 1.00 13.90  ? 237  ILE C N     1 
ATOM   8678  C  CA    . ILE C 3  237 ? 115.354 150.440 140.212 1.00 13.90  ? 237  ILE C CA    1 
ATOM   8679  C  C     . ILE C 3  237 ? 116.722 149.854 140.512 1.00 13.90  ? 237  ILE C C     1 
ATOM   8680  O  O     . ILE C 3  237 ? 117.049 148.762 140.036 1.00 13.90  ? 237  ILE C O     1 
ATOM   8681  C  CB    . ILE C 3  237 ? 114.239 149.542 140.771 1.00 13.90  ? 237  ILE C CB    1 
ATOM   8682  C  CG1   . ILE C 3  237 ? 112.880 150.223 140.617 1.00 13.90  ? 237  ILE C CG1   1 
ATOM   8683  C  CG2   . ILE C 3  237 ? 114.496 149.223 142.223 1.00 13.90  ? 237  ILE C CG2   1 
ATOM   8684  C  CD1   . ILE C 3  237 ? 111.714 149.327 140.890 1.00 13.90  ? 237  ILE C CD1   1 
ATOM   8685  N  N     . PHE C 3  238 ? 117.521 150.579 141.287 1.00 16.14  ? 238  PHE C N     1 
ATOM   8686  C  CA    . PHE C 3  238 ? 118.887 150.192 141.613 1.00 16.14  ? 238  PHE C CA    1 
ATOM   8687  C  C     . PHE C 3  238 ? 118.937 149.775 143.076 1.00 16.14  ? 238  PHE C C     1 
ATOM   8688  O  O     . PHE C 3  238 ? 118.725 150.599 143.969 1.00 16.14  ? 238  PHE C O     1 
ATOM   8689  C  CB    . PHE C 3  238 ? 119.855 151.339 141.341 1.00 16.14  ? 238  PHE C CB    1 
ATOM   8690  C  CG    . PHE C 3  238 ? 120.034 151.650 139.889 1.00 16.14  ? 238  PHE C CG    1 
ATOM   8691  C  CD1   . PHE C 3  238 ? 120.936 150.940 139.120 1.00 16.14  ? 238  PHE C CD1   1 
ATOM   8692  C  CD2   . PHE C 3  238 ? 119.298 152.651 139.289 1.00 16.14  ? 238  PHE C CD2   1 
ATOM   8693  C  CE1   . PHE C 3  238 ? 121.100 151.230 137.784 1.00 16.14  ? 238  PHE C CE1   1 
ATOM   8694  C  CE2   . PHE C 3  238 ? 119.461 152.940 137.952 1.00 16.14  ? 238  PHE C CE2   1 
ATOM   8695  C  CZ    . PHE C 3  238 ? 120.359 152.231 137.203 1.00 16.14  ? 238  PHE C CZ    1 
ATOM   8696  N  N     . ASN C 3  239 ? 119.224 148.499 143.319 1.00 16.94  ? 239  ASN C N     1 
ATOM   8697  C  CA    . ASN C 3  239 ? 119.371 147.976 144.677 1.00 16.94  ? 239  ASN C CA    1 
ATOM   8698  C  C     . ASN C 3  239 ? 120.813 148.167 145.146 1.00 16.94  ? 239  ASN C C     1 
ATOM   8699  O  O     . ASN C 3  239 ? 121.592 147.222 145.271 1.00 16.94  ? 239  ASN C O     1 
ATOM   8700  C  CB    . ASN C 3  239 ? 118.977 146.509 144.722 1.00 16.94  ? 239  ASN C CB    1 
ATOM   8701  C  CG    . ASN C 3  239 ? 117.516 146.285 144.469 1.00 16.94  ? 239  ASN C CG    1 
ATOM   8702  O  OD1   . ASN C 3  239 ? 117.122 145.835 143.402 1.00 16.94  ? 239  ASN C OD1   1 
ATOM   8703  N  ND2   . ASN C 3  239 ? 116.706 146.528 145.481 1.00 16.94  ? 239  ASN C ND2   1 
ATOM   8704  N  N     . ILE C 3  240 ? 121.166 149.422 145.401 1.00 25.90  ? 240  ILE C N     1 
ATOM   8705  C  CA    . ILE C 3  240 ? 122.528 149.752 145.810 1.00 25.90  ? 240  ILE C CA    1 
ATOM   8706  C  C     . ILE C 3  240 ? 122.718 149.362 147.276 1.00 25.90  ? 240  ILE C C     1 
ATOM   8707  O  O     . ILE C 3  240 ? 122.134 149.953 148.185 1.00 25.90  ? 240  ILE C O     1 
ATOM   8708  C  CB    . ILE C 3  240 ? 122.865 151.225 145.534 1.00 25.90  ? 240  ILE C CB    1 
ATOM   8709  C  CG1   . ILE C 3  240 ? 121.751 152.178 145.957 1.00 25.90  ? 240  ILE C CG1   1 
ATOM   8710  C  CG2   . ILE C 3  240 ? 123.117 151.449 144.064 1.00 25.90  ? 240  ILE C CG2   1 
ATOM   8711  C  CD1   . ILE C 3  240 ? 122.112 153.622 145.745 1.00 25.90  ? 240  ILE C CD1   1 
ATOM   8712  N  N     . ASN C 3  241 ? 123.517 148.316 147.496 1.00 37.70  ? 241  ASN C N     1 
ATOM   8713  C  CA    . ASN C 3  241 ? 123.671 147.734 148.825 1.00 37.70  ? 241  ASN C CA    1 
ATOM   8714  C  C     . ASN C 3  241 ? 124.508 148.622 149.732 1.00 37.70  ? 241  ASN C C     1 
ATOM   8715  O  O     . ASN C 3  241 ? 124.352 148.587 150.955 1.00 37.70  ? 241  ASN C O     1 
ATOM   8716  C  CB    . ASN C 3  241 ? 124.318 146.351 148.701 1.00 37.70  ? 241  ASN C CB    1 
ATOM   8717  C  CG    . ASN C 3  241 ? 124.186 145.512 149.960 1.00 37.70  ? 241  ASN C CG    1 
ATOM   8718  O  OD1   . ASN C 3  241 ? 123.513 145.889 150.916 1.00 37.70  ? 241  ASN C OD1   1 
ATOM   8719  N  ND2   . ASN C 3  241 ? 124.854 144.364 149.968 1.00 37.70  ? 241  ASN C ND2   1 
ATOM   8720  N  N     . THR C 3  242 ? 125.397 149.426 149.160 1.00 49.32  ? 242  THR C N     1 
ATOM   8721  C  CA    . THR C 3  242 ? 126.375 150.155 149.953 1.00 49.32  ? 242  THR C CA    1 
ATOM   8722  C  C     . THR C 3  242 ? 126.072 151.643 150.044 1.00 49.32  ? 242  THR C C     1 
ATOM   8723  O  O     . THR C 3  242 ? 125.920 152.190 151.140 1.00 49.32  ? 242  THR C O     1 
ATOM   8724  C  CB    . THR C 3  242 ? 127.766 149.971 149.348 1.00 49.32  ? 242  THR C CB    1 
ATOM   8725  O  OG1   . THR C 3  242 ? 127.804 150.575 148.049 1.00 49.32  ? 242  THR C OG1   1 
ATOM   8726  C  CG2   . THR C 3  242 ? 128.080 148.525 149.212 1.00 49.32  ? 242  THR C CG2   1 
ATOM   8727  N  N     . ASN C 3  243 ? 125.959 152.301 148.899 1.00 48.24  ? 243  ASN C N     1 
ATOM   8728  C  CA    . ASN C 3  243 ? 126.322 153.703 148.819 1.00 48.24  ? 243  ASN C CA    1 
ATOM   8729  C  C     . ASN C 3  243 ? 125.874 154.249 147.478 1.00 48.24  ? 243  ASN C C     1 
ATOM   8730  O  O     . ASN C 3  243 ? 125.907 153.532 146.480 1.00 48.24  ? 243  ASN C O     1 
ATOM   8731  C  CB    . ASN C 3  243 ? 127.838 153.833 148.950 1.00 48.24  ? 243  ASN C CB    1 
ATOM   8732  C  CG    . ASN C 3  243 ? 128.308 155.252 149.011 1.00 48.24  ? 243  ASN C CG    1 
ATOM   8733  O  OD1   . ASN C 3  243 ? 127.529 156.189 149.179 1.00 48.24  ? 243  ASN C OD1   1 
ATOM   8734  N  ND2   . ASN C 3  243 ? 129.596 155.428 148.804 1.00 48.24  ? 243  ASN C ND2   1 
ATOM   8735  N  N     . LEU C 3  244 ? 125.475 155.518 147.459 1.00 41.67  ? 244  LEU C N     1 
ATOM   8736  C  CA    . LEU C 3  244 ? 125.266 156.203 146.192 1.00 41.67  ? 244  LEU C CA    1 
ATOM   8737  C  C     . LEU C 3  244 ? 126.538 156.878 145.704 1.00 41.67  ? 244  LEU C C     1 
ATOM   8738  O  O     . LEU C 3  244 ? 126.747 156.997 144.491 1.00 41.67  ? 244  LEU C O     1 
ATOM   8739  C  CB    . LEU C 3  244 ? 124.134 157.227 146.323 1.00 41.67  ? 244  LEU C CB    1 
ATOM   8740  C  CG    . LEU C 3  244 ? 123.683 157.905 145.029 1.00 41.67  ? 244  LEU C CG    1 
ATOM   8741  C  CD1   . LEU C 3  244 ? 123.191 156.865 144.046 1.00 41.67  ? 244  LEU C CD1   1 
ATOM   8742  C  CD2   . LEU C 3  244 ? 122.610 158.928 145.284 1.00 41.67  ? 244  LEU C CD2   1 
ATOM   8743  N  N     . SER C 3  245 ? 127.415 157.278 146.629 1.00 49.19  ? 245  SER C N     1 
ATOM   8744  C  CA    . SER C 3  245 ? 128.648 157.963 146.256 1.00 49.19  ? 245  SER C CA    1 
ATOM   8745  C  C     . SER C 3  245 ? 129.626 157.033 145.552 1.00 49.19  ? 245  SER C C     1 
ATOM   8746  O  O     . SER C 3  245 ? 130.485 157.503 144.805 1.00 49.19  ? 245  SER C O     1 
ATOM   8747  C  CB    . SER C 3  245 ? 129.304 158.572 147.495 1.00 49.19  ? 245  SER C CB    1 
ATOM   8748  O  OG    . SER C 3  245 ? 128.467 159.547 148.092 1.00 49.19  ? 245  SER C OG    1 
ATOM   8749  N  N     . ASN C 3  246 ? 129.518 155.722 145.773 1.00 47.94  ? 246  ASN C N     1 
ATOM   8750  C  CA    . ASN C 3  246 ? 130.372 154.782 145.057 1.00 47.94  ? 246  ASN C CA    1 
ATOM   8751  C  C     . ASN C 3  246 ? 129.878 154.573 143.632 1.00 47.94  ? 246  ASN C C     1 
ATOM   8752  O  O     . ASN C 3  246 ? 130.667 154.245 142.741 1.00 47.94  ? 246  ASN C O     1 
ATOM   8753  C  CB    . ASN C 3  246 ? 130.418 153.450 145.808 1.00 47.94  ? 246  ASN C CB    1 
ATOM   8754  C  CG    . ASN C 3  246 ? 131.581 152.563 145.382 1.00 47.94  ? 246  ASN C CG    1 
ATOM   8755  O  OD1   . ASN C 3  246 ? 132.417 152.946 144.564 1.00 47.94  ? 246  ASN C OD1   1 
ATOM   8756  N  ND2   . ASN C 3  246 ? 131.637 151.363 145.949 1.00 47.94  ? 246  ASN C ND2   1 
ATOM   8757  N  N     . ILE C 3  247 ? 128.584 154.780 143.393 1.00 42.69  ? 247  ILE C N     1 
ATOM   8758  C  CA    . ILE C 3  247 ? 128.012 154.492 142.084 1.00 42.69  ? 247  ILE C CA    1 
ATOM   8759  C  C     . ILE C 3  247 ? 128.284 155.631 141.114 1.00 42.69  ? 247  ILE C C     1 
ATOM   8760  O  O     . ILE C 3  247 ? 128.588 155.402 139.939 1.00 42.69  ? 247  ILE C O     1 
ATOM   8761  C  CB    . ILE C 3  247 ? 126.507 154.211 142.225 1.00 42.69  ? 247  ILE C CB    1 
ATOM   8762  C  CG1   . ILE C 3  247 ? 126.282 153.134 143.279 1.00 42.69  ? 247  ILE C CG1   1 
ATOM   8763  C  CG2   . ILE C 3  247 ? 125.907 153.762 140.910 1.00 42.69  ? 247  ILE C CG2   1 
ATOM   8764  C  CD1   . ILE C 3  247 ? 126.941 151.819 142.989 1.00 42.69  ? 247  ILE C CD1   1 
ATOM   8765  N  N     . GLU C 3  248 ? 128.204 156.872 141.588 1.00 40.21  ? 248  GLU C N     1 
ATOM   8766  C  CA    . GLU C 3  248 ? 128.419 158.018 140.718 1.00 40.21  ? 248  GLU C CA    1 
ATOM   8767  C  C     . GLU C 3  248 ? 129.888 158.264 140.399 1.00 40.21  ? 248  GLU C C     1 
ATOM   8768  O  O     . GLU C 3  248 ? 130.182 159.082 139.524 1.00 40.21  ? 248  GLU C O     1 
ATOM   8769  C  CB    . GLU C 3  248 ? 127.792 159.270 141.335 1.00 40.21  ? 248  GLU C CB    1 
ATOM   8770  C  CG    . GLU C 3  248 ? 128.393 159.698 142.657 1.00 40.21  ? 248  GLU C CG    1 
ATOM   8771  C  CD    . GLU C 3  248 ? 127.648 160.865 143.274 1.00 40.21  ? 248  GLU C CD    1 
ATOM   8772  O  OE1   . GLU C 3  248 ? 126.647 161.315 142.675 1.00 40.21  ? 248  GLU C OE1   1 
ATOM   8773  O  OE2   . GLU C 3  248 ? 128.059 161.333 144.355 1.00 40.21  ? 248  GLU C OE2   1 
ATOM   8774  N  N     . LYS C 3  249 ? 130.816 157.589 141.075 1.00 39.47  ? 249  LYS C N     1 
ATOM   8775  C  CA    . LYS C 3  249 ? 132.202 157.601 140.630 1.00 39.47  ? 249  LYS C CA    1 
ATOM   8776  C  C     . LYS C 3  249 ? 132.477 156.539 139.576 1.00 39.47  ? 249  LYS C C     1 
ATOM   8777  O  O     . LYS C 3  249 ? 133.534 156.576 138.941 1.00 39.47  ? 249  LYS C O     1 
ATOM   8778  C  CB    . LYS C 3  249 ? 133.149 157.390 141.810 1.00 39.47  ? 249  LYS C CB    1 
ATOM   8779  C  CG    . LYS C 3  249 ? 132.959 158.375 142.938 1.00 39.47  ? 249  LYS C CG    1 
ATOM   8780  C  CD    . LYS C 3  249 ? 133.241 159.798 142.522 1.00 39.47  ? 249  LYS C CD    1 
ATOM   8781  C  CE    . LYS C 3  249 ? 133.102 160.733 143.710 1.00 39.47  ? 249  LYS C CE    1 
ATOM   8782  N  NZ    . LYS C 3  249 ? 131.684 160.848 144.153 1.00 39.47  ? 249  LYS C NZ    1 
ATOM   8783  N  N     . ASN C 3  250 ? 131.551 155.604 139.377 1.00 36.60  ? 250  ASN C N     1 
ATOM   8784  C  CA    . ASN C 3  250 ? 131.723 154.500 138.442 1.00 36.60  ? 250  ASN C CA    1 
ATOM   8785  C  C     . ASN C 3  250 ? 131.074 154.776 137.095 1.00 36.60  ? 250  ASN C C     1 
ATOM   8786  O  O     . ASN C 3  250 ? 131.659 154.472 136.051 1.00 36.60  ? 250  ASN C O     1 
ATOM   8787  C  CB    . ASN C 3  250 ? 131.138 153.222 139.039 1.00 36.60  ? 250  ASN C CB    1 
ATOM   8788  C  CG    . ASN C 3  250 ? 131.926 152.719 140.224 1.00 36.60  ? 250  ASN C CG    1 
ATOM   8789  O  OD1   . ASN C 3  250 ? 133.154 152.681 140.198 1.00 36.60  ? 250  ASN C OD1   1 
ATOM   8790  N  ND2   . ASN C 3  250 ? 131.222 152.342 141.281 1.00 36.60  ? 250  ASN C ND2   1 
ATOM   8791  N  N     . LEU C 3  251 ? 129.868 155.334 137.100 1.00 29.11  ? 251  LEU C N     1 
