data_5ZRV
# 
_entry.id   5ZRV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.295 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZRV         
WWPDB D_1300007553 
EMDB  EMD-6944     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Structure of human mitochondrial trifunctional protein, tetramer' EMD-6940 'other EM volume'      
EMDB 'Structure of human mitochondrial trifunctional protein, octamer'  EMD-6944 'associated EM volume' 
EMDB 'Structure of human mitochondrial trifunctional protein'           EMD-6945 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZRV 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Liang, K.' 1 ? 
'Li, N.'    2 ? 
'Dai, J.'   3 ? 
'Wang, X.'  4 ? 
'Liu, P.'   5 ? 
'Chen, X.'  6 ? 
'Wang, C.'  7 ? 
'Gao, N.'   8 ? 
'Xiao, J.'  9 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            115 
_citation.language                  ? 
_citation.page_first                7039 
_citation.page_last                 7044 
_citation.title                     'Cryo-EM structure of human mitochondrial trifunctional protein' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1801252115 
_citation.pdbx_database_id_PubMed   29915090 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liang, K.'  1 
primary 'Li, N.'     2 
primary 'Wang, X.'   3 
primary 'Dai, J.'    4 
primary 'Liu, P.'    5 
primary 'Wang, C.'   6 
primary 'Chen, X.W.' 7 
primary 'Gao, N.'    8 
primary 'Xiao, J.'   9 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ZRV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ZRV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Trifunctional enzyme subunit alpha, mitochondrial' 83112.625 4 4.2.1.17,1.1.1.211 ? ? ? 
2 polymer man 'Trifunctional enzyme subunit beta, mitochondrial'  51360.359 4 2.3.1.16           ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'TP-alpha, mitochondrial trifunctional protein-alpha subunit' 
2 TP-beta                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIW
ASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRI
ATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGY
LCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRG
QQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIR
ILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQ
EGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
;
;MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIW
ASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRI
ATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGY
LCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRG
QQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIR
ILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQ
EGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLA
RAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVI
VAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLE
QDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLI
MAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
NYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK
;
;MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLA
RAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVI
VAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLE
QDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLI
MAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
NYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK
;
B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ALA n 
1 4   CYS n 
1 5   ARG n 
1 6   ALA n 
1 7   ILE n 
1 8   GLY n 
1 9   ILE n 
1 10  LEU n 
1 11  SER n 
1 12  ARG n 
1 13  PHE n 
1 14  SER n 
1 15  ALA n 
1 16  PHE n 
1 17  ARG n 
1 18  ILE n 
1 19  LEU n 
1 20  ARG n 
1 21  SER n 
1 22  ARG n 
1 23  GLY n 
1 24  TYR n 
1 25  ILE n 
1 26  CYS n 
1 27  ARG n 
1 28  ASN n 
1 29  PHE n 
1 30  THR n 
1 31  GLY n 
1 32  SER n 
1 33  SER n 
1 34  ALA n 
1 35  LEU n 
1 36  LEU n 
1 37  THR n 
1 38  ARG n 
1 39  THR n 
1 40  HIS n 
1 41  ILE n 
1 42  ASN n 
1 43  TYR n 
1 44  GLY n 
1 45  VAL n 
1 46  LYS n 
1 47  GLY n 
1 48  ASP n 
1 49  VAL n 
1 50  ALA n 
1 51  VAL n 
1 52  VAL n 
1 53  ARG n 
1 54  ILE n 
1 55  ASN n 
1 56  SER n 
1 57  PRO n 
1 58  ASN n 
1 59  SER n 
1 60  LYS n 
1 61  VAL n 
1 62  ASN n 
1 63  THR n 
1 64  LEU n 
1 65  SER n 
1 66  LYS n 
1 67  GLU n 
1 68  LEU n 
1 69  HIS n 
1 70  SER n 
1 71  GLU n 
1 72  PHE n 
1 73  SER n 
1 74  GLU n 
1 75  VAL n 
1 76  MET n 
1 77  ASN n 
1 78  GLU n 
1 79  ILE n 
1 80  TRP n 
1 81  ALA n 
1 82  SER n 
1 83  ASP n 
1 84  GLN n 
1 85  ILE n 
1 86  ARG n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  LEU n 
1 91  ILE n 
1 92  SER n 
1 93  SER n 
1 94  LYS n 
1 95  PRO n 
1 96  GLY n 
1 97  CYS n 
1 98  PHE n 
1 99  ILE n 
1 100 ALA n 
1 101 GLY n 
1 102 ALA n 
1 103 ASP n 
1 104 ILE n 
1 105 ASN n 
1 106 MET n 
1 107 LEU n 
1 108 ALA n 
1 109 ALA n 
1 110 CYS n 
1 111 LYS n 
1 112 THR n 
1 113 LEU n 
1 114 GLN n 
1 115 GLU n 
1 116 VAL n 
1 117 THR n 
1 118 GLN n 
1 119 LEU n 
1 120 SER n 
1 121 GLN n 
1 122 GLU n 
1 123 ALA n 
1 124 GLN n 
1 125 ARG n 
1 126 ILE n 
1 127 VAL n 
1 128 GLU n 
1 129 LYS n 
1 130 LEU n 
1 131 GLU n 
1 132 LYS n 
1 133 SER n 
1 134 THR n 
1 135 LYS n 
1 136 PRO n 
1 137 ILE n 
1 138 VAL n 
1 139 ALA n 
1 140 ALA n 
1 141 ILE n 
1 142 ASN n 
1 143 GLY n 
1 144 SER n 
1 145 CYS n 
1 146 LEU n 
1 147 GLY n 
1 148 GLY n 
1 149 GLY n 
1 150 LEU n 
1 151 GLU n 
1 152 VAL n 
1 153 ALA n 
1 154 ILE n 
1 155 SER n 
1 156 CYS n 
1 157 GLN n 
1 158 TYR n 
1 159 ARG n 
1 160 ILE n 
1 161 ALA n 
1 162 THR n 
1 163 LYS n 
1 164 ASP n 
1 165 ARG n 
1 166 LYS n 
1 167 THR n 
1 168 VAL n 
1 169 LEU n 
1 170 GLY n 
1 171 THR n 
1 172 PRO n 
1 173 GLU n 
1 174 VAL n 
1 175 LEU n 
1 176 LEU n 
1 177 GLY n 
1 178 ALA n 
1 179 LEU n 
1 180 PRO n 
1 181 GLY n 
1 182 ALA n 
1 183 GLY n 
1 184 GLY n 
1 185 THR n 
1 186 GLN n 
1 187 ARG n 
1 188 LEU n 
1 189 PRO n 
1 190 LYS n 
1 191 MET n 
1 192 VAL n 
1 193 GLY n 
1 194 VAL n 
1 195 PRO n 
1 196 ALA n 
1 197 ALA n 
1 198 LEU n 
1 199 ASP n 
1 200 MET n 
1 201 MET n 
1 202 LEU n 
1 203 THR n 
1 204 GLY n 
1 205 ARG n 
1 206 SER n 
1 207 ILE n 
1 208 ARG n 
1 209 ALA n 
1 210 ASP n 
1 211 ARG n 
1 212 ALA n 
1 213 LYS n 
1 214 LYS n 
1 215 MET n 
1 216 GLY n 
1 217 LEU n 
1 218 VAL n 
1 219 ASP n 
1 220 GLN n 
1 221 LEU n 
1 222 VAL n 
1 223 GLU n 
1 224 PRO n 
1 225 LEU n 
1 226 GLY n 
1 227 PRO n 
1 228 GLY n 
1 229 LEU n 
1 230 LYS n 
1 231 PRO n 
1 232 PRO n 
1 233 GLU n 
1 234 GLU n 
1 235 ARG n 
1 236 THR n 
1 237 ILE n 
1 238 GLU n 
1 239 TYR n 
1 240 LEU n 
1 241 GLU n 
1 242 GLU n 
1 243 VAL n 
1 244 ALA n 
1 245 ILE n 
1 246 THR n 
1 247 PHE n 
1 248 ALA n 
1 249 LYS n 
1 250 GLY n 
1 251 LEU n 
1 252 ALA n 
1 253 ASP n 
1 254 LYS n 
1 255 LYS n 
1 256 ILE n 
1 257 SER n 
1 258 PRO n 
1 259 LYS n 
1 260 ARG n 
1 261 ASP n 
1 262 LYS n 
1 263 GLY n 
1 264 LEU n 
1 265 VAL n 
1 266 GLU n 
1 267 LYS n 
1 268 LEU n 
1 269 THR n 
1 270 ALA n 
1 271 TYR n 
1 272 ALA n 
1 273 MET n 
1 274 THR n 
1 275 ILE n 
1 276 PRO n 
1 277 PHE n 
1 278 VAL n 
1 279 ARG n 
1 280 GLN n 
1 281 GLN n 
1 282 VAL n 
1 283 TYR n 
1 284 LYS n 
1 285 LYS n 
1 286 VAL n 
1 287 GLU n 
1 288 GLU n 
1 289 LYS n 
1 290 VAL n 
1 291 ARG n 
1 292 LYS n 
1 293 GLN n 
1 294 THR n 
1 295 LYS n 
1 296 GLY n 
1 297 LEU n 
1 298 TYR n 
1 299 PRO n 
1 300 ALA n 
1 301 PRO n 
1 302 LEU n 
1 303 LYS n 
1 304 ILE n 
1 305 ILE n 
1 306 ASP n 
1 307 VAL n 
1 308 VAL n 
1 309 LYS n 
1 310 THR n 
1 311 GLY n 
1 312 ILE n 
1 313 GLU n 
1 314 GLN n 
1 315 GLY n 
1 316 SER n 
1 317 ASP n 
1 318 ALA n 
1 319 GLY n 
1 320 TYR n 
1 321 LEU n 
1 322 CYS n 
1 323 GLU n 
1 324 SER n 
1 325 GLN n 
1 326 LYS n 
1 327 PHE n 
1 328 GLY n 
1 329 GLU n 
1 330 LEU n 
1 331 VAL n 
1 332 MET n 
1 333 THR n 
1 334 LYS n 
1 335 GLU n 
1 336 SER n 
1 337 LYS n 
1 338 ALA n 
1 339 LEU n 
1 340 MET n 
1 341 GLY n 
1 342 LEU n 
1 343 TYR n 
1 344 HIS n 
1 345 GLY n 
1 346 GLN n 
1 347 VAL n 
1 348 LEU n 
1 349 CYS n 
1 350 LYS n 
1 351 LYS n 
1 352 ASN n 
1 353 LYS n 
1 354 PHE n 
1 355 GLY n 
1 356 ALA n 
1 357 PRO n 
1 358 GLN n 
1 359 LYS n 
1 360 ASP n 
1 361 VAL n 
1 362 LYS n 
1 363 HIS n 
1 364 LEU n 
1 365 ALA n 
1 366 ILE n 
1 367 LEU n 
1 368 GLY n 
1 369 ALA n 
1 370 GLY n 
1 371 LEU n 
1 372 MET n 
1 373 GLY n 
1 374 ALA n 
1 375 GLY n 
1 376 ILE n 
1 377 ALA n 
1 378 GLN n 
1 379 VAL n 
1 380 SER n 
1 381 VAL n 
1 382 ASP n 
1 383 LYS n 
1 384 GLY n 
1 385 LEU n 
1 386 LYS n 
1 387 THR n 
1 388 ILE n 
1 389 LEU n 
1 390 LYS n 
1 391 ASP n 
1 392 ALA n 
1 393 THR n 
1 394 LEU n 
1 395 THR n 
1 396 ALA n 
1 397 LEU n 
1 398 ASP n 
1 399 ARG n 
1 400 GLY n 
1 401 GLN n 
1 402 GLN n 
1 403 GLN n 
1 404 VAL n 
1 405 PHE n 
1 406 LYS n 
1 407 GLY n 
1 408 LEU n 
1 409 ASN n 
1 410 ASP n 
1 411 LYS n 
1 412 VAL n 
1 413 LYS n 
1 414 LYS n 
1 415 LYS n 
1 416 ALA n 
1 417 LEU n 
1 418 THR n 
1 419 SER n 
1 420 PHE n 
1 421 GLU n 
1 422 ARG n 
1 423 ASP n 
1 424 SER n 
1 425 ILE n 
1 426 PHE n 
1 427 SER n 
1 428 ASN n 
1 429 LEU n 
1 430 THR n 
1 431 GLY n 
1 432 GLN n 
1 433 LEU n 
1 434 ASP n 
1 435 TYR n 
1 436 GLN n 
1 437 GLY n 
1 438 PHE n 
1 439 GLU n 
1 440 LYS n 
1 441 ALA n 
1 442 ASP n 
1 443 MET n 
1 444 VAL n 
1 445 ILE n 
1 446 GLU n 
1 447 ALA n 
1 448 VAL n 
1 449 PHE n 
1 450 GLU n 
1 451 ASP n 
1 452 LEU n 
1 453 SER n 
1 454 LEU n 
1 455 LYS n 
1 456 HIS n 
1 457 ARG n 
1 458 VAL n 
1 459 LEU n 
1 460 LYS n 
1 461 GLU n 
1 462 VAL n 
1 463 GLU n 
1 464 ALA n 
1 465 VAL n 
1 466 ILE n 
1 467 PRO n 
1 468 ASP n 
1 469 HIS n 
1 470 CYS n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 SER n 
1 475 ASN n 
1 476 THR n 
1 477 SER n 
1 478 ALA n 
1 479 LEU n 
1 480 PRO n 
1 481 ILE n 
1 482 SER n 
1 483 GLU n 
1 484 ILE n 
1 485 ALA n 
1 486 ALA n 
1 487 VAL n 
1 488 SER n 
1 489 LYS n 
1 490 ARG n 
1 491 PRO n 
1 492 GLU n 
1 493 LYS n 
1 494 VAL n 
1 495 ILE n 
1 496 GLY n 
1 497 MET n 
1 498 HIS n 
1 499 TYR n 
1 500 PHE n 
1 501 SER n 
1 502 PRO n 
1 503 VAL n 
1 504 ASP n 
1 505 LYS n 
1 506 MET n 
1 507 GLN n 
1 508 LEU n 
1 509 LEU n 
1 510 GLU n 
1 511 ILE n 
1 512 ILE n 
1 513 THR n 
1 514 THR n 
1 515 GLU n 
1 516 LYS n 
1 517 THR n 
1 518 SER n 
1 519 LYS n 
1 520 ASP n 
1 521 THR n 
1 522 SER n 
1 523 ALA n 
1 524 SER n 
1 525 ALA n 
1 526 VAL n 
1 527 ALA n 
1 528 VAL n 
1 529 GLY n 
1 530 LEU n 
1 531 LYS n 
1 532 GLN n 
1 533 GLY n 
1 534 LYS n 
1 535 VAL n 
1 536 ILE n 
1 537 ILE n 
1 538 VAL n 
1 539 VAL n 
1 540 LYS n 
1 541 ASP n 
1 542 GLY n 
1 543 PRO n 
1 544 GLY n 
1 545 PHE n 
1 546 TYR n 
1 547 THR n 
1 548 THR n 
1 549 ARG n 
1 550 CYS n 
1 551 LEU n 
1 552 ALA n 
1 553 PRO n 
1 554 MET n 
1 555 MET n 
1 556 SER n 
1 557 GLU n 
1 558 VAL n 
1 559 ILE n 
1 560 ARG n 
1 561 ILE n 
1 562 LEU n 
1 563 GLN n 
1 564 GLU n 
1 565 GLY n 
1 566 VAL n 
1 567 ASP n 
1 568 PRO n 
1 569 LYS n 
1 570 LYS n 
1 571 LEU n 
1 572 ASP n 
1 573 SER n 
1 574 LEU n 
1 575 THR n 
1 576 THR n 
1 577 SER n 
1 578 PHE n 
1 579 GLY n 
1 580 PHE n 
1 581 PRO n 
1 582 VAL n 
1 583 GLY n 
1 584 ALA n 
1 585 ALA n 
1 586 THR n 
1 587 LEU n 
1 588 VAL n 
1 589 ASP n 
1 590 GLU n 
1 591 VAL n 
1 592 GLY n 
1 593 VAL n 
1 594 ASP n 
1 595 VAL n 
1 596 ALA n 
1 597 LYS n 
1 598 HIS n 
1 599 VAL n 
1 600 ALA n 
1 601 GLU n 
1 602 ASP n 
1 603 LEU n 
1 604 GLY n 
1 605 LYS n 
1 606 VAL n 
1 607 PHE n 
1 608 GLY n 
1 609 GLU n 
1 610 ARG n 
1 611 PHE n 
1 612 GLY n 
1 613 GLY n 
1 614 GLY n 
1 615 ASN n 
1 616 PRO n 
1 617 GLU n 
1 618 LEU n 
1 619 LEU n 
1 620 THR n 
1 621 GLN n 
1 622 MET n 
1 623 VAL n 
1 624 SER n 
1 625 LYS n 
1 626 GLY n 
1 627 PHE n 
1 628 LEU n 
1 629 GLY n 
1 630 ARG n 
1 631 LYS n 
1 632 SER n 
1 633 GLY n 
1 634 LYS n 
1 635 GLY n 
1 636 PHE n 
1 637 TYR n 
1 638 ILE n 
1 639 TYR n 
1 640 GLN n 
1 641 GLU n 
1 642 GLY n 
1 643 VAL n 
1 644 LYS n 
1 645 ARG n 
1 646 LYS n 
1 647 ASP n 
1 648 LEU n 
1 649 ASN n 
1 650 SER n 
1 651 ASP n 
1 652 MET n 
1 653 ASP n 
1 654 SER n 
1 655 ILE n 
1 656 LEU n 
1 657 ALA n 
1 658 SER n 
1 659 LEU n 
1 660 LYS n 
1 661 LEU n 
1 662 PRO n 
1 663 PRO n 
1 664 LYS n 
1 665 SER n 
1 666 GLU n 
1 667 VAL n 
1 668 SER n 
1 669 SER n 
1 670 ASP n 
1 671 GLU n 
1 672 ASP n 
1 673 ILE n 
1 674 GLN n 
1 675 PHE n 
1 676 ARG n 
1 677 LEU n 
1 678 VAL n 
1 679 THR n 
1 680 ARG n 
1 681 PHE n 
1 682 VAL n 
1 683 ASN n 
1 684 GLU n 
1 685 ALA n 
1 686 VAL n 
1 687 MET n 
1 688 CYS n 
1 689 LEU n 
1 690 GLN n 
1 691 GLU n 
1 692 GLY n 
1 693 ILE n 
1 694 LEU n 
1 695 ALA n 
1 696 THR n 
1 697 PRO n 
1 698 ALA n 
1 699 GLU n 
1 700 GLY n 
1 701 ASP n 
1 702 ILE n 
1 703 GLY n 
1 704 ALA n 
1 705 VAL n 
1 706 PHE n 
1 707 GLY n 
1 708 LEU n 
1 709 GLY n 
1 710 PHE n 
1 711 PRO n 
1 712 PRO n 
1 713 CYS n 
1 714 LEU n 
1 715 GLY n 
1 716 GLY n 
1 717 PRO n 
1 718 PHE n 
1 719 ARG n 
1 720 PHE n 
1 721 VAL n 
1 722 ASP n 
1 723 LEU n 
1 724 TYR n 
1 725 GLY n 
1 726 ALA n 
1 727 GLN n 
1 728 LYS n 
1 729 ILE n 
1 730 VAL n 
1 731 ASP n 
1 732 ARG n 
1 733 LEU n 
1 734 LYS n 
1 735 LYS n 
1 736 TYR n 
1 737 GLU n 
1 738 ALA n 
1 739 ALA n 
1 740 TYR n 
1 741 GLY n 
1 742 LYS n 
1 743 GLN n 
1 744 PHE n 
1 745 THR n 
1 746 PRO n 
1 747 CYS n 
1 748 GLN n 
1 749 LEU n 
1 750 LEU n 
1 751 ALA n 
1 752 ASP n 
1 753 HIS n 
1 754 ALA n 
1 755 ASN n 
1 756 SER n 
1 757 PRO n 
1 758 ASN n 
1 759 LYS n 
1 760 LYS n 
1 761 PHE n 
1 762 TYR n 
1 763 GLN n 
2 1   MET n 
2 2   THR n 
2 3   ILE n 
2 4   LEU n 
2 5   THR n 
2 6   TYR n 
2 7   PRO n 
2 8   PHE n 
2 9   LYS n 
2 10  ASN n 
2 11  LEU n 
2 12  PRO n 
2 13  THR n 
2 14  ALA n 
2 15  SER n 
2 16  LYS n 
2 17  TRP n 
2 18  ALA n 
2 19  LEU n 
2 20  ARG n 
2 21  PHE n 
2 22  SER n 
2 23  ILE n 
2 24  ARG n 
2 25  PRO n 
2 26  LEU n 
2 27  SER n 
2 28  CYS n 
2 29  SER n 
2 30  SER n 
2 31  GLN n 
2 32  LEU n 
2 33  ARG n 
2 34  ALA n 
2 35  ALA n 
2 36  PRO n 
2 37  ALA n 
2 38  VAL n 
2 39  GLN n 
2 40  THR n 
2 41  LYS n 
2 42  THR n 
2 43  LYS n 
2 44  LYS n 
2 45  THR n 
2 46  LEU n 
2 47  ALA n 
2 48  LYS n 
2 49  PRO n 
2 50  ASN n 
2 51  ILE n 
2 52  ARG n 
2 53  ASN n 
2 54  VAL n 
2 55  VAL n 
2 56  VAL n 
2 57  VAL n 
2 58  ASP n 
2 59  GLY n 
2 60  VAL n 
2 61  ARG n 
2 62  THR n 
2 63  PRO n 
2 64  PHE n 
2 65  LEU n 
2 66  LEU n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  SER n 
2 71  TYR n 
2 72  LYS n 
2 73  ASP n 
2 74  LEU n 
2 75  MET n 
2 76  PRO n 
2 77  HIS n 
2 78  ASP n 
2 79  LEU n 
2 80  ALA n 
2 81  ARG n 
2 82  ALA n 
2 83  ALA n 
2 84  LEU n 
2 85  THR n 
2 86  GLY n 
2 87  LEU n 
2 88  LEU n 
2 89  HIS n 
2 90  ARG n 
2 91  THR n 
2 92  SER n 
2 93  VAL n 
2 94  PRO n 
2 95  LYS n 
2 96  GLU n 
2 97  VAL n 
2 98  VAL n 
2 99  ASP n 
2 100 TYR n 
2 101 ILE n 
2 102 ILE n 
2 103 PHE n 
2 104 GLY n 
2 105 THR n 
2 106 VAL n 
2 107 ILE n 
2 108 GLN n 
2 109 GLU n 
2 110 VAL n 
2 111 LYS n 
2 112 THR n 
2 113 SER n 
2 114 ASN n 
2 115 VAL n 
2 116 ALA n 
2 117 ARG n 
2 118 GLU n 
2 119 ALA n 
2 120 ALA n 
2 121 LEU n 
2 122 GLY n 
2 123 ALA n 
2 124 GLY n 
2 125 PHE n 
2 126 SER n 
2 127 ASP n 
2 128 LYS n 
2 129 THR n 
2 130 PRO n 
2 131 ALA n 
2 132 HIS n 
2 133 THR n 
2 134 VAL n 
2 135 THR n 
2 136 MET n 
2 137 ALA n 
2 138 CYS n 
2 139 ILE n 
2 140 SER n 
2 141 ALA n 
2 142 ASN n 
2 143 GLN n 
2 144 ALA n 
2 145 MET n 
2 146 THR n 
2 147 THR n 
2 148 GLY n 
2 149 VAL n 
2 150 GLY n 
2 151 LEU n 
2 152 ILE n 
2 153 ALA n 
2 154 SER n 
2 155 GLY n 
2 156 GLN n 
2 157 CYS n 
2 158 ASP n 
2 159 VAL n 
2 160 ILE n 
2 161 VAL n 
2 162 ALA n 
2 163 GLY n 
2 164 GLY n 
2 165 VAL n 
2 166 GLU n 
2 167 LEU n 
2 168 MET n 
2 169 SER n 
2 170 ASP n 
2 171 VAL n 
2 172 PRO n 
2 173 ILE n 
2 174 ARG n 
2 175 HIS n 
2 176 SER n 
2 177 ARG n 
2 178 LYS n 
2 179 MET n 
2 180 ARG n 
2 181 LYS n 
2 182 LEU n 
2 183 MET n 
2 184 LEU n 
2 185 ASP n 
2 186 LEU n 
2 187 ASN n 
2 188 LYS n 
2 189 ALA n 
2 190 LYS n 
2 191 SER n 
2 192 MET n 
2 193 GLY n 
2 194 GLN n 
2 195 ARG n 
2 196 LEU n 
2 197 SER n 
2 198 LEU n 
2 199 ILE n 
2 200 SER n 
2 201 LYS n 
2 202 PHE n 
2 203 ARG n 
2 204 PHE n 
2 205 ASN n 
2 206 PHE n 
2 207 LEU n 
2 208 ALA n 
2 209 PRO n 
2 210 GLU n 
2 211 LEU n 
2 212 PRO n 
2 213 ALA n 
2 214 VAL n 
2 215 SER n 
2 216 GLU n 
2 217 PHE n 
2 218 SER n 
2 219 THR n 
2 220 SER n 
2 221 GLU n 
2 222 THR n 
2 223 MET n 
2 224 GLY n 
2 225 HIS n 
2 226 SER n 
2 227 ALA n 
2 228 ASP n 
2 229 ARG n 
2 230 LEU n 
2 231 ALA n 
2 232 ALA n 
2 233 ALA n 
2 234 PHE n 
2 235 ALA n 
2 236 VAL n 
2 237 SER n 
2 238 ARG n 
2 239 LEU n 
2 240 GLU n 
2 241 GLN n 
2 242 ASP n 
2 243 GLU n 
2 244 TYR n 
2 245 ALA n 
2 246 LEU n 
2 247 ARG n 
2 248 SER n 
2 249 HIS n 
2 250 SER n 
2 251 LEU n 
2 252 ALA n 
2 253 LYS n 
2 254 LYS n 
2 255 ALA n 
2 256 GLN n 
2 257 ASP n 
2 258 GLU n 
2 259 GLY n 
2 260 LEU n 
2 261 LEU n 
2 262 SER n 
2 263 ASP n 
2 264 VAL n 
2 265 VAL n 
2 266 PRO n 
2 267 PHE n 
2 268 LYS n 
2 269 VAL n 
2 270 PRO n 
2 271 GLY n 
2 272 LYS n 
2 273 ASP n 
2 274 THR n 
2 275 VAL n 
2 276 THR n 
2 277 LYS n 
2 278 ASP n 
2 279 ASN n 
2 280 GLY n 
2 281 ILE n 
2 282 ARG n 
2 283 PRO n 
2 284 SER n 
2 285 SER n 
2 286 LEU n 
2 287 GLU n 
2 288 GLN n 
2 289 MET n 
2 290 ALA n 
2 291 LYS n 
2 292 LEU n 
2 293 LYS n 
2 294 PRO n 
2 295 ALA n 
2 296 PHE n 
2 297 ILE n 
2 298 LYS n 
2 299 PRO n 
2 300 TYR n 
2 301 GLY n 
2 302 THR n 
2 303 VAL n 
2 304 THR n 
2 305 ALA n 
2 306 ALA n 
2 307 ASN n 
2 308 SER n 
2 309 SER n 
2 310 PHE n 
2 311 LEU n 
2 312 THR n 
2 313 ASP n 
2 314 GLY n 
2 315 ALA n 
2 316 SER n 
2 317 ALA n 
2 318 MET n 
2 319 LEU n 
2 320 ILE n 
2 321 MET n 
2 322 ALA n 
2 323 GLU n 
2 324 GLU n 
2 325 LYS n 
2 326 ALA n 
2 327 LEU n 
2 328 ALA n 
2 329 MET n 
2 330 GLY n 
2 331 TYR n 
2 332 LYS n 
2 333 PRO n 
2 334 LYS n 
2 335 ALA n 
2 336 TYR n 
2 337 LEU n 
2 338 ARG n 
2 339 ASP n 
2 340 PHE n 
2 341 MET n 
2 342 TYR n 
2 343 VAL n 
2 344 SER n 
2 345 GLN n 
2 346 ASP n 
2 347 PRO n 
2 348 LYS n 
2 349 ASP n 
2 350 GLN n 
2 351 LEU n 
2 352 LEU n 
2 353 LEU n 
2 354 GLY n 
2 355 PRO n 
2 356 THR n 
2 357 TYR n 
2 358 ALA n 
2 359 THR n 
2 360 PRO n 
2 361 LYS n 
2 362 VAL n 
2 363 LEU n 
2 364 GLU n 
2 365 LYS n 
2 366 ALA n 
2 367 GLY n 
2 368 LEU n 
2 369 THR n 
2 370 MET n 
2 371 ASN n 
2 372 ASP n 
2 373 ILE n 
2 374 ASP n 
2 375 ALA n 
2 376 PHE n 
2 377 GLU n 
2 378 PHE n 
2 379 HIS n 
2 380 GLU n 
2 381 ALA n 
2 382 PHE n 
2 383 SER n 
2 384 GLY n 
2 385 GLN n 
2 386 ILE n 
2 387 LEU n 
2 388 ALA n 
2 389 ASN n 
2 390 PHE n 
2 391 LYS n 
2 392 ALA n 
2 393 MET n 
2 394 ASP n 
2 395 SER n 
2 396 ASP n 
2 397 TRP n 
2 398 PHE n 
2 399 ALA n 
2 400 GLU n 
2 401 ASN n 
2 402 TYR n 
2 403 MET n 
2 404 GLY n 
2 405 ARG n 
2 406 LYS n 
2 407 THR n 
2 408 LYS n 
2 409 VAL n 
2 410 GLY n 
2 411 LEU n 
2 412 PRO n 
2 413 PRO n 
2 414 LEU n 
2 415 GLU n 
2 416 LYS n 
2 417 PHE n 
2 418 ASN n 
2 419 ASN n 
2 420 TRP n 
2 421 GLY n 
2 422 GLY n 
2 423 SER n 
2 424 LEU n 
2 425 SER n 
2 426 LEU n 
2 427 GLY n 
2 428 HIS n 
2 429 PRO n 
2 430 PHE n 
2 431 GLY n 
2 432 ALA n 
2 433 THR n 
2 434 GLY n 
2 435 CYS n 
2 436 ARG n 
2 437 LEU n 
2 438 VAL n 
2 439 MET n 
2 440 ALA n 
2 441 ALA n 
2 442 ALA n 
2 443 ASN n 
2 444 ARG n 
2 445 LEU n 
2 446 ARG n 
2 447 LYS n 
2 448 GLU n 
2 449 GLY n 
2 450 GLY n 
2 451 GLN n 
2 452 TYR n 
2 453 GLY n 
2 454 LEU n 
2 455 VAL n 
2 456 ALA n 
2 457 ALA n 
2 458 CYS n 
2 459 ALA n 
2 460 ALA n 
2 461 GLY n 
2 462 GLY n 
2 463 GLN n 
2 464 GLY n 
2 465 HIS n 
2 466 ALA n 
2 467 MET n 
2 468 ILE n 
2 469 VAL n 
2 470 GLU n 
2 471 ALA n 
2 472 TYR n 
2 473 PRO n 
2 474 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 763 Human ? 'HADHA, HADH'    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 474 Human ? 'HADHB, MSTP029' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ECHA_HUMAN P40939 ? 1 
;MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIW
ASDQIRSAVLISSKPGCFIAGADINMLAACKTLQEVTQLSQEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRI
ATKDRKTVLGTPEVLLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAITFAKGLADKKISPKRDKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIIDVVKTGIEQGSDAGY
LCESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTALDRG
QQQVFKGLNDKVKKKALTSFERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIR
ILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQ
EGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
;
1 
2 UNP ECHB_HUMAN P55084 ? 2 
;MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLA
RAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVI
VAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLE
QDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLI
MAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE
NYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ZRV A 1 ? 763 ? P40939 1 ? 763 ? 1 763 
2 2 5ZRV B 1 ? 474 ? P55084 1 ? 474 ? 1 474 
3 1 5ZRV C 1 ? 763 ? P40939 1 ? 763 ? 1 763 
4 2 5ZRV D 1 ? 474 ? P55084 1 ? 474 ? 1 474 
5 1 5ZRV E 1 ? 763 ? P40939 1 ? 763 ? 1 763 
6 2 5ZRV F 1 ? 474 ? P55084 1 ? 474 ? 1 474 
7 1 5ZRV G 1 ? 763 ? P40939 1 ? 763 ? 1 763 
8 2 5ZRV H 1 ? 474 ? P55084 1 ? 474 ? 1 474 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZRV 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ZRV 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.007  ? 17740 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.359  ? 22112 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 11.711 ? 4408  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.000  ? 0     ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.008  ? 4408  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5ZRV 
_struct.title                        'Structure of human mitochondrial trifunctional protein, octamer' 
_struct.pdbx_descriptor              
;Trifunctional enzyme subunit alpha, mitochondrial (E.C.4.2.1.17,1.1.1.211), Trifunctional enzyme subunit beta, mitochondrial (E.C.2.3.1.16)
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZRV 
_struct_keywords.text            
;fatty acid beta-oxidation, cryo-EM single-particle reconstruction, mitochondrial trifunctional protein, Liase, Oxidoreductase-Transferase complex
;
_struct_keywords.pdbx_keywords   'Liase, Oxidoreductase/Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 65  ? ALA A 81  ? SER A 65  ALA A 81  1 ? 17 
HELX_P HELX_P2   AA2 ASP A 103 ? ALA A 108 ? ASP A 103 ALA A 108 1 ? 6  
HELX_P HELX_P3   AA3 THR A 112 ? ILE A 126 ? THR A 112 ILE A 126 1 ? 15 
HELX_P HELX_P4   AA4 ILE A 126 ? GLU A 131 ? ILE A 126 GLU A 131 1 ? 6  
HELX_P HELX_P5   AA5 GLY A 148 ? ILE A 154 ? GLY A 148 ILE A 154 1 ? 7  
HELX_P HELX_P6   AA6 GLY A 183 ? GLN A 186 ? GLY A 183 GLN A 186 5 ? 4  
HELX_P HELX_P7   AA7 ARG A 187 ? VAL A 192 ? ARG A 187 VAL A 192 1 ? 6  
HELX_P HELX_P8   AA8 GLY A 193 ? LEU A 202 ? GLY A 193 LEU A 202 1 ? 10 
HELX_P HELX_P9   AA9 ASP A 210 ? GLY A 216 ? ASP A 210 GLY A 216 1 ? 7  
HELX_P HELX_P10  AB1 GLU A 233 ? ASP A 253 ? GLU A 233 ASP A 253 1 ? 21 
HELX_P HELX_P11  AB2 LYS A 267 ? ALA A 272 ? LYS A 267 ALA A 272 1 ? 6  
HELX_P HELX_P12  AB3 ARG A 279 ? THR A 294 ? ARG A 279 THR A 294 1 ? 16 
HELX_P HELX_P13  AB4 PRO A 301 ? ILE A 312 ? PRO A 301 ILE A 312 1 ? 12 
HELX_P HELX_P14  AB5 ASP A 317 ? CYS A 322 ? ASP A 317 CYS A 322 5 ? 6  
HELX_P HELX_P15  AB6 GLU A 323 ? MET A 332 ? GLU A 323 MET A 332 1 ? 10 
HELX_P HELX_P16  AB7 ALA A 338 ? CYS A 349 ? ALA A 338 CYS A 349 1 ? 12 
HELX_P HELX_P17  AB8 MET A 372 ? SER A 380 ? MET A 372 SER A 380 1 ? 9  
HELX_P HELX_P18  AB9 THR A 393 ? ALA A 396 ? THR A 393 ALA A 396 5 ? 4  
HELX_P HELX_P19  AC1 LEU A 397 ? PHE A 405 ? LEU A 397 PHE A 405 1 ? 9  
HELX_P HELX_P20  AC2 PHE A 405 ? LYS A 414 ? PHE A 405 LYS A 414 1 ? 10 
HELX_P HELX_P21  AC3 THR A 418 ? SER A 427 ? THR A 418 SER A 427 1 ? 10 
HELX_P HELX_P22  AC4 SER A 453 ? VAL A 462 ? SER A 453 VAL A 462 1 ? 10 
HELX_P HELX_P23  AC5 SER A 518 ? GLY A 533 ? SER A 518 GLY A 533 1 ? 16 
HELX_P HELX_P24  AC6 TYR A 546 ? SER A 556 ? TYR A 546 SER A 556 1 ? 11 
HELX_P HELX_P25  AC7 GLU A 557 ? LEU A 562 ? GLU A 557 LEU A 562 1 ? 6  
HELX_P HELX_P26  AC8 PRO A 568 ? GLY A 579 ? PRO A 568 GLY A 579 1 ? 12 
HELX_P HELX_P27  AC9 GLY A 583 ? GLY A 592 ? GLY A 583 GLY A 592 1 ? 10 
HELX_P HELX_P28  AD1 GLY A 592 ? LYS A 605 ? GLY A 592 LYS A 605 1 ? 14 
HELX_P HELX_P29  AD2 LEU A 618 ? GLY A 626 ? LEU A 618 GLY A 626 1 ? 9  
HELX_P HELX_P30  AD3 LEU A 628 ? GLY A 633 ? LEU A 628 GLY A 633 5 ? 6  
HELX_P HELX_P31  AD4 ASP A 651 ? ALA A 657 ? ASP A 651 ALA A 657 1 ? 7  
HELX_P HELX_P32  AD5 SER A 669 ? CYS A 688 ? SER A 669 CYS A 688 1 ? 20 
HELX_P HELX_P33  AD6 THR A 696 ? GLU A 699 ? THR A 696 GLU A 699 5 ? 4  
HELX_P HELX_P34  AD7 GLY A 700 ? VAL A 705 ? GLY A 700 VAL A 705 1 ? 6  
HELX_P HELX_P35  AD8 GLY A 716 ? PHE A 720 ? GLY A 716 PHE A 720 5 ? 5  
HELX_P HELX_P36  AD9 GLY A 725 ? TYR A 736 ? GLY A 725 TYR A 736 1 ? 12 
HELX_P HELX_P37  AE1 CYS A 747 ? HIS A 753 ? CYS A 747 HIS A 753 1 ? 7  
HELX_P HELX_P38  AE2 THR B 69  ? ASP B 73  ? THR B 69  ASP B 73  5 ? 5  
HELX_P HELX_P39  AE3 HIS B 77  ? LEU B 88  ? HIS B 77  LEU B 88  1 ? 12 
HELX_P HELX_P40  AE4 ASN B 114 ? GLY B 122 ? ASN B 114 GLY B 122 1 ? 9  
HELX_P HELX_P41  AE5 GLN B 143 ? SER B 154 ? GLN B 143 SER B 154 1 ? 12 
HELX_P HELX_P42  AE6 LYS B 178 ? LEU B 186 ? LYS B 178 LEU B 186 5 ? 9  
HELX_P HELX_P43  AE7 GLN B 194 ? LYS B 201 ? GLN B 194 LYS B 201 1 ? 8  
HELX_P HELX_P44  AE8 THR B 222 ? PHE B 234 ? THR B 222 PHE B 234 1 ? 13 
HELX_P HELX_P45  AE9 LEU B 239 ? GLY B 259 ? LEU B 239 GLY B 259 1 ? 21 
HELX_P HELX_P46  AF1 GLU B 323 ? GLY B 330 ? GLU B 323 GLY B 330 1 ? 8  
HELX_P HELX_P47  AF2 GLY B 354 ? TYR B 357 ? GLY B 354 TYR B 357 5 ? 4  
HELX_P HELX_P48  AF3 ALA B 358 ? GLY B 367 ? ALA B 358 GLY B 367 1 ? 10 
HELX_P HELX_P49  AF4 GLY B 384 ? ALA B 392 ? GLY B 384 ALA B 392 1 ? 9  
HELX_P HELX_P50  AF5 MET B 393 ? SER B 395 ? MET B 393 SER B 395 5 ? 3  
HELX_P HELX_P51  AF6 VAL B 438 ? GLU B 448 ? VAL B 438 GLU B 448 1 ? 11 
HELX_P HELX_P52  AF7 SER C 65  ? ALA C 81  ? SER C 65  ALA C 81  1 ? 17 
HELX_P HELX_P53  AF8 ASP C 103 ? ALA C 108 ? ASP C 103 ALA C 108 1 ? 6  
HELX_P HELX_P54  AF9 THR C 112 ? ILE C 126 ? THR C 112 ILE C 126 1 ? 15 
HELX_P HELX_P55  AG1 ILE C 126 ? GLU C 131 ? ILE C 126 GLU C 131 1 ? 6  
HELX_P HELX_P56  AG2 GLY C 148 ? ILE C 154 ? GLY C 148 ILE C 154 1 ? 7  
HELX_P HELX_P57  AG3 GLY C 183 ? GLN C 186 ? GLY C 183 GLN C 186 5 ? 4  
HELX_P HELX_P58  AG4 ARG C 187 ? VAL C 192 ? ARG C 187 VAL C 192 1 ? 6  
HELX_P HELX_P59  AG5 GLY C 193 ? LEU C 202 ? GLY C 193 LEU C 202 1 ? 10 
HELX_P HELX_P60  AG6 ASP C 210 ? GLY C 216 ? ASP C 210 GLY C 216 1 ? 7  
HELX_P HELX_P61  AG7 GLU C 233 ? ASP C 253 ? GLU C 233 ASP C 253 1 ? 21 
HELX_P HELX_P62  AG8 LYS C 267 ? ALA C 272 ? LYS C 267 ALA C 272 1 ? 6  
HELX_P HELX_P63  AG9 ARG C 279 ? THR C 294 ? ARG C 279 THR C 294 1 ? 16 
HELX_P HELX_P64  AH1 PRO C 301 ? ILE C 312 ? PRO C 301 ILE C 312 1 ? 12 
HELX_P HELX_P65  AH2 ASP C 317 ? CYS C 322 ? ASP C 317 CYS C 322 5 ? 6  
HELX_P HELX_P66  AH3 GLU C 323 ? MET C 332 ? GLU C 323 MET C 332 1 ? 10 
HELX_P HELX_P67  AH4 ALA C 338 ? CYS C 349 ? ALA C 338 CYS C 349 1 ? 12 
HELX_P HELX_P68  AH5 MET C 372 ? SER C 380 ? MET C 372 SER C 380 1 ? 9  
HELX_P HELX_P69  AH6 THR C 393 ? ALA C 396 ? THR C 393 ALA C 396 5 ? 4  
HELX_P HELX_P70  AH7 LEU C 397 ? PHE C 405 ? LEU C 397 PHE C 405 1 ? 9  
HELX_P HELX_P71  AH8 PHE C 405 ? LYS C 414 ? PHE C 405 LYS C 414 1 ? 10 
HELX_P HELX_P72  AH9 THR C 418 ? SER C 427 ? THR C 418 SER C 427 1 ? 10 
HELX_P HELX_P73  AI1 SER C 453 ? VAL C 462 ? SER C 453 VAL C 462 1 ? 10 
HELX_P HELX_P74  AI2 SER C 518 ? GLY C 533 ? SER C 518 GLY C 533 1 ? 16 
HELX_P HELX_P75  AI3 TYR C 546 ? SER C 556 ? TYR C 546 SER C 556 1 ? 11 
HELX_P HELX_P76  AI4 GLU C 557 ? LEU C 562 ? GLU C 557 LEU C 562 1 ? 6  
HELX_P HELX_P77  AI5 PRO C 568 ? GLY C 579 ? PRO C 568 GLY C 579 1 ? 12 
HELX_P HELX_P78  AI6 GLY C 583 ? GLY C 592 ? GLY C 583 GLY C 592 1 ? 10 
HELX_P HELX_P79  AI7 GLY C 592 ? LYS C 605 ? GLY C 592 LYS C 605 1 ? 14 
HELX_P HELX_P80  AI8 LEU C 618 ? GLY C 626 ? LEU C 618 GLY C 626 1 ? 9  
HELX_P HELX_P81  AI9 LEU C 628 ? GLY C 633 ? LEU C 628 GLY C 633 5 ? 6  
HELX_P HELX_P82  AJ1 ASP C 651 ? ALA C 657 ? ASP C 651 ALA C 657 1 ? 7  
HELX_P HELX_P83  AJ2 SER C 669 ? CYS C 688 ? SER C 669 CYS C 688 1 ? 20 
HELX_P HELX_P84  AJ3 THR C 696 ? GLU C 699 ? THR C 696 GLU C 699 5 ? 4  
HELX_P HELX_P85  AJ4 GLY C 700 ? VAL C 705 ? GLY C 700 VAL C 705 1 ? 6  
HELX_P HELX_P86  AJ5 GLY C 716 ? PHE C 720 ? GLY C 716 PHE C 720 5 ? 5  
HELX_P HELX_P87  AJ6 GLY C 725 ? TYR C 736 ? GLY C 725 TYR C 736 1 ? 12 
HELX_P HELX_P88  AJ7 CYS C 747 ? HIS C 753 ? CYS C 747 HIS C 753 1 ? 7  
HELX_P HELX_P89  AJ8 THR D 69  ? ASP D 73  ? THR D 69  ASP D 73  5 ? 5  
HELX_P HELX_P90  AJ9 HIS D 77  ? LEU D 88  ? HIS D 77  LEU D 88  1 ? 12 
HELX_P HELX_P91  AK1 ASN D 114 ? GLY D 122 ? ASN D 114 GLY D 122 1 ? 9  
HELX_P HELX_P92  AK2 GLN D 143 ? SER D 154 ? GLN D 143 SER D 154 1 ? 12 
HELX_P HELX_P93  AK3 LYS D 178 ? LEU D 186 ? LYS D 178 LEU D 186 5 ? 9  
HELX_P HELX_P94  AK4 GLN D 194 ? LYS D 201 ? GLN D 194 LYS D 201 1 ? 8  
HELX_P HELX_P95  AK5 THR D 222 ? PHE D 234 ? THR D 222 PHE D 234 1 ? 13 
HELX_P HELX_P96  AK6 LEU D 239 ? GLY D 259 ? LEU D 239 GLY D 259 1 ? 21 
HELX_P HELX_P97  AK7 GLU D 323 ? GLY D 330 ? GLU D 323 GLY D 330 1 ? 8  
HELX_P HELX_P98  AK8 GLY D 354 ? TYR D 357 ? GLY D 354 TYR D 357 5 ? 4  
HELX_P HELX_P99  AK9 ALA D 358 ? GLY D 367 ? ALA D 358 GLY D 367 1 ? 10 
HELX_P HELX_P100 AL1 GLY D 384 ? ALA D 392 ? GLY D 384 ALA D 392 1 ? 9  
HELX_P HELX_P101 AL2 MET D 393 ? SER D 395 ? MET D 393 SER D 395 5 ? 3  
HELX_P HELX_P102 AL3 VAL D 438 ? GLU D 448 ? VAL D 438 GLU D 448 1 ? 11 
HELX_P HELX_P103 AL4 SER E 65  ? ALA E 81  ? SER E 65  ALA E 81  1 ? 17 
HELX_P HELX_P104 AL5 ASP E 103 ? ALA E 108 ? ASP E 103 ALA E 108 1 ? 6  
HELX_P HELX_P105 AL6 THR E 112 ? ILE E 126 ? THR E 112 ILE E 126 1 ? 15 
HELX_P HELX_P106 AL7 ILE E 126 ? GLU E 131 ? ILE E 126 GLU E 131 1 ? 6  
HELX_P HELX_P107 AL8 GLY E 148 ? ILE E 154 ? GLY E 148 ILE E 154 1 ? 7  
HELX_P HELX_P108 AL9 GLY E 183 ? GLN E 186 ? GLY E 183 GLN E 186 5 ? 4  
HELX_P HELX_P109 AM1 ARG E 187 ? VAL E 192 ? ARG E 187 VAL E 192 1 ? 6  
HELX_P HELX_P110 AM2 GLY E 193 ? LEU E 202 ? GLY E 193 LEU E 202 1 ? 10 
HELX_P HELX_P111 AM3 ASP E 210 ? GLY E 216 ? ASP E 210 GLY E 216 1 ? 7  
HELX_P HELX_P112 AM4 GLU E 233 ? ASP E 253 ? GLU E 233 ASP E 253 1 ? 21 
HELX_P HELX_P113 AM5 LYS E 267 ? ALA E 272 ? LYS E 267 ALA E 272 1 ? 6  
HELX_P HELX_P114 AM6 ARG E 279 ? THR E 294 ? ARG E 279 THR E 294 1 ? 16 
HELX_P HELX_P115 AM7 PRO E 301 ? ILE E 312 ? PRO E 301 ILE E 312 1 ? 12 
HELX_P HELX_P116 AM8 ASP E 317 ? CYS E 322 ? ASP E 317 CYS E 322 5 ? 6  
HELX_P HELX_P117 AM9 GLU E 323 ? MET E 332 ? GLU E 323 MET E 332 1 ? 10 
HELX_P HELX_P118 AN1 ALA E 338 ? CYS E 349 ? ALA E 338 CYS E 349 1 ? 12 
HELX_P HELX_P119 AN2 MET E 372 ? SER E 380 ? MET E 372 SER E 380 1 ? 9  
HELX_P HELX_P120 AN3 THR E 393 ? ALA E 396 ? THR E 393 ALA E 396 5 ? 4  
HELX_P HELX_P121 AN4 LEU E 397 ? PHE E 405 ? LEU E 397 PHE E 405 1 ? 9  
HELX_P HELX_P122 AN5 PHE E 405 ? LYS E 414 ? PHE E 405 LYS E 414 1 ? 10 
HELX_P HELX_P123 AN6 THR E 418 ? SER E 427 ? THR E 418 SER E 427 1 ? 10 
HELX_P HELX_P124 AN7 SER E 453 ? VAL E 462 ? SER E 453 VAL E 462 1 ? 10 
HELX_P HELX_P125 AN8 SER E 518 ? GLY E 533 ? SER E 518 GLY E 533 1 ? 16 
HELX_P HELX_P126 AN9 TYR E 546 ? SER E 556 ? TYR E 546 SER E 556 1 ? 11 
HELX_P HELX_P127 AO1 GLU E 557 ? LEU E 562 ? GLU E 557 LEU E 562 1 ? 6  
HELX_P HELX_P128 AO2 PRO E 568 ? GLY E 579 ? PRO E 568 GLY E 579 1 ? 12 
HELX_P HELX_P129 AO3 GLY E 583 ? GLY E 592 ? GLY E 583 GLY E 592 1 ? 10 
HELX_P HELX_P130 AO4 GLY E 592 ? LYS E 605 ? GLY E 592 LYS E 605 1 ? 14 
HELX_P HELX_P131 AO5 LEU E 618 ? GLY E 626 ? LEU E 618 GLY E 626 1 ? 9  
HELX_P HELX_P132 AO6 LEU E 628 ? GLY E 633 ? LEU E 628 GLY E 633 5 ? 6  
HELX_P HELX_P133 AO7 ASP E 651 ? ALA E 657 ? ASP E 651 ALA E 657 1 ? 7  
HELX_P HELX_P134 AO8 SER E 669 ? CYS E 688 ? SER E 669 CYS E 688 1 ? 20 
HELX_P HELX_P135 AO9 THR E 696 ? GLU E 699 ? THR E 696 GLU E 699 5 ? 4  
HELX_P HELX_P136 AP1 GLY E 700 ? VAL E 705 ? GLY E 700 VAL E 705 1 ? 6  
HELX_P HELX_P137 AP2 GLY E 716 ? PHE E 720 ? GLY E 716 PHE E 720 5 ? 5  
HELX_P HELX_P138 AP3 GLY E 725 ? TYR E 736 ? GLY E 725 TYR E 736 1 ? 12 
HELX_P HELX_P139 AP4 CYS E 747 ? HIS E 753 ? CYS E 747 HIS E 753 1 ? 7  
HELX_P HELX_P140 AP5 THR F 69  ? ASP F 73  ? THR F 69  ASP F 73  5 ? 5  
HELX_P HELX_P141 AP6 HIS F 77  ? LEU F 88  ? HIS F 77  LEU F 88  1 ? 12 
HELX_P HELX_P142 AP7 ASN F 114 ? GLY F 122 ? ASN F 114 GLY F 122 1 ? 9  
HELX_P HELX_P143 AP8 GLN F 143 ? SER F 154 ? GLN F 143 SER F 154 1 ? 12 
HELX_P HELX_P144 AP9 LYS F 178 ? LEU F 186 ? LYS F 178 LEU F 186 5 ? 9  
HELX_P HELX_P145 AQ1 GLN F 194 ? LYS F 201 ? GLN F 194 LYS F 201 1 ? 8  
HELX_P HELX_P146 AQ2 THR F 222 ? PHE F 234 ? THR F 222 PHE F 234 1 ? 13 
HELX_P HELX_P147 AQ3 LEU F 239 ? GLY F 259 ? LEU F 239 GLY F 259 1 ? 21 
HELX_P HELX_P148 AQ4 GLU F 323 ? GLY F 330 ? GLU F 323 GLY F 330 1 ? 8  
HELX_P HELX_P149 AQ5 GLY F 354 ? TYR F 357 ? GLY F 354 TYR F 357 5 ? 4  
HELX_P HELX_P150 AQ6 ALA F 358 ? GLY F 367 ? ALA F 358 GLY F 367 1 ? 10 
HELX_P HELX_P151 AQ7 GLY F 384 ? ALA F 392 ? GLY F 384 ALA F 392 1 ? 9  
HELX_P HELX_P152 AQ8 MET F 393 ? SER F 395 ? MET F 393 SER F 395 5 ? 3  
HELX_P HELX_P153 AQ9 VAL F 438 ? GLU F 448 ? VAL F 438 GLU F 448 1 ? 11 
HELX_P HELX_P154 AR1 SER G 65  ? ALA G 81  ? SER G 65  ALA G 81  1 ? 17 
HELX_P HELX_P155 AR2 ASP G 103 ? ALA G 108 ? ASP G 103 ALA G 108 1 ? 6  
HELX_P HELX_P156 AR3 THR G 112 ? ILE G 126 ? THR G 112 ILE G 126 1 ? 15 
HELX_P HELX_P157 AR4 ILE G 126 ? GLU G 131 ? ILE G 126 GLU G 131 1 ? 6  
HELX_P HELX_P158 AR5 GLY G 148 ? ILE G 154 ? GLY G 148 ILE G 154 1 ? 7  
HELX_P HELX_P159 AR6 GLY G 183 ? GLN G 186 ? GLY G 183 GLN G 186 5 ? 4  
HELX_P HELX_P160 AR7 ARG G 187 ? VAL G 192 ? ARG G 187 VAL G 192 1 ? 6  
HELX_P HELX_P161 AR8 GLY G 193 ? LEU G 202 ? GLY G 193 LEU G 202 1 ? 10 
HELX_P HELX_P162 AR9 ASP G 210 ? GLY G 216 ? ASP G 210 GLY G 216 1 ? 7  
HELX_P HELX_P163 AS1 GLU G 233 ? ASP G 253 ? GLU G 233 ASP G 253 1 ? 21 
HELX_P HELX_P164 AS2 LYS G 267 ? ALA G 272 ? LYS G 267 ALA G 272 1 ? 6  
HELX_P HELX_P165 AS3 ARG G 279 ? THR G 294 ? ARG G 279 THR G 294 1 ? 16 
HELX_P HELX_P166 AS4 PRO G 301 ? ILE G 312 ? PRO G 301 ILE G 312 1 ? 12 
HELX_P HELX_P167 AS5 ASP G 317 ? CYS G 322 ? ASP G 317 CYS G 322 5 ? 6  
HELX_P HELX_P168 AS6 GLU G 323 ? MET G 332 ? GLU G 323 MET G 332 1 ? 10 
HELX_P HELX_P169 AS7 ALA G 338 ? CYS G 349 ? ALA G 338 CYS G 349 1 ? 12 
HELX_P HELX_P170 AS8 MET G 372 ? SER G 380 ? MET G 372 SER G 380 1 ? 9  
HELX_P HELX_P171 AS9 THR G 393 ? ALA G 396 ? THR G 393 ALA G 396 5 ? 4  
HELX_P HELX_P172 AT1 LEU G 397 ? PHE G 405 ? LEU G 397 PHE G 405 1 ? 9  
HELX_P HELX_P173 AT2 PHE G 405 ? LYS G 414 ? PHE G 405 LYS G 414 1 ? 10 
HELX_P HELX_P174 AT3 THR G 418 ? SER G 427 ? THR G 418 SER G 427 1 ? 10 
HELX_P HELX_P175 AT4 SER G 453 ? VAL G 462 ? SER G 453 VAL G 462 1 ? 10 
HELX_P HELX_P176 AT5 SER G 518 ? GLY G 533 ? SER G 518 GLY G 533 1 ? 16 
HELX_P HELX_P177 AT6 TYR G 546 ? SER G 556 ? TYR G 546 SER G 556 1 ? 11 
HELX_P HELX_P178 AT7 GLU G 557 ? LEU G 562 ? GLU G 557 LEU G 562 1 ? 6  
HELX_P HELX_P179 AT8 PRO G 568 ? GLY G 579 ? PRO G 568 GLY G 579 1 ? 12 
HELX_P HELX_P180 AT9 GLY G 583 ? GLY G 592 ? GLY G 583 GLY G 592 1 ? 10 
HELX_P HELX_P181 AU1 GLY G 592 ? LYS G 605 ? GLY G 592 LYS G 605 1 ? 14 
HELX_P HELX_P182 AU2 LEU G 618 ? GLY G 626 ? LEU G 618 GLY G 626 1 ? 9  
HELX_P HELX_P183 AU3 LEU G 628 ? GLY G 633 ? LEU G 628 GLY G 633 5 ? 6  
HELX_P HELX_P184 AU4 ASP G 651 ? ALA G 657 ? ASP G 651 ALA G 657 1 ? 7  
HELX_P HELX_P185 AU5 SER G 669 ? CYS G 688 ? SER G 669 CYS G 688 1 ? 20 
HELX_P HELX_P186 AU6 THR G 696 ? GLU G 699 ? THR G 696 GLU G 699 5 ? 4  
HELX_P HELX_P187 AU7 GLY G 700 ? VAL G 705 ? GLY G 700 VAL G 705 1 ? 6  
HELX_P HELX_P188 AU8 GLY G 716 ? PHE G 720 ? GLY G 716 PHE G 720 5 ? 5  
HELX_P HELX_P189 AU9 GLY G 725 ? TYR G 736 ? GLY G 725 TYR G 736 1 ? 12 
HELX_P HELX_P190 AV1 CYS G 747 ? HIS G 753 ? CYS G 747 HIS G 753 1 ? 7  
HELX_P HELX_P191 AV2 THR H 69  ? ASP H 73  ? THR H 69  ASP H 73  5 ? 5  
HELX_P HELX_P192 AV3 HIS H 77  ? LEU H 88  ? HIS H 77  LEU H 88  1 ? 12 
HELX_P HELX_P193 AV4 ASN H 114 ? GLY H 122 ? ASN H 114 GLY H 122 1 ? 9  
HELX_P HELX_P194 AV5 GLN H 143 ? SER H 154 ? GLN H 143 SER H 154 1 ? 12 
HELX_P HELX_P195 AV6 LYS H 178 ? LEU H 186 ? LYS H 178 LEU H 186 5 ? 9  
HELX_P HELX_P196 AV7 GLN H 194 ? LYS H 201 ? GLN H 194 LYS H 201 1 ? 8  
HELX_P HELX_P197 AV8 THR H 222 ? PHE H 234 ? THR H 222 PHE H 234 1 ? 13 
HELX_P HELX_P198 AV9 LEU H 239 ? GLY H 259 ? LEU H 239 GLY H 259 1 ? 21 
HELX_P HELX_P199 AW1 GLU H 323 ? GLY H 330 ? GLU H 323 GLY H 330 1 ? 8  
HELX_P HELX_P200 AW2 GLY H 354 ? TYR H 357 ? GLY H 354 TYR H 357 5 ? 4  
HELX_P HELX_P201 AW3 ALA H 358 ? GLY H 367 ? ALA H 358 GLY H 367 1 ? 10 
HELX_P HELX_P202 AW4 GLY H 384 ? ALA H 392 ? GLY H 384 ALA H 392 1 ? 9  
HELX_P HELX_P203 AW5 MET H 393 ? SER H 395 ? MET H 393 SER H 395 5 ? 3  
HELX_P HELX_P204 AW6 VAL H 438 ? GLU H 448 ? VAL H 438 GLU H 448 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 4  ? 
AA3 ? 3  ? 
AA4 ? 2  ? 
AA5 ? 5  ? 
AA6 ? 3  ? 
AA7 ? 10 ? 
AA8 ? 12 ? 
AA9 ? 4  ? 
AB1 ? 3  ? 
AB2 ? 4  ? 
AB3 ? 3  ? 
AB4 ? 2  ? 
AB5 ? 5  ? 
AB6 ? 3  ? 
AB7 ? 4  ? 
AB8 ? 3  ? 
AB9 ? 4  ? 
AC1 ? 3  ? 
AC2 ? 2  ? 
AC3 ? 5  ? 
AC4 ? 3  ? 
AC5 ? 10 ? 
AC6 ? 12 ? 
AC7 ? 4  ? 
AC8 ? 3  ? 
AC9 ? 4  ? 
AD1 ? 3  ? 
AD2 ? 2  ? 
AD3 ? 5  ? 
AD4 ? 3  ? 
AD5 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? parallel      
AA2 3  4  ? parallel      
AA3 1  2  ? parallel      
AA3 2  3  ? anti-parallel 
AA4 1  2  ? parallel      
AA5 1  2  ? parallel      
AA5 2  3  ? parallel      
AA5 3  4  ? parallel      
AA5 4  5  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? parallel      
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? parallel      
AA7 4  5  ? parallel      
AA7 5  6  ? anti-parallel 
AA7 6  7  ? parallel      
AA7 7  8  ? parallel      
AA7 8  9  ? anti-parallel 
AA7 9  10 ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA8 2  3  ? anti-parallel 
AA8 3  4  ? anti-parallel 
AA8 4  5  ? parallel      
AA8 5  6  ? parallel      
AA8 6  7  ? anti-parallel 
AA8 7  8  ? parallel      
AA8 8  9  ? parallel      
AA8 9  10 ? anti-parallel 
AA8 10 11 ? anti-parallel 
AA8 11 12 ? anti-parallel 
AA9 1  2  ? anti-parallel 
AA9 2  3  ? anti-parallel 
AA9 3  4  ? parallel      
AB1 1  2  ? anti-parallel 
AB1 2  3  ? anti-parallel 
AB2 1  2  ? anti-parallel 
AB2 2  3  ? parallel      
AB2 3  4  ? parallel      
AB3 1  2  ? parallel      
AB3 2  3  ? anti-parallel 
AB4 1  2  ? parallel      
AB5 1  2  ? parallel      
AB5 2  3  ? parallel      
AB5 3  4  ? parallel      
AB5 4  5  ? parallel      
AB6 1  2  ? anti-parallel 
AB6 2  3  ? parallel      
AB7 1  2  ? anti-parallel 
AB7 2  3  ? anti-parallel 
AB7 3  4  ? parallel      
AB8 1  2  ? anti-parallel 
AB8 2  3  ? anti-parallel 
AB9 1  2  ? anti-parallel 
AB9 2  3  ? parallel      
AB9 3  4  ? parallel      
AC1 1  2  ? parallel      
AC1 2  3  ? anti-parallel 
AC2 1  2  ? parallel      
AC3 1  2  ? parallel      
AC3 2  3  ? parallel      
AC3 3  4  ? parallel      
AC3 4  5  ? parallel      
AC4 1  2  ? anti-parallel 
AC4 2  3  ? parallel      
AC5 1  2  ? anti-parallel 
AC5 2  3  ? anti-parallel 
AC5 3  4  ? parallel      
AC5 4  5  ? parallel      
AC5 5  6  ? anti-parallel 
AC5 6  7  ? parallel      
AC5 7  8  ? parallel      
AC5 8  9  ? anti-parallel 
AC5 9  10 ? anti-parallel 
AC6 1  2  ? anti-parallel 
AC6 2  3  ? anti-parallel 
AC6 3  4  ? anti-parallel 
AC6 4  5  ? parallel      
AC6 5  6  ? parallel      
AC6 6  7  ? anti-parallel 
AC6 7  8  ? parallel      
AC6 8  9  ? parallel      
AC6 9  10 ? anti-parallel 
AC6 10 11 ? anti-parallel 
AC6 11 12 ? anti-parallel 
AC7 1  2  ? anti-parallel 
AC7 2  3  ? anti-parallel 
AC7 3  4  ? parallel      
AC8 1  2  ? anti-parallel 
AC8 2  3  ? anti-parallel 
AC9 1  2  ? anti-parallel 
AC9 2  3  ? parallel      
AC9 3  4  ? parallel      
AD1 1  2  ? parallel      
AD1 2  3  ? anti-parallel 
AD2 1  2  ? parallel      
AD3 1  2  ? parallel      
AD3 2  3  ? parallel      
AD3 3  4  ? parallel      
AD3 4  5  ? parallel      
AD4 1  2  ? anti-parallel 
AD4 2  3  ? parallel      
AD5 1  2  ? anti-parallel 
AD5 2  3  ? anti-parallel 
AD5 3  4  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ILE A 41  ? ASN A 42  ? ILE A 41  ASN A 42  
AA1 2  VAL A 49  ? ILE A 54  ? VAL A 49  ILE A 54  
AA1 3  VAL A 45  ? LYS A 46  ? VAL A 45  LYS A 46  
AA2 1  ILE A 41  ? ASN A 42  ? ILE A 41  ASN A 42  
AA2 2  VAL A 49  ? ILE A 54  ? VAL A 49  ILE A 54  
AA2 3  ALA A 88  ? SER A 92  ? ALA A 88  SER A 92  
AA2 4  ILE A 137 ? VAL A 138 ? ILE A 137 VAL A 138 
AA3 1  CYS A 145 ? LEU A 146 ? CYS A 145 LEU A 146 
AA3 2  VAL A 168 ? GLY A 170 ? VAL A 168 GLY A 170 
AA3 3  ILE A 207 ? ARG A 208 ? ILE A 207 ARG A 208 
AA4 1  ILE A 160 ? THR A 162 ? ILE A 160 THR A 162 
AA4 2  GLN A 220 ? VAL A 222 ? GLN A 220 VAL A 222 
AA5 1  LEU A 429 ? THR A 430 ? LEU A 429 THR A 430 
AA5 2  THR A 387 ? LYS A 390 ? THR A 387 LYS A 390 
AA5 3  ILE A 366 ? LEU A 367 ? ILE A 366 LEU A 367 
AA5 4  VAL A 444 ? GLU A 446 ? VAL A 444 GLU A 446 
AA5 5  PHE A 472 ? SER A 474 ? PHE A 472 SER A 474 
AA6 1  GLY A 496 ? HIS A 498 ? GLY A 496 HIS A 498 
AA6 2  GLU A 510 ? THR A 513 ? GLU A 510 THR A 513 
AA6 3  VAL A 538 ? LYS A 540 ? VAL A 538 LYS A 540 
AA7 1  LEU B 65  ? LEU B 66  ? LEU B 65  LEU B 66  
AA7 2  THR B 312 ? ALA B 317 ? THR B 312 ALA B 317 
AA7 3  VAL B 159 ? GLU B 166 ? VAL B 159 GLU B 166 
AA7 4  TYR B 100 ? PHE B 103 ? TYR B 100 PHE B 103 
AA7 5  HIS B 132 ? THR B 135 ? HIS B 132 THR B 135 
AA7 6  HIS D 132 ? THR D 135 ? HIS D 132 THR D 135 
AA7 7  TYR D 100 ? PHE D 103 ? TYR D 100 PHE D 103 
AA7 8  VAL D 159 ? GLU D 166 ? VAL D 159 GLU D 166 
AA7 9  THR D 312 ? ALA D 317 ? THR D 312 ALA D 317 
AA7 10 LEU D 65  ? LEU D 66  ? LEU D 65  LEU D 66  
AA8 1  ALA B 335 ? TYR B 336 ? ALA B 335 TYR B 336 
AA8 2  VAL B 54  ? VAL B 57  ? VAL B 54  VAL B 57  
AA8 3  LEU B 319 ? ALA B 322 ? LEU B 319 ALA B 322 
AA8 4  VAL B 159 ? GLU B 166 ? VAL B 159 GLU B 166 
AA8 5  TYR B 100 ? PHE B 103 ? TYR B 100 PHE B 103 
AA8 6  HIS B 132 ? THR B 135 ? HIS B 132 THR B 135 
AA8 7  HIS D 132 ? THR D 135 ? HIS D 132 THR D 135 
AA8 8  TYR D 100 ? PHE D 103 ? TYR D 100 PHE D 103 
AA8 9  VAL D 159 ? GLU D 166 ? VAL D 159 GLU D 166 
AA8 10 LEU D 319 ? ALA D 322 ? LEU D 319 ALA D 322 
AA8 11 VAL D 54  ? VAL D 57  ? VAL D 54  VAL D 57  
AA8 12 ALA D 335 ? TYR D 336 ? ALA D 335 TYR D 336 
AA9 1  PHE B 340 ? MET B 341 ? PHE B 340 MET B 341 
AA9 2  GLY B 464 ? GLU B 470 ? GLY B 464 GLU B 470 
AA9 3  TYR B 452 ? CYS B 458 ? TYR B 452 CYS B 458 
AA9 4  GLU B 377 ? PHE B 378 ? GLU B 377 PHE B 378 
AB1 1  ILE C 41  ? ASN C 42  ? ILE C 41  ASN C 42  
AB1 2  VAL C 49  ? ILE C 54  ? VAL C 49  ILE C 54  
AB1 3  VAL C 45  ? LYS C 46  ? VAL C 45  LYS C 46  
AB2 1  ILE C 41  ? ASN C 42  ? ILE C 41  ASN C 42  
AB2 2  VAL C 49  ? ILE C 54  ? VAL C 49  ILE C 54  
AB2 3  ALA C 88  ? SER C 92  ? ALA C 88  SER C 92  
AB2 4  ILE C 137 ? VAL C 138 ? ILE C 137 VAL C 138 
AB3 1  CYS C 145 ? LEU C 146 ? CYS C 145 LEU C 146 
AB3 2  VAL C 168 ? GLY C 170 ? VAL C 168 GLY C 170 
AB3 3  ILE C 207 ? ARG C 208 ? ILE C 207 ARG C 208 
AB4 1  ILE C 160 ? THR C 162 ? ILE C 160 THR C 162 
AB4 2  GLN C 220 ? VAL C 222 ? GLN C 220 VAL C 222 
AB5 1  LEU C 429 ? THR C 430 ? LEU C 429 THR C 430 
AB5 2  THR C 387 ? LYS C 390 ? THR C 387 LYS C 390 
AB5 3  ILE C 366 ? LEU C 367 ? ILE C 366 LEU C 367 
AB5 4  VAL C 444 ? GLU C 446 ? VAL C 444 GLU C 446 
AB5 5  PHE C 472 ? SER C 474 ? PHE C 472 SER C 474 
AB6 1  GLY C 496 ? HIS C 498 ? GLY C 496 HIS C 498 
AB6 2  GLU C 510 ? THR C 513 ? GLU C 510 THR C 513 
AB6 3  VAL C 538 ? LYS C 540 ? VAL C 538 LYS C 540 
AB7 1  PHE D 340 ? MET D 341 ? PHE D 340 MET D 341 
AB7 2  GLY D 464 ? GLU D 470 ? GLY D 464 GLU D 470 
AB7 3  TYR D 452 ? CYS D 458 ? TYR D 452 CYS D 458 
AB7 4  GLU D 377 ? PHE D 378 ? GLU D 377 PHE D 378 
AB8 1  ILE E 41  ? ASN E 42  ? ILE E 41  ASN E 42  
AB8 2  VAL E 49  ? ILE E 54  ? VAL E 49  ILE E 54  
AB8 3  VAL E 45  ? LYS E 46  ? VAL E 45  LYS E 46  
AB9 1  ILE E 41  ? ASN E 42  ? ILE E 41  ASN E 42  
AB9 2  VAL E 49  ? ILE E 54  ? VAL E 49  ILE E 54  
AB9 3  ALA E 88  ? SER E 92  ? ALA E 88  SER E 92  
AB9 4  ILE E 137 ? VAL E 138 ? ILE E 137 VAL E 138 
AC1 1  CYS E 145 ? LEU E 146 ? CYS E 145 LEU E 146 
AC1 2  VAL E 168 ? GLY E 170 ? VAL E 168 GLY E 170 
AC1 3  ILE E 207 ? ARG E 208 ? ILE E 207 ARG E 208 
AC2 1  ILE E 160 ? THR E 162 ? ILE E 160 THR E 162 
AC2 2  GLN E 220 ? VAL E 222 ? GLN E 220 VAL E 222 
AC3 1  LEU E 429 ? THR E 430 ? LEU E 429 THR E 430 
AC3 2  THR E 387 ? LYS E 390 ? THR E 387 LYS E 390 
AC3 3  ILE E 366 ? LEU E 367 ? ILE E 366 LEU E 367 
AC3 4  VAL E 444 ? GLU E 446 ? VAL E 444 GLU E 446 
AC3 5  PHE E 472 ? SER E 474 ? PHE E 472 SER E 474 
AC4 1  GLY E 496 ? HIS E 498 ? GLY E 496 HIS E 498 
AC4 2  GLU E 510 ? THR E 513 ? GLU E 510 THR E 513 
AC4 3  VAL E 538 ? LYS E 540 ? VAL E 538 LYS E 540 
AC5 1  LEU F 65  ? LEU F 66  ? LEU F 65  LEU F 66  
AC5 2  THR F 312 ? ALA F 317 ? THR F 312 ALA F 317 
AC5 3  VAL F 159 ? GLU F 166 ? VAL F 159 GLU F 166 
AC5 4  TYR F 100 ? PHE F 103 ? TYR F 100 PHE F 103 
AC5 5  HIS F 132 ? THR F 135 ? HIS F 132 THR F 135 
AC5 6  HIS H 132 ? THR H 135 ? HIS H 132 THR H 135 
AC5 7  TYR H 100 ? PHE H 103 ? TYR H 100 PHE H 103 
AC5 8  VAL H 159 ? GLU H 166 ? VAL H 159 GLU H 166 
AC5 9  THR H 312 ? ALA H 317 ? THR H 312 ALA H 317 
AC5 10 LEU H 65  ? LEU H 66  ? LEU H 65  LEU H 66  
AC6 1  ALA F 335 ? TYR F 336 ? ALA F 335 TYR F 336 
AC6 2  VAL F 54  ? VAL F 57  ? VAL F 54  VAL F 57  
AC6 3  LEU F 319 ? ALA F 322 ? LEU F 319 ALA F 322 
AC6 4  VAL F 159 ? GLU F 166 ? VAL F 159 GLU F 166 
AC6 5  TYR F 100 ? PHE F 103 ? TYR F 100 PHE F 103 
AC6 6  HIS F 132 ? THR F 135 ? HIS F 132 THR F 135 
AC6 7  HIS H 132 ? THR H 135 ? HIS H 132 THR H 135 
AC6 8  TYR H 100 ? PHE H 103 ? TYR H 100 PHE H 103 
AC6 9  VAL H 159 ? GLU H 166 ? VAL H 159 GLU H 166 
AC6 10 LEU H 319 ? ALA H 322 ? LEU H 319 ALA H 322 
AC6 11 VAL H 54  ? VAL H 57  ? VAL H 54  VAL H 57  
AC6 12 ALA H 335 ? TYR H 336 ? ALA H 335 TYR H 336 
AC7 1  PHE F 340 ? MET F 341 ? PHE F 340 MET F 341 
AC7 2  GLY F 464 ? GLU F 470 ? GLY F 464 GLU F 470 
AC7 3  TYR F 452 ? CYS F 458 ? TYR F 452 CYS F 458 
AC7 4  GLU F 377 ? PHE F 378 ? GLU F 377 PHE F 378 
AC8 1  ILE G 41  ? ASN G 42  ? ILE G 41  ASN G 42  
AC8 2  VAL G 49  ? ILE G 54  ? VAL G 49  ILE G 54  
AC8 3  VAL G 45  ? LYS G 46  ? VAL G 45  LYS G 46  
AC9 1  ILE G 41  ? ASN G 42  ? ILE G 41  ASN G 42  
AC9 2  VAL G 49  ? ILE G 54  ? VAL G 49  ILE G 54  
AC9 3  ALA G 88  ? SER G 92  ? ALA G 88  SER G 92  
AC9 4  ILE G 137 ? VAL G 138 ? ILE G 137 VAL G 138 
AD1 1  CYS G 145 ? LEU G 146 ? CYS G 145 LEU G 146 
AD1 2  VAL G 168 ? GLY G 170 ? VAL G 168 GLY G 170 
AD1 3  ILE G 207 ? ARG G 208 ? ILE G 207 ARG G 208 
AD2 1  ILE G 160 ? THR G 162 ? ILE G 160 THR G 162 
AD2 2  GLN G 220 ? VAL G 222 ? GLN G 220 VAL G 222 
AD3 1  LEU G 429 ? THR G 430 ? LEU G 429 THR G 430 
AD3 2  THR G 387 ? LYS G 390 ? THR G 387 LYS G 390 
AD3 3  ILE G 366 ? LEU G 367 ? ILE G 366 LEU G 367 
AD3 4  VAL G 444 ? GLU G 446 ? VAL G 444 GLU G 446 
AD3 5  PHE G 472 ? SER G 474 ? PHE G 472 SER G 474 
AD4 1  GLY G 496 ? HIS G 498 ? GLY G 496 HIS G 498 
AD4 2  GLU G 510 ? THR G 513 ? GLU G 510 THR G 513 
AD4 3  VAL G 538 ? LYS G 540 ? VAL G 538 LYS G 540 
AD5 1  PHE H 340 ? MET H 341 ? PHE H 340 MET H 341 
AD5 2  GLY H 464 ? GLU H 470 ? GLY H 464 GLU H 470 
AD5 3  TYR H 452 ? CYS H 458 ? TYR H 452 CYS H 458 
AD5 4  GLU H 377 ? PHE H 378 ? GLU H 377 PHE H 378 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N ASN A 42  ? N ASN A 42  O ARG A 53  ? O ARG A 53  
AA1 2  3  O VAL A 49  ? O VAL A 49  N LYS A 46  ? N LYS A 46  
AA2 1  2  N ASN A 42  ? N ASN A 42  O ARG A 53  ? O ARG A 53  
AA2 2  3  N ILE A 54  ? N ILE A 54  O ILE A 91  ? O ILE A 91  
AA2 3  4  N ALA A 88  ? N ALA A 88  O VAL A 138 ? O VAL A 138 
AA3 1  2  N CYS A 145 ? N CYS A 145 O GLY A 170 ? O GLY A 170 
AA3 2  3  N LEU A 169 ? N LEU A 169 O ILE A 207 ? O ILE A 207 
AA4 1  2  N ALA A 161 ? N ALA A 161 O GLN A 220 ? O GLN A 220 
AA5 1  2  O THR A 430 ? O THR A 430 N LEU A 389 ? N LEU A 389 
AA5 2  3  O ILE A 388 ? O ILE A 388 N ILE A 366 ? N ILE A 366 
AA5 3  4  N LEU A 367 ? N LEU A 367 O ILE A 445 ? O ILE A 445 
AA5 4  5  N GLU A 446 ? N GLU A 446 O ALA A 473 ? O ALA A 473 
AA6 1  2  N GLY A 496 ? N GLY A 496 O ILE A 512 ? O ILE A 512 
AA6 2  3  N THR A 513 ? N THR A 513 O VAL A 539 ? O VAL A 539 
AA7 1  2  N LEU B 65  ? N LEU B 65  O ASP B 313 ? O ASP B 313 
AA7 2  3  O GLY B 314 ? O GLY B 314 N GLU B 166 ? N GLU B 166 
AA7 3  4  O VAL B 161 ? O VAL B 161 N ILE B 102 ? N ILE B 102 
AA7 4  5  N PHE B 103 ? N PHE B 103 O HIS B 132 ? O HIS B 132 
AA7 5  6  N THR B 133 ? N THR B 133 O THR D 135 ? O THR D 135 
AA7 6  7  O HIS D 132 ? O HIS D 132 N PHE D 103 ? N PHE D 103 
AA7 7  8  N ILE D 102 ? N ILE D 102 O VAL D 161 ? O VAL D 161 
AA7 8  9  N GLU D 166 ? N GLU D 166 O GLY D 314 ? O GLY D 314 
AA7 9  10 O ASP D 313 ? O ASP D 313 N LEU D 65  ? N LEU D 65  
AA8 1  2  O ALA B 335 ? O ALA B 335 N VAL B 56  ? N VAL B 56  
AA8 2  3  N VAL B 57  ? N VAL B 57  O LEU B 319 ? O LEU B 319 
AA8 3  4  O ILE B 320 ? O ILE B 320 N ILE B 160 ? N ILE B 160 
AA8 4  5  O VAL B 161 ? O VAL B 161 N ILE B 102 ? N ILE B 102 
AA8 5  6  N PHE B 103 ? N PHE B 103 O HIS B 132 ? O HIS B 132 
AA8 6  7  N THR B 133 ? N THR B 133 O THR D 135 ? O THR D 135 
AA8 7  8  O HIS D 132 ? O HIS D 132 N PHE D 103 ? N PHE D 103 
AA8 8  9  N ILE D 102 ? N ILE D 102 O VAL D 161 ? O VAL D 161 
AA8 9  10 N ILE D 160 ? N ILE D 160 O ILE D 320 ? O ILE D 320 
AA8 10 11 O LEU D 319 ? O LEU D 319 N VAL D 57  ? N VAL D 57  
AA8 11 12 N VAL D 56  ? N VAL D 56  O ALA D 335 ? O ALA D 335 
AA9 1  2  N MET B 341 ? N MET B 341 O ALA B 466 ? O ALA B 466 
AA9 2  3  O MET B 467 ? O MET B 467 N VAL B 455 ? N VAL B 455 
AA9 3  4  O ALA B 456 ? O ALA B 456 N GLU B 377 ? N GLU B 377 
AB1 1  2  N ASN C 42  ? N ASN C 42  O ARG C 53  ? O ARG C 53  
AB1 2  3  O VAL C 49  ? O VAL C 49  N LYS C 46  ? N LYS C 46  
AB2 1  2  N ASN C 42  ? N ASN C 42  O ARG C 53  ? O ARG C 53  
AB2 2  3  N ILE C 54  ? N ILE C 54  O ILE C 91  ? O ILE C 91  
AB2 3  4  N ALA C 88  ? N ALA C 88  O VAL C 138 ? O VAL C 138 
AB3 1  2  N CYS C 145 ? N CYS C 145 O GLY C 170 ? O GLY C 170 
AB3 2  3  N LEU C 169 ? N LEU C 169 O ILE C 207 ? O ILE C 207 
AB4 1  2  N ALA C 161 ? N ALA C 161 O GLN C 220 ? O GLN C 220 
AB5 1  2  O THR C 430 ? O THR C 430 N LEU C 389 ? N LEU C 389 
AB5 2  3  O ILE C 388 ? O ILE C 388 N ILE C 366 ? N ILE C 366 
AB5 3  4  N LEU C 367 ? N LEU C 367 O ILE C 445 ? O ILE C 445 
AB5 4  5  N GLU C 446 ? N GLU C 446 O ALA C 473 ? O ALA C 473 
AB6 1  2  N GLY C 496 ? N GLY C 496 O ILE C 512 ? O ILE C 512 
AB6 2  3  N THR C 513 ? N THR C 513 O VAL C 539 ? O VAL C 539 
AB7 1  2  N MET D 341 ? N MET D 341 O ALA D 466 ? O ALA D 466 
AB7 2  3  O MET D 467 ? O MET D 467 N VAL D 455 ? N VAL D 455 
AB7 3  4  O ALA D 456 ? O ALA D 456 N GLU D 377 ? N GLU D 377 
AB8 1  2  N ASN E 42  ? N ASN E 42  O ARG E 53  ? O ARG E 53  
AB8 2  3  O VAL E 49  ? O VAL E 49  N LYS E 46  ? N LYS E 46  
AB9 1  2  N ASN E 42  ? N ASN E 42  O ARG E 53  ? O ARG E 53  
AB9 2  3  N ILE E 54  ? N ILE E 54  O ILE E 91  ? O ILE E 91  
AB9 3  4  N ALA E 88  ? N ALA E 88  O VAL E 138 ? O VAL E 138 
AC1 1  2  N CYS E 145 ? N CYS E 145 O GLY E 170 ? O GLY E 170 
AC1 2  3  N LEU E 169 ? N LEU E 169 O ILE E 207 ? O ILE E 207 
AC2 1  2  N ALA E 161 ? N ALA E 161 O GLN E 220 ? O GLN E 220 
AC3 1  2  O THR E 430 ? O THR E 430 N LEU E 389 ? N LEU E 389 
AC3 2  3  O ILE E 388 ? O ILE E 388 N ILE E 366 ? N ILE E 366 
AC3 3  4  N LEU E 367 ? N LEU E 367 O ILE E 445 ? O ILE E 445 
AC3 4  5  N GLU E 446 ? N GLU E 446 O ALA E 473 ? O ALA E 473 
AC4 1  2  N GLY E 496 ? N GLY E 496 O ILE E 512 ? O ILE E 512 
AC4 2  3  N THR E 513 ? N THR E 513 O VAL E 539 ? O VAL E 539 
AC5 1  2  N LEU F 65  ? N LEU F 65  O ASP F 313 ? O ASP F 313 
AC5 2  3  O GLY F 314 ? O GLY F 314 N GLU F 166 ? N GLU F 166 
AC5 3  4  O VAL F 161 ? O VAL F 161 N ILE F 102 ? N ILE F 102 
AC5 4  5  N PHE F 103 ? N PHE F 103 O HIS F 132 ? O HIS F 132 
AC5 5  6  N THR F 133 ? N THR F 133 O THR H 135 ? O THR H 135 
AC5 6  7  O HIS H 132 ? O HIS H 132 N PHE H 103 ? N PHE H 103 
AC5 7  8  N ILE H 102 ? N ILE H 102 O VAL H 161 ? O VAL H 161 
AC5 8  9  N GLU H 166 ? N GLU H 166 O GLY H 314 ? O GLY H 314 
AC5 9  10 O ASP H 313 ? O ASP H 313 N LEU H 65  ? N LEU H 65  
AC6 1  2  O ALA F 335 ? O ALA F 335 N VAL F 56  ? N VAL F 56  
AC6 2  3  N VAL F 57  ? N VAL F 57  O LEU F 319 ? O LEU F 319 
AC6 3  4  O ILE F 320 ? O ILE F 320 N ILE F 160 ? N ILE F 160 
AC6 4  5  O VAL F 161 ? O VAL F 161 N ILE F 102 ? N ILE F 102 
AC6 5  6  N PHE F 103 ? N PHE F 103 O HIS F 132 ? O HIS F 132 
AC6 6  7  N THR F 133 ? N THR F 133 O THR H 135 ? O THR H 135 
AC6 7  8  O HIS H 132 ? O HIS H 132 N PHE H 103 ? N PHE H 103 
AC6 8  9  N ILE H 102 ? N ILE H 102 O VAL H 161 ? O VAL H 161 
AC6 9  10 N ILE H 160 ? N ILE H 160 O ILE H 320 ? O ILE H 320 
AC6 10 11 O LEU H 319 ? O LEU H 319 N VAL H 57  ? N VAL H 57  
AC6 11 12 N VAL H 56  ? N VAL H 56  O ALA H 335 ? O ALA H 335 
AC7 1  2  N MET F 341 ? N MET F 341 O ALA F 466 ? O ALA F 466 
AC7 2  3  O MET F 467 ? O MET F 467 N VAL F 455 ? N VAL F 455 
AC7 3  4  O ALA F 456 ? O ALA F 456 N GLU F 377 ? N GLU F 377 
AC8 1  2  N ASN G 42  ? N ASN G 42  O ARG G 53  ? O ARG G 53  
AC8 2  3  O VAL G 49  ? O VAL G 49  N LYS G 46  ? N LYS G 46  
AC9 1  2  N ASN G 42  ? N ASN G 42  O ARG G 53  ? O ARG G 53  
AC9 2  3  N ILE G 54  ? N ILE G 54  O ILE G 91  ? O ILE G 91  
AC9 3  4  N ALA G 88  ? N ALA G 88  O VAL G 138 ? O VAL G 138 
AD1 1  2  N CYS G 145 ? N CYS G 145 O GLY G 170 ? O GLY G 170 
AD1 2  3  N LEU G 169 ? N LEU G 169 O ILE G 207 ? O ILE G 207 
AD2 1  2  N ALA G 161 ? N ALA G 161 O GLN G 220 ? O GLN G 220 
AD3 1  2  O THR G 430 ? O THR G 430 N LEU G 389 ? N LEU G 389 
AD3 2  3  O ILE G 388 ? O ILE G 388 N ILE G 366 ? N ILE G 366 
AD3 3  4  N LEU G 367 ? N LEU G 367 O ILE G 445 ? O ILE G 445 
AD3 4  5  N GLU G 446 ? N GLU G 446 O ALA G 473 ? O ALA G 473 
AD4 1  2  N GLY G 496 ? N GLY G 496 O ILE G 512 ? O ILE G 512 
AD4 2  3  N THR G 513 ? N THR G 513 O VAL G 539 ? O VAL G 539 
AD5 1  2  N MET H 341 ? N MET H 341 O ALA H 466 ? O ALA H 466 
AD5 2  3  O MET H 467 ? O MET H 467 N VAL H 455 ? N VAL H 455 
AD5 3  4  O ALA H 456 ? O ALA H 456 N GLU H 377 ? N GLU H 377 
# 
_atom_sites.entry_id                    5ZRV 
_atom_sites.fract_transf_matrix[1][1]   0.002959 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002959 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002959 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N  . THR A 1 37  ? 137.119 183.001 42.936  1.00 106.43 ? 37  THR A N  1 
ATOM 2     C CA . THR A 1 37  ? 135.763 182.852 42.433  1.00 106.43 ? 37  THR A CA 1 
ATOM 3     C C  . THR A 1 37  ? 135.302 181.400 42.540  1.00 106.43 ? 37  THR A C  1 
ATOM 4     O O  . THR A 1 37  ? 135.071 180.884 43.628  1.00 106.43 ? 37  THR A O  1 
ATOM 5     N N  . ARG A 1 38  ? 135.154 180.743 41.395  1.00 95.94  ? 38  ARG A N  1 
ATOM 6     C CA . ARG A 1 38  ? 134.799 179.333 41.340  1.00 95.94  ? 38  ARG A CA 1 
ATOM 7     C C  . ARG A 1 38  ? 135.837 178.696 40.432  1.00 95.94  ? 38  ARG A C  1 
ATOM 8     O O  . ARG A 1 38  ? 135.599 178.501 39.238  1.00 95.94  ? 38  ARG A O  1 
ATOM 9     N N  . THR A 1 39  ? 136.988 178.375 41.004  1.00 96.24  ? 39  THR A N  1 
ATOM 10    C CA . THR A 1 39  ? 138.066 177.774 40.237  1.00 96.24  ? 39  THR A CA 1 
ATOM 11    C C  . THR A 1 39  ? 138.156 176.275 40.446  1.00 96.24  ? 39  THR A C  1 
ATOM 12    O O  . THR A 1 39  ? 138.611 175.555 39.552  1.00 96.24  ? 39  THR A O  1 
ATOM 13    N N  . HIS A 1 40  ? 137.743 175.792 41.611  1.00 92.19  ? 40  HIS A N  1 
ATOM 14    C CA . HIS A 1 40  ? 137.826 174.373 41.905  1.00 92.19  ? 40  HIS A CA 1 
ATOM 15    C C  . HIS A 1 40  ? 136.537 173.873 42.528  1.00 92.19  ? 40  HIS A C  1 
ATOM 16    O O  . HIS A 1 40  ? 136.231 172.680 42.463  1.00 92.19  ? 40  HIS A O  1 
ATOM 17    N N  . ILE A 1 41  ? 135.780 174.777 43.138  1.00 88.19  ? 41  ILE A N  1 
ATOM 18    C CA . ILE A 1 41  ? 134.553 174.437 43.843  1.00 88.19  ? 41  ILE A CA 1 
ATOM 19    C C  . ILE A 1 41  ? 133.419 175.242 43.228  1.00 88.19  ? 41  ILE A C  1 
ATOM 20    O O  . ILE A 1 41  ? 133.598 176.412 42.879  1.00 88.19  ? 41  ILE A O  1 
ATOM 21    N N  . ASN A 1 42  ? 132.259 174.613 43.092  1.00 82.58  ? 42  ASN A N  1 
ATOM 22    C CA . ASN A 1 42  ? 131.091 175.271 42.539  1.00 82.58  ? 42  ASN A CA 1 
ATOM 23    C C  . ASN A 1 42  ? 129.847 174.535 42.992  1.00 82.58  ? 42  ASN A C  1 
ATOM 24    O O  . ASN A 1 42  ? 129.908 173.372 43.384  1.00 82.58  ? 42  ASN A O  1 
ATOM 25    N N  . TYR A 1 43  ? 128.717 175.215 42.900  1.00 80.03  ? 43  TYR A N  1 
ATOM 26    C CA . TYR A 1 43  ? 127.424 174.588 43.095  1.00 80.03  ? 43  TYR A CA 1 
ATOM 27    C C  . TYR A 1 43  ? 126.431 175.141 42.096  1.00 80.03  ? 43  TYR A C  1 
ATOM 28    O O  . TYR A 1 43  ? 126.747 175.996 41.273  1.00 80.03  ? 43  TYR A O  1 
ATOM 29    N N  . GLY A 1 44  ? 125.205 174.660 42.215  1.00 92.40  ? 44  GLY A N  1 
ATOM 30    C CA . GLY A 1 44  ? 124.082 175.267 41.543  1.00 92.40  ? 44  GLY A CA 1 
ATOM 31    C C  . GLY A 1 44  ? 122.838 175.118 42.388  1.00 92.40  ? 44  GLY A C  1 
ATOM 32    O O  . GLY A 1 44  ? 122.923 174.851 43.589  1.00 92.40  ? 44  GLY A O  1 
ATOM 33    N N  . VAL A 1 45  ? 121.674 175.289 41.776  1.00 100.31 ? 45  VAL A N  1 
ATOM 34    C CA . VAL A 1 45  ? 120.403 175.072 42.448  1.00 100.31 ? 45  VAL A CA 1 
ATOM 35    C C  . VAL A 1 45  ? 119.643 173.979 41.710  1.00 100.31 ? 45  VAL A C  1 
ATOM 36    O O  . VAL A 1 45  ? 119.430 174.068 40.494  1.00 100.31 ? 45  VAL A O  1 
ATOM 37    N N  . LYS A 1 46  ? 119.296 172.917 42.430  1.00 93.45  ? 46  LYS A N  1 
ATOM 38    C CA . LYS A 1 46  ? 118.380 171.893 41.929  1.00 93.45  ? 46  LYS A CA 1 
ATOM 39    C C  . LYS A 1 46  ? 117.701 171.331 43.177  1.00 93.45  ? 46  LYS A C  1 
ATOM 40    O O  . LYS A 1 46  ? 118.358 170.964 44.153  1.00 93.45  ? 46  LYS A O  1 
ATOM 41    N N  . GLY A 1 47  ? 116.374 171.350 43.170  1.00 104.61 ? 47  GLY A N  1 
ATOM 42    C CA . GLY A 1 47  ? 115.619 171.029 44.366  1.00 104.61 ? 47  GLY A CA 1 
ATOM 43    C C  . GLY A 1 47  ? 115.759 172.064 45.458  1.00 104.61 ? 47  GLY A C  1 
ATOM 44    O O  . GLY A 1 47  ? 115.410 171.784 46.615  1.00 104.61 ? 47  GLY A O  1 
ATOM 45    N N  . ASP A 1 48  ? 116.248 173.263 45.102  1.00 108.93 ? 48  ASP A N  1 
ATOM 46    C CA . ASP A 1 48  ? 116.654 174.323 46.027  1.00 108.93 ? 48  ASP A CA 1 
ATOM 47    C C  . ASP A 1 48  ? 117.663 173.790 47.049  1.00 108.93 ? 48  ASP A C  1 
ATOM 48    O O  . ASP A 1 48  ? 117.568 174.046 48.250  1.00 108.93 ? 48  ASP A O  1 
ATOM 49    N N  . VAL A 1 49  ? 118.621 173.004 46.557  1.00 98.01  ? 49  VAL A N  1 
ATOM 50    C CA . VAL A 1 49  ? 119.647 172.375 47.377  1.00 98.01  ? 49  VAL A CA 1 
ATOM 51    C C  . VAL A 1 49  ? 121.013 172.665 46.751  1.00 98.01  ? 49  VAL A C  1 
ATOM 52    O O  . VAL A 1 49  ? 121.220 172.498 45.549  1.00 98.01  ? 49  VAL A O  1 
ATOM 53    N N  . ALA A 1 50  ? 121.947 173.108 47.590  1.00 83.81  ? 50  ALA A N  1 
ATOM 54    C CA . ALA A 1 50  ? 123.271 173.557 47.160  1.00 83.81  ? 50  ALA A CA 1 
ATOM 55    C C  . ALA A 1 50  ? 124.172 172.342 46.973  1.00 83.81  ? 50  ALA A C  1 
ATOM 56    O O  . ALA A 1 50  ? 124.612 171.722 47.945  1.00 83.81  ? 50  ALA A O  1 
ATOM 57    N N  . VAL A 1 51  ? 124.460 172.018 45.719  1.00 79.21  ? 51  VAL A N  1 
ATOM 58    C CA . VAL A 1 51  ? 125.283 170.865 45.377  1.00 79.21  ? 51  VAL A CA 1 
ATOM 59    C C  . VAL A 1 51  ? 126.723 171.338 45.143  1.00 79.21  ? 51  VAL A C  1 
ATOM 60    O O  . VAL A 1 51  ? 127.235 171.451 44.028  1.00 79.21  ? 51  VAL A O  1 
ATOM 61    N N  . VAL A 1 52  ? 127.428 171.569 46.238  1.00 75.47  ? 52  VAL A N  1 
ATOM 62    C CA . VAL A 1 52  ? 128.821 171.977 46.119  1.00 75.47  ? 52  VAL A CA 1 
ATOM 63    C C  . VAL A 1 52  ? 129.671 170.782 45.707  1.00 75.47  ? 52  VAL A C  1 
ATOM 64    O O  . VAL A 1 52  ? 129.577 169.681 46.272  1.00 75.47  ? 52  VAL A O  1 
ATOM 65    N N  . ARG A 1 53  ? 130.480 170.997 44.678  1.00 71.24  ? 53  ARG A N  1 
ATOM 66    C CA . ARG A 1 53  ? 131.256 169.948 44.044  1.00 71.24  ? 53  ARG A CA 1 
ATOM 67    C C  . ARG A 1 53  ? 132.736 170.238 44.194  1.00 71.24  ? 53  ARG A C  1 
ATOM 68    O O  . ARG A 1 53  ? 133.150 171.397 44.255  1.00 71.24  ? 53  ARG A O  1 
ATOM 69    N N  . ILE A 1 54  ? 133.528 169.178 44.260  1.00 78.86  ? 54  ILE A N  1 
ATOM 70    C CA . ILE A 1 54  ? 134.961 169.277 44.482  1.00 78.86  ? 54  ILE A CA 1 
ATOM 71    C C  . ILE A 1 54  ? 135.669 168.725 43.258  1.00 78.86  ? 54  ILE A C  1 
ATOM 72    O O  . ILE A 1 54  ? 135.379 167.609 42.815  1.00 78.86  ? 54  ILE A O  1 
ATOM 73    N N  . ASN A 1 55  ? 136.587 169.509 42.708  1.00 95.05  ? 55  ASN A N  1 
ATOM 74    C CA . ASN A 1 55  ? 137.332 169.091 41.535  1.00 95.05  ? 55  ASN A CA 1 
ATOM 75    C C  . ASN A 1 55  ? 138.628 169.884 41.499  1.00 95.05  ? 55  ASN A C  1 
ATOM 76    O O  . ASN A 1 55  ? 138.717 170.969 42.073  1.00 95.05  ? 55  ASN A O  1 
ATOM 77    N N  . SER A 1 56  ? 139.628 169.325 40.835  1.00 97.01  ? 56  SER A N  1 
ATOM 78    C CA . SER A 1 56  ? 140.899 170.013 40.615  1.00 97.01  ? 56  SER A CA 1 
ATOM 79    C C  . SER A 1 56  ? 141.519 169.419 39.364  1.00 97.01  ? 56  SER A C  1 
ATOM 80    O O  . SER A 1 56  ? 142.140 168.348 39.415  1.00 97.01  ? 56  SER A O  1 
ATOM 81    N N  . PRO A 1 57  ? 141.384 170.091 38.217  1.00 107.20 ? 57  PRO A N  1 
ATOM 82    C CA . PRO A 1 57  ? 141.798 169.485 36.943  1.00 107.20 ? 57  PRO A CA 1 
ATOM 83    C C  . PRO A 1 57  ? 143.298 169.451 36.727  1.00 107.20 ? 57  PRO A C  1 
ATOM 84    O O  . PRO A 1 57  ? 143.752 168.800 35.776  1.00 107.20 ? 57  PRO A O  1 
ATOM 85    N N  . ASN A 1 58  ? 144.072 170.130 37.571  1.00 111.06 ? 58  ASN A N  1 
ATOM 86    C CA . ASN A 1 58  ? 145.504 170.255 37.343  1.00 111.06 ? 58  ASN A CA 1 
ATOM 87    C C  . ASN A 1 58  ? 146.211 168.938 37.628  1.00 111.06 ? 58  ASN A C  1 
ATOM 88    O O  . ASN A 1 58  ? 146.837 168.347 36.740  1.00 111.06 ? 58  ASN A O  1 
ATOM 89    N N  . SER A 1 59  ? 146.103 168.453 38.857  1.00 96.64  ? 59  SER A N  1 
ATOM 90    C CA . SER A 1 59  ? 146.617 167.143 39.207  1.00 96.64  ? 59  SER A CA 1 
ATOM 91    C C  . SER A 1 59  ? 145.584 166.079 38.856  1.00 96.64  ? 59  SER A C  1 
ATOM 92    O O  . SER A 1 59  ? 144.465 166.375 38.433  1.00 96.64  ? 59  SER A O  1 
ATOM 93    N N  . LYS A 1 60  ? 145.964 164.816 39.033  1.00 85.85  ? 60  LYS A N  1 
ATOM 94    C CA . LYS A 1 60  ? 145.003 163.741 38.833  1.00 85.85  ? 60  LYS A CA 1 
ATOM 95    C C  . LYS A 1 60  ? 144.085 163.619 40.040  1.00 85.85  ? 60  LYS A C  1 
ATOM 96    O O  . LYS A 1 60  ? 142.893 163.342 39.893  1.00 85.85  ? 60  LYS A O  1 
ATOM 97    N N  . VAL A 1 61  ? 144.628 163.806 41.236  1.00 83.87  ? 61  VAL A N  1 
ATOM 98    C CA . VAL A 1 61  ? 143.874 163.689 42.474  1.00 83.87  ? 61  VAL A CA 1 
ATOM 99    C C  . VAL A 1 61  ? 143.790 165.056 43.127  1.00 83.87  ? 61  VAL A C  1 
ATOM 100   O O  . VAL A 1 61  ? 144.614 165.939 42.875  1.00 83.87  ? 61  VAL A O  1 
ATOM 101   N N  . ASN A 1 62  ? 142.772 165.234 43.961  1.00 86.66  ? 62  ASN A N  1 
ATOM 102   C CA . ASN A 1 62  ? 142.560 166.516 44.618  1.00 86.66  ? 62  ASN A CA 1 
ATOM 103   C C  . ASN A 1 62  ? 143.147 166.509 46.019  1.00 86.66  ? 62  ASN A C  1 
ATOM 104   O O  . ASN A 1 62  ? 143.018 165.529 46.756  1.00 86.66  ? 62  ASN A O  1 
ATOM 105   N N  . THR A 1 63  ? 143.795 167.606 46.382  1.00 97.80  ? 63  THR A N  1 
ATOM 106   C CA . THR A 1 63  ? 144.514 167.715 47.639  1.00 97.80  ? 63  THR A CA 1 
ATOM 107   C C  . THR A 1 63  ? 143.955 168.864 48.457  1.00 97.80  ? 63  THR A C  1 
ATOM 108   O O  . THR A 1 63  ? 143.637 169.924 47.911  1.00 97.80  ? 63  THR A O  1 
ATOM 109   N N  . LEU A 1 64  ? 143.843 168.647 49.759  1.00 96.66  ? 64  LEU A N  1 
ATOM 110   C CA . LEU A 1 64  ? 143.572 169.735 50.678  1.00 96.66  ? 64  LEU A CA 1 
ATOM 111   C C  . LEU A 1 64  ? 144.752 170.692 50.675  1.00 96.66  ? 64  LEU A C  1 
ATOM 112   O O  . LEU A 1 64  ? 145.893 170.280 50.884  1.00 96.66  ? 64  LEU A O  1 
ATOM 113   N N  . SER A 1 65  ? 144.484 171.971 50.429  1.00 110.88 ? 65  SER A N  1 
ATOM 114   C CA . SER A 1 65  ? 145.555 172.955 50.403  1.00 110.88 ? 65  SER A CA 1 
ATOM 115   C C  . SER A 1 65  ? 145.025 174.298 50.869  1.00 110.88 ? 65  SER A C  1 
ATOM 116   O O  . SER A 1 65  ? 143.818 174.503 51.012  1.00 110.88 ? 65  SER A O  1 
ATOM 117   N N  . LYS A 1 66  ? 145.963 175.222 51.095  1.00 117.10 ? 66  LYS A N  1 
ATOM 118   C CA . LYS A 1 66  ? 145.602 176.620 51.292  1.00 117.10 ? 66  LYS A CA 1 
ATOM 119   C C  . LYS A 1 66  ? 144.929 177.172 50.048  1.00 117.10 ? 66  LYS A C  1 
ATOM 120   O O  . LYS A 1 66  ? 143.977 177.955 50.137  1.00 117.10 ? 66  LYS A O  1 
ATOM 121   N N  . GLU A 1 67  ? 145.387 176.740 48.882  1.00 118.75 ? 67  GLU A N  1 
ATOM 122   C CA . GLU A 1 67  ? 144.817 177.104 47.602  1.00 118.75 ? 67  GLU A CA 1 
ATOM 123   C C  . GLU A 1 67  ? 143.479 176.517 47.381  1.00 118.75 ? 67  GLU A C  1 
ATOM 124   O O  . GLU A 1 67  ? 142.897 176.916 46.389  1.00 118.75 ? 67  GLU A O  1 
ATOM 125   N N  . LEU A 1 68  ? 142.972 175.596 48.194  1.00 112.06 ? 68  LEU A N  1 
ATOM 126   C CA . LEU A 1 68  ? 141.585 175.157 48.114  1.00 112.06 ? 68  LEU A CA 1 
ATOM 127   C C  . LEU A 1 68  ? 140.694 175.832 49.139  1.00 112.06 ? 68  LEU A C  1 
ATOM 128   O O  . LEU A 1 68  ? 139.591 176.261 48.802  1.00 112.06 ? 68  LEU A O  1 
ATOM 129   N N  . HIS A 1 69  ? 141.157 175.957 50.383  1.00 110.18 ? 69  HIS A N  1 
ATOM 130   C CA . HIS A 1 69  ? 140.372 176.642 51.401  1.00 110.18 ? 69  HIS A CA 1 
ATOM 131   C C  . HIS A 1 69  ? 140.235 178.129 51.129  1.00 110.18 ? 69  HIS A C  1 
ATOM 132   O O  . HIS A 1 69  ? 139.249 178.726 51.566  1.00 110.18 ? 69  HIS A O  1 
ATOM 133   N N  . SER A 1 70  ? 141.166 178.713 50.361  1.00 114.56 ? 70  SER A N  1 
ATOM 134   C CA . SER A 1 70  ? 141.102 180.121 49.975  1.00 114.56 ? 70  SER A CA 1 
ATOM 135   C C  . SER A 1 70  ? 139.862 180.455 49.159  1.00 114.56 ? 70  SER A C  1 
ATOM 136   O O  . SER A 1 70  ? 139.509 181.635 49.048  1.00 114.56 ? 70  SER A O  1 
ATOM 137   N N  . GLU A 1 71  ? 139.212 179.456 48.565  1.00 116.67 ? 71  GLU A N  1 
ATOM 138   C CA . GLU A 1 71  ? 137.900 179.627 47.973  1.00 116.67 ? 71  GLU A CA 1 
ATOM 139   C C  . GLU A 1 71  ? 136.819 178.801 48.644  1.00 116.67 ? 71  GLU A C  1 
ATOM 140   O O  . GLU A 1 71  ? 135.642 179.155 48.538  1.00 116.67 ? 71  GLU A O  1 
ATOM 141   N N  . PHE A 1 72  ? 137.180 177.740 49.365  1.00 96.76  ? 72  PHE A N  1 
ATOM 142   C CA . PHE A 1 72  ? 136.222 176.972 50.146  1.00 96.76  ? 72  PHE A CA 1 
ATOM 143   C C  . PHE A 1 72  ? 135.687 177.775 51.322  1.00 96.76  ? 72  PHE A C  1 
ATOM 144   O O  . PHE A 1 72  ? 134.652 177.412 51.887  1.00 96.76  ? 72  PHE A O  1 
ATOM 145   N N  . SER A 1 73  ? 136.379 178.848 51.703  1.00 103.28 ? 73  SER A N  1 
ATOM 146   C CA . SER A 1 73  ? 135.880 179.740 52.736  1.00 103.28 ? 73  SER A CA 1 
ATOM 147   C C  . SER A 1 73  ? 134.635 180.477 52.266  1.00 103.28 ? 73  SER A C  1 
ATOM 148   O O  . SER A 1 73  ? 133.541 180.286 52.807  1.00 103.28 ? 73  SER A O  1 
ATOM 149   N N  . GLU A 1 74  ? 134.763 181.275 51.209  1.00 106.42 ? 74  GLU A N  1 
ATOM 150   C CA . GLU A 1 74  ? 133.729 182.237 50.849  1.00 106.42 ? 74  GLU A CA 1 
ATOM 151   C C  . GLU A 1 74  ? 132.594 181.623 50.047  1.00 106.42 ? 74  GLU A C  1 
ATOM 152   O O  . GLU A 1 74  ? 131.855 182.345 49.364  1.00 106.42 ? 74  GLU A O  1 
ATOM 153   N N  . VAL A 1 75  ? 132.395 180.315 50.147  1.00 98.65  ? 75  VAL A N  1 
ATOM 154   C CA . VAL A 1 75  ? 131.205 179.695 49.614  1.00 98.65  ? 75  VAL A CA 1 
ATOM 155   C C  . VAL A 1 75  ? 130.193 179.316 50.698  1.00 98.65  ? 75  VAL A C  1 
ATOM 156   O O  . VAL A 1 75  ? 129.019 179.684 50.574  1.00 98.65  ? 75  VAL A O  1 
ATOM 157   N N  . MET A 1 76  ? 130.612 178.661 51.786  1.00 98.42  ? 76  MET A N  1 
ATOM 158   C CA . MET A 1 76  ? 129.645 178.244 52.798  1.00 98.42  ? 76  MET A CA 1 
ATOM 159   C C  . MET A 1 76  ? 129.069 179.407 53.580  1.00 98.42  ? 76  MET A C  1 
ATOM 160   O O  . MET A 1 76  ? 127.966 179.280 54.112  1.00 98.42  ? 76  MET A O  1 
ATOM 161   N N  . ASN A 1 77  ? 129.773 180.533 53.649  1.00 106.54 ? 77  ASN A N  1 
ATOM 162   C CA . ASN A 1 77  ? 129.170 181.716 54.240  1.00 106.54 ? 77  ASN A CA 1 
ATOM 163   C C  . ASN A 1 77  ? 128.025 182.237 53.386  1.00 106.54 ? 77  ASN A C  1 
ATOM 164   O O  . ASN A 1 77  ? 127.023 182.711 53.924  1.00 106.54 ? 77  ASN A O  1 
ATOM 165   N N  . GLU A 1 78  ? 128.163 182.150 52.061  1.00 109.10 ? 78  GLU A N  1 
ATOM 166   C CA . GLU A 1 78  ? 127.059 182.481 51.169  1.00 109.10 ? 78  GLU A CA 1 
ATOM 167   C C  . GLU A 1 78  ? 125.948 181.458 51.298  1.00 109.10 ? 78  GLU A C  1 
ATOM 168   O O  . GLU A 1 78  ? 124.763 181.797 51.183  1.00 109.10 ? 78  GLU A O  1 
ATOM 169   N N  . ILE A 1 79  ? 126.314 180.199 51.544  1.00 102.44 ? 79  ILE A N  1 
ATOM 170   C CA . ILE A 1 79  ? 125.318 179.203 51.918  1.00 102.44 ? 79  ILE A CA 1 
ATOM 171   C C  . ILE A 1 79  ? 124.674 179.590 53.238  1.00 102.44 ? 79  ILE A C  1 
ATOM 172   O O  . ILE A 1 79  ? 123.459 179.458 53.421  1.00 102.44 ? 79  ILE A O  1 
ATOM 173   N N  . TRP A 1 80  ? 125.462 180.135 54.154  1.00 109.18 ? 80  TRP A N  1 
ATOM 174   C CA . TRP A 1 80  ? 124.934 180.606 55.420  1.00 109.18 ? 80  TRP A CA 1 
ATOM 175   C C  . TRP A 1 80  ? 124.303 181.983 55.290  1.00 109.18 ? 80  TRP A C  1 
ATOM 176   O O  . TRP A 1 80  ? 123.605 182.423 56.207  1.00 109.18 ? 80  TRP A O  1 
ATOM 177   N N  . ALA A 1 81  ? 124.532 182.675 54.172  1.00 110.03 ? 81  ALA A N  1 
ATOM 178   C CA . ALA A 1 81  ? 123.844 183.925 53.884  1.00 110.03 ? 81  ALA A CA 1 
ATOM 179   C C  . ALA A 1 81  ? 122.595 183.724 53.046  1.00 110.03 ? 81  ALA A C  1 
ATOM 180   O O  . ALA A 1 81  ? 121.942 184.710 52.692  1.00 110.03 ? 81  ALA A O  1 
ATOM 181   N N  . SER A 1 82  ? 122.260 182.486 52.710  1.00 112.90 ? 82  SER A N  1 
ATOM 182   C CA . SER A 1 82  ? 121.052 182.194 51.958  1.00 112.90 ? 82  SER A CA 1 
ATOM 183   C C  . SER A 1 82  ? 119.932 181.751 52.886  1.00 112.90 ? 82  SER A C  1 
ATOM 184   O O  . SER A 1 82  ? 120.148 181.429 54.056  1.00 112.90 ? 82  SER A O  1 
ATOM 185   N N  . ASP A 1 83  ? 118.721 181.745 52.339  1.00 108.05 ? 83  ASP A N  1 
ATOM 186   C CA . ASP A 1 83  ? 117.556 181.246 53.042  1.00 108.05 ? 83  ASP A CA 1 
ATOM 187   C C  . ASP A 1 83  ? 116.675 180.336 52.209  1.00 108.05 ? 83  ASP A C  1 
ATOM 188   O O  . ASP A 1 83  ? 115.950 179.523 52.792  1.00 108.05 ? 83  ASP A O  1 
ATOM 189   N N  . GLN A 1 84  ? 116.706 180.446 50.879  1.00 105.45 ? 84  GLN A N  1 
ATOM 190   C CA . GLN A 1 84  ? 115.894 179.566 50.047  1.00 105.45 ? 84  GLN A CA 1 
ATOM 191   C C  . GLN A 1 84  ? 116.399 178.139 50.125  1.00 105.45 ? 84  GLN A C  1 
ATOM 192   O O  . GLN A 1 84  ? 115.621 177.207 50.358  1.00 105.45 ? 84  GLN A O  1 
ATOM 193   N N  . ILE A 1 85  ? 117.696 177.962 49.964  1.00 97.79  ? 85  ILE A N  1 
ATOM 194   C CA . ILE A 1 85  ? 118.316 176.660 50.118  1.00 97.79  ? 85  ILE A CA 1 
ATOM 195   C C  . ILE A 1 85  ? 118.254 176.285 51.588  1.00 97.79  ? 85  ILE A C  1 
ATOM 196   O O  . ILE A 1 85  ? 118.547 177.103 52.466  1.00 97.79  ? 85  ILE A O  1 
ATOM 197   N N  . ARG A 1 86  ? 117.812 175.067 51.866  1.00 94.91  ? 86  ARG A N  1 
ATOM 198   C CA . ARG A 1 86  ? 117.619 174.629 53.236  1.00 94.91  ? 86  ARG A CA 1 
ATOM 199   C C  . ARG A 1 86  ? 118.455 173.403 53.561  1.00 94.91  ? 86  ARG A C  1 
ATOM 200   O O  . ARG A 1 86  ? 118.366 172.883 54.680  1.00 94.91  ? 86  ARG A O  1 
ATOM 201   N N  . SER A 1 87  ? 119.266 172.932 52.614  1.00 90.72  ? 87  SER A N  1 
ATOM 202   C CA . SER A 1 87  ? 120.189 171.827 52.839  1.00 90.72  ? 87  SER A CA 1 
ATOM 203   C C  . SER A 1 87  ? 121.239 171.858 51.743  1.00 90.72  ? 87  SER A C  1 
ATOM 204   O O  . SER A 1 87  ? 120.970 172.317 50.631  1.00 90.72  ? 87  SER A O  1 
ATOM 205   N N  . ALA A 1 88  ? 122.430 171.368 52.055  1.00 74.93  ? 88  ALA A N  1 
ATOM 206   C CA . ALA A 1 88  ? 123.519 171.392 51.095  1.00 74.93  ? 88  ALA A CA 1 
ATOM 207   C C  . ALA A 1 88  ? 124.252 170.065 51.126  1.00 74.93  ? 88  ALA A C  1 
ATOM 208   O O  . ALA A 1 88  ? 124.133 169.304 52.086  1.00 74.93  ? 88  ALA A O  1 
ATOM 209   N N  . VAL A 1 89  ? 125.005 169.788 50.065  1.00 67.86  ? 89  VAL A N  1 
ATOM 210   C CA . VAL A 1 89  ? 125.756 168.549 49.950  1.00 67.86  ? 89  VAL A CA 1 
ATOM 211   C C  . VAL A 1 89  ? 127.004 168.770 49.103  1.00 67.86  ? 89  VAL A C  1 
ATOM 212   O O  . VAL A 1 89  ? 126.964 169.356 48.021  1.00 67.86  ? 89  VAL A O  1 
ATOM 213   N N  . LEU A 1 90  ? 128.129 168.293 49.625  1.00 63.95  ? 90  LEU A N  1 
ATOM 214   C CA . LEU A 1 90  ? 129.400 168.374 48.931  1.00 63.95  ? 90  LEU A CA 1 
ATOM 215   C C  . LEU A 1 90  ? 129.799 167.008 48.413  1.00 63.95  ? 90  LEU A C  1 
ATOM 216   O O  . LEU A 1 90  ? 129.448 165.982 48.999  1.00 63.95  ? 90  LEU A O  1 
ATOM 217   N N  . ILE A 1 91  ? 130.515 167.014 47.297  1.00 70.91  ? 91  ILE A N  1 
ATOM 218   C CA . ILE A 1 91  ? 130.935 165.784 46.638  1.00 70.91  ? 91  ILE A CA 1 
ATOM 219   C C  . ILE A 1 91  ? 132.153 166.077 45.768  1.00 70.91  ? 91  ILE A C  1 
ATOM 220   O O  . ILE A 1 91  ? 132.376 167.223 45.369  1.00 70.91  ? 91  ILE A O  1 
ATOM 221   N N  . SER A 1 92  ? 132.980 165.063 45.532  1.00 79.58  ? 92  SER A N  1 
ATOM 222   C CA . SER A 1 92  ? 134.071 165.159 44.568  1.00 79.58  ? 92  SER A CA 1 
ATOM 223   C C  . SER A 1 92  ? 133.578 164.692 43.208  1.00 79.58  ? 92  SER A C  1 
ATOM 224   O O  . SER A 1 92  ? 133.491 163.497 42.935  1.00 79.58  ? 92  SER A O  1 
ATOM 225   N N  . SER A 1 93  ? 133.277 165.650 42.331  1.00 80.91  ? 93  SER A N  1 
ATOM 226   C CA . SER A 1 93  ? 132.780 165.306 41.005  1.00 80.91  ? 93  SER A CA 1 
ATOM 227   C C  . SER A 1 93  ? 133.858 164.717 40.110  1.00 80.91  ? 93  SER A C  1 
ATOM 228   O O  . SER A 1 93  ? 133.530 164.067 39.112  1.00 80.91  ? 93  SER A O  1 
ATOM 229   N N  . LYS A 1 94  ? 135.122 164.953 40.420  1.00 79.64  ? 94  LYS A N  1 
ATOM 230   C CA . LYS A 1 94  ? 136.191 164.226 39.763  1.00 79.64  ? 94  LYS A CA 1 
ATOM 231   C C  . LYS A 1 94  ? 136.131 162.758 40.173  1.00 79.64  ? 94  LYS A C  1 
ATOM 232   O O  . LYS A 1 94  ? 135.915 162.456 41.349  1.00 79.64  ? 94  LYS A O  1 
ATOM 233   N N  . PRO A 1 95  ? 136.278 161.828 39.234  1.00 73.62  ? 95  PRO A N  1 
ATOM 234   C CA . PRO A 1 95  ? 136.323 160.415 39.610  1.00 73.62  ? 95  PRO A CA 1 
ATOM 235   C C  . PRO A 1 95  ? 137.594 160.088 40.368  1.00 73.62  ? 95  PRO A C  1 
ATOM 236   O O  . PRO A 1 95  ? 138.597 160.798 40.282  1.00 73.62  ? 95  PRO A O  1 
ATOM 237   N N  . GLY A 1 96  ? 137.534 159.004 41.133  1.00 75.63  ? 96  GLY A N  1 
ATOM 238   C CA . GLY A 1 96  ? 138.687 158.569 41.890  1.00 75.63  ? 96  GLY A CA 1 
ATOM 239   C C  . GLY A 1 96  ? 138.533 158.796 43.376  1.00 75.63  ? 96  GLY A C  1 
ATOM 240   O O  . GLY A 1 96  ? 137.490 158.475 43.946  1.00 75.63  ? 96  GLY A O  1 
ATOM 241   N N  . CYS A 1 97  ? 139.562 159.359 44.007  1.00 78.39  ? 97  CYS A N  1 
ATOM 242   C CA . CYS A 1 97  ? 139.603 159.546 45.450  1.00 78.39  ? 97  CYS A CA 1 
ATOM 243   C C  . CYS A 1 97  ? 138.713 160.711 45.863  1.00 78.39  ? 97  CYS A C  1 
ATOM 244   O O  . CYS A 1 97  ? 138.254 161.500 45.035  1.00 78.39  ? 97  CYS A O  1 
ATOM 245   N N  . PHE A 1 98  ? 138.480 160.841 47.170  1.00 72.25  ? 98  PHE A N  1 
ATOM 246   C CA . PHE A 1 98  ? 137.634 161.935 47.643  1.00 72.25  ? 98  PHE A CA 1 
ATOM 247   C C  . PHE A 1 98  ? 138.412 163.245 47.685  1.00 72.25  ? 98  PHE A C  1 
ATOM 248   O O  . PHE A 1 98  ? 138.191 164.132 46.859  1.00 72.25  ? 98  PHE A O  1 
ATOM 249   N N  . ILE A 1 99  ? 139.357 163.356 48.620  1.00 80.46  ? 99  ILE A N  1 
ATOM 250   C CA . ILE A 1 99  ? 140.422 164.352 48.628  1.00 80.46  ? 99  ILE A CA 1 
ATOM 251   C C  . ILE A 1 99  ? 141.668 163.662 49.164  1.00 80.46  ? 99  ILE A C  1 
ATOM 252   O O  . ILE A 1 99  ? 141.632 162.498 49.566  1.00 80.46  ? 99  ILE A O  1 
ATOM 253   N N  . ALA A 1 100 ? 142.775 164.383 49.183  1.00 94.95  ? 100 ALA A N  1 
ATOM 254   C CA . ALA A 1 100 ? 143.985 163.831 49.762  1.00 94.95  ? 100 ALA A CA 1 
ATOM 255   C C  . ALA A 1 100 ? 144.041 164.183 51.244  1.00 94.95  ? 100 ALA A C  1 
ATOM 256   O O  . ALA A 1 100 ? 143.063 164.645 51.834  1.00 94.95  ? 100 ALA A O  1 
ATOM 257   N N  . GLY A 1 101 ? 145.192 163.958 51.864  1.00 97.38  ? 101 GLY A N  1 
ATOM 258   C CA . GLY A 1 101 ? 145.412 164.438 53.210  1.00 97.38  ? 101 GLY A CA 1 
ATOM 259   C C  . GLY A 1 101 ? 146.014 165.822 53.176  1.00 97.38  ? 101 GLY A C  1 
ATOM 260   O O  . GLY A 1 101 ? 145.584 166.672 52.391  1.00 97.38  ? 101 GLY A O  1 
ATOM 261   N N  . ALA A 1 102 ? 147.005 166.064 54.026  1.00 111.75 ? 102 ALA A N  1 
ATOM 262   C CA . ALA A 1 102 ? 147.791 167.279 53.908  1.00 111.75 ? 102 ALA A CA 1 
ATOM 263   C C  . ALA A 1 102 ? 148.623 167.212 52.640  1.00 111.75 ? 102 ALA A C  1 
ATOM 264   O O  . ALA A 1 102 ? 149.234 166.183 52.339  1.00 111.75 ? 102 ALA A O  1 
ATOM 265   N N  . ASP A 1 103 ? 148.617 168.302 51.879  1.00 123.61 ? 103 ASP A N  1 
ATOM 266   C CA . ASP A 1 103 ? 149.278 168.308 50.585  1.00 123.61 ? 103 ASP A CA 1 
ATOM 267   C C  . ASP A 1 103 ? 150.778 168.264 50.792  1.00 123.61 ? 103 ASP A C  1 
ATOM 268   O O  . ASP A 1 103 ? 151.334 169.105 51.506  1.00 123.61 ? 103 ASP A O  1 
ATOM 269   N N  . ILE A 1 104 ? 151.416 167.307 50.123  1.00 127.44 ? 104 ILE A N  1 
ATOM 270   C CA . ILE A 1 104 ? 152.687 166.724 50.530  1.00 127.44 ? 104 ILE A CA 1 
ATOM 271   C C  . ILE A 1 104 ? 153.777 167.782 50.492  1.00 127.44 ? 104 ILE A C  1 
ATOM 272   O O  . ILE A 1 104 ? 154.652 167.814 51.361  1.00 127.44 ? 104 ILE A O  1 
ATOM 273   N N  . ASN A 1 105 ? 153.684 168.700 49.534  1.00 130.88 ? 105 ASN A N  1 
ATOM 274   C CA . ASN A 1 105 ? 154.632 169.798 49.426  1.00 130.88 ? 105 ASN A CA 1 
ATOM 275   C C  . ASN A 1 105 ? 154.152 171.080 50.099  1.00 130.88 ? 105 ASN A C  1 
ATOM 276   O O  . ASN A 1 105 ? 154.661 172.158 49.785  1.00 130.88 ? 105 ASN A O  1 
ATOM 277   N N  . MET A 1 106 ? 153.192 171.000 51.013  1.00 127.05 ? 106 MET A N  1 
ATOM 278   C CA . MET A 1 106 ? 152.764 172.177 51.760  1.00 127.05 ? 106 MET A CA 1 
ATOM 279   C C  . MET A 1 106 ? 153.000 172.060 53.250  1.00 127.05 ? 106 MET A C  1 
ATOM 280   O O  . MET A 1 106 ? 153.341 173.051 53.896  1.00 127.05 ? 106 MET A O  1 
ATOM 281   N N  . LEU A 1 107 ? 152.797 170.880 53.823  1.00 121.35 ? 107 LEU A N  1 
ATOM 282   C CA . LEU A 1 107 ? 153.267 170.678 55.181  1.00 121.35 ? 107 LEU A CA 1 
ATOM 283   C C  . LEU A 1 107 ? 154.775 170.506 55.196  1.00 121.35 ? 107 LEU A C  1 
ATOM 284   O O  . LEU A 1 107 ? 155.430 170.862 56.178  1.00 121.35 ? 107 LEU A O  1 
ATOM 285   N N  . ALA A 1 108 ? 155.347 169.995 54.111  1.00 120.22 ? 108 ALA A N  1 
ATOM 286   C CA . ALA A 1 108 ? 156.794 169.969 53.993  1.00 120.22 ? 108 ALA A CA 1 
ATOM 287   C C  . ALA A 1 108 ? 157.349 171.276 53.459  1.00 120.22 ? 108 ALA A C  1 
ATOM 288   O O  . ALA A 1 108 ? 158.571 171.401 53.333  1.00 120.22 ? 108 ALA A O  1 
ATOM 289   N N  . ALA A 1 109 ? 156.488 172.233 53.122  1.00 128.01 ? 109 ALA A N  1 
ATOM 290   C CA . ALA A 1 109 ? 156.958 173.578 52.838  1.00 128.01 ? 109 ALA A CA 1 
ATOM 291   C C  . ALA A 1 109 ? 157.541 174.167 54.112  1.00 128.01 ? 109 ALA A C  1 
ATOM 292   O O  . ALA A 1 109 ? 156.832 174.355 55.105  1.00 128.01 ? 109 ALA A O  1 
ATOM 293   N N  . CYS A 1 110 ? 158.844 174.423 54.085  1.00 143.48 ? 110 CYS A N  1 
ATOM 294   C CA . CYS A 1 110 ? 159.590 174.750 55.291  1.00 143.48 ? 110 CYS A CA 1 
ATOM 295   C C  . CYS A 1 110 ? 159.225 176.139 55.803  1.00 143.48 ? 110 CYS A C  1 
ATOM 296   O O  . CYS A 1 110 ? 159.401 177.142 55.104  1.00 143.48 ? 110 CYS A O  1 
ATOM 297   N N  . LYS A 1 111 ? 158.669 176.191 57.010  1.00 147.69 ? 111 LYS A N  1 
ATOM 298   C CA . LYS A 1 111 ? 158.375 177.474 57.621  1.00 147.69 ? 111 LYS A CA 1 
ATOM 299   C C  . LYS A 1 111 ? 158.643 177.355 59.117  1.00 147.69 ? 111 LYS A C  1 
ATOM 300   O O  . LYS A 1 111 ? 158.711 176.250 59.659  1.00 147.69 ? 111 LYS A O  1 
ATOM 301   N N  . THR A 1 112 ? 158.778 178.504 59.779  1.00 147.96 ? 112 THR A N  1 
ATOM 302   C CA . THR A 1 112 ? 159.181 178.564 61.173  1.00 147.96 ? 112 THR A CA 1 
ATOM 303   C C  . THR A 1 112 ? 157.997 178.152 62.058  1.00 147.96 ? 112 THR A C  1 
ATOM 304   O O  . THR A 1 112 ? 156.853 178.038 61.603  1.00 147.96 ? 112 THR A O  1 
ATOM 305   N N  . LEU A 1 113 ? 158.296 177.929 63.340  1.00 140.91 ? 113 LEU A N  1 
ATOM 306   C CA . LEU A 1 113 ? 157.423 177.192 64.247  1.00 140.91 ? 113 LEU A CA 1 
ATOM 307   C C  . LEU A 1 113 ? 156.120 177.925 64.539  1.00 140.91 ? 113 LEU A C  1 
ATOM 308   O O  . LEU A 1 113 ? 155.056 177.296 64.603  1.00 140.91 ? 113 LEU A O  1 
ATOM 309   N N  . GLN A 1 114 ? 156.181 179.242 64.733  1.00 138.88 ? 114 GLN A N  1 
ATOM 310   C CA . GLN A 1 114 ? 154.965 179.986 65.035  1.00 138.88 ? 114 GLN A CA 1 
ATOM 311   C C  . GLN A 1 114 ? 154.001 179.989 63.854  1.00 138.88 ? 114 GLN A C  1 
ATOM 312   O O  . GLN A 1 114 ? 152.785 179.951 64.050  1.00 138.88 ? 114 GLN A O  1 
ATOM 313   N N  . GLU A 1 115 ? 154.510 179.964 62.625  1.00 136.39 ? 115 GLU A N  1 
ATOM 314   C CA . GLU A 1 115 ? 153.598 179.938 61.492  1.00 136.39 ? 115 GLU A CA 1 
ATOM 315   C C  . GLU A 1 115 ? 153.057 178.534 61.246  1.00 136.39 ? 115 GLU A C  1 
ATOM 316   O O  . GLU A 1 115 ? 151.900 178.385 60.841  1.00 136.39 ? 115 GLU A O  1 
ATOM 317   N N  . VAL A 1 116 ? 153.862 177.499 61.494  1.00 128.59 ? 116 VAL A N  1 
ATOM 318   C CA . VAL A 1 116 ? 153.365 176.145 61.301  1.00 128.59 ? 116 VAL A CA 1 
ATOM 319   C C  . VAL A 1 116 ? 152.395 175.766 62.409  1.00 128.59 ? 116 VAL A C  1 
ATOM 320   O O  . VAL A 1 116 ? 151.546 174.889 62.209  1.00 128.59 ? 116 VAL A O  1 
ATOM 321   N N  . THR A 1 117 ? 152.454 176.430 63.561  1.00 129.60 ? 117 THR A N  1 
ATOM 322   C CA . THR A 1 117 ? 151.376 176.226 64.512  1.00 129.60 ? 117 THR A CA 1 
ATOM 323   C C  . THR A 1 117 ? 150.209 177.172 64.273  1.00 129.60 ? 117 THR A C  1 
ATOM 324   O O  . THR A 1 117 ? 149.074 176.814 64.599  1.00 129.60 ? 117 THR A O  1 
ATOM 325   N N  . GLN A 1 118 ? 150.438 178.330 63.645  1.00 126.53 ? 118 GLN A N  1 
ATOM 326   C CA . GLN A 1 118 ? 149.329 179.217 63.315  1.00 126.53 ? 118 GLN A CA 1 
ATOM 327   C C  . GLN A 1 118 ? 148.449 178.613 62.232  1.00 126.53 ? 118 GLN A C  1 
ATOM 328   O O  . GLN A 1 118 ? 147.220 178.714 62.305  1.00 126.53 ? 118 GLN A O  1 
ATOM 329   N N  . LEU A 1 119 ? 149.058 177.994 61.219  1.00 123.64 ? 119 LEU A N  1 
ATOM 330   C CA . LEU A 1 119 ? 148.266 177.372 60.166  1.00 123.64 ? 119 LEU A CA 1 
ATOM 331   C C  . LEU A 1 119 ? 147.505 176.173 60.700  1.00 123.64 ? 119 LEU A C  1 
ATOM 332   O O  . LEU A 1 119 ? 146.333 175.982 60.372  1.00 123.64 ? 119 LEU A O  1 
ATOM 333   N N  . SER A 1 120 ? 148.140 175.382 61.553  1.00 115.24 ? 120 SER A N  1 
ATOM 334   C CA . SER A 1 120 ? 147.504 174.220 62.146  1.00 115.24 ? 120 SER A CA 1 
ATOM 335   C C  . SER A 1 120 ? 146.616 174.572 63.328  1.00 115.24 ? 120 SER A C  1 
ATOM 336   O O  . SER A 1 120 ? 146.071 173.662 63.956  1.00 115.24 ? 120 SER A O  1 
ATOM 337   N N  . GLN A 1 121 ? 146.512 175.850 63.685  1.00 121.28 ? 121 GLN A N  1 
ATOM 338   C CA . GLN A 1 121 ? 145.442 176.308 64.561  1.00 121.28 ? 121 GLN A CA 1 
ATOM 339   C C  . GLN A 1 121 ? 144.303 176.929 63.760  1.00 121.28 ? 121 GLN A C  1 
ATOM 340   O O  . GLN A 1 121 ? 143.138 176.870 64.166  1.00 121.28 ? 121 GLN A O  1 
ATOM 341   N N  . GLU A 1 122 ? 144.625 177.523 62.614  1.00 117.58 ? 122 GLU A N  1 
ATOM 342   C CA . GLU A 1 122 ? 143.595 178.067 61.743  1.00 117.58 ? 122 GLU A CA 1 
ATOM 343   C C  . GLU A 1 122 ? 142.869 176.960 60.989  1.00 117.58 ? 122 GLU A C  1 
ATOM 344   O O  . GLU A 1 122 ? 141.701 177.122 60.617  1.00 117.58 ? 122 GLU A O  1 
ATOM 345   N N  . ALA A 1 123 ? 143.531 175.820 60.797  1.00 107.22 ? 123 ALA A N  1 
ATOM 346   C CA . ALA A 1 123 ? 143.028 174.793 59.896  1.00 107.22 ? 123 ALA A CA 1 
ATOM 347   C C  . ALA A 1 123 ? 141.809 174.081 60.450  1.00 107.22 ? 123 ALA A C  1 
ATOM 348   O O  . ALA A 1 123 ? 141.046 173.480 59.690  1.00 107.22 ? 123 ALA A O  1 
ATOM 349   N N  . GLN A 1 124 ? 141.607 174.123 61.753  1.00 107.39 ? 124 GLN A N  1 
ATOM 350   C CA . GLN A 1 124 ? 140.415 173.538 62.334  1.00 107.39 ? 124 GLN A CA 1 
ATOM 351   C C  . GLN A 1 124 ? 139.390 174.574 62.732  1.00 107.39 ? 124 GLN A C  1 
ATOM 352   O O  . GLN A 1 124 ? 138.260 174.197 63.049  1.00 107.39 ? 124 GLN A O  1 
ATOM 353   N N  . ARG A 1 125 ? 139.771 175.854 62.754  1.00 108.78 ? 125 ARG A N  1 
ATOM 354   C CA . ARG A 1 125 ? 138.806 176.916 63.017  1.00 108.78 ? 125 ARG A CA 1 
ATOM 355   C C  . ARG A 1 125 ? 137.740 176.943 61.929  1.00 108.78 ? 125 ARG A C  1 
ATOM 356   O O  . ARG A 1 125 ? 136.548 177.134 62.204  1.00 108.78 ? 125 ARG A O  1 
ATOM 357   N N  . ILE A 1 126 ? 138.143 176.671 60.693  1.00 104.65 ? 126 ILE A N  1 
ATOM 358   C CA . ILE A 1 126 ? 137.186 176.549 59.610  1.00 104.65 ? 126 ILE A CA 1 
ATOM 359   C C  . ILE A 1 126 ? 136.360 175.274 59.712  1.00 104.65 ? 126 ILE A C  1 
ATOM 360   O O  . ILE A 1 126 ? 135.325 175.160 59.049  1.00 104.65 ? 126 ILE A O  1 
ATOM 361   N N  . VAL A 1 127 ? 136.790 174.307 60.522  1.00 100.73 ? 127 VAL A N  1 
ATOM 362   C CA . VAL A 1 127 ? 135.999 173.102 60.737  1.00 100.73 ? 127 VAL A CA 1 
ATOM 363   C C  . VAL A 1 127 ? 134.987 173.326 61.850  1.00 100.73 ? 127 VAL A C  1 
ATOM 364   O O  . VAL A 1 127 ? 133.809 172.945 61.737  1.00 100.73 ? 127 VAL A O  1 
ATOM 365   N N  . GLU A 1 128 ? 135.425 173.992 62.921  1.00 106.97 ? 128 GLU A N  1 
ATOM 366   C CA . GLU A 1 128 ? 134.514 174.465 63.953  1.00 106.97 ? 128 GLU A CA 1 
ATOM 367   C C  . GLU A 1 128 ? 133.591 175.577 63.466  1.00 106.97 ? 128 GLU A C  1 
ATOM 368   O O  . GLU A 1 128 ? 132.708 176.002 64.215  1.00 106.97 ? 128 GLU A O  1 
ATOM 369   N N  . LYS A 1 129 ? 133.792 176.101 62.262  1.00 101.33 ? 129 LYS A N  1 
ATOM 370   C CA . LYS A 1 129 ? 132.705 176.824 61.619  1.00 101.33 ? 129 LYS A CA 1 
ATOM 371   C C  . LYS A 1 129 ? 131.542 175.892 61.303  1.00 101.33 ? 129 LYS A C  1 
ATOM 372   O O  . LYS A 1 129 ? 130.425 176.083 61.791  1.00 101.33 ? 129 LYS A O  1 
ATOM 373   N N  . LEU A 1 130 ? 131.789 174.854 60.511  1.00 103.00 ? 130 LEU A N  1 
ATOM 374   C CA . LEU A 1 130 ? 130.667 174.195 59.861  1.00 103.00 ? 130 LEU A CA 1 
ATOM 375   C C  . LEU A 1 130 ? 130.155 172.975 60.603  1.00 103.00 ? 130 LEU A C  1 
ATOM 376   O O  . LEU A 1 130 ? 129.125 172.426 60.198  1.00 103.00 ? 130 LEU A O  1 