ATOM   8792  C  CA    . LEU C 3  251 ? 129.189 155.680 135.863 1.00 29.11  ? 251  LEU C CA    1 
ATOM   8793  C  C     . LEU C 3  251 ? 129.841 156.899 135.228 1.00 29.11  ? 251  LEU C C     1 
ATOM   8794  O  O     . LEU C 3  251 ? 130.471 157.715 135.903 1.00 29.11  ? 251  LEU C O     1 
ATOM   8795  C  CB    . LEU C 3  251 ? 127.715 155.965 136.132 1.00 29.11  ? 251  LEU C CB    1 
ATOM   8796  C  CG    . LEU C 3  251 ? 126.876 154.806 136.659 1.00 29.11  ? 251  LEU C CG    1 
ATOM   8797  C  CD1   . LEU C 3  251 ? 125.521 155.319 137.053 1.00 29.11  ? 251  LEU C CD1   1 
ATOM   8798  C  CD2   . LEU C 3  251 ? 126.738 153.723 135.616 1.00 29.11  ? 251  LEU C CD2   1 
ATOM   8799  N  N     . ARG C 3  252 ? 129.694 157.015 133.912 1.00 25.88  ? 252  ARG C N     1 
ATOM   8800  C  CA    . ARG C 3  252 ? 130.193 158.197 133.233 1.00 25.88  ? 252  ARG C CA    1 
ATOM   8801  C  C     . ARG C 3  252 ? 129.301 159.392 133.547 1.00 25.88  ? 252  ARG C C     1 
ATOM   8802  O  O     . ARG C 3  252 ? 128.143 159.248 133.946 1.00 25.88  ? 252  ARG C O     1 
ATOM   8803  C  CB    . ARG C 3  252 ? 130.283 157.967 131.724 1.00 25.88  ? 252  ARG C CB    1 
ATOM   8804  C  CG    . ARG C 3  252 ? 131.394 157.011 131.316 1.00 25.88  ? 252  ARG C CG    1 
ATOM   8805  C  CD    . ARG C 3  252 ? 131.599 156.992 129.812 1.00 25.88  ? 252  ARG C CD    1 
ATOM   8806  N  NE    . ARG C 3  252 ? 130.454 156.448 129.091 1.00 25.88  ? 252  ARG C NE    1 
ATOM   8807  C  CZ    . ARG C 3  252 ? 130.298 155.160 128.800 1.00 25.88  ? 252  ARG C CZ    1 
ATOM   8808  N  NH1   . ARG C 3  252 ? 131.213 154.278 129.172 1.00 25.88  ? 252  ARG C NH1   1 
ATOM   8809  N  NH2   . ARG C 3  252 ? 129.226 154.752 128.140 1.00 25.88  ? 252  ARG C NH2   1 
ATOM   8810  N  N     . GLN C 3  253 ? 129.865 160.587 133.364 1.00 28.30  ? 253  GLN C N     1 
ATOM   8811  C  CA    . GLN C 3  253 ? 129.230 161.810 133.843 1.00 28.30  ? 253  GLN C CA    1 
ATOM   8812  C  C     . GLN C 3  253 ? 127.975 162.155 133.052 1.00 28.30  ? 253  GLN C C     1 
ATOM   8813  O  O     . GLN C 3  253 ? 127.022 162.702 133.615 1.00 28.30  ? 253  GLN C O     1 
ATOM   8814  C  CB    . GLN C 3  253 ? 130.241 162.956 133.794 1.00 28.30  ? 253  GLN C CB    1 
ATOM   8815  C  CG    . GLN C 3  253 ? 129.770 164.258 134.408 1.00 28.30  ? 253  GLN C CG    1 
ATOM   8816  C  CD    . GLN C 3  253 ? 129.448 164.121 135.875 1.00 28.30  ? 253  GLN C CD    1 
ATOM   8817  O  OE1   . GLN C 3  253 ? 128.283 164.111 136.267 1.00 28.30  ? 253  GLN C OE1   1 
ATOM   8818  N  NE2   . GLN C 3  253 ? 130.481 164.005 136.699 1.00 28.30  ? 253  GLN C NE2   1 
ATOM   8819  N  N     . SER C 3  254 ? 127.935 161.814 131.765 1.00 23.97  ? 254  SER C N     1 
ATOM   8820  C  CA    . SER C 3  254 ? 126.759 162.087 130.950 1.00 23.97  ? 254  SER C CA    1 
ATOM   8821  C  C     . SER C 3  254 ? 125.598 161.145 131.239 1.00 23.97  ? 254  SER C C     1 
ATOM   8822  O  O     . SER C 3  254 ? 124.483 161.414 130.786 1.00 23.97  ? 254  SER C O     1 
ATOM   8823  C  CB    . SER C 3  254 ? 127.123 162.009 129.470 1.00 23.97  ? 254  SER C CB    1 
ATOM   8824  O  OG    . SER C 3  254 ? 127.501 160.694 129.111 1.00 23.97  ? 254  SER C OG    1 
ATOM   8825  N  N     . THR C 3  255 ? 125.832 160.053 131.963 1.00 24.33  ? 255  THR C N     1 
ATOM   8826  C  CA    . THR C 3  255 ? 124.773 159.139 132.367 1.00 24.33  ? 255  THR C CA    1 
ATOM   8827  C  C     . THR C 3  255 ? 124.092 159.615 133.642 1.00 24.33  ? 255  THR C C     1 
ATOM   8828  O  O     . THR C 3  255 ? 122.872 159.483 133.789 1.00 24.33  ? 255  THR C O     1 
ATOM   8829  C  CB    . THR C 3  255 ? 125.354 157.737 132.564 1.00 24.33  ? 255  THR C CB    1 
ATOM   8830  O  OG1   . THR C 3  255 ? 126.044 157.345 131.373 1.00 24.33  ? 255  THR C OG1   1 
ATOM   8831  C  CG2   . THR C 3  255 ? 124.262 156.716 132.838 1.00 24.33  ? 255  THR C CG2   1 
ATOM   8832  N  N     . ILE C 3  256 ? 124.875 160.186 134.556 1.00 25.76  ? 256  ILE C N     1 
ATOM   8833  C  CA    . ILE C 3  256 ? 124.351 160.751 135.793 1.00 25.76  ? 256  ILE C CA    1 
ATOM   8834  C  C     . ILE C 3  256 ? 123.456 161.947 135.506 1.00 25.76  ? 256  ILE C C     1 
ATOM   8835  O  O     . ILE C 3  256 ? 122.438 162.147 136.177 1.00 25.76  ? 256  ILE C O     1 
ATOM   8836  C  CB    . ILE C 3  256 ? 125.541 161.106 136.700 1.00 25.76  ? 256  ILE C CB    1 
ATOM   8837  C  CG1   . ILE C 3  256 ? 126.319 159.840 137.037 1.00 25.76  ? 256  ILE C CG1   1 
ATOM   8838  C  CG2   . ILE C 3  256 ? 125.104 161.801 137.963 1.00 25.76  ? 256  ILE C CG2   1 
ATOM   8839  C  CD1   . ILE C 3  256 ? 127.639 160.116 137.676 1.00 25.76  ? 256  ILE C CD1   1 
ATOM   8840  N  N     . ARG C 3  257 ? 123.788 162.731 134.479 1.00 28.03  ? 257  ARG C N     1 
ATOM   8841  C  CA    . ARG C 3  257 ? 122.906 163.806 134.047 1.00 28.03  ? 257  ARG C CA    1 
ATOM   8842  C  C     . ARG C 3  257 ? 121.610 163.285 133.441 1.00 28.03  ? 257  ARG C C     1 
ATOM   8843  O  O     . ARG C 3  257 ? 120.618 164.016 133.418 1.00 28.03  ? 257  ARG C O     1 
ATOM   8844  C  CB    . ARG C 3  257 ? 123.623 164.711 133.046 1.00 28.03  ? 257  ARG C CB    1 
ATOM   8845  C  CG    . ARG C 3  257 ? 124.749 165.515 133.656 1.00 28.03  ? 257  ARG C CG    1 
ATOM   8846  C  CD    . ARG C 3  257 ? 125.159 166.662 132.755 1.00 28.03  ? 257  ARG C CD    1 
ATOM   8847  N  NE    . ARG C 3  257 ? 125.742 166.221 131.495 1.00 28.03  ? 257  ARG C NE    1 
ATOM   8848  C  CZ    . ARG C 3  257 ? 127.039 166.017 131.312 1.00 28.03  ? 257  ARG C CZ    1 
ATOM   8849  N  NH1   . ARG C 3  257 ? 127.885 166.213 132.310 1.00 28.03  ? 257  ARG C NH1   1 
ATOM   8850  N  NH2   . ARG C 3  257 ? 127.488 165.616 130.133 1.00 28.03  ? 257  ARG C NH2   1 
ATOM   8851  N  N     . LEU C 3  258 ? 121.599 162.047 132.949 1.00 27.62  ? 258  LEU C N     1 
ATOM   8852  C  CA    . LEU C 3  258 ? 120.363 161.420 132.500 1.00 27.62  ? 258  LEU C CA    1 
ATOM   8853  C  C     . LEU C 3  258 ? 119.561 160.860 133.667 1.00 27.62  ? 258  LEU C C     1 
ATOM   8854  O  O     . LEU C 3  258 ? 118.327 160.901 133.641 1.00 27.62  ? 258  LEU C O     1 
ATOM   8855  C  CB    . LEU C 3  258 ? 120.682 160.311 131.498 1.00 27.62  ? 258  LEU C CB    1 
ATOM   8856  C  CG    . LEU C 3  258 ? 119.530 159.542 130.857 1.00 27.62  ? 258  LEU C CG    1 
ATOM   8857  C  CD1   . LEU C 3  258 ? 118.718 160.437 129.941 1.00 27.62  ? 258  LEU C CD1   1 
ATOM   8858  C  CD2   . LEU C 3  258 ? 120.058 158.328 130.123 1.00 27.62  ? 258  LEU C CD2   1 
ATOM   8859  N  N     . LEU C 3  259 ? 120.240 160.355 134.698 1.00 26.43  ? 259  LEU C N     1 
ATOM   8860  C  CA    . LEU C 3  259 ? 119.605 159.768 135.874 1.00 26.43  ? 259  LEU C CA    1 
ATOM   8861  C  C     . LEU C 3  259 ? 119.056 160.799 136.851 1.00 26.43  ? 259  LEU C C     1 
ATOM   8862  O  O     . LEU C 3  259 ? 118.509 160.405 137.883 1.00 26.43  ? 259  LEU C O     1 
ATOM   8863  C  CB    . LEU C 3  259 ? 120.601 158.883 136.630 1.00 26.43  ? 259  LEU C CB    1 
ATOM   8864  C  CG    . LEU C 3  259 ? 121.177 157.605 136.026 1.00 26.43  ? 259  LEU C CG    1 
ATOM   8865  C  CD1   . LEU C 3  259 ? 122.283 157.097 136.911 1.00 26.43  ? 259  LEU C CD1   1 
ATOM   8866  C  CD2   . LEU C 3  259 ? 120.134 156.551 135.924 1.00 26.43  ? 259  LEU C CD2   1 
ATOM   8867  N  N     . LYS C 3  260 ? 119.195 162.094 136.574 1.00 34.05  ? 260  LYS C N     1 
ATOM   8868  C  CA    . LYS C 3  260 ? 118.893 163.126 137.554 1.00 34.05  ? 260  LYS C CA    1 
ATOM   8869  C  C     . LYS C 3  260 ? 117.670 163.949 137.163 1.00 34.05  ? 260  LYS C C     1 
ATOM   8870  O  O     . LYS C 3  260 ? 117.296 164.872 137.894 1.00 34.05  ? 260  LYS C O     1 
ATOM   8871  C  CB    . LYS C 3  260 ? 120.125 164.029 137.742 1.00 34.05  ? 260  LYS C CB    1 
ATOM   8872  C  CG    . LYS C 3  260 ? 120.208 164.782 139.074 1.00 34.05  ? 260  LYS C CG    1 
ATOM   8873  C  CD    . LYS C 3  260 ? 121.474 165.603 139.214 1.00 34.05  ? 260  LYS C CD    1 
ATOM   8874  C  CE    . LYS C 3  260 ? 121.376 166.904 138.453 1.00 34.05  ? 260  LYS C CE    1 
ATOM   8875  N  NZ    . LYS C 3  260 ? 122.545 167.780 138.717 1.00 34.05  ? 260  LYS C NZ    1 
ATOM   8876  N  N     . ARG C 3  261 ? 117.026 163.633 136.035 1.00 36.28  ? 261  ARG C N     1 
ATOM   8877  C  CA    . ARG C 3  261 ? 115.793 164.328 135.673 1.00 36.28  ? 261  ARG C CA    1 
ATOM   8878  C  C     . ARG C 3  261 ? 114.681 164.028 136.668 1.00 36.28  ? 261  ARG C C     1 
ATOM   8879  O  O     . ARG C 3  261 ? 113.939 164.932 137.067 1.00 36.28  ? 261  ARG C O     1 
ATOM   8880  C  CB    . ARG C 3  261 ? 115.354 163.959 134.258 1.00 36.28  ? 261  ARG C CB    1 
ATOM   8881  C  CG    . ARG C 3  261 ? 116.010 164.754 133.139 1.00 36.28  ? 261  ARG C CG    1 
ATOM   8882  C  CD    . ARG C 3  261 ? 117.382 164.233 132.780 1.00 36.28  ? 261  ARG C CD    1 
ATOM   8883  N  NE    . ARG C 3  261 ? 117.961 164.976 131.668 1.00 36.28  ? 261  ARG C NE    1 
ATOM   8884  C  CZ    . ARG C 3  261 ? 117.756 164.683 130.389 1.00 36.28  ? 261  ARG C CZ    1 
ATOM   8885  N  NH1   . ARG C 3  261 ? 116.981 163.661 130.056 1.00 36.28  ? 261  ARG C NH1   1 
ATOM   8886  N  NH2   . ARG C 3  261 ? 118.324 165.414 129.443 1.00 36.28  ? 261  ARG C NH2   1 
ATOM   8887  N  N     . ASN C 3  262 ? 114.555 162.770 137.082 1.00 32.02  ? 262  ASN C N     1 
ATOM   8888  C  CA    . ASN C 3  262 ? 113.798 162.424 138.282 1.00 32.02  ? 262  ASN C CA    1 
ATOM   8889  C  C     . ASN C 3  262 ? 114.401 161.168 138.896 1.00 32.02  ? 262  ASN C C     1 
ATOM   8890  O  O     . ASN C 3  262 ? 114.343 160.085 138.311 1.00 32.02  ? 262  ASN C O     1 
ATOM   8891  C  CB    . ASN C 3  262 ? 112.302 162.256 137.998 1.00 32.02  ? 262  ASN C CB    1 
ATOM   8892  C  CG    . ASN C 3  262 ? 112.023 161.434 136.771 1.00 32.02  ? 262  ASN C CG    1 
ATOM   8893  O  OD1   . ASN C 3  262 ? 112.933 161.037 136.057 1.00 32.02  ? 262  ASN C OD1   1 
ATOM   8894  N  ND2   . ASN C 3  262 ? 110.751 161.151 136.531 1.00 32.02  ? 262  ASN C ND2   1 
ATOM   8895  N  N     . TYR C 3  263 ? 114.996 161.321 140.070 1.00 29.55  ? 263  TYR C N     1 
ATOM   8896  C  CA    . TYR C 3  263 ? 115.468 160.193 140.848 1.00 29.55  ? 263  TYR C CA    1 
ATOM   8897  C  C     . TYR C 3  263 ? 114.874 160.308 142.241 1.00 29.55  ? 263  TYR C C     1 
ATOM   8898  O  O     . TYR C 3  263 ? 114.430 161.378 142.659 1.00 29.55  ? 263  TYR C O     1 
ATOM   8899  C  CB    . TYR C 3  263 ? 117.001 160.133 140.910 1.00 29.55  ? 263  TYR C CB    1 
ATOM   8900  C  CG    . TYR C 3  263 ? 117.647 161.220 141.734 1.00 29.55  ? 263  TYR C CG    1 
ATOM   8901  C  CD1   . TYR C 3  263 ? 117.863 162.482 141.203 1.00 29.55  ? 263  TYR C CD1   1 
ATOM   8902  C  CD2   . TYR C 3  263 ? 118.088 160.967 143.028 1.00 29.55  ? 263  TYR C CD2   1 
ATOM   8903  C  CE1   . TYR C 3  263 ? 118.460 163.473 141.950 1.00 29.55  ? 263  TYR C CE1   1 
ATOM   8904  C  CE2   . TYR C 3  263 ? 118.688 161.951 143.779 1.00 29.55  ? 263  TYR C CE2   1 
ATOM   8905  C  CZ    . TYR C 3  263 ? 118.874 163.200 143.234 1.00 29.55  ? 263  TYR C CZ    1 