ATOM 377   N N  . GLU A 1 131 ? 130.824 172.528 61.662  1.00 101.43 ? 131 GLU A N  1 
ATOM 378   C CA . GLU A 1 131 ? 130.449 171.244 62.248  1.00 101.43 ? 131 GLU A CA 1 
ATOM 379   C C  . GLU A 1 131 ? 129.154 171.365 63.056  1.00 101.43 ? 131 GLU A C  1 
ATOM 380   O O  . GLU A 1 131 ? 128.508 170.359 63.367  1.00 101.43 ? 131 GLU A O  1 
ATOM 381   N N  . LYS A 1 132 ? 128.761 172.594 63.418  1.00 95.95  ? 132 LYS A N  1 
ATOM 382   C CA . LYS A 1 132 ? 127.536 172.827 64.185  1.00 95.95  ? 132 LYS A CA 1 
ATOM 383   C C  . LYS A 1 132 ? 126.663 173.893 63.543  1.00 95.95  ? 132 LYS A C  1 
ATOM 384   O O  . LYS A 1 132 ? 126.260 174.848 64.212  1.00 95.95  ? 132 LYS A O  1 
ATOM 385   N N  . SER A 1 133 ? 126.384 173.765 62.255  1.00 98.88  ? 133 SER A N  1 
ATOM 386   C CA . SER A 1 133 ? 125.567 174.770 61.600  1.00 98.88  ? 133 SER A CA 1 
ATOM 387   C C  . SER A 1 133 ? 124.098 174.619 61.967  1.00 98.88  ? 133 SER A C  1 
ATOM 388   O O  . SER A 1 133 ? 123.608 173.531 62.281  1.00 98.88  ? 133 SER A O  1 
ATOM 389   N N  . THR A 1 134 ? 123.392 175.747 61.910  1.00 86.42  ? 134 THR A N  1 
ATOM 390   C CA . THR A 1 134 ? 121.937 175.737 61.986  1.00 86.42  ? 134 THR A CA 1 
ATOM 391   C C  . THR A 1 134 ? 121.334 175.007 60.796  1.00 86.42  ? 134 THR A C  1 
ATOM 392   O O  . THR A 1 134 ? 120.458 174.151 60.953  1.00 86.42  ? 134 THR A O  1 
ATOM 393   N N  . LYS A 1 135 ? 121.791 175.335 59.611  1.00 85.26  ? 135 LYS A N  1 
ATOM 394   C CA . LYS A 1 135 ? 121.423 174.621 58.406  1.00 85.26  ? 135 LYS A CA 1 
ATOM 395   C C  . LYS A 1 135 ? 122.251 173.356 58.299  1.00 85.26  ? 135 LYS A C  1 
ATOM 396   O O  . LYS A 1 135 ? 123.458 173.448 58.045  1.00 85.26  ? 135 LYS A O  1 
ATOM 397   N N  . PRO A 1 136 ? 121.668 172.178 58.463  1.00 76.27  ? 136 PRO A N  1 
ATOM 398   C CA . PRO A 1 136 ? 122.457 170.947 58.461  1.00 76.27  ? 136 PRO A CA 1 
ATOM 399   C C  . PRO A 1 136 ? 122.905 170.595 57.053  1.00 76.27  ? 136 PRO A C  1 
ATOM 400   O O  . PRO A 1 136 ? 122.379 171.084 56.056  1.00 76.27  ? 136 PRO A O  1 
ATOM 401   N N  . ILE A 1 137 ? 123.905 169.724 56.990  1.00 66.82  ? 137 ILE A N  1 
ATOM 402   C CA . ILE A 1 137 ? 124.602 169.456 55.746  1.00 66.82  ? 137 ILE A CA 1 
ATOM 403   C C  . ILE A 1 137 ? 124.905 167.966 55.708  1.00 66.82  ? 137 ILE A C  1 
ATOM 404   O O  . ILE A 1 137 ? 124.831 167.271 56.723  1.00 66.82  ? 137 ILE A O  1 
ATOM 405   N N  . VAL A 1 138 ? 125.200 167.463 54.514  1.00 60.53  ? 138 VAL A N  1 
ATOM 406   C CA . VAL A 1 138 ? 125.500 166.054 54.323  1.00 60.53  ? 138 VAL A CA 1 
ATOM 407   C C  . VAL A 1 138 ? 126.696 165.939 53.390  1.00 60.53  ? 138 VAL A C  1 
ATOM 408   O O  . VAL A 1 138 ? 126.772 166.631 52.367  1.00 60.53  ? 138 VAL A O  1 
ATOM 409   N N  . ALA A 1 139 ? 127.669 165.132 53.783  1.00 62.03  ? 139 ALA A N  1 
ATOM 410   C CA . ALA A 1 139 ? 128.794 164.853 52.916  1.00 62.03  ? 139 ALA A CA 1 
ATOM 411   C C  . ALA A 1 139 ? 128.609 163.480 52.300  1.00 62.03  ? 139 ALA A C  1 
ATOM 412   O O  . ALA A 1 139 ? 127.686 162.745 52.643  1.00 62.03  ? 139 ALA A O  1 
ATOM 413   N N  . ALA A 1 140 ? 129.518 163.109 51.410  1.00 65.85  ? 140 ALA A N  1 
ATOM 414   C CA . ALA A 1 140 ? 129.416 161.827 50.741  1.00 65.85  ? 140 ALA A CA 1 
ATOM 415   C C  . ALA A 1 140 ? 130.811 161.322 50.434  1.00 65.85  ? 140 ALA A C  1 
ATOM 416   O O  . ALA A 1 140 ? 131.758 162.103 50.338  1.00 65.85  ? 140 ALA A O  1 
ATOM 417   N N  . ILE A 1 141 ? 130.942 160.007 50.301  1.00 62.73  ? 141 ILE A N  1 
ATOM 418   C CA . ILE A 1 141 ? 132.240 159.393 50.058  1.00 62.73  ? 141 ILE A CA 1 
ATOM 419   C C  . ILE A 1 141 ? 132.117 158.409 48.912  1.00 62.73  ? 141 ILE A C  1 
ATOM 420   O O  . ILE A 1 141 ? 131.358 157.438 49.000  1.00 62.73  ? 141 ILE A O  1 
ATOM 421   N N  . ASN A 1 142 ? 132.860 158.660 47.839  1.00 63.59  ? 142 ASN A N  1 
ATOM 422   C CA . ASN A 1 142 ? 133.012 157.716 46.737  1.00 63.59  ? 142 ASN A CA 1 
ATOM 423   C C  . ASN A 1 142 ? 134.474 157.648 46.319  1.00 63.59  ? 142 ASN A C  1 
ATOM 424   O O  . ASN A 1 142 ? 134.821 157.761 45.144  1.00 63.59  ? 142 ASN A O  1 
ATOM 425   N N  . GLY A 1 143 ? 135.368 157.489 47.280  1.00 68.83  ? 143 GLY A N  1 
ATOM 426   C CA . GLY A 1 143 ? 136.761 157.373 46.912  1.00 68.83  ? 143 GLY A CA 1 
ATOM 427   C C  . GLY A 1 143 ? 137.603 156.990 48.098  1.00 68.83  ? 143 GLY A C  1 
ATOM 428   O O  . GLY A 1 143 ? 137.095 156.747 49.190  1.00 68.83  ? 143 GLY A O  1 
ATOM 429   N N  . SER A 1 144 ? 138.912 156.939 47.867  1.00 79.82  ? 144 SER A N  1 
ATOM 430   C CA . SER A 1 144 ? 139.845 156.657 48.948  1.00 79.82  ? 144 SER A CA 1 
ATOM 431   C C  . SER A 1 144 ? 140.030 157.938 49.761  1.00 79.82  ? 144 SER A C  1 
ATOM 432   O O  . SER A 1 144 ? 140.982 158.702 49.584  1.00 79.82  ? 144 SER A O  1 
ATOM 433   N N  . CYS A 1 145 ? 139.076 158.181 50.659  1.00 80.32  ? 145 CYS A N  1 
ATOM 434   C CA . CYS A 1 145 ? 139.183 159.299 51.584  1.00 80.32  ? 145 CYS A CA 1 
ATOM 435   C C  . CYS A 1 145 ? 140.255 158.998 52.613  1.00 80.32  ? 145 CYS A C  1 
ATOM 436   O O  . CYS A 1 145 ? 140.177 157.994 53.328  1.00 80.32  ? 145 CYS A O  1 
ATOM 437   N N  . LEU A 1 146 ? 141.256 159.865 52.687  1.00 83.92  ? 146 LEU A N  1 
ATOM 438   C CA . LEU A 1 146 ? 142.390 159.633 53.559  1.00 83.92  ? 146 LEU A CA 1 
ATOM 439   C C  . LEU A 1 146 ? 142.907 160.963 54.086  1.00 83.92  ? 146 LEU A C  1 
ATOM 440   O O  . LEU A 1 146 ? 142.827 161.994 53.415  1.00 83.92  ? 146 LEU A O  1 
ATOM 441   N N  . GLY A 1 147 ? 143.412 160.927 55.312  1.00 82.09  ? 147 GLY A N  1 
ATOM 442   C CA . GLY A 1 147 ? 144.085 162.061 55.906  1.00 82.09  ? 147 GLY A CA 1 
ATOM 443   C C  . GLY A 1 147 ? 143.126 163.062 56.501  1.00 82.09  ? 147 GLY A C  1 
ATOM 444   O O  . GLY A 1 147 ? 142.319 162.724 57.369  1.00 82.09  ? 147 GLY A O  1 
ATOM 445   N N  . GLY A 1 148 ? 143.193 164.301 56.024  1.00 86.40  ? 148 GLY A N  1 
ATOM 446   C CA . GLY A 1 148 ? 142.311 165.337 56.518  1.00 86.40  ? 148 GLY A CA 1 
ATOM 447   C C  . GLY A 1 148 ? 140.883 165.226 56.040  1.00 86.40  ? 148 GLY A C  1 
ATOM 448   O O  . GLY A 1 148 ? 140.031 165.982 56.523  1.00 86.40  ? 148 GLY A O  1 
ATOM 449   N N  . GLY A 1 149 ? 140.604 164.308 55.112  1.00 90.07  ? 149 GLY A N  1 
ATOM 450   C CA . GLY A 1 149 ? 139.254 164.147 54.603  1.00 90.07  ? 149 GLY A CA 1 
ATOM 451   C C  . GLY A 1 149 ? 138.269 163.675 55.647  1.00 90.07  ? 149 GLY A C  1 
ATOM 452   O O  . GLY A 1 149 ? 137.099 164.068 55.618  1.00 90.07  ? 149 GLY A O  1 
ATOM 453   N N  . LEU A 1 150 ? 138.731 162.853 56.590  1.00 86.03  ? 150 LEU A N  1 
ATOM 454   C CA . LEU A 1 150 ? 137.891 162.484 57.721  1.00 86.03  ? 150 LEU A CA 1 
ATOM 455   C C  . LEU A 1 150 ? 137.576 163.702 58.572  1.00 86.03  ? 150 LEU A C  1 
ATOM 456   O O  . LEU A 1 150 ? 136.486 163.798 59.150  1.00 86.03  ? 150 LEU A O  1 
ATOM 457   N N  . GLU A 1 151 ? 138.525 164.648 58.635  1.00 91.85  ? 151 GLU A N  1 
ATOM 458   C CA . GLU A 1 151 ? 138.273 165.967 59.200  1.00 91.85  ? 151 GLU A CA 1 
ATOM 459   C C  . GLU A 1 151 ? 137.086 166.630 58.529  1.00 91.85  ? 151 GLU A C  1 
ATOM 460   O O  . GLU A 1 151 ? 136.241 167.231 59.195  1.00 91.85  ? 151 GLU A O  1 
ATOM 461   N N  . VAL A 1 152 ? 137.001 166.519 57.209  1.00 82.38  ? 152 VAL A N  1 
ATOM 462   C CA . VAL A 1 152 ? 135.824 167.031 56.539  1.00 82.38  ? 152 VAL A CA 1 
ATOM 463   C C  . VAL A 1 152 ? 134.667 166.066 56.736  1.00 82.38  ? 152 VAL A C  1 
ATOM 464   O O  . VAL A 1 152 ? 133.517 166.493 56.882  1.00 82.38  ? 152 VAL A O  1 
ATOM 465   N N  . ALA A 1 153 ? 134.952 164.767 56.831  1.00 80.59  ? 153 ALA A N  1 
ATOM 466   C CA . ALA A 1 153 ? 133.877 163.783 56.823  1.00 80.59  ? 153 ALA A CA 1 
ATOM 467   C C  . ALA A 1 153 ? 133.139 163.752 58.148  1.00 80.59  ? 153 ALA A C  1 
ATOM 468   O O  . ALA A 1 153 ? 131.929 163.988 58.206  1.00 80.59  ? 153 ALA A O  1 
ATOM 469   N N  . ILE A 1 154 ? 133.851 163.465 59.235  1.00 85.32  ? 154 ILE A N  1 
ATOM 470   C CA . ILE A 1 154 ? 133.142 163.183 60.469  1.00 85.32  ? 154 ILE A CA 1 
ATOM 471   C C  . ILE A 1 154 ? 132.758 164.469 61.198  1.00 85.32  ? 154 ILE A C  1 
ATOM 472   O O  . ILE A 1 154 ? 132.002 164.430 62.175  1.00 85.32  ? 154 ILE A O  1 
ATOM 473   N N  . SER A 1 155 ? 133.224 165.625 60.723  1.00 88.75  ? 155 SER A N  1 
ATOM 474   C CA . SER A 1 155 ? 132.684 166.883 61.224  1.00 88.75  ? 155 SER A CA 1 
ATOM 475   C C  . SER A 1 155 ? 131.254 167.101 60.775  1.00 88.75  ? 155 SER A C  1 
ATOM 476   O O  . SER A 1 155 ? 130.521 167.856 61.418  1.00 88.75  ? 155 SER A O  1 
ATOM 477   N N  . CYS A 1 156 ? 130.848 166.462 59.685  1.00 87.34  ? 156 CYS A N  1 
ATOM 478   C CA . CYS A 1 156 ? 129.493 166.567 59.177  1.00 87.34  ? 156 CYS A CA 1 
ATOM 479   C C  . CYS A 1 156 ? 128.512 165.835 60.083  1.00 87.34  ? 156 CYS A C  1 
ATOM 480   O O  . CYS A 1 156 ? 128.887 165.113 61.009  1.00 87.34  ? 156 CYS A O  1 
ATOM 481   N N  . GLN A 1 157 ? 127.227 166.015 59.800  1.00 79.31  ? 157 GLN A N  1 
ATOM 482   C CA . GLN A 1 157 ? 126.190 165.395 60.598  1.00 79.31  ? 157 GLN A CA 1 
ATOM 483   C C  . GLN A 1 157 ? 125.842 163.994 60.135  1.00 79.31  ? 157 GLN A C  1 
ATOM 484   O O  . GLN A 1 157 ? 125.244 163.241 60.910  1.00 79.31  ? 157 GLN A O  1 
ATOM 485   N N  . TYR A 1 158 ? 126.238 163.619 58.920  1.00 69.60  ? 158 TYR A N  1 
ATOM 486   C CA . TYR A 1 158 ? 125.687 162.438 58.262  1.00 69.60  ? 158 TYR A CA 1 
ATOM 487   C C  . TYR A 1 158 ? 126.473 162.204 56.987  1.00 69.60  ? 158 TYR A C  1 
ATOM 488   O O  . TYR A 1 158 ? 126.339 162.985 56.043  1.00 69.60  ? 158 TYR A O  1 
ATOM 489   N N  . ARG A 1 159 ? 127.264 161.146 56.921  1.00 73.12  ? 159 ARG A N  1 
ATOM 490   C CA . ARG A 1 159 ? 127.982 160.874 55.690  1.00 73.12  ? 159 ARG A CA 1 
ATOM 491   C C  . ARG A 1 159 ? 127.498 159.570 55.088  1.00 73.12  ? 159 ARG A C  1 
ATOM 492   O O  . ARG A 1 159 ? 126.824 158.774 55.743  1.00 73.12  ? 159 ARG A O  1 
ATOM 493   N N  . ILE A 1 160 ? 127.840 159.377 53.819  1.00 59.10  ? 160 ILE A N  1 
ATOM 494   C CA . ILE A 1 160 ? 127.298 158.304 52.999  1.00 59.10  ? 160 ILE A CA 1 
ATOM 495   C C  . ILE A 1 160 ? 128.388 157.803 52.058  1.00 59.10  ? 160 ILE A C  1 
ATOM 496   O O  . ILE A 1 160 ? 129.134 158.593 51.468  1.00 59.10  ? 160 ILE A O  1 
ATOM 497   N N  . ALA A 1 161 ? 128.501 156.481 51.949  1.00 59.10  ? 161 ALA A N  1 
ATOM 498   C CA . ALA A 1 161 ? 129.662 155.843 51.353  1.00 59.10  ? 161 ALA A CA 1 
ATOM 499   C C  . ALA A 1 161 ? 129.251 154.794 50.335  1.00 59.10  ? 161 ALA A C  1 
ATOM 500   O O  . ALA A 1 161 ? 128.132 154.275 50.351  1.00 59.10  ? 161 ALA A O  1 
ATOM 501   N N  . THR A 1 162 ? 130.201 154.463 49.464  1.00 64.05  ? 162 THR A N  1 
ATOM 502   C CA . THR A 1 162 ? 129.990 153.568 48.336  1.00 64.05  ? 162 THR A CA 1 
ATOM 503   C C  . THR A 1 162 ? 130.750 152.272 48.554  1.00 64.05  ? 162 THR A C  1 
ATOM 504   O O  . THR A 1 162 ? 131.979 152.281 48.626  1.00 64.05  ? 162 THR A O  1 
ATOM 505   N N  . LYS A 1 163 ? 130.025 151.162 48.629  1.00 70.33  ? 163 LYS A N  1 
ATOM 506   C CA . LYS A 1 163 ? 130.618 149.872 48.970  1.00 70.33  ? 163 LYS A CA 1 
ATOM 507   C C  . LYS A 1 163 ? 131.304 149.281 47.744  1.00 70.33  ? 163 LYS A C  1 
ATOM 508   O O  . LYS A 1 163 ? 130.662 148.639 46.914  1.00 70.33  ? 163 LYS A O  1 
ATOM 509   N N  . ASP A 1 164 ? 132.615 149.485 47.631  1.00 71.69  ? 164 ASP A N  1 
ATOM 510   C CA . ASP A 1 164 ? 133.442 148.808 46.632  1.00 71.69  ? 164 ASP A CA 1 
ATOM 511   C C  . ASP A 1 164 ? 134.886 148.795 47.124  1.00 71.69  ? 164 ASP A C  1 
ATOM 512   O O  . ASP A 1 164 ? 135.211 149.381 48.161  1.00 71.69  ? 164 ASP A O  1 
ATOM 513   N N  . ARG A 1 165 ? 135.758 148.132 46.363  1.00 75.60  ? 165 ARG A N  1 
ATOM 514   C CA . ARG A 1 165 ? 137.140 147.960 46.798  1.00 75.60  ? 165 ARG A CA 1 
ATOM 515   C C  . ARG A 1 165 ? 137.933 149.250 46.667  1.00 75.60  ? 165 ARG A C  1 
ATOM 516   O O  . ARG A 1 165 ? 138.899 149.468 47.406  1.00 75.60  ? 165 ARG A O  1 
ATOM 517   N N  . LYS A 1 166 ? 137.547 150.107 45.722  1.00 72.37  ? 166 LYS A N  1 
ATOM 518   C CA . LYS A 1 166 ? 138.327 151.306 45.449  1.00 72.37  ? 166 LYS A CA 1 
ATOM 519   C C  . LYS A 1 166 ? 138.204 152.317 46.577  1.00 72.37  ? 166 LYS A C  1 
ATOM 520   O O  . LYS A 1 166 ? 139.206 152.898 47.004  1.00 72.37  ? 166 LYS A O  1 
ATOM 521   N N  . THR A 1 167 ? 136.994 152.539 47.076  1.00 74.76  ? 167 THR A N  1 
ATOM 522   C CA . THR A 1 167 ? 136.806 153.388 48.246  1.00 74.76  ? 167 THR A CA 1 
ATOM 523   C C  . THR A 1 167 ? 137.371 152.689 49.463  1.00 74.76  ? 167 THR A C  1 
ATOM 524   O O  . THR A 1 167 ? 136.940 151.589 49.814  1.00 74.76  ? 167 THR A O  1 
ATOM 525   N N  . VAL A 1 168 ? 138.373 153.304 50.073  1.00 83.82  ? 168 VAL A N  1 
ATOM 526   C CA . VAL A 1 168 ? 138.847 152.911 51.385  1.00 83.82  ? 168 VAL A CA 1 
ATOM 527   C C  . VAL A 1 168 ? 138.826 154.151 52.256  1.00 83.82  ? 168 VAL A C  1 
ATOM 528   O O  . VAL A 1 168 ? 138.788 155.283 51.771  1.00 83.82  ? 168 VAL A O  1 
ATOM 529   N N  . LEU A 1 169 ? 138.845 153.929 53.561  1.00 86.69  ? 169 LEU A N  1 
ATOM 530   C CA . LEU A 1 169 ? 138.755 155.004 54.535  1.00 86.69  ? 169 LEU A CA 1 
ATOM 531   C C  . LEU A 1 169 ? 139.841 154.737 55.567  1.00 86.69  ? 169 LEU A C  1 
ATOM 532   O O  . LEU A 1 169 ? 139.738 153.794 56.357  1.00 86.69  ? 169 LEU A O  1 
ATOM 533   N N  . GLY A 1 170 ? 140.909 155.530 55.513  1.00 90.55  ? 170 GLY A N  1 
ATOM 534   C CA . GLY A 1 170 ? 142.021 155.365 56.418  1.00 90.55  ? 170 GLY A CA 1 
ATOM 535   C C  . GLY A 1 170 ? 142.555 156.713 56.855  1.00 90.55  ? 170 GLY A C  1 
ATOM 536   O O  . GLY A 1 170 ? 142.250 157.746 56.267  1.00 90.55  ? 170 GLY A O  1 
ATOM 537   N N  . THR A 1 171 ? 143.363 156.686 57.915  1.00 100.62 ? 171 THR A N  1 
ATOM 538   C CA . THR A 1 171 ? 143.977 157.891 58.467  1.00 100.62 ? 171 THR A CA 1 
ATOM 539   C C  . THR A 1 171 ? 145.491 157.771 58.372  1.00 100.62 ? 171 THR A C  1 
ATOM 540   O O  . THR A 1 171 ? 146.140 157.261 59.295  1.00 100.62 ? 171 THR A O  1 
ATOM 541   N N  . PRO A 1 172 ? 146.095 158.217 57.280  1.00 105.27 ? 172 PRO A N  1 
ATOM 542   C CA . PRO A 1 172 ? 147.553 158.310 57.244  1.00 105.27 ? 172 PRO A CA 1 
ATOM 543   C C  . PRO A 1 172 ? 148.028 159.476 58.081  1.00 105.27 ? 172 PRO A C  1 
ATOM 544   O O  . PRO A 1 172 ? 148.255 160.584 57.591  1.00 105.27 ? 172 PRO A O  1 
ATOM 545   N N  . GLU A 1 173 ? 148.121 159.224 59.380  1.00 104.22 ? 173 GLU A N  1 
ATOM 546   C CA . GLU A 1 173 ? 148.626 160.180 60.352  1.00 104.22 ? 173 GLU A CA 1 
ATOM 547   C C  . GLU A 1 173 ? 149.918 159.700 60.991  1.00 104.22 ? 173 GLU A C  1 
ATOM 548   O O  . GLU A 1 173 ? 150.916 160.424 60.991  1.00 104.22 ? 173 GLU A O  1 
ATOM 549   N N  . VAL A 1 174 ? 149.922 158.497 61.551  1.00 96.17  ? 174 VAL A N  1 
ATOM 550   C CA . VAL A 1 174 ? 151.136 158.015 62.176  1.00 96.17  ? 174 VAL A CA 1 
ATOM 551   C C  . VAL A 1 174 ? 152.078 157.445 61.141  1.00 96.17  ? 174 VAL A C  1 
ATOM 552   O O  . VAL A 1 174 ? 153.283 157.353 61.387  1.00 96.17  ? 174 VAL A O  1 
ATOM 553   N N  . LEU A 1 175 ? 151.565 157.067 59.970  1.00 101.85 ? 175 LEU A N  1 
ATOM 554   C CA . LEU A 1 175 ? 152.432 156.515 58.942  1.00 101.85 ? 175 LEU A CA 1 
ATOM 555   C C  . LEU A 1 175 ? 153.368 157.553 58.364  1.00 101.85 ? 175 LEU A C  1 
ATOM 556   O O  . LEU A 1 175 ? 154.466 157.200 57.928  1.00 101.85 ? 175 LEU A O  1 
ATOM 557   N N  . LEU A 1 176 ? 152.980 158.818 58.362  1.00 93.27  ? 176 LEU A N  1 
ATOM 558   C CA . LEU A 1 176 ? 154.002 159.820 58.144  1.00 93.27  ? 176 LEU A CA 1 
ATOM 559   C C  . LEU A 1 176 ? 154.442 160.453 59.452  1.00 93.27  ? 176 LEU A C  1 
ATOM 560   O O  . LEU A 1 176 ? 155.389 161.244 59.458  1.00 93.27  ? 176 LEU A O  1 
ATOM 561   N N  . GLY A 1 177 ? 153.799 160.096 60.559  1.00 98.19  ? 177 GLY A N  1 
ATOM 562   C CA . GLY A 1 177 ? 154.243 160.542 61.859  1.00 98.19  ? 177 GLY A CA 1 
ATOM 563   C C  . GLY A 1 177 ? 153.852 161.948 62.237  1.00 98.19  ? 177 GLY A C  1 
ATOM 564   O O  . GLY A 1 177 ? 154.721 162.822 62.318  1.00 98.19  ? 177 GLY A O  1 
ATOM 565   N N  . ALA A 1 178 ? 152.572 162.203 62.466  1.00 99.81  ? 178 ALA A N  1 
ATOM 566   C CA . ALA A 1 178 ? 152.112 163.538 62.819  1.00 99.81  ? 178 ALA A CA 1 
ATOM 567   C C  . ALA A 1 178 ? 150.839 163.390 63.644  1.00 99.81  ? 178 ALA A C  1 
ATOM 568   O O  . ALA A 1 178 ? 150.581 162.327 64.218  1.00 99.81  ? 178 ALA A O  1 
ATOM 569   N N  . LEU A 1 179 ? 150.088 164.470 63.757  1.00 99.79  ? 179 LEU A N  1 
ATOM 570   C CA . LEU A 1 179 ? 148.707 164.482 64.196  1.00 99.79  ? 179 LEU A CA 1 
ATOM 571   C C  . LEU A 1 179 ? 147.906 165.129 63.072  1.00 99.79  ? 179 LEU A C  1 
ATOM 572   O O  . LEU A 1 179 ? 148.474 165.897 62.289  1.00 99.79  ? 179 LEU A O  1 
ATOM 573   N N  . PRO A 1 180 ? 146.577 164.831 62.929  1.00 99.97  ? 180 PRO A N  1 
ATOM 574   C CA . PRO A 1 180 ? 145.943 165.033 61.614  1.00 99.97  ? 180 PRO A CA 1 
ATOM 575   C C  . PRO A 1 180 ? 145.720 166.489 61.227  1.00 99.97  ? 180 PRO A C  1 
ATOM 576   O O  . PRO A 1 180 ? 146.040 167.399 61.999  1.00 99.97  ? 180 PRO A O  1 
ATOM 577   N N  . GLY A 1 181 ? 145.160 166.701 60.031  1.00 99.26  ? 181 GLY A N  1 
ATOM 578   C CA . GLY A 1 181 ? 145.161 168.020 59.418  1.00 99.26  ? 181 GLY A CA 1 
ATOM 579   C C  . GLY A 1 181 ? 144.311 169.052 60.132  1.00 99.26  ? 181 GLY A C  1 
ATOM 580   O O  . GLY A 1 181 ? 144.545 170.256 59.986  1.00 99.26  ? 181 GLY A O  1 
ATOM 581   N N  . ALA A 1 182 ? 143.314 168.611 60.897  1.00 100.74 ? 182 ALA A N  1 
ATOM 582   C CA . ALA A 1 182 ? 142.569 169.543 61.730  1.00 100.74 ? 182 ALA A CA 1 
ATOM 583   C C  . ALA A 1 182 ? 142.217 168.964 63.094  1.00 100.74 ? 182 ALA A C  1 
ATOM 584   O O  . ALA A 1 182 ? 141.328 169.502 63.764  1.00 100.74 ? 182 ALA A O  1 
ATOM 585   N N  . GLY A 1 183 ? 142.878 167.896 63.524  1.00 95.78  ? 183 GLY A N  1 
ATOM 586   C CA . GLY A 1 183 ? 142.685 167.380 64.860  1.00 95.78  ? 183 GLY A CA 1 
ATOM 587   C C  . GLY A 1 183 ? 141.321 166.771 65.088  1.00 95.78  ? 183 GLY A C  1 
ATOM 588   O O  . GLY A 1 183 ? 140.612 167.152 66.021  1.00 95.78  ? 183 GLY A O  1 
ATOM 589   N N  . GLY A 1 184 ? 140.943 165.826 64.243  1.00 94.51  ? 184 GLY A N  1 
ATOM 590   C CA . GLY A 1 184 ? 139.684 165.136 64.383  1.00 94.51  ? 184 GLY A CA 1 
ATOM 591   C C  . GLY A 1 184 ? 139.665 164.121 65.489  1.00 94.51  ? 184 GLY A C  1 
ATOM 592   O O  . GLY A 1 184 ? 138.603 163.629 65.873  1.00 94.51  ? 184 GLY A O  1 
ATOM 593   N N  . THR A 1 185 ? 140.830 163.826 66.054  1.00 97.07  ? 185 THR A N  1 
ATOM 594   C CA . THR A 1 185 ? 140.952 162.878 67.142  1.00 97.07  ? 185 THR A CA 1 
ATOM 595   C C  . THR A 1 185 ? 140.320 163.364 68.435  1.00 97.07  ? 185 THR A C  1 
ATOM 596   O O  . THR A 1 185 ? 140.277 162.599 69.397  1.00 97.07  ? 185 THR A O  1 
ATOM 597   N N  . GLN A 1 186 ? 139.854 164.607 68.500  1.00 96.36  ? 186 GLN A N  1 
ATOM 598   C CA . GLN A 1 186 ? 139.065 165.053 69.632  1.00 96.36  ? 186 GLN A CA 1 
ATOM 599   C C  . GLN A 1 186 ? 137.572 164.960 69.364  1.00 96.36  ? 186 GLN A C  1 
ATOM 600   O O  . GLN A 1 186 ? 136.778 165.484 70.150  1.00 96.36  ? 186 GLN A O  1 
ATOM 601   N N  . ARG A 1 187 ? 137.169 164.323 68.264  1.00 90.26  ? 187 ARG A N  1 
ATOM 602   C CA . ARG A 1 187 ? 135.763 163.958 68.145  1.00 90.26  ? 187 ARG A CA 1 
ATOM 603   C C  . ARG A 1 187 ? 135.550 162.593 67.503  1.00 90.26  ? 187 ARG A C  1 
ATOM 604   O O  . ARG A 1 187 ? 134.403 162.164 67.361  1.00 90.26  ? 187 ARG A O  1 
ATOM 605   N N  . LEU A 1 188 ? 136.618 161.904 67.104  1.00 86.18  ? 188 LEU A N  1 
ATOM 606   C CA . LEU A 1 188 ? 136.475 160.472 66.838  1.00 86.18  ? 188 LEU A CA 1 
ATOM 607   C C  . LEU A 1 188 ? 136.020 159.669 68.058  1.00 86.18  ? 188 LEU A C  1 
ATOM 608   O O  . LEU A 1 188 ? 135.015 158.949 67.935  1.00 86.18  ? 188 LEU A O  1 
ATOM 609   N N  . PRO A 1 189 ? 136.661 159.729 69.238  1.00 85.21  ? 189 PRO A N  1 
ATOM 610   C CA . PRO A 1 189 ? 136.175 158.882 70.331  1.00 85.21  ? 189 PRO A CA 1 
ATOM 611   C C  . PRO A 1 189 ? 134.929 159.410 70.992  1.00 85.21  ? 189 PRO A C  1 
ATOM 612   O O  . PRO A 1 189 ? 134.277 158.669 71.732  1.00 85.21  ? 189 PRO A O  1 
ATOM 613   N N  . LYS A 1 190 ? 134.588 160.674 70.760  1.00 86.55  ? 190 LYS A N  1 
ATOM 614   C CA . LYS A 1 190 ? 133.252 161.150 71.081  1.00 86.55  ? 190 LYS A CA 1 
ATOM 615   C C  . LYS A 1 190 ? 132.208 160.423 70.246  1.00 86.55  ? 190 LYS A C  1 
ATOM 616   O O  . LYS A 1 190 ? 131.082 160.195 70.704  1.00 86.55  ? 190 LYS A O  1 
ATOM 617   N N  . MET A 1 191 ? 132.587 160.003 69.042  1.00 93.23  ? 191 MET A N  1 
ATOM 618   C CA . MET A 1 191 ? 131.685 159.411 68.065  1.00 93.23  ? 191 MET A CA 1 
ATOM 619   C C  . MET A 1 191 ? 131.710 157.889 68.120  1.00 93.23  ? 191 MET A C  1 
ATOM 620   O O  . MET A 1 191 ? 130.671 157.253 68.310  1.00 93.23  ? 191 MET A O  1 
ATOM 621   N N  . VAL A 1 192 ? 132.883 157.292 67.935  1.00 88.46  ? 192 VAL A N  1 
ATOM 622   C CA . VAL A 1 192 ? 132.952 155.841 67.828  1.00 88.46  ? 192 VAL A CA 1 
ATOM 623   C C  . VAL A 1 192 ? 133.527 155.248 69.111  1.00 88.46  ? 192 VAL A C  1 
ATOM 624   O O  . VAL A 1 192 ? 133.139 154.146 69.515  1.00 88.46  ? 192 VAL A O  1 
ATOM 625   N N  . GLY A 1 193 ? 134.391 155.988 69.805  1.00 92.63  ? 193 GLY A N  1 
ATOM 626   C CA . GLY A 1 193 ? 134.897 155.506 71.079  1.00 92.63  ? 193 GLY A CA 1 
ATOM 627   C C  . GLY A 1 193 ? 136.403 155.457 71.235  1.00 92.63  ? 193 GLY A C  1 
ATOM 628   O O  . GLY A 1 193 ? 137.135 155.327 70.251  1.00 92.63  ? 193 GLY A O  1 
ATOM 629   N N  . VAL A 1 194 ? 136.867 155.593 72.484  1.00 89.27  ? 194 VAL A N  1 
ATOM 630   C CA . VAL A 1 194 ? 138.294 155.437 72.769  1.00 89.27  ? 194 VAL A CA 1 
ATOM 631   C C  . VAL A 1 194 ? 138.836 154.060 72.406  1.00 89.27  ? 194 VAL A C  1 
ATOM 632   O O  . VAL A 1 194 ? 139.786 153.990 71.619  1.00 89.27  ? 194 VAL A O  1 
ATOM 633   N N  . PRO A 1 195 ? 138.283 152.930 72.906  1.00 99.97  ? 195 PRO A N  1 
ATOM 634   C CA . PRO A 1 195 ? 138.932 151.655 72.568  1.00 99.97  ? 195 PRO A CA 1 
ATOM 635   C C  . PRO A 1 195 ? 138.629 151.194 71.165  1.00 99.97  ? 195 PRO A C  1 
ATOM 636   O O  . PRO A 1 195 ? 139.365 150.356 70.633  1.00 99.97  ? 195 PRO A O  1 
ATOM 637   N N  . ALA A 1 196 ? 137.565 151.703 70.554  1.00 99.11  ? 196 ALA A N  1 
ATOM 638   C CA . ALA A 1 196 ? 137.216 151.302 69.205  1.00 99.11  ? 196 ALA A CA 1 
ATOM 639   C C  . ALA A 1 196 ? 138.170 151.865 68.168  1.00 99.11  ? 196 ALA A C  1 
ATOM 640   O O  . ALA A 1 196 ? 138.727 151.096 67.380  1.00 99.11  ? 196 ALA A O  1 
ATOM 641   N N  . ALA A 1 197 ? 138.407 153.169 68.173  1.00 100.62 ? 197 ALA A N  1 
ATOM 642   C CA . ALA A 1 197 ? 139.306 153.761 67.211  1.00 100.62 ? 197 ALA A CA 1 
ATOM 643   C C  . ALA A 1 197 ? 140.699 153.974 67.752  1.00 100.62 ? 197 ALA A C  1 
ATOM 644   O O  . ALA A 1 197 ? 141.552 154.480 67.012  1.00 100.62 ? 197 ALA A O  1 
ATOM 645   N N  . LEU A 1 198 ? 140.960 153.626 69.008  1.00 97.00  ? 198 LEU A N  1 
ATOM 646   C CA . LEU A 1 198 ? 142.315 153.740 69.503  1.00 97.00  ? 198 LEU A CA 1 
ATOM 647   C C  . LEU A 1 198 ? 143.221 152.733 68.818  1.00 97.00  ? 198 LEU A C  1 
ATOM 648   O O  . LEU A 1 198 ? 144.387 153.036 68.576  1.00 97.00  ? 198 LEU A O  1 
ATOM 649   N N  . ASP A 1 199 ? 142.694 151.574 68.434  1.00 105.35 ? 199 ASP A N  1 
ATOM 650   C CA . ASP A 1 199 ? 143.404 150.692 67.523  1.00 105.35 ? 199 ASP A CA 1 
ATOM 651   C C  . ASP A 1 199 ? 143.141 151.030 66.069  1.00 105.35 ? 199 ASP A C  1 
ATOM 652   O O  . ASP A 1 199 ? 143.298 150.163 65.210  1.00 105.35 ? 199 ASP A O  1 
ATOM 653   N N  . MET A 1 200 ? 142.727 152.254 65.771  1.00 100.54 ? 200 MET A N  1 
ATOM 654   C CA . MET A 1 200 ? 142.582 152.682 64.391  1.00 100.54 ? 200 MET A CA 1 
ATOM 655   C C  . MET A 1 200 ? 143.514 153.837 64.079  1.00 100.54 ? 200 MET A C  1 
ATOM 656   O O  . MET A 1 200 ? 144.247 153.788 63.089  1.00 100.54 ? 200 MET A O  1 
ATOM 657   N N  . MET A 1 201 ? 143.511 154.877 64.910  1.00 94.96  ? 201 MET A N  1 
ATOM 658   C CA . MET A 1 201 ? 144.110 156.128 64.463  1.00 94.96  ? 201 MET A CA 1 
ATOM 659   C C  . MET A 1 201 ? 145.628 156.082 64.572  1.00 94.96  ? 201 MET A C  1 
ATOM 660   O O  . MET A 1 201 ? 146.329 156.879 63.939  1.00 94.96  ? 201 MET A O  1 
ATOM 661   N N  . LEU A 1 202 ? 146.167 155.148 65.348  1.00 87.74  ? 202 LEU A N  1 
ATOM 662   C CA . LEU A 1 202 ? 147.606 154.944 65.335  1.00 87.74  ? 202 LEU A CA 1 
ATOM 663   C C  . LEU A 1 202 ? 148.015 153.538 64.936  1.00 87.74  ? 202 LEU A C  1 
ATOM 664   O O  . LEU A 1 202 ? 149.185 153.182 65.096  1.00 87.74  ? 202 LEU A O  1 
ATOM 665   N N  . THR A 1 203 ? 147.102 152.727 64.417  1.00 94.04  ? 203 THR A N  1 
ATOM 666   C CA . THR A 1 203 ? 147.592 151.543 63.733  1.00 94.04  ? 203 THR A CA 1 
ATOM 667   C C  . THR A 1 203 ? 147.983 151.858 62.300  1.00 94.04  ? 203 THR A C  1 
ATOM 668   O O  . THR A 1 203 ? 148.651 151.040 61.661  1.00 94.04  ? 203 THR A O  1 
ATOM 669   N N  . GLY A 1 204 ? 147.575 153.018 61.787  1.00 90.60  ? 204 GLY A N  1 
ATOM 670   C CA . GLY A 1 204 ? 147.893 153.439 60.437  1.00 90.60  ? 204 GLY A CA 1 
ATOM 671   C C  . GLY A 1 204 ? 147.015 152.857 59.348  1.00 90.60  ? 204 GLY A C  1 
ATOM 672   O O  . GLY A 1 204 ? 146.783 153.505 58.326  1.00 90.60  ? 204 GLY A O  1 
ATOM 673   N N  . ARG A 1 205 ? 146.506 151.650 59.558  1.00 89.39  ? 205 ARG A N  1 
ATOM 674   C CA . ARG A 1 205 ? 145.908 150.879 58.487  1.00 89.39  ? 205 ARG A CA 1 
ATOM 675   C C  . ARG A 1 205 ? 144.491 151.354 58.199  1.00 89.39  ? 205 ARG A C  1 
ATOM 676   O O  . ARG A 1 205 ? 143.768 151.825 59.077  1.00 89.39  ? 205 ARG A O  1 
ATOM 677   N N  . SER A 1 206 ? 144.104 151.221 56.939  1.00 88.07  ? 206 SER A N  1 
ATOM 678   C CA . SER A 1 206 ? 142.829 151.693 56.438  1.00 88.07  ? 206 SER A CA 1 
ATOM 679   C C  . SER A 1 206 ? 141.774 150.609 56.601  1.00 88.07  ? 206 SER A C  1 
ATOM 680   O O  . SER A 1 206 ? 142.081 149.447 56.871  1.00 88.07  ? 206 SER A O  1 
ATOM 681   N N  . ILE A 1 207 ? 140.510 150.996 56.441  1.00 90.28  ? 207 ILE A N  1 
ATOM 682   C CA . ILE A 1 207 ? 139.383 150.076 56.520  1.00 90.28  ? 207 ILE A CA 1 
ATOM 683   C C  . ILE A 1 207 ? 138.567 150.258 55.251  1.00 90.28  ? 207 ILE A C  1 
ATOM 684   O O  . ILE A 1 207 ? 138.379 151.387 54.793  1.00 90.28  ? 207 ILE A O  1 
ATOM 685   N N  . ARG A 1 208 ? 138.073 149.163 54.684  1.00 87.71  ? 208 ARG A N  1 
ATOM 686   C CA . ARG A 1 208 ? 137.116 149.311 53.601  1.00 87.71  ? 208 ARG A CA 1 
ATOM 687   C C  . ARG A 1 208 ? 135.764 149.747 54.143  1.00 87.71  ? 208 ARG A C  1 
ATOM 688   O O  . ARG A 1 208 ? 135.515 149.742 55.349  1.00 87.71  ? 208 ARG A O  1 
ATOM 689   N N  . ALA A 1 209 ? 134.870 150.094 53.226  1.00 79.62  ? 209 ALA A N  1 
ATOM 690   C CA . ALA A 1 209 ? 133.585 150.653 53.607  1.00 79.62  ? 209 ALA A CA 1 
ATOM 691   C C  . ALA A 1 209 ? 132.645 149.633 54.229  1.00 79.62  ? 209 ALA A C  1 
ATOM 692   O O  . ALA A 1 209 ? 131.615 150.032 54.778  1.00 79.62  ? 209 ALA A O  1 
ATOM 693   N N  . ASP A 1 210 ? 132.963 148.344 54.158  1.00 85.99  ? 210 ASP A N  1 
ATOM 694   C CA . ASP A 1 210 ? 132.044 147.342 54.679  1.00 85.99  ? 210 ASP A CA 1 
ATOM 695   C C  . ASP A 1 210 ? 132.047 147.335 56.203  1.00 85.99  ? 210 ASP A C  1 
ATOM 696   O O  . ASP A 1 210 ? 130.981 147.325 56.828  1.00 85.99  ? 210 ASP A O  1 
ATOM 697   N N  . ARG A 1 211 ? 133.227 147.350 56.820  1.00 85.13  ? 211 ARG A N  1 
ATOM 698   C CA . ARG A 1 211 ? 133.300 147.358 58.275  1.00 85.13  ? 211 ARG A CA 1 
ATOM 699   C C  . ARG A 1 211 ? 132.993 148.714 58.883  1.00 85.13  ? 211 ARG A C  1 
ATOM 700   O O  . ARG A 1 211 ? 132.866 148.801 60.104  1.00 85.13  ? 211 ARG A O  1 
ATOM 701   N N  . ALA A 1 212 ? 132.879 149.767 58.077  1.00 78.80  ? 212 ALA A N  1 
ATOM 702   C CA . ALA A 1 212 ? 132.634 151.084 58.640  1.00 78.80  ? 212 ALA A CA 1 
ATOM 703   C C  . ALA A 1 212 ? 131.206 151.243 59.141  1.00 78.80  ? 212 ALA A C  1 
ATOM 704   O O  . ALA A 1 212 ? 130.947 152.121 59.970  1.00 78.80  ? 212 ALA A O  1 
ATOM 705   N N  . LYS A 1 213 ? 130.280 150.410 58.671  1.00 78.03  ? 213 LYS A N  1 
ATOM 706   C CA . LYS A 1 213 ? 128.938 150.416 59.236  1.00 78.03  ? 213 LYS A CA 1 
ATOM 707   C C  . LYS A 1 213 ? 128.930 149.767 60.610  1.00 78.03  ? 213 LYS A C  1 
ATOM 708   O O  . LYS A 1 213 ? 128.352 150.309 61.558  1.00 78.03  ? 213 LYS A O  1 
ATOM 709   N N  . LYS A 1 214 ? 129.566 148.601 60.735  1.00 79.19  ? 214 LYS A N  1 
ATOM 710   C CA . LYS A 1 214 ? 129.647 147.931 62.028  1.00 79.19  ? 214 LYS A CA 1 
ATOM 711   C C  . LYS A 1 214 ? 130.519 148.708 62.998  1.00 79.19  ? 214 LYS A C  1 
ATOM 712   O O  . LYS A 1 214 ? 130.342 148.602 64.215  1.00 79.19  ? 214 LYS A O  1 
ATOM 713   N N  . MET A 1 215 ? 131.464 149.485 62.479  1.00 82.29  ? 215 MET A N  1 
ATOM 714   C CA . MET A 1 215 ? 132.209 150.402 63.325  1.00 82.29  ? 215 MET A CA 1 
ATOM 715   C C  . MET A 1 215 ? 131.339 151.586 63.706  1.00 82.29  ? 215 MET A C  1 
ATOM 716   O O  . MET A 1 215 ? 131.158 151.883 64.891  1.00 82.29  ? 215 MET A O  1 
ATOM 717   N N  . GLY A 1 216 ? 130.766 152.255 62.713  1.00 81.07  ? 216 GLY A N  1 
ATOM 718   C CA . GLY A 1 216 ? 129.814 153.312 62.952  1.00 81.07  ? 216 GLY A CA 1 
ATOM 719   C C  . GLY A 1 216 ? 130.204 154.688 62.463  1.00 81.07  ? 216 GLY A C  1 
ATOM 720   O O  . GLY A 1 216 ? 129.524 155.658 62.816  1.00 81.07  ? 216 GLY A O  1 
ATOM 721   N N  . LEU A 1 217 ? 131.270 154.814 61.677  1.00 79.04  ? 217 LEU A N  1 
ATOM 722   C CA . LEU A 1 217 ? 131.638 156.119 61.152  1.00 79.04  ? 217 LEU A CA 1 
ATOM 723   C C  . LEU A 1 217 ? 130.623 156.553 60.117  1.00 79.04  ? 217 LEU A C  1 
ATOM 724   O O  . LEU A 1 217 ? 129.889 157.524 60.320  1.00 79.04  ? 217 LEU A O  1 
ATOM 725   N N  . VAL A 1 218 ? 130.554 155.823 59.033  1.00 80.42  ? 218 VAL A N  1 
ATOM 726   C CA . VAL A 1 218 ? 129.496 156.021 58.069  1.00 80.42  ? 218 VAL A CA 1 
ATOM 727   C C  . VAL A 1 218 ? 128.373 155.058 58.424  1.00 80.42  ? 218 VAL A C  1 
ATOM 728   O O  . VAL A 1 218 ? 128.595 153.989 58.996  1.00 80.42  ? 218 VAL A O  1 
ATOM 729   N N  . ASP A 1 219 ? 127.146 155.467 58.152  1.00 74.59  ? 219 ASP A N  1 
ATOM 730   C CA . ASP A 1 219 ? 126.003 154.679 58.562  1.00 74.59  ? 219 ASP A CA 1 
ATOM 731   C C  . ASP A 1 219 ? 125.271 153.993 57.427  1.00 74.59  ? 219 ASP A C  1 
ATOM 732   O O  . ASP A 1 219 ? 124.870 152.839 57.582  1.00 74.59  ? 219 ASP A O  1 
ATOM 733   N N  . GLN A 1 220 ? 125.102 154.645 56.289  1.00 71.11  ? 220 GLN A N  1 
ATOM 734   C CA . GLN A 1 220 ? 124.347 154.066 55.193  1.00 71.11  ? 220 GLN A CA 1 
ATOM 735   C C  . GLN A 1 220 ? 125.319 153.693 54.090  1.00 71.11  ? 220 GLN A C  1 
ATOM 736   O O  . GLN A 1 220 ? 126.340 154.359 53.904  1.00 71.11  ? 220 GLN A O  1 
ATOM 737   N N  . LEU A 1 221 ? 125.033 152.599 53.402  1.00 68.97  ? 221 LEU A N  1 
ATOM 738   C CA . LEU A 1 221 ? 125.850 152.201 52.275  1.00 68.97  ? 221 LEU A CA 1 
ATOM 739   C C  . LEU A 1 221 ? 125.024 152.237 51.002  1.00 68.97  ? 221 LEU A C  1 
ATOM 740   O O  . LEU A 1 221 ? 123.797 152.149 51.023  1.00 68.97  ? 221 LEU A O  1 
ATOM 741   N N  . VAL A 1 222 ? 125.718 152.357 49.880  1.00 64.67  ? 222 VAL A N  1 
ATOM 742   C CA . VAL A 1 222 ? 125.087 152.198 48.584  1.00 64.67  ? 222 VAL A CA 1 
ATOM 743   C C  . VAL A 1 222 ? 126.110 151.617 47.621  1.00 64.67  ? 222 VAL A C  1 
ATOM 744   O O  . VAL A 1 222 ? 127.218 152.130 47.466  1.00 64.67  ? 222 VAL A O  1 
ATOM 745   N N  . GLU A 1 223 ? 125.756 150.537 47.019  1.00 63.40  ? 223 GLU A N  1 
ATOM 746   C CA . GLU A 1 223 ? 126.642 149.852 46.100  1.00 63.40  ? 223 GLU A CA 1 
ATOM 747   C C  . GLU A 1 223 ? 126.669 150.573 44.762  1.00 63.40  ? 223 GLU A C  1 
ATOM 748   O O  . GLU A 1 223 ? 125.714 151.258 44.404  1.00 63.40  ? 223 GLU A O  1 
ATOM 749   N N  . PRO A 1 224 ? 127.764 150.479 44.003  1.00 69.76  ? 224 PRO A N  1 
ATOM 750   C CA . PRO A 1 224 ? 127.827 151.217 42.737  1.00 69.76  ? 224 PRO A CA 1 
ATOM 751   C C  . PRO A 1 224 ? 126.979 150.572 41.663  1.00 69.76  ? 224 PRO A C  1 
ATOM 752   O O  . PRO A 1 224 ? 126.294 149.578 41.914  1.00 69.76  ? 224 PRO A O  1 
ATOM 753   N N  . LEU A 1 225 ? 127.025 151.112 40.454  1.00 65.18  ? 225 LEU A N  1 
ATOM 754   C CA . LEU A 1 225 ? 126.185 150.627 39.370  1.00 65.18  ? 225 LEU A CA 1 
ATOM 755   C C  . LEU A 1 225 ? 127.061 150.111 38.248  1.00 65.18  ? 225 LEU A C  1 
ATOM 756   O O  . LEU A 1 225 ? 128.266 150.375 38.226  1.00 65.18  ? 225 LEU A O  1 
ATOM 757   N N  . GLY A 1 226 ? 126.459 149.369 37.332  1.00 67.86  ? 226 GLY A N  1 
ATOM 758   C CA . GLY A 1 226 ? 127.144 148.937 36.144  1.00 67.86  ? 226 GLY A CA 1 
ATOM 759   C C  . GLY A 1 226 ? 126.790 149.810 34.961  1.00 67.86  ? 226 GLY A C  1 
ATOM 760   O O  . GLY A 1 226 ? 127.143 150.988 34.905  1.00 67.86  ? 226 GLY A O  1 
ATOM 761   N N  . PRO A 1 227 ? 126.049 149.256 34.016  1.00 64.90  ? 227 PRO A N  1 
ATOM 762   C CA . PRO A 1 227 ? 125.810 149.949 32.745  1.00 64.90  ? 227 PRO A CA 1 
ATOM 763   C C  . PRO A 1 227 ? 124.830 151.098 32.863  1.00 64.90  ? 227 PRO A C  1 
ATOM 764   O O  . PRO A 1 227 ? 123.857 151.004 33.615  1.00 64.90  ? 227 PRO A O  1 
ATOM 765   N N  . GLY A 1 228 ? 125.059 152.181 32.118  1.00 61.68  ? 228 GLY A N  1 
ATOM 766   C CA . GLY A 1 228 ? 124.167 153.317 32.143  1.00 61.68  ? 228 GLY A CA 1 
ATOM 767   C C  . GLY A 1 228 ? 123.942 153.875 30.752  1.00 61.68  ? 228 GLY A C  1 
ATOM 768   O O  . GLY A 1 228 ? 124.501 153.397 29.768  1.00 61.68  ? 228 GLY A O  1 
ATOM 769   N N  . LEU A 1 229 ? 123.103 154.910 30.692  1.00 66.76  ? 229 LEU A N  1 
ATOM 770   C CA . LEU A 1 229 ? 122.943 155.658 29.451  1.00 66.76  ? 229 LEU A CA 1 
ATOM 771   C C  . LEU A 1 229 ? 124.169 156.520 29.199  1.00 66.76  ? 229 LEU A C  1 
ATOM 772   O O  . LEU A 1 229 ? 124.405 156.987 28.080  1.00 66.76  ? 229 LEU A O  1 
ATOM 773   N N  . LYS A 1 230 ? 124.922 156.792 30.255  1.00 69.02  ? 230 LYS A N  1 
ATOM 774   C CA . LYS A 1 230 ? 126.213 157.458 30.259  1.00 69.02  ? 230 LYS A CA 1 
ATOM 775   C C  . LYS A 1 230 ? 127.232 156.389 30.670  1.00 69.02  ? 230 LYS A C  1 
ATOM 776   O O  . LYS A 1 230 ? 126.793 155.315 31.100  1.00 69.02  ? 230 LYS A O  1 
ATOM 777   N N  . PRO A 1 231 ? 128.548 156.588 30.484  1.00 72.01  ? 231 PRO A N  1 
ATOM 778   C CA . PRO A 1 231 ? 129.534 155.499 30.708  1.00 72.01  ? 231 PRO A CA 1 
ATOM 779   C C  . PRO A 1 231 ? 129.526 154.982 32.137  1.00 72.01  ? 231 PRO A C  1 
ATOM 780   O O  . PRO A 1 231 ? 129.195 155.729 33.068  1.00 72.01  ? 231 PRO A O  1 
ATOM 781   N N  . PRO A 1 232 ? 129.890 153.717 32.358  1.00 72.83  ? 232 PRO A N  1 
ATOM 782   C CA . PRO A 1 232 ? 129.438 152.985 33.553  1.00 72.83  ? 232 PRO A CA 1 
ATOM 783   C C  . PRO A 1 232 ? 130.080 153.380 34.872  1.00 72.83  ? 232 PRO A C  1 
ATOM 784   O O  . PRO A 1 232 ? 129.936 152.631 35.840  1.00 72.83  ? 232 PRO A O  1 
ATOM 785   N N  . GLU A 1 233 ? 130.797 154.479 34.940  1.00 73.81  ? 233 GLU A N  1 
ATOM 786   C CA . GLU A 1 233 ? 131.257 154.995 36.222  1.00 73.81  ? 233 GLU A CA 1 
ATOM 787   C C  . GLU A 1 233 ? 130.862 156.443 36.452  1.00 73.81  ? 233 GLU A C  1 
ATOM 788   O O  . GLU A 1 233 ? 130.708 156.842 37.611  1.00 73.81  ? 233 GLU A O  1 
ATOM 789   N N  . GLU A 1 234 ? 130.652 157.232 35.397  1.00 80.18  ? 234 GLU A N  1 
ATOM 790   C CA . GLU A 1 234 ? 130.231 158.617 35.539  1.00 80.18  ? 234 GLU A CA 1 
ATOM 791   C C  . GLU A 1 234 ? 128.824 158.734 36.109  1.00 80.18  ? 234 GLU A C  1 
ATOM 792   O O  . GLU A 1 234 ? 128.505 159.748 36.736  1.00 80.18  ? 234 GLU A O  1 
ATOM 793   N N  . ARG A 1 235 ? 127.981 157.714 35.949  1.00 68.35  ? 235 ARG A N  1 
ATOM 794   C CA . ARG A 1 235 ? 126.663 157.815 36.558  1.00 68.35  ? 235 ARG A CA 1 
ATOM 795   C C  . ARG A 1 235 ? 126.738 157.550 38.048  1.00 68.35  ? 235 ARG A C  1 
ATOM 796   O O  . ARG A 1 235 ? 125.983 158.140 38.821  1.00 68.35  ? 235 ARG A O  1 
ATOM 797   N N  . THR A 1 236 ? 127.662 156.690 38.472  1.00 67.40  ? 236 THR A N  1 
ATOM 798   C CA . THR A 1 236 ? 127.753 156.349 39.886  1.00 67.40  ? 236 THR A CA 1 
ATOM 799   C C  . THR A 1 236 ? 128.227 157.532 40.711  1.00 67.40  ? 236 THR A C  1 
ATOM 800   O O  . THR A 1 236 ? 127.879 157.648 41.888  1.00 67.40  ? 236 THR A O  1 
ATOM 801   N N  . ILE A 1 237 ? 129.002 158.430 40.111  1.00 66.90  ? 237 ILE A N  1 
ATOM 802   C CA . ILE A 1 237 ? 129.344 159.651 40.818  1.00 66.90  ? 237 ILE A CA 1 
ATOM 803   C C  . ILE A 1 237 ? 128.206 160.654 40.729  1.00 66.90  ? 237 ILE A C  1 
ATOM 804   O O  . ILE A 1 237 ? 128.114 161.555 41.567  1.00 66.90  ? 237 ILE A O  1 
ATOM 805   N N  . GLU A 1 238 ? 127.304 160.499 39.759  1.00 69.91  ? 238 GLU A N  1 
ATOM 806   C CA . GLU A 1 238 ? 126.139 161.359 39.637  1.00 69.91  ? 238 GLU A CA 1 
ATOM 807   C C  . GLU A 1 238 ? 124.887 160.685 40.166  1.00 69.91  ? 238 GLU A C  1 
ATOM 808   O O  . GLU A 1 238 ? 123.796 161.250 40.072  1.00 69.91  ? 238 GLU A O  1 
ATOM 809   N N  . TYR A 1 239 ? 125.023 159.476 40.693  1.00 56.32  ? 239 TYR A N  1 
ATOM 810   C CA . TYR A 1 239 ? 123.933 158.809 41.383  1.00 56.32  ? 239 TYR A CA 1 
ATOM 811   C C  . TYR A 1 239 ? 123.836 159.248 42.826  1.00 56.32  ? 239 TYR A C  1 
ATOM 812   O O  . TYR A 1 239 ? 122.729 159.358 43.364  1.00 56.32  ? 239 TYR A O  1 
ATOM 813   N N  . LEU A 1 240 ? 124.978 159.519 43.451  1.00 61.53  ? 240 LEU A N  1 
ATOM 814   C CA . LEU A 1 240 ? 125.013 159.869 44.860  1.00 61.53  ? 240 LEU A CA 1 
ATOM 815   C C  . LEU A 1 240 ? 124.422 161.228 45.133  1.00 61.53  ? 240 LEU A C  1 
ATOM 816   O O  . LEU A 1 240 ? 123.990 161.477 46.258  1.00 61.53  ? 240 LEU A O  1 
ATOM 817   N N  . GLU A 1 241 ? 124.406 162.099 44.132  1.00 74.71  ? 241 GLU A N  1 
ATOM 818   C CA . GLU A 1 241 ? 123.820 163.421 44.289  1.00 74.71  ? 241 GLU A CA 1 
ATOM 819   C C  . GLU A 1 241 ? 122.338 163.320 44.611  1.00 74.71  ? 241 GLU A C  1 
ATOM 820   O O  . GLU A 1 241 ? 121.829 164.004 45.503  1.00 74.71  ? 241 GLU A O  1 
ATOM 821   N N  . GLU A 1 242 ? 121.644 162.411 43.945  1.00 75.25  ? 242 GLU A N  1 
ATOM 822   C CA . GLU A 1 242 ? 120.214 162.289 44.168  1.00 75.25  ? 242 GLU A CA 1 
ATOM 823   C C  . GLU A 1 242 ? 119.871 161.484 45.413  1.00 75.25  ? 242 GLU A C  1 
ATOM 824   O O  . GLU A 1 242 ? 118.866 161.791 46.064  1.00 75.25  ? 242 GLU A O  1 
ATOM 825   N N  . VAL A 1 243 ? 120.685 160.495 45.783  1.00 62.62  ? 243 VAL A N  1 
ATOM 826   C CA . VAL A 1 243 ? 120.478 159.837 47.066  1.00 62.62  ? 243 VAL A CA 1 
ATOM 827   C C  . VAL A 1 243 ? 120.762 160.810 48.197  1.00 62.62  ? 243 VAL A C  1 
ATOM 828   O O  . VAL A 1 243 ? 120.086 160.820 49.234  1.00 62.62  ? 243 VAL A O  1 
ATOM 829   N N  . ALA A 1 244 ? 121.717 161.700 47.977  1.00 65.96  ? 244 ALA A N  1 
ATOM 830   C CA . ALA A 1 244 ? 121.984 162.744 48.941  1.00 65.96  ? 244 ALA A CA 1 
ATOM 831   C C  . ALA A 1 244 ? 120.842 163.738 49.019  1.00 65.96  ? 244 ALA A C  1 
ATOM 832   O O  . ALA A 1 244 ? 120.489 164.175 50.112  1.00 65.96  ? 244 ALA A O  1 
ATOM 833   N N  . ILE A 1 245 ? 120.227 164.086 47.890  1.00 71.29  ? 245 ILE A N  1 
ATOM 834   C CA . ILE A 1 245 ? 119.165 165.081 47.949  1.00 71.29  ? 245 ILE A CA 1 
ATOM 835   C C  . ILE A 1 245 ? 117.886 164.456 48.499  1.00 71.29  ? 245 ILE A C  1 
ATOM 836   O O  . ILE A 1 245 ? 117.020 165.152 49.043  1.00 71.29  ? 245 ILE A O  1 
ATOM 837   N N  . THR A 1 246 ? 117.753 163.130 48.401  1.00 65.64  ? 246 THR A N  1 
ATOM 838   C CA . THR A 1 246 ? 116.580 162.510 49.003  1.00 65.64  ? 246 THR A CA 1 
ATOM 839   C C  . THR A 1 246 ? 116.823 162.210 50.472  1.00 65.64  ? 246 THR A C  1 
ATOM 840   O O  . THR A 1 246 ? 115.879 161.969 51.226  1.00 65.64  ? 246 THR A O  1 
ATOM 841   N N  . PHE A 1 247 ? 118.080 162.219 50.904  1.00 60.92  ? 247 PHE A N  1 
ATOM 842   C CA . PHE A 1 247 ? 118.321 162.299 52.336  1.00 60.92  ? 247 PHE A CA 1 
ATOM 843   C C  . PHE A 1 247 ? 118.168 163.726 52.822  1.00 60.92  ? 247 PHE A C  1 
ATOM 844   O O  . PHE A 1 247 ? 117.794 163.963 53.972  1.00 60.92  ? 247 PHE A O  1 
ATOM 845   N N  . ALA A 1 248 ? 118.389 164.689 51.936  1.00 72.17  ? 248 ALA A N  1 
ATOM 846   C CA . ALA A 1 248 ? 118.656 166.054 52.367  1.00 72.17  ? 248 ALA A CA 1 
ATOM 847   C C  . ALA A 1 248 ? 117.389 166.771 52.792  1.00 72.17  ? 248 ALA A C  1 
ATOM 848   O O  . ALA A 1 248 ? 117.379 167.469 53.813  1.00 72.17  ? 248 ALA A O  1 
ATOM 849   N N  . LYS A 1 249 ? 116.317 166.622 52.013  1.00 71.86  ? 249 LYS A N  1 
ATOM 850   C CA . LYS A 1 249 ? 115.051 167.248 52.371  1.00 71.86  ? 249 LYS A CA 1 
ATOM 851   C C  . LYS A 1 249 ? 114.490 166.639 53.648  1.00 71.86  ? 249 LYS A C  1 
ATOM 852   O O  . LYS A 1 249 ? 113.833 167.326 54.438  1.00 71.86  ? 249 LYS A O  1 
ATOM 853   N N  . GLY A 1 250 ? 114.791 165.362 53.890  1.00 77.89  ? 250 GLY A N  1 
ATOM 854   C CA . GLY A 1 250 ? 114.361 164.731 55.125  1.00 77.89  ? 250 GLY A CA 1 
ATOM 855   C C  . GLY A 1 250 ? 115.087 165.262 56.343  1.00 77.89  ? 250 GLY A C  1 
ATOM 856   O O  . GLY A 1 250 ? 114.550 165.247 57.451  1.00 77.89  ? 250 GLY A O  1 
ATOM 857   N N  . LEU A 1 251 ? 116.316 165.744 56.158  1.00 78.13  ? 251 LEU A N  1 
ATOM 858   C CA . LEU A 1 251 ? 117.049 166.296 57.289  1.00 78.13  ? 251 LEU A CA 1 
ATOM 859   C C  . LEU A 1 251 ? 116.505 167.649 57.698  1.00 78.13  ? 251 LEU A C  1 
ATOM 860   O O  . LEU A 1 251 ? 116.590 168.030 58.870  1.00 78.13  ? 251 LEU A O  1 
ATOM 861   N N  . ALA A 1 252 ? 115.950 168.394 56.747  1.00 87.31  ? 252 ALA A N  1 
ATOM 862   C CA . ALA A 1 252 ? 115.469 169.732 57.061  1.00 87.31  ? 252 ALA A CA 1 
ATOM 863   C C  . ALA A 1 252 ? 114.186 169.674 57.878  1.00 87.31  ? 252 ALA A C  1 
ATOM 864   O O  . ALA A 1 252 ? 113.969 170.504 58.768  1.00 87.31  ? 252 ALA A O  1 
ATOM 865   N N  . ASP A 1 253 ? 113.328 168.696 57.601  1.00 93.79  ? 253 ASP A N  1 
ATOM 866   C CA . ASP A 1 253 ? 112.094 168.590 58.366  1.00 93.79  ? 253 ASP A CA 1 
ATOM 867   C C  . ASP A 1 253 ? 112.092 167.363 59.263  1.00 93.79  ? 253 ASP A C  1 
ATOM 868   O O  . ASP A 1 253 ? 111.029 166.954 59.742  1.00 93.79  ? 253 ASP A O  1 
ATOM 869   N N  . LYS A 1 254 ? 113.258 166.749 59.454  1.00 90.39  ? 254 LYS A N  1 
ATOM 870   C CA . LYS A 1 254 ? 113.561 165.852 60.565  1.00 90.39  ? 254 LYS A CA 1 
ATOM 871   C C  . LYS A 1 254 ? 112.764 164.556 60.525  1.00 90.39  ? 254 LYS A C  1 
ATOM 872   O O  . LYS A 1 254 ? 112.358 164.054 61.573  1.00 90.39  ? 254 LYS A O  1 
ATOM 873   N N  . LYS A 1 255 ? 112.513 163.994 59.342  1.00 91.79  ? 255 LYS A N  1 
ATOM 874   C CA . LYS A 1 255 ? 111.852 162.696 59.300  1.00 91.79  ? 255 LYS A CA 1 
ATOM 875   C C  . LYS A 1 255 ? 112.804 161.581 59.701  1.00 91.79  ? 255 LYS A C  1 
ATOM 876   O O  . LYS A 1 255 ? 112.367 160.522 60.162  1.00 91.79  ? 255 LYS A O  1 
ATOM 877   N N  . ILE A 1 256 ? 114.104 161.790 59.525  1.00 99.21  ? 256 ILE A N  1 
ATOM 878   C CA . ILE A 1 256 ? 115.119 160.840 59.963  1.00 99.21  ? 256 ILE A CA 1 
ATOM 879   C C  . ILE A 1 256 ? 116.055 161.572 60.920  1.00 99.21  ? 256 ILE A C  1 
ATOM 880   O O  . ILE A 1 256 ? 116.232 162.791 60.812  1.00 99.21  ? 256 ILE A O  1 
ATOM 881   N N  . SER A 1 257 ? 116.604 160.833 61.912  1.00 117.65 ? 257 SER A N  1 
ATOM 882   C CA . SER A 1 257 ? 117.379 161.445 62.988  1.00 117.65 ? 257 SER A CA 1 
ATOM 883   C C  . SER A 1 257 ? 118.826 160.985 62.943  1.00 117.65 ? 257 SER A C  1 
ATOM 884   O O  . SER A 1 257 ? 119.095 159.843 62.545  1.00 117.65 ? 257 SER A O  1 
ATOM 885   N N  . PRO A 1 258 ? 119.758 161.865 63.338  1.00 121.66 ? 258 PRO A N  1 
ATOM 886   C CA . PRO A 1 258 ? 121.190 161.567 63.359  1.00 121.66 ? 258 PRO A CA 1 
ATOM 887   C C  . PRO A 1 258 ? 121.621 161.003 64.708  1.00 121.66 ? 258 PRO A C  1 
ATOM 888   O O  . PRO A 1 258 ? 122.714 161.309 65.183  1.00 121.66 ? 258 PRO A O  1 
ATOM 889   N N  . LYS A 1 259 ? 120.762 160.189 65.316  1.00 126.77 ? 259 LYS A N  1 
ATOM 890   C CA . LYS A 1 259 ? 121.058 159.590 66.613  1.00 126.77 ? 259 LYS A CA 1 
ATOM 891   C C  . LYS A 1 259 ? 122.044 158.433 66.482  1.00 126.77 ? 259 LYS A C  1 
ATOM 892   O O  . LYS A 1 259 ? 123.258 158.631 66.515  1.00 126.77 ? 259 LYS A O  1 
ATOM 893   N N  . ARG A 1 260 ? 121.513 157.223 66.337  1.00 125.73 ? 260 ARG A N  1 
ATOM 894   C CA . ARG A 1 260 ? 122.344 156.034 66.203  1.00 125.73 ? 260 ARG A CA 1 
ATOM 895   C C  . ARG A 1 260 ? 123.284 156.150 65.007  1.00 125.73 ? 260 ARG A C  1 
ATOM 896   O O  . ARG A 1 260 ? 124.479 155.876 65.116  1.00 125.73 ? 260 ARG A O  1 
ATOM 897   N N  . GLU A 1 266 ? 127.607 146.053 70.366  1.00 102.52 ? 266 GLU A N  1 
ATOM 898   C CA . GLU A 1 266 ? 127.057 146.049 71.711  1.00 102.52 ? 266 GLU A CA 1 
ATOM 899   C C  . GLU A 1 266 ? 128.179 145.986 72.724  1.00 102.52 ? 266 GLU A C  1 
ATOM 900   O O  . GLU A 1 266 ? 127.941 145.837 73.917  1.00 102.52 ? 266 GLU A O  1 
ATOM 901   N N  . LYS A 1 267 ? 129.409 146.100 72.240  1.00 102.21 ? 267 LYS A N  1 
ATOM 902   C CA . LYS A 1 267 ? 130.575 146.157 73.108  1.00 102.21 ? 267 LYS A CA 1 
ATOM 903   C C  . LYS A 1 267 ? 130.909 147.569 73.543  1.00 102.21 ? 267 LYS A C  1 
ATOM 904   O O  . LYS A 1 267 ? 131.254 147.784 74.706  1.00 102.21 ? 267 LYS A O  1 
ATOM 905   N N  . LEU A 1 268 ? 130.813 148.537 72.640  1.00 103.02 ? 268 LEU A N  1 
ATOM 906   C CA . LEU A 1 268 ? 131.038 149.927 73.008  1.00 103.02 ? 268 LEU A CA 1 
ATOM 907   C C  . LEU A 1 268 ? 129.935 150.476 73.898  1.00 103.02 ? 268 LEU A C  1 
ATOM 908   O O  . LEU A 1 268 ? 130.203 151.374 74.699  1.00 103.02 ? 268 LEU A O  1 
ATOM 909   N N  . THR A 1 269 ? 128.715 149.947 73.786  1.00 101.44 ? 269 THR A N  1 
ATOM 910   C CA . THR A 1 269 ? 127.639 150.368 74.666  1.00 101.44 ? 269 THR A CA 1 
ATOM 911   C C  . THR A 1 269 ? 127.880 149.914 76.091  1.00 101.44 ? 269 THR A C  1 
ATOM 912   O O  . THR A 1 269 ? 127.390 150.556 77.023  1.00 101.44 ? 269 THR A O  1 
ATOM 913   N N  . ALA A 1 270 ? 128.629 148.827 76.274  1.00 105.54 ? 270 ALA A N  1 
ATOM 914   C CA . ALA A 1 270 ? 129.115 148.491 77.604  1.00 105.54 ? 270 ALA A CA 1 
ATOM 915   C C  . ALA A 1 270 ? 130.111 149.532 78.089  1.00 105.54 ? 270 ALA A C  1 
ATOM 916   O O  . ALA A 1 270 ? 130.140 149.869 79.278  1.00 105.54 ? 270 ALA A O  1 
ATOM 917   N N  . TYR A 1 271 ? 130.926 150.067 77.183  1.00 107.22 ? 271 TYR A N  1 
ATOM 918   C CA . TYR A 1 271 ? 131.860 151.103 77.592  1.00 107.22 ? 271 TYR A CA 1 
ATOM 919   C C  . TYR A 1 271 ? 131.195 152.463 77.733  1.00 107.22 ? 271 TYR A C  1 
ATOM 920   O O  . TYR A 1 271 ? 131.623 153.250 78.588  1.00 107.22 ? 271 TYR A O  1 
ATOM 921   N N  . ALA A 1 272 ? 130.105 152.699 76.986  1.00 113.12 ? 272 ALA A N  1 
ATOM 922   C CA . ALA A 1 272 ? 129.600 154.010 76.564  1.00 113.12 ? 272 ALA A CA 1 
ATOM 923   C C  . ALA A 1 272 ? 129.466 155.038 77.676  1.00 113.12 ? 272 ALA A C  1 
ATOM 924   O O  . ALA A 1 272 ? 129.616 156.233 77.408  1.00 113.12 ? 272 ALA A O  1 
ATOM 925   N N  . MET A 1 273 ? 129.207 154.616 78.907  1.00 121.05 ? 273 MET A N  1 
ATOM 926   C CA . MET A 1 273 ? 129.204 155.533 80.035  1.00 121.05 ? 273 MET A CA 1 
ATOM 927   C C  . MET A 1 273 ? 130.231 155.136 81.079  1.00 121.05 ? 273 MET A C  1 
ATOM 928   O O  . MET A 1 273 ? 130.433 155.872 82.053  1.00 121.05 ? 273 MET A O  1 
ATOM 929   N N  . THR A 1 274 ? 130.913 154.019 80.885  1.00 115.32 ? 274 THR A N  1 
ATOM 930   C CA . THR A 1 274 ? 131.640 153.376 81.965  1.00 115.32 ? 274 THR A CA 1 
ATOM 931   C C  . THR A 1 274 ? 133.125 153.657 81.794  1.00 115.32 ? 274 THR A C  1 
ATOM 932   O O  . THR A 1 274 ? 133.853 152.863 81.199  1.00 115.32 ? 274 THR A O  1 
ATOM 933   N N  . ILE A 1 275 ? 133.555 154.804 82.313  1.00 124.68 ? 275 ILE A N  1 
ATOM 934   C CA . ILE A 1 275 ? 134.942 155.025 82.718  1.00 124.68 ? 275 ILE A CA 1 
ATOM 935   C C  . ILE A 1 275 ? 134.989 156.031 83.874  1.00 124.68 ? 275 ILE A C  1 
ATOM 936   O O  . ILE A 1 275 ? 135.223 157.231 83.667  1.00 124.68 ? 275 ILE A O  1 
ATOM 937   N N  . PRO A 1 276 ? 134.691 155.631 85.109  1.00 137.04 ? 276 PRO A N  1 
ATOM 938   C CA . PRO A 1 276 ? 135.035 156.526 86.225  1.00 137.04 ? 276 PRO A CA 1 
ATOM 939   C C  . PRO A 1 276 ? 136.406 156.254 86.824  1.00 137.04 ? 276 PRO A C  1 
ATOM 940   O O  . PRO A 1 276 ? 137.075 157.174 87.308  1.00 137.04 ? 276 PRO A O  1 
ATOM 941   N N  . PHE A 1 277 ? 136.844 154.998 86.772  1.00 138.37 ? 277 PHE A N  1 
ATOM 942   C CA . PHE A 1 277 ? 137.995 154.566 87.555  1.00 138.37 ? 277 PHE A CA 1 
ATOM 943   C C  . PHE A 1 277 ? 138.989 153.724 86.771  1.00 138.37 ? 277 PHE A C  1 
ATOM 944   O O  . PHE A 1 277 ? 140.173 153.715 87.129  1.00 138.37 ? 277 PHE A O  1 
ATOM 945   N N  . VAL A 1 278 ? 138.595 153.114 85.645  1.00 128.10 ? 278 VAL A N  1 
ATOM 946   C CA . VAL A 1 278 ? 139.489 152.276 84.843  1.00 128.10 ? 278 VAL A CA 1 
ATOM 947   C C  . VAL A 1 278 ? 140.398 153.114 83.957  1.00 128.10 ? 278 VAL A C  1 
ATOM 948   O O  . VAL A 1 278 ? 141.097 152.563 83.093  1.00 128.10 ? 278 VAL A O  1 
ATOM 949   N N  . ARG A 1 279 ? 140.410 154.435 84.181  1.00 135.55 ? 279 ARG A N  1 
ATOM 950   C CA . ARG A 1 279 ? 141.048 155.435 83.325  1.00 135.55 ? 279 ARG A CA 1 
ATOM 951   C C  . ARG A 1 279 ? 142.515 155.128 83.061  1.00 135.55 ? 279 ARG A C  1 
ATOM 952   O O  . ARG A 1 279 ? 142.896 154.883 81.913  1.00 135.55 ? 279 ARG A O  1 
ATOM 953   N N  . GLN A 1 280 ? 143.332 155.086 84.113  1.00 126.78 ? 280 GLN A N  1 
ATOM 954   C CA . GLN A 1 280 ? 144.742 154.713 83.985  1.00 126.78 ? 280 GLN A CA 1 
ATOM 955   C C  . GLN A 1 280 ? 144.901 153.276 83.494  1.00 126.78 ? 280 GLN A C  1 
ATOM 956   O O  . GLN A 1 280 ? 145.854 152.954 82.775  1.00 126.78 ? 280 GLN A O  1 
ATOM 957   N N  . GLN A 1 281 ? 143.949 152.411 83.835  1.00 131.53 ? 281 GLN A N  1 
ATOM 958   C CA . GLN A 1 281 ? 143.982 150.992 83.512  1.00 131.53 ? 281 GLN A CA 1 
ATOM 959   C C  . GLN A 1 281 ? 143.474 150.687 82.112  1.00 131.53 ? 281 GLN A C  1 
ATOM 960   O O  . GLN A 1 281 ? 143.020 149.570 81.852  1.00 131.53 ? 281 GLN A O  1 
ATOM 961   N N  . VAL A 1 282 ? 143.504 151.671 81.217  1.00 111.80 ? 282 VAL A N  1 
ATOM 962   C CA . VAL A 1 282 ? 143.397 151.439 79.787  1.00 111.80 ? 282 VAL A CA 1 
ATOM 963   C C  . VAL A 1 282 ? 144.578 152.036 79.036  1.00 111.80 ? 282 VAL A C  1 
ATOM 964   O O  . VAL A 1 282 ? 145.258 151.334 78.272  1.00 111.80 ? 282 VAL A O  1 
ATOM 965   N N  . TYR A 1 283 ? 144.881 153.313 79.273  1.00 115.38 ? 283 TYR A N  1 
ATOM 966   C CA . TYR A 1 283 ? 145.984 153.903 78.529  1.00 115.38 ? 283 TYR A CA 1 
ATOM 967   C C  . TYR A 1 283 ? 147.331 153.497 79.113  1.00 115.38 ? 283 TYR A C  1 
ATOM 968   O O  . TYR A 1 283 ? 148.358 153.690 78.469  1.00 115.38 ? 283 TYR A O  1 
ATOM 969   N N  . LYS A 1 284 ? 147.360 152.895 80.302  1.00 109.71 ? 284 LYS A N  1 
ATOM 970   C CA . LYS A 1 284 ? 148.606 152.271 80.738  1.00 109.71 ? 284 LYS A CA 1 
ATOM 971   C C  . LYS A 1 284 ? 148.859 150.980 79.976  1.00 109.71 ? 284 LYS A C  1 
ATOM 972   O O  . LYS A 1 284 ? 149.995 150.704 79.554  1.00 109.71 ? 284 LYS A O  1 
ATOM 973   N N  . LYS A 1 285 ? 147.802 150.181 79.795  1.00 111.79 ? 285 LYS A N  1 
ATOM 974   C CA . LYS A 1 285 ? 147.873 148.985 78.966  1.00 111.79 ? 285 LYS A CA 1 
ATOM 975   C C  . LYS A 1 285 ? 148.267 149.336 77.544  1.00 111.79 ? 285 LYS A C  1 
ATOM 976   O O  . LYS A 1 285 ? 149.006 148.586 76.909  1.00 111.79 ? 285 LYS A O  1 
ATOM 977   N N  . VAL A 1 286 ? 147.826 150.494 77.058  1.00 103.58 ? 286 VAL A N  1 
ATOM 978   C CA . VAL A 1 286 ? 148.268 150.971 75.755  1.00 103.58 ? 286 VAL A CA 1 
ATOM 979   C C  . VAL A 1 286 ? 149.680 151.567 75.791  1.00 103.58 ? 286 VAL A C  1 
ATOM 980   O O  . VAL A 1 286 ? 150.440 151.424 74.819  1.00 103.58 ? 286 VAL A O  1 
ATOM 981   N N  . GLU A 1 287 ? 150.054 152.213 76.899  1.00 106.47 ? 287 GLU A N  1 
ATOM 982   C CA . GLU A 1 287 ? 151.373 152.796 77.105  1.00 106.47 ? 287 GLU A CA 1 
ATOM 983   C C  . GLU A 1 287 ? 152.473 151.763 77.001  1.00 106.47 ? 287 GLU A C  1 
ATOM 984   O O  . GLU A 1 287 ? 153.540 152.044 76.446  1.00 106.47 ? 287 GLU A O  1 
ATOM 985   N N  . GLU A 1 288 ? 152.226 150.567 77.511  1.00 107.40 ? 288 GLU A N  1 
ATOM 986   C CA . GLU A 1 288 ? 153.237 149.542 77.318  1.00 107.40 ? 288 GLU A CA 1 
ATOM 987   C C  . GLU A 1 288 ? 152.951 148.730 76.058  1.00 107.40 ? 288 GLU A C  1 
ATOM 988   O O  . GLU A 1 288 ? 153.845 148.044 75.551  1.00 107.40 ? 288 GLU A O  1 
ATOM 989   N N  . LYS A 1 289 ? 151.739 148.846 75.496  1.00 103.19 ? 289 LYS A N  1 
ATOM 990   C CA . LYS A 1 289 ? 151.441 148.215 74.209  1.00 103.19 ? 289 LYS A CA 1 
ATOM 991   C C  . LYS A 1 289 ? 152.242 148.821 73.072  1.00 103.19 ? 289 LYS A C  1 
ATOM 992   O O  . LYS A 1 289 ? 152.724 148.095 72.195  1.00 103.19 ? 289 LYS A O  1 
ATOM 993   N N  . VAL A 1 290 ? 152.375 150.144 73.064  1.00 101.23 ? 290 VAL A N  1 
ATOM 994   C CA . VAL A 1 290 ? 153.053 150.798 71.959  1.00 101.23 ? 290 VAL A CA 1 
ATOM 995   C C  . VAL A 1 290 ? 154.553 150.540 72.017  1.00 101.23 ? 290 VAL A C  1 
ATOM 996   O O  . VAL A 1 290 ? 155.223 150.512 70.978  1.00 101.23 ? 290 VAL A O  1 
ATOM 997   N N  . ARG A 1 291 ? 155.090 150.270 73.199  1.00 101.32 ? 291 ARG A N  1 
ATOM 998   C CA . ARG A 1 291 ? 156.498 149.965 73.331  1.00 101.32 ? 291 ARG A CA 1 
ATOM 999   C C  . ARG A 1 291 ? 156.780 148.474 73.370  1.00 101.32 ? 291 ARG A C  1 
ATOM 1000  O O  . ARG A 1 291 ? 157.951 148.090 73.438  1.00 101.32 ? 291 ARG A O  1 
ATOM 1001  N N  . LYS A 1 292 ? 155.750 147.628 73.383  1.00 110.65 ? 292 LYS A N  1 
ATOM 1002  C CA . LYS A 1 292 ? 155.964 146.220 73.074  1.00 110.65 ? 292 LYS A CA 1 
ATOM 1003  C C  . LYS A 1 292 ? 155.786 145.919 71.591  1.00 110.65 ? 292 LYS A C  1 
ATOM 1004  O O  . LYS A 1 292 ? 156.437 145.006 71.074  1.00 110.65 ? 292 LYS A O  1 
ATOM 1005  N N  . GLN A 1 293 ? 154.936 146.667 70.881  1.00 105.36 ? 293 GLN A N  1 
ATOM 1006  C CA . GLN A 1 293 ? 154.818 146.464 69.441  1.00 105.36 ? 293 GLN A CA 1 
ATOM 1007  C C  . GLN A 1 293 ? 156.047 146.981 68.720  1.00 105.36 ? 293 GLN A C  1 
ATOM 1008  O O  . GLN A 1 293 ? 156.809 146.214 68.123  1.00 105.36 ? 293 GLN A O  1 
ATOM 1009  N N  . THR A 1 294 ? 156.262 148.282 68.778  1.00 106.25 ? 294 THR A N  1 
ATOM 1010  C CA . THR A 1 294 ? 157.516 148.865 68.351  1.00 106.25 ? 294 THR A CA 1 
ATOM 1011  C C  . THR A 1 294 ? 158.424 148.929 69.562  1.00 106.25 ? 294 THR A C  1 
ATOM 1012  O O  . THR A 1 294 ? 158.153 148.331 70.602  1.00 106.25 ? 294 THR A O  1 
ATOM 1013  N N  . LYS A 1 295 ? 159.502 149.667 69.440  1.00 112.74 ? 295 LYS A N  1 
ATOM 1014  C CA . LYS A 1 295 ? 160.350 149.985 70.568  1.00 112.74 ? 295 LYS A CA 1 
ATOM 1015  C C  . LYS A 1 295 ? 160.138 151.449 70.923  1.00 112.74 ? 295 LYS A C  1 
ATOM 1016  O O  . LYS A 1 295 ? 159.501 152.211 70.192  1.00 112.74 ? 295 LYS A O  1 
ATOM 1017  N N  . GLY A 1 296 ? 160.711 151.853 72.043  1.00 120.13 ? 296 GLY A N  1 
ATOM 1018  C CA . GLY A 1 296 ? 160.478 153.186 72.535  1.00 120.13 ? 296 GLY A CA 1 
ATOM 1019  C C  . GLY A 1 296 ? 161.118 154.321 71.773  1.00 120.13 ? 296 GLY A C  1 
ATOM 1020  O O  . GLY A 1 296 ? 160.934 155.472 72.172  1.00 120.13 ? 296 GLY A O  1 
ATOM 1021  N N  . LEU A 1 297 ? 161.866 154.075 70.699  1.00 111.41 ? 297 LEU A N  1 
ATOM 1022  C CA . LEU A 1 297 ? 162.504 155.187 70.011  1.00 111.41 ? 297 LEU A CA 1 
ATOM 1023  C C  . LEU A 1 297 ? 161.709 155.678 68.814  1.00 111.41 ? 297 LEU A C  1 
ATOM 1024  O O  . LEU A 1 297 ? 162.298 156.150 67.835  1.00 111.41 ? 297 LEU A O  1 
ATOM 1025  N N  . TYR A 1 298 ? 160.381 155.584 68.886  1.00 106.14 ? 298 TYR A N  1 
ATOM 1026  C CA . TYR A 1 298 ? 159.452 156.377 68.088  1.00 106.14 ? 298 TYR A CA 1 
ATOM 1027  C C  . TYR A 1 298 ? 158.862 157.450 68.992  1.00 106.14 ? 298 TYR A C  1 
ATOM 1028  O O  . TYR A 1 298 ? 157.874 157.192 69.693  1.00 106.14 ? 298 TYR A O  1 
ATOM 1029  N N  . PRO A 1 299 ? 159.402 158.672 69.023  1.00 98.15  ? 299 PRO A N  1 
ATOM 1030  C CA . PRO A 1 299 ? 158.685 159.749 69.721  1.00 98.15  ? 299 PRO A CA 1 
ATOM 1031  C C  . PRO A 1 299 ? 157.479 160.298 68.971  1.00 98.15  ? 299 PRO A C  1 
ATOM 1032  O O  . PRO A 1 299 ? 156.886 161.273 69.434  1.00 98.15  ? 299 PRO A O  1 
ATOM 1033  N N  . ALA A 1 300 ? 157.082 159.723 67.843  1.00 89.57  ? 300 ALA A N  1 
ATOM 1034  C CA . ALA A 1 300 ? 155.867 160.185 67.184  1.00 89.57  ? 300 ALA A CA 1 
ATOM 1035  C C  . ALA A 1 300 ? 154.562 159.701 67.826  1.00 89.57  ? 300 ALA A C  1 
ATOM 1036  O O  . ALA A 1 300 ? 153.789 160.552 68.275  1.00 89.57  ? 300 ALA A O  1 
ATOM 1037  N N  . PRO A 1 301 ? 154.248 158.394 67.915  1.00 86.05  ? 301 PRO A N  1 
ATOM 1038  C CA . PRO A 1 301 ? 152.839 158.022 68.113  1.00 86.05  ? 301 PRO A CA 1 
ATOM 1039  C C  . PRO A 1 301 ? 152.315 158.230 69.520  1.00 86.05  ? 301 PRO A C  1 
ATOM 1040  O O  . PRO A 1 301 ? 151.119 158.496 69.669  1.00 86.05  ? 301 PRO A O  1 
ATOM 1041  N N  . LEU A 1 302 ? 153.159 158.152 70.552  1.00 93.83  ? 302 LEU A N  1 
ATOM 1042  C CA . LEU A 1 302 ? 152.710 158.472 71.905  1.00 93.83  ? 302 LEU A CA 1 
ATOM 1043  C C  . LEU A 1 302 ? 152.318 159.931 72.042  1.00 93.83  ? 302 LEU A C  1 
ATOM 1044  O O  . LEU A 1 302 ? 151.493 160.276 72.893  1.00 93.83  ? 302 LEU A O  1 
ATOM 1045  N N  . LYS A 1 303 ? 152.857 160.787 71.191  1.00 94.69  ? 303 LYS A N  1 
ATOM 1046  C CA . LYS A 1 303 ? 152.445 162.168 71.135  1.00 94.69  ? 303 LYS A CA 1 
ATOM 1047  C C  . LYS A 1 303 ? 151.118 162.369 70.419  1.00 94.69  ? 303 LYS A C  1 
ATOM 1048  O O  . LYS A 1 303 ? 150.760 163.526 70.182  1.00 94.69  ? 303 LYS A O  1 
ATOM 1049  N N  . ILE A 1 304 ? 150.362 161.324 70.071  1.00 99.44  ? 304 ILE A N  1 
ATOM 1050  C CA . ILE A 1 304 ? 148.934 161.543 69.870  1.00 99.44  ? 304 ILE A CA 1 
ATOM 1051  C C  . ILE A 1 304 ? 148.153 160.904 71.006  1.00 99.44  ? 304 ILE A C  1 
ATOM 1052  O O  . ILE A 1 304 ? 146.933 161.103 71.104  1.00 99.44  ? 304 ILE A O  1 
ATOM 1053  N N  . ILE A 1 305 ? 148.818 160.124 71.849  1.00 101.24 ? 305 ILE A N  1 
ATOM 1054  C CA . ILE A 1 305 ? 148.144 159.532 72.989  1.00 101.24 ? 305 ILE A CA 1 
ATOM 1055  C C  . ILE A 1 305 ? 147.846 160.592 74.031  1.00 101.24 ? 305 ILE A C  1 
ATOM 1056  O O  . ILE A 1 305 ? 146.739 160.646 74.574  1.00 101.24 ? 305 ILE A O  1 
ATOM 1057  N N  . ASP A 1 306 ? 148.812 161.482 74.275  1.00 104.17 ? 306 ASP A N  1 
ATOM 1058  C CA . ASP A 1 306 ? 148.655 162.589 75.213  1.00 104.17 ? 306 ASP A CA 1 
ATOM 1059  C C  . ASP A 1 306 ? 147.517 163.524 74.837  1.00 104.17 ? 306 ASP A C  1 
ATOM 1060  O O  . ASP A 1 306 ? 146.965 164.194 75.713  1.00 104.17 ? 306 ASP A O  1 
ATOM 1061  N N  . VAL A 1 307 ? 147.186 163.597 73.552  1.00 104.45 ? 307 VAL A N  1 
ATOM 1062  C CA . VAL A 1 307 ? 145.956 164.248 73.139  1.00 104.45 ? 307 VAL A CA 1 
ATOM 1063  C C  . VAL A 1 307 ? 144.759 163.526 73.734  1.00 104.45 ? 307 VAL A C  1 
ATOM 1064  O O  . VAL A 1 307 ? 144.012 164.091 74.541  1.00 104.45 ? 307 VAL A O  1 
ATOM 1065  N N  . VAL A 1 308 ? 144.601 162.244 73.400  1.00 104.30 ? 308 VAL A N  1 
ATOM 1066  C CA . VAL A 1 308 ? 143.412 161.532 73.836  1.00 104.30 ? 308 VAL A CA 1 
ATOM 1067  C C  . VAL A 1 308 ? 143.505 161.190 75.317  1.00 104.30 ? 308 VAL A C  1 
ATOM 1068  O O  . VAL A 1 308 ? 142.488 160.890 75.950  1.00 104.30 ? 308 VAL A O  1 
ATOM 1069  N N  . LYS A 1 309 ? 144.701 161.264 75.899  1.00 113.70 ? 309 LYS A N  1 
ATOM 1070  C CA . LYS A 1 309 ? 144.840 161.255 77.346  1.00 113.70 ? 309 LYS A CA 1 
ATOM 1071  C C  . LYS A 1 309 ? 144.322 162.534 77.984  1.00 113.70 ? 309 LYS A C  1 
ATOM 1072  O O  . LYS A 1 309 ? 143.669 162.471 79.031  1.00 113.70 ? 309 LYS A O  1 
ATOM 1073  N N  . THR A 1 310 ? 144.580 163.690 77.375  1.00 118.96 ? 310 THR A N  1 
ATOM 1074  C CA . THR A 1 310 ? 144.103 164.944 77.931  1.00 118.96 ? 310 THR A CA 1 
ATOM 1075  C C  . THR A 1 310 ? 142.755 165.378 77.389  1.00 118.96 ? 310 THR A C  1 
ATOM 1076  O O  . THR A 1 310 ? 142.094 166.201 78.029  1.00 118.96 ? 310 THR A O  1 
ATOM 1077  N N  . GLY A 1 311 ? 142.340 164.863 76.233  1.00 120.86 ? 311 GLY A N  1 
ATOM 1078  C CA . GLY A 1 311 ? 141.012 165.173 75.737  1.00 120.86 ? 311 GLY A CA 1 
ATOM 1079  C C  . GLY A 1 311 ? 139.922 164.629 76.632  1.00 120.86 ? 311 GLY A C  1 
ATOM 1080  O O  . GLY A 1 311 ? 138.922 165.305 76.887  1.00 120.86 ? 311 GLY A O  1 
ATOM 1081  N N  . ILE A 1 312 ? 140.108 163.417 77.144  1.00 117.48 ? 312 ILE A N  1 
ATOM 1082  C CA . ILE A 1 312 ? 139.244 162.932 78.202  1.00 117.48 ? 312 ILE A CA 1 
ATOM 1083  C C  . ILE A 1 312 ? 139.600 163.666 79.490  1.00 117.48 ? 312 ILE A C  1 
ATOM 1084  O O  . ILE A 1 312 ? 140.738 164.131 79.664  1.00 117.48 ? 312 ILE A O  1 
ATOM 1085  N N  . GLU A 1 313 ? 138.577 163.917 80.316  1.00 136.39 ? 313 GLU A N  1 
ATOM 1086  C CA . GLU A 1 313 ? 138.627 164.373 81.707  1.00 136.39 ? 313 GLU A CA 1 
ATOM 1087  C C  . GLU A 1 313 ? 139.013 165.849 81.834  1.00 136.39 ? 313 GLU A C  1 
ATOM 1088  O O  . GLU A 1 313 ? 138.841 166.453 82.896  1.00 136.39 ? 313 GLU A O  1 
ATOM 1089  N N  . GLN A 1 314 ? 139.454 166.474 80.761  1.00 121.17 ? 314 GLN A N  1 
ATOM 1090  C CA . GLN A 1 314 ? 139.805 167.877 80.838  1.00 121.17 ? 314 GLN A CA 1 
ATOM 1091  C C  . GLN A 1 314 ? 138.957 168.653 79.844  1.00 121.17 ? 314 GLN A C  1 
ATOM 1092  O O  . GLN A 1 314 ? 138.003 168.121 79.270  1.00 121.17 ? 314 GLN A O  1 
ATOM 1093  N N  . GLY A 1 315 ? 139.290 169.930 79.670  1.00 124.56 ? 315 GLY A N  1 
ATOM 1094  C CA . GLY A 1 315 ? 138.555 170.808 78.781  1.00 124.56 ? 315 GLY A CA 1 
ATOM 1095  C C  . GLY A 1 315 ? 138.634 170.387 77.331  1.00 124.56 ? 315 GLY A C  1 
ATOM 1096  O O  . GLY A 1 315 ? 139.700 170.459 76.716  1.00 124.56 ? 315 GLY A O  1 
ATOM 1097  N N  . SER A 1 316 ? 137.501 169.937 76.787  1.00 121.12 ? 316 SER A N  1 
ATOM 1098  C CA . SER A 1 316 ? 137.475 169.404 75.430  1.00 121.12 ? 316 SER A CA 1 
ATOM 1099  C C  . SER A 1 316 ? 137.700 170.506 74.406  1.00 121.12 ? 316 SER A C  1 
ATOM 1100  O O  . SER A 1 316 ? 138.582 170.394 73.549  1.00 121.12 ? 316 SER A O  1 
ATOM 1101  N N  . ASP A 1 317 ? 136.913 171.582 74.489  1.00 121.40 ? 317 ASP A N  1 
ATOM 1102  C CA . ASP A 1 317 ? 137.134 172.736 73.624  1.00 121.40 ? 317 ASP A CA 1 
ATOM 1103  C C  . ASP A 1 317 ? 138.458 173.416 73.934  1.00 121.40 ? 317 ASP A C  1 
ATOM 1104  O O  . ASP A 1 317 ? 139.116 173.937 73.027  1.00 121.40 ? 317 ASP A O  1 
ATOM 1105  N N  . ALA A 1 318 ? 138.872 173.403 75.202  1.00 117.01 ? 318 ALA A N  1 
ATOM 1106  C CA . ALA A 1 318 ? 140.215 173.838 75.552  1.00 117.01 ? 318 ALA A CA 1 
ATOM 1107  C C  . ALA A 1 318 ? 141.272 172.868 75.055  1.00 117.01 ? 318 ALA A C  1 
ATOM 1108  O O  . ALA A 1 318 ? 142.438 173.251 74.921  1.00 117.01 ? 318 ALA A O  1 
ATOM 1109  N N  . GLY A 1 319 ? 140.896 171.623 74.786  1.00 108.70 ? 319 GLY A N  1 
ATOM 1110  C CA . GLY A 1 319 ? 141.846 170.663 74.275  1.00 108.70 ? 319 GLY A CA 1 
ATOM 1111  C C  . GLY A 1 319 ? 142.193 170.818 72.822  1.00 108.70 ? 319 GLY A C  1 
ATOM 1112  O O  . GLY A 1 319 ? 143.134 170.174 72.363  1.00 108.70 ? 319 GLY A O  1 
ATOM 1113  N N  . TYR A 1 320 ? 141.472 171.647 72.076  1.00 106.02 ? 320 TYR A N  1 
ATOM 1114  C CA . TYR A 1 320 ? 141.755 171.828 70.661  1.00 106.02 ? 320 TYR A CA 1 
ATOM 1115  C C  . TYR A 1 320 ? 142.948 172.733 70.394  1.00 106.02 ? 320 TYR A C  1 
ATOM 1116  O O  . TYR A 1 320 ? 143.264 172.986 69.229  1.00 106.02 ? 320 TYR A O  1 
ATOM 1117  N N  . LEU A 1 321 ? 143.614 173.230 71.430  1.00 102.45 ? 321 LEU A N  1 
ATOM 1118  C CA . LEU A 1 321 ? 144.814 174.024 71.255  1.00 102.45 ? 321 LEU A CA 1 
ATOM 1119  C C  . LEU A 1 321 ? 146.053 173.375 71.836  1.00 102.45 ? 321 LEU A C  1 
ATOM 1120  O O  . LEU A 1 321 ? 147.129 173.977 71.765  1.00 102.45 ? 321 LEU A O  1 
ATOM 1121  N N  . CYS A 1 322 ? 145.937 172.183 72.414  1.00 111.26 ? 322 CYS A N  1 
ATOM 1122  C CA . CYS A 1 322 ? 147.129 171.493 72.885  1.00 111.26 ? 322 CYS A CA 1 
ATOM 1123  C C  . CYS A 1 322 ? 147.957 171.004 71.711  1.00 111.26 ? 322 CYS A C  1 
ATOM 1124  O O  . CYS A 1 322 ? 149.178 171.166 71.697  1.00 111.26 ? 322 CYS A O  1 
ATOM 1125  N N  . GLU A 1 323 ? 147.296 170.441 70.700  1.00 103.62 ? 323 GLU A N  1 
ATOM 1126  C CA . GLU A 1 323 ? 147.984 169.912 69.533  1.00 103.62 ? 323 GLU A CA 1 
ATOM 1127  C C  . GLU A 1 323 ? 148.591 171.006 68.677  1.00 103.62 ? 323 GLU A C  1 
ATOM 1128  O O  . GLU A 1 323 ? 149.491 170.724 67.880  1.00 103.62 ? 323 GLU A O  1 
ATOM 1129  N N  . SER A 1 324 ? 148.116 172.243 68.827  1.00 109.89 ? 324 SER A N  1 
ATOM 1130  C CA . SER A 1 324 ? 148.817 173.388 68.268  1.00 109.89 ? 324 SER A CA 1 
ATOM 1131  C C  . SER A 1 324 ? 150.185 173.554 68.900  1.00 109.89 ? 324 SER A C  1 
ATOM 1132  O O  . SER A 1 324 ? 151.124 174.010 68.242  1.00 109.89 ? 324 SER A O  1 
ATOM 1133  N N  . GLN A 1 325 ? 150.320 173.194 70.165  1.00 107.53 ? 325 GLN A N  1 
ATOM 1134  C CA . GLN A 1 325 ? 151.636 173.123 70.767  1.00 107.53 ? 325 GLN A CA 1 
ATOM 1135  C C  . GLN A 1 325 ? 152.289 171.767 70.565  1.00 107.53 ? 325 GLN A C  1 
ATOM 1136  O O  . GLN A 1 325 ? 153.330 171.505 71.176  1.00 107.53 ? 325 GLN A O  1 
ATOM 1137  N N  . LYS A 1 326 ? 151.702 170.897 69.744  1.00 109.87 ? 326 LYS A N  1 
ATOM 1138  C CA . LYS A 1 326 ? 152.282 169.584 69.497  1.00 109.87 ? 326 LYS A CA 1 
ATOM 1139  C C  . LYS A 1 326 ? 152.600 169.325 68.036  1.00 109.87 ? 326 LYS A C  1 
ATOM 1140  O O  . LYS A 1 326 ? 153.674 168.800 67.746  1.00 109.87 ? 326 LYS A O  1 
ATOM 1141  N N  . PHE A 1 327 ? 151.700 169.696 67.116  1.00 106.26 ? 327 PHE A N  1 
ATOM 1142  C CA . PHE A 1 327 ? 151.907 169.443 65.690  1.00 106.26 ? 327 PHE A CA 1 
ATOM 1143  C C  . PHE A 1 327 ? 153.135 170.163 65.168  1.00 106.26 ? 327 PHE A C  1 
ATOM 1144  O O  . PHE A 1 327 ? 153.866 169.627 64.331  1.00 106.26 ? 327 PHE A O  1 
ATOM 1145  N N  . GLY A 1 328 ? 153.387 171.371 65.664  1.00 109.76 ? 328 GLY A N  1 
ATOM 1146  C CA . GLY A 1 328 ? 154.603 172.070 65.307  1.00 109.76 ? 328 GLY A CA 1 
ATOM 1147  C C  . GLY A 1 328 ? 155.852 171.431 65.864  1.00 109.76 ? 328 GLY A C  1 
ATOM 1148  O O  . GLY A 1 328 ? 156.929 171.589 65.284  1.00 109.76 ? 328 GLY A O  1 
ATOM 1149  N N  . GLU A 1 329 ? 155.730 170.696 66.967  1.00 111.70 ? 329 GLU A N  1 
ATOM 1150  C CA . GLU A 1 329 ? 156.889 170.003 67.505  1.00 111.70 ? 329 GLU A CA 1 
ATOM 1151  C C  . GLU A 1 329 ? 157.271 168.818 66.627  1.00 111.70 ? 329 GLU A C  1 
ATOM 1152  O O  . GLU A 1 329 ? 158.357 168.795 66.034  1.00 111.70 ? 329 GLU A O  1 
ATOM 1153  N N  . LEU A 1 330 ? 156.374 167.840 66.489  1.00 103.85 ? 330 LEU A N  1 
ATOM 1154  C CA . LEU A 1 330 ? 156.784 166.584 65.875  1.00 103.85 ? 330 LEU A CA 1 
ATOM 1155  C C  . LEU A 1 330 ? 156.813 166.637 64.354  1.00 103.85 ? 330 LEU A C  1 
ATOM 1156  O O  . LEU A 1 330 ? 157.162 165.636 63.724  1.00 103.85 ? 330 LEU A O  1 
ATOM 1157  N N  . VAL A 1 331 ? 156.459 167.764 63.742  1.00 101.54 ? 331 VAL A N  1 
ATOM 1158  C CA . VAL A 1 331 ? 156.771 167.959 62.333  1.00 101.54 ? 331 VAL A CA 1 
ATOM 1159  C C  . VAL A 1 331 ? 158.127 168.617 62.158  1.00 101.54 ? 331 VAL A C  1 
ATOM 1160  O O  . VAL A 1 331 ? 158.887 168.231 61.257  1.00 101.54 ? 331 VAL A O  1 
ATOM 1161  N N  . MET A 1 332 ? 158.507 169.520 63.050  1.00 109.44 ? 332 MET A N  1 
ATOM 1162  C CA . MET A 1 332 ? 159.784 170.207 62.951  1.00 109.44 ? 332 MET A CA 1 
ATOM 1163  C C  . MET A 1 332 ? 160.878 169.478 63.724  1.00 109.44 ? 332 MET A C  1 
ATOM 1164  O O  . MET A 1 332 ? 161.787 170.106 64.270  1.00 109.44 ? 332 MET A O  1 
ATOM 1165  N N  . THR A 1 333 ? 160.801 168.155 63.779  1.00 97.27  ? 333 THR A N  1 
ATOM 1166  C CA . THR A 1 333 ? 161.765 167.344 64.498  1.00 97.27  ? 333 THR A CA 1 
ATOM 1167  C C  . THR A 1 333 ? 162.569 166.476 63.541  1.00 97.27  ? 333 THR A C  1 
ATOM 1168  O O  . THR A 1 333 ? 162.304 166.406 62.339  1.00 97.27  ? 333 THR A O  1 
ATOM 1169  N N  . LYS A 1 334 ? 163.567 165.806 64.110  1.00 94.91  ? 334 LYS A N  1 
ATOM 1170  C CA . LYS A 1 334 ? 164.461 164.922 63.383  1.00 94.91  ? 334 LYS A CA 1 
ATOM 1171  C C  . LYS A 1 334 ? 163.972 163.491 63.343  1.00 94.91  ? 334 LYS A C  1 
ATOM 1172  O O  . LYS A 1 334 ? 164.742 162.599 62.978  1.00 94.91  ? 334 LYS A O  1 
ATOM 1173  N N  . GLU A 1 335 ? 162.727 163.242 63.735  1.00 98.55  ? 335 GLU A N  1 
ATOM 1174  C CA . GLU A 1 335 ? 162.187 161.897 63.614  1.00 98.55  ? 335 GLU A CA 1 
ATOM 1175  C C  . GLU A 1 335 ? 161.638 161.661 62.215  1.00 98.55  ? 335 GLU A C  1 
ATOM 1176  O O  . GLU A 1 335 ? 162.043 160.725 61.523  1.00 98.55  ? 335 GLU A O  1 
ATOM 1177  N N  . SER A 1 336 ? 160.718 162.514 61.778  1.00 90.09  ? 336 SER A N  1 
ATOM 1178  C CA . SER A 1 336 ? 160.003 162.286 60.535  1.00 90.09  ? 336 SER A CA 1 
ATOM 1179  C C  . SER A 1 336 ? 160.274 163.353 59.489  1.00 90.09  ? 336 SER A C  1 
ATOM 1180  O O  . SER A 1 336 ? 159.470 163.514 58.571  1.00 90.09  ? 336 SER A O  1 
ATOM 1181  N N  . LYS A 1 337 ? 161.381 164.090 59.609  1.00 90.37  ? 337 LYS A N  1 
ATOM 1182  C CA . LYS A 1 337 ? 161.667 165.130 58.626  1.00 90.37  ? 337 LYS A CA 1 
ATOM 1183  C C  . LYS A 1 337 ? 161.962 164.523 57.263  1.00 90.37  ? 337 LYS A C  1 
ATOM 1184  O O  . LYS A 1 337 ? 161.474 165.011 56.240  1.00 90.37  ? 337 LYS A O  1 
ATOM 1185  N N  . ALA A 1 338 ? 162.736 163.448 57.235  1.00 91.63  ? 338 ALA A N  1 
ATOM 1186  C CA . ALA A 1 338 ? 163.007 162.724 56.007  1.00 91.63  ? 338 ALA A CA 1 
ATOM 1187  C C  . ALA A 1 338 ? 161.910 161.738 55.654  1.00 91.63  ? 338 ALA A C  1 
ATOM 1188  O O  . ALA A 1 338 ? 161.980 161.098 54.598  1.00 91.63  ? 338 ALA A O  1 
ATOM 1189  N N  . LEU A 1 339 ? 160.903 161.601 56.511  1.00 90.26  ? 339 LEU A N  1 
ATOM 1190  C CA . LEU A 1 339 ? 159.829 160.672 56.219  1.00 90.26  ? 339 LEU A CA 1 
ATOM 1191  C C  . LEU A 1 339 ? 158.963 161.204 55.087  1.00 90.26  ? 339 LEU A C  1 
ATOM 1192  O O  . LEU A 1 339 ? 158.398 160.424 54.313  1.00 90.26  ? 339 LEU A O  1 
ATOM 1193  N N  . MET A 1 340 ? 158.904 162.528 54.940  1.00 107.06 ? 340 MET A N  1 
ATOM 1194  C CA . MET A 1 340 ? 158.228 163.118 53.788  1.00 107.06 ? 340 MET A CA 1 
ATOM 1195  C C  . MET A 1 340 ? 158.962 162.769 52.498  1.00 107.06 ? 340 MET A C  1 
ATOM 1196  O O  . MET A 1 340 ? 158.336 162.480 51.475  1.00 107.06 ? 340 MET A O  1 
ATOM 1197  N N  . GLY A 1 341 ? 160.299 162.774 52.531  1.00 99.94  ? 341 GLY A N  1 
ATOM 1198  C CA . GLY A 1 341 ? 161.066 162.371 51.362  1.00 99.94  ? 341 GLY A CA 1 
ATOM 1199  C C  . GLY A 1 341 ? 160.923 160.896 51.066  1.00 99.94  ? 341 GLY A C  1 
ATOM 1200  O O  . GLY A 1 341 ? 160.920 160.495 49.897  1.00 99.94  ? 341 GLY A O  1 
ATOM 1201  N N  . LEU A 1 342 ? 160.791 160.080 52.117  1.00 93.92  ? 342 LEU A N  1 
ATOM 1202  C CA . LEU A 1 342 ? 160.428 158.680 51.937  1.00 93.92  ? 342 LEU A CA 1 
ATOM 1203  C C  . LEU A 1 342 ? 159.086 158.551 51.234  1.00 93.92  ? 342 LEU A C  1 
ATOM 1204  O O  . LEU A 1 342 ? 158.909 157.677 50.383  1.00 93.92  ? 342 LEU A O  1 
ATOM 1205  N N  . TYR A 1 343 ? 158.134 159.427 51.553  1.00 90.87  ? 343 TYR A N  1 
ATOM 1206  C CA . TYR A 1 343 ? 156.838 159.325 50.893  1.00 90.87  ? 343 TYR A CA 1 
ATOM 1207  C C  . TYR A 1 343 ? 156.883 159.837 49.462  1.00 90.87  ? 343 TYR A C  1 
ATOM 1208  O O  . TYR A 1 343 ? 156.171 159.312 48.599  1.00 90.87  ? 343 TYR A O  1 
ATOM 1209  N N  . HIS A 1 344 ? 157.685 160.873 49.205  1.00 95.36  ? 344 HIS A N  1 
ATOM 1210  C CA . HIS A 1 344 ? 157.893 161.334 47.837  1.00 95.36  ? 344 HIS A CA 1 
ATOM 1211  C C  . HIS A 1 344 ? 158.498 160.243 46.978  1.00 95.36  ? 344 HIS A C  1 
ATOM 1212  O O  . HIS A 1 344 ? 158.099 160.061 45.827  1.00 95.36  ? 344 HIS A O  1 
ATOM 1213  N N  . GLY A 1 345 ? 159.458 159.504 47.518  1.00 92.89  ? 345 GLY A N  1 
ATOM 1214  C CA . GLY A 1 345 ? 159.998 158.388 46.769  1.00 92.89  ? 345 GLY A CA 1 
ATOM 1215  C C  . GLY A 1 345 ? 159.042 157.217 46.673  1.00 92.89  ? 345 GLY A C  1 
ATOM 1216  O O  . GLY A 1 345 ? 159.062 156.474 45.687  1.00 92.89  ? 345 GLY A O  1 
ATOM 1217  N N  . GLN A 1 346 ? 158.206 157.033 47.698  1.00 90.69  ? 346 GLN A N  1 
ATOM 1218  C CA . GLN A 1 346 ? 157.203 155.979 47.698  1.00 90.69  ? 346 GLN A CA 1 
ATOM 1219  C C  . GLN A 1 346 ? 156.199 156.179 46.582  1.00 90.69  ? 346 GLN A C  1 
ATOM 1220  O O  . GLN A 1 346 ? 155.831 155.229 45.884  1.00 90.69  ? 346 GLN A O  1 
ATOM 1221  N N  . VAL A 1 347 ? 155.752 157.413 46.391  1.00 99.14  ? 347 VAL A N  1 
ATOM 1222  C CA . VAL A 1 347 ? 154.855 157.685 45.279  1.00 99.14  ? 347 VAL A CA 1 
ATOM 1223  C C  . VAL A 1 347 ? 155.652 157.811 43.983  1.00 99.14  ? 347 VAL A C  1 
ATOM 1224  O O  . VAL A 1 347 ? 155.141 157.531 42.894  1.00 99.14  ? 347 VAL A O  1 
ATOM 1225  N N  . LEU A 1 348 ? 156.933 158.166 44.085  1.00 92.19  ? 348 LEU A N  1 
ATOM 1226  C CA . LEU A 1 348 ? 157.728 158.503 42.911  1.00 92.19  ? 348 LEU A CA 1 
ATOM 1227  C C  . LEU A 1 348 ? 158.159 157.271 42.135  1.00 92.19  ? 348 LEU A C  1 
ATOM 1228  O O  . LEU A 1 348 ? 158.388 157.362 40.926  1.00 92.19  ? 348 LEU A O  1 
ATOM 1229  N N  . CYS A 1 349 ? 158.282 156.132 42.798  1.00 93.89  ? 349 CYS A N  1 
ATOM 1230  C CA . CYS A 1 349 ? 158.674 154.903 42.135  1.00 93.89  ? 349 CYS A CA 1 
ATOM 1231  C C  . CYS A 1 349 ? 157.512 153.954 41.913  1.00 93.89  ? 349 CYS A C  1 
ATOM 1232  O O  . CYS A 1 349 ? 157.721 152.848 41.411  1.00 93.89  ? 349 CYS A O  1 
ATOM 1233  N N  . LYS A 1 350 ? 156.301 154.346 42.275  1.00 86.49  ? 350 LYS A N  1 
ATOM 1234  C CA . LYS A 1 350 ? 155.104 153.691 41.758  1.00 86.49  ? 350 LYS A CA 1 
ATOM 1235  C C  . LYS A 1 350 ? 154.648 154.387 40.480  1.00 86.49  ? 350 LYS A C  1 
ATOM 1236  O O  . LYS A 1 350 ? 153.541 154.905 40.373  1.00 86.49  ? 350 LYS A O  1 
ATOM 1237  N N  . LYS A 1 351 ? 155.547 154.401 39.507  1.00 85.73  ? 351 LYS A N  1 
ATOM 1238  C CA . LYS A 1 351 ? 155.318 155.059 38.236  1.00 85.73  ? 351 LYS A CA 1 
ATOM 1239  C C  . LYS A 1 351 ? 156.066 154.263 37.179  1.00 85.73  ? 351 LYS A C  1 
ATOM 1240  O O  . LYS A 1 351 ? 157.089 153.641 37.470  1.00 85.73  ? 351 LYS A O  1 
ATOM 1241  N N  . ASN A 1 352 ? 155.525 154.261 35.959  1.00 84.76  ? 352 ASN A N  1 
ATOM 1242  C CA . ASN A 1 352 ? 156.058 153.423 34.889  1.00 84.76  ? 352 ASN A CA 1 
ATOM 1243  C C  . ASN A 1 352 ? 157.468 153.851 34.501  1.00 84.76  ? 352 ASN A C  1 
ATOM 1244  O O  . ASN A 1 352 ? 158.352 153.005 34.323  1.00 84.76  ? 352 ASN A O  1 
ATOM 1245  N N  . LYS A 1 353 ? 157.657 155.150 34.255  1.00 83.78  ? 353 LYS A N  1 
ATOM 1246  C CA . LYS A 1 353 ? 158.936 155.856 34.172  1.00 83.78  ? 353 LYS A CA 1 
ATOM 1247  C C  . LYS A 1 353 ? 159.721 155.513 32.905  1.00 83.78  ? 353 LYS A C  1 
ATOM 1248  O O  . LYS A 1 353 ? 160.670 156.218 32.552  1.00 83.78  ? 353 LYS A O  1 
ATOM 1249  N N  . PHE A 1 354 ? 159.291 154.510 32.157  1.00 85.09  ? 354 PHE A N  1 
ATOM 1250  C CA . PHE A 1 354 ? 159.925 154.164 30.893  1.00 85.09  ? 354 PHE A CA 1 
ATOM 1251  C C  . PHE A 1 354 ? 158.897 154.294 29.778  1.00 85.09  ? 354 PHE A C  1 
ATOM 1252  O O  . PHE A 1 354 ? 158.309 153.297 29.350  1.00 85.09  ? 354 PHE A O  1 
ATOM 1253  N N  . GLY A 1 355 ? 158.711 155.522 29.297  1.00 99.68  ? 355 GLY A N  1 
ATOM 1254  C CA . GLY A 1 355 ? 157.950 155.772 28.083  1.00 99.68  ? 355 GLY A CA 1 
ATOM 1255  C C  . GLY A 1 355 ? 156.491 155.389 28.194  1.00 99.68  ? 355 GLY A C  1 
ATOM 1256  O O  . GLY A 1 355 ? 155.739 155.920 29.018  1.00 99.68  ? 355 GLY A O  1 
ATOM 1257  N N  . ALA A 1 356 ? 156.090 154.451 27.350  1.00 111.66 ? 356 ALA A N  1 
ATOM 1258  C CA . ALA A 1 356 ? 154.767 153.853 27.333  1.00 111.66 ? 356 ALA A CA 1 
ATOM 1259  C C  . ALA A 1 356 ? 154.926 152.345 27.272  1.00 111.66 ? 356 ALA A C  1 
ATOM 1260  O O  . ALA A 1 356 ? 155.881 151.839 26.674  1.00 111.66 ? 356 ALA A O  1 
ATOM 1261  N N  . PRO A 1 357 ? 154.023 151.594 27.898  1.00 109.95 ? 357 PRO A N  1 
ATOM 1262  C CA . PRO A 1 357 ? 154.113 150.135 27.801  1.00 109.95 ? 357 PRO A CA 1 
ATOM 1263  C C  . PRO A 1 357 ? 153.701 149.666 26.416  1.00 109.95 ? 357 PRO A C  1 
ATOM 1264  O O  . PRO A 1 357 ? 152.625 149.996 25.918  1.00 109.95 ? 357 PRO A O  1 
ATOM 1265  N N  . GLN A 1 358 ? 154.588 148.916 25.777  1.00 103.56 ? 358 GLN A N  1 
ATOM 1266  C CA . GLN A 1 358 ? 154.316 148.384 24.454  1.00 103.56 ? 358 GLN A CA 1 
ATOM 1267  C C  . GLN A 1 358 ? 154.196 146.878 24.568  1.00 103.56 ? 358 GLN A C  1 
ATOM 1268  O O  . GLN A 1 358 ? 155.079 146.218 25.120  1.00 103.56 ? 358 GLN A O  1 
ATOM 1269  N N  . LYS A 1 359 ? 153.080 146.358 24.047  1.00 111.36 ? 359 LYS A N  1 
ATOM 1270  C CA . LYS A 1 359 ? 152.792 144.928 23.939  1.00 111.36 ? 359 LYS A CA 1 
ATOM 1271  C C  . LYS A 1 359 ? 152.804 144.261 25.308  1.00 111.36 ? 359 LYS A C  1 
ATOM 1272  O O  . LYS A 1 359 ? 153.717 143.490 25.614  1.00 111.36 ? 359 LYS A O  1 
ATOM 1273  N N  . ASP A 1 360 ? 151.810 144.585 26.137  1.00 104.93 ? 360 ASP A N  1 
ATOM 1274  C CA . ASP A 1 360 ? 151.772 144.163 27.530  1.00 104.93 ? 360 ASP A CA 1 
ATOM 1275  C C  . ASP A 1 360 ? 151.662 142.649 27.660  1.00 104.93 ? 360 ASP A C  1 
ATOM 1276  O O  . ASP A 1 360 ? 151.170 141.949 26.771  1.00 104.93 ? 360 ASP A O  1 
ATOM 1277  N N  . VAL A 1 361 ? 152.131 142.146 28.790  1.00 93.57  ? 361 VAL A N  1 
ATOM 1278  C CA . VAL A 1 361 ? 152.186 140.720 29.016  1.00 93.57  ? 361 VAL A CA 1 
ATOM 1279  C C  . VAL A 1 361 ? 150.831 140.254 29.516  1.00 93.57  ? 361 VAL A C  1 
ATOM 1280  O O  . VAL A 1 361 ? 150.040 141.014 30.082  1.00 93.57  ? 361 VAL A O  1 
ATOM 1281  N N  . LYS A 1 362 ? 150.539 138.987 29.255  1.00 82.75  ? 362 LYS A N  1 
ATOM 1282  C CA . LYS A 1 362 ? 149.383 138.330 29.845  1.00 82.75  ? 362 LYS A CA 1 
ATOM 1283  C C  . LYS A 1 362 ? 149.702 136.957 30.402  1.00 82.75  ? 362 LYS A C  1 
ATOM 1284  O O  . LYS A 1 362 ? 148.943 136.463 31.242  1.00 82.75  ? 362 LYS A O  1 
ATOM 1285  N N  . HIS A 1 363 ? 150.787 136.322 29.972  1.00 74.22  ? 363 HIS A N  1 
ATOM 1286  C CA . HIS A 1 363 ? 151.169 135.004 30.440  1.00 74.22  ? 363 HIS A CA 1 
ATOM 1287  C C  . HIS A 1 363 ? 152.502 135.100 31.168  1.00 74.22  ? 363 HIS A C  1 
ATOM 1288  O O  . HIS A 1 363 ? 153.264 136.051 30.985  1.00 74.22  ? 363 HIS A O  1 
ATOM 1289  N N  . LEU A 1 364 ? 152.771 134.121 32.020  1.00 59.88  ? 364 LEU A N  1 
ATOM 1290  C CA . LEU A 1 364 ? 154.045 134.034 32.712  1.00 59.88  ? 364 LEU A CA 1 
ATOM 1291  C C  . LEU A 1 364 ? 154.600 132.631 32.576  1.00 59.88  ? 364 LEU A C  1 
ATOM 1292  O O  . LEU A 1 364 ? 153.944 131.722 32.063  1.00 59.88  ? 364 LEU A O  1 
ATOM 1293  N N  . ALA A 1 365 ? 155.821 132.458 33.066  1.00 63.64  ? 365 ALA A N  1 
ATOM 1294  C CA . ALA A 1 365 ? 156.507 131.177 32.980  1.00 63.64  ? 365 ALA A CA 1 
ATOM 1295  C C  . ALA A 1 365 ? 157.517 131.143 34.115  1.00 63.64  ? 365 ALA A C  1 
ATOM 1296  O O  . ALA A 1 365 ? 158.551 131.809 34.046  1.00 63.64  ? 365 ALA A O  1 
ATOM 1297  N N  . ILE A 1 366 ? 157.213 130.375 35.146  1.00 65.21  ? 366 ILE A N  1 
ATOM 1298  C CA . ILE A 1 366 ? 158.012 130.373 36.358  1.00 65.21  ? 366 ILE A CA 1 
ATOM 1299  C C  . ILE A 1 366 ? 158.784 129.070 36.416  1.00 65.21  ? 366 ILE A C  1 
ATOM 1300  O O  . ILE A 1 366 ? 158.233 128.015 36.739  1.00 65.21  ? 366 ILE A O  1 
ATOM 1301  N N  . LEU A 1 367 ? 160.065 129.158 36.120  1.00 74.55  ? 367 LEU A N  1 
ATOM 1302  C CA . LEU A 1 367 ? 160.923 127.995 35.997  1.00 74.55  ? 367 LEU A CA 1 
ATOM 1303  C C  . LEU A 1 367 ? 161.410 127.605 37.381  1.00 74.55  ? 367 LEU A C  1 
ATOM 1304  O O  . LEU A 1 367 ? 162.370 128.183 37.893  1.00 74.55  ? 367 LEU A O  1 
ATOM 1305  N N  . GLY A 1 368 ? 160.749 126.631 37.989  1.00 82.13  ? 368 GLY A N  1 
ATOM 1306  C CA . GLY A 1 368 ? 161.196 126.150 39.279  1.00 82.13  ? 368 GLY A CA 1 
ATOM 1307  C C  . GLY A 1 368 ? 160.264 126.484 40.421  1.00 82.13  ? 368 GLY A C  1 
ATOM 1308  O O  . GLY A 1 368 ? 159.969 127.654 40.670  1.00 82.13  ? 368 GLY A O  1 
ATOM 1309  N N  . ALA A 1 369 ? 159.806 125.461 41.136  1.00 85.59  ? 369 ALA A N  1 
ATOM 1310  C CA . ALA A 1 369 ? 158.990 125.650 42.326  1.00 85.59  ? 369 ALA A CA 1 
ATOM 1311  C C  . ALA A 1 369 ? 159.898 125.961 43.506  1.00 85.59  ? 369 ALA A C  1 
ATOM 1312  O O  . ALA A 1 369 ? 161.086 126.253 43.352  1.00 85.59  ? 369 ALA A O  1 
ATOM 1313  N N  . GLY A 1 370 ? 159.352 125.904 44.709  1.00 81.75  ? 370 GLY A N  1 
ATOM 1314  C CA . GLY A 1 370 ? 160.173 126.140 45.873  1.00 81.75  ? 370 GLY A CA 1 
ATOM 1315  C C  . GLY A 1 370 ? 159.638 127.256 46.731  1.00 81.75  ? 370 GLY A C  1 
ATOM 1316  O O  . GLY A 1 370 ? 158.452 127.272 47.067  1.00 81.75  ? 370 GLY A O  1 
ATOM 1317  N N  . LEU A 1 371 ? 160.497 128.204 47.087  1.00 76.19  ? 371 LEU A N  1 
ATOM 1318  C CA . LEU A 1 371 ? 160.095 129.294 47.958  1.00 76.19  ? 371 LEU A CA 1 
ATOM 1319  C C  . LEU A 1 371 ? 159.999 130.626 47.244  1.00 76.19  ? 371 LEU A C  1 
ATOM 1320  O O  . LEU A 1 371 ? 159.178 131.460 47.622  1.00 76.19  ? 371 LEU A O  1 
ATOM 1321  N N  . MET A 1 372 ? 160.791 130.844 46.210  1.00 69.13  ? 372 MET A N  1 
ATOM 1322  C CA . MET A 1 372 ? 160.587 132.039 45.414  1.00 69.13  ? 372 MET A CA 1 
ATOM 1323  C C  . MET A 1 372 ? 159.533 131.850 44.342  1.00 69.13  ? 372 MET A C  1 
ATOM 1324  O O  . MET A 1 372 ? 158.681 132.721 44.169  1.00 69.13  ? 372 MET A O  1 
ATOM 1325  N N  . GLY A 1 373 ? 159.570 130.736 43.623  1.00 70.18  ? 373 GLY A N  1 
ATOM 1326  C CA . GLY A 1 373 ? 158.716 130.542 42.472  1.00 70.18  ? 373 GLY A CA 1 
ATOM 1327  C C  . GLY A 1 373 ? 157.253 130.469 42.830  1.00 70.18  ? 373 GLY A C  1 
ATOM 1328  O O  . GLY A 1 373 ? 156.446 131.266 42.341  1.00 70.18  ? 373 GLY A O  1 
ATOM 1329  N N  . ALA A 1 374 ? 156.914 129.543 43.731  1.00 69.64  ? 374 ALA A N  1 
ATOM 1330  C CA . ALA A 1 374 ? 155.583 129.529 44.321  1.00 69.64  ? 374 ALA A CA 1 
ATOM 1331  C C  . ALA A 1 374 ? 155.338 130.789 45.125  1.00 69.64  ? 374 ALA A C  1 
ATOM 1332  O O  . ALA A 1 374 ? 154.200 131.267 45.201  1.00 69.64  ? 374 ALA A O  1 
ATOM 1333  N N  . GLY A 1 375 ? 156.405 131.365 45.675  1.00 64.45  ? 375 GLY A N  1 
ATOM 1334  C CA . GLY A 1 375 ? 156.289 132.642 46.339  1.00 64.45  ? 375 GLY A CA 1 
ATOM 1335  C C  . GLY A 1 375 ? 155.833 133.754 45.414  1.00 64.45  ? 375 GLY A C  1 
ATOM 1336  O O  . GLY A 1 375 ? 154.830 134.413 45.684  1.00 64.45  ? 375 GLY A O  1 
ATOM 1337  N N  . ILE A 1 376 ? 156.540 133.974 44.301  1.00 61.35  ? 376 ILE A N  1 
ATOM 1338  C CA . ILE A 1 376 ? 156.110 135.089 43.465  1.00 61.35  ? 376 ILE A CA 1 
ATOM 1339  C C  . ILE A 1 376 ? 154.845 134.736 42.713  1.00 61.35  ? 376 ILE A C  1 
ATOM 1340  O O  . ILE A 1 376 ? 154.136 135.636 42.264  1.00 61.35  ? 376 ILE A O  1 
ATOM 1341  N N  . ALA A 1 377 ? 154.537 133.449 42.578  1.00 63.73  ? 377 ALA A N  1 
ATOM 1342  C CA . ALA A 1 377 ? 153.232 133.069 42.066  1.00 63.73  ? 377 ALA A CA 1 
ATOM 1343  C C  . ALA A 1 377 ? 152.124 133.465 43.025  1.00 63.73  ? 377 ALA A C  1 
ATOM 1344  O O  . ALA A 1 377 ? 151.030 133.810 42.577  1.00 63.73  ? 377 ALA A O  1 
ATOM 1345  N N  . GLN A 1 378 ? 152.393 133.446 44.337  1.00 62.62  ? 378 GLN A N  1 
ATOM 1346  C CA . GLN A 1 378 ? 151.393 133.815 45.338  1.00 62.62  ? 378 GLN A CA 1 
ATOM 1347  C C  . GLN A 1 378 ? 150.928 135.260 45.205  1.00 62.62  ? 378 GLN A C  1 
ATOM 1348  O O  . GLN A 1 378 ? 149.793 135.567 45.578  1.00 62.62  ? 378 GLN A O  1 
ATOM 1349  N N  . VAL A 1 379 ? 151.739 136.142 44.633  1.00 65.03  ? 379 VAL A N  1 
ATOM 1350  C CA . VAL A 1 379 ? 151.341 137.528 44.473  1.00 65.03  ? 379 VAL A CA 1 
ATOM 1351  C C  . VAL A 1 379 ? 150.999 137.859 43.025  1.00 65.03  ? 379 VAL A C  1 
ATOM 1352  O O  . VAL A 1 379 ? 150.144 138.726 42.789  1.00 65.03  ? 379 VAL A O  1 
ATOM 1353  N N  . SER A 1 380 ? 151.587 137.169 42.051  1.00 71.66  ? 380 SER A N  1 
ATOM 1354  C CA . SER A 1 380 ? 151.393 137.499 40.646  1.00 71.66  ? 380 SER A CA 1 
ATOM 1355  C C  . SER A 1 380 ? 150.234 136.753 40.018  1.00 71.66  ? 380 SER A C  1 
ATOM 1356  O O  . SER A 1 380 ? 150.191 136.632 38.790  1.00 71.66  ? 380 SER A O  1 
ATOM 1357  N N  . VAL A 1 381 ? 149.294 136.246 40.809  1.00 66.17  ? 381 VAL A N  1 
ATOM 1358  C CA . VAL A 1 381 ? 148.221 135.455 40.251  1.00 66.17  ? 381 VAL A CA 1 
ATOM 1359  C C  . VAL A 1 381 ? 146.858 136.118 40.410  1.00 66.17  ? 381 VAL A C  1 
ATOM 1360  O O  . VAL A 1 381 ? 145.992 135.924 39.551  1.00 66.17  ? 381 VAL A O  1 
ATOM 1361  N N  . ASP A 1 382 ? 146.655 136.951 41.429  1.00 74.90  ? 382 ASP A N  1 
ATOM 1362  C CA . ASP A 1 382 ? 145.296 137.371 41.727  1.00 74.90  ? 382 ASP A CA 1 
ATOM 1363  C C  . ASP A 1 382 ? 144.789 138.457 40.794  1.00 74.90  ? 382 ASP A C  1 
ATOM 1364  O O  . ASP A 1 382 ? 143.643 138.383 40.347  1.00 74.90  ? 382 ASP A O  1 
ATOM 1365  N N  . LYS A 1 383 ? 145.626 139.427 40.447  1.00 73.29  ? 383 LYS A N  1 
ATOM 1366  C CA . LYS A 1 383 ? 145.179 140.602 39.718  1.00 73.29  ? 383 LYS A CA 1 
ATOM 1367  C C  . LYS A 1 383 ? 145.391 140.473 38.225  1.00 73.29  ? 383 LYS A C  1 
ATOM 1368  O O  . LYS A 1 383 ? 145.748 141.448 37.552  1.00 73.29  ? 383 LYS A O  1 
ATOM 1369  N N  . GLY A 1 384 ? 145.180 139.278 37.691  1.00 83.41  ? 384 GLY A N  1 
ATOM 1370  C CA . GLY A 1 384 ? 145.037 139.108 36.265  1.00 83.41  ? 384 GLY A CA 1 
ATOM 1371  C C  . GLY A 1 384 ? 146.319 138.856 35.516  1.00 83.41  ? 384 GLY A C  1 
ATOM 1372  O O  . GLY A 1 384 ? 146.677 139.613 34.612  1.00 83.41  ? 384 GLY A O  1 
ATOM 1373  N N  . LEU A 1 385 ? 147.033 137.805 35.898  1.00 73.69  ? 385 LEU A N  1 
ATOM 1374  C CA . LEU A 1 385 ? 148.180 137.337 35.137  1.00 73.69  ? 385 LEU A CA 1 
ATOM 1375  C C  . LEU A 1 385 ? 148.090 135.823 35.059  1.00 73.69  ? 385 LEU A C  1 
ATOM 1376  O O  . LEU A 1 385 ? 148.085 135.154 36.094  1.00 73.69  ? 385 LEU A O  1 
ATOM 1377  N N  . LYS A 1 386 ? 147.988 135.285 33.847  1.00 68.00  ? 386 LYS A N  1 
ATOM 1378  C CA . LYS A 1 386 ? 148.056 133.841 33.664  1.00 68.00  ? 386 LYS A CA 1 
ATOM 1379  C C  . LYS A 1 386 ? 149.468 133.340 33.943  1.00 68.00  ? 386 LYS A C  1 
ATOM 1380  O O  . LYS A 1 386 ? 150.449 133.906 33.456  1.00 68.00  ? 386 LYS A O  1 
ATOM 1381  N N  . THR A 1 387 ? 149.578 132.289 34.757  1.00 59.22  ? 387 THR A N  1 
ATOM 1382  C CA . THR A 1 387 ? 150.889 131.769 35.132  1.00 59.22  ? 387 THR A CA 1 
ATOM 1383  C C  . THR A 1 387 ? 150.976 130.270 34.911  1.00 59.22  ? 387 THR A C  1 
ATOM 1384  O O  . THR A 1 387 ? 149.981 129.550 35.048  1.00 59.22  ? 387 THR A O  1 
ATOM 1385  N N  . ILE A 1 388 ? 152.180 129.806 34.600  1.00 58.82  ? 388 ILE A N  1 
ATOM 1386  C CA . ILE A 1 388 ? 152.507 128.390 34.520  1.00 58.82  ? 388 ILE A CA 1 
ATOM 1387  C C  . ILE A 1 388 ? 153.730 128.149 35.388  1.00 58.82  ? 388 ILE A C  1 
ATOM 1388  O O  . ILE A 1 388 ? 154.731 128.862 35.269  1.00 58.82  ? 388 ILE A O  1 
ATOM 1389  N N  . LEU A 1 389 ? 153.657 127.150 36.260  1.00 60.68  ? 389 LEU A N  1 
ATOM 1390  C CA . LEU A 1 389 ? 154.676 126.929 37.281  1.00 60.68  ? 389 LEU A CA 1 
ATOM 1391  C C  . LEU A 1 389 ? 155.432 125.637 36.969  1.00 60.68  ? 389 LEU A C  1 
ATOM 1392  O O  . LEU A 1 389 ? 154.932 124.536 37.205  1.00 60.68  ? 389 LEU A O  1 
ATOM 1393  N N  . LYS A 1 390 ? 156.652 125.780 36.463  1.00 80.65  ? 390 LYS A N  1 
ATOM 1394  C CA . LYS A 1 390 ? 157.507 124.641 36.163  1.00 80.65  ? 390 LYS A CA 1 
ATOM 1395  C C  . LYS A 1 390 ? 158.049 124.011 37.437  1.00 80.65  ? 390 LYS A C  1 
ATOM 1396  O O  . LYS A 1 390 ? 158.395 124.704 38.393  1.00 80.65  ? 390 LYS A O  1 
ATOM 1397  N N  . ASP A 1 391 ? 158.119 122.686 37.445  1.00 97.29  ? 391 ASP A N  1 
ATOM 1398  C CA . ASP A 1 391 ? 158.770 121.937 38.505  1.00 97.29  ? 391 ASP A CA 1 
ATOM 1399  C C  . ASP A 1 391 ? 159.551 120.813 37.837  1.00 97.29  ? 391 ASP A C  1 
ATOM 1400  O O  . ASP A 1 391 ? 159.459 120.609 36.625  1.00 97.29  ? 391 ASP A O  1 
ATOM 1401  N N  . ALA A 1 392 ? 160.342 120.095 38.630  1.00 107.77 ? 392 ALA A N  1 
ATOM 1402  C CA . ALA A 1 392 ? 161.049 118.918 38.138  1.00 107.77 ? 392 ALA A CA 1 
ATOM 1403  C C  . ALA A 1 392 ? 160.197 117.660 38.275  1.00 107.77 ? 392 ALA A C  1 
ATOM 1404  O O  . ALA A 1 392 ? 159.898 116.995 37.279  1.00 107.77 ? 392 ALA A O  1 
ATOM 1405  N N  . THR A 1 393 ? 159.811 117.315 39.497  1.00 101.64 ? 393 THR A N  1 
ATOM 1406  C CA . THR A 1 393 ? 158.933 116.182 39.741  1.00 101.64 ? 393 THR A CA 1 
ATOM 1407  C C  . THR A 1 393 ? 157.701 116.659 40.492  1.00 101.64 ? 393 THR A C  1 
ATOM 1408  O O  . THR A 1 393 ? 157.594 117.826 40.874  1.00 101.64 ? 393 THR A O  1 
ATOM 1409  N N  . LEU A 1 394 ? 156.770 115.729 40.708  1.00 87.91  ? 394 LEU A N  1 
ATOM 1410  C CA . LEU A 1 394 ? 155.559 116.020 41.463  1.00 87.91  ? 394 LEU A CA 1 
ATOM 1411  C C  . LEU A 1 394 ? 155.853 116.352 42.910  1.00 87.91  ? 394 LEU A C  1 
ATOM 1412  O O  . LEU A 1 394 ? 155.132 117.154 43.513  1.00 87.91  ? 394 LEU A O  1 
ATOM 1413  N N  . THR A 1 395 ? 156.936 115.799 43.451  1.00 103.92 ? 395 THR A N  1 
ATOM 1414  C CA . THR A 1 395 ? 157.298 115.805 44.862  1.00 103.92 ? 395 THR A CA 1 
ATOM 1415  C C  . THR A 1 395 ? 157.509 117.198 45.447  1.00 103.92 ? 395 THR A C  1 
ATOM 1416  O O  . THR A 1 395 ? 157.670 117.306 46.666  1.00 103.92 ? 395 THR A O  1 
ATOM 1417  N N  . ALA A 1 396 ? 157.526 118.256 44.634  1.00 92.38  ? 396 ALA A N  1 
ATOM 1418  C CA . ALA A 1 396 ? 157.646 119.611 45.149  1.00 92.38  ? 396 ALA A CA 1 
ATOM 1419  C C  . ALA A 1 396 ? 156.490 120.522 44.739  1.00 92.38  ? 396 ALA A C  1 
ATOM 1420  O O  . ALA A 1 396 ? 156.480 121.692 45.126  1.00 92.38  ? 396 ALA A O  1 
ATOM 1421  N N  . LEU A 1 397 ? 155.517 120.036 43.968  1.00 78.94  ? 397 LEU A N  1 
ATOM 1422  C CA . LEU A 1 397 ? 154.341 120.858 43.713  1.00 78.94  ? 397 LEU A CA 1 
ATOM 1423  C C  . LEU A 1 397 ? 153.384 120.870 44.887  1.00 78.94  ? 397 LEU A C  1 
ATOM 1424  O O  . LEU A 1 397 ? 152.624 121.833 45.042  1.00 78.94  ? 397 LEU A O  1 
ATOM 1425  N N  . ASP A 1 398 ? 153.383 119.801 45.676  1.00 87.23  ? 398 ASP A N  1 
ATOM 1426  C CA . ASP A 1 398 ? 152.668 119.777 46.944  1.00 87.23  ? 398 ASP A CA 1 
ATOM 1427  C C  . ASP A 1 398 ? 153.182 120.840 47.903  1.00 87.23  ? 398 ASP A C  1 
ATOM 1428  O O  . ASP A 1 398 ? 152.393 121.477 48.603  1.00 87.23  ? 398 ASP A O  1 
ATOM 1429  N N  . ARG A 1 399 ? 154.490 121.058 47.933  1.00 80.91  ? 399 ARG A N  1 
ATOM 1430  C CA . ARG A 1 399 ? 155.031 122.196 48.652  1.00 80.91  ? 399 ARG A CA 1 
ATOM 1431  C C  . ARG A 1 399 ? 154.822 123.480 47.863  1.00 80.91  ? 399 ARG A C  1 
ATOM 1432  O O  . ARG A 1 399 ? 154.893 124.572 48.434  1.00 80.91  ? 399 ARG A O  1 
ATOM 1433  N N  . GLY A 1 400 ? 154.499 123.366 46.579  1.00 71.16  ? 400 GLY A N  1 
ATOM 1434  C CA . GLY A 1 400 ? 154.199 124.511 45.749  1.00 71.16  ? 400 GLY A CA 1 
ATOM 1435  C C  . GLY A 1 400 ? 152.839 125.137 45.968  1.00 71.16  ? 400 GLY A C  1 
ATOM 1436  O O  . GLY A 1 400 ? 152.751 126.246 46.504  1.00 71.16  ? 400 GLY A O  1 
ATOM 1437  N N  . GLN A 1 401 ? 151.772 124.430 45.595  1.00 70.30  ? 401 GLN A N  1 
ATOM 1438  C CA . GLN A 1 401 ? 150.449 125.046 45.586  1.00 70.30  ? 401 GLN A CA 1 
ATOM 1439  C C  . GLN A 1 401 ? 149.942 125.297 47.000  1.00 70.30  ? 401 GLN A C  1 
ATOM 1440  O O  . GLN A 1 401 ? 149.220 126.270 47.244  1.00 70.30  ? 401 GLN A O  1 
ATOM 1441  N N  . GLN A 1 402 ? 150.401 124.505 47.967  1.00 66.78  ? 402 GLN A N  1 
ATOM 1442  C CA . GLN A 1 402 ? 150.112 124.790 49.368  1.00 66.78  ? 402 GLN A CA 1 
ATOM 1443  C C  . GLN A 1 402 ? 150.782 126.047 49.903  1.00 66.78  ? 402 GLN A C  1 
ATOM 1444  O O  . GLN A 1 402 ? 150.693 126.283 51.107  1.00 66.78  ? 402 GLN A O  1 
ATOM 1445  N N  . GLN A 1 403 ? 151.496 126.824 49.099  1.00 65.51  ? 403 GLN A N  1 
ATOM 1446  C CA . GLN A 1 403 ? 151.726 128.220 49.468  1.00 65.51  ? 403 GLN A CA 1 
ATOM 1447  C C  . GLN A 1 403 ? 150.620 129.057 48.839  1.00 65.51  ? 403 GLN A C  1 
ATOM 1448  O O  . GLN A 1 403 ? 149.857 129.717 49.551  1.00 65.51  ? 403 GLN A O  1 
ATOM 1449  N N  . VAL A 1 404 ? 150.448 128.941 47.517  1.00 58.03  ? 404 VAL A N  1 
ATOM 1450  C CA . VAL A 1 404 ? 149.525 129.795 46.771  1.00 58.03  ? 404 VAL A CA 1 
ATOM 1451  C C  . VAL A 1 404 ? 148.071 129.515 47.117  1.00 58.03  ? 404 VAL A C  1 
ATOM 1452  O O  . VAL A 1 404 ? 147.178 130.264 46.717  1.00 58.03  ? 404 VAL A O  1 
ATOM 1453  N N  . PHE A 1 405 ? 147.806 128.458 47.865  1.00 58.17  ? 405 PHE A N  1 
ATOM 1454  C CA . PHE A 1 405 ? 146.508 128.275 48.471  1.00 58.17  ? 405 PHE A CA 1 
ATOM 1455  C C  . PHE A 1 405 ? 146.483 128.717 49.929  1.00 58.17  ? 405 PHE A C  1 
ATOM 1456  O O  . PHE A 1 405 ? 145.567 129.443 50.324  1.00 58.17  ? 405 PHE A O  1 
ATOM 1457  N N  . LYS A 1 406 ? 147.494 128.340 50.728  1.00 61.86  ? 406 LYS A N  1 
ATOM 1458  C CA . LYS A 1 406 ? 147.442 128.611 52.165  1.00 61.86  ? 406 LYS A CA 1 
ATOM 1459  C C  . LYS A 1 406 ? 147.604 130.086 52.458  1.00 61.86  ? 406 LYS A C  1 
ATOM 1460  O O  . LYS A 1 406 ? 146.872 130.640 53.282  1.00 61.86  ? 406 LYS A O  1 
ATOM 1461  N N  . GLY A 1 407 ? 148.505 130.746 51.758  1.00 60.86  ? 407 GLY A N  1 
ATOM 1462  C CA . GLY A 1 407 ? 148.570 132.182 51.821  1.00 60.86  ? 407 GLY A CA 1 
ATOM 1463  C C  . GLY A 1 407 ? 147.520 132.905 51.015  1.00 60.86  ? 407 GLY A C  1 
ATOM 1464  O O  . GLY A 1 407 ? 147.645 134.111 50.793  1.00 60.86  ? 407 GLY A O  1 
ATOM 1465  N N  . LEU A 1 408 ? 146.479 132.210 50.573  1.00 57.86  ? 408 LEU A N  1 
ATOM 1466  C CA . LEU A 1 408 ? 145.382 132.828 49.855  1.00 57.86  ? 408 LEU A CA 1 
ATOM 1467  C C  . LEU A 1 408 ? 144.082 132.782 50.636  1.00 57.86  ? 408 LEU A C  1 
ATOM 1468  O O  . LEU A 1 408 ? 143.394 133.797 50.721  1.00 57.86  ? 408 LEU A O  1 
ATOM 1469  N N  . ASN A 1 409 ? 143.722 131.635 51.218  1.00 63.54  ? 409 ASN A N  1 
ATOM 1470  C CA . ASN A 1 409 ? 142.410 131.541 51.849  1.00 63.54  ? 409 ASN A CA 1 
ATOM 1471  C C  . ASN A 1 409 ? 142.380 132.218 53.206  1.00 63.54  ? 409 ASN A C  1 
ATOM 1472  O O  . ASN A 1 409 ? 141.297 132.502 53.722  1.00 63.54  ? 409 ASN A O  1 
ATOM 1473  N N  . ASP A 1 410 ? 143.542 132.480 53.802  1.00 68.06  ? 410 ASP A N  1 
ATOM 1474  C CA . ASP A 1 410 ? 143.568 133.405 54.929  1.00 68.06  ? 410 ASP A CA 1 
ATOM 1475  C C  . ASP A 1 410 ? 143.063 134.779 54.510  1.00 68.06  ? 410 ASP A C  1 
ATOM 1476  O O  . ASP A 1 410 ? 142.392 135.464 55.292  1.00 68.06  ? 410 ASP A O  1 
ATOM 1477  N N  . LYS A 1 411 ? 143.339 135.152 53.258  1.00 62.90  ? 411 LYS A N  1 
ATOM 1478  C CA . LYS A 1 411 ? 142.748 136.323 52.633  1.00 62.90  ? 411 LYS A CA 1 
ATOM 1479  C C  . LYS A 1 411 ? 141.227 136.257 52.623  1.00 62.90  ? 411 LYS A C  1 
ATOM 1480  O O  . LYS A 1 411 ? 140.570 137.283 52.827  1.00 62.90  ? 411 LYS A O  1 
ATOM 1481  N N  . VAL A 1 412 ? 140.639 135.076 52.407  1.00 62.93  ? 412 VAL A N  1 
ATOM 1482  C CA . VAL A 1 412 ? 139.184 135.003 52.511  1.00 62.93  ? 412 VAL A CA 1 
ATOM 1483  C C  . VAL A 1 412 ? 138.772 134.678 53.938  1.00 62.93  ? 412 VAL A C  1 
ATOM 1484  O O  . VAL A 1 412 ? 137.588 134.803 54.283  1.00 62.93  ? 412 VAL A O  1 
ATOM 1485  N N  . LYS A 1 413 ? 139.721 134.307 54.797  1.00 67.40  ? 413 LYS A N  1 
ATOM 1486  C CA . LYS A 1 413 ? 139.409 134.147 56.207  1.00 67.40  ? 413 LYS A CA 1 
ATOM 1487  C C  . LYS A 1 413 ? 139.330 135.492 56.910  1.00 67.40  ? 413 LYS A C  1 
ATOM 1488  O O  . LYS A 1 413 ? 138.629 135.618 57.916  1.00 67.40  ? 413 LYS A O  1 
ATOM 1489  N N  . LYS A 1 414 ? 139.994 136.510 56.378  1.00 68.76  ? 414 LYS A N  1 
ATOM 1490  C CA . LYS A 1 414 ? 139.838 137.867 56.871  1.00 68.76  ? 414 LYS A CA 1 
ATOM 1491  C C  . LYS A 1 414 ? 138.807 138.654 56.081  1.00 68.76  ? 414 LYS A C  1 
ATOM 1492  O O  . LYS A 1 414 ? 138.765 139.882 56.201  1.00 68.76  ? 414 LYS A O  1 
ATOM 1493  N N  . LYS A 1 415 ? 138.012 137.971 55.249  1.00 61.91  ? 415 LYS A N  1 
ATOM 1494  C CA . LYS A 1 415 ? 136.864 138.529 54.520  1.00 61.91  ? 415 LYS A CA 1 
ATOM 1495  C C  . LYS A 1 415 ? 137.262 139.643 53.554  1.00 61.91  ? 415 LYS A C  1 
ATOM 1496  O O  . LYS A 1 415 ? 136.449 140.502 53.212  1.00 61.91  ? 415 LYS A O  1 
ATOM 1497  N N  . ALA A 1 416 ? 138.510 139.627 53.095  1.00 64.58  ? 416 ALA A N  1 
ATOM 1498  C CA . ALA A 1 416 ? 138.972 140.618 52.136  1.00 64.58  ? 416 ALA A CA 1 
ATOM 1499  C C  . ALA A 1 416 ? 138.607 140.268 50.702  1.00 64.58  ? 416 ALA A C  1 
ATOM 1500  O O  . ALA A 1 416 ? 138.747 141.121 49.822  1.00 64.58  ? 416 ALA A O  1 
ATOM 1501  N N  . LEU A 1 417 ? 138.167 139.040 50.443  1.00 60.77  ? 417 LEU A N  1 
ATOM 1502  C CA . LEU A 1 417 ? 137.714 138.626 49.123  1.00 60.77  ? 417 LEU A CA 1 
ATOM 1503  C C  . LEU A 1 417 ? 136.462 137.780 49.279  1.00 60.77  ? 417 LEU A C  1 
ATOM 1504  O O  . LEU A 1 417 ? 136.069 137.414 50.386  1.00 60.77  ? 417 LEU A O  1 
ATOM 1505  N N  . THR A 1 418 ? 135.824 137.481 48.159  1.00 50.64  ? 418 THR A N  1 
ATOM 1506  C CA . THR A 1 418 ? 134.696 136.573 48.216  1.00 50.64  ? 418 THR A CA 1 
ATOM 1507  C C  . THR A 1 418 ? 135.193 135.138 48.194  1.00 50.64  ? 418 THR A C  1 
ATOM 1508  O O  . THR A 1 418 ? 136.328 134.856 47.810  1.00 50.64  ? 418 THR A O  1 
ATOM 1509  N N  . SER A 1 419 ? 134.318 134.221 48.601  1.00 47.63  ? 419 SER A N  1 
ATOM 1510  C CA . SER A 1 419 ? 134.695 132.814 48.608  1.00 47.63  ? 419 SER A CA 1 
ATOM 1511  C C  . SER A 1 419 ? 134.761 132.248 47.204  1.00 47.63  ? 419 SER A C  1 
ATOM 1512  O O  . SER A 1 419 ? 135.440 131.244 46.978  1.00 47.63  ? 419 SER A O  1 
ATOM 1513  N N  . PHE A 1 420 ? 134.069 132.865 46.255  1.00 46.09  ? 420 PHE A N  1 
ATOM 1514  C CA . PHE A 1 420 ? 134.069 132.325 44.905  1.00 46.09  ? 420 PHE A CA 1 
ATOM 1515  C C  . PHE A 1 420 ? 135.290 132.770 44.120  1.00 46.09  ? 420 PHE A C  1 
ATOM 1516  O O  . PHE A 1 420 ? 135.959 131.946 43.491  1.00 46.09  ? 420 PHE A O  1 
ATOM 1517  N N  . GLU A 1 421 ? 135.574 134.076 44.124  1.00 52.04  ? 421 GLU A N  1 
ATOM 1518  C CA . GLU A 1 421 ? 136.642 134.622 43.291  1.00 52.04  ? 421 GLU A CA 1 
ATOM 1519  C C  . GLU A 1 421 ? 138.008 134.120 43.723  1.00 52.04  ? 421 GLU A C  1 
ATOM 1520  O O  . GLU A 1 421 ? 138.939 134.101 42.907  1.00 52.04  ? 421 GLU A O  1 
ATOM 1521  N N  . ARG A 1 422 ? 138.135 133.756 45.006  1.00 49.44  ? 422 ARG A N  1 
ATOM 1522  C CA . ARG A 1 422 ? 139.215 132.932 45.544  1.00 49.44  ? 422 ARG A CA 1 
ATOM 1523  C C  . ARG A 1 422 ? 139.610 131.811 44.606  1.00 49.44  ? 422 ARG A C  1 
ATOM 1524  O O  . ARG A 1 422 ? 140.780 131.645 44.246  1.00 49.44  ? 422 ARG A O  1 
ATOM 1525  N N  . ASP A 1 423 ? 138.625 131.044 44.183  1.00 50.37  ? 423 ASP A N  1 
ATOM 1526  C CA . ASP A 1 423 ? 138.952 129.813 43.510  1.00 50.37  ? 423 ASP A CA 1 
ATOM 1527  C C  . ASP A 1 423 ? 139.207 130.032 42.027  1.00 50.37  ? 423 ASP A C  1 
ATOM 1528  O O  . ASP A 1 423 ? 139.968 129.273 41.425  1.00 50.37  ? 423 ASP A O  1 
ATOM 1529  N N  . SER A 1 424 ? 138.641 131.084 41.428  1.00 46.89  ? 424 SER A N  1 
ATOM 1530  C CA . SER A 1 424 ? 139.046 131.436 40.069  1.00 46.89  ? 424 SER A CA 1 
ATOM 1531  C C  . SER A 1 424 ? 140.468 131.975 40.048  1.00 46.89  ? 424 SER A C  1 
ATOM 1532  O O  . SER A 1 424 ? 141.232 131.700 39.111  1.00 46.89  ? 424 SER A O  1 
ATOM 1533  N N  . ILE A 1 425 ? 140.833 132.741 41.082  1.00 48.48  ? 425 ILE A N  1 
ATOM 1534  C CA . ILE A 1 425 ? 142.209 133.192 41.262  1.00 48.48  ? 425 ILE A CA 1 
ATOM 1535  C C  . ILE A 1 425 ? 143.155 132.009 41.394  1.00 48.48  ? 425 ILE A C  1 
ATOM 1536  O O  . ILE A 1 425 ? 144.234 131.990 40.791  1.00 48.48  ? 425 ILE A O  1 
ATOM 1537  N N  . PHE A 1 426 ? 142.749 130.987 42.146  1.00 50.46  ? 426 PHE A N  1 
ATOM 1538  C CA . PHE A 1 426 ? 143.576 129.791 42.254  1.00 50.46  ? 426 PHE A CA 1 
ATOM 1539  C C  . PHE A 1 426 ? 143.667 129.046 40.930  1.00 50.46  ? 426 PHE A C  1 
ATOM 1540  O O  . PHE A 1 426 ? 144.720 128.495 40.597  1.00 50.46  ? 426 PHE A O  1 
ATOM 1541  N N  . SER A 1 427 ? 142.580 128.996 40.176  1.00 46.88  ? 427 SER A N  1 
ATOM 1542  C CA . SER A 1 427 ? 142.582 128.252 38.927  1.00 46.88  ? 427 SER A CA 1 
ATOM 1543  C C  . SER A 1 427 ? 143.145 129.043 37.759  1.00 46.88  ? 427 SER A C  1 
ATOM 1544  O O  . SER A 1 427 ? 143.160 128.524 36.640  1.00 46.88  ? 427 SER A O  1 
ATOM 1545  N N  . ASN A 1 428 ? 143.593 130.282 37.967  1.00 48.57  ? 428 ASN A N  1 
ATOM 1546  C CA . ASN A 1 428 ? 144.424 130.906 36.941  1.00 48.57  ? 428 ASN A CA 1 
ATOM 1547  C C  . ASN A 1 428 ? 145.825 130.320 36.893  1.00 48.57  ? 428 ASN A C  1 
ATOM 1548  O O  . ASN A 1 428 ? 146.554 130.580 35.936  1.00 48.57  ? 428 ASN A O  1 
ATOM 1549  N N  . LEU A 1 429 ? 146.223 129.569 37.907  1.00 48.70  ? 429 LEU A N  1 
ATOM 1550  C CA . LEU A 1 429 ? 147.570 129.027 38.040  1.00 48.70  ? 429 LEU A CA 1 
ATOM 1551  C C  . LEU A 1 429 ? 147.550 127.544 37.729  1.00 48.70  ? 429 LEU A C  1 
ATOM 1552  O O  . LEU A 1 429 ? 147.036 126.754 38.516  1.00 48.70  ? 429 LEU A O  1 
ATOM 1553  N N  . THR A 1 430 ? 148.112 127.169 36.593  1.00 64.20  ? 430 THR A N  1 
ATOM 1554  C CA . THR A 1 430 ? 148.305 125.764 36.280  1.00 64.20  ? 430 THR A CA 1 
ATOM 1555  C C  . THR A 1 430 ? 149.752 125.391 36.533  1.00 64.20  ? 430 THR A C  1 
ATOM 1556  O O  . THR A 1 430 ? 150.651 126.221 36.412  1.00 64.20  ? 430 THR A O  1 
ATOM 1557  N N  . GLY A 1 431 ? 149.969 124.136 36.886  1.00 65.75  ? 431 GLY A N  1 
ATOM 1558  C CA . GLY A 1 431 ? 151.322 123.672 37.052  1.00 65.75  ? 431 GLY A CA 1 
ATOM 1559  C C  . GLY A 1 431 ? 151.641 122.573 36.073  1.00 65.75  ? 431 GLY A C  1 
ATOM 1560  O O  . GLY A 1 431 ? 151.105 121.468 36.180  1.00 65.75  ? 431 GLY A O  1 
ATOM 1561  N N  . GLN A 1 432 ? 152.509 122.854 35.110  1.00 73.95  ? 432 GLN A N  1 
ATOM 1562  C CA . GLN A 1 432 ? 152.923 121.816 34.188  1.00 73.95  ? 432 GLN A CA 1 
ATOM 1563  C C  . GLN A 1 432 ? 153.976 120.937 34.836  1.00 73.95  ? 432 GLN A C  1 
ATOM 1564  O O  . GLN A 1 432 ? 154.413 121.157 35.968  1.00 73.95  ? 432 GLN A O  1 
ATOM 1565  N N  . LEU A 1 433 ? 154.392 119.922 34.094  1.00 79.31  ? 433 LEU A N  1 
ATOM 1566  C CA . LEU A 1 433 ? 155.505 119.086 34.501  1.00 79.31  ? 433 LEU A CA 1 
ATOM 1567  C C  . LEU A 1 433 ? 156.687 119.219 33.562  1.00 79.31  ? 433 LEU A C  1 
ATOM 1568  O O  . LEU A 1 433 ? 157.815 119.397 34.029  1.00 79.31  ? 433 LEU A O  1 
ATOM 1569  N N  . ASP A 1 434 ? 156.474 119.149 32.248  1.00 92.25  ? 434 ASP A N  1 
ATOM 1570  C CA . ASP A 1 434 ? 157.660 119.219 31.415  1.00 92.25  ? 434 ASP A CA 1 
ATOM 1571  C C  . ASP A 1 434 ? 157.734 120.473 30.560  1.00 92.25  ? 434 ASP A C  1 
ATOM 1572  O O  . ASP A 1 434 ? 158.443 121.412 30.932  1.00 92.25  ? 434 ASP A O  1 
ATOM 1573  N N  . TYR A 1 435 ? 156.968 120.555 29.457  1.00 92.78  ? 435 TYR A N  1 
ATOM 1574  C CA . TYR A 1 435 ? 157.099 121.725 28.591  1.00 92.78  ? 435 TYR A CA 1 
ATOM 1575  C C  . TYR A 1 435 ? 155.862 122.146 27.813  1.00 92.78  ? 435 TYR A C  1 
ATOM 1576  O O  . TYR A 1 435 ? 155.951 123.144 27.097  1.00 92.78  ? 435 TYR A O  1 
ATOM 1577  N N  . GLN A 1 436 ? 154.729 121.459 27.897  1.00 96.82  ? 436 GLN A N  1 
ATOM 1578  C CA . GLN A 1 436 ? 153.699 121.646 26.871  1.00 96.82  ? 436 GLN A CA 1 
ATOM 1579  C C  . GLN A 1 436 ? 152.889 122.914 27.150  1.00 96.82  ? 436 GLN A C  1 
ATOM 1580  O O  . GLN A 1 436 ? 151.927 122.916 27.919  1.00 96.82  ? 436 GLN A O  1 
ATOM 1581  N N  . GLY A 1 437 ? 153.287 124.011 26.515  1.00 98.73  ? 437 GLY A N  1 
ATOM 1582  C CA . GLY A 1 437 ? 152.564 125.254 26.687  1.00 98.73  ? 437 GLY A CA 1 
ATOM 1583  C C  . GLY A 1 437 ? 153.409 126.513 26.702  1.00 98.73  ? 437 GLY A C  1 
ATOM 1584  O O  . GLY A 1 437 ? 152.869 127.619 26.784  1.00 98.73  ? 437 GLY A O  1 
ATOM 1585  N N  . PHE A 1 438 ? 154.729 126.376 26.604  1.00 98.68  ? 438 PHE A N  1 
ATOM 1586  C CA . PHE A 1 438 ? 155.583 127.555 26.568  1.00 98.68  ? 438 PHE A CA 1 
ATOM 1587  C C  . PHE A 1 438 ? 155.610 128.232 25.210  1.00 98.68  ? 438 PHE A C  1 
ATOM 1588  O O  . PHE A 1 438 ? 156.257 129.272 25.072  1.00 98.68  ? 438 PHE A O  1 
ATOM 1589  N N  . GLU A 1 439 ? 154.938 127.675 24.206  1.00 102.36 ? 439 GLU A N  1 
ATOM 1590  C CA . GLU A 1 439 ? 154.816 128.380 22.941  1.00 102.36 ? 439 GLU A CA 1 
ATOM 1591  C C  . GLU A 1 439 ? 153.855 129.550 23.048  1.00 102.36 ? 439 GLU A C  1 
ATOM 1592  O O  . GLU A 1 439 ? 153.899 130.466 22.224  1.00 102.36 ? 439 GLU A O  1 
ATOM 1593  N N  . LYS A 1 440 ? 152.975 129.533 24.035  1.00 91.62  ? 440 LYS A N  1 
ATOM 1594  C CA . LYS A 1 440 ? 152.062 130.640 24.243  1.00 91.62  ? 440 LYS A CA 1 
ATOM 1595  C C  . LYS A 1 440 ? 152.630 131.681 25.186  1.00 91.62  ? 440 LYS A C  1 
ATOM 1596  O O  . LYS A 1 440 ? 152.075 132.778 25.287  1.00 91.62  ? 440 LYS A O  1 
ATOM 1597  N N  . ALA A 1 441 ? 153.723 131.361 25.868  1.00 88.19  ? 441 ALA A N  1 
ATOM 1598  C CA . ALA A 1 441 ? 154.273 132.245 26.879  1.00 88.19  ? 441 ALA A CA 1 
ATOM 1599  C C  . ALA A 1 441 ? 154.992 133.424 26.244  1.00 88.19  ? 441 ALA A C  1 
ATOM 1600  O O  . ALA A 1 441 ? 155.476 133.354 25.113  1.00 88.19  ? 441 ALA A O  1 
ATOM 1601  N N  . ASP A 1 442 ? 155.063 134.518 26.991  1.00 84.86  ? 442 ASP A N  1 
ATOM 1602  C CA . ASP A 1 442 ? 155.722 135.721 26.522  1.00 84.86  ? 442 ASP A CA 1 
ATOM 1603  C C  . ASP A 1 442 ? 156.659 136.345 27.544  1.00 84.86  ? 442 ASP A C  1 
ATOM 1604  O O  . ASP A 1 442 ? 157.292 137.358 27.235  1.00 84.86  ? 442 ASP A O  1 
ATOM 1605  N N  . MET A 1 443 ? 156.774 135.775 28.742  1.00 75.99  ? 443 MET A N  1 
ATOM 1606  C CA . MET A 1 443 ? 157.711 136.291 29.729  1.00 75.99  ? 443 MET A CA 1 
ATOM 1607  C C  . MET A 1 443 ? 158.076 135.158 30.672  1.00 75.99  ? 443 MET A C  1 
ATOM 1608  O O  . MET A 1 443 ? 157.192 134.489 31.207  1.00 75.99  ? 443 MET A O  1 
ATOM 1609  N N  . VAL A 1 444 ? 159.370 134.948 30.870  1.00 71.98  ? 444 VAL A N  1 
ATOM 1610  C CA . VAL A 1 444 ? 159.894 133.796 31.591  1.00 71.98  ? 444 VAL A CA 1 
ATOM 1611  C C  . VAL A 1 444 ? 160.677 134.306 32.791  1.00 71.98  ? 444 VAL A C  1 
ATOM 1612  O O  . VAL A 1 444 ? 161.473 135.241 32.658  1.00 71.98  ? 444 VAL A O  1 
ATOM 1613  N N  . ILE A 1 445 ? 160.464 133.694 33.953  1.00 71.08  ? 445 ILE A N  1 
ATOM 1614  C CA . ILE A 1 445 ? 161.250 133.998 35.143  1.00 71.08  ? 445 ILE A CA 1 
ATOM 1615  C C  . ILE A 1 445 ? 161.821 132.705 35.704  1.00 71.08  ? 445 ILE A C  1 
ATOM 1616  O O  . ILE A 1 445 ? 161.070 131.811 36.112  1.00 71.08  ? 445 ILE A O  1 
ATOM 1617  N N  . GLU A 1 446 ? 163.142 132.610 35.723  1.00 82.42  ? 446 GLU A N  1 
ATOM 1618  C CA . GLU A 1 446 ? 163.845 131.516 36.365  1.00 82.42  ? 446 GLU A CA 1 
ATOM 1619  C C  . GLU A 1 446 ? 163.694 131.615 37.876  1.00 82.42  ? 446 GLU A C  1 
ATOM 1620  O O  . GLU A 1 446 ? 163.593 132.705 38.435  1.00 82.42  ? 446 GLU A O  1 
ATOM 1621  N N  . ALA A 1 447 ? 163.650 130.456 38.540  1.00 88.08  ? 447 ALA A N  1 
ATOM 1622  C CA . ALA A 1 447 ? 163.581 130.429 39.996  1.00 88.08  ? 447 ALA A CA 1 
ATOM 1623  C C  . ALA A 1 447 ? 164.423 129.319 40.613  1.00 88.08  ? 447 ALA A C  1 
ATOM 1624  O O  . ALA A 1 447 ? 164.218 128.987 41.786  1.00 88.08  ? 447 ALA A O  1 
ATOM 1625  N N  . VAL A 1 448 ? 165.348 128.725 39.860  1.00 96.70  ? 448 VAL A N  1 
ATOM 1626  C CA . VAL A 1 448 ? 166.098 127.581 40.357  1.00 96.70  ? 448 VAL A CA 1 
ATOM 1627  C C  . VAL A 1 448 ? 167.129 128.074 41.365  1.00 96.70  ? 448 VAL A C  1 
ATOM 1628  O O  . VAL A 1 448 ? 167.552 129.237 41.325  1.00 96.70  ? 448 VAL A O  1 
ATOM 1629  N N  . PHE A 1 449 ? 167.479 127.203 42.321  1.00 120.23 ? 449 PHE A N  1 
ATOM 1630  C CA . PHE A 1 449 ? 168.521 127.497 43.296  1.00 120.23 ? 449 PHE A CA 1 
ATOM 1631  C C  . PHE A 1 449 ? 169.837 127.824 42.609  1.00 120.23 ? 449 PHE A C  1 
ATOM 1632  O O  . PHE A 1 449 ? 170.229 127.176 41.636  1.00 120.23 ? 449 PHE A O  1 
ATOM 1633  N N  . GLU A 1 450 ? 170.517 128.831 43.151  1.00 121.43 ? 450 GLU A N  1 
ATOM 1634  C CA . GLU A 1 450 ? 171.540 129.558 42.414  1.00 121.43 ? 450 GLU A CA 1 
ATOM 1635  C C  . GLU A 1 450 ? 172.779 128.706 42.168  1.00 121.43 ? 450 GLU A C  1 
ATOM 1636  O O  . GLU A 1 450 ? 173.304 128.060 43.079  1.00 121.43 ? 450 GLU A O  1 
ATOM 1637  N N  . ASP A 1 451 ? 173.218 128.703 40.913  1.00 121.29 ? 451 ASP A N  1 
ATOM 1638  C CA . ASP A 1 451 ? 174.460 128.099 40.471  1.00 121.29 ? 451 ASP A CA 1 
ATOM 1639  C C  . ASP A 1 451 ? 174.812 128.740 39.139  1.00 121.29 ? 451 ASP A C  1 
ATOM 1640  O O  . ASP A 1 451 ? 173.937 129.155 38.379  1.00 121.29 ? 451 ASP A O  1 
ATOM 1641  N N  . LEU A 1 452 ? 176.105 128.805 38.853  1.00 109.61 ? 452 LEU A N  1 
ATOM 1642  C CA . LEU A 1 452 ? 176.574 129.363 37.593  1.00 109.61 ? 452 LEU A CA 1 
ATOM 1643  C C  . LEU A 1 452 ? 176.604 128.318 36.496  1.00 109.61 ? 452 LEU A C  1 
ATOM 1644  O O  . LEU A 1 452 ? 176.506 128.657 35.312  1.00 109.61 ? 452 LEU A O  1 
ATOM 1645  N N  . SER A 1 453 ? 176.695 127.056 36.864  1.00 112.73 ? 453 SER A N  1 
ATOM 1646  C CA . SER A 1 453 ? 176.912 125.977 35.924  1.00 112.73 ? 453 SER A CA 1 
ATOM 1647  C C  . SER A 1 453 ? 175.635 125.358 35.400  1.00 112.73 ? 453 SER A C  1 
ATOM 1648  O O  . SER A 1 453 ? 175.512 125.178 34.189  1.00 112.73 ? 453 SER A O  1 
ATOM 1649  N N  . LEU A 1 454 ? 174.685 125.026 36.270  1.00 112.73 ? 454 LEU A N  1 
ATOM 1650  C CA . LEU A 1 454 ? 173.491 124.326 35.816  1.00 112.73 ? 454 LEU A CA 1 
ATOM 1651  C C  . LEU A 1 454 ? 172.546 125.257 35.070  1.00 112.73 ? 454 LEU A C  1 
ATOM 1652  O O  . LEU A 1 454 ? 171.968 124.869 34.050  1.00 112.73 ? 454 LEU A O  1 
ATOM 1653  N N  . LYS A 1 455 ? 172.413 126.496 35.539  1.00 110.68 ? 455 LYS A N  1 
ATOM 1654  C CA . LYS A 1 455 ? 171.526 127.461 34.891  1.00 110.68 ? 455 LYS A CA 1 
ATOM 1655  C C  . LYS A 1 455 ? 172.062 127.880 33.537  1.00 110.68 ? 455 LYS A C  1 
ATOM 1656  O O  . LYS A 1 455 ? 171.283 128.216 32.638  1.00 110.68 ? 455 LYS A O  1 
ATOM 1657  N N  . HIS A 1 456 ? 173.390 127.849 33.388  1.00 121.43 ? 456 HIS A N  1 
ATOM 1658  C CA . HIS A 1 456 ? 174.052 128.053 32.106  1.00 121.43 ? 456 HIS A CA 1 
ATOM 1659  C C  . HIS A 1 456 ? 173.543 127.087 31.046  1.00 121.43 ? 456 HIS A C  1 
ATOM 1660  O O  . HIS A 1 456 ? 173.399 127.469 29.884  1.00 121.43 ? 456 HIS A O  1 
ATOM 1661  N N  . ARG A 1 457 ? 173.239 125.849 31.432  1.00 117.48 ? 457 ARG A N  1 
ATOM 1662  C CA . ARG A 1 457 ? 172.587 124.894 30.546  1.00 117.48 ? 457 ARG A CA 1 
ATOM 1663  C C  . ARG A 1 457 ? 171.079 125.079 30.488  1.00 117.48 ? 457 ARG A C  1 
ATOM 1664  O O  . ARG A 1 457 ? 170.487 124.929 29.410  1.00 117.48 ? 457 ARG A O  1 
ATOM 1665  N N  . VAL A 1 458 ? 170.468 125.407 31.631  1.00 111.85 ? 458 VAL A N  1 
ATOM 1666  C CA . VAL A 1 458 ? 169.011 125.494 31.750  1.00 111.85 ? 458 VAL A CA 1 
ATOM 1667  C C  . VAL A 1 458 ? 168.448 126.583 30.845  1.00 111.85 ? 458 VAL A C  1 
ATOM 1668  O O  . VAL A 1 458 ? 167.391 126.421 30.220  1.00 111.85 ? 458 VAL A O  1 
ATOM 1669  N N  . LEU A 1 459 ? 169.193 127.670 30.696  1.00 114.62 ? 459 LEU A N  1 
ATOM 1670  C CA . LEU A 1 459 ? 168.831 128.673 29.711  1.00 114.62 ? 459 LEU A CA 1 
ATOM 1671  C C  . LEU A 1 459 ? 169.017 128.162 28.288  1.00 114.62 ? 459 LEU A C  1 
ATOM 1672  O O  . LEU A 1 459 ? 168.373 128.676 27.366  1.00 114.62 ? 459 LEU A O  1 
ATOM 1673  N N  . LYS A 1 460 ? 169.865 127.153 28.090  1.00 117.72 ? 460 LYS A N  1 
ATOM 1674  C CA . LYS A 1 460 ? 170.104 126.659 26.741  1.00 117.72 ? 460 LYS A CA 1 
ATOM 1675  C C  . LYS A 1 460 ? 169.125 125.567 26.330  1.00 117.72 ? 460 LYS A C  1 
ATOM 1676  O O  . LYS A 1 460 ? 169.003 125.290 25.134  1.00 117.72 ? 460 LYS A O  1 
ATOM 1677  N N  . GLU A 1 461 ? 168.434 124.916 27.272  1.00 113.66 ? 461 GLU A N  1 
ATOM 1678  C CA . GLU A 1 461 ? 167.407 123.990 26.792  1.00 113.66 ? 461 GLU A CA 1 
ATOM 1679  C C  . GLU A 1 461 ? 166.003 124.574 26.840  1.00 113.66 ? 461 GLU A C  1 
ATOM 1680  O O  . GLU A 1 461 ? 165.089 124.002 26.240  1.00 113.66 ? 461 GLU A O  1 
ATOM 1681  N N  . VAL A 1 462 ? 165.809 125.703 27.512  1.00 106.91 ? 462 VAL A N  1 
ATOM 1682  C CA . VAL A 1 462 ? 164.491 126.316 27.629  1.00 106.91 ? 462 VAL A CA 1 
ATOM 1683  C C  . VAL A 1 462 ? 164.604 127.613 26.835  1.00 106.91 ? 462 VAL A C  1 
ATOM 1684  O O  . VAL A 1 462 ? 164.197 128.693 27.276  1.00 106.91 ? 462 VAL A O  1 
ATOM 1685  N N  . GLU A 1 463 ? 165.297 127.534 25.709  1.00 113.58 ? 463 GLU A N  1 
ATOM 1686  C CA . GLU A 1 463 ? 165.273 128.630 24.760  1.00 113.58 ? 463 GLU A CA 1 
ATOM 1687  C C  . GLU A 1 463 ? 164.507 128.300 23.492  1.00 113.58 ? 463 GLU A C  1 
ATOM 1688  O O  . GLU A 1 463 ? 164.050 129.219 22.806  1.00 113.58 ? 463 GLU A O  1 
ATOM 1689  N N  . ALA A 1 464 ? 164.359 127.020 23.160  1.00 108.39 ? 464 ALA A N  1 
ATOM 1690  C CA . ALA A 1 464 ? 163.901 126.667 21.825  1.00 108.39 ? 464 ALA A CA 1 
ATOM 1691  C C  . ALA A 1 464 ? 162.383 126.618 21.711  1.00 108.39 ? 464 ALA A C  1 
ATOM 1692  O O  . ALA A 1 464 ? 161.848 126.810 20.615  1.00 108.39 ? 464 ALA A O  1 
ATOM 1693  N N  . VAL A 1 465 ? 161.671 126.380 22.808  1.00 105.48 ? 465 VAL A N  1 
ATOM 1694  C CA . VAL A 1 465 ? 160.233 126.150 22.725  1.00 105.48 ? 465 VAL A CA 1 
ATOM 1695  C C  . VAL A 1 465 ? 159.525 127.438 23.151  1.00 105.48 ? 465 VAL A C  1 
ATOM 1696  O O  . VAL A 1 465 ? 158.355 127.443 23.557  1.00 105.48 ? 465 VAL A O  1 
ATOM 1697  N N  . ILE A 1 466 ? 160.221 128.558 23.003  1.00 103.83 ? 466 ILE A N  1 
ATOM 1698  C CA . ILE A 1 466 ? 159.718 129.858 23.435  1.00 103.83 ? 466 ILE A CA 1 
ATOM 1699  C C  . ILE A 1 466 ? 159.786 130.815 22.249  1.00 103.83 ? 466 ILE A C  1 
ATOM 1700  O O  . ILE A 1 466 ? 160.782 130.801 21.514  1.00 103.83 ? 466 ILE A O  1 
ATOM 1701  N N  . PRO A 1 467 ? 158.743 131.637 22.002  1.00 103.25 ? 467 PRO A N  1 
ATOM 1702  C CA . PRO A 1 467 ? 158.789 132.599 20.888  1.00 103.25 ? 467 PRO A CA 1 
ATOM 1703  C C  . PRO A 1 467 ? 159.859 133.673 21.029  1.00 103.25 ? 467 PRO A C  1 
ATOM 1704  O O  . PRO A 1 467 ? 160.523 133.777 22.064  1.00 103.25 ? 467 PRO A O  1 
ATOM 1705  N N  . ASP A 1 468 ? 160.025 134.492 19.994  1.00 108.47 ? 468 ASP A N  1 
ATOM 1706  C CA . ASP A 1 468 ? 161.110 135.460 19.990  1.00 108.47 ? 468 ASP A CA 1 
ATOM 1707  C C  . ASP A 1 468 ? 160.753 136.784 20.645  1.00 108.47 ? 468 ASP A C  1 
ATOM 1708  O O  . ASP A 1 468 ? 161.660 137.513 21.055  1.00 108.47 ? 468 ASP A O  1 
ATOM 1709  N N  . HIS A 1 469 ? 159.474 137.121 20.758  1.00 100.93 ? 469 HIS A N  1 
ATOM 1710  C CA . HIS A 1 469 ? 159.095 138.356 21.443  1.00 100.93 ? 469 HIS A CA 1 
ATOM 1711  C C  . HIS A 1 469 ? 158.841 138.105 22.927  1.00 100.93 ? 469 HIS A C  1 
ATOM 1712  O O  . HIS A 1 469 ? 157.851 138.535 23.512  1.00 100.93 ? 469 HIS A O  1 
ATOM 1713  N N  . CYS A 1 470 ? 159.783 137.443 23.567  1.00 93.57  ? 470 CYS A N  1 
ATOM 1714  C CA . CYS A 1 470 ? 159.630 137.029 24.943  1.00 93.57  ? 470 CYS A CA 1 
ATOM 1715  C C  . CYS A 1 470 ? 160.530 137.868 25.830  1.00 93.57  ? 470 CYS A C  1 
ATOM 1716  O O  . CYS A 1 470 ? 161.164 138.826 25.380  1.00 93.57  ? 470 CYS A O  1 
ATOM 1717  N N  . ILE A 1 471 ? 160.573 137.511 27.105  1.00 77.42  ? 471 ILE A N  1 
ATOM 1718  C CA . ILE A 1 471 ? 161.541 138.049 28.049  1.00 77.42  ? 471 ILE A CA 1 
ATOM 1719  C C  . ILE A 1 471 ? 162.039 136.902 28.897  1.00 77.42  ? 471 ILE A C  1 
ATOM 1720  O O  . ILE A 1 471 ? 161.245 136.205 29.536  1.00 77.42  ? 471 ILE A O  1 
ATOM 1721  N N  . PHE A 1 472 ? 163.340 136.700 28.911  1.00 75.55  ? 472 PHE A N  1 
ATOM 1722  C CA . PHE A 1 472 ? 163.953 135.840 29.898  1.00 75.55  ? 472 PHE A CA 1 
ATOM 1723  C C  . PHE A 1 472 ? 164.373 136.704 31.077  1.00 75.55  ? 472 PHE A C  1 
ATOM 1724  O O  . PHE A 1 472 ? 164.840 137.828 30.890  1.00 75.55  ? 472 PHE A O  1 
ATOM 1725  N N  . ALA A 1 473 ? 164.174 136.202 32.288  1.00 75.86  ? 473 ALA A N  1 
ATOM 1726  C CA . ALA A 1 473 ? 164.648 136.917 33.460  1.00 75.86  ? 473 ALA A CA 1 
ATOM 1727  C C  . ALA A 1 473 ? 164.975 135.902 34.536  1.00 75.86  ? 473 ALA A C  1 
ATOM 1728  O O  . ALA A 1 473 ? 164.558 134.747 34.463  1.00 75.86  ? 473 ALA A O  1 
ATOM 1729  N N  . SER A 1 474 ? 165.726 136.334 35.546  1.00 79.40  ? 474 SER A N  1 
ATOM 1730  C CA . SER A 1 474 ? 166.153 135.409 36.583  1.00 79.40  ? 474 SER A CA 1 
ATOM 1731  C C  . SER A 1 474 ? 166.264 136.136 37.910  1.00 79.40  ? 474 SER A C  1 
ATOM 1732  O O  . SER A 1 474 ? 166.646 137.307 37.953  1.00 79.40  ? 474 SER A O  1 
ATOM 1733  N N  . ASN A 1 475 ? 165.925 135.441 38.987  1.00 79.73  ? 475 ASN A N  1 
ATOM 1734  C CA . ASN A 1 475 ? 166.118 135.977 40.330  1.00 79.73  ? 475 ASN A CA 1 
ATOM 1735  C C  . ASN A 1 475 ? 167.398 135.429 40.959  1.00 79.73  ? 475 ASN A C  1 
ATOM 1736  O O  . ASN A 1 475 ? 167.391 134.757 41.988  1.00 79.73  ? 475 ASN A O  1 
ATOM 1737  N N  . THR A 1 476 ? 168.518 135.738 40.320  1.00 82.18  ? 476 THR A N  1 
ATOM 1738  C CA . THR A 1 476 ? 169.801 135.507 40.964  1.00 82.18  ? 476 THR A CA 1 
ATOM 1739  C C  . THR A 1 476 ? 169.962 136.436 42.153  1.00 82.18  ? 476 THR A C  1 
ATOM 1740  O O  . THR A 1 476 ? 169.326 137.489 42.243  1.00 82.18  ? 476 THR A O  1 
ATOM 1741  N N  . SER A 1 477 ? 170.794 136.022 43.088  1.00 88.98  ? 477 SER A N  1 
ATOM 1742  C CA . SER A 1 477 ? 171.141 136.883 44.196  1.00 88.98  ? 477 SER A CA 1 
ATOM 1743  C C  . SER A 1 477 ? 172.613 137.239 44.209  1.00 88.98  ? 477 SER A C  1 
ATOM 1744  O O  . SER A 1 477 ? 172.973 138.303 44.718  1.00 88.98  ? 477 SER A O  1 
ATOM 1745  N N  . ALA A 1 478 ? 173.465 136.389 43.645  1.00 107.33 ? 478 ALA A N  1 
ATOM 1746  C CA . ALA A 1 478 ? 174.902 136.598 43.724  1.00 107.33 ? 478 ALA A CA 1 
ATOM 1747  C C  . ALA A 1 478 ? 175.538 136.816 42.360  1.00 107.33 ? 478 ALA A C  1 
ATOM 1748  O O  . ALA A 1 478 ? 176.159 137.861 42.137  1.00 107.33 ? 478 ALA A O  1 
ATOM 1749  N N  . LEU A 1 479 ? 175.387 135.904 41.464  1.00 105.47 ? 479 LEU A N  1 
ATOM 1750  C CA . LEU A 1 479 ? 176.253 136.039 40.309  1.00 105.47 ? 479 LEU A CA 1 
ATOM 1751  C C  . LEU A 1 479 ? 175.580 136.888 39.239  1.00 105.47 ? 479 LEU A C  1 
ATOM 1752  O O  . LEU A 1 479 ? 174.371 136.777 39.023  1.00 105.47 ? 479 LEU A O  1 
ATOM 1753  N N  . PRO A 1 480 ? 176.345 137.759 38.576  1.00 105.88 ? 480 PRO A N  1 
ATOM 1754  C CA . PRO A 1 480 ? 175.729 138.749 37.685  1.00 105.88 ? 480 PRO A CA 1 
ATOM 1755  C C  . PRO A 1 480 ? 175.199 138.174 36.385  1.00 105.88 ? 480 PRO A C  1 
ATOM 1756  O O  . PRO A 1 480 ? 175.512 137.043 36.003  1.00 105.88 ? 480 PRO A O  1 
ATOM 1757  N N  . ILE A 1 481 ? 174.404 138.979 35.687  1.00 100.04 ? 481 ILE A N  1 
ATOM 1758  C CA . ILE A 1 481 ? 173.715 138.531 34.489  1.00 100.04 ? 481 ILE A CA 1 
ATOM 1759  C C  . ILE A 1 481 ? 174.562 138.710 33.238  1.00 100.04 ? 481 ILE A C  1 
ATOM 1760  O O  . ILE A 1 481 ? 174.466 137.884 32.319  1.00 100.04 ? 481 ILE A O  1 
ATOM 1761  N N  . SER A 1 482 ? 175.446 139.710 33.208  1.00 101.27 ? 482 SER A N  1 
ATOM 1762  C CA . SER A 1 482 ? 176.311 139.908 32.050  1.00 101.27 ? 482 SER A CA 1 
ATOM 1763  C C  . SER A 1 482 ? 177.310 138.771 31.877  1.00 101.27 ? 482 SER A C  1 
ATOM 1764  O O  . SER A 1 482 ? 177.847 138.580 30.783  1.00 101.27 ? 482 SER A O  1 
ATOM 1765  N N  . GLU A 1 483 ? 177.557 138.001 32.929  1.00 104.34 ? 483 GLU A N  1 
ATOM 1766  C CA . GLU A 1 483 ? 178.270 136.744 32.802  1.00 104.34 ? 483 GLU A CA 1 
ATOM 1767  C C  . GLU A 1 483 ? 177.429 135.663 32.142  1.00 104.34 ? 483 GLU A C  1 
ATOM 1768  O O  . GLU A 1 483 ? 177.991 134.722 31.575  1.00 104.34 ? 483 GLU A O  1 
ATOM 1769  N N  . ILE A 1 484 ? 176.104 135.774 32.191  1.00 104.23 ? 484 ILE A N  1 
ATOM 1770  C CA . ILE A 1 484 ? 175.240 134.789 31.554  1.00 104.23 ? 484 ILE A CA 1 
ATOM 1771  C C  . ILE A 1 484 ? 174.369 135.381 30.460  1.00 104.23 ? 484 ILE A C  1 
ATOM 1772  O O  . ILE A 1 484 ? 173.494 134.673 29.938  1.00 104.23 ? 484 ILE A O  1 
ATOM 1773  N N  . ALA A 1 485 ? 174.547 136.652 30.103  1.00 112.47 ? 485 ALA A N  1 
ATOM 1774  C CA . ALA A 1 485 ? 173.792 137.271 29.023  1.00 112.47 ? 485 ALA A CA 1 
ATOM 1775  C C  . ALA A 1 485 ? 174.468 137.099 27.670  1.00 112.47 ? 485 ALA A C  1 
ATOM 1776  O O  . ALA A 1 485 ? 173.943 137.565 26.655  1.00 112.47 ? 485 ALA A O  1 
ATOM 1777  N N  . ALA A 1 486 ? 175.619 136.434 27.628  1.00 111.36 ? 486 ALA A N  1 
ATOM 1778  C CA . ALA A 1 486 ? 176.345 136.240 26.383  1.00 111.36 ? 486 ALA A CA 1 
ATOM 1779  C C  . ALA A 1 486 ? 176.236 134.822 25.848  1.00 111.36 ? 486 ALA A C  1 
ATOM 1780  O O  . ALA A 1 486 ? 177.085 134.406 25.055  1.00 111.36 ? 486 ALA A O  1 
ATOM 1781  N N  . VAL A 1 487 ? 175.216 134.072 26.256  1.00 114.68 ? 487 VAL A N  1 
ATOM 1782  C CA . VAL A 1 487 ? 175.103 132.664 25.926  1.00 114.68 ? 487 VAL A CA 1 
ATOM 1783  C C  . VAL A 1 487 ? 173.935 132.397 24.986  1.00 114.68 ? 487 VAL A C  1 
ATOM 1784  O O  . VAL A 1 487 ? 174.069 131.640 24.023  1.00 114.68 ? 487 VAL A O  1 
ATOM 1785  N N  . SER A 1 488 ? 172.794 133.032 25.235  1.00 120.28 ? 488 SER A N  1 
ATOM 1786  C CA . SER A 1 488 ? 171.551 132.690 24.562  1.00 120.28 ? 488 SER A CA 1 
ATOM 1787  C C  . SER A 1 488 ? 171.541 133.160 23.109  1.00 120.28 ? 488 SER A C  1 
ATOM 1788  O O  . SER A 1 488 ? 172.459 133.829 22.627  1.00 120.28 ? 488 SER A O  1 
ATOM 1789  N N  . LYS A 1 489 ? 170.471 132.780 22.406  1.00 116.54 ? 489 LYS A N  1 
ATOM 1790  C CA . LYS A 1 489 ? 170.289 133.212 21.027  1.00 116.54 ? 489 LYS A CA 1 
ATOM 1791  C C  . LYS A 1 489 ? 169.980 134.696 20.946  1.00 116.54 ? 489 LYS A C  1 
ATOM 1792  O O  . LYS A 1 489 ? 170.572 135.408 20.130  1.00 116.54 ? 489 LYS A O  1 
ATOM 1793  N N  . ARG A 1 490 ? 169.071 135.180 21.781  1.00 110.40 ? 490 ARG A N  1 
ATOM 1794  C CA . ARG A 1 490 ? 168.765 136.595 21.806  1.00 110.40 ? 490 ARG A CA 1 
ATOM 1795  C C  . ARG A 1 490 ? 169.576 137.281 22.895  1.00 110.40 ? 490 ARG A C  1 
ATOM 1796  O O  . ARG A 1 490 ? 169.700 136.757 24.010  1.00 110.40 ? 490 ARG A O  1 
ATOM 1797  N N  . PRO A 1 491 ? 170.232 138.372 22.576  1.00 93.15  ? 491 PRO A N  1 
ATOM 1798  C CA . PRO A 1 491 ? 171.052 139.048 23.583  1.00 93.15  ? 491 PRO A CA 1 
ATOM 1799  C C  . PRO A 1 491 ? 170.305 140.115 24.361  1.00 93.15  ? 491 PRO A C  1 
ATOM 1800  O O  . PRO A 1 491 ? 170.664 140.430 25.498  1.00 93.15  ? 491 PRO A O  1 
ATOM 1801  N N  . GLU A 1 492 ? 169.259 140.674 23.767  1.00 102.35 ? 492 GLU A N  1 
ATOM 1802  C CA . GLU A 1 492 ? 168.684 141.905 24.272  1.00 102.35 ? 492 GLU A CA 1 
ATOM 1803  C C  . GLU A 1 492 ? 167.398 141.692 25.044  1.00 102.35 ? 492 GLU A C  1 
ATOM 1804  O O  . GLU A 1 492 ? 166.950 142.614 25.731  1.00 102.35 ? 492 GLU A O  1 
ATOM 1805  N N  . LYS A 1 493 ? 166.796 140.511 24.952  1.00 90.03  ? 493 LYS A N  1 
ATOM 1806  C CA . LYS A 1 493 ? 165.513 140.248 25.582  1.00 90.03  ? 493 LYS A CA 1 
ATOM 1807  C C  . LYS A 1 493 ? 165.678 139.572 26.930  1.00 90.03  ? 493 LYS A C  1 
ATOM 1808  O O  . LYS A 1 493 ? 164.820 138.785 27.338  1.00 90.03  ? 493 LYS A O  1 
ATOM 1809  N N  . VAL A 1 494 ? 166.780 139.840 27.621  1.00 84.11  ? 494 VAL A N  1 
ATOM 1810  C CA . VAL A 1 494 ? 167.047 139.257 28.927  1.00 84.11  ? 494 VAL A CA 1 
ATOM 1811  C C  . VAL A 1 494 ? 167.304 140.388 29.903  1.00 84.11  ? 494 VAL A C  1 
ATOM 1812  O O  . VAL A 1 494 ? 168.245 141.169 29.727  1.00 84.11  ? 494 VAL A O  1 
ATOM 1813  N N  . ILE A 1 495 ? 166.477 140.473 30.933  1.00 82.19  ? 495 ILE A N  1 
ATOM 1814  C CA . ILE A 1 495 ? 166.718 141.351 32.049  1.00 82.19  ? 495 ILE A CA 1 
ATOM 1815  C C  . ILE A 1 495 ? 166.856 140.493 33.295  1.00 82.19  ? 495 ILE A C  1 
ATOM 1816  O O  . ILE A 1 495 ? 166.917 139.271 33.231  1.00 82.19  ? 495 ILE A O  1 
ATOM 1817  N N  . GLY A 1 496 ? 166.919 141.139 34.448  1.00 78.42  ? 496 GLY A N  1 
ATOM 1818  C CA . GLY A 1 496 ? 166.845 140.456 35.725  1.00 78.42  ? 496 GLY A CA 1 
ATOM 1819  C C  . GLY A 1 496 ? 165.766 141.074 36.596  1.00 78.42  ? 496 GLY A C  1 
ATOM 1820  O O  . GLY A 1 496 ? 165.549 142.285 36.558  1.00 78.42  ? 496 GLY A O  1 
ATOM 1821  N N  . MET A 1 497 ? 165.101 140.230 37.374  1.00 74.29  ? 497 MET A N  1 
ATOM 1822  C CA . MET A 1 497 ? 164.187 140.671 38.418  1.00 74.29  ? 497 MET A CA 1 
ATOM 1823  C C  . MET A 1 497 ? 164.551 139.921 39.680  1.00 74.29  ? 497 MET A C  1 
ATOM 1824  O O  . MET A 1 497 ? 164.362 138.707 39.751  1.00 74.29  ? 497 MET A O  1 
ATOM 1825  N N  . HIS A 1 498 ? 165.067 140.626 40.672  1.00 74.43  ? 498 HIS A N  1 
ATOM 1826  C CA . HIS A 1 498 ? 165.316 140.027 41.968  1.00 74.43  ? 498 HIS A CA 1 
ATOM 1827  C C  . HIS A 1 498 ? 164.190 140.417 42.912  1.00 74.43  ? 498 HIS A C  1 
ATOM 1828  O O  . HIS A 1 498 ? 163.789 141.586 42.969  1.00 74.43  ? 498 HIS A O  1 
ATOM 1829  N N  . TYR A 1 499 ? 163.673 139.433 43.622  1.00 63.84  ? 499 TYR A N  1 
ATOM 1830  C CA . TYR A 1 499 ? 162.633 139.603 44.614  1.00 63.84  ? 499 TYR A CA 1 
ATOM 1831  C C  . TYR A 1 499 ? 163.267 139.623 45.994  1.00 63.84  ? 499 TYR A C  1 
ATOM 1832  O O  . TYR A 1 499 ? 164.484 139.750 46.137  1.00 63.84  ? 499 TYR A O  1 
ATOM 1833  N N  . PHE A 1 500 ? 162.443 139.538 47.028  1.00 66.59  ? 500 PHE A N  1 
ATOM 1834  C CA . PHE A 1 500 ? 162.932 139.360 48.384  1.00 66.59  ? 500 PHE A CA 1 
ATOM 1835  C C  . PHE A 1 500 ? 162.128 138.250 49.046  1.00 66.59  ? 500 PHE A C  1 
ATOM 1836  O O  . PHE A 1 500 ? 161.106 137.821 48.512  1.00 66.59  ? 500 PHE A O  1 
ATOM 1837  N N  . SER A 1 501 ? 162.595 137.776 50.204  1.00 83.34  ? 501 SER A N  1 
ATOM 1838  C CA . SER A 1 501 ? 162.289 136.385 50.531  1.00 83.34  ? 501 SER A CA 1 
ATOM 1839  C C  . SER A 1 501 ? 160.867 136.091 51.040  1.00 83.34  ? 501 SER A C  1 
ATOM 1840  O O  . SER A 1 501 ? 160.192 135.306 50.364  1.00 83.34  ? 501 SER A O  1 
ATOM 1841  N N  . PRO A 1 502 ? 160.313 136.660 52.160  1.00 85.91  ? 502 PRO A N  1 
ATOM 1842  C CA . PRO A 1 502 ? 158.833 136.497 52.170  1.00 85.91  ? 502 PRO A CA 1 
ATOM 1843  C C  . PRO A 1 502 ? 158.146 137.514 51.266  1.00 85.91  ? 502 PRO A C  1 
ATOM 1844  O O  . PRO A 1 502 ? 158.053 138.705 51.531  1.00 85.91  ? 502 PRO A O  1 
ATOM 1845  N N  . VAL A 1 503 ? 157.624 136.987 50.168  1.00 77.60  ? 503 VAL A N  1 
ATOM 1846  C CA . VAL A 1 503 ? 157.162 137.799 49.054  1.00 77.60  ? 503 VAL A CA 1 
ATOM 1847  C C  . VAL A 1 503 ? 155.864 138.531 49.342  1.00 77.60  ? 503 VAL A C  1 
ATOM 1848  O O  . VAL A 1 503 ? 155.542 139.511 48.664  1.00 77.60  ? 503 VAL A O  1 
ATOM 1849  N N  . ASP A 1 504 ? 155.076 138.070 50.306  1.00 91.32  ? 504 ASP A N  1 
ATOM 1850  C CA . ASP A 1 504 ? 153.798 138.718 50.538  1.00 91.32  ? 504 ASP A CA 1 
ATOM 1851  C C  . ASP A 1 504 ? 153.976 139.983 51.356  1.00 91.32  ? 504 ASP A C  1 
ATOM 1852  O O  . ASP A 1 504 ? 153.463 141.046 50.993  1.00 91.32  ? 504 ASP A O  1 
ATOM 1853  N N  . LYS A 1 505 ? 154.720 139.890 52.458  1.00 92.52  ? 505 LYS A N  1 
ATOM 1854  C CA . LYS A 1 505 ? 154.741 140.996 53.407  1.00 92.52  ? 505 LYS A CA 1 
ATOM 1855  C C  . LYS A 1 505 ? 155.553 142.169 52.879  1.00 92.52  ? 505 LYS A C  1 
ATOM 1856  O O  . LYS A 1 505 ? 155.043 143.293 52.832  1.00 92.52  ? 505 LYS A O  1 
ATOM 1857  N N  . MET A 1 506 ? 156.790 141.933 52.440  1.00 87.04  ? 506 MET A N  1 
ATOM 1858  C CA . MET A 1 506 ? 157.578 143.023 51.886  1.00 87.04  ? 506 MET A CA 1 
ATOM 1859  C C  . MET A 1 506 ? 157.062 143.394 50.504  1.00 87.04  ? 506 MET A C  1 
ATOM 1860  O O  . MET A 1 506 ? 156.289 142.660 49.884  1.00 87.04  ? 506 MET A O  1 
ATOM 1861  N N  . GLN A 1 507 ? 157.461 144.572 50.039  1.00 78.50  ? 507 GLN A N  1 
ATOM 1862  C CA . GLN A 1 507 ? 156.649 145.254 49.052  1.00 78.50  ? 507 GLN A CA 1 
ATOM 1863  C C  . GLN A 1 507 ? 157.514 145.877 47.958  1.00 78.50  ? 507 GLN A C  1 
ATOM 1864  O O  . GLN A 1 507 ? 157.163 146.889 47.355  1.00 78.50  ? 507 GLN A O  1 
ATOM 1865  N N  . LEU A 1 508 ? 158.621 145.239 47.599  1.00 72.73  ? 508 LEU A N  1 
ATOM 1866  C CA . LEU A 1 508 ? 159.369 145.802 46.483  1.00 72.73  ? 508 LEU A CA 1 
ATOM 1867  C C  . LEU A 1 508 ? 160.069 144.739 45.662  1.00 72.73  ? 508 LEU A C  1 
ATOM 1868  O O  . LEU A 1 508 ? 160.258 143.601 46.098  1.00 72.73  ? 508 LEU A O  1 
ATOM 1869  N N  . LEU A 1 509 ? 160.434 145.153 44.459  1.00 71.27  ? 509 LEU A N  1 
ATOM 1870  C CA . LEU A 1 509 ? 161.211 144.396 43.502  1.00 71.27  ? 509 LEU A CA 1 
ATOM 1871  C C  . LEU A 1 509 ? 162.543 145.091 43.322  1.00 71.27  ? 509 LEU A C  1 
ATOM 1872  O O  . LEU A 1 509 ? 162.782 146.146 43.913  1.00 71.27  ? 509 LEU A O  1 
ATOM 1873  N N  . GLU A 1 510 ? 163.405 144.505 42.498  1.00 80.80  ? 510 GLU A N  1 
ATOM 1874  C CA . GLU A 1 510 ? 164.530 145.245 41.943  1.00 80.80  ? 510 GLU A CA 1 
ATOM 1875  C C  . GLU A 1 510 ? 164.876 144.716 40.565  1.00 80.80  ? 510 GLU A C  1 
ATOM 1876  O O  . GLU A 1 510 ? 164.793 143.509 40.313  1.00 80.80  ? 510 GLU A O  1 
ATOM 1877  N N  . ILE A 1 511 ? 165.259 145.628 39.680  1.00 75.64  ? 511 ILE A N  1 
ATOM 1878  C CA . ILE A 1 511 ? 165.500 145.331 38.279  1.00 75.64  ? 511 ILE A CA 1 
ATOM 1879  C C  . ILE A 1 511 ? 166.997 145.295 38.028  1.00 75.64  ? 511 ILE A C  1 
ATOM 1880  O O  . ILE A 1 511 ? 167.766 146.087 38.580  1.00 75.64  ? 511 ILE A O  1 
ATOM 1881  N N  . ILE A 1 512 ? 167.408 144.348 37.195  1.00 86.74  ? 512 ILE A N  1 
ATOM 1882  C CA . ILE A 1 512 ? 168.791 144.149 36.817  1.00 86.74  ? 512 ILE A CA 1 
ATOM 1883  C C  . ILE A 1 512 ? 168.882 144.402 35.322  1.00 86.74  ? 512 ILE A C  1 
ATOM 1884  O O  . ILE A 1 512 ? 168.259 143.687 34.529  1.00 86.74  ? 512 ILE A O  1 
ATOM 1885  N N  . THR A 1 513 ? 169.636 145.429 34.936  1.00 97.68  ? 513 THR A N  1 
ATOM 1886  C CA . THR A 1 513 ? 169.649 145.949 33.572  1.00 97.68  ? 513 THR A CA 1 
ATOM 1887  C C  . THR A 1 513 ? 171.058 145.898 33.004  1.00 97.68  ? 513 THR A C  1 
ATOM 1888  O O  . THR A 1 513 ? 171.954 146.594 33.490  1.00 97.68  ? 513 THR A O  1 
ATOM 1889  N N  . THR A 1 514 ? 171.233 145.135 31.931  1.00 104.58 ? 514 THR A N  1 
ATOM 1890  C CA . THR A 1 514 ? 172.530 144.936 31.300  1.00 104.58 ? 514 THR A CA 1 
ATOM 1891  C C  . THR A 1 514 ? 172.906 146.144 30.446  1.00 104.58 ? 514 THR A C  1 
ATOM 1892  O O  . THR A 1 514 ? 172.287 147.210 30.496  1.00 104.58 ? 514 THR A O  1 
ATOM 1893  N N  . GLU A 1 515 ? 173.951 145.977 29.640  1.00 102.35 ? 515 GLU A N  1 
ATOM 1894  C CA . GLU A 1 515 ? 174.203 146.919 28.562  1.00 102.35 ? 515 GLU A CA 1 
ATOM 1895  C C  . GLU A 1 515 ? 173.147 146.789 27.477  1.00 102.35 ? 515 GLU A C  1 
ATOM 1896  O O  . GLU A 1 515 ? 172.716 147.788 26.892  1.00 102.35 ? 515 GLU A O  1 
ATOM 1897  N N  . LYS A 1 516 ? 172.693 145.569 27.221  1.00 103.59 ? 516 LYS A N  1 
ATOM 1898  C CA . LYS A 1 516 ? 171.926 145.256 26.026  1.00 103.59 ? 516 LYS A CA 1 
ATOM 1899  C C  . LYS A 1 516 ? 170.421 145.341 26.218  1.00 103.59 ? 516 LYS A C  1 
ATOM 1900  O O  . LYS A 1 516 ? 169.682 144.962 25.307  1.00 103.59 ? 516 LYS A O  1 
ATOM 1901  N N  . THR A 1 517 ? 169.941 145.803 27.365  1.00 106.77 ? 517 THR A N  1 
ATOM 1902  C CA . THR A 1 517 ? 168.500 145.857 27.590  1.00 106.77 ? 517 THR A CA 1 
ATOM 1903  C C  . THR A 1 517 ? 167.903 146.998 26.783  1.00 106.77 ? 517 THR A C  1 
ATOM 1904  O O  . THR A 1 517 ? 168.283 148.159 26.946  1.00 106.77 ? 517 THR A O  1 
ATOM 1905  N N  . SER A 1 518 ? 166.972 146.667 25.894  1.00 100.30 ? 518 SER A N  1 
ATOM 1906  C CA . SER A 1 518 ? 166.266 147.682 25.134  1.00 100.30 ? 518 SER A CA 1 
ATOM 1907  C C  . SER A 1 518 ? 165.319 148.459 26.034  1.00 100.30 ? 518 SER A C  1 
ATOM 1908  O O  . SER A 1 518 ? 164.965 148.030 27.136  1.00 100.30 ? 518 SER A O  1 
ATOM 1909  N N  . LYS A 1 519 ? 164.910 149.627 25.539  1.00 106.31 ? 519 LYS A N  1 
ATOM 1910  C CA . LYS A 1 519 ? 163.901 150.410 26.235  1.00 106.31 ? 519 LYS A CA 1 
ATOM 1911  C C  . LYS A 1 519 ? 162.570 149.685 26.283  1.00 106.31 ? 519 LYS A C  1 
ATOM 1912  O O  . LYS A 1 519 ? 161.854 149.782 27.287  1.00 106.31 ? 519 LYS A O  1 
ATOM 1913  N N  . ASP A 1 520 ? 162.234 148.947 25.227  1.00 100.57 ? 520 ASP A N  1 
ATOM 1914  C CA . ASP A 1 520 ? 160.984 148.204 25.231  1.00 100.57 ? 520 ASP A CA 1 
ATOM 1915  C C  . ASP A 1 520 ? 161.048 147.043 26.209  1.00 100.57 ? 520 ASP A C  1 
ATOM 1916  O O  . ASP A 1 520 ? 160.057 146.736 26.882  1.00 100.57 ? 520 ASP A O  1 
ATOM 1917  N N  . THR A 1 521 ? 162.216 146.403 26.318  1.00 88.31  ? 521 THR A N  1 
ATOM 1918  C CA . THR A 1 521 ? 162.396 145.323 27.279  1.00 88.31  ? 521 THR A CA 1 
ATOM 1919  C C  . THR A 1 521 ? 162.269 145.835 28.703  1.00 88.31  ? 521 THR A C  1 
ATOM 1920  O O  . THR A 1 521 ? 161.592 145.224 29.534  1.00 88.31  ? 521 THR A O  1 
ATOM 1921  N N  . SER A 1 522 ? 162.886 146.980 28.985  1.00 88.90  ? 522 SER A N  1 
ATOM 1922  C CA . SER A 1 522 ? 162.842 147.539 30.328  1.00 88.90  ? 522 SER A CA 1 
ATOM 1923  C C  . SER A 1 522 ? 161.445 148.016 30.682  1.00 88.90  ? 522 SER A C  1 
ATOM 1924  O O  . SER A 1 522 ? 160.978 147.807 31.810  1.00 88.90  ? 522 SER A O  1 
ATOM 1925  N N  . ALA A 1 523 ? 160.764 148.652 29.729  1.00 88.29  ? 523 ALA A N  1 
ATOM 1926  C CA . ALA A 1 523 ? 159.408 149.120 29.973  1.00 88.29  ? 523 ALA A CA 1 
ATOM 1927  C C  . ALA A 1 523 ? 158.458 147.953 30.173  1.00 88.29  ? 523 ALA A C  1 
ATOM 1928  O O  . ALA A 1 523 ? 157.600 147.987 31.060  1.00 88.29  ? 523 ALA A O  1 
ATOM 1929  N N  . SER A 1 524 ? 158.619 146.897 29.378  1.00 81.00  ? 524 SER A N  1 
ATOM 1930  C CA . SER A 1 524 ? 157.798 145.710 29.540  1.00 81.00  ? 524 SER A CA 1 
ATOM 1931  C C  . SER A 1 524 ? 158.089 145.000 30.848  1.00 81.00  ? 524 SER A C  1 
ATOM 1932  O O  . SER A 1 524 ? 157.198 144.363 31.412  1.00 81.00  ? 524 SER A O  1 
ATOM 1933  N N  . ALA A 1 525 ? 159.311 145.104 31.349  1.00 70.90  ? 525 ALA A N  1 
ATOM 1934  C CA . ALA A 1 525 ? 159.603 144.531 32.651  1.00 70.90  ? 525 ALA A CA 1 
ATOM 1935  C C  . ALA A 1 525 ? 158.920 145.323 33.753  1.00 70.90  ? 525 ALA A C  1 
ATOM 1936  O O  . ALA A 1 525 ? 158.218 144.760 34.603  1.00 70.90  ? 525 ALA A O  1 
ATOM 1937  N N  . VAL A 1 526 ? 159.076 146.647 33.728  1.00 72.01  ? 526 VAL A N  1 
ATOM 1938  C CA . VAL A 1 526 ? 158.536 147.445 34.818  1.00 72.01  ? 526 VAL A CA 1 
ATOM 1939  C C  . VAL A 1 526 ? 157.027 147.550 34.729  1.00 72.01  ? 526 VAL A C  1 
ATOM 1940  O O  . VAL A 1 526 ? 156.382 147.927 35.713  1.00 72.01  ? 526 VAL A O  1 
ATOM 1941  N N  . ALA A 1 527 ? 156.446 147.202 33.580  1.00 70.93  ? 527 ALA A N  1 
ATOM 1942  C CA . ALA A 1 527 ? 155.001 147.047 33.518  1.00 70.93  ? 527 ALA A CA 1 
ATOM 1943  C C  . ALA A 1 527 ? 154.550 145.904 34.404  1.00 70.93  ? 527 ALA A C  1 
ATOM 1944  O O  . ALA A 1 527 ? 153.576 146.043 35.149  1.00 70.93  ? 527 ALA A O  1 
ATOM 1945  N N  . VAL A 1 528 ? 155.282 144.790 34.375  1.00 59.99  ? 528 VAL A N  1 
ATOM 1946  C CA . VAL A 1 528 ? 154.996 143.686 35.277  1.00 59.99  ? 528 VAL A CA 1 
ATOM 1947  C C  . VAL A 1 528 ? 155.294 144.106 36.693  1.00 59.99  ? 528 VAL A C  1 
ATOM 1948  O O  . VAL A 1 528 ? 154.618 143.684 37.636  1.00 59.99  ? 528 VAL A O  1 
ATOM 1949  N N  . GLY A 1 529 ? 156.289 144.972 36.856  1.00 63.86  ? 529 GLY A N  1 
ATOM 1950  C CA . GLY A 1 529 ? 156.650 145.441 38.184  1.00 63.86  ? 529 GLY A CA 1 
ATOM 1951  C C  . GLY A 1 529 ? 155.562 146.263 38.851  1.00 63.86  ? 529 GLY A C  1 
ATOM 1952  O O  . GLY A 1 529 ? 155.264 146.074 40.030  1.00 63.86  ? 529 GLY A O  1 
ATOM 1953  N N  . LEU A 1 530 ? 154.947 147.182 38.113  1.00 66.29  ? 530 LEU A N  1 
ATOM 1954  C CA . LEU A 1 530 ? 153.984 148.031 38.804  1.00 66.29  ? 530 LEU A CA 1 
ATOM 1955  C C  . LEU A 1 530 ? 152.571 147.474 38.694  1.00 66.29  ? 530 LEU A C  1 
ATOM 1956  O O  . LEU A 1 530 ? 151.737 147.741 39.565  1.00 66.29  ? 530 LEU A O  1 
ATOM 1957  N N  . LYS A 1 531 ? 152.270 146.705 37.637  1.00 60.00  ? 531 LYS A N  1 
ATOM 1958  C CA . LYS A 1 531 ? 151.034 145.939 37.614  1.00 60.00  ? 531 LYS A CA 1 
ATOM 1959  C C  . LYS A 1 531 ? 151.048 144.874 38.688  1.00 60.00  ? 531 LYS A C  1 
ATOM 1960  O O  . LYS A 1 531 ? 149.992 144.513 39.204  1.00 60.00  ? 531 LYS A O  1 
ATOM 1961  N N  . GLN A 1 532 ? 152.232 144.388 39.041  1.00 59.64  ? 532 GLN A N  1 
ATOM 1962  C CA . GLN A 1 532 ? 152.392 143.585 40.237  1.00 59.64  ? 532 GLN A CA 1 
ATOM 1963  C C  . GLN A 1 532 ? 151.982 144.367 41.473  1.00 59.64  ? 532 GLN A C  1 
ATOM 1964  O O  . GLN A 1 532 ? 151.348 143.819 42.382  1.00 59.64  ? 532 GLN A O  1 
ATOM 1965  N N  . GLY A 1 533 ? 152.292 145.664 41.500  1.00 62.45  ? 533 GLY A N  1 
ATOM 1966  C CA . GLY A 1 533 ? 151.967 146.522 42.620  1.00 62.45  ? 533 GLY A CA 1 
ATOM 1967  C C  . GLY A 1 533 ? 153.120 146.840 43.541  1.00 62.45  ? 533 GLY A C  1 
ATOM 1968  O O  . GLY A 1 533 ? 152.995 147.738 44.375  1.00 62.45  ? 533 GLY A O  1 
ATOM 1969  N N  . LYS A 1 534 ? 154.226 146.123 43.424  1.00 64.40  ? 534 LYS A N  1 
ATOM 1970  C CA . LYS A 1 534 ? 155.362 146.278 44.311  1.00 64.40  ? 534 LYS A CA 1 
ATOM 1971  C C  . LYS A 1 534 ? 156.348 147.293 43.739  1.00 64.40  ? 534 LYS A C  1 
ATOM 1972  O O  . LYS A 1 534 ? 156.748 147.204 42.577  1.00 64.40  ? 534 LYS A O  1 
ATOM 1973  N N  . VAL A 1 535 ? 156.768 148.245 44.585  1.00 67.81  ? 535 VAL A N  1 
ATOM 1974  C CA . VAL A 1 535 ? 157.383 149.483 44.106  1.00 67.81  ? 535 VAL A CA 1 
ATOM 1975  C C  . VAL A 1 535 ? 158.776 149.184 43.566  1.00 67.81  ? 535 VAL A C  1 
ATOM 1976  O O  . VAL A 1 535 ? 159.576 148.475 44.186  1.00 67.81  ? 535 VAL A O  1 
ATOM 1977  N N  . ILE A 1 536 ? 159.047 149.697 42.382  1.00 72.29  ? 536 ILE A N  1 
ATOM 1978  C CA . ILE A 1 536 ? 160.124 149.216 41.537  1.00 72.29  ? 536 ILE A CA 1 
ATOM 1979  C C  . ILE A 1 536 ? 161.297 150.148 41.757  1.00 72.29  ? 536 ILE A C  1 
ATOM 1980  O O  . ILE A 1 536 ? 161.108 151.281 42.208  1.00 72.29  ? 536 ILE A O  1 
ATOM 1981  N N  . ILE A 1 537 ? 162.501 149.652 41.514  1.00 78.47  ? 537 ILE A N  1 
ATOM 1982  C CA . ILE A 1 537 ? 163.666 150.494 41.295  1.00 78.47  ? 537 ILE A CA 1 
ATOM 1983  C C  . ILE A 1 537 ? 164.513 149.861 40.210  1.00 78.47  ? 537 ILE A C  1 
ATOM 1984  O O  . ILE A 1 537 ? 164.658 148.636 40.150  1.00 78.47  ? 537 ILE A O  1 
ATOM 1985  N N  . VAL A 1 538 ? 165.045 150.684 39.362  1.00 81.52  ? 538 VAL A N  1 
ATOM 1986  C CA . VAL A 1 538 ? 165.880 150.249 38.259  1.00 81.52  ? 538 VAL A CA 1 
ATOM 1987  C C  . VAL A 1 538 ? 167.334 150.446 38.654  1.00 81.52  ? 538 VAL A C  1 
ATOM 1988  O O  . VAL A 1 538 ? 167.690 151.439 39.295  1.00 81.52  ? 538 VAL A O  1 
ATOM 1989  N N  . VAL A 1 539 ? 168.170 149.458 38.355  1.00 87.86  ? 539 VAL A N  1 
ATOM 1990  C CA . VAL A 1 539 ? 169.570 149.476 38.761  1.00 87.86  ? 539 VAL A CA 1 
ATOM 1991  C C  . VAL A 1 539 ? 170.427 149.049 37.582  1.00 87.86  ? 539 VAL A C  1 
ATOM 1992  O O  . VAL A 1 539 ? 170.238 147.955 37.039  1.00 87.86  ? 539 VAL A O  1 
ATOM 1993  N N  . LYS A 1 540 ? 171.355 149.914 37.181  1.00 101.67 ? 540 LYS A N  1 
ATOM 1994  C CA . LYS A 1 540 ? 172.440 149.490 36.309  1.00 101.67 ? 540 LYS A CA 1 
ATOM 1995  C C  . LYS A 1 540 ? 173.437 148.676 37.123  1.00 101.67 ? 540 LYS A C  1 
ATOM 1996  O O  . LYS A 1 540 ? 173.837 149.073 38.219  1.00 101.67 ? 540 LYS A O  1 
ATOM 1997  N N  . ASP A 1 541 ? 173.875 147.558 36.559  1.00 105.35 ? 541 ASP A N  1 
ATOM 1998  C CA . ASP A 1 541 ? 174.399 146.452 37.349  1.00 105.35 ? 541 ASP A CA 1 
ATOM 1999  C C  . ASP A 1 541 ? 175.841 146.704 37.784  1.00 105.35 ? 541 ASP A C  1 
ATOM 2000  O O  . ASP A 1 541 ? 176.395 147.795 37.631  1.00 105.35 ? 541 ASP A O  1 
ATOM 2001  N N  . GLY A 1 542 ? 176.465 145.659 38.320  1.00 96.30  ? 542 GLY A N  1 
ATOM 2002  C CA . GLY A 1 542 ? 177.824 145.702 38.798  1.00 96.30  ? 542 GLY A CA 1 
ATOM 2003  C C  . GLY A 1 542 ? 178.134 144.382 39.468  1.00 96.30  ? 542 GLY A C  1 
ATOM 2004  O O  . GLY A 1 542 ? 177.233 143.567 39.684  1.00 96.30  ? 542 GLY A O  1 
ATOM 2005  N N  . PRO A 1 543 ? 179.402 144.131 39.802  1.00 95.32  ? 543 PRO A N  1 
ATOM 2006  C CA . PRO A 1 543 ? 179.753 142.835 40.409  1.00 95.32  ? 543 PRO A CA 1 
ATOM 2007  C C  . PRO A 1 543 ? 179.214 142.760 41.829  1.00 95.32  ? 543 PRO A C  1 
ATOM 2008  O O  . PRO A 1 543 ? 179.805 143.294 42.767  1.00 95.32  ? 543 PRO A O  1 
ATOM 2009  N N  . GLY A 1 544 ? 178.072 142.096 41.971  1.00 91.38  ? 544 GLY A N  1 
ATOM 2010  C CA . GLY A 1 544 ? 177.268 142.261 43.160  1.00 91.38  ? 544 GLY A CA 1 
ATOM 2011  C C  . GLY A 1 544 ? 176.409 143.480 42.898  1.00 91.38  ? 544 GLY A C  1 
ATOM 2012  O O  . GLY A 1 544 ? 176.960 144.577 42.780  1.00 91.38  ? 544 GLY A O  1 
ATOM 2013  N N  . PHE A 1 545 ? 175.086 143.354 42.777  1.00 86.91  ? 545 PHE A N  1 
ATOM 2014  C CA . PHE A 1 545 ? 174.361 144.481 42.207  1.00 86.91  ? 545 PHE A CA 1 
ATOM 2015  C C  . PHE A 1 545 ? 174.046 145.558 43.247  1.00 86.91  ? 545 PHE A C  1 
ATOM 2016  O O  . PHE A 1 545 ? 174.700 146.606 43.263  1.00 86.91  ? 545 PHE A O  1 
ATOM 2017  N N  . TYR A 1 546 ? 173.091 145.331 44.145  1.00 86.70  ? 546 TYR A N  1 
ATOM 2018  C CA . TYR A 1 546 ? 172.850 146.382 45.126  1.00 86.70  ? 546 TYR A CA 1 
ATOM 2019  C C  . TYR A 1 546 ? 172.606 145.860 46.529  1.00 86.70  ? 546 TYR A C  1 
ATOM 2020  O O  . TYR A 1 546 ? 173.256 146.289 47.486  1.00 86.70  ? 546 TYR A O  1 
ATOM 2021  N N  . THR A 1 547 ? 171.728 144.872 46.648  1.00 82.40  ? 547 THR A N  1 
ATOM 2022  C CA . THR A 1 547 ? 171.148 144.602 47.955  1.00 82.40  ? 547 THR A CA 1 
ATOM 2023  C C  . THR A 1 547 ? 171.963 143.591 48.730  1.00 82.40  ? 547 THR A C  1 
ATOM 2024  O O  . THR A 1 547 ? 172.303 143.829 49.889  1.00 82.40  ? 547 THR A O  1 
ATOM 2025  N N  . THR A 1 548 ? 172.313 142.470 48.109  1.00 88.48  ? 548 THR A N  1 
ATOM 2026  C CA . THR A 1 548 ? 173.323 141.618 48.716  1.00 88.48  ? 548 THR A CA 1 
ATOM 2027  C C  . THR A 1 548 ? 174.681 142.298 48.694  1.00 88.48  ? 548 THR A C  1 
ATOM 2028  O O  . THR A 1 548 ? 175.496 142.082 49.601  1.00 88.48  ? 548 THR A O  1 
ATOM 2029  N N  . ARG A 1 549 ? 174.894 143.161 47.692  1.00 96.80  ? 549 ARG A N  1 
ATOM 2030  C CA . ARG A 1 549 ? 176.095 143.982 47.578  1.00 96.80  ? 549 ARG A CA 1 
ATOM 2031  C C  . ARG A 1 549 ? 176.292 144.873 48.799  1.00 96.80  ? 549 ARG A C  1 
ATOM 2032  O O  . ARG A 1 549 ? 177.428 145.153 49.195  1.00 96.80  ? 549 ARG A O  1 
ATOM 2033  N N  . CYS A 1 550 ? 175.201 145.317 49.417  1.00 92.21  ? 550 CYS A N  1 
ATOM 2034  C CA . CYS A 1 550 ? 175.310 146.044 50.673  1.00 92.21  ? 550 CYS A CA 1 
ATOM 2035  C C  . CYS A 1 550 ? 175.022 145.182 51.894  1.00 92.21  ? 550 CYS A C  1 
ATOM 2036  O O  . CYS A 1 550 ? 175.339 145.595 53.011  1.00 92.21  ? 550 CYS A O  1 
ATOM 2037  N N  . LEU A 1 551 ? 174.437 144.002 51.721  1.00 91.80  ? 551 LEU A N  1 
ATOM 2038  C CA . LEU A 1 551 ? 174.070 143.202 52.879  1.00 91.80  ? 551 LEU A CA 1 
ATOM 2039  C C  . LEU A 1 551 ? 175.238 142.381 53.394  1.00 91.80  ? 551 LEU A C  1 
ATOM 2040  O O  . LEU A 1 551 ? 175.383 142.221 54.610  1.00 91.80  ? 551 LEU A O  1 
ATOM 2041  N N  . ALA A 1 552 ? 176.040 141.819 52.497  1.00 100.93 ? 552 ALA A N  1 
ATOM 2042  C CA . ALA A 1 552 ? 177.206 141.056 52.938  1.00 100.93 ? 552 ALA A CA 1 
ATOM 2043  C C  . ALA A 1 552 ? 178.264 141.897 53.654  1.00 100.93 ? 552 ALA A C  1 
ATOM 2044  O O  . ALA A 1 552 ? 178.836 141.399 54.637  1.00 100.93 ? 552 ALA A O  1 
ATOM 2045  N N  . PRO A 1 553 ? 178.555 143.152 53.272  1.00 99.36  ? 553 PRO A N  1 
ATOM 2046  C CA . PRO A 1 553 ? 179.382 143.970 54.171  1.00 99.36  ? 553 PRO A CA 1 
ATOM 2047  C C  . PRO A 1 553 ? 178.687 144.394 55.447  1.00 99.36  ? 553 PRO A C  1 
ATOM 2048  O O  . PRO A 1 553 ? 179.307 145.083 56.263  1.00 99.36  ? 553 PRO A O  1 
ATOM 2049  N N  . MET A 1 554 ? 177.414 144.060 55.633  1.00 106.14 ? 554 MET A N  1 
ATOM 2050  C CA . MET A 1 554 ? 176.854 144.120 56.971  1.00 106.14 ? 554 MET A CA 1 
ATOM 2051  C C  . MET A 1 554 ? 176.897 142.756 57.633  1.00 106.14 ? 554 MET A C  1 
ATOM 2052  O O  . MET A 1 554 ? 177.130 142.663 58.842  1.00 106.14 ? 554 MET A O  1 
ATOM 2053  N N  . MET A 1 555 ? 176.675 141.696 56.866  1.00 106.47 ? 555 MET A N  1 
ATOM 2054  C CA . MET A 1 555 ? 176.558 140.381 57.473  1.00 106.47 ? 555 MET A CA 1 
ATOM 2055  C C  . MET A 1 555 ? 177.914 139.852 57.915  1.00 106.47 ? 555 MET A C  1 
ATOM 2056  O O  . MET A 1 555 ? 177.992 139.069 58.866  1.00 106.47 ? 555 MET A O  1 
ATOM 2057  N N  . SER A 1 556 ? 178.995 140.326 57.292  1.00 106.94 ? 556 SER A N  1 
ATOM 2058  C CA . SER A 1 556 ? 180.334 139.837 57.609  1.00 106.94 ? 556 SER A CA 1 
ATOM 2059  C C  . SER A 1 556 ? 180.829 140.306 58.968  1.00 106.94 ? 556 SER A C  1 
ATOM 2060  O O  . SER A 1 556 ? 181.865 139.830 59.435  1.00 106.94 ? 556 SER A O  1 
ATOM 2061  N N  . GLU A 1 557 ? 180.120 141.223 59.611  1.00 101.65 ? 557 GLU A N  1 
ATOM 2062  C CA . GLU A 1 557 ? 180.443 141.656 60.959  1.00 101.65 ? 557 GLU A CA 1 
ATOM 2063  C C  . GLU A 1 557 ? 179.376 141.231 61.941  1.00 101.65 ? 557 GLU A C  1 
ATOM 2064  O O  . GLU A 1 557 ? 179.465 141.546 63.127  1.00 101.65 ? 557 GLU A O  1 
ATOM 2065  N N  . VAL A 1 558 ? 178.351 140.536 61.465  1.00 104.35 ? 558 VAL A N  1 
ATOM 2066  C CA . VAL A 1 558 ? 177.440 139.866 62.379  1.00 104.35 ? 558 VAL A CA 1 
ATOM 2067  C C  . VAL A 1 558 ? 178.170 138.736 63.087  1.00 104.35 ? 558 VAL A C  1 
ATOM 2068  O O  . VAL A 1 558 ? 177.845 138.385 64.219  1.00 104.35 ? 558 VAL A O  1 
ATOM 2069  N N  . ILE A 1 559 ? 179.198 138.172 62.458  1.00 113.38 ? 559 ILE A N  1 
ATOM 2070  C CA . ILE A 1 559 ? 180.030 137.261 63.230  1.00 113.38 ? 559 ILE A CA 1 
ATOM 2071  C C  . ILE A 1 559 ? 180.942 138.008 64.195  1.00 113.38 ? 559 ILE A C  1 
ATOM 2072  O O  . ILE A 1 559 ? 181.352 137.434 65.212  1.00 113.38 ? 559 ILE A O  1 
ATOM 2073  N N  . ARG A 1 560 ? 181.203 139.296 63.950  1.00 112.85 ? 560 ARG A N  1 
ATOM 2074  C CA . ARG A 1 560 ? 182.224 140.020 64.700  1.00 112.85 ? 560 ARG A CA 1 
ATOM 2075  C C  . ARG A 1 560 ? 181.807 140.320 66.139  1.00 112.85 ? 560 ARG A C  1 
ATOM 2076  O O  . ARG A 1 560 ? 182.679 140.459 66.997  1.00 112.85 ? 560 ARG A O  1 
ATOM 2077  N N  . ILE A 1 561 ? 180.507 140.393 66.445  1.00 121.87 ? 561 ILE A N  1 
ATOM 2078  C CA . ILE A 1 561 ? 180.135 140.589 67.848  1.00 121.87 ? 561 ILE A CA 1 
ATOM 2079  C C  . ILE A 1 561 ? 180.362 139.312 68.633  1.00 121.87 ? 561 ILE A C  1 
ATOM 2080  O O  . ILE A 1 561 ? 180.949 139.346 69.720  1.00 121.87 ? 561 ILE A O  1 
ATOM 2081  N N  . LEU A 1 562 ? 179.928 138.170 68.112  1.00 121.93 ? 562 LEU A N  1 
ATOM 2082  C CA . LEU A 1 562 ? 180.233 136.912 68.771  1.00 121.93 ? 562 LEU A CA 1 
ATOM 2083  C C  . LEU A 1 562 ? 181.618 136.400 68.419  1.00 121.93 ? 562 LEU A C  1 
ATOM 2084  O O  . LEU A 1 562 ? 181.954 135.274 68.784  1.00 121.93 ? 562 LEU A O  1 
ATOM 2085  N N  . GLN A 1 563 ? 182.430 137.205 67.738  1.00 133.70 ? 563 GLN A N  1 
ATOM 2086  C CA . GLN A 1 563 ? 183.826 136.859 67.539  1.00 133.70 ? 563 GLN A CA 1 
ATOM 2087  C C  . GLN A 1 563 ? 184.610 137.022 68.829  1.00 133.70 ? 563 GLN A C  1 
ATOM 2088  O O  . GLN A 1 563 ? 185.622 136.339 69.029  1.00 133.70 ? 563 GLN A O  1 
ATOM 2089  N N  . GLU A 1 564 ? 184.172 137.943 69.690  1.00 136.16 ? 564 GLU A N  1 
ATOM 2090  C CA . GLU A 1 564 ? 184.632 138.053 71.067  1.00 136.16 ? 564 GLU A CA 1 
ATOM 2091  C C  . GLU A 1 564 ? 183.795 137.226 72.039  1.00 136.16 ? 564 GLU A C  1 
ATOM 2092  O O  . GLU A 1 564 ? 184.360 136.610 72.951  1.00 136.16 ? 564 GLU A O  1 
ATOM 2093  N N  . GLY A 1 565 ? 182.485 137.110 71.808  1.00 124.80 ? 565 GLY A N  1 
ATOM 2094  C CA . GLY A 1 565 ? 181.640 136.281 72.642  1.00 124.80 ? 565 GLY A CA 1 
ATOM 2095  C C  . GLY A 1 565 ? 180.820 137.028 73.672  1.00 124.80 ? 565 GLY A C  1 
ATOM 2096  O O  . GLY A 1 565 ? 180.882 136.739 74.875  1.00 124.80 ? 565 GLY A O  1 
ATOM 2097  N N  . VAL A 1 566 ? 180.019 137.972 73.197  1.00 112.43 ? 566 VAL A N  1 
ATOM 2098  C CA . VAL A 1 566 ? 179.283 138.874 74.060  1.00 112.43 ? 566 VAL A CA 1 
ATOM 2099  C C  . VAL A 1 566 ? 177.834 138.428 74.233  1.00 112.43 ? 566 VAL A C  1 
ATOM 2100  O O  . VAL A 1 566 ? 176.963 139.258 74.494  1.00 112.43 ? 566 VAL A O  1 
ATOM 2101  N N  . ASP A 1 567 ? 177.571 137.116 74.085  1.00 113.99 ? 567 ASP A N  1 
ATOM 2102  C CA . ASP A 1 567 ? 176.279 136.461 74.256  1.00 113.99 ? 567 ASP A CA 1 
ATOM 2103  C C  . ASP A 1 567 ? 175.274 137.059 73.281  1.00 113.99 ? 567 ASP A C  1 
ATOM 2104  O O  . ASP A 1 567 ? 174.452 137.891 73.677  1.00 113.99 ? 567 ASP A O  1 
ATOM 2105  N N  . PRO A 1 568 ? 175.319 136.666 72.003  1.00 111.18 ? 568 PRO A N  1 
ATOM 2106  C CA . PRO A 1 568 ? 174.575 137.373 70.948  1.00 111.18 ? 568 PRO A CA 1 
ATOM 2107  C C  . PRO A 1 568 ? 173.063 137.334 71.080  1.00 111.18 ? 568 PRO A C  1 
ATOM 2108  O O  . PRO A 1 568 ? 172.378 137.941 70.251  1.00 111.18 ? 568 PRO A O  1 
ATOM 2109  N N  . LYS A 1 569 ? 172.517 136.629 72.070  1.00 110.21 ? 569 LYS A N  1 
ATOM 2110  C CA . LYS A 1 569 ? 171.148 136.874 72.483  1.00 110.21 ? 569 LYS A CA 1 
ATOM 2111  C C  . LYS A 1 569 ? 170.959 138.306 72.958  1.00 110.21 ? 569 LYS A C  1 
ATOM 2112  O O  . LYS A 1 569 ? 169.895 138.883 72.727  1.00 110.21 ? 569 LYS A O  1 
ATOM 2113  N N  . LYS A 1 570 ? 171.972 138.889 73.603  1.00 109.75 ? 570 LYS A N  1 
ATOM 2114  C CA . LYS A 1 570 ? 171.969 140.310 73.927  1.00 109.75 ? 570 LYS A CA 1 
ATOM 2115  C C  . LYS A 1 570 ? 171.961 141.186 72.686  1.00 109.75 ? 570 LYS A C  1 
ATOM 2116  O O  . LYS A 1 570 ? 171.368 142.273 72.708  1.00 109.75 ? 570 LYS A O  1 
ATOM 2117  N N  . LEU A 1 571 ? 172.581 140.721 71.600  1.00 108.06 ? 571 LEU A N  1 
ATOM 2118  C CA . LEU A 1 571 ? 172.715 141.525 70.395  1.00 108.06 ? 571 LEU A CA 1 
ATOM 2119  C C  . LEU A 1 571 ? 171.378 141.796 69.730  1.00 108.06 ? 571 LEU A C  1 
ATOM 2120  O O  . LEU A 1 571 ? 171.239 142.825 69.065  1.00 108.06 ? 571 LEU A O  1 
ATOM 2121  N N  . ASP A 1 572 ? 170.406 140.903 69.905  1.00 112.00 ? 572 ASP A N  1 
ATOM 2122  C CA . ASP A 1 572 ? 169.074 141.125 69.359  1.00 112.00 ? 572 ASP A CA 1 
ATOM 2123  C C  . ASP A 1 572 ? 168.443 142.373 69.952  1.00 112.00 ? 572 ASP A C  1 
ATOM 2124  O O  . ASP A 1 572 ? 167.999 143.264 69.220  1.00 112.00 ? 572 ASP A O  1 
ATOM 2125  N N  . SER A 1 573 ? 168.445 142.473 71.282  1.00 116.38 ? 573 SER A N  1 
ATOM 2126  C CA . SER A 1 573 ? 167.993 143.686 71.948  1.00 116.38 ? 573 SER A CA 1 
ATOM 2127  C C  . SER A 1 573 ? 168.875 144.870 71.603  1.00 116.38 ? 573 SER A C  1 
ATOM 2128  O O  . SER A 1 573 ? 168.365 145.974 71.395  1.00 116.38 ? 573 SER A O  1 
ATOM 2129  N N  . LEU A 1 574 ? 170.183 144.636 71.480  1.00 112.33 ? 574 LEU A N  1 
ATOM 2130  C CA . LEU A 1 574 ? 171.141 145.705 71.228  1.00 112.33 ? 574 LEU A CA 1 
ATOM 2131  C C  . LEU A 1 574 ? 170.917 146.357 69.871  1.00 112.33 ? 574 LEU A C  1 
ATOM 2132  O O  . LEU A 1 574 ? 171.107 147.569 69.728  1.00 112.33 ? 574 LEU A O  1 
ATOM 2133  N N  . THR A 1 575 ? 170.492 145.583 68.878  1.00 113.64 ? 575 THR A N  1 
ATOM 2134  C CA . THR A 1 575 ? 170.344 146.129 67.535  1.00 113.64 ? 575 THR A CA 1 
ATOM 2135  C C  . THR A 1 575 ? 168.908 146.523 67.238  1.00 113.64 ? 575 THR A C  1 
ATOM 2136  O O  . THR A 1 575 ? 168.666 147.455 66.463  1.00 113.64 ? 575 THR A O  1 
ATOM 2137  N N  . THR A 1 576 ? 167.937 145.849 67.853  1.00 107.11 ? 576 THR A N  1 
ATOM 2138  C CA . THR A 1 576 ? 166.582 146.359 67.759  1.00 107.11 ? 576 THR A CA 1 
ATOM 2139  C C  . THR A 1 576 ? 166.405 147.628 68.572  1.00 107.11 ? 576 THR A C  1 
ATOM 2140  O O  . THR A 1 576 ? 165.459 148.380 68.322  1.00 107.11 ? 576 THR A O  1 
ATOM 2141  N N  . SER A 1 577 ? 167.296 147.884 69.532  1.00 115.53 ? 577 SER A N  1 
ATOM 2142  C CA . SER A 1 577 ? 167.284 149.152 70.241  1.00 115.53 ? 577 SER A CA 1 
ATOM 2143  C C  . SER A 1 577 ? 167.645 150.303 69.315  1.00 115.53 ? 577 SER A C  1 
ATOM 2144  O O  . SER A 1 577 ? 167.083 151.394 69.435  1.00 115.53 ? 577 SER A O  1 
ATOM 2145  N N  . PHE A 1 578 ? 168.574 150.084 68.384  1.00 108.31 ? 578 PHE A N  1 
ATOM 2146  C CA . PHE A 1 578 ? 168.905 151.166 67.470  1.00 108.31 ? 578 PHE A CA 1 
ATOM 2147  C C  . PHE A 1 578 ? 167.811 151.380 66.439  1.00 108.31 ? 578 PHE A C  1 
ATOM 2148  O O  . PHE A 1 578 ? 167.646 152.497 65.936  1.00 108.31 ? 578 PHE A O  1 
ATOM 2149  N N  . GLY A 1 579 ? 167.049 150.342 66.123  1.00 98.62  ? 579 GLY A N  1 
ATOM 2150  C CA . GLY A 1 579 ? 165.876 150.553 65.310  1.00 98.62  ? 579 GLY A CA 1 
ATOM 2151  C C  . GLY A 1 579 ? 165.549 149.471 64.307  1.00 98.62  ? 579 GLY A C  1 
ATOM 2152  O O  . GLY A 1 579 ? 164.439 149.473 63.764  1.00 98.62  ? 579 GLY A O  1 
ATOM 2153  N N  . PHE A 1 580 ? 166.491 148.572 64.036  1.00 97.70  ? 580 PHE A N  1 
ATOM 2154  C CA . PHE A 1 580 ? 166.265 147.481 63.095  1.00 97.70  ? 580 PHE A CA 1 
ATOM 2155  C C  . PHE A 1 580 ? 165.122 146.604 63.586  1.00 97.70  ? 580 PHE A C  1 
ATOM 2156  O O  . PHE A 1 580 ? 165.098 146.241 64.767  1.00 97.70  ? 580 PHE A O  1 
ATOM 2157  N N  . PRO A 1 581 ? 164.127 146.314 62.748  1.00 100.29 ? 581 PRO A N  1 
ATOM 2158  C CA . PRO A 1 581 ? 162.952 145.585 63.233  1.00 100.29 ? 581 PRO A CA 1 
ATOM 2159  C C  . PRO A 1 581 ? 163.224 144.134 63.536  1.00 100.29 ? 581 PRO A C  1 
ATOM 2160  O O  . PRO A 1 581 ? 162.471 143.527 64.306  1.00 100.29 ? 581 PRO A O  1 
ATOM 2161  N N  . VAL A 1 582 ? 164.257 143.547 62.950  1.00 104.06 ? 582 VAL A N  1 
ATOM 2162  C CA . VAL A 1 582 ? 164.599 142.153 63.182  1.00 104.06 ? 582 VAL A CA 1 
ATOM 2163  C C  . VAL A 1 582 ? 166.080 142.072 63.521  1.00 104.06 ? 582 VAL A C  1 
ATOM 2164  O O  . VAL A 1 582 ? 166.895 142.793 62.936  1.00 104.06 ? 582 VAL A O  1 
ATOM 2165  N N  . GLY A 1 583 ? 166.420 141.220 64.490  1.00 112.51 ? 583 GLY A N  1 
ATOM 2166  C CA . GLY A 1 583 ? 167.783 141.161 64.980  1.00 112.51 ? 583 GLY A CA 1 
ATOM 2167  C C  . GLY A 1 583 ? 168.724 140.522 63.981  1.00 112.51 ? 583 GLY A C  1 
ATOM 2168  O O  . GLY A 1 583 ? 168.308 139.824 63.062  1.00 112.51 ? 583 GLY A O  1 
ATOM 2169  N N  . ALA A 1 584 ? 170.023 140.784 64.163  1.00 105.84 ? 584 ALA A N  1 
ATOM 2170  C CA . ALA A 1 584 ? 171.016 140.278 63.220  1.00 105.84 ? 584 ALA A CA 1 
ATOM 2171  C C  . ALA A 1 584 ? 171.137 138.765 63.292  1.00 105.84 ? 584 ALA A C  1 
ATOM 2172  O O  . ALA A 1 584 ? 171.475 138.122 62.291  1.00 105.84 ? 584 ALA A O  1 
ATOM 2173  N N  . ALA A 1 585 ? 170.849 138.185 64.457  1.00 113.39 ? 585 ALA A N  1 
ATOM 2174  C CA . ALA A 1 585 ? 170.662 136.743 64.534  1.00 113.39 ? 585 ALA A CA 1 
ATOM 2175  C C  . ALA A 1 585 ? 169.470 136.307 63.697  1.00 113.39 ? 585 ALA A C  1 
ATOM 2176  O O  . ALA A 1 585 ? 169.546 135.312 62.970  1.00 113.39 ? 585 ALA A O  1 
ATOM 2177  N N  . THR A 1 586 ? 168.372 137.060 63.751  1.00 122.53 ? 586 THR A N  1 
ATOM 2178  C CA . THR A 1 586 ? 167.241 136.739 62.890  1.00 122.53 ? 586 THR A CA 1 
ATOM 2179  C C  . THR A 1 586 ? 167.525 137.113 61.445  1.00 122.53 ? 586 THR A C  1 
ATOM 2180  O O  . THR A 1 586 ? 166.851 136.621 60.537  1.00 122.53 ? 586 THR A O  1 
ATOM 2181  N N  . LEU A 1 587 ? 168.513 137.974 61.207  1.00 117.01 ? 587 LEU A N  1 
ATOM 2182  C CA . LEU A 1 587 ? 168.928 138.232 59.836  1.00 117.01 ? 587 LEU A CA 1 
ATOM 2183  C C  . LEU A 1 587 ? 169.732 137.066 59.275  1.00 117.01 ? 587 LEU A C  1 
ATOM 2184  O O  . LEU A 1 587 ? 169.606 136.737 58.091  1.00 117.01 ? 587 LEU A O  1 
ATOM 2185  N N  . VAL A 1 588 ? 170.561 136.420 60.098  1.00 110.79 ? 588 VAL A N  1 
ATOM 2186  C CA . VAL A 1 588 ? 171.258 135.244 59.586  1.00 110.79 ? 588 VAL A CA 1 
ATOM 2187  C C  . VAL A 1 588 ? 170.352 134.021 59.627  1.00 110.79 ? 588 VAL A C  1 
ATOM 2188  O O  . VAL A 1 588 ? 170.622 133.026 58.945  1.00 110.79 ? 588 VAL A O  1 
ATOM 2189  N N  . ASP A 1 589 ? 169.271 134.073 60.396  1.00 114.92 ? 589 ASP A N  1 
ATOM 2190  C CA . ASP A 1 589 ? 168.235 133.058 60.315  1.00 114.92 ? 589 ASP A CA 1 
ATOM 2191  C C  . ASP A 1 589 ? 167.178 133.424 59.277  1.00 114.92 ? 589 ASP A C  1 
ATOM 2192  O O  . ASP A 1 589 ? 166.224 132.668 59.077  1.00 114.92 ? 589 ASP A O  1 
ATOM 2193  N N  . GLU A 1 590 ? 167.331 134.577 58.630  1.00 117.32 ? 590 GLU A N  1 
ATOM 2194  C CA . GLU A 1 590 ? 166.486 135.071 57.552  1.00 117.32 ? 590 GLU A CA 1 
ATOM 2195  C C  . GLU A 1 590 ? 167.025 134.702 56.184  1.00 117.32 ? 590 GLU A C  1 
ATOM 2196  O O  . GLU A 1 590 ? 166.256 134.354 55.284  1.00 117.32 ? 590 GLU A O  1 
ATOM 2197  N N  . VAL A 1 591 ? 168.346 134.750 56.026  1.00 121.18 ? 591 VAL A N  1 
ATOM 2198  C CA . VAL A 1 591 ? 168.952 134.568 54.719  1.00 121.18 ? 591 VAL A CA 1 
ATOM 2199  C C  . VAL A 1 591 ? 169.037 133.108 54.300  1.00 121.18 ? 591 VAL A C  1 
ATOM 2200  O O  . VAL A 1 591 ? 169.083 132.824 53.098  1.00 121.18 ? 591 VAL A O  1 
ATOM 2201  N N  . GLY A 1 592 ? 169.041 132.173 55.243  1.00 121.29 ? 592 GLY A N  1 
ATOM 2202  C CA . GLY A 1 592 ? 169.307 130.791 54.905  1.00 121.29 ? 592 GLY A CA 1 
ATOM 2203  C C  . GLY A 1 592 ? 170.787 130.500 55.018  1.00 121.29 ? 592 GLY A C  1 
ATOM 2204  O O  . GLY A 1 592 ? 171.609 131.204 54.427  1.00 121.29 ? 592 GLY A O  1 
ATOM 2205  N N  . VAL A 1 593 ? 171.138 129.462 55.779  1.00 123.57 ? 593 VAL A N  1 
ATOM 2206  C CA . VAL A 1 593 ? 172.536 129.217 56.112  1.00 123.57 ? 593 VAL A CA 1 
ATOM 2207  C C  . VAL A 1 593 ? 173.319 128.668 54.921  1.00 123.57 ? 593 VAL A C  1 
ATOM 2208  O O  . VAL A 1 593 ? 174.547 128.824 54.867  1.00 123.57 ? 593 VAL A O  1 
ATOM 2209  N N  . ASP A 1 594 ? 172.641 128.081 53.935  1.00 131.49 ? 594 ASP A N  1 
ATOM 2210  C CA . ASP A 1 594 ? 173.346 127.460 52.825  1.00 131.49 ? 594 ASP A CA 1 
ATOM 2211  C C  . ASP A 1 594 ? 173.848 128.486 51.823  1.00 131.49 ? 594 ASP A C  1 
ATOM 2212  O O  . ASP A 1 594 ? 174.936 128.318 51.265  1.00 131.49 ? 594 ASP A O  1 
ATOM 2213  N N  . VAL A 1 595 ? 173.083 129.553 51.588  1.00 120.29 ? 595 VAL A N  1 
ATOM 2214  C CA . VAL A 1 595 ? 173.534 130.582 50.659  1.00 120.29 ? 595 VAL A CA 1 
ATOM 2215  C C  . VAL A 1 595 ? 174.503 131.549 51.302  1.00 120.29 ? 595 VAL A C  1 
ATOM 2216  O O  . VAL A 1 595 ? 175.065 132.393 50.600  1.00 120.29 ? 595 VAL A O  1 
ATOM 2217  N N  . ALA A 1 596 ? 174.708 131.449 52.617  1.00 116.62 ? 596 ALA A N  1 
ATOM 2218  C CA . ALA A 1 596 ? 175.613 132.360 53.303  1.00 116.62 ? 596 ALA A CA 1 
ATOM 2219  C C  . ALA A 1 596 ? 177.060 132.130 52.894  1.00 116.62 ? 596 ALA A C  1 
ATOM 2220  O O  . ALA A 1 596 ? 177.814 133.093 52.723  1.00 116.62 ? 596 ALA A O  1 
ATOM 2221  N N  . LYS A 1 597 ? 177.456 130.872 52.691  1.00 118.84 ? 597 LYS A N  1 
ATOM 2222  C CA . LYS A 1 597 ? 178.802 130.604 52.207  1.00 118.84 ? 597 LYS A CA 1 
ATOM 2223  C C  . LYS A 1 597 ? 178.995 131.100 50.779  1.00 118.84 ? 597 LYS A C  1 
ATOM 2224  O O  . LYS A 1 597 ? 180.069 131.607 50.445  1.00 118.84 ? 597 LYS A O  1 
ATOM 2225  N N  . HIS A 1 598 ? 177.959 131.029 49.945  1.00 117.53 ? 598 HIS A N  1 
ATOM 2226  C CA . HIS A 1 598 ? 178.100 131.503 48.579  1.00 117.53 ? 598 HIS A CA 1 
ATOM 2227  C C  . HIS A 1 598 ? 178.131 133.018 48.525  1.00 117.53 ? 598 HIS A C  1 
ATOM 2228  O O  . HIS A 1 598 ? 178.915 133.591 47.762  1.00 117.53 ? 598 HIS A O  1 
ATOM 2229  N N  . VAL A 1 599 ? 177.339 133.681 49.369  1.00 114.98 ? 599 VAL A N  1 
ATOM 2230  C CA . VAL A 1 599 ? 177.393 135.133 49.387  1.00 114.98 ? 599 VAL A CA 1 
ATOM 2231  C C  . VAL A 1 599 ? 178.570 135.612 50.220  1.00 114.98 ? 599 VAL A C  1 
ATOM 2232  O O  . VAL A 1 599 ? 178.821 136.817 50.317  1.00 114.98 ? 599 VAL A O  1 
ATOM 2233  N N  . ALA A 1 600 ? 179.296 134.696 50.853  1.00 111.88 ? 600 ALA A N  1 
ATOM 2234  C CA . ALA A 1 600 ? 180.623 135.028 51.337  1.00 111.88 ? 600 ALA A CA 1 
ATOM 2235  C C  . ALA A 1 600 ? 181.684 134.876 50.259  1.00 111.88 ? 600 ALA A C  1 
ATOM 2236  O O  . ALA A 1 600 ? 182.614 135.687 50.202  1.00 111.88 ? 600 ALA A O  1 
ATOM 2237  N N  . GLU A 1 601 ? 181.562 133.866 49.400  1.00 118.03 ? 601 GLU A N  1 
ATOM 2238  C CA . GLU A 1 601 ? 182.629 133.582 48.448  1.00 118.03 ? 601 GLU A CA 1 
ATOM 2239  C C  . GLU A 1 601 ? 182.513 134.417 47.185  1.00 118.03 ? 601 GLU A C  1 
ATOM 2240  O O  . GLU A 1 601 ? 183.493 134.554 46.446  1.00 118.03 ? 601 GLU A O  1 
ATOM 2241  N N  . ASP A 1 602 ? 181.331 134.971 46.919  1.00 122.59 ? 602 ASP A N  1 
ATOM 2242  C CA . ASP A 1 602 ? 181.066 135.563 45.612  1.00 122.59 ? 602 ASP A CA 1 
ATOM 2243  C C  . ASP A 1 602 ? 181.857 136.848 45.394  1.00 122.59 ? 602 ASP A C  1 
ATOM 2244  O O  . ASP A 1 602 ? 182.576 136.984 44.400  1.00 122.59 ? 602 ASP A O  1 
ATOM 2245  N N  . LEU A 1 603 ? 181.757 137.796 46.317  1.00 124.69 ? 603 LEU A N  1 
ATOM 2246  C CA . LEU A 1 603 ? 182.503 139.027 46.154  1.00 124.69 ? 603 LEU A CA 1 
ATOM 2247  C C  . LEU A 1 603 ? 183.864 138.913 46.810  1.00 124.69 ? 603 LEU A C  1 
ATOM 2248  O O  . LEU A 1 603 ? 184.788 139.651 46.448  1.00 124.69 ? 603 LEU A O  1 
ATOM 2249  N N  . GLY A 1 604 ? 184.015 137.946 47.721  1.00 128.22 ? 604 GLY A N  1 
ATOM 2250  C CA . GLY A 1 604 ? 185.333 137.559 48.191  1.00 128.22 ? 604 GLY A CA 1 
ATOM 2251  C C  . GLY A 1 604 ? 186.190 136.962 47.097  1.00 128.22 ? 604 GLY A C  1 
ATOM 2252  O O  . GLY A 1 604 ? 187.418 136.935 47.212  1.00 128.22 ? 604 GLY A O  1 
ATOM 2253  N N  . LYS A 1 605 ? 185.559 136.462 46.032  1.00 132.09 ? 605 LYS A N  1 
ATOM 2254  C CA . LYS A 1 605 ? 186.300 136.140 44.824  1.00 132.09 ? 605 LYS A CA 1 
ATOM 2255  C C  . LYS A 1 605 ? 186.909 137.388 44.193  1.00 132.09 ? 605 LYS A C  1 
ATOM 2256  O O  . LYS A 1 605 ? 187.995 137.311 43.606  1.00 132.09 ? 605 LYS A O  1 
ATOM 2257  N N  . VAL A 1 606 ? 186.269 138.552 44.325  1.00 127.42 ? 606 VAL A N  1 
ATOM 2258  C CA . VAL A 1 606 ? 186.714 139.760 43.636  1.00 127.42 ? 606 VAL A CA 1 
ATOM 2259  C C  . VAL A 1 606 ? 187.379 140.743 44.595  1.00 127.42 ? 606 VAL A C  1 
ATOM 2260  O O  . VAL A 1 606 ? 188.584 140.982 44.511  1.00 127.42 ? 606 VAL A O  1 
ATOM 2261  N N  . PHE A 1 607 ? 186.606 141.328 45.520  1.00 125.90 ? 607 PHE A N  1 
ATOM 2262  C CA . PHE A 1 607 ? 187.206 142.247 46.484  1.00 125.90 ? 607 PHE A CA 1 
ATOM 2263  C C  . PHE A 1 607 ? 186.571 142.148 47.865  1.00 125.90 ? 607 PHE A C  1 
ATOM 2264  O O  . PHE A 1 607 ? 186.712 143.073 48.674  1.00 125.90 ? 607 PHE A O  1 
ATOM 2265  N N  . GLY A 1 608 ? 185.895 141.041 48.167  1.00 134.21 ? 608 GLY A N  1 
ATOM 2266  C CA . GLY A 1 608 ? 185.218 140.944 49.448  1.00 134.21 ? 608 GLY A CA 1 
ATOM 2267  C C  . GLY A 1 608 ? 186.152 140.652 50.604  1.00 134.21 ? 608 GLY A C  1 
ATOM 2268  O O  . GLY A 1 608 ? 185.746 140.713 51.766  1.00 134.21 ? 608 GLY A O  1 
ATOM 2269  N N  . GLU A 1 609 ? 187.412 140.338 50.308  1.00 143.88 ? 609 GLU A N  1 
ATOM 2270  C CA . GLU A 1 609 ? 188.346 139.990 51.368  1.00 143.88 ? 609 GLU A CA 1 
ATOM 2271  C C  . GLU A 1 609 ? 188.907 141.239 52.033  1.00 143.88 ? 609 GLU A C  1 
ATOM 2272  O O  . GLU A 1 609 ? 189.340 141.184 53.189  1.00 143.88 ? 609 GLU A O  1 
ATOM 2273  N N  . ARG A 1 610 ? 188.887 142.379 51.342  1.00 130.40 ? 610 ARG A N  1 
ATOM 2274  C CA . ARG A 1 610 ? 189.498 143.566 51.932  1.00 130.40 ? 610 ARG A CA 1 
ATOM 2275  C C  . ARG A 1 610 ? 188.451 144.569 52.408  1.00 130.40 ? 610 ARG A C  1 
ATOM 2276  O O  . ARG A 1 610 ? 188.575 145.130 53.500  1.00 130.40 ? 610 ARG A O  1 
ATOM 2277  N N  . PHE A 1 611 ? 187.395 144.800 51.630  1.00 125.65 ? 611 PHE A N  1 
ATOM 2278  C CA . PHE A 1 611 ? 186.352 145.677 52.138  1.00 125.65 ? 611 PHE A CA 1 
ATOM 2279  C C  . PHE A 1 611 ? 184.935 145.264 51.760  1.00 125.65 ? 611 PHE A C  1 
ATOM 2280  O O  . PHE A 1 611 ? 184.008 146.039 52.009  1.00 125.65 ? 611 PHE A O  1 
ATOM 2281  N N  . GLY A 1 612 ? 184.723 144.076 51.210  1.00 110.62 ? 612 GLY A N  1 
ATOM 2282  C CA . GLY A 1 612 ? 183.384 143.532 51.212  1.00 110.62 ? 612 GLY A CA 1 
ATOM 2283  C C  . GLY A 1 612 ? 183.267 142.512 52.323  1.00 110.62 ? 612 GLY A C  1 
ATOM 2284  O O  . GLY A 1 612 ? 182.472 141.572 52.242  1.00 110.62 ? 612 GLY A O  1 
ATOM 2285  N N  . GLY A 1 613 ? 184.062 142.704 53.374  1.00 110.87 ? 613 GLY A N  1 
ATOM 2286  C CA . GLY A 1 613 ? 184.164 141.780 54.487  1.00 110.87 ? 613 GLY A CA 1 
ATOM 2287  C C  . GLY A 1 613 ? 185.246 142.225 55.451  1.00 110.87 ? 613 GLY A C  1 
ATOM 2288  O O  . GLY A 1 613 ? 185.309 143.401 55.802  1.00 110.87 ? 613 GLY A O  1 
ATOM 2289  N N  . GLY A 1 614 ? 186.111 141.321 55.890  1.00 119.98 ? 614 GLY A N  1 
ATOM 2290  C CA . GLY A 1 614 ? 187.202 141.763 56.735  1.00 119.98 ? 614 GLY A CA 1 
ATOM 2291  C C  . GLY A 1 614 ? 187.295 141.063 58.072  1.00 119.98 ? 614 GLY A C  1 
ATOM 2292  O O  . GLY A 1 614 ? 187.854 141.603 59.031  1.00 119.98 ? 614 GLY A O  1 
ATOM 2293  N N  . ASN A 1 615 ? 186.722 139.870 58.157  1.00 123.03 ? 615 ASN A N  1 
ATOM 2294  C CA . ASN A 1 615 ? 186.827 139.029 59.325  1.00 123.03 ? 615 ASN A CA 1 
ATOM 2295  C C  . ASN A 1 615 ? 187.001 137.602 58.822  1.00 123.03 ? 615 ASN A C  1 
ATOM 2296  O O  . ASN A 1 615 ? 186.625 137.310 57.677  1.00 123.03 ? 615 ASN A O  1 
ATOM 2297  N N  . PRO A 1 616 ? 187.600 136.706 59.613  1.00 126.74 ? 616 PRO A N  1 
ATOM 2298  C CA . PRO A 1 616 ? 187.706 135.302 59.181  1.00 126.74 ? 616 PRO A CA 1 
ATOM 2299  C C  . PRO A 1 616 ? 186.338 134.643 59.111  1.00 126.74 ? 616 PRO A C  1 
ATOM 2300  O O  . PRO A 1 616 ? 185.537 134.739 60.041  1.00 126.74 ? 616 PRO A O  1 
ATOM 2301  N N  . GLU A 1 617 ? 186.064 134.010 57.980  1.00 120.03 ? 617 GLU A N  1 
ATOM 2302  C CA . GLU A 1 617 ? 184.796 133.327 57.779  1.00 120.03 ? 617 GLU A CA 1 
ATOM 2303  C C  . GLU A 1 617 ? 184.787 132.044 58.590  1.00 120.03 ? 617 GLU A C  1 
ATOM 2304  O O  . GLU A 1 617 ? 185.750 131.272 58.561  1.00 120.03 ? 617 GLU A O  1 
ATOM 2305  N N  . LEU A 1 618 ? 183.705 131.814 59.319  1.00 120.42 ? 618 LEU A N  1 
ATOM 2306  C CA . LEU A 1 618 ? 183.558 130.590 60.083  1.00 120.42 ? 618 LEU A CA 1 
ATOM 2307  C C  . LEU A 1 618 ? 182.237 129.882 59.815  1.00 120.42 ? 618 LEU A C  1 
ATOM 2308  O O  . LEU A 1 618 ? 181.958 128.855 60.446  1.00 120.42 ? 618 LEU A O  1 
ATOM 2309  N N  . LEU A 1 619 ? 181.434 130.390 58.876  1.00 124.31 ? 619 LEU A N  1 
ATOM 2310  C CA . LEU A 1 619 ? 180.129 129.797 58.600  1.00 124.31 ? 619 LEU A CA 1 
ATOM 2311  C C  . LEU A 1 619 ? 180.268 128.405 58.000  1.00 124.31 ? 619 LEU A C  1 
ATOM 2312  O O  . LEU A 1 619 ? 179.369 127.571 58.161  1.00 124.31 ? 619 LEU A O  1 
ATOM 2313  N N  . THR A 1 620 ? 181.390 128.123 57.335  1.00 129.20 ? 620 THR A N  1 
ATOM 2314  C CA . THR A 1 620 ? 181.637 126.756 56.897  1.00 129.20 ? 620 THR A CA 1 
ATOM 2315  C C  . THR A 1 620 ? 181.894 125.840 58.090  1.00 129.20 ? 620 THR A C  1 
ATOM 2316  O O  . THR A 1 620 ? 181.527 124.663 58.066  1.00 129.20 ? 620 THR A O  1 
ATOM 2317  N N  . GLN A 1 621 ? 182.451 126.380 59.178  1.00 122.29 ? 621 GLN A N  1 
ATOM 2318  C CA . GLN A 1 621 ? 182.513 125.594 60.399  1.00 122.29 ? 621 GLN A CA 1 
ATOM 2319  C C  . GLN A 1 621 ? 181.151 125.459 61.053  1.00 122.29 ? 621 GLN A C  1 
ATOM 2320  O O  . GLN A 1 621 ? 180.904 124.450 61.722  1.00 122.29 ? 621 GLN A O  1 
ATOM 2321  N N  . MET A 1 622 ? 180.265 126.447 60.878  1.00 124.02 ? 622 MET A N  1 
ATOM 2322  C CA . MET A 1 622 ? 178.892 126.290 61.360  1.00 124.02 ? 622 MET A CA 1 
ATOM 2323  C C  . MET A 1 622 ? 178.157 125.174 60.625  1.00 124.02 ? 622 MET A C  1 
ATOM 2324  O O  . MET A 1 622 ? 177.443 124.377 61.241  1.00 124.02 ? 622 MET A O  1 
ATOM 2325  N N  . VAL A 1 623 ? 178.307 125.113 59.302  1.00 120.22 ? 623 VAL A N  1 
ATOM 2326  C CA . VAL A 1 623 ? 177.629 124.071 58.534  1.00 120.22 ? 623 VAL A CA 1 
ATOM 2327  C C  . VAL A 1 623 ? 178.417 122.777 58.476  1.00 120.22 ? 623 VAL A C  1 
ATOM 2328  O O  . VAL A 1 623 ? 177.931 121.797 57.898  1.00 120.22 ? 623 VAL A O  1 
ATOM 2329  N N  . SER A 1 624 ? 179.636 122.762 59.026  1.00 118.34 ? 624 SER A N  1 
ATOM 2330  C CA . SER A 1 624 ? 180.414 121.533 59.104  1.00 118.34 ? 624 SER A CA 1 
ATOM 2331  C C  . SER A 1 624 ? 179.722 120.494 59.968  1.00 118.34 ? 624 SER A C  1 
ATOM 2332  O O  . SER A 1 624 ? 179.722 119.305 59.630  1.00 118.34 ? 624 SER A O  1 
ATOM 2333  N N  . LYS A 1 625 ? 179.108 120.926 61.067  1.00 124.41 ? 625 LYS A N  1 
ATOM 2334  C CA . LYS A 1 625 ? 178.225 120.033 61.800  1.00 124.41 ? 625 LYS A CA 1 
ATOM 2335  C C  . LYS A 1 625 ? 176.951 119.772 61.010  1.00 124.41 ? 625 LYS A C  1 
ATOM 2336  O O  . LYS A 1 625 ? 176.400 118.668 61.067  1.00 124.41 ? 625 LYS A O  1 
ATOM 2337  N N  . GLY A 1 626 ? 176.494 120.750 60.238  1.00 118.03 ? 626 GLY A N  1 
ATOM 2338  C CA . GLY A 1 626 ? 175.300 120.587 59.446  1.00 118.03 ? 626 GLY A CA 1 
ATOM 2339  C C  . GLY A 1 626 ? 174.072 121.287 59.971  1.00 118.03 ? 626 GLY A C  1 
ATOM 2340  O O  . GLY A 1 626 ? 172.987 120.697 59.930  1.00 118.03 ? 626 GLY A O  1 
ATOM 2341  N N  . PHE A 1 627 ? 174.202 122.511 60.482  1.00 113.73 ? 627 PHE A N  1 
ATOM 2342  C CA . PHE A 1 627 ? 173.037 123.242 60.961  1.00 113.73 ? 627 PHE A CA 1 
ATOM 2343  C C  . PHE A 1 627 ? 172.227 123.736 59.767  1.00 113.73 ? 627 PHE A C  1 
ATOM 2344  O O  . PHE A 1 627 ? 172.790 124.082 58.723  1.00 113.73 ? 627 PHE A O  1 
ATOM 2345  N N  . LEU A 1 628 ? 170.905 123.776 59.927  1.00 107.36 ? 628 LEU A N  1 
ATOM 2346  C CA . LEU A 1 628 ? 169.988 123.859 58.798  1.00 107.36 ? 628 LEU A CA 1 
ATOM 2347  C C  . LEU A 1 628 ? 169.236 125.190 58.762  1.00 107.36 ? 628 LEU A C  1 
ATOM 2348  O O  . LEU A 1 628 ? 168.525 125.479 57.792  1.00 107.36 ? 628 LEU A O  1 
ATOM 2349  N N  . GLY A 1 629 ? 169.419 126.035 59.770  1.00 112.27 ? 629 GLY A N  1 
ATOM 2350  C CA . GLY A 1 629 ? 168.816 127.352 59.751  1.00 112.27 ? 629 GLY A CA 1 
ATOM 2351  C C  . GLY A 1 629 ? 167.347 127.351 60.098  1.00 112.27 ? 629 GLY A C  1 
ATOM 2352  O O  . GLY A 1 629 ? 166.952 126.786 61.120  1.00 112.27 ? 629 GLY A O  1 
ATOM 2353  N N  . ARG A 1 630 ? 166.525 127.979 59.256  1.00 118.23 ? 630 ARG A N  1 
ATOM 2354  C CA . ARG A 1 630 ? 165.094 128.059 59.535  1.00 118.23 ? 630 ARG A CA 1 
ATOM 2355  C C  . ARG A 1 630 ? 164.421 126.709 59.372  1.00 118.23 ? 630 ARG A C  1 
ATOM 2356  O O  . ARG A 1 630 ? 163.418 126.429 60.039  1.00 118.23 ? 630 ARG A O  1 
ATOM 2357  N N  . LYS A 1 631 ? 164.969 125.849 58.517  1.00 113.70 ? 631 LYS A N  1 
ATOM 2358  C CA . LYS A 1 631 ? 164.368 124.540 58.313  1.00 113.70 ? 631 LYS A CA 1 
ATOM 2359  C C  . LYS A 1 631 ? 164.693 123.585 59.453  1.00 113.70 ? 631 LYS A C  1 
ATOM 2360  O O  . LYS A 1 631 ? 164.089 122.512 59.536  1.00 113.70 ? 631 LYS A O  1 
ATOM 2361  N N  . SER A 1 632 ? 165.646 123.942 60.319  1.00 116.91 ? 632 SER A N  1 
ATOM 2362  C CA . SER A 1 632 ? 165.867 123.251 61.584  1.00 116.91 ? 632 SER A CA 1 
ATOM 2363  C C  . SER A 1 632 ? 164.987 123.783 62.700  1.00 116.91 ? 632 SER A C  1 
ATOM 2364  O O  . SER A 1 632 ? 165.104 123.319 63.838  1.00 116.91 ? 632 SER A O  1 
ATOM 2365  N N  . GLY A 1 633 ? 164.138 124.755 62.409  1.00 122.55 ? 633 GLY A N  1 
ATOM 2366  C CA . GLY A 1 633 ? 163.179 125.264 63.389  1.00 122.55 ? 633 GLY A CA 1 
ATOM 2367  C C  . GLY A 1 633 ? 163.749 126.126 64.477  1.00 122.55 ? 633 GLY A C  1 
ATOM 2368  O O  . GLY A 1 633 ? 163.493 127.332 64.512  1.00 122.55 ? 633 GLY A O  1 
ATOM 2369  N N  . LYS A 1 634 ? 164.532 125.543 65.372  1.00 116.34 ? 634 LYS A N  1 
ATOM 2370  C CA . LYS A 1 634 ? 165.100 126.284 66.483  1.00 116.34 ? 634 LYS A CA 1 
ATOM 2371  C C  . LYS A 1 634 ? 166.347 127.014 66.012  1.00 116.34 ? 634 LYS A C  1 
ATOM 2372  O O  . LYS A 1 634 ? 167.186 126.456 65.302  1.00 116.34 ? 634 LYS A O  1 
ATOM 2373  N N  . GLY A 1 635 ? 166.470 128.264 66.439  1.00 118.25 ? 635 GLY A N  1 
ATOM 2374  C CA . GLY A 1 635 ? 167.578 129.113 66.062  1.00 118.25 ? 635 GLY A CA 1 
ATOM 2375  C C  . GLY A 1 635 ? 168.831 128.820 66.856  1.00 118.25 ? 635 GLY A C  1 
ATOM 2376  O O  . GLY A 1 635 ? 169.228 127.669 67.050  1.00 118.25 ? 635 GLY A O  1 
ATOM 2377  N N  . PHE A 1 636 ? 169.478 129.888 67.299  1.00 116.41 ? 636 PHE A N  1 
ATOM 2378  C CA . PHE A 1 636 ? 170.664 129.739 68.121  1.00 116.41 ? 636 PHE A CA 1 
ATOM 2379  C C  . PHE A 1 636 ? 170.274 129.728 69.588  1.00 116.41 ? 636 PHE A C  1 
ATOM 2380  O O  . PHE A 1 636 ? 169.089 129.689 69.919  1.00 116.41 ? 636 PHE A O  1 
ATOM 2381  N N  . LEU A 1 648 ? 170.063 128.402 73.016  1.00 129.53 ? 648 LEU A N  1 
ATOM 2382  C CA . LEU A 1 648 ? 171.468 128.715 73.218  1.00 129.53 ? 648 LEU A CA 1 
ATOM 2383  C C  . LEU A 1 648 ? 172.307 127.868 72.261  1.00 129.53 ? 648 LEU A C  1 
ATOM 2384  O O  . LEU A 1 648 ? 173.343 128.321 71.768  1.00 129.53 ? 648 LEU A O  1 
ATOM 2385  N N  . ASN A 1 649 ? 171.864 126.622 72.071  1.00 133.80 ? 649 ASN A N  1 
ATOM 2386  C CA . ASN A 1 649 ? 172.313 125.604 71.117  1.00 133.80 ? 649 ASN A CA 1 
ATOM 2387  C C  . ASN A 1 649 ? 173.667 124.983 71.481  1.00 133.80 ? 649 ASN A C  1 
ATOM 2388  O O  . ASN A 1 649 ? 174.021 123.942 70.916  1.00 133.80 ? 649 ASN A O  1 
ATOM 2389  N N  . SER A 1 650 ? 174.408 125.554 72.434  1.00 135.75 ? 650 SER A N  1 
ATOM 2390  C CA . SER A 1 650 ? 175.565 124.975 73.121  1.00 135.75 ? 650 SER A CA 1 
ATOM 2391  C C  . SER A 1 650 ? 176.746 124.626 72.215  1.00 135.75 ? 650 SER A C  1 
ATOM 2392  O O  . SER A 1 650 ? 177.629 123.874 72.639  1.00 135.75 ? 650 SER A O  1 
ATOM 2393  N N  . ASP A 1 651 ? 176.810 125.140 70.988  1.00 123.75 ? 651 ASP A N  1 
ATOM 2394  C CA . ASP A 1 651 ? 177.909 124.789 70.095  1.00 123.75 ? 651 ASP A CA 1 
ATOM 2395  C C  . ASP A 1 651 ? 178.564 125.966 69.385  1.00 123.75 ? 651 ASP A C  1 
ATOM 2396  O O  . ASP A 1 651 ? 179.597 125.766 68.735  1.00 123.75 ? 651 ASP A O  1 
ATOM 2397  N N  . MET A 1 652 ? 178.009 127.174 69.485  1.00 114.37 ? 652 MET A N  1 
ATOM 2398  C CA . MET A 1 652 ? 178.697 128.353 68.974  1.00 114.37 ? 652 MET A CA 1 
ATOM 2399  C C  . MET A 1 652 ? 179.938 128.688 69.782  1.00 114.37 ? 652 MET A C  1 
ATOM 2400  O O  . MET A 1 652 ? 180.883 129.264 69.239  1.00 114.37 ? 652 MET A O  1 
ATOM 2401  N N  . ASP A 1 653 ? 179.938 128.353 71.069  1.00 118.64 ? 653 ASP A N  1 
ATOM 2402  C CA . ASP A 1 653 ? 181.045 128.676 71.953  1.00 118.64 ? 653 ASP A CA 1 