ATOM   8906  O  OH    . TYR C 3  263 ? 119.475 164.186 143.980 1.00 29.55  ? 263  TYR C OH    1 
ATOM   8907  N  N     . HIS C 3  264 ? 114.853 159.190 142.957 1.00 27.54  ? 264  HIS C N     1 
ATOM   8908  C  CA    . HIS C 3  264 ? 114.340 159.175 144.319 1.00 27.54  ? 264  HIS C CA    1 
ATOM   8909  C  C     . HIS C 3  264 ? 115.185 158.229 145.149 1.00 27.54  ? 264  HIS C C     1 
ATOM   8910  O  O     . HIS C 3  264 ? 115.285 157.042 144.829 1.00 27.54  ? 264  HIS C O     1 
ATOM   8911  C  CB    . HIS C 3  264 ? 112.872 158.756 144.355 1.00 27.54  ? 264  HIS C CB    1 
ATOM   8912  C  CG    . HIS C 3  264 ? 111.943 159.742 143.722 1.00 27.54  ? 264  HIS C CG    1 
ATOM   8913  N  ND1   . HIS C 3  264 ? 111.674 159.746 142.371 1.00 27.54  ? 264  HIS C ND1   1 
ATOM   8914  C  CD2   . HIS C 3  264 ? 111.209 160.747 144.254 1.00 27.54  ? 264  HIS C CD2   1 
ATOM   8915  C  CE1   . HIS C 3  264 ? 110.824 160.717 142.096 1.00 27.54  ? 264  HIS C CE1   1 
ATOM   8916  N  NE2   . HIS C 3  264 ? 110.523 161.338 143.222 1.00 27.54  ? 264  HIS C NE2   1 
ATOM   8917  N  N     . LYS C 3  265 ? 115.792 158.753 146.206 1.00 35.13  ? 265  LYS C N     1 
ATOM   8918  C  CA    . LYS C 3  265 ? 116.569 157.941 147.129 1.00 35.13  ? 265  LYS C CA    1 
ATOM   8919  C  C     . LYS C 3  265 ? 115.642 157.422 148.217 1.00 35.13  ? 265  LYS C C     1 
ATOM   8920  O  O     . LYS C 3  265 ? 115.030 158.210 148.945 1.00 35.13  ? 265  LYS C O     1 
ATOM   8921  C  CB    . LYS C 3  265 ? 117.709 158.751 147.738 1.00 35.13  ? 265  LYS C CB    1 
ATOM   8922  C  CG    . LYS C 3  265 ? 118.798 159.129 146.762 1.00 35.13  ? 265  LYS C CG    1 
ATOM   8923  C  CD    . LYS C 3  265 ? 119.811 160.036 147.430 1.00 35.13  ? 265  LYS C CD    1 
ATOM   8924  C  CE    . LYS C 3  265 ? 120.630 159.266 148.451 1.00 35.13  ? 265  LYS C CE    1 
ATOM   8925  N  NZ    . LYS C 3  265 ? 121.722 160.077 149.053 1.00 35.13  ? 265  LYS C NZ    1 
ATOM   8926  N  N     . LEU C 3  266 ? 115.527 156.103 148.316 1.00 31.59  ? 266  LEU C N     1 
ATOM   8927  C  CA    . LEU C 3  266 ? 114.721 155.458 149.345 1.00 31.59  ? 266  LEU C CA    1 
ATOM   8928  C  C     . LEU C 3  266 ? 115.648 154.598 150.187 1.00 31.59  ? 266  LEU C C     1 
ATOM   8929  O  O     . LEU C 3  266 ? 116.199 153.610 149.694 1.00 31.59  ? 266  LEU C O     1 
ATOM   8930  C  CB    . LEU C 3  266 ? 113.602 154.621 148.733 1.00 30.00  ? 266  LEU C CB    1 
ATOM   8931  C  CG    . LEU C 3  266 ? 112.691 153.945 149.754 1.00 30.00  ? 266  LEU C CG    1 
ATOM   8932  C  CD1   . LEU C 3  266 ? 112.000 154.992 150.593 1.00 30.00  ? 266  LEU C CD1   1 
ATOM   8933  C  CD2   . LEU C 3  266 ? 111.672 153.056 149.073 1.00 30.00  ? 266  LEU C CD2   1 
ATOM   8934  N  N     . ASP C 3  267 ? 115.828 154.979 151.446 1.00 41.23  ? 267  ASP C N     1 
ATOM   8935  C  CA    . ASP C 3  267 ? 116.659 154.194 152.345 1.00 41.23  ? 267  ASP C CA    1 
ATOM   8936  C  C     . ASP C 3  267 ? 115.897 152.937 152.741 1.00 41.23  ? 267  ASP C C     1 
ATOM   8937  O  O     . ASP C 3  267 ? 114.819 153.019 153.336 1.00 41.23  ? 267  ASP C O     1 
ATOM   8938  C  CB    . ASP C 3  267 ? 117.037 155.016 153.573 1.00 41.23  ? 267  ASP C CB    1 
ATOM   8939  C  CG    . ASP C 3  267 ? 118.140 154.373 154.385 1.00 41.23  ? 267  ASP C CG    1 
ATOM   8940  O  OD1   . ASP C 3  267 ? 119.309 154.445 153.955 1.00 41.23  ? 267  ASP C OD1   1 
ATOM   8941  O  OD2   . ASP C 3  267 ? 117.844 153.793 155.448 1.00 41.23  ? 267  ASP C OD2   1 
ATOM   8942  N  N     . VAL C 3  268 ? 116.431 151.780 152.371 1.00 40.00  ? 268  VAL C N     1 
ATOM   8943  C  CA    . VAL C 3  268 ? 115.789 150.493 152.606 1.00 40.00  ? 268  VAL C CA    1 
ATOM   8944  C  C     . VAL C 3  268 ? 116.749 149.662 153.436 1.00 40.00  ? 268  VAL C C     1 
ATOM   8945  O  O     . VAL C 3  268 ? 117.757 149.169 152.919 1.00 40.00  ? 268  VAL C O     1 
ATOM   8946  C  CB    . VAL C 3  268 ? 115.435 149.776 151.297 1.00 40.00  ? 268  VAL C CB    1 
ATOM   8947  C  CG1   . VAL C 3  268 ? 114.895 148.383 151.576 1.00 40.00  ? 268  VAL C CG1   1 
ATOM   8948  C  CG2   . VAL C 3  268 ? 114.422 150.578 150.524 1.00 40.00  ? 268  VAL C CG2   1 
ATOM   8949  N  N     . SER C 3  269 ? 116.449 149.508 154.718 1.00 52.57  ? 269  SER C N     1 
ATOM   8950  C  CA    . SER C 3  269 ? 117.293 148.689 155.566 1.00 52.57  ? 269  SER C CA    1 
ATOM   8951  C  C     . SER C 3  269 ? 116.473 148.160 156.728 1.00 52.57  ? 269  SER C C     1 
ATOM   8952  O  O     . SER C 3  269 ? 115.474 148.761 157.133 1.00 52.57  ? 269  SER C O     1 
ATOM   8953  C  CB    . SER C 3  269 ? 118.506 149.467 156.089 1.00 52.57  ? 269  SER C CB    1 
ATOM   8954  O  OG    . SER C 3  269 ? 119.305 148.649 156.923 1.00 52.57  ? 269  SER C OG    1 
ATOM   8955  N  N     . SER C 3  270 ? 116.906 147.014 157.249 1.00 59.55  ? 270  SER C N     1 
ATOM   8956  C  CA    . SER C 3  270 ? 116.387 146.515 158.511 1.00 59.55  ? 270  SER C CA    1 
ATOM   8957  C  C     . SER C 3  270 ? 116.928 147.303 159.695 1.00 59.55  ? 270  SER C C     1 
ATOM   8958  O  O     . SER C 3  270 ? 116.355 147.238 160.788 1.00 59.55  ? 270  SER C O     1 
ATOM   8959  C  CB    . SER C 3  270 ? 116.744 145.040 158.659 1.00 59.55  ? 270  SER C CB    1 
ATOM   8960  O  OG    . SER C 3  270 ? 118.149 144.871 158.746 1.00 59.55  ? 270  SER C OG    1 
ATOM   8961  N  N     . ASN C 3  271 ? 118.008 148.051 159.492 1.00 62.03  ? 271  ASN C N     1 
ATOM   8962  C  CA    . ASN C 3  271 ? 118.707 148.747 160.557 1.00 62.03  ? 271  ASN C CA    1 
ATOM   8963  C  C     . ASN C 3  271 ? 118.356 150.232 160.608 1.00 62.03  ? 271  ASN C C     1 
ATOM   8964  O  O     . ASN C 3  271 ? 118.835 150.939 161.500 1.00 62.03  ? 271  ASN C O     1 
ATOM   8965  C  CB    . ASN C 3  271 ? 120.221 148.554 160.371 1.00 62.03  ? 271  ASN C CB    1 
ATOM   8966  C  CG    . ASN C 3  271 ? 121.008 148.706 161.664 1.00 62.03  ? 271  ASN C CG    1 
ATOM   8967  O  OD1   . ASN C 3  271 ? 120.445 148.935 162.734 1.00 62.03  ? 271  ASN C OD1   1 
ATOM   8968  N  ND2   . ASN C 3  271 ? 122.324 148.564 161.566 1.00 62.03  ? 271  ASN C ND2   1 
ATOM   8969  N  N     . LYS C 3  272 ? 117.526 150.725 159.686 1.00 58.18  ? 272  LYS C N     1 
ATOM   8970  C  CA    . LYS C 3  272 ? 117.170 152.139 159.690 1.00 58.18  ? 272  LYS C CA    1 
ATOM   8971  C  C     . LYS C 3  272 ? 116.145 152.410 160.791 1.00 58.18  ? 272  LYS C C     1 
ATOM   8972  O  O     . LYS C 3  272 ? 115.181 151.655 160.967 1.00 58.18  ? 272  LYS C O     1 
ATOM   8973  C  CB    . LYS C 3  272 ? 116.655 152.594 158.317 1.00 58.18  ? 272  LYS C CB    1 
ATOM   8974  C  CG    . LYS C 3  272 ? 115.292 152.074 157.868 1.00 58.18  ? 272  LYS C CG    1 
ATOM   8975  C  CD    . LYS C 3  272 ? 114.842 152.716 156.581 1.00 58.18  ? 272  LYS C CD    1 
ATOM   8976  C  CE    . LYS C 3  272 ? 113.424 152.299 156.231 1.00 58.18  ? 272  LYS C CE    1 
ATOM   8977  N  NZ    . LYS C 3  272 ? 112.447 152.893 157.181 1.00 58.18  ? 272  LYS C NZ    1 
ATOM   8978  N  N     . GLY C 3  273 ? 116.427 153.420 161.615 1.00 55.74  ? 273  GLY C N     1 
ATOM   8979  C  CA    . GLY C 3  273 ? 115.571 153.794 162.732 1.00 55.74  ? 273  GLY C CA    1 
ATOM   8980  C  C     . GLY C 3  273 ? 115.381 152.769 163.838 1.00 55.74  ? 273  GLY C C     1 
ATOM   8981  O  O     . GLY C 3  273 ? 114.603 153.002 164.768 1.00 55.74  ? 273  GLY C O     1 
ATOM   8982  N  N     . PHE C 3  274 ? 116.058 151.620 163.716 1.00 46.17  ? 274  PHE C N     1 
ATOM   8983  C  CA    . PHE C 3  274 ? 115.989 150.450 164.592 1.00 46.17  ? 274  PHE C CA    1 
ATOM   8984  C  C     . PHE C 3  274 ? 114.584 149.861 164.710 1.00 46.17  ? 274  PHE C C     1 
ATOM   8985  O  O     . PHE C 3  274 ? 114.345 149.034 165.587 1.00 46.17  ? 274  PHE C O     1 
ATOM   8986  C  CB    . PHE C 3  274 ? 116.535 150.760 165.989 1.00 46.17  ? 274  PHE C CB    1 
ATOM   8987  C  CG    . PHE C 3  274 ? 117.935 151.289 165.986 1.00 46.17  ? 274  PHE C CG    1 
ATOM   8988  C  CD1   . PHE C 3  274 ? 119.003 150.458 165.711 1.00 46.17  ? 274  PHE C CD1   1 
ATOM   8989  C  CD2   . PHE C 3  274 ? 118.182 152.617 166.278 1.00 46.17  ? 274  PHE C CD2   1 
ATOM   8990  C  CE1   . PHE C 3  274 ? 120.294 150.940 165.727 1.00 46.17  ? 274  PHE C CE1   1 
ATOM   8991  C  CE2   . PHE C 3  274 ? 119.468 153.105 166.289 1.00 46.17  ? 274  PHE C CE2   1 
ATOM   8992  C  CZ    . PHE C 3  274 ? 120.525 152.266 166.013 1.00 46.17  ? 274  PHE C CZ    1 
ATOM   8993  N  N     . LYS C 3  275 ? 113.653 150.215 163.818 1.00 42.04  ? 275  LYS C N     1 
ATOM   8994  C  CA    . LYS C 3  275 ? 112.239 149.972 164.080 1.00 42.04  ? 275  LYS C CA    1 
ATOM   8995  C  C     . LYS C 3  275 ? 111.833 148.516 163.915 1.00 42.04  ? 275  LYS C C     1 
ATOM   8996  O  O     . LYS C 3  275 ? 110.751 148.141 164.373 1.00 42.04  ? 275  LYS C O     1 
ATOM   8997  C  CB    . LYS C 3  275 ? 111.363 150.833 163.171 1.00 42.04  ? 275  LYS C CB    1 
ATOM   8998  C  CG    . LYS C 3  275 ? 111.320 150.382 161.726 1.00 42.04  ? 275  LYS C CG    1 
ATOM   8999  C  CD    . LYS C 3  275 ? 110.413 151.278 160.906 1.00 42.04  ? 275  LYS C CD    1 
ATOM   9000  C  CE    . LYS C 3  275 ? 108.966 151.145 161.356 1.00 42.04  ? 275  LYS C CE    1 
ATOM   9001  N  NZ    . LYS C 3  275 ? 108.404 149.790 161.113 1.00 42.04  ? 275  LYS C NZ    1 
ATOM   9002  N  N     . TYR C 3  276 ? 112.656 147.690 163.277 1.00 41.99  ? 276  TYR C N     1 
ATOM   9003  C  CA    . TYR C 3  276 ? 112.343 146.271 163.185 1.00 41.99  ? 276  TYR C CA    1 
ATOM   9004  C  C     . TYR C 3  276 ? 113.171 145.422 164.131 1.00 41.99  ? 276  TYR C C     1 
ATOM   9005  O  O     . TYR C 3  276 ? 112.729 144.338 164.518 1.00 41.99  ? 276  TYR C O     1 
ATOM   9006  C  CB    . TYR C 3  276 ? 112.537 145.767 161.755 1.00 41.99  ? 276  TYR C CB    1 
ATOM   9007  C  CG    . TYR C 3  276 ? 111.658 146.478 160.764 1.00 41.99  ? 276  TYR C CG    1 
ATOM   9008  C  CD1   . TYR C 3  276 ? 110.281 146.327 160.803 1.00 41.99  ? 276  TYR C CD1   1 
ATOM   9009  C  CD2   . TYR C 3  276 ? 112.205 147.274 159.767 1.00 41.99  ? 276  TYR C CD2   1 
ATOM   9010  C  CE1   . TYR C 3  276 ? 109.468 146.960 159.885 1.00 41.99  ? 276  TYR C CE1   1 
ATOM   9011  C  CE2   . TYR C 3  276 ? 111.402 147.917 158.846 1.00 41.99  ? 276  TYR C CE2   1 
ATOM   9012  C  CZ    . TYR C 3  276 ? 110.033 147.757 158.912 1.00 41.99  ? 276  TYR C CZ    1 
ATOM   9013  O  OH    . TYR C 3  276 ? 109.224 148.392 157.999 1.00 41.99  ? 276  TYR C OH    1 
ATOM   9014  N  N     . GLY C 3  277 ? 114.360 145.890 164.509 1.00 36.02  ? 277  GLY C N     1 
ATOM   9015  C  CA    . GLY C 3  277 ? 115.076 145.256 165.597 1.00 36.02  ? 277  GLY C CA    1 
ATOM   9016  C  C     . GLY C 3  277 ? 114.430 145.514 166.939 1.00 36.02  ? 277  GLY C C     1 
ATOM   9017  O  O     . GLY C 3  277 ? 114.548 144.695 167.855 1.00 36.02  ? 277  GLY C O     1 
ATOM   9018  N  N     . ASN C 3  278 ? 113.737 146.647 167.078 1.00 34.95  ? 278  ASN C N     1 
ATOM   9019  C  CA    . ASN C 3  278 ? 113.029 146.920 168.320 1.00 34.95  ? 278  ASN C CA    1 