ATOM 2403  C C  . ASP A 1 653 ? 182.291 127.863 71.653  1.00 118.64 ? 653 ASP A C  1 
ATOM 2404  O O  . ASP A 1 653 ? 183.402 128.370 71.837  1.00 118.64 ? 653 ASP A O  1 
ATOM 2405  N N  . SER A 1 654 ? 182.134 126.630 71.177  1.00 118.73 ? 654 SER A N  1 
ATOM 2406  C CA . SER A 1 654 ? 183.279 125.797 70.838  1.00 118.73 ? 654 SER A CA 1 
ATOM 2407  C C  . SER A 1 654 ? 184.027 126.318 69.624  1.00 118.73 ? 654 SER A C  1 
ATOM 2408  O O  . SER A 1 654 ? 185.219 126.034 69.469  1.00 118.73 ? 654 SER A O  1 
ATOM 2409  N N  . ILE A 1 655 ? 183.348 127.100 68.789  1.00 114.04 ? 655 ILE A N  1 
ATOM 2410  C CA . ILE A 1 655 ? 183.979 127.739 67.646  1.00 114.04 ? 655 ILE A CA 1 
ATOM 2411  C C  . ILE A 1 655 ? 185.032 128.733 68.093  1.00 114.04 ? 655 ILE A C  1 
ATOM 2412  O O  . ILE A 1 655 ? 186.156 128.737 67.580  1.00 114.04 ? 655 ILE A O  1 
ATOM 2413  N N  . LEU A 1 656 ? 184.694 129.578 69.052  1.00 112.83 ? 656 LEU A N  1 
ATOM 2414  C CA . LEU A 1 656 ? 185.579 130.672 69.399  1.00 112.83 ? 656 LEU A CA 1 
ATOM 2415  C C  . LEU A 1 656 ? 186.687 130.190 70.305  1.00 112.83 ? 656 LEU A C  1 
ATOM 2416  O O  . LEU A 1 656 ? 187.808 130.701 70.241  1.00 112.83 ? 656 LEU A O  1 
ATOM 2417  N N  . ALA A 1 657 ? 186.386 129.194 71.131  1.00 119.77 ? 657 ALA A N  1 
ATOM 2418  C CA . ALA A 1 657 ? 187.354 128.564 72.009  1.00 119.77 ? 657 ALA A CA 1 
ATOM 2419  C C  . ALA A 1 657 ? 188.012 127.349 71.375  1.00 119.77 ? 657 ALA A C  1 
ATOM 2420  O O  . ALA A 1 657 ? 188.635 126.559 72.093  1.00 119.77 ? 657 ALA A O  1 
ATOM 2421  N N  . SER A 1 658 ? 187.836 127.157 70.065  1.00 128.45 ? 658 SER A N  1 
ATOM 2422  C CA . SER A 1 658 ? 188.663 126.209 69.328  1.00 128.45 ? 658 SER A CA 1 
ATOM 2423  C C  . SER A 1 658 ? 190.140 126.559 69.468  1.00 128.45 ? 658 SER A C  1 
ATOM 2424  O O  . SER A 1 658 ? 190.905 125.837 70.114  1.00 128.45 ? 658 SER A O  1 
ATOM 2425  N N  . LEU A 1 659 ? 190.550 127.671 68.879  1.00 134.82 ? 659 LEU A N  1 
ATOM 2426  C CA . LEU A 1 659 ? 191.816 128.312 69.190  1.00 134.82 ? 659 LEU A CA 1 
ATOM 2427  C C  . LEU A 1 659 ? 191.520 129.748 69.592  1.00 134.82 ? 659 LEU A C  1 
ATOM 2428  O O  . LEU A 1 659 ? 190.535 130.340 69.137  1.00 134.82 ? 659 LEU A O  1 
ATOM 2429  N N  . LYS A 1 660 ? 192.370 130.306 70.450  1.00 140.56 ? 660 LYS A N  1 
ATOM 2430  C CA . LYS A 1 660 ? 192.029 131.541 71.149  1.00 140.56 ? 660 LYS A CA 1 
ATOM 2431  C C  . LYS A 1 660 ? 192.218 132.735 70.218  1.00 140.56 ? 660 LYS A C  1 
ATOM 2432  O O  . LYS A 1 660 ? 193.220 133.452 70.243  1.00 140.56 ? 660 LYS A O  1 
ATOM 2433  N N  . LEU A 1 661 ? 191.221 132.918 69.369  1.00 146.12 ? 661 LEU A N  1 
ATOM 2434  C CA . LEU A 1 661 ? 191.117 134.082 68.501  1.00 146.12 ? 661 LEU A CA 1 
ATOM 2435  C C  . LEU A 1 661 ? 190.644 135.390 69.171  1.00 146.12 ? 661 LEU A C  1 
ATOM 2436  O O  . LEU A 1 661 ? 191.049 136.456 68.688  1.00 146.12 ? 661 LEU A O  1 
ATOM 2437  N N  . PRO A 1 662 ? 189.828 135.422 70.243  1.00 154.71 ? 662 PRO A N  1 
ATOM 2438  C CA . PRO A 1 662 ? 189.531 136.728 70.882  1.00 154.71 ? 662 PRO A CA 1 
ATOM 2439  C C  . PRO A 1 662 ? 190.316 137.043 72.152  1.00 154.71 ? 662 PRO A C  1 
ATOM 2440  O O  . PRO A 1 662 ? 189.693 137.116 73.218  1.00 154.71 ? 662 PRO A O  1 
ATOM 2441  N N  . PRO A 1 663 ? 191.640 137.310 72.112  1.00 166.82 ? 663 PRO A N  1 
ATOM 2442  C CA . PRO A 1 663 ? 192.194 138.170 73.179  1.00 166.82 ? 663 PRO A CA 1 
ATOM 2443  C C  . PRO A 1 663 ? 192.028 139.671 72.932  1.00 166.82 ? 663 PRO A C  1 
ATOM 2444  O O  . PRO A 1 663 ? 192.720 140.474 73.576  1.00 166.82 ? 663 PRO A O  1 
ATOM 2445  N N  . LYS A 1 664 ? 191.150 140.066 72.009  1.00 155.28 ? 664 LYS A N  1 
ATOM 2446  C CA . LYS A 1 664 ? 191.081 141.444 71.525  1.00 155.28 ? 664 LYS A CA 1 
ATOM 2447  C C  . LYS A 1 664 ? 190.550 142.394 72.587  1.00 155.28 ? 664 LYS A C  1 
ATOM 2448  O O  . LYS A 1 664 ? 189.735 142.019 73.433  1.00 155.28 ? 664 LYS A O  1 
ATOM 2449  N N  . SER A 1 665 ? 191.006 143.642 72.512  1.00 169.03 ? 665 SER A N  1 
ATOM 2450  C CA . SER A 1 665 ? 190.626 144.674 73.458  1.00 169.03 ? 665 SER A CA 1 
ATOM 2451  C C  . SER A 1 665 ? 190.507 146.008 72.737  1.00 169.03 ? 665 SER A C  1 
ATOM 2452  O O  . SER A 1 665 ? 191.455 146.484 72.108  1.00 169.03 ? 665 SER A O  1 
ATOM 2453  N N  . GLU A 1 666 ? 189.323 146.609 72.848  1.00 149.49 ? 666 GLU A N  1 
ATOM 2454  C CA . GLU A 1 666 ? 189.092 147.986 72.430  1.00 149.49 ? 666 GLU A CA 1 
ATOM 2455  C C  . GLU A 1 666 ? 187.851 148.472 73.157  1.00 149.49 ? 666 GLU A C  1 
ATOM 2456  O O  . GLU A 1 666 ? 186.980 147.671 73.509  1.00 149.49 ? 666 GLU A O  1 
ATOM 2457  N N  . VAL A 1 667 ? 187.763 149.776 73.394  1.00 133.90 ? 667 VAL A N  1 
ATOM 2458  C CA . VAL A 1 667 ? 186.603 150.370 74.036  1.00 133.90 ? 667 VAL A CA 1 
ATOM 2459  C C  . VAL A 1 667 ? 185.505 150.397 72.978  1.00 133.90 ? 667 VAL A C  1 
ATOM 2460  O O  . VAL A 1 667 ? 185.400 151.334 72.185  1.00 133.90 ? 667 VAL A O  1 
ATOM 2461  N N  . SER A 1 668 ? 184.689 149.347 72.962  1.00 130.09 ? 668 SER A N  1 
ATOM 2462  C CA . SER A 1 668 ? 183.590 149.217 72.007  1.00 130.09 ? 668 SER A CA 1 
ATOM 2463  C C  . SER A 1 668 ? 182.361 148.840 72.822  1.00 130.09 ? 668 SER A C  1 
ATOM 2464  O O  . SER A 1 668 ? 182.107 147.662 73.075  1.00 130.09 ? 668 SER A O  1 
ATOM 2465  N N  . SER A 1 669 ? 181.597 149.848 73.219  1.00 130.47 ? 669 SER A N  1 
ATOM 2466  C CA . SER A 1 669 ? 180.345 149.619 73.921  1.00 130.47 ? 669 SER A CA 1 
ATOM 2467  C C  . SER A 1 669 ? 179.257 149.256 72.913  1.00 130.47 ? 669 SER A C  1 
ATOM 2468  O O  . SER A 1 669 ? 179.512 149.024 71.728  1.00 130.47 ? 669 SER A O  1 
ATOM 2469  N N  . ASP A 1 670 ? 178.014 149.210 73.393  1.00 132.91 ? 670 ASP A N  1 
ATOM 2470  C CA . ASP A 1 670 ? 176.887 148.856 72.539  1.00 132.91 ? 670 ASP A CA 1 
ATOM 2471  C C  . ASP A 1 670 ? 176.618 149.929 71.492  1.00 132.91 ? 670 ASP A C  1 
ATOM 2472  O O  . ASP A 1 670 ? 176.427 149.613 70.313  1.00 132.91 ? 670 ASP A O  1 
ATOM 2473  N N  . GLU A 1 671 ? 176.626 151.200 71.909  1.00 128.57 ? 671 GLU A N  1 
ATOM 2474  C CA . GLU A 1 671 ? 176.495 152.317 70.980  1.00 128.57 ? 671 GLU A CA 1 
ATOM 2475  C C  . GLU A 1 671 ? 177.630 152.328 69.970  1.00 128.57 ? 671 GLU A C  1 
ATOM 2476  O O  . GLU A 1 671 ? 177.425 152.665 68.794  1.00 128.57 ? 671 GLU A O  1 
ATOM 2477  N N  . ASP A 1 672 ? 178.825 151.935 70.415  1.00 132.23 ? 672 ASP A N  1 
ATOM 2478  C CA . ASP A 1 672 ? 179.988 151.880 69.542  1.00 132.23 ? 672 ASP A CA 1 
ATOM 2479  C C  . ASP A 1 672 ? 179.781 150.878 68.419  1.00 132.23 ? 672 ASP A C  1 
ATOM 2480  O O  . ASP A 1 672 ? 179.943 151.216 67.247  1.00 132.23 ? 672 ASP A O  1 
ATOM 2481  N N  . ILE A 1 673 ? 179.362 149.658 68.751  1.00 125.00 ? 673 ILE A N  1 
ATOM 2482  C CA . ILE A 1 673 ? 179.223 148.640 67.716  1.00 125.00 ? 673 ILE A CA 1 
ATOM 2483  C C  . ILE A 1 673 ? 177.973 148.879 66.858  1.00 125.00 ? 673 ILE A C  1 
ATOM 2484  O O  . ILE A 1 673 ? 177.966 148.530 65.664  1.00 125.00 ? 673 ILE A O  1 
ATOM 2485  N N  . GLN A 1 674 ? 176.936 149.518 67.423  1.00 118.89 ? 674 GLN A N  1 
ATOM 2486  C CA . GLN A 1 674 ? 175.792 149.964 66.628  1.00 118.89 ? 674 GLN A CA 1 
ATOM 2487  C C  . GLN A 1 674 ? 176.230 150.931 65.543  1.00 118.89 ? 674 GLN A C  1 
ATOM 2488  O O  . GLN A 1 674 ? 175.959 150.717 64.354  1.00 118.89 ? 674 GLN A O  1 
ATOM 2489  N N  . PHE A 1 675 ? 176.947 151.983 65.933  1.00 128.35 ? 675 PHE A N  1 
ATOM 2490  C CA . PHE A 1 675 ? 177.425 152.897 64.912  1.00 128.35 ? 675 PHE A CA 1 
ATOM 2491  C C  . PHE A 1 675 ? 178.513 152.294 64.037  1.00 128.35 ? 675 PHE A C  1 
ATOM 2492  O O  . PHE A 1 675 ? 178.653 152.742 62.909  1.00 128.35 ? 675 PHE A O  1 
ATOM 2493  N N  . ARG A 1 676 ? 179.245 151.271 64.491  1.00 123.54 ? 676 ARG A N  1 
ATOM 2494  C CA . ARG A 1 676 ? 180.208 150.627 63.597  1.00 123.54 ? 676 ARG A CA 1 
ATOM 2495  C C  . ARG A 1 676 ? 179.501 149.905 62.461  1.00 123.54 ? 676 ARG A C  1 
ATOM 2496  O O  . ARG A 1 676 ? 179.854 150.084 61.284  1.00 123.54 ? 676 ARG A O  1 
ATOM 2497  N N  . LEU A 1 677 ? 178.470 149.122 62.790  1.00 104.80 ? 677 LEU A N  1 
ATOM 2498  C CA . LEU A 1 677 ? 177.759 148.395 61.746  1.00 104.80 ? 677 LEU A CA 1 
ATOM 2499  C C  . LEU A 1 677 ? 176.983 149.350 60.848  1.00 104.80 ? 677 LEU A C  1 
ATOM 2500  O O  . LEU A 1 677 ? 176.982 149.192 59.620  1.00 104.80 ? 677 LEU A O  1 
ATOM 2501  N N  . VAL A 1 678 ? 176.415 150.409 61.427  1.00 110.33 ? 678 VAL A N  1 
ATOM 2502  C CA . VAL A 1 678 ? 175.660 151.358 60.616  1.00 110.33 ? 678 VAL A CA 1 
ATOM 2503  C C  . VAL A 1 678 ? 176.588 152.205 59.748  1.00 110.33 ? 678 VAL A C  1 
ATOM 2504  O O  . VAL A 1 678 ? 176.294 152.445 58.574  1.00 110.33 ? 678 VAL A O  1 
ATOM 2505  N N  . THR A 1 679 ? 177.733 152.638 60.286  1.00 120.75 ? 679 THR A N  1 
ATOM 2506  C CA . THR A 1 679 ? 178.657 153.454 59.502  1.00 120.75 ? 679 THR A CA 1 
ATOM 2507  C C  . THR A 1 679 ? 179.335 152.660 58.399  1.00 120.75 ? 679 THR A C  1 
ATOM 2508  O O  . THR A 1 679 ? 179.597 153.213 57.329  1.00 120.75 ? 679 THR A O  1 
ATOM 2509  N N  . ARG A 1 680 ? 179.590 151.370 58.602  1.00 109.63 ? 680 ARG A N  1 
ATOM 2510  C CA . ARG A 1 680 ? 180.085 150.607 57.466  1.00 109.63 ? 680 ARG A CA 1 
ATOM 2511  C C  . ARG A 1 680 ? 178.987 150.358 56.441  1.00 109.63 ? 680 ARG A C  1 
ATOM 2512  O O  . ARG A 1 680 ? 179.247 150.410 55.227  1.00 109.63 ? 680 ARG A O  1 
ATOM 2513  N N  . PHE A 1 681 ? 177.755 150.147 56.916  1.00 90.99  ? 681 PHE A N  1 
ATOM 2514  C CA . PHE A 1 681 ? 176.615 149.987 56.023  1.00 90.99  ? 681 PHE A CA 1 
ATOM 2515  C C  . PHE A 1 681 ? 176.392 151.229 55.170  1.00 90.99  ? 681 PHE A C  1 
ATOM 2516  O O  . PHE A 1 681 ? 176.139 151.132 53.966  1.00 90.99  ? 681 PHE A O  1 
ATOM 2517  N N  . VAL A 1 682 ? 176.572 152.410 55.754  1.00 100.61 ? 682 VAL A N  1 
ATOM 2518  C CA . VAL A 1 682 ? 176.408 153.620 54.963  1.00 100.61 ? 682 VAL A CA 1 
ATOM 2519  C C  . VAL A 1 682 ? 177.665 153.955 54.179  1.00 100.61 ? 682 VAL A C  1 
ATOM 2520  O O  . VAL A 1 682 ? 177.570 154.674 53.182  1.00 100.61 ? 682 VAL A O  1 
ATOM 2521  N N  . ASN A 1 683 ? 178.835 153.448 54.583  1.00 105.00 ? 683 ASN A N  1 
ATOM 2522  C CA . ASN A 1 683 ? 180.016 153.569 53.739  1.00 105.00 ? 683 ASN A CA 1 
ATOM 2523  C C  . ASN A 1 683 ? 179.806 152.820 52.441  1.00 105.00 ? 683 ASN A C  1 
ATOM 2524  O O  . ASN A 1 683 ? 180.157 153.314 51.362  1.00 105.00 ? 683 ASN A O  1 
ATOM 2525  N N  . GLU A 1 684 ? 179.211 151.639 52.526  1.00 107.88 ? 684 GLU A N  1 
ATOM 2526  C CA . GLU A 1 684 ? 178.896 150.942 51.293  1.00 107.88 ? 684 GLU A CA 1 
ATOM 2527  C C  . GLU A 1 684 ? 177.730 151.595 50.564  1.00 107.88 ? 684 GLU A C  1 
ATOM 2528  O O  . GLU A 1 684 ? 177.740 151.686 49.330  1.00 107.88 ? 684 GLU A O  1 
ATOM 2529  N N  . ALA A 1 685 ? 176.752 152.106 51.302  1.00 103.30 ? 685 ALA A N  1 
ATOM 2530  C CA . ALA A 1 685 ? 175.611 152.746 50.670  1.00 103.30 ? 685 ALA A CA 1 
ATOM 2531  C C  . ALA A 1 685 ? 175.947 154.101 50.058  1.00 103.30 ? 685 ALA A C  1 
ATOM 2532  O O  . ALA A 1 685 ? 175.135 154.636 49.298  1.00 103.30 ? 685 ALA A O  1 
ATOM 2533  N N  . VAL A 1 686 ? 177.103 154.673 50.389  1.00 109.07 ? 686 VAL A N  1 
ATOM 2534  C CA . VAL A 1 686 ? 177.626 155.837 49.686  1.00 109.07 ? 686 VAL A CA 1 
ATOM 2535  C C  . VAL A 1 686 ? 178.677 155.440 48.670  1.00 109.07 ? 686 VAL A C  1 
ATOM 2536  O O  . VAL A 1 686 ? 179.008 156.250 47.789  1.00 109.07 ? 686 VAL A O  1 
ATOM 2537  N N  . MET A 1 687 ? 179.194 154.210 48.748  1.00 115.85 ? 687 MET A N  1 
ATOM 2538  C CA . MET A 1 687 ? 180.026 153.708 47.665  1.00 115.85 ? 687 MET A CA 1 
ATOM 2539  C C  . MET A 1 687 ? 179.230 153.582 46.376  1.00 115.85 ? 687 MET A C  1 
ATOM 2540  O O  . MET A 1 687 ? 179.775 153.819 45.293  1.00 115.85 ? 687 MET A O  1 
ATOM 2541  N N  . CYS A 1 688 ? 177.938 153.275 46.466  1.00 118.56 ? 688 CYS A N  1 
ATOM 2542  C CA . CYS A 1 688 ? 177.128 153.217 45.261  1.00 118.56 ? 688 CYS A CA 1 
ATOM 2543  C C  . CYS A 1 688 ? 176.925 154.622 44.713  1.00 118.56 ? 688 CYS A C  1 
ATOM 2544  O O  . CYS A 1 688 ? 176.994 155.603 45.460  1.00 118.56 ? 688 CYS A O  1 
ATOM 2545  N N  . LEU A 1 689 ? 176.796 154.696 43.380  1.00 118.81 ? 689 LEU A N  1 
ATOM 2546  C CA . LEU A 1 689 ? 176.700 155.876 42.514  1.00 118.81 ? 689 LEU A CA 1 
ATOM 2547  C C  . LEU A 1 689 ? 178.042 156.601 42.391  1.00 118.81 ? 689 LEU A C  1 
ATOM 2548  O O  . LEU A 1 689 ? 178.208 157.458 41.519  1.00 118.81 ? 689 LEU A O  1 
ATOM 2549  N N  . GLN A 1 690 ? 179.043 156.210 43.177  1.00 119.80 ? 690 GLN A N  1 
ATOM 2550  C CA . GLN A 1 690 ? 180.393 156.687 42.910  1.00 119.80 ? 690 GLN A CA 1 
ATOM 2551  C C  . GLN A 1 690 ? 180.939 156.034 41.644  1.00 119.80 ? 690 GLN A C  1 
ATOM 2552  O O  . GLN A 1 690 ? 181.722 156.644 40.906  1.00 119.80 ? 690 GLN A O  1 
ATOM 2553  N N  . GLU A 1 691 ? 180.496 154.809 41.361  1.00 133.71 ? 691 GLU A N  1 
ATOM 2554  C CA . GLU A 1 691 ? 180.686 154.162 40.070  1.00 133.71 ? 691 GLU A CA 1 
ATOM 2555  C C  . GLU A 1 691 ? 179.482 154.368 39.161  1.00 133.71 ? 691 GLU A C  1 
ATOM 2556  O O  . GLU A 1 691 ? 179.469 153.880 38.026  1.00 133.71 ? 691 GLU A O  1 
ATOM 2557  N N  . GLY A 1 692 ? 178.476 155.092 39.634  1.00 130.32 ? 692 GLY A N  1 
ATOM 2558  C CA . GLY A 1 692 ? 177.243 155.220 38.891  1.00 130.32 ? 692 GLY A CA 1 
ATOM 2559  C C  . GLY A 1 692 ? 176.416 153.954 38.885  1.00 130.32 ? 692 GLY A C  1 
ATOM 2560  O O  . GLY A 1 692 ? 176.282 153.304 37.846  1.00 130.32 ? 692 GLY A O  1 
ATOM 2561  N N  . ILE A 1 693 ? 175.868 153.582 40.047  1.00 123.33 ? 693 ILE A N  1 
ATOM 2562  C CA . ILE A 1 693 ? 174.966 152.435 40.133  1.00 123.33 ? 693 ILE A CA 1 
ATOM 2563  C C  . ILE A 1 693 ? 173.637 152.704 39.435  1.00 123.33 ? 693 ILE A C  1 
ATOM 2564  O O  . ILE A 1 693 ? 172.971 151.751 39.000  1.00 123.33 ? 693 ILE A O  1 
ATOM 2565  N N  . LEU A 1 694 ? 173.265 153.973 39.261  1.00 134.34 ? 694 LEU A N  1 
ATOM 2566  C CA . LEU A 1 694 ? 172.048 154.403 38.585  1.00 134.34 ? 694 LEU A CA 1 
ATOM 2567  C C  . LEU A 1 694 ? 172.212 155.874 38.205  1.00 134.34 ? 694 LEU A C  1 
ATOM 2568  O O  . LEU A 1 694 ? 173.323 156.410 38.202  1.00 134.34 ? 694 LEU A O  1 
ATOM 2569  N N  . ALA A 1 695 ? 171.105 156.528 37.849  1.00 133.01 ? 695 ALA A N  1 
ATOM 2570  C CA . ALA A 1 695 ? 171.178 157.896 37.342  1.00 133.01 ? 695 ALA A CA 1 
ATOM 2571  C C  . ALA A 1 695 ? 171.370 158.928 38.451  1.00 133.01 ? 695 ALA A C  1 
ATOM 2572  O O  . ALA A 1 695 ? 172.361 159.663 38.447  1.00 133.01 ? 695 ALA A O  1 
ATOM 2573  N N  . THR A 1 696 ? 170.436 158.997 39.401  1.00 117.92 ? 696 THR A N  1 
ATOM 2574  C CA . THR A 1 696 ? 170.454 159.996 40.464  1.00 117.92 ? 696 THR A CA 1 
ATOM 2575  C C  . THR A 1 696 ? 170.117 159.326 41.791  1.00 117.92 ? 696 THR A C  1 
ATOM 2576  O O  . THR A 1 696 ? 169.062 158.694 41.912  1.00 117.92 ? 696 THR A O  1 
ATOM 2577  N N  . PRO A 1 697 ? 170.966 159.454 42.812  1.00 109.78 ? 697 PRO A N  1 
ATOM 2578  C CA . PRO A 1 697 ? 170.834 158.592 43.994  1.00 109.78 ? 697 PRO A CA 1 
ATOM 2579  C C  . PRO A 1 697 ? 169.726 158.971 44.960  1.00 109.78 ? 697 PRO A C  1 
ATOM 2580  O O  . PRO A 1 697 ? 169.560 158.278 45.971  1.00 109.78 ? 697 PRO A O  1 
ATOM 2581  N N  . ALA A 1 698 ? 168.944 160.017 44.687  1.00 99.88  ? 698 ALA A N  1 
ATOM 2582  C CA . ALA A 1 698 ? 167.770 160.278 45.513  1.00 99.88  ? 698 ALA A CA 1 
ATOM 2583  C C  . ALA A 1 698 ? 166.704 159.210 45.335  1.00 99.88  ? 698 ALA A C  1 
ATOM 2584  O O  . ALA A 1 698 ? 165.816 159.094 46.180  1.00 99.88  ? 698 ALA A O  1 
ATOM 2585  N N  . GLU A 1 699 ? 166.780 158.432 44.256  1.00 94.20  ? 699 GLU A N  1 
ATOM 2586  C CA . GLU A 1 699 ? 166.006 157.215 44.075  1.00 94.20  ? 699 GLU A CA 1 
ATOM 2587  C C  . GLU A 1 699 ? 166.505 156.039 44.899  1.00 94.20  ? 699 GLU A C  1 
ATOM 2588  O O  . GLU A 1 699 ? 166.000 154.929 44.708  1.00 94.20  ? 699 GLU A O  1 
ATOM 2589  N N  . GLY A 1 700 ? 167.478 156.226 45.782  1.00 83.95  ? 700 GLY A N  1 
ATOM 2590  C CA . GLY A 1 700 ? 168.165 155.070 46.324  1.00 83.95  ? 700 GLY A CA 1 
ATOM 2591  C C  . GLY A 1 700 ? 167.441 154.274 47.391  1.00 83.95  ? 700 GLY A C  1 
ATOM 2592  O O  . GLY A 1 700 ? 166.917 153.192 47.111  1.00 83.95  ? 700 GLY A O  1 
ATOM 2593  N N  . ASP A 1 701 ? 167.367 154.804 48.610  1.00 86.73  ? 701 ASP A N  1 
ATOM 2594  C CA . ASP A 1 701 ? 166.894 153.997 49.720  1.00 86.73  ? 701 ASP A CA 1 
ATOM 2595  C C  . ASP A 1 701 ? 165.387 153.908 49.807  1.00 86.73  ? 701 ASP A C  1 
ATOM 2596  O O  . ASP A 1 701 ? 164.879 153.442 50.828  1.00 86.73  ? 701 ASP A O  1 
ATOM 2597  N N  . ILE A 1 702 ? 164.660 154.371 48.796  1.00 80.48  ? 702 ILE A N  1 
ATOM 2598  C CA . ILE A 1 702 ? 163.324 153.844 48.579  1.00 80.48  ? 702 ILE A CA 1 
ATOM 2599  C C  . ILE A 1 702 ? 163.391 152.334 48.454  1.00 80.48  ? 702 ILE A C  1 
ATOM 2600  O O  . ILE A 1 702 ? 162.530 151.619 48.963  1.00 80.48  ? 702 ILE A O  1 
ATOM 2601  N N  . GLY A 1 703 ? 164.430 151.825 47.809  1.00 82.09  ? 703 GLY A N  1 
ATOM 2602  C CA . GLY A 1 703 ? 164.730 150.421 47.919  1.00 82.09  ? 703 GLY A CA 1 
ATOM 2603  C C  . GLY A 1 703 ? 165.311 150.037 49.265  1.00 82.09  ? 703 GLY A C  1 
ATOM 2604  O O  . GLY A 1 703 ? 164.732 149.226 49.993  1.00 82.09  ? 703 GLY A O  1 
ATOM 2605  N N  . ALA A 1 704 ? 166.441 150.646 49.624  1.00 83.72  ? 704 ALA A N  1 
ATOM 2606  C CA . ALA A 1 704 ? 167.324 150.103 50.650  1.00 83.72  ? 704 ALA A CA 1 
ATOM 2607  C C  . ALA A 1 704 ? 166.811 150.249 52.080  1.00 83.72  ? 704 ALA A C  1 
ATOM 2608  O O  . ALA A 1 704 ? 167.514 149.827 53.002  1.00 83.72  ? 704 ALA A O  1 
ATOM 2609  N N  . VAL A 1 705 ? 165.645 150.839 52.314  1.00 84.63  ? 705 VAL A N  1 
ATOM 2610  C CA . VAL A 1 705 ? 165.075 150.772 53.654  1.00 84.63  ? 705 VAL A CA 1 
ATOM 2611  C C  . VAL A 1 705 ? 163.829 149.921 53.667  1.00 84.63  ? 705 VAL A C  1 
ATOM 2612  O O  . VAL A 1 705 ? 163.315 149.556 54.727  1.00 84.63  ? 705 VAL A O  1 
ATOM 2613  N N  . PHE A 1 706 ? 163.322 149.599 52.492  1.00 81.42  ? 706 PHE A N  1 
ATOM 2614  C CA . PHE A 1 706 ? 161.947 149.160 52.436  1.00 81.42  ? 706 PHE A CA 1 
ATOM 2615  C C  . PHE A 1 706 ? 161.845 147.660 52.279  1.00 81.42  ? 706 PHE A C  1 
ATOM 2616  O O  . PHE A 1 706 ? 160.761 147.105 52.467  1.00 81.42  ? 706 PHE A O  1 
ATOM 2617  N N  . GLY A 1 707 ? 162.940 147.000 51.933  1.00 70.00  ? 707 GLY A N  1 
ATOM 2618  C CA . GLY A 1 707 ? 163.000 145.562 52.043  1.00 70.00  ? 707 GLY A CA 1 
ATOM 2619  C C  . GLY A 1 707 ? 164.261 145.068 52.699  1.00 70.00  ? 707 GLY A C  1 
ATOM 2620  O O  . GLY A 1 707 ? 164.325 143.915 53.127  1.00 70.00  ? 707 GLY A O  1 
ATOM 2621  N N  . LEU A 1 708 ? 165.274 145.926 52.768  1.00 77.16  ? 708 LEU A N  1 
ATOM 2622  C CA . LEU A 1 708 ? 166.547 145.502 53.328  1.00 77.16  ? 708 LEU A CA 1 
ATOM 2623  C C  . LEU A 1 708 ? 166.431 145.302 54.830  1.00 77.16  ? 708 LEU A C  1 
ATOM 2624  O O  . LEU A 1 708 ? 167.094 144.432 55.400  1.00 77.16  ? 708 LEU A O  1 
ATOM 2625  N N  . GLY A 1 709 ? 165.597 146.101 55.481  1.00 86.32  ? 709 GLY A N  1 
ATOM 2626  C CA . GLY A 1 709 ? 165.396 145.966 56.905  1.00 86.32  ? 709 GLY A CA 1 
ATOM 2627  C C  . GLY A 1 709 ? 165.896 147.174 57.661  1.00 86.32  ? 709 GLY A C  1 
ATOM 2628  O O  . GLY A 1 709 ? 166.007 147.145 58.889  1.00 86.32  ? 709 GLY A O  1 
ATOM 2629  N N  . PHE A 1 710 ? 166.210 148.235 56.933  1.00 85.91  ? 710 PHE A N  1 
ATOM 2630  C CA . PHE A 1 710 ? 166.693 149.448 57.567  1.00 85.91  ? 710 PHE A CA 1 
ATOM 2631  C C  . PHE A 1 710 ? 165.534 150.132 58.288  1.00 85.91  ? 710 PHE A C  1 
ATOM 2632  O O  . PHE A 1 710 ? 164.400 150.094 57.804  1.00 85.91  ? 710 PHE A O  1 
ATOM 2633  N N  . PRO A 1 711 ? 165.776 150.736 59.450  1.00 85.17  ? 711 PRO A N  1 
ATOM 2634  C CA . PRO A 1 711 ? 164.683 151.319 60.220  1.00 85.17  ? 711 PRO A CA 1 
ATOM 2635  C C  . PRO A 1 711 ? 164.135 152.574 59.575  1.00 85.17  ? 711 PRO A C  1 
ATOM 2636  O O  . PRO A 1 711 ? 164.893 153.482 59.211  1.00 85.17  ? 711 PRO A O  1 
ATOM 2637  N N  . PRO A 1 712 ? 162.821 152.661 59.418  1.00 78.76  ? 712 PRO A N  1 
ATOM 2638  C CA . PRO A 1 712 ? 162.187 153.967 59.320  1.00 78.76  ? 712 PRO A CA 1 
ATOM 2639  C C  . PRO A 1 712 ? 162.173 154.605 60.693  1.00 78.76  ? 712 PRO A C  1 
ATOM 2640  O O  . PRO A 1 712 ? 162.376 153.944 61.712  1.00 78.76  ? 712 PRO A O  1 
ATOM 2641  N N  . CYS A 1 713 ? 161.926 155.918 60.687  1.00 93.93  ? 713 CYS A N  1 
ATOM 2642  C CA . CYS A 1 713 ? 162.319 156.919 61.684  1.00 93.93  ? 713 CYS A CA 1 
ATOM 2643  C C  . CYS A 1 713 ? 163.830 157.064 61.795  1.00 93.93  ? 713 CYS A C  1 
ATOM 2644  O O  . CYS A 1 713 ? 164.325 157.725 62.711  1.00 93.93  ? 713 CYS A O  1 
ATOM 2645  N N  . LEU A 1 714 ? 164.568 156.450 60.882  1.00 95.46  ? 714 LEU A N  1 
ATOM 2646  C CA . LEU A 1 714 ? 165.896 156.871 60.492  1.00 95.46  ? 714 LEU A CA 1 
ATOM 2647  C C  . LEU A 1 714 ? 165.845 157.020 58.982  1.00 95.46  ? 714 LEU A C  1 
ATOM 2648  O O  . LEU A 1 714 ? 165.426 156.093 58.283  1.00 95.46  ? 714 LEU A O  1 
ATOM 2649  N N  . GLY A 1 715 ? 166.250 158.186 58.484  1.00 103.10 ? 715 GLY A N  1 
ATOM 2650  C CA . GLY A 1 715 ? 165.906 158.642 57.147  1.00 103.10 ? 715 GLY A CA 1 
ATOM 2651  C C  . GLY A 1 715 ? 166.430 157.820 55.993  1.00 103.10 ? 715 GLY A C  1 
ATOM 2652  O O  . GLY A 1 715 ? 165.963 158.002 54.867  1.00 103.10 ? 715 GLY A O  1 
ATOM 2653  N N  . GLY A 1 716 ? 167.355 156.907 56.227  1.00 101.02 ? 716 GLY A N  1 
ATOM 2654  C CA . GLY A 1 716 ? 167.947 156.168 55.147  1.00 101.02 ? 716 GLY A CA 1 
ATOM 2655  C C  . GLY A 1 716 ? 169.447 156.314 55.174  1.00 101.02 ? 716 GLY A C  1 
ATOM 2656  O O  . GLY A 1 716 ? 169.985 157.300 55.683  1.00 101.02 ? 716 GLY A O  1 
ATOM 2657  N N  . PRO A 1 717 ? 170.151 155.304 54.675  1.00 101.03 ? 717 PRO A N  1 
ATOM 2658  C CA . PRO A 1 717 ? 171.614 155.391 54.633  1.00 101.03 ? 717 PRO A CA 1 
ATOM 2659  C C  . PRO A 1 717 ? 172.137 156.473 53.704  1.00 101.03 ? 717 PRO A C  1 
ATOM 2660  O O  . PRO A 1 717 ? 173.212 157.030 53.951  1.00 101.03 ? 717 PRO A O  1 
ATOM 2661  N N  . PHE A 1 718 ? 171.395 156.807 52.654  1.00 106.40 ? 718 PHE A N  1 
ATOM 2662  C CA . PHE A 1 718 ? 171.713 157.979 51.856  1.00 106.40 ? 718 PHE A CA 1 
ATOM 2663  C C  . PHE A 1 718 ? 171.225 159.256 52.538  1.00 106.40 ? 718 PHE A C  1 
ATOM 2664  O O  . PHE A 1 718 ? 171.510 160.359 52.063  1.00 106.40 ? 718 PHE A O  1 
ATOM 2665  N N  . ARG A 1 719 ? 170.542 159.134 53.674  1.00 96.97  ? 719 ARG A N  1 
ATOM 2666  C CA . ARG A 1 719 ? 170.052 160.274 54.435  1.00 96.97  ? 719 ARG A CA 1 
ATOM 2667  C C  . ARG A 1 719 ? 170.609 160.320 55.851  1.00 96.97  ? 719 ARG A C  1 
ATOM 2668  O O  . ARG A 1 719 ? 169.863 160.447 56.822  1.00 96.97  ? 719 ARG A O  1 
ATOM 2669  N N  . PHE A 1 720 ? 171.921 160.183 56.002  1.00 102.45 ? 720 PHE A N  1 
ATOM 2670  C CA . PHE A 1 720 ? 172.568 160.609 57.232  1.00 102.45 ? 720 PHE A CA 1 
ATOM 2671  C C  . PHE A 1 720 ? 173.673 161.614 56.988  1.00 102.45 ? 720 PHE A C  1 
ATOM 2672  O O  . PHE A 1 720 ? 174.474 161.879 57.890  1.00 102.45 ? 720 PHE A O  1 
ATOM 2673  N N  . VAL A 1 721 ? 173.731 162.188 55.790  1.00 123.20 ? 721 VAL A N  1 
ATOM 2674  C CA . VAL A 1 721 ? 174.574 163.348 55.580  1.00 123.20 ? 721 VAL A CA 1 
ATOM 2675  C C  . VAL A 1 721 ? 173.844 164.617 55.973  1.00 123.20 ? 721 VAL A C  1 
ATOM 2676  O O  . VAL A 1 721 ? 174.450 165.693 56.025  1.00 123.20 ? 721 VAL A O  1 
ATOM 2677  N N  . ASP A 1 722 ? 172.551 164.519 56.255  1.00 118.77 ? 722 ASP A N  1 
ATOM 2678  C CA . ASP A 1 722 ? 171.683 165.677 56.388  1.00 118.77 ? 722 ASP A CA 1 
ATOM 2679  C C  . ASP A 1 722 ? 171.274 165.985 57.818  1.00 118.77 ? 722 ASP A C  1 
ATOM 2680  O O  . ASP A 1 722 ? 171.563 167.077 58.310  1.00 118.77 ? 722 ASP A O  1 
ATOM 2681  N N  . LEU A 1 723 ? 170.620 165.052 58.507  1.00 119.81 ? 723 LEU A N  1 
ATOM 2682  C CA . LEU A 1 723 ? 170.212 165.290 59.883  1.00 119.81 ? 723 LEU A CA 1 
ATOM 2683  C C  . LEU A 1 723 ? 171.246 164.764 60.859  1.00 119.81 ? 723 LEU A C  1 
ATOM 2684  O O  . LEU A 1 723 ? 171.256 165.175 62.023  1.00 119.81 ? 723 LEU A O  1 
ATOM 2685  N N  . TYR A 1 724 ? 172.119 163.860 60.418  1.00 128.27 ? 724 TYR A N  1 
ATOM 2686  C CA . TYR A 1 724 ? 173.258 163.500 61.240  1.00 128.27 ? 724 TYR A CA 1 
ATOM 2687  C C  . TYR A 1 724 ? 174.574 164.035 60.701  1.00 128.27 ? 724 TYR A C  1 
ATOM 2688  O O  . TYR A 1 724 ? 175.515 164.206 61.478  1.00 128.27 ? 724 TYR A O  1 
ATOM 2689  N N  . GLY A 1 725 ? 174.664 164.325 59.411  1.00 123.16 ? 725 GLY A N  1 
ATOM 2690  C CA . GLY A 1 725 ? 175.816 165.048 58.918  1.00 123.16 ? 725 GLY A CA 1 
ATOM 2691  C C  . GLY A 1 725 ? 177.011 164.177 58.612  1.00 123.16 ? 725 GLY A C  1 
ATOM 2692  O O  . GLY A 1 725 ? 177.373 163.305 59.407  1.00 123.16 ? 725 GLY A O  1 
ATOM 2693  N N  . ALA A 1 726 ? 177.631 164.413 57.454  1.00 123.98 ? 726 ALA A N  1 
ATOM 2694  C CA . ALA A 1 726 ? 178.830 163.670 57.085  1.00 123.98 ? 726 ALA A CA 1 
ATOM 2695  C C  . ALA A 1 726 ? 179.994 164.027 57.996  1.00 123.98 ? 726 ALA A C  1 
ATOM 2696  O O  . ALA A 1 726 ? 180.872 163.194 58.249  1.00 123.98 ? 726 ALA A O  1 
ATOM 2697  N N  . GLN A 1 727 ? 179.996 165.264 58.500  1.00 131.42 ? 727 GLN A N  1 
ATOM 2698  C CA . GLN A 1 727 ? 180.951 165.729 59.498  1.00 131.42 ? 727 GLN A CA 1 
ATOM 2699  C C  . GLN A 1 727 ? 180.946 164.852 60.745  1.00 131.42 ? 727 GLN A C  1 
ATOM 2700  O O  . GLN A 1 727 ? 182.011 164.459 61.240  1.00 131.42 ? 727 GLN A O  1 
ATOM 2701  N N  . LYS A 1 728 ? 179.767 164.474 61.228  1.00 130.37 ? 728 LYS A N  1 
ATOM 2702  C CA . LYS A 1 728 ? 179.734 163.732 62.478  1.00 130.37 ? 728 LYS A CA 1 
ATOM 2703  C C  . LYS A 1 728 ? 180.116 162.270 62.281  1.00 130.37 ? 728 LYS A C  1 
ATOM 2704  O O  . LYS A 1 728 ? 180.834 161.710 63.113  1.00 130.37 ? 728 LYS A O  1 
ATOM 2705  N N  . ILE A 1 729 ? 179.708 161.642 61.174  1.00 127.37 ? 729 ILE A N  1 
ATOM 2706  C CA . ILE A 1 729 ? 180.111 160.254 60.966  1.00 127.37 ? 729 ILE A CA 1 
ATOM 2707  C C  . ILE A 1 729 ? 181.587 160.170 60.609  1.00 127.37 ? 729 ILE A C  1 
ATOM 2708  O O  . ILE A 1 729 ? 182.249 159.171 60.920  1.00 127.37 ? 729 ILE A O  1 
ATOM 2709  N N  . VAL A 1 730 ? 182.137 161.206 59.961  1.00 133.43 ? 730 VAL A N  1 
ATOM 2710  C CA . VAL A 1 730 ? 183.568 161.148 59.692  1.00 133.43 ? 730 VAL A CA 1 
ATOM 2711  C C  . VAL A 1 730 ? 184.341 161.406 60.972  1.00 133.43 ? 730 VAL A C  1 
ATOM 2712  O O  . VAL A 1 730 ? 185.424 160.849 61.145  1.00 133.43 ? 730 VAL A O  1 
ATOM 2713  N N  . ASP A 1 731 ? 183.762 162.138 61.930  1.00 146.63 ? 731 ASP A N  1 
ATOM 2714  C CA . ASP A 1 731 ? 184.368 162.153 63.256  1.00 146.63 ? 731 ASP A CA 1 
ATOM 2715  C C  . ASP A 1 731 ? 184.197 160.815 63.969  1.00 146.63 ? 731 ASP A C  1 
ATOM 2716  O O  . ASP A 1 731 ? 185.018 160.462 64.821  1.00 146.63 ? 731 ASP A O  1 
ATOM 2717  N N  . ARG A 1 732 ? 183.145 160.058 63.645  1.00 141.26 ? 732 ARG A N  1 
ATOM 2718  C CA . ARG A 1 732 ? 182.972 158.752 64.282  1.00 141.26 ? 732 ARG A CA 1 
ATOM 2719  C C  . ARG A 1 732 ? 184.002 157.745 63.783  1.00 141.26 ? 732 ARG A C  1 
ATOM 2720  O O  . ARG A 1 732 ? 184.614 157.026 64.579  1.00 141.26 ? 732 ARG A O  1 
ATOM 2721  N N  . LEU A 1 733 ? 184.211 157.667 62.473  1.00 140.89 ? 733 LEU A N  1 
ATOM 2722  C CA . LEU A 1 733 ? 185.250 156.738 62.043  1.00 140.89 ? 733 LEU A CA 1 
ATOM 2723  C C  . LEU A 1 733 ? 186.645 157.330 62.153  1.00 140.89 ? 733 LEU A C  1 
ATOM 2724  O O  . LEU A 1 733 ? 187.617 156.582 62.039  1.00 140.89 ? 733 LEU A O  1 
ATOM 2725  N N  . LYS A 1 734 ? 186.779 158.643 62.343  1.00 147.83 ? 734 LYS A N  1 
ATOM 2726  C CA . LYS A 1 734 ? 188.076 159.205 62.683  1.00 147.83 ? 734 LYS A CA 1 
ATOM 2727  C C  . LYS A 1 734 ? 188.356 159.023 64.168  1.00 147.83 ? 734 LYS A C  1 
ATOM 2728  O O  . LYS A 1 734 ? 189.509 159.078 64.602  1.00 147.83 ? 734 LYS A O  1 
ATOM 2729  N N  . LYS A 1 735 ? 187.316 158.784 64.961  1.00 159.02 ? 735 LYS A N  1 
ATOM 2730  C CA . LYS A 1 735 ? 187.523 158.195 66.275  1.00 159.02 ? 735 LYS A CA 1 
ATOM 2731  C C  . LYS A 1 735 ? 187.942 156.739 66.130  1.00 159.02 ? 735 LYS A C  1 
ATOM 2732  O O  . LYS A 1 735 ? 188.706 156.211 66.946  1.00 159.02 ? 735 LYS A O  1 
ATOM 2733  N N  . TYR A 1 736 ? 187.473 156.081 65.074  1.00 146.64 ? 736 TYR A N  1 
ATOM 2734  C CA . TYR A 1 736 ? 187.795 154.688 64.809  1.00 146.64 ? 736 TYR A CA 1 
ATOM 2735  C C  . TYR A 1 736 ? 188.970 154.556 63.837  1.00 146.64 ? 736 TYR A C  1 
ATOM 2736  O O  . TYR A 1 736 ? 189.121 153.536 63.169  1.00 146.64 ? 736 TYR A O  1 
ATOM 2737  N N  . GLU A 1 737 ? 189.836 155.569 63.751  1.00 151.68 ? 737 GLU A N  1 
ATOM 2738  C CA . GLU A 1 737 ? 190.769 155.616 62.626  1.00 151.68 ? 737 GLU A CA 1 
ATOM 2739  C C  . GLU A 1 737 ? 191.940 154.658 62.818  1.00 151.68 ? 737 GLU A C  1 
ATOM 2740  O O  . GLU A 1 737 ? 192.460 154.111 61.840  1.00 151.68 ? 737 GLU A O  1 
ATOM 2741  N N  . ALA A 1 738 ? 192.359 154.426 64.056  1.00 147.25 ? 738 ALA A N  1 
ATOM 2742  C CA . ALA A 1 738 ? 193.548 153.621 64.293  1.00 147.25 ? 738 ALA A CA 1 
ATOM 2743  C C  . ALA A 1 738 ? 193.224 152.181 64.646  1.00 147.25 ? 738 ALA A C  1 
ATOM 2744  O O  . ALA A 1 738 ? 194.065 151.500 65.241  1.00 147.25 ? 738 ALA A O  1 
ATOM 2745  N N  . ALA A 1 739 ? 192.032 151.699 64.300  1.00 135.76 ? 739 ALA A N  1 
ATOM 2746  C CA . ALA A 1 739 ? 191.677 150.328 64.640  1.00 135.76 ? 739 ALA A CA 1 
ATOM 2747  C C  . ALA A 1 739 ? 192.314 149.344 63.667  1.00 135.76 ? 739 ALA A C  1 
ATOM 2748  O O  . ALA A 1 739 ? 193.088 148.471 64.073  1.00 135.76 ? 739 ALA A O  1 
ATOM 2749  N N  . TYR A 1 740 ? 192.004 149.468 62.389  1.00 142.29 ? 740 TYR A N  1 
ATOM 2750  C CA . TYR A 1 740 ? 192.498 148.504 61.411  1.00 142.29 ? 740 TYR A CA 1 
ATOM 2751  C C  . TYR A 1 740 ? 193.139 149.150 60.191  1.00 142.29 ? 740 TYR A C  1 
ATOM 2752  O O  . TYR A 1 740 ? 194.076 148.583 59.628  1.00 142.29 ? 740 TYR A O  1 
ATOM 2753  N N  . GLY A 1 741 ? 192.646 150.307 59.757  1.00 145.23 ? 741 GLY A N  1 
ATOM 2754  C CA . GLY A 1 741 ? 193.188 151.029 58.627  1.00 145.23 ? 741 GLY A CA 1 
ATOM 2755  C C  . GLY A 1 741 ? 192.898 150.432 57.269  1.00 145.23 ? 741 GLY A C  1 
ATOM 2756  O O  . GLY A 1 741 ? 193.376 150.970 56.262  1.00 145.23 ? 741 GLY A O  1 
ATOM 2757  N N  . LYS A 1 742 ? 192.140 149.337 57.199  1.00 137.16 ? 742 LYS A N  1 
ATOM 2758  C CA . LYS A 1 742 ? 191.972 148.603 55.952  1.00 137.16 ? 742 LYS A CA 1 
ATOM 2759  C C  . LYS A 1 742 ? 190.515 148.540 55.503  1.00 137.16 ? 742 LYS A C  1 
ATOM 2760  O O  . LYS A 1 742 ? 190.199 148.910 54.368  1.00 137.16 ? 742 LYS A O  1 
ATOM 2761  N N  . GLN A 1 743 ? 189.615 148.086 56.371  1.00 127.80 ? 743 GLN A N  1 
ATOM 2762  C CA . GLN A 1 743 ? 188.263 147.751 55.944  1.00 127.80 ? 743 GLN A CA 1 
ATOM 2763  C C  . GLN A 1 743 ? 187.275 148.904 56.058  1.00 127.80 ? 743 GLN A C  1 
ATOM 2764  O O  . GLN A 1 743 ? 186.334 148.974 55.263  1.00 127.80 ? 743 GLN A O  1 
ATOM 2765  N N  . PHE A 1 744 ? 187.451 149.798 57.023  1.00 128.12 ? 744 PHE A N  1 
ATOM 2766  C CA . PHE A 1 744 ? 186.471 150.845 57.259  1.00 128.12 ? 744 PHE A CA 1 
ATOM 2767  C C  . PHE A 1 744 ? 186.780 152.125 56.506  1.00 128.12 ? 744 PHE A C  1 
ATOM 2768  O O  . PHE A 1 744 ? 186.254 153.177 56.880  1.00 128.12 ? 744 PHE A O  1 
ATOM 2769  N N  . THR A 1 745 ? 187.605 152.063 55.475  1.00 125.69 ? 745 THR A N  1 
ATOM 2770  C CA . THR A 1 745 ? 188.130 153.257 54.837  1.00 125.69 ? 745 THR A CA 1 
ATOM 2771  C C  . THR A 1 745 ? 187.035 153.997 54.077  1.00 125.69 ? 745 THR A C  1 
ATOM 2772  O O  . THR A 1 745 ? 186.311 153.377 53.284  1.00 125.69 ? 745 THR A O  1 
ATOM 2773  N N  . PRO A 1 746 ? 186.864 155.294 54.301  1.00 120.02 ? 746 PRO A N  1 
ATOM 2774  C CA . PRO A 1 746 ? 185.700 155.997 53.761  1.00 120.02 ? 746 PRO A CA 1 
ATOM 2775  C C  . PRO A 1 746 ? 185.865 156.302 52.282  1.00 120.02 ? 746 PRO A C  1 
ATOM 2776  O O  . PRO A 1 746 ? 186.972 156.326 51.743  1.00 120.02 ? 746 PRO A O  1 
ATOM 2777  N N  . CYS A 1 747 ? 184.733 156.529 51.621  1.00 120.98 ? 747 CYS A N  1 
ATOM 2778  C CA . CYS A 1 747 ? 184.776 156.873 50.209  1.00 120.98 ? 747 CYS A CA 1 
ATOM 2779  C C  . CYS A 1 747 ? 185.204 158.324 50.025  1.00 120.98 ? 747 CYS A C  1 
ATOM 2780  O O  . CYS A 1 747 ? 185.213 159.124 50.965  1.00 120.98 ? 747 CYS A O  1 
ATOM 2781  N N  . GLN A 1 748 ? 185.562 158.662 48.785  1.00 131.66 ? 748 GLN A N  1 
ATOM 2782  C CA . GLN A 1 748 ? 186.167 159.962 48.515  1.00 131.66 ? 748 GLN A CA 1 
ATOM 2783  C C  . GLN A 1 748 ? 185.149 161.027 48.141  1.00 131.66 ? 748 GLN A C  1 
ATOM 2784  O O  . GLN A 1 748 ? 185.395 162.213 48.388  1.00 131.66 ? 748 GLN A O  1 
ATOM 2785  N N  . LEU A 1 749 ? 184.029 160.640 47.531  1.00 134.81 ? 749 LEU A N  1 
ATOM 2786  C CA . LEU A 1 749 ? 183.103 161.646 47.026  1.00 134.81 ? 749 LEU A CA 1 
ATOM 2787  C C  . LEU A 1 749 ? 182.351 162.326 48.160  1.00 134.81 ? 749 LEU A C  1 
ATOM 2788  O O  . LEU A 1 749 ? 182.158 163.546 48.134  1.00 134.81 ? 749 LEU A O  1 
ATOM 2789  N N  . LEU A 1 750 ? 181.933 161.566 49.172  1.00 134.36 ? 750 LEU A N  1 
ATOM 2790  C CA . LEU A 1 750 ? 181.188 162.189 50.256  1.00 134.36 ? 750 LEU A CA 1 
ATOM 2791  C C  . LEU A 1 750 ? 182.118 162.964 51.177  1.00 134.36 ? 750 LEU A C  1 
ATOM 2792  O O  . LEU A 1 750 ? 181.693 163.917 51.838  1.00 134.36 ? 750 LEU A O  1 
ATOM 2793  N N  . ALA A 1 751 ? 183.397 162.591 51.205  1.00 143.88 ? 751 ALA A N  1 
ATOM 2794  C CA . ALA A 1 751 ? 184.312 163.122 52.201  1.00 143.88 ? 751 ALA A CA 1 
ATOM 2795  C C  . ALA A 1 751 ? 184.807 164.515 51.861  1.00 143.88 ? 751 ALA A C  1 
ATOM 2796  O O  . ALA A 1 751 ? 185.143 165.277 52.773  1.00 143.88 ? 751 ALA A O  1 
ATOM 2797  N N  . ASP A 1 752 ? 184.874 164.863 50.580  1.00 151.16 ? 752 ASP A N  1 
ATOM 2798  C CA . ASP A 1 752 ? 185.436 166.157 50.223  1.00 151.16 ? 752 ASP A CA 1 
ATOM 2799  C C  . ASP A 1 752 ? 184.448 167.288 50.482  1.00 151.16 ? 752 ASP A C  1 
ATOM 2800  O O  . ASP A 1 752 ? 184.857 168.404 50.816  1.00 151.16 ? 752 ASP A O  1 
ATOM 2801  N N  . HIS A 1 753 ? 183.148 167.019 50.361  1.00 142.49 ? 753 HIS A N  1 
ATOM 2802  C CA . HIS A 1 753 ? 182.141 168.002 50.726  1.00 142.49 ? 753 HIS A CA 1 
ATOM 2803  C C  . HIS A 1 753 ? 181.543 167.719 52.097  1.00 142.49 ? 753 HIS A C  1 
ATOM 2804  O O  . HIS A 1 753 ? 180.465 168.229 52.417  1.00 142.49 ? 753 HIS A O  1 
ATOM 2805  N N  . ALA A 1 754 ? 182.244 166.944 52.923  1.00 148.00 ? 754 ALA A N  1 
ATOM 2806  C CA . ALA A 1 754 ? 181.653 166.447 54.158  1.00 148.00 ? 754 ALA A CA 1 
ATOM 2807  C C  . ALA A 1 754 ? 181.520 167.540 55.210  1.00 148.00 ? 754 ALA A C  1 
ATOM 2808  O O  . ALA A 1 754 ? 180.407 167.945 55.561  1.00 148.00 ? 754 ALA A O  1 
ATOM 2809  N N  . ASN A 1 755 ? 182.645 168.049 55.700  1.00 159.71 ? 755 ASN A N  1 
ATOM 2810  C CA . ASN A 1 755 ? 182.619 168.791 56.952  1.00 159.71 ? 755 ASN A CA 1 
ATOM 2811  C C  . ASN A 1 755 ? 182.513 170.308 56.802  1.00 159.71 ? 755 ASN A C  1 
ATOM 2812  O O  . ASN A 1 755 ? 181.525 170.899 57.245  1.00 159.71 ? 755 ASN A O  1 
ATOM 2813  N N  . SER A 1 756 ? 183.500 170.950 56.186  1.00 157.25 ? 756 SER A N  1 
ATOM 2814  C CA . SER A 1 756 ? 183.568 172.404 56.267  1.00 157.25 ? 756 SER A CA 1 
ATOM 2815  C C  . SER A 1 756 ? 182.584 173.143 55.353  1.00 157.25 ? 756 SER A C  1 
ATOM 2816  O O  . SER A 1 756 ? 181.733 173.870 55.883  1.00 157.25 ? 756 SER A O  1 
ATOM 2817  N N  . PRO A 1 757 ? 182.604 172.996 53.993  1.00 151.36 ? 757 PRO A N  1 
ATOM 2818  C CA . PRO A 1 757 ? 181.913 174.015 53.189  1.00 151.36 ? 757 PRO A CA 1 
ATOM 2819  C C  . PRO A 1 757 ? 180.416 173.798 53.029  1.00 151.36 ? 757 PRO A C  1 
ATOM 2820  O O  . PRO A 1 757 ? 179.925 173.938 51.907  1.00 151.36 ? 757 PRO A O  1 
ATOM 2821  N N  . ASN A 1 758 ? 179.710 173.471 54.125  1.00 143.14 ? 758 ASN A N  1 
ATOM 2822  C CA . ASN A 1 758 ? 178.275 173.184 54.281  1.00 143.14 ? 758 ASN A CA 1 
ATOM 2823  C C  . ASN A 1 758 ? 177.536 172.620 53.065  1.00 143.14 ? 758 ASN A C  1 
ATOM 2824  O O  . ASN A 1 758 ? 176.383 172.982 52.813  1.00 143.14 ? 758 ASN A O  1 
ATOM 2825  N N  . LYS A 1 759 ? 178.173 171.720 52.321  1.00 140.56 ? 759 LYS A N  1 
ATOM 2826  C CA . LYS A 1 759 ? 177.546 171.161 51.138  1.00 140.56 ? 759 LYS A CA 1 
ATOM 2827  C C  . LYS A 1 759 ? 176.762 169.912 51.491  1.00 140.56 ? 759 LYS A C  1 
ATOM 2828  O O  . LYS A 1 759 ? 177.101 169.184 52.429  1.00 140.56 ? 759 LYS A O  1 
ATOM 2829  N N  . LYS A 1 760 ? 175.699 169.679 50.741  1.00 139.64 ? 760 LYS A N  1 
ATOM 2830  C CA . LYS A 1 760 ? 174.887 168.487 50.868  1.00 139.64 ? 760 LYS A CA 1 
ATOM 2831  C C  . LYS A 1 760 ? 174.872 167.777 49.525  1.00 139.64 ? 760 LYS A C  1 
ATOM 2832  O O  . LYS A 1 760 ? 175.534 168.191 48.572  1.00 139.64 ? 760 LYS A O  1 
ATOM 2833  N N  . PHE A 1 761 ? 174.113 166.689 49.457  1.00 127.56 ? 761 PHE A N  1 
ATOM 2834  C CA . PHE A 1 761 ? 173.964 165.977 48.194  1.00 127.56 ? 761 PHE A CA 1 
ATOM 2835  C C  . PHE A 1 761 ? 173.130 166.784 47.211  1.00 127.56 ? 761 PHE A C  1 
ATOM 2836  O O  . PHE A 1 761 ? 173.599 167.142 46.125  1.00 127.56 ? 761 PHE A O  1 
ATOM 2837  N N  . TYR A 1 762 ? 171.897 167.104 47.586  1.00 129.47 ? 762 TYR A N  1 
ATOM 2838  C CA . TYR A 1 762 ? 171.028 167.867 46.702  1.00 129.47 ? 762 TYR A CA 1 
ATOM 2839  C C  . TYR A 1 762 ? 170.287 168.976 47.435  1.00 129.47 ? 762 TYR A C  1 
ATOM 2840  O O  . TYR A 1 762 ? 169.390 169.593 46.847  1.00 129.47 ? 762 TYR A O  1 
ATOM 2841  N N  . GLN A 1 763 ? 170.627 169.244 48.688  1.00 140.17 ? 763 GLN A N  1 
ATOM 2842  C CA . GLN A 1 763 ? 169.824 170.112 49.534  1.00 140.17 ? 763 GLN A CA 1 
ATOM 2843  C C  . GLN A 1 763 ? 170.696 171.100 50.299  1.00 140.17 ? 763 GLN A C  1 
ATOM 2844  O O  . GLN A 1 763 ? 171.609 171.706 49.734  1.00 140.17 ? 763 GLN A O  1 
ATOM 2845  N N  . PRO B 2 49  ? 115.130 125.404 4.559   1.00 67.42  ? 49  PRO B N  1 
ATOM 2846  C CA . PRO B 2 49  ? 113.791 125.371 3.968   1.00 67.42  ? 49  PRO B CA 1 
ATOM 2847  C C  . PRO B 2 49  ? 113.326 123.950 3.728   1.00 67.42  ? 49  PRO B C  1 
ATOM 2848  O O  . PRO B 2 49  ? 112.172 123.733 3.375   1.00 67.42  ? 49  PRO B O  1 
ATOM 2849  N N  . ASN B 2 50  ? 114.234 122.993 3.907   1.00 77.24  ? 50  ASN B N  1 
ATOM 2850  C CA . ASN B 2 50  ? 113.893 121.580 3.867   1.00 77.24  ? 50  ASN B CA 1 
ATOM 2851  C C  . ASN B 2 50  ? 113.950 120.932 5.239   1.00 77.24  ? 50  ASN B C  1 
ATOM 2852  O O  . ASN B 2 50  ? 113.777 119.714 5.347   1.00 77.24  ? 50  ASN B O  1 
ATOM 2853  N N  . ILE B 2 51  ? 114.198 121.714 6.287   1.00 69.31  ? 51  ILE B N  1 
ATOM 2854  C CA . ILE B 2 51  ? 114.150 121.199 7.643   1.00 69.31  ? 51  ILE B CA 1 
ATOM 2855  C C  . ILE B 2 51  ? 112.698 120.934 8.003   1.00 69.31  ? 51  ILE B C  1 
ATOM 2856  O O  . ILE B 2 51  ? 111.807 121.719 7.653   1.00 69.31  ? 51  ILE B O  1 
ATOM 2857  N N  . ARG B 2 52  ? 112.450 119.801 8.656   1.00 68.52  ? 52  ARG B N  1 
ATOM 2858  C CA . ARG B 2 52  ? 111.108 119.432 9.083   1.00 68.52  ? 52  ARG B CA 1 
ATOM 2859  C C  . ARG B 2 52  ? 110.552 120.459 10.053  1.00 68.52  ? 52  ARG B C  1 
ATOM 2860  O O  . ARG B 2 52  ? 111.278 120.998 10.888  1.00 68.52  ? 52  ARG B O  1 
ATOM 2861  N N  . ASN B 2 53  ? 109.266 120.753 9.924   1.00 61.12  ? 53  ASN B N  1 
ATOM 2862  C CA . ASN B 2 53  ? 108.669 121.730 10.812  1.00 61.12  ? 53  ASN B CA 1 
ATOM 2863  C C  . ASN B 2 53  ? 108.249 121.077 12.121  1.00 61.12  ? 53  ASN B C  1 
ATOM 2864  O O  . ASN B 2 53  ? 108.471 119.889 12.361  1.00 61.12  ? 53  ASN B O  1 
ATOM 2865  N N  . VAL B 2 54  ? 107.599 121.869 12.966  1.00 51.03  ? 54  VAL B N  1 
ATOM 2866  C CA . VAL B 2 54  ? 107.418 121.528 14.366  1.00 51.03  ? 54  VAL B CA 1 
ATOM 2867  C C  . VAL B 2 54  ? 106.280 122.378 14.916  1.00 51.03  ? 54  VAL B C  1 
ATOM 2868  O O  . VAL B 2 54  ? 106.032 123.493 14.455  1.00 51.03  ? 54  VAL B O  1 
ATOM 2869  N N  . VAL B 2 55  ? 105.531 121.821 15.863  1.00 43.76  ? 55  VAL B N  1 
ATOM 2870  C CA . VAL B 2 55  ? 104.190 122.303 16.166  1.00 43.76  ? 55  VAL B CA 1 
ATOM 2871  C C  . VAL B 2 55  ? 103.923 122.230 17.662  1.00 43.76  ? 55  VAL B C  1 
ATOM 2872  O O  . VAL B 2 55  ? 104.209 121.213 18.298  1.00 43.76  ? 55  VAL B O  1 
ATOM 2873  N N  . VAL B 2 56  ? 103.381 123.312 18.219  1.00 28.24  ? 56  VAL B N  1 
ATOM 2874  C CA . VAL B 2 56  ? 102.837 123.330 19.569  1.00 28.24  ? 56  VAL B CA 1 
ATOM 2875  C C  . VAL B 2 56  ? 101.380 122.895 19.518  1.00 28.24  ? 56  VAL B C  1 
ATOM 2876  O O  . VAL B 2 56  ? 100.616 123.366 18.676  1.00 28.24  ? 56  VAL B O  1 
ATOM 2877  N N  . VAL B 2 57  ? 100.988 121.998 20.419  1.00 27.89  ? 57  VAL B N  1 
ATOM 2878  C CA . VAL B 2 57  ? 99.599  121.576 20.540  1.00 27.89  ? 57  VAL B CA 1 
ATOM 2879  C C  . VAL B 2 57  ? 99.198  122.077 21.926  1.00 27.89  ? 57  VAL B C  1 
ATOM 2880  O O  . VAL B 2 57  ? 99.975  122.795 22.555  1.00 27.89  ? 57  VAL B O  1 
ATOM 2881  N N  . ASP B 2 58  ? 97.993  121.758 22.396  1.00 38.11  ? 58  ASP B N  1 
ATOM 2882  C CA . ASP B 2 58  ? 97.325  122.508 23.456  1.00 38.11  ? 58  ASP B CA 1 
ATOM 2883  C C  . ASP B 2 58  ? 98.045  122.419 24.799  1.00 38.11  ? 58  ASP B C  1 
ATOM 2884  O O  . ASP B 2 58  ? 98.301  121.330 25.312  1.00 38.11  ? 58  ASP B O  1 
ATOM 2885  N N  . GLY B 2 59  ? 98.387  123.584 25.339  1.00 30.11  ? 59  GLY B N  1 
ATOM 2886  C CA . GLY B 2 59  ? 99.284  123.781 26.462  1.00 30.11  ? 59  GLY B CA 1 
ATOM 2887  C C  . GLY B 2 59  ? 98.756  123.853 27.882  1.00 30.11  ? 59  GLY B C  1 
ATOM 2888  O O  . GLY B 2 59  ? 98.542  124.955 28.386  1.00 30.11  ? 59  GLY B O  1 
ATOM 2889  N N  . VAL B 2 60  ? 98.509  122.713 28.521  1.00 26.37  ? 60  VAL B N  1 
ATOM 2890  C CA . VAL B 2 60  ? 97.915  122.675 29.855  1.00 26.37  ? 60  VAL B CA 1 
ATOM 2891  C C  . VAL B 2 60  ? 98.791  123.345 30.904  1.00 26.37  ? 60  VAL B C  1 
ATOM 2892  O O  . VAL B 2 60  ? 99.994  123.096 30.977  1.00 26.37  ? 60  VAL B O  1 
ATOM 2893  N N  . ARG B 2 61  ? 98.183  124.204 31.727  1.00 34.45  ? 61  ARG B N  1 
ATOM 2894  C CA . ARG B 2 61  ? 98.842  124.841 32.867  1.00 34.45  ? 61  ARG B CA 1 
ATOM 2895  C C  . ARG B 2 61  ? 97.969  124.744 34.108  1.00 34.45  ? 61  ARG B C  1 
ATOM 2896  O O  . ARG B 2 61  ? 96.894  125.340 34.148  1.00 34.45  ? 61  ARG B O  1 
ATOM 2897  N N  . THR B 2 62  ? 98.425  124.026 35.125  1.00 33.20  ? 62  THR B N  1 
ATOM 2898  C CA . THR B 2 62  ? 97.741  124.068 36.408  1.00 33.20  ? 62  THR B CA 1 
ATOM 2899  C C  . THR B 2 62  ? 97.944  125.439 37.045  1.00 33.20  ? 62  THR B C  1 
ATOM 2900  O O  . THR B 2 62  ? 98.984  126.055 36.844  1.00 33.20  ? 62  THR B O  1 
ATOM 2901  N N  . PRO B 2 63  ? 96.950  125.978 37.742  1.00 35.56  ? 63  PRO B N  1 
ATOM 2902  C CA . PRO B 2 63  ? 97.005  127.395 38.090  1.00 35.56  ? 63  PRO B CA 1 
ATOM 2903  C C  . PRO B 2 63  ? 97.960  127.671 39.225  1.00 35.56  ? 63  PRO B C  1 
ATOM 2904  O O  . PRO B 2 63  ? 98.230  126.819 40.069  1.00 35.56  ? 63  PRO B O  1 
ATOM 2905  N N  . PHE B 2 64  ? 98.453  128.896 39.233  1.00 38.39  ? 64  PHE B N  1 
ATOM 2906  C CA . PHE B 2 64  ? 99.532  129.281 40.118  1.00 38.39  ? 64  PHE B CA 1 
ATOM 2907  C C  . PHE B 2 64  ? 98.964  129.821 41.412  1.00 38.39  ? 64  PHE B C  1 
ATOM 2908  O O  . PHE B 2 64  ? 98.106  130.704 41.404  1.00 38.39  ? 64  PHE B O  1 
ATOM 2909  N N  . LEU B 2 65  ? 99.437  129.288 42.519  1.00 41.64  ? 65  LEU B N  1 
ATOM 2910  C CA . LEU B 2 65  ? 98.952  129.665 43.830  1.00 41.64  ? 65  LEU B CA 1 
ATOM 2911  C C  . LEU B 2 65  ? 100.093 130.303 44.591  1.00 41.64  ? 65  LEU B C  1 
ATOM 2912  O O  . LEU B 2 65  ? 101.232 129.840 44.507  1.00 41.64  ? 65  LEU B O  1 
ATOM 2913  N N  . LEU B 2 66  ? 99.801  131.387 45.294  1.00 47.73  ? 66  LEU B N  1 
ATOM 2914  C CA . LEU B 2 66  ? 100.783 131.962 46.197  1.00 47.73  ? 66  LEU B CA 1 
ATOM 2915  C C  . LEU B 2 66  ? 101.054 130.986 47.332  1.00 47.73  ? 66  LEU B C  1 
ATOM 2916  O O  . LEU B 2 66  ? 100.150 130.286 47.792  1.00 47.73  ? 66  LEU B O  1 
ATOM 2917  N N  . SER B 2 67  ? 102.313 130.901 47.746  1.00 51.45  ? 67  SER B N  1 
ATOM 2918  C CA . SER B 2 67  ? 102.714 129.861 48.681  1.00 51.45  ? 67  SER B CA 1 
ATOM 2919  C C  . SER B 2 67  ? 102.155 130.138 50.062  1.00 51.45  ? 67  SER B C  1 
ATOM 2920  O O  . SER B 2 67  ? 102.183 131.271 50.543  1.00 51.45  ? 67  SER B O  1 
ATOM 2921  N N  . GLY B 2 68  ? 101.646 129.091 50.697  1.00 51.38  ? 68  GLY B N  1 
ATOM 2922  C CA . GLY B 2 68  ? 100.905 129.195 51.933  1.00 51.38  ? 68  GLY B CA 1 
ATOM 2923  C C  . GLY B 2 68  ? 99.470  128.748 51.804  1.00 51.38  ? 68  GLY B C  1 
ATOM 2924  O O  . GLY B 2 68  ? 98.834  128.437 52.816  1.00 51.38  ? 68  GLY B O  1 
ATOM 2925  N N  . THR B 2 69  ? 98.954  128.701 50.587  1.00 53.27  ? 69  THR B N  1 
ATOM 2926  C CA . THR B 2 69  ? 97.635  128.163 50.296  1.00 53.27  ? 69  THR B CA 1 
ATOM 2927  C C  . THR B 2 69  ? 97.840  126.676 49.979  1.00 53.27  ? 69  THR B C  1 
ATOM 2928  O O  . THR B 2 69  ? 98.871  126.106 50.343  1.00 53.27  ? 69  THR B O  1 
ATOM 2929  N N  . SER B 2 70  ? 96.886  126.032 49.312  1.00 54.55  ? 70  SER B N  1 
ATOM 2930  C CA . SER B 2 70  ? 96.730  124.585 49.276  1.00 54.55  ? 70  SER B CA 1 
ATOM 2931  C C  . SER B 2 70  ? 97.892  123.769 48.720  1.00 54.55  ? 70  SER B C  1 
ATOM 2932  O O  . SER B 2 70  ? 97.880  122.544 48.829  1.00 54.55  ? 70  SER B O  1 
ATOM 2933  N N  . TYR B 2 71  ? 98.908  124.402 48.151  1.00 49.30  ? 71  TYR B N  1 
ATOM 2934  C CA . TYR B 2 71  ? 100.070 123.651 47.706  1.00 49.30  ? 71  TYR B CA 1 
ATOM 2935  C C  . TYR B 2 71  ? 101.145 123.541 48.770  1.00 49.30  ? 71  TYR B C  1 
ATOM 2936  O O  . TYR B 2 71  ? 102.259 123.116 48.459  1.00 49.30  ? 71  TYR B O  1 
ATOM 2937  N N  . LYS B 2 72  ? 100.851 123.905 50.012  1.00 63.81  ? 72  LYS B N  1 
ATOM 2938  C CA . LYS B 2 72  ? 101.801 123.686 51.094  1.00 63.81  ? 72  LYS B CA 1 
ATOM 2939  C C  . LYS B 2 72  ? 101.697 122.291 51.673  1.00 63.81  ? 72  LYS B C  1 
ATOM 2940  O O  . LYS B 2 72  ? 102.367 121.985 52.662  1.00 63.81  ? 72  LYS B O  1 
ATOM 2941  N N  . ASP B 2 73  ? 100.874 121.444 51.070  1.00 66.78  ? 73  ASP B N  1 
ATOM 2942  C CA . ASP B 2 73  ? 100.727 120.068 51.485  1.00 66.78  ? 73  ASP B CA 1 
ATOM 2943  C C  . ASP B 2 73  ? 101.358 119.096 50.506  1.00 66.78  ? 73  ASP B C  1 
ATOM 2944  O O  . ASP B 2 73  ? 101.603 117.945 50.874  1.00 66.78  ? 73  ASP B O  1 
ATOM 2945  N N  . LEU B 2 74  ? 101.661 119.532 49.291  1.00 54.38  ? 74  LEU B N  1 
ATOM 2946  C CA . LEU B 2 74  ? 101.927 118.605 48.207  1.00 54.38  ? 74  LEU B CA 1 
ATOM 2947  C C  . LEU B 2 74  ? 103.333 118.034 48.290  1.00 54.38  ? 74  LEU B C  1 
ATOM 2948  O O  . LEU B 2 74  ? 104.063 118.209 49.266  1.00 54.38  ? 74  LEU B O  1 
ATOM 2949  N N  . MET B 2 75  ? 103.703 117.330 47.228  1.00 53.87  ? 75  MET B N  1 
ATOM 2950  C CA . MET B 2 75  ? 104.936 116.604 47.117  1.00 53.87  ? 75  MET B CA 1 
ATOM 2951  C C  . MET B 2 75  ? 105.504 116.887 45.735  1.00 53.87  ? 75  MET B C  1 
ATOM 2952  O O  . MET B 2 75  ? 104.850 116.591 44.730  1.00 53.87  ? 75  MET B O  1 
ATOM 2953  N N  . PRO B 2 76  ? 106.733 117.401 45.652  1.00 50.60  ? 76  PRO B N  1 
ATOM 2954  C CA . PRO B 2 76  ? 107.187 118.113 44.443  1.00 50.60  ? 76  PRO B CA 1 
ATOM 2955  C C  . PRO B 2 76  ? 107.299 117.339 43.143  1.00 50.60  ? 76  PRO B C  1 
ATOM 2956  O O  . PRO B 2 76  ? 107.851 117.863 42.177  1.00 50.60  ? 76  PRO B O  1 
ATOM 2957  N N  . HIS B 2 77  ? 106.820 116.104 43.098  1.00 49.52  ? 77  HIS B N  1 
ATOM 2958  C CA . HIS B 2 77  ? 106.527 115.488 41.818  1.00 49.52  ? 77  HIS B CA 1 
ATOM 2959  C C  . HIS B 2 77  ? 105.056 115.185 41.617  1.00 49.52  ? 77  HIS B C  1 
ATOM 2960  O O  . HIS B 2 77  ? 104.731 114.412 40.716  1.00 49.52  ? 77  HIS B O  1 
ATOM 2961  N N  . ASP B 2 78  ? 104.162 115.741 42.422  1.00 53.39  ? 78  ASP B N  1 
ATOM 2962  C CA . ASP B 2 78  ? 102.765 115.358 42.293  1.00 53.39  ? 78  ASP B CA 1 
ATOM 2963  C C  . ASP B 2 78  ? 101.976 116.246 41.357  1.00 53.39  ? 78  ASP B C  1 
ATOM 2964  O O  . ASP B 2 78  ? 101.147 115.746 40.596  1.00 53.39  ? 78  ASP B O  1 
ATOM 2965  N N  . LEU B 2 79  ? 102.164 117.555 41.403  1.00 43.67  ? 79  LEU B N  1 
ATOM 2966  C CA . LEU B 2 79  ? 101.429 118.386 40.462  1.00 43.67  ? 79  LEU B CA 1 
ATOM 2967  C C  . LEU B 2 79  ? 102.058 118.351 39.085  1.00 43.67  ? 79  LEU B C  1 
ATOM 2968  O O  . LEU B 2 79  ? 101.424 118.758 38.107  1.00 43.67  ? 79  LEU B O  1 
ATOM 2969  N N  . ALA B 2 80  ? 103.287 117.843 38.983  1.00 36.70  ? 80  ALA B N  1 
ATOM 2970  C CA . ALA B 2 80  ? 103.769 117.323 37.711  1.00 36.70  ? 80  ALA B CA 1 
ATOM 2971  C C  . ALA B 2 80  ? 102.802 116.315 37.135  1.00 36.70  ? 80  ALA B C  1 
ATOM 2972  O O  . ALA B 2 80  ? 102.378 116.444 35.980  1.00 36.70  ? 80  ALA B O  1 
ATOM 2973  N N  . ARG B 2 81  ? 102.417 115.339 37.949  1.00 43.87  ? 81  ARG B N  1 
ATOM 2974  C CA . ARG B 2 81  ? 101.468 114.317 37.544  1.00 43.87  ? 81  ARG B CA 1 
ATOM 2975  C C  . ARG B 2 81  ? 100.108 114.915 37.252  1.00 43.87  ? 81  ARG B C  1 
ATOM 2976  O O  . ARG B 2 81  ? 99.429  114.479 36.320  1.00 43.87  ? 81  ARG B O  1 
ATOM 2977  N N  . ALA B 2 82  ? 99.714  115.937 38.010  1.00 40.49  ? 82  ALA B N  1 
ATOM 2978  C CA . ALA B 2 82  ? 98.420  116.563 37.764  1.00 40.49  ? 82  ALA B CA 1 
ATOM 2979  C C  . ALA B 2 82  ? 98.397  117.284 36.424  1.00 40.49  ? 82  ALA B C  1 
ATOM 2980  O O  . ALA B 2 82  ? 97.466  117.098 35.631  1.00 40.49  ? 82  ALA B O  1 
ATOM 2981  N N  . ALA B 2 83  ? 99.434  118.075 36.142  1.00 31.72  ? 83  ALA B N  1 
ATOM 2982  C CA . ALA B 2 83  ? 99.509  118.802 34.882  1.00 31.72  ? 83  ALA B CA 1 
ATOM 2983  C C  . ALA B 2 83  ? 99.634  117.853 33.712  1.00 31.72  ? 83  ALA B C  1 
ATOM 2984  O O  . ALA B 2 83  ? 99.054  118.082 32.648  1.00 31.72  ? 83  ALA B O  1 
ATOM 2985  N N  . LEU B 2 84  ? 100.336 116.748 33.905  1.00 36.55  ? 84  LEU B N  1 
ATOM 2986  C CA . LEU B 2 84  ? 100.519 115.816 32.809  1.00 36.55  ? 84  LEU B CA 1 
ATOM 2987  C C  . LEU B 2 84  ? 99.243  115.026 32.527  1.00 36.55  ? 84  LEU B C  1 
ATOM 2988  O O  . LEU B 2 84  ? 98.914  114.786 31.360  1.00 36.55  ? 84  LEU B O  1 
ATOM 2989  N N  . THR B 2 85  ? 98.500  114.634 33.568  1.00 40.73  ? 85  THR B N  1 
ATOM 2990  C CA . THR B 2 85  ? 97.205  114.001 33.342  1.00 40.73  ? 85  THR B CA 1 
ATOM 2991  C C  . THR B 2 85  ? 96.226  114.960 32.701  1.00 40.73  ? 85  THR B C  1 
ATOM 2992  O O  . THR B 2 85  ? 95.401  114.555 31.875  1.00 40.73  ? 85  THR B O  1 
ATOM 2993  N N  . GLY B 2 86  ? 96.293  116.234 33.075  1.00 40.17  ? 86  GLY B N  1 
ATOM 2994  C CA . GLY B 2 86  ? 95.471  117.221 32.408  1.00 40.17  ? 86  GLY B CA 1 
ATOM 2995  C C  . GLY B 2 86  ? 95.840  117.391 30.953  1.00 40.17  ? 86  GLY B C  1 
ATOM 2996  O O  . GLY B 2 86  ? 94.974  117.660 30.118  1.00 40.17  ? 86  GLY B O  1 
ATOM 2997  N N  . LEU B 2 87  ? 97.125  117.235 30.629  1.00 39.41  ? 87  LEU B N  1 
ATOM 2998  C CA . LEU B 2 87  ? 97.517  117.219 29.229  1.00 39.41  ? 87  LEU B CA 1 
ATOM 2999  C C  . LEU B 2 87  ? 96.943  116.008 28.532  1.00 39.41  ? 87  LEU B C  1 
ATOM 3000  O O  . LEU B 2 87  ? 96.498  116.104 27.387  1.00 39.41  ? 87  LEU B O  1 
ATOM 3001  N N  . LEU B 2 88  ? 96.923  114.869 29.210  1.00 43.09  ? 88  LEU B N  1 
ATOM 3002  C CA . LEU B 2 88  ? 96.312  113.697 28.599  1.00 43.09  ? 88  LEU B CA 1 
ATOM 3003  C C  . LEU B 2 88  ? 94.803  113.691 28.716  1.00 43.09  ? 88  LEU B C  1 
ATOM 3004  O O  . LEU B 2 88  ? 94.169  112.718 28.303  1.00 43.09  ? 88  LEU B O  1 
ATOM 3005  N N  . HIS B 2 89  ? 94.209  114.739 29.272  1.00 46.06  ? 89  HIS B N  1 
ATOM 3006  C CA . HIS B 2 89  ? 92.761  114.791 29.300  1.00 46.06  ? 89  HIS B CA 1 
ATOM 3007  C C  . HIS B 2 89  ? 92.184  115.498 28.085  1.00 46.06  ? 89  HIS B C  1 
ATOM 3008  O O  . HIS B 2 89  ? 91.097  115.135 27.630  1.00 46.06  ? 89  HIS B O  1 
ATOM 3009  N N  . ARG B 2 90  ? 92.866  116.509 27.557  1.00 40.20  ? 90  ARG B N  1 
ATOM 3010  C CA . ARG B 2 90  ? 92.326  117.272 26.443  1.00 40.20  ? 90  ARG B CA 1 
ATOM 3011  C C  . ARG B 2 90  ? 93.067  117.033 25.146  1.00 40.20  ? 90  ARG B C  1 
ATOM 3012  O O  . ARG B 2 90  ? 92.875  117.786 24.188  1.00 40.20  ? 90  ARG B O  1 
ATOM 3013  N N  . THR B 2 91  ? 93.894  116.000 25.071  1.00 57.32  ? 91  THR B N  1 
ATOM 3014  C CA . THR B 2 91  ? 94.605  115.765 23.832  1.00 57.32  ? 91  THR B CA 1 
ATOM 3015  C C  . THR B 2 91  ? 94.127  114.543 23.069  1.00 57.32  ? 91  THR B C  1 
ATOM 3016  O O  . THR B 2 91  ? 94.412  114.451 21.873  1.00 57.32  ? 91  THR B O  1 
ATOM 3017  N N  . SER B 2 92  ? 93.430  113.606 23.724  1.00 64.16  ? 92  SER B N  1 
ATOM 3018  C CA . SER B 2 92  ? 92.883  112.370 23.136  1.00 64.16  ? 92  SER B CA 1 
ATOM 3019  C C  . SER B 2 92  ? 93.933  111.508 22.415  1.00 64.16  ? 92  SER B C  1 
ATOM 3020  O O  . SER B 2 92  ? 93.581  110.643 21.611  1.00 64.16  ? 92  SER B O  1 
ATOM 3021  N N  . VAL B 2 93  ? 95.216  111.706 22.696  1.00 62.77  ? 93  VAL B N  1 
ATOM 3022  C CA . VAL B 2 93  ? 96.294  111.004 22.011  1.00 62.77  ? 93  VAL B CA 1 
ATOM 3023  C C  . VAL B 2 93  ? 96.415  109.637 22.664  1.00 62.77  ? 93  VAL B C  1 
ATOM 3024  O O  . VAL B 2 93  ? 96.243  109.536 23.886  1.00 62.77  ? 93  VAL B O  1 
ATOM 3025  N N  . PRO B 2 94  ? 96.618  108.565 21.900  1.00 60.11  ? 94  PRO B N  1 
ATOM 3026  C CA . PRO B 2 94  ? 96.984  107.280 22.508  1.00 60.11  ? 94  PRO B CA 1 
ATOM 3027  C C  . PRO B 2 94  ? 98.266  107.416 23.311  1.00 60.11  ? 94  PRO B C  1 
ATOM 3028  O O  . PRO B 2 94  ? 99.228  108.046 22.877  1.00 60.11  ? 94  PRO B O  1 
ATOM 3029  N N  . LYS B 2 95  ? 98.274  106.818 24.493  1.00 46.08  ? 95  LYS B N  1 
ATOM 3030  C CA . LYS B 2 95  ? 99.342  107.021 25.457  1.00 46.08  ? 95  LYS B CA 1 
ATOM 3031  C C  . LYS B 2 95  ? 100.629 106.298 25.087  1.00 46.08  ? 95  LYS B C  1 
ATOM 3032  O O  . LYS B 2 95  ? 101.603 106.377 25.839  1.00 46.08  ? 95  LYS B O  1 
ATOM 3033  N N  . GLU B 2 96  ? 100.651 105.588 23.968  1.00 51.20  ? 96  GLU B N  1 
ATOM 3034  C CA . GLU B 2 96  ? 101.829 104.890 23.491  1.00 51.20  ? 96  GLU B CA 1 
ATOM 3035  C C  . GLU B 2 96  ? 102.486 105.600 22.322  1.00 51.20  ? 96  GLU B C  1 
ATOM 3036  O O  . GLU B 2 96  ? 103.508 105.127 21.820  1.00 51.20  ? 96  GLU B O  1 
ATOM 3037  N N  . VAL B 2 97  ? 101.917 106.711 21.872  1.00 47.30  ? 97  VAL B N  1 
ATOM 3038  C CA . VAL B 2 97  ? 102.421 107.426 20.712  1.00 47.30  ? 97  VAL B CA 1 
ATOM 3039  C C  . VAL B 2 97  ? 103.347 108.520 21.209  1.00 47.30  ? 97  VAL B C  1 
ATOM 3040  O O  . VAL B 2 97  ? 104.336 108.850 20.548  1.00 47.30  ? 97  VAL B O  1 
ATOM 3041  N N  . VAL B 2 98  ? 103.044 109.060 22.393  1.00 45.85  ? 98  VAL B N  1 
ATOM 3042  C CA . VAL B 2 98  ? 103.865 110.075 23.049  1.00 45.85  ? 98  VAL B CA 1 
ATOM 3043  C C  . VAL B 2 98  ? 105.257 109.517 23.290  1.00 45.85  ? 98  VAL B C  1 
ATOM 3044  O O  . VAL B 2 98  ? 105.423 108.427 23.837  1.00 45.85  ? 98  VAL B O  1 
ATOM 3045  N N  . ASP B 2 99  ? 106.268 110.202 22.780  1.00 40.82  ? 99  ASP B N  1 
ATOM 3046  C CA . ASP B 2 99  ? 107.538 109.513 22.641  1.00 40.82  ? 99  ASP B CA 1 
ATOM 3047  C C  . ASP B 2 99  ? 108.489 109.779 23.797  1.00 40.82  ? 99  ASP B C  1 
ATOM 3048  O O  . ASP B 2 99  ? 108.910 108.846 24.481  1.00 40.82  ? 99  ASP B O  1 
ATOM 3049  N N  . TYR B 2 100 ? 108.851 111.031 24.019  1.00 34.43  ? 100 TYR B N  1 
ATOM 3050  C CA . TYR B 2 100 ? 110.034 111.347 24.810  1.00 34.43  ? 100 TYR B CA 1 
ATOM 3051  C C  . TYR B 2 100 ? 109.767 112.553 25.692  1.00 34.43  ? 100 TYR B C  1 
ATOM 3052  O O  . TYR B 2 100 ? 110.084 113.673 25.309  1.00 34.43  ? 100 TYR B O  1 
ATOM 3053  N N  . ILE B 2 101 ? 109.236 112.331 26.887  1.00 29.38  ? 101 ILE B N  1 
ATOM 3054  C CA . ILE B 2 101 ? 108.801 113.456 27.703  1.00 29.38  ? 101 ILE B CA 1 
ATOM 3055  C C  . ILE B 2 101 ? 110.007 113.996 28.452  1.00 29.38  ? 101 ILE B C  1 
ATOM 3056  O O  . ILE B 2 101 ? 110.891 113.235 28.842  1.00 29.38  ? 101 ILE B O  1 
ATOM 3057  N N  . ILE B 2 102 ? 110.087 115.314 28.592  1.00 30.93  ? 102 ILE B N  1 
ATOM 3058  C CA . ILE B 2 102 ? 111.175 115.971 29.299  1.00 30.93  ? 102 ILE B CA 1 
ATOM 3059  C C  . ILE B 2 102 ? 110.601 117.096 30.136  1.00 30.93  ? 102 ILE B C  1 
ATOM 3060  O O  . ILE B 2 102 ? 109.769 117.875 29.668  1.00 30.93  ? 102 ILE B O  1 
ATOM 3061  N N  . PHE B 2 103 ? 111.021 117.166 31.375  1.00 24.21  ? 103 PHE B N  1 
ATOM 3062  C CA . PHE B 2 103 ? 110.522 118.168 32.295  1.00 24.21  ? 103 PHE B CA 1 
ATOM 3063  C C  . PHE B 2 103 ? 111.650 119.082 32.715  1.00 24.21  ? 103 PHE B C  1 
ATOM 3064  O O  . PHE B 2 103 ? 112.742 119.038 32.167  1.00 24.21  ? 103 PHE B O  1 
ATOM 3065  N N  . GLY B 2 104 ? 111.372 119.930 33.685  1.00 28.71  ? 104 GLY B N  1 
ATOM 3066  C CA . GLY B 2 104 ? 112.440 120.725 34.224  1.00 28.71  ? 104 GLY B CA 1 
ATOM 3067  C C  . GLY B 2 104 ? 112.109 121.351 35.551  1.00 28.71  ? 104 GLY B C  1 
ATOM 3068  O O  . GLY B 2 104 ? 111.101 122.036 35.683  1.00 28.71  ? 104 GLY B O  1 
ATOM 3069  N N  . THR B 2 105 ? 112.963 121.140 36.533  1.00 30.86  ? 105 THR B N  1 
ATOM 3070  C CA . THR B 2 105 ? 112.776 121.659 37.871  1.00 30.86  ? 105 THR B CA 1 
ATOM 3071  C C  . THR B 2 105 ? 113.883 122.653 38.167  1.00 30.86  ? 105 THR B C  1 
ATOM 3072  O O  . THR B 2 105 ? 114.602 123.093 37.273  1.00 30.86  ? 105 THR B O  1 
ATOM 3073  N N  . VAL B 2 106 ? 114.002 123.040 39.429  1.00 47.49  ? 106 VAL B N  1 
ATOM 3074  C CA . VAL B 2 106 ? 115.160 123.809 39.859  1.00 47.49  ? 106 VAL B CA 1 
ATOM 3075  C C  . VAL B 2 106 ? 115.611 123.305 41.225  1.00 47.49  ? 106 VAL B C  1 
ATOM 3076  O O  . VAL B 2 106 ? 116.756 123.509 41.634  1.00 47.49  ? 106 VAL B O  1 
ATOM 3077  N N  . ILE B 2 107 ? 114.730 122.603 41.923  1.00 54.18  ? 107 ILE B N  1 
ATOM 3078  C CA . ILE B 2 107 ? 114.990 122.242 43.310  1.00 54.18  ? 107 ILE B CA 1 
ATOM 3079  C C  . ILE B 2 107 ? 115.567 120.841 43.438  1.00 54.18  ? 107 ILE B C  1 
ATOM 3080  O O  . ILE B 2 107 ? 116.491 120.629 44.229  1.00 54.18  ? 107 ILE B O  1 
ATOM 3081  N N  . GLN B 2 108 ? 115.033 119.900 42.655  1.00 54.70  ? 108 GLN B N  1 
ATOM 3082  C CA . GLN B 2 108 ? 115.491 118.512 42.572  1.00 54.70  ? 108 GLN B CA 1 
ATOM 3083  C C  . GLN B 2 108 ? 115.354 117.817 43.931  1.00 54.70  ? 108 GLN B C  1 
ATOM 3084  O O  . GLN B 2 108 ? 116.325 117.614 44.658  1.00 54.70  ? 108 GLN B O  1 
ATOM 3085  N N  . GLU B 2 109 ? 114.095 117.541 44.280  1.00 64.40  ? 109 GLU B N  1 
ATOM 3086  C CA . GLU B 2 109 ? 113.740 116.814 45.496  1.00 64.40  ? 109 GLU B CA 1 
ATOM 3087  C C  . GLU B 2 109 ? 114.411 115.451 45.516  1.00 64.40  ? 109 GLU B C  1 
ATOM 3088  O O  . GLU B 2 109 ? 113.995 114.545 44.793  1.00 64.40  ? 109 GLU B O  1 
ATOM 3089  N N  . VAL B 2 110 ? 115.414 115.277 46.380  1.00 65.99  ? 110 VAL B N  1 
ATOM 3090  C CA . VAL B 2 110 ? 116.428 114.254 46.134  1.00 65.99  ? 110 VAL B CA 1 
ATOM 3091  C C  . VAL B 2 110 ? 116.016 112.877 46.620  1.00 65.99  ? 110 VAL B C  1 
ATOM 3092  O O  . VAL B 2 110 ? 116.734 111.900 46.365  1.00 65.99  ? 110 VAL B O  1 
ATOM 3093  N N  . LYS B 2 111 ? 114.876 112.756 47.298  1.00 63.35  ? 111 LYS B N  1 
ATOM 3094  C CA . LYS B 2 111 ? 114.340 111.424 47.552  1.00 63.35  ? 111 LYS B CA 1 
ATOM 3095  C C  . LYS B 2 111 ? 113.968 110.741 46.247  1.00 63.35  ? 111 LYS B C  1 
ATOM 3096  O O  . LYS B 2 111 ? 114.144 109.527 46.102  1.00 63.35  ? 111 LYS B O  1 
ATOM 3097  N N  . THR B 2 112 ? 113.521 111.513 45.267  1.00 60.65  ? 112 THR B N  1 
ATOM 3098  C CA . THR B 2 112 ? 113.313 111.001 43.921  1.00 60.65  ? 112 THR B CA 1 
ATOM 3099  C C  . THR B 2 112 ? 113.947 111.948 42.911  1.00 60.65  ? 112 THR B C  1 
ATOM 3100  O O  . THR B 2 112 ? 113.355 112.964 42.539  1.00 60.65  ? 112 THR B O  1 
ATOM 3101  N N  . SER B 2 113 ? 115.133 111.582 42.433  1.00 56.75  ? 113 SER B N  1 
ATOM 3102  C CA . SER B 2 113 ? 115.777 112.283 41.333  1.00 56.75  ? 113 SER B CA 1 
ATOM 3103  C C  . SER B 2 113 ? 115.045 111.999 40.025  1.00 56.75  ? 113 SER B C  1 
ATOM 3104  O O  . SER B 2 113 ? 114.052 111.271 39.997  1.00 56.75  ? 113 SER B O  1 
ATOM 3105  N N  . ASN B 2 114 ? 115.540 112.636 38.955  1.00 39.16  ? 114 ASN B N  1 
ATOM 3106  C CA . ASN B 2 114 ? 115.050 112.670 37.570  1.00 39.16  ? 114 ASN B CA 1 
ATOM 3107  C C  . ASN B 2 114 ? 113.532 112.591 37.437  1.00 39.16  ? 114 ASN B C  1 
ATOM 3108  O O  . ASN B 2 114 ? 112.995 111.651 36.844  1.00 39.16  ? 114 ASN B O  1 
ATOM 3109  N N  . VAL B 2 115 ? 112.869 113.632 37.961  1.00 35.54  ? 115 VAL B N  1 
ATOM 3110  C CA . VAL B 2 115 ? 111.432 113.812 38.187  1.00 35.54  ? 115 VAL B CA 1 
ATOM 3111  C C  . VAL B 2 115 ? 110.556 113.236 37.088  1.00 35.54  ? 115 VAL B C  1 
ATOM 3112  O O  . VAL B 2 115 ? 109.572 112.540 37.359  1.00 35.54  ? 115 VAL B O  1 
ATOM 3113  N N  . ALA B 2 116 ? 110.969 113.462 35.848  1.00 41.59  ? 116 ALA B N  1 
ATOM 3114  C CA . ALA B 2 116 ? 110.162 113.128 34.687  1.00 41.59  ? 116 ALA B CA 1 
ATOM 3115  C C  . ALA B 2 116 ? 109.923 111.633 34.524  1.00 41.59  ? 116 ALA B C  1 
ATOM 3116  O O  . ALA B 2 116 ? 108.851 111.251 34.055  1.00 41.59  ? 116 ALA B O  1 
ATOM 3117  N N  . ARG B 2 117 ? 110.881 110.782 34.921  1.00 43.08  ? 117 ARG B N  1 
ATOM 3118  C CA . ARG B 2 117 ? 110.735 109.333 34.742  1.00 43.08  ? 117 ARG B CA 1 
ATOM 3119  C C  . ARG B 2 117 ? 109.551 108.789 35.519  1.00 43.08  ? 117 ARG B C  1 
ATOM 3120  O O  . ARG B 2 117 ? 108.586 108.270 34.940  1.00 43.08  ? 117 ARG B O  1 
ATOM 3121  N N  . GLU B 2 118 ? 109.581 108.943 36.834  1.00 45.56  ? 118 GLU B N  1 
ATOM 3122  C CA . GLU B 2 118 ? 108.472 108.443 37.625  1.00 45.56  ? 118 GLU B CA 1 
ATOM 3123  C C  . GLU B 2 118 ? 107.269 109.357 37.520  1.00 45.56  ? 118 GLU B C  1 
ATOM 3124  O O  . GLU B 2 118 ? 106.143 108.945 37.805  1.00 45.56  ? 118 GLU B O  1 
ATOM 3125  N N  . ALA B 2 119 ? 107.473 110.608 37.114  1.00 37.81  ? 119 ALA B N  1 
ATOM 3126  C CA . ALA B 2 119 ? 106.331 111.492 36.940  1.00 37.81  ? 119 ALA B CA 1 
ATOM 3127  C C  . ALA B 2 119 ? 105.561 111.196 35.671  1.00 37.81  ? 119 ALA B C  1 
ATOM 3128  O O  . ALA B 2 119 ? 104.418 111.633 35.548  1.00 37.81  ? 119 ALA B O  1 
ATOM 3129  N N  . ALA B 2 120 ? 106.167 110.500 34.723  1.00 35.57  ? 120 ALA B N  1 
ATOM 3130  C CA . ALA B 2 120 ? 105.425 109.927 33.617  1.00 35.57  ? 120 ALA B CA 1 
ATOM 3131  C C  . ALA B 2 120 ? 104.905 108.551 33.950  1.00 35.57  ? 120 ALA B C  1 
ATOM 3132  O O  . ALA B 2 120 ? 103.844 108.162 33.455  1.00 35.57  ? 120 ALA B O  1 
ATOM 3133  N N  . LEU B 2 121 ? 105.628 107.803 34.780  1.00 39.78  ? 121 LEU B N  1 
ATOM 3134  C CA . LEU B 2 121 ? 105.126 106.492 35.158  1.00 39.78  ? 121 LEU B CA 1 
ATOM 3135  C C  . LEU B 2 121 ? 103.921 106.607 36.082  1.00 39.78  ? 121 LEU B C  1 
ATOM 3136  O O  . LEU B 2 121 ? 103.079 105.706 36.116  1.00 39.78  ? 121 LEU B O  1 
ATOM 3137  N N  . GLY B 2 122 ? 103.806 107.711 36.808  1.00 39.06  ? 122 GLY B N  1 
ATOM 3138  C CA . GLY B 2 122 ? 102.719 107.903 37.739  1.00 39.06  ? 122 GLY B CA 1 
ATOM 3139  C C  . GLY B 2 122 ? 101.407 108.153 37.038  1.00 39.06  ? 122 GLY B C  1 
ATOM 3140  O O  . GLY B 2 122 ? 100.353 107.723 37.508  1.00 39.06  ? 122 GLY B O  1 
ATOM 3141  N N  . ALA B 2 123 ? 101.457 108.825 35.899  1.00 37.88  ? 123 ALA B N  1 
ATOM 3142  C CA . ALA B 2 123 ? 100.259 109.084 35.122  1.00 37.88  ? 123 ALA B CA 1 
ATOM 3143  C C  . ALA B 2 123 ? 99.929  107.967 34.170  1.00 37.88  ? 123 ALA B C  1 
ATOM 3144  O O  . ALA B 2 123 ? 99.177  108.182 33.218  1.00 37.88  ? 123 ALA B O  1 
ATOM 3145  N N  . GLY B 2 124 ? 100.483 106.783 34.393  1.00 42.05  ? 124 GLY B N  1 
ATOM 3146  C CA . GLY B 2 124 ? 100.075 105.624 33.638  1.00 42.05  ? 124 GLY B CA 1 
ATOM 3147  C C  . GLY B 2 124 ? 100.565 105.584 32.216  1.00 42.05  ? 124 GLY B C  1 
ATOM 3148  O O  . GLY B 2 124 ? 99.949  104.912 31.388  1.00 42.05  ? 124 GLY B O  1 
ATOM 3149  N N  . PHE B 2 125 ? 101.640 106.298 31.899  1.00 40.49  ? 125 PHE B N  1 
ATOM 3150  C CA . PHE B 2 125 ? 102.212 106.197 30.570  1.00 40.49  ? 125 PHE B CA 1 
ATOM 3151  C C  . PHE B 2 125 ? 102.789 104.814 30.315  1.00 40.49  ? 125 PHE B C  1 
ATOM 3152  O O  . PHE B 2 125 ? 103.186 104.092 31.233  1.00 40.49  ? 125 PHE B O  1 
ATOM 3153  N N  . SER B 2 126 ? 102.799 104.439 29.040  1.00 44.05  ? 126 SER B N  1 
ATOM 3154  C CA . SER B 2 126 ? 103.582 103.291 28.633  1.00 44.05  ? 126 SER B CA 1 
ATOM 3155  C C  . SER B 2 126 ? 105.042 103.596 28.876  1.00 44.05  ? 126 SER B C  1 
ATOM 3156  O O  . SER B 2 126 ? 105.549 104.660 28.520  1.00 44.05  ? 126 SER B O  1 
ATOM 3157  N N  . ASP B 2 127 ? 105.716 102.660 29.511  1.00 50.33  ? 127 ASP B N  1 
ATOM 3158  C CA . ASP B 2 127 ? 107.023 102.930 30.064  1.00 50.33  ? 127 ASP B CA 1 
ATOM 3159  C C  . ASP B 2 127 ? 108.138 102.646 29.081  1.00 50.33  ? 127 ASP B C  1 
ATOM 3160  O O  . ASP B 2 127 ? 109.298 102.521 29.485  1.00 50.33  ? 127 ASP B O  1 
ATOM 3161  N N  . LYS B 2 128 ? 107.816 102.548 27.800  1.00 50.92  ? 128 LYS B N  1 
ATOM 3162  C CA . LYS B 2 128 ? 108.821 102.570 26.742  1.00 50.92  ? 128 LYS B CA 1 
ATOM 3163  C C  . LYS B 2 128 ? 108.988 103.993 26.219  1.00 50.92  ? 128 LYS B C  1 
ATOM 3164  O O  . LYS B 2 128 ? 108.942 104.258 25.020  1.00 50.92  ? 128 LYS B O  1 
ATOM 3165  N N  . THR B 2 129 ? 109.152 104.929 27.154  1.00 41.41  ? 129 THR B N  1 
ATOM 3166  C CA . THR B 2 129 ? 109.250 106.359 26.867  1.00 41.41  ? 129 THR B CA 1 
ATOM 3167  C C  . THR B 2 129 ? 110.328 106.917 27.775  1.00 41.41  ? 129 THR B C  1 
ATOM 3168  O O  . THR B 2 129 ? 110.080 107.160 28.965  1.00 41.41  ? 129 THR B O  1 
ATOM 3169  N N  . PRO B 2 130 ? 111.523 107.136 27.262  1.00 34.84  ? 130 PRO B N  1 
ATOM 3170  C CA . PRO B 2 130 ? 112.603 107.650 28.100  1.00 34.84  ? 130 PRO B CA 1 
ATOM 3171  C C  . PRO B 2 130 ? 112.389 109.107 28.445  1.00 34.84  ? 130 PRO B C  1 
ATOM 3172  O O  . PRO B 2 130 ? 111.691 109.833 27.742  1.00 34.84  ? 130 PRO B O  1 
ATOM 3173  N N  . ALA B 2 131 ? 113.001 109.537 29.540  1.00 37.48  ? 131 ALA B N  1 
ATOM 3174  C CA . ALA B 2 131 ? 112.753 110.876 30.039  1.00 37.48  ? 131 ALA B CA 1 
ATOM 3175  C C  . ALA B 2 131 ? 113.985 111.419 30.716  1.00 37.48  ? 131 ALA B C  1 
ATOM 3176  O O  . ALA B 2 131 ? 114.824 110.661 31.189  1.00 37.48  ? 131 ALA B O  1 
ATOM 3177  N N  . HIS B 2 132 ? 114.077 112.740 30.779  1.00 72.35  ? 132 HIS B N  1 
ATOM 3178  C CA . HIS B 2 132 ? 115.072 113.359 31.631  1.00 72.35  ? 132 HIS B CA 1 
ATOM 3179  C C  . HIS B 2 132 ? 114.605 114.730 32.063  1.00 72.35  ? 132 HIS B C  1 
ATOM 3180  O O  . HIS B 2 132 ? 113.720 115.320 31.451  1.00 72.35  ? 132 HIS B O  1 
ATOM 3181  N N  . THR B 2 133 ? 115.216 115.240 33.117  1.00 39.03  ? 133 THR B N  1 
ATOM 3182  C CA . THR B 2 133 ? 114.964 116.603 33.535  1.00 39.03  ? 133 THR B CA 1 
ATOM 3183  C C  . THR B 2 133 ? 116.062 117.493 33.004  1.00 39.03  ? 133 THR B C  1 
ATOM 3184  O O  . THR B 2 133 ? 117.107 117.010 32.584  1.00 39.03  ? 133 THR B O  1 
ATOM 3185  N N  . VAL B 2 134 ? 115.799 118.793 32.987  1.00 27.31  ? 134 VAL B N  1 
ATOM 3186  C CA . VAL B 2 134 ? 116.755 119.796 32.558  1.00 27.31  ? 134 VAL B CA 1 
ATOM 3187  C C  . VAL B 2 134 ? 116.643 120.927 33.553  1.00 27.31  ? 134 VAL B C  1 
ATOM 3188  O O  . VAL B 2 134 ? 115.584 121.544 33.675  1.00 27.31  ? 134 VAL B O  1 
ATOM 3189  N N  . THR B 2 135 ? 117.708 121.189 34.284  1.00 29.95  ? 135 THR B N  1 
ATOM 3190  C CA . THR B 2 135 ? 117.668 122.177 35.347  1.00 29.95  ? 135 THR B CA 1 
ATOM 3191  C C  . THR B 2 135 ? 118.471 123.404 34.966  1.00 29.95  ? 135 THR B C  1 
ATOM 3192  O O  . THR B 2 135 ? 119.688 123.327 34.799  1.00 29.95  ? 135 THR B O  1 
ATOM 3193  N N  . MET B 2 136 ? 117.781 124.528 34.828  1.00 34.48  ? 136 MET B N  1 
ATOM 3194  C CA . MET B 2 136 ? 118.425 125.830 34.850  1.00 34.48  ? 136 MET B CA 1 
ATOM 3195  C C  . MET B 2 136 ? 117.882 126.648 35.995  1.00 34.48  ? 136 MET B C  1 
ATOM 3196  O O  . MET B 2 136 ? 117.128 126.142 36.828  1.00 34.48  ? 136 MET B O  1 
ATOM 3197  N N  . ALA B 2 137 ? 118.243 127.922 36.034  1.00 45.49  ? 137 ALA B N  1 
ATOM 3198  C CA . ALA B 2 137 ? 117.756 128.770 37.105  1.00 45.49  ? 137 ALA B CA 1 
ATOM 3199  C C  . ALA B 2 137 ? 116.290 129.096 36.905  1.00 45.49  ? 137 ALA B C  1 
ATOM 3200  O O  . ALA B 2 137 ? 115.440 128.705 37.708  1.00 45.49  ? 137 ALA B O  1 
ATOM 3201  N N  . CYS B 2 138 ? 115.968 129.782 35.822  1.00 42.21  ? 138 CYS B N  1 
ATOM 3202  C CA . CYS B 2 138 ? 114.657 130.389 35.698  1.00 42.21  ? 138 CYS B CA 1 
ATOM 3203  C C  . CYS B 2 138 ? 113.928 130.032 34.425  1.00 42.21  ? 138 CYS B C  1 
ATOM 3204  O O  . CYS B 2 138 ? 112.695 130.038 34.425  1.00 42.21  ? 138 CYS B O  1 
ATOM 3205  N N  . ILE B 2 139 ? 114.627 129.677 33.362  1.00 32.25  ? 139 ILE B N  1 
ATOM 3206  C CA . ILE B 2 139 ? 113.967 129.378 32.104  1.00 32.25  ? 139 ILE B CA 1 
ATOM 3207  C C  . ILE B 2 139 ? 114.155 127.907 31.788  1.00 32.25  ? 139 ILE B C  1 
ATOM 3208  O O  . ILE B 2 139 ? 114.250 127.522 30.618  1.00 32.25  ? 139 ILE B O  1 
ATOM 3209  N N  . SER B 2 140 ? 114.184 127.095 32.845  1.00 30.10  ? 140 SER B N  1 
ATOM 3210  C CA . SER B 2 140 ? 114.214 125.641 32.803  1.00 30.10  ? 140 SER B CA 1 
ATOM 3211  C C  . SER B 2 140 ? 113.210 125.045 31.843  1.00 30.10  ? 140 SER B C  1 
ATOM 3212  O O  . SER B 2 140 ? 113.579 124.494 30.807  1.00 30.10  ? 140 SER B O  1 
ATOM 3213  N N  . ALA B 2 141 ? 111.939 125.186 32.146  1.00 37.79  ? 141 ALA B N  1 
ATOM 3214  C CA . ALA B 2 141 ? 110.978 125.116 31.074  1.00 37.79  ? 141 ALA B CA 1 
ATOM 3215  C C  . ALA B 2 141 ? 111.188 126.355 30.231  1.00 37.79  ? 141 ALA B C  1 
ATOM 3216  O O  . ALA B 2 141 ? 111.376 127.441 30.777  1.00 37.79  ? 141 ALA B O  1 
ATOM 3217  N N  . ASN B 2 142 ? 111.159 126.163 28.903  1.00 37.46  ? 142 ASN B N  1 
ATOM 3218  C CA . ASN B 2 142 ? 111.623 127.037 27.818  1.00 37.46  ? 142 ASN B CA 1 
ATOM 3219  C C  . ASN B 2 142 ? 113.143 126.950 27.735  1.00 37.46  ? 142 ASN B C  1 
ATOM 3220  O O  . ASN B 2 142 ? 113.800 127.786 27.114  1.00 37.46  ? 142 ASN B O  1 
ATOM 3221  N N  . GLN B 2 143 ? 113.715 125.937 28.374  1.00 37.53  ? 143 GLN B N  1 
ATOM 3222  C CA . GLN B 2 143 ? 114.850 125.242 27.795  1.00 37.53  ? 143 GLN B CA 1 
ATOM 3223  C C  . GLN B 2 143 ? 114.412 123.852 27.407  1.00 37.53  ? 143 GLN B C  1 
ATOM 3224  O O  . GLN B 2 143 ? 115.078 123.183 26.615  1.00 37.53  ? 143 GLN B O  1 
ATOM 3225  N N  . ALA B 2 144 ? 113.276 123.430 27.946  1.00 38.31  ? 144 ALA B N  1 
ATOM 3226  C CA . ALA B 2 144 ? 112.708 122.142 27.609  1.00 38.31  ? 144 ALA B CA 1 
ATOM 3227  C C  . ALA B 2 144 ? 112.241 122.110 26.164  1.00 38.31  ? 144 ALA B C  1 
ATOM 3228  O O  . ALA B 2 144 ? 112.539 121.161 25.430  1.00 38.31  ? 144 ALA B O  1 
ATOM 3229  N N  . MET B 2 145 ? 111.535 123.149 25.727  1.00 37.69  ? 145 MET B N  1 
ATOM 3230  C CA . MET B 2 145 ? 111.036 123.163 24.362  1.00 37.69  ? 145 MET B CA 1 
ATOM 3231  C C  . MET B 2 145 ? 112.159 123.250 23.348  1.00 37.69  ? 145 MET B C  1 
ATOM 3232  O O  . MET B 2 145 ? 112.043 122.690 22.257  1.00 37.69  ? 145 MET B O  1 
ATOM 3233  N N  . THR B 2 146 ? 113.260 123.914 23.682  1.00 39.07  ? 146 THR B N  1 
ATOM 3234  C CA . THR B 2 146 ? 114.288 124.079 22.670  1.00 39.07  ? 146 THR B CA 1 
ATOM 3235  C C  . THR B 2 146 ? 115.121 122.807 22.520  1.00 39.07  ? 146 THR B C  1 
ATOM 3236  O O  . THR B 2 146 ? 115.499 122.436 21.404  1.00 39.07  ? 146 THR B O  1 
ATOM 3237  N N  . THR B 2 147 ? 115.338 122.062 23.606  1.00 38.47  ? 147 THR B N  1 
ATOM 3238  C CA . THR B 2 147 ? 115.991 120.777 23.407  1.00 38.47  ? 147 THR B CA 1 
ATOM 3239  C C  . THR B 2 147 ? 115.031 119.771 22.803  1.00 38.47  ? 147 THR B C  1 
ATOM 3240  O O  . THR B 2 147 ? 115.469 118.873 22.084  1.00 38.47  ? 147 THR B O  1 
ATOM 3241  N N  . GLY B 2 148 ? 113.726 119.967 22.986  1.00 38.66  ? 148 GLY B N  1 
ATOM 3242  C CA . GLY B 2 148 ? 112.773 119.114 22.304  1.00 38.66  ? 148 GLY B CA 1 
ATOM 3243  C C  . GLY B 2 148 ? 112.741 119.369 20.811  1.00 38.66  ? 148 GLY B C  1 
ATOM 3244  O O  . GLY B 2 148 ? 112.678 118.434 20.012  1.00 38.66  ? 148 GLY B O  1 
ATOM 3245  N N  . VAL B 2 149 ? 112.792 120.639 20.413  1.00 37.55  ? 149 VAL B N  1 
ATOM 3246  C CA . VAL B 2 149 ? 112.735 120.925 18.990  1.00 37.55  ? 149 VAL B CA 1 
ATOM 3247  C C  . VAL B 2 149 ? 114.054 120.542 18.341  1.00 37.55  ? 149 VAL B C  1 
ATOM 3248  O O  . VAL B 2 149 ? 114.082 120.122 17.176  1.00 37.55  ? 149 VAL B O  1 
ATOM 3249  N N  . GLY B 2 150 ? 115.150 120.576 19.101  1.00 39.21  ? 150 GLY B N  1 
ATOM 3250  C CA . GLY B 2 150 ? 116.382 119.997 18.602  1.00 39.21  ? 150 GLY B CA 1 
ATOM 3251  C C  . GLY B 2 150 ? 116.287 118.492 18.466  1.00 39.21  ? 150 GLY B C  1 
ATOM 3252  O O  . GLY B 2 150 ? 116.860 117.904 17.546  1.00 39.21  ? 150 GLY B O  1 
ATOM 3253  N N  . LEU B 2 151 ? 115.542 117.853 19.366  1.00 38.34  ? 151 LEU B N  1 
ATOM 3254  C CA . LEU B 2 151 ? 115.379 116.412 19.292  1.00 38.34  ? 151 LEU B CA 1 
ATOM 3255  C C  . LEU B 2 151 ? 114.513 116.021 18.105  1.00 38.34  ? 151 LEU B C  1 
ATOM 3256  O O  . LEU B 2 151 ? 114.719 114.963 17.507  1.00 38.34  ? 151 LEU B O  1 
ATOM 3257  N N  . ILE B 2 152 ? 113.547 116.860 17.756  1.00 40.50  ? 152 ILE B N  1 
ATOM 3258  C CA . ILE B 2 152 ? 112.665 116.552 16.637  1.00 40.50  ? 152 ILE B CA 1 
ATOM 3259  C C  . ILE B 2 152 ? 113.371 116.795 15.319  1.00 40.50  ? 152 ILE B C  1 
ATOM 3260  O O  . ILE B 2 152 ? 113.394 115.926 14.440  1.00 40.50  ? 152 ILE B O  1 
ATOM 3261  N N  . ALA B 2 153 ? 113.978 117.973 15.171  1.00 46.61  ? 153 ALA B N  1 
ATOM 3262  C CA . ALA B 2 153 ? 114.594 118.353 13.908  1.00 46.61  ? 153 ALA B CA 1 
ATOM 3263  C C  . ALA B 2 153 ? 115.834 117.533 13.578  1.00 46.61  ? 153 ALA B C  1 
ATOM 3264  O O  . ALA B 2 153 ? 116.295 117.580 12.434  1.00 46.61  ? 153 ALA B O  1 
ATOM 3265  N N  . SER B 2 154 ? 116.372 116.778 14.539  1.00 50.36  ? 154 SER B N  1 
ATOM 3266  C CA . SER B 2 154 ? 117.351 115.750 14.218  1.00 50.36  ? 154 SER B CA 1 
ATOM 3267  C C  . SER B 2 154 ? 116.748 114.630 13.391  1.00 50.36  ? 154 SER B C  1 
ATOM 3268  O O  . SER B 2 154 ? 117.483 113.924 12.698  1.00 50.36  ? 154 SER B O  1 
ATOM 3269  N N  . GLY B 2 155 ? 115.437 114.441 13.462  1.00 51.37  ? 155 GLY B N  1 
ATOM 3270  C CA . GLY B 2 155 ? 114.796 113.446 12.638  1.00 51.37  ? 155 GLY B CA 1 
ATOM 3271  C C  . GLY B 2 155 ? 114.980 112.034 13.131  1.00 51.37  ? 155 GLY B C  1 
ATOM 3272  O O  . GLY B 2 155 ? 115.373 111.158 12.353  1.00 51.37  ? 155 GLY B O  1 
ATOM 3273  N N  . GLN B 2 156 ? 114.722 111.782 14.414  1.00 59.89  ? 156 GLN B N  1 
ATOM 3274  C CA . GLN B 2 156 ? 114.734 110.419 14.911  1.00 59.89  ? 156 GLN B CA 1 
ATOM 3275  C C  . GLN B 2 156 ? 113.494 110.024 15.698  1.00 59.89  ? 156 GLN B C  1 
ATOM 3276  O O  . GLN B 2 156 ? 113.243 108.823 15.836  1.00 59.89  ? 156 GLN B O  1 
ATOM 3277  N N  . CYS B 2 157 ? 112.713 110.967 16.216  1.00 59.79  ? 157 CYS B N  1 
ATOM 3278  C CA . CYS B 2 157 ? 111.608 110.625 17.096  1.00 59.79  ? 157 CYS B CA 1 
ATOM 3279  C C  . CYS B 2 157 ? 110.331 111.292 16.609  1.00 59.79  ? 157 CYS B C  1 
ATOM 3280  O O  . CYS B 2 157 ? 110.252 111.802 15.487  1.00 59.79  ? 157 CYS B O  1 
ATOM 3281  N N  . ASP B 2 158 ? 109.306 111.241 17.453  1.00 56.21  ? 158 ASP B N  1 
ATOM 3282  C CA . ASP B 2 158 ? 107.961 111.559 17.004  1.00 56.21  ? 158 ASP B CA 1 
ATOM 3283  C C  . ASP B 2 158 ? 107.365 112.777 17.693  1.00 56.21  ? 158 ASP B C  1 
ATOM 3284  O O  . ASP B 2 158 ? 107.029 113.747 17.011  1.00 56.21  ? 158 ASP B O  1 
ATOM 3285  N N  . VAL B 2 159 ? 107.224 112.758 19.019  1.00 41.10  ? 159 VAL B N  1 
ATOM 3286  C CA . VAL B 2 159 ? 106.535 113.810 19.760  1.00 41.10  ? 159 VAL B CA 1 
ATOM 3287  C C  . VAL B 2 159 ? 107.201 114.002 21.110  1.00 41.10  ? 159 VAL B C  1 
ATOM 3288  O O  . VAL B 2 159 ? 107.821 113.096 21.658  1.00 41.10  ? 159 VAL B O  1 
ATOM 3289  N N  . ILE B 2 160 ? 107.052 115.203 21.652  1.00 29.63  ? 160 ILE B N  1 
ATOM 3290  C CA . ILE B 2 160 ? 107.761 115.646 22.843  1.00 29.63  ? 160 ILE B CA 1 
ATOM 3291  C C  . ILE B 2 160 ? 106.732 116.177 23.819  1.00 29.63  ? 160 ILE B C  1 
ATOM 3292  O O  . ILE B 2 160 ? 105.762 116.816 23.408  1.00 29.63  ? 160 ILE B O  1 
ATOM 3293  N N  . VAL B 2 161 ? 106.909 115.906 25.087  1.00 27.31  ? 161 VAL B N  1 
ATOM 3294  C CA . VAL B 2 161 ? 106.205 116.648 26.113  1.00 27.31  ? 161 VAL B CA 1 
ATOM 3295  C C  . VAL B 2 161 ? 107.218 117.503 26.842  1.00 27.31  ? 161 VAL B C  1 
ATOM 3296  O O  . VAL B 2 161 ? 108.271 117.012 27.247  1.00 27.31  ? 161 VAL B O  1 
ATOM 3297  N N  . ALA B 2 162 ? 106.928 118.780 26.990  1.00 17.32  ? 162 ALA B N  1 
ATOM 3298  C CA . ALA B 2 162 ? 107.823 119.675 27.692  1.00 17.32  ? 162 ALA B CA 1 
ATOM 3299  C C  . ALA B 2 162 ? 107.062 120.365 28.804  1.00 17.32  ? 162 ALA B C  1 
ATOM 3300  O O  . ALA B 2 162 ? 105.984 120.908 28.576  1.00 17.32  ? 162 ALA B O  1 
ATOM 3301  N N  . GLY B 2 163 ? 107.625 120.351 30.004  1.00 31.63  ? 163 GLY B N  1 
ATOM 3302  C CA . GLY B 2 163 ? 106.911 120.919 31.131  1.00 31.63  ? 163 GLY B CA 1 
ATOM 3303  C C  . GLY B 2 163 ? 107.860 121.395 32.204  1.00 31.63  ? 163 GLY B C  1 
ATOM 3304  O O  . GLY B 2 163 ? 109.033 121.025 32.241  1.00 31.63  ? 163 GLY B O  1 
ATOM 3305  N N  . GLY B 2 164 ? 107.323 122.213 33.099  1.00 27.16  ? 164 GLY B N  1 
ATOM 3306  C CA . GLY B 2 164 ? 108.113 122.801 34.164  1.00 27.16  ? 164 GLY B CA 1 
ATOM 3307  C C  . GLY B 2 164 ? 107.317 122.811 35.444  1.00 27.16  ? 164 GLY B C  1 
ATOM 3308  O O  . GLY B 2 164 ? 106.155 123.211 35.468  1.00 27.16  ? 164 GLY B O  1 
ATOM 3309  N N  . VAL B 2 165 ? 107.930 122.287 36.500  1.00 31.05  ? 165 VAL B N  1 
ATOM 3310  C CA . VAL B 2 165 ? 107.204 121.901 37.703  1.00 31.05  ? 165 VAL B CA 1 
ATOM 3311  C C  . VAL B 2 165 ? 107.986 122.309 38.931  1.00 31.05  ? 165 VAL B C  1 
ATOM 3312  O O  . VAL B 2 165 ? 109.073 121.772 39.144  1.00 31.05  ? 165 VAL B O  1 
ATOM 3313  N N  . GLU B 2 166 ? 107.456 123.198 39.777  1.00 36.85  ? 166 GLU B N  1 
ATOM 3314  C CA . GLU B 2 166 ? 108.135 123.386 41.054  1.00 36.85  ? 166 GLU B CA 1 
ATOM 3315  C C  . GLU B 2 166 ? 107.246 123.929 42.153  1.00 36.85  ? 166 GLU B C  1 
ATOM 3316  O O  . GLU B 2 166 ? 106.131 124.413 41.923  1.00 36.85  ? 166 GLU B O  1 
ATOM 3317  N N  . LEU B 2 167 ? 107.788 123.830 43.361  1.00 47.07  ? 167 LEU B N  1 
ATOM 3318  C CA . LEU B 2 167 ? 107.147 124.225 44.601  1.00 47.07  ? 167 LEU B CA 1 
ATOM 3319  C C  . LEU B 2 167 ? 108.209 124.906 45.439  1.00 47.07  ? 167 LEU B C  1 
ATOM 3320  O O  . LEU B 2 167 ? 109.116 124.239 45.943  1.00 47.07  ? 167 LEU B O  1 
ATOM 3321  N N  . MET B 2 168 ? 108.100 126.213 45.608  1.00 61.21  ? 168 MET B N  1 
ATOM 3322  C CA . MET B 2 168 ? 109.022 126.851 46.531  1.00 61.21  ? 168 MET B CA 1 
ATOM 3323  C C  . MET B 2 168 ? 108.501 126.867 47.954  1.00 61.21  ? 168 MET B C  1 
ATOM 3324  O O  . MET B 2 168 ? 109.089 127.544 48.801  1.00 61.21  ? 168 MET B O  1 
ATOM 3325  N N  . SER B 2 169 ? 107.422 126.137 48.229  1.00 67.58  ? 169 SER B N  1 
ATOM 3326  C CA . SER B 2 169 ? 106.918 126.010 49.586  1.00 67.58  ? 169 SER B CA 1 
ATOM 3327  C C  . SER B 2 169 ? 107.881 125.250 50.491  1.00 67.58  ? 169 SER B C  1 
ATOM 3328  O O  . SER B 2 169 ? 108.258 125.774 51.543  1.00 67.58  ? 169 SER B O  1 
ATOM 3329  N N  . ASP B 2 170 ? 108.289 124.035 50.120  1.00 80.00  ? 170 ASP B N  1 
ATOM 3330  C CA . ASP B 2 170 ? 109.317 123.325 50.879  1.00 80.00  ? 170 ASP B CA 1 
ATOM 3331  C C  . ASP B 2 170 ? 110.678 123.441 50.196  1.00 80.00  ? 170 ASP B C  1 
ATOM 3332  O O  . ASP B 2 170 ? 111.086 122.594 49.410  1.00 80.00  ? 170 ASP B O  1 
ATOM 3333  N N  . VAL B 2 171 ? 111.375 124.521 50.526  1.00 79.40  ? 171 VAL B N  1 
ATOM 3334  C CA . VAL B 2 171 ? 112.760 124.697 50.106  1.00 79.40  ? 171 VAL B CA 1 
ATOM 3335  C C  . VAL B 2 171 ? 113.630 123.700 50.859  1.00 79.40  ? 171 VAL B C  1 
ATOM 3336  O O  . VAL B 2 171 ? 113.331 123.358 52.011  1.00 79.40  ? 171 VAL B O  1 
ATOM 3337  N N  . PRO B 2 172 ? 114.678 123.189 50.243  1.00 81.61  ? 172 PRO B N  1 
ATOM 3338  C CA . PRO B 2 172 ? 115.541 122.222 50.926  1.00 81.61  ? 172 PRO B CA 1 
ATOM 3339  C C  . PRO B 2 172 ? 116.486 122.845 51.931  1.00 81.61  ? 172 PRO B C  1 
ATOM 3340  O O  . PRO B 2 172 ? 117.496 123.437 51.553  1.00 81.61  ? 172 PRO B O  1 
ATOM 3341  N N  . ILE B 2 173 ? 116.199 122.684 53.218  1.00 82.79  ? 173 ILE B N  1 
ATOM 3342  C CA . ILE B 2 173 ? 117.096 123.152 54.266  1.00 82.79  ? 173 ILE B CA 1 
ATOM 3343  C C  . ILE B 2 173 ? 117.918 121.949 54.718  1.00 82.79  ? 173 ILE B C  1 
ATOM 3344  O O  . ILE B 2 173 ? 117.439 121.077 55.441  1.00 82.79  ? 173 ILE B O  1 
ATOM 3345  N N  . ARG B 2 174 ? 119.157 121.894 54.255  1.00 79.61  ? 174 ARG B N  1 
ATOM 3346  C CA . ARG B 2 174 ? 120.001 120.739 54.487  1.00 79.61  ? 174 ARG B CA 1 
ATOM 3347  C C  . ARG B 2 174 ? 120.940 120.939 55.657  1.00 79.61  ? 174 ARG B C  1 
ATOM 3348  O O  . ARG B 2 174 ? 121.196 122.057 56.103  1.00 79.61  ? 174 ARG B O  1 
ATOM 3349  N N  . HIS B 2 175 ? 121.496 119.822 56.114  1.00 79.58  ? 175 HIS B N  1 
ATOM 3350  C CA . HIS B 2 175 ? 121.704 119.637 57.541  1.00 79.58  ? 175 HIS B CA 1 
ATOM 3351  C C  . HIS B 2 175 ? 122.966 120.346 58.016  1.00 79.58  ? 175 HIS B C  1 
ATOM 3352  O O  . HIS B 2 175 ? 122.888 121.269 58.829  1.00 79.58  ? 175 HIS B O  1 
ATOM 3353  N N  . SER B 2 176 ? 124.130 119.935 57.514  1.00 82.34  ? 176 SER B N  1 
ATOM 3354  C CA . SER B 2 176 ? 125.356 120.728 57.553  1.00 82.34  ? 176 SER B CA 1 
ATOM 3355  C C  . SER B 2 176 ? 126.359 120.063 56.631  1.00 82.34  ? 176 SER B C  1 
ATOM 3356  O O  . SER B 2 176 ? 126.151 118.945 56.165  1.00 82.34  ? 176 SER B O  1 
ATOM 3357  N N  . ARG B 2 177 ? 127.469 120.756 56.402  1.00 87.16  ? 177 ARG B N  1 
ATOM 3358  C CA . ARG B 2 177 ? 128.586 120.172 55.677  1.00 87.16  ? 177 ARG B CA 1 
ATOM 3359  C C  . ARG B 2 177 ? 129.266 119.052 56.453  1.00 87.16  ? 177 ARG B C  1 
ATOM 3360  O O  . ARG B 2 177 ? 129.739 118.089 55.841  1.00 87.16  ? 177 ARG B O  1 
ATOM 3361  N N  . LYS B 2 178 ? 129.278 119.117 57.780  1.00 89.83  ? 178 LYS B N  1 
ATOM 3362  C CA . LYS B 2 178 ? 130.105 118.215 58.568  1.00 89.83  ? 178 LYS B CA 1 
ATOM 3363  C C  . LYS B 2 178 ? 129.335 117.253 59.468  1.00 89.83  ? 178 LYS B C  1 
ATOM 3364  O O  . LYS B 2 178 ? 129.883 116.207 59.821  1.00 89.83  ? 178 LYS B O  1 
ATOM 3365  N N  . MET B 2 179 ? 128.090 117.562 59.858  1.00 95.18  ? 179 MET B N  1 
ATOM 3366  C CA . MET B 2 179 ? 127.265 116.553 60.528  1.00 95.18  ? 179 MET B CA 1 
ATOM 3367  C C  . MET B 2 179 ? 126.949 115.379 59.619  1.00 95.18  ? 179 MET B C  1 
ATOM 3368  O O  . MET B 2 179 ? 126.790 114.257 60.098  1.00 95.18  ? 179 MET B O  1 
ATOM 3369  N N  . ARG B 2 180 ? 126.894 115.604 58.309  1.00 85.63  ? 180 ARG B N  1 
ATOM 3370  C CA . ARG B 2 180 ? 126.601 114.516 57.388  1.00 85.63  ? 180 ARG B CA 1 
ATOM 3371  C C  . ARG B 2 180 ? 127.777 113.552 57.252  1.00 85.63  ? 180 ARG B C  1 
ATOM 3372  O O  . ARG B 2 180 ? 127.622 112.463 56.685  1.00 85.63  ? 180 ARG B O  1 
ATOM 3373  N N  . LYS B 2 181 ? 128.945 113.905 57.809  1.00 99.67  ? 181 LYS B N  1 
ATOM 3374  C CA . LYS B 2 181 ? 130.033 112.942 57.959  1.00 99.67  ? 181 LYS B CA 1 
ATOM 3375  C C  . LYS B 2 181 ? 129.679 111.824 58.938  1.00 99.67  ? 181 LYS B C  1 
ATOM 3376  O O  . LYS B 2 181 ? 130.300 110.749 58.900  1.00 99.67  ? 181 LYS B O  1 
ATOM 3377  N N  . LEU B 2 182 ? 128.628 112.008 59.751  1.00 101.65 ? 182 LEU B N  1 
ATOM 3378  C CA . LEU B 2 182 ? 128.087 110.901 60.533  1.00 101.65 ? 182 LEU B CA 1 
ATOM 3379  C C  . LEU B 2 182 ? 127.383 109.853 59.672  1.00 101.65 ? 182 LEU B C  1 
ATOM 3380  O O  . LEU B 2 182 ? 126.906 108.850 60.213  1.00 101.65 ? 182 LEU B O  1 
ATOM 3381  N N  . MET B 2 183 ? 127.339 110.046 58.346  1.00 108.22 ? 183 MET B N  1 
ATOM 3382  C CA . MET B 2 183 ? 127.048 108.961 57.413  1.00 108.22 ? 183 MET B CA 1 
ATOM 3383  C C  . MET B 2 183 ? 128.065 107.821 57.531  1.00 108.22 ? 183 MET B C  1 
ATOM 3384  O O  . MET B 2 183 ? 127.762 106.675 57.176  1.00 108.22 ? 183 MET B O  1 
ATOM 3385  N N  . LEU B 2 184 ? 129.265 108.101 58.058  1.00 104.29 ? 184 LEU B N  1 
ATOM 3386  C CA . LEU B 2 184 ? 130.212 107.044 58.408  1.00 104.29 ? 184 LEU B CA 1 
ATOM 3387  C C  . LEU B 2 184 ? 129.691 106.102 59.495  1.00 104.29 ? 184 LEU B C  1 
ATOM 3388  O O  . LEU B 2 184 ? 130.142 104.957 59.586  1.00 104.29 ? 184 LEU B O  1 
ATOM 3389  N N  . ASP B 2 185 ? 128.734 106.558 60.310  1.00 103.62 ? 185 ASP B N  1 
ATOM 3390  C CA . ASP B 2 185 ? 128.074 105.687 61.274  1.00 103.62 ? 185 ASP B CA 1 
ATOM 3391  C C  . ASP B 2 185 ? 127.256 104.584 60.624  1.00 103.62 ? 185 ASP B C  1 
ATOM 3392  O O  . ASP B 2 185 ? 127.084 103.524 61.229  1.00 103.62 ? 185 ASP B O  1 
ATOM 3393  N N  . LEU B 2 186 ? 126.739 104.810 59.424  1.00 95.62  ? 186 LEU B N  1 
ATOM 3394  C CA . LEU B 2 186 ? 125.806 103.879 58.813  1.00 95.62  ? 186 LEU B CA 1 
ATOM 3395  C C  . LEU B 2 186 ? 126.516 103.106 57.708  1.00 95.62  ? 186 LEU B C  1 
ATOM 3396  O O  . LEU B 2 186 ? 126.227 101.934 57.472  1.00 95.62  ? 186 LEU B O  1 
ATOM 3397  N N  . GLY B 2 193 ? 131.741 97.789  67.165  1.00 118.83 ? 193 GLY B N  1 
ATOM 3398  C CA . GLY B 2 193 ? 130.877 98.523  68.068  1.00 118.83 ? 193 GLY B CA 1 
ATOM 3399  C C  . GLY B 2 193 ? 131.591 99.676  68.742  1.00 118.83 ? 193 GLY B C  1 
ATOM 3400  O O  . GLY B 2 193 ? 130.966 100.539 69.351  1.00 118.83 ? 193 GLY B O  1 
ATOM 3401  N N  . GLN B 2 194 ? 132.921 99.671  68.637  1.00 125.95 ? 194 GLN B N  1 
ATOM 3402  C CA . GLN B 2 194 ? 133.710 100.762 69.195  1.00 125.95 ? 194 GLN B CA 1 
ATOM 3403  C C  . GLN B 2 194 ? 133.979 101.829 68.143  1.00 125.95 ? 194 GLN B C  1 
ATOM 3404  O O  . GLN B 2 194 ? 134.157 103.006 68.473  1.00 125.95 ? 194 GLN B O  1 
ATOM 3405  N N  . ARG B 2 195 ? 134.011 101.441 66.867  1.00 127.37 ? 195 ARG B N  1 
ATOM 3406  C CA . ARG B 2 195 ? 134.168 102.435 65.810  1.00 127.37 ? 195 ARG B CA 1 
ATOM 3407  C C  . ARG B 2 195 ? 132.919 103.300 65.679  1.00 127.37 ? 195 ARG B C  1 
ATOM 3408  O O  . ARG B 2 195 ? 133.016 104.504 65.396  1.00 127.37 ? 195 ARG B O  1 
ATOM 3409  N N  . LEU B 2 196 ? 131.744 102.713 65.950  1.00 128.44 ? 196 LEU B N  1 
ATOM 3410  C CA . LEU B 2 196 ? 130.505 103.484 66.056  1.00 128.44 ? 196 LEU B CA 1 
ATOM 3411  C C  . LEU B 2 196 ? 130.582 104.501 67.186  1.00 128.44 ? 196 LEU B C  1 
ATOM 3412  O O  . LEU B 2 196 ? 129.921 105.543 67.141  1.00 128.44 ? 196 LEU B O  1 
ATOM 3413  N N  . SER B 2 197 ? 131.381 104.214 68.212  1.00 122.45 ? 197 SER B N  1 
ATOM 3414  C CA . SER B 2 197 ? 131.598 105.194 69.263  1.00 122.45 ? 197 SER B CA 1 
ATOM 3415  C C  . SER B 2 197 ? 132.624 106.234 68.842  1.00 122.45 ? 197 SER B C  1 