ATOM   9020  C  C     . ASN C 3  278 ? 111.770 146.079 168.442 1.00 34.95  ? 278  ASN C C     1 
ATOM   9021  O  O     . ASN C 3  278 ? 111.287 145.862 169.553 1.00 34.95  ? 278  ASN C O     1 
ATOM   9022  C  CB    . ASN C 3  278 ? 112.662 148.399 168.431 1.00 34.95  ? 278  ASN C CB    1 
ATOM   9023  C  CG    . ASN C 3  278 ? 113.869 149.290 168.578 1.00 34.95  ? 278  ASN C CG    1 
ATOM   9024  O  OD1   . ASN C 3  278 ? 114.874 148.905 169.168 1.00 34.95  ? 278  ASN C OD1   1 
ATOM   9025  N  ND2   . ASN C 3  278 ? 113.769 150.503 168.056 1.00 34.95  ? 278  ASN C ND2   1 
ATOM   9026  N  N     . GLN C 3  279 ? 111.221 145.606 167.323 1.00 31.70  ? 279  GLN C N     1 
ATOM   9027  C  CA    . GLN C 3  279 ? 110.023 144.779 167.387 1.00 31.70  ? 279  GLN C CA    1 
ATOM   9028  C  C     . GLN C 3  279 ? 110.344 143.321 167.682 1.00 31.70  ? 279  GLN C C     1 
ATOM   9029  O  O     . GLN C 3  279 ? 109.561 142.653 168.362 1.00 31.70  ? 279  GLN C O     1 
ATOM   9030  C  CB    . GLN C 3  279 ? 109.233 144.879 166.084 1.00 31.70  ? 279  GLN C CB    1 
ATOM   9031  C  CG    . GLN C 3  279 ? 108.569 146.218 165.862 1.00 31.70  ? 279  GLN C CG    1 
ATOM   9032  C  CD    . GLN C 3  279 ? 107.849 146.292 164.535 1.00 31.70  ? 279  GLN C CD    1 
ATOM   9033  O  OE1   . GLN C 3  279 ? 107.874 145.346 163.749 1.00 31.70  ? 279  GLN C OE1   1 
ATOM   9034  N  NE2   . GLN C 3  279 ? 107.213 147.424 164.270 1.00 31.70  ? 279  GLN C NE2   1 
ATOM   9035  N  N     . ILE C 3  280 ? 111.469 142.810 167.178 1.00 30.16  ? 280  ILE C N     1 
ATOM   9036  C  CA    . ILE C 3  280 ? 111.836 141.423 167.444 1.00 30.16  ? 280  ILE C CA    1 
ATOM   9037  C  C     . ILE C 3  280 ? 112.313 141.271 168.883 1.00 30.16  ? 280  ILE C C     1 
ATOM   9038  O  O     . ILE C 3  280 ? 112.008 140.277 169.553 1.00 30.16  ? 280  ILE C O     1 
ATOM   9039  C  CB    . ILE C 3  280 ? 112.898 140.950 166.435 1.00 30.16  ? 280  ILE C CB    1 
ATOM   9040  C  CG1   . ILE C 3  280 ? 112.377 141.080 165.009 1.00 30.16  ? 280  ILE C CG1   1 
ATOM   9041  C  CG2   . ILE C 3  280 ? 113.248 139.495 166.654 1.00 30.16  ? 280  ILE C CG2   1 
ATOM   9042  C  CD1   . ILE C 3  280 ? 113.439 140.876 163.967 1.00 30.16  ? 280  ILE C CD1   1 
ATOM   9043  N  N     . PHE C 3  281 ? 113.037 142.267 169.393 1.00 28.66  ? 281  PHE C N     1 
ATOM   9044  C  CA    . PHE C 3  281 ? 113.509 142.202 170.771 1.00 28.66  ? 281  PHE C CA    1 
ATOM   9045  C  C     . PHE C 3  281 ? 112.374 142.422 171.763 1.00 28.66  ? 281  PHE C C     1 
ATOM   9046  O  O     . PHE C 3  281 ? 112.398 141.859 172.860 1.00 28.66  ? 281  PHE C O     1 
ATOM   9047  C  CB    . PHE C 3  281 ? 114.620 143.227 170.989 1.00 28.66  ? 281  PHE C CB    1 
ATOM   9048  C  CG    . PHE C 3  281 ? 115.307 143.107 172.316 1.00 28.66  ? 281  PHE C CG    1 
ATOM   9049  C  CD1   . PHE C 3  281 ? 116.212 142.088 172.547 1.00 28.66  ? 281  PHE C CD1   1 
ATOM   9050  C  CD2   . PHE C 3  281 ? 115.064 144.022 173.325 1.00 28.66  ? 281  PHE C CD2   1 
ATOM   9051  C  CE1   . PHE C 3  281 ? 116.852 141.977 173.760 1.00 28.66  ? 281  PHE C CE1   1 
ATOM   9052  C  CE2   . PHE C 3  281 ? 115.701 143.918 174.540 1.00 28.66  ? 281  PHE C CE2   1 
ATOM   9053  C  CZ    . PHE C 3  281 ? 116.597 142.893 174.758 1.00 28.66  ? 281  PHE C CZ    1 
ATOM   9054  N  N     . GLN C 3  282 ? 111.375 143.231 171.400 1.00 29.19  ? 282  GLN C N     1 
ATOM   9055  C  CA    . GLN C 3  282 ? 110.183 143.363 172.233 1.00 29.19  ? 282  GLN C CA    1 
ATOM   9056  C  C     . GLN C 3  282 ? 109.328 142.107 172.175 1.00 29.19  ? 282  GLN C C     1 
ATOM   9057  O  O     . GLN C 3  282 ? 108.719 141.724 173.180 1.00 29.19  ? 282  GLN C O     1 
ATOM   9058  C  CB    . GLN C 3  282 ? 109.368 144.579 171.795 1.00 29.19  ? 282  GLN C CB    1 
ATOM   9059  C  CG    . GLN C 3  282 ? 108.128 144.855 172.609 1.00 29.19  ? 282  GLN C CG    1 
ATOM   9060  C  CD    . GLN C 3  282 ? 108.451 145.204 174.038 1.00 29.19  ? 282  GLN C CD    1 
ATOM   9061  O  OE1   . GLN C 3  282 ? 109.393 145.945 174.309 1.00 29.19  ? 282  GLN C OE1   1 
ATOM   9062  N  NE2   . GLN C 3  282 ? 107.674 144.664 174.966 1.00 29.19  ? 282  GLN C NE2   1 
ATOM   9063  N  N     . SER C 3  283 ? 109.275 141.457 171.011 1.00 27.88  ? 283  SER C N     1 
ATOM   9064  C  CA    . SER C 3  283 ? 108.595 140.174 170.900 1.00 27.88  ? 283  SER C CA    1 
ATOM   9065  C  C     . SER C 3  283 ? 109.279 139.098 171.724 1.00 27.88  ? 283  SER C C     1 
ATOM   9066  O  O     . SER C 3  283 ? 108.612 138.187 172.222 1.00 27.88  ? 283  SER C O     1 
ATOM   9067  C  CB    . SER C 3  283 ? 108.529 139.740 169.442 1.00 27.88  ? 283  SER C CB    1 
ATOM   9068  O  OG    . SER C 3  283 ? 108.053 138.416 169.353 1.00 27.88  ? 283  SER C OG    1 
ATOM   9069  N  N     . PHE C 3  284 ? 110.600 139.184 171.878 1.00 26.95  ? 284  PHE C N     1 
ATOM   9070  C  CA    . PHE C 3  284 ? 111.298 138.262 172.764 1.00 26.95  ? 284  PHE C CA    1 
ATOM   9071  C  C     . PHE C 3  284 ? 110.949 138.531 174.217 1.00 26.95  ? 284  PHE C C     1 
ATOM   9072  O  O     . PHE C 3  284 ? 110.691 137.593 174.978 1.00 26.95  ? 284  PHE C O     1 
ATOM   9073  C  CB    . PHE C 3  284 ? 112.803 138.367 172.558 1.00 26.95  ? 284  PHE C CB    1 
ATOM   9074  C  CG    . PHE C 3  284 ? 113.588 137.403 173.389 1.00 26.95  ? 284  PHE C CG    1 
ATOM   9075  C  CD1   . PHE C 3  284 ? 113.619 136.062 173.055 1.00 26.95  ? 284  PHE C CD1   1 
ATOM   9076  C  CD2   . PHE C 3  284 ? 114.298 137.832 174.498 1.00 26.95  ? 284  PHE C CD2   1 
ATOM   9077  C  CE1   . PHE C 3  284 ? 114.339 135.168 173.805 1.00 26.95  ? 284  PHE C CE1   1 
ATOM   9078  C  CE2   . PHE C 3  284 ? 115.019 136.935 175.258 1.00 26.95  ? 284  PHE C CE2   1 
ATOM   9079  C  CZ    . PHE C 3  284 ? 115.037 135.602 174.908 1.00 26.95  ? 284  PHE C CZ    1 
ATOM   9080  N  N     . LEU C 3  285 ? 110.918 139.805 174.617 1.00 29.97  ? 285  LEU C N     1 
ATOM   9081  C  CA    . LEU C 3  285 ? 110.640 140.145 176.007 1.00 29.97  ? 285  LEU C CA    1 
ATOM   9082  C  C     . LEU C 3  285 ? 109.193 139.890 176.394 1.00 29.97  ? 285  LEU C C     1 
ATOM   9083  O  O     . LEU C 3  285 ? 108.896 139.807 177.588 1.00 29.97  ? 285  LEU C O     1 
ATOM   9084  C  CB    . LEU C 3  285 ? 110.986 141.605 176.285 1.00 29.97  ? 285  LEU C CB    1 
ATOM   9085  C  CG    . LEU C 3  285 ? 112.460 141.985 176.219 1.00 29.97  ? 285  LEU C CG    1 
ATOM   9086  C  CD1   . LEU C 3  285 ? 112.620 143.470 176.460 1.00 29.97  ? 285  LEU C CD1   1 
ATOM   9087  C  CD2   . LEU C 3  285 ? 113.252 141.185 177.225 1.00 29.97  ? 285  LEU C CD2   1 
ATOM   9088  N  N     . ASP C 3  286 ? 108.290 139.774 175.424 1.00 33.33  ? 286  ASP C N     1 
ATOM   9089  C  CA    . ASP C 3  286 ? 106.922 139.386 175.734 1.00 33.33  ? 286  ASP C CA    1 
ATOM   9090  C  C     . ASP C 3  286 ? 106.807 137.902 176.051 1.00 33.33  ? 286  ASP C C     1 
ATOM   9091  O  O     . ASP C 3  286 ? 105.965 137.515 176.867 1.00 33.33  ? 286  ASP C O     1 
ATOM   9092  C  CB    . ASP C 3  286 ? 105.993 139.740 174.575 1.00 33.33  ? 286  ASP C CB    1 
ATOM   9093  C  CG    . ASP C 3  286 ? 105.823 141.231 174.402 1.00 33.33  ? 286  ASP C CG    1 
ATOM   9094  O  OD1   . ASP C 3  286 ? 105.984 141.967 175.398 1.00 33.33  ? 286  ASP C OD1   1 
ATOM   9095  O  OD2   . ASP C 3  286 ? 105.512 141.666 173.273 1.00 33.33  ? 286  ASP C OD2   1 
ATOM   9096  N  N     . THR C 3  287 ? 107.630 137.062 175.419 1.00 29.75  ? 287  THR C N     1 
ATOM   9097  C  CA    . THR C 3  287 ? 107.585 135.631 175.703 1.00 29.75  ? 287  THR C CA    1 
ATOM   9098  C  C     . THR C 3  287 ? 108.165 135.324 177.074 1.00 29.75  ? 287  THR C C     1 
ATOM   9099  O  O     . THR C 3  287 ? 107.639 134.476 177.802 1.00 29.75  ? 287  THR C O     1 
ATOM   9100  C  CB    . THR C 3  287 ? 108.351 134.847 174.640 1.00 29.75  ? 287  THR C CB    1 
ATOM   9101  O  OG1   . THR C 3  287 ? 109.735 135.201 174.699 1.00 29.75  ? 287  THR C OG1   1 
ATOM   9102  C  CG2   . THR C 3  287 ? 107.834 135.169 173.268 1.00 29.75  ? 287  THR C CG2   1 
ATOM   9103  N  N     . VAL C 3  288 ? 109.245 136.003 177.443 1.00 32.64  ? 288  VAL C N     1 
ATOM   9104  C  CA    . VAL C 3  288 ? 109.936 135.723 178.693 1.00 32.64  ? 288  VAL C CA    1 
ATOM   9105  C  C     . VAL C 3  288 ? 109.520 136.731 179.758 1.00 32.64  ? 288  VAL C C     1 
ATOM   9106  O  O     . VAL C 3  288 ? 110.214 136.909 180.763 1.00 32.64  ? 288  VAL C O     1 
ATOM   9107  C  CB    . VAL C 3  288 ? 111.462 135.717 178.482 1.00 32.64  ? 288  VAL C CB    1 
ATOM   9108  C  CG1   . VAL C 3  288 ? 111.849 134.620 177.515 1.00 32.64  ? 288  VAL C CG1   1 
ATOM   9109  C  CG2   . VAL C 3  288 ? 111.944 137.055 177.968 1.00 32.64  ? 288  VAL C CG2   1 
ATOM   9110  N  N     . ASP C 3  289 ? 108.379 137.385 179.554 1.00 41.91  ? 289  ASP C N     1 
ATOM   9111  C  CA    . ASP C 3  289 ? 107.854 138.309 180.552 1.00 41.91  ? 289  ASP C CA    1 
ATOM   9112  C  C     . ASP C 3  289 ? 107.322 137.529 181.746 1.00 41.91  ? 289  ASP C C     1 
ATOM   9113  O  O     . ASP C 3  289 ? 106.448 136.670 181.604 1.00 41.91  ? 289  ASP C O     1 
ATOM   9114  C  CB    . ASP C 3  289 ? 106.748 139.177 179.948 1.00 41.91  ? 289  ASP C CB    1 
ATOM   9115  C  CG    . ASP C 3  289 ? 106.365 140.367 180.831 1.00 41.91  ? 289  ASP C CG    1 
ATOM   9116  O  OD1   . ASP C 3  289 ? 106.898 140.517 181.951 1.00 41.91  ? 289  ASP C OD1   1 
ATOM   9117  O  OD2   . ASP C 3  289 ? 105.523 141.173 180.386 1.00 41.91  ? 289  ASP C OD2   1 
ATOM   9118  N  N     . GLY C 3  290 ? 107.854 137.839 182.926 1.00 38.06  ? 290  GLY C N     1 
ATOM   9119  C  CA    . GLY C 3  290 ? 107.421 137.211 184.153 1.00 38.06  ? 290  GLY C CA    1 
ATOM   9120  C  C     . GLY C 3  290 ? 107.971 135.827 184.403 1.00 38.06  ? 290  GLY C C     1 
ATOM   9121  O  O     . GLY C 3  290 ? 107.610 135.212 185.413 1.00 38.06  ? 290  GLY C O     1 
ATOM   9122  N  N     . LYS C 3  291 ? 108.819 135.306 183.519 1.00 34.42  ? 291  LYS C N     1 
ATOM   9123  C  CA    . LYS C 3  291 ? 109.356 133.963 183.700 1.00 34.42  ? 291  LYS C CA    1 
ATOM   9124  C  C     . LYS C 3  291 ? 110.846 133.821 183.429 1.00 34.42  ? 291  LYS C C     1 
ATOM   9125  O  O     . LYS C 3  291 ? 111.449 132.875 183.945 1.00 34.42  ? 291  LYS C O     1 
ATOM   9126  C  CB    . LYS C 3  291 ? 108.579 132.971 182.831 1.00 34.42  ? 291  LYS C CB    1 
ATOM   9127  C  CG    . LYS C 3  291 ? 108.495 133.346 181.373 1.00 34.42  ? 291  LYS C CG    1 
ATOM   9128  C  CD    . LYS C 3  291 ? 107.694 132.309 180.613 1.00 34.42  ? 291  LYS C CD    1 
ATOM   9129  C  CE    . LYS C 3  291 ? 106.217 132.349 180.960 1.00 34.42  ? 291  LYS C CE    1 
ATOM   9130  N  NZ    . LYS C 3  291 ? 105.558 133.594 180.486 1.00 34.42  ? 291  LYS C NZ    1 
ATOM   9131  N  N     . LEU C 3  292 ? 111.473 134.711 182.664 1.00 30.58  ? 292  LEU C N     1 
ATOM   9132  C  CA    . LEU C 3  292 ? 112.920 134.715 182.504 1.00 30.58  ? 292  LEU C CA    1 
ATOM   9133  C  C     . LEU C 3  292 ? 113.437 136.141 182.560 1.00 30.58  ? 292  LEU C C     1 