ATOM 3416  O O  . SER B 2 197 ? 132.444 107.428 69.106  1.00 122.45 ? 197 SER B O  1 
ATOM 3417  N N  . LEU B 2 198 ? 133.705 105.808 68.180  1.00 118.50 ? 198 LEU B N  1 
ATOM 3418  C CA . LEU B 2 198 ? 134.824 106.722 67.979  1.00 118.50 ? 198 LEU B CA 1 
ATOM 3419  C C  . LEU B 2 198 ? 134.525 107.729 66.884  1.00 118.50 ? 198 LEU B C  1 
ATOM 3420  O O  . LEU B 2 198 ? 135.128 108.807 66.847  1.00 118.50 ? 198 LEU B O  1 
ATOM 3421  N N  . ILE B 2 199 ? 133.606 107.398 65.974  1.00 117.66 ? 199 ILE B N  1 
ATOM 3422  C CA . ILE B 2 199 ? 133.135 108.415 65.037  1.00 117.66 ? 199 ILE B CA 1 
ATOM 3423  C C  . ILE B 2 199 ? 132.304 109.456 65.777  1.00 117.66 ? 199 ILE B C  1 
ATOM 3424  O O  . ILE B 2 199 ? 132.373 110.656 65.484  1.00 117.66 ? 199 ILE B O  1 
ATOM 3425  N N  . SER B 2 200 ? 131.578 109.030 66.809  1.00 121.83 ? 200 SER B N  1 
ATOM 3426  C CA . SER B 2 200 ? 130.753 109.968 67.560  1.00 121.83 ? 200 SER B CA 1 
ATOM 3427  C C  . SER B 2 200 ? 131.557 110.709 68.622  1.00 121.83 ? 200 SER B C  1 
ATOM 3428  O O  . SER B 2 200 ? 131.022 111.587 69.307  1.00 121.83 ? 200 SER B O  1 
ATOM 3429  N N  . LYS B 2 201 ? 132.842 110.363 68.781  1.00 124.94 ? 201 LYS B N  1 
ATOM 3430  C CA . LYS B 2 201 ? 133.633 110.927 69.875  1.00 124.94 ? 201 LYS B CA 1 
ATOM 3431  C C  . LYS B 2 201 ? 133.956 112.398 69.655  1.00 124.94 ? 201 LYS B C  1 
ATOM 3432  O O  . LYS B 2 201 ? 134.015 113.172 70.616  1.00 124.94 ? 201 LYS B O  1 
ATOM 3433  N N  . PHE B 2 202 ? 134.192 112.807 68.411  1.00 130.16 ? 202 PHE B N  1 
ATOM 3434  C CA . PHE B 2 202 ? 134.542 114.202 68.147  1.00 130.16 ? 202 PHE B CA 1 
ATOM 3435  C C  . PHE B 2 202 ? 133.268 115.007 67.888  1.00 130.16 ? 202 PHE B C  1 
ATOM 3436  O O  . PHE B 2 202 ? 132.536 114.809 66.920  1.00 130.16 ? 202 PHE B O  1 
ATOM 3437  N N  . ARG B 2 203 ? 132.990 115.915 68.818  1.00 123.88 ? 203 ARG B N  1 
ATOM 3438  C CA . ARG B 2 203 ? 131.800 116.748 68.761  1.00 123.88 ? 203 ARG B CA 1 
ATOM 3439  C C  . ARG B 2 203 ? 131.943 117.996 69.613  1.00 123.88 ? 203 ARG B C  1 
ATOM 3440  O O  . ARG B 2 203 ? 132.373 117.939 70.768  1.00 123.88 ? 203 ARG B O  1 
ATOM 3441  N N  . PHE B 2 204 ? 131.623 119.130 68.999  1.00 120.75 ? 204 PHE B N  1 
ATOM 3442  C CA . PHE B 2 204 ? 131.246 120.339 69.701  1.00 120.75 ? 204 PHE B CA 1 
ATOM 3443  C C  . PHE B 2 204 ? 129.884 120.775 69.173  1.00 120.75 ? 204 PHE B C  1 
ATOM 3444  O O  . PHE B 2 204 ? 129.204 120.018 68.479  1.00 120.75 ? 204 PHE B O  1 
ATOM 3445  N N  . ASN B 2 205 ? 129.452 121.974 69.559  1.00 118.28 ? 205 ASN B N  1 
ATOM 3446  C CA . ASN B 2 205 ? 128.171 122.498 69.080  1.00 118.28 ? 205 ASN B CA 1 
ATOM 3447  C C  . ASN B 2 205 ? 128.376 123.199 67.737  1.00 118.28 ? 205 ASN B C  1 
ATOM 3448  O O  . ASN B 2 205 ? 128.655 124.394 67.650  1.00 118.28 ? 205 ASN B O  1 
ATOM 3449  N N  . PHE B 2 206 ? 128.228 122.413 66.668  1.00 104.70 ? 206 PHE B N  1 
ATOM 3450  C CA . PHE B 2 206 ? 128.341 122.909 65.300  1.00 104.70 ? 206 PHE B CA 1 
ATOM 3451  C C  . PHE B 2 206 ? 127.104 122.490 64.503  1.00 104.70 ? 206 PHE B C  1 
ATOM 3452  O O  . PHE B 2 206 ? 127.141 122.395 63.277  1.00 104.70 ? 206 PHE B O  1 
ATOM 3453  N N  . LEU B 2 207 ? 125.989 122.274 65.194  1.00 98.35  ? 207 LEU B N  1 
ATOM 3454  C CA . LEU B 2 207 ? 124.720 121.998 64.536  1.00 98.35  ? 207 LEU B CA 1 
ATOM 3455  C C  . LEU B 2 207 ? 124.157 123.315 64.027  1.00 98.35  ? 207 LEU B C  1 
ATOM 3456  O O  . LEU B 2 207 ? 123.838 124.207 64.822  1.00 98.35  ? 207 LEU B O  1 
ATOM 3457  N N  . ALA B 2 208 ? 124.044 123.435 62.707  1.00 100.25 ? 208 ALA B N  1 
ATOM 3458  C CA . ALA B 2 208 ? 123.460 124.608 62.073  1.00 100.25 ? 208 ALA B CA 1 
ATOM 3459  C C  . ALA B 2 208 ? 122.983 124.210 60.689  1.00 100.25 ? 208 ALA B C  1 
ATOM 3460  O O  . ALA B 2 208 ? 123.793 123.821 59.843  1.00 100.25 ? 208 ALA B O  1 
ATOM 3461  N N  . PRO B 2 209 ? 121.688 124.305 60.422  1.00 93.86  ? 209 PRO B N  1 
ATOM 3462  C CA . PRO B 2 209 ? 121.206 124.037 59.065  1.00 93.86  ? 209 PRO B CA 1 
ATOM 3463  C C  . PRO B 2 209 ? 121.533 125.162 58.099  1.00 93.86  ? 209 PRO B C  1 
ATOM 3464  O O  . PRO B 2 209 ? 121.052 126.286 58.261  1.00 93.86  ? 209 PRO B O  1 
ATOM 3465  N N  . GLU B 2 210 ? 122.363 124.879 57.099  1.00 96.93  ? 210 GLU B N  1 
ATOM 3466  C CA . GLU B 2 210 ? 122.719 125.911 56.137  1.00 96.93  ? 210 GLU B CA 1 
ATOM 3467  C C  . GLU B 2 210 ? 121.607 126.076 55.113  1.00 96.93  ? 210 GLU B C  1 
ATOM 3468  O O  . GLU B 2 210 ? 120.951 125.110 54.717  1.00 96.93  ? 210 GLU B O  1 
ATOM 3469  N N  . LEU B 2 211 ? 121.393 127.304 54.698  1.00 94.58  ? 211 LEU B N  1 
ATOM 3470  C CA . LEU B 2 211 ? 120.184 127.672 53.993  1.00 94.58  ? 211 LEU B CA 1 
ATOM 3471  C C  . LEU B 2 211 ? 120.435 127.849 52.506  1.00 94.58  ? 211 LEU B C  1 
ATOM 3472  O O  . LEU B 2 211 ? 121.494 128.345 52.111  1.00 94.58  ? 211 LEU B O  1 
ATOM 3473  N N  . PRO B 2 212 ? 119.483 127.469 51.663  1.00 91.76  ? 212 PRO B N  1 
ATOM 3474  C CA . PRO B 2 212 ? 119.617 127.709 50.217  1.00 91.76  ? 212 PRO B CA 1 
ATOM 3475  C C  . PRO B 2 212 ? 119.238 129.137 49.853  1.00 91.76  ? 212 PRO B C  1 
ATOM 3476  O O  . PRO B 2 212 ? 118.225 129.404 49.201  1.00 91.76  ? 212 PRO B O  1 
ATOM 3477  N N  . ALA B 2 213 ? 120.063 130.081 50.298  1.00 95.86  ? 213 ALA B N  1 
ATOM 3478  C CA . ALA B 2 213 ? 119.807 131.496 50.063  1.00 95.86  ? 213 ALA B CA 1 
ATOM 3479  C C  . ALA B 2 213 ? 119.983 131.783 48.583  1.00 95.86  ? 213 ALA B C  1 
ATOM 3480  O O  . ALA B 2 213 ? 121.089 131.662 48.048  1.00 95.86  ? 213 ALA B O  1 
ATOM 3481  N N  . VAL B 2 214 ? 118.889 132.139 47.917  1.00 85.82  ? 214 VAL B N  1 
ATOM 3482  C CA . VAL B 2 214 ? 118.915 132.291 46.469  1.00 85.82  ? 214 VAL B CA 1 
ATOM 3483  C C  . VAL B 2 214 ? 119.680 133.571 46.143  1.00 85.82  ? 214 VAL B C  1 
ATOM 3484  O O  . VAL B 2 214 ? 119.164 134.687 46.254  1.00 85.82  ? 214 VAL B O  1 
ATOM 3485  N N  . SER B 2 215 ? 120.948 133.397 45.780  1.00 72.00  ? 215 SER B N  1 
ATOM 3486  C CA . SER B 2 215 ? 121.878 134.505 45.656  1.00 72.00  ? 215 SER B CA 1 
ATOM 3487  C C  . SER B 2 215 ? 122.748 134.410 44.414  1.00 72.00  ? 215 SER B C  1 
ATOM 3488  O O  . SER B 2 215 ? 123.667 135.218 44.266  1.00 72.00  ? 215 SER B O  1 
ATOM 3489  N N  . GLU B 2 216 ? 122.534 133.407 43.552  1.00 64.77  ? 216 GLU B N  1 
ATOM 3490  C CA . GLU B 2 216 ? 123.202 133.118 42.272  1.00 64.77  ? 216 GLU B CA 1 
ATOM 3491  C C  . GLU B 2 216 ? 124.674 132.725 42.396  1.00 64.77  ? 216 GLU B C  1 
ATOM 3492  O O  . GLU B 2 216 ? 125.287 132.323 41.402  1.00 64.77  ? 216 GLU B O  1 
ATOM 3493  N N  . PHE B 2 217 ? 125.267 132.882 43.584  1.00 51.52  ? 217 PHE B N  1 
ATOM 3494  C CA . PHE B 2 217 ? 126.568 132.373 44.015  1.00 51.52  ? 217 PHE B CA 1 
ATOM 3495  C C  . PHE B 2 217 ? 127.773 132.900 43.236  1.00 51.52  ? 217 PHE B C  1 
ATOM 3496  O O  . PHE B 2 217 ? 128.899 132.844 43.733  1.00 51.52  ? 217 PHE B O  1 
ATOM 3497  N N  . SER B 2 218 ? 127.572 133.472 42.058  1.00 53.43  ? 218 SER B N  1 
ATOM 3498  C CA . SER B 2 218 ? 128.675 134.022 41.293  1.00 53.43  ? 218 SER B CA 1 
ATOM 3499  C C  . SER B 2 218 ? 129.060 135.407 41.770  1.00 53.43  ? 218 SER B C  1 
ATOM 3500  O O  . SER B 2 218 ? 130.159 135.880 41.472  1.00 53.43  ? 218 SER B O  1 
ATOM 3501  N N  . THR B 2 219 ? 128.165 136.051 42.508  1.00 57.26  ? 219 THR B N  1 
ATOM 3502  C CA . THR B 2 219 ? 128.377 137.381 43.039  1.00 57.26  ? 219 THR B CA 1 
ATOM 3503  C C  . THR B 2 219 ? 127.855 137.548 44.454  1.00 57.26  ? 219 THR B C  1 
ATOM 3504  O O  . THR B 2 219 ? 127.957 138.652 44.998  1.00 57.26  ? 219 THR B O  1 
ATOM 3505  N N  . SER B 2 220 ? 127.278 136.494 45.036  1.00 59.51  ? 220 SER B N  1 
ATOM 3506  C CA . SER B 2 220 ? 126.967 136.387 46.466  1.00 59.51  ? 220 SER B CA 1 
ATOM 3507  C C  . SER B 2 220 ? 126.013 137.476 46.948  1.00 59.51  ? 220 SER B C  1 
ATOM 3508  O O  . SER B 2 220 ? 126.201 138.051 48.021  1.00 59.51  ? 220 SER B O  1 
ATOM 3509  N N  . GLU B 2 221 ? 124.994 137.773 46.153  1.00 58.14  ? 221 GLU B N  1 
ATOM 3510  C CA . GLU B 2 221 ? 123.985 138.755 46.505  1.00 58.14  ? 221 GLU B CA 1 
ATOM 3511  C C  . GLU B 2 221 ? 122.672 138.407 45.823  1.00 58.14  ? 221 GLU B C  1 
ATOM 3512  O O  . GLU B 2 221 ? 122.662 137.851 44.725  1.00 58.14  ? 221 GLU B O  1 
ATOM 3513  N N  . THR B 2 222 ? 121.561 138.753 46.477  1.00 58.51  ? 222 THR B N  1 
ATOM 3514  C CA . THR B 2 222 ? 120.254 138.218 46.115  1.00 58.51  ? 222 THR B CA 1 
ATOM 3515  C C  . THR B 2 222 ? 119.752 138.814 44.805  1.00 58.51  ? 222 THR B C  1 
ATOM 3516  O O  . THR B 2 222 ? 120.430 139.588 44.129  1.00 58.51  ? 222 THR B O  1 
ATOM 3517  N N  . MET B 2 223 ? 118.526 138.441 44.456  1.00 52.30  ? 223 MET B N  1 
ATOM 3518  C CA . MET B 2 223 ? 117.935 138.886 43.206  1.00 52.30  ? 223 MET B CA 1 
ATOM 3519  C C  . MET B 2 223 ? 117.648 140.377 43.245  1.00 52.30  ? 223 MET B C  1 
ATOM 3520  O O  . MET B 2 223 ? 117.778 141.074 42.230  1.00 52.30  ? 223 MET B O  1 
ATOM 3521  N N  . GLY B 2 224 ? 117.326 140.891 44.428  1.00 54.46  ? 224 GLY B N  1 
ATOM 3522  C CA . GLY B 2 224 ? 116.773 142.227 44.517  1.00 54.46  ? 224 GLY B CA 1 
ATOM 3523  C C  . GLY B 2 224 ? 117.817 143.319 44.442  1.00 54.46  ? 224 GLY B C  1 
ATOM 3524  O O  . GLY B 2 224 ? 117.527 144.422 43.970  1.00 54.46  ? 224 GLY B O  1 
ATOM 3525  N N  . HIS B 2 225 ? 119.028 143.045 44.937  1.00 53.94  ? 225 HIS B N  1 
ATOM 3526  C CA . HIS B 2 225 ? 120.107 144.012 44.791  1.00 53.94  ? 225 HIS B CA 1 
ATOM 3527  C C  . HIS B 2 225 ? 120.404 144.283 43.327  1.00 53.94  ? 225 HIS B C  1 
ATOM 3528  O O  . HIS B 2 225 ? 120.447 145.439 42.904  1.00 53.94  ? 225 HIS B O  1 
ATOM 3529  N N  . SER B 2 226 ? 120.548 143.235 42.527  1.00 53.41  ? 226 SER B N  1 
ATOM 3530  C CA . SER B 2 226 ? 120.804 143.441 41.109  1.00 53.41  ? 226 SER B CA 1 
ATOM 3531  C C  . SER B 2 226 ? 119.578 144.014 40.417  1.00 53.41  ? 226 SER B C  1 
ATOM 3532  O O  . SER B 2 226 ? 119.703 144.803 39.467  1.00 53.41  ? 226 SER B O  1 
ATOM 3533  N N  . ALA B 2 227 ? 118.394 143.673 40.934  1.00 53.85  ? 227 ALA B N  1 
ATOM 3534  C CA . ALA B 2 227 ? 117.151 144.215 40.407  1.00 53.85  ? 227 ALA B CA 1 
ATOM 3535  C C  . ALA B 2 227 ? 117.103 145.727 40.526  1.00 53.85  ? 227 ALA B C  1 
ATOM 3536  O O  . ALA B 2 227 ? 116.960 146.421 39.516  1.00 53.85  ? 227 ALA B O  1 
ATOM 3537  N N  . ASP B 2 228 ? 117.277 146.272 41.728  1.00 57.12  ? 228 ASP B N  1 
ATOM 3538  C CA . ASP B 2 228 ? 117.125 147.716 41.835  1.00 57.12  ? 228 ASP B CA 1 
ATOM 3539  C C  . ASP B 2 228 ? 118.376 148.445 41.367  1.00 57.12  ? 228 ASP B C  1 
ATOM 3540  O O  . ASP B 2 228 ? 118.314 149.636 41.064  1.00 57.12  ? 228 ASP B O  1 
ATOM 3541  N N  . ARG B 2 229 ? 119.514 147.745 41.271  1.00 52.22  ? 229 ARG B N  1 
ATOM 3542  C CA . ARG B 2 229 ? 120.669 148.343 40.603  1.00 52.22  ? 229 ARG B CA 1 
ATOM 3543  C C  . ARG B 2 229 ? 120.366 148.641 39.148  1.00 52.22  ? 229 ARG B C  1 
ATOM 3544  O O  . ARG B 2 229 ? 120.510 149.781 38.695  1.00 52.22  ? 229 ARG B O  1 
ATOM 3545  N N  . LEU B 2 230 ? 119.942 147.621 38.400  1.00 56.85  ? 230 LEU B N  1 
ATOM 3546  C CA . LEU B 2 230 ? 119.613 147.837 36.999  1.00 56.85  ? 230 LEU B CA 1 
ATOM 3547  C C  . LEU B 2 230 ? 118.404 148.739 36.847  1.00 56.85  ? 230 LEU B C  1 
ATOM 3548  O O  . LEU B 2 230 ? 118.290 149.432 35.834  1.00 56.85  ? 230 LEU B O  1 
ATOM 3549  N N  . ALA B 2 231 ? 117.518 148.757 37.836  1.00 56.21  ? 231 ALA B N  1 
ATOM 3550  C CA . ALA B 2 231 ? 116.384 149.659 37.778  1.00 56.21  ? 231 ALA B CA 1 
ATOM 3551  C C  . ALA B 2 231 ? 116.816 151.104 37.938  1.00 56.21  ? 231 ALA B C  1 
ATOM 3552  O O  . ALA B 2 231 ? 116.435 151.957 37.132  1.00 56.21  ? 231 ALA B O  1 
ATOM 3553  N N  . ALA B 2 232 ? 117.616 151.400 38.952  1.00 56.40  ? 232 ALA B N  1 
ATOM 3554  C CA . ALA B 2 232 ? 118.032 152.769 39.166  1.00 56.40  ? 232 ALA B CA 1 
ATOM 3555  C C  . ALA B 2 232 ? 119.047 153.231 38.139  1.00 56.40  ? 232 ALA B C  1 
ATOM 3556  O O  . ALA B 2 232 ? 119.159 154.436 37.902  1.00 56.40  ? 232 ALA B O  1 
ATOM 3557  N N  . ALA B 2 233 ? 119.757 152.301 37.500  1.00 57.20  ? 233 ALA B N  1 
ATOM 3558  C CA . ALA B 2 233 ? 120.828 152.692 36.597  1.00 57.20  ? 233 ALA B CA 1 
ATOM 3559  C C  . ALA B 2 233 ? 120.298 153.274 35.301  1.00 57.20  ? 233 ALA B C  1 
ATOM 3560  O O  . ALA B 2 233 ? 121.007 154.023 34.627  1.00 57.20  ? 233 ALA B O  1 
ATOM 3561  N N  . PHE B 2 234 ? 119.066 152.948 34.930  1.00 61.74  ? 234 PHE B N  1 
ATOM 3562  C CA . PHE B 2 234 ? 118.493 153.468 33.700  1.00 61.74  ? 234 PHE B CA 1 
ATOM 3563  C C  . PHE B 2 234 ? 117.364 154.455 33.957  1.00 61.74  ? 234 PHE B C  1 
ATOM 3564  O O  . PHE B 2 234 ? 116.383 154.466 33.205  1.00 61.74  ? 234 PHE B O  1 
ATOM 3565  N N  . ALA B 2 235 ? 117.483 155.258 35.021  1.00 66.39  ? 235 ALA B N  1 
ATOM 3566  C CA . ALA B 2 235 ? 116.692 156.475 35.250  1.00 66.39  ? 235 ALA B CA 1 
ATOM 3567  C C  . ALA B 2 235 ? 115.198 156.180 35.355  1.00 66.39  ? 235 ALA B C  1 
ATOM 3568  O O  . ALA B 2 235 ? 114.374 156.718 34.618  1.00 66.39  ? 235 ALA B O  1 
ATOM 3569  N N  . VAL B 2 236 ? 114.862 155.305 36.285  1.00 66.96  ? 236 VAL B N  1 
ATOM 3570  C CA . VAL B 2 236 ? 113.489 154.877 36.488  1.00 66.96  ? 236 VAL B CA 1 
ATOM 3571  C C  . VAL B 2 236 ? 112.990 155.507 37.776  1.00 66.96  ? 236 VAL B C  1 
ATOM 3572  O O  . VAL B 2 236 ? 113.521 155.236 38.856  1.00 66.96  ? 236 VAL B O  1 
ATOM 3573  N N  . SER B 2 237 ? 111.981 156.361 37.675  1.00 69.76  ? 237 SER B N  1 
ATOM 3574  C CA . SER B 2 237 ? 111.412 156.926 38.882  1.00 69.76  ? 237 SER B CA 1 
ATOM 3575  C C  . SER B 2 237 ? 110.446 155.936 39.511  1.00 69.76  ? 237 SER B C  1 
ATOM 3576  O O  . SER B 2 237 ? 110.060 154.938 38.906  1.00 69.76  ? 237 SER B O  1 
ATOM 3577  N N  . ARG B 2 238 ? 110.047 156.236 40.744  1.00 66.57  ? 238 ARG B N  1 
ATOM 3578  C CA . ARG B 2 238 ? 109.106 155.384 41.453  1.00 66.57  ? 238 ARG B CA 1 
ATOM 3579  C C  . ARG B 2 238 ? 107.719 155.459 40.834  1.00 66.57  ? 238 ARG B C  1 
ATOM 3580  O O  . ARG B 2 238 ? 106.990 154.462 40.818  1.00 66.57  ? 238 ARG B O  1 
ATOM 3581  N N  . LEU B 2 239 ? 107.347 156.623 40.305  1.00 70.39  ? 239 LEU B N  1 
ATOM 3582  C CA . LEU B 2 239 ? 106.044 156.761 39.667  1.00 70.39  ? 239 LEU B CA 1 
ATOM 3583  C C  . LEU B 2 239 ? 106.011 156.048 38.328  1.00 70.39  ? 239 LEU B C  1 
ATOM 3584  O O  . LEU B 2 239 ? 105.016 155.399 37.989  1.00 70.39  ? 239 LEU B O  1 
ATOM 3585  N N  . GLU B 2 240 ? 107.090 156.155 37.554  1.00 77.73  ? 240 GLU B N  1 
ATOM 3586  C CA . GLU B 2 240 ? 107.145 155.469 36.273  1.00 77.73  ? 240 GLU B CA 1 
ATOM 3587  C C  . GLU B 2 240 ? 107.270 153.963 36.433  1.00 77.73  ? 240 GLU B C  1 
ATOM 3588  O O  . GLU B 2 240 ? 106.876 153.222 35.532  1.00 77.73  ? 240 GLU B O  1 
ATOM 3589  N N  . GLN B 2 241 ? 107.788 153.496 37.562  1.00 71.28  ? 241 GLN B N  1 
ATOM 3590  C CA . GLN B 2 241 ? 107.981 152.075 37.790  1.00 71.28  ? 241 GLN B CA 1 
ATOM 3591  C C  . GLN B 2 241 ? 106.689 151.383 38.195  1.00 71.28  ? 241 GLN B C  1 
ATOM 3592  O O  . GLN B 2 241 ? 106.627 150.152 38.203  1.00 71.28  ? 241 GLN B O  1 
ATOM 3593  N N  . ASP B 2 242 ? 105.634 152.130 38.480  1.00 72.10  ? 242 ASP B N  1 
ATOM 3594  C CA . ASP B 2 242 ? 104.431 151.512 38.989  1.00 72.10  ? 242 ASP B CA 1 
ATOM 3595  C C  . ASP B 2 242 ? 103.200 151.743 38.135  1.00 72.10  ? 242 ASP B C  1 
ATOM 3596  O O  . ASP B 2 242 ? 102.163 151.129 38.412  1.00 72.10  ? 242 ASP B O  1 
ATOM 3597  N N  . GLU B 2 243 ? 103.287 152.589 37.109  1.00 69.68  ? 243 GLU B N  1 
ATOM 3598  C CA . GLU B 2 243 ? 102.327 152.537 36.015  1.00 69.68  ? 243 GLU B CA 1 
ATOM 3599  C C  . GLU B 2 243 ? 102.245 151.132 35.442  1.00 69.68  ? 243 GLU B C  1 
ATOM 3600  O O  . GLU B 2 243 ? 101.149 150.602 35.206  1.00 69.68  ? 243 GLU B O  1 
ATOM 3601  N N  . TYR B 2 244 ? 103.400 150.493 35.260  1.00 67.44  ? 244 TYR B N  1 
ATOM 3602  C CA . TYR B 2 244 ? 103.415 149.132 34.757  1.00 67.44  ? 244 TYR B CA 1 
ATOM 3603  C C  . TYR B 2 244 ? 102.864 148.156 35.780  1.00 67.44  ? 244 TYR B C  1 
ATOM 3604  O O  . TYR B 2 244 ? 102.246 147.154 35.403  1.00 67.44  ? 244 TYR B O  1 
ATOM 3605  N N  . ALA B 2 245 ? 103.069 148.426 37.067  1.00 64.76  ? 245 ALA B N  1 
ATOM 3606  C CA . ALA B 2 245 ? 102.498 147.565 38.095  1.00 64.76  ? 245 ALA B CA 1 
ATOM 3607  C C  . ALA B 2 245 ? 100.984 147.659 38.107  1.00 64.76  ? 245 ALA B C  1 
ATOM 3608  O O  . ALA B 2 245 ? 100.295 146.667 38.365  1.00 64.76  ? 245 ALA B O  1 
ATOM 3609  N N  . LEU B 2 246 ? 100.459 148.846 37.827  1.00 59.58  ? 246 LEU B N  1 
ATOM 3610  C CA . LEU B 2 246 ? 99.019  149.021 37.708  1.00 59.58  ? 246 LEU B CA 1 
ATOM 3611  C C  . LEU B 2 246 ? 98.478  148.276 36.499  1.00 59.58  ? 246 LEU B C  1 
ATOM 3612  O O  . LEU B 2 246 ? 97.420  147.643 36.581  1.00 59.58  ? 246 LEU B O  1 
ATOM 3613  N N  . ARG B 2 247 ? 99.194  148.348 35.374  1.00 59.57  ? 247 ARG B N  1 
ATOM 3614  C CA . ARG B 2 247 ? 98.780  147.633 34.169  1.00 59.57  ? 247 ARG B CA 1 
ATOM 3615  C C  . ARG B 2 247 ? 98.759  146.129 34.381  1.00 59.57  ? 247 ARG B C  1 
ATOM 3616  O O  . ARG B 2 247 ? 97.785  145.453 34.021  1.00 59.57  ? 247 ARG B O  1 
ATOM 3617  N N  . SER B 2 248 ? 99.806  145.587 34.998  1.00 61.04  ? 248 SER B N  1 
ATOM 3618  C CA . SER B 2 248 ? 99.956  144.141 35.098  1.00 61.04  ? 248 SER B CA 1 
ATOM 3619  C C  . SER B 2 248 ? 99.024  143.502 36.112  1.00 61.04  ? 248 SER B C  1 
ATOM 3620  O O  . SER B 2 248 ? 99.130  142.297 36.341  1.00 61.04  ? 248 SER B O  1 
ATOM 3621  N N  . HIS B 2 249 ? 98.142  144.263 36.745  1.00 57.49  ? 249 HIS B N  1 
ATOM 3622  C CA . HIS B 2 249 ? 96.991  143.693 37.416  1.00 57.49  ? 249 HIS B CA 1 
ATOM 3623  C C  . HIS B 2 249 ? 95.683  144.124 36.789  1.00 57.49  ? 249 HIS B C  1 
ATOM 3624  O O  . HIS B 2 249 ? 94.729  143.335 36.774  1.00 57.49  ? 249 HIS B O  1 
ATOM 3625  N N  . SER B 2 250 ? 95.622  145.363 36.284  1.00 56.81  ? 250 SER B N  1 
ATOM 3626  C CA . SER B 2 250 ? 94.395  145.885 35.704  1.00 56.81  ? 250 SER B CA 1 
ATOM 3627  C C  . SER B 2 250 ? 93.994  145.108 34.470  1.00 56.81  ? 250 SER B C  1 
ATOM 3628  O O  . SER B 2 250 ? 92.802  144.924 34.211  1.00 56.81  ? 250 SER B O  1 
ATOM 3629  N N  . LEU B 2 251 ? 94.965  144.622 33.715  1.00 55.01  ? 251 LEU B N  1 
ATOM 3630  C CA . LEU B 2 251 ? 94.609  143.765 32.604  1.00 55.01  ? 251 LEU B CA 1 
ATOM 3631  C C  . LEU B 2 251 ? 94.281  142.363 33.076  1.00 55.01  ? 251 LEU B C  1 
ATOM 3632  O O  . LEU B 2 251 ? 93.435  141.696 32.475  1.00 55.01  ? 251 LEU B O  1 
ATOM 3633  N N  . ALA B 2 252 ? 94.913  141.923 34.164  1.00 59.11  ? 252 ALA B N  1 
ATOM 3634  C CA . ALA B 2 252 ? 94.795  140.533 34.584  1.00 59.11  ? 252 ALA B CA 1 
ATOM 3635  C C  . ALA B 2 252 ? 93.414  140.233 35.130  1.00 59.11  ? 252 ALA B C  1 
ATOM 3636  O O  . ALA B 2 252 ? 92.857  139.155 34.875  1.00 59.11  ? 252 ALA B O  1 
ATOM 3637  N N  . LYS B 2 253 ? 92.853  141.171 35.889  1.00 65.27  ? 253 LYS B N  1 
ATOM 3638  C CA . LYS B 2 253 ? 91.521  140.946 36.442  1.00 65.27  ? 253 LYS B CA 1 
ATOM 3639  C C  . LYS B 2 253 ? 90.475  140.927 35.340  1.00 65.27  ? 253 LYS B C  1 
ATOM 3640  O O  . LYS B 2 253 ? 89.542  140.123 35.383  1.00 65.27  ? 253 LYS B O  1 
ATOM 3641  N N  . LYS B 2 254 ? 90.648  141.763 34.314  1.00 63.21  ? 254 LYS B N  1 
ATOM 3642  C CA . LYS B 2 254 ? 89.750  141.717 33.167  1.00 63.21  ? 254 LYS B CA 1 
ATOM 3643  C C  . LYS B 2 254 ? 89.933  140.431 32.375  1.00 63.21  ? 254 LYS B C  1 
ATOM 3644  O O  . LYS B 2 254 ? 88.961  139.896 31.824  1.00 63.21  ? 254 LYS B O  1 
ATOM 3645  N N  . ALA B 2 255 ? 91.161  139.911 32.339  1.00 58.29  ? 255 ALA B N  1 
ATOM 3646  C CA . ALA B 2 255 ? 91.429  138.669 31.630  1.00 58.29  ? 255 ALA B CA 1 
ATOM 3647  C C  . ALA B 2 255 ? 90.755  137.489 32.306  1.00 58.29  ? 255 ALA B C  1 
ATOM 3648  O O  . ALA B 2 255 ? 90.193  136.618 31.636  1.00 58.29  ? 255 ALA B O  1 
ATOM 3649  N N  . GLN B 2 256 ? 90.794  137.444 33.632  1.00 61.63  ? 256 GLN B N  1 
ATOM 3650  C CA . GLN B 2 256 ? 90.027  136.416 34.319  1.00 61.63  ? 256 GLN B CA 1 
ATOM 3651  C C  . GLN B 2 256 ? 88.539  136.707 34.309  1.00 61.63  ? 256 GLN B C  1 
ATOM 3652  O O  . GLN B 2 256 ? 87.745  135.775 34.463  1.00 61.63  ? 256 GLN B O  1 
ATOM 3653  N N  . ASP B 2 257 ? 88.146  137.970 34.134  1.00 79.23  ? 257 ASP B N  1 
ATOM 3654  C CA . ASP B 2 257 ? 86.729  138.311 34.105  1.00 79.23  ? 257 ASP B CA 1 
ATOM 3655  C C  . ASP B 2 257 ? 86.071  137.798 32.834  1.00 79.23  ? 257 ASP B C  1 
ATOM 3656  O O  . ASP B 2 257 ? 84.984  137.211 32.887  1.00 79.23  ? 257 ASP B O  1 
ATOM 3657  N N  . GLU B 2 258 ? 86.705  138.012 31.682  1.00 75.59  ? 258 GLU B N  1 
ATOM 3658  C CA . GLU B 2 258 ? 86.126  137.470 30.465  1.00 75.59  ? 258 GLU B CA 1 
ATOM 3659  C C  . GLU B 2 258 ? 86.310  135.961 30.395  1.00 75.59  ? 258 GLU B C  1 
ATOM 3660  O O  . GLU B 2 258 ? 85.503  135.273 29.764  1.00 75.59  ? 258 GLU B O  1 
ATOM 3661  N N  . GLY B 2 259 ? 87.319  135.426 31.073  1.00 73.24  ? 259 GLY B N  1 
ATOM 3662  C CA . GLY B 2 259 ? 87.407  133.990 31.251  1.00 73.24  ? 259 GLY B CA 1 
ATOM 3663  C C  . GLY B 2 259 ? 87.837  133.221 30.027  1.00 73.24  ? 259 GLY B C  1 
ATOM 3664  O O  . GLY B 2 259 ? 87.527  132.033 29.908  1.00 73.24  ? 259 GLY B O  1 
ATOM 3665  N N  . LEU B 2 260 ? 88.546  133.864 29.111  1.00 61.11  ? 260 LEU B N  1 
ATOM 3666  C CA . LEU B 2 260 ? 89.070  133.156 27.956  1.00 61.11  ? 260 LEU B CA 1 
ATOM 3667  C C  . LEU B 2 260 ? 90.531  132.789 28.102  1.00 61.11  ? 260 LEU B C  1 
ATOM 3668  O O  . LEU B 2 260 ? 91.100  132.198 27.180  1.00 61.11  ? 260 LEU B O  1 
ATOM 3669  N N  . LEU B 2 261 ? 91.162  133.122 29.222  1.00 48.49  ? 261 LEU B N  1 
ATOM 3670  C CA . LEU B 2 261 ? 92.465  132.536 29.490  1.00 48.49  ? 261 LEU B CA 1 
ATOM 3671  C C  . LEU B 2 261 ? 92.232  131.088 29.883  1.00 48.49  ? 261 LEU B C  1 
ATOM 3672  O O  . LEU B 2 261 ? 92.113  130.764 31.067  1.00 48.49  ? 261 LEU B O  1 
ATOM 3673  N N  . SER B 2 262 ? 92.145  130.214 28.889  1.00 51.11  ? 262 SER B N  1 
ATOM 3674  C CA . SER B 2 262 ? 91.614  128.872 29.063  1.00 51.11  ? 262 SER B CA 1 
ATOM 3675  C C  . SER B 2 262 ? 92.698  127.851 28.826  1.00 51.11  ? 262 SER B C  1 
ATOM 3676  O O  . SER B 2 262 ? 92.519  126.852 28.129  1.00 51.11  ? 262 SER B O  1 
ATOM 3677  N N  . ASP B 2 263 ? 93.853  128.103 29.403  1.00 43.39  ? 263 ASP B N  1 
ATOM 3678  C CA . ASP B 2 263 ? 94.949  127.158 29.399  1.00 43.39  ? 263 ASP B CA 1 
ATOM 3679  C C  . ASP B 2 263 ? 95.090  126.533 30.771  1.00 43.39  ? 263 ASP B C  1 
ATOM 3680  O O  . ASP B 2 263 ? 96.179  126.165 31.199  1.00 43.39  ? 263 ASP B O  1 
ATOM 3681  N N  . VAL B 2 264 ? 93.977  126.416 31.480  1.00 38.06  ? 264 VAL B N  1 
ATOM 3682  C CA . VAL B 2 264 ? 93.983  126.035 32.882  1.00 38.06  ? 264 VAL B CA 1 
ATOM 3683  C C  . VAL B 2 264 ? 93.141  124.789 33.061  1.00 38.06  ? 264 VAL B C  1 
ATOM 3684  O O  . VAL B 2 264 ? 91.955  124.783 32.722  1.00 38.06  ? 264 VAL B O  1 
ATOM 3685  N N  . VAL B 2 265 ? 93.749  123.739 33.591  1.00 38.77  ? 265 VAL B N  1 
ATOM 3686  C CA . VAL B 2 265 ? 92.995  122.606 34.103  1.00 38.77  ? 265 VAL B CA 1 
ATOM 3687  C C  . VAL B 2 265 ? 92.844  122.832 35.604  1.00 38.77  ? 265 VAL B C  1 
ATOM 3688  O O  . VAL B 2 265 ? 93.677  123.520 36.205  1.00 38.77  ? 265 VAL B O  1 
ATOM 3689  N N  . PRO B 2 266 ? 91.757  122.406 36.220  1.00 45.39  ? 266 PRO B N  1 
ATOM 3690  C CA . PRO B 2 266 ? 91.769  122.261 37.668  1.00 45.39  ? 266 PRO B CA 1 
ATOM 3691  C C  . PRO B 2 266 ? 92.119  120.836 38.042  1.00 45.39  ? 266 PRO B C  1 
ATOM 3692  O O  . PRO B 2 266 ? 91.958  119.901 37.260  1.00 45.39  ? 266 PRO B O  1 
ATOM 3693  N N  . PHE B 2 267 ? 92.631  120.684 39.253  1.00 54.48  ? 267 PHE B N  1 
ATOM 3694  C CA . PHE B 2 267 ? 92.703  119.377 39.883  1.00 54.48  ? 267 PHE B CA 1 
ATOM 3695  C C  . PHE B 2 267 ? 92.428  119.602 41.355  1.00 54.48  ? 267 PHE B C  1 
ATOM 3696  O O  . PHE B 2 267 ? 92.449  120.742 41.818  1.00 54.48  ? 267 PHE B O  1 
ATOM 3697  N N  . LYS B 2 268 ? 92.178  118.528 42.094  1.00 65.18  ? 268 LYS B N  1 
ATOM 3698  C CA . LYS B 2 268 ? 91.928  118.685 43.517  1.00 65.18  ? 268 LYS B CA 1 
ATOM 3699  C C  . LYS B 2 268 ? 93.214  118.427 44.291  1.00 65.18  ? 268 LYS B C  1 
ATOM 3700  O O  . LYS B 2 268 ? 93.923  117.451 44.043  1.00 65.18  ? 268 LYS B O  1 
ATOM 3701  N N  . VAL B 2 269 ? 93.517  119.318 45.223  1.00 72.80  ? 269 VAL B N  1 
ATOM 3702  C CA . VAL B 2 269 ? 94.586  119.090 46.183  1.00 72.80  ? 269 VAL B CA 1 
ATOM 3703  C C  . VAL B 2 269 ? 94.090  118.024 47.149  1.00 72.80  ? 269 VAL B C  1 
ATOM 3704  O O  . VAL B 2 269 ? 92.981  118.140 47.679  1.00 72.80  ? 269 VAL B O  1 
ATOM 3705  N N  . PRO B 2 270 ? 94.849  116.950 47.362  1.00 74.65  ? 270 PRO B N  1 
ATOM 3706  C CA . PRO B 2 270 ? 94.306  115.810 48.119  1.00 74.65  ? 270 PRO B CA 1 
ATOM 3707  C C  . PRO B 2 270 ? 94.092  116.090 49.595  1.00 74.65  ? 270 PRO B C  1 
ATOM 3708  O O  . PRO B 2 270 ? 93.218  115.480 50.223  1.00 74.65  ? 270 PRO B O  1 
ATOM 3709  N N  . GLY B 2 271 ? 94.837  117.024 50.163  1.00 82.77  ? 271 GLY B N  1 
ATOM 3710  C CA . GLY B 2 271 ? 94.674  117.285 51.573  1.00 82.77  ? 271 GLY B CA 1 
ATOM 3711  C C  . GLY B 2 271 ? 93.603  118.313 51.866  1.00 82.77  ? 271 GLY B C  1 
ATOM 3712  O O  . GLY B 2 271 ? 92.800  118.125 52.781  1.00 82.77  ? 271 GLY B O  1 
ATOM 3713  N N  . LYS B 2 272 ? 93.553  119.385 51.081  1.00 84.15  ? 272 LYS B N  1 
ATOM 3714  C CA . LYS B 2 272 ? 92.617  120.459 51.371  1.00 84.15  ? 272 LYS B CA 1 
ATOM 3715  C C  . LYS B 2 272 ? 91.445  120.410 50.411  1.00 84.15  ? 272 LYS B C  1 
ATOM 3716  O O  . LYS B 2 272 ? 91.386  119.538 49.541  1.00 84.15  ? 272 LYS B O  1 
ATOM 3717  N N  . ASP B 2 273 ? 90.504  121.335 50.596  1.00 101.43 ? 273 ASP B N  1 
ATOM 3718  C CA . ASP B 2 273 ? 89.110  121.045 50.290  1.00 101.43 ? 273 ASP B CA 1 
ATOM 3719  C C  . ASP B 2 273 ? 88.760  120.812 48.825  1.00 101.43 ? 273 ASP B C  1 
ATOM 3720  O O  . ASP B 2 273 ? 88.552  119.659 48.436  1.00 101.43 ? 273 ASP B O  1 
ATOM 3721  N N  . THR B 2 274 ? 88.736  121.844 47.984  1.00 87.22  ? 274 THR B N  1 
ATOM 3722  C CA . THR B 2 274 ? 87.927  121.611 46.794  1.00 87.22  ? 274 THR B CA 1 
ATOM 3723  C C  . THR B 2 274 ? 88.670  121.590 45.470  1.00 87.22  ? 274 THR B C  1 
ATOM 3724  O O  . THR B 2 274 ? 88.832  120.533 44.858  1.00 87.22  ? 274 THR B O  1 
ATOM 3725  N N  . VAL B 2 275 ? 89.137  122.749 45.034  1.00 71.64  ? 275 VAL B N  1 
ATOM 3726  C CA . VAL B 2 275 ? 89.667  122.941 43.691  1.00 71.64  ? 275 VAL B CA 1 
ATOM 3727  C C  . VAL B 2 275 ? 90.708  124.031 43.774  1.00 71.64  ? 275 VAL B C  1 
ATOM 3728  O O  . VAL B 2 275 ? 91.029  124.513 44.862  1.00 71.64  ? 275 VAL B O  1 
ATOM 3729  N N  . THR B 2 276 ? 91.246  124.416 42.627  1.00 61.20  ? 276 THR B N  1 
ATOM 3730  C CA . THR B 2 276 ? 92.096  125.591 42.552  1.00 61.20  ? 276 THR B CA 1 
ATOM 3731  C C  . THR B 2 276 ? 91.756  126.504 41.376  1.00 61.20  ? 276 THR B C  1 
ATOM 3732  O O  . THR B 2 276 ? 91.216  126.062 40.357  1.00 61.20  ? 276 THR B O  1 
ATOM 3733  N N  . LYS B 2 277 ? 92.057  127.789 41.541  1.00 54.90  ? 277 LYS B N  1 
ATOM 3734  C CA . LYS B 2 277 ? 92.075  128.782 40.479  1.00 54.90  ? 277 LYS B CA 1 
ATOM 3735  C C  . LYS B 2 277 ? 92.955  129.913 40.991  1.00 54.90  ? 277 LYS B C  1 
ATOM 3736  O O  . LYS B 2 277 ? 93.050  130.125 42.201  1.00 54.90  ? 277 LYS B O  1 
ATOM 3737  N N  . ASP B 2 278 ? 93.597  130.620 40.057  1.00 54.75  ? 278 ASP B N  1 
ATOM 3738  C CA . ASP B 2 278 ? 94.734  131.510 40.303  1.00 54.75  ? 278 ASP B CA 1 
ATOM 3739  C C  . ASP B 2 278 ? 94.438  132.578 41.350  1.00 54.75  ? 278 ASP B C  1 
ATOM 3740  O O  . ASP B 2 278 ? 93.306  133.031 41.511  1.00 54.75  ? 278 ASP B O  1 
ATOM 3741  N N  . ASN B 2 279 ? 95.479  132.974 42.077  1.00 52.32  ? 279 ASN B N  1 
ATOM 3742  C CA . ASN B 2 279 ? 95.245  133.660 43.338  1.00 52.32  ? 279 ASN B CA 1 
ATOM 3743  C C  . ASN B 2 279 ? 95.992  134.977 43.430  1.00 52.32  ? 279 ASN B C  1 
ATOM 3744  O O  . ASN B 2 279 ? 95.615  135.860 44.203  1.00 52.32  ? 279 ASN B O  1 
ATOM 3745  N N  . GLY B 2 280 ? 97.043  135.129 42.643  1.00 55.26  ? 280 GLY B N  1 
ATOM 3746  C CA . GLY B 2 280 ? 97.904  136.288 42.783  1.00 55.26  ? 280 GLY B CA 1 
ATOM 3747  C C  . GLY B 2 280 ? 97.376  137.583 42.208  1.00 55.26  ? 280 GLY B C  1 
ATOM 3748  O O  . GLY B 2 280 ? 98.147  138.536 42.080  1.00 55.26  ? 280 GLY B O  1 
ATOM 3749  N N  . ILE B 2 281 ? 96.100  137.656 41.854  1.00 60.32  ? 281 ILE B N  1 
ATOM 3750  C CA . ILE B 2 281 ? 95.568  138.824 41.169  1.00 60.32  ? 281 ILE B CA 1 
ATOM 3751  C C  . ILE B 2 281 ? 94.885  139.740 42.176  1.00 60.32  ? 281 ILE B C  1 
ATOM 3752  O O  . ILE B 2 281 ? 93.867  139.375 42.771  1.00 60.32  ? 281 ILE B O  1 
ATOM 3753  N N  . ARG B 2 282 ? 95.443  140.936 42.364  1.00 72.97  ? 282 ARG B N  1 
ATOM 3754  C CA . ARG B 2 282 ? 94.769  141.937 43.145  1.00 72.97  ? 282 ARG B CA 1 
ATOM 3755  C C  . ARG B 2 282 ? 95.040  143.316 42.555  1.00 72.97  ? 282 ARG B C  1 
ATOM 3756  O O  . ARG B 2 282 ? 96.204  143.654 42.288  1.00 72.97  ? 282 ARG B O  1 
ATOM 3757  N N  . PRO B 2 283 ? 94.001  144.084 42.253  1.00 77.91  ? 283 PRO B N  1 
ATOM 3758  C CA . PRO B 2 283 ? 94.196  145.461 41.797  1.00 77.91  ? 283 PRO B CA 1 
ATOM 3759  C C  . PRO B 2 283 ? 94.120  146.458 42.938  1.00 77.91  ? 283 PRO B C  1 
ATOM 3760  O O  . PRO B 2 283 ? 93.435  146.254 43.941  1.00 77.91  ? 283 PRO B O  1 
ATOM 3761  N N  . SER B 2 284 ? 94.843  147.561 42.772  1.00 85.85  ? 284 SER B N  1 
ATOM 3762  C CA . SER B 2 284 ? 94.837  148.639 43.751  1.00 85.85  ? 284 SER B CA 1 
ATOM 3763  C C  . SER B 2 284 ? 95.094  149.954 43.030  1.00 85.85  ? 284 SER B C  1 
ATOM 3764  O O  . SER B 2 284 ? 95.227  149.996 41.805  1.00 85.85  ? 284 SER B O  1 
ATOM 3765  N N  . SER B 2 285 ? 95.166  151.033 43.800  1.00 89.89  ? 285 SER B N  1 
ATOM 3766  C CA . SER B 2 285 ? 95.451  152.351 43.258  1.00 89.89  ? 285 SER B CA 1 
ATOM 3767  C C  . SER B 2 285 ? 96.909  152.708 43.490  1.00 89.89  ? 285 SER B C  1 
ATOM 3768  O O  . SER B 2 285 ? 97.613  152.076 44.279  1.00 89.89  ? 285 SER B O  1 
ATOM 3769  N N  . LEU B 2 286 ? 97.350  153.758 42.800  1.00 85.48  ? 286 LEU B N  1 
ATOM 3770  C CA . LEU B 2 286 ? 98.752  154.150 42.861  1.00 85.48  ? 286 LEU B CA 1 
ATOM 3771  C C  . LEU B 2 286 ? 99.097  154.740 44.217  1.00 85.48  ? 286 LEU B C  1 
ATOM 3772  O O  . LEU B 2 286 ? 100.211 154.551 44.718  1.00 85.48  ? 286 LEU B O  1 
ATOM 3773  N N  . GLU B 2 287 ? 98.150  155.444 44.829  1.00 94.61  ? 287 GLU B N  1 
ATOM 3774  C CA . GLU B 2 287 ? 98.385  156.006 46.148  1.00 94.61  ? 287 GLU B CA 1 
ATOM 3775  C C  . GLU B 2 287 ? 98.442  154.932 47.215  1.00 94.61  ? 287 GLU B C  1 
ATOM 3776  O O  . GLU B 2 287 ? 99.071  155.138 48.256  1.00 94.61  ? 287 GLU B O  1 
ATOM 3777  N N  . GLN B 2 288 ? 97.814  153.786 46.980  1.00 102.78 ? 288 GLN B N  1 
ATOM 3778  C CA . GLN B 2 288 ? 97.874  152.687 47.924  1.00 102.78 ? 288 GLN B CA 1 
ATOM 3779  C C  . GLN B 2 288 ? 99.036  151.753 47.642  1.00 102.78 ? 288 GLN B C  1 
ATOM 3780  O O  . GLN B 2 288 ? 99.057  150.628 48.152  1.00 102.78 ? 288 GLN B O  1 
ATOM 3781  N N  . MET B 2 289 ? 100.000 152.189 46.849  1.00 87.80  ? 289 MET B N  1 
ATOM 3782  C CA . MET B 2 289 ? 101.188 151.399 46.598  1.00 87.80  ? 289 MET B CA 1 
ATOM 3783  C C  . MET B 2 289 ? 102.466 152.048 47.082  1.00 87.80  ? 289 MET B C  1 
ATOM 3784  O O  . MET B 2 289 ? 103.341 151.342 47.579  1.00 87.80  ? 289 MET B O  1 
ATOM 3785  N N  . ALA B 2 290 ? 102.592 153.371 46.970  1.00 80.76  ? 290 ALA B N  1 
ATOM 3786  C CA . ALA B 2 290 ? 103.825 154.042 47.360  1.00 80.76  ? 290 ALA B CA 1 
ATOM 3787  C C  . ALA B 2 290 ? 104.045 154.054 48.865  1.00 80.76  ? 290 ALA B C  1 
ATOM 3788  O O  . ALA B 2 290 ? 105.160 154.345 49.307  1.00 80.76  ? 290 ALA B O  1 
ATOM 3789  N N  . LYS B 2 291 ? 103.021 153.741 49.658  1.00 78.15  ? 291 LYS B N  1 
ATOM 3790  C CA . LYS B 2 291 ? 103.191 153.653 51.099  1.00 78.15  ? 291 LYS B CA 1 
ATOM 3791  C C  . LYS B 2 291 ? 103.943 152.393 51.506  1.00 78.15  ? 291 LYS B C  1 
ATOM 3792  O O  . LYS B 2 291 ? 104.537 152.361 52.590  1.00 78.15  ? 291 LYS B O  1 
ATOM 3793  N N  . LEU B 2 292 ? 103.951 151.367 50.655  1.00 79.41  ? 292 LEU B N  1 
ATOM 3794  C CA . LEU B 2 292 ? 104.622 150.117 50.988  1.00 79.41  ? 292 LEU B CA 1 
ATOM 3795  C C  . LEU B 2 292 ? 106.128 150.333 51.012  1.00 79.41  ? 292 LEU B C  1 
ATOM 3796  O O  . LEU B 2 292 ? 106.742 150.595 49.974  1.00 79.41  ? 292 LEU B O  1 
ATOM 3797  N N  . LYS B 2 293 ? 106.711 150.233 52.196  1.00 70.20  ? 293 LYS B N  1 
ATOM 3798  C CA . LYS B 2 293 ? 108.121 150.523 52.360  1.00 70.20  ? 293 LYS B CA 1 
ATOM 3799  C C  . LYS B 2 293 ? 108.958 149.389 51.778  1.00 70.20  ? 293 LYS B C  1 
ATOM 3800  O O  . LYS B 2 293 ? 108.663 148.219 52.022  1.00 70.20  ? 293 LYS B O  1 
ATOM 3801  N N  . PRO B 2 294 ? 109.990 149.706 50.993  1.00 69.95  ? 294 PRO B N  1 
ATOM 3802  C CA . PRO B 2 294 ? 110.713 148.660 50.263  1.00 69.95  ? 294 PRO B CA 1 
ATOM 3803  C C  . PRO B 2 294 ? 111.534 147.776 51.179  1.00 69.95  ? 294 PRO B C  1 
ATOM 3804  O O  . PRO B 2 294 ? 112.072 148.230 52.188  1.00 69.95  ? 294 PRO B O  1 
ATOM 3805  N N  . ALA B 2 295 ? 111.618 146.501 50.812  1.00 70.00  ? 295 ALA B N  1 
ATOM 3806  C CA . ALA B 2 295 ? 112.234 145.492 51.660  1.00 70.00  ? 295 ALA B CA 1 
ATOM 3807  C C  . ALA B 2 295 ? 113.610 145.057 51.200  1.00 70.00  ? 295 ALA B C  1 
ATOM 3808  O O  . ALA B 2 295 ? 114.422 144.666 52.040  1.00 70.00  ? 295 ALA B O  1 
ATOM 3809  N N  . PHE B 2 296 ? 113.898 145.112 49.900  1.00 62.58  ? 296 PHE B N  1 
ATOM 3810  C CA . PHE B 2 296 ? 115.173 144.621 49.394  1.00 62.58  ? 296 PHE B CA 1 
ATOM 3811  C C  . PHE B 2 296 ? 116.347 145.529 49.713  1.00 62.58  ? 296 PHE B C  1 
ATOM 3812  O O  . PHE B 2 296 ? 117.488 145.064 49.651  1.00 62.58  ? 296 PHE B O  1 
ATOM 3813  N N  . ILE B 2 297 ? 116.111 146.784 50.070  1.00 58.58  ? 297 ILE B N  1 
ATOM 3814  C CA . ILE B 2 297 ? 117.188 147.720 50.346  1.00 58.58  ? 297 ILE B CA 1 
ATOM 3815  C C  . ILE B 2 297 ? 116.633 148.784 51.294  1.00 58.58  ? 297 ILE B C  1 
ATOM 3816  O O  . ILE B 2 297 ? 115.446 148.789 51.618  1.00 58.58  ? 297 ILE B O  1 
ATOM 3817  N N  . LYS B 2 298 ? 117.511 149.644 51.804  1.00 70.63  ? 298 LYS B N  1 
ATOM 3818  C CA . LYS B 2 298 ? 117.119 150.741 52.678  1.00 70.63  ? 298 LYS B CA 1 
ATOM 3819  C C  . LYS B 2 298 ? 116.222 151.706 51.905  1.00 70.63  ? 298 LYS B C  1 
ATOM 3820  O O  . LYS B 2 298 ? 116.396 151.867 50.697  1.00 70.63  ? 298 LYS B O  1 
ATOM 3821  N N  . PRO B 2 299 ? 115.273 152.389 52.587  1.00 73.88  ? 299 PRO B N  1 
ATOM 3822  C CA . PRO B 2 299 ? 114.242 153.190 51.895  1.00 73.88  ? 299 PRO B CA 1 
ATOM 3823  C C  . PRO B 2 299 ? 114.598 154.234 50.840  1.00 73.88  ? 299 PRO B C  1 
ATOM 3824  O O  . PRO B 2 299 ? 113.683 154.861 50.300  1.00 73.88  ? 299 PRO B O  1 
ATOM 3825  N N  . TYR B 2 300 ? 115.866 154.450 50.518  1.00 70.82  ? 300 TYR B N  1 
ATOM 3826  C CA . TYR B 2 300 ? 116.143 155.253 49.336  1.00 70.82  ? 300 TYR B CA 1 
ATOM 3827  C C  . TYR B 2 300 ? 115.865 154.511 48.032  1.00 70.82  ? 300 TYR B C  1 
ATOM 3828  O O  . TYR B 2 300 ? 115.609 155.161 47.015  1.00 70.82  ? 300 TYR B O  1 
ATOM 3829  N N  . GLY B 2 301 ? 115.898 153.181 48.033  1.00 65.90  ? 301 GLY B N  1 
ATOM 3830  C CA . GLY B 2 301 ? 115.735 152.398 46.823  1.00 65.90  ? 301 GLY B CA 1 
ATOM 3831  C C  . GLY B 2 301 ? 114.307 152.364 46.316  1.00 65.90  ? 301 GLY B C  1 
ATOM 3832  O O  . GLY B 2 301 ? 113.413 153.040 46.824  1.00 65.90  ? 301 GLY B O  1 
ATOM 3833  N N  . THR B 2 302 ? 114.089 151.535 45.288  1.00 69.66  ? 302 THR B N  1 
ATOM 3834  C CA . THR B 2 302 ? 112.853 151.645 44.521  1.00 69.66  ? 302 THR B CA 1 
ATOM 3835  C C  . THR B 2 302 ? 112.271 150.302 44.087  1.00 69.66  ? 302 THR B C  1 
ATOM 3836  O O  . THR B 2 302 ? 111.641 150.209 43.029  1.00 69.66  ? 302 THR B O  1 
ATOM 3837  N N  . VAL B 2 303 ? 112.436 149.255 44.883  1.00 69.80  ? 303 VAL B N  1 
ATOM 3838  C CA . VAL B 2 303 ? 111.777 147.983 44.622  1.00 69.80  ? 303 VAL B CA 1 
ATOM 3839  C C  . VAL B 2 303 ? 111.127 147.517 45.910  1.00 69.80  ? 303 VAL B C  1 
ATOM 3840  O O  . VAL B 2 303 ? 111.822 147.252 46.896  1.00 69.80  ? 303 VAL B O  1 
ATOM 3841  N N  . THR B 2 304 ? 109.804 147.419 45.908  1.00 77.76  ? 304 THR B N  1 
ATOM 3842  C CA . THR B 2 304 ? 109.069 146.923 47.059  1.00 77.76  ? 304 THR B CA 1 
ATOM 3843  C C  . THR B 2 304 ? 108.317 145.660 46.677  1.00 77.76  ? 304 THR B C  1 
ATOM 3844  O O  . THR B 2 304 ? 108.224 145.295 45.507  1.00 77.76  ? 304 THR B O  1 
ATOM 3845  N N  . ALA B 2 305 ? 107.751 145.006 47.689  1.00 80.37  ? 305 ALA B N  1 
ATOM 3846  C CA . ALA B 2 305 ? 107.088 143.724 47.494  1.00 80.37  ? 305 ALA B CA 1 
ATOM 3847  C C  . ALA B 2 305 ? 105.767 143.828 46.746  1.00 80.37  ? 305 ALA B C  1 
ATOM 3848  O O  . ALA B 2 305 ? 105.238 142.794 46.330  1.00 80.37  ? 305 ALA B O  1 
ATOM 3849  N N  . ALA B 2 306 ? 105.211 145.029 46.584  1.00 77.46  ? 306 ALA B N  1 
ATOM 3850  C CA . ALA B 2 306 ? 103.981 145.167 45.814  1.00 77.46  ? 306 ALA B CA 1 
ATOM 3851  C C  . ALA B 2 306 ? 104.238 144.900 44.345  1.00 77.46  ? 306 ALA B C  1 
ATOM 3852  O O  . ALA B 2 306 ? 103.612 144.028 43.737  1.00 77.46  ? 306 ALA B O  1 
ATOM 3853  N N  . ASN B 2 307 ? 105.159 145.644 43.759  1.00 72.41  ? 307 ASN B N  1 
ATOM 3854  C CA . ASN B 2 307 ? 105.485 145.472 42.351  1.00 72.41  ? 307 ASN B CA 1 
ATOM 3855  C C  . ASN B 2 307 ? 106.661 144.526 42.150  1.00 72.41  ? 307 ASN B C  1 
ATOM 3856  O O  . ASN B 2 307 ? 107.607 144.821 41.428  1.00 72.41  ? 307 ASN B O  1 
ATOM 3857  N N  . SER B 2 308 ? 106.602 143.353 42.768  1.00 75.12  ? 308 SER B N  1 
ATOM 3858  C CA . SER B 2 308 ? 107.698 142.403 42.673  1.00 75.12  ? 308 SER B CA 1 
ATOM 3859  C C  . SER B 2 308 ? 107.140 140.997 42.723  1.00 75.12  ? 308 SER B C  1 
ATOM 3860  O O  . SER B 2 308 ? 106.014 140.778 43.173  1.00 75.12  ? 308 SER B O  1 
ATOM 3861  N N  . SER B 2 309 ? 107.921 140.054 42.213  1.00 57.80  ? 309 SER B N  1 
ATOM 3862  C CA . SER B 2 309 ? 107.488 138.674 42.184  1.00 57.80  ? 309 SER B CA 1 
ATOM 3863  C C  . SER B 2 309 ? 107.379 138.119 43.592  1.00 57.80  ? 309 SER B C  1 
ATOM 3864  O O  . SER B 2 309 ? 107.959 138.637 44.545  1.00 57.80  ? 309 SER B O  1 
ATOM 3865  N N  . PHE B 2 310 ? 106.611 137.055 43.718  1.00 52.94  ? 310 PHE B N  1 
ATOM 3866  C CA . PHE B 2 310 ? 106.382 136.440 45.007  1.00 52.94  ? 310 PHE B CA 1 
ATOM 3867  C C  . PHE B 2 310 ? 106.531 134.938 44.874  1.00 52.94  ? 310 PHE B C  1 
ATOM 3868  O O  . PHE B 2 310 ? 106.424 134.377 43.782  1.00 52.94  ? 310 PHE B O  1 
ATOM 3869  N N  . LEU B 2 311 ? 106.800 134.304 46.006  1.00 53.87  ? 311 LEU B N  1 
ATOM 3870  C CA . LEU B 2 311 ? 107.049 132.872 46.047  1.00 53.87  ? 311 LEU B CA 1 
ATOM 3871  C C  . LEU B 2 311 ? 105.767 132.128 45.709  1.00 53.87  ? 311 LEU B C  1 
ATOM 3872  O O  . LEU B 2 311 ? 104.844 132.077 46.524  1.00 53.87  ? 311 LEU B O  1 
ATOM 3873  N N  . THR B 2 312 ? 105.695 131.574 44.501  1.00 49.73  ? 312 THR B N  1 
ATOM 3874  C CA . THR B 2 312 ? 104.505 130.831 44.115  1.00 49.73  ? 312 THR B CA 1 
ATOM 3875  C C  . THR B 2 312 ? 104.849 129.492 43.495  1.00 49.73  ? 312 THR B C  1 
ATOM 3876  O O  . THR B 2 312 ? 105.978 129.275 43.055  1.00 49.73  ? 312 THR B O  1 
ATOM 3877  N N  . ASP B 2 313 ? 103.876 128.591 43.446  1.00 50.00  ? 313 ASP B N  1 
ATOM 3878  C CA . ASP B 2 313 ? 104.145 127.207 43.105  1.00 50.00  ? 313 ASP B CA 1 
ATOM 3879  C C  . ASP B 2 313 ? 103.206 126.796 41.988  1.00 50.00  ? 313 ASP B C  1 
ATOM 3880  O O  . ASP B 2 313 ? 102.104 127.327 41.867  1.00 50.00  ? 313 ASP B O  1 
ATOM 3881  N N  . GLY B 2 314 ? 103.629 125.838 41.174  1.00 34.86  ? 314 GLY B N  1 
ATOM 3882  C CA . GLY B 2 314 ? 102.810 125.406 40.061  1.00 34.86  ? 314 GLY B CA 1 
ATOM 3883  C C  . GLY B 2 314 ? 103.603 124.630 39.033  1.00 34.86  ? 314 GLY B C  1 
ATOM 3884  O O  . GLY B 2 314 ? 104.811 124.431 39.147  1.00 34.86  ? 314 GLY B O  1 
ATOM 3885  N N  . ALA B 2 315 ? 102.881 124.185 38.012  1.00 27.10  ? 315 ALA B N  1 
ATOM 3886  C CA . ALA B 2 315 ? 103.452 123.337 36.984  1.00 27.10  ? 315 ALA B CA 1 
ATOM 3887  C C  . ALA B 2 315 ? 102.843 123.697 35.646  1.00 27.10  ? 315 ALA B C  1 
ATOM 3888  O O  . ALA B 2 315 ? 101.885 124.464 35.563  1.00 27.10  ? 315 ALA B O  1 
ATOM 3889  N N  . SER B 2 316 ? 103.405 123.122 34.593  1.00 28.74  ? 316 SER B N  1 
ATOM 3890  C CA . SER B 2 316 ? 102.929 123.379 33.247  1.00 28.74  ? 316 SER B CA 1 
ATOM 3891  C C  . SER B 2 316 ? 103.451 122.295 32.335  1.00 28.74  ? 316 SER B C  1 
ATOM 3892  O O  . SER B 2 316 ? 104.499 121.711 32.599  1.00 28.74  ? 316 SER B O  1 
ATOM 3893  N N  . ALA B 2 317 ? 102.741 122.075 31.239  1.00 24.04  ? 317 ALA B N  1 
ATOM 3894  C CA . ALA B 2 317 ? 103.164 121.107 30.244  1.00 24.04  ? 317 ALA B CA 1 
ATOM 3895  C C  . ALA B 2 317 ? 102.559 121.495 28.913  1.00 24.04  ? 317 ALA B C  1 
ATOM 3896  O O  . ALA B 2 317 ? 101.693 122.362 28.841  1.00 24.04  ? 317 ALA B O  1 
ATOM 3897  N N  . MET B 2 318 ? 103.021 120.840 27.859  1.00 17.39  ? 318 MET B N  1 
ATOM 3898  C CA . MET B 2 318 ? 102.448 121.044 26.539  1.00 17.39  ? 318 MET B CA 1 
ATOM 3899  C C  . MET B 2 318 ? 102.710 119.787 25.730  1.00 17.39  ? 318 MET B C  1 
ATOM 3900  O O  . MET B 2 318 ? 103.057 118.742 26.286  1.00 17.39  ? 318 MET B O  1 
ATOM 3901  N N  . LEU B 2 319 ? 102.530 119.869 24.423  1.00 30.48  ? 319 LEU B N  1 
ATOM 3902  C CA . LEU B 2 319 ? 102.916 118.775 23.558  1.00 30.48  ? 319 LEU B CA 1 
ATOM 3903  C C  . LEU B 2 319 ? 103.516 119.378 22.310  1.00 30.48  ? 319 LEU B C  1 
ATOM 3904  O O  . LEU B 2 319 ? 103.012 120.378 21.801  1.00 30.48  ? 319 LEU B O  1 
ATOM 3905  N N  . ILE B 2 320 ? 104.587 118.775 21.816  1.00 35.05  ? 320 ILE B N  1 
ATOM 3906  C CA . ILE B 2 320 ? 105.267 119.259 20.627  1.00 35.05  ? 320 ILE B CA 1 
ATOM 3907  C C  . ILE B 2 320 ? 105.342 118.138 19.610  1.00 35.05  ? 320 ILE B C  1 
ATOM 3908  O O  . ILE B 2 320 ? 105.925 117.085 19.876  1.00 35.05  ? 320 ILE B O  1 
ATOM 3909  N N  . MET B 2 321 ? 104.799 118.393 18.435  1.00 60.48  ? 321 MET B N  1 
ATOM 3910  C CA . MET B 2 321 ? 104.520 117.378 17.443  1.00 60.48  ? 321 MET B CA 1 
ATOM 3911  C C  . MET B 2 321 ? 105.294 117.729 16.191  1.00 60.48  ? 321 MET B C  1 
ATOM 3912  O O  . MET B 2 321 ? 105.554 118.903 15.918  1.00 60.48  ? 321 MET B O  1 
ATOM 3913  N N  . ALA B 2 322 ? 105.695 116.714 15.446  1.00 62.09  ? 322 ALA B N  1 
ATOM 3914  C CA . ALA B 2 322 ? 106.132 116.975 14.087  1.00 62.09  ? 322 ALA B CA 1 
ATOM 3915  C C  . ALA B 2 322 ? 104.917 117.337 13.250  1.00 62.09  ? 322 ALA B C  1 
ATOM 3916  O O  . ALA B 2 322 ? 103.815 116.852 13.503  1.00 62.09  ? 322 ALA B O  1 
ATOM 3917  N N  . GLU B 2 323 ? 105.114 118.211 12.260  1.00 66.69  ? 323 GLU B N  1 
ATOM 3918  C CA . GLU B 2 323 ? 103.972 118.680 11.483  1.00 66.69  ? 323 GLU B CA 1 
ATOM 3919  C C  . GLU B 2 323 ? 103.367 117.574 10.632  1.00 66.69  ? 323 GLU B C  1 
ATOM 3920  O O  . GLU B 2 323 ? 102.143 117.517 10.480  1.00 66.69  ? 323 GLU B O  1 
ATOM 3921  N N  . GLU B 2 324 ? 104.192 116.675 10.098  1.00 80.84  ? 324 GLU B N  1 
ATOM 3922  C CA . GLU B 2 324 ? 103.661 115.672 9.187   1.00 80.84  ? 324 GLU B CA 1 
ATOM 3923  C C  . GLU B 2 324 ? 102.810 114.643 9.923   1.00 80.84  ? 324 GLU B C  1 
ATOM 3924  O O  . GLU B 2 324 ? 101.759 114.234 9.423   1.00 80.84  ? 324 GLU B O  1 
ATOM 3925  N N  . LYS B 2 325 ? 103.186 114.272 11.147  1.00 76.87  ? 325 LYS B N  1 
ATOM 3926  C CA . LYS B 2 325 ? 102.268 113.420 11.889  1.00 76.87  ? 325 LYS B CA 1 
ATOM 3927  C C  . LYS B 2 325 ? 101.124 114.222 12.503  1.00 76.87  ? 325 LYS B C  1 
ATOM 3928  O O  . LYS B 2 325 ? 100.052 113.662 12.757  1.00 76.87  ? 325 LYS B O  1 
ATOM 3929  N N  . ALA B 2 326 ? 101.295 115.532 12.676  1.00 77.87  ? 326 ALA B N  1 
ATOM 3930  C CA . ALA B 2 326 ? 100.172 116.356 13.110  1.00 77.87  ? 326 ALA B CA 1 
ATOM 3931  C C  . ALA B 2 326 ? 99.096  116.441 12.037  1.00 77.87  ? 326 ALA B C  1 
ATOM 3932  O O  . ALA B 2 326 ? 97.904  116.524 12.351  1.00 77.87  ? 326 ALA B O  1 
ATOM 3933  N N  . LEU B 2 327 ? 99.489  116.411 10.770  1.00 87.64  ? 327 LEU B N  1 
ATOM 3934  C CA . LEU B 2 327 ? 98.511  116.368 9.695   1.00 87.64  ? 327 LEU B CA 1 
ATOM 3935  C C  . LEU B 2 327 ? 98.113  114.956 9.308   1.00 87.64  ? 327 LEU B C  1 
ATOM 3936  O O  . LEU B 2 327 ? 97.073  114.780 8.666   1.00 87.64  ? 327 LEU B O  1 
ATOM 3937  N N  . ALA B 2 328 ? 98.898  113.948 9.681   1.00 93.02  ? 328 ALA B N  1 
ATOM 3938  C CA . ALA B 2 328 ? 98.518  112.569 9.412   1.00 93.02  ? 328 ALA B CA 1 
ATOM 3939  C C  . ALA B 2 328 ? 97.509  112.053 10.430  1.00 93.02  ? 328 ALA B C  1 
ATOM 3940  O O  . ALA B 2 328 ? 96.529  111.402 10.061  1.00 93.02  ? 328 ALA B O  1 
ATOM 3941  N N  . MET B 2 329 ? 97.730  112.332 11.713  1.00 92.43  ? 329 MET B N  1 
ATOM 3942  C CA . MET B 2 329 ? 96.753  111.938 12.717  1.00 92.43  ? 329 MET B CA 1 
ATOM 3943  C C  . MET B 2 329 ? 95.523  112.829 12.652  1.00 92.43  ? 329 MET B C  1 
ATOM 3944  O O  . MET B 2 329 ? 94.390  112.340 12.710  1.00 92.43  ? 329 MET B O  1 
ATOM 3945  N N  . GLY B 2 330 ? 95.722  114.129 12.522  1.00 79.85  ? 330 GLY B N  1 
ATOM 3946  C CA . GLY B 2 330 ? 94.641  115.051 12.286  1.00 79.85  ? 330 GLY B CA 1 
ATOM 3947  C C  . GLY B 2 330 ? 94.299  116.011 13.407  1.00 79.85  ? 330 GLY B C  1 
ATOM 3948  O O  . GLY B 2 330 ? 93.173  116.521 13.430  1.00 79.85  ? 330 GLY B O  1 
ATOM 3949  N N  . TYR B 2 331 ? 95.215  116.274 14.330  1.00 75.03  ? 331 TYR B N  1 
ATOM 3950  C CA . TYR B 2 331 ? 94.955  117.267 15.358  1.00 75.03  ? 331 TYR B CA 1 
ATOM 3951  C C  . TYR B 2 331 ? 95.129  118.664 14.803  1.00 75.03  ? 331 TYR B C  1 
ATOM 3952  O O  . TYR B 2 331 ? 96.029  118.922 14.001  1.00 75.03  ? 331 TYR B O  1 
ATOM 3953  N N  . LYS B 2 332 ? 94.269  119.565 15.234  1.00 60.22  ? 332 LYS B N  1 
ATOM 3954  C CA . LYS B 2 332 ? 94.391  120.943 14.813  1.00 60.22  ? 332 LYS B CA 1 
ATOM 3955  C C  . LYS B 2 332 ? 95.478  121.616 15.635  1.00 60.22  ? 332 LYS B C  1 
ATOM 3956  O O  . LYS B 2 332 ? 95.344  121.716 16.857  1.00 60.22  ? 332 LYS B O  1 
ATOM 3957  N N  . PRO B 2 333 ? 96.544  122.085 15.017  1.00 46.07  ? 333 PRO B N  1 
ATOM 3958  C CA . PRO B 2 333 ? 97.688  122.614 15.764  1.00 46.07  ? 333 PRO B CA 1 
ATOM 3959  C C  . PRO B 2 333 ? 97.436  123.978 16.370  1.00 46.07  ? 333 PRO B C  1 
ATOM 3960  O O  . PRO B 2 333 ? 96.313  124.480 16.338  1.00 46.07  ? 333 PRO B O  1 
ATOM 3961  N N  . LYS B 2 334 ? 98.458  124.591 16.931  1.00 38.19  ? 334 LYS B N  1 
ATOM 3962  C CA . LYS B 2 334 ? 98.349  125.997 17.277  1.00 38.19  ? 334 LYS B CA 1 
ATOM 3963  C C  . LYS B 2 334 ? 99.366  126.875 16.583  1.00 38.19  ? 334 LYS B C  1 
ATOM 3964  O O  . LYS B 2 334 ? 99.014  127.953 16.118  1.00 38.19  ? 334 LYS B O  1 
ATOM 3965  N N  . ALA B 2 335 ? 100.619 126.456 16.504  1.00 44.30  ? 335 ALA B N  1 
ATOM 3966  C CA . ALA B 2 335 ? 101.667 127.368 16.083  1.00 44.30  ? 335 ALA B CA 1 
ATOM 3967  C C  . ALA B 2 335 ? 102.813 126.572 15.496  1.00 44.30  ? 335 ALA B C  1 
ATOM 3968  O O  . ALA B 2 335 ? 102.966 125.381 15.765  1.00 44.30  ? 335 ALA B O  1 
ATOM 3969  N N  . TYR B 2 336 ? 103.634 127.241 14.704  1.00 51.32  ? 336 TYR B N  1 
ATOM 3970  C CA . TYR B 2 336 ? 104.931 126.665 14.398  1.00 51.32  ? 336 TYR B CA 1 
ATOM 3971  C C  . TYR B 2 336 ? 105.879 127.052 15.518  1.00 51.32  ? 336 TYR B C  1 
ATOM 3972  O O  . TYR B 2 336 ? 105.504 127.720 16.483  1.00 51.32  ? 336 TYR B O  1 
ATOM 3973  N N  . LEU B 2 337 ? 107.130 126.653 15.398  1.00 46.52  ? 337 LEU B N  1 
ATOM 3974  C CA . LEU B 2 337 ? 108.124 127.001 16.387  1.00 46.52  ? 337 LEU B CA 1 
ATOM 3975  C C  . LEU B 2 337 ? 109.446 127.221 15.672  1.00 46.52  ? 337 LEU B C  1 
ATOM 3976  O O  . LEU B 2 337 ? 110.242 126.294 15.528  1.00 46.52  ? 337 LEU B O  1 
ATOM 3977  N N  . ARG B 2 338 ? 109.684 128.452 15.258  1.00 48.86  ? 338 ARG B N  1 
ATOM 3978  C CA . ARG B 2 338 ? 110.820 128.783 14.419  1.00 48.86  ? 338 ARG B CA 1 
ATOM 3979  C C  . ARG B 2 338 ? 112.023 129.077 15.330  1.00 48.86  ? 338 ARG B C  1 
ATOM 3980  O O  . ARG B 2 338 ? 112.119 128.539 16.433  1.00 48.86  ? 338 ARG B O  1 
ATOM 3981  N N  . ASP B 2 339 ? 112.977 129.865 14.823  1.00 58.66  ? 339 ASP B N  1 
ATOM 3982  C CA . ASP B 2 339 ? 114.326 130.002 15.377  1.00 58.66  ? 339 ASP B CA 1 
ATOM 3983  C C  . ASP B 2 339 ? 114.380 130.421 16.843  1.00 58.66  ? 339 ASP B C  1 
ATOM 3984  O O  . ASP B 2 339 ? 113.405 130.915 17.410  1.00 58.66  ? 339 ASP B O  1 
ATOM 3985  N N  . PHE B 2 340 ? 115.559 130.244 17.440  1.00 44.82  ? 340 PHE B N  1 
ATOM 3986  C CA . PHE B 2 340 ? 115.784 130.472 18.867  1.00 44.82  ? 340 PHE B CA 1 
ATOM 3987  C C  . PHE B 2 340 ? 117.248 130.839 19.103  1.00 44.82  ? 340 PHE B C  1 
ATOM 3988  O O  . PHE B 2 340 ? 118.179 130.098 18.805  1.00 44.82  ? 340 PHE B O  1 
ATOM 3989  N N  . MET B 2 341 ? 117.453 132.064 19.559  1.00 46.42  ? 341 MET B N  1 
ATOM 3990  C CA . MET B 2 341 ? 118.775 132.413 20.041  1.00 46.42  ? 341 MET B CA 1 
ATOM 3991  C C  . MET B 2 341 ? 118.806 132.189 21.538  1.00 46.42  ? 341 MET B C  1 
ATOM 3992  O O  . MET B 2 341 ? 117.771 132.174 22.201  1.00 46.42  ? 341 MET B O  1 
ATOM 3993  N N  . TYR B 2 342 ? 119.996 131.992 22.072  1.00 35.41  ? 342 TYR B N  1 
ATOM 3994  C CA . TYR B 2 342 ? 120.093 131.533 23.441  1.00 35.41  ? 342 TYR B CA 1 
ATOM 3995  C C  . TYR B 2 342 ? 121.429 132.023 23.988  1.00 35.41  ? 342 TYR B C  1 
ATOM 3996  O O  . TYR B 2 342 ? 122.455 131.392 23.740  1.00 35.41  ? 342 TYR B O  1 
ATOM 3997  N N  . VAL B 2 343 ? 121.421 133.140 24.723  1.00 36.65  ? 343 VAL B N  1 
ATOM 3998  C CA . VAL B 2 343 ? 122.656 133.843 25.045  1.00 36.65  ? 343 VAL B CA 1 
ATOM 3999  C C  . VAL B 2 343 ? 122.690 134.187 26.529  1.00 36.65  ? 343 VAL B C  1 
ATOM 4000  O O  . VAL B 2 343 ? 121.667 134.197 27.215  1.00 36.65  ? 343 VAL B O  1 
ATOM 4001  N N  . SER B 2 344 ? 123.894 134.459 27.022  1.00 45.59  ? 344 SER B N  1 
ATOM 4002  C CA . SER B 2 344 ? 124.168 134.719 28.425  1.00 45.59  ? 344 SER B CA 1 
ATOM 4003  C C  . SER B 2 344 ? 124.865 136.061 28.595  1.00 45.59  ? 344 SER B C  1 
ATOM 4004  O O  . SER B 2 344 ? 125.468 136.596 27.670  1.00 45.59  ? 344 SER B O  1 
ATOM 4005  N N  . GLN B 2 345 ? 124.818 136.580 29.818  1.00 51.54  ? 345 GLN B N  1 
ATOM 4006  C CA . GLN B 2 345 ? 125.406 137.870 30.143  1.00 51.54  ? 345 GLN B CA 1 
ATOM 4007  C C  . GLN B 2 345 ? 126.231 137.742 31.411  1.00 51.54  ? 345 GLN B C  1 
ATOM 4008  O O  . GLN B 2 345 ? 125.901 136.969 32.312  1.00 51.54  ? 345 GLN B O  1 
ATOM 4009  N N  . ASP B 2 346 ? 127.304 138.524 31.465  1.00 54.86  ? 346 ASP B N  1 
ATOM 4010  C CA . ASP B 2 346 ? 128.266 138.434 32.554  1.00 54.86  ? 346 ASP B CA 1 
ATOM 4011  C C  . ASP B 2 346 ? 127.651 138.935 33.856  1.00 54.86  ? 346 ASP B C  1 
ATOM 4012  O O  . ASP B 2 346 ? 127.268 140.099 33.949  1.00 54.86  ? 346 ASP B O  1 
ATOM 4013  N N  . PRO B 2 347 ? 127.605 138.110 34.892  1.00 45.29  ? 347 PRO B N  1 
ATOM 4014  C CA . PRO B 2 347 ? 126.766 138.424 36.051  1.00 45.29  ? 347 PRO B CA 1 
ATOM 4015  C C  . PRO B 2 347 ? 127.354 139.428 37.019  1.00 45.29  ? 347 PRO B C  1 
ATOM 4016  O O  . PRO B 2 347 ? 126.997 139.416 38.196  1.00 45.29  ? 347 PRO B O  1 
ATOM 4017  N N  . LYS B 2 348 ? 128.296 140.242 36.587  1.00 58.07  ? 348 LYS B N  1 
ATOM 4018  C CA . LYS B 2 348 ? 128.683 141.381 37.394  1.00 58.07  ? 348 LYS B CA 1 
ATOM 4019  C C  . LYS B 2 348 ? 127.953 142.657 37.018  1.00 58.07  ? 348 LYS B C  1 
ATOM 4020  O O  . LYS B 2 348 ? 127.524 143.386 37.912  1.00 58.07  ? 348 LYS B O  1 
ATOM 4021  N N  . ASP B 2 349 ? 127.773 142.940 35.730  1.00 66.88  ? 349 ASP B N  1 
ATOM 4022  C CA . ASP B 2 349 ? 127.106 144.167 35.319  1.00 66.88  ? 349 ASP B CA 1 
ATOM 4023  C C  . ASP B 2 349 ? 125.657 143.935 34.909  1.00 66.88  ? 349 ASP B C  1 
ATOM 4024  O O  . ASP B 2 349 ? 124.730 144.422 35.562  1.00 66.88  ? 349 ASP B O  1 
ATOM 4025  N N  . GLN B 2 350 ? 125.443 143.162 33.856  1.00 59.27  ? 350 GLN B N  1 
ATOM 4026  C CA . GLN B 2 350 ? 124.128 143.019 33.250  1.00 59.27  ? 350 GLN B CA 1 
ATOM 4027  C C  . GLN B 2 350 ? 123.528 141.725 33.766  1.00 59.27  ? 350 GLN B C  1 
ATOM 4028  O O  . GLN B 2 350 ? 123.454 140.732 33.047  1.00 59.27  ? 350 GLN B O  1 
ATOM 4029  N N  . LEU B 2 351 ? 123.090 141.730 35.016  1.00 48.85  ? 351 LEU B N  1 
ATOM 4030  C CA . LEU B 2 351 ? 122.575 140.495 35.590  1.00 48.85  ? 351 LEU B CA 1 
ATOM 4031  C C  . LEU B 2 351 ? 121.191 140.198 35.050  1.00 48.85  ? 351 LEU B C  1 
ATOM 4032  O O  . LEU B 2 351 ? 120.928 139.105 34.543  1.00 48.85  ? 351 LEU B O  1 
ATOM 4033  N N  . LEU B 2 352 ? 120.286 141.159 35.165  1.00 47.96  ? 352 LEU B N  1 
ATOM 4034  C CA . LEU B 2 352 ? 118.929 140.995 34.675  1.00 47.96  ? 352 LEU B CA 1 
ATOM 4035  C C  . LEU B 2 352 ? 118.681 141.813 33.430  1.00 47.96  ? 352 LEU B C  1 
ATOM 4036  O O  . LEU B 2 352 ? 117.574 142.302 33.223  1.00 47.96  ? 352 LEU B O  1 
ATOM 4037  N N  . LEU B 2 353 ? 119.705 141.987 32.607  1.00 53.20  ? 353 LEU B N  1 
ATOM 4038  C CA . LEU B 2 353 ? 119.523 142.517 31.269  1.00 53.20  ? 353 LEU B CA 1 
ATOM 4039  C C  . LEU B 2 353 ? 119.441 141.289 30.371  1.00 53.20  ? 353 LEU B C  1 
ATOM 4040  O O  . LEU B 2 353 ? 120.276 141.043 29.501  1.00 53.20  ? 353 LEU B O  1 
ATOM 4041  N N  . GLY B 2 354 ? 118.438 140.472 30.633  1.00 52.73  ? 354 GLY B N  1 
ATOM 4042  C CA . GLY B 2 354 ? 118.304 139.206 29.961  1.00 52.73  ? 354 GLY B CA 1 
ATOM 4043  C C  . GLY B 2 354 ? 117.873 139.291 28.512  1.00 52.73  ? 354 GLY B C  1 
ATOM 4044  O O  . GLY B 2 354 ? 118.664 139.003 27.612  1.00 52.73  ? 354 GLY B O  1 
ATOM 4045  N N  . PRO B 2 355 ? 116.616 139.695 28.246  1.00 49.65  ? 355 PRO B N  1 
ATOM 4046  C CA . PRO B 2 355 ? 116.091 139.559 26.886  1.00 49.65  ? 355 PRO B CA 1 
ATOM 4047  C C  . PRO B 2 355 ? 116.707 140.497 25.871  1.00 49.65  ? 355 PRO B C  1 
ATOM 4048  O O  . PRO B 2 355 ? 117.022 140.089 24.751  1.00 49.65  ? 355 PRO B O  1 
ATOM 4049  N N  . THR B 2 356 ? 116.923 141.743 26.247  1.00 53.39  ? 356 THR B N  1 
ATOM 4050  C CA . THR B 2 356 ? 117.224 142.730 25.232  1.00 53.39  ? 356 THR B CA 1 
ATOM 4051  C C  . THR B 2 356 ? 118.690 142.811 24.876  1.00 53.39  ? 356 THR B C  1 
ATOM 4052  O O  . THR B 2 356 ? 119.109 143.809 24.289  1.00 53.39  ? 356 THR B O  1 
ATOM 4053  N N  . TYR B 2 357 ? 119.484 141.817 25.231  1.00 59.92  ? 357 TYR B N  1 
ATOM 4054  C CA . TYR B 2 357 ? 120.745 141.612 24.547  1.00 59.92  ? 357 TYR B CA 1 
ATOM 4055  C C  . TYR B 2 357 ? 120.632 140.452 23.568  1.00 59.92  ? 357 TYR B C  1 
ATOM 4056  O O  . TYR B 2 357 ? 121.511 140.259 22.727  1.00 59.92  ? 357 TYR B O  1 
ATOM 4057  N N  . ALA B 2 358 ? 119.536 139.706 23.634  1.00 51.77  ? 358 ALA B N  1 
ATOM 4058  C CA . ALA B 2 358 ? 119.321 138.524 22.811  1.00 51.77  ? 358 ALA B CA 1 
ATOM 4059  C C  . ALA B 2 358 ? 118.428 138.759 21.605  1.00 51.77  ? 358 ALA B C  1 
ATOM 4060  O O  . ALA B 2 358 ? 118.595 138.078 20.589  1.00 51.77  ? 358 ALA B O  1 
ATOM 4061  N N  . THR B 2 359 ? 117.475 139.685 21.692  1.00 54.79  ? 359 THR B N  1 
ATOM 4062  C CA . THR B 2 359 ? 116.514 139.870 20.606  1.00 54.79  ? 359 THR B CA 1 
ATOM 4063  C C  . THR B 2 359 ? 117.087 140.312 19.257  1.00 54.79  ? 359 THR B C  1 
ATOM 4064  O O  . THR B 2 359 ? 116.684 139.713 18.243  1.00 54.79  ? 359 THR B O  1 
ATOM 4065  N N  . PRO B 2 360 ? 118.021 141.269 19.132  1.00 65.69  ? 360 PRO B N  1 
ATOM 4066  C CA . PRO B 2 360 ? 118.508 141.575 17.782  1.00 65.69  ? 360 PRO B CA 1 
ATOM 4067  C C  . PRO B 2 360 ? 119.470 140.543 17.255  1.00 65.69  ? 360 PRO B C  1 
ATOM 4068  O O  . PRO B 2 360 ? 119.912 140.665 16.109  1.00 65.69  ? 360 PRO B O  1 
ATOM 4069  N N  . LYS B 2 361 ? 119.826 139.553 18.058  1.00 60.89  ? 361 LYS B N  1 
ATOM 4070  C CA . LYS B 2 361 ? 120.537 138.397 17.559  1.00 60.89  ? 361 LYS B CA 1 
ATOM 4071  C C  . LYS B 2 361 ? 119.603 137.325 17.023  1.00 60.89  ? 361 LYS B C  1 
ATOM 4072  O O  . LYS B 2 361 ? 120.058 136.445 16.289  1.00 60.89  ? 361 LYS B O  1 
ATOM 4073  N N  . VAL B 2 362 ? 118.313 137.379 17.350  1.00 55.66  ? 362 VAL B N  1 
ATOM 4074  C CA . VAL B 2 362 ? 117.381 136.430 16.765  1.00 55.66  ? 362 VAL B CA 1 
ATOM 4075  C C  . VAL B 2 362 ? 116.597 137.049 15.613  1.00 55.66  ? 362 VAL B C  1 
ATOM 4076  O O  . VAL B 2 362 ? 116.146 136.310 14.723  1.00 55.66  ? 362 VAL B O  1 
ATOM 4077  N N  . LEU B 2 363 ? 116.468 138.377 15.569  1.00 62.04  ? 363 LEU B N  1 
ATOM 4078  C CA . LEU B 2 363 ? 115.785 138.989 14.436  1.00 62.04  ? 363 LEU B CA 1 
ATOM 4079  C C  . LEU B 2 363 ? 116.600 138.836 13.164  1.00 62.04  ? 363 LEU B C  1 
ATOM 4080  O O  . LEU B 2 363 ? 116.061 138.487 12.110  1.00 62.04  ? 363 LEU B O  1 
ATOM 4081  N N  . GLU B 2 364 ? 117.906 139.062 13.256  1.00 69.47  ? 364 GLU B N  1 
ATOM 4082  C CA . GLU B 2 364 ? 118.770 138.861 12.107  1.00 69.47  ? 364 GLU B CA 1 
ATOM 4083  C C  . GLU B 2 364 ? 118.938 137.377 11.813  1.00 69.47  ? 364 GLU B C  1 
ATOM 4084  O O  . GLU B 2 364 ? 119.224 136.999 10.672  1.00 69.47  ? 364 GLU B O  1 
ATOM 4085  N N  . LYS B 2 365 ? 118.757 136.529 12.826  1.00 60.28  ? 365 LYS B N  1 
ATOM 4086  C CA . LYS B 2 365 ? 118.794 135.091 12.603  1.00 60.28  ? 365 LYS B CA 1 
ATOM 4087  C C  . LYS B 2 365 ? 117.620 134.645 11.751  1.00 60.28  ? 365 LYS B C  1 
ATOM 4088  O O  . LYS B 2 365 ? 117.782 133.839 10.830  1.00 60.28  ? 365 LYS B O  1 
ATOM 4089  N N  . ALA B 2 366 ? 116.435 135.173 12.026  1.00 63.08  ? 366 ALA B N  1 
ATOM 4090  C CA . ALA B 2 366 ? 115.281 134.819 11.217  1.00 63.08  ? 366 ALA B CA 1 
ATOM 4091  C C  . ALA B 2 366 ? 115.211 135.606 9.919   1.00 63.08  ? 366 ALA B C  1 
ATOM 4092  O O  . ALA B 2 366 ? 114.631 135.119 8.941   1.00 63.08  ? 366 ALA B O  1 
ATOM 4093  N N  . GLY B 2 367 ? 115.791 136.800 9.880   1.00 71.78  ? 367 GLY B N  1 
ATOM 4094  C CA . GLY B 2 367 ? 115.737 137.612 8.683   1.00 71.78  ? 367 GLY B CA 1 
ATOM 4095  C C  . GLY B 2 367 ? 114.470 138.431 8.569   1.00 71.78  ? 367 GLY B C  1 
ATOM 4096  O O  . GLY B 2 367 ? 113.702 138.262 7.618   1.00 71.78  ? 367 GLY B O  1 
ATOM 4097  N N  . LEU B 2 368 ? 114.243 139.313 9.535   1.00 78.68  ? 368 LEU B N  1 
ATOM 4098  C CA . LEU B 2 368 ? 113.091 140.204 9.540   1.00 78.68  ? 368 LEU B CA 1 
ATOM 4099  C C  . LEU B 2 368 ? 113.436 141.416 10.395  1.00 78.68  ? 368 LEU B C  1 
ATOM 4100  O O  . LEU B 2 368 ? 114.586 141.598 10.801  1.00 78.68  ? 368 LEU B O  1 
ATOM 4101  N N  . THR B 2 369 ? 112.438 142.246 10.681  1.00 98.26  ? 369 THR B N  1 
ATOM 4102  C CA . THR B 2 369 ? 112.666 143.480 11.419  1.00 98.26  ? 369 THR B CA 1 
ATOM 4103  C C  . THR B 2 369 ? 111.771 143.569 12.643  1.00 98.26  ? 369 THR B C  1 
ATOM 4104  O O  . THR B 2 369 ? 110.756 142.876 12.751  1.00 98.26  ? 369 THR B O  1 
ATOM 4105  N N  . MET B 2 370 ? 112.176 144.443 13.556  1.00 91.96  ? 370 MET B N  1 
ATOM 4106  C CA . MET B 2 370 ? 111.610 144.592 14.887  1.00 91.96  ? 370 MET B CA 1 
ATOM 4107  C C  . MET B 2 370 ? 110.167 145.069 14.879  1.00 91.96  ? 370 MET B C  1 
ATOM 4108  O O  . MET B 2 370 ? 109.291 144.408 15.441  1.00 91.96  ? 370 MET B O  1 
ATOM 4109  N N  . ASN B 2 371 ? 109.915 146.206 14.223  1.00 98.19  ? 371 ASN B N  1 
ATOM 4110  C CA . ASN B 2 371 ? 108.628 146.886 14.356  1.00 98.19  ? 371 ASN B CA 1 
ATOM 4111  C C  . ASN B 2 371 ? 107.512 146.120 13.669  1.00 98.19  ? 371 ASN B C  1 
ATOM 4112  O O  . ASN B 2 371 ? 106.331 146.329 13.964  1.00 98.19  ? 371 ASN B O  1 
ATOM 4113  N N  . ASP B 2 372 ? 107.866 145.238 12.747  1.00 106.25 ? 372 ASP B N  1 
ATOM 4114  C CA . ASP B 2 372 ? 106.889 144.472 11.994  1.00 106.25 ? 372 ASP B CA 1 
ATOM 4115  C C  . ASP B 2 372 ? 106.644 143.109 12.626  1.00 106.25 ? 372 ASP B C  1 
ATOM 4116  O O  . ASP B 2 372 ? 106.173 142.182 11.963  1.00 106.25 ? 372 ASP B O  1 
ATOM 4117  N N  . ILE B 2 373 ? 106.945 142.987 13.913  1.00 82.53  ? 373 ILE B N  1 
ATOM 4118  C CA . ILE B 2 373 ? 106.455 141.867 14.700  1.00 82.53  ? 373 ILE B CA 1 
ATOM 4119  C C  . ILE B 2 373 ? 105.025 142.224 15.081  1.00 82.53  ? 373 ILE B C  1 
ATOM 4120  O O  . ILE B 2 373 ? 104.614 143.383 14.954  1.00 82.53  ? 373 ILE B O  1 
ATOM 4121  N N  . ASP B 2 374 ? 104.247 141.237 15.503  1.00 82.07  ? 374 ASP B N  1 
ATOM 4122  C CA . ASP B 2 374 ? 102.832 141.507 15.660  1.00 82.07  ? 374 ASP B CA 1 
ATOM 4123  C C  . ASP B 2 374 ? 102.415 141.514 17.117  1.00 82.07  ? 374 ASP B C  1 
ATOM 4124  O O  . ASP B 2 374 ? 101.484 142.235 17.480  1.00 82.07  ? 374 ASP B O  1 
ATOM 4125  N N  . ALA B 2 375 ? 103.100 140.753 17.966  1.00 66.17  ? 375 ALA B N  1 
ATOM 4126  C CA . ALA B 2 375 ? 102.702 140.640 19.364  1.00 66.17  ? 375 ALA B CA 1 
ATOM 4127  C C  . ALA B 2 375 ? 103.889 140.124 20.160  1.00 66.17  ? 375 ALA B C  1 
ATOM 4128  O O  . ALA B 2 375 ? 104.227 138.944 20.067  1.00 66.17  ? 375 ALA B O  1 
ATOM 4129  N N  . PHE B 2 376 ? 104.475 140.985 20.978  1.00 61.97  ? 376 PHE B N  1 
ATOM 4130  C CA . PHE B 2 376 ? 105.442 140.485 21.929  1.00 61.97  ? 376 PHE B CA 1 
ATOM 4131  C C  . PHE B 2 376 ? 104.742 139.779 23.063  1.00 61.97  ? 376 PHE B C  1 
ATOM 4132  O O  . PHE B 2 376 ? 103.522 139.815 23.193  1.00 61.97  ? 376 PHE B O  1 
ATOM 4133  N N  . GLU B 2 377 ? 105.551 139.129 23.884  1.00 51.30  ? 377 GLU B N  1 
ATOM 4134  C CA . GLU B 2 377 ? 105.361 139.133 25.327  1.00 51.30  ? 377 GLU B CA 1 
ATOM 4135  C C  . GLU B 2 377 ? 106.713 138.881 25.963  1.00 51.30  ? 377 GLU B C  1 
ATOM 4136  O O  . GLU B 2 377 ? 107.351 137.867 25.698  1.00 51.30  ? 377 GLU B O  1 
ATOM 4137  N N  . PHE B 2 378 ? 107.211 139.873 26.671  1.00 46.04  ? 378 PHE B N  1 
ATOM 4138  C CA . PHE B 2 378 ? 108.434 139.721 27.430  1.00 46.04  ? 378 PHE B CA 1 
ATOM 4139  C C  . PHE B 2 378 ? 108.098 139.244 28.828  1.00 46.04  ? 378 PHE B C  1 
ATOM 4140  O O  . PHE B 2 378 ? 107.123 139.687 29.438  1.00 46.04  ? 378 PHE B O  1 
ATOM 4141  N N  . HIS B 2 379 ? 108.926 138.357 29.340  1.00 46.11  ? 379 HIS B N  1 
ATOM 4142  C CA . HIS B 2 379 ? 108.770 137.891 30.697  1.00 46.11  ? 379 HIS B CA 1 
ATOM 4143  C C  . HIS B 2 379 ? 109.344 138.919 31.654  1.00 46.11  ? 379 HIS B C  1 
ATOM 4144  O O  . HIS B 2 379 ? 110.301 139.625 31.334  1.00 46.11  ? 379 HIS B O  1 
ATOM 4145  N N  . GLU B 2 380 ? 108.747 139.007 32.835  1.00 55.60  ? 380 GLU B N  1 
ATOM 4146  C CA . GLU B 2 380 ? 109.227 139.907 33.866  1.00 55.60  ? 380 GLU B CA 1 
ATOM 4147  C C  . GLU B 2 380 ? 109.669 139.076 35.053  1.00 55.60  ? 380 GLU B C  1 
ATOM 4148  O O  . GLU B 2 380 ? 109.291 137.916 35.199  1.00 55.60  ? 380 GLU B O  1 
ATOM 4149  N N  . ALA B 2 381 ? 110.472 139.682 35.912  1.00 56.59  ? 381 ALA B N  1 
ATOM 4150  C CA . ALA B 2 381 ? 110.621 139.184 37.267  1.00 56.59  ? 381 ALA B CA 1 
ATOM 4151  C C  . ALA B 2 381 ? 110.540 140.301 38.272  1.00 56.59  ? 381 ALA B C  1 
ATOM 4152  O O  . ALA B 2 381 ? 110.369 140.032 39.462  1.00 56.59  ? 381 ALA B O  1 
ATOM 4153  N N  . PHE B 2 382 ? 110.660 141.541 37.835  1.00 57.44  ? 382 PHE B N  1 
ATOM 4154  C CA . PHE B 2 382 ? 110.499 142.702 38.677  1.00 57.44  ? 382 PHE B CA 1 
ATOM 4155  C C  . PHE B 2 382 ? 109.860 143.786 37.841  1.00 57.44  ? 382 PHE B C  1 
ATOM 4156  O O  . PHE B 2 382 ? 110.040 143.836 36.624  1.00 57.44  ? 382 PHE B O  1 
ATOM 4157  N N  . SER B 2 383 ? 109.097 144.639 38.495  1.00 64.29  ? 383 SER B N  1 
ATOM 4158  C CA . SER B 2 383 ? 108.653 145.843 37.827  1.00 64.29  ? 383 SER B CA 1 
ATOM 4159  C C  . SER B 2 383 ? 109.854 146.721 37.562  1.00 64.29  ? 383 SER B C  1 
ATOM 4160  O O  . SER B 2 383 ? 110.833 146.705 38.309  1.00 64.29  ? 383 SER B O  1 
ATOM 4161  N N  . GLY B 2 384 ? 109.801 147.457 36.474  1.00 59.66  ? 384 GLY B N  1 
ATOM 4162  C CA . GLY B 2 384 ? 110.879 148.374 36.218  1.00 59.66  ? 384 GLY B CA 1 
ATOM 4163  C C  . GLY B 2 384 ? 111.964 147.755 35.375  1.00 59.66  ? 384 GLY B C  1 
ATOM 4164  O O  . GLY B 2 384 ? 112.426 148.389 34.419  1.00 59.66  ? 384 GLY B O  1 
ATOM 4165  N N  . GLN B 2 385 ? 112.378 146.534 35.754  1.00 56.02  ? 385 GLN B N  1 
ATOM 4166  C CA . GLN B 2 385 ? 113.237 145.695 34.925  1.00 56.02  ? 385 GLN B CA 1 
ATOM 4167  C C  . GLN B 2 385 ? 112.744 145.638 33.500  1.00 56.02  ? 385 GLN B C  1 
ATOM 4168  O O  . GLN B 2 385 ? 113.520 145.809 32.561  1.00 56.02  ? 385 GLN B O  1 
ATOM 4169  N N  . ILE B 2 386 ? 111.442 145.444 33.322  1.00 62.54  ? 386 ILE B N  1 
ATOM 4170  C CA . ILE B 2 386 ? 110.918 145.365 31.973  1.00 62.54  ? 386 ILE B CA 1 
ATOM 4171  C C  . ILE B 2 386 ? 110.827 146.747 31.340  1.00 62.54  ? 386 ILE B C  1 
ATOM 4172  O O  . ILE B 2 386 ? 110.880 146.877 30.111  1.00 62.54  ? 386 ILE B O  1 
ATOM 4173  N N  . LEU B 2 387 ? 110.754 147.810 32.140  1.00 62.59  ? 387 LEU B N  1 
ATOM 4174  C CA . LEU B 2 387 ? 110.767 149.111 31.495  1.00 62.59  ? 387 LEU B CA 1 
ATOM 4175  C C  . LEU B 2 387 ? 112.178 149.637 31.382  1.00 62.59  ? 387 LEU B C  1 
ATOM 4176  O O  . LEU B 2 387 ? 112.443 150.525 30.570  1.00 62.59  ? 387 LEU B O  1 
ATOM 4177  N N  . ALA B 2 388 ? 113.091 149.114 32.181  1.00 59.69  ? 388 ALA B N  1 
ATOM 4178  C CA . ALA B 2 388 ? 114.489 149.298 31.849  1.00 59.69  ? 388 ALA B CA 1 
ATOM 4179  C C  . ALA B 2 388 ? 114.863 148.539 30.594  1.00 59.69  ? 388 ALA B C  1 
ATOM 4180  O O  . ALA B 2 388 ? 115.691 149.012 29.813  1.00 59.69  ? 388 ALA B O  1 
ATOM 4181  N N  . ASN B 2 389 ? 114.228 147.400 30.358  1.00 61.07  ? 389 ASN B N  1 
ATOM 4182  C CA . ASN B 2 389 ? 114.265 146.739 29.071  1.00 61.07  ? 389 ASN B CA 1 
ATOM 4183  C C  . ASN B 2 389 ? 113.314 147.365 28.069  1.00 61.07  ? 389 ASN B C  1 
ATOM 4184  O O  . ASN B 2 389 ? 113.137 146.823 26.977  1.00 61.07  ? 389 ASN B O  1 
ATOM 4185  N N  . PHE B 2 390 ? 112.682 148.469 28.425  1.00 65.27  ? 390 PHE B N  1 
ATOM 4186  C CA . PHE B 2 390 ? 112.189 149.413 27.447  1.00 65.27  ? 390 PHE B CA 1 
ATOM 4187  C C  . PHE B 2 390 ? 113.086 150.617 27.289  1.00 65.27  ? 390 PHE B C  1 
ATOM 4188  O O  . PHE B 2 390 ? 113.270 151.089 26.170  1.00 65.27  ? 390 PHE B O  1 
ATOM 4189  N N  . LYS B 2 391 ? 113.640 151.134 28.372  1.00 63.78  ? 391 LYS B N  1 
ATOM 4190  C CA . LYS B 2 391 ? 114.294 152.426 28.335  1.00 63.78  ? 391 LYS B CA 1 
ATOM 4191  C C  . LYS B 2 391 ? 115.658 152.382 27.675  1.00 63.78  ? 391 LYS B C  1 
ATOM 4192  O O  . LYS B 2 391 ? 115.988 153.300 26.921  1.00 63.78  ? 391 LYS B O  1 
ATOM 4193  N N  . ALA B 2 392 ? 116.434 151.325 27.893  1.00 67.01  ? 392 ALA B N  1 
ATOM 4194  C CA . ALA B 2 392 ? 117.833 151.306 27.498  1.00 67.01  ? 392 ALA B CA 1 
ATOM 4195  C C  . ALA B 2 392 ? 118.045 151.266 26.001  1.00 67.01  ? 392 ALA B C  1 
ATOM 4196  O O  . ALA B 2 392 ? 118.958 151.918 25.495  1.00 67.01  ? 392 ALA B O  1 
ATOM 4197  N N  . MET B 2 393 ? 117.211 150.544 25.289  1.00 71.33  ? 393 MET B N  1 
ATOM 4198  C CA . MET B 2 393 ? 117.387 150.296 23.875  1.00 71.33  ? 393 MET B CA 1 
ATOM 4199  C C  . MET B 2 393 ? 116.486 151.163 23.027  1.00 71.33  ? 393 MET B C  1 
ATOM 4200  O O  . MET B 2 393 ? 116.554 151.087 21.799  1.00 71.33  ? 393 MET B O  1 
ATOM 4201  N N  . ASP B 2 394 ? 115.672 152.007 23.654  1.00 80.61  ? 394 ASP B N  1 
ATOM 4202  C CA . ASP B 2 394 ? 115.080 153.147 22.972  1.00 80.61  ? 394 ASP B CA 1 
ATOM 4203  C C  . ASP B 2 394 ? 116.025 154.333 22.931  1.00 80.61  ? 394 ASP B C  1 
ATOM 4204  O O  . ASP B 2 394 ? 115.574 155.462 22.723  1.00 80.61  ? 394 ASP B O  1 
ATOM 4205  N N  . SER B 2 395 ? 117.312 154.103 23.157  1.00 87.34  ? 395 SER B N  1 
ATOM 4206  C CA . SER B 2 395 ? 118.349 155.101 23.015  1.00 87.34  ? 395 SER B CA 1 
ATOM 4207  C C  . SER B 2 395 ? 119.609 154.434 22.488  1.00 87.34  ? 395 SER B C  1 
ATOM 4208  O O  . SER B 2 395 ? 119.687 153.210 22.351  1.00 87.34  ? 395 SER B O  1 
ATOM 4209  N N  . ASP B 2 396 ? 120.603 155.266 22.209  1.00 83.41  ? 396 ASP B N  1 
ATOM 4210  C CA . ASP B 2 396 ? 121.909 154.816 21.769  1.00 83.41  ? 396 ASP B CA 1 
ATOM 4211  C C  . ASP B 2 396 ? 122.748 154.425 22.977  1.00 83.41  ? 396 ASP B C  1 
ATOM 4212  O O  . ASP B 2 396 ? 122.229 154.117 24.053  1.00 83.41  ? 396 ASP B O  1 
ATOM 4213  N N  . TRP B 2 397 ? 124.055 154.310 22.756  1.00 78.54  ? 397 TRP B N  1 
ATOM 4214  C CA . TRP B 2 397 ? 125.134 154.166 23.739  1.00 78.54  ? 397 TRP B CA 1 
ATOM 4215  C C  . TRP B 2 397 ? 125.132 152.783 24.391  1.00 78.54  ? 397 TRP B C  1 
ATOM 4216  O O  . TRP B 2 397 ? 126.149 152.386 24.959  1.00 78.54  ? 397 TRP B O  1 
ATOM 4217  N N  . PHE B 2 398 ? 124.091 151.984 24.236  1.00 74.06  ? 398 PHE B N  1 
ATOM 4218  C CA . PHE B 2 398 ? 124.083 150.711 24.924  1.00 74.06  ? 398 PHE B CA 1 
ATOM 4219  C C  . PHE B 2 398 ? 124.249 149.547 23.983  1.00 74.06  ? 398 PHE B C  1 
ATOM 4220  O O  . PHE B 2 398 ? 124.954 148.591 24.317  1.00 74.06  ? 398 PHE B O  1 
ATOM 4221  N N  . ALA B 2 399 ? 123.613 149.603 22.820  1.00 92.09  ? 399 ALA B N  1 
ATOM 4222  C CA . ALA B 2 399 ? 124.038 148.742 21.732  1.00 92.09  ? 399 ALA B CA 1 
ATOM 4223  C C  . ALA B 2 399 ? 125.442 149.120 21.301  1.00 92.09  ? 399 ALA B C  1 
ATOM 4224  O O  . ALA B 2 399 ? 126.284 148.247 21.058  1.00 92.09  ? 399 ALA B O  1 
ATOM 4225  N N  . GLU B 2 400 ? 125.727 150.420 21.268  1.00 86.90  ? 400 GLU B N  1 
ATOM 4226  C CA . GLU B 2 400 ? 127.097 150.895 21.193  1.00 86.90  ? 400 GLU B CA 1 
ATOM 4227  C C  . GLU B 2 400 ? 127.852 150.409 22.418  1.00 86.90  ? 400 GLU B C  1 
ATOM 4228  O O  . GLU B 2 400 ? 127.268 150.263 23.495  1.00 86.90  ? 400 GLU B O  1 
ATOM 4229  N N  . ASN B 2 401 ? 129.116 150.059 22.223  1.00 79.19  ? 401 ASN B N  1 
ATOM 4230  C CA . ASN B 2 401 ? 130.070 149.615 23.233  1.00 79.19  ? 401 ASN B CA 1 
ATOM 4231  C C  . ASN B 2 401 ? 129.698 148.285 23.883  1.00 79.19  ? 401 ASN B C  1 
ATOM 4232  O O  . ASN B 2 401 ? 130.347 147.917 24.866  1.00 79.19  ? 401 ASN B O  1 
ATOM 4233  N N  . TYR B 2 402 ? 128.677 147.568 23.412  1.00 76.59  ? 402 TYR B N  1 
ATOM 4234  C CA . TYR B 2 402 ? 128.450 146.211 23.905  1.00 76.59  ? 402 TYR B CA 1 
ATOM 4235  C C  . TYR B 2 402 ? 128.141 145.295 22.734  1.00 76.59  ? 402 TYR B C  1 
ATOM 4236  O O  . TYR B 2 402 ? 127.928 144.101 22.938  1.00 76.59  ? 402 TYR B O  1 
ATOM 4237  N N  . MET B 2 403 ? 128.128 145.860 21.528  1.00 89.39  ? 403 MET B N  1 
ATOM 4238  C CA . MET B 2 403 ? 128.305 145.168 20.252  1.00 89.39  ? 403 MET B CA 1 
ATOM 4239  C C  . MET B 2 403 ? 128.572 146.286 19.255  1.00 89.39  ? 403 MET B C  1 
ATOM 4240  O O  . MET B 2 403 ? 128.695 147.444 19.663  1.00 89.39  ? 403 MET B O  1 
ATOM 4241  N N  . GLY B 2 404 ? 128.624 145.993 17.967  1.00 99.25  ? 404 GLY B N  1 
ATOM 4242  C CA . GLY B 2 404 ? 129.080 146.985 17.008  1.00 99.25  ? 404 GLY B CA 1 
ATOM 4243  C C  . GLY B 2 404 ? 128.008 147.432 16.043  1.00 99.25  ? 404 GLY B C  1 
ATOM 4244  O O  . GLY B 2 404 ? 127.480 146.634 15.263  1.00 99.25  ? 404 GLY B O  1 
ATOM 4245  N N  . ARG B 2 405 ? 127.687 148.729 16.104  1.00 101.22 ? 405 ARG B N  1 
ATOM 4246  C CA . ARG B 2 405 ? 126.976 149.456 15.044  1.00 101.22 ? 405 ARG B CA 1 
ATOM 4247  C C  . ARG B 2 405 ? 125.573 148.910 14.767  1.00 101.22 ? 405 ARG B C  1 
ATOM 4248  O O  . ARG B 2 405 ? 125.331 148.176 13.807  1.00 101.22 ? 405 ARG B O  1 
ATOM 4249  N N  . LYS B 2 406 ? 124.669 149.180 15.695  1.00 99.15  ? 406 LYS B N  1 
ATOM 4250  C CA . LYS B 2 406 ? 123.235 149.158 15.459  1.00 99.15  ? 406 LYS B CA 1 
ATOM 4251  C C  . LYS B 2 406 ? 122.679 150.417 16.094  1.00 99.15  ? 406 LYS B C  1 
ATOM 4252  O O  . LYS B 2 406 ? 123.400 151.124 16.804  1.00 99.15  ? 406 LYS B O  1 
ATOM 4253  N N  . THR B 2 407 ? 121.426 150.723 15.805  1.00 118.15 ? 407 THR B N  1 
ATOM 4254  C CA . THR B 2 407 ? 120.714 151.793 16.486  1.00 118.15 ? 407 THR B CA 1 
ATOM 4255  C C  . THR B 2 407 ? 119.268 151.374 16.691  1.00 118.15 ? 407 THR B C  1 
ATOM 4256  O O  . THR B 2 407 ? 118.606 150.950 15.738  1.00 118.15 ? 407 THR B O  1 
ATOM 4257  N N  . LYS B 2 408 ? 118.818 151.428 17.947  1.00 109.57 ? 408 LYS B N  1 
ATOM 4258  C CA . LYS B 2 408 ? 117.406 151.331 18.324  1.00 109.57 ? 408 LYS B CA 1 
ATOM 4259  C C  . LYS B 2 408 ? 116.772 150.014 17.886  1.00 109.57 ? 408 LYS B C  1 
ATOM 4260  O O  . LYS B 2 408 ? 115.622 149.965 17.447  1.00 109.57 ? 408 LYS B O  1 
ATOM 4261  N N  . VAL B 2 409 ? 117.532 148.927 18.014  1.00 97.79  ? 409 VAL B N  1 
ATOM 4262  C CA . VAL B 2 409 ? 117.042 147.639 17.534  1.00 97.79  ? 409 VAL B CA 1 
ATOM 4263  C C  . VAL B 2 409 ? 116.013 147.060 18.489  1.00 97.79  ? 409 VAL B C  1 
ATOM 4264  O O  . VAL B 2 409 ? 115.330 146.082 18.171  1.00 97.79  ? 409 VAL B O  1 
ATOM 4265  N N  . GLY B 2 410 ? 115.886 147.643 19.669  1.00 91.75  ? 410 GLY B N  1 
ATOM 4266  C CA . GLY B 2 410 ? 114.688 147.425 20.439  1.00 91.75  ? 410 GLY B CA 1 
ATOM 4267  C C  . GLY B 2 410 ? 113.802 148.651 20.403  1.00 91.75  ? 410 GLY B C  1 
ATOM 4268  O O  . GLY B 2 410 ? 114.147 149.682 20.980  1.00 91.75  ? 410 GLY B O  1 
ATOM 4269  N N  . LEU B 2 411 ? 112.672 148.568 19.707  1.00 83.95  ? 411 LEU B N  1 
ATOM 4270  C CA . LEU B 2 411 ? 111.615 149.564 19.837  1.00 83.95  ? 411 LEU B CA 1 
ATOM 4271  C C  . LEU B 2 411 ? 110.301 148.809 19.981  1.00 83.95  ? 411 LEU B C  1 
ATOM 4272  O O  . LEU B 2 411 ? 109.608 148.580 18.970  1.00 83.95  ? 411 LEU B O  1 
ATOM 4273  N N  . PRO B 2 412 ? 109.934 148.355 21.175  1.00 70.31  ? 412 PRO B N  1 
ATOM 4274  C CA . PRO B 2 412 ? 108.604 147.798 21.362  1.00 70.31  ? 412 PRO B CA 1 
ATOM 4275  C C  . PRO B 2 412 ? 107.592 148.904 21.591  1.00 70.31  ? 412 PRO B C  1 
ATOM 4276  O O  . PRO B 2 412 ? 107.762 149.751 22.480  1.00 70.31  ? 412 PRO B O  1 
ATOM 4277  N N  . PRO B 2 413 ? 106.526 148.946 20.791  1.00 68.73  ? 413 PRO B N  1 
ATOM 4278  C CA . PRO B 2 413 ? 105.619 150.098 20.840  1.00 68.73  ? 413 PRO B CA 1 
ATOM 4279  C C  . PRO B 2 413 ? 104.620 150.066 21.976  1.00 68.73  ? 413 PRO B C  1 
ATOM 4280  O O  . PRO B 2 413 ? 103.674 150.865 21.933  1.00 68.73  ? 413 PRO B O  1 
ATOM 4281  N N  . LEU B 2 414 ? 104.716 149.099 22.900  1.00 73.31  ? 414 LEU B N  1 
ATOM 4282  C CA . LEU B 2 414 ? 104.005 149.069 24.195  1.00 73.31  ? 414 LEU B CA 1 
ATOM 4283  C C  . LEU B 2 414 ? 102.515 148.738 24.053  1.00 73.31  ? 414 LEU B C  1 
ATOM 4284  O O  . LEU B 2 414 ? 101.840 148.386 25.019  1.00 73.31  ? 414 LEU B O  1 
ATOM 4285  N N  . GLU B 2 415 ? 102.014 148.777 22.826  1.00 72.21  ? 415 GLU B N  1 
ATOM 4286  C CA . GLU B 2 415 ? 100.598 148.556 22.585  1.00 72.21  ? 415 GLU B CA 1 
ATOM 4287  C C  . GLU B 2 415 ? 100.377 147.079 22.366  1.00 72.21  ? 415 GLU B C  1 
ATOM 4288  O O  . GLU B 2 415 ? 99.347  146.523 22.752  1.00 72.21  ? 415 GLU B O  1 
ATOM 4289  N N  . LYS B 2 416 ? 101.359 146.436 21.768  1.00 70.49  ? 416 LYS B N  1 
ATOM 4290  C CA . LYS B 2 416 ? 101.260 145.038 21.389  1.00 70.49  ? 416 LYS B CA 1 
ATOM 4291  C C  . LYS B 2 416 ? 102.008 144.196 22.411  1.00 70.49  ? 416 LYS B C  1 
ATOM 4292  O O  . LYS B 2 416 ? 102.489 143.099 22.130  1.00 70.49  ? 416 LYS B O  1 
ATOM 4293  N N  . PHE B 2 417 ? 102.087 144.733 23.621  1.00 62.80  ? 417 PHE B N  1 
ATOM 4294  C CA . PHE B 2 417 ? 102.797 144.140 24.736  1.00 62.80  ? 417 PHE B CA 1 
ATOM 4295  C C  . PHE B 2 417 ? 101.815 143.276 25.530  1.00 62.80  ? 417 PHE B C  1 
ATOM 4296  O O  . PHE B 2 417 ? 100.798 142.829 25.000  1.00 62.80  ? 417 PHE B O  1 
ATOM 4297  N N  . ASN B 2 418 ? 102.098 143.077 26.811  1.00 55.29  ? 418 ASN B N  1 
ATOM 4298  C CA . ASN B 2 418 ? 101.710 141.959 27.655  1.00 55.29  ? 418 ASN B CA 1 
ATOM 4299  C C  . ASN B 2 418 ? 100.244 141.899 28.044  1.00 55.29  ? 418 ASN B C  1 
ATOM 4300  O O  . ASN B 2 418 ? 99.933  141.486 29.162  1.00 55.29  ? 418 ASN B O  1 
ATOM 4301  N N  . ASN B 2 419 ? 99.355  142.414 27.183  1.00 58.95  ? 419 ASN B N  1 
ATOM 4302  C CA . ASN B 2 419 ? 97.914  142.590 27.370  1.00 58.95  ? 419 ASN B CA 1 
ATOM 4303  C C  . ASN B 2 419 ? 97.194  141.485 28.137  1.00 58.95  ? 419 ASN B C  1 
ATOM 4304  O O  . ASN B 2 419 ? 96.457  141.771 29.081  1.00 58.95  ? 419 ASN B O  1 
ATOM 4305  N N  . TRP B 2 420 ? 97.426  140.229 27.792  1.00 59.60  ? 420 TRP B N  1 
ATOM 4306  C CA . TRP B 2 420 ? 97.015  139.183 28.712  1.00 59.60  ? 420 TRP B CA 1 
ATOM 4307  C C  . TRP B 2 420 ? 98.148  139.106 29.711  1.00 59.60  ? 420 TRP B C  1 
ATOM 4308  O O  . TRP B 2 420 ? 99.215  138.596 29.360  1.00 59.60  ? 420 TRP B O  1 
ATOM 4309  N N  . GLY B 2 421 ? 97.960  139.690 30.896  1.00 56.81  ? 421 GLY B N  1 
ATOM 4310  C CA . GLY B 2 421 ? 98.995  139.937 31.893  1.00 56.81  ? 421 GLY B CA 1 
ATOM 4311  C C  . GLY B 2 421 ? 100.002 138.843 32.179  1.00 56.81  ? 421 GLY B C  1 
ATOM 4312  O O  . GLY B 2 421 ? 99.627  137.728 32.549  1.00 56.81  ? 421 GLY B O  1 
ATOM 4313  N N  . GLY B 2 422 ? 101.285 139.157 32.012  1.00 55.53  ? 422 GLY B N  1 
ATOM 4314  C CA . GLY B 2 422 ? 102.339 138.163 32.060  1.00 55.53  ? 422 GLY B CA 1 
ATOM 4315  C C  . GLY B 2 422 ? 102.782 137.868 33.475  1.00 55.53  ? 422 GLY B C  1 
ATOM 4316  O O  . GLY B 2 422 ? 101.957 137.499 34.309  1.00 55.53  ? 422 GLY B O  1 
ATOM 4317  N N  . SER B 2 423 ? 104.069 137.997 33.771  1.00 55.49  ? 423 SER B N  1 
ATOM 4318  C CA . SER B 2 423 ? 104.457 137.880 35.164  1.00 55.49  ? 423 SER B CA 1 
ATOM 4319  C C  . SER B 2 423 ? 104.018 139.128 35.923  1.00 55.49  ? 423 SER B C  1 
ATOM 4320  O O  . SER B 2 423 ? 103.652 140.145 35.324  1.00 55.49  ? 423 SER B O  1 
ATOM 4321  N N  . LEU B 2 424 ? 103.997 138.997 37.259  1.00 56.46  ? 424 LEU B N  1 
ATOM 4322  C CA . LEU B 2 424 ? 103.374 139.863 38.267  1.00 56.46  ? 424 LEU B CA 1 
ATOM 4323  C C  . LEU B 2 424 ? 101.858 139.827 38.227  1.00 56.46  ? 424 LEU B C  1 
ATOM 4324  O O  . LEU B 2 424 ? 101.199 140.393 39.103  1.00 56.46  ? 424 LEU B O  1 
ATOM 4325  N N  . SER B 2 425 ? 101.285 139.166 37.236  1.00 58.37  ? 425 SER B N  1 
ATOM 4326  C CA . SER B 2 425 ? 99.840  139.105 37.154  1.00 58.37  ? 425 SER B CA 1 
ATOM 4327  C C  . SER B 2 425 ? 99.352  137.893 37.923  1.00 58.37  ? 425 SER B C  1 
ATOM 4328  O O  . SER B 2 425 ? 98.632  138.019 38.916  1.00 58.37  ? 425 SER B O  1 
ATOM 4329  N N  . LEU B 2 426 ? 99.785  136.723 37.500  1.00 48.97  ? 426 LEU B N  1 
ATOM 4330  C CA . LEU B 2 426 ? 99.412  135.480 38.142  1.00 48.97  ? 426 LEU B CA 1 
ATOM 4331  C C  . LEU B 2 426 ? 100.633 134.765 38.696  1.00 48.97  ? 426 LEU B C  1 
ATOM 4332  O O  . LEU B 2 426 ? 100.706 133.539 38.697  1.00 48.97  ? 426 LEU B O  1 
ATOM 4333  N N  . GLY B 2 427 ? 101.597 135.527 39.176  1.00 50.36  ? 427 GLY B N  1 
ATOM 4334  C CA . GLY B 2 427 ? 102.748 134.954 39.829  1.00 50.36  ? 427 GLY B CA 1 
ATOM 4335  C C  . GLY B 2 427 ? 103.811 134.486 38.871  1.00 50.36  ? 427 GLY B C  1 
ATOM 4336  O O  . GLY B 2 427 ? 103.596 134.256 37.681  1.00 50.36  ? 427 GLY B O  1 
ATOM 4337  N N  . HIS B 2 428 ? 104.987 134.330 39.429  1.00 49.20  ? 428 HIS B N  1 
ATOM 4338  C CA . HIS B 2 428 ? 106.162 133.873 38.691  1.00 49.20  ? 428 HIS B CA 1 
ATOM 4339  C C  . HIS B 2 428 ? 106.686 132.637 39.383  1.00 49.20  ? 428 HIS B C  1 
ATOM 4340  O O  . HIS B 2 428 ? 107.364 132.733 40.417  1.00 49.20  ? 428 HIS B O  1 
ATOM 4341  N N  . PRO B 2 429 ? 106.317 131.457 38.910  1.00 46.12  ? 429 PRO B N  1 
ATOM 4342  C CA . PRO B 2 429 ? 107.006 130.250 39.350  1.00 46.12  ? 429 PRO B CA 1 
ATOM 4343  C C  . PRO B 2 429 ? 108.454 130.304 38.914  1.00 46.12  ? 429 PRO B C  1 
ATOM 4344  O O  . PRO B 2 429 ? 108.803 130.892 37.892  1.00 46.12  ? 429 PRO B O  1 
ATOM 4345  N N  . PHE B 2 430 ? 109.306 129.682 39.720  1.00 46.64  ? 430 PHE B N  1 
ATOM 4346  C CA . PHE B 2 430 ? 110.735 129.932 39.619  1.00 46.64  ? 430 PHE B CA 1 
ATOM 4347  C C  . PHE B 2 430 ? 111.373 129.190 38.460  1.00 46.64  ? 430 PHE B C  1 
ATOM 4348  O O  . PHE B 2 430 ? 112.408 129.631 37.960  1.00 46.64  ? 430 PHE B O  1 
ATOM 4349  N N  . GLY B 2 431 ? 110.776 128.092 38.022  1.00 40.23  ? 431 GLY B N  1 
ATOM 4350  C CA . GLY B 2 431 ? 111.248 127.321 36.895  1.00 40.23  ? 431 GLY B CA 1 
ATOM 4351  C C  . GLY B 2 431 ? 110.124 126.762 36.046  1.00 40.23  ? 431 GLY B C  1 
ATOM 4352  O O  . GLY B 2 431 ? 110.249 125.671 35.491  1.00 40.23  ? 431 GLY B O  1 
ATOM 4353  N N  . ALA B 2 432 ? 109.006 127.465 35.954  1.00 41.35  ? 432 ALA B N  1 
ATOM 4354  C CA . ALA B 2 432 ? 107.911 126.961 35.139  1.00 41.35  ? 432 ALA B CA 1 
ATOM 4355  C C  . ALA B 2 432 ? 107.335 128.010 34.205  1.00 41.35  ? 432 ALA B C  1 
ATOM 4356  O O  . ALA B 2 432 ? 106.472 127.677 33.384  1.00 41.35  ? 432 ALA B O  1 
ATOM 4357  N N  . THR B 2 433 ? 107.762 129.258 34.313  1.00 46.20  ? 433 THR B N  1 
ATOM 4358  C CA . THR B 2 433 ? 107.360 130.238 33.331  1.00 46.20  ? 433 THR B CA 1 
ATOM 4359  C C  . THR B 2 433 ? 108.040 129.936 32.008  1.00 46.20  ? 433 THR B C  1 
ATOM 4360  O O  . THR B 2 433 ? 109.055 129.249 31.942  1.00 46.20  ? 433 THR B O  1 
ATOM 4361  N N  . GLY B 2 434 ? 107.481 130.480 30.947  1.00 44.49  ? 434 GLY B N  1 
ATOM 4362  C CA . GLY B 2 434 ? 107.926 130.087 29.635  1.00 44.49  ? 434 GLY B CA 1 
ATOM 4363  C C  . GLY B 2 434 ? 106.974 129.060 29.076  1.00 44.49  ? 434 GLY B C  1 
ATOM 4364  O O  . GLY B 2 434 ? 106.346 129.291 28.040  1.00 44.49  ? 434 GLY B O  1 
ATOM 4365  N N  . CYS B 2 435 ? 106.812 127.937 29.772  1.00 38.66  ? 435 CYS B N  1 
ATOM 4366  C CA . CYS B 2 435 ? 105.822 126.966 29.326  1.00 38.66  ? 435 CYS B CA 1 
ATOM 4367  C C  . CYS B 2 435 ? 104.428 127.317 29.808  1.00 38.66  ? 435 CYS B C  1 
ATOM 4368  O O  . CYS B 2 435 ? 103.506 126.518 29.654  1.00 38.66  ? 435 CYS B O  1 
ATOM 4369  N N  . ARG B 2 436 ? 104.263 128.467 30.452  1.00 40.29  ? 436 ARG B N  1 
ATOM 4370  C CA . ARG B 2 436 ? 103.034 129.212 30.231  1.00 40.29  ? 436 ARG B CA 1 
ATOM 4371  C C  . ARG B 2 436 ? 103.113 130.000 28.935  1.00 40.29  ? 436 ARG B C  1 
ATOM 4372  O O  . ARG B 2 436 ? 102.181 129.946 28.128  1.00 40.29  ? 436 ARG B O  1 
ATOM 4373  N N  . LEU B 2 437 ? 104.229 130.690 28.704  1.00 38.86  ? 437 LEU B N  1 
ATOM 4374  C CA . LEU B 2 437 ? 104.261 131.864 27.844  1.00 38.86  ? 437 LEU B CA 1 
ATOM 4375  C C  . LEU B 2 437 ? 104.008 131.566 26.384  1.00 38.86  ? 437 LEU B C  1 
ATOM 4376  O O  . LEU B 2 437 ? 103.525 132.444 25.664  1.00 38.86  ? 437 LEU B O  1 
ATOM 4377  N N  . VAL B 2 438 ? 104.235 130.337 25.943  1.00 30.99  ? 438 VAL B N  1 
ATOM 4378  C CA . VAL B 2 438 ? 104.106 130.066 24.523  1.00 30.99  ? 438 VAL B CA 1 
ATOM 4379  C C  . VAL B 2 438 ? 102.646 130.017 24.105  1.00 30.99  ? 438 VAL B C  1 
ATOM 4380  O O  . VAL B 2 438 ? 102.270 130.588 23.079  1.00 30.99  ? 438 VAL B O  1 
ATOM 4381  N N  . MET B 2 439 ? 101.790 129.402 24.913  1.00 37.86  ? 439 MET B N  1 
ATOM 4382  C CA . MET B 2 439 ? 100.368 129.417 24.580  1.00 37.86  ? 439 MET B CA 1 
ATOM 4383  C C  . MET B 2 439 ? 99.768  130.790 24.807  1.00 37.86  ? 439 MET B C  1 
ATOM 4384  O O  . MET B 2 439 ? 98.832  131.190 24.107  1.00 37.86  ? 439 MET B O  1 
ATOM 4385  N N  . ALA B 2 440 ? 100.323 131.539 25.757  1.00 40.12  ? 440 ALA B N  1 
ATOM 4386  C CA . ALA B 2 440 ? 99.910  132.916 25.948  1.00 40.12  ? 440 ALA B CA 1 
ATOM 4387  C C  . ALA B 2 440 ? 100.399 133.814 24.831  1.00 40.12  ? 440 ALA B C  1 
ATOM 4388  O O  . ALA B 2 440 ? 99.987  134.971 24.759  1.00 40.12  ? 440 ALA B O  1 
ATOM 4389  N N  . ALA B 2 441 ? 101.314 133.335 24.004  1.00 38.82  ? 441 ALA B N  1 
ATOM 4390  C CA . ALA B 2 441 ? 101.551 134.007 22.740  1.00 38.82  ? 441 ALA B CA 1 
ATOM 4391  C C  . ALA B 2 441 ? 100.609 133.482 21.668  1.00 38.82  ? 441 ALA B C  1 
ATOM 4392  O O  . ALA B 2 441 ? 100.071 134.253 20.869  1.00 38.82  ? 441 ALA B O  1 
ATOM 4393  N N  . ALA B 2 442 ? 100.372 132.170 21.669  1.00 43.78  ? 442 ALA B N  1 
ATOM 4394  C CA . ALA B 2 442 ? 99.734  131.509 20.537  1.00 43.78  ? 442 ALA B CA 1 
ATOM 4395  C C  . ALA B 2 442 ? 98.251  131.831 20.460  1.00 43.78  ? 442 ALA B C  1 
ATOM 4396  O O  . ALA B 2 442 ? 97.757  132.310 19.428  1.00 43.78  ? 442 ALA B O  1 
ATOM 4397  N N  . ASN B 2 443 ? 97.519  131.560 21.539  1.00 54.19  ? 443 ASN B N  1 
ATOM 4398  C CA . ASN B 2 443 ? 96.097  131.857 21.536  1.00 54.19  ? 443 ASN B CA 1 
ATOM 4399  C C  . ASN B 2 443 ? 95.851  133.348 21.457  1.00 54.19  ? 443 ASN B C  1 
ATOM 4400  O O  . ASN B 2 443 ? 94.863  133.783 20.856  1.00 54.19  ? 443 ASN B O  1 
ATOM 4401  N N  . ARG B 2 444 ? 96.798  134.130 21.970  1.00 58.26  ? 444 ARG B N  1 
ATOM 4402  C CA . ARG B 2 444 ? 96.732  135.572 21.858  1.00 58.26  ? 444 ARG B CA 1 
ATOM 4403  C C  . ARG B 2 444 ? 96.824  136.038 20.423  1.00 58.26  ? 444 ARG B C  1 
ATOM 4404  O O  . ARG B 2 444 ? 95.926  136.751 19.961  1.00 58.26  ? 444 ARG B O  1 
ATOM 4405  N N  . LEU B 2 445 ? 97.836  135.613 19.677  1.00 59.26  ? 445 LEU B N  1 
ATOM 4406  C CA . LEU B 2 445 ? 97.939  136.186 18.348  1.00 59.26  ? 445 LEU B CA 1 
ATOM 4407  C C  . LEU B 2 445 ? 96.979  135.515 17.379  1.00 59.26  ? 445 LEU B C  1 
ATOM 4408  O O  . LEU B 2 445 ? 96.730  136.047 16.295  1.00 59.26  ? 445 LEU B O  1 
ATOM 4409  N N  . ARG B 2 446 ? 96.404  134.374 17.755  1.00 59.42  ? 446 ARG B N  1 
ATOM 4410  C CA . ARG B 2 446 ? 95.237  133.911 17.015  1.00 59.42  ? 446 ARG B CA 1 
ATOM 4411  C C  . ARG B 2 446 ? 94.031  134.808 17.272  1.00 59.42  ? 446 ARG B C  1 
ATOM 4412  O O  . ARG B 2 446 ? 93.235  135.057 16.358  1.00 59.42  ? 446 ARG B O  1 
ATOM 4413  N N  . LYS B 2 447 ? 93.889  135.309 18.507  1.00 63.57  ? 447 LYS B N  1 
ATOM 4414  C CA . LYS B 2 447 ? 92.683  136.043 18.891  1.00 63.57  ? 447 LYS B CA 1 
ATOM 4415  C C  . LYS B 2 447 ? 92.533  137.343 18.113  1.00 63.57  ? 447 LYS B C  1 
ATOM 4416  O O  . LYS B 2 447 ? 91.458  137.627 17.575  1.00 63.57  ? 447 LYS B O  1 
ATOM 4417  N N  . GLU B 2 448 ? 93.590  138.132 18.023  1.00 74.72  ? 448 GLU B N  1 
ATOM 4418  C CA . GLU B 2 448 ? 93.605  139.233 17.075  1.00 74.72  ? 448 GLU B CA 1 
ATOM 4419  C C  . GLU B 2 448 ? 94.196  138.733 15.763  1.00 74.72  ? 448 GLU B C  1 
ATOM 4420  O O  . GLU B 2 448 ? 94.345  137.533 15.540  1.00 74.72  ? 448 GLU B O  1 
ATOM 4421  N N  . GLY B 2 449 ? 94.534  139.656 14.869  1.00 91.60  ? 449 GLY B N  1 
ATOM 4422  C CA . GLY B 2 449 ? 95.264  139.325 13.667  1.00 91.60  ? 449 GLY B CA 1 
ATOM 4423  C C  . GLY B 2 449 ? 96.746  139.148 13.924  1.00 91.60  ? 449 GLY B C  1 
ATOM 4424  O O  . GLY B 2 449 ? 97.193  138.872 15.038  1.00 91.60  ? 449 GLY B O  1 
ATOM 4425  N N  . GLY B 2 450 ? 97.520  139.314 12.864  1.00 95.24  ? 450 GLY B N  1 
ATOM 4426  C CA . GLY B 2 450 ? 98.953  139.155 12.960  1.00 95.24  ? 450 GLY B CA 1 
ATOM 4427  C C  . GLY B 2 450 ? 99.359  137.712 12.770  1.00 95.24  ? 450 GLY B C  1 
ATOM 4428  O O  . GLY B 2 450 ? 98.540  136.795 12.767  1.00 95.24  ? 450 GLY B O  1 
ATOM 4429  N N  . GLN B 2 451 ? 100.657 137.511 12.569  1.00 78.70  ? 451 GLN B N  1 
ATOM 4430  C CA . GLN B 2 451 ? 101.139 136.154 12.355  1.00 78.70  ? 451 GLN B CA 1 
ATOM 4431  C C  . GLN B 2 451 ? 102.429 135.800 13.070  1.00 78.70  ? 451 GLN B C  1 
ATOM 4432  O O  . GLN B 2 451 ? 102.683 134.606 13.242  1.00 78.70  ? 451 GLN B O  1 
ATOM 4433  N N  . TYR B 2 452 ? 103.256 136.743 13.497  1.00 71.49  ? 452 TYR B N  1 
ATOM 4434  C CA . TYR B 2 452 ? 104.497 136.405 14.174  1.00 71.49  ? 452 TYR B CA 1 
ATOM 4435  C C  . TYR B 2 452 ? 104.489 136.975 15.581  1.00 71.49  ? 452 TYR B C  1 
ATOM 4436  O O  . TYR B 2 452 ? 103.671 137.833 15.909  1.00 71.49  ? 452 TYR B O  1 
ATOM 4437  N N  . GLY B 2 453 ? 105.409 136.495 16.413  1.00 55.67  ? 453 GLY B N  1 
ATOM 4438  C CA . GLY B 2 453 ? 105.596 137.116 17.713  1.00 55.67  ? 453 GLY B CA 1 
ATOM 4439  C C  . GLY B 2 453 ? 106.703 136.492 18.533  1.00 55.67  ? 453 GLY B C  1 
ATOM 4440  O O  . GLY B 2 453 ? 106.800 135.270 18.587  1.00 55.67  ? 453 GLY B O  1 
ATOM 4441  N N  . LEU B 2 454 ? 107.539 137.289 19.184  1.00 44.20  ? 454 LEU B N  1 
ATOM 4442  C CA . LEU B 2 454 ? 108.664 136.743 19.923  1.00 44.20  ? 454 LEU B CA 1 
ATOM 4443  C C  . LEU B 2 454 ? 108.327 136.615 21.395  1.00 44.20  ? 454 LEU B C  1 
ATOM 4444  O O  . LEU B 2 454 ? 107.635 137.463 21.961  1.00 44.20  ? 454 LEU B O  1 
ATOM 4445  N N  . VAL B 2 455 ? 108.831 135.555 22.008  1.00 38.19  ? 455 VAL B N  1 
ATOM 4446  C CA . VAL B 2 455 ? 108.820 135.377 23.450  1.00 38.19  ? 455 VAL B CA 1 
ATOM 4447  C C  . VAL B 2 455 ? 110.259 135.406 23.932  1.00 38.19  ? 455 VAL B C  1 
ATOM 4448  O O  . VAL B 2 455 ? 111.145 134.802 23.317  1.00 38.19  ? 455 VAL B O  1 
ATOM 4449  N N  . ALA B 2 456 ? 110.496 136.138 25.015  1.00 37.74  ? 456 ALA B N  1 
ATOM 4450  C CA . ALA B 2 456 ? 111.837 136.344 25.525  1.00 37.74  ? 456 ALA B CA 1 
ATOM 4451  C C  . ALA B 2 456 ? 111.775 136.457 27.035  1.00 37.74  ? 456 ALA B C  1 
ATOM 4452  O O  . ALA B 2 456 ? 110.858 137.070 27.583  1.00 37.74  ? 456 ALA B O  1 
ATOM 4453  N N  . ALA B 2 457 ? 112.770 135.883 27.696  1.00 38.95  ? 457 ALA B N  1 
ATOM 4454  C CA . ALA B 2 457 ? 112.761 135.771 29.142  1.00 38.95  ? 457 ALA B CA 1 
ATOM 4455  C C  . ALA B 2 457 ? 114.174 135.910 29.673  1.00 38.95  ? 457 ALA B C  1 
ATOM 4456  O O  . ALA B 2 457 ? 115.152 135.627 28.978  1.00 38.95  ? 457 ALA B O  1 
ATOM 4457  N N  . CYS B 2 458 ? 114.268 136.328 30.930  1.00 48.31  ? 458 CYS B N  1 
ATOM 4458  C CA . CYS B 2 458 ? 115.541 136.559 31.592  1.00 48.31  ? 458 CYS B CA 1 
ATOM 4459  C C  . CYS B 2 458 ? 115.679 135.553 32.712  1.00 48.31  ? 458 CYS B C  1 
ATOM 4460  O O  . CYS B 2 458 ? 114.676 135.117 33.277  1.00 48.31  ? 458 CYS B O  1 
ATOM 4461  N N  . ALA B 2 459 ? 116.906 135.174 33.018  1.00 53.32  ? 459 ALA B N  1 
ATOM 4462  C CA . ALA B 2 459 ? 117.155 134.136 33.999  1.00 53.32  ? 459 ALA B CA 1 
ATOM 4463  C C  . ALA B 2 459 ? 118.153 134.600 35.046  1.00 53.32  ? 459 ALA B C  1 
ATOM 4464  O O  . ALA B 2 459 ? 119.004 135.452 34.785  1.00 53.32  ? 459 ALA B O  1 
ATOM 4465  N N  . ALA B 2 460 ? 118.051 134.004 36.226  1.00 50.38  ? 460 ALA B N  1 
ATOM 4466  C CA . ALA B 2 460 ? 118.942 134.299 37.342  1.00 50.38  ? 460 ALA B CA 1 
ATOM 4467  C C  . ALA B 2 460 ? 120.317 133.723 37.054  1.00 50.38  ? 460 ALA B C  1 
ATOM 4468  O O  . ALA B 2 460 ? 120.601 132.571 37.375  1.00 50.38  ? 460 ALA B O  1 
ATOM 4469  N N  . GLY B 2 461 ? 121.197 134.527 36.486  1.00 49.12  ? 461 GLY B N  1 
ATOM 4470  C CA . GLY B 2 461 ? 122.527 134.029 36.223  1.00 49.12  ? 461 GLY B CA 1 
ATOM 4471  C C  . GLY B 2 461 ? 123.097 134.588 34.946  1.00 49.12  ? 461 GLY B C  1 
ATOM 4472  O O  . GLY B 2 461 ? 124.269 134.376 34.626  1.00 49.12  ? 461 GLY B O  1 
ATOM 4473  N N  . GLY B 2 462 ? 122.269 135.300 34.202  1.00 55.41  ? 462 GLY B N  1 
ATOM 4474  C CA . GLY B 2 462 ? 122.707 136.003 33.026  1.00 55.41  ? 462 GLY B CA 1 
ATOM 4475  C C  . GLY B 2 462 ? 122.200 135.425 31.731  1.00 55.41  ? 462 GLY B C  1 
ATOM 4476  O O  . GLY B 2 462 ? 122.282 136.105 30.703  1.00 55.41  ? 462 GLY B O  1 
ATOM 4477  N N  . GLN B 2 463 ? 121.696 134.192 31.739  1.00 48.06  ? 463 GLN B N  1 
ATOM 4478  C CA . GLN B 2 463 ? 121.155 133.613 30.519  1.00 48.06  ? 463 GLN B CA 1 
ATOM 4479  C C  . GLN B 2 463 ? 119.889 134.323 30.097  1.00 48.06  ? 463 GLN B C  1 
ATOM 4480  O O  . GLN B 2 463 ? 119.041 134.658 30.924  1.00 48.06  ? 463 GLN B O  1 
ATOM 4481  N N  . GLY B 2 464 ? 119.757 134.538 28.795  1.00 43.68  ? 464 GLY B N  1 
ATOM 4482  C CA . GLY B 2 464 ? 118.537 135.038 28.214  1.00 43.68  ? 464 GLY B CA 1 
ATOM 4483  C C  . GLY B 2 464 ? 117.888 133.947 27.392  1.00 43.68  ? 464 GLY B C  1 
ATOM 4484  O O  . GLY B 2 464 ? 118.433 132.868 27.205  1.00 43.68  ? 464 GLY B O  1 
ATOM 4485  N N  . HIS B 2 465 ? 116.696 134.247 26.906  1.00 39.65  ? 465 HIS B N  1 
ATOM 4486  C CA . HIS B 2 465 ? 116.045 133.332 25.994  1.00 39.65  ? 465 HIS B CA 1 
ATOM 4487  C C  . HIS B 2 465 ? 115.139 134.128 25.085  1.00 39.65  ? 465 HIS B C  1 
ATOM 4488  O O  . HIS B 2 465 ? 114.450 135.031 25.547  1.00 39.65  ? 465 HIS B O  1 
ATOM 4489  N N  . ALA B 2 466 ? 115.118 133.775 23.808  1.00 42.91  ? 466 ALA B N  1 
ATOM 4490  C CA . ALA B 2 466 ? 114.299 134.502 22.853  1.00 42.91  ? 466 ALA B CA 1 
ATOM 4491  C C  . ALA B 2 466 ? 114.027 133.607 21.663  1.00 42.91  ? 466 ALA B C  1 
ATOM 4492  O O  . ALA B 2 466 ? 114.959 133.036 21.096  1.00 42.91  ? 466 ALA B O  1 
ATOM 4493  N N  . MET B 2 467 ? 112.761 133.497 21.283  1.00 47.14  ? 467 MET B N  1 
ATOM 4494  C CA . MET B 2 467 ? 112.398 132.657 20.151  1.00 47.14  ? 467 MET B CA 1 
ATOM 4495  C C  . MET B 2 467 ? 111.113 133.184 19.545  1.00 47.14  ? 467 MET B C  1 
ATOM 4496  O O  . MET B 2 467 ? 110.253 133.702 20.263  1.00 47.14  ? 467 MET B O  1 
ATOM 4497  N N  . ILE B 2 468 ? 110.998 133.095 18.235  1.00 44.91  ? 468 ILE B N  1 
ATOM 4498  C CA . ILE B 2 468 ? 109.825 133.610 17.551  1.00 44.91  ? 468 ILE B CA 1 
ATOM 4499  C C  . ILE B 2 468 ? 108.844 132.479 17.337  1.00 44.91  ? 468 ILE B C  1 
ATOM 4500  O O  . ILE B 2 468 ? 109.231 131.320 17.169  1.00 44.91  ? 468 ILE B O  1 
ATOM 4501  N N  . VAL B 2 469 ? 107.567 132.817 17.395  1.00 50.00  ? 469 VAL B N  1 
ATOM 4502  C CA . VAL B 2 469 ? 106.467 131.876 17.305  1.00 50.00  ? 469 VAL B CA 1 
ATOM 4503  C C  . VAL B 2 469 ? 105.511 132.415 16.256  1.00 50.00  ? 469 VAL B C  1 
ATOM 4504  O O  . VAL B 2 469 ? 105.151 133.596 16.282  1.00 50.00  ? 469 VAL B O  1 
ATOM 4505  N N  . GLU B 2 470 ? 105.115 131.563 15.329  1.00 59.62  ? 470 GLU B N  1 
ATOM 4506  C CA . GLU B 2 470 ? 104.332 131.956 14.176  1.00 59.62  ? 470 GLU B CA 1 
ATOM 4507  C C  . GLU B 2 470 ? 102.895 131.503 14.435  1.00 59.62  ? 470 GLU B C  1 
ATOM 4508  O O  . GLU B 2 470 ? 102.645 130.697 15.322  1.00 59.62  ? 470 GLU B O  1 
ATOM 4509  N N  . ALA B 2 471 ? 101.935 132.027 13.677  1.00 58.64  ? 471 ALA B N  1 
ATOM 4510  C CA . ALA B 2 471 ? 100.520 131.745 13.906  1.00 58.64  ? 471 ALA B CA 1 
ATOM 4511  C C  . ALA B 2 471 ? 100.104 130.375 13.390  1.00 58.64  ? 471 ALA B C  1 
ATOM 4512  O O  . ALA B 2 471 ? 100.953 129.560 13.026  1.00 58.64  ? 471 ALA B O  1 
ATOM 4513  N N  . TYR B 2 472 ? 98.803  130.109 13.355  1.00 58.46  ? 472 TYR B N  1 
ATOM 4514  C CA . TYR B 2 472 ? 98.361  128.785 12.985  1.00 58.46  ? 472 TYR B CA 1 
ATOM 4515  C C  . TYR B 2 472 ? 98.486  128.607 11.482  1.00 58.46  ? 472 TYR B C  1 
ATOM 4516  O O  . TYR B 2 472 ? 98.320  129.561 10.724  1.00 58.46  ? 472 TYR B O  1 
ATOM 4517  N N  . PRO B 2 473 ? 98.831  127.397 11.031  1.00 58.85  ? 473 PRO B N  1 
ATOM 4518  C CA . PRO B 2 473 ? 99.198  127.229 9.614   1.00 58.85  ? 473 PRO B CA 1 
ATOM 4519  C C  . PRO B 2 473 ? 98.039  127.381 8.641   1.00 58.85  ? 473 PRO B C  1 
ATOM 4520  O O  . PRO B 2 473 ? 98.264  127.506 7.432   1.00 58.85  ? 473 PRO B O  1 
ATOM 4521  N N  . LYS B 2 474 ? 96.809  127.394 9.130   1.00 67.25  ? 474 LYS B N  1 
ATOM 4522  C CA . LYS B 2 474 ? 95.675  127.684 8.271   1.00 67.25  ? 474 LYS B CA 1 
ATOM 4523  C C  . LYS B 2 474 ? 95.578  129.192 8.115   1.00 67.25  ? 474 LYS B C  1 
ATOM 4524  O O  . LYS B 2 474 ? 96.153  129.940 8.897   1.00 67.25  ? 474 LYS B O  1 
ATOM 4525  N N  . THR C 1 37  ? 100.717 54.528  42.966  1.00 100.84 ? 37  THR C N  1 
ATOM 4526  C CA . THR C 1 37  ? 102.074 54.681  42.465  1.00 100.84 ? 37  THR C CA 1 
ATOM 4527  C C  . THR C 1 37  ? 102.530 56.135  42.571  1.00 100.84 ? 37  THR C C  1 
ATOM 4528  O O  . THR C 1 37  ? 102.758 56.653  43.660  1.00 100.84 ? 37  THR C O  1 
ATOM 4529  N N  . ARG C 1 38  ? 102.677 56.791  41.428  1.00 93.09  ? 38  ARG C N  1 
ATOM 4530  C CA . ARG C 1 38  ? 103.028 58.203  41.372  1.00 93.09  ? 38  ARG C CA 1 
ATOM 4531  C C  . ARG C 1 38  ? 101.988 58.836  40.463  1.00 93.09  ? 38  ARG C C  1 
ATOM 4532  O O  . ARG C 1 38  ? 102.228 59.033  39.269  1.00 93.09  ? 38  ARG C O  1 
ATOM 4533  N N  . THR C 1 39  ? 100.836 59.154  41.032  1.00 95.24  ? 39  THR C N  1 
ATOM 4534  C CA . THR C 1 39  ? 99.757  59.752  40.264  1.00 95.24  ? 39  THR C CA 1 
ATOM 4535  C C  . THR C 1 39  ? 99.662  61.251  40.473  1.00 95.24  ? 39  THR C C  1 
ATOM 4536  O O  . THR C 1 39  ? 99.205  61.969  39.579  1.00 95.24  ? 39  THR C O  1 
ATOM 4537  N N  . HIS C 1 40  ? 100.072 61.735  41.638  1.00 91.15  ? 40  HIS C N  1 
ATOM 4538  C CA . HIS C 1 40  ? 99.984  63.154  41.931  1.00 91.15  ? 40  HIS C CA 1 
ATOM 4539  C C  . HIS C 1 40  ? 101.272 63.657  42.556  1.00 91.15  ? 40  HIS C C  1 
ATOM 4540  O O  . HIS C 1 40  ? 101.574 64.852  42.492  1.00 91.15  ? 40  HIS C O  1 
ATOM 4541  N N  . ILE C 1 41  ? 102.031 62.757  43.168  1.00 86.33  ? 41  ILE C N  1 
ATOM 4542  C CA . ILE C 1 41  ? 103.256 63.100  43.874  1.00 86.33  ? 41  ILE C CA 1 
ATOM 4543  C C  . ILE C 1 41  ? 104.393 62.298  43.260  1.00 86.33  ? 41  ILE C C  1 
ATOM 4544  O O  . ILE C 1 41  ? 104.218 61.128  42.912  1.00 86.33  ? 41  ILE C O  1 
ATOM 4545  N N  . ASN C 1 42  ? 105.551 62.931  43.125  1.00 83.21  ? 42  ASN C N  1 
ATOM 4546  C CA . ASN C 1 42  ? 106.722 62.276  42.573  1.00 83.21  ? 42  ASN C CA 1 
ATOM 4547  C C  . ASN C 1 42  ? 107.963 63.016  43.027  1.00 83.21  ? 42  ASN C C  1 
ATOM 4548  O O  . ASN C 1 42  ? 107.898 64.179  43.419  1.00 83.21  ? 42  ASN C O  1 
ATOM 4549  N N  . TYR C 1 43  ? 109.096 62.340  42.936  1.00 80.03  ? 43  TYR C N  1 
ATOM 4550  C CA . TYR C 1 43  ? 110.387 62.971  43.132  1.00 80.03  ? 43  TYR C CA 1 
ATOM 4551  C C  . TYR C 1 43  ? 111.382 62.421  42.134  1.00 80.03  ? 43  TYR C C  1 
ATOM 4552  O O  . TYR C 1 43  ? 111.069 61.565  41.312  1.00 80.03  ? 43  TYR C O  1 
ATOM 4553  N N  . GLY C 1 44  ? 112.606 62.906  42.254  1.00 91.07  ? 44  GLY C N  1 
ATOM 4554  C CA . GLY C 1 44  ? 113.732 62.302  41.585  1.00 91.07  ? 44  GLY C CA 1 
ATOM 4555  C C  . GLY C 1 44  ? 114.974 62.454  42.431  1.00 91.07  ? 44  GLY C C  1 
ATOM 4556  O O  . GLY C 1 44  ? 114.888 62.721  43.633  1.00 91.07  ? 44  GLY C O  1 
ATOM 4557  N N  . VAL C 1 45  ? 116.139 62.287  41.820  1.00 99.47  ? 45  VAL C N  1 
ATOM 4558  C CA . VAL C 1 45  ? 117.409 62.508  42.493  1.00 99.47  ? 45  VAL C CA 1 
ATOM 4559  C C  . VAL C 1 45  ? 118.166 63.604  41.755  1.00 99.47  ? 45  VAL C C  1 
ATOM 4560  O O  . VAL C 1 45  ? 118.381 63.515  40.540  1.00 99.47  ? 45  VAL C O  1 
ATOM 4561  N N  . LYS C 1 46  ? 118.509 64.667  42.475  1.00 93.12  ? 46  LYS C N  1 
ATOM 4562  C CA . LYS C 1 46  ? 119.424 65.693  41.975  1.00 93.12  ? 46  LYS C CA 1 
ATOM 4563  C C  . LYS C 1 46  ? 120.099 66.258  43.223  1.00 93.12  ? 46  LYS C C  1 
ATOM 4564  O O  . LYS C 1 46  ? 119.440 66.623  44.199  1.00 93.12  ? 46  LYS C O  1 
ATOM 4565  N N  . GLY C 1 47  ? 121.426 66.243  43.218  1.00 105.96 ? 47  GLY C N  1 
ATOM 4566  C CA . GLY C 1 47  ? 122.178 66.567  44.414  1.00 105.96 ? 47  GLY C CA 1 
ATOM 4567  C C  . GLY C 1 47  ? 122.042 65.531  45.507  1.00 105.96 ? 47  GLY C C  1 
ATOM 4568  O O  . GLY C 1 47  ? 122.388 65.813  46.665  1.00 105.96 ? 47  GLY C O  1 
ATOM 4569  N N  . ASP C 1 48  ? 121.557 64.331  45.150  1.00 111.22 ? 48  ASP C N  1 
ATOM 4570  C CA . ASP C 1 48  ? 121.151 63.270  46.076  1.00 111.22 ? 48  ASP C CA 1 
ATOM 4571  C C  . ASP C 1 48  ? 120.141 63.800  47.097  1.00 111.22 ? 48  ASP C C  1 
ATOM 4572  O O  . ASP C 1 48  ? 120.235 63.545  48.298  1.00 111.22 ? 48  ASP C O  1 
ATOM 4573  N N  . VAL C 1 49  ? 119.180 64.583  46.603  1.00 99.38  ? 49  VAL C N  1 
ATOM 4574  C CA . VAL C 1 49  ? 118.151 65.209  47.423  1.00 99.38  ? 49  VAL C CA 1 
ATOM 4575  C C  . VAL C 1 49  ? 116.788 64.915  46.795  1.00 99.38  ? 49  VAL C C  1 
ATOM 4576  O O  . VAL C 1 49  ? 116.581 65.081  45.592  1.00 99.38  ? 49  VAL C O  1 
ATOM 4577  N N  . ALA C 1 50  ? 115.854 64.470  47.633  1.00 84.89  ? 50  ALA C N  1 
ATOM 4578  C CA . ALA C 1 50  ? 114.532 64.016  47.202  1.00 84.89  ? 50  ALA C CA 1 
ATOM 4579  C C  . ALA C 1 50  ? 113.627 65.228  47.013  1.00 84.89  ? 50  ALA C C  1 
ATOM 4580  O O  . ALA C 1 50  ? 113.184 65.847  47.985  1.00 84.89  ? 50  ALA C O  1 
ATOM 4581  N N  . VAL C 1 51  ? 113.340 65.550  45.759  1.00 80.52  ? 51  VAL C N  1 
ATOM 4582  C CA . VAL C 1 51  ? 112.512 66.701  45.416  1.00 80.52  ? 51  VAL C CA 1 
ATOM 4583  C C  . VAL C 1 51  ? 111.076 66.224  45.182  1.00 80.52  ? 51  VAL C C  1 
ATOM 4584  O O  . VAL C 1 51  ? 110.564 66.109  44.066  1.00 80.52  ? 51  VAL C O  1 
ATOM 4585  N N  . VAL C 1 52  ? 110.368 65.991  46.275  1.00 75.08  ? 52  VAL C N  1 
ATOM 4586  C CA . VAL C 1 52  ? 108.978 65.579  46.155  1.00 75.08  ? 52  VAL C CA 1 
ATOM 4587  C C  . VAL C 1 52  ? 108.125 66.771  45.741  1.00 75.08  ? 52  VAL C C  1 
ATOM 4588  O O  . VAL C 1 52  ? 108.214 67.871  46.307  1.00 75.08  ? 52  VAL C O  1 
ATOM 4589  N N  . ARG C 1 53  ? 107.317 66.553  44.711  1.00 70.51  ? 53  ARG C N  1 
ATOM 4590  C CA . ARG C 1 53  ? 106.539 67.599  44.078  1.00 70.51  ? 53  ARG C CA 1 
ATOM 4591  C C  . ARG C 1 53  ? 105.060 67.305  44.226  1.00 70.51  ? 53  ARG C C  1 
ATOM 4592  O O  . ARG C 1 53  ? 104.649 66.144  44.285  1.00 70.51  ? 53  ARG C O  1 
ATOM 4593  N N  . ILE C 1 54  ? 104.264 68.364  44.289  1.00 77.96  ? 54  ILE C N  1 
ATOM 4594  C CA . ILE C 1 54  ? 102.832 68.259  44.510  1.00 77.96  ? 54  ILE C CA 1 
ATOM 4595  C C  . ILE C 1 54  ? 102.123 68.809  43.286  1.00 77.96  ? 54  ILE C C  1 
ATOM 4596  O O  . ILE C 1 54  ? 102.411 69.926  42.842  1.00 77.96  ? 54  ILE C O  1 
ATOM 4597  N N  . ASN C 1 55  ? 101.208 68.022  42.735  1.00 94.10  ? 55  ASN C N  1 
ATOM 4598  C CA . ASN C 1 55  ? 100.462 68.437  41.561  1.00 94.10  ? 55  ASN C CA 1 
ATOM 4599  C C  . ASN C 1 55  ? 99.170  67.640  41.524  1.00 94.10  ? 55  ASN C C  1 
ATOM 4600  O O  . ASN C 1 55  ? 99.084  66.555  42.099  1.00 94.10  ? 55  ASN C O  1 
ATOM 4601  N N  . SER C 1 56  ? 98.168  68.196  40.860  1.00 95.80  ? 56  SER C N  1 
ATOM 4602  C CA . SER C 1 56  ? 96.900  67.504  40.637  1.00 95.80  ? 56  SER C CA 1 
ATOM 4603  C C  . SER C 1 56  ? 96.279  68.095  39.387  1.00 95.80  ? 56  SER C C  1 
ATOM 4604  O O  . SER C 1 56  ? 95.655  69.166  39.436  1.00 95.80  ? 56  SER C O  1 
ATOM 4605  N N  . PRO C 1 57  ? 96.417  67.424  38.240  1.00 106.31 ? 57  PRO C N  1 
ATOM 4606  C CA . PRO C 1 57  ? 96.003  68.029  36.965  1.00 106.31 ? 57  PRO C CA 1 
ATOM 4607  C C  . PRO C 1 57  ? 94.503  68.057  36.747  1.00 106.31 ? 57  PRO C C  1 
ATOM 4608  O O  . PRO C 1 57  ? 94.048  68.707  35.795  1.00 106.31 ? 57  PRO C O  1 
ATOM 4609  N N  . ASN C 1 58  ? 93.731  67.376  37.591  1.00 110.76 ? 58  ASN C N  1 
ATOM 4610  C CA . ASN C 1 58  ? 92.299  67.246  37.361  1.00 110.76 ? 58  ASN C CA 1 
ATOM 4611  C C  . ASN C 1 58  ? 91.587  68.561  37.644  1.00 110.76 ? 58  ASN C C  1 
ATOM 4612  O O  . ASN C 1 58  ? 90.961  69.150  36.757  1.00 110.76 ? 58  ASN C O  1 
ATOM 4613  N N  . SER C 1 59  ? 91.693  69.048  38.874  1.00 96.71  ? 59  SER C N  1 
ATOM 4614  C CA . SER C 1 59  ? 91.175  70.356  39.223  1.00 96.71  ? 59  SER C CA 1 
ATOM 4615  C C  . SER C 1 59  ? 92.204  71.423  38.873  1.00 96.71  ? 59  SER C C  1 
ATOM 4616  O O  . SER C 1 59  ? 93.324  71.130  38.451  1.00 96.71  ? 59  SER C O  1 
ATOM 4617  N N  . LYS C 1 60  ? 91.820  72.685  39.048  1.00 85.09  ? 60  LYS C N  1 
ATOM 4618  C CA . LYS C 1 60  ? 92.778  73.763  38.851  1.00 85.09  ? 60  LYS C CA 1 
ATOM 4619  C C  . LYS C 1 60  ? 93.695  73.887  40.058  1.00 85.09  ? 60  LYS C C  1 
ATOM 4620  O O  . LYS C 1 60  ? 94.887  74.169  39.913  1.00 85.09  ? 60  LYS C O  1 
ATOM 4621  N N  . VAL C 1 61  ? 93.151  73.700  41.254  1.00 82.98  ? 61  VAL C N  1 
ATOM 4622  C CA . VAL C 1 61  ? 93.904  73.819  42.492  1.00 82.98  ? 61  VAL C CA 1 
ATOM 4623  C C  . VAL C 1 61  ? 93.992  72.453  43.145  1.00 82.98  ? 61  VAL C C  1 
ATOM 4624  O O  . VAL C 1 61  ? 93.170  71.567  42.893  1.00 82.98  ? 61  VAL C O  1 
ATOM 4625  N N  . ASN C 1 62  ? 95.008  72.278  43.981  1.00 86.19  ? 62  ASN C N  1 
ATOM 4626  C CA . ASN C 1 62  ? 95.224  70.996  44.637  1.00 86.19  ? 62  ASN C CA 1 
ATOM 4627  C C  . ASN C 1 62  ? 94.636  71.002  46.038  1.00 86.19  ? 62  ASN C C  1 
ATOM 4628  O O  . ASN C 1 62  ? 94.761  71.983  46.776  1.00 86.19  ? 62  ASN C O  1 
ATOM 4629  N N  . THR C 1 63  ? 93.990  69.904  46.402  1.00 96.86  ? 63  THR C N  1 
ATOM 4630  C CA . THR C 1 63  ? 93.270  69.792  47.657  1.00 96.86  ? 63  THR C CA 1 
ATOM 4631  C C  . THR C 1 63  ? 93.832  68.646  48.476  1.00 96.86  ? 63  THR C C  1 
ATOM 4632  O O  . THR C 1 63  ? 94.154  67.587  47.931  1.00 96.86  ? 63  THR C O  1 
ATOM 4633  N N  . LEU C 1 64  ? 93.942  68.864  49.778  1.00 96.75  ? 64  LEU C N  1 
ATOM 4634  C CA . LEU C 1 64  ? 94.216  67.777  50.699  1.00 96.75  ? 64  LEU C CA 1 
ATOM 4635  C C  . LEU C 1 64  ? 93.039  66.815  50.694  1.00 96.75  ? 64  LEU C C  1 
ATOM 4636  O O  . LEU C 1 64  ? 91.896  67.224  50.902  1.00 96.75  ? 64  LEU C O  1 
ATOM 4637  N N  . SER C 1 65  ? 93.311  65.537  50.449  1.00 110.67 ? 65  SER C N  1 
ATOM 4638  C CA . SER C 1 65  ? 92.243  64.550  50.421  1.00 110.67 ? 65  SER C CA 1 
ATOM 4639  C C  . SER C 1 65  ? 92.776  63.209  50.889  1.00 110.67 ? 65  SER C C  1 
ATOM 4640  O O  . SER C 1 65  ? 93.984  63.008  51.033  1.00 110.67 ? 65  SER C O  1 
ATOM 4641  N N  . LYS C 1 66  ? 91.842  62.283  51.114  1.00 115.38 ? 66  LYS C N  1 
ATOM 4642  C CA . LYS C 1 66  ? 92.206  60.886  51.312  1.00 115.38 ? 66  LYS C CA 1 
ATOM 4643  C C  . LYS C 1 66  ? 92.882  60.335  50.068  1.00 115.38 ? 66  LYS C C  1 
ATOM 4644  O O  . LYS C 1 66  ? 93.837  59.555  50.159  1.00 115.38 ? 66  LYS C O  1 
ATOM 4645  N N  . GLU C 1 67  ? 92.424  60.765  48.902  1.00 116.65 ? 67  GLU C N  1 
ATOM 4646  C CA . GLU C 1 67  ? 92.997  60.403  47.622  1.00 116.65 ? 67  GLU C CA 1 
ATOM 4647  C C  . GLU C 1 67  ? 94.333  60.994  47.403  1.00 116.65 ? 67  GLU C C  1 
ATOM 4648  O O  . GLU C 1 67  ? 94.917  60.596  46.411  1.00 116.65 ? 67  GLU C O  1 
ATOM 4649  N N  . LEU C 1 68  ? 94.837  61.917  48.217  1.00 111.61 ? 68  LEU C N  1 
ATOM 4650  C CA . LEU C 1 68  ? 96.222  62.360  48.138  1.00 111.61 ? 68  LEU C CA 1 
ATOM 4651  C C  . LEU C 1 68  ? 97.114  61.689  49.163  1.00 111.61 ? 68  LEU C C  1 
ATOM 4652  O O  . LEU C 1 68  ? 98.218  61.262  48.827  1.00 111.61 ? 68  LEU C O  1 
ATOM 4653  N N  . HIS C 1 69  ? 96.650  61.562  50.407  1.00 110.83 ? 69  HIS C N  1 
ATOM 4654  C CA . HIS C 1 69  ? 97.436  60.880  51.426  1.00 110.83 ? 69  HIS C CA 1 
ATOM 4655  C C  . HIS C 1 69  ? 97.577  59.393  51.154  1.00 110.83 ? 69  HIS C C  1 
ATOM 4656  O O  . HIS C 1 69  ? 98.565  58.800  51.593  1.00 110.83 ? 69  HIS C O  1 
ATOM 4657  N N  . SER C 1 70  ? 96.649  58.805  50.385  1.00 113.78 ? 70  SER C N  1 
ATOM 4658  C CA . SER C 1 70  ? 96.718  57.399  50.000  1.00 113.78 ? 70  SER C CA 1 
ATOM 4659  C C  . SER C 1 70  ? 97.960  57.067  49.185  1.00 113.78 ? 70  SER C C  1 
ATOM 4660  O O  . SER C 1 70  ? 98.316  55.889  49.076  1.00 113.78 ? 70  SER C O  1 
ATOM 4661  N N  . GLU C 1 71  ? 98.608  58.069  48.593  1.00 116.31 ? 71  GLU C N  1 
ATOM 4662  C CA . GLU C 1 71  ? 99.920  57.901  48.001  1.00 116.31 ? 71  GLU C CA 1 
ATOM 4663  C C  . GLU C 1 71  ? 100.999 58.731  48.674  1.00 116.31 ? 71  GLU C C  1 
ATOM 4664  O O  . GLU C 1 71  ? 102.177 58.381  48.569  1.00 116.31 ? 71  GLU C O  1 
ATOM 4665  N N  . PHE C 1 72  ? 100.634 59.791  49.394  1.00 97.01  ? 72  PHE C N  1 
ATOM 4666  C CA . PHE C 1 72  ? 101.588 60.562  50.176  1.00 97.01  ? 72  PHE C CA 1 
ATOM 4667  C C  . PHE C 1 72  ? 102.125 59.761  51.352  1.00 97.01  ? 72  PHE C C  1 
ATOM 4668  O O  . PHE C 1 72  ? 103.159 60.128  51.918  1.00 97.01  ? 72  PHE C O  1 
ATOM 4669  N N  . SER C 1 73  ? 101.436 58.686  51.733  1.00 102.22 ? 73  SER C N  1 
ATOM 4670  C CA . SER C 1 73  ? 101.937 57.796  52.766  1.00 102.22 ? 73  SER C CA 1 
ATOM 4671  C C  . SER C 1 73  ? 103.184 57.064  52.299  1.00 102.22 ? 73  SER C C  1 
ATOM 4672  O O  . SER C 1 73  ? 104.277 57.257  52.841  1.00 102.22 ? 73  SER C O  1 
ATOM 4673  N N  . GLU C 1 74  ? 103.059 56.263  51.241  1.00 105.80 ? 74  GLU C N  1 
ATOM 4674  C CA . GLU C 1 74  ? 104.097 55.305  50.883  1.00 105.80 ? 74  GLU C CA 1 
ATOM 4675  C C  . GLU C 1 74  ? 105.231 55.922  50.081  1.00 105.80 ? 74  GLU C C  1 
ATOM 4676  O O  . GLU C 1 74  ? 105.973 55.201  49.400  1.00 105.80 ? 74  GLU C O  1 
ATOM 4677  N N  . VAL C 1 75  ? 105.426 57.231  50.182  1.00 100.23 ? 75  VAL C N  1 
ATOM 4678  C CA . VAL C 1 75  ? 106.614 57.854  49.649  1.00 100.23 ? 75  VAL C CA 1 
ATOM 4679  C C  . VAL C 1 75  ? 107.624 58.236  50.733  1.00 100.23 ? 75  VAL C C  1 
ATOM 4680  O O  . VAL C 1 75  ? 108.799 57.873  50.612  1.00 100.23 ? 75  VAL C O  1 
ATOM 4681  N N  . MET C 1 76  ? 107.202 58.891  51.822  1.00 99.61  ? 76  MET C N  1 
ATOM 4682  C CA . MET C 1 76  ? 108.166 59.311  52.834  1.00 99.61  ? 76  MET C CA 1 
ATOM 4683  C C  . MET C 1 76  ? 108.746 58.150  53.617  1.00 99.61  ? 76  MET C C  1 
ATOM 4684  O O  . MET C 1 76  ? 109.848 58.281  54.151  1.00 99.61  ? 76  MET C O  1 
ATOM 4685  N N  . ASN C 1 77  ? 108.045 57.022  53.686  1.00 107.48 ? 77  ASN C N  1 
ATOM 4686  C CA . ASN C 1 77  ? 108.650 55.841  54.278  1.00 107.48 ? 77  ASN C CA 1 
ATOM 4687  C C  . ASN C 1 77  ? 109.798 55.323  53.426  1.00 107.48 ? 77  ASN C C  1 
ATOM 4688  O O  . ASN C 1 77  ? 110.801 54.852  53.964  1.00 107.48 ? 77  ASN C O  1 
ATOM 4689  N N  . GLU C 1 78  ? 109.660 55.409  52.100  1.00 109.08 ? 78  GLU C N  1 
ATOM 4690  C CA . GLU C 1 78  ? 110.766 55.081  51.209  1.00 109.08 ? 78  GLU C CA 1 
ATOM 4691  C C  . GLU C 1 78  ? 111.876 56.108  51.340  1.00 109.08 ? 78  GLU C C  1 
ATOM 4692  O O  . GLU C 1 78  ? 113.061 55.772  51.226  1.00 109.08 ? 78  GLU C O  1 
ATOM 4693  N N  . ILE C 1 79  ? 111.505 57.366  51.585  1.00 102.72 ? 79  ILE C N  1 
ATOM 4694  C CA . ILE C 1 79  ? 112.497 58.364  51.960  1.00 102.72 ? 79  ILE C CA 1 
ATOM 4695  C C  . ILE C 1 79  ? 113.141 57.981  53.281  1.00 102.72 ? 79  ILE C C  1 
ATOM 4696  O O  . ILE C 1 79  ? 114.355 58.116  53.464  1.00 102.72 ? 79  ILE C O  1 
ATOM 4697  N N  . TRP C 1 80  ? 112.354 57.433  54.195  1.00 109.66 ? 80  TRP C N  1 
ATOM 4698  C CA . TRP C 1 80  ? 112.883 56.965  55.461  1.00 109.66 ? 80  TRP C CA 1 
ATOM 4699  C C  . TRP C 1 80  ? 113.517 55.589  55.333  1.00 109.66 ? 80  TRP C C  1 
ATOM 4700  O O  . TRP C 1 80  ? 114.215 55.152  56.251  1.00 109.66 ? 80  TRP C O  1 
ATOM 4701  N N  . ALA C 1 81  ? 113.291 54.896  54.214  1.00 109.67 ? 81  ALA C N  1 
ATOM 4702  C CA . ALA C 1 81  ? 113.983 53.649  53.928  1.00 109.67 ? 81  ALA C CA 1 
ATOM 4703  C C  . ALA C 1 81  ? 115.232 53.853  53.091  1.00 109.67 ? 81  ALA C C  1 
ATOM 4704  O O  . ALA C 1 81  ? 115.889 52.869  52.738  1.00 109.67 ? 81  ALA C O  1 
ATOM 4705  N N  . SER C 1 82  ? 115.565 55.091  52.754  1.00 112.77 ? 82  SER C N  1 
ATOM 4706  C CA . SER C 1 82  ? 116.772 55.387  52.003  1.00 112.77 ? 82  SER C CA 1 
ATOM 4707  C C  . SER C 1 82  ? 117.889 55.834  52.933  1.00 112.77 ? 82  SER C C  1 
ATOM 4708  O O  . SER C 1 82  ? 117.672 56.156  54.103  1.00 112.77 ? 82  SER C O  1 
ATOM 4709  N N  . ASP C 1 83  ? 119.102 55.844  52.387  1.00 108.39 ? 83  ASP C N  1 
ATOM 4710  C CA . ASP C 1 83  ? 120.264 56.346  53.092  1.00 108.39 ? 83  ASP C CA 1 
ATOM 4711  C C  . ASP C 1 83  ? 121.145 57.258  52.259  1.00 108.39 ? 83  ASP C C  1 
ATOM 4712  O O  . ASP C 1 83  ? 121.865 58.073  52.842  1.00 108.39 ? 83  ASP C O  1 
ATOM 4713  N N  . GLN C 1 84  ? 121.114 57.149  50.930  1.00 105.15 ? 84  GLN C N  1 
ATOM 4714  C CA . GLN C 1 84  ? 121.925 58.030  50.097  1.00 105.15 ? 84  GLN C CA 1 
ATOM 4715  C C  . GLN C 1 84  ? 121.415 59.455  50.176  1.00 105.15 ? 84  GLN C C  1 
ATOM 4716  O O  . GLN C 1 84  ? 122.190 60.390  50.408  1.00 105.15 ? 84  GLN C O  1 
ATOM 4717  N N  . ILE C 1 85  ? 120.117 59.629  50.013  1.00 98.42  ? 85  ILE C N  1 
ATOM 4718  C CA . ILE C 1 85  ? 119.492 60.929  50.166  1.00 98.42  ? 85  ILE C CA 1 
ATOM 4719  C C  . ILE C 1 85  ? 119.553 61.304  51.636  1.00 98.42  ? 85  ILE C C  1 
ATOM 4720  O O  . ILE C 1 85  ? 119.262 60.486  52.514  1.00 98.42  ? 85  ILE C O  1 
ATOM 4721  N N  . ARG C 1 86  ? 119.990 62.523  51.914  1.00 96.40  ? 86  ARG C N  1 
ATOM 4722  C CA . ARG C 1 86  ? 120.181 62.963  53.284  1.00 96.40  ? 86  ARG C CA 1 
ATOM 4723  C C  . ARG C 1 86  ? 119.342 64.186  53.608  1.00 96.40  ? 86  ARG C C  1 
ATOM 4724  O O  . ARG C 1 86  ? 119.427 64.707  54.726  1.00 96.40  ? 86  ARG C O  1 
ATOM 4725  N N  . SER C 1 87  ? 118.529 64.654  52.660  1.00 91.92  ? 87  SER C N  1 
ATOM 4726  C CA . SER C 1 87  ? 117.603 65.757  52.882  1.00 91.92  ? 87  SER C CA 1 
ATOM 4727  C C  . SER C 1 87  ? 116.554 65.722  51.785  1.00 91.92  ? 87  SER C C  1 
ATOM 4728  O O  . SER C 1 87  ? 116.826 65.264  50.674  1.00 91.92  ? 87  SER C O  1 
ATOM 4729  N N  . ALA C 1 88  ? 115.361 66.209  52.097  1.00 76.39  ? 88  ALA C N  1 
ATOM 4730  C CA . ALA C 1 88  ? 114.273 66.181  51.136  1.00 76.39  ? 88  ALA C CA 1 
ATOM 4731  C C  . ALA C 1 88  ? 113.536 67.506  51.165  1.00 76.39  ? 88  ALA C C  1 
ATOM 4732  O O  . ALA C 1 88  ? 113.651 68.268  52.126  1.00 76.39  ? 88  ALA C O  1 
ATOM 4733  N N  . VAL C 1 89  ? 112.783 67.780  50.104  1.00 68.52  ? 89  VAL C N  1 
ATOM 4734  C CA . VAL C 1 89  ? 112.029 69.017  49.987  1.00 68.52  ? 89  VAL C CA 1 
ATOM 4735  C C  . VAL C 1 89  ? 110.782 68.793  49.139  1.00 68.52  ? 89  VAL C C  1 
ATOM 4736  O O  . VAL C 1 89  ? 110.826 68.206  48.059  1.00 68.52  ? 89  VAL C O  1 
ATOM 4737  N N  . LEU C 1 90  ? 109.655 69.265  49.660  1.00 65.09  ? 90  LEU C N  1 
ATOM 4738  C CA . LEU C 1 90  ? 108.385 69.181  48.965  1.00 65.09  ? 90  LEU C CA 1 
ATOM 4739  C C  . LEU C 1 90  ? 107.983 70.544  48.446  1.00 65.09  ? 90  LEU C C  1 
ATOM 4740  O O  . LEU C 1 90  ? 108.330 71.572  49.033  1.00 65.09  ? 90  LEU C O  1 
ATOM 4741  N N  . ILE C 1 91  ? 107.267 70.536  47.329  1.00 70.49  ? 91  ILE C N  1 
ATOM 4742  C CA . ILE C 1 91  ? 106.844 71.764  46.670  1.00 70.49  ? 91  ILE C CA 1 
ATOM 4743  C C  . ILE C 1 91  ? 105.629 71.468  45.799  1.00 70.49  ? 91  ILE C C  1 
ATOM 4744  O O  . ILE C 1 91  ? 105.410 70.322  45.399  1.00 70.49  ? 91  ILE C O  1 
ATOM 4745  N N  . SER C 1 92  ? 104.800 72.480  45.561  1.00 78.15  ? 92  SER C N  1 
ATOM 4746  C CA . SER C 1 92  ? 103.709 72.380  44.596  1.00 78.15  ? 92  SER C CA 1 
ATOM 4747  C C  . SER C 1 92  ? 104.201 72.847  43.237  1.00 78.15  ? 92  SER C C  1 
ATOM 4748  O O  . SER C 1 92  ? 104.286 74.043  42.963  1.00 78.15  ? 92  SER C O  1 
ATOM 4749  N N  . SER C 1 93  ? 104.507 71.891  42.360  1.00 79.51  ? 93  SER C N  1 
ATOM 4750  C CA . SER C 1 93  ? 105.004 72.236  41.034  1.00 79.51  ? 93  SER C CA 1 
ATOM 4751  C C  . SER C 1 93  ? 103.925 72.821  40.138  1.00 79.51  ? 93  SER C C  1 
ATOM 4752  O O  . SER C 1 93  ? 104.251 73.472  39.142  1.00 79.51  ? 93  SER C O  1 
ATOM 4753  N N  . LYS C 1 94  ? 102.661 72.581  40.447  1.00 77.99  ? 94  LYS C N  1 
ATOM 4754  C CA . LYS C 1 94  ? 101.591 73.305  39.790  1.00 77.99  ? 94  LYS C CA 1 
ATOM 4755  C C  . LYS C 1 94  ? 101.646 74.774  40.199  1.00 77.99  ? 94  LYS C C  1 
ATOM 4756  O O  . LYS C 1 94  ? 101.860 75.076  41.375  1.00 77.99  ? 94  LYS C O  1 
ATOM 4757  N N  . PRO C 1 95  ? 101.496 75.703  39.258  1.00 72.44  ? 95  PRO C N  1 
ATOM 4758  C CA . PRO C 1 95  ? 101.447 77.116  39.636  1.00 72.44  ? 95  PRO C CA 1 
ATOM 4759  C C  . PRO C 1 95  ? 100.175 77.439  40.392  1.00 72.44  ? 95  PRO C C  1 
ATOM 4760  O O  . PRO C 1 95  ? 99.174  76.726  40.305  1.00 72.44  ? 95  PRO C O  1 
ATOM 4761  N N  . GLY C 1 96  ? 100.231 78.524  41.156  1.00 73.58  ? 96  GLY C N  1 
ATOM 4762  C CA . GLY C 1 96  ? 99.076  78.955  41.912  1.00 73.58  ? 96  GLY C CA 1 
ATOM 4763  C C  . GLY C 1 96  ? 99.228  78.729  43.398  1.00 73.58  ? 96  GLY C C  1 
ATOM 4764  O O  . GLY C 1 96  ? 100.270 79.053  43.970  1.00 73.58  ? 96  GLY C O  1 
ATOM 4765  N N  . CYS C 1 97  ? 98.200  78.163  44.028  1.00 77.86  ? 97  CYS C N  1 
ATOM 4766  C CA . CYS C 1 97  ? 98.160  77.976  45.471  1.00 77.86  ? 97  CYS C CA 1 
ATOM 4767  C C  . CYS C 1 97  ? 99.052  76.813  45.886  1.00 77.86  ? 97  CYS C C  1 
ATOM 4768  O O  . CYS C 1 97  ? 99.514  76.027  45.058  1.00 77.86  ? 97  CYS C O  1 
ATOM 4769  N N  . PHE C 1 98  ? 99.284  76.685  47.193  1.00 73.18  ? 98  PHE C N  1 
ATOM 4770  C CA . PHE C 1 98  ? 100.133 75.594  47.666  1.00 73.18  ? 98  PHE C CA 1 
ATOM 4771  C C  . PHE C 1 98  ? 99.359  74.281  47.709  1.00 73.18  ? 98  PHE C C  1 
ATOM 4772  O O  . PHE C 1 98  ? 99.584  73.395  46.882  1.00 73.18  ? 98  PHE C O  1 
ATOM 4773  N N  . ILE C 1 99  ? 98.412  74.167  48.642  1.00 80.49  ? 99  ILE C N  1 
ATOM 4774  C CA . ILE C 1 99  ? 97.351  73.168  48.649  1.00 80.49  ? 99  ILE C CA 1 
ATOM 4775  C C  . ILE C 1 99  ? 96.102  73.854  49.184  1.00 80.49  ? 99  ILE C C  1 
ATOM 4776  O O  . ILE C 1 99  ? 96.135  75.019  49.585  1.00 80.49  ? 99  ILE C O  1 
ATOM 4777  N N  . ALA C 1 100 ? 94.998  73.130  49.202  1.00 94.72  ? 100 ALA C N  1 
ATOM 4778  C CA . ALA C 1 100 ? 93.785  73.678  49.781  1.00 94.72  ? 100 ALA C CA 1 
ATOM 4779  C C  . ALA C 1 100 ? 93.729  73.327  51.262  1.00 94.72  ? 100 ALA C C  1 
ATOM 4780  O O  . ALA C 1 100 ? 94.708  72.868  51.852  1.00 94.72  ? 100 ALA C O  1 
ATOM 4781  N N  . GLY C 1 101 ? 92.576  73.549  51.881  1.00 98.09  ? 101 GLY C N  1 
ATOM 4782  C CA . GLY C 1 101 ? 92.356  73.069  53.227  1.00 98.09  ? 101 GLY C CA 1 
ATOM 4783  C C  . GLY C 1 101 ? 91.759  71.683  53.192  1.00 98.09  ? 101 GLY C C  1 
ATOM 4784  O O  . GLY C 1 101 ? 92.193  70.834  52.407  1.00 98.09  ? 101 GLY C O  1 
ATOM 4785  N N  . ALA C 1 102 ? 90.767  71.438  54.042  1.00 112.97 ? 102 ALA C N  1 
ATOM 4786  C CA . ALA C 1 102 ? 89.985  70.220  53.922  1.00 112.97 ? 102 ALA C CA 1 
ATOM 4787  C C  . ALA C 1 102 ? 89.154  70.285  52.653  1.00 112.97 ? 102 ALA C C  1 
ATOM 4788  O O  . ALA C 1 102 ? 88.542  71.312  52.353  1.00 112.97 ? 102 ALA C O  1 
ATOM 4789  N N  . ASP C 1 103 ? 89.164  69.195  51.894  1.00 126.69 ? 103 ASP C N  1 
ATOM 4790  C CA . ASP C 1 103 ? 88.505  69.186  50.599  1.00 126.69 ? 103 ASP C CA 1 
ATOM 4791  C C  . ASP C 1 103 ? 87.006  69.226  50.805  1.00 126.69 ? 103 ASP C C  1 
ATOM 4792  O O  . ASP C 1 103 ? 86.451  68.383  51.518  1.00 126.69 ? 103 ASP C O  1 
ATOM 4793  N N  . ILE C 1 104 ? 86.365  70.180  50.134  1.00 129.85 ? 104 ILE C N  1 
ATOM 4794  C CA . ILE C 1 104 ? 85.092  70.760  50.540  1.00 129.85 ? 104 ILE C CA 1 
ATOM 4795  C C  . ILE C 1 104 ? 84.004  69.699  50.500  1.00 129.85 ? 104 ILE C C  1 
ATOM 4796  O O  . ILE C 1 104 ? 83.128  69.663  51.368  1.00 129.85 ? 104 ILE C O  1 
ATOM 4797  N N  . ASN C 1 105 ? 84.100  68.780  49.544  1.00 134.94 ? 105 ASN C N  1 
ATOM 4798  C CA . ASN C 1 105 ? 83.157  67.678  49.434  1.00 134.94 ? 105 ASN C CA 1 
ATOM 4799  C C  . ASN C 1 105 ? 83.641  66.398  50.109  1.00 134.94 ? 105 ASN C C  1 
ATOM 4800  O O  . ASN C 1 105 ? 83.135  65.319  49.794  1.00 134.94 ? 105 ASN C O  1 
ATOM 4801  N N  . MET C 1 106 ? 84.599  66.483  51.023  1.00 130.39 ? 106 MET C N  1 
ATOM 4802  C CA . MET C 1 106 ? 85.029  65.308  51.771  1.00 130.39 ? 106 MET C CA 1 
ATOM 4803  C C  . MET C 1 106 ? 84.793  65.424  53.261  1.00 130.39 ? 106 MET C C  1 
ATOM 4804  O O  . MET C 1 106 ? 84.454  64.431  53.907  1.00 130.39 ? 106 MET C O  1 
ATOM 4805  N N  . LEU C 1 107 ? 84.991  66.605  53.834  1.00 123.61 ? 107 LEU C N  1 
ATOM 4806  C CA . LEU C 1 107 ? 84.518  66.805  55.192  1.00 123.61 ? 107 LEU C CA 1 
ATOM 4807  C C  . LEU C 1 107 ? 83.010  66.972  55.204  1.00 123.61 ? 107 LEU C C  1 
ATOM 4808  O O  . LEU C 1 107 ? 82.355  66.614  56.187  1.00 123.61 ? 107 LEU C O  1 
ATOM 4809  N N  . ALA C 1 108 ? 82.439  67.481  54.118  1.00 121.29 ? 108 ALA C N  1 
ATOM 4810  C CA . ALA C 1 108 ? 80.992  67.502  54.000  1.00 121.29 ? 108 ALA C CA 1 
ATOM 4811  C C  . ALA C 1 108 ? 80.441  66.194  53.466  1.00 121.29 ? 108 ALA C C  1 
ATOM 4812  O O  . ALA C 1 108 ? 79.219  66.064  53.339  1.00 121.29 ? 108 ALA C O  1 
ATOM 4813  N N  . ALA C 1 109 ? 81.305  65.239  53.129  1.00 128.98 ? 109 ALA C N  1 
ATOM 4814  C CA . ALA C 1 109 ? 80.839  63.893  52.846  1.00 128.98 ? 109 ALA C CA 1 
ATOM 4815  C C  . ALA C 1 109 ? 80.257  63.302  54.119  1.00 128.98 ? 109 ALA C C  1 
ATOM 4816  O O  . ALA C 1 109 ? 80.965  63.117  55.112  1.00 128.98 ? 109 ALA C O  1 
ATOM 4817  N N  . CYS C 1 110 ? 78.954  63.042  54.090  1.00 143.84 ? 110 CYS C N  1 
ATOM 4818  C CA . CYS C 1 110 ? 78.209  62.713  55.296  1.00 143.84 ? 110 CYS C CA 1 
ATOM 4819  C C  . CYS C 1 110 ? 78.577  61.326  55.809  1.00 143.84 ? 110 CYS C C  1 
ATOM 4820  O O  . CYS C 1 110 ? 78.404  60.322  55.109  1.00 143.84 ? 110 CYS C O  1 
ATOM 4821  N N  . LYS C 1 111 ? 79.131  61.276  57.016  1.00 147.60 ? 111 LYS C N  1 
ATOM 4822  C CA . LYS C 1 111 ? 79.429  59.994  57.628  1.00 147.60 ? 111 LYS C CA 1 
ATOM 4823  C C  . LYS C 1 111 ? 79.159  60.112  59.124  1.00 147.60 ? 111 LYS C C  1 
ATOM 4824  O O  . LYS C 1 111 ? 79.088  61.218  59.665  1.00 147.60 ? 111 LYS C O  1 
ATOM 4825  N N  . THR C 1 112 ? 79.027  58.964  59.786  1.00 146.18 ? 112 THR C N  1 
ATOM 4826  C CA . THR C 1 112 ? 78.623  58.903  61.179  1.00 146.18 ? 112 THR C CA 1 
ATOM 4827  C C  . THR C 1 112 ? 79.805  59.318  62.065  1.00 146.18 ? 112 THR C C  1 
ATOM 4828  O O  . THR C 1 112 ? 80.948  59.435  61.612  1.00 146.18 ? 112 THR C O  1 
ATOM 4829  N N  . LEU C 1 113 ? 79.504  59.541  63.348  1.00 137.51 ? 113 LEU C N  1 
ATOM 4830  C CA . LEU C 1 113 ? 80.374  60.280  64.255  1.00 137.51 ? 113 LEU C CA 1 
ATOM 4831  C C  . LEU C 1 113 ? 81.679  59.553  64.548  1.00 137.51 ? 113 LEU C C  1 
ATOM 4832  O O  . LEU C 1 113 ? 82.741  60.184  64.614  1.00 137.51 ? 113 LEU C O  1 
ATOM 4833  N N  . GLN C 1 114 ? 81.622  58.235  64.744  1.00 135.00 ? 114 GLN C N  1 
ATOM 4834  C CA . GLN C 1 114 ? 82.840  57.494  65.046  1.00 135.00 ? 114 GLN C CA 1 
ATOM 4835  C C  . GLN C 1 114 ? 83.805  57.494  63.866  1.00 135.00 ? 114 GLN C C  1 
ATOM 4836  O O  . GLN C 1 114 ? 85.020  57.536  64.063  1.00 135.00 ? 114 GLN C O  1 
ATOM 4837  N N  . GLU C 1 115 ? 83.297  57.518  62.637  1.00 133.43 ? 115 GLU C N  1 
ATOM 4838  C CA . GLU C 1 115 ? 84.211  57.546  61.504  1.00 133.43 ? 115 GLU C CA 1 
ATOM 4839  C C  . GLU C 1 115 ? 84.747  58.951  61.259  1.00 133.43 ? 115 GLU C C  1 
ATOM 4840  O O  . GLU C 1 115 ? 85.905  59.104  60.855  1.00 133.43 ? 115 GLU C O  1 
ATOM 4841  N N  . VAL C 1 116 ? 83.938  59.984  61.506  1.00 125.25 ? 116 VAL C N  1 
ATOM 4842  C CA . VAL C 1 116 ? 84.431  61.340  61.313  1.00 125.25 ? 116 VAL C CA 1 
ATOM 4843  C C  . VAL C 1 116 ? 85.399  61.721  62.422  1.00 125.25 ? 116 VAL C C  1 
ATOM 4844  O O  . VAL C 1 116 ? 86.245  62.601  62.223  1.00 125.25 ? 116 VAL C O  1 
ATOM 4845  N N  . THR C 1 117 ? 85.341  61.058  63.574  1.00 126.57 ? 117 THR C N  1 
ATOM 4846  C CA . THR C 1 117 ? 86.417  61.265  64.526  1.00 126.57 ? 117 THR C CA 1 
ATOM 4847  C C  . THR C 1 117 ? 87.588  60.323  64.288  1.00 126.57 ? 117 THR C C  1 
ATOM 4848  O O  . THR C 1 117 ? 88.721  60.684  64.615  1.00 126.57 ? 117 THR C O  1 
ATOM 4849  N N  . GLN C 1 118 ? 87.363  59.165  63.660  1.00 124.56 ? 118 GLN C N  1 
ATOM 4850  C CA . GLN C 1 118 ? 88.475  58.281  63.332  1.00 124.56 ? 118 GLN C CA 1 
ATOM 4851  C C  . GLN C 1 118 ? 89.354  58.886  62.250  1.00 124.56 ? 118 GLN C C  1 
ATOM 4852  O O  . GLN C 1 118 ? 90.583  58.790  62.324  1.00 124.56 ? 118 GLN C O  1 
ATOM 4853  N N  . LEU C 1 119 ? 88.744  59.503  61.236  1.00 121.40 ? 119 LEU C N  1 
ATOM 4854  C CA . LEU C 1 119 ? 89.536  60.128  60.183  1.00 121.40 ? 119 LEU C CA 1 
ATOM 4855  C C  . LEU C 1 119 ? 90.293  61.330  60.718  1.00 121.40 ? 119 LEU C C  1 
ATOM 4856  O O  . LEU C 1 119 ? 91.465  61.525  60.392  1.00 121.40 ? 119 LEU C O  1 
ATOM 4857  N N  . SER C 1 120 ? 89.654  62.118  61.570  1.00 112.97 ? 120 SER C N  1 
ATOM 4858  C CA . SER C 1 120 ? 90.286  63.282  62.164  1.00 112.97 ? 120 SER C CA 1 
ATOM 4859  C C  . SER C 1 120 ? 91.173  62.933  63.346  1.00 112.97 ? 120 SER C C  1 
ATOM 4860  O O  . SER C 1 120 ? 91.715  63.845  63.974  1.00 112.97 ? 120 SER C O  1 
ATOM 4861  N N  . GLN C 1 121 ? 91.281  61.655  63.704  1.00 120.06 ? 121 GLN C N  1 
ATOM 4862  C CA . GLN C 1 121 ? 92.352  61.201  64.581  1.00 120.06 ? 121 GLN C CA 1 
ATOM 4863  C C  . GLN C 1 121 ? 93.493  60.583  63.780  1.00 120.06 ? 121 GLN C C  1 
ATOM 4864  O O  . GLN C 1 121 ? 94.658  60.646  64.187  1.00 120.06 ? 121 GLN C O  1 
ATOM 4865  N N  . GLU C 1 122 ? 93.174  59.990  62.635  1.00 116.14 ? 122 GLU C N  1 
ATOM 4866  C CA . GLU C 1 122 ? 94.208  59.447  61.765  1.00 116.14 ? 122 GLU C CA 1 
ATOM 4867  C C  . GLU C 1 122 ? 94.930  60.556  61.011  1.00 116.14 ? 122 GLU C C  1 
ATOM 4868  O O  . GLU C 1 122 ? 96.099  60.398  60.640  1.00 116.14 ? 122 GLU C O  1 
ATOM 4869  N N  . ALA C 1 123 ? 94.264  61.694  60.819  1.00 106.31 ? 123 ALA C N  1 
ATOM 4870  C CA . ALA C 1 123 ? 94.766  62.722  59.918  1.00 106.31 ? 123 ALA C CA 1 
ATOM 4871  C C  . ALA C 1 123 ? 95.982  63.439  60.473  1.00 106.31 ? 123 ALA C C  1 
ATOM 4872  O O  . ALA C 1 123 ? 96.743  64.042  59.714  1.00 106.31 ? 123 ALA C O  1 
ATOM 4873  N N  . GLN C 1 124 ? 96.183  63.397  61.776  1.00 107.43 ? 124 GLN C N  1 
ATOM 4874  C CA . GLN C 1 124 ? 97.372  63.987  62.359  1.00 107.43 ? 124 GLN C CA 1 
ATOM 4875  C C  . GLN C 1 124 ? 98.401  62.954  62.756  1.00 107.43 ? 124 GLN C C  1 
ATOM 4876  O O  . GLN C 1 124 ? 99.529  63.334  63.075  1.00 107.43 ? 124 GLN C O  1 
ATOM 4877  N N  . ARG C 1 125 ? 98.023  61.671  62.780  1.00 109.04 ? 125 ARG C N  1 
ATOM 4878  C CA . ARG C 1 125 ? 98.991  60.613  63.045  1.00 109.04 ? 125 ARG C CA 1 
ATOM 4879  C C  . ARG C 1 125 ? 100.059 60.589  61.958  1.00 109.04 ? 125 ARG C C  1 
ATOM 4880  O O  . ARG C 1 125 ? 101.250 60.402  62.234  1.00 109.04 ? 125 ARG C O  1 
ATOM 4881  N N  . ILE C 1 126 ? 99.655  60.860  60.720  1.00 104.90 ? 126 ILE C N  1 
ATOM 4882  C CA . ILE C 1 126 ? 100.613 60.984  59.639  1.00 104.90 ? 126 ILE C CA 1 
ATOM 4883  C C  . ILE C 1 126 ? 101.435 62.263  59.741  1.00 104.90 ? 126 ILE C C  1 
ATOM 4884  O O  . ILE C 1 126 ? 102.470 62.378  59.079  1.00 104.90 ? 126 ILE C O  1 
ATOM 4885  N N  . VAL C 1 127 ? 101.002 63.228  60.550  1.00 101.38 ? 127 VAL C N  1 
ATOM 4886  C CA . VAL C 1 127 ? 101.789 64.435  60.766  1.00 101.38 ? 127 VAL C CA 1 
ATOM 4887  C C  . VAL C 1 127 ? 102.799 64.215  61.880  1.00 101.38 ? 127 VAL C C  1 
ATOM 4888  O O  . VAL C 1 127 ? 103.977 64.599  61.768  1.00 101.38 ? 127 VAL C O  1 
ATOM 4889  N N  . GLU C 1 128 ? 102.363 63.549  62.950  1.00 106.76 ? 128 GLU C N  1 
ATOM 4890  C CA . GLU C 1 128 ? 103.274 63.077  63.985  1.00 106.76 ? 128 GLU C CA 1 
ATOM 4891  C C  . GLU C 1 128 ? 104.201 61.968  63.497  1.00 106.76 ? 128 GLU C C  1 
ATOM 4892  O O  . GLU C 1 128 ? 105.085 61.547  64.247  1.00 106.76 ? 128 GLU C O  1 
ATOM 4893  N N  . LYS C 1 129 ? 104.003 61.443  62.294  1.00 100.70 ? 129 LYS C N  1 
ATOM 4894  C CA . LYS C 1 129 ? 105.093 60.724  61.652  1.00 100.70 ? 129 LYS C CA 1 
ATOM 4895  C C  . LYS C 1 129 ? 106.253 61.661  61.337  1.00 100.70 ? 129 LYS C C  1 
ATOM 4896  O O  . LYS C 1 129 ? 107.370 61.472  61.826  1.00 100.70 ? 129 LYS C O  1 
ATOM 4897  N N  . LEU C 1 130 ? 106.004 62.696  60.545  1.00 103.56 ? 130 LEU C N  1 
ATOM 4898  C CA . LEU C 1 130 ? 107.124 63.359  59.896  1.00 103.56 ? 130 LEU C CA 1 
ATOM 4899  C C  . LEU C 1 130 ? 107.632 64.581  60.637  1.00 103.56 ? 130 LEU C C  1 
ATOM 4900  O O  . LEU C 1 130 ? 108.661 65.132  60.234  1.00 103.56 ? 130 LEU C O  1 
ATOM 4901  N N  . GLU C 1 131 ? 106.960 65.025  61.696  1.00 100.74 ? 131 GLU C N  1 
ATOM 4902  C CA . GLU C 1 131 ? 107.332 66.311  62.281  1.00 100.74 ? 131 GLU C CA 1 
ATOM 4903  C C  . GLU C 1 131 ? 108.627 66.194  63.091  1.00 100.74 ? 131 GLU C C  1 
ATOM 4904  O O  . GLU C 1 131 ? 109.268 67.203  63.402  1.00 100.74 ? 131 GLU C O  1 
ATOM 4905  N N  . LYS C 1 132 ? 109.023 64.967  63.454  1.00 96.16  ? 132 LYS C N  1 
ATOM 4906  C CA . LYS C 1 132 ? 110.247 64.737  64.221  1.00 96.16  ? 132 LYS C CA 1 
ATOM 4907  C C  . LYS C 1 132 ? 111.124 63.674  63.581  1.00 96.16  ? 132 LYS C C  1 
ATOM 4908  O O  . LYS C 1 132 ? 111.528 62.720  64.250  1.00 96.16  ? 132 LYS C O  1 
ATOM 4909  N N  . SER C 1 133 ? 111.404 63.802  62.294  1.00 98.92  ? 133 SER C N  1 
ATOM 4910  C CA . SER C 1 133 ? 112.224 62.800  61.639  1.00 98.92  ? 133 SER C CA 1 
ATOM 4911  C C  . SER C 1 133 ? 113.694 62.955  62.008  1.00 98.92  ? 133 SER C C  1 
ATOM 4912  O O  . SER C 1 133 ? 114.179 64.045  62.322  1.00 98.92  ? 133 SER C O  1 
ATOM 4913  N N  . THR C 1 134 ? 114.402 61.830  61.952  1.00 86.47  ? 134 THR C N  1 
ATOM 4914  C CA . THR C 1 134 ? 115.857 61.844  62.030  1.00 86.47  ? 134 THR C CA 1 
ATOM 4915  C C  . THR C 1 134 ? 116.459 62.576  60.841  1.00 86.47  ? 134 THR C C  1 
ATOM 4916  O O  . THR C 1 134 ? 117.333 63.434  60.998  1.00 86.47  ? 134 THR C O  1 
ATOM 4917  N N  . LYS C 1 135 ? 116.004 62.246  59.655  1.00 85.96  ? 135 LYS C N  1 
ATOM 4918  C CA . LYS C 1 135 ? 116.372 62.960  58.451  1.00 85.96  ? 135 LYS C CA 1 
ATOM 4919  C C  . LYS C 1 135 ? 115.540 64.224  58.342  1.00 85.96  ? 135 LYS C C  1 
ATOM 4920  O O  . LYS C 1 135 ? 114.333 64.128  58.087  1.00 85.96  ? 135 LYS C O  1 
ATOM 4921  N N  . PRO C 1 136 ? 116.118 65.404  58.505  1.00 77.00  ? 136 PRO C N  1 
ATOM 4922  C CA . PRO C 1 136 ? 115.325 66.632  58.503  1.00 77.00  ? 136 PRO C CA 1 
ATOM 4923  C C  . PRO C 1 136 ? 114.878 66.982  57.094  1.00 77.00  ? 136 PRO C C  1 
ATOM 4924  O O  . PRO C 1 136 ? 115.406 66.493  56.098  1.00 77.00  ? 136 PRO C O  1 
ATOM 4925  N N  . ILE C 1 137 ? 113.877 67.849  57.030  1.00 67.45  ? 137 ILE C N  1 
ATOM 4926  C CA . ILE C 1 137 ? 113.178 68.115  55.785  1.00 67.45  ? 137 ILE C CA 1 
ATOM 4927  C C  . ILE C 1 137 ? 112.872 69.604  55.746  1.00 67.45  ? 137 ILE C C  1 
ATOM 4928  O O  . ILE C 1 137 ? 112.944 70.299  56.762  1.00 67.45  ? 137 ILE C O  1 
ATOM 4929  N N  . VAL C 1 138 ? 112.576 70.106  54.553  1.00 60.49  ? 138 VAL C N  1 
ATOM 4930  C CA . VAL C 1 138 ? 112.272 71.513  54.360  1.00 60.49  ? 138 VAL C CA 1 
ATOM 4931  C C  . VAL C 1 138 ? 111.076 71.625  53.426  1.00 60.49  ? 138 VAL C C  1 
ATOM 4932  O O  . VAL C 1 138 ? 111.004 70.934  52.402  1.00 60.49  ? 138 VAL C O  1 
ATOM 4933  N N  . ALA C 1 139 ? 110.102 72.429  53.818  1.00 61.24  ? 139 ALA C N  1 
ATOM 4934  C CA . ALA C 1 139 ? 108.977 72.704  52.949  1.00 61.24  ? 139 ALA C CA 1 
ATOM 4935  C C  . ALA C 1 139 ? 109.158 74.077  52.334  1.00 61.24  ? 139 ALA C C  1 
ATOM 4936  O O  . ALA C 1 139 ? 110.078 74.815  52.677  1.00 61.24  ? 139 ALA C O  1 
ATOM 4937  N N  . ALA C 1 140 ? 108.249 74.445  51.443  1.00 66.09  ? 140 ALA C N  1 
ATOM 4938  C CA . ALA C 1 140 ? 108.347 75.728  50.773  1.00 66.09  ? 140 ALA C CA 1 
ATOM 4939  C C  . ALA C 1 140 ? 106.951 76.229  50.465  1.00 66.09  ? 140 ALA C C  1 
ATOM 4940  O O  . ALA C 1 140 ? 106.006 75.445  50.369  1.00 66.09  ? 140 ALA C O  1 
ATOM 4941  N N  . ILE C 1 141 ? 106.815 77.543  50.331  1.00 63.95  ? 141 ILE C N  1 
ATOM 4942  C CA . ILE C 1 141 ? 105.517 78.152  50.087  1.00 63.95  ? 141 ILE C CA 1 
ATOM 4943  C C  . ILE C 1 141 ? 105.637 79.137  48.940  1.00 63.95  ? 141 ILE C C  1 
ATOM 4944  O O  . ILE C 1 141 ? 106.393 80.110  49.029  1.00 63.95  ? 141 ILE C O  1 
ATOM 4945  N N  . ASN C 1 142 ? 104.897 78.884  47.866  1.00 65.84  ? 142 ASN C N  1 
ATOM 4946  C CA . ASN C 1 142 ? 104.743 79.828  46.765  1.00 65.84  ? 142 ASN C CA 1 
ATOM 4947  C C  . ASN C 1 142 ? 103.281 79.889  46.345  1.00 65.84  ? 142 ASN C C  1 
ATOM 4948  O O  . ASN C 1 142 ? 102.936 79.776  45.170  1.00 65.84  ? 142 ASN C O  1 
ATOM 4949  N N  . GLY C 1 143 ? 102.386 80.047  47.305  1.00 69.62  ? 143 GLY C N  1 
ATOM 4950  C CA . GLY C 1 143 ? 100.992 80.158  46.936  1.00 69.62  ? 143 GLY C CA 1 
ATOM 4951  C C  . GLY C 1 143 ? 100.148 80.540  48.120  1.00 69.62  ? 143 GLY C C  1 
ATOM 4952  O O  . GLY C 1 143 ? 100.654 80.784  49.213  1.00 69.62  ? 143 GLY C O  1 
ATOM 4953  N N  . SER C 1 144 ? 98.840  80.586  47.888  1.00 80.17  ? 144 SER C N  1 
ATOM 4954  C CA . SER C 1 144 ? 97.903  80.866  48.969  1.00 80.17  ? 144 SER C CA 1 
ATOM 4955  C C  . SER C 1 144 ? 97.722  79.585  49.781  1.00 80.17  ? 144 SER C C  1 
ATOM 4956  O O  . SER C 1 144 ? 96.772  78.817  49.605  1.00 80.17  ? 144 SER C O  1 
ATOM 4957  N N  . CYS C 1 145 ? 98.676  79.343  50.679  1.00 79.86  ? 145 CYS C N  1 
ATOM 4958  C CA . CYS C 1 145 ? 98.571  78.226  51.606  1.00 79.86  ? 145 CYS C CA 1 
ATOM 4959  C C  . CYS C 1 145 ? 97.497  78.524  52.634  1.00 79.86  ? 145 CYS C C  1 
ATOM 4960  O O  . CYS C 1 145 ? 97.572  79.529  53.347  1.00 79.86  ? 145 CYS C O  1 
ATOM 4961  N N  . LEU C 1 146 ? 96.499  77.654  52.706  1.00 83.88  ? 146 LEU C N  1 
ATOM 4962  C CA . LEU C 1 146 ? 95.364  77.883  53.578  1.00 83.88  ? 146 LEU C CA 1 
ATOM 4963  C C  . LEU C 1 146 ? 94.849  76.552  54.104  1.00 83.88  ? 146 LEU C C  1 
ATOM 4964  O O  . LEU C 1 146 ? 94.934  75.520  53.433  1.00 83.88  ? 146 LEU C O  1 
ATOM 4965  N N  . GLY C 1 147 ? 94.343  76.587  55.330  1.00 81.94  ? 147 GLY C N  1 
ATOM 4966  C CA . GLY C 1 147 ? 93.675  75.450  55.924  1.00 81.94  ? 147 GLY C CA 1 
ATOM 4967  C C  . GLY C 1 147 ? 94.636  74.452  56.520  1.00 81.94  ? 147 GLY C C  1 
ATOM 4968  O O  . GLY C 1 147 ? 95.440  74.792  57.389  1.00 81.94  ? 147 GLY C O  1 
ATOM 4969  N N  . GLY C 1 148 ? 94.573  73.213  56.042  1.00 86.48  ? 148 GLY C N  1 
ATOM 4970  C CA . GLY C 1 148 ? 95.457  72.180  56.539  1.00 86.48  ? 148 GLY C CA 1 
ATOM 4971  C C  . GLY C 1 148 ? 96.886  72.295  56.062  1.00 86.48  ? 148 GLY C C  1 
ATOM 4972  O O  . GLY C 1 148 ? 97.739  71.542  56.545  1.00 86.48  ? 148 GLY C O  1 
ATOM 4973  N N  . GLY C 1 149 ? 97.162  73.214  55.133  1.00 90.21  ? 149 GLY C N  1 
ATOM 4974  C CA . GLY C 1 149 ? 98.512  73.379  54.625  1.00 90.21  ? 149 GLY C CA 1 
ATOM 4975  C C  . GLY C 1 149 ? 99.495  73.854  55.670  1.00 90.21  ? 149 GLY C C  1 
ATOM 4976  O O  . GLY C 1 149 ? 100.667 73.464  55.643  1.00 90.21  ? 149 GLY C O  1 
ATOM 4977  N N  . LEU C 1 150 ? 99.030  74.675  56.614  1.00 85.99  ? 150 LEU C N  1 
ATOM 4978  C CA . LEU C 1 150 ? 99.868  75.048  57.745  1.00 85.99  ? 150 LEU C CA 1 
ATOM 4979  C C  . LEU C 1 150 ? 100.185 73.830  58.596  1.00 85.99  ? 150 LEU C C  1 
ATOM 4980  O O  . LEU C 1 150 ? 101.275 73.738  59.175  1.00 85.99  ? 150 LEU C O  1 
ATOM 4981  N N  . GLU C 1 151 ? 99.239  72.881  58.659  1.00 91.67  ? 151 GLU C N  1 
ATOM 4982  C CA . GLU C 1 151 ? 99.494  71.563  59.224  1.00 91.67  ? 151 GLU C CA 1 
ATOM 4983  C C  . GLU C 1 151 ? 100.684 70.904  58.556  1.00 91.67  ? 151 GLU C C  1 
ATOM 4984  O O  . GLU C 1 151 ? 101.531 70.305  59.222  1.00 91.67  ? 151 GLU C O  1 
ATOM 4985  N N  . VAL C 1 152 ? 100.770 71.015  57.236  1.00 83.80  ? 152 VAL C N  1 
ATOM 4986  C CA . VAL C 1 152 ? 101.949 70.507  56.566  1.00 83.80  ? 152 VAL C CA 1 
ATOM 4987  C C  . VAL C 1 152 ? 103.103 71.475  56.763  1.00 83.80  ? 152 VAL C C  1 
ATOM 4988  O O  . VAL C 1 152 ? 104.254 71.051  56.911  1.00 83.80  ? 152 VAL C O  1 
ATOM 4989  N N  . ALA C 1 153 ? 102.814 72.774  56.859  1.00 81.17  ? 153 ALA C N  1 
ATOM 4990  C CA . ALA C 1 153 ? 103.886 73.760  56.851  1.00 81.17  ? 153 ALA C CA 1 
ATOM 4991  C C  . ALA C 1 153 ? 104.623 73.794  58.177  1.00 81.17  ? 153 ALA C C  1 
ATOM 4992  O O  . ALA C 1 153 ? 105.834 73.561  58.237  1.00 81.17  ? 153 ALA C O  1 
ATOM 4993  N N  . ILE C 1 154 ? 103.909 74.079  59.263  1.00 85.70  ? 154 ILE C N  1 
ATOM 4994  C CA . ILE C 1 154 ? 104.615 74.363  60.497  1.00 85.70  ? 154 ILE C CA 1 
ATOM 4995  C C  . ILE C 1 154 ? 105.003 73.078  61.227  1.00 85.70  ? 154 ILE C C  1 
ATOM 4996  O O  . ILE C 1 154 ? 105.758 73.121  62.205  1.00 85.70  ? 154 ILE C O  1 
ATOM 4997  N N  . SER C 1 155 ? 104.541 71.921  60.753  1.00 89.54  ? 155 SER C N  1 
ATOM 4998  C CA . SER C 1 155 ? 105.083 70.665  61.254  1.00 89.54  ? 155 SER C CA 1 
ATOM 4999  C C  . SER C 1 155 ? 106.515 70.451  60.806  1.00 89.54  ? 155 SER C C  1 
ATOM 5000  O O  . SER C 1 155 ? 107.250 69.698  61.451  1.00 89.54  ? 155 SER C O  1 
ATOM 5001  N N  . CYS C 1 156 ? 106.920 71.091  59.717  1.00 88.20  ? 156 CYS C N  1 
ATOM 5002  C CA . CYS C 1 156 ? 108.275 70.991  59.210  1.00 88.20  ? 156 CYS C CA 1 
ATOM 5003  C C  . CYS C 1 156 ? 109.254 71.727  60.118  1.00 88.20  ? 156 CYS C C  1 
ATOM 5004  O O  . CYS C 1 156 ? 108.876 72.446  61.043  1.00 88.20  ? 156 CYS C O  1 
ATOM 5005  N N  . GLN C 1 157 ? 110.540 71.549  59.836  1.00 78.45  ? 157 GLN C N  1 
ATOM 5006  C CA . GLN C 1 157 ? 111.574 72.173  60.635  1.00 78.45  ? 157 GLN C CA 1 
ATOM 5007  C C  . GLN C 1 157 ? 111.919 73.575  60.171  1.00 78.45  ? 157 GLN C C  1 
ATOM 5008  O O  . GLN C 1 157 ? 112.513 74.330  60.947  1.00 78.45  ? 157 GLN C O  1 
ATOM 5009  N N  . TYR C 1 158 ? 111.522 73.948  58.956  1.00 69.41  ? 158 TYR C N  1 
ATOM 5010  C CA . TYR C 1 158 ? 112.070 75.130  58.298  1.00 69.41  ? 158 TYR C CA 1 
ATOM 5011  C C  . TYR C 1 158 ? 111.285 75.362  57.022  1.00 69.41  ? 158 TYR C C  1 
ATOM 5012  O O  . TYR C 1 158 ? 111.422 74.581  56.080  1.00 69.41  ? 158 TYR C O  1 
ATOM 5013  N N  . ARG C 1 159 ? 110.490 76.417  56.956  1.00 72.78  ? 159 ARG C N  1 
ATOM 5014  C CA . ARG C 1 159 ? 109.773 76.686  55.724  1.00 72.78  ? 159 ARG C CA 1 
ATOM 5015  C C  . ARG C 1 159 ? 110.254 77.993  55.122  1.00 72.78  ? 159 ARG C C  1 
ATOM 5016  O O  . ARG C 1 159 ? 110.924 78.791  55.777  1.00 72.78  ? 159 ARG C O  1 
ATOM 5017  N N  . ILE C 1 160 ? 109.913 78.184  53.853  1.00 58.81  ? 160 ILE C N  1 
ATOM 5018  C CA . ILE C 1 160 ? 110.452 79.259  53.032  1.00 58.81  ? 160 ILE C CA 1 
ATOM 5019  C C  . ILE C 1 160 ? 109.361 79.755  52.090  1.00 58.81  ? 160 ILE C C  1 
ATOM 5020  O O  . ILE C 1 160 ? 108.619 78.963  51.499  1.00 58.81  ? 160 ILE C O  1 
ATOM 5021  N N  . ALA C 1 161 ? 109.245 81.078  51.980  1.00 58.95  ? 161 ALA C N  1 
ATOM 5022  C CA . ALA C 1 161 ? 108.083 81.711  51.383  1.00 58.95  ? 161 ALA C CA 1 
ATOM 5023  C C  . ALA C 1 161 ? 108.491 82.762  50.364  1.00 58.95  ? 161 ALA C C  1 
ATOM 5024  O O  . ALA C 1 161 ? 109.608 83.283  50.382  1.00 58.95  ? 161 ALA C O  1 
ATOM 5025  N N  . THR C 1 162 ? 107.541 83.089  49.493  1.00 64.86  ? 162 THR C N  1 
ATOM 5026  C CA . THR C 1 162 ? 107.750 83.985  48.365  1.00 64.86  ? 162 THR C CA 1 
ATOM 5027  C C  . THR C 1 162 ? 106.987 85.279  48.583  1.00 64.86  ? 162 THR C C  1 
ATOM 5028  O O  . THR C 1 162 ? 105.757 85.266  48.653  1.00 64.86  ? 162 THR C O  1 
ATOM 5029  N N  . LYS C 1 163 ? 107.707 86.390  48.659  1.00 71.05  ? 163 LYS C N  1 
ATOM 5030  C CA . LYS C 1 163 ? 107.110 87.678  48.998  1.00 71.05  ? 163 LYS C CA 1 
ATOM 5031  C C  . LYS C 1 163 ? 106.423 88.267  47.772  1.00 71.05  ? 163 LYS C C  1 
ATOM 5032  O O  . LYS C 1 163 ? 107.066 88.911  46.941  1.00 71.05  ? 163 LYS C O  1 
ATOM 5033  N N  . ASP C 1 164 ? 105.114 88.060  47.657  1.00 73.26  ? 164 ASP C N  1 
ATOM 5034  C CA . ASP C 1 164 ? 104.285 88.733  46.656  1.00 73.26  ? 164 ASP C CA 1 
ATOM 5035  C C  . ASP C 1 164 ? 102.841 88.742  47.147  1.00 73.26  ? 164 ASP C C  1 
ATOM 5036  O O  . ASP C 1 164 ? 102.516 88.156  48.183  1.00 73.26  ? 164 ASP C O  1 
ATOM 5037  N N  . ARG C 1 165 ? 101.967 89.402  46.386  1.00 77.47  ? 165 ARG C N  1 
ATOM 5038  C CA . ARG C 1 165 ? 100.584 89.570  46.819  1.00 77.47  ? 165 ARG C CA 1 
ATOM 5039  C C  . ARG C 1 165 ? 99.796  88.278  46.686  1.00 77.47  ? 165 ARG C C  1 
ATOM 5040  O O  . ARG C 1 165 ? 98.830  88.057  47.424  1.00 77.47  ? 165 ARG C O  1 
ATOM 5041  N N  . LYS C 1 166 ? 100.185 87.422  45.743  1.00 73.45  ? 166 LYS C N  1 
ATOM 5042  C CA . LYS C 1 166 ? 99.410  86.220  45.469  1.00 73.45  ? 166 LYS C CA 1 
ATOM 5043  C C  . LYS C 1 166 ? 99.534  85.210  46.598  1.00 73.45  ? 166 LYS C C  1 
ATOM 5044  O O  . LYS C 1 166 ? 98.534  84.626  47.024  1.00 73.45  ? 166 LYS C O  1 
ATOM 5045  N N  . THR C 1 167 ? 100.745 84.992  47.098  1.00 76.11  ? 167 THR C N  1 
ATOM 5046  C CA . THR C 1 167 ? 100.933 84.143  48.268  1.00 76.11  ? 167 THR C CA 1 
ATOM 5047  C C  . THR C 1 167 ? 100.365 84.842  49.485  1.00 76.11  ? 167 THR C C  1 
ATOM 5048  O O  . THR C 1 167 ? 100.793 85.943  49.835  1.00 76.11  ? 167 THR C O  1 
ATOM 5049  N N  . VAL C 1 168 ? 99.365  84.223  50.093  1.00 84.24  ? 168 VAL C N  1 
ATOM 5050  C CA . VAL C 1 168 ? 98.888  84.615  51.405  1.00 84.24  ? 168 VAL C CA 1 
ATOM 5051  C C  . VAL C 1 168 ? 98.913  83.375  52.276  1.00 84.24  ? 168 VAL C C  1 
ATOM 5052  O O  . VAL C 1 168 ? 98.953  82.243  51.792  1.00 84.24  ? 168 VAL C O  1 
ATOM 5053  N N  . LEU C 1 169 ? 98.890  83.597  53.581  1.00 87.71  ? 169 LEU C N  1 
ATOM 5054  C CA . LEU C 1 169 ? 98.983  82.524  54.556  1.00 87.71  ? 169 LEU C CA 1 
ATOM 5055  C C  . LEU C 1 169 ? 97.896  82.787  55.587  1.00 87.71  ? 169 LEU C C  1 
ATOM 5056  O O  . LEU C 1 169 ? 97.995  83.730  56.376  1.00 87.71  ? 169 LEU C O  1 
ATOM 5057  N N  . GLY C 1 170 ? 96.830  81.990  55.532  1.00 91.82  ? 170 GLY C N  1 
ATOM 5058  C CA . GLY C 1 170 ? 95.717  82.153  56.436  1.00 91.82  ? 170 GLY C CA 1 
ATOM 5059  C C  . GLY C 1 170 ? 95.186  80.803  56.872  1.00 91.82  ? 170 GLY C C  1 
ATOM 5060  O O  . GLY C 1 170 ? 95.495  79.771  56.285  1.00 91.82  ? 170 GLY C O  1 
ATOM 5061  N N  . THR C 1 171 ? 94.378  80.828  57.930  1.00 100.81 ? 171 THR C N  1 
ATOM 5062  C CA . THR C 1 171 ? 93.767  79.622  58.483  1.00 100.81 ? 171 THR C CA 1 
ATOM 5063  C C  . THR C 1 171 ? 92.252  79.737  58.387  1.00 100.81 ? 171 THR C C  1 
ATOM 5064  O O  . THR C 1 171 ? 91.600  80.245  59.309  1.00 100.81 ? 171 THR C O  1 
ATOM 5065  N N  . PRO C 1 172 ? 91.651  79.289  57.294  1.00 104.35 ? 172 PRO C N  1 
ATOM 5066  C CA . PRO C 1 172 ? 90.192  79.191  57.256  1.00 104.35 ? 172 PRO C CA 1 
ATOM 5067  C C  . PRO C 1 172 ? 89.721  78.024  58.094  1.00 104.35 ? 172 PRO C C  1 
ATOM 5068  O O  . PRO C 1 172 ? 89.498  76.915  57.604  1.00 104.35 ? 172 PRO C O  1 
ATOM 5069  N N  . GLU C 1 173 ? 89.625  78.276  59.392  1.00 104.56 ? 173 GLU C N  1 
ATOM 5070  C CA . GLU C 1 173 ? 89.122  77.318  60.364  1.00 104.56 ? 173 GLU C CA 1 
ATOM 5071  C C  . GLU C 1 173 ? 87.829  77.796  61.001  1.00 104.56 ? 173 GLU C C  1 
ATOM 5072  O O  . GLU C 1 173 ? 86.832  77.068  61.002  1.00 104.56 ? 173 GLU C O  1 
ATOM 5073  N N  . VAL C 1 174 ? 87.821  78.998  61.561  1.00 95.49  ? 174 VAL C N  1 
ATOM 5074  C CA . VAL C 1 174 ? 86.604  79.477  62.186  1.00 95.49  ? 174 VAL C CA 1 
ATOM 5075  C C  . VAL C 1 174 ? 85.661  80.044  61.148  1.00 95.49  ? 174 VAL C C  1 
ATOM 5076  O O  . VAL C 1 174 ? 84.456  80.132  61.393  1.00 95.49  ? 174 VAL C O  1 
ATOM 5077  N N  . LEU C 1 175 ? 86.174  80.423  59.978  1.00 101.80 ? 175 LEU C N  1 
ATOM 5078  C CA . LEU C 1 175 ? 85.306  80.971  58.949  1.00 101.80 ? 175 LEU C CA 1 
ATOM 5079  C C  . LEU C 1 175 ? 84.374  79.930  58.370  1.00 101.80 ? 175 LEU C C  1 
ATOM 5080  O O  . LEU C 1 175 ? 83.276  80.281  57.933  1.00 101.80 ? 175 LEU C O  1 
ATOM 5081  N N  . LEU C 1 176 ? 84.766  78.667  58.370  1.00 93.91  ? 176 LEU C N  1 
ATOM 5082  C CA . LEU C 1 176 ? 83.747  77.662  58.150  1.00 93.91  ? 176 LEU C CA 1 
ATOM 5083  C C  . LEU C 1 176 ? 83.308  77.027  59.459  1.00 93.91  ? 176 LEU C C  1 
ATOM 5084  O O  . LEU C 1 176 ? 82.364  76.233  59.464  1.00 93.91  ? 176 LEU C O  1 
ATOM 5085  N N  . GLY C 1 177 ? 83.949  77.386  60.565  1.00 97.60  ? 177 GLY C N  1 
ATOM 5086  C CA . GLY C 1 177 ? 83.505  76.940  61.866  1.00 97.60  ? 177 GLY C CA 1 
ATOM 5087  C C  . GLY C 1 177 ? 83.900  75.534  62.243  1.00 97.60  ? 177 GLY C C  1 
ATOM 5088  O O  . GLY C 1 177 ? 83.034  74.658  62.325  1.00 97.60  ? 177 GLY C O  1 
ATOM 5089  N N  . ALA C 1 178 ? 85.180  75.284  62.475  1.00 99.05  ? 178 ALA C N  1 
ATOM 5090  C CA . ALA C 1 178 ? 85.644  73.950  62.828  1.00 99.05  ? 178 ALA C CA 1 
ATOM 5091  C C  . ALA C 1 178 ? 86.916  74.103  63.654  1.00 99.05  ? 178 ALA C C  1 
ATOM 5092  O O  . ALA C 1 178 ? 87.170  75.167  64.230  1.00 99.05  ? 178 ALA C O  1 
ATOM 5093  N N  . LEU C 1 179 ? 87.669  73.025  63.769  1.00 98.85  ? 179 LEU C N  1 
ATOM 5094  C CA . LEU C 1 179 ? 89.050  73.017  64.209  1.00 98.85  ? 179 LEU C CA 1 
ATOM 5095  C C  . LEU C 1 179 ? 89.855  72.372  63.086  1.00 98.85  ? 179 LEU C C  1 
ATOM 5096  O O  . LEU C 1 179 ? 89.289  71.602  62.304  1.00 98.85  ? 179 LEU C O  1 
ATOM 5097  N N  . PRO C 1 180 ? 91.183  72.674  62.944  1.00 99.06  ? 180 PRO C N  1 
ATOM 5098  C CA . PRO C 1 180 ? 91.819  72.474  61.630  1.00 99.06  ? 180 PRO C CA 1 
ATOM 5099  C C  . PRO C 1 180 ? 92.047  71.018  61.244  1.00 99.06  ? 180 PRO C C  1 
ATOM 5100  O O  . PRO C 1 180 ? 91.728  70.108  62.015  1.00 99.06  ? 180 PRO C O  1 
ATOM 5101  N N  . GLY C 1 181 ? 92.609  70.809  60.048  1.00 99.57  ? 181 GLY C N  1 
ATOM 5102  C CA . GLY C 1 181 ? 92.612  69.489  59.436  1.00 99.57  ? 181 GLY C CA 1 
ATOM 5103  C C  . GLY C 1 181 ? 93.464  68.459  60.150  1.00 99.57  ? 181 GLY C C  1 
ATOM 5104  O O  . GLY C 1 181 ? 93.235  67.255  60.006  1.00 99.57  ? 181 GLY C O  1 
ATOM 5105  N N  . ALA C 1 182 ? 94.460  68.905  60.916  1.00 100.00 ? 182 ALA C N  1 
ATOM 5106  C CA . ALA C 1 182 ? 95.207  67.974  61.752  1.00 100.00 ? 182 ALA C CA 1 
ATOM 5107  C C  . ALA C 1 182 ? 95.556  68.556  63.115  1.00 100.00 ? 182 ALA C C  1 
ATOM 5108  O O  . ALA C 1 182 ? 96.446  68.020  63.787  1.00 100.00 ? 182 ALA C O  1 
ATOM 5109  N N  . GLY C 1 183 ? 94.891  69.621  63.544  1.00 94.73  ? 183 GLY C N  1 
ATOM 5110  C CA . GLY C 1 183 ? 95.081  70.138  64.881  1.00 94.73  ? 183 GLY C CA 1 
ATOM 5111  C C  . GLY C 1 183 ? 96.442  70.750  65.109  1.00 94.73  ? 183 GLY C C  1 
ATOM 5112  O O  . GLY C 1 183 ? 97.152  70.372  66.044  1.00 94.73  ? 183 GLY C O  1 
ATOM 5113  N N  . GLY C 1 184 ? 96.819  71.698  64.264  1.00 93.84  ? 184 GLY C N  1 
ATOM 5114  C CA . GLY C 1 184 ? 98.076  72.392  64.406  1.00 93.84  ? 184 GLY C CA 1 
ATOM 5115  C C  . GLY C 1 184 ? 98.091  73.407  65.511  1.00 93.84  ? 184 GLY C C  1 
ATOM 5116  O O  . GLY C 1 184 ? 99.151  73.901  65.896  1.00 93.84  ? 184 GLY C O  1 
ATOM 5117  N N  . THR C 1 185 ? 96.924  73.698  66.075  1.00 96.52  ? 185 THR C N  1 
ATOM 5118  C CA . THR C 1 185 ? 96.797  74.645  67.164  1.00 96.52  ? 185 THR C CA 1 
ATOM 5119  C C  . THR C 1 185 ? 97.430  74.162  68.456  1.00 96.52  ? 185 THR C C  1 
ATOM 5120  O O  . THR C 1 185 ? 97.470  74.928  69.419  1.00 96.52  ? 185 THR C O  1 
ATOM 5121  N N  . GLN C 1 186 ? 97.900  72.920  68.522  1.00 95.77  ? 186 GLN C N  1 
ATOM 5122  C CA . GLN C 1 186 ? 98.689  72.477  69.656  1.00 95.77  ? 186 GLN C CA 1 
ATOM 5123  C C  . GLN C 1 186 ? 100.182 72.575  69.389  1.00 95.77  ? 186 GLN C C  1 
ATOM 5124  O O  . GLN C 1 186 ? 100.976 72.053  70.176  1.00 95.77  ? 186 GLN C O  1 
ATOM 5125  N N  . ARG C 1 187 ? 100.584 73.212  68.288  1.00 89.56  ? 187 ARG C N  1 
ATOM 5126  C CA . ARG C 1 187 ? 101.990 73.583  68.172  1.00 89.56  ? 187 ARG C CA 1 
ATOM 5127  C C  . ARG C 1 187 ? 102.198 74.948  67.530  1.00 89.56  ? 187 ARG C C  1 
ATOM 5128  O O  . ARG C 1 187 ? 103.344 75.380  67.389  1.00 89.56  ? 187 ARG C O  1 
ATOM 5129  N N  . LEU C 1 188 ? 101.128 75.633  67.128  1.00 84.70  ? 188 LEU C N  1 
ATOM 5130  C CA . LEU C 1 188 ? 101.268 77.066  66.864  1.00 84.70  ? 188 LEU C CA 1 
ATOM 5131  C C  . LEU C 1 188 ? 101.719 77.870  68.082  1.00 84.70  ? 188 LEU C C  1 
ATOM 5132  O O  . LEU C 1 188 ? 102.722 78.594  67.960  1.00 84.70  ? 188 LEU C O  1 
ATOM 5133  N N  . PRO C 1 189 ? 101.078 77.808  69.261  1.00 83.84  ? 189 PRO C N  1 
ATOM 5134  C CA . PRO C 1 189 ? 101.560 78.659  70.356  1.00 83.84  ? 189 PRO C CA 1 
ATOM 5135  C C  . PRO C 1 189 ? 102.806 78.133  71.017  1.00 83.84  ? 189 PRO C C  1 
ATOM 5136  O O  . PRO C 1 189 ? 103.456 78.876  71.758  1.00 83.84  ? 189 PRO C O  1 
ATOM 5137  N N  . LYS C 1 190 ? 103.151 76.871  70.787  1.00 84.01  ? 190 LYS C N  1 
ATOM 5138  C CA . LYS C 1 190 ? 104.488 76.398  71.109  1.00 84.01  ? 190 LYS C CA 1 
ATOM 5139  C C  . LYS C 1 190 ? 105.531 77.129  70.275  1.00 84.01  ? 190 LYS C C  1 
ATOM 5140  O O  . LYS C 1 190 ? 106.655 77.360  70.734  1.00 84.01  ? 190 LYS C O  1 
ATOM 5141  N N  . MET C 1 191 ? 105.152 77.548  69.071  1.00 90.74  ? 191 MET C N  1 
ATOM 5142  C CA . MET C 1 191 ? 106.054 78.141  68.094  1.00 90.74  ? 191 MET C CA 1 
ATOM 5143  C C  . MET C 1 191 ? 106.023 79.664  68.149  1.00 90.74  ? 191 MET C C  1 
ATOM 5144  O O  . MET C 1 191 ? 107.060 80.304  68.340  1.00 90.74  ? 191 MET C O  1 
ATOM 5145  N N  . VAL C 1 192 ? 104.849 80.257  67.962  1.00 86.20  ? 192 VAL C N  1 
ATOM 5146  C CA . VAL C 1 192 ? 104.775 81.707  67.855  1.00 86.20  ? 192 VAL C CA 1 
ATOM 5147  C C  . VAL C 1 192 ? 104.197 82.299  69.136  1.00 86.20  ? 192 VAL C C  1 
ATOM 5148  O O  . VAL C 1 192 ? 104.581 83.402  69.542  1.00 86.20  ? 192 VAL C O  1 
ATOM 5149  N N  . GLY C 1 193 ? 103.335 81.556  69.831  1.00 91.60  ? 193 GLY C N  1 
ATOM 5150  C CA . GLY C 1 193 ? 102.826 82.038  71.103  1.00 91.60  ? 193 GLY C CA 1 
ATOM 5151  C C  . GLY C 1 193 ? 101.319 82.082  71.258  1.00 91.60  ? 193 GLY C C  1 
ATOM 5152  O O  . GLY C 1 193 ? 100.589 82.209  70.274  1.00 91.60  ? 193 GLY C O  1 
ATOM 5153  N N  . VAL C 1 194 ? 100.855 81.946  72.506  1.00 89.71  ? 194 VAL C N  1 
ATOM 5154  C CA . VAL C 1 194 ? 99.427  82.097  72.790  1.00 89.71  ? 194 VAL C CA 1 
ATOM 5155  C C  . VAL C 1 194 ? 98.880  83.472  72.427  1.00 89.71  ? 194 VAL C C  1 
ATOM 5156  O O  . VAL C 1 194 ? 97.933  83.540  71.638  1.00 89.71  ? 194 VAL C O  1 
ATOM 5157  N N  . PRO C 1 195 ? 99.429  84.604  72.927  1.00 99.88  ? 195 PRO C N  1 
ATOM 5158  C CA . PRO C 1 195 ? 98.778  85.877  72.587  1.00 99.88  ? 195 PRO C CA 1 
ATOM 5159  C C  . PRO C 1 195 ? 99.081  86.339  71.185  1.00 99.88  ? 195 PRO C C  1 
ATOM 5160  O O  . PRO C 1 195 ? 98.342  87.174  70.653  1.00 99.88  ? 195 PRO C O  1 
ATOM 5161  N N  . ALA C 1 196 ? 100.147 85.832  70.574  1.00 99.04  ? 196 ALA C N  1 
ATOM 5162  C CA . ALA C 1 196 ? 100.496 86.233  69.226  1.00 99.04  ? 196 ALA C CA 1 
ATOM 5163  C C  . ALA C 1 196 ? 99.545  85.668  68.188  1.00 99.04  ? 196 ALA C C  1 
ATOM 5164  O O  . ALA C 1 196 ? 98.987  86.435  67.400  1.00 99.04  ? 196 ALA C O  1 
ATOM 5165  N N  . ALA C 1 197 ? 99.312  84.363  68.194  1.00 101.41 ? 197 ALA C N  1 
ATOM 5166  C CA . ALA C 1 197 ? 98.415  83.769  67.231  1.00 101.41 ? 197 ALA C CA 1 
ATOM 5167  C C  . ALA C 1 197 ? 97.023  83.550  67.770  1.00 101.41 ? 197 ALA C C  1 
ATOM 5168  O O  . ALA C 1 197 ? 96.172  83.043  67.030  1.00 101.41 ? 197 ALA C O  1 
ATOM 5169  N N  . LEU C 1 198 ? 96.759  83.899  69.026  1.00 97.40  ? 198 LEU C N  1 
ATOM 5170  C CA . LEU C 1 198 ? 95.404  83.780  69.519  1.00 97.40  ? 198 LEU C CA 1 
ATOM 5171  C C  . LEU C 1 198 ? 94.495  84.785  68.834  1.00 97.40  ? 198 LEU C C  1 
ATOM 5172  O O  . LEU C 1 198 ? 93.331  84.477  68.591  1.00 97.40  ? 198 LEU C O  1 
ATOM 5173  N N  . ASP C 1 199 ? 95.020  85.944  68.450  1.00 106.22 ? 199 ASP C N  1 
ATOM 5174  C CA . ASP C 1 199 ? 94.308  86.824  67.537  1.00 106.22 ? 199 ASP C CA 1 
ATOM 5175  C C  . ASP C 1 199 ? 94.573  86.487  66.085  1.00 106.22 ? 199 ASP C C  1 
ATOM 5176  O O  . ASP C 1 199 ? 94.415  87.352  65.225  1.00 106.22 ? 199 ASP C O  1 
ATOM 5177  N N  . MET C 1 200 ? 94.992  85.264  65.787  1.00 102.11 ? 200 MET C N  1 
ATOM 5178  C CA . MET C 1 200 ? 95.139  84.836  64.407  1.00 102.11 ? 200 MET C CA 1 
ATOM 5179  C C  . MET C 1 200 ? 94.211  83.678  64.094  1.00 102.11 ? 200 MET C C  1 
ATOM 5180  O O  . MET C 1 200 ? 93.480  83.725  63.104  1.00 102.11 ? 200 MET C O  1 
ATOM 5181  N N  . MET C 1 201 ? 94.217  82.639  64.926  1.00 95.72  ? 201 MET C N  1 
ATOM 5182  C CA . MET C 1 201 ? 93.622  81.386  64.478  1.00 95.72  ? 201 MET C CA 1 
ATOM 5183  C C  . MET C 1 201 ? 92.104  81.426  64.586  1.00 95.72  ? 201 MET C C  1 
ATOM 5184  O O  . MET C 1 201 ? 91.406  80.628  63.952  1.00 95.72  ? 201 MET C O  1 
ATOM 5185  N N  . LEU C 1 202 ? 91.561  82.360  65.362  1.00 88.72  ? 202 LEU C N  1 
ATOM 5186  C CA . LEU C 1 202 ? 90.121  82.559  65.347  1.00 88.72  ? 202 LEU C CA 1 
ATOM 5187  C C  . LEU C 1 202 ? 89.709  83.964  64.948  1.00 88.72  ? 202 LEU C C  1 
ATOM 5188  O O  . LEU C 1 202 ? 88.537  84.316  65.105  1.00 88.72  ? 202 LEU C O  1 
ATOM 5189  N N  . THR C 1 203 ? 90.620  84.777  64.428  1.00 94.58  ? 203 THR C N  1 
ATOM 5190  C CA . THR C 1 203 ? 90.127  85.960  63.744  1.00 94.58  ? 203 THR C CA 1 
ATOM 5191  C C  . THR C 1 203 ? 89.737  85.643  62.311  1.00 94.58  ? 203 THR C C  1 
ATOM 5192  O O  . THR C 1 203 ? 89.068  86.459  61.670  1.00 94.58  ? 203 THR C O  1 
ATOM 5193  N N  . GLY C 1 204 ? 90.149  84.484  61.797  1.00 91.82  ? 204 GLY C N  1 
ATOM 5194  C CA . GLY C 1 204 ? 89.835  84.062  60.447  1.00 91.82  ? 204 GLY C CA 1 
ATOM 5195  C C  . GLY C 1 204 ? 90.711  84.646  59.359  1.00 91.82  ? 204 GLY C C  1 
ATOM 5196  O O  . GLY C 1 204 ? 90.947  83.999  58.338  1.00 91.82  ? 204 GLY C O  1 
ATOM 5197  N N  . ARG C 1 205 ? 91.217  85.856  59.570  1.00 89.72  ? 205 ARG C N  1 
ATOM 5198  C CA . ARG C 1 205 ? 91.814  86.627  58.498  1.00 89.72  ? 205 ARG C CA 1 
ATOM 5199  C C  . ARG C 1 205 ? 93.232  86.156  58.214  1.00 89.72  ? 205 ARG C C  1 
ATOM 5200  O O  . ARG C 1 205 ? 93.956  85.688  59.092  1.00 89.72  ? 205 ARG C O  1 
ATOM 5201  N N  . SER C 1 206 ? 93.620  86.290  56.954  1.00 90.05  ? 206 SER C N  1 
ATOM 5202  C CA . SER C 1 206 ? 94.897  85.822  56.454  1.00 90.05  ? 206 SER C CA 1 
ATOM 5203  C C  . SER C 1 206 ? 95.949  86.910  56.618  1.00 90.05  ? 206 SER C C  1 
ATOM 5204  O O  . SER C 1 206 ? 95.638  88.071  56.887  1.00 90.05  ? 206 SER C O  1 
ATOM 5205  N N  . ILE C 1 207 ? 97.215  86.527  56.459  1.00 91.99  ? 207 ILE C N  1 
ATOM 5206  C CA . ILE C 1 207 ? 98.338  87.450  56.539  1.00 91.99  ? 207 ILE C CA 1 
ATOM 5207  C C  . ILE C 1 207 ? 99.157  87.271  55.271  1.00 91.99  ? 207 ILE C C  1 
ATOM 5208  O O  . ILE C 1 207 ? 99.347  86.141  54.813  1.00 91.99  ? 207 ILE C O  1 
ATOM 5209  N N  . ARG C 1 208 ? 99.648  88.366  54.704  1.00 89.54  ? 208 ARG C N  1 
ATOM 5210  C CA . ARG C 1 208 ? 100.605 88.220  53.622  1.00 89.54  ? 208 ARG C CA 1 
ATOM 5211  C C  . ARG C 1 208 ? 101.958 87.789  54.165  1.00 89.54  ? 208 ARG C C  1 
ATOM 5212  O O  . ARG C 1 208 ? 102.205 87.795  55.372  1.00 89.54  ? 208 ARG C O  1 
ATOM 5213  N N  . ALA C 1 209 ? 102.855 87.444  53.250  1.00 80.05  ? 209 ALA C N  1 
ATOM 5214  C CA . ALA C 1 209 ? 104.141 86.890  53.632  1.00 80.05  ? 209 ALA C CA 1 
ATOM 5215  C C  . ALA C 1 209 ? 105.077 87.912  54.255  1.00 80.05  ? 209 ALA C C  1 
ATOM 5216  O O  . ALA C 1 209 ? 106.108 87.518  54.805  1.00 80.05  ? 209 ALA C O  1 
ATOM 5217  N N  . ASP C 1 210 ? 104.755 89.201  54.183  1.00 88.36  ? 210 ASP C N  1 
ATOM 5218  C CA . ASP C 1 210 ? 105.671 90.205  54.705  1.00 88.36  ? 210 ASP C CA 1 
ATOM 5219  C C  . ASP C 1 210 ? 105.667 90.213  56.229  1.00 88.36  ? 210 ASP C C  1 
ATOM 5220  O O  . ASP C 1 210 ? 106.732 90.227  56.855  1.00 88.36  ? 210 ASP C O  1 
ATOM 5221  N N  . ARG C 1 211 ? 104.485 90.194  56.844  1.00 85.74  ? 211 ARG C N  1 
ATOM 5222  C CA . ARG C 1 211 ? 104.411 90.187  58.299  1.00 85.74  ? 211 ARG C CA 1 
ATOM 5223  C C  . ARG C 1 211 ? 104.722 88.832  58.907  1.00 85.74  ? 211 ARG C C  1 
ATOM 5224  O O  . ARG C 1 211 ? 104.848 88.745  60.129  1.00 85.74  ? 211 ARG C O  1 
ATOM 5225  N N  . ALA C 1 212 ? 104.840 87.780  58.103  1.00 78.94  ? 212 ALA C N  1 
ATOM 5226  C CA . ALA C 1 212 ? 105.088 86.463  58.665  1.00 78.94  ? 212 ALA C CA 1 
ATOM 5227  C C  . ALA C 1 212 ? 106.516 86.308  59.168  1.00 78.94  ? 212 ALA C C  1 
ATOM 5228  O O  . ALA C 1 212 ? 106.778 85.432  59.998  1.00 78.94  ? 212 ALA C O  1 
ATOM 5229  N N  . LYS C 1 213 ? 107.440 87.144  58.699  1.00 78.27  ? 213 LYS C N  1 
ATOM 5230  C CA . LYS C 1 213 ? 108.782 87.143  59.265  1.00 78.27  ? 213 LYS C CA 1 
ATOM 5231  C C  . LYS C 1 213 ? 108.787 87.791  60.639  1.00 78.27  ? 213 LYS C C  1 
ATOM 5232  O O  . LYS C 1 213 ? 109.365 87.251  61.587  1.00 78.27  ? 213 LYS C O  1 
ATOM 5233  N N  . LYS C 1 214 ? 108.147 88.957  60.762  1.00 79.93  ? 214 LYS C N  1 
ATOM 5234  C CA . LYS C 1 214 ? 108.062 89.625  62.056  1.00 79.93  ? 214 LYS C CA 1 
ATOM 5235  C C  . LYS C 1 214 ? 107.191 88.846  63.025  1.00 79.93  ? 214 LYS C C  1 
ATOM 5236  O O  . LYS C 1 214 ? 107.366 88.953  64.242  1.00 79.93  ? 214 LYS C O  1 
ATOM 5237  N N  . MET C 1 215 ? 106.249 88.066  62.507  1.00 82.47  ? 215 MET C N  1 
ATOM 5238  C CA . MET C 1 215 ? 105.506 87.147  63.351  1.00 82.47  ? 215 MET C CA 1 
ATOM 5239  C C  . MET C 1 215 ? 106.380 85.967  63.734  1.00 82.47  ? 215 MET C C  1 
ATOM 5240  O O  . MET C 1 215 ? 106.560 85.670  64.919  1.00 82.47  ? 215 MET C O  1 
ATOM 5241  N N  . GLY C 1 216 ? 106.955 85.299  62.741  1.00 81.62  ? 216 GLY C N  1 
ATOM 5242  C CA . GLY C 1 216 ? 107.911 84.244  62.982  1.00 81.62  ? 216 GLY C CA 1 
ATOM 5243  C C  . GLY C 1 216 ? 107.526 82.868  62.492  1.00 81.62  ? 216 GLY C C  1 
ATOM 5244  O O  . GLY C 1 216 ? 108.208 81.900  62.847  1.00 81.62  ? 216 GLY C O  1 
ATOM 5245  N N  . LEU C 1 217 ? 106.461 82.739  61.705  1.00 79.74  ? 217 LEU C N  1 
ATOM 5246  C CA . LEU C 1 217 ? 106.096 81.432  61.180  1.00 79.74  ? 217 LEU C CA 1 
ATOM 5247  C C  . LEU C 1 217 ? 107.114 81.000  60.146  1.00 79.74  ? 217 LEU C C  1 
ATOM 5248  O O  . LEU C 1 217 ? 107.851 80.033  60.351  1.00 79.74  ? 217 LEU C O  1 
ATOM 5249  N N  . VAL C 1 218 ? 107.183 81.730  59.063  1.00 81.07  ? 218 VAL C N  1 
ATOM 5250  C CA . VAL C 1 218 ? 108.242 81.535  58.099  1.00 81.07  ? 218 VAL C CA 1 
ATOM 5251  C C  . VAL C 1 218 ? 109.362 82.502  58.456  1.00 81.07  ? 218 VAL C C  1 
ATOM 5252  O O  . VAL C 1 218 ? 109.135 83.571  59.027  1.00 81.07  ? 218 VAL C O  1 
ATOM 5253  N N  . ASP C 1 219 ? 110.590 82.097  58.185  1.00 74.28  ? 219 ASP C N  1 
ATOM 5254  C CA . ASP C 1 219 ? 111.731 82.889  58.596  1.00 74.28  ? 219 ASP C CA 1 
ATOM 5255  C C  . ASP C 1 219 ? 112.461 83.577  57.460  1.00 74.28  ? 219 ASP C C  1 
ATOM 5256  O O  . ASP C 1 219 ? 112.858 84.732  57.617  1.00 74.28  ? 219 ASP C O  1 
ATOM 5257  N N  . GLN C 1 220 ? 112.634 82.924  56.325  1.00 70.36  ? 220 GLN C N  1 
ATOM 5258  C CA . GLN C 1 220 ? 113.389 83.506  55.227  1.00 70.36  ? 220 GLN C CA 1 
ATOM 5259  C C  . GLN C 1 220 ? 112.416 83.875  54.124  1.00 70.36  ? 220 GLN C C  1 
ATOM 5260  O O  . GLN C 1 220 ? 111.397 83.205  53.937  1.00 70.36  ? 220 GLN C O  1 
ATOM 5261  N N  . LEU C 1 221 ? 112.699 84.970  53.437  1.00 67.91  ? 221 LEU C N  1 
ATOM 5262  C CA . LEU C 1 221 ? 111.882 85.365  52.308  1.00 67.91  ? 221 LEU C CA 1 
ATOM 5263  C C  . LEU C 1 221 ? 112.708 85.331  51.036  1.00 67.91  ? 221 LEU C C  1 
ATOM 5264  O O  . LEU C 1 221 ? 113.937 85.422  51.058  1.00 67.91  ? 221 LEU C O  1 
ATOM 5265  N N  . VAL C 1 222 ? 112.016 85.209  49.913  1.00 63.39  ? 222 VAL C N  1 
ATOM 5266  C CA . VAL C 1 222 ? 112.649 85.369  48.617  1.00 63.39  ? 222 VAL C CA 1 
ATOM 5267  C C  . VAL C 1 222 ? 111.625 85.947  47.653  1.00 63.39  ? 222 VAL C C  1 
ATOM 5268  O O  . VAL C 1 222 ? 110.518 85.430  47.498  1.00 63.39  ? 222 VAL C O  1 
ATOM 5269  N N  . GLU C 1 223 ? 111.976 87.029  47.052  1.00 62.33  ? 223 GLU C N  1 
ATOM 5270  C CA . GLU C 1 223 ? 111.089 87.711  46.132  1.00 62.33  ? 223 GLU C CA 1 
ATOM 5271  C C  . GLU C 1 223 ? 111.066 86.989  44.793  1.00 62.33  ? 223 GLU C C  1 
ATOM 5272  O O  . GLU C 1 223 ? 112.023 86.306  44.437  1.00 62.33  ? 223 GLU C O  1 
ATOM 5273  N N  . PRO C 1 224 ? 109.971 87.078  44.033  1.00 68.23  ? 224 PRO C N  1 
ATOM 5274  C CA . PRO C 1 224 ? 109.911 86.341  42.769  1.00 68.23  ? 224 PRO C CA 1 
ATOM 5275  C C  . PRO C 1 224 ? 110.759 86.988  41.695  1.00 68.23  ? 224 PRO C C  1 
ATOM 5276  O O  . PRO C 1 224 ? 111.441 87.985  41.946  1.00 68.23  ? 224 PRO C O  1 
ATOM 5277  N N  . LEU C 1 225 ? 110.716 86.447  40.486  1.00 63.33  ? 225 LEU C N  1 
ATOM 5278  C CA . LEU C 1 225 ? 111.555 86.935  39.402  1.00 63.33  ? 225 LEU C CA 1 
ATOM 5279  C C  . LEU C 1 225 ? 110.679 87.447  38.279  1.00 63.33  ? 225 LEU C C  1 
ATOM 5280  O O  . LEU C 1 225 ? 109.475 87.180  38.255  1.00 63.33  ? 225 LEU C O  1 
ATOM 5281  N N  . GLY C 1 226 ? 111.279 88.192  37.363  1.00 65.95  ? 226 GLY C N  1 
ATOM 5282  C CA . GLY C 1 226 ? 110.595 88.621  36.175  1.00 65.95  ? 226 GLY C CA 1 
ATOM 5283  C C  . GLY C 1 226 ? 110.953 87.749  34.993  1.00 65.95  ? 226 GLY C C  1 
ATOM 5284  O O  . GLY C 1 226 ? 110.603 86.570  34.938  1.00 65.95  ? 226 GLY C O  1 
ATOM 5285  N N  . PRO C 1 227 ? 111.693 88.304  34.048  1.00 63.46  ? 227 PRO C N  1 
ATOM 5286  C CA . PRO C 1 227 ? 111.935 87.612  32.777  1.00 63.46  ? 227 PRO C CA 1 
ATOM 5287  C C  . PRO C 1 227 ? 112.918 86.466  32.897  1.00 63.46  ? 227 PRO C C  1 
ATOM 5288  O O  . PRO C 1 227 ? 113.889 86.563  33.650  1.00 63.46  ? 227 PRO C O  1 
ATOM 5289  N N  . GLY C 1 228 ? 112.693 85.383  32.151  1.00 61.59  ? 228 GLY C N  1 
ATOM 5290  C CA . GLY C 1 228 ? 113.589 84.248  32.178  1.00 61.59  ? 228 GLY C CA 1 
ATOM 5291  C C  . GLY C 1 228 ? 113.817 83.691  30.787  1.00 61.59  ? 228 GLY C C  1 
ATOM 5292  O O  . GLY C 1 228 ? 113.258 84.168  29.803  1.00 61.59  ? 228 GLY C O  1 
ATOM 5293  N N  . LEU C 1 229 ? 114.659 82.659  30.729  1.00 66.63  ? 229 LEU C N  1 
ATOM 5294  C CA . LEU C 1 229 ? 114.823 81.910  29.488  1.00 66.63  ? 229 LEU C CA 1 
ATOM 5295  C C  . LEU C 1 229 ? 113.599 81.045  29.236  1.00 66.63  ? 229 LEU C C  1 
ATOM 5296  O O  . LEU C 1 229 ? 113.366 80.577  28.117  1.00 66.63  ? 229 LEU C O  1 
ATOM 5297  N N  . LYS C 1 230 ? 112.846 80.771  30.291  1.00 69.84  ? 230 LYS C N  1 
ATOM 5298  C CA . LYS C 1 230 ? 111.557 80.101  30.293  1.00 69.84  ? 230 LYS C CA 1 
ATOM 5299  C C  . LYS C 1 230 ? 110.536 81.166  30.703  1.00 69.84  ? 230 LYS C C  1 
ATOM 5300  O O  . LYS C 1 230 ? 110.970 82.243  31.134  1.00 69.84  ? 230 LYS C O  1 
ATOM 5301  N N  . PRO C 1 231 ? 109.220 80.965  30.515  1.00 72.06  ? 231 PRO C N  1 
ATOM 5302  C CA . PRO C 1 231 ? 108.230 82.051  30.739  1.00 72.06  ? 231 PRO C CA 1 
ATOM 5303  C C  . PRO C 1 231 ? 108.235 82.568  32.168  1.00 72.06  ? 231 PRO C C  1 
ATOM 5304  O O  . PRO C 1 231 ? 108.568 81.821  33.099  1.00 72.06  ? 231 PRO C O  1 
ATOM 5305  N N  . PRO C 1 232 ? 107.867 83.832  32.388  1.00 73.85  ? 232 PRO C N  1 
ATOM 5306  C CA . PRO C 1 232 ? 108.315 84.565  33.583  1.00 73.85  ? 232 PRO C CA 1 
ATOM 5307  C C  . PRO C 1 232 ? 107.673 84.169  34.902  1.00 73.85  ? 232 PRO C C  1 
ATOM 5308  O O  . PRO C 1 232 ? 107.814 84.919  35.868  1.00 73.85  ? 232 PRO C O  1 
ATOM 5309  N N  . GLU C 1 233 ? 106.959 83.067  34.968  1.00 74.33  ? 233 GLU C N  1 
ATOM 5310  C CA . GLU C 1 233 ? 106.500 82.550  36.249  1.00 74.33  ? 233 GLU C CA 1 
ATOM 5311  C C  . GLU C 1 233 ? 106.900 81.103  36.481  1.00 74.33  ? 233 GLU C C  1 
ATOM 5312  O O  . GLU C 1 233 ? 107.054 80.706  37.640  1.00 74.33  ? 233 GLU C O  1 
ATOM 5313  N N  . GLU C 1 234 ? 107.112 80.315  35.427  1.00 79.93  ? 234 GLU C N  1 
ATOM 5314  C CA . GLU C 1 234 ? 107.538 78.931  35.569  1.00 79.93  ? 234 GLU C CA 1 
ATOM 5315  C C  . GLU C 1 234 ? 108.945 78.819  36.140  1.00 79.93  ? 234 GLU C C  1 
ATOM 5316  O O  . GLU C 1 234 ? 109.266 77.806  36.768  1.00 79.93  ? 234 GLU C O  1 
ATOM 5317  N N  . ARG C 1 235 ? 109.785 79.842  35.981  1.00 68.65  ? 235 ARG C N  1 
ATOM 5318  C CA . ARG C 1 235 ? 111.102 79.744  36.591  1.00 68.65  ? 235 ARG C CA 1 
ATOM 5319  C C  . ARG C 1 235 ? 111.024 80.010  38.082  1.00 68.65  ? 235 ARG C C  1 
ATOM 5320  O O  . ARG C 1 235 ? 111.782 79.421  38.855  1.00 68.65  ? 235 ARG C O  1 
ATOM 5321  N N  . THR C 1 236 ? 110.097 80.867  38.504  1.00 67.59  ? 236 THR C N  1 
ATOM 5322  C CA . THR C 1 236 ? 110.004 81.208  39.918  1.00 67.59  ? 236 THR C CA 1 
ATOM 5323  C C  . THR C 1 236 ? 109.533 80.024  40.744  1.00 67.59  ? 236 THR C C  1 
ATOM 5324  O O  . THR C 1 236 ? 109.880 79.909  41.921  1.00 67.59  ? 236 THR C O  1 
ATOM 5325  N N  . ILE C 1 237 ? 108.761 79.123  40.142  1.00 67.11  ? 237 ILE C N  1 
ATOM 5326  C CA . ILE C 1 237 ? 108.423 77.901  40.850  1.00 67.11  ? 237 ILE C CA 1 
ATOM 5327  C C  . ILE C 1 237 ? 109.565 76.902  40.761  1.00 67.11  ? 237 ILE C C  1 
ATOM 5328  O O  . ILE C 1 237 ? 109.658 76.001  41.601  1.00 67.11  ? 237 ILE C O  1 
ATOM 5329  N N  . GLU C 1 238 ? 110.466 77.059  39.793  1.00 69.67  ? 238 GLU C N  1 
ATOM 5330  C CA . GLU C 1 238 ? 111.634 76.203  39.673  1.00 69.67  ? 238 GLU C CA 1 
ATOM 5331  C C  . GLU C 1 238 ? 112.883 76.880  40.202  1.00 69.67  ? 238 GLU C C  1 
ATOM 5332  O O  . GLU C 1 238 ? 113.976 76.319  40.110  1.00 69.67  ? 238 GLU C O  1 
ATOM 5333  N N  . TYR C 1 239 ? 112.743 78.090  40.729  1.00 55.68  ? 239 TYR C N  1 
ATOM 5334  C CA . TYR C 1 239 ? 113.830 78.760  41.421  1.00 55.68  ? 239 TYR C CA 1 
ATOM 5335  C C  . TYR C 1 239 ? 113.927 78.322  42.864  1.00 55.68  ? 239 TYR C C  1 
ATOM 5336  O O  . TYR C 1 239 ? 115.034 78.215  43.402  1.00 55.68  ? 239 TYR C O  1 
ATOM 5337  N N  . LEU C 1 240 ? 112.785 78.047  43.487  1.00 61.04  ? 240 LEU C N  1 
ATOM 5338  C CA . LEU C 1 240 ? 112.751 77.698  44.896  1.00 61.04  ? 240 LEU C CA 1 
ATOM 5339  C C  . LEU C 1 240 ? 113.345 76.341  45.170  1.00 61.04  ? 240 LEU C C  1 
ATOM 5340  O O  . LEU C 1 240 ? 113.776 76.093  46.296  1.00 61.04  ? 240 LEU C O  1 
ATOM 5341  N N  . GLU C 1 241 ? 113.365 75.469  44.169  1.00 74.02  ? 241 GLU C N  1 
ATOM 5342  C CA . GLU C 1 241 ? 113.954 74.150  44.328  1.00 74.02  ? 241 GLU C CA 1 
ATOM 5343  C C  . GLU C 1 241 ? 115.436 74.255  44.651  1.00 74.02  ? 241 GLU C C  1 
ATOM 5344  O O  . GLU C 1 241 ? 115.946 73.572  45.542  1.00 74.02  ? 241 GLU C O  1 
ATOM 5345  N N  . GLU C 1 242 ? 116.129 75.166  43.986  1.00 75.02  ? 242 GLU C N  1 
ATOM 5346  C CA . GLU C 1 242 ? 117.557 75.292  44.210  1.00 75.02  ? 242 GLU C CA 1 
ATOM 5347  C C  . GLU C 1 242 ? 117.897 76.098  45.454  1.00 75.02  ? 242 GLU C C  1 
ATOM 5348  O O  . GLU C 1 242 ? 118.902 75.796  46.107  1.00 75.02  ? 242 GLU C O  1 
ATOM 5349  N N  . VAL C 1 243 ? 117.079 77.085  45.824  1.00 63.27  ? 243 VAL C N  1 
ATOM 5350  C CA . VAL C 1 243 ? 117.283 77.744  47.107  1.00 63.27  ? 243 VAL C CA 1 
ATOM 5351  C C  . VAL C 1 243 ? 116.999 76.770  48.238  1.00 63.27  ? 243 VAL C C  1 
ATOM 5352  O O  . VAL C 1 243 ? 117.676 76.763  49.275  1.00 63.27  ? 243 VAL C O  1 
ATOM 5353  N N  . ALA C 1 244 ? 116.048 75.878  48.016  1.00 65.64  ? 244 ALA C N  1 
ATOM 5354  C CA . ALA C 1 244 ? 115.784 74.832  48.981  1.00 65.64  ? 244 ALA C CA 1 
ATOM 5355  C C  . ALA C 1 244 ? 116.929 73.843  49.060  1.00 65.64  ? 244 ALA C C  1 
ATOM 5356  O O  . ALA C 1 244 ? 117.283 73.407  50.154  1.00 65.64  ? 244 ALA C O  1 
ATOM 5357  N N  . ILE C 1 245 ? 117.546 73.497  47.932  1.00 71.77  ? 245 ILE C N  1 
ATOM 5358  C CA . ILE C 1 245 ? 118.612 72.504  47.993  1.00 71.77  ? 245 ILE C CA 1 
ATOM 5359  C C  . ILE C 1 245 ? 119.888 73.133  48.544  1.00 71.77  ? 245 ILE C C  1 
ATOM 5360  O O  . ILE C 1 245 ? 120.755 72.440  49.088  1.00 71.77  ? 245 ILE C O  1 
ATOM 5361  N N  . THR C 1 246 ? 120.016 74.460  48.445  1.00 67.17  ? 246 THR C N  1 
ATOM 5362  C CA . THR C 1 246 ? 121.187 75.084  49.048  1.00 67.17  ? 246 THR C CA 1 
ATOM 5363  C C  . THR C 1 246 ? 120.941 75.384  50.518  1.00 67.17  ? 246 THR C C  1 
ATOM 5364  O O  . THR C 1 246 ? 121.884 75.627  51.273  1.00 67.17  ? 246 THR C O  1 
ATOM 5365  N N  . PHE C 1 247 ? 119.685 75.371  50.948  1.00 62.12  ? 247 PHE C N  1 
ATOM 5366  C CA . PHE C 1 247 ? 119.443 75.290  52.380  1.00 62.12  ? 247 PHE C CA 1 
ATOM 5367  C C  . PHE C 1 247 ? 119.599 73.863  52.866  1.00 62.12  ? 247 PHE C C  1 
ATOM 5368  O O  . PHE C 1 247 ? 119.972 73.629  54.017  1.00 62.12  ? 247 PHE C O  1 
ATOM 5369  N N  . ALA C 1 248 ? 119.382 72.900  51.981  1.00 72.31  ? 248 ALA C N  1 
ATOM 5370  C CA . ALA C 1 248 ? 119.118 71.534  52.412  1.00 72.31  ? 248 ALA C CA 1 
ATOM 5371  C C  . ALA C 1 248 ? 120.386 70.822  52.838  1.00 72.31  ? 248 ALA C C  1 
ATOM 5372  O O  . ALA C 1 248 ? 120.398 70.124  53.858  1.00 72.31  ? 248 ALA C O  1 
ATOM 5373  N N  . LYS C 1 249 ? 121.460 70.973  52.060  1.00 73.62  ? 249 LYS C N  1 
ATOM 5374  C CA . LYS C 1 249 ? 122.727 70.352  52.418  1.00 73.62  ? 249 LYS C CA 1 
ATOM 5375  C C  . LYS C 1 249 ? 123.284 70.962  53.696  1.00 73.62  ? 249 LYS C C  1 
ATOM 5376  O O  . LYS C 1 249 ? 123.943 70.278  54.487  1.00 73.62  ? 249 LYS C O  1 
ATOM 5377  N N  . GLY C 1 250 ? 122.979 72.238  53.938  1.00 80.44  ? 250 GLY C N  1 
ATOM 5378  C CA . GLY C 1 250 ? 123.407 72.872  55.173  1.00 80.44  ? 250 GLY C CA 1 
ATOM 5379  C C  . GLY C 1 250 ? 122.680 72.338  56.391  1.00 80.44  ? 250 GLY C C  1 
ATOM 5380  O O  . GLY C 1 250 ? 123.217 72.356  57.500  1.00 80.44  ? 250 GLY C O  1 
ATOM 5381  N N  . LEU C 1 251 ? 121.454 71.854  56.205  1.00 79.31  ? 251 LEU C N  1 
ATOM 5382  C CA . LEU C 1 251 ? 120.720 71.298  57.336  1.00 79.31  ? 251 LEU C CA 1 
ATOM 5383  C C  . LEU C 1 251 ? 121.269 69.947  57.745  1.00 79.31  ? 251 LEU C C  1 
ATOM 5384  O O  . LEU C 1 251 ? 121.185 69.567  58.918  1.00 79.31  ? 251 LEU C O  1 
ATOM 5385  N N  . ALA C 1 252 ? 121.826 69.204  56.794  1.00 89.94  ? 252 ALA C N  1 
ATOM 5386  C CA . ALA C 1 252 ? 122.312 67.868  57.110  1.00 89.94  ? 252 ALA C CA 1 
ATOM 5387  C C  . ALA C 1 252 ? 123.593 67.930  57.929  1.00 89.94  ? 252 ALA C C  1 
ATOM 5388  O O  . ALA C 1 252 ? 123.812 67.101  58.819  1.00 89.94  ? 252 ALA C O  1 
ATOM 5389  N N  . ASP C 1 253 ? 124.450 68.911  57.651  1.00 96.62  ? 253 ASP C N  1 
ATOM 5390  C CA . ASP C 1 253 ? 125.681 69.020  58.417  1.00 96.62  ? 253 ASP C CA 1 
ATOM 5391  C C  . ASP C 1 253 ? 125.680 70.248  59.315  1.00 96.62  ? 253 ASP C C  1 
ATOM 5392  O O  . ASP C 1 253 ? 126.741 70.661  59.795  1.00 96.62  ? 253 ASP C O  1 
ATOM 5393  N N  . LYS C 1 254 ? 124.511 70.858  59.504  1.00 90.96  ? 254 LYS C N  1 
ATOM 5394  C CA . LYS C 1 254 ? 124.204 71.754  60.615  1.00 90.96  ? 254 LYS C CA 1 
ATOM 5395  C C  . LYS C 1 254 ? 124.998 73.052  60.574  1.00 90.96  ? 254 LYS C C  1 
ATOM 5396  O O  . LYS C 1 254 ? 125.402 73.556  61.623  1.00 90.96  ? 254 LYS C O  1 
ATOM 5397  N N  . LYS C 1 255 ? 125.248 73.615  59.392  1.00 90.93  ? 255 LYS C N  1 
ATOM 5398  C CA . LYS C 1 255 ? 125.905 74.915  59.350  1.00 90.93  ? 255 LYS C CA 1 
ATOM 5399  C C  . LYS C 1 255 ? 124.949 76.027  59.751  1.00 90.93  ? 255 LYS C C  1 
ATOM 5400  O O  . LYS C 1 255 ? 125.382 77.088  60.211  1.00 90.93  ? 255 LYS C O  1 
ATOM 5401  N N  . ILE C 1 256 ? 123.650 75.815  59.573  1.00 97.45  ? 256 ILE C N  1 
ATOM 5402  C CA . ILE C 1 256 ? 122.632 76.761  60.009  1.00 97.45  ? 256 ILE C CA 1 
ATOM 5403  C C  . ILE C 1 256 ? 121.697 76.027  60.966  1.00 97.45  ? 256 ILE C C  1 
ATOM 5404  O O  . ILE C 1 256 ? 121.524 74.807  60.858  1.00 97.45  ? 256 ILE C O  1 
ATOM 5405  N N  . SER C 1 257 ? 121.146 76.765  61.957  1.00 113.89 ? 257 SER C N  1 
ATOM 5406  C CA . SER C 1 257 ? 120.371 76.150  63.031  1.00 113.89 ? 257 SER C CA 1 
ATOM 5407  C C  . SER C 1 257 ? 118.921 76.606  62.985  1.00 113.89 ? 257 SER C C  1 
ATOM 5408  O O  . SER C 1 257 ? 118.650 77.747  62.587  1.00 113.89 ? 257 SER C O  1 
ATOM 5409  N N  . PRO C 1 258 ? 117.977 75.747  63.378  1.00 117.21 ? 258 PRO C N  1 
ATOM 5410  C CA . PRO C 1 258 ? 116.561 76.152  63.354  1.00 117.21 ? 258 PRO C CA 1 
ATOM 5411  C C  . PRO C 1 258 ? 116.079 76.845  64.618  1.00 117.21 ? 258 PRO C C  1 
ATOM 5412  O O  . PRO C 1 258 ? 114.865 76.872  64.854  1.00 117.21 ? 258 PRO C O  1 
ATOM 5413  N N  . LYS C 1 259 ? 116.999 77.389  65.408  1.00 123.20 ? 259 LYS C N  1 
ATOM 5414  C CA . LYS C 1 259 ? 116.638 78.077  66.642  1.00 123.20 ? 259 LYS C CA 1 
ATOM 5415  C C  . LYS C 1 259 ? 116.353 79.553  66.388  1.00 123.20 ? 259 LYS C C  1 
ATOM 5416  O O  . LYS C 1 259 ? 116.784 80.418  67.150  1.00 123.20 ? 259 LYS C O  1 
ATOM 5417  N N  . ARG C 1 260 ? 115.624 79.834  65.313  1.00 122.83 ? 260 ARG C N  1 
ATOM 5418  C CA . ARG C 1 260 ? 115.280 81.205  64.957  1.00 122.83 ? 260 ARG C CA 1 
ATOM 5419  C C  . ARG C 1 260 ? 113.912 81.591  65.510  1.00 122.83 ? 260 ARG C C  1 
ATOM 5420  O O  . ARG C 1 260 ? 113.677 82.748  65.860  1.00 122.83 ? 260 ARG C O  1 
ATOM 5421  N N  . GLU C 1 266 ? 110.087 91.514  70.396  1.00 102.88 ? 266 GLU C N  1 
ATOM 5422  C CA . GLU C 1 266 ? 110.637 91.519  71.740  1.00 102.88 ? 266 GLU C CA 1 
ATOM 5423  C C  . GLU C 1 266 ? 109.513 91.578  72.753  1.00 102.88 ? 266 GLU C C  1 
ATOM 5424  O O  . GLU C 1 266 ? 109.750 91.729  73.946  1.00 102.88 ? 266 GLU C O  1 
ATOM 5425  N N  . LYS C 1 267 ? 108.284 91.461  72.267  1.00 102.32 ? 267 LYS C N  1 
ATOM 5426  C CA . LYS C 1 267 ? 107.117 91.400  73.134  1.00 102.32 ? 267 LYS C CA 1 
ATOM 5427  C C  . LYS C 1 267 ? 106.787 89.988  73.571  1.00 102.32 ? 267 LYS C C  1 
ATOM 5428  O O  . LYS C 1 267 ? 106.442 89.772  74.733  1.00 102.32 ? 267 LYS C O  1 
ATOM 5429  N N  . LEU C 1 268 ? 106.887 89.018  72.667  1.00 103.82 ? 268 LEU C N  1 
ATOM 5430  C CA . LEU C 1 268 ? 106.667 87.628  73.036  1.00 103.82 ? 268 LEU C CA 1 
ATOM 5431  C C  . LEU C 1 268 ? 107.770 87.084  73.926  1.00 103.82 ? 268 LEU C C  1 
ATOM 5432  O O  . LEU C 1 268 ? 107.504 86.184  74.728  1.00 103.82 ? 268 LEU C O  1 
ATOM 5433  N N  . THR C 1 269 ? 108.989 87.616  73.815  1.00 101.54 ? 269 THR C N  1 
ATOM 5434  C CA . THR C 1 269 ? 110.066 87.199  74.696  1.00 101.54 ? 269 THR C CA 1 
ATOM 5435  C C  . THR C 1 269 ? 109.821 87.652  76.121  1.00 101.54 ? 269 THR C C  1 
ATOM 5436  O O  . THR C 1 269 ? 110.311 87.013  77.055  1.00 101.54 ? 269 THR C O  1 
ATOM 5437  N N  . ALA C 1 270 ? 109.068 88.737  76.304  1.00 105.87 ? 270 ALA C N  1 
ATOM 5438  C CA . ALA C 1 270 ? 108.580 89.071  77.633  1.00 105.87 ? 270 ALA C CA 1 
ATOM 5439  C C  . ALA C 1 270 ? 107.586 88.028  78.118  1.00 105.87 ? 270 ALA C C  1 
ATOM 5440  O O  . ALA C 1 270 ? 107.558 87.691  79.306  1.00 105.87 ? 270 ALA C O  1 