ATOM   9134  O  O     . LEU C 3  292 ? 112.758 137.083 182.150 1.00 30.58  ? 292  LEU C O     1 
ATOM   9135  C  CB    . LEU C 3  292 ? 113.374 134.066 181.192 1.00 30.58  ? 292  LEU C CB    1 
ATOM   9136  C  CG    . LEU C 3  292 ? 113.311 132.548 181.131 1.00 30.58  ? 292  LEU C CG    1 
ATOM   9137  C  CD1   . LEU C 3  292 ? 113.652 132.040 179.751 1.00 30.58  ? 292  LEU C CD1   1 
ATOM   9138  C  CD2   . LEU C 3  292 ? 114.290 132.031 182.141 1.00 30.58  ? 292  LEU C CD2   1 
ATOM   9139  N  N     . ASN C 3  293 ? 114.652 136.288 183.069 1.00 35.18  ? 293  ASN C N     1 
ATOM   9140  C  CA    . ASN C 3  293 ? 115.314 137.576 183.145 1.00 35.18  ? 293  ASN C CA    1 
ATOM   9141  C  C     . ASN C 3  293 ? 116.485 137.609 182.176 1.00 35.18  ? 293  ASN C C     1 
ATOM   9142  O  O     . ASN C 3  293 ? 116.966 136.575 181.713 1.00 35.18  ? 293  ASN C O     1 
ATOM   9143  C  CB    . ASN C 3  293 ? 115.794 137.860 184.569 1.00 35.18  ? 293  ASN C CB    1 
ATOM   9144  C  CG    . ASN C 3  293 ? 114.653 137.936 185.555 1.00 35.18  ? 293  ASN C CG    1 
ATOM   9145  O  OD1   . ASN C 3  293 ? 114.549 137.116 186.465 1.00 35.18  ? 293  ASN C OD1   1 
ATOM   9146  N  ND2   . ASN C 3  293 ? 113.780 138.916 185.372 1.00 35.18  ? 293  ASN C ND2   1 
ATOM   9147  N  N     . LEU C 3  294 ? 116.930 138.817 181.863 1.00 32.78  ? 294  LEU C N     1 
ATOM   9148  C  CA    . LEU C 3  294 ? 118.048 139.027 180.955 1.00 32.78  ? 294  LEU C CA    1 
ATOM   9149  C  C     . LEU C 3  294 ? 119.123 139.796 181.702 1.00 32.78  ? 294  LEU C C     1 
ATOM   9150  O  O     . LEU C 3  294 ? 118.904 140.944 182.101 1.00 32.78  ? 294  LEU C O     1 
ATOM   9151  C  CB    . LEU C 3  294 ? 117.615 139.787 179.699 1.00 32.78  ? 294  LEU C CB    1 
ATOM   9152  C  CG    . LEU C 3  294 ? 116.955 139.035 178.540 1.00 32.78  ? 294  LEU C CG    1 
ATOM   9153  C  CD1   . LEU C 3  294 ? 115.525 138.624 178.837 1.00 32.78  ? 294  LEU C CD1   1 
ATOM   9154  C  CD2   . LEU C 3  294 ? 117.001 139.891 177.290 1.00 32.78  ? 294  LEU C CD2   1 
ATOM   9155  N  N     . SER C 3  295 ? 120.270 139.160 181.907 1.00 35.70  ? 295  SER C N     1 
ATOM   9156  C  CA    . SER C 3  295 ? 121.390 139.849 182.522 1.00 35.70  ? 295  SER C CA    1 
ATOM   9157  C  C     . SER C 3  295 ? 121.968 140.872 181.557 1.00 35.70  ? 295  SER C C     1 
ATOM   9158  O  O     . SER C 3  295 ? 121.921 140.702 180.337 1.00 35.70  ? 295  SER C O     1 
ATOM   9159  C  CB    . SER C 3  295 ? 122.467 138.853 182.934 1.00 35.70  ? 295  SER C CB    1 
ATOM   9160  O  OG    . SER C 3  295 ? 123.588 139.518 183.484 1.00 35.70  ? 295  SER C OG    1 
ATOM   9161  N  N     . ASP C 3  296 ? 122.511 141.955 182.116 1.00 36.29  ? 296  ASP C N     1 
ATOM   9162  C  CA    . ASP C 3  296 ? 123.096 143.000 181.284 1.00 36.29  ? 296  ASP C CA    1 
ATOM   9163  C  C     . ASP C 3  296 ? 124.395 142.561 180.625 1.00 36.29  ? 296  ASP C C     1 
ATOM   9164  O  O     . ASP C 3  296 ? 124.785 143.146 179.611 1.00 36.29  ? 296  ASP C O     1 
ATOM   9165  C  CB    . ASP C 3  296 ? 123.312 144.267 182.110 1.00 36.29  ? 296  ASP C CB    1 
ATOM   9166  C  CG    . ASP C 3  296 ? 124.130 144.023 183.363 1.00 36.29  ? 296  ASP C CG    1 
ATOM   9167  O  OD1   . ASP C 3  296 ? 124.429 142.852 183.677 1.00 36.29  ? 296  ASP C OD1   1 
ATOM   9168  O  OD2   . ASP C 3  296 ? 124.481 145.011 184.039 1.00 36.29  ? 296  ASP C OD2   1 
ATOM   9169  N  N     . ARG C 3  297 ? 125.067 141.548 181.176 1.00 38.77  ? 297  ARG C N     1 
ATOM   9170  C  CA    . ARG C 3  297 ? 126.200 140.936 180.492 1.00 38.77  ? 297  ARG C CA    1 
ATOM   9171  C  C     . ARG C 3  297 ? 125.760 140.214 179.228 1.00 38.77  ? 297  ARG C C     1 
ATOM   9172  O  O     . ARG C 3  297 ? 126.534 140.108 178.272 1.00 38.77  ? 297  ARG C O     1 
ATOM   9173  C  CB    . ARG C 3  297 ? 126.909 139.965 181.433 1.00 38.77  ? 297  ARG C CB    1 
ATOM   9174  C  CG    . ARG C 3  297 ? 127.541 140.624 182.641 1.00 38.77  ? 297  ARG C CG    1 
ATOM   9175  C  CD    . ARG C 3  297 ? 128.777 141.408 182.244 1.00 38.77  ? 297  ARG C CD    1 
ATOM   9176  N  NE    . ARG C 3  297 ? 129.786 140.537 181.648 1.00 38.77  ? 297  ARG C NE    1 
ATOM   9177  C  CZ    . ARG C 3  297 ? 130.684 139.844 182.341 1.00 38.77  ? 297  ARG C CZ    1 
ATOM   9178  N  NH1   . ARG C 3  297 ? 130.710 139.919 183.666 1.00 38.77  ? 297  ARG C NH1   1 
ATOM   9179  N  NH2   . ARG C 3  297 ? 131.559 139.076 181.709 1.00 38.77  ? 297  ARG C NH2   1 
ATOM   9180  N  N     . PHE C 3  298 ? 124.526 139.712 179.210 1.00 29.04  ? 298  PHE C N     1 
ATOM   9181  C  CA    . PHE C 3  298 ? 123.969 139.110 178.008 1.00 29.04  ? 298  PHE C CA    1 
ATOM   9182  C  C     . PHE C 3  298 ? 123.494 140.162 177.018 1.00 29.04  ? 298  PHE C C     1 
ATOM   9183  O  O     . PHE C 3  298 ? 123.725 140.019 175.816 1.00 29.04  ? 298  PHE C O     1 
ATOM   9184  C  CB    . PHE C 3  298 ? 122.823 138.171 178.383 1.00 29.04  ? 298  PHE C CB    1 
ATOM   9185  C  CG    . PHE C 3  298 ? 122.056 137.648 177.208 1.00 29.04  ? 298  PHE C CG    1 
ATOM   9186  C  CD1   . PHE C 3  298 ? 122.625 136.736 176.341 1.00 29.04  ? 298  PHE C CD1   1 
ATOM   9187  C  CD2   . PHE C 3  298 ? 120.747 138.047 176.992 1.00 29.04  ? 298  PHE C CD2   1 
ATOM   9188  C  CE1   . PHE C 3  298 ? 121.914 136.253 175.264 1.00 29.04  ? 298  PHE C CE1   1 
ATOM   9189  C  CE2   . PHE C 3  298 ? 120.030 137.566 175.920 1.00 29.04  ? 298  PHE C CE2   1 
ATOM   9190  C  CZ    . PHE C 3  298 ? 120.613 136.665 175.057 1.00 29.04  ? 298  PHE C CZ    1 
ATOM   9191  N  N     . VAL C 3  299 ? 122.856 141.230 177.505 1.00 27.79  ? 299  VAL C N     1 
ATOM   9192  C  CA    . VAL C 3  299 ? 122.213 142.196 176.616 1.00 27.79  ? 299  VAL C CA    1 
ATOM   9193  C  C     . VAL C 3  299 ? 123.252 143.029 175.870 1.00 27.79  ? 299  VAL C C     1 
ATOM   9194  O  O     . VAL C 3  299 ? 123.090 143.322 174.679 1.00 27.79  ? 299  VAL C O     1 
ATOM   9195  C  CB    . VAL C 3  299 ? 121.225 143.070 177.416 1.00 27.79  ? 299  VAL C CB    1 
ATOM   9196  C  CG1   . VAL C 3  299 ? 120.612 144.152 176.553 1.00 27.79  ? 299  VAL C CG1   1 
ATOM   9197  C  CG2   . VAL C 3  299 ? 120.122 142.210 177.996 1.00 27.79  ? 299  VAL C CG2   1 
ATOM   9198  N  N     . GLU C 3  300 ? 124.358 143.383 176.529 1.00 27.43  ? 300  GLU C N     1 
ATOM   9199  C  CA    . GLU C 3  300 ? 125.394 144.125 175.820 1.00 27.43  ? 300  GLU C CA    1 
ATOM   9200  C  C     . GLU C 3  300 ? 126.216 143.235 174.901 1.00 27.43  ? 300  GLU C C     1 
ATOM   9201  O  O     . GLU C 3  300 ? 126.870 143.748 173.990 1.00 27.43  ? 300  GLU C O     1 
ATOM   9202  C  CB    . GLU C 3  300 ? 126.318 144.851 176.798 1.00 27.43  ? 300  GLU C CB    1 
ATOM   9203  C  CG    . GLU C 3  300 ? 127.247 143.969 177.599 1.00 27.43  ? 300  GLU C CG    1 
ATOM   9204  C  CD    . GLU C 3  300 ? 128.041 144.757 178.624 1.00 27.43  ? 300  GLU C CD    1 
ATOM   9205  O  OE1   . GLU C 3  300 ? 127.817 145.980 178.736 1.00 27.43  ? 300  GLU C OE1   1 
ATOM   9206  O  OE2   . GLU C 3  300 ? 128.892 144.156 179.313 1.00 27.43  ? 300  GLU C OE2   1 
ATOM   9207  N  N     . PHE C 3  301 ? 126.199 141.920 175.121 1.00 25.29  ? 301  PHE C N     1 
ATOM   9208  C  CA    . PHE C 3  301 ? 126.751 140.995 174.139 1.00 25.29  ? 301  PHE C CA    1 
ATOM   9209  C  C     . PHE C 3  301 ? 125.887 140.953 172.890 1.00 25.29  ? 301  PHE C C     1 
ATOM   9210  O  O     . PHE C 3  301 ? 126.408 140.884 171.772 1.00 25.29  ? 301  PHE C O     1 
ATOM   9211  C  CB    . PHE C 3  301 ? 126.861 139.602 174.742 1.00 25.29  ? 301  PHE C CB    1 
ATOM   9212  C  CG    . PHE C 3  301 ? 127.377 138.565 173.791 1.00 25.29  ? 301  PHE C CG    1 
ATOM   9213  C  CD1   . PHE C 3  301 ? 128.728 138.475 173.515 1.00 25.29  ? 301  PHE C CD1   1 
ATOM   9214  C  CD2   . PHE C 3  301 ? 126.511 137.663 173.190 1.00 25.29  ? 301  PHE C CD2   1 
ATOM   9215  C  CE1   . PHE C 3  301 ? 129.204 137.516 172.650 1.00 25.29  ? 301  PHE C CE1   1 
ATOM   9216  C  CE2   . PHE C 3  301 ? 126.981 136.710 172.321 1.00 25.29  ? 301  PHE C CE2   1 
ATOM   9217  C  CZ    . PHE C 3  301 ? 128.329 136.634 172.052 1.00 25.29  ? 301  PHE C CZ    1 
ATOM   9218  N  N     . ILE C 3  302 ? 124.564 140.934 173.077 1.00 23.84  ? 302  ILE C N     1 
ATOM   9219  C  CA    . ILE C 3  302 ? 123.623 141.082 171.971 1.00 23.84  ? 302  ILE C CA    1 
ATOM   9220  C  C     . ILE C 3  302 ? 123.859 142.404 171.260 1.00 23.84  ? 302  ILE C C     1 
ATOM   9221  O  O     . ILE C 3  302 ? 123.860 142.476 170.027 1.00 23.84  ? 302  ILE C O     1 
ATOM   9222  C  CB    . ILE C 3  302 ? 122.177 140.983 172.496 1.00 23.84  ? 302  ILE C CB    1 
ATOM   9223  C  CG1   . ILE C 3  302 ? 121.919 139.647 173.182 1.00 23.84  ? 302  ILE C CG1   1 
ATOM   9224  C  CG2   . ILE C 3  302 ? 121.187 141.180 171.396 1.00 23.84  ? 302  ILE C CG2   1 
ATOM   9225  C  CD1   . ILE C 3  302 ? 122.107 138.473 172.307 1.00 23.84  ? 302  ILE C CD1   1 
ATOM   9226  N  N     . LEU C 3  303 ? 124.113 143.458 172.030 1.00 26.07  ? 303  LEU C N     1 
ATOM   9227  C  CA    . LEU C 3  303 ? 124.242 144.797 171.476 1.00 26.07  ? 303  LEU C CA    1 
ATOM   9228  C  C     . LEU C 3  303 ? 125.561 144.982 170.738 1.00 26.07  ? 303  LEU C C     1 
ATOM   9229  O  O     . LEU C 3  303 ? 125.630 145.760 169.781 1.00 26.07  ? 303  LEU C O     1 
ATOM   9230  C  CB    . LEU C 3  303 ? 124.110 145.809 172.610 1.00 26.07  ? 303  LEU C CB    1 
ATOM   9231  C  CG    . LEU C 3  303 ? 124.017 147.290 172.301 1.00 26.07  ? 303  LEU C CG    1 
ATOM   9232  C  CD1   . LEU C 3  303 ? 122.725 147.569 171.571 1.00 26.07  ? 303  LEU C CD1   1 
ATOM   9233  C  CD2   . LEU C 3  303 ? 124.100 148.055 173.598 1.00 26.07  ? 303  LEU C CD2   1 
ATOM   9234  N  N     . SER C 3  304 ? 126.611 144.271 171.155 1.00 24.81  ? 304  SER C N     1 
ATOM   9235  C  CA    . SER C 3  304 ? 127.913 144.422 170.518 1.00 24.81  ? 304  SER C CA    1 
ATOM   9236  C  C     . SER C 3  304 ? 128.030 143.578 169.257 1.00 24.81  ? 304  SER C C     1 
ATOM   9237  O  O     . SER C 3  304 ? 128.582 144.039 168.254 1.00 24.81  ? 304  SER C O     1 
ATOM   9238  C  CB    . SER C 3  304 ? 129.024 144.058 171.499 1.00 24.81  ? 304  SER C CB    1 
ATOM   9239  O  OG    . SER C 3  304 ? 129.041 144.957 172.593 1.00 24.81  ? 304  SER C OG    1 
ATOM   9240  N  N     . LYS C 3  305 ? 127.522 142.343 169.286 1.00 24.06  ? 305  LYS C N     1 
ATOM   9241  C  CA    . LYS C 3  305 ? 127.626 141.472 168.120 1.00 24.06  ? 305  LYS C CA    1 
ATOM   9242  C  C     . LYS C 3  305 ? 126.681 141.878 167.004 1.00 24.06  ? 305  LYS C C     1 
ATOM   9243  O  O     . LYS C 3  305 ? 126.916 141.512 165.849 1.00 24.06  ? 305  LYS C O     1 
ATOM   9244  C  CB    . LYS C 3  305 ? 127.358 140.021 168.508 1.00 24.06  ? 305  LYS C CB    1 
ATOM   9245  C  CG    . LYS C 3  305 ? 128.381 139.456 169.458 1.00 24.06  ? 305  LYS C CG    1 
ATOM   9246  C  CD    . LYS C 3  305 ? 129.727 139.380 168.784 1.00 24.06  ? 305  LYS C CD    1 
ATOM   9247  C  CE    . LYS C 3  305 ? 130.771 138.781 169.686 1.00 24.06  ? 305  LYS C CE    1 
ATOM   9248  N  NZ    . LYS C 3  305 ? 132.103 138.761 169.034 1.00 24.06  ? 305  LYS C NZ    1 
ATOM   9249  N  N     . MET C 3  306 ? 125.624 142.618 167.318 1.00 26.88  ? 306  MET C N     1 
ATOM   9250  C  CA    . MET C 3  306 ? 124.698 143.068 166.292 1.00 26.88  ? 306  MET C CA    1 
ATOM   9251  C  C     . MET C 3  306 ? 125.222 144.309 165.582 1.00 26.88  ? 306  MET C C     1 
ATOM   9252  O  O     . MET C 3  306 ? 124.758 144.632 164.484 1.00 26.88  ? 306  MET C O     1 
ATOM   9253  C  CB    . MET C 3  306 ? 123.333 143.330 166.932 1.00 26.88  ? 306  MET C CB    1 
ATOM   9254  C  CG    . MET C 3  306 ? 122.159 143.449 165.989 1.00 26.88  ? 306  MET C CG    1 
ATOM   9255  S  SD    . MET C 3  306 ? 120.651 143.866 166.873 1.00 26.88  ? 306  MET C SD    1 
ATOM   9256  C  CE    . MET C 3  306 ? 120.976 145.588 167.245 1.00 26.88  ? 306  MET C CE    1 
ATOM   9257  N  N     . ALA C 3  307 ? 126.199 144.993 166.175 1.00 27.60  ? 307  ALA C N     1 
ATOM   9258  C  CA    . ALA C 3  307 ? 126.858 146.118 165.528 1.00 27.60  ? 307  ALA C CA    1 
ATOM   9259  C  C     . ALA C 3  307 ? 127.982 145.690 164.596 1.00 27.60  ? 307  ALA C C     1 
ATOM   9260  O  O     . ALA C 3  307 ? 128.383 146.478 163.734 1.00 27.60  ? 307  ALA C O     1 
ATOM   9261  C  CB    . ALA C 3  307 ? 127.417 147.080 166.578 1.00 27.60  ? 307  ALA C CB    1 
ATOM   9262  N  N     . ASN C 3  308 ? 128.497 144.470 164.748 1.00 28.20  ? 308  ASN C N     1 
ATOM   9263  C  CA    . ASN C 3  308 ? 129.549 143.970 163.873 1.00 28.20  ? 308  ASN C CA    1 
ATOM   9264  C  C     . ASN C 3  308 ? 129.022 143.433 162.551 1.00 28.20  ? 308  ASN C C     1 
ATOM   9265  O  O     . ASN C 3  308 ? 129.824 143.125 161.664 1.00 28.20  ? 308  ASN C O     1 
ATOM   9266  C  CB    . ASN C 3  308 ? 130.353 142.875 164.570 1.00 28.20  ? 308  ASN C CB    1 
ATOM   9267  C  CG    . ASN C 3  308 ? 131.265 143.418 165.642 1.00 28.20  ? 308  ASN C CG    1 
ATOM   9268  O  OD1   . ASN C 3  308 ? 131.881 144.468 165.471 1.00 28.20  ? 308  ASN C OD1   1 
ATOM   9269  N  ND2   . ASN C 3  308 ? 131.371 142.697 166.750 1.00 28.20  ? 308  ASN C ND2   1 
ATOM   9270  N  N     . ASN C 3  309 ? 127.709 143.302 162.404 1.00 30.26  ? 309  ASN C N     1 
ATOM   9271  C  CA    . ASN C 3  309 ? 127.072 142.841 161.173 1.00 30.26  ? 309  ASN C CA    1 
ATOM   9272  C  C     . ASN C 3  309 ? 125.928 143.811 160.916 1.00 30.26  ? 309  ASN C C     1 
ATOM   9273  O  O     . ASN C 3  309 ? 124.876 143.702 161.547 1.00 30.26  ? 309  ASN C O     1 
ATOM   9274  C  CB    . ASN C 3  309 ? 126.569 141.407 161.315 1.00 30.26  ? 309  ASN C CB    1 
ATOM   9275  C  CG    . ASN C 3  309 ? 126.094 140.810 160.005 1.00 30.26  ? 309  ASN C CG    1 
ATOM   9276  O  OD1   . ASN C 3  309 ? 126.141 141.447 158.957 1.00 30.26  ? 309  ASN C OD1   1 
ATOM   9277  N  ND2   . ASN C 3  309 ? 125.624 139.574 160.065 1.00 30.26  ? 309  ASN C ND2   1 
ATOM   9278  N  N     . THR C 3  310 ? 126.126 144.759 160.003 1.00 34.78  ? 310  THR C N     1 
ATOM   9279  C  CA    . THR C 3  310 ? 125.121 145.789 159.778 1.00 34.78  ? 310  THR C CA    1 
ATOM   9280  C  C     . THR C 3  310 ? 124.148 145.461 158.659 1.00 34.78  ? 310  THR C C     1 
ATOM   9281  O  O     . THR C 3  310 ? 123.078 146.075 158.596 1.00 34.78  ? 310  THR C O     1 
ATOM   9282  C  CB    . THR C 3  310 ? 125.786 147.135 159.469 1.00 34.78  ? 310  THR C CB    1 
ATOM   9283  O  OG1   . THR C 3  310 ? 126.620 147.004 158.311 1.00 34.78  ? 310  THR C OG1   1 
ATOM   9284  C  CG2   . THR C 3  310 ? 126.610 147.609 160.655 1.00 34.78  ? 310  THR C CG2   1 
ATOM   9285  N  N     . ASN C 3  311 ? 124.482 144.520 157.783 1.00 35.97  ? 311  ASN C N     1 
ATOM   9286  C  CA    . ASN C 3  311 ? 123.613 144.230 156.652 1.00 35.97  ? 311  ASN C CA    1 
ATOM   9287  C  C     . ASN C 3  311 ? 122.514 143.240 157.019 1.00 35.97  ? 311  ASN C C     1 
ATOM   9288  O  O     . ASN C 3  311 ? 121.355 143.438 156.644 1.00 35.97  ? 311  ASN C O     1 
ATOM   9289  C  CB    . ASN C 3  311 ? 124.443 143.696 155.483 1.00 35.97  ? 311  ASN C CB    1 
ATOM   9290  C  CG    . ASN C 3  311 ? 123.704 143.756 154.161 1.00 35.97  ? 311  ASN C CG    1 
ATOM   9291  O  OD1   . ASN C 3  311 ? 122.566 144.220 154.086 1.00 35.97  ? 311  ASN C OD1   1 
ATOM   9292  N  ND2   . ASN C 3  311 ? 124.354 143.283 153.105 1.00 35.97  ? 311  ASN C ND2   1 
ATOM   9293  N  N     . HIS C 3  312 ? 122.850 142.183 157.754 1.00 33.26  ? 312  HIS C N     1 
ATOM   9294  C  CA    . HIS C 3  312 ? 121.886 141.165 158.167 1.00 33.26  ? 312  HIS C CA    1 
ATOM   9295  C  C     . HIS C 3  312 ? 121.875 141.116 159.690 1.00 33.26  ? 312  HIS C C     1 
ATOM   9296  O  O     . HIS C 3  312 ? 122.534 140.277 160.304 1.00 33.26  ? 312  HIS C O     1 
ATOM   9297  C  CB    . HIS C 3  312 ? 122.240 139.816 157.559 1.00 33.26  ? 312  HIS C CB    1 
ATOM   9298  C  CG    . HIS C 3  312 ? 122.185 139.794 156.064 1.00 33.26  ? 312  HIS C CG    1 
ATOM   9299  N  ND1   . HIS C 3  312 ? 121.002 139.718 155.364 1.00 33.26  ? 312  HIS C ND1   1 
ATOM   9300  C  CD2   . HIS C 3  312 ? 123.168 139.851 155.136 1.00 33.26  ? 312  HIS C CD2   1 
ATOM   9301  C  CE1   . HIS C 3  312 ? 121.259 139.722 154.068 1.00 33.26  ? 312  HIS C CE1   1 
ATOM   9302  N  NE2   . HIS C 3  312 ? 122.566 139.803 153.903 1.00 33.26  ? 312  HIS C NE2   1 
ATOM   9303  N  N     . ASN C 3  313 ? 121.101 142.014 160.299 1.00 33.68  ? 313  ASN C N     1 
ATOM   9304  C  CA    . ASN C 3  313 ? 120.990 142.080 161.751 1.00 33.68  ? 313  ASN C CA    1 
ATOM   9305  C  C     . ASN C 3  313 ? 119.896 141.179 162.295 1.00 33.68  ? 313  ASN C C     1 
ATOM   9306  O  O     . ASN C 3  313 ? 120.096 140.522 163.321 1.00 33.68  ? 313  ASN C O     1 
ATOM   9307  C  CB    . ASN C 3  313 ? 120.705 143.513 162.205 1.00 33.68  ? 313  ASN C CB    1 
ATOM   9308  C  CG    . ASN C 3  313 ? 121.871 144.433 162.004 1.00 33.68  ? 313  ASN C CG    1 
ATOM   9309  O  OD1   . ASN C 3  313 ? 121.820 145.352 161.190 1.00 33.68  ? 313  ASN C OD1   1 
ATOM   9310  N  ND2   . ASN C 3  313 ? 122.928 144.214 162.767 1.00 33.68  ? 313  ASN C ND2   1 
ATOM   9311  N  N     . LEU C 3  314 ? 118.740 141.143 161.631 1.00 28.06  ? 314  LEU C N     1 
ATOM   9312  C  CA    . LEU C 3  314 ? 117.555 140.552 162.236 1.00 28.06  ? 314  LEU C CA    1 
ATOM   9313  C  C     . LEU C 3  314 ? 117.614 139.034 162.264 1.00 28.06  ? 314  LEU C C     1 
ATOM   9314  O  O     . LEU C 3  314 ? 117.060 138.419 163.181 1.00 28.06  ? 314  LEU C O     1 
ATOM   9315  C  CB    . LEU C 3  314 ? 116.299 141.005 161.497 1.00 28.06  ? 314  LEU C CB    1 
ATOM   9316  C  CG    . LEU C 3  314 ? 116.074 142.512 161.424 1.00 28.06  ? 314  LEU C CG    1 
ATOM   9317  C  CD1   . LEU C 3  314 ? 114.728 142.810 160.783 1.00 28.06  ? 314  LEU C CD1   1 
ATOM   9318  C  CD2   . LEU C 3  314 ? 116.207 143.164 162.779 1.00 28.06  ? 314  LEU C CD2   1 
ATOM   9319  N  N     . GLN C 3  315 ? 118.263 138.413 161.280 1.00 20.29  ? 315  GLN C N     1 
ATOM   9320  C  CA    . GLN C 3  315 ? 118.504 136.981 161.377 1.00 20.29  ? 315  GLN C CA    1 
ATOM   9321  C  C     . GLN C 3  315 ? 119.556 136.682 162.432 1.00 20.29  ? 315  GLN C C     1 
ATOM   9322  O  O     . GLN C 3  315 ? 119.492 135.642 163.093 1.00 20.29  ? 315  GLN C O     1 
ATOM   9323  C  CB    . GLN C 3  315 ? 118.916 136.421 160.014 1.00 20.29  ? 315  GLN C CB    1 
ATOM   9324  C  CG    . GLN C 3  315 ? 118.940 134.893 159.922 1.00 20.29  ? 315  GLN C CG    1 
ATOM   9325  C  CD    . GLN C 3  315 ? 120.287 134.289 160.289 1.00 20.29  ? 315  GLN C CD    1 
ATOM   9326  O  OE1   . GLN C 3  315 ? 121.332 134.903 160.084 1.00 20.29  ? 315  GLN C OE1   1 
ATOM   9327  N  NE2   . GLN C 3  315 ? 120.263 133.086 160.846 1.00 20.29  ? 315  GLN C NE2   1 
ATOM   9328  N  N     . LEU C 3  316 ? 120.514 137.587 162.618 1.00 20.16  ? 316  LEU C N     1 
ATOM   9329  C  CA    . LEU C 3  316 ? 121.549 137.394 163.621 1.00 20.16  ? 316  LEU C CA    1 
ATOM   9330  C  C     . LEU C 3  316 ? 121.073 137.795 165.009 1.00 20.16  ? 316  LEU C C     1 
ATOM   9331  O  O     . LEU C 3  316 ? 121.602 137.288 166.002 1.00 20.16  ? 316  LEU C O     1 
ATOM   9332  C  CB    . LEU C 3  316 ? 122.801 138.174 163.204 1.00 20.16  ? 316  LEU C CB    1 
ATOM   9333  C  CG    . LEU C 3  316 ? 124.180 137.950 163.829 1.00 20.16  ? 316  LEU C CG    1 
ATOM   9334  C  CD1   . LEU C 3  316 ? 124.421 138.755 165.091 1.00 20.16  ? 316  LEU C CD1   1 
ATOM   9335  C  CD2   . LEU C 3  316 ? 124.344 136.472 164.097 1.00 20.16  ? 316  LEU C CD2   1 
ATOM   9336  N  N     . LEU C 3  317 ? 120.086 138.686 165.097 1.00 17.94  ? 317  LEU C N     1 
ATOM   9337  C  CA    . LEU C 3  317 ? 119.448 138.968 166.377 1.00 17.94  ? 317  LEU C CA    1 
ATOM   9338  C  C     . LEU C 3  317 ? 118.599 137.787 166.826 1.00 17.94  ? 317  LEU C C     1 
ATOM   9339  O  O     . LEU C 3  317 ? 118.591 137.434 168.009 1.00 17.94  ? 317  LEU C O     1 
ATOM   9340  C  CB    . LEU C 3  317 ? 118.613 140.247 166.254 1.00 17.94  ? 317  LEU C CB    1 
ATOM   9341  C  CG    . LEU C 3  317 ? 117.958 140.997 167.420 1.00 17.94  ? 317  LEU C CG    1 
ATOM   9342  C  CD1   . LEU C 3  317 ? 116.602 140.479 167.792 1.00 17.94  ? 317  LEU C CD1   1 
ATOM   9343  C  CD2   . LEU C 3  317 ? 118.849 140.909 168.611 1.00 17.94  ? 317  LEU C CD2   1 
ATOM   9344  N  N     . THR C 3  318 ? 117.883 137.164 165.889 1.00 17.71  ? 318  THR C N     1 
ATOM   9345  C  CA    . THR C 3  318 ? 117.062 136.001 166.198 1.00 17.71  ? 318  THR C CA    1 
ATOM   9346  C  C     . THR C 3  318 ? 117.922 134.787 166.529 1.00 17.71  ? 318  THR C C     1 
ATOM   9347  O  O     . THR C 3  318 ? 117.560 133.994 167.403 1.00 17.71  ? 318  THR C O     1 
ATOM   9348  C  CB    . THR C 3  318 ? 116.137 135.715 165.014 1.00 17.71  ? 318  THR C CB    1 
ATOM   9349  O  OG1   . THR C 3  318 ? 115.386 136.895 164.714 1.00 17.71  ? 318  THR C OG1   1 
ATOM   9350  C  CG2   . THR C 3  318 ? 115.160 134.603 165.323 1.00 17.71  ? 318  THR C CG2   1 
ATOM   9351  N  N     . LYS C 3  319 ? 119.079 134.656 165.874 1.00 17.38  ? 319  LYS C N     1 
ATOM   9352  C  CA    . LYS C 3  319 ? 119.969 133.519 166.095 1.00 17.38  ? 319  LYS C CA    1 
ATOM   9353  C  C     . LYS C 3  319 ? 120.565 133.520 167.496 1.00 17.38  ? 319  LYS C C     1 
ATOM   9354  O  O     . LYS C 3  319 ? 120.755 132.453 168.089 1.00 17.38  ? 319  LYS C O     1 
ATOM   9355  C  CB    . LYS C 3  319 ? 121.084 133.540 165.052 1.00 17.38  ? 319  LYS C CB    1 
ATOM   9356  C  CG    . LYS C 3  319 ? 122.027 132.363 165.088 1.00 17.38  ? 319  LYS C CG    1 
ATOM   9357  C  CD    . LYS C 3  319 ? 123.055 132.471 163.987 1.00 17.38  ? 319  LYS C CD    1 
ATOM   9358  C  CE    . LYS C 3  319 ? 124.006 131.300 164.023 1.00 17.38  ? 319  LYS C CE    1 
ATOM   9359  N  NZ    . LYS C 3  319 ? 125.033 131.386 162.958 1.00 17.38  ? 319  LYS C NZ    1 
ATOM   9360  N  N     . MET C 3  320 ? 120.850 134.697 168.046 1.00 19.47  ? 320  MET C N     1 
ATOM   9361  C  CA    . MET C 3  320 ? 121.438 134.762 169.375 1.00 19.47  ? 320  MET C CA    1 
ATOM   9362  C  C     . MET C 3  320 ? 120.397 134.603 170.472 1.00 19.47  ? 320  MET C C     1 