ATOM 5441  N N  . TYR C 1 271 ? 106.774 87.490  77.211  1.00 107.95 ? 271 TYR C N  1 
ATOM 5442  C CA . TYR C 1 271 ? 105.843 86.452  77.619  1.00 107.95 ? 271 TYR C CA 1 
ATOM 5443  C C  . TYR C 1 271 ? 106.512 85.093  77.760  1.00 107.95 ? 271 TYR C C  1 
ATOM 5444  O O  . TYR C 1 271 ? 106.085 84.305  78.615  1.00 107.95 ? 271 TYR C O  1 
ATOM 5445  N N  . ALA C 1 272 ? 107.603 84.862  77.014  1.00 114.05 ? 272 ALA C N  1 
ATOM 5446  C CA . ALA C 1 272 ? 108.113 83.552  76.594  1.00 114.05 ? 272 ALA C CA 1 
ATOM 5447  C C  . ALA C 1 272 ? 108.249 82.525  77.706  1.00 114.05 ? 272 ALA C C  1 
ATOM 5448  O O  . ALA C 1 272 ? 108.101 81.328  77.438  1.00 114.05 ? 272 ALA C O  1 
ATOM 5449  N N  . MET C 1 273 ? 108.505 82.947  78.937  1.00 123.32 ? 273 MET C N  1 
ATOM 5450  C CA . MET C 1 273 ? 108.510 82.030  80.066  1.00 123.32 ? 273 MET C CA 1 
ATOM 5451  C C  . MET C 1 273 ? 107.480 82.425  81.109  1.00 123.32 ? 273 MET C C  1 
ATOM 5452  O O  . MET C 1 273 ? 107.280 81.689  82.083  1.00 123.32 ? 273 MET C O  1 
ATOM 5453  N N  . THR C 1 274 ? 106.796 83.540  80.914  1.00 116.18 ? 274 THR C N  1 
ATOM 5454  C CA . THR C 1 274 ? 106.065 84.180  81.993  1.00 116.18 ? 274 THR C CA 1 
ATOM 5455  C C  . THR C 1 274 ? 104.582 83.895  81.821  1.00 116.18 ? 274 THR C C  1 
ATOM 5456  O O  . THR C 1 274 ? 103.852 84.686  81.223  1.00 116.18 ? 274 THR C O  1 
ATOM 5457  N N  . ILE C 1 275 ? 104.155 82.747  82.339  1.00 126.43 ? 275 ILE C N  1 
ATOM 5458  C CA . ILE C 1 275 ? 102.767 82.522  82.743  1.00 126.43 ? 275 ILE C CA 1 
ATOM 5459  C C  . ILE C 1 275 ? 102.723 81.516  83.899  1.00 126.43 ? 275 ILE C C  1 
ATOM 5460  O O  . ILE C 1 275 ? 102.492 80.316  83.692  1.00 126.43 ? 275 ILE C O  1 
ATOM 5461  N N  . PRO C 1 276 ? 103.019 81.916  85.135  1.00 139.32 ? 276 PRO C N  1 
ATOM 5462  C CA . PRO C 1 276 ? 102.676 81.022  86.250  1.00 139.32 ? 276 PRO C CA 1 
ATOM 5463  C C  . PRO C 1 276 ? 101.303 81.289  86.848  1.00 139.32 ? 276 PRO C C  1 
ATOM 5464  O O  . PRO C 1 276 ? 100.636 80.368  87.331  1.00 139.32 ? 276 PRO C O  1 
ATOM 5465  N N  . PHE C 1 277 ? 100.861 82.543  86.795  1.00 138.83 ? 277 PHE C N  1 
ATOM 5466  C CA . PHE C 1 277 ? 99.707  82.972  87.577  1.00 138.83 ? 277 PHE C CA 1 
ATOM 5467  C C  . PHE C 1 277 ? 98.712  83.811  86.791  1.00 138.83 ? 277 PHE C C  1 
ATOM 5468  O O  . PHE C 1 277 ? 97.528  83.816  87.148  1.00 138.83 ? 277 PHE C O  1 
ATOM 5469  N N  . VAL C 1 278 ? 99.106  84.422  85.665  1.00 129.57 ? 278 VAL C N  1 
ATOM 5470  C CA . VAL C 1 278 ? 98.210  85.257  84.863  1.00 129.57 ? 278 VAL C CA 1 
ATOM 5471  C C  . VAL C 1 278 ? 97.305  84.417  83.975  1.00 129.57 ? 278 VAL C C  1 
ATOM 5472  O O  . VAL C 1 278 ? 96.605  84.966  83.110  1.00 129.57 ? 278 VAL C O  1 
ATOM 5473  N N  . ARG C 1 279 ? 97.296  83.094  84.200  1.00 136.27 ? 279 ARG C N  1 
ATOM 5474  C CA . ARG C 1 279 ? 96.662  82.093  83.344  1.00 136.27 ? 279 ARG C CA 1 
ATOM 5475  C C  . ARG C 1 279 ? 95.195  82.396  83.078  1.00 136.27 ? 279 ARG C C  1 
ATOM 5476  O O  . ARG C 1 279 ? 94.814  82.638  81.930  1.00 136.27 ? 279 ARG C O  1 
ATOM 5477  N N  . GLN C 1 280 ? 94.375  82.436  84.130  1.00 128.44 ? 280 GLN C N  1 
ATOM 5478  C CA . GLN C 1 280 ? 92.965  82.805  83.999  1.00 128.44 ? 280 GLN C CA 1 
ATOM 5479  C C  . GLN C 1 280 ? 92.803  84.240  83.508  1.00 128.44 ? 280 GLN C C  1 
ATOM 5480  O O  . GLN C 1 280 ? 91.849  84.559  82.788  1.00 128.44 ? 280 GLN C O  1 
ATOM 5481  N N  . GLN C 1 281 ? 93.751  85.109  83.849  1.00 133.44 ? 281 GLN C N  1 
ATOM 5482  C CA . GLN C 1 281 ? 93.715  86.527  83.527  1.00 133.44 ? 281 GLN C CA 1 
ATOM 5483  C C  . GLN C 1 281 ? 94.223  86.833  82.126  1.00 133.44 ? 281 GLN C C  1 
ATOM 5484  O O  . GLN C 1 281 ? 94.673  87.952  81.867  1.00 133.44 ? 281 GLN C O  1 
ATOM 5485  N N  . VAL C 1 282 ? 94.198  85.850  81.232  1.00 113.82 ? 282 VAL C N  1 
ATOM 5486  C CA . VAL C 1 282 ? 94.304  86.080  79.802  1.00 113.82 ? 282 VAL C CA 1 
ATOM 5487  C C  . VAL C 1 282 ? 93.126  85.480  79.050  1.00 113.82 ? 282 VAL C C  1 
ATOM 5488  O O  . VAL C 1 282 ? 92.444  86.180  78.286  1.00 113.82 ? 282 VAL C O  1 
ATOM 5489  N N  . TYR C 1 283 ? 92.827  84.202  79.287  1.00 116.57 ? 283 TYR C N  1 
ATOM 5490  C CA . TYR C 1 283 ? 91.727  83.609  78.542  1.00 116.57 ? 283 TYR C CA 1 
ATOM 5491  C C  . TYR C 1 283 ? 90.378  84.010  79.125  1.00 116.57 ? 283 TYR C C  1 
ATOM 5492  O O  . TYR C 1 283 ? 89.352  83.814  78.480  1.00 116.57 ? 283 TYR C O  1 
ATOM 5493  N N  . LYS C 1 284 ? 90.345  84.612  80.312  1.00 111.11 ? 284 LYS C N  1 
ATOM 5494  C CA . LYS C 1 284 ? 89.097  85.233  80.748  1.00 111.11 ? 284 LYS C CA 1 
ATOM 5495  C C  . LYS C 1 284 ? 88.840  86.523  79.985  1.00 111.11 ? 284 LYS C C  1 
ATOM 5496  O O  . LYS C 1 284 ? 87.704  86.796  79.562  1.00 111.11 ? 284 LYS C O  1 
ATOM 5497  N N  . LYS C 1 285 ? 89.896  87.326  79.805  1.00 111.23 ? 285 LYS C N  1 
ATOM 5498  C CA . LYS C 1 285 ? 89.822  88.521  78.975  1.00 111.23 ? 285 LYS C CA 1 
ATOM 5499  C C  . LYS C 1 285 ? 89.430  88.168  77.554  1.00 111.23 ? 285 LYS C C  1 
ATOM 5500  O O  . LYS C 1 285 ? 88.691  88.916  76.917  1.00 111.23 ? 285 LYS C O  1 
ATOM 5501  N N  . VAL C 1 286 ? 89.875  87.012  77.068  1.00 104.17 ? 286 VAL C N  1 
ATOM 5502  C CA . VAL C 1 286 ? 89.436  86.533  75.764  1.00 104.17 ? 286 VAL C CA 1 
ATOM 5503  C C  . VAL C 1 286 ? 88.026  85.932  75.800  1.00 104.17 ? 286 VAL C C  1 
ATOM 5504  O O  . VAL C 1 286 ? 87.267  86.073  74.826  1.00 104.17 ? 286 VAL C O  1 
ATOM 5505  N N  . GLU C 1 287 ? 87.653  85.286  76.908  1.00 106.35 ? 287 GLU C N  1 
ATOM 5506  C CA . GLU C 1 287 ? 86.335  84.698  77.113  1.00 106.35 ? 287 GLU C CA 1 
ATOM 5507  C C  . GLU C 1 287 ? 85.233  85.728  77.006  1.00 106.35 ? 287 GLU C C  1 
ATOM 5508  O O  . GLU C 1 287 ? 84.167  85.444  76.451  1.00 106.35 ? 287 GLU C O  1 
ATOM 5509  N N  . GLU C 1 288 ? 85.476  86.925  77.517  1.00 106.99 ? 288 GLU C N  1 
ATOM 5510  C CA . GLU C 1 288 ? 84.462  87.947  77.321  1.00 106.99 ? 288 GLU C CA 1 
ATOM 5511  C C  . GLU C 1 288 ? 84.747  88.760  76.063  1.00 106.99 ? 288 GLU C C  1 
ATOM 5512  O O  . GLU C 1 288 ? 83.850  89.442  75.554  1.00 106.99 ? 288 GLU C O  1 
ATOM 5513  N N  . LYS C 1 289 ? 85.960  88.647  75.502  1.00 103.40 ? 289 LYS C N  1 
ATOM 5514  C CA . LYS C 1 289 ? 86.257  89.279  74.215  1.00 103.40 ? 289 LYS C CA 1 
ATOM 5515  C C  . LYS C 1 289 ? 85.459  88.671  73.077  1.00 103.40 ? 289 LYS C C  1 
ATOM 5516  O O  . LYS C 1 289 ? 84.974  89.393  72.200  1.00 103.40 ? 289 LYS C O  1 
ATOM 5517  N N  . VAL C 1 290 ? 85.330  87.347  73.070  1.00 100.70 ? 290 VAL C N  1 
ATOM 5518  C CA . VAL C 1 290 ? 84.655  86.690  71.964  1.00 100.70 ? 290 VAL C CA 1 
ATOM 5519  C C  . VAL C 1 290 ? 83.154  86.944  72.021  1.00 100.70 ? 290 VAL C C  1 
ATOM 5520  O O  . VAL C 1 290 ? 82.486  86.969  70.982  1.00 100.70 ? 290 VAL C O  1 
ATOM 5521  N N  . ARG C 1 291 ? 82.615  87.212  73.202  1.00 100.59 ? 291 ARG C N  1 
ATOM 5522  C CA . ARG C 1 291 ? 81.206  87.514  73.332  1.00 100.59 ? 291 ARG C CA 1 
ATOM 5523  C C  . ARG C 1 291 ? 80.919  89.003  73.372  1.00 100.59 ? 291 ARG C C  1 
ATOM 5524  O O  . ARG C 1 291 ? 79.747  89.383  73.436  1.00 100.59 ? 291 ARG C O  1 
ATOM 5525  N N  . LYS C 1 292 ? 81.947  89.852  73.384  1.00 110.71 ? 292 LYS C N  1 
ATOM 5526  C CA . LYS C 1 292 ? 81.728  91.260  73.075  1.00 110.71 ? 292 LYS C CA 1 
ATOM 5527  C C  . LYS C 1 292 ? 81.907  91.561  71.591  1.00 110.71 ? 292 LYS C C  1 
ATOM 5528  O O  . LYS C 1 292 ? 81.254  92.471  71.074  1.00 110.71 ? 292 LYS C O  1 
ATOM 5529  N N  . GLN C 1 293 ? 82.760  90.815  70.883  1.00 103.57 ? 293 GLN C N  1 
ATOM 5530  C CA . GLN C 1 293 ? 82.880  91.018  69.443  1.00 103.57 ? 293 GLN C CA 1 
ATOM 5531  C C  . GLN C 1 293 ? 81.652  90.496  68.721  1.00 103.57 ? 293 GLN C C  1 
ATOM 5532  O O  . GLN C 1 293 ? 80.889  91.262  68.123  1.00 103.57 ? 293 GLN C O  1 
ATOM 5533  N N  . THR C 1 294 ? 81.441  89.195  68.779  1.00 104.35 ? 294 THR C N  1 
ATOM 5534  C CA . THR C 1 294 ? 80.189  88.608  68.352  1.00 104.35 ? 294 THR C CA 1 
ATOM 5535  C C  . THR C 1 294 ? 79.280  88.542  69.562  1.00 104.35 ? 294 THR C C  1 
ATOM 5536  O O  . THR C 1 294 ? 79.548  89.141  70.600  1.00 104.35 ? 294 THR C O  1 
ATOM 5537  N N  . LYS C 1 295 ? 78.205  87.800  69.438  1.00 111.14 ? 295 LYS C N  1 
ATOM 5538  C CA . LYS C 1 295 ? 77.357  87.481  70.565  1.00 111.14 ? 295 LYS C CA 1 
ATOM 5539  C C  . LYS C 1 295 ? 77.573  86.017  70.922  1.00 111.14 ? 295 LYS C C  1 
ATOM 5540  O O  . LYS C 1 295 ? 78.213  85.257  70.191  1.00 111.14 ? 295 LYS C O  1 
ATOM 5541  N N  . GLY C 1 296 ? 77.000  85.612  72.040  1.00 118.88 ? 296 GLY C N  1 
ATOM 5542  C CA . GLY C 1 296 ? 77.237  84.279  72.534  1.00 118.88 ? 296 GLY C CA 1 
ATOM 5543  C C  . GLY C 1 296 ? 76.601  83.143  71.770  1.00 118.88 ? 296 GLY C C  1 
ATOM 5544  O O  . GLY C 1 296 ? 76.788  81.993  72.171  1.00 118.88 ? 296 GLY C O  1 
ATOM 5545  N N  . LEU C 1 297 ? 75.854  83.385  70.696  1.00 109.26 ? 297 LEU C N  1 
ATOM 5546  C CA . LEU C 1 297 ? 75.219  82.272  70.007  1.00 109.26 ? 297 LEU C CA 1 
ATOM 5547  C C  . LEU C 1 297 ? 76.017  81.783  68.812  1.00 109.26 ? 297 LEU C C  1 
ATOM 5548  O O  . LEU C 1 297 ? 75.430  81.309  67.832  1.00 109.26 ? 297 LEU C O  1 
ATOM 5549  N N  . TYR C 1 298 ? 77.344  81.880  68.885  1.00 104.19 ? 298 TYR C N  1 
ATOM 5550  C CA . TYR C 1 298 ? 78.277  81.091  68.087  1.00 104.19 ? 298 TYR C CA 1 
ATOM 5551  C C  . TYR C 1 298 ? 78.869  80.020  68.994  1.00 104.19 ? 298 TYR C C  1 
ATOM 5552  O O  . TYR C 1 298 ? 79.856  80.280  69.695  1.00 104.19 ? 298 TYR C O  1 
ATOM 5553  N N  . PRO C 1 299 ? 78.332  78.796  69.023  1.00 96.80  ? 299 PRO C N  1 
ATOM 5554  C CA . PRO C 1 299 ? 79.053  77.721  69.723  1.00 96.80  ? 299 PRO C CA 1 
ATOM 5555  C C  . PRO C 1 299 ? 80.261  77.176  68.974  1.00 96.80  ? 299 PRO C C  1 
ATOM 5556  O O  . PRO C 1 299 ? 80.857  76.202  69.438  1.00 96.80  ? 299 PRO C O  1 
ATOM 5557  N N  . ALA C 1 300 ? 80.658  77.752  67.846  1.00 88.69  ? 300 ALA C N  1 
ATOM 5558  C CA . ALA C 1 300 ? 81.875  77.292  67.189  1.00 88.69  ? 300 ALA C CA 1 
ATOM 5559  C C  . ALA C 1 300 ? 83.178  77.782  67.832  1.00 88.69  ? 300 ALA C C  1 
ATOM 5560  O O  . ALA C 1 300 ? 83.952  76.933  68.283  1.00 88.69  ? 300 ALA C O  1 
ATOM 5561  N N  . PRO C 1 301 ? 83.487  79.089  67.922  1.00 84.74  ? 301 PRO C N  1 
ATOM 5562  C CA . PRO C 1 301 ? 84.894  79.466  68.120  1.00 84.74  ? 301 PRO C CA 1 
ATOM 5563  C C  . PRO C 1 301 ? 85.418  79.260  69.529  1.00 84.74  ? 301 PRO C C  1 
ATOM 5564  O O  . PRO C 1 301 ? 86.615  78.998  69.678  1.00 84.74  ? 301 PRO C O  1 
ATOM 5565  N N  . LEU C 1 302 ? 84.572  79.336  70.559  1.00 92.11  ? 302 LEU C N  1 
ATOM 5566  C CA . LEU C 1 302 ? 85.021  79.017  71.913  1.00 92.11  ? 302 LEU C CA 1 
ATOM 5567  C C  . LEU C 1 302 ? 85.418  77.559  72.049  1.00 92.11  ? 302 LEU C C  1 
ATOM 5568  O O  . LEU C 1 302 ? 86.242  77.217  72.903  1.00 92.11  ? 302 LEU C O  1 
ATOM 5569  N N  . LYS C 1 303 ? 84.882  76.702  71.199  1.00 94.34  ? 303 LYS C N  1 
ATOM 5570  C CA . LYS C 1 303 ? 85.299  75.321  71.143  1.00 94.34  ? 303 LYS C CA 1 
ATOM 5571  C C  . LYS C 1 303 ? 86.626  75.125  70.429  1.00 94.34  ? 303 LYS C C  1 
ATOM 5572  O O  . LYS C 1 303 ? 86.989  73.969  70.192  1.00 94.34  ? 303 LYS C O  1 
ATOM 5573  N N  . ILE C 1 304 ? 87.379  76.172  70.081  1.00 100.03 ? 304 ILE C N  1 
ATOM 5574  C CA . ILE C 1 304 ? 88.809  75.958  69.881  1.00 100.03 ? 304 ILE C CA 1 
ATOM 5575  C C  . ILE C 1 304 ? 89.587  76.600  71.018  1.00 100.03 ? 304 ILE C C  1 
ATOM 5576  O O  . ILE C 1 304 ? 90.807  76.404  71.117  1.00 100.03 ? 304 ILE C O  1 
ATOM 5577  N N  . ILE C 1 305 ? 88.919  77.377  71.862  1.00 100.39 ? 305 ILE C N  1 
ATOM 5578  C CA . ILE C 1 305 ? 89.590  77.972  73.002  1.00 100.39 ? 305 ILE C CA 1 
ATOM 5579  C C  . ILE C 1 305 ? 89.890  76.913  74.044  1.00 100.39 ? 305 ILE C C  1 
ATOM 5580  O O  . ILE C 1 305 ? 90.996  76.862  74.588  1.00 100.39 ? 305 ILE C O  1 
ATOM 5581  N N  . ASP C 1 306 ? 88.925  76.019  74.286  1.00 103.41 ? 306 ASP C N  1 
ATOM 5582  C CA . ASP C 1 306 ? 89.085  74.913  75.226  1.00 103.41 ? 306 ASP C CA 1 
ATOM 5583  C C  . ASP C 1 306 ? 90.226  73.982  74.851  1.00 103.41 ? 306 ASP C C  1 
ATOM 5584  O O  . ASP C 1 306 ? 90.780  73.315  75.728  1.00 103.41 ? 306 ASP C O  1 
ATOM 5585  N N  . VAL C 1 307 ? 90.559  73.908  73.567  1.00 103.98 ? 307 VAL C N  1 
ATOM 5586  C CA . VAL C 1 307 ? 91.792  73.263  73.155  1.00 103.98 ? 307 VAL C CA 1 
ATOM 5587  C C  . VAL C 1 307 ? 92.986  73.988  73.752  1.00 103.98 ? 307 VAL C C  1 
ATOM 5588  O O  . VAL C 1 307 ? 93.734  73.425  74.559  1.00 103.98 ? 307 VAL C O  1 
ATOM 5589  N N  . VAL C 1 308 ? 93.141  75.271  73.417  1.00 105.11 ? 308 VAL C N  1 
ATOM 5590  C CA . VAL C 1 308 ? 94.326  75.986  73.854  1.00 105.11 ? 308 VAL C CA 1 
ATOM 5591  C C  . VAL C 1 308 ? 94.231  76.329  75.335  1.00 105.11 ? 308 VAL C C  1 
ATOM 5592  O O  . VAL C 1 308 ? 95.247  76.632  75.969  1.00 105.11 ? 308 VAL C O  1 
ATOM 5593  N N  . LYS C 1 309 ? 93.035  76.250  75.916  1.00 114.07 ? 309 LYS C N  1 
ATOM 5594  C CA . LYS C 1 309 ? 92.894  76.259  77.363  1.00 114.07 ? 309 LYS C CA 1 
ATOM 5595  C C  . LYS C 1 309 ? 93.415  74.982  78.000  1.00 114.07 ? 309 LYS C C  1 
ATOM 5596  O O  . LYS C 1 309 ? 94.067  75.047  79.048  1.00 114.07 ? 309 LYS C O  1 
ATOM 5597  N N  . THR C 1 310 ? 93.162  73.825  77.393  1.00 119.76 ? 310 THR C N  1 
ATOM 5598  C CA . THR C 1 310 ? 93.642  72.573  77.948  1.00 119.76 ? 310 THR C CA 1 
ATOM 5599  C C  . THR C 1 310 ? 94.991  72.143  77.409  1.00 119.76 ? 310 THR C C  1 
ATOM 5600  O O  . THR C 1 310 ? 95.654  71.323  78.049  1.00 119.76 ? 310 THR C O  1 
ATOM 5601  N N  . GLY C 1 311 ? 95.407  72.660  76.253  1.00 120.58 ? 311 GLY C N  1 
ATOM 5602  C CA . GLY C 1 311 ? 96.736  72.353  75.759  1.00 120.58 ? 311 GLY C CA 1 
ATOM 5603  C C  . GLY C 1 311 ? 97.824  72.901  76.654  1.00 120.58 ? 311 GLY C C  1 
ATOM 5604  O O  . GLY C 1 311 ? 98.826  72.229  76.910  1.00 120.58 ? 311 GLY C O  1 
ATOM 5605  N N  . ILE C 1 312 ? 97.633  74.113  77.166  1.00 118.02 ? 312 ILE C N  1 
ATOM 5606  C CA . ILE C 1 312 ? 98.495  74.600  78.225  1.00 118.02 ? 312 ILE C CA 1 
ATOM 5607  C C  . ILE C 1 312 ? 98.139  73.865  79.512  1.00 118.02 ? 312 ILE C C  1 
ATOM 5608  O O  . ILE C 1 312 ? 97.003  73.397  79.685  1.00 118.02 ? 312 ILE C O  1 
ATOM 5609  N N  . GLU C 1 313 ? 99.163  73.619  80.339  1.00 136.25 ? 313 GLU C N  1 
ATOM 5610  C CA . GLU C 1 313 ? 99.113  73.163  81.731  1.00 136.25 ? 313 GLU C CA 1 
ATOM 5611  C C  . GLU C 1 313 ? 98.731  71.685  81.857  1.00 136.25 ? 313 GLU C C  1 
ATOM 5612  O O  . GLU C 1 313 ? 98.904  71.082  82.920  1.00 136.25 ? 313 GLU C O  1 
ATOM 5613  N N  . GLN C 1 314 ? 98.293  71.058  80.784  1.00 121.78 ? 314 GLN C N  1 
ATOM 5614  C CA . GLN C 1 314 ? 97.945  69.654  80.861  1.00 121.78 ? 314 GLN C CA 1 
ATOM 5615  C C  . GLN C 1 314 ? 98.798  68.880  79.868  1.00 121.78 ? 314 GLN C C  1 
ATOM 5616  O O  . GLN C 1 314 ? 99.751  69.415  79.294  1.00 121.78 ? 314 GLN C O  1 
ATOM 5617  N N  . GLY C 1 315 ? 98.469  67.603  79.694  1.00 125.50 ? 315 GLY C N  1 
ATOM 5618  C CA . GLY C 1 315 ? 99.207  66.727  78.807  1.00 125.50 ? 315 GLY C CA 1 
ATOM 5619  C C  . GLY C 1 315 ? 99.128  67.146  77.356  1.00 125.50 ? 315 GLY C C  1 
ATOM 5620  O O  . GLY C 1 315 ? 98.063  67.072  76.740  1.00 125.50 ? 315 GLY C O  1 
ATOM 5621  N N  . SER C 1 316 ? 100.260 67.601  76.813  1.00 121.94 ? 316 SER C N  1 
ATOM 5622  C CA . SER C 1 316 ? 100.286 68.132  75.456  1.00 121.94 ? 316 SER C CA 1 
ATOM 5623  C C  . SER C 1 316 ? 100.066 67.030  74.432  1.00 121.94 ? 316 SER C C  1 
ATOM 5624  O O  . SER C 1 316 ? 99.184  67.140  73.573  1.00 121.94 ? 316 SER C O  1 
ATOM 5625  N N  . ASP C 1 317 ? 100.855 65.957  74.516  1.00 122.35 ? 317 ASP C N  1 
ATOM 5626  C CA . ASP C 1 317 ? 100.640 64.801  73.652  1.00 122.35 ? 317 ASP C CA 1 
ATOM 5627  C C  . ASP C 1 317 ? 99.317  64.118  73.960  1.00 122.35 ? 317 ASP C C  1 
ATOM 5628  O O  . ASP C 1 317 ? 98.662  63.594  73.053  1.00 122.35 ? 317 ASP C O  1 
ATOM 5629  N N  . ALA C 1 318 ? 98.902  64.130  75.228  1.00 116.43 ? 318 ALA C N  1 
ATOM 5630  C CA . ALA C 1 318 ? 97.560  63.691  75.576  1.00 116.43 ? 318 ALA C CA 1 
ATOM 5631  C C  . ALA C 1 318 ? 96.499  64.657  75.078  1.00 116.43 ? 318 ALA C C  1 
ATOM 5632  O O  . ALA C 1 318 ? 95.337  64.271  74.944  1.00 116.43 ? 318 ALA C O  1 
ATOM 5633  N N  . GLY C 1 319 ? 96.873  65.903  74.809  1.00 107.89 ? 319 GLY C N  1 
ATOM 5634  C CA . GLY C 1 319 ? 95.921  66.861  74.297  1.00 107.89 ? 319 GLY C CA 1 
ATOM 5635  C C  . GLY C 1 319 ? 95.576  66.703  72.843  1.00 107.89 ? 319 GLY C C  1 
ATOM 5636  O O  . GLY C 1 319 ? 94.633  67.344  72.383  1.00 107.89 ? 319 GLY C O  1 
ATOM 5637  N N  . TYR C 1 320 ? 96.299  65.876  72.099  1.00 105.87 ? 320 TYR C N  1 
ATOM 5638  C CA . TYR C 1 320 ? 96.019  65.694  70.683  1.00 105.87 ? 320 TYR C CA 1 
ATOM 5639  C C  . TYR C 1 320 ? 94.828  64.786  70.415  1.00 105.87 ? 320 TYR C C  1 
ATOM 5640  O O  . TYR C 1 320 ? 94.514  64.532  69.249  1.00 105.87 ? 320 TYR C O  1 
ATOM 5641  N N  . LEU C 1 321 ? 94.164  64.287  71.451  1.00 100.67 ? 321 LEU C N  1 
ATOM 5642  C CA . LEU C 1 321 ? 92.966  63.490  71.275  1.00 100.67 ? 321 LEU C CA 1 
ATOM 5643  C C  . LEU C 1 321 ? 91.724  64.135  71.853  1.00 100.67 ? 321 LEU C C  1 
ATOM 5644  O O  . LEU C 1 321 ? 90.650  63.530  71.784  1.00 100.67 ? 321 LEU C O  1 
ATOM 5645  N N  . CYS C 1 322 ? 91.836  65.328  72.433  1.00 110.24 ? 322 CYS C N  1 
ATOM 5646  C CA . CYS C 1 322 ? 90.642  66.013  72.901  1.00 110.24 ? 322 CYS C CA 1 
ATOM 5647  C C  . CYS C 1 322 ? 89.813  66.500  71.726  1.00 110.24 ? 322 CYS C C  1 
ATOM 5648  O O  . CYS C 1 322 ? 88.592  66.334  71.712  1.00 110.24 ? 322 CYS C O  1 
ATOM 5649  N N  . GLU C 1 323 ? 90.473  67.063  70.716  1.00 102.73 ? 323 GLU C N  1 
ATOM 5650  C CA . GLU C 1 323 ? 89.784  67.591  69.549  1.00 102.73 ? 323 GLU C CA 1 
ATOM 5651  C C  . GLU C 1 323 ? 89.182  66.495  68.692  1.00 102.73 ? 323 GLU C C  1 
ATOM 5652  O O  . GLU C 1 323 ? 88.282  66.774  67.894  1.00 102.73 ? 323 GLU C O  1 
ATOM 5653  N N  . SER C 1 324 ? 89.661  65.261  68.843  1.00 107.61 ? 324 SER C N  1 
ATOM 5654  C CA . SER C 1 324 ? 88.965  64.112  68.283  1.00 107.61 ? 324 SER C CA 1 
ATOM 5655  C C  . SER C 1 324 ? 87.595  63.941  68.914  1.00 107.61 ? 324 SER C C  1 
ATOM 5656  O O  . SER C 1 324 ? 86.659  63.483  68.255  1.00 107.61 ? 324 SER C O  1 
ATOM 5657  N N  . GLN C 1 325 ? 87.459  64.303  70.179  1.00 106.28 ? 325 GLN C N  1 
ATOM 5658  C CA . GLN C 1 325 ? 86.141  64.370  70.779  1.00 106.28 ? 325 GLN C CA 1 
ATOM 5659  C C  . GLN C 1 325 ? 85.484  65.723  70.576  1.00 106.28 ? 325 GLN C C  1 
ATOM 5660  O O  . GLN C 1 325 ? 84.442  65.982  71.187  1.00 106.28 ? 325 GLN C O  1 
ATOM 5661  N N  . LYS C 1 326 ? 86.069  66.595  69.756  1.00 108.52 ? 326 LYS C N  1 
ATOM 5662  C CA . LYS C 1 326 ? 85.486  67.905  69.508  1.00 108.52 ? 326 LYS C CA 1 
ATOM 5663  C C  . LYS C 1 326 ? 85.168  68.164  68.046  1.00 108.52 ? 326 LYS C C  1 
ATOM 5664  O O  . LYS C 1 326 ? 84.093  68.685  67.756  1.00 108.52 ? 326 LYS C O  1 
ATOM 5665  N N  . PHE C 1 327 ? 86.072  67.796  67.127  1.00 104.36 ? 327 PHE C N  1 
ATOM 5666  C CA . PHE C 1 327 ? 85.864  68.047  65.701  1.00 104.36 ? 327 PHE C CA 1 
ATOM 5667  C C  . PHE C 1 327 ? 84.639  67.324  65.177  1.00 104.36 ? 327 PHE C C  1 
ATOM 5668  O O  . PHE C 1 327 ? 83.907  67.856  64.340  1.00 104.36 ? 327 PHE C O  1 
ATOM 5669  N N  . GLY C 1 328 ? 84.391  66.114  65.674  1.00 108.09 ? 328 GLY C N  1 
ATOM 5670  C CA . GLY C 1 328 ? 83.177  65.411  65.316  1.00 108.09 ? 328 GLY C CA 1 
ATOM 5671  C C  . GLY C 1 328 ? 81.926  66.048  65.873  1.00 108.09 ? 328 GLY C C  1 
ATOM 5672  O O  . GLY C 1 328 ? 80.850  65.886  65.291  1.00 108.09 ? 328 GLY C O  1 
ATOM 5673  N N  . GLU C 1 329 ? 82.043  66.782  66.975  1.00 110.43 ? 329 GLU C N  1 
ATOM 5674  C CA . GLU C 1 329 ? 80.881  67.473  67.511  1.00 110.43 ? 329 GLU C CA 1 
ATOM 5675  C C  . GLU C 1 329 ? 80.497  68.657  66.632  1.00 110.43 ? 329 GLU C C  1 
ATOM 5676  O O  . GLU C 1 329 ? 79.412  68.675  66.038  1.00 110.43 ? 329 GLU C O  1 
ATOM 5677  N N  . LEU C 1 330 ? 81.392  69.637  66.495  1.00 103.02 ? 330 LEU C N  1 
ATOM 5678  C CA . LEU C 1 330 ? 80.978  70.891  65.880  1.00 103.02 ? 330 LEU C CA 1 
ATOM 5679  C C  . LEU C 1 330 ? 80.952  70.838  64.359  1.00 103.02 ? 330 LEU C C  1 
ATOM 5680  O O  . LEU C 1 330 ? 80.600  71.838  63.729  1.00 103.02 ? 330 LEU C O  1 
ATOM 5681  N N  . VAL C 1 331 ? 81.310  69.711  63.748  1.00 100.75 ? 331 VAL C N  1 
ATOM 5682  C CA . VAL C 1 331 ? 80.999  69.515  62.339  1.00 100.75 ? 331 VAL C CA 1 
ATOM 5683  C C  . VAL C 1 331 ? 79.646  68.853  62.162  1.00 100.75 ? 331 VAL C C  1 
ATOM 5684  O O  . VAL C 1 331 ? 78.885  69.237  61.261  1.00 100.75 ? 331 VAL C O  1 
ATOM 5685  N N  . MET C 1 332 ? 79.268  67.950  63.055  1.00 108.33 ? 332 MET C N  1 
ATOM 5686  C CA . MET C 1 332 ? 77.992  67.258  62.955  1.00 108.33 ? 332 MET C CA 1 
ATOM 5687  C C  . MET C 1 332 ? 76.895  67.983  63.727  1.00 108.33 ? 332 MET C C  1 
ATOM 5688  O O  . MET C 1 332 ? 75.988  67.353  64.272  1.00 108.33 ? 332 MET C O  1 
ATOM 5689  N N  . THR C 1 333 ? 76.969  69.307  63.781  1.00 97.97  ? 333 THR C N  1 
ATOM 5690  C CA . THR C 1 333 ? 76.002  70.116  64.499  1.00 97.97  ? 333 THR C CA 1 
ATOM 5691  C C  . THR C 1 333 ? 75.195  70.980  63.541  1.00 97.97  ? 333 THR C C  1 
ATOM 5692  O O  . THR C 1 333 ? 75.461  71.051  62.339  1.00 97.97  ? 333 THR C O  1 
ATOM 5693  N N  . LYS C 1 334 ? 74.195  71.649  64.109  1.00 95.59  ? 334 LYS C N  1 
ATOM 5694  C CA . LYS C 1 334 ? 73.298  72.529  63.380  1.00 95.59  ? 334 LYS C CA 1 
ATOM 5695  C C  . LYS C 1 334 ? 73.783  73.961  63.339  1.00 95.59  ? 334 LYS C C  1 
ATOM 5696  O O  . LYS C 1 334 ? 73.011  74.851  62.975  1.00 95.59  ? 334 LYS C O  1 
ATOM 5697  N N  . GLU C 1 335 ? 75.027  74.214  63.733  1.00 99.15  ? 335 GLU C N  1 
ATOM 5698  C CA . GLU C 1 335 ? 75.565  75.561  63.613  1.00 99.15  ? 335 GLU C CA 1 
ATOM 5699  C C  . GLU C 1 335 ? 76.113  75.797  62.215  1.00 99.15  ? 335 GLU C C  1 
ATOM 5700  O O  . GLU C 1 335 ? 75.705  76.732  61.521  1.00 99.15  ? 335 GLU C O  1 
ATOM 5701  N N  . SER C 1 336 ? 77.037  74.947  61.778  1.00 89.89  ? 336 SER C N  1 
ATOM 5702  C CA . SER C 1 336 ? 77.752  75.177  60.536  1.00 89.89  ? 336 SER C CA 1 
ATOM 5703  C C  . SER C 1 336 ? 77.484  74.110  59.491  1.00 89.89  ? 336 SER C C  1 
ATOM 5704  O O  . SER C 1 336 ? 78.291  73.951  58.574  1.00 89.89  ? 336 SER C O  1 
ATOM 5705  N N  . LYS C 1 337 ? 76.380  73.369  59.610  1.00 89.90  ? 337 LYS C N  1 
ATOM 5706  C CA . LYS C 1 337 ? 76.099  72.328  58.625  1.00 89.90  ? 337 LYS C CA 1 
ATOM 5707  C C  . LYS C 1 337 ? 75.803  72.934  57.263  1.00 89.90  ? 337 LYS C C  1 
ATOM 5708  O O  . LYS C 1 337 ? 76.293  72.447  56.240  1.00 89.90  ? 337 LYS C O  1 
ATOM 5709  N N  . ALA C 1 338 ? 75.026  74.006  57.233  1.00 91.74  ? 338 ALA C N  1 
ATOM 5710  C CA . ALA C 1 338 ? 74.754  74.730  56.005  1.00 91.74  ? 338 ALA C CA 1 
ATOM 5711  C C  . ALA C 1 338 ? 75.848  75.719  55.654  1.00 91.74  ? 338 ALA C C  1 
ATOM 5712  O O  . ALA C 1 338 ? 75.777  76.358  54.596  1.00 91.74  ? 338 ALA C O  1 
ATOM 5713  N N  . LEU C 1 339 ? 76.853  75.858  56.512  1.00 91.21  ? 339 LEU C N  1 
ATOM 5714  C CA . LEU C 1 339 ? 77.925  76.792  56.219  1.00 91.21  ? 339 LEU C CA 1 
ATOM 5715  C C  . LEU C 1 339 ? 78.794  76.261  55.090  1.00 91.21  ? 339 LEU C C  1 
ATOM 5716  O O  . LEU C 1 339 ? 79.357  77.043  54.314  1.00 91.21  ? 339 LEU C O  1 
ATOM 5717  N N  . MET C 1 340 ? 78.857  74.937  54.942  1.00 108.16 ? 340 MET C N  1 
ATOM 5718  C CA . MET C 1 340 ? 79.536  74.350  53.792  1.00 108.16 ? 340 MET C CA 1 
ATOM 5719  C C  . MET C 1 340 ? 78.803  74.696  52.499  1.00 108.16 ? 340 MET C C  1 
ATOM 5720  O O  . MET C 1 340 ? 79.429  74.987  51.477  1.00 108.16 ? 340 MET C O  1 
ATOM 5721  N N  . GLY C 1 341 ? 77.465  74.687  52.531  1.00 100.57 ? 341 GLY C N  1 
ATOM 5722  C CA . GLY C 1 341 ? 76.698  75.088  51.362  1.00 100.57 ? 341 GLY C CA 1 
ATOM 5723  C C  . GLY C 1 341 ? 76.837  76.562  51.065  1.00 100.57 ? 341 GLY C C  1 
ATOM 5724  O O  . GLY C 1 341 ? 76.841  76.964  49.896  1.00 100.57 ? 341 GLY C O  1 
ATOM 5725  N N  . LEU C 1 342 ? 76.964  77.379  52.117  1.00 93.71  ? 342 LEU C N  1 
ATOM 5726  C CA . LEU C 1 342 ? 77.324  78.780  51.937  1.00 93.71  ? 342 LEU C CA 1 
ATOM 5727  C C  . LEU C 1 342 ? 78.667  78.913  51.234  1.00 93.71  ? 342 LEU C C  1 
ATOM 5728  O O  . LEU C 1 342 ? 78.843  79.788  50.384  1.00 93.71  ? 342 LEU C O  1 
ATOM 5729  N N  . TYR C 1 343 ? 79.621  78.041  51.556  1.00 92.25  ? 343 TYR C N  1 
ATOM 5730  C CA . TYR C 1 343 ? 80.917  78.146  50.897  1.00 92.25  ? 343 TYR C CA 1 
ATOM 5731  C C  . TYR C 1 343 ? 80.875  77.633  49.466  1.00 92.25  ? 343 TYR C C  1 
ATOM 5732  O O  . TYR C 1 343 ? 81.586  78.161  48.603  1.00 92.25  ? 343 TYR C O  1 
ATOM 5733  N N  . HIS C 1 344 ? 80.078  76.595  49.209  1.00 96.25  ? 344 HIS C N  1 
ATOM 5734  C CA . HIS C 1 344 ? 79.872  76.133  47.840  1.00 96.25  ? 344 HIS C CA 1 
ATOM 5735  C C  . HIS C 1 344 ? 79.264  77.221  46.979  1.00 96.25  ? 344 HIS C C  1 
ATOM 5736  O O  . HIS C 1 344 ? 79.664  77.404  45.829  1.00 96.25  ? 344 HIS C O  1 
ATOM 5737  N N  . GLY C 1 345 ? 78.302  77.959  47.519  1.00 93.15  ? 345 GLY C N  1 
ATOM 5738  C CA . GLY C 1 345 ? 77.759  79.073  46.768  1.00 93.15  ? 345 GLY C CA 1 
ATOM 5739  C C  . GLY C 1 345 ? 78.711  80.246  46.674  1.00 93.15  ? 345 GLY C C  1 
ATOM 5740  O O  . GLY C 1 345 ? 78.690  80.989  45.686  1.00 93.15  ? 345 GLY C O  1 
ATOM 5741  N N  . GLN C 1 346 ? 79.545  80.432  47.701  1.00 90.92  ? 346 GLN C N  1 
ATOM 5742  C CA . GLN C 1 346 ? 80.545  81.491  47.700  1.00 90.92  ? 346 GLN C CA 1 
ATOM 5743  C C  . GLN C 1 346 ? 81.552  81.293  46.585  1.00 90.92  ? 346 GLN C C  1 
ATOM 5744  O O  . GLN C 1 346 ? 81.917  82.244  45.887  1.00 90.92  ? 346 GLN C O  1 
ATOM 5745  N N  . VAL C 1 347 ? 82.003  80.060  46.395  1.00 99.48  ? 347 VAL C N  1 
ATOM 5746  C CA . VAL C 1 347 ? 82.902  79.790  45.283  1.00 99.48  ? 347 VAL C CA 1 
ATOM 5747  C C  . VAL C 1 347 ? 82.106  79.662  43.987  1.00 99.48  ? 347 VAL C C  1 
ATOM 5748  O O  . VAL C 1 347 ? 82.618  79.943  42.898  1.00 99.48  ? 347 VAL C O  1 
ATOM 5749  N N  . LEU C 1 348 ? 80.825  79.302  44.087  1.00 92.71  ? 348 LEU C N  1 
ATOM 5750  C CA . LEU C 1 348 ? 80.033  78.962  42.913  1.00 92.71  ? 348 LEU C CA 1 
ATOM 5751  C C  . LEU C 1 348 ? 79.599  80.192  42.137  1.00 92.71  ? 348 LEU C C  1 
ATOM 5752  O O  . LEU C 1 348 ? 79.371  80.101  40.928  1.00 92.71  ? 348 LEU C O  1 
ATOM 5753  N N  . CYS C 1 349 ? 79.472  81.333  42.799  1.00 95.05  ? 349 CYS C N  1 
ATOM 5754  C CA . CYS C 1 349 ? 79.077  82.560  42.137  1.00 95.05  ? 349 CYS C CA 1 
ATOM 5755  C C  . CYS C 1 349 ? 80.236  83.512  41.914  1.00 95.05  ? 349 CYS C C  1 
ATOM 5756  O O  . CYS C 1 349 ? 80.025  84.617  41.413  1.00 95.05  ? 349 CYS C O  1 
ATOM 5757  N N  . LYS C 1 350 ? 81.448  83.124  42.277  1.00 86.31  ? 350 LYS C N  1 
ATOM 5758  C CA . LYS C 1 350 ? 82.643  83.783  41.761  1.00 86.31  ? 350 LYS C CA 1 
ATOM 5759  C C  . LYS C 1 350 ? 83.103  83.089  40.485  1.00 86.31  ? 350 LYS C C  1 
ATOM 5760  O O  . LYS C 1 350 ? 84.211  82.572  40.379  1.00 86.31  ? 350 LYS C O  1 
ATOM 5761  N N  . LYS C 1 351 ? 82.205  83.071  39.510  1.00 86.23  ? 351 LYS C N  1 
ATOM 5762  C CA . LYS C 1 351 ? 82.437  82.413  38.240  1.00 86.23  ? 351 LYS C CA 1 
ATOM 5763  C C  . LYS C 1 351 ? 81.688  83.207  37.181  1.00 86.23  ? 351 LYS C C  1 
ATOM 5764  O O  . LYS C 1 351 ? 80.662  83.826  37.471  1.00 86.23  ? 351 LYS C O  1 
ATOM 5765  N N  . ASN C 1 352 ? 82.230  83.210  35.962  1.00 85.28  ? 352 ASN C N  1 
ATOM 5766  C CA . ASN C 1 352 ? 81.695  84.045  34.892  1.00 85.28  ? 352 ASN C CA 1 
ATOM 5767  C C  . ASN C 1 352 ? 80.288  83.614  34.502  1.00 85.28  ? 352 ASN C C  1 
ATOM 5768  O O  . ASN C 1 352 ? 79.400  84.456  34.324  1.00 85.28  ? 352 ASN C O  1 
ATOM 5769  N N  . LYS C 1 353 ? 80.103  82.314  34.257  1.00 83.46  ? 353 LYS C N  1 
ATOM 5770  C CA . LYS C 1 353 ? 78.826  81.604  34.173  1.00 83.46  ? 353 LYS C CA 1 
ATOM 5771  C C  . LYS C 1 353 ? 78.042  81.944  32.905  1.00 83.46  ? 353 LYS C C  1 
ATOM 5772  O O  . LYS C 1 353 ? 77.095  81.237  32.550  1.00 83.46  ? 353 LYS C O  1 
ATOM 5773  N N  . PHE C 1 354 ? 78.469  82.948  32.156  1.00 85.71  ? 354 PHE C N  1 
ATOM 5774  C CA . PHE C 1 354 ? 77.835  83.291  30.892  1.00 85.71  ? 354 PHE C CA 1 
ATOM 5775  C C  . PHE C 1 354 ? 78.864  83.165  29.778  1.00 85.71  ? 354 PHE C C  1 
ATOM 5776  O O  . PHE C 1 354 ? 79.451  84.163  29.351  1.00 85.71  ? 354 PHE C O  1 
ATOM 5777  N N  . GLY C 1 355 ? 79.055  81.936  29.298  1.00 99.14  ? 355 GLY C N  1 
ATOM 5778  C CA . GLY C 1 355 ? 79.819  81.690  28.084  1.00 99.14  ? 355 GLY C CA 1 
ATOM 5779  C C  . GLY C 1 355 ? 81.275  82.077  28.197  1.00 99.14  ? 355 GLY C C  1 
ATOM 5780  O O  . GLY C 1 355 ? 82.028  81.548  29.022  1.00 99.14  ? 355 GLY C O  1 
ATOM 5781  N N  . ALA C 1 356 ? 81.675  83.016  27.353  1.00 109.05 ? 356 ALA C N  1 
ATOM 5782  C CA . ALA C 1 356 ? 82.996  83.617  27.336  1.00 109.05 ? 356 ALA C CA 1 
ATOM 5783  C C  . ALA C 1 356 ? 82.833  85.126  27.277  1.00 109.05 ? 356 ALA C C  1 
ATOM 5784  O O  . ALA C 1 356 ? 81.877  85.628  26.676  1.00 109.05 ? 356 ALA C O  1 
ATOM 5785  N N  . PRO C 1 357 ? 83.733  85.880  27.901  1.00 108.31 ? 357 PRO C N  1 
ATOM 5786  C CA . PRO C 1 357 ? 83.638  87.338  27.805  1.00 108.31 ? 357 PRO C CA 1 
ATOM 5787  C C  . PRO C 1 357 ? 84.049  87.807  26.419  1.00 108.31 ? 357 PRO C C  1 
ATOM 5788  O O  . PRO C 1 357 ? 85.127  87.480  25.924  1.00 108.31 ? 357 PRO C O  1 
ATOM 5789  N N  . GLN C 1 358 ? 83.161  88.556  25.780  1.00 101.42 ? 358 GLN C N  1 
ATOM 5790  C CA . GLN C 1 358 ? 83.432  89.087  24.458  1.00 101.42 ? 358 GLN C CA 1 
ATOM 5791  C C  . GLN C 1 358 ? 83.547  90.594  24.571  1.00 101.42 ? 358 GLN C C  1 
ATOM 5792  O O  . GLN C 1 358 ? 82.663  91.251  25.123  1.00 101.42 ? 358 GLN C O  1 
ATOM 5793  N N  . LYS C 1 359 ? 84.663  91.117  24.052  1.00 109.20 ? 359 LYS C N  1 
ATOM 5794  C CA . LYS C 1 359 ? 84.947  92.548  23.943  1.00 109.20 ? 359 LYS C CA 1 
ATOM 5795  C C  . LYS C 1 359 ? 84.932  93.215  25.312  1.00 109.20 ? 359 LYS C C  1 
ATOM 5796  O O  . LYS C 1 359 ? 84.015  93.983  25.616  1.00 109.20 ? 359 LYS C O  1 
ATOM 5797  N N  . ASP C 1 360 ? 85.926  92.894  26.141  1.00 103.02 ? 360 ASP C N  1 
ATOM 5798  C CA . ASP C 1 360 ? 85.961  93.316  27.534  1.00 103.02 ? 360 ASP C CA 1 
ATOM 5799  C C  . ASP C 1 360 ? 86.065  94.831  27.664  1.00 103.02 ? 360 ASP C C  1 
ATOM 5800  O O  . ASP C 1 360 ? 86.557  95.532  26.776  1.00 103.02 ? 360 ASP C O  1 
ATOM 5801  N N  . VAL C 1 361 ? 85.595  95.332  28.794  1.00 91.24  ? 361 VAL C N  1 
ATOM 5802  C CA . VAL C 1 361 ? 85.535  96.759  29.019  1.00 91.24  ? 361 VAL C CA 1 
ATOM 5803  C C  . VAL C 1 361 ? 86.888  97.230  29.521  1.00 91.24  ? 361 VAL C C  1 
ATOM 5804  O O  . VAL C 1 361 ? 87.681  96.472  30.087  1.00 91.24  ? 361 VAL C O  1 
ATOM 5805  N N  . LYS C 1 362 ? 87.176  98.497  29.259  1.00 81.01  ? 362 LYS C N  1 
ATOM 5806  C CA . LYS C 1 362 ? 88.329  99.158  29.851  1.00 81.01  ? 362 LYS C CA 1 
ATOM 5807  C C  . LYS C 1 362 ? 88.005  100.530 30.406  1.00 81.01  ? 362 LYS C C  1 
ATOM 5808  O O  . LYS C 1 362 ? 88.761  101.026 31.247  1.00 81.01  ? 362 LYS C O  1 
ATOM 5809  N N  . HIS C 1 363 ? 86.920  101.161 29.976  1.00 72.62  ? 363 HIS C N  1 
ATOM 5810  C CA . HIS C 1 363 ? 86.532  102.478 30.442  1.00 72.62  ? 363 HIS C CA 1 
ATOM 5811  C C  . HIS C 1 363 ? 85.199  102.378 31.169  1.00 72.62  ? 363 HIS C C  1 
ATOM 5812  O O  . HIS C 1 363 ? 84.441  101.425 30.987  1.00 72.62  ? 363 HIS C O  1 
ATOM 5813  N N  . LEU C 1 364 ? 84.927  103.357 32.021  1.00 58.68  ? 364 LEU C N  1 
ATOM 5814  C CA . LEU C 1 364 ? 83.651  103.440 32.712  1.00 58.68  ? 364 LEU C CA 1 
ATOM 5815  C C  . LEU C 1 364 ? 83.093  104.842 32.574  1.00 58.68  ? 364 LEU C C  1 
ATOM 5816  O O  . LEU C 1 364 ? 83.745  105.751 32.063  1.00 58.68  ? 364 LEU C O  1 
ATOM 5817  N N  . ALA C 1 365 ? 81.870  105.010 33.064  1.00 62.93  ? 365 ALA C N  1 
ATOM 5818  C CA . ALA C 1 365 ? 81.180  106.290 32.976  1.00 62.93  ? 365 ALA C CA 1 
ATOM 5819  C C  . ALA C 1 365 ? 80.169  106.322 34.110  1.00 62.93  ? 365 ALA C C  1 
ATOM 5820  O O  . ALA C 1 365 ? 79.137  105.651 34.040  1.00 62.93  ? 365 ALA C O  1 
ATOM 5821  N N  . ILE C 1 366 ? 80.469  107.089 35.142  1.00 64.60  ? 366 ILE C N  1 
ATOM 5822  C CA . ILE C 1 366 ? 79.669  107.090 36.353  1.00 64.60  ? 366 ILE C CA 1 
ATOM 5823  C C  . ILE C 1 366 ? 78.894  108.391 36.409  1.00 64.60  ? 366 ILE C C  1 
ATOM 5824  O O  . ILE C 1 366 ? 79.441  109.448 36.732  1.00 64.60  ? 366 ILE C O  1 
ATOM 5825  N N  . LEU C 1 367 ? 77.613  108.299 36.112  1.00 74.62  ? 367 LEU C N  1 
ATOM 5826  C CA . LEU C 1 367 ? 76.752  109.459 35.987  1.00 74.62  ? 367 LEU C CA 1 
ATOM 5827  C C  . LEU C 1 367 ? 76.262  109.848 37.371  1.00 74.62  ? 367 LEU C C  1 
ATOM 5828  O O  . LEU C 1 367 ? 75.303  109.268 37.882  1.00 74.62  ? 367 LEU C O  1 
ATOM 5829  N N  . GLY C 1 368 ? 76.919  110.824 37.980  1.00 81.09  ? 368 GLY C N  1 
ATOM 5830  C CA . GLY C 1 368 ? 76.469  111.304 39.269  1.00 81.09  ? 368 GLY C CA 1 
ATOM 5831  C C  . GLY C 1 368 ? 77.401  110.973 40.413  1.00 81.09  ? 368 GLY C C  1 
ATOM 5832  O O  . GLY C 1 368 ? 77.700  109.804 40.662  1.00 81.09  ? 368 GLY C O  1 
ATOM 5833  N N  . ALA C 1 369 ? 77.856  111.998 41.126  1.00 85.18  ? 369 ALA C N  1 
ATOM 5834  C CA . ALA C 1 369 ? 78.671  111.811 42.317  1.00 85.18  ? 369 ALA C CA 1 
ATOM 5835  C C  . ALA C 1 369 ? 77.763  111.498 43.496  1.00 85.18  ? 369 ALA C C  1 
ATOM 5836  O O  . ALA C 1 369 ? 76.576  111.203 43.342  1.00 85.18  ? 369 ALA C O  1 
ATOM 5837  N N  . GLY C 1 370 ? 78.308  111.558 44.700  1.00 82.55  ? 370 GLY C N  1 
ATOM 5838  C CA . GLY C 1 370 ? 77.486  111.319 45.863  1.00 82.55  ? 370 GLY C CA 1 
ATOM 5839  C C  . GLY C 1 370 ? 78.024  110.204 46.723  1.00 82.55  ? 370 GLY C C  1 
ATOM 5840  O O  . GLY C 1 370 ? 79.209  110.192 47.060  1.00 82.55  ? 370 GLY C O  1 
ATOM 5841  N N  . LEU C 1 371 ? 77.167  109.255 47.077  1.00 75.94  ? 371 LEU C N  1 
ATOM 5842  C CA . LEU C 1 371 ? 77.572  108.166 47.949  1.00 75.94  ? 371 LEU C CA 1 
ATOM 5843  C C  . LEU C 1 371 ? 77.672  106.833 47.237  1.00 75.94  ? 371 LEU C C  1 
ATOM 5844  O O  . LEU C 1 371 ? 78.496  106.004 47.615  1.00 75.94  ? 371 LEU C O  1 
ATOM 5845  N N  . MET C 1 372 ? 76.882  106.613 46.202  1.00 68.28  ? 372 MET C N  1 
ATOM 5846  C CA . MET C 1 372 ? 77.090  105.419 45.405  1.00 68.28  ? 372 MET C CA 1 
ATOM 5847  C C  . MET C 1 372 ? 78.145  105.611 44.335  1.00 68.28  ? 372 MET C C  1 
ATOM 5848  O O  . MET C 1 372 ? 78.999  104.742 44.163  1.00 68.28  ? 372 MET C O  1 
ATOM 5849  N N  . GLY C 1 373 ? 78.104  106.724 43.617  1.00 70.54  ? 373 GLY C N  1 
ATOM 5850  C CA . GLY C 1 373 ? 78.960  106.921 42.466  1.00 70.54  ? 373 GLY C CA 1 
ATOM 5851  C C  . GLY C 1 373 ? 80.423  106.998 42.825  1.00 70.54  ? 373 GLY C C  1 
ATOM 5852  O O  . GLY C 1 373 ? 81.232  106.203 42.337  1.00 70.54  ? 373 GLY C O  1 
ATOM 5853  N N  . ALA C 1 374 ? 80.757  107.925 43.725  1.00 70.68  ? 374 ALA C N  1 
ATOM 5854  C CA . ALA C 1 374 ? 82.088  107.944 44.316  1.00 70.68  ? 374 ALA C CA 1 
ATOM 5855  C C  . ALA C 1 374 ? 82.335  106.685 45.122  1.00 70.68  ? 374 ALA C C  1 
ATOM 5856  O O  . ALA C 1 374 ? 83.475  106.211 45.199  1.00 70.68  ? 374 ALA C O  1 
ATOM 5857  N N  . GLY C 1 375 ? 81.270  106.107 45.670  1.00 64.95  ? 375 GLY C N  1 
ATOM 5858  C CA . GLY C 1 375 ? 81.390  104.830 46.336  1.00 64.95  ? 375 GLY C CA 1 
ATOM 5859  C C  . GLY C 1 375 ? 81.849  103.718 45.411  1.00 64.95  ? 375 GLY C C  1 
ATOM 5860  O O  . GLY C 1 375 ? 82.854  103.063 45.683  1.00 64.95  ? 375 GLY C O  1 
ATOM 5861  N N  . ILE C 1 376 ? 81.145  103.495 44.297  1.00 62.03  ? 376 ILE C N  1 
ATOM 5862  C CA . ILE C 1 376 ? 81.579  102.381 43.462  1.00 62.03  ? 376 ILE C CA 1 
ATOM 5863  C C  . ILE C 1 376 ? 82.844  102.739 42.712  1.00 62.03  ? 376 ILE C C  1 
ATOM 5864  O O  . ILE C 1 376 ? 83.555  101.840 42.264  1.00 62.03  ? 376 ILE C O  1 
ATOM 5865  N N  . ALA C 1 377 ? 83.148  104.027 42.576  1.00 64.12  ? 377 ALA C N  1 
ATOM 5866  C CA . ALA C 1 377 ? 84.452  104.410 42.066  1.00 64.12  ? 377 ALA C CA 1 
ATOM 5867  C C  . ALA C 1 377 ? 85.560  104.018 43.026  1.00 64.12  ? 377 ALA C C  1 
ATOM 5868  O O  . ALA C 1 377 ? 86.655  103.676 42.580  1.00 64.12  ? 377 ALA C O  1 
ATOM 5869  N N  . GLN C 1 378 ? 85.289  104.037 44.338  1.00 62.45  ? 378 GLN C N  1 
ATOM 5870  C CA . GLN C 1 378 ? 86.290  103.671 45.341  1.00 62.45  ? 378 GLN C CA 1 
ATOM 5871  C C  . GLN C 1 378 ? 86.759  102.227 45.208  1.00 62.45  ? 378 GLN C C  1 
ATOM 5872  O O  . GLN C 1 378 ? 87.894  101.922 45.583  1.00 62.45  ? 378 GLN C O  1 
ATOM 5873  N N  . VAL C 1 379 ? 85.951  101.343 44.636  1.00 65.13  ? 379 VAL C N  1 
ATOM 5874  C CA . VAL C 1 379 ? 86.354  99.958  44.477  1.00 65.13  ? 379 VAL C CA 1 
ATOM 5875  C C  . VAL C 1 379 ? 86.699  99.627  43.029  1.00 65.13  ? 379 VAL C C  1 
ATOM 5876  O O  . VAL C 1 379 ? 87.556  98.763  42.793  1.00 65.13  ? 379 VAL C O  1 
ATOM 5877  N N  . SER C 1 380 ? 86.109  100.315 42.053  1.00 72.81  ? 380 SER C N  1 
ATOM 5878  C CA . SER C 1 380 ? 86.305  99.986  40.649  1.00 72.81  ? 380 SER C CA 1 
ATOM 5879  C C  . SER C 1 380 ? 87.463  100.735 40.022  1.00 72.81  ? 380 SER C C  1 
ATOM 5880  O O  . SER C 1 380 ? 87.507  100.856 38.794  1.00 72.81  ? 380 SER C O  1 
ATOM 5881  N N  . VAL C 1 381 ? 88.401  101.245 40.814  1.00 67.05  ? 381 VAL C N  1 
ATOM 5882  C CA . VAL C 1 381 ? 89.472  102.040 40.257  1.00 67.05  ? 381 VAL C CA 1 
ATOM 5883  C C  . VAL C 1 381 ? 90.837  101.380 40.417  1.00 67.05  ? 381 VAL C C  1 
ATOM 5884  O O  . VAL C 1 381 ? 91.703  101.577 39.559  1.00 67.05  ? 381 VAL C O  1 
ATOM 5885  N N  . ASP C 1 382 ? 91.042  100.549 41.438  1.00 74.78  ? 382 ASP C N  1 
ATOM 5886  C CA . ASP C 1 382 ? 92.401  100.133 41.737  1.00 74.78  ? 382 ASP C CA 1 
ATOM 5887  C C  . ASP C 1 382 ? 92.912  99.048  40.804  1.00 74.78  ? 382 ASP C C  1 
ATOM 5888  O O  . ASP C 1 382 ? 94.058  99.125  40.359  1.00 74.78  ? 382 ASP C O  1 
ATOM 5889  N N  . LYS C 1 383 ? 92.079  98.075  40.457  1.00 73.96  ? 383 LYS C N  1 
ATOM 5890  C CA . LYS C 1 383 ? 92.530  96.901  39.729  1.00 73.96  ? 383 LYS C CA 1 
ATOM 5891  C C  . LYS C 1 383 ? 92.319  97.029  38.234  1.00 73.96  ? 383 LYS C C  1 
ATOM 5892  O O  . LYS C 1 383 ? 91.966  96.052  37.562  1.00 73.96  ? 383 LYS C O  1 
ATOM 5893  N N  . GLY C 1 384 ? 92.527  98.224  37.701  1.00 82.76  ? 384 GLY C N  1 
ATOM 5894  C CA . GLY C 1 384 ? 92.672  98.396  36.275  1.00 82.76  ? 384 GLY C CA 1 
ATOM 5895  C C  . GLY C 1 384 ? 91.389  98.643  35.525  1.00 82.76  ? 384 GLY C C  1 
ATOM 5896  O O  . GLY C 1 384 ? 91.035  97.885  34.621  1.00 82.76  ? 384 GLY C O  1 
ATOM 5897  N N  . LEU C 1 385 ? 90.671  99.691  35.906  1.00 74.21  ? 385 LEU C N  1 
ATOM 5898  C CA . LEU C 1 385 ? 89.524  100.157 35.144  1.00 74.21  ? 385 LEU C CA 1 
ATOM 5899  C C  . LEU C 1 385 ? 89.609  101.671 35.065  1.00 74.21  ? 385 LEU C C  1 
ATOM 5900  O O  . LEU C 1 385 ? 89.612  102.341 36.100  1.00 74.21  ? 385 LEU C O  1 
ATOM 5901  N N  . LYS C 1 386 ? 89.711  102.207 33.853  1.00 68.48  ? 386 LYS C N  1 
ATOM 5902  C CA . LYS C 1 386 ? 89.638  103.651 33.670  1.00 68.48  ? 386 LYS C CA 1 
ATOM 5903  C C  . LYS C 1 386 ? 88.225  104.148 33.948  1.00 68.48  ? 386 LYS C C  1 
ATOM 5904  O O  . LYS C 1 386 ? 87.245  103.580 33.459  1.00 68.48  ? 386 LYS C O  1 
ATOM 5905  N N  . THR C 1 387 ? 88.111  105.200 34.761  1.00 59.12  ? 387 THR C N  1 
ATOM 5906  C CA . THR C 1 387 ? 86.798  105.715 35.134  1.00 59.12  ? 387 THR C CA 1 
ATOM 5907  C C  . THR C 1 387 ? 86.707  107.214 34.912  1.00 59.12  ? 387 THR C C  1 
ATOM 5908  O O  . THR C 1 387 ? 87.698  107.937 35.051  1.00 59.12  ? 387 THR C O  1 
ATOM 5909  N N  . ILE C 1 388 ? 85.501  107.675 34.601  1.00 59.33  ? 388 ILE C N  1 
ATOM 5910  C CA . ILE C 1 388 ? 85.170  109.089 34.519  1.00 59.33  ? 388 ILE C CA 1 
ATOM 5911  C C  . ILE C 1 388 ? 83.946  109.327 35.387  1.00 59.33  ? 388 ILE C C  1 
ATOM 5912  O O  . ILE C 1 388 ? 82.947  108.612 35.266  1.00 59.33  ? 388 ILE C O  1 
ATOM 5913  N N  . LEU C 1 389 ? 84.015  110.326 36.257  1.00 61.73  ? 389 LEU C N  1 
ATOM 5914  C CA . LEU C 1 389 ? 82.995  110.544 37.277  1.00 61.73  ? 389 LEU C CA 1 
ATOM 5915  C C  . LEU C 1 389 ? 82.234  111.834 36.965  1.00 61.73  ? 389 LEU C C  1 
ATOM 5916  O O  . LEU C 1 389 ? 82.730  112.937 37.201  1.00 61.73  ? 389 LEU C O  1 
ATOM 5917  N N  . LYS C 1 390 ? 81.015  111.687 36.458  1.00 80.75  ? 390 LYS C N  1 
ATOM 5918  C CA . LYS C 1 390 ? 80.157  112.823 36.156  1.00 80.75  ? 390 LYS C CA 1 
ATOM 5919  C C  . LYS C 1 390 ? 79.611  113.453 37.430  1.00 80.75  ? 390 LYS C C  1 
ATOM 5920  O O  . LYS C 1 390 ? 79.267  112.759 38.385  1.00 80.75  ? 390 LYS C O  1 
ATOM 5921  N N  . ASP C 1 391 ? 79.538  114.778 37.437  1.00 97.84  ? 391 ASP C N  1 
ATOM 5922  C CA . ASP C 1 391 ? 78.884  115.524 38.497  1.00 97.84  ? 391 ASP C CA 1 
ATOM 5923  C C  . ASP C 1 391 ? 78.101  116.646 37.827  1.00 97.84  ? 391 ASP C C  1 
ATOM 5924  O O  . ASP C 1 391 ? 78.191  116.849 36.615  1.00 97.84  ? 391 ASP C O  1 
ATOM 5925  N N  . ALA C 1 392 ? 77.305  117.361 38.619  1.00 109.66 ? 392 ALA C N  1 
ATOM 5926  C CA . ALA C 1 392 ? 76.596  118.536 38.127  1.00 109.66 ? 392 ALA C CA 1 
ATOM 5927  C C  . ALA C 1 392 ? 77.444  119.797 38.263  1.00 109.66 ? 392 ALA C C  1 
ATOM 5928  O O  . ALA C 1 392 ? 77.742  120.462 37.268  1.00 109.66 ? 392 ALA C O  1 
ATOM 5929  N N  . THR C 1 393 ? 77.828  120.143 39.486  1.00 102.35 ? 393 THR C N  1 
ATOM 5930  C CA . THR C 1 393 ? 78.701  121.280 39.731  1.00 102.35 ? 393 THR C CA 1 
ATOM 5931  C C  . THR C 1 393 ? 79.933  120.805 40.483  1.00 102.35 ? 393 THR C C  1 
ATOM 5932  O O  . THR C 1 393 ? 80.044  119.639 40.865  1.00 102.35 ? 393 THR C O  1 
ATOM 5933  N N  . LEU C 1 394 ? 80.862  121.739 40.700  1.00 88.52  ? 394 LEU C N  1 
ATOM 5934  C CA . LEU C 1 394 ? 82.073  121.452 41.456  1.00 88.52  ? 394 LEU C CA 1 
ATOM 5935  C C  . LEU C 1 394 ? 81.780  121.120 42.903  1.00 88.52  ? 394 LEU C C  1 
ATOM 5936  O O  . LEU C 1 394 ? 82.503  120.319 43.506  1.00 88.52  ? 394 LEU C O  1 
ATOM 5937  N N  . THR C 1 395 ? 80.694  121.669 43.444  1.00 103.58 ? 395 THR C N  1 
ATOM 5938  C CA . THR C 1 395 ? 80.330  121.662 44.854  1.00 103.58 ? 395 THR C CA 1 
ATOM 5939  C C  . THR C 1 395 ? 80.123  120.269 45.438  1.00 103.58 ? 395 THR C C  1 
ATOM 5940  O O  . THR C 1 395 ? 79.961  120.160 46.657  1.00 103.58 ? 395 THR C O  1 
ATOM 5941  N N  . ALA C 1 396 ? 80.110  119.210 44.626  1.00 92.29  ? 396 ALA C N  1 
ATOM 5942  C CA . ALA C 1 396 ? 79.993  117.855 45.140  1.00 92.29  ? 396 ALA C CA 1 
ATOM 5943  C C  . ALA C 1 396 ? 81.152  116.948 44.732  1.00 92.29  ? 396 ALA C C  1 
ATOM 5944  O O  . ALA C 1 396 ? 81.166  115.779 45.120  1.00 92.29  ? 396 ALA C O  1 
ATOM 5945  N N  . LEU C 1 397 ? 82.125  117.438 43.963  1.00 79.79  ? 397 LEU C N  1 
ATOM 5946  C CA . LEU C 1 397 ? 83.305  116.618 43.708  1.00 79.79  ? 397 LEU C CA 1 
ATOM 5947  C C  . LEU C 1 397 ? 84.260  116.610 44.882  1.00 79.79  ? 397 LEU C C  1 
ATOM 5948  O O  . LEU C 1 397 ? 85.022  115.649 45.040  1.00 79.79  ? 397 LEU C O  1 
ATOM 5949  N N  . ASP C 1 398 ? 84.257  117.679 45.673  1.00 86.80  ? 398 ASP C N  1 
ATOM 5950  C CA . ASP C 1 398 ? 84.970  117.705 46.941  1.00 86.80  ? 398 ASP C CA 1 
ATOM 5951  C C  . ASP C 1 398 ? 84.459  116.641 47.899  1.00 86.80  ? 398 ASP C C  1 
ATOM 5952  O O  . ASP C 1 398 ? 85.248  116.006 48.602  1.00 86.80  ? 398 ASP C O  1 
ATOM 5953  N N  . ARG C 1 399 ? 83.150  116.419 47.928  1.00 81.27  ? 399 ARG C N  1 
ATOM 5954  C CA . ARG C 1 399 ? 82.613  115.279 48.648  1.00 81.27  ? 399 ARG C CA 1 
ATOM 5955  C C  . ARG C 1 399 ? 82.827  113.995 47.859  1.00 81.27  ? 399 ARG C C  1 
ATOM 5956  O O  . ARG C 1 399 ? 82.758  112.904 48.430  1.00 81.27  ? 399 ARG C O  1 
ATOM 5957  N N  . GLY C 1 400 ? 83.151  114.111 46.575  1.00 70.72  ? 400 GLY C N  1 
ATOM 5958  C CA . GLY C 1 400 ? 83.454  112.966 45.746  1.00 70.72  ? 400 GLY C CA 1 
ATOM 5959  C C  . GLY C 1 400 ? 84.816  112.344 45.966  1.00 70.72  ? 400 GLY C C  1 
ATOM 5960  O O  . GLY C 1 400 ? 84.907  111.236 46.502  1.00 70.72  ? 400 GLY C O  1 
ATOM 5961  N N  . GLN C 1 401 ? 85.882  113.055 45.594  1.00 69.87  ? 401 GLN C N  1 
ATOM 5962  C CA . GLN C 1 401 ? 87.207  112.443 45.587  1.00 69.87  ? 401 GLN C CA 1 
ATOM 5963  C C  . GLN C 1 401 ? 87.713  112.194 47.002  1.00 69.87  ? 401 GLN C C  1 
ATOM 5964  O O  . GLN C 1 401 ? 88.439  111.223 47.246  1.00 69.87  ? 401 GLN C O  1 
ATOM 5965  N N  . GLN C 1 402 ? 87.251  112.985 47.967  1.00 65.75  ? 402 GLN C N  1 
ATOM 5966  C CA . GLN C 1 402 ? 87.538  112.701 49.368  1.00 65.75  ? 402 GLN C CA 1 
ATOM 5967  C C  . GLN C 1 402 ? 86.872  111.442 49.904  1.00 65.75  ? 402 GLN C C  1 
ATOM 5968  O O  . GLN C 1 402 ? 86.961  111.207 51.107  1.00 65.75  ? 402 GLN C O  1 
ATOM 5969  N N  . GLN C 1 403 ? 86.160  110.663 49.098  1.00 65.10  ? 403 GLN C N  1 
ATOM 5970  C CA . GLN C 1 403 ? 85.935  109.266 49.469  1.00 65.10  ? 403 GLN C CA 1 
ATOM 5971  C C  . GLN C 1 403 ? 87.045  108.431 48.841  1.00 65.10  ? 403 GLN C C  1 
ATOM 5972  O O  . GLN C 1 403 ? 87.810  107.775 49.554  1.00 65.10  ? 403 GLN C O  1 
ATOM 5973  N N  . VAL C 1 404 ? 87.217  108.548 47.518  1.00 58.53  ? 404 VAL C N  1 
ATOM 5974  C CA . VAL C 1 404 ? 88.145  107.697 46.774  1.00 58.53  ? 404 VAL C CA 1 
ATOM 5975  C C  . VAL C 1 404 ? 89.597  107.982 47.121  1.00 58.53  ? 404 VAL C C  1 
ATOM 5976  O O  . VAL C 1 404 ? 90.493  107.235 46.722  1.00 58.53  ? 404 VAL C O  1 
ATOM 5977  N N  . PHE C 1 405 ? 89.857  109.039 47.869  1.00 57.89  ? 405 PHE C N  1 
ATOM 5978  C CA . PHE C 1 405 ? 91.155  109.227 48.476  1.00 57.89  ? 405 PHE C CA 1 
ATOM 5979  C C  . PHE C 1 405 ? 91.180  108.786 49.935  1.00 57.89  ? 405 PHE C C  1 
ATOM 5980  O O  . PHE C 1 405 ? 92.097  108.063 50.331  1.00 57.89  ? 405 PHE C O  1 
ATOM 5981  N N  . LYS C 1 406 ? 90.167  109.159 50.732  1.00 60.71  ? 406 LYS C N  1 
ATOM 5982  C CA . LYS C 1 406 ? 90.218  108.887 52.170  1.00 60.71  ? 406 LYS C CA 1 
ATOM 5983  C C  . LYS C 1 406 ? 90.060  107.413 52.463  1.00 60.71  ? 406 LYS C C  1 
ATOM 5984  O O  . LYS C 1 406 ? 90.793  106.862 53.288  1.00 60.71  ? 406 LYS C O  1 
ATOM 5985  N N  . GLY C 1 407 ? 89.161  106.751 51.761  1.00 60.03  ? 407 GLY C N  1 
ATOM 5986  C CA . GLY C 1 407 ? 89.100  105.314 51.826  1.00 60.03  ? 407 GLY C CA 1 
ATOM 5987  C C  . GLY C 1 407 ? 90.154  104.594 51.020  1.00 60.03  ? 407 GLY C C  1 
ATOM 5988  O O  . GLY C 1 407 ? 90.033  103.387 50.799  1.00 60.03  ? 407 GLY C O  1 
ATOM 5989  N N  . LEU C 1 408 ? 91.193  105.292 50.580  1.00 56.81  ? 408 LEU C N  1 
ATOM 5990  C CA . LEU C 1 408 ? 92.293  104.678 49.864  1.00 56.81  ? 408 LEU C CA 1 
ATOM 5991  C C  . LEU C 1 408 ? 93.593  104.727 50.645  1.00 56.81  ? 408 LEU C C  1 
ATOM 5992  O O  . LEU C 1 408 ? 94.283  103.714 50.730  1.00 56.81  ? 408 LEU C O  1 
ATOM 5993  N N  . ASN C 1 409 ? 93.948  105.876 51.227  1.00 62.64  ? 409 ASN C N  1 
ATOM 5994  C CA . ASN C 1 409 ? 95.259  105.974 51.859  1.00 62.64  ? 409 ASN C CA 1 
ATOM 5995  C C  . ASN C 1 409 ? 95.290  105.298 53.217  1.00 62.64  ? 409 ASN C C  1 
ATOM 5996  O O  . ASN C 1 409 ? 96.373  105.017 53.735  1.00 62.64  ? 409 ASN C O  1 
ATOM 5997  N N  . ASP C 1 410 ? 94.128  105.031 53.813  1.00 66.49  ? 410 ASP C N  1 
ATOM 5998  C CA . ASP C 1 410 ? 94.104  104.107 54.939  1.00 66.49  ? 410 ASP C CA 1 
ATOM 5999  C C  . ASP C 1 410 ? 94.613  102.735 54.521  1.00 66.49  ? 410 ASP C C  1 
ATOM 6000  O O  . ASP C 1 410 ? 95.286  102.052 55.303  1.00 66.49  ? 410 ASP C O  1 
ATOM 6001  N N  . LYS C 1 411 ? 94.340  102.361 53.269  1.00 62.35  ? 411 LYS C N  1 
ATOM 6002  C CA . LYS C 1 411 ? 94.935  101.192 52.644  1.00 62.35  ? 411 LYS C CA 1 
ATOM 6003  C C  . LYS C 1 411 ? 96.456  101.261 52.637  1.00 62.35  ? 411 LYS C C  1 
ATOM 6004  O O  . LYS C 1 411 ? 97.116  100.239 52.841  1.00 62.35  ? 411 LYS C O  1 
ATOM 6005  N N  . VAL C 1 412 ? 97.041  102.445 52.420  1.00 61.78  ? 412 VAL C N  1 
ATOM 6006  C CA . VAL C 1 412 ? 98.495  102.523 52.525  1.00 61.78  ? 412 VAL C CA 1 
ATOM 6007  C C  . VAL C 1 412 ? 98.904  102.848 53.953  1.00 61.78  ? 412 VAL C C  1 
ATOM 6008  O O  . VAL C 1 412 ? 100.089 102.727 54.300  1.00 61.78  ? 412 VAL C O  1 
ATOM 6009  N N  . LYS C 1 413 ? 97.954  103.217 54.811  1.00 66.21  ? 413 LYS C N  1 
ATOM 6010  C CA . LYS C 1 413 ? 98.263  103.379 56.222  1.00 66.21  ? 413 LYS C CA 1 
ATOM 6011  C C  . LYS C 1 413 ? 98.346  102.034 56.924  1.00 66.21  ? 413 LYS C C  1 
ATOM 6012  O O  . LYS C 1 413 ? 99.046  101.912 57.932  1.00 66.21  ? 413 LYS C O  1 
ATOM 6013  N N  . LYS C 1 414 ? 97.686  101.014 56.393  1.00 68.46  ? 414 LYS C N  1 
ATOM 6014  C CA . LYS C 1 414 ? 97.845  99.657  56.886  1.00 68.46  ? 414 LYS C CA 1 
ATOM 6015  C C  . LYS C 1 414 ? 98.879  98.872  56.097  1.00 68.46  ? 414 LYS C C  1 
ATOM 6016  O O  . LYS C 1 414 ? 98.925  97.645  56.218  1.00 68.46  ? 414 LYS C O  1 
ATOM 6017  N N  . LYS C 1 415 ? 99.673  99.559  55.267  1.00 62.81  ? 415 LYS C N  1 
ATOM 6018  C CA . LYS C 1 415 ? 100.825 99.004  54.538  1.00 62.81  ? 415 LYS C CA 1 
ATOM 6019  C C  . LYS C 1 415 ? 100.430 97.888  53.572  1.00 62.81  ? 415 LYS C C  1 
ATOM 6020  O O  . LYS C 1 415 ? 101.246 97.032  53.231  1.00 62.81  ? 415 LYS C O  1 
ATOM 6021  N N  . ALA C 1 416 ? 99.183  97.901  53.111  1.00 65.34  ? 416 ALA C N  1 
ATOM 6022  C CA . ALA C 1 416 ? 98.726  96.909  52.153  1.00 65.34  ? 416 ALA C CA 1 
ATOM 6023  C C  . ALA C 1 416 ? 99.090  97.258  50.719  1.00 65.34  ? 416 ALA C C  1 
ATOM 6024  O O  . ALA C 1 416 ? 98.953  96.405  49.839  1.00 65.34  ? 416 ALA C O  1 
ATOM 6025  N N  . LEU C 1 417 ? 99.527  98.488  50.459  1.00 61.97  ? 417 LEU C N  1 
ATOM 6026  C CA . LEU C 1 417 ? 99.980  98.902  49.140  1.00 61.97  ? 417 LEU C CA 1 
ATOM 6027  C C  . LEU C 1 417 ? 101.229 99.752  49.298  1.00 61.97  ? 417 LEU C C  1 
ATOM 6028  O O  . LEU C 1 417 ? 101.621 100.120 50.405  1.00 61.97  ? 417 LEU C O  1 
ATOM 6029  N N  . THR C 1 418 ? 101.868 100.054 48.178  1.00 52.01  ? 418 THR C N  1 
ATOM 6030  C CA . THR C 1 418 ? 102.993 100.964 48.235  1.00 52.01  ? 418 THR C CA 1 
ATOM 6031  C C  . THR C 1 418 ? 102.490 102.398 48.213  1.00 52.01  ? 418 THR C C  1 
ATOM 6032  O O  . THR C 1 418 ? 101.354 102.677 47.828  1.00 52.01  ? 418 THR C O  1 
ATOM 6033  N N  . SER C 1 419 ? 103.362 103.319 48.620  1.00 48.77  ? 419 SER C N  1 
ATOM 6034  C CA . SER C 1 419 ? 102.981 104.723 48.626  1.00 48.77  ? 419 SER C CA 1 
ATOM 6035  C C  . SER C 1 419 ? 102.914 105.290 47.223  1.00 48.77  ? 419 SER C C  1 
ATOM 6036  O O  . SER C 1 419 ? 102.233 106.291 46.995  1.00 48.77  ? 419 SER C O  1 
ATOM 6037  N N  . PHE C 1 420 ? 103.611 104.674 46.274  1.00 46.63  ? 420 PHE C N  1 
ATOM 6038  C CA . PHE C 1 420 ? 103.610 105.214 44.924  1.00 46.63  ? 420 PHE C CA 1 
ATOM 6039  C C  . PHE C 1 420 ? 102.391 104.764 44.138  1.00 46.63  ? 420 PHE C C  1 
ATOM 6040  O O  . PHE C 1 420 ? 101.720 105.587 43.509  1.00 46.63  ? 420 PHE C O  1 
ATOM 6041  N N  . GLU C 1 421 ? 102.110 103.458 44.143  1.00 52.61  ? 421 GLU C N  1 
ATOM 6042  C CA . GLU C 1 421 ? 101.045 102.909 43.308  1.00 52.61  ? 421 GLU C CA 1 
ATOM 6043  C C  . GLU C 1 421 ? 99.678  103.406 43.739  1.00 52.61  ? 421 GLU C C  1 
ATOM 6044  O O  . GLU C 1 421 ? 98.748  103.423 42.922  1.00 52.61  ? 421 GLU C O  1 
ATOM 6045  N N  . ARG C 1 422 ? 99.549  103.770 45.023  1.00 50.23  ? 422 ARG C N  1 
ATOM 6046  C CA . ARG C 1 422 ? 98.465  104.591 45.558  1.00 50.23  ? 422 ARG C CA 1 
ATOM 6047  C C  . ARG C 1 422 ? 98.068  105.711 44.620  1.00 50.23  ? 422 ARG C C  1 
ATOM 6048  O O  . ARG C 1 422 ? 96.897  105.873 44.257  1.00 50.23  ? 422 ARG C O  1 
ATOM 6049  N N  . ASP C 1 423 ? 99.050  106.480 44.197  1.00 51.69  ? 423 ASP C N  1 
ATOM 6050  C CA . ASP C 1 423 ? 98.720  107.711 43.525  1.00 51.69  ? 423 ASP C CA 1 
ATOM 6051  C C  . ASP C 1 423 ? 98.468  107.490 42.041  1.00 51.69  ? 423 ASP C C  1 
ATOM 6052  O O  . ASP C 1 423 ? 97.705  108.247 41.436  1.00 51.69  ? 423 ASP C O  1 
ATOM 6053  N N  . SER C 1 424 ? 99.037  106.440 41.442  1.00 47.56  ? 424 SER C N  1 
ATOM 6054  C CA . SER C 1 424 ? 98.635  106.087 40.082  1.00 47.56  ? 424 SER C CA 1 
ATOM 6055  C C  . SER C 1 424 ? 97.215  105.543 40.060  1.00 47.56  ? 424 SER C C  1 
ATOM 6056  O O  . SER C 1 424 ? 96.451  105.815 39.122  1.00 47.56  ? 424 SER C O  1 
ATOM 6057  N N  . ILE C 1 425 ? 96.851  104.776 41.095  1.00 49.08  ? 425 ILE C N  1 
ATOM 6058  C CA . ILE C 1 425 ? 95.475  104.321 41.273  1.00 49.08  ? 425 ILE C CA 1 
ATOM 6059  C C  . ILE C 1 425 ? 94.527  105.502 41.404  1.00 49.08  ? 425 ILE C C  1 
ATOM 6060  O O  . ILE C 1 425 ? 93.448  105.517 40.800  1.00 49.08  ? 425 ILE C O  1 
ATOM 6061  N N  . PHE C 1 426 ? 94.928  106.524 42.157  1.00 50.69  ? 426 PHE C N  1 
ATOM 6062  C CA . PHE C 1 426 ? 94.097  107.718 42.263  1.00 50.69  ? 426 PHE C CA 1 
ATOM 6063  C C  . PHE C 1 426 ? 94.004  108.462 40.939  1.00 50.69  ? 426 PHE C C  1 
ATOM 6064  O O  . PHE C 1 426 ? 92.951  109.009 40.605  1.00 50.69  ? 426 PHE C O  1 
ATOM 6065  N N  . SER C 1 427 ? 95.094  108.515 40.186  1.00 47.57  ? 427 SER C N  1 
ATOM 6066  C CA . SER C 1 427 ? 95.090  109.259 38.937  1.00 47.57  ? 427 SER C CA 1 
ATOM 6067  C C  . SER C 1 427 ? 94.531  108.466 37.768  1.00 47.57  ? 427 SER C C  1 
ATOM 6068  O O  . SER C 1 427 ? 94.515  108.985 36.650  1.00 47.57  ? 427 SER C O  1 
ATOM 6069  N N  . ASN C 1 428 ? 94.087  107.225 37.976  1.00 49.06  ? 428 ASN C N  1 
ATOM 6070  C CA . ASN C 1 428 ? 93.259  106.600 36.950  1.00 49.06  ? 428 ASN C CA 1 
ATOM 6071  C C  . ASN C 1 428 ? 91.855  107.180 36.899  1.00 49.06  ? 428 ASN C C  1 
ATOM 6072  O O  . ASN C 1 428 ? 91.128  106.918 35.942  1.00 49.06  ? 428 ASN C O  1 
ATOM 6073  N N  . LEU C 1 429 ? 91.455  107.932 37.913  1.00 48.78  ? 429 LEU C N  1 
ATOM 6074  C CA . LEU C 1 429 ? 90.106  108.468 38.046  1.00 48.78  ? 429 LEU C CA 1 
ATOM 6075  C C  . LEU C 1 429 ? 90.121  109.950 37.733  1.00 48.78  ? 429 LEU C C  1 
ATOM 6076  O O  . LEU C 1 429 ? 90.632  110.744 38.521  1.00 48.78  ? 429 LEU C O  1 
ATOM 6077  N N  . THR C 1 430 ? 89.560  110.325 36.597  1.00 64.49  ? 430 THR C N  1 
ATOM 6078  C CA . THR C 1 430 ? 89.362  111.728 36.282  1.00 64.49  ? 430 THR C CA 1 
ATOM 6079  C C  . THR C 1 430 ? 87.915  112.097 36.535  1.00 64.49  ? 430 THR C C  1 
ATOM 6080  O O  . THR C 1 430 ? 87.017  111.265 36.413  1.00 64.49  ? 430 THR C O  1 
ATOM 6081  N N  . GLY C 1 431 ? 87.693  113.352 36.887  1.00 66.50  ? 431 GLY C N  1 
ATOM 6082  C CA . GLY C 1 431 ? 86.339  113.812 37.052  1.00 66.50  ? 431 GLY C CA 1 
ATOM 6083  C C  . GLY C 1 431 ? 86.017  114.910 36.071  1.00 66.50  ? 431 GLY C C  1 
ATOM 6084  O O  . GLY C 1 431 ? 86.549  116.016 36.180  1.00 66.50  ? 431 GLY C O  1 
ATOM 6085  N N  . GLN C 1 432 ? 85.151  114.626 35.107  1.00 73.19  ? 432 GLN C N  1 
ATOM 6086  C CA . GLN C 1 432 ? 84.734  115.662 34.186  1.00 73.19  ? 432 GLN C CA 1 
ATOM 6087  C C  . GLN C 1 432 ? 83.678  116.539 34.831  1.00 73.19  ? 432 GLN C C  1 
ATOM 6088  O O  . GLN C 1 432 ? 83.240  116.318 35.962  1.00 73.19  ? 432 GLN C O  1 
ATOM 6089  N N  . LEU C 1 433 ? 83.260  117.551 34.090  1.00 78.02  ? 433 LEU C N  1 
ATOM 6090  C CA . LEU C 1 433 ? 82.143  118.384 34.494  1.00 78.02  ? 433 LEU C CA 1 
ATOM 6091  C C  . LEU C 1 433 ? 80.964  118.247 33.554  1.00 78.02  ? 433 LEU C C  1 
ATOM 6092  O O  . LEU C 1 433 ? 79.835  118.066 34.020  1.00 78.02  ? 433 LEU C O  1 
ATOM 6093  N N  . ASP C 1 434 ? 81.178  118.317 32.240  1.00 91.80  ? 434 ASP C N  1 
ATOM 6094  C CA . ASP C 1 434 ? 79.992  118.244 31.407  1.00 91.80  ? 434 ASP C CA 1 
ATOM 6095  C C  . ASP C 1 434 ? 79.923  116.989 30.553  1.00 91.80  ? 434 ASP C C  1 
ATOM 6096  O O  . ASP C 1 434 ? 79.217  116.049 30.923  1.00 91.80  ? 434 ASP C O  1 
ATOM 6097  N N  . TYR C 1 435 ? 80.691  116.910 29.450  1.00 92.12  ? 435 TYR C N  1 
ATOM 6098  C CA . TYR C 1 435 ? 80.564  115.739 28.584  1.00 92.12  ? 435 TYR C CA 1 
ATOM 6099  C C  . TYR C 1 435 ? 81.803  115.322 27.808  1.00 92.12  ? 435 TYR C C  1 
ATOM 6100  O O  . TYR C 1 435 ? 81.717  114.323 27.091  1.00 92.12  ? 435 TYR C O  1 
ATOM 6101  N N  . GLN C 1 436 ? 82.934  116.012 27.892  1.00 97.40  ? 436 GLN C N  1 
ATOM 6102  C CA . GLN C 1 436 ? 83.966  115.828 26.868  1.00 97.40  ? 436 GLN C CA 1 
ATOM 6103  C C  . GLN C 1 436 ? 84.780  114.563 27.147  1.00 97.40  ? 436 GLN C C  1 
ATOM 6104  O O  . GLN C 1 436 ? 85.740  114.563 27.916  1.00 97.40  ? 436 GLN C O  1 
ATOM 6105  N N  . GLY C 1 437 ? 84.386  113.463 26.513  1.00 97.37  ? 437 GLY C N  1 
ATOM 6106  C CA . GLY C 1 437 ? 85.111  112.223 26.685  1.00 97.37  ? 437 GLY C CA 1 
ATOM 6107  C C  . GLY C 1 437 ? 84.270  110.962 26.700  1.00 97.37  ? 437 GLY C C  1 
ATOM 6108  O O  . GLY C 1 437 ? 84.814  109.857 26.783  1.00 97.37  ? 437 GLY C O  1 
ATOM 6109  N N  . PHE C 1 438 ? 82.951  111.094 26.601  1.00 96.44  ? 438 PHE C N  1 
ATOM 6110  C CA . PHE C 1 438 ? 82.099  109.913 26.564  1.00 96.44  ? 438 PHE C CA 1 
ATOM 6111  C C  . PHE C 1 438 ? 82.076  109.235 25.207  1.00 96.44  ? 438 PHE C C  1 
ATOM 6112  O O  . PHE C 1 438 ? 81.433  108.194 25.067  1.00 96.44  ? 438 PHE C O  1 
ATOM 6113  N N  . GLU C 1 439 ? 82.749  109.794 24.203  1.00 100.58 ? 439 GLU C N  1 
ATOM 6114  C CA . GLU C 1 439 ? 82.873  109.089 22.938  1.00 100.58 ? 439 GLU C CA 1 
ATOM 6115  C C  . GLU C 1 439 ? 83.837  107.922 23.046  1.00 100.58 ? 439 GLU C C  1 
ATOM 6116  O O  . GLU C 1 439 ? 83.798  107.006 22.223  1.00 100.58 ? 439 GLU C O  1 
ATOM 6117  N N  . LYS C 1 440 ? 84.716  107.942 24.035  1.00 89.68  ? 440 LYS C N  1 
ATOM 6118  C CA . LYS C 1 440 ? 85.632  106.837 24.244  1.00 89.68  ? 440 LYS C CA 1 
ATOM 6119  C C  . LYS C 1 440 ? 85.067  105.795 25.187  1.00 89.68  ? 440 LYS C C  1 
ATOM 6120  O O  . LYS C 1 440 ? 85.626  104.700 25.288  1.00 89.68  ? 440 LYS C O  1 
ATOM 6121  N N  . ALA C 1 441 ? 83.972  106.112 25.866  1.00 87.12  ? 441 ALA C N  1 
ATOM 6122  C CA . ALA C 1 441 ? 83.424  105.228 26.878  1.00 87.12  ? 441 ALA C CA 1 
ATOM 6123  C C  . ALA C 1 441 ? 82.709  104.045 26.241  1.00 87.12  ? 441 ALA C C  1 
ATOM 6124  O O  . ALA C 1 441 ? 82.227  104.114 25.111  1.00 87.12  ? 441 ALA C O  1 
ATOM 6125  N N  . ASP C 1 442 ? 82.641  102.951 26.990  1.00 84.73  ? 442 ASP C N  1 
ATOM 6126  C CA . ASP C 1 442 ? 81.986  101.747 26.520  1.00 84.73  ? 442 ASP C CA 1 
ATOM 6127  C C  . ASP C 1 442 ? 81.049  101.121 27.542  1.00 84.73  ? 442 ASP C C  1 
ATOM 6128  O O  . ASP C 1 442 ? 80.420  100.104 27.232  1.00 84.73  ? 442 ASP C O  1 
ATOM 6129  N N  . MET C 1 443 ? 80.932  101.690 28.739  1.00 74.54  ? 443 MET C N  1 
ATOM 6130  C CA . MET C 1 443 ? 79.996  101.171 29.726  1.00 74.54  ? 443 MET C CA 1 
ATOM 6131  C C  . MET C 1 443 ? 79.627  102.303 30.668  1.00 74.54  ? 443 MET C C  1 
ATOM 6132  O O  . MET C 1 443 ? 80.508  102.975 31.204  1.00 74.54  ? 443 MET C O  1 
ATOM 6133  N N  . VAL C 1 444 ? 78.331  102.509 30.864  1.00 71.61  ? 444 VAL C N  1 
ATOM 6134  C CA . VAL C 1 444 ? 77.802  103.659 31.584  1.00 71.61  ? 444 VAL C CA 1 
ATOM 6135  C C  . VAL C 1 444 ? 77.020  103.148 32.782  1.00 71.61  ? 444 VAL C C  1 
ATOM 6136  O O  . VAL C 1 444 ? 76.227  102.211 32.651  1.00 71.61  ? 444 VAL C O  1 
ATOM 6137  N N  . ILE C 1 445 ? 77.230  103.761 33.946  1.00 70.68  ? 445 ILE C N  1 
ATOM 6138  C CA . ILE C 1 445 ? 76.444  103.454 35.135  1.00 70.68  ? 445 ILE C CA 1 
ATOM 6139  C C  . ILE C 1 445 ? 75.868  104.746 35.695  1.00 70.68  ? 445 ILE C C  1 
ATOM 6140  O O  . ILE C 1 445 ? 76.616  105.642 36.103  1.00 70.68  ? 445 ILE C O  1 
ATOM 6141  N N  . GLU C 1 446 ? 74.546  104.837 35.712  1.00 82.74  ? 446 GLU C N  1 
ATOM 6142  C CA . GLU C 1 446 ? 73.840  105.929 36.354  1.00 82.74  ? 446 GLU C CA 1 
ATOM 6143  C C  . GLU C 1 446 ? 73.990  105.831 37.865  1.00 82.74  ? 446 GLU C C  1 
ATOM 6144  O O  . GLU C 1 446 ? 74.093  104.742 38.424  1.00 82.74  ? 446 GLU C O  1 
ATOM 6145  N N  . ALA C 1 447 ? 74.030  106.991 38.528  1.00 87.97  ? 447 ALA C N  1 
ATOM 6146  C CA . ALA C 1 447 ? 74.097  107.018 39.984  1.00 87.97  ? 447 ALA C CA 1 
ATOM 6147  C C  . ALA C 1 447 ? 73.251  108.126 40.601  1.00 87.97  ? 447 ALA C C  1 
ATOM 6148  O O  . ALA C 1 447 ? 73.454  108.459 41.774  1.00 87.97  ? 447 ALA C O  1 
ATOM 6149  N N  . VAL C 1 448 ? 72.325  108.716 39.845  1.00 97.27  ? 448 VAL C N  1 
ATOM 6150  C CA . VAL C 1 448 ? 71.571  109.859 40.343  1.00 97.27  ? 448 VAL C CA 1 
ATOM 6151  C C  . VAL C 1 448 ? 70.540  109.363 41.350  1.00 97.27  ? 448 VAL C C  1 
ATOM 6152  O O  . VAL C 1 448 ? 70.121  108.198 41.309  1.00 97.27  ? 448 VAL C O  1 
ATOM 6153  N N  . PHE C 1 449 ? 70.187  110.232 42.305  1.00 119.68 ? 449 PHE C N  1 
ATOM 6154  C CA . PHE C 1 449 ? 69.145  109.935 43.280  1.00 119.68 ? 449 PHE C CA 1 
ATOM 6155  C C  . PHE C 1 449 ? 67.831  109.605 42.591  1.00 119.68 ? 449 PHE C C  1 
ATOM 6156  O O  . PHE C 1 449 ? 67.437  110.252 41.617  1.00 119.68 ? 449 PHE C O  1 
ATOM 6157  N N  . GLU C 1 450 ? 67.153  108.595 43.132  1.00 119.34 ? 450 GLU C N  1 
ATOM 6158  C CA . GLU C 1 450 ? 66.133  107.865 42.394  1.00 119.34 ? 450 GLU C CA 1 
ATOM 6159  C C  . GLU C 1 450 ? 64.891  108.714 42.147  1.00 119.34 ? 450 GLU C C  1 
ATOM 6160  O O  . GLU C 1 450 ? 64.364  109.359 43.057  1.00 119.34 ? 450 GLU C O  1 
ATOM 6161  N N  . ASP C 1 451 ? 64.454  108.714 40.891  1.00 119.64 ? 451 ASP C N  1 
ATOM 6162  C CA . ASP C 1 451 ? 63.210  109.315 40.448  1.00 119.64 ? 451 ASP C CA 1 
ATOM 6163  C C  . ASP C 1 451 ? 62.861  108.672 39.116  1.00 119.64 ? 451 ASP C C  1 
ATOM 6164  O O  . ASP C 1 451 ? 63.740  108.260 38.357  1.00 119.64 ? 451 ASP C O  1 
ATOM 6165  N N  . LEU C 1 452 ? 61.569  108.604 38.829  1.00 107.44 ? 452 LEU C N  1 
ATOM 6166  C CA . LEU C 1 452 ? 61.103  108.043 37.568  1.00 107.44 ? 452 LEU C CA 1 
ATOM 6167  C C  . LEU C 1 452 ? 61.071  109.087 36.469  1.00 107.44 ? 452 LEU C C  1 
ATOM 6168  O O  . LEU C 1 452 ? 61.171  108.749 35.288  1.00 107.44 ? 452 LEU C O  1 
ATOM 6169  N N  . SER C 1 453 ? 60.975  110.350 36.838  1.00 111.57 ? 453 SER C N  1 
ATOM 6170  C CA . SER C 1 453 ? 60.756  111.428 35.897  1.00 111.57 ? 453 SER C CA 1 
ATOM 6171  C C  . SER C 1 453 ? 62.032  112.051 35.374  1.00 111.57 ? 453 SER C C  1 
ATOM 6172  O O  . SER C 1 453 ? 62.156  112.230 34.164  1.00 111.57 ? 453 SER C O  1 
ATOM 6173  N N  . LEU C 1 454 ? 62.980  112.386 36.246  1.00 113.11 ? 454 LEU C N  1 
ATOM 6174  C CA . LEU C 1 454 ? 64.173  113.089 35.794  1.00 113.11 ? 454 LEU C CA 1 
ATOM 6175  C C  . LEU C 1 454 ? 65.121  112.161 35.048  1.00 113.11 ? 454 LEU C C  1 
ATOM 6176  O O  . LEU C 1 454 ? 65.698  112.551 34.029  1.00 113.11 ? 454 LEU C O  1 
ATOM 6177  N N  . LYS C 1 455 ? 65.258  110.923 35.518  1.00 110.08 ? 455 LYS C N  1 
ATOM 6178  C CA . LYS C 1 455 ? 66.148  109.960 34.870  1.00 110.08 ? 455 LYS C CA 1 
ATOM 6179  C C  . LYS C 1 455 ? 65.614  109.540 33.516  1.00 110.08 ? 455 LYS C C  1 
ATOM 6180  O O  . LYS C 1 455 ? 66.396  109.205 32.619  1.00 110.08 ? 455 LYS C O  1 
ATOM 6181  N N  . HIS C 1 456 ? 64.287  109.566 33.365  1.00 121.60 ? 456 HIS C N  1 
ATOM 6182  C CA . HIS C 1 456 ? 63.627  109.359 32.083  1.00 121.60 ? 456 HIS C CA 1 
ATOM 6183  C C  . HIS C 1 456 ? 64.134  110.326 31.024  1.00 121.60 ? 456 HIS C C  1 
ATOM 6184  O O  . HIS C 1 456 ? 64.280  109.946 29.861  1.00 121.60 ? 456 HIS C O  1 
ATOM 6185  N N  . ARG C 1 457 ? 64.434  111.566 31.410  1.00 117.74 ? 457 ARG C N  1 
ATOM 6186  C CA . ARG C 1 457 ? 65.084  112.522 30.524  1.00 117.74 ? 457 ARG C CA 1 
ATOM 6187  C C  . ARG C 1 457 ? 66.592  112.343 30.468  1.00 117.74 ? 457 ARG C C  1 
ATOM 6188  O O  . ARG C 1 457 ? 67.185  112.494 29.390  1.00 117.74 ? 457 ARG C O  1 
ATOM 6189  N N  . VAL C 1 458 ? 67.203  112.017 31.610  1.00 113.03 ? 458 VAL C N  1 
ATOM 6190  C CA . VAL C 1 458 ? 68.660  111.934 31.732  1.00 113.03 ? 458 VAL C CA 1 
ATOM 6191  C C  . VAL C 1 458 ? 69.227  110.846 30.827  1.00 113.03 ? 458 VAL C C  1 
ATOM 6192  O O  . VAL C 1 458 ? 70.285  111.011 30.203  1.00 113.03 ? 458 VAL C O  1 
ATOM 6193  N N  . LEU C 1 459 ? 68.486  109.757 30.679  1.00 114.84 ? 459 LEU C N  1 
ATOM 6194  C CA . LEU C 1 459 ? 68.852  108.755 29.694  1.00 114.84 ? 459 LEU C CA 1 
ATOM 6195  C C  . LEU C 1 459 ? 68.666  109.265 28.271  1.00 114.84 ? 459 LEU C C  1 
ATOM 6196  O O  . LEU C 1 459 ? 69.312  108.753 27.349  1.00 114.84 ? 459 LEU C O  1 
ATOM 6197  N N  . LYS C 1 460 ? 67.815  110.272 28.070  1.00 118.77 ? 460 LYS C N  1 
ATOM 6198  C CA . LYS C 1 460 ? 67.577  110.764 26.722  1.00 118.77 ? 460 LYS C CA 1 
ATOM 6199  C C  . LYS C 1 460 ? 68.552  111.859 26.313  1.00 118.77 ? 460 LYS C C  1 
ATOM 6200  O O  . LYS C 1 460 ? 68.674  112.137 25.115  1.00 118.77 ? 460 LYS C O  1 
ATOM 6201  N N  . GLU C 1 461 ? 69.240  112.512 27.254  1.00 114.80 ? 461 GLU C N  1 
ATOM 6202  C CA . GLU C 1 461 ? 70.265  113.442 26.776  1.00 114.80 ? 461 GLU C CA 1 
ATOM 6203  C C  . GLU C 1 461 ? 71.671  112.861 26.823  1.00 114.80 ? 461 GLU C C  1 
ATOM 6204  O O  . GLU C 1 461 ? 72.583  113.436 26.225  1.00 114.80 ? 461 GLU C O  1 
ATOM 6205  N N  . VAL C 1 462 ? 71.867  111.734 27.497  1.00 108.15 ? 462 VAL C N  1 
ATOM 6206  C CA . VAL C 1 462 ? 73.187  111.124 27.615  1.00 108.15 ? 462 VAL C CA 1 
ATOM 6207  C C  . VAL C 1 462 ? 73.078  109.828 26.822  1.00 108.15 ? 462 VAL C C  1 
ATOM 6208  O O  . VAL C 1 462 ? 73.489  108.749 27.262  1.00 108.15 ? 462 VAL C O  1 
ATOM 6209  N N  . GLU C 1 463 ? 72.386  109.903 25.695  1.00 115.72 ? 463 GLU C N  1 
ATOM 6210  C CA . GLU C 1 463 ? 72.415  108.807 24.745  1.00 115.72 ? 463 GLU C CA 1 
ATOM 6211  C C  . GLU C 1 463 ? 73.182  109.140 23.478  1.00 115.72 ? 463 GLU C C  1 
ATOM 6212  O O  . GLU C 1 463 ? 73.642  108.221 22.794  1.00 115.72 ? 463 GLU C O  1 
ATOM 6213  N N  . ALA C 1 464 ? 73.325  110.420 23.148  1.00 109.68 ? 464 ALA C N  1 
ATOM 6214  C CA . ALA C 1 464 ? 73.784  110.775 21.812  1.00 109.68 ? 464 ALA C CA 1 
ATOM 6215  C C  . ALA C 1 464 ? 75.302  110.828 21.700  1.00 109.68 ? 464 ALA C C  1 
ATOM 6216  O O  . ALA C 1 464 ? 75.839  110.637 20.606  1.00 109.68 ? 464 ALA C O  1 
ATOM 6217  N N  . VAL C 1 465 ? 76.011  111.069 22.798  1.00 105.63 ? 465 VAL C N  1 
ATOM 6218  C CA . VAL C 1 465 ? 77.449  111.302 22.715  1.00 105.63 ? 465 VAL C CA 1 
ATOM 6219  C C  . VAL C 1 465 ? 78.162  110.017 23.143  1.00 105.63 ? 465 VAL C C  1 
ATOM 6220  O O  . VAL C 1 465 ? 79.330  110.016 23.550  1.00 105.63 ? 465 VAL C O  1 
ATOM 6221  N N  . ILE C 1 466 ? 77.469  108.894 22.996  1.00 104.10 ? 466 ILE C N  1 
ATOM 6222  C CA . ILE C 1 466 ? 77.976  107.596 23.426  1.00 104.10 ? 466 ILE C CA 1 
ATOM 6223  C C  . ILE C 1 466 ? 77.911  106.639 22.243  1.00 104.10 ? 466 ILE C C  1 
ATOM 6224  O O  . ILE C 1 466 ? 76.916  106.649 21.507  1.00 104.10 ? 466 ILE C O  1 
ATOM 6225  N N  . PRO C 1 467 ? 78.956  105.819 21.996  1.00 104.85 ? 467 PRO C N  1 
ATOM 6226  C CA . PRO C 1 467 ? 78.915  104.858 20.882  1.00 104.85 ? 467 PRO C CA 1 
ATOM 6227  C C  . PRO C 1 467 ? 77.848  103.780 21.022  1.00 104.85 ? 467 PRO C C  1 
ATOM 6228  O O  . PRO C 1 467 ? 77.183  103.675 22.057  1.00 104.85 ? 467 PRO C O  1 
ATOM 6229  N N  . ASP C 1 468 ? 77.686  102.960 19.988  1.00 111.46 ? 468 ASP C N  1 
ATOM 6230  C CA . ASP C 1 468 ? 76.604  101.988 19.983  1.00 111.46 ? 468 ASP C CA 1 
ATOM 6231  C C  . ASP C 1 468 ? 76.964  100.667 20.639  1.00 111.46 ? 468 ASP C C  1 
ATOM 6232  O O  . ASP C 1 468 ? 76.059  99.935  21.048  1.00 111.46 ? 468 ASP C O  1 
ATOM 6233  N N  . HIS C 1 469 ? 78.244  100.333 20.753  1.00 104.22 ? 469 HIS C N  1 
ATOM 6234  C CA . HIS C 1 469 ? 78.626  99.099  21.438  1.00 104.22 ? 469 HIS C CA 1 
ATOM 6235  C C  . HIS C 1 469 ? 78.878  99.352  22.922  1.00 104.22 ? 469 HIS C C  1 
ATOM 6236  O O  . HIS C 1 469 ? 79.868  98.925  23.509  1.00 104.22 ? 469 HIS C O  1 
ATOM 6237  N N  . CYS C 1 470 ? 77.933  100.012 23.561  1.00 94.89  ? 470 CYS C N  1 
ATOM 6238  C CA . CYS C 1 470 ? 78.083  100.427 24.938  1.00 94.89  ? 470 CYS C CA 1 
ATOM 6239  C C  . CYS C 1 470 ? 77.184  99.584  25.824  1.00 94.89  ? 470 CYS C C  1 
ATOM 6240  O O  . CYS C 1 470 ? 76.555  98.625  25.375  1.00 94.89  ? 470 CYS C O  1 
ATOM 6241  N N  . ILE C 1 471 ? 77.140  99.942  27.099  1.00 78.32  ? 471 ILE C N  1 
ATOM 6242  C CA . ILE C 1 471 ? 76.173  99.401  28.041  1.00 78.32  ? 471 ILE C CA 1 
ATOM 6243  C C  . ILE C 1 471 ? 75.670  100.547 28.890  1.00 78.32  ? 471 ILE C C  1 
ATOM 6244  O O  . ILE C 1 471 ? 76.461  101.246 29.528  1.00 78.32  ? 471 ILE C O  1 
ATOM 6245  N N  . PHE C 1 472 ? 74.369  100.745 28.901  1.00 75.61  ? 472 PHE C N  1 
ATOM 6246  C CA . PHE C 1 472 ? 73.753  101.603 29.888  1.00 75.61  ? 472 PHE C CA 1 
ATOM 6247  C C  . PHE C 1 472 ? 73.333  100.738 31.065  1.00 75.61  ? 472 PHE C C  1 
ATOM 6248  O O  . PHE C 1 472 ? 72.870  99.613  30.879  1.00 75.61  ? 472 PHE C O  1 
ATOM 6249  N N  . ALA C 1 473 ? 73.530  101.241 32.278  1.00 75.44  ? 473 ALA C N  1 
ATOM 6250  C CA . ALA C 1 473 ? 73.057  100.524 33.448  1.00 75.44  ? 473 ALA C CA 1 
ATOM 6251  C C  . ALA C 1 473 ? 72.725  101.540 34.525  1.00 75.44  ? 473 ALA C C  1 
ATOM 6252  O O  . ALA C 1 473 ? 73.140  102.695 34.451  1.00 75.44  ? 473 ALA C O  1 
ATOM 6253  N N  . SER C 1 474 ? 71.975  101.105 35.534  1.00 78.44  ? 474 SER C N  1 
ATOM 6254  C CA . SER C 1 474 ? 71.544  102.029 36.572  1.00 78.44  ? 474 SER C CA 1 
ATOM 6255  C C  . SER C 1 474 ? 71.434  101.302 37.898  1.00 78.44  ? 474 SER C C  1 
ATOM 6256  O O  . SER C 1 474 ? 71.054  100.130 37.940  1.00 78.44  ? 474 SER C O  1 
ATOM 6257  N N  . ASN C 1 475 ? 71.770  101.998 38.975  1.00 78.23  ? 475 ASN C N  1 
ATOM 6258  C CA . ASN C 1 475 ? 71.576  101.462 40.318  1.00 78.23  ? 475 ASN C CA 1 
ATOM 6259  C C  . ASN C 1 475 ? 70.295  102.007 40.945  1.00 78.23  ? 475 ASN C C  1 
ATOM 6260  O O  . ASN C 1 475 ? 70.298  102.680 41.973  1.00 78.23  ? 475 ASN C O  1 
ATOM 6261  N N  . THR C 1 476 ? 69.175  101.694 40.306  1.00 81.21  ? 476 THR C N  1 
ATOM 6262  C CA . THR C 1 476 ? 67.892  101.922 40.947  1.00 81.21  ? 476 THR C CA 1 
ATOM 6263  C C  . THR C 1 476 ? 67.733  100.992 42.137  1.00 81.21  ? 476 THR C C  1 
ATOM 6264  O O  . THR C 1 476 ? 68.372  99.941  42.227  1.00 81.21  ? 476 THR C O  1 
ATOM 6265  N N  . SER C 1 477 ? 66.898  101.404 43.071  1.00 86.47  ? 477 SER C N  1 
ATOM 6266  C CA . SER C 1 477 ? 66.553  100.542 44.179  1.00 86.47  ? 477 SER C CA 1 
ATOM 6267  C C  . SER C 1 477 ? 65.081  100.182 44.191  1.00 86.47  ? 477 SER C C  1 
ATOM 6268  O O  . SER C 1 477 ? 64.724  99.116  44.700  1.00 86.47  ? 477 SER C O  1 
ATOM 6269  N N  . ALA C 1 478 ? 64.227  101.029 43.627  1.00 104.31 ? 478 ALA C N  1 
ATOM 6270  C CA . ALA C 1 478 ? 62.790  100.815 43.703  1.00 104.31 ? 478 ALA C CA 1 
ATOM 6271  C C  . ALA C 1 478 ? 62.157  100.595 42.339  1.00 104.31 ? 478 ALA C C  1 
ATOM 6272  O O  . ALA C 1 478 ? 61.539  99.548  42.115  1.00 104.31 ? 478 ALA C O  1 
ATOM 6273  N N  . LEU C 1 479 ? 62.307  101.508 41.442  1.00 103.43 ? 479 LEU C N  1 
ATOM 6274  C CA . LEU C 1 479 ? 61.441  101.369 40.286  1.00 103.43 ? 479 LEU C CA 1 
ATOM 6275  C C  . LEU C 1 479 ? 62.119  100.522 39.218  1.00 103.43 ? 479 LEU C C  1 
ATOM 6276  O O  . LEU C 1 479 ? 63.328  100.638 39.003  1.00 103.43 ? 479 LEU C O  1 
ATOM 6277  N N  . PRO C 1 480 ? 61.357  99.649  38.553  1.00 105.31 ? 480 PRO C N  1 
ATOM 6278  C CA . PRO C 1 480 ? 61.977  98.660  37.664  1.00 105.31 ? 480 PRO C CA 1 
ATOM 6279  C C  . PRO C 1 480 ? 62.507  99.236  36.363  1.00 105.31 ? 480 PRO C C  1 
ATOM 6280  O O  . PRO C 1 480 ? 62.191  100.366 35.981  1.00 105.31 ? 480 PRO C O  1 
ATOM 6281  N N  . ILE C 1 481 ? 63.304  98.434  35.668  1.00 99.60  ? 481 ILE C N  1 
ATOM 6282  C CA . ILE C 1 481 ? 63.993  98.883  34.470  1.00 99.60  ? 481 ILE C CA 1 
ATOM 6283  C C  . ILE C 1 481 ? 63.149  98.701  33.218  1.00 99.60  ? 481 ILE C C  1 
ATOM 6284  O O  . ILE C 1 481 ? 63.242  99.528  32.298  1.00 99.60  ? 481 ILE C O  1 
ATOM 6285  N N  . SER C 1 482 ? 62.268  97.699  33.186  1.00 101.86 ? 482 SER C N  1 
ATOM 6286  C CA . SER C 1 482 ? 61.403  97.497  32.028  1.00 101.86 ? 482 SER C CA 1 
ATOM 6287  C C  . SER C 1 482 ? 60.402  98.632  31.854  1.00 101.86 ? 482 SER C C  1 
ATOM 6288  O O  . SER C 1 482 ? 59.865  98.821  30.759  1.00 101.86 ? 482 SER C O  1 
ATOM 6289  N N  . GLU C 1 483 ? 60.151  99.402  32.905  1.00 105.31 ? 483 GLU C N  1 
ATOM 6290  C CA . GLU C 1 483 ? 59.435  100.655 32.776  1.00 105.31 ? 483 GLU C CA 1 
ATOM 6291  C C  . GLU C 1 483 ? 60.273  101.739 32.118  1.00 105.31 ? 483 GLU C C  1 
ATOM 6292  O O  . GLU C 1 483 ? 59.709  102.679 31.550  1.00 105.31 ? 483 GLU C O  1 
ATOM 6293  N N  . ILE C 1 484 ? 61.599  101.632 32.168  1.00 106.35 ? 484 ILE C N  1 
ATOM 6294  C CA . ILE C 1 484 ? 62.459  102.620 31.533  1.00 106.35 ? 484 ILE C CA 1 
ATOM 6295  C C  . ILE C 1 484 ? 63.334  102.030 30.439  1.00 106.35 ? 484 ILE C C  1 
ATOM 6296  O O  . ILE C 1 484 ? 64.208  102.741 29.918  1.00 106.35 ? 484 ILE C O  1 
ATOM 6297  N N  . ALA C 1 485 ? 63.161  100.758 30.083  1.00 111.85 ? 485 ALA C N  1 
ATOM 6298  C CA . ALA C 1 485 ? 63.919  100.141 29.003  1.00 111.85 ? 485 ALA C CA 1 
ATOM 6299  C C  . ALA C 1 485 ? 63.243  100.310 27.649  1.00 111.85 ? 485 ALA C C  1 
ATOM 6300  O O  . ALA C 1 485 ? 63.770  99.847  26.634  1.00 111.85 ? 485 ALA C O  1 
ATOM 6301  N N  . ALA C 1 486 ? 62.091  100.973 27.606  1.00 112.49 ? 486 ALA C N  1 
ATOM 6302  C CA . ALA C 1 486 ? 61.364  101.164 26.360  1.00 112.49 ? 486 ALA C CA 1 
ATOM 6303  C C  . ALA C 1 486 ? 61.470  102.582 25.826  1.00 112.49 ? 486 ALA C C  1 
ATOM 6304  O O  . ALA C 1 486 ? 60.621  102.995 25.030  1.00 112.49 ? 486 ALA C O  1 
ATOM 6305  N N  . VAL C 1 487 ? 62.487  103.335 26.233  1.00 116.34 ? 487 VAL C N  1 
ATOM 6306  C CA . VAL C 1 487 ? 62.597  104.744 25.904  1.00 116.34 ? 487 VAL C CA 1 
ATOM 6307  C C  . VAL C 1 487 ? 63.765  105.014 24.966  1.00 116.34 ? 487 VAL C C  1 
ATOM 6308  O O  . VAL C 1 487 ? 63.629  105.771 24.001  1.00 116.34 ? 487 VAL C O  1 
ATOM 6309  N N  . SER C 1 488 ? 64.907  104.382 25.215  1.00 121.00 ? 488 SER C N  1 
ATOM 6310  C CA . SER C 1 488 ? 66.149  104.729 24.543  1.00 121.00 ? 488 SER C CA 1 
ATOM 6311  C C  . SER C 1 488 ? 66.163  104.258 23.090  1.00 121.00 ? 488 SER C C  1 
ATOM 6312  O O  . SER C 1 488 ? 65.247  103.586 22.607  1.00 121.00 ? 488 SER C O  1 
ATOM 6313  N N  . LYS C 1 489 ? 67.232  104.641 22.388  1.00 118.01 ? 489 LYS C N  1 
ATOM 6314  C CA . LYS C 1 489 ? 67.417  104.209 21.009  1.00 118.01 ? 489 LYS C CA 1 
ATOM 6315  C C  . LYS C 1 489 ? 67.731  102.726 20.930  1.00 118.01 ? 489 LYS C C  1 
ATOM 6316  O O  . LYS C 1 489 ? 67.142  102.011 20.113  1.00 118.01 ? 489 LYS C O  1 
ATOM 6317  N N  . ARG C 1 490 ? 68.640  102.246 21.765  1.00 110.82 ? 490 ARG C N  1 
ATOM 6318  C CA . ARG C 1 490 ? 68.950  100.830 21.791  1.00 110.82 ? 490 ARG C CA 1 
ATOM 6319  C C  . ARG C 1 490 ? 68.141  100.142 22.879  1.00 110.82 ? 490 ARG C C  1 
ATOM 6320  O O  . ARG C 1 490 ? 68.014  100.668 23.994  1.00 110.82 ? 490 ARG C O  1 
ATOM 6321  N N  . PRO C 1 491 ? 67.488  99.050  22.560  1.00 92.57  ? 491 PRO C N  1 
ATOM 6322  C CA . PRO C 1 491 ? 66.669  98.371  23.567  1.00 92.57  ? 491 PRO C CA 1 
ATOM 6323  C C  . PRO C 1 491 ? 67.418  97.307  24.346  1.00 92.57  ? 491 PRO C C  1 
ATOM 6324  O O  . PRO C 1 491 ? 67.059  96.991  25.482  1.00 92.57  ? 491 PRO C O  1 
ATOM 6325  N N  . GLU C 1 492 ? 68.467  96.752  23.752  1.00 101.13 ? 492 GLU C N  1 
ATOM 6326  C CA . GLU C 1 492 ? 69.045  95.522  24.259  1.00 101.13 ? 492 GLU C CA 1 
ATOM 6327  C C  . GLU C 1 492 ? 70.330  95.739  25.032  1.00 101.13 ? 492 GLU C C  1 
ATOM 6328  O O  . GLU C 1 492 ? 70.780  94.819  25.719  1.00 101.13 ? 492 GLU C O  1 
ATOM 6329  N N  . LYS C 1 493 ? 70.929  96.922  24.940  1.00 89.80  ? 493 LYS C N  1 
ATOM 6330  C CA . LYS C 1 493 ? 72.210  97.189  25.571  1.00 89.80  ? 493 LYS C CA 1 
ATOM 6331  C C  . LYS C 1 493 ? 72.041  97.865  26.920  1.00 89.80  ? 493 LYS C C  1 
ATOM 6332  O O  . LYS C 1 493 ? 72.896  98.656  27.327  1.00 89.80  ? 493 LYS C O  1 
ATOM 6333  N N  . VAL C 1 494 ? 70.940  97.594  27.610  1.00 84.50  ? 494 VAL C N  1 
ATOM 6334  C CA . VAL C 1 494 ? 70.669  98.176  28.913  1.00 84.50  ? 494 VAL C CA 1 
ATOM 6335  C C  . VAL C 1 494 ? 70.415  97.045  29.890  1.00 84.50  ? 494 VAL C C  1 
ATOM 6336  O O  . VAL C 1 494 ? 69.476  96.260  29.713  1.00 84.50  ? 494 VAL C O  1 
ATOM 6337  N N  . ILE C 1 495 ? 71.241  96.963  30.921  1.00 82.18  ? 495 ILE C N  1 
ATOM 6338  C CA . ILE C 1 495 ? 71.002  96.085  32.036  1.00 82.18  ? 495 ILE C CA 1 
ATOM 6339  C C  . ILE C 1 495 ? 70.860  96.942  33.283  1.00 82.18  ? 495 ILE C C  1 
ATOM 6340  O O  . ILE C 1 495 ? 70.796  98.164  33.218  1.00 82.18  ? 495 ILE C O  1 
ATOM 6341  N N  . GLY C 1 496 ? 70.798  96.297  34.436  1.00 78.80  ? 496 GLY C N  1 
ATOM 6342  C CA . GLY C 1 496 ? 70.868  96.981  35.713  1.00 78.80  ? 496 GLY C CA 1 
ATOM 6343  C C  . GLY C 1 496 ? 71.948  96.365  36.584  1.00 78.80  ? 496 GLY C C  1 
ATOM 6344  O O  . GLY C 1 496 ? 72.169  95.155  36.548  1.00 78.80  ? 496 GLY C O  1 
ATOM 6345  N N  . MET C 1 497 ? 72.609  97.212  37.363  1.00 75.70  ? 497 MET C N  1 
ATOM 6346  C CA . MET C 1 497 ? 73.525  96.774  38.409  1.00 75.70  ? 497 MET C CA 1 
ATOM 6347  C C  . MET C 1 497 ? 73.155  97.523  39.671  1.00 75.70  ? 497 MET C C  1 
ATOM 6348  O O  . MET C 1 497 ? 73.342  98.738  39.741  1.00 75.70  ? 497 MET C O  1 
ATOM 6349  N N  . HIS C 1 498 ? 72.641  96.816  40.661  1.00 74.60  ? 498 HIS C N  1 
ATOM 6350  C CA . HIS C 1 498 ? 72.389  97.416  41.957  1.00 74.60  ? 498 HIS C CA 1 
ATOM 6351  C C  . HIS C 1 498 ? 73.515  97.030  42.902  1.00 74.60  ? 498 HIS C C  1 
ATOM 6352  O O  . HIS C 1 498 ? 73.920  95.861  42.961  1.00 74.60  ? 498 HIS C O  1 
ATOM 6353  N N  . TYR C 1 499 ? 74.029  98.015  43.614  1.00 63.98  ? 499 TYR C N  1 
ATOM 6354  C CA . TYR C 1 499 ? 75.069  97.849  44.606  1.00 63.98  ? 499 TYR C CA 1 
ATOM 6355  C C  . TYR C 1 499 ? 74.433  97.826  45.986  1.00 63.98  ? 499 TYR C C  1 
ATOM 6356  O O  . TYR C 1 499 ? 73.216  97.695  46.128  1.00 63.98  ? 499 TYR C O  1 
ATOM 6357  N N  . PHE C 1 500 ? 75.256  97.914  47.021  1.00 66.46  ? 500 PHE C N  1 
ATOM 6358  C CA . PHE C 1 500 ? 74.765  98.091  48.376  1.00 66.46  ? 500 PHE C CA 1 
ATOM 6359  C C  . PHE C 1 500 ? 75.564  99.204  49.037  1.00 66.46  ? 500 PHE C C  1 
ATOM 6360  O O  . PHE C 1 500 ? 76.586  99.637  48.505  1.00 66.46  ? 500 PHE C O  1 
ATOM 6361  N N  . SER C 1 501 ? 75.095  99.676  50.196  1.00 83.17  ? 501 SER C N  1 
ATOM 6362  C CA . SER C 1 501 ? 75.397  101.068 50.522  1.00 83.17  ? 501 SER C CA 1 
ATOM 6363  C C  . SER C 1 501 ? 76.818  101.368 51.032  1.00 83.17  ? 501 SER C C  1 
ATOM 6364  O O  . SER C 1 501 ? 77.490  102.154 50.358  1.00 83.17  ? 501 SER C O  1 
ATOM 6365  N N  . PRO C 1 502 ? 77.372  100.800 52.154  1.00 85.12  ? 502 PRO C N  1 
ATOM 6366  C CA . PRO C 1 502 ? 78.851  100.968 52.166  1.00 85.12  ? 502 PRO C CA 1 
ATOM 6367  C C  . PRO C 1 502 ? 79.542  99.953  51.262  1.00 85.12  ? 502 PRO C C  1 
ATOM 6368  O O  . PRO C 1 502 ? 79.638  98.762  51.528  1.00 85.12  ? 502 PRO C O  1 
ATOM 6369  N N  . VAL C 1 503 ? 80.064  100.480 50.164  1.00 76.37  ? 503 VAL C N  1 
ATOM 6370  C CA . VAL C 1 503 ? 80.529  99.670  49.051  1.00 76.37  ? 503 VAL C CA 1 
ATOM 6371  C C  . VAL C 1 503 ? 81.829  98.942  49.342  1.00 76.37  ? 503 VAL C C  1 
ATOM 6372  O O  . VAL C 1 503 ? 82.155  97.964  48.663  1.00 76.37  ? 503 VAL C O  1 
ATOM 6373  N N  . ASP C 1 504 ? 82.614  99.406  50.306  1.00 88.95  ? 504 ASP C N  1 
ATOM 6374  C CA . ASP C 1 504 ? 83.895  98.763  50.539  1.00 88.95  ? 504 ASP C CA 1 
ATOM 6375  C C  . ASP C 1 504 ? 83.720  97.497  51.358  1.00 88.95  ? 504 ASP C C  1 
ATOM 6376  O O  . ASP C 1 504 ? 84.236  96.436  50.995  1.00 88.95  ? 504 ASP C O  1 
ATOM 6377  N N  . LYS C 1 505 ? 82.974  97.587  52.458  1.00 90.08  ? 505 LYS C N  1 
ATOM 6378  C CA . LYS C 1 505 ? 82.955  96.482  53.408  1.00 90.08  ? 505 LYS C CA 1 
ATOM 6379  C C  . LYS C 1 505 ? 82.148  95.305  52.880  1.00 90.08  ? 505 LYS C C  1 
ATOM 6380  O O  . LYS C 1 505 ? 82.662  94.183  52.833  1.00 90.08  ? 505 LYS C O  1 
ATOM 6381  N N  . MET C 1 506 ? 80.911  95.539  52.438  1.00 86.65  ? 506 MET C N  1 
ATOM 6382  C CA . MET C 1 506 ? 80.126  94.446  51.884  1.00 86.65  ? 506 MET C CA 1 
ATOM 6383  C C  . MET C 1 506 ? 80.644  94.076  50.503  1.00 86.65  ? 506 MET C C  1 
ATOM 6384  O O  . MET C 1 506 ? 81.415  94.812  49.884  1.00 86.65  ? 506 MET C O  1 
ATOM 6385  N N  . GLN C 1 507 ? 80.250  92.897  50.039  1.00 78.52  ? 507 GLN C N  1 
ATOM 6386  C CA . GLN C 1 507 ? 81.065  92.217  49.052  1.00 78.52  ? 507 GLN C CA 1 
ATOM 6387  C C  . GLN C 1 507 ? 80.203  91.592  47.957  1.00 78.52  ? 507 GLN C C  1 
ATOM 6388  O O  . GLN C 1 507 ? 80.558  90.580  47.356  1.00 78.52  ? 507 GLN C O  1 
ATOM 6389  N N  . LEU C 1 508 ? 79.095  92.225  47.597  1.00 73.41  ? 508 LEU C N  1 
ATOM 6390  C CA . LEU C 1 508 ? 78.349  91.660  46.480  1.00 73.41  ? 508 LEU C CA 1 
ATOM 6391  C C  . LEU C 1 508 ? 77.647  92.720  45.658  1.00 73.41  ? 508 LEU C C  1 
ATOM 6392  O O  . LEU C 1 508 ? 77.454  93.858  46.094  1.00 73.41  ? 508 LEU C O  1 
ATOM 6393  N N  . LEU C 1 509 ? 77.285  92.306  44.456  1.00 71.40  ? 509 LEU C N  1 
ATOM 6394  C CA . LEU C 1 509 ? 76.507  93.059  43.496  1.00 71.40  ? 509 LEU C CA 1 
ATOM 6395  C C  . LEU C 1 509 ? 75.177  92.361  43.316  1.00 71.40  ? 509 LEU C C  1 
ATOM 6396  O O  . LEU C 1 509 ? 74.939  91.305  43.906  1.00 71.40  ? 509 LEU C O  1 
ATOM 6397  N N  . GLU C 1 510 ? 74.314  92.943  42.490  1.00 80.54  ? 510 GLU C N  1 
ATOM 6398  C CA . GLU C 1 510 ? 73.192  92.200  41.935  1.00 80.54  ? 510 GLU C CA 1 
ATOM 6399  C C  . GLU C 1 510 ? 72.844  92.728  40.556  1.00 80.54  ? 510 GLU C C  1 
ATOM 6400  O O  . GLU C 1 510 ? 72.925  93.934  40.305  1.00 80.54  ? 510 GLU C O  1 
ATOM 6401  N N  . ILE C 1 511 ? 72.466  91.814  39.672  1.00 75.84  ? 511 ILE C N  1 
ATOM 6402  C CA . ILE C 1 511 ? 72.226  92.110  38.270  1.00 75.84  ? 511 ILE C CA 1 
ATOM 6403  C C  . ILE C 1 511 ? 70.728  92.141  38.017  1.00 75.84  ? 511 ILE C C  1 
ATOM 6404  O O  . ILE C 1 511 ? 69.962  91.347  38.569  1.00 75.84  ? 511 ILE C O  1 
ATOM 6405  N N  . ILE C 1 512 ? 70.316  93.087  37.184  1.00 86.89  ? 512 ILE C N  1 
ATOM 6406  C CA . ILE C 1 512 ? 68.932  93.282  36.804  1.00 86.89  ? 512 ILE C CA 1 
ATOM 6407  C C  . ILE C 1 512 ? 68.843  93.027  35.309  1.00 86.89  ? 512 ILE C C  1 
ATOM 6408  O O  . ILE C 1 512 ? 69.466  93.745  34.517  1.00 86.89  ? 512 ILE C O  1 
ATOM 6409  N N  . THR C 1 513 ? 68.093  91.998  34.922  1.00 97.79  ? 513 THR C N  1 
ATOM 6410  C CA . THR C 1 513 ? 68.083  91.478  33.558  1.00 97.79  ? 513 THR C CA 1 
ATOM 6411  C C  . THR C 1 513 ? 66.675  91.524  32.988  1.00 97.79  ? 513 THR C C  1 
ATOM 6412  O O  . THR C 1 513 ? 65.780  90.826  33.475  1.00 97.79  ? 513 THR C O  1 
ATOM 6413  N N  . THR C 1 514 ? 66.498  92.286  31.916  1.00 105.35 ? 514 THR C N  1 
ATOM 6414  C CA . THR C 1 514 ? 65.200  92.481  31.284  1.00 105.35 ? 514 THR C CA 1 
ATOM 6415  C C  . THR C 1 514 ? 64.830  91.271  30.428  1.00 105.35 ? 514 THR C C  1 
ATOM 6416  O O  . THR C 1 514 ? 65.453  90.208  30.481  1.00 105.35 ? 514 THR C O  1 
ATOM 6417  N N  . GLU C 1 515 ? 63.785  91.436  29.622  1.00 101.67 ? 515 GLU C N  1 
ATOM 6418  C CA . GLU C 1 515 ? 63.537  90.492  28.545  1.00 101.67 ? 515 GLU C CA 1 
ATOM 6419  C C  . GLU C 1 515 ? 64.595  90.625  27.461  1.00 101.67 ? 515 GLU C C  1 
ATOM 6420  O O  . GLU C 1 515 ? 65.029  89.627  26.875  1.00 101.67 ? 515 GLU C O  1 
ATOM 6421  N N  . LYS C 1 516 ? 65.044  91.846  27.205  1.00 103.34 ? 516 LYS C N  1 
ATOM 6422  C CA . LYS C 1 516 ? 65.811  92.161  26.011  1.00 103.34 ? 516 LYS C CA 1 
ATOM 6423  C C  . LYS C 1 516 ? 67.317  92.081  26.203  1.00 103.34 ? 516 LYS C C  1 
ATOM 6424  O O  . LYS C 1 516 ? 68.056  92.462  25.294  1.00 103.34 ? 516 LYS C O  1 
ATOM 6425  N N  . THR C 1 517 ? 67.797  91.622  27.350  1.00 106.78 ? 517 THR C N  1 
ATOM 6426  C CA . THR C 1 517 ? 69.239  91.572  27.578  1.00 106.78 ? 517 THR C CA 1 
ATOM 6427  C C  . THR C 1 517 ? 69.839  90.432  26.771  1.00 106.78 ? 517 THR C C  1 
ATOM 6428  O O  . THR C 1 517 ? 69.463  89.270  26.935  1.00 106.78 ? 517 THR C O  1 
ATOM 6429  N N  . SER C 1 518 ? 70.771  90.766  25.884  1.00 101.44 ? 518 SER C N  1 
ATOM 6430  C CA . SER C 1 518 ? 71.481  89.753  25.126  1.00 101.44 ? 518 SER C CA 1 
ATOM 6431  C C  . SER C 1 518 ? 72.428  88.979  26.026  1.00 101.44 ? 518 SER C C  1 
ATOM 6432  O O  . SER C 1 518 ? 72.780  89.410  27.129  1.00 101.44 ? 518 SER C O  1 
ATOM 6433  N N  . LYS C 1 519 ? 72.842  87.812  25.532  1.00 106.01 ? 519 LYS C N  1 
ATOM 6434  C CA . LYS C 1 519 ? 73.852  87.032  26.229  1.00 106.01 ? 519 LYS C CA 1 
ATOM 6435  C C  . LYS C 1 519 ? 75.181  87.761  26.279  1.00 106.01 ? 519 LYS C C  1 
ATOM 6436  O O  . LYS C 1 519 ? 75.897  87.667  27.283  1.00 106.01 ? 519 LYS C O  1 
ATOM 6437  N N  . ASP C 1 520 ? 75.516  88.500  25.221  1.00 99.46  ? 520 ASP C N  1 
ATOM 6438  C CA . ASP C 1 520 ? 76.764  89.247  25.227  1.00 99.46  ? 520 ASP C CA 1 
ATOM 6439  C C  . ASP C 1 520 ? 76.695  90.409  26.206  1.00 99.46  ? 520 ASP C C  1 
ATOM 6440  O O  . ASP C 1 520 ? 77.684  90.717  26.879  1.00 99.46  ? 520 ASP C O  1 
ATOM 6441  N N  . THR C 1 521 ? 75.524  91.045  26.312  1.00 88.50  ? 521 THR C N  1 
ATOM 6442  C CA . THR C 1 521 ? 75.341  92.124  27.274  1.00 88.50  ? 521 THR C CA 1 
ATOM 6443  C C  . THR C 1 521 ? 75.468  91.612  28.697  1.00 88.50  ? 521 THR C C  1 
ATOM 6444  O O  . THR C 1 521 ? 76.143  92.227  29.529  1.00 88.50  ? 521 THR C O  1 
ATOM 6445  N N  . SER C 1 522 ? 74.853  90.466  28.978  1.00 89.36  ? 522 SER C N  1 
ATOM 6446  C CA . SER C 1 522 ? 74.899  89.908  30.322  1.00 89.36  ? 522 SER C CA 1 
ATOM 6447  C C  . SER C 1 522 ? 76.297  89.435  30.678  1.00 89.36  ? 522 SER C C  1 
ATOM 6448  O O  . SER C 1 522 ? 76.761  89.646  31.806  1.00 89.36  ? 522 SER C O  1 
ATOM 6449  N N  . ALA C 1 523 ? 76.980  88.801  29.725  1.00 88.79  ? 523 ALA C N  1 
ATOM 6450  C CA . ALA C 1 523 ? 78.338  88.337  29.972  1.00 88.79  ? 523 ALA C CA 1 
ATOM 6451  C C  . ALA C 1 523 ? 79.285  89.507  30.171  1.00 88.79  ? 523 ALA C C  1 
ATOM 6452  O O  . ALA C 1 523 ? 80.141  89.476  31.059  1.00 88.79  ? 523 ALA C O  1 
ATOM 6453  N N  . SER C 1 524 ? 79.120  90.562  29.377  1.00 82.15  ? 524 SER C N  1 