ATOM   9363  O  O     . MET C 3  320 ? 120.706 134.052 171.533 1.00 19.47  ? 320  MET C O     1 
ATOM   9364  C  CB    . MET C 3  320 ? 122.174 136.082 169.559 1.00 19.47  ? 320  MET C CB    1 
ATOM   9365  C  CG    . MET C 3  320 ? 123.370 136.284 168.669 1.00 19.47  ? 320  MET C CG    1 
ATOM   9366  S  SD    . MET C 3  320 ? 124.227 137.797 169.130 1.00 19.47  ? 320  MET C SD    1 
ATOM   9367  C  CE    . MET C 3  320 ? 123.069 139.026 168.548 1.00 19.47  ? 320  MET C CE    1 
ATOM   9368  N  N     . LEU C 3  321 ? 119.176 135.089 170.247 1.00 18.84  ? 321  LEU C N     1 
ATOM   9369  C  CA    . LEU C 3  321 ? 118.119 134.912 171.235 1.00 18.84  ? 321  LEU C CA    1 
ATOM   9370  C  C     . LEU C 3  321 ? 117.622 133.477 171.268 1.00 18.84  ? 321  LEU C C     1 
ATOM   9371  O  O     . LEU C 3  321 ? 117.159 133.011 172.312 1.00 18.84  ? 321  LEU C O     1 
ATOM   9372  C  CB    . LEU C 3  321 ? 116.956 135.854 170.945 1.00 18.84  ? 321  LEU C CB    1 
ATOM   9373  C  CG    . LEU C 3  321 ? 117.206 137.351 171.081 1.00 18.84  ? 321  LEU C CG    1 
ATOM   9374  C  CD1   . LEU C 3  321 ? 115.979 138.096 170.622 1.00 18.84  ? 321  LEU C CD1   1 
ATOM   9375  C  CD2   . LEU C 3  321 ? 117.559 137.713 172.508 1.00 18.84  ? 321  LEU C CD2   1 
ATOM   9376  N  N     . ASP C 3  322 ? 117.696 132.768 170.142 1.00 17.99  ? 322  ASP C N     1 
ATOM   9377  C  CA    . ASP C 3  322 ? 117.270 131.375 170.119 1.00 17.99  ? 322  ASP C CA    1 
ATOM   9378  C  C     . ASP C 3  322 ? 118.297 130.466 170.763 1.00 17.99  ? 322  ASP C C     1 
ATOM   9379  O  O     . ASP C 3  322 ? 117.933 129.585 171.546 1.00 17.99  ? 322  ASP C O     1 
ATOM   9380  C  CB    . ASP C 3  322 ? 117.013 130.908 168.692 1.00 17.99  ? 322  ASP C CB    1 
ATOM   9381  C  CG    . ASP C 3  322 ? 115.803 131.544 168.093 1.00 17.99  ? 322  ASP C CG    1 
ATOM   9382  O  OD1   . ASP C 3  322 ? 114.923 131.956 168.873 1.00 17.99  ? 322  ASP C OD1   1 
ATOM   9383  O  OD2   . ASP C 3  322 ? 115.726 131.622 166.850 1.00 17.99  ? 322  ASP C OD2   1 
ATOM   9384  N  N     . TYR C 3  323 ? 119.578 130.660 170.445 1.00 17.38  ? 323  TYR C N     1 
ATOM   9385  C  CA    . TYR C 3  323 ? 120.605 129.768 170.965 1.00 17.38  ? 323  TYR C CA    1 
ATOM   9386  C  C     . TYR C 3  323 ? 120.811 129.966 172.457 1.00 17.38  ? 323  TYR C C     1 
ATOM   9387  O  O     . TYR C 3  323 ? 121.214 129.030 173.148 1.00 17.38  ? 323  TYR C O     1 
ATOM   9388  C  CB    . TYR C 3  323 ? 121.919 129.966 170.213 1.00 17.38  ? 323  TYR C CB    1 
ATOM   9389  C  CG    . TYR C 3  323 ? 122.966 128.939 170.566 1.00 17.38  ? 323  TYR C CG    1 
ATOM   9390  C  CD1   . TYR C 3  323 ? 122.898 127.653 170.053 1.00 17.38  ? 323  TYR C CD1   1 
ATOM   9391  C  CD2   . TYR C 3  323 ? 124.008 129.245 171.428 1.00 17.38  ? 323  TYR C CD2   1 
ATOM   9392  C  CE1   . TYR C 3  323 ? 123.842 126.707 170.376 1.00 17.38  ? 323  TYR C CE1   1 
ATOM   9393  C  CE2   . TYR C 3  323 ? 124.958 128.302 171.757 1.00 17.38  ? 323  TYR C CE2   1 
ATOM   9394  C  CZ    . TYR C 3  323 ? 124.867 127.035 171.229 1.00 17.38  ? 323  TYR C CZ    1 
ATOM   9395  O  OH    . TYR C 3  323 ? 125.805 126.085 171.547 1.00 17.38  ? 323  TYR C OH    1 
ATOM   9396  N  N     . SER C 3  324 ? 120.522 131.159 172.977 1.00 18.62  ? 324  SER C N     1 
ATOM   9397  C  CA    . SER C 3  324 ? 120.527 131.345 174.422 1.00 18.62  ? 324  SER C CA    1 
ATOM   9398  C  C     . SER C 3  324 ? 119.279 130.761 175.063 1.00 18.62  ? 324  SER C C     1 
ATOM   9399  O  O     . SER C 3  324 ? 119.321 130.342 176.223 1.00 18.62  ? 324  SER C O     1 
ATOM   9400  C  CB    . SER C 3  324 ? 120.639 132.827 174.768 1.00 18.62  ? 324  SER C CB    1 
ATOM   9401  O  OG    . SER C 3  324 ? 119.460 133.519 174.404 1.00 18.62  ? 324  SER C OG    1 
ATOM   9402  N  N     . LEU C 3  325 ? 118.168 130.730 174.331 1.00 17.49  ? 325  LEU C N     1 
ATOM   9403  C  CA    . LEU C 3  325 ? 116.956 130.100 174.838 1.00 17.49  ? 325  LEU C CA    1 
ATOM   9404  C  C     . LEU C 3  325 ? 117.046 128.586 174.710 1.00 17.49  ? 325  LEU C C     1 
ATOM   9405  O  O     . LEU C 3  325 ? 116.532 127.859 175.564 1.00 17.49  ? 325  LEU C O     1 
ATOM   9406  C  CB    . LEU C 3  325 ? 115.743 130.646 174.089 1.00 17.49  ? 325  LEU C CB    1 
ATOM   9407  C  CG    . LEU C 3  325 ? 114.320 130.528 174.628 1.00 17.49  ? 325  LEU C CG    1 
ATOM   9408  C  CD1   . LEU C 3  325 ? 113.557 131.697 174.096 1.00 17.49  ? 325  LEU C CD1   1 
ATOM   9409  C  CD2   . LEU C 3  325 ? 113.636 129.278 174.182 1.00 17.49  ? 325  LEU C CD2   1 
ATOM   9410  N  N     . MET C 3  326 ? 117.694 128.103 173.646 1.00 17.91  ? 326  MET C N     1 
ATOM   9411  C  CA    . MET C 3  326 ? 118.048 126.691 173.548 1.00 17.91  ? 326  MET C CA    1 
ATOM   9412  C  C     . MET C 3  326 ? 118.999 126.282 174.658 1.00 17.91  ? 326  MET C C     1 
ATOM   9413  O  O     . MET C 3  326 ? 118.943 125.150 175.150 1.00 17.91  ? 326  MET C O     1 
ATOM   9414  C  CB    . MET C 3  326 ? 118.699 126.407 172.198 1.00 17.91  ? 326  MET C CB    1 
ATOM   9415  C  CG    . MET C 3  326 ? 117.761 126.379 171.034 1.00 17.91  ? 326  MET C CG    1 
ATOM   9416  S  SD    . MET C 3  326 ? 118.676 126.264 169.506 1.00 17.91  ? 326  MET C SD    1 
ATOM   9417  C  CE    . MET C 3  326 ? 119.411 124.653 169.706 1.00 17.91  ? 326  MET C CE    1 
ATOM   9418  N  N     . SER C 3  327 ? 119.896 127.186 175.048 1.00 19.60  ? 327  SER C N     1 
ATOM   9419  C  CA    . SER C 3  327 ? 120.890 126.853 176.055 1.00 19.60  ? 327  SER C CA    1 
ATOM   9420  C  C     . SER C 3  327 ? 120.282 126.767 177.441 1.00 19.60  ? 327  SER C C     1 
ATOM   9421  O  O     . SER C 3  327 ? 120.754 125.981 178.260 1.00 19.60  ? 327  SER C O     1 
ATOM   9422  C  CB    . SER C 3  327 ? 122.020 127.876 176.043 1.00 19.60  ? 327  SER C CB    1 
ATOM   9423  O  OG    . SER C 3  327 ? 122.963 127.604 177.058 1.00 19.60  ? 327  SER C OG    1 
ATOM   9424  N  N     . TYR C 3  328 ? 119.237 127.548 177.714 1.00 24.73  ? 328  TYR C N     1 
ATOM   9425  C  CA    . TYR C 3  328 ? 118.666 127.586 179.056 1.00 24.73  ? 328  TYR C CA    1 
ATOM   9426  C  C     . TYR C 3  328 ? 117.921 126.299 179.378 1.00 24.73  ? 328  TYR C C     1 
ATOM   9427  O  O     . TYR C 3  328 ? 118.181 125.660 180.403 1.00 24.73  ? 328  TYR C O     1 
ATOM   9428  C  CB    . TYR C 3  328 ? 117.730 128.785 179.197 1.00 24.73  ? 328  TYR C CB    1 
ATOM   9429  C  CG    . TYR C 3  328 ? 117.126 128.907 180.573 1.00 24.73  ? 328  TYR C CG    1 
ATOM   9430  C  CD1   . TYR C 3  328 ? 117.862 129.423 181.624 1.00 24.73  ? 328  TYR C CD1   1 
ATOM   9431  C  CD2   . TYR C 3  328 ? 115.824 128.490 180.824 1.00 24.73  ? 328  TYR C CD2   1 
ATOM   9432  C  CE1   . TYR C 3  328 ? 117.321 129.528 182.884 1.00 24.73  ? 328  TYR C CE1   1 
ATOM   9433  C  CE2   . TYR C 3  328 ? 115.278 128.585 182.081 1.00 24.73  ? 328  TYR C CE2   1 
ATOM   9434  C  CZ    . TYR C 3  328 ? 116.030 129.109 183.106 1.00 24.73  ? 328  TYR C CZ    1 
ATOM   9435  O  OH    . TYR C 3  328 ? 115.490 129.216 184.363 1.00 24.73  ? 328  TYR C OH    1 
ATOM   9436  N  N     . PHE C 3  329 ? 116.990 125.903 178.513 1.00 23.22  ? 329  PHE C N     1 
ATOM   9437  C  CA    . PHE C 3  329 ? 116.162 124.732 178.765 1.00 23.22  ? 329  PHE C CA    1 
ATOM   9438  C  C     . PHE C 3  329 ? 116.931 123.427 178.644 1.00 23.22  ? 329  PHE C C     1 
ATOM   9439  O  O     . PHE C 3  329 ? 116.423 122.388 179.073 1.00 23.22  ? 329  PHE C O     1 
ATOM   9440  C  CB    . PHE C 3  329 ? 114.967 124.742 177.814 1.00 23.22  ? 329  PHE C CB    1 
ATOM   9441  C  CG    . PHE C 3  329 ? 114.013 125.865 178.076 1.00 23.22  ? 329  PHE C CG    1 
ATOM   9442  C  CD1   . PHE C 3  329 ? 113.091 125.770 179.093 1.00 23.22  ? 329  PHE C CD1   1 
ATOM   9443  C  CD2   . PHE C 3  329 ? 114.055 127.024 177.327 1.00 23.22  ? 329  PHE C CD2   1 
ATOM   9444  C  CE1   . PHE C 3  329 ? 112.229 126.807 179.354 1.00 23.22  ? 329  PHE C CE1   1 
ATOM   9445  C  CE2   . PHE C 3  329 ? 113.185 128.064 177.584 1.00 23.22  ? 329  PHE C CE2   1 
ATOM   9446  C  CZ    . PHE C 3  329 ? 112.270 127.950 178.597 1.00 23.22  ? 329  PHE C CZ    1 
ATOM   9447  N  N     . PHE C 3  330 ? 118.136 123.456 178.082 1.00 21.76  ? 330  PHE C N     1 
ATOM   9448  C  CA    . PHE C 3  330 ? 118.967 122.267 178.013 1.00 21.76  ? 330  PHE C CA    1 
ATOM   9449  C  C     . PHE C 3  330 ? 119.803 122.086 179.275 1.00 21.76  ? 330  PHE C C     1 
ATOM   9450  O  O     . PHE C 3  330 ? 120.141 120.951 179.625 1.00 21.76  ? 330  PHE C O     1 
ATOM   9451  C  CB    . PHE C 3  330 ? 119.873 122.355 176.784 1.00 21.76  ? 330  PHE C CB    1 
ATOM   9452  C  CG    . PHE C 3  330 ? 120.607 121.089 176.469 1.00 21.76  ? 330  PHE C CG    1 
ATOM   9453  C  CD1   . PHE C 3  330 ? 119.981 120.069 175.780 1.00 21.76  ? 330  PHE C CD1   1 
ATOM   9454  C  CD2   . PHE C 3  330 ? 121.921 120.920 176.856 1.00 21.76  ? 330  PHE C CD2   1 
ATOM   9455  C  CE1   . PHE C 3  330 ? 120.654 118.905 175.485 1.00 21.76  ? 330  PHE C CE1   1 
ATOM   9456  C  CE2   . PHE C 3  330 ? 122.593 119.759 176.568 1.00 21.76  ? 330  PHE C CE2   1 
ATOM   9457  C  CZ    . PHE C 3  330 ? 121.961 118.752 175.879 1.00 21.76  ? 330  PHE C CZ    1 
ATOM   9458  N  N     . GLN C 3  331 ? 120.131 123.174 179.983 1.00 30.67  ? 331  GLN C N     1 
ATOM   9459  C  CA    . GLN C 3  331 ? 121.110 123.109 181.060 1.00 30.67  ? 331  GLN C CA    1 
ATOM   9460  C  C     . GLN C 3  331 ? 120.534 123.285 182.457 1.00 30.67  ? 331  GLN C C     1 
ATOM   9461  O  O     . GLN C 3  331 ? 121.187 122.878 183.421 1.00 30.67  ? 331  GLN C O     1 
ATOM   9462  C  CB    . GLN C 3  331 ? 122.207 124.167 180.866 1.00 30.67  ? 331  GLN C CB    1 
ATOM   9463  C  CG    . GLN C 3  331 ? 121.820 125.594 181.235 1.00 30.67  ? 331  GLN C CG    1 
ATOM   9464  C  CD    . GLN C 3  331 ? 122.867 126.617 180.838 1.00 30.67  ? 331  GLN C CD    1 
ATOM   9465  O  OE1   . GLN C 3  331 ? 123.928 126.269 180.325 1.00 30.67  ? 331  GLN C OE1   1 
ATOM   9466  N  NE2   . GLN C 3  331 ? 122.566 127.890 181.064 1.00 30.67  ? 331  GLN C NE2   1 
ATOM   9467  N  N     . ASN C 3  332 ? 119.350 123.874 182.604 1.00 34.55  ? 332  ASN C N     1 
ATOM   9468  C  CA    . ASN C 3  332 ? 118.784 124.157 183.917 1.00 34.55  ? 332  ASN C CA    1 
ATOM   9469  C  C     . ASN C 3  332 ? 117.671 123.171 184.232 1.00 34.55  ? 332  ASN C C     1 
ATOM   9470  O  O     . ASN C 3  332 ? 116.708 123.049 183.469 1.00 34.55  ? 332  ASN C O     1 
ATOM   9471  C  CB    . ASN C 3  332 ? 118.267 125.592 184.000 1.00 34.55  ? 332  ASN C CB    1 
ATOM   9472  C  CG    . ASN C 3  332 ? 119.381 126.601 184.167 1.00 34.55  ? 332  ASN C CG    1 
ATOM   9473  O  OD1   . ASN C 3  332 ? 119.683 127.371 183.262 1.00 34.55  ? 332  ASN C OD1   1 
ATOM   9474  N  ND2   . ASN C 3  332 ? 119.985 126.615 185.346 1.00 34.55  ? 332  ASN C ND2   1 
ATOM   9475  N  N     . ALA C 3  333 ? 117.807 122.475 185.363 1.00 39.94  ? 333  ALA C N     1 
ATOM   9476  C  CA    . ALA C 3  333 ? 116.731 121.634 185.866 1.00 39.94  ? 333  ALA C CA    1 
ATOM   9477  C  C     . ALA C 3  333 ? 115.571 122.460 186.393 1.00 39.94  ? 333  ALA C C     1 
ATOM   9478  O  O     . ALA C 3  333 ? 114.443 121.963 186.450 1.00 39.94  ? 333  ALA C O     1 
ATOM   9479  C  CB    . ALA C 3  333 ? 117.255 120.709 186.963 1.00 39.94  ? 333  ALA C CB    1 
ATOM   9480  N  N     . PHE C 3  334 ? 115.827 123.713 186.764 1.00 45.66  ? 334  PHE C N     1 
ATOM   9481  C  CA    . PHE C 3  334 ? 114.828 124.671 187.208 1.00 45.66  ? 334  PHE C CA    1 
ATOM   9482  C  C     . PHE C 3  334 ? 114.113 125.362 186.060 1.00 45.66  ? 334  PHE C C     1 
ATOM   9483  O  O     . PHE C 3  334 ? 113.466 126.390 186.276 1.00 45.66  ? 334  PHE C O     1 
ATOM   9484  C  CB    . PHE C 3  334 ? 115.489 125.708 188.115 1.00 45.66  ? 334  PHE C CB    1 
ATOM   9485  C  CG    . PHE C 3  334 ? 115.825 125.187 189.476 1.00 45.66  ? 334  PHE C CG    1 
ATOM   9486  C  CD1   . PHE C 3  334 ? 115.130 124.123 190.016 1.00 45.66  ? 334  PHE C CD1   1 
ATOM   9487  C  CD2   . PHE C 3  334 ? 116.867 125.729 190.196 1.00 45.66  ? 334  PHE C CD2   1 
ATOM   9488  C  CE1   . PHE C 3  334 ? 115.438 123.642 191.268 1.00 45.66  ? 334  PHE C CE1   1 
ATOM   9489  C  CE2   . PHE C 3  334 ? 117.190 125.247 191.442 1.00 45.66  ? 334  PHE C CE2   1 
ATOM   9490  C  CZ    . PHE C 3  334 ? 116.474 124.202 191.981 1.00 45.66  ? 334  PHE C CZ    1 
ATOM   9491  N  N     . SER C 3  335 ? 114.222 124.838 184.842 1.00 42.39  ? 335  SER C N     1 
ATOM   9492  C  CA    . SER C 3  335 ? 113.453 125.377 183.733 1.00 42.39  ? 335  SER C CA    1 
ATOM   9493  C  C     . SER C 3  335 ? 111.988 124.983 183.817 1.00 42.39  ? 335  SER C C     1 
ATOM   9494  O  O     . SER C 3  335 ? 111.140 125.664 183.233 1.00 42.39  ? 335  SER C O     1 
ATOM   9495  C  CB    . SER C 3  335 ? 114.046 124.899 182.413 1.00 42.39  ? 335  SER C CB    1 
ATOM   9496  O  OG    . SER C 3  335 ? 115.374 125.357 182.256 1.00 42.39  ? 335  SER C OG    1 
ATOM   9497  N  N     . VAL C 3  336 ? 111.673 123.899 184.532 1.00 47.61  ? 336  VAL C N     1 
ATOM   9498  C  CA    . VAL C 3  336 ? 110.286 123.479 184.717 1.00 47.61  ? 336  VAL C CA    1 
ATOM   9499  C  C     . VAL C 3  336 ? 109.551 124.307 185.753 1.00 47.61  ? 336  VAL C C     1 
ATOM   9500  O  O     . VAL C 3  336 ? 108.346 124.108 185.946 1.00 47.61  ? 336  VAL C O     1 
ATOM   9501  C  CB    . VAL C 3  336 ? 110.196 122.002 185.140 1.00 47.61  ? 336  VAL C CB    1 
ATOM   9502  C  CG1   . VAL C 3  336 ? 110.714 121.102 184.047 1.00 47.61  ? 336  VAL C CG1   1 
ATOM   9503  C  CG2   . VAL C 3  336 ? 110.973 121.776 186.419 1.00 47.61  ? 336  VAL C CG2   1 
ATOM   9504  N  N     . PHE C 3  337 ? 110.235 125.225 186.429 1.00 52.15  ? 337  PHE C N     1 
ATOM   9505  C  CA    . PHE C 3  337 ? 109.634 126.028 187.489 1.00 52.15  ? 337  PHE C CA    1 
ATOM   9506  C  C     . PHE C 3  337 ? 109.334 127.440 187.024 1.00 52.15  ? 337  PHE C C     1 
ATOM   9507  O  O     . PHE C 3  337 ? 109.512 128.395 187.779 1.00 52.15  ? 337  PHE C O     1 
ATOM   9508  C  CB    . PHE C 3  337 ? 110.537 126.058 188.716 1.00 52.15  ? 337  PHE C CB    1 
ATOM   9509  C  CG    . PHE C 3  337 ? 110.643 124.744 189.433 1.00 52.15  ? 337  PHE C CG    1 
ATOM   9510  C  CD1   . PHE C 3  337 ? 109.716 123.733 189.230 1.00 52.15  ? 337  PHE C CD1   1 
ATOM   9511  C  CD2   . PHE C 3  337 ? 111.682 124.519 190.313 1.00 52.15  ? 337  PHE C CD2   1 
ATOM   9512  C  CE1   . PHE C 3  337 ? 109.834 122.527 189.889 1.00 52.15  ? 337  PHE C CE1   1 
ATOM   9513  C  CE2   . PHE C 3  337 ? 111.802 123.316 190.972 1.00 52.15  ? 337  PHE C CE2   1 
ATOM   9514  C  CZ    . PHE C 3  337 ? 110.875 122.321 190.764 1.00 52.15  ? 337  PHE C CZ    1 
ATOM   9515  N  N     . ILE C 3  338 ? 108.907 127.616 185.778 1.00 49.93  ? 338  ILE C N     1 
ATOM   9516  C  CA    . ILE C 3  338 ? 108.369 128.899 185.343 1.00 49.93  ? 338  ILE C CA    1 
ATOM   9517  C  C     . ILE C 3  338 ? 106.877 128.835 185.076 1.00 49.93  ? 338  ILE C C     1 
ATOM   9518  O  O     . ILE C 3  338 ? 106.239 129.895 184.962 1.00 49.93  ? 338  ILE C O     1 
ATOM   9519  C  CB    . ILE C 3  338 ? 109.119 129.453 184.115 1.00 49.93  ? 338  ILE C CB    1 
ATOM   9520  C  CG1   . ILE C 3  338 ? 108.929 128.562 182.898 1.00 49.93  ? 338  ILE C CG1   1 
ATOM   9521  C  CG2   . ILE C 3  338 ? 110.598 129.585 184.420 1.00 49.93  ? 338  ILE C CG2   1 
ATOM   9522  C  CD1   . ILE C 3  338 ? 109.481 129.191 181.651 1.00 49.93  ? 338  ILE C CD1   1 
ATOM   9523  N  N     . ASP C 3  339 ? 106.301 127.640 184.972 1.00 60.84  ? 339  ASP C N     1 
ATOM   9524  C  CA    . ASP C 3  339 ? 104.861 127.577 185.164 1.00 60.84  ? 339  ASP C CA    1 
ATOM   9525  C  C     . ASP C 3  339 ? 104.540 127.086 186.573 1.00 60.84  ? 339  ASP C C     1 
ATOM   9526  O  O     . ASP C 3  339 ? 105.229 126.203 187.096 1.00 60.84  ? 339  ASP C O     1 
ATOM   9527  C  CB    . ASP C 3  339 ? 104.194 126.675 184.121 1.00 60.84  ? 339  ASP C CB    1 
ATOM   9528  C  CG    . ASP C 3  339 ? 104.854 125.314 183.995 1.00 60.84  ? 339  ASP C CG    1 
ATOM   9529  O  OD1   . ASP C 3  339 ? 105.932 125.098 184.582 1.00 60.84  ? 339  ASP C OD1   1 
ATOM   9530  O  OD2   . ASP C 3  339 ? 104.283 124.451 183.297 1.00 60.84  ? 339  ASP C OD2   1 
ATOM   9531  N  N     . PRO C 3  340 ? 103.530 127.663 187.233 1.00 67.07  ? 340  PRO C N     1 
ATOM   9532  C  CA    . PRO C 3  340 ? 103.329 127.386 188.665 1.00 67.07  ? 340  PRO C CA    1 
ATOM   9533  C  C     . PRO C 3  340 ? 102.773 126.003 188.976 1.00 67.07  ? 340  PRO C C     1 
ATOM   9534  O  O     . PRO C 3  340 ? 102.741 125.629 190.156 1.00 67.07  ? 340  PRO C O     1 
ATOM   9535  C  CB    . PRO C 3  340 ? 102.345 128.480 189.099 1.00 67.07  ? 340  PRO C CB    1 
ATOM   9536  C  CG    . PRO C 3  340 ? 102.480 129.549 188.071 1.00 67.07  ? 340  PRO C CG    1 
ATOM   9537  C  CD    . PRO C 3  340 ? 102.732 128.817 186.790 1.00 67.07  ? 340  PRO C CD    1 
ATOM   9538  N  N     . VAL C 3  341 ? 102.341 125.232 187.976 1.00 66.71  ? 341  VAL C N     1 
ATOM   9539  C  CA    . VAL C 3  341 ? 101.741 123.933 188.258 1.00 66.71  ? 341  VAL C CA    1 
ATOM   9540  C  C     . VAL C 3  341 ? 102.776 122.878 188.629 1.00 66.71  ? 341  VAL C C     1 
ATOM   9541  O  O     . VAL C 3  341 ? 102.411 121.842 189.197 1.00 66.71  ? 341  VAL C O     1 
ATOM   9542  C  CB    . VAL C 3  341 ? 100.902 123.444 187.066 1.00 66.71  ? 341  VAL C CB    1 
ATOM   9543  C  CG1   . VAL C 3  341 ? 99.759  124.407 186.796 1.00 66.71  ? 341  VAL C CG1   1 
ATOM   9544  C  CG2   . VAL C 3  341 ? 101.769 123.280 185.827 1.00 66.71  ? 341  VAL C CG2   1 
ATOM   9545  N  N     . ASN C 3  342 ? 104.053 123.107 188.335 1.00 67.85  ? 342  ASN C N     1 
ATOM   9546  C  CA    . ASN C 3  342 ? 105.106 122.156 188.662 1.00 67.85  ? 342  ASN C CA    1 
ATOM   9547  C  C     . ASN C 3  342 ? 105.827 122.492 189.956 1.00 67.85  ? 342  ASN C C     1 
ATOM   9548  O  O     . ASN C 3  342 ? 106.774 121.791 190.320 1.00 67.85  ? 342  ASN C O     1 
ATOM   9549  C  CB    . ASN C 3  342 ? 106.119 122.073 187.521 1.00 67.85  ? 342  ASN C CB    1 
ATOM   9550  C  CG    . ASN C 3  342 ? 105.512 121.541 186.250 1.00 67.85  ? 342  ASN C CG    1 
ATOM   9551  O  OD1   . ASN C 3  342 ? 105.415 122.255 185.256 1.00 67.85  ? 342  ASN C OD1   1 
ATOM   9552  N  ND2   . ASN C 3  342 ? 105.096 120.281 186.273 1.00 67.85  ? 342  ASN C ND2   1 
ATOM   9553  N  N     . VAL C 3  343 ? 105.399 123.541 190.662 1.00 70.39  ? 343  VAL C N     1 
ATOM   9554  C  CA    . VAL C 3  343 ? 106.024 123.898 191.927 1.00 70.39  ? 343  VAL C CA    1 
ATOM   9555  C  C     . VAL C 3  343 ? 105.633 122.901 193.013 1.00 70.39  ? 343  VAL C C     1 
ATOM   9556  O  O     . VAL C 3  343 ? 106.373 122.708 193.986 1.00 70.39  ? 343  VAL C O     1 
ATOM   9557  C  CB    . VAL C 3  343 ? 105.635 125.351 192.270 1.00 70.39  ? 343  VAL C CB    1 
ATOM   9558  C  CG1   . VAL C 3  343 ? 106.386 125.868 193.475 1.00 70.39  ? 343  VAL C CG1   1 
ATOM   9559  C  CG2   . VAL C 3  343 ? 105.889 126.244 191.083 1.00 70.39  ? 343  VAL C CG2   1 
ATOM   9560  N  N     . ASP C 3  344 ? 104.523 122.190 192.821 1.00 72.33  ? 344  ASP C N     1 
ATOM   9561  C  CA    . ASP C 3  344 ? 104.053 121.153 193.730 1.00 72.33  ? 344  ASP C CA    1 
ATOM   9562  C  C     . ASP C 3  344 ? 104.800 119.828 193.566 1.00 72.33  ? 344  ASP C C     1 
ATOM   9563  O  O     . ASP C 3  344 ? 104.340 118.804 194.082 1.00 72.33  ? 344  ASP C O     1 
ATOM   9564  C  CB    . ASP C 3  344 ? 102.555 120.932 193.513 1.00 72.33  ? 344  ASP C CB    1 
ATOM   9565  C  CG    . ASP C 3  344 ? 101.740 122.179 193.781 1.00 72.33  ? 344  ASP C CG    1 
ATOM   9566  O  OD1   . ASP C 3  344 ? 102.167 123.005 194.615 1.00 72.33  ? 344  ASP C OD1   1 
ATOM   9567  O  OD2   . ASP C 3  344 ? 100.677 122.340 193.146 1.00 72.33  ? 344  ASP C OD2   1 
ATOM   9568  N  N     . PHE C 3  345 ? 105.928 119.827 192.857 1.00 74.71  ? 345  PHE C N     1 
ATOM   9569  C  CA    . PHE C 3  345 ? 106.735 118.644 192.601 1.00 74.71  ? 345  PHE C CA    1 
ATOM   9570  C  C     . PHE C 3  345 ? 107.993 118.599 193.463 1.00 74.71  ? 345  PHE C C     1 
ATOM   9571  O  O     . PHE C 3  345 ? 108.587 117.522 193.596 1.00 74.71  ? 345  PHE C O     1 
ATOM   9572  C  CB    . PHE C 3  345 ? 107.116 118.609 191.109 1.00 74.71  ? 345  PHE C CB    1 
ATOM   9573  C  CG    . PHE C 3  345 ? 107.779 117.336 190.667 1.00 74.71  ? 345  PHE C CG    1 
ATOM   9574  C  CD1   . PHE C 3  345 ? 107.023 116.206 190.398 1.00 74.71  ? 345  PHE C CD1   1 
ATOM   9575  C  CD2   . PHE C 3  345 ? 109.156 117.268 190.524 1.00 74.71  ? 345  PHE C CD2   1 
ATOM   9576  C  CE1   . PHE C 3  345 ? 107.630 115.030 189.993 1.00 74.71  ? 345  PHE C CE1   1 
ATOM   9577  C  CE2   . PHE C 3  345 ? 109.766 116.097 190.138 1.00 74.71  ? 345  PHE C CE2   1 
ATOM   9578  C  CZ    . PHE C 3  345 ? 109.005 114.978 189.861 1.00 74.71  ? 345  PHE C CZ    1 
ATOM   9579  N  N     . LEU C 3  346 ? 108.323 119.714 194.130 1.00 71.58  ? 346  LEU C N     1 
ATOM   9580  C  CA    . LEU C 3  346 ? 109.688 120.075 194.521 1.00 71.58  ? 346  LEU C CA    1 
ATOM   9581  C  C     . LEU C 3  346 ? 110.373 119.025 195.396 1.00 71.58  ? 346  LEU C C     1 
ATOM   9582  O  O     . LEU C 3  346 ? 109.778 118.471 196.324 1.00 71.58  ? 346  LEU C O     1 
ATOM   9583  C  CB    . LEU C 3  346 ? 109.649 121.425 195.238 1.00 71.58  ? 346  LEU C CB    1 
ATOM   9584  C  CG    . LEU C 3  346 ? 110.942 122.124 195.633 1.00 71.58  ? 346  LEU C CG    1 
ATOM   9585  C  CD1   . LEU C 3  346 ? 111.768 122.330 194.413 1.00 71.58  ? 346  LEU C CD1   1 
ATOM   9586  C  CD2   . LEU C 3  346 ? 110.599 123.466 196.213 1.00 71.58  ? 346  LEU C CD2   1 
ATOM   9587  N  N     . ASN C 3  347 ? 111.637 118.758 195.080 1.00 74.82  ? 347  ASN C N     1 
ATOM   9588  C  CA    . ASN C 3  347 ? 112.383 117.588 195.524 1.00 74.82  ? 347  ASN C CA    1 
ATOM   9589  C  C     . ASN C 3  347 ? 113.546 118.046 196.409 1.00 74.82  ? 347  ASN C C     1 
ATOM   9590  O  O     . ASN C 3  347 ? 113.708 119.235 196.681 1.00 74.82  ? 347