ATOM 6454  C CA . SER C 1 524 ? 79.937  91.751  29.539  1.00 82.15  ? 524 SER C CA 1 
ATOM 6455  C C  . SER C 1 524 ? 79.644  92.461  30.847  1.00 82.15  ? 524 SER C C  1 
ATOM 6456  O O  . SER C 1 524 ? 80.532  93.101  31.411  1.00 82.15  ? 524 SER C O  1 
ATOM 6457  N N  . ALA C 1 525 ? 78.421  92.353  31.346  1.00 72.16  ? 525 ALA C N  1 
ATOM 6458  C CA . ALA C 1 525 ? 78.126  92.926  32.648  1.00 72.16  ? 525 ALA C CA 1 
ATOM 6459  C C  . ALA C 1 525 ? 78.810  92.137  33.751  1.00 72.16  ? 525 ALA C C  1 
ATOM 6460  O O  . ALA C 1 525 ? 79.510  92.702  34.602  1.00 72.16  ? 525 ALA C O  1 
ATOM 6461  N N  . VAL C 1 526 ? 78.658  90.812  33.725  1.00 72.44  ? 526 VAL C N  1 
ATOM 6462  C CA . VAL C 1 526 ? 79.200  90.016  34.816  1.00 72.44  ? 526 VAL C CA 1 
ATOM 6463  C C  . VAL C 1 526 ? 80.708  89.915  34.729  1.00 72.44  ? 526 VAL C C  1 
ATOM 6464  O O  . VAL C 1 526 ? 81.354  89.541  35.713  1.00 72.44  ? 526 VAL C O  1 
ATOM 6465  N N  . ALA C 1 527 ? 81.290  90.265  33.581  1.00 71.77  ? 527 ALA C N  1 
ATOM 6466  C CA . ALA C 1 527 ? 82.735  90.424  33.520  1.00 71.77  ? 527 ALA C CA 1 
ATOM 6467  C C  . ALA C 1 527 ? 83.180  91.570  34.406  1.00 71.77  ? 527 ALA C C  1 
ATOM 6468  O O  . ALA C 1 527 ? 84.154  91.433  35.153  1.00 71.77  ? 527 ALA C O  1 
ATOM 6469  N N  . VAL C 1 528 ? 82.446  92.681  34.376  1.00 61.22  ? 528 VAL C N  1 
ATOM 6470  C CA . VAL C 1 528 ? 82.728  93.786  35.277  1.00 61.22  ? 528 VAL C CA 1 
ATOM 6471  C C  . VAL C 1 528 ? 82.429  93.366  36.694  1.00 61.22  ? 528 VAL C C  1 
ATOM 6472  O O  . VAL C 1 528 ? 83.104  93.790  37.636  1.00 61.22  ? 528 VAL C O  1 
ATOM 6473  N N  . GLY C 1 529 ? 81.436  92.496  36.856  1.00 64.84  ? 529 GLY C N  1 
ATOM 6474  C CA . GLY C 1 529 ? 81.076  92.027  38.183  1.00 64.84  ? 529 GLY C CA 1 
ATOM 6475  C C  . GLY C 1 529 ? 82.166  91.209  38.853  1.00 64.84  ? 529 GLY C C  1 
ATOM 6476  O O  . GLY C 1 529 ? 82.462  91.399  40.032  1.00 64.84  ? 529 GLY C O  1 
ATOM 6477  N N  . LEU C 1 530 ? 82.784  90.290  38.115  1.00 66.65  ? 530 LEU C N  1 
ATOM 6478  C CA . LEU C 1 530 ? 83.749  89.445  38.807  1.00 66.65  ? 530 LEU C CA 1 
ATOM 6479  C C  . LEU C 1 530 ? 85.161  90.007  38.698  1.00 66.65  ? 530 LEU C C  1 
ATOM 6480  O O  . LEU C 1 530 ? 85.994  89.743  39.571  1.00 66.65  ? 530 LEU C O  1 
ATOM 6481  N N  . LYS C 1 531 ? 85.459  90.776  37.642  1.00 60.51  ? 531 LYS C N  1 
ATOM 6482  C CA . LYS C 1 531 ? 86.694  91.547  37.621  1.00 60.51  ? 531 LYS C CA 1 
ATOM 6483  C C  . LYS C 1 531 ? 86.677  92.611  38.693  1.00 60.51  ? 531 LYS C C  1 
ATOM 6484  O O  . LYS C 1 531 ? 87.730  92.975  39.210  1.00 60.51  ? 531 LYS C O  1 
ATOM 6485  N N  . GLN C 1 532 ? 85.489  93.094  39.045  1.00 60.55  ? 532 GLN C N  1 
ATOM 6486  C CA . GLN C 1 532 ? 85.325  93.897  40.241  1.00 60.55  ? 532 GLN C CA 1 
ATOM 6487  C C  . GLN C 1 532 ? 85.738  93.116  41.478  1.00 60.55  ? 532 GLN C C  1 
ATOM 6488  O O  . GLN C 1 532 ? 86.368  93.666  42.387  1.00 60.55  ? 532 GLN C O  1 
ATOM 6489  N N  . GLY C 1 533 ? 85.431  91.819  41.505  1.00 62.91  ? 533 GLY C N  1 
ATOM 6490  C CA . GLY C 1 533 ? 85.758  90.961  42.625  1.00 62.91  ? 533 GLY C CA 1 
ATOM 6491  C C  . GLY C 1 533 ? 84.604  90.641  43.545  1.00 62.91  ? 533 GLY C C  1 
ATOM 6492  O O  . GLY C 1 533 ? 84.732  89.743  44.379  1.00 62.91  ? 533 GLY C O  1 
ATOM 6493  N N  . LYS C 1 534 ? 83.496  91.353  43.428  1.00 64.80  ? 534 LYS C N  1 
ATOM 6494  C CA . LYS C 1 534 ? 82.360  91.195  44.313  1.00 64.80  ? 534 LYS C CA 1 
ATOM 6495  C C  . LYS C 1 534 ? 81.378  90.177  43.740  1.00 64.80  ? 534 LYS C C  1 
ATOM 6496  O O  . LYS C 1 534 ? 80.979  90.265  42.577  1.00 64.80  ? 534 LYS C O  1 
ATOM 6497  N N  . VAL C 1 535 ? 80.960  89.225  44.585  1.00 68.29  ? 535 VAL C N  1 
ATOM 6498  C CA . VAL C 1 535 ? 80.349  87.984  44.106  1.00 68.29  ? 535 VAL C CA 1 
ATOM 6499  C C  . VAL C 1 535 ? 78.956  88.278  43.565  1.00 68.29  ? 535 VAL C C  1 
ATOM 6500  O O  . VAL C 1 535 ? 78.153  88.985  44.183  1.00 68.29  ? 535 VAL C O  1 
ATOM 6501  N N  . ILE C 1 536 ? 78.687  87.765  42.381  1.00 73.24  ? 536 ILE C N  1 
ATOM 6502  C CA . ILE C 1 536 ? 77.610  88.242  41.535  1.00 73.24  ? 536 ILE C CA 1 
ATOM 6503  C C  . ILE C 1 536 ? 76.440  87.307  41.753  1.00 73.24  ? 536 ILE C C  1 
ATOM 6504  O O  . ILE C 1 536 ? 76.631  86.175  42.205  1.00 73.24  ? 536 ILE C O  1 
ATOM 6505  N N  . ILE C 1 537 ? 75.235  87.799  41.510  1.00 78.82  ? 537 ILE C N  1 
ATOM 6506  C CA . ILE C 1 537 ? 74.072  86.953  41.289  1.00 78.82  ? 537 ILE C CA 1 
ATOM 6507  C C  . ILE C 1 537 ? 73.224  87.584  40.204  1.00 78.82  ? 537 ILE C C  1 
ATOM 6508  O O  . ILE C 1 537 ? 73.076  88.808  40.142  1.00 78.82  ? 537 ILE C O  1 
ATOM 6509  N N  . VAL C 1 538 ? 72.696  86.758  39.355  1.00 82.02  ? 538 VAL C N  1 
ATOM 6510  C CA . VAL C 1 538 ? 71.861  87.191  38.251  1.00 82.02  ? 538 VAL C CA 1 
ATOM 6511  C C  . VAL C 1 538 ? 70.407  86.989  38.644  1.00 82.02  ? 538 VAL C C  1 
ATOM 6512  O O  . VAL C 1 538 ? 70.053  85.995  39.284  1.00 82.02  ? 538 VAL C O  1 
ATOM 6513  N N  . VAL C 1 539 ? 69.567  87.975  38.344  1.00 87.92  ? 539 VAL C N  1 
ATOM 6514  C CA . VAL C 1 539 ? 68.169  87.952  38.749  1.00 87.92  ? 539 VAL C CA 1 
ATOM 6515  C C  . VAL C 1 539 ? 67.311  88.376  37.569  1.00 87.92  ? 539 VAL C C  1 
ATOM 6516  O O  . VAL C 1 539 ? 67.496  89.470  37.025  1.00 87.92  ? 539 VAL C O  1 
ATOM 6517  N N  . LYS C 1 540 ? 66.386  87.510  37.167  1.00 101.26 ? 540 LYS C N  1 
ATOM 6518  C CA . LYS C 1 540 ? 65.301  87.929  36.293  1.00 101.26 ? 540 LYS C CA 1 
ATOM 6519  C C  . LYS C 1 540 ? 64.299  88.740  37.107  1.00 101.26 ? 540 LYS C C  1 
ATOM 6520  O O  . LYS C 1 540 ? 63.900  88.342  38.203  1.00 101.26 ? 540 LYS C O  1 
ATOM 6521  N N  . ASP C 1 541 ? 63.859  89.856  36.542  1.00 104.09 ? 541 ASP C N  1 
ATOM 6522  C CA . ASP C 1 541 ? 63.331  90.960  37.331  1.00 104.09 ? 541 ASP C CA 1 
ATOM 6523  C C  . ASP C 1 541 ? 61.889  90.705  37.765  1.00 104.09 ? 541 ASP C C  1 
ATOM 6524  O O  . ASP C 1 541 ? 61.338  89.612  37.612  1.00 104.09 ? 541 ASP C O  1 
ATOM 6525  N N  . GLY C 1 542 ? 61.261  91.747  38.300  1.00 96.59  ? 542 GLY C N  1 
ATOM 6526  C CA . GLY C 1 542 ? 59.902  91.701  38.777  1.00 96.59  ? 542 GLY C CA 1 
ATOM 6527  C C  . GLY C 1 542 ? 59.587  93.020  39.445  1.00 96.59  ? 542 GLY C C  1 
ATOM 6528  O O  . GLY C 1 542 ? 60.485  93.838  39.663  1.00 96.59  ? 542 GLY C O  1 
ATOM 6529  N N  . PRO C 1 543 ? 58.318  93.267  39.779  1.00 96.14  ? 543 PRO C N  1 
ATOM 6530  C CA . PRO C 1 543 ? 57.963  94.562  40.384  1.00 96.14  ? 543 PRO C CA 1 
ATOM 6531  C C  . PRO C 1 543 ? 58.499  94.639  41.805  1.00 96.14  ? 543 PRO C C  1 
ATOM 6532  O O  . PRO C 1 543 ? 57.910  94.104  42.744  1.00 96.14  ? 543 PRO C O  1 
ATOM 6533  N N  . GLY C 1 544 ? 59.639  95.307  41.948  1.00 91.16  ? 544 GLY C N  1 
ATOM 6534  C CA . GLY C 1 544 ? 60.443  95.146  43.137  1.00 91.16  ? 544 GLY C CA 1 
ATOM 6535  C C  . GLY C 1 544 ? 61.307  93.928  42.878  1.00 91.16  ? 544 GLY C C  1 
ATOM 6536  O O  . GLY C 1 544 ? 60.758  92.830  42.758  1.00 91.16  ? 544 GLY C O  1 
ATOM 6537  N N  . PHE C 1 545 ? 62.628  94.059  42.758  1.00 88.01  ? 545 PHE C N  1 
ATOM 6538  C CA . PHE C 1 545 ? 63.359  92.933  42.189  1.00 88.01  ? 545 PHE C CA 1 
ATOM 6539  C C  . PHE C 1 545 ? 63.675  91.857  43.230  1.00 88.01  ? 545 PHE C C  1 
ATOM 6540  O O  . PHE C 1 545 ? 63.025  90.809  43.245  1.00 88.01  ? 545 PHE C O  1 
ATOM 6541  N N  . TYR C 1 546 ? 64.629  92.088  44.128  1.00 86.61  ? 546 TYR C N  1 
ATOM 6542  C CA . TYR C 1 546 ? 64.872  91.038  45.110  1.00 86.61  ? 546 TYR C CA 1 
ATOM 6543  C C  . TYR C 1 546 ? 65.112  91.561  46.512  1.00 86.61  ? 546 TYR C C  1 
ATOM 6544  O O  . TYR C 1 546 ? 64.463  91.130  47.468  1.00 86.61  ? 546 TYR C O  1 
ATOM 6545  N N  . THR C 1 547 ? 65.987  92.552  46.633  1.00 81.47  ? 547 THR C N  1 
ATOM 6546  C CA . THR C 1 547 ? 66.565  92.824  47.941  1.00 81.47  ? 547 THR C CA 1 
ATOM 6547  C C  . THR C 1 547 ? 65.746  93.833  48.714  1.00 81.47  ? 547 THR C C  1 
ATOM 6548  O O  . THR C 1 547 ? 65.406  93.594  49.872  1.00 81.47  ? 547 THR C O  1 
ATOM 6549  N N  . THR C 1 548 ? 65.394  94.952  48.093  1.00 88.97  ? 548 THR C N  1 
ATOM 6550  C CA . THR C 1 548 ? 64.380  95.802  48.697  1.00 88.97  ? 548 THR C CA 1 
ATOM 6551  C C  . THR C 1 548 ? 63.024  95.117  48.674  1.00 88.97  ? 548 THR C C  1 
ATOM 6552  O O  . THR C 1 548 ? 62.208  95.331  49.580  1.00 88.97  ? 548 THR C O  1 
ATOM 6553  N N  . ARG C 1 549 ? 62.816  94.253  47.673  1.00 96.34  ? 549 ARG C N  1 
ATOM 6554  C CA . ARG C 1 549 ? 61.617  93.429  47.558  1.00 96.34  ? 549 ARG C CA 1 
ATOM 6555  C C  . ARG C 1 549 ? 61.422  92.538  48.780  1.00 96.34  ? 549 ARG C C  1 
ATOM 6556  O O  . ARG C 1 549 ? 60.286  92.253  49.174  1.00 96.34  ? 549 ARG C O  1 
ATOM 6557  N N  . CYS C 1 550 ? 62.513  92.097  49.398  1.00 91.82  ? 550 CYS C N  1 
ATOM 6558  C CA . CYS C 1 550 ? 62.406  91.371  50.653  1.00 91.82  ? 550 CYS C CA 1 
ATOM 6559  C C  . CYS C 1 550 ? 62.690  92.233  51.875  1.00 91.82  ? 550 CYS C C  1 
ATOM 6560  O O  . CYS C 1 550 ? 62.371  91.819  52.992  1.00 91.82  ? 550 CYS C O  1 
ATOM 6561  N N  . LEU C 1 551 ? 63.271  93.416  51.702  1.00 92.26  ? 551 LEU C N  1 
ATOM 6562  C CA . LEU C 1 551 ? 63.634  94.216  52.861  1.00 92.26  ? 551 LEU C CA 1 
ATOM 6563  C C  . LEU C 1 551 ? 62.464  95.033  53.373  1.00 92.26  ? 551 LEU C C  1 
ATOM 6564  O O  . LEU C 1 551 ? 62.316  95.193  54.589  1.00 92.26  ? 551 LEU C O  1 
ATOM 6565  N N  . ALA C 1 552 ? 61.660  95.593  52.476  1.00 101.21 ? 552 ALA C N  1 
ATOM 6566  C CA . ALA C 1 552 ? 60.491  96.354  52.917  1.00 101.21 ? 552 ALA C CA 1 
ATOM 6567  C C  . ALA C 1 552 ? 59.436  95.509  53.631  1.00 101.21 ? 552 ALA C C  1 
ATOM 6568  O O  . ALA C 1 552 ? 58.860  96.005  54.614  1.00 101.21 ? 552 ALA C O  1 
ATOM 6569  N N  . PRO C 1 553 ? 59.149  94.253  53.250  1.00 99.66  ? 553 PRO C N  1 
ATOM 6570  C CA . PRO C 1 553 ? 58.322  93.433  54.147  1.00 99.66  ? 553 PRO C CA 1 
ATOM 6571  C C  . PRO C 1 553 ? 59.019  93.010  55.424  1.00 99.66  ? 553 PRO C C  1 
ATOM 6572  O O  . PRO C 1 553 ? 58.400  92.320  56.238  1.00 99.66  ? 553 PRO C O  1 
ATOM 6573  N N  . MET C 1 554 ? 60.289  93.348  55.612  1.00 106.38 ? 554 MET C N  1 
ATOM 6574  C CA . MET C 1 554 ? 60.848  93.290  56.949  1.00 106.38 ? 554 MET C CA 1 
ATOM 6575  C C  . MET C 1 554 ? 60.801  94.655  57.611  1.00 106.38 ? 554 MET C C  1 
ATOM 6576  O O  . MET C 1 554 ? 60.566  94.748  58.819  1.00 106.38 ? 554 MET C O  1 
ATOM 6577  N N  . MET C 1 555 ? 61.020  95.716  56.844  1.00 106.66 ? 555 MET C N  1 
ATOM 6578  C CA . MET C 1 555 ? 61.133  97.031  57.450  1.00 106.66 ? 555 MET C CA 1 
ATOM 6579  C C  . MET C 1 555 ? 59.775  97.556  57.891  1.00 106.66 ? 555 MET C C  1 
ATOM 6580  O O  . MET C 1 555 ? 59.693  98.339  58.843  1.00 106.66 ? 555 MET C O  1 
ATOM 6581  N N  . SER C 1 556 ? 58.695  97.078  57.268  1.00 108.25 ? 556 SER C N  1 
ATOM 6582  C CA . SER C 1 556 ? 57.356  97.565  57.583  1.00 108.25 ? 556 SER C CA 1 
ATOM 6583  C C  . SER C 1 556 ? 56.860  97.092  58.942  1.00 108.25 ? 556 SER C C  1 
ATOM 6584  O O  . SER C 1 556 ? 55.823  97.567  59.409  1.00 108.25 ? 556 SER C O  1 
ATOM 6585  N N  . GLU C 1 557 ? 57.571  96.178  59.585  1.00 102.37 ? 557 GLU C N  1 
ATOM 6586  C CA . GLU C 1 557 ? 57.248  95.745  60.934  1.00 102.37 ? 557 GLU C CA 1 
ATOM 6587  C C  . GLU C 1 557 ? 58.313  96.173  61.917  1.00 102.37 ? 557 GLU C C  1 
ATOM 6588  O O  . GLU C 1 557 ? 58.224  95.859  63.103  1.00 102.37 ? 557 GLU C O  1 
ATOM 6589  N N  . VAL C 1 558 ? 59.336  96.871  61.441  1.00 104.27 ? 558 VAL C N  1 
ATOM 6590  C CA . VAL C 1 558 ? 60.244  97.545  62.356  1.00 104.27 ? 558 VAL C CA 1 
ATOM 6591  C C  . VAL C 1 558 ? 59.510  98.672  63.062  1.00 104.27 ? 558 VAL C C  1 
ATOM 6592  O O  . VAL C 1 558 ? 59.832  99.025  64.194  1.00 104.27 ? 558 VAL C O  1 
ATOM 6593  N N  . ILE C 1 559 ? 58.480  99.233  62.433  1.00 113.38 ? 559 ILE C N  1 
ATOM 6594  C CA . ILE C 1 559 ? 57.646  100.142 63.205  1.00 113.38 ? 559 ILE C CA 1 
ATOM 6595  C C  . ILE C 1 559 ? 56.735  99.393  64.168  1.00 113.38 ? 559 ILE C C  1 
ATOM 6596  O O  . ILE C 1 559 ? 56.322  99.965  65.185  1.00 113.38 ? 559 ILE C O  1 
ATOM 6597  N N  . ARG C 1 560 ? 56.478  98.104  63.923  1.00 113.10 ? 560 ARG C N  1 
ATOM 6598  C CA . ARG C 1 560 ? 55.459  97.377  64.673  1.00 113.10 ? 560 ARG C CA 1 
ATOM 6599  C C  . ARG C 1 560 ? 55.875  97.078  66.112  1.00 113.10 ? 560 ARG C C  1 
ATOM 6600  O O  . ARG C 1 560 ? 55.002  96.937  66.969  1.00 113.10 ? 560 ARG C O  1 
ATOM 6601  N N  . ILE C 1 561 ? 57.174  97.010  66.419  1.00 122.24 ? 561 ILE C N  1 
ATOM 6602  C CA . ILE C 1 561 ? 57.546  96.815  67.823  1.00 122.24 ? 561 ILE C CA 1 
ATOM 6603  C C  . ILE C 1 561 ? 57.315  98.092  68.608  1.00 122.24 ? 561 ILE C C  1 
ATOM 6604  O O  . ILE C 1 561 ? 56.727  98.056  69.694  1.00 122.24 ? 561 ILE C O  1 
ATOM 6605  N N  . LEU C 1 562 ? 57.745  99.235  68.086  1.00 121.84 ? 562 LEU C N  1 
ATOM 6606  C CA . LEU C 1 562 ? 57.435  100.491 68.744  1.00 121.84 ? 562 LEU C CA 1 
ATOM 6607  C C  . LEU C 1 562 ? 56.050  100.999 68.390  1.00 121.84 ? 562 LEU C C  1 
ATOM 6608  O O  . LEU C 1 562 ? 55.709  102.125 68.755  1.00 121.84 ? 562 LEU C O  1 
ATOM 6609  N N  . GLN C 1 563 ? 55.240  100.191 67.708  1.00 133.59 ? 563 GLN C N  1 
ATOM 6610  C CA . GLN C 1 563 ? 53.844  100.534 67.509  1.00 133.59 ? 563 GLN C CA 1 
ATOM 6611  C C  . GLN C 1 563 ? 53.059  100.368 68.798  1.00 133.59 ? 563 GLN C C  1 
ATOM 6612  O O  . GLN C 1 563 ? 52.045  101.049 68.997  1.00 133.59 ? 563 GLN C O  1 
ATOM 6613  N N  . GLU C 1 564 ? 53.499  99.449  69.660  1.00 135.77 ? 564 GLU C N  1 
ATOM 6614  C CA . GLU C 1 564 ? 53.039  99.338  71.037  1.00 135.77 ? 564 GLU C CA 1 
ATOM 6615  C C  . GLU C 1 564 ? 53.870  100.168 72.008  1.00 135.77 ? 564 GLU C C  1 
ATOM 6616  O O  . GLU C 1 564 ? 53.303  100.782 72.920  1.00 135.77 ? 564 GLU C O  1 
ATOM 6617  N N  . GLY C 1 565 ? 55.181  100.288 71.778  1.00 122.87 ? 565 GLY C N  1 
ATOM 6618  C CA . GLY C 1 565 ? 56.022  101.119 72.614  1.00 122.87 ? 565 GLY C CA 1 
ATOM 6619  C C  . GLY C 1 565 ? 56.843  100.375 73.644  1.00 122.87 ? 565 GLY C C  1 
ATOM 6620  O O  . GLY C 1 565 ? 56.780  100.664 74.847  1.00 122.87 ? 565 GLY C O  1 
ATOM 6621  N N  . VAL C 1 566 ? 57.648  99.434  73.171  1.00 109.57 ? 566 VAL C N  1 
ATOM 6622  C CA . VAL C 1 566 ? 58.386  98.535  74.034  1.00 109.57 ? 566 VAL C CA 1 
ATOM 6623  C C  . VAL C 1 566 ? 59.833  98.985  74.209  1.00 109.57 ? 566 VAL C C  1 
ATOM 6624  O O  . VAL C 1 566 ? 60.708  98.157  74.472  1.00 109.57 ? 566 VAL C O  1 
ATOM 6625  N N  . ASP C 1 567 ? 60.092  100.297 74.062  1.00 111.21 ? 567 ASP C N  1 
ATOM 6626  C CA . ASP C 1 567 ? 61.383  100.956 74.233  1.00 111.21 ? 567 ASP C CA 1 
ATOM 6627  C C  . ASP C 1 567 ? 62.391  100.360 73.260  1.00 111.21 ? 567 ASP C C  1 
ATOM 6628  O O  . ASP C 1 567 ? 63.215  99.532  73.656  1.00 111.21 ? 567 ASP C O  1 
ATOM 6629  N N  . PRO C 1 568 ? 62.346  100.754 71.982  1.00 107.30 ? 568 PRO C N  1 
ATOM 6630  C CA . PRO C 1 568 ? 63.092  100.049 70.927  1.00 107.30 ? 568 PRO C CA 1 
ATOM 6631  C C  . PRO C 1 568 ? 64.604  100.092 71.061  1.00 107.30 ? 568 PRO C C  1 
ATOM 6632  O O  . PRO C 1 568 ? 65.292  99.487  70.232  1.00 107.30 ? 568 PRO C O  1 
ATOM 6633  N N  . LYS C 1 569 ? 65.147  100.799 72.052  1.00 107.07 ? 569 LYS C N  1 
ATOM 6634  C CA . LYS C 1 569 ? 66.516  100.559 72.466  1.00 107.07 ? 569 LYS C CA 1 
ATOM 6635  C C  . LYS C 1 569 ? 66.709  99.128  72.942  1.00 107.07 ? 569 LYS C C  1 
ATOM 6636  O O  . LYS C 1 569 ? 67.776  98.554  72.712  1.00 107.07 ? 569 LYS C O  1 
ATOM 6637  N N  . LYS C 1 570 ? 65.697  98.541  73.585  1.00 107.27 ? 570 LYS C N  1 
ATOM 6638  C CA . LYS C 1 570 ? 65.704  97.121  73.911  1.00 107.27 ? 570 LYS C CA 1 
ATOM 6639  C C  . LYS C 1 570 ? 65.717  96.244  72.669  1.00 107.27 ? 570 LYS C C  1 
ATOM 6640  O O  . LYS C 1 570 ? 66.313  95.159  72.693  1.00 107.27 ? 570 LYS C O  1 
ATOM 6641  N N  . LEU C 1 571 ? 65.096  96.706  71.582  1.00 106.77 ? 571 LEU C N  1 
ATOM 6642  C CA . LEU C 1 571 ? 64.966  95.902  70.377  1.00 106.77 ? 571 LEU C CA 1 
ATOM 6643  C C  . LEU C 1 571 ? 66.304  95.636  69.713  1.00 106.77 ? 571 LEU C C  1 
ATOM 6644  O O  . LEU C 1 571 ? 66.447  94.607  69.050  1.00 106.77 ? 571 LEU C O  1 
ATOM 6645  N N  . ASP C 1 572 ? 67.274  96.532  69.889  1.00 109.72 ? 572 ASP C N  1 
ATOM 6646  C CA . ASP C 1 572 ? 68.607  96.313  69.345  1.00 109.72 ? 572 ASP C CA 1 
ATOM 6647  C C  . ASP C 1 572 ? 69.240  95.067  69.939  1.00 109.72 ? 572 ASP C C  1 
ATOM 6648  O O  . ASP C 1 572 ? 69.689  94.177  69.207  1.00 109.72 ? 572 ASP C O  1 
ATOM 6649  N N  . SER C 1 573 ? 69.237  94.968  71.269  1.00 114.33 ? 573 SER C N  1 
ATOM 6650  C CA . SER C 1 573 ? 69.693  93.757  71.936  1.00 114.33 ? 573 SER C CA 1 
ATOM 6651  C C  . SER C 1 573 ? 68.815  92.569  71.590  1.00 114.33 ? 573 SER C C  1 
ATOM 6652  O O  . SER C 1 573 ? 69.329  91.467  71.384  1.00 114.33 ? 573 SER C O  1 
ATOM 6653  N N  . LEU C 1 574 ? 67.507  92.800  71.466  1.00 111.39 ? 574 LEU C N  1 
ATOM 6654  C CA . LEU C 1 574 ? 66.552  91.728  71.213  1.00 111.39 ? 574 LEU C CA 1 
ATOM 6655  C C  . LEU C 1 574 ? 66.779  91.075  69.857  1.00 111.39 ? 574 LEU C C  1 
ATOM 6656  O O  . LEU C 1 574 ? 66.594  89.864  69.713  1.00 111.39 ? 574 LEU C O  1 
ATOM 6657  N N  . THR C 1 575 ? 67.203  91.852  68.864  1.00 112.37 ? 575 THR C N  1 
ATOM 6658  C CA . THR C 1 575 ? 67.353  91.305  67.522  1.00 112.37 ? 575 THR C CA 1 
ATOM 6659  C C  . THR C 1 575 ? 68.791  90.916  67.226  1.00 112.37 ? 575 THR C C  1 
ATOM 6660  O O  . THR C 1 575 ? 69.038  89.983  66.450  1.00 112.37 ? 575 THR C O  1 
ATOM 6661  N N  . THR C 1 576 ? 69.760  91.593  67.843  1.00 106.42 ? 576 THR C N  1 
ATOM 6662  C CA . THR C 1 576 ? 71.117  91.086  67.749  1.00 106.42 ? 576 THR C CA 1 
ATOM 6663  C C  . THR C 1 576 ? 71.297  89.818  68.563  1.00 106.42 ? 576 THR C C  1 
ATOM 6664  O O  . THR C 1 576 ? 72.245  89.069  68.314  1.00 106.42 ? 576 THR C O  1 
ATOM 6665  N N  . SER C 1 577 ? 70.405  89.561  69.522  1.00 114.48 ? 577 SER C N  1 
ATOM 6666  C CA . SER C 1 577 ? 70.420  88.291  70.230  1.00 114.48 ? 577 SER C CA 1 
ATOM 6667  C C  . SER C 1 577 ? 70.063  87.140  69.306  1.00 114.48 ? 577 SER C C  1 
ATOM 6668  O O  . SER C 1 577 ? 70.630  86.051  69.425  1.00 114.48 ? 577 SER C O  1 
ATOM 6669  N N  . PHE C 1 578 ? 69.135  87.355  68.374  1.00 106.70 ? 578 PHE C N  1 
ATOM 6670  C CA . PHE C 1 578 ? 68.808  86.272  67.459  1.00 106.70 ? 578 PHE C CA 1 
ATOM 6671  C C  . PHE C 1 578 ? 69.905  86.062  66.429  1.00 106.70 ? 578 PHE C C  1 
ATOM 6672  O O  . PHE C 1 578 ? 70.073  84.945  65.927  1.00 106.70 ? 578 PHE C O  1 
ATOM 6673  N N  . GLY C 1 579 ? 70.663  87.102  66.114  1.00 97.58  ? 579 GLY C N  1 
ATOM 6674  C CA . GLY C 1 579 ? 71.838  86.894  65.302  1.00 97.58  ? 579 GLY C CA 1 
ATOM 6675  C C  . GLY C 1 579 ? 72.164  87.976  64.299  1.00 97.58  ? 579 GLY C C  1 
ATOM 6676  O O  . GLY C 1 579 ? 73.273  87.978  63.758  1.00 97.58  ? 579 GLY C O  1 
ATOM 6677  N N  . PHE C 1 580 ? 71.218  88.873  64.027  1.00 97.90  ? 580 PHE C N  1 
ATOM 6678  C CA . PHE C 1 580 ? 71.442  89.964  63.086  1.00 97.90  ? 580 PHE C CA 1 
ATOM 6679  C C  . PHE C 1 580 ? 72.582  90.844  63.577  1.00 97.90  ? 580 PHE C C  1 
ATOM 6680  O O  . PHE C 1 580 ? 72.603  91.208  64.759  1.00 97.90  ? 580 PHE C O  1 
ATOM 6681  N N  . PRO C 1 581 ? 73.576  91.138  62.740  1.00 99.91  ? 581 PRO C N  1 
ATOM 6682  C CA . PRO C 1 581 ? 74.749  91.870  63.226  1.00 99.91  ? 581 PRO C CA 1 
ATOM 6683  C C  . PRO C 1 581 ? 74.472  93.322  63.529  1.00 99.91  ? 581 PRO C C  1 
ATOM 6684  O O  . PRO C 1 581 ? 75.222  93.930  64.299  1.00 99.91  ? 581 PRO C O  1 
ATOM 6685  N N  . VAL C 1 582 ? 73.437  93.904  62.942  1.00 103.83 ? 582 VAL C N  1 
ATOM 6686  C CA . VAL C 1 582 ? 73.091  95.297  63.173  1.00 103.83 ? 582 VAL C CA 1 
ATOM 6687  C C  . VAL C 1 582 ? 71.610  95.373  63.511  1.00 103.83 ? 582 VAL C C  1 
ATOM 6688  O O  . VAL C 1 582 ? 70.798  94.650  62.924  1.00 103.83 ? 582 VAL C O  1 
ATOM 6689  N N  . GLY C 1 583 ? 71.266  96.225  64.478  1.00 111.44 ? 583 GLY C N  1 
ATOM 6690  C CA . GLY C 1 583 ? 69.902  96.280  64.967  1.00 111.44 ? 583 GLY C CA 1 
ATOM 6691  C C  . GLY C 1 583 ? 68.960  96.915  63.967  1.00 111.44 ? 583 GLY C C  1 
ATOM 6692  O O  . GLY C 1 583 ? 69.376  97.615  63.049  1.00 111.44 ? 583 GLY C O  1 
ATOM 6693  N N  . ALA C 1 584 ? 67.662  96.649  64.148  1.00 104.89 ? 584 ALA C N  1 
ATOM 6694  C CA . ALA C 1 584 ? 66.668  97.152  63.205  1.00 104.89 ? 584 ALA C CA 1 
ATOM 6695  C C  . ALA C 1 584 ? 66.542  98.665  63.276  1.00 104.89 ? 584 ALA C C  1 
ATOM 6696  O O  . ALA C 1 584 ? 66.204  99.308  62.274  1.00 104.89 ? 584 ALA C O  1 
ATOM 6697  N N  . ALA C 1 585 ? 66.828  99.247  64.441  1.00 111.89 ? 585 ALA C N  1 
ATOM 6698  C CA . ALA C 1 585 ? 67.010  100.689 64.517  1.00 111.89 ? 585 ALA C CA 1 
ATOM 6699  C C  . ALA C 1 585 ? 68.202  101.129 63.681  1.00 111.89 ? 585 ALA C C  1 
ATOM 6700  O O  . ALA C 1 585 ? 68.124  102.123 62.954  1.00 111.89 ? 585 ALA C O  1 
ATOM 6701  N N  . THR C 1 586 ? 69.302  100.379 63.736  1.00 120.89 ? 586 THR C N  1 
ATOM 6702  C CA . THR C 1 586 ? 70.433  100.703 62.876  1.00 120.89 ? 586 THR C CA 1 
ATOM 6703  C C  . THR C 1 586 ? 70.151  100.328 61.431  1.00 120.89 ? 586 THR C C  1 
ATOM 6704  O O  . THR C 1 586 ? 70.825  100.821 60.524  1.00 120.89 ? 586 THR C O  1 
ATOM 6705  N N  . LEU C 1 587 ? 69.167  99.464  61.194  1.00 114.92 ? 587 LEU C N  1 
ATOM 6706  C CA . LEU C 1 587 ? 68.754  99.203  59.822  1.00 114.92 ? 587 LEU C CA 1 
ATOM 6707  C C  . LEU C 1 587 ? 67.947  100.367 59.259  1.00 114.92 ? 587 LEU C C  1 
ATOM 6708  O O  . LEU C 1 587 ? 68.073  100.697 58.075  1.00 114.92 ? 587 LEU C O  1 
ATOM 6709  N N  . VAL C 1 588 ? 67.115  101.011 60.082  1.00 109.65 ? 588 VAL C N  1 
ATOM 6710  C CA . VAL C 1 588 ? 66.415  102.185 59.568  1.00 109.65 ? 588 VAL C CA 1 
ATOM 6711  C C  . VAL C 1 588 ? 67.317  103.411 59.611  1.00 109.65 ? 588 VAL C C  1 
ATOM 6712  O O  . VAL C 1 588 ? 67.045  104.404 58.927  1.00 109.65 ? 588 VAL C O  1 
ATOM 6713  N N  . ASP C 1 589 ? 68.397  103.362 60.380  1.00 113.79 ? 589 ASP C N  1 
ATOM 6714  C CA . ASP C 1 589 ? 69.430  104.380 60.299  1.00 113.79 ? 589 ASP C CA 1 
ATOM 6715  C C  . ASP C 1 589 ? 70.490  104.017 59.263  1.00 113.79 ? 589 ASP C C  1 
ATOM 6716  O O  . ASP C 1 589 ? 71.442  104.776 59.063  1.00 113.79 ? 589 ASP C O  1 
ATOM 6717  N N  . GLU C 1 590 ? 70.341  102.863 58.616  1.00 115.20 ? 590 GLU C N  1 
ATOM 6718  C CA . GLU C 1 590 ? 71.189  102.372 57.538  1.00 115.20 ? 590 GLU C CA 1 
ATOM 6719  C C  . GLU C 1 590 ? 70.650  102.739 56.170  1.00 115.20 ? 590 GLU C C  1 
ATOM 6720  O O  . GLU C 1 590 ? 71.419  103.089 55.271  1.00 115.20 ? 590 GLU C O  1 
ATOM 6721  N N  . VAL C 1 591 ? 69.329  102.687 56.011  1.00 119.41 ? 591 VAL C N  1 
ATOM 6722  C CA . VAL C 1 591 ? 68.723  102.867 54.703  1.00 119.41 ? 591 VAL C CA 1 
ATOM 6723  C C  . VAL C 1 591 ? 68.635  104.327 54.284  1.00 119.41 ? 591 VAL C C  1 
ATOM 6724  O O  . VAL C 1 591 ? 68.589  104.610 53.081  1.00 119.41 ? 591 VAL C O  1 
ATOM 6725  N N  . GLY C 1 592 ? 68.627  105.262 55.227  1.00 119.01 ? 592 GLY C N  1 
ATOM 6726  C CA . GLY C 1 592 ? 68.357  106.642 54.887  1.00 119.01 ? 592 GLY C CA 1 
ATOM 6727  C C  . GLY C 1 592 ? 66.877  106.929 55.000  1.00 119.01 ? 592 GLY C C  1 
ATOM 6728  O O  . GLY C 1 592 ? 66.056  106.223 54.407  1.00 119.01 ? 592 GLY C O  1 
ATOM 6729  N N  . VAL C 1 593 ? 66.522  107.966 55.759  1.00 120.31 ? 593 VAL C N  1 
ATOM 6730  C CA . VAL C 1 593 ? 65.121  108.206 56.091  1.00 120.31 ? 593 VAL C CA 1 
ATOM 6731  C C  . VAL C 1 593 ? 64.338  108.753 54.900  1.00 120.31 ? 593 VAL C C  1 
ATOM 6732  O O  . VAL C 1 593 ? 63.111  108.593 54.844  1.00 120.31 ? 593 VAL C O  1 
ATOM 6733  N N  . ASP C 1 594 ? 65.016  109.342 53.915  1.00 127.95 ? 594 ASP C N  1 
ATOM 6734  C CA . ASP C 1 594 ? 64.310  109.961 52.802  1.00 127.95 ? 594 ASP C CA 1 
ATOM 6735  C C  . ASP C 1 594 ? 63.812  108.933 51.802  1.00 127.95 ? 594 ASP C C  1 
ATOM 6736  O O  . ASP C 1 594 ? 62.724  109.096 51.242  1.00 127.95 ? 594 ASP C O  1 
ATOM 6737  N N  . VAL C 1 595 ? 64.580  107.869 51.566  1.00 118.60 ? 595 VAL C N  1 
ATOM 6738  C CA . VAL C 1 595 ? 64.133  106.838 50.638  1.00 118.60 ? 595 VAL C CA 1 
ATOM 6739  C C  . VAL C 1 595 ? 63.167  105.867 51.280  1.00 118.60 ? 595 VAL C C  1 
ATOM 6740  O O  . VAL C 1 595 ? 62.608  105.022 50.578  1.00 118.60 ? 595 VAL C O  1 
ATOM 6741  N N  . ALA C 1 596 ? 62.961  105.967 52.595  1.00 115.72 ? 596 ALA C N  1 
ATOM 6742  C CA . ALA C 1 596 ? 62.057  105.054 53.280  1.00 115.72 ? 596 ALA C CA 1 
ATOM 6743  C C  . ALA C 1 596 ? 60.609  105.280 52.869  1.00 115.72 ? 596 ALA C C  1 
ATOM 6744  O O  . ALA C 1 596 ? 59.860  104.314 52.699  1.00 115.72 ? 596 ALA C O  1 
ATOM 6745  N N  . LYS C 1 597 ? 60.211  106.536 52.666  1.00 117.27 ? 597 LYS C N  1 
ATOM 6746  C CA . LYS C 1 597 ? 58.863  106.800 52.179  1.00 117.27 ? 597 LYS C CA 1 
ATOM 6747  C C  . LYS C 1 597 ? 58.674  106.303 50.753  1.00 117.27 ? 597 LYS C C  1 
ATOM 6748  O O  . LYS C 1 597 ? 57.603  105.792 50.418  1.00 117.27 ? 597 LYS C O  1 
ATOM 6749  N N  . HIS C 1 598 ? 59.711  106.377 49.919  1.00 115.90 ? 598 HIS C N  1 
ATOM 6750  C CA . HIS C 1 598 ? 59.573  105.901 48.553  1.00 115.90 ? 598 HIS C CA 1 
ATOM 6751  C C  . HIS C 1 598 ? 59.547  104.387 48.500  1.00 115.90 ? 598 HIS C C  1 
ATOM 6752  O O  . HIS C 1 598 ? 58.765  103.811 47.736  1.00 115.90 ? 598 HIS C O  1 
ATOM 6753  N N  . VAL C 1 599 ? 60.339  103.727 49.345  1.00 114.29 ? 599 VAL C N  1 
ATOM 6754  C CA . VAL C 1 599 ? 60.290  102.273 49.364  1.00 114.29 ? 599 VAL C CA 1 
ATOM 6755  C C  . VAL C 1 599 ? 59.113  101.792 50.195  1.00 114.29 ? 599 VAL C C  1 
ATOM 6756  O O  . VAL C 1 599 ? 58.867  100.586 50.291  1.00 114.29 ? 599 VAL C O  1 
ATOM 6757  N N  . ALA C 1 600 ? 58.384  102.705 50.826  1.00 112.50 ? 600 ALA C N  1 
ATOM 6758  C CA . ALA C 1 600 ? 57.058  102.369 51.309  1.00 112.50 ? 600 ALA C CA 1 
ATOM 6759  C C  . ALA C 1 600 ? 55.996  102.518 50.230  1.00 112.50 ? 600 ALA C C  1 
ATOM 6760  O O  . ALA C 1 600 ? 55.070  101.705 50.173  1.00 112.50 ? 600 ALA C O  1 
ATOM 6761  N N  . GLU C 1 601 ? 56.118  103.528 49.372  1.00 120.88 ? 601 GLU C N  1 
ATOM 6762  C CA . GLU C 1 601 ? 55.050  103.809 48.419  1.00 120.88 ? 601 GLU C CA 1 
ATOM 6763  C C  . GLU C 1 601 ? 55.170  102.975 47.155  1.00 120.88 ? 601 GLU C C  1 
ATOM 6764  O O  . GLU C 1 601 ? 54.191  102.833 46.415  1.00 120.88 ? 601 GLU C O  1 
ATOM 6765  N N  . ASP C 1 602 ? 56.354  102.424 46.890  1.00 123.20 ? 602 ASP C N  1 
ATOM 6766  C CA . ASP C 1 602 ? 56.622  101.832 45.584  1.00 123.20 ? 602 ASP C CA 1 
ATOM 6767  C C  . ASP C 1 602 ? 55.835  100.544 45.366  1.00 123.20 ? 602 ASP C C  1 
ATOM 6768  O O  . ASP C 1 602 ? 55.117  100.407 44.370  1.00 123.20 ? 602 ASP C O  1 
ATOM 6769  N N  . LEU C 1 603 ? 55.937  99.597  46.290  1.00 125.96 ? 603 LEU C N  1 
ATOM 6770  C CA . LEU C 1 603 ? 55.196  98.364  46.125  1.00 125.96 ? 603 LEU C CA 1 
ATOM 6771  C C  . LEU C 1 603 ? 53.833  98.473  46.780  1.00 125.96 ? 603 LEU C C  1 
ATOM 6772  O O  . LEU C 1 603 ? 52.912  97.733  46.416  1.00 125.96 ? 603 LEU C O  1 
ATOM 6773  N N  . GLY C 1 604 ? 53.678  99.440  47.692  1.00 130.33 ? 604 GLY C N  1 
ATOM 6774  C CA . GLY C 1 604 ? 52.359  99.824  48.158  1.00 130.33 ? 604 GLY C CA 1 
ATOM 6775  C C  . GLY C 1 604 ? 51.501  100.417 47.064  1.00 130.33 ? 604 GLY C C  1 
ATOM 6776  O O  . GLY C 1 604 ? 50.272  100.441 47.178  1.00 130.33 ? 604 GLY C O  1 
ATOM 6777  N N  . LYS C 1 605 ? 52.130  100.919 46.001  1.00 134.37 ? 605 LYS C N  1 
ATOM 6778  C CA . LYS C 1 605 ? 51.391  101.240 44.792  1.00 134.37 ? 605 LYS C CA 1 
ATOM 6779  C C  . LYS C 1 605 ? 50.787  99.988  44.159  1.00 134.37 ? 605 LYS C C  1 
ATOM 6780  O O  . LYS C 1 605 ? 49.701  100.062 43.571  1.00 134.37 ? 605 LYS C O  1 
ATOM 6781  N N  . VAL C 1 606 ? 51.430  98.827  44.294  1.00 128.86 ? 606 VAL C N  1 
ATOM 6782  C CA . VAL C 1 606 ? 50.989  97.616  43.603  1.00 128.86 ? 606 VAL C CA 1 
ATOM 6783  C C  . VAL C 1 606 ? 50.327  96.633  44.562  1.00 128.86 ? 606 VAL C C  1 
ATOM 6784  O O  . VAL C 1 606 ? 49.123  96.389  44.477  1.00 128.86 ? 606 VAL C O  1 
ATOM 6785  N N  . PHE C 1 607 ? 51.100  96.050  45.488  1.00 125.89 ? 607 PHE C N  1 
ATOM 6786  C CA . PHE C 1 607 ? 50.501  95.130  46.452  1.00 125.89 ? 607 PHE C CA 1 
ATOM 6787  C C  . PHE C 1 607 ? 51.135  95.230  47.834  1.00 125.89 ? 607 PHE C C  1 
ATOM 6788  O O  . PHE C 1 607 ? 50.996  94.306  48.643  1.00 125.89 ? 607 PHE C O  1 
ATOM 6789  N N  . GLY C 1 608 ? 51.807  96.340  48.136  1.00 134.75 ? 608 GLY C N  1 
ATOM 6790  C CA . GLY C 1 608 ? 52.482  96.439  49.418  1.00 134.75 ? 608 GLY C CA 1 
ATOM 6791  C C  . GLY C 1 608 ? 51.546  96.729  50.572  1.00 134.75 ? 608 GLY C C  1 
ATOM 6792  O O  . GLY C 1 608 ? 51.952  96.669  51.735  1.00 134.75 ? 608 GLY C O  1 
ATOM 6793  N N  . GLU C 1 609 ? 50.286  97.038  50.276  1.00 142.34 ? 609 GLU C N  1 
ATOM 6794  C CA . GLU C 1 609 ? 49.349  97.385  51.334  1.00 142.34 ? 609 GLU C CA 1 
ATOM 6795  C C  . GLU C 1 609 ? 48.792  96.134  51.999  1.00 142.34 ? 609 GLU C C  1 
ATOM 6796  O O  . GLU C 1 609 ? 48.358  96.188  53.155  1.00 142.34 ? 609 GLU C O  1 
ATOM 6797  N N  . ARG C 1 610 ? 48.816  94.994  51.308  1.00 131.75 ? 610 ARG C N  1 
ATOM 6798  C CA . ARG C 1 610 ? 48.208  93.804  51.897  1.00 131.75 ? 610 ARG C CA 1 
ATOM 6799  C C  . ARG C 1 610 ? 49.258  92.804  52.376  1.00 131.75 ? 610 ARG C C  1 
ATOM 6800  O O  . ARG C 1 610 ? 49.134  92.244  53.467  1.00 131.75 ? 610 ARG C O  1 
ATOM 6801  N N  . PHE C 1 611 ? 50.314  92.578  51.599  1.00 126.12 ? 611 PHE C N  1 
ATOM 6802  C CA . PHE C 1 611 ? 51.361  91.704  52.107  1.00 126.12 ? 611 PHE C CA 1 
ATOM 6803  C C  . PHE C 1 611 ? 52.777  92.120  51.731  1.00 126.12 ? 611 PHE C C  1 
ATOM 6804  O O  . PHE C 1 611 ? 53.707  91.348  51.982  1.00 126.12 ? 611 PHE C O  1 
ATOM 6805  N N  . GLY C 1 612 ? 52.984  93.309  51.182  1.00 110.55 ? 612 GLY C N  1 
ATOM 6806  C CA . GLY C 1 612 ? 54.323  93.857  51.184  1.00 110.55 ? 612 GLY C CA 1 
ATOM 6807  C C  . GLY C 1 612 ? 54.435  94.878  52.295  1.00 110.55 ? 612 GLY C C  1 
ATOM 6808  O O  . GLY C 1 612 ? 55.228  95.820  52.215  1.00 110.55 ? 612 GLY C O  1 
ATOM 6809  N N  . GLY C 1 613 ? 53.640  94.684  53.345  1.00 111.85 ? 613 GLY C N  1 
ATOM 6810  C CA . GLY C 1 613 ? 53.534  95.607  54.459  1.00 111.85 ? 613 GLY C CA 1 
ATOM 6811  C C  . GLY C 1 613 ? 52.453  95.160  55.421  1.00 111.85 ? 613 GLY C C  1 
ATOM 6812  O O  . GLY C 1 613 ? 52.392  93.984  55.772  1.00 111.85 ? 613 GLY C O  1 
ATOM 6813  N N  . GLY C 1 614 ? 51.585  96.062  55.858  1.00 123.44 ? 614 GLY C N  1 
ATOM 6814  C CA . GLY C 1 614 ? 50.495  95.617  56.702  1.00 123.44 ? 614 GLY C CA 1 
ATOM 6815  C C  . GLY C 1 614 ? 50.398  96.316  58.040  1.00 123.44 ? 614 GLY C C  1 
ATOM 6816  O O  . GLY C 1 614 ? 49.839  95.774  58.997  1.00 123.44 ? 614 GLY C O  1 
ATOM 6817  N N  . ASN C 1 615 ? 50.967  97.511  58.124  1.00 127.10 ? 615 ASN C N  1 
ATOM 6818  C CA . ASN C 1 615 ? 50.859  98.351  59.292  1.00 127.10 ? 615 ASN C CA 1 
ATOM 6819  C C  . ASN C 1 615 ? 50.680  99.778  58.788  1.00 127.10 ? 615 ASN C C  1 
ATOM 6820  O O  . ASN C 1 615 ? 51.056  100.071 57.644  1.00 127.10 ? 615 ASN C O  1 
ATOM 6821  N N  . PRO C 1 616 ? 50.078  100.672 59.579  1.00 131.78 ? 616 PRO C N  1 
ATOM 6822  C CA . PRO C 1 616 ? 49.968  102.076 59.146  1.00 131.78 ? 616 PRO C CA 1 
ATOM 6823  C C  . PRO C 1 616 ? 51.333  102.739 59.078  1.00 131.78 ? 616 PRO C C  1 
ATOM 6824  O O  . PRO C 1 616 ? 52.134  102.646 60.008  1.00 131.78 ? 616 PRO C O  1 
ATOM 6825  N N  . GLU C 1 617 ? 51.607  103.373 57.948  1.00 126.11 ? 617 GLU C N  1 
ATOM 6826  C CA . GLU C 1 617 ? 52.874  104.060 57.746  1.00 126.11 ? 617 GLU C CA 1 
ATOM 6827  C C  . GLU C 1 617 ? 52.877  105.343 58.558  1.00 126.11 ? 617 GLU C C  1 
ATOM 6828  O O  . GLU C 1 617 ? 51.912  106.112 58.527  1.00 126.11 ? 617 GLU C O  1 
ATOM 6829  N N  . LEU C 1 618 ? 53.957  105.577 59.288  1.00 125.70 ? 618 LEU C N  1 
ATOM 6830  C CA . LEU C 1 618 ? 54.100  106.802 60.051  1.00 125.70 ? 618 LEU C CA 1 
ATOM 6831  C C  . LEU C 1 618 ? 55.419  107.514 59.784  1.00 125.70 ? 618 LEU C C  1 
ATOM 6832  O O  . LEU C 1 618 ? 55.694  108.542 60.414  1.00 125.70 ? 618 LEU C O  1 
ATOM 6833  N N  . LEU C 1 619 ? 56.225  107.007 58.846  1.00 128.16 ? 619 LEU C N  1 
ATOM 6834  C CA . LEU C 1 619 ? 57.528  107.604 58.572  1.00 128.16 ? 619 LEU C CA 1 
ATOM 6835  C C  . LEU C 1 619 ? 57.386  108.996 57.971  1.00 128.16 ? 619 LEU C C  1 
ATOM 6836  O O  . LEU C 1 619 ? 58.282  109.832 58.133  1.00 128.16 ? 619 LEU C O  1 
ATOM 6837  N N  . THR C 1 620 ? 56.263  109.274 57.305  1.00 132.85 ? 620 THR C N  1 
ATOM 6838  C CA . THR C 1 620 ? 56.011  110.640 56.865  1.00 132.85 ? 620 THR C CA 1 
ATOM 6839  C C  . THR C 1 620 ? 55.752  111.555 58.059  1.00 132.85 ? 620 THR C C  1 
ATOM 6840  O O  . THR C 1 620 ? 56.114  112.734 58.034  1.00 132.85 ? 620 THR C O  1 
ATOM 6841  N N  . GLN C 1 621 ? 55.195  111.014 59.146  1.00 125.49 ? 621 GLN C N  1 
ATOM 6842  C CA . GLN C 1 621 ? 55.130  111.801 60.368  1.00 125.49 ? 621 GLN C CA 1 
ATOM 6843  C C  . GLN C 1 621 ? 56.491  111.940 61.023  1.00 125.49 ? 621 GLN C C  1 
ATOM 6844  O O  . GLN C 1 621 ? 56.734  112.950 61.691  1.00 125.49 ? 621 GLN C O  1 
ATOM 6845  N N  . MET C 1 622 ? 57.379  110.954 60.848  1.00 126.59 ? 622 MET C N  1 
ATOM 6846  C CA . MET C 1 622 ? 58.751  111.115 61.331  1.00 126.59 ? 622 MET C CA 1 
ATOM 6847  C C  . MET C 1 622 ? 59.483  112.235 60.597  1.00 126.59 ? 622 MET C C  1 
ATOM 6848  O O  . MET C 1 622 ? 60.195  113.033 61.214  1.00 126.59 ? 622 MET C O  1 
ATOM 6849  N N  . VAL C 1 623 ? 59.336  112.294 59.275  1.00 123.71 ? 623 VAL C N  1 
ATOM 6850  C CA . VAL C 1 623 ? 60.011  113.338 58.506  1.00 123.71 ? 623 VAL C CA 1 
ATOM 6851  C C  . VAL C 1 623 ? 59.219  114.629 58.449  1.00 123.71 ? 623 VAL C C  1 
ATOM 6852  O O  . VAL C 1 623 ? 59.702  115.611 57.870  1.00 123.71 ? 623 VAL C O  1 
ATOM 6853  N N  . SER C 1 624 ? 57.999  114.641 58.997  1.00 120.93 ? 624 SER C N  1 
ATOM 6854  C CA . SER C 1 624 ? 57.218  115.868 59.073  1.00 120.93 ? 624 SER C CA 1 
ATOM 6855  C C  . SER C 1 624 ? 57.906  116.908 59.936  1.00 120.93 ? 624 SER C C  1 
ATOM 6856  O O  . SER C 1 624 ? 57.902  118.098 59.600  1.00 120.93 ? 624 SER C O  1 
ATOM 6857  N N  . LYS C 1 625 ? 58.519  116.479 61.038  1.00 126.75 ? 625 LYS C N  1 
ATOM 6858  C CA . LYS C 1 625 ? 59.400  117.375 61.770  1.00 126.75 ? 625 LYS C CA 1 
ATOM 6859  C C  . LYS C 1 625 ? 60.673  117.640 60.982  1.00 126.75 ? 625 LYS C C  1 
ATOM 6860  O O  . LYS C 1 625 ? 61.221  118.745 61.040  1.00 126.75 ? 625 LYS C O  1 
ATOM 6861  N N  . GLY C 1 626 ? 61.134  116.663 60.212  1.00 121.48 ? 626 GLY C N  1 
ATOM 6862  C CA . GLY C 1 626 ? 62.328  116.830 59.421  1.00 121.48 ? 626 GLY C CA 1 
ATOM 6863  C C  . GLY C 1 626 ? 63.558  116.133 59.946  1.00 121.48 ? 626 GLY C C  1 
ATOM 6864  O O  . GLY C 1 626 ? 64.640  116.727 59.907  1.00 121.48 ? 626 GLY C O  1 
ATOM 6865  N N  . PHE C 1 627 ? 63.431  114.910 60.458  1.00 117.45 ? 627 PHE C N  1 
ATOM 6866  C CA . PHE C 1 627 ? 64.597  114.182 60.937  1.00 117.45 ? 627 PHE C CA 1 
ATOM 6867  C C  . PHE C 1 627 ? 65.409  113.690 59.745  1.00 117.45 ? 627 PHE C C  1 
ATOM 6868  O O  . PHE C 1 627 ? 64.849  113.342 58.701  1.00 117.45 ? 627 PHE C O  1 
ATOM 6869  N N  . LEU C 1 628 ? 66.732  113.653 59.907  1.00 109.24 ? 628 LEU C N  1 
ATOM 6870  C CA . LEU C 1 628 ? 67.650  113.574 58.779  1.00 109.24 ? 628 LEU C CA 1 
ATOM 6871  C C  . LEU C 1 628 ? 68.407  112.245 58.743  1.00 109.24 ? 628 LEU C C  1 
ATOM 6872  O O  . LEU C 1 628 ? 69.120  111.959 57.775  1.00 109.24 ? 628 LEU C O  1 
ATOM 6873  N N  . GLY C 1 629 ? 68.224  111.399 59.752  1.00 115.30 ? 629 GLY C N  1 
ATOM 6874  C CA . GLY C 1 629 ? 68.831  110.084 59.733  1.00 115.30 ? 629 GLY C CA 1 
ATOM 6875  C C  . GLY C 1 629 ? 70.301  110.091 60.083  1.00 115.30 ? 629 GLY C C  1 
ATOM 6876  O O  . GLY C 1 629 ? 70.694  110.656 61.103  1.00 115.30 ? 629 GLY C O  1 
ATOM 6877  N N  . ARG C 1 630 ? 71.126  109.463 59.241  1.00 121.18 ? 630 ARG C N  1 
ATOM 6878  C CA . ARG C 1 630 ? 72.556  109.388 59.521  1.00 121.18 ? 630 ARG C CA 1 
ATOM 6879  C C  . ARG C 1 630 ? 73.226  110.741 59.358  1.00 121.18 ? 630 ARG C C  1 
ATOM 6880  O O  . ARG C 1 630 ? 74.227  111.024 60.026  1.00 121.18 ? 630 ARG C O  1 
ATOM 6881  N N  . LYS C 1 631 ? 72.676  111.599 58.503  1.00 117.92 ? 631 LYS C N  1 
ATOM 6882  C CA . LYS C 1 631 ? 73.274  112.910 58.298  1.00 117.92 ? 631 LYS C CA 1 
ATOM 6883  C C  . LYS C 1 631 ? 72.944  113.864 59.439  1.00 117.92 ? 631 LYS C C  1 
ATOM 6884  O O  . LYS C 1 631 ? 73.545  114.939 59.521  1.00 117.92 ? 631 LYS C O  1 
ATOM 6885  N N  . SER C 1 632 ? 71.992  113.504 60.304  1.00 119.55 ? 632 SER C N  1 
ATOM 6886  C CA . SER C 1 632 ? 71.767  114.195 61.569  1.00 119.55 ? 632 SER C CA 1 
ATOM 6887  C C  . SER C 1 632 ? 72.648  113.666 62.686  1.00 119.55 ? 632 SER C C  1 
ATOM 6888  O O  . SER C 1 632 ? 72.528  114.130 63.823  1.00 119.55 ? 632 SER C O  1 
ATOM 6889  N N  . GLY C 1 633 ? 73.500  112.696 62.395  1.00 124.32 ? 633 GLY C N  1 
ATOM 6890  C CA . GLY C 1 633 ? 74.459  112.191 63.377  1.00 124.32 ? 633 GLY C CA 1 
ATOM 6891  C C  . GLY C 1 633 ? 73.890  111.327 64.464  1.00 124.32 ? 633 GLY C C  1 
ATOM 6892  O O  . GLY C 1 633 ? 74.150  110.122 64.500  1.00 124.32 ? 633 GLY C O  1 
ATOM 6893  N N  . LYS C 1 634 ? 73.105  111.907 65.358  1.00 117.31 ? 634 LYS C N  1 
ATOM 6894  C CA . LYS C 1 634 ? 72.539  111.165 66.469  1.00 117.31 ? 634 LYS C CA 1 
ATOM 6895  C C  . LYS C 1 634 ? 71.294  110.432 65.997  1.00 117.31 ? 634 LYS C C  1 
ATOM 6896  O O  . LYS C 1 634 ? 70.454  110.986 65.285  1.00 117.31 ? 634 LYS C O  1 
ATOM 6897  N N  . GLY C 1 635 ? 71.174  109.182 66.424  1.00 118.47 ? 635 GLY C N  1 
ATOM 6898  C CA . GLY C 1 635 ? 70.069  108.328 66.045  1.00 118.47 ? 635 GLY C CA 1 
ATOM 6899  C C  . GLY C 1 635 ? 68.815  108.618 66.838  1.00 118.47 ? 635 GLY C C  1 
ATOM 6900  O O  . GLY C 1 635 ? 68.414  109.769 67.033  1.00 118.47 ? 635 GLY C O  1 
ATOM 6901  N N  . PHE C 1 636 ? 68.170  107.549 67.282  1.00 115.53 ? 636 PHE C N  1 
ATOM 6902  C CA . PHE C 1 636 ? 66.983  107.693 68.102  1.00 115.53 ? 636 PHE C CA 1 
ATOM 6903  C C  . PHE C 1 636 ? 67.372  107.707 69.570  1.00 115.53 ? 636 PHE C C  1 
ATOM 6904  O O  . PHE C 1 636 ? 68.556  107.749 69.903  1.00 115.53 ? 636 PHE C O  1 
ATOM 6905  N N  . LEU C 1 648 ? 67.575  109.034 72.998  1.00 128.64 ? 648 LEU C N  1 
ATOM 6906  C CA . LEU C 1 648 ? 66.171  108.718 73.199  1.00 128.64 ? 648 LEU C CA 1 
ATOM 6907  C C  . LEU C 1 648 ? 65.331  109.561 72.240  1.00 128.64 ? 648 LEU C C  1 
ATOM 6908  O O  . LEU C 1 648 ? 64.296  109.106 71.747  1.00 128.64 ? 648 LEU C O  1 
ATOM 6909  N N  . ASN C 1 649 ? 65.770  110.808 72.051  1.00 133.87 ? 649 ASN C N  1 
ATOM 6910  C CA . ASN C 1 649 ? 65.319  111.825 71.095  1.00 133.87 ? 649 ASN C CA 1 
ATOM 6911  C C  . ASN C 1 649 ? 63.963  112.442 71.458  1.00 133.87 ? 649 ASN C C  1 
ATOM 6912  O O  . ASN C 1 649 ? 63.605  113.481 70.893  1.00 133.87 ? 649 ASN C O  1 
ATOM 6913  N N  . SER C 1 650 ? 63.223  111.869 72.410  1.00 136.60 ? 650 SER C N  1 
ATOM 6914  C CA . SER C 1 650 ? 62.061  112.444 73.097  1.00 136.60 ? 650 SER C CA 1 
ATOM 6915  C C  . SER C 1 650 ? 60.882  112.790 72.189  1.00 136.60 ? 650 SER C C  1 
ATOM 6916  O O  . SER C 1 650 ? 59.996  113.540 72.611  1.00 136.60 ? 650 SER C O  1 
ATOM 6917  N N  . ASP C 1 651 ? 60.820  112.275 70.962  1.00 124.79 ? 651 ASP C N  1 
ATOM 6918  C CA . ASP C 1 651 ? 59.722  112.621 70.069  1.00 124.79 ? 651 ASP C CA 1 
ATOM 6919  C C  . ASP C 1 651 ? 59.070  111.444 69.357  1.00 124.79 ? 651 ASP C C  1 
ATOM 6920  O O  . ASP C 1 651 ? 58.037  111.640 68.706  1.00 124.79 ? 651 ASP C O  1 
ATOM 6921  N N  . MET C 1 652 ? 59.629  110.237 69.458  1.00 114.15 ? 652 MET C N  1 
ATOM 6922  C CA . MET C 1 652 ? 58.945  109.056 68.946  1.00 114.15 ? 652 MET C CA 1 
ATOM 6923  C C  . MET C 1 652 ? 57.705  108.718 69.752  1.00 114.15 ? 652 MET C C  1 
ATOM 6924  O O  . MET C 1 652 ? 56.762  108.138 69.211  1.00 114.15 ? 652 MET C O  1 
ATOM 6925  N N  . ASP C 1 653 ? 57.703  109.052 71.040  1.00 119.30 ? 653 ASP C N  1 
ATOM 6926  C CA . ASP C 1 653 ? 56.595  108.726 71.923  1.00 119.30 ? 653 ASP C CA 1 
ATOM 6927  C C  . ASP C 1 653 ? 55.346  109.535 71.622  1.00 119.30 ? 653 ASP C C  1 
ATOM 6928  O O  . ASP C 1 653 ? 54.237  109.025 71.804  1.00 119.30 ? 653 ASP C O  1 
ATOM 6929  N N  . SER C 1 654 ? 55.500  110.768 71.145  1.00 118.65 ? 654 SER C N  1 
ATOM 6930  C CA . SER C 1 654 ? 54.353  111.597 70.806  1.00 118.65 ? 654 SER C CA 1 
ATOM 6931  C C  . SER C 1 654 ? 53.608  111.074 69.591  1.00 118.65 ? 654 SER C C  1 
ATOM 6932  O O  . SER C 1 654 ? 52.415  111.354 69.434  1.00 118.65 ? 654 SER C O  1 
ATOM 6933  N N  . ILE C 1 655 ? 54.290  110.294 68.756  1.00 115.45 ? 655 ILE C N  1 
ATOM 6934  C CA . ILE C 1 655 ? 53.663  109.654 67.613  1.00 115.45 ? 655 ILE C CA 1 
ATOM 6935  C C  . ILE C 1 655 ? 52.611  108.656 68.059  1.00 115.45 ? 655 ILE C C  1 
ATOM 6936  O O  . ILE C 1 655 ? 51.489  108.648 67.545  1.00 115.45 ? 655 ILE C O  1 
ATOM 6937  N N  . LEU C 1 656 ? 52.952  107.811 69.020  1.00 114.01 ? 656 LEU C N  1 
ATOM 6938  C CA . LEU C 1 656 ? 52.070  106.715 69.365  1.00 114.01 ? 656 LEU C CA 1 
ATOM 6939  C C  . LEU C 1 656 ? 50.960  107.194 70.271  1.00 114.01 ? 656 LEU C C  1 
ATOM 6940  O O  . LEU C 1 656 ? 49.840  106.679 70.206  1.00 114.01 ? 656 LEU C O  1 
ATOM 6941  N N  . ALA C 1 657 ? 51.257  108.192 71.096  1.00 120.09 ? 657 ALA C N  1 
ATOM 6942  C CA . ALA C 1 657 ? 50.285  108.819 71.973  1.00 120.09 ? 657 ALA C CA 1 
ATOM 6943  C C  . ALA C 1 657 ? 49.625  110.032 71.337  1.00 120.09 ? 657 ALA C C  1 
ATOM 6944  O O  . ALA C 1 657 ? 48.999  110.820 72.056  1.00 120.09 ? 657 ALA C O  1 
ATOM 6945  N N  . SER C 1 658 ? 49.801  110.224 70.028  1.00 129.29 ? 658 SER C N  1 
ATOM 6946  C CA . SER C 1 658 ? 48.971  111.169 69.290  1.00 129.29 ? 658 SER C CA 1 
ATOM 6947  C C  . SER C 1 658 ? 47.497  110.815 69.429  1.00 129.29 ? 658 SER C C  1 
ATOM 6948  O O  . SER C 1 658 ? 46.728  111.535 70.073  1.00 129.29 ? 658 SER C O  1 
ATOM 6949  N N  . LEU C 1 659 ? 47.090  109.700 68.839  1.00 136.09 ? 659 LEU C N  1 
ATOM 6950  C CA . LEU C 1 659 ? 45.826  109.056 69.148  1.00 136.09 ? 659 LEU C CA 1 
ATOM 6951  C C  . LEU C 1 659 ? 46.126  107.621 69.552  1.00 136.09 ? 659 LEU C C  1 
ATOM 6952  O O  . LEU C 1 659 ? 47.113  107.032 69.100  1.00 136.09 ? 659 LEU C O  1 
ATOM 6953  N N  . LYS C 1 660 ? 45.277  107.061 70.408  1.00 141.26 ? 660 LYS C N  1 
ATOM 6954  C CA . LYS C 1 660 ? 45.621  105.827 71.109  1.00 141.26 ? 660 LYS C CA 1 
ATOM 6955  C C  . LYS C 1 660 ? 45.437  104.632 70.179  1.00 141.26 ? 660 LYS C C  1 
ATOM 6956  O O  . LYS C 1 660 ? 44.437  103.913 70.203  1.00 141.26 ? 660 LYS C O  1 
ATOM 6957  N N  . LEU C 1 661 ? 46.434  104.453 69.331  1.00 147.81 ? 661 LEU C N  1 
ATOM 6958  C CA . LEU C 1 661 ? 46.543  103.288 68.462  1.00 147.81 ? 661 LEU C CA 1 
ATOM 6959  C C  . LEU C 1 661 ? 47.020  101.982 69.133  1.00 147.81 ? 661 LEU C C  1 
ATOM 6960  O O  . LEU C 1 661 ? 46.618  100.915 68.650  1.00 147.81 ? 661 LEU C O  1 
ATOM 6961  N N  . PRO C 1 662 ? 47.834  101.953 70.206  1.00 155.95 ? 662 PRO C N  1 
ATOM 6962  C CA . PRO C 1 662 ? 48.135  100.647 70.847  1.00 155.95 ? 662 PRO C CA 1 
ATOM 6963  C C  . PRO C 1 662 ? 47.350  100.331 72.116  1.00 155.95 ? 662 PRO C C  1 
ATOM 6964  O O  . PRO C 1 662 ? 47.972  100.261 73.182  1.00 155.95 ? 662 PRO C O  1 
ATOM 6965  N N  . PRO C 1 663 ? 46.027  100.060 72.074  1.00 166.98 ? 663 PRO C N  1 
ATOM 6966  C CA . PRO C 1 663 ? 45.475  99.198  73.141  1.00 166.98 ? 663 PRO C CA 1 
ATOM 6967  C C  . PRO C 1 663 ? 45.644  97.699  72.894  1.00 166.98 ? 663 PRO C C  1 
ATOM 6968  O O  . PRO C 1 663 ? 44.955  96.893  73.537  1.00 166.98 ? 663 PRO C O  1 
ATOM 6969  N N  . LYS C 1 664 ? 46.525  97.305  71.971  1.00 156.12 ? 664 LYS C N  1 
ATOM 6970  C CA . LYS C 1 664 ? 46.599  95.926  71.489  1.00 156.12 ? 664 LYS C CA 1 
ATOM 6971  C C  . LYS C 1 664 ? 47.132  94.979  72.550  1.00 156.12 ? 664 LYS C C  1 
ATOM 6972  O O  . LYS C 1 664 ? 47.945  95.357  73.398  1.00 156.12 ? 664 LYS C O  1 
ATOM 6973  N N  . SER C 1 665 ? 46.679  93.730  72.477  1.00 169.27 ? 665 SER C N  1 
ATOM 6974  C CA . SER C 1 665 ? 47.062  92.699  73.424  1.00 169.27 ? 665 SER C CA 1 
ATOM 6975  C C  . SER C 1 665 ? 47.186  91.365  72.702  1.00 169.27 ? 665 SER C C  1 
ATOM 6976  O O  . SER C 1 665 ? 46.240  90.887  72.072  1.00 169.27 ? 665 SER C O  1 
ATOM 6977  N N  . GLU C 1 666 ? 48.372  90.768  72.815  1.00 147.38 ? 666 GLU C N  1 
ATOM 6978  C CA . GLU C 1 666 ? 48.606  89.391  72.397  1.00 147.38 ? 666 GLU C CA 1 
ATOM 6979  C C  . GLU C 1 666 ? 49.848  88.909  73.126  1.00 147.38 ? 666 GLU C C  1 
ATOM 6980  O O  . GLU C 1 666 ? 50.717  89.714  73.478  1.00 147.38 ? 666 GLU C O  1 
ATOM 6981  N N  . VAL C 1 667 ? 49.941  87.605  73.363  1.00 131.18 ? 667 VAL C N  1 
ATOM 6982  C CA . VAL C 1 667 ? 51.102  87.017  74.007  1.00 131.18 ? 667 VAL C CA 1 
ATOM 6983  C C  . VAL C 1 667 ? 52.200  86.991  72.951  1.00 131.18 ? 667 VAL C C  1 
ATOM 6984  O O  . VAL C 1 667 ? 52.309  86.055  72.157  1.00 131.18 ? 667 VAL C O  1 
ATOM 6985  N N  . SER C 1 668 ? 53.014  88.045  72.934  1.00 126.32 ? 668 SER C N  1 
ATOM 6986  C CA . SER C 1 668 ? 54.113  88.178  71.980  1.00 126.32 ? 668 SER C CA 1 
ATOM 6987  C C  . SER C 1 668 ? 55.341  88.558  72.796  1.00 126.32 ? 668 SER C C  1 
ATOM 6988  O O  . SER C 1 668 ? 55.590  89.738  73.050  1.00 126.32 ? 668 SER C O  1 
ATOM 6989  N N  . SER C 1 669 ? 56.106  87.553  73.196  1.00 130.74 ? 669 SER C N  1 
ATOM 6990  C CA . SER C 1 669 ? 57.357  87.786  73.898  1.00 130.74 ? 669 SER C CA 1 
ATOM 6991  C C  . SER C 1 669 ? 58.446  88.151  72.891  1.00 130.74 ? 669 SER C C  1 
ATOM 6992  O O  . SER C 1 669 ? 58.190  88.382  71.705  1.00 130.74 ? 669 SER C O  1 
ATOM 6993  N N  . ASP C 1 670 ? 59.688  88.201  73.373  1.00 133.69 ? 670 ASP C N  1 
ATOM 6994  C CA . ASP C 1 670 ? 60.814  88.559  72.518  1.00 133.69 ? 670 ASP C CA 1 
ATOM 6995  C C  . ASP C 1 670 ? 61.088  87.487  71.473  1.00 133.69 ? 670 ASP C C  1 
ATOM 6996  O O  . ASP C 1 670 ? 61.279  87.804  70.294  1.00 133.69 ? 670 ASP C O  1 
ATOM 6997  N N  . GLU C 1 671 ? 61.083  86.216  71.891  1.00 128.62 ? 671 GLU C N  1 
ATOM 6998  C CA . GLU C 1 671 ? 61.219  85.098  70.961  1.00 128.62 ? 671 GLU C CA 1 
ATOM 6999  C C  . GLU C 1 671 ? 60.084  85.084  69.950  1.00 128.62 ? 671 GLU C C  1 
ATOM 7000  O O  . GLU C 1 671 ? 60.292  84.748  68.774  1.00 128.62 ? 671 GLU C O  1 
ATOM 7001  N N  . ASP C 1 672 ? 58.888  85.474  70.395  1.00 132.80 ? 672 ASP C N  1 
ATOM 7002  C CA . ASP C 1 672 ? 57.725  85.526  69.520  1.00 132.80 ? 672 ASP C CA 1 
ATOM 7003  C C  . ASP C 1 672 ? 57.931  86.528  68.396  1.00 132.80 ? 672 ASP C C  1 
ATOM 7004  O O  . ASP C 1 672 ? 57.771  86.189  67.224  1.00 132.80 ? 672 ASP C O  1 
ATOM 7005  N N  . ILE C 1 673 ? 58.346  87.749  68.730  1.00 125.95 ? 673 ILE C N  1 
ATOM 7006  C CA . ILE C 1 673 ? 58.482  88.767  67.693  1.00 125.95 ? 673 ILE C CA 1 
ATOM 7007  C C  . ILE C 1 673 ? 59.734  88.530  66.836  1.00 125.95 ? 673 ILE C C  1 
ATOM 7008  O O  . ILE C 1 673 ? 59.741  88.880  65.642  1.00 125.95 ? 673 ILE C O  1 
ATOM 7009  N N  . GLN C 1 674 ? 60.773  87.895  67.404  1.00 119.14 ? 674 GLN C N  1 
ATOM 7010  C CA . GLN C 1 674 ? 61.919  87.453  66.610  1.00 119.14 ? 674 GLN C CA 1 
ATOM 7011  C C  . GLN C 1 674 ? 61.484  86.485  65.524  1.00 119.14 ? 674 GLN C C  1 
ATOM 7012  O O  . GLN C 1 674 ? 61.756  86.698  64.335  1.00 119.14 ? 674 GLN C O  1 
ATOM 7013  N N  . PHE C 1 675 ? 60.771  85.430  65.914  1.00 127.99 ? 675 PHE C N  1 
ATOM 7014  C CA . PHE C 1 675 ? 60.297  84.515  64.892  1.00 127.99 ? 675 PHE C CA 1 
ATOM 7015  C C  . PHE C 1 675 ? 59.209  85.114  64.017  1.00 127.99 ? 675 PHE C C  1 
ATOM 7016  O O  . PHE C 1 675 ? 59.071  84.665  62.888  1.00 127.99 ? 675 PHE C O  1 
ATOM 7017  N N  . ARG C 1 676 ? 58.472  86.135  64.470  1.00 124.22 ? 676 ARG C N  1 
ATOM 7018  C CA . ARG C 1 676 ? 57.507  86.776  63.574  1.00 124.22 ? 676 ARG C CA 1 
ATOM 7019  C C  . ARG C 1 676 ? 58.214  87.499  62.439  1.00 124.22 ? 676 ARG C C  1 
ATOM 7020  O O  . ARG C 1 676 ? 57.863  87.319  61.262  1.00 124.22 ? 676 ARG C O  1 
ATOM 7021  N N  . LEU C 1 677 ? 59.242  88.286  62.769  1.00 104.16 ? 677 LEU C N  1 
ATOM 7022  C CA . LEU C 1 677 ? 59.952  89.014  61.725  1.00 104.16 ? 677 LEU C CA 1 
ATOM 7023  C C  . LEU C 1 677 ? 60.733  88.062  60.829  1.00 104.16 ? 677 LEU C C  1 
ATOM 7024  O O  . LEU C 1 677 ? 60.733  88.220  59.601  1.00 104.16 ? 677 LEU C O  1 
ATOM 7025  N N  . VAL C 1 678 ? 61.302  87.004  61.407  1.00 109.90 ? 678 VAL C N  1 
ATOM 7026  C CA . VAL C 1 678 ? 62.062  86.058  60.599  1.00 109.90 ? 678 VAL C CA 1 
ATOM 7027  C C  . VAL C 1 678 ? 61.137  85.208  59.729  1.00 109.90 ? 678 VAL C C  1 
ATOM 7028  O O  . VAL C 1 678 ? 61.432  84.968  58.555  1.00 109.90 ? 678 VAL C O  1 
ATOM 7029  N N  . THR C 1 679 ? 59.992  84.771  60.265  1.00 120.59 ? 679 THR C N  1 
ATOM 7030  C CA . THR C 1 679 ? 59.072  83.952  59.482  1.00 120.59 ? 679 THR C CA 1 
ATOM 7031  C C  . THR C 1 679 ? 58.393  84.744  58.377  1.00 120.59 ? 679 THR C C  1 
ATOM 7032  O O  . THR C 1 679 ? 58.134  84.189  57.306  1.00 120.59 ? 679 THR C O  1 
ATOM 7033  N N  . ARG C 1 680 ? 58.133  86.034  58.580  1.00 109.77 ? 680 ARG C N  1 
ATOM 7034  C CA . ARG C 1 680 ? 57.638  86.794  57.443  1.00 109.77 ? 680 ARG C CA 1 
ATOM 7035  C C  . ARG C 1 680 ? 58.736  87.045  56.419  1.00 109.77 ? 680 ARG C C  1 
ATOM 7036  O O  . ARG C 1 680 ? 58.477  86.993  55.205  1.00 109.77 ? 680 ARG C O  1 
ATOM 7037  N N  . PHE C 1 681 ? 59.967  87.261  56.895  1.00 90.13  ? 681 PHE C N  1 
ATOM 7038  C CA . PHE C 1 681 ? 61.106  87.425  56.004  1.00 90.13  ? 681 PHE C CA 1 
ATOM 7039  C C  . PHE C 1 681 ? 61.335  86.183  55.152  1.00 90.13  ? 681 PHE C C  1 
ATOM 7040  O O  . PHE C 1 681 ? 61.588  86.280  53.948  1.00 90.13  ? 681 PHE C O  1 
ATOM 7041  N N  . VAL C 1 682 ? 61.158  85.001  55.735  1.00 99.45  ? 682 VAL C N  1 
ATOM 7042  C CA . VAL C 1 682 ? 61.326  83.792  54.946  1.00 99.45  ? 682 VAL C CA 1 
ATOM 7043  C C  . VAL C 1 682 ? 60.071  83.453  54.160  1.00 99.45  ? 682 VAL C C  1 
ATOM 7044  O O  . VAL C 1 682 ? 60.169  82.735  53.162  1.00 99.45  ? 682 VAL C O  1 
ATOM 7045  N N  . ASN C 1 683 ? 58.899  83.956  54.564  1.00 104.25 ? 683 ASN C N  1 
ATOM 7046  C CA . ASN C 1 683 ? 57.719  83.831  53.719  1.00 104.25 ? 683 ASN C CA 1 
ATOM 7047  C C  . ASN C 1 683 ? 57.927  84.581  52.419  1.00 104.25 ? 683 ASN C C  1 
ATOM 7048  O O  . ASN C 1 683 ? 57.581  84.085  51.339  1.00 104.25 ? 683 ASN C O  1 
ATOM 7049  N N  . GLU C 1 684 ? 58.519  85.763  52.505  1.00 106.78 ? 684 GLU C N  1 
ATOM 7050  C CA . GLU C 1 684 ? 58.834  86.461  51.271  1.00 106.78 ? 684 GLU C CA 1 
ATOM 7051  C C  . GLU C 1 684 ? 60.002  85.812  50.545  1.00 106.78 ? 684 GLU C C  1 
ATOM 7052  O O  . GLU C 1 684 ? 59.993  85.720  49.311  1.00 106.78 ? 684 GLU C O  1 
ATOM 7053  N N  . ALA C 1 685 ? 60.981  85.304  51.283  1.00 102.61 ? 685 ALA C N  1 
ATOM 7054  C CA . ALA C 1 685 ? 62.125  84.667  50.652  1.00 102.61 ? 685 ALA C CA 1 
ATOM 7055  C C  . ALA C 1 685 ? 61.793  83.311  50.041  1.00 102.61 ? 685 ALA C C  1 
ATOM 7056  O O  . ALA C 1 685 ? 62.608  82.778  49.281  1.00 102.61 ? 685 ALA C O  1 
ATOM 7057  N N  . VAL C 1 686 ? 60.638  82.736  50.370  1.00 108.12 ? 686 VAL C N  1 
ATOM 7058  C CA . VAL C 1 686 ? 60.121  81.570  49.667  1.00 108.12 ? 686 VAL C CA 1 
ATOM 7059  C C  . VAL C 1 686 ? 59.069  81.963  48.651  1.00 108.12 ? 686 VAL C C  1 
ATOM 7060  O O  . VAL C 1 686 ? 58.742  81.151  47.769  1.00 108.12 ? 686 VAL C O  1 
ATOM 7061  N N  . MET C 1 687 ? 58.547  83.191  48.727  1.00 115.24 ? 687 MET C N  1 
ATOM 7062  C CA . MET C 1 687 ? 57.716  83.691  47.644  1.00 115.24 ? 687 MET C CA 1 
ATOM 7063  C C  . MET C 1 687 ? 58.512  83.819  46.356  1.00 115.24 ? 687 MET C C  1 
ATOM 7064  O O  . MET C 1 687 ? 57.969  83.580  45.272  1.00 115.24 ? 687 MET C O  1 
ATOM 7065  N N  . CYS C 1 688 ? 59.802  84.130  46.448  1.00 117.94 ? 688 CYS C N  1 
ATOM 7066  C CA . CYS C 1 688 ? 60.614  84.190  45.243  1.00 117.94 ? 688 CYS C CA 1 
ATOM 7067  C C  . CYS C 1 688 ? 60.822  82.786  44.694  1.00 117.94 ? 688 CYS C C  1 
ATOM 7068  O O  . CYS C 1 688 ? 60.756  81.804  45.443  1.00 117.94 ? 688 CYS C O  1 
ATOM 7069  N N  . LEU C 1 689 ? 60.953  82.712  43.361  1.00 118.27 ? 689 LEU C N  1 
ATOM 7070  C CA . LEU C 1 689 ? 61.054  81.531  42.497  1.00 118.27 ? 689 LEU C CA 1 
ATOM 7071  C C  . LEU C 1 689 ? 59.714  80.802  42.372  1.00 118.27 ? 689 LEU C C  1 
ATOM 7072  O O  . LEU C 1 689 ? 59.552  79.944  41.501  1.00 118.27 ? 689 LEU C O  1 
ATOM 7073  N N  . GLN C 1 690 ? 58.711  81.190  43.158  1.00 118.46 ? 690 GLN C N  1 
ATOM 7074  C CA . GLN C 1 690 ? 57.362  80.710  42.889  1.00 118.46 ? 690 GLN C CA 1 
ATOM 7075  C C  . GLN C 1 690 ? 56.816  81.359  41.623  1.00 118.46 ? 690 GLN C C  1 
ATOM 7076  O O  . GLN C 1 690 ? 56.036  80.748  40.883  1.00 118.46 ? 690 GLN C O  1 
ATOM 7077  N N  . GLU C 1 691 ? 57.255  82.587  41.339  1.00 131.54 ? 691 GLU C N  1 
ATOM 7078  C CA . GLU C 1 691 ? 57.065  83.233  40.048  1.00 131.54 ? 691 GLU C CA 1 
ATOM 7079  C C  . GLU C 1 691 ? 58.270  83.029  39.141  1.00 131.54 ? 691 GLU C C  1 
ATOM 7080  O O  . GLU C 1 691 ? 58.283  83.517  38.006  1.00 131.54 ? 691 GLU C O  1 
ATOM 7081  N N  . GLY C 1 692 ? 59.278  82.309  39.614  1.00 128.69 ? 692 GLY C N  1 
ATOM 7082  C CA . GLY C 1 692 ? 60.513  82.185  38.874  1.00 128.69 ? 692 GLY C CA 1 
ATOM 7083  C C  . GLY C 1 692 ? 61.335  83.454  38.867  1.00 128.69 ? 692 GLY C C  1 
ATOM 7084  O O  . GLY C 1 692 ? 61.468  84.104  37.828  1.00 128.69 ? 692 GLY C O  1 
ATOM 7085  N N  . ILE C 1 693 ? 61.881  83.827  40.030  1.00 123.74 ? 693 ILE C N  1 
ATOM 7086  C CA . ILE C 1 693 ? 62.778  84.977  40.116  1.00 123.74 ? 693 ILE C CA 1 
ATOM 7087  C C  . ILE C 1 693 ? 64.110  84.713  39.420  1.00 123.74 ? 693 ILE C C  1 
ATOM 7088  O O  . ILE C 1 693 ? 64.774  85.667  38.985  1.00 123.74 ? 693 ILE C O  1 
ATOM 7089  N N  . LEU C 1 694 ? 64.487  83.444  39.246  1.00 134.29 ? 694 LEU C N  1 
ATOM 7090  C CA . LEU C 1 694 ? 65.705  83.018  38.572  1.00 134.29 ? 694 LEU C CA 1 
ATOM 7091  C C  . LEU C 1 694 ? 65.546  81.546  38.192  1.00 134.29 ? 694 LEU C C  1 
ATOM 7092  O O  . LEU C 1 694 ? 64.436  81.006  38.187  1.00 134.29 ? 694 LEU C O  1 
ATOM 7093  N N  . ALA C 1 695 ? 66.655  80.895  37.838  1.00 132.29 ? 695 ALA C N  1 
ATOM 7094  C CA . ALA C 1 695 ? 66.588  79.527  37.330  1.00 132.29 ? 695 ALA C CA 1 
ATOM 7095  C C  . ALA C 1 695 ? 66.397  78.495  38.440  1.00 132.29 ? 695 ALA C C  1 
ATOM 7096  O O  . ALA C 1 695 ? 65.408  77.756  38.434  1.00 132.29 ? 695 ALA C O  1 
ATOM 7097  N N  . THR C 1 696 ? 67.329  78.429  39.391  1.00 117.16 ? 696 THR C N  1 
ATOM 7098  C CA . THR C 1 696 ? 67.315  77.431  40.454  1.00 117.16 ? 696 THR C CA 1 
ATOM 7099  C C  . THR C 1 696 ? 67.648  78.101  41.781  1.00 117.16 ? 696 THR C C  1 
ATOM 7100  O O  . THR C 1 696 ? 68.702  78.737  41.903  1.00 117.16 ? 696 THR C O  1 
ATOM 7101  N N  . PRO C 1 697 ? 66.799  77.972  42.801  1.00 108.28 ? 697 PRO C N  1 
ATOM 7102  C CA . PRO C 1 697 ? 66.926  78.833  43.984  1.00 108.28 ? 697 PRO C CA 1 
ATOM 7103  C C  . PRO C 1 697 ? 68.035  78.458  44.950  1.00 108.28 ? 697 PRO C C  1 
ATOM 7104  O O  . PRO C 1 697 ? 68.198  79.153  45.962  1.00 108.28 ? 697 PRO C O  1 
ATOM 7105  N N  . ALA C 1 698 ? 68.821  77.414  44.677  1.00 99.81  ? 698 ALA C N  1 
ATOM 7106  C CA . ALA C 1 698 ? 69.993  77.158  45.506  1.00 99.81  ? 698 ALA C CA 1 
ATOM 7107  C C  . ALA C 1 698 ? 71.058  78.229  45.328  1.00 99.81  ? 698 ALA C C  1 
ATOM 7108  O O  . ALA C 1 698 ? 71.944  78.347  46.174  1.00 99.81  ? 698 ALA C O  1 
ATOM 7109  N N  . GLU C 1 699 ? 70.981  79.006  44.249  1.00 93.66  ? 699 GLU C N  1 
ATOM 7110  C CA . GLU C 1 699 ? 71.750  80.226  44.068  1.00 93.66  ? 699 GLU C CA 1 
ATOM 7111  C C  . GLU C 1 699 ? 71.246  81.401  44.893  1.00 93.66  ? 699 GLU C C  1 
ATOM 7112  O O  . GLU C 1 699 ? 71.748  82.511  44.701  1.00 93.66  ? 699 GLU C O  1 
ATOM 7113  N N  . GLY C 1 700 ? 70.272  81.212  45.775  1.00 82.17  ? 700 GLY C N  1 
ATOM 7114  C CA . GLY C 1 700 ? 69.582  82.364  46.315  1.00 82.17  ? 700 GLY C CA 1 
ATOM 7115  C C  . GLY C 1 700 ? 70.303  83.164  47.383  1.00 82.17  ? 700 GLY C C  1 
ATOM 7116  O O  . GLY C 1 700 ? 70.823  84.247  47.102  1.00 82.17  ? 700 GLY C O  1 
ATOM 7117  N N  . ASP C 1 701 ? 70.377  82.634  48.601  1.00 84.90  ? 701 ASP C N  1 
ATOM 7118  C CA . ASP C 1 701 ? 70.847  83.443  49.713  1.00 84.90  ? 701 ASP C CA 1 
ATOM 7119  C C  . ASP C 1 701 ? 72.354  83.536  49.801  1.00 84.90  ? 701 ASP C C  1 
ATOM 7120  O O  . ASP C 1 701 ? 72.858  84.004  50.822  1.00 84.90  ? 701 ASP C O  1 
ATOM 7121  N N  . ILE C 1 702 ? 73.083  83.075  48.790  1.00 79.87  ? 702 ILE C N  1 
ATOM 7122  C CA . ILE C 1 702 ? 74.418  83.606  48.575  1.00 79.87  ? 702 ILE C CA 1 
ATOM 7123  C C  . ILE C 1 702 ? 74.346  85.116  48.448  1.00 79.87  ? 702 ILE C C  1 
ATOM 7124  O O  . ILE C 1 702 ? 75.204  85.834  48.959  1.00 79.87  ? 702 ILE C O  1 
ATOM 7125  N N  . GLY C 1 703 ? 73.306  85.622  47.803  1.00 81.03  ? 703 GLY C N  1 
ATOM 7126  C CA . GLY C 1 703 ? 73.001  87.024  47.912  1.00 81.03  ? 703 GLY C CA 1 
ATOM 7127  C C  . GLY C 1 703 ? 72.418  87.407  49.258  1.00 81.03  ? 703 GLY C C  1 
ATOM 7128  O O  . GLY C 1 703 ? 72.994  88.220  49.985  1.00 81.03  ? 703 GLY C O  1 
ATOM 7129  N N  . ALA C 1 704 ? 71.290  86.795  49.616  1.00 83.26  ? 704 ALA C N  1 
ATOM 7130  C CA . ALA C 1 704 ? 70.404  87.336  50.640  1.00 83.26  ? 704 ALA C CA 1 
ATOM 7131  C C  . ALA C 1 704 ? 70.916  87.192  52.071  1.00 83.26  ? 704 ALA C C  1 
ATOM 7132  O O  . ALA C 1 704 ? 70.211  87.611  52.992  1.00 83.26  ? 704 ALA C O  1 
ATOM 7133  N N  . VAL C 1 705 ? 72.083  86.606  52.306  1.00 83.79  ? 705 VAL C N  1 
ATOM 7134  C CA . VAL C 1 705 ? 72.651  86.674  53.647  1.00 83.79  ? 705 VAL C CA 1 
ATOM 7135  C C  . VAL C 1 705 ? 73.895  87.529  53.661  1.00 83.79  ? 705 VAL C C  1 
ATOM 7136  O O  . VAL C 1 705 ? 74.406  87.895  54.722  1.00 83.79  ? 705 VAL C O  1 
ATOM 7137  N N  . PHE C 1 706 ? 74.402  87.852  52.487  1.00 80.86  ? 706 PHE C N  1 
ATOM 7138  C CA . PHE C 1 706 ? 75.775  88.295  52.432  1.00 80.86  ? 706 PHE C CA 1 
ATOM 7139  C C  . PHE C 1 706 ? 75.874  89.796  52.275  1.00 80.86  ? 706 PHE C C  1 
ATOM 7140  O O  . PHE C 1 706 ? 76.957  90.354  52.464  1.00 80.86  ? 706 PHE C O  1 
ATOM 7141  N N  . GLY C 1 707 ? 74.776  90.453  51.926  1.00 69.92  ? 707 GLY C N  1 
ATOM 7142  C CA . GLY C 1 707 ? 74.712  91.890  52.037  1.00 69.92  ? 707 GLY C CA 1 
ATOM 7143  C C  . GLY C 1 707 ? 73.450  92.380  52.690  1.00 69.92  ? 707 GLY C C  1 
ATOM 7144  O O  . GLY C 1 707 ? 73.381  93.534  53.119  1.00 69.92  ? 707 GLY C O  1 
ATOM 7145  N N  . LEU C 1 708 ? 72.438  91.519  52.759  1.00 77.90  ? 708 LEU C N  1 
ATOM 7146  C CA . LEU C 1 708 ? 71.163  91.940  53.318  1.00 77.90  ? 708 LEU C CA 1 
ATOM 7147  C C  . LEU C 1 708 ? 71.277  92.140  54.819  1.00 77.90  ? 708 LEU C C  1 
ATOM 7148  O O  . LEU C 1 708 ? 70.611  93.008  55.389  1.00 77.90  ? 708 LEU C O  1 
ATOM 7149  N N  . GLY C 1 709 ? 72.113  91.344  55.472  1.00 87.87  ? 709 GLY C N  1 
ATOM 7150  C CA . GLY C 1 709 ? 72.313  91.479  56.897  1.00 87.87  ? 709 GLY C CA 1 
ATOM 7151  C C  . GLY C 1 709 ? 71.816  90.271  57.652  1.00 87.87  ? 709 GLY C C  1 
ATOM 7152  O O  . GLY C 1 709 ? 71.704  90.300  58.879  1.00 87.87  ? 709 GLY C O  1 
ATOM 7153  N N  . PHE C 1 710 ? 71.505  89.208  56.924  1.00 85.58  ? 710 PHE C N  1 
ATOM 7154  C CA . PHE C 1 710 ? 71.025  87.994  57.557  1.00 85.58  ? 710 PHE C CA 1 
ATOM 7155  C C  . PHE C 1 710 ? 72.186  87.313  58.280  1.00 85.58  ? 710 PHE C C  1 
ATOM 7156  O O  . PHE C 1 710 ? 73.321  87.355  57.797  1.00 85.58  ? 710 PHE C O  1 
ATOM 7157  N N  . PRO C 1 711 ? 71.944  86.709  59.442  1.00 84.58  ? 711 PRO C N  1 
ATOM 7158  C CA . PRO C 1 711 ? 73.039  86.130  60.213  1.00 84.58  ? 711 PRO C CA 1 
ATOM 7159  C C  . PRO C 1 711 ? 73.592  84.877  59.569  1.00 84.58  ? 711 PRO C C  1 
ATOM 7160  O O  . PRO C 1 711 ? 72.836  83.967  59.205  1.00 84.58  ? 711 PRO C O  1 
ATOM 7161  N N  . PRO C 1 712 ? 74.906  84.794  59.413  1.00 77.78  ? 712 PRO C N  1 
ATOM 7162  C CA . PRO C 1 712 ? 75.544  83.489  59.317  1.00 77.78  ? 712 PRO C CA 1 
ATOM 7163  C C  . PRO C 1 712 ? 75.558  82.852  60.689  1.00 77.78  ? 712 PRO C C  1 
ATOM 7164  O O  . PRO C 1 712 ? 75.351  83.513  61.709  1.00 77.78  ? 712 PRO C O  1 
ATOM 7165  N N  . CYS C 1 713 ? 75.809  81.540  60.684  1.00 93.14  ? 713 CYS C N  1 
ATOM 7166  C CA . CYS C 1 713 ? 75.417  80.538  61.680  1.00 93.14  ? 713 CYS C CA 1 
ATOM 7167  C C  . CYS C 1 713 ? 73.907  80.389  61.790  1.00 93.14  ? 713 CYS C C  1 
ATOM 7168  O O  . CYS C 1 713 ? 73.414  79.726  62.708  1.00 93.14  ? 713 CYS C O  1 
ATOM 7169  N N  . LEU C 1 714 ? 73.169  80.999  60.877  1.00 93.85  ? 714 LEU C N  1 
ATOM 7170  C CA . LEU C 1 714 ? 71.843  80.574  60.486  1.00 93.85  ? 714 LEU C CA 1 
ATOM 7171  C C  . LEU C 1 714 ? 71.895  80.425  58.975  1.00 93.85  ? 714 LEU C C  1 
ATOM 7172  O O  . LEU C 1 714 ? 72.312  81.353  58.277  1.00 93.85  ? 714 LEU C O  1 
ATOM 7173  N N  . GLY C 1 715 ? 71.493  79.259  58.478  1.00 101.85 ? 715 GLY C N  1 
ATOM 7174  C CA . GLY C 1 715 ? 71.842  78.803  57.141  1.00 101.85 ? 715 GLY C CA 1 
ATOM 7175  C C  . GLY C 1 715 ? 71.316  79.622  55.986  1.00 101.85 ? 715 GLY C C  1 
ATOM 7176  O O  . GLY C 1 715 ? 71.785  79.442  54.861  1.00 101.85 ? 715 GLY C O  1 
ATOM 7177  N N  . GLY C 1 716 ? 70.388  80.533  56.220  1.00 99.69  ? 716 GLY C N  1 
ATOM 7178  C CA . GLY C 1 716 ? 69.795  81.271  55.139  1.00 99.69  ? 716 GLY C CA 1 
ATOM 7179  C C  . GLY C 1 716 ? 68.296  81.119  55.165  1.00 99.69  ? 716 GLY C C  1 
ATOM 7180  O O  . GLY C 1 716 ? 67.760  80.132  55.672  1.00 99.69  ? 716 GLY C O  1 
ATOM 7181  N N  . PRO C 1 717 ? 67.589  82.126  54.663  1.00 99.52  ? 717 PRO C N  1 
ATOM 7182  C CA . PRO C 1 717 ? 66.126  82.036  54.620  1.00 99.52  ? 717 PRO C CA 1 
ATOM 7183  C C  . PRO C 1 717 ? 65.607  80.953  53.692  1.00 99.52  ? 717 PRO C C  1 
ATOM 7184  O O  . PRO C 1 717 ? 64.533  80.391  53.938  1.00 99.52  ? 717 PRO C O  1 
ATOM 7185  N N  . PHE C 1 718 ? 66.351  80.620  52.643  1.00 105.53 ? 718 PHE C N  1 
ATOM 7186  C CA . PHE C 1 718 ? 66.037  79.446  51.843  1.00 105.53 ? 718 PHE C CA 1 
ATOM 7187  C C  . PHE C 1 718 ? 66.529  78.171  52.527  1.00 105.53 ? 718 PHE C C  1 
ATOM 7188  O O  . PHE C 1 718 ? 66.247  77.068  52.051  1.00 105.53 ? 718 PHE C O  1 
ATOM 7189  N N  . ARG C 1 719 ? 67.211  78.295  53.663  1.00 96.71  ? 719 ARG C N  1 
ATOM 7190  C CA . ARG C 1 719 ? 67.704  77.158  54.426  1.00 96.71  ? 719 ARG C CA 1 
ATOM 7191  C C  . ARG C 1 719 ? 67.144  77.110  55.841  1.00 96.71  ? 719 ARG C C  1 
ATOM 7192  O O  . ARG C 1 719 ? 67.889  76.986  56.813  1.00 96.71  ? 719 ARG C O  1 
ATOM 7193  N N  . PHE C 1 720 ? 65.833  77.242  55.990  1.00 101.44 ? 720 PHE C N  1 
ATOM 7194  C CA . PHE C 1 720 ? 65.185  76.816  57.219  1.00 101.44 ? 720 PHE C CA 1 
ATOM 7195  C C  . PHE C 1 720 ? 64.083  75.806  56.976  1.00 101.44 ? 720 PHE C C  1 
ATOM 7196  O O  . PHE C 1 720 ? 63.282  75.539  57.877  1.00 101.44 ? 720 PHE C O  1 
ATOM 7197  N N  . VAL C 1 721 ? 64.028  75.232  55.777  1.00 122.53 ? 721 VAL C N  1 
ATOM 7198  C CA . VAL C 1 721 ? 63.190  74.070  55.568  1.00 122.53 ? 721 VAL C CA 1 
ATOM 7199  C C  . VAL C 1 721 ? 63.923  72.803  55.960  1.00 122.53 ? 721 VAL C C  1 
ATOM 7200  O O  . VAL C 1 721 ? 63.320  71.725  56.013  1.00 122.53 ? 721 VAL C O  1 
ATOM 7201  N N  . ASP C 1 722 ? 65.215  72.906  56.243  1.00 119.34 ? 722 ASP C N  1 
ATOM 7202  C CA . ASP C 1 722 ? 66.086  71.750  56.378  1.00 119.34 ? 722 ASP C CA 1 
ATOM 7203  C C  . ASP C 1 722 ? 66.495  71.443  57.809  1.00 119.34 ? 722 ASP C C  1 
ATOM 7204  O O  . ASP C 1 722 ? 66.209  70.350  58.301  1.00 119.34 ? 722 ASP C O  1 
ATOM 7205  N N  . LEU C 1 723 ? 67.146  72.379  58.498  1.00 120.55 ? 723 LEU C N  1 
ATOM 7206  C CA . LEU C 1 723 ? 67.553  72.143  59.874  1.00 120.55 ? 723 LEU C CA 1 
ATOM 7207  C C  . LEU C 1 723 ? 66.515  72.665  60.850  1.00 120.55 ? 723 LEU C C  1 
ATOM 7208  O O  . LEU C 1 723 ? 66.506  72.255  62.014  1.00 120.55 ? 723 LEU C O  1 
ATOM 7209  N N  . TYR C 1 724 ? 65.640  73.566  60.407  1.00 128.17 ? 724 TYR C N  1 
ATOM 7210  C CA . TYR C 1 724 ? 64.500  73.924  61.229  1.00 128.17 ? 724 TYR C CA 1 
ATOM 7211  C C  . TYR C 1 724 ? 63.186  73.385  60.688  1.00 128.17 ? 724 TYR C C  1 
ATOM 7212  O O  . TYR C 1 724 ? 62.245  73.211  61.464  1.00 128.17 ? 724 TYR C O  1 
ATOM 7213  N N  . GLY C 1 725 ? 63.099  73.094  59.397  1.00 123.16 ? 725 GLY C N  1 
ATOM 7214  C CA . GLY C 1 725 ? 61.948  72.366  58.903  1.00 123.16 ? 725 GLY C CA 1 
ATOM 7215  C C  . GLY C 1 725 ? 60.752  73.234  58.597  1.00 123.16 ? 725 GLY C C  1 
ATOM 7216  O O  . GLY C 1 725 ? 60.386  74.105  59.390  1.00 123.16 ? 725 GLY C O  1 
ATOM 7217  N N  . ALA C 1 726 ? 60.133  72.995  57.438  1.00 125.29 ? 726 ALA C N  1 
ATOM 7218  C CA . ALA C 1 726 ? 58.933  73.735  57.068  1.00 125.29 ? 726 ALA C CA 1 
ATOM 7219  C C  . ALA C 1 726 ? 57.768  73.374  57.978  1.00 125.29 ? 726 ALA C C  1 
ATOM 7220  O O  . ALA C 1 726 ? 56.887  74.204  58.228  1.00 125.29 ? 726 ALA C O  1 
ATOM 7221  N N  . GLN C 1 727 ? 57.770  72.139  58.481  1.00 130.33 ? 727 GLN C N  1 
ATOM 7222  C CA . GLN C 1 727 ? 56.815  71.670  59.478  1.00 130.33 ? 727 GLN C CA 1 
ATOM 7223  C C  . GLN C 1 727 ? 56.817  72.547  60.726  1.00 130.33 ? 727 GLN C C  1 
ATOM 7224  O O  . GLN C 1 727 ? 55.749  72.938  61.219  1.00 130.33 ? 727 GLN C O  1 
ATOM 7225  N N  . LYS C 1 728 ? 57.994  72.929  61.210  1.00 130.62 ? 728 LYS C N  1 
ATOM 7226  C CA . LYS C 1 728 ? 58.025  73.672  62.460  1.00 130.62 ? 728 LYS C CA 1 
ATOM 7227  C C  . LYS C 1 728 ? 57.637  75.132  62.262  1.00 130.62 ? 728 LYS C C  1 
ATOM 7228  O O  . LYS C 1 728 ? 56.916  75.691  63.092  1.00 130.62 ? 728 LYS C O  1 
ATOM 7229  N N  . ILE C 1 729 ? 58.045  75.761  61.155  1.00 128.60 ? 729 ILE C N  1 
ATOM 7230  C CA . ILE C 1 729 ? 57.636  77.148  60.946  1.00 128.60 ? 729 ILE C CA 1 
ATOM 7231  C C  . ILE C 1 729 ? 56.160  77.228  60.588  1.00 128.60 ? 729 ILE C C  1 
ATOM 7232  O O  . ILE C 1 729 ? 55.496  78.225  60.897  1.00 128.60 ? 729 ILE C O  1 
ATOM 7233  N N  . VAL C 1 730 ? 55.614  76.189  59.939  1.00 135.10 ? 730 VAL C N  1 
ATOM 7234  C CA . VAL C 1 730 ? 54.185  76.243  59.669  1.00 135.10 ? 730 VAL C CA 1 
ATOM 7235  C C  . VAL C 1 730 ? 53.412  75.983  60.948  1.00 135.10 ? 730 VAL C C  1 
ATOM 7236  O O  . VAL C 1 730 ? 52.325  76.536  61.120  1.00 135.10 ? 730 VAL C O  1 
ATOM 7237  N N  . ASP C 1 731 ? 53.991  75.254  61.907  1.00 147.24 ? 731 ASP C N  1 
ATOM 7238  C CA . ASP C 1 731 ? 53.384  75.237  63.232  1.00 147.24 ? 731 ASP C CA 1 
ATOM 7239  C C  . ASP C 1 731 ? 53.549  76.575  63.946  1.00 147.24 ? 731 ASP C C  1 
ATOM 7240  O O  . ASP C 1 731 ? 52.728  76.926  64.797  1.00 147.24 ? 731 ASP C O  1 
ATOM 7241  N N  . ARG C 1 732 ? 54.600  77.336  63.622  1.00 140.90 ? 732 ARG C N  1 
ATOM 7242  C CA . ARG C 1 732 ? 54.768  78.643  64.259  1.00 140.90 ? 732 ARG C CA 1 
ATOM 7243  C C  . ARG C 1 732 ? 53.736  79.646  63.758  1.00 140.90 ? 732 ARG C C  1 
ATOM 7244  O O  . ARG C 1 732 ? 53.121  80.363  64.554  1.00 140.90 ? 732 ARG C O  1 
ATOM 7245  N N  . LEU C 1 733 ? 53.528  79.724  62.448  1.00 140.91 ? 733 LEU C N  1 
ATOM 7246  C CA . LEU C 1 733 ? 52.485  80.648  62.018  1.00 140.91 ? 733 LEU C CA 1 
ATOM 7247  C C  . LEU C 1 733 ? 51.093  80.053  62.126  1.00 140.91 ? 733 LEU C C  1 
ATOM 7248  O O  . LEU C 1 733 ? 50.118  80.797  62.011  1.00 140.91 ? 733 LEU C O  1 
ATOM 7249  N N  . LYS C 1 734 ? 50.963  78.740  62.317  1.00 147.91 ? 734 LYS C N  1 
ATOM 7250  C CA . LYS C 1 734 ? 49.668  78.174  62.655  1.00 147.91 ? 734 LYS C CA 1 
ATOM 7251  C C  . LYS C 1 734 ? 49.385  78.355  64.140  1.00 147.91 ? 734 LYS C C  1 
ATOM 7252  O O  . LYS C 1 734 ? 48.231  78.296  64.573  1.00 147.91 ? 734 LYS C O  1 
ATOM 7253  N N  . LYS C 1 735 ? 50.424  78.597  64.934  1.00 158.67 ? 735 LYS C N  1 
ATOM 7254  C CA . LYS C 1 735 ? 50.213  79.186  66.247  1.00 158.67 ? 735 LYS C CA 1 
ATOM 7255  C C  . LYS C 1 735 ? 49.790  80.642  66.102  1.00 158.67 ? 735 LYS C C  1 
ATOM 7256  O O  . LYS C 1 735 ? 49.025  81.166  66.916  1.00 158.67 ? 735 LYS C O  1 
ATOM 7257  N N  . TYR C 1 736 ? 50.258  81.300  65.045  1.00 145.86 ? 736 TYR C N  1 
ATOM 7258  C CA . TYR C 1 736 ? 49.932  82.692  64.780  1.00 145.86 ? 736 TYR C CA 1 
ATOM 7259  C C  . TYR C 1 736 ? 48.757  82.819  63.805  1.00 145.86 ? 736 TYR C C  1 
ATOM 7260  O O  . TYR C 1 736 ? 48.604  83.838  63.138  1.00 145.86 ? 736 TYR C O  1 
ATOM 7261  N N  . GLU C 1 737 ? 47.895  81.803  63.720  1.00 151.64 ? 737 GLU C N  1 
ATOM 7262  C CA . GLU C 1 737 ? 46.963  81.754  62.594  1.00 151.64 ? 737 GLU C CA 1 
ATOM 7263  C C  . GLU C 1 737 ? 45.790  82.708  62.783  1.00 151.64 ? 737 GLU C C  1 
ATOM 7264  O O  . GLU C 1 737 ? 45.269  83.253  61.805  1.00 151.64 ? 737 GLU C O  1 
ATOM 7265  N N  . ALA C 1 738 ? 45.367  82.940  64.021  1.00 146.95 ? 738 ALA C N  1 
ATOM 7266  C CA . ALA C 1 738 ? 44.177  83.741  64.258  1.00 146.95 ? 738 ALA C CA 1 
ATOM 7267  C C  . ALA C 1 738 ? 44.496  85.183  64.610  1.00 146.95 ? 738 ALA C C  1 
ATOM 7268  O O  . ALA C 1 738 ? 43.652  85.860  65.206  1.00 146.95 ? 738 ALA C O  1 
ATOM 7269  N N  . ALA C 1 739 ? 45.687  85.668  64.266  1.00 134.61 ? 739 ALA C N  1 
ATOM 7270  C CA . ALA C 1 739 ? 46.037  87.040  64.605  1.00 134.61 ? 739 ALA C CA 1 
ATOM 7271  C C  . ALA C 1 739 ? 45.399  88.022  63.633  1.00 134.61 ? 739 ALA C C  1 
ATOM 7272  O O  . ALA C 1 739 ? 44.620  88.893  64.036  1.00 134.61 ? 739 ALA C O  1 
ATOM 7273  N N  . TYR C 1 740 ? 45.709  87.898  62.355  1.00 141.41 ? 740 TYR C N  1 
ATOM 7274  C CA . TYR C 1 740 ? 45.214  88.860  61.374  1.00 141.41 ? 740 TYR C CA 1 
ATOM 7275  C C  . TYR C 1 740 ? 44.576  88.211  60.156  1.00 141.41 ? 740 TYR C C  1 
ATOM 7276  O O  . TYR C 1 740 ? 43.638  88.776  59.590  1.00 141.41 ? 740 TYR C O  1 
ATOM 7277  N N  . GLY C 1 741 ? 45.073  87.056  59.722  1.00 144.94 ? 741 GLY C N  1 
ATOM 7278  C CA . GLY C 1 741 ? 44.535  86.332  58.591  1.00 144.94 ? 741 GLY C CA 1 
ATOM 7279  C C  . GLY C 1 741 ? 44.824  86.930  57.232  1.00 144.94 ? 741 GLY C C  1 
ATOM 7280  O O  . GLY C 1 741 ? 44.348  86.391  56.225  1.00 144.94 ? 741 GLY C O  1 
ATOM 7281  N N  . LYS C 1 742 ? 45.578  88.028  57.164  1.00 138.31 ? 742 LYS C N  1 
ATOM 7282  C CA . LYS C 1 742 ? 45.745  88.761  55.916  1.00 138.31 ? 742 LYS C CA 1 
ATOM 7283  C C  . LYS C 1 742 ? 47.203  88.829  55.468  1.00 138.31 ? 742 LYS C C  1 
ATOM 7284  O O  . LYS C 1 742 ? 47.521  88.460  54.335  1.00 138.31 ? 742 LYS C O  1 
ATOM 7285  N N  . GLN C 1 743 ? 48.101  89.286  56.337  1.00 127.32 ? 743 GLN C N  1 
ATOM 7286  C CA . GLN C 1 743 ? 49.453  89.625  55.912  1.00 127.32 ? 743 GLN C CA 1 
ATOM 7287  C C  . GLN C 1 743 ? 50.443  88.474  56.028  1.00 127.32 ? 743 GLN C C  1 
ATOM 7288  O O  . GLN C 1 743 ? 51.385  88.407  55.234  1.00 127.32 ? 743 GLN C O  1 
ATOM 7289  N N  . PHE C 1 744 ? 50.269  87.581  56.992  1.00 127.92 ? 744 PHE C N  1 
ATOM 7290  C CA . PHE C 1 744 ? 51.253  86.536  57.230  1.00 127.92 ? 744 PHE C CA 1 
ATOM 7291  C C  . PHE C 1 744 ? 50.948  85.255  56.476  1.00 127.92 ? 744 PHE C C  1 
ATOM 7292  O O  . PHE C 1 744 ? 51.477  84.205  56.851  1.00 127.92 ? 744 PHE C O  1 
ATOM 7293  N N  . THR C 1 745 ? 50.123  85.315  55.445  1.00 125.16 ? 745 THR C N  1 
ATOM 7294  C CA . THR C 1 745 ? 49.604  84.119  54.807  1.00 125.16 ? 745 THR C CA 1 
ATOM 7295  C C  . THR C 1 745 ? 50.701  83.382  54.048  1.00 125.16 ? 745 THR C C  1 
ATOM 7296  O O  . THR C 1 745 ? 51.423  84.004  53.256  1.00 125.16 ? 745 THR C O  1 
ATOM 7297  N N  . PRO C 1 746 ? 50.876  82.086  54.273  1.00 118.61 ? 746 PRO C N  1 
ATOM 7298  C CA . PRO C 1 746 ? 52.042  81.385  53.734  1.00 118.61 ? 746 PRO C CA 1 
ATOM 7299  C C  . PRO C 1 746 ? 51.881  81.080  52.255  1.00 118.61 ? 746 PRO C C  1 
ATOM 7300  O O  . PRO C 1 746 ? 50.774  81.053  51.714  1.00 118.61 ? 746 PRO C O  1 
ATOM 7301  N N  . CYS C 1 747 ? 53.012  80.857  51.595  1.00 119.36 ? 747 CYS C N  1 
ATOM 7302  C CA . CYS C 1 747 ? 52.973  80.512  50.184  1.00 119.36 ? 747 CYS C CA 1 
ATOM 7303  C C  . CYS C 1 747 ? 52.549  79.059  50.000  1.00 119.36 ? 747 CYS C C  1 
ATOM 7304  O O  . CYS C 1 747 ? 52.542  78.259  50.939  1.00 119.36 ? 747 CYS C O  1 
ATOM 7305  N N  . GLN C 1 748 ? 52.195  78.720  48.760  1.00 130.50 ? 748 GLN C N  1 
ATOM 7306  C CA . GLN C 1 748 ? 51.593  77.418  48.489  1.00 130.50 ? 748 GLN C CA 1 
ATOM 7307  C C  . GLN C 1 748 ? 52.614  76.357  48.117  1.00 130.50 ? 748 GLN C C  1 
ATOM 7308  O O  . GLN C 1 748 ? 52.372  75.169  48.362  1.00 130.50 ? 748 GLN C O  1 
ATOM 7309  N N  . LEU C 1 749 ? 53.734  76.746  47.508  1.00 134.04 ? 749 LEU C N  1 
ATOM 7310  C CA . LEU C 1 749 ? 54.665  75.743  47.002  1.00 134.04 ? 749 LEU C CA 1 
ATOM 7311  C C  . LEU C 1 749 ? 55.417  75.066  48.139  1.00 134.04 ? 749 LEU C C  1 
ATOM 7312  O O  . LEU C 1 749 ? 55.613  73.846  48.113  1.00 134.04 ? 749 LEU C O  1 
ATOM 7313  N N  . LEU C 1 750 ? 55.831  75.828  49.149  1.00 133.60 ? 750 LEU C N  1 
ATOM 7314  C CA . LEU C 1 750 ? 56.577  75.206  50.236  1.00 133.60 ? 750 LEU C CA 1 
ATOM 7315  C C  . LEU C 1 750 ? 55.648  74.430  51.156  1.00 133.60 ? 750 LEU C C  1 
ATOM 7316  O O  . LEU C 1 750 ? 56.076  73.478  51.817  1.00 133.60 ? 750 LEU C O  1 
ATOM 7317  N N  . ALA C 1 751 ? 54.369  74.799  51.183  1.00 143.12 ? 751 ALA C N  1 
ATOM 7318  C CA . ALA C 1 751 ? 53.454  74.265  52.177  1.00 143.12 ? 751 ALA C CA 1 
ATOM 7319  C C  . ALA C 1 751 ? 52.963  72.870  51.838  1.00 143.12 ? 751 ALA C C  1 
ATOM 7320  O O  . ALA C 1 751 ? 52.629  72.108  52.750  1.00 143.12 ? 751 ALA C O  1 
ATOM 7321  N N  . ASP C 1 752 ? 52.899  72.521  50.557  1.00 150.47 ? 752 ASP C N  1 
ATOM 7322  C CA . ASP C 1 752 ? 52.341  71.226  50.199  1.00 150.47 ? 752 ASP C CA 1 
ATOM 7323  C C  . ASP C 1 752 ? 53.332  70.099  50.459  1.00 150.47 ? 752 ASP C C  1 
ATOM 7324  O O  . ASP C 1 752 ? 52.926  68.980  50.793  1.00 150.47 ? 752 ASP C O  1 
ATOM 7325  N N  . HIS C 1 753 ? 54.631  70.372  50.340  1.00 142.39 ? 753 HIS C N  1 
ATOM 7326  C CA . HIS C 1 753 ? 55.643  69.390  50.706  1.00 142.39 ? 753 HIS C CA 1 
ATOM 7327  C C  . HIS C 1 753 ? 56.237  69.677  52.077  1.00 142.39 ? 753 HIS C C  1 
ATOM 7328  O O  . HIS C 1 753 ? 57.317  69.170  52.399  1.00 142.39 ? 753 HIS C O  1 
ATOM 7329  N N  . ALA C 1 754 ? 55.533  70.449  52.903  1.00 146.78 ? 754 ALA C N  1 
ATOM 7330  C CA . ALA C 1 754 ? 56.121  70.949  54.139  1.00 146.78 ? 754 ALA C CA 1 
ATOM 7331  C C  . ALA C 1 754 ? 56.257  69.857  55.190  1.00 146.78 ? 754 ALA C C  1 
ATOM 7332  O O  . ALA C 1 754 ? 57.369  69.454  55.544  1.00 146.78 ? 754 ALA C O  1 
ATOM 7333  N N  . ASN C 1 755 ? 55.133  69.344  55.679  1.00 158.72 ? 755 ASN C N  1 
ATOM 7334  C CA . ASN C 1 755 ? 55.159  68.602  56.932  1.00 158.72 ? 755 ASN C CA 1 
ATOM 7335  C C  . ASN C 1 755 ? 55.270  67.086  56.783  1.00 158.72 ? 755 ASN C C  1 
ATOM 7336  O O  . ASN C 1 755 ? 56.261  66.497  57.227  1.00 158.72 ? 755 ASN C O  1 
ATOM 7337  N N  . SER C 1 756 ? 54.285  66.441  56.166  1.00 154.71 ? 756 SER C N  1 
ATOM 7338  C CA . SER C 1 756 ? 54.222  64.986  56.246  1.00 154.71 ? 756 SER C CA 1 
ATOM 7339  C C  . SER C 1 756 ? 55.210  64.251  55.335  1.00 154.71 ? 756 SER C C  1 
ATOM 7340  O O  . SER C 1 756 ? 56.062  63.527  55.864  1.00 154.71 ? 756 SER C O  1 
ATOM 7341  N N  . PRO C 1 757 ? 55.191  64.397  53.974  1.00 150.51 ? 757 PRO C N  1 
ATOM 7342  C CA . PRO C 1 757 ? 55.886  63.381  53.170  1.00 150.51 ? 757 PRO C CA 1 
ATOM 7343  C C  . PRO C 1 757 ? 57.383  63.602  53.012  1.00 150.51 ? 757 PRO C C  1 
ATOM 7344  O O  . PRO C 1 757 ? 57.874  63.463  51.891  1.00 150.51 ? 757 PRO C O  1 
ATOM 7345  N N  . ASN C 1 758 ? 58.086  63.931  54.109  1.00 143.83 ? 758 ASN C N  1 
ATOM 7346  C CA . ASN C 1 758 ? 59.520  64.221  54.266  1.00 143.83 ? 758 ASN C CA 1 
ATOM 7347  C C  . ASN C 1 758 ? 60.258  64.788  53.051  1.00 143.83 ? 758 ASN C C  1 
ATOM 7348  O O  . ASN C 1 758 ? 61.414  64.429  52.799  1.00 143.83 ? 758 ASN C O  1 
ATOM 7349  N N  . LYS C 1 759 ? 59.619  65.686  52.308  1.00 141.63 ? 759 LYS C N  1 
ATOM 7350  C CA . LYS C 1 759 ? 60.246  66.246  51.123  1.00 141.63 ? 759 LYS C CA 1 
ATOM 7351  C C  . LYS C 1 759 ? 61.026  67.498  51.477  1.00 141.63 ? 759 LYS C C  1 
ATOM 7352  O O  . LYS C 1 759 ? 60.684  68.225  52.414  1.00 141.63 ? 759 LYS C O  1 
ATOM 7353  N N  . LYS C 1 760 ? 62.089  67.734  50.729  1.00 139.79 ? 760 LYS C N  1 
ATOM 7354  C CA . LYS C 1 760 ? 62.897  68.929  50.855  1.00 139.79 ? 760 LYS C CA 1 
ATOM 7355  C C  . LYS C 1 760 ? 62.911  69.638  49.512  1.00 139.79 ? 760 LYS C C  1 
ATOM 7356  O O  . LYS C 1 760 ? 62.250  69.221  48.559  1.00 139.79 ? 760 LYS C O  1 
ATOM 7357  N N  . PHE C 1 761 ? 63.667  70.729  49.444  1.00 127.56 ? 761 PHE C N  1 
ATOM 7358  C CA . PHE C 1 761 ? 63.815  71.440  48.182  1.00 127.56 ? 761 PHE C CA 1 
ATOM 7359  C C  . PHE C 1 761 ? 64.653  70.636  47.199  1.00 127.56 ? 761 PHE C C  1 
ATOM 7360  O O  . PHE C 1 761 ? 64.186  70.276  46.114  1.00 127.56 ? 761 PHE C O  1 
ATOM 7361  N N  . TYR C 1 762 ? 65.886  70.319  47.577  1.00 129.09 ? 762 TYR C N  1 
ATOM 7362  C CA . TYR C 1 762 ? 66.758  69.559  46.693  1.00 129.09 ? 762 TYR C CA 1 
ATOM 7363  C C  . TYR C 1 762 ? 67.502  68.453  47.428  1.00 129.09 ? 762 TYR C C  1 
ATOM 7364  O O  . TYR C 1 762 ? 68.401  67.838  46.840  1.00 129.09 ? 762 TYR C O  1 
ATOM 7365  N N  . GLN C 1 763 ? 67.161  68.184  48.680  1.00 141.78 ? 763 GLN C N  1 
ATOM 7366  C CA . GLN C 1 763 ? 67.966  67.319  49.527  1.00 141.78 ? 763 GLN C CA 1 
ATOM 7367  C C  . GLN C 1 763 ? 67.096  66.328  50.292  1.00 141.78 ? 763 GLN C C  1 
ATOM 7368  O O  . GLN C 1 763 ? 66.186  65.720  49.726  1.00 141.78 ? 763 GLN C O  1 
ATOM 7369  N N  . PRO D 2 49  ? 122.653 111.967 4.564   1.00 71.38  ? 49  PRO D N  1 
ATOM 7370  C CA . PRO D 2 49  ? 123.993 111.999 3.977   1.00 71.38  ? 49  PRO D CA 1 
ATOM 7371  C C  . PRO D 2 49  ? 124.457 113.420 3.735   1.00 71.38  ? 49  PRO D C  1 
ATOM 7372  O O  . PRO D 2 49  ? 125.613 113.637 3.384   1.00 71.38  ? 49  PRO D O  1 
ATOM 7373  N N  . ASN D 2 50  ? 123.549 114.376 3.910   1.00 81.10  ? 50  ASN D N  1 
ATOM 7374  C CA . ASN D 2 50  ? 123.890 115.790 3.868   1.00 81.10  ? 50  ASN D CA 1 
ATOM 7375  C C  . ASN D 2 50  ? 123.829 116.441 5.239   1.00 81.10  ? 50  ASN D C  1 
ATOM 7376  O O  . ASN D 2 50  ? 124.001 117.659 5.344   1.00 81.10  ? 50  ASN D O  1 
ATOM 7377  N N  . ILE D 2 51  ? 123.579 115.661 6.287   1.00 71.84  ? 51  ILE D N  1 
ATOM 7378  C CA . ILE D 2 51  ? 123.622 116.178 7.643   1.00 71.84  ? 51  ILE D CA 1 
ATOM 7379  C C  . ILE D 2 51  ? 125.073 116.445 8.006   1.00 71.84  ? 51  ILE D C  1 
ATOM 7380  O O  . ILE D 2 51  ? 125.965 115.660 7.659   1.00 71.84  ? 51  ILE D O  1 
ATOM 7381  N N  . ARG D 2 52  ? 125.318 117.579 8.657   1.00 68.73  ? 52  ARG D N  1 
ATOM 7382  C CA . ARG D 2 52  ? 126.659 117.950 9.087   1.00 68.73  ? 52  ARG D CA 1 
ATOM 7383  C C  . ARG D 2 52  ? 127.212 116.925 10.061  1.00 68.73  ? 52  ARG D C  1 
ATOM 7384  O O  . ARG D 2 52  ? 126.485 116.387 10.895  1.00 68.73  ? 52  ARG D O  1 
ATOM 7385  N N  . ASN D 2 53  ? 128.498 116.632 9.937   1.00 60.44  ? 53  ASN D N  1 
ATOM 7386  C CA . ASN D 2 53  ? 129.094 115.657 10.829  1.00 60.44  ? 53  ASN D CA 1 
ATOM 7387  C C  . ASN D 2 53  ? 129.511 116.312 12.136  1.00 60.44  ? 53  ASN D C  1 
ATOM 7388  O O  . ASN D 2 53  ? 129.287 117.500 12.374  1.00 60.44  ? 53  ASN D O  1 
ATOM 7389  N N  . VAL D 2 54  ? 130.158 115.522 12.986  1.00 50.64  ? 54  VAL D N  1 
ATOM 7390  C CA . VAL D 2 54  ? 130.335 115.867 14.386  1.00 50.64  ? 54  VAL D CA 1 
ATOM 7391  C C  . VAL D 2 54  ? 131.471 115.017 14.940  1.00 50.64  ? 54  VAL D C  1 
ATOM 7392  O O  . VAL D 2 54  ? 131.722 113.901 14.483  1.00 50.64  ? 54  VAL D O  1 
ATOM 7393  N N  . VAL D 2 55  ? 132.217 115.577 15.889  1.00 43.97  ? 55  VAL D N  1 
ATOM 7394  C CA . VAL D 2 55  ? 133.558 115.096 16.195  1.00 43.97  ? 55  VAL D CA 1 
ATOM 7395  C C  . VAL D 2 55  ? 133.821 115.172 17.692  1.00 43.97  ? 55  VAL D C  1 
ATOM 7396  O O  . VAL D 2 55  ? 133.533 116.190 18.326  1.00 43.97  ? 55  VAL D O  1 
ATOM 7397  N N  . VAL D 2 56  ? 134.362 114.091 18.253  1.00 26.78  ? 56  VAL D N  1 
ATOM 7398  C CA . VAL D 2 56  ? 134.902 114.078 19.606  1.00 26.78  ? 56  VAL D CA 1 
ATOM 7399  C C  . VAL D 2 56  ? 136.359 114.512 19.558  1.00 26.78  ? 56  VAL D C  1 
ATOM 7400  O O  . VAL D 2 56  ? 137.127 114.039 18.718  1.00 26.78  ? 56  VAL D O  1 
ATOM 7401  N N  . VAL D 2 57  ? 136.748 115.412 20.457  1.00 30.03  ? 57  VAL D N  1 
ATOM 7402  C CA . VAL D 2 57  ? 138.137 115.834 20.581  1.00 30.03  ? 57  VAL D CA 1 
ATOM 7403  C C  . VAL D 2 57  ? 138.534 115.336 21.969  1.00 30.03  ? 57  VAL D C  1 
ATOM 7404  O O  . VAL D 2 57  ? 137.756 114.619 22.598  1.00 30.03  ? 57  VAL D O  1 
ATOM 7405  N N  . ASP D 2 58  ? 139.737 115.656 22.441  1.00 37.43  ? 58  ASP D N  1 
ATOM 7406  C CA . ASP D 2 58  ? 140.403 114.908 23.506  1.00 37.43  ? 58  ASP D CA 1 
ATOM 7407  C C  . ASP D 2 58  ? 139.678 115.001 24.847  1.00 37.43  ? 58  ASP D C  1 
ATOM 7408  O O  . ASP D 2 58  ? 139.420 116.090 25.356  1.00 37.43  ? 58  ASP D O  1 
ATOM 7409  N N  . GLY D 2 59  ? 139.336 113.837 25.387  1.00 30.52  ? 59  GLY D N  1 
ATOM 7410  C CA . GLY D 2 59  ? 138.436 113.642 26.509  1.00 30.52  ? 59  GLY D CA 1 
ATOM 7411  C C  . GLY D 2 59  ? 138.961 113.572 27.930  1.00 30.52  ? 59  GLY D C  1 
ATOM 7412  O O  . GLY D 2 59  ? 139.173 112.471 28.438  1.00 30.52  ? 59  GLY D O  1 
ATOM 7413  N N  . VAL D 2 60  ? 139.204 114.715 28.568  1.00 26.13  ? 60  VAL D N  1 
ATOM 7414  C CA . VAL D 2 60  ? 139.794 114.755 29.904  1.00 26.13  ? 60  VAL D CA 1 
ATOM 7415  C C  . VAL D 2 60  ? 138.917 114.086 30.951  1.00 26.13  ? 60  VAL D C  1 
ATOM 7416  O O  . VAL D 2 60  ? 137.713 114.334 31.020  1.00 26.13  ? 60  VAL D O  1 
ATOM 7417  N N  . ARG D 2 61  ? 139.523 113.230 31.777  1.00 34.39  ? 61  ARG D N  1 
ATOM 7418  C CA . ARG D 2 61  ? 138.860 112.595 32.917  1.00 34.39  ? 61  ARG D CA 1 
ATOM 7419  C C  . ARG D 2 61  ? 139.730 112.695 34.160  1.00 34.39  ? 61  ARG D C  1 
ATOM 7420  O O  . ARG D 2 61  ? 140.805 112.099 34.204  1.00 34.39  ? 61  ARG D O  1 
ATOM 7421  N N  . THR D 2 62  ? 139.270 113.414 35.174  1.00 33.82  ? 62  THR D N  1 
ATOM 7422  C CA . THR D 2 62  ? 139.951 113.375 36.460  1.00 33.82  ? 62  THR D CA 1 
ATOM 7423  C C  . THR D 2 62  ? 139.747 112.006 37.099  1.00 33.82  ? 62  THR D C  1 
ATOM 7424  O O  . THR D 2 62  ? 138.708 111.388 36.895  1.00 33.82  ? 62  THR D O  1 
ATOM 7425  N N  . PRO D 2 63  ? 140.740 111.468 37.800  1.00 35.46  ? 63  PRO D N  1 
ATOM 7426  C CA . PRO D 2 63  ? 140.684 110.053 38.150  1.00 35.46  ? 63  PRO D CA 1 
ATOM 7427  C C  . PRO D 2 63  ? 139.726 109.778 39.282  1.00 35.46  ? 63  PRO D C  1 
ATOM 7428  O O  . PRO D 2 63  ? 139.453 110.632 40.125  1.00 35.46  ? 63  PRO D O  1 
ATOM 7429  N N  . PHE D 2 64  ? 139.233 108.552 39.293  1.00 38.45  ? 64  PHE D N  1 
ATOM 7430  C CA . PHE D 2 64  ? 138.152 108.168 40.175  1.00 38.45  ? 64  PHE D CA 1 
ATOM 7431  C C  . PHE D 2 64  ? 138.717 107.632 41.472  1.00 38.45  ? 64  PHE D C  1 
ATOM 7432  O O  . PHE D 2 64  ? 139.575 106.748 41.469  1.00 38.45  ? 64  PHE D O  1 
ATOM 7433  N N  . LEU D 2 65  ? 138.239 108.167 42.577  1.00 42.30  ? 65  LEU D N  1 
ATOM 7434  C CA . LEU D 2 65  ? 138.723 107.793 43.889  1.00 42.30  ? 65  LEU D CA 1 
ATOM 7435  C C  . LEU D 2 65  ? 137.579 107.156 44.648  1.00 42.30  ? 65  LEU D C  1 
ATOM 7436  O O  . LEU D 2 65  ? 136.440 107.618 44.560  1.00 42.30  ? 65  LEU D O  1 
ATOM 7437  N N  . LEU D 2 66  ? 137.870 106.074 45.354  1.00 48.24  ? 66  LEU D N  1 
ATOM 7438  C CA . LEU D 2 66  ? 136.885 105.500 46.255  1.00 48.24  ? 66  LEU D CA 1 
ATOM 7439  C C  . LEU D 2 66  ? 136.610 106.478 47.389  1.00 48.24  ? 66  LEU D C  1 
ATOM 7440  O O  . LEU D 2 66  ? 137.513 107.179 47.849  1.00 48.24  ? 66  LEU D O  1 
ATOM 7441  N N  . SER D 2 67  ? 135.350 106.564 47.799  1.00 52.33  ? 67  SER D N  1 
ATOM 7442  C CA . SER D 2 67  ? 134.945 107.606 48.730  1.00 52.33  ? 67  SER D CA 1 
ATOM 7443  C C  . SER D 2 67  ? 135.501 107.330 50.113  1.00 52.33  ? 67  SER D C  1 
ATOM 7444  O O  . SER D 2 67  ? 135.472 106.199 50.597  1.00 52.33  ? 67  SER D O  1 
ATOM 7445  N N  . GLY D 2 68  ? 136.008 108.379 50.749  1.00 52.24  ? 68  GLY D N  1 
ATOM 7446  C CA . GLY D 2 68  ? 136.746 108.279 51.986  1.00 52.24  ? 68  GLY D CA 1 
ATOM 7447  C C  . GLY D 2 68  ? 138.181 108.726 51.861  1.00 52.24  ? 68  GLY D C  1 
ATOM 7448  O O  . GLY D 2 68  ? 138.814 109.039 52.873  1.00 52.24  ? 68  GLY D O  1 
ATOM 7449  N N  . THR D 2 69  ? 138.700 108.770 50.645  1.00 54.34  ? 69  THR D N  1 
ATOM 7450  C CA . THR D 2 69  ? 140.019 109.309 50.356  1.00 54.34  ? 69  THR D CA 1 
ATOM 7451  C C  . THR D 2 69  ? 139.815 110.795 50.036  1.00 54.34  ? 69  THR D C  1 
ATOM 7452  O O  . THR D 2 69  ? 138.783 111.365 50.395  1.00 54.34  ? 69  THR D O  1 
ATOM 7453  N N  . SER D 2 70  ? 140.771 111.438 49.370  1.00 56.12  ? 70  SER D N  1 
ATOM 7454  C CA . SER D 2 70  ? 140.927 112.885 49.332  1.00 56.12  ? 70  SER D CA 1 
ATOM 7455  C C  . SER D 2 70  ? 139.766 113.699 48.770  1.00 56.12  ? 70  SER D C  1 
ATOM 7456  O O  . SER D 2 70  ? 139.776 114.924 48.878  1.00 56.12  ? 70  SER D O  1 
ATOM 7457  N N  . TYR D 2 71  ? 138.752 113.064 48.201  1.00 50.35  ? 71  TYR D N  1 
ATOM 7458  C CA . TYR D 2 71  ? 137.590 113.815 47.750  1.00 50.35  ? 71  TYR D CA 1 
ATOM 7459  C C  . TYR D 2 71  ? 136.512 113.926 48.810  1.00 50.35  ? 71  TYR D C  1 
ATOM 7460  O O  . TYR D 2 71  ? 135.399 114.350 48.496  1.00 50.35  ? 71  TYR D O  1 
ATOM 7461  N N  . LYS D 2 72  ? 136.803 113.565 50.054  1.00 64.28  ? 72  LYS D N  1 
ATOM 7462  C CA . LYS D 2 72  ? 135.849 113.785 51.133  1.00 64.28  ? 72  LYS D CA 1 
ATOM 7463  C C  . LYS D 2 72  ? 135.951 115.181 51.708  1.00 64.28  ? 72  LYS D C  1 
ATOM 7464  O O  . LYS D 2 72  ? 135.278 115.489 52.696  1.00 64.28  ? 72  LYS D O  1 
ATOM 7465  N N  . ASP D 2 73  ? 136.775 116.027 51.107  1.00 66.79  ? 73  ASP D N  1 
ATOM 7466  C CA . ASP D 2 73  ? 136.921 117.405 51.519  1.00 66.79  ? 73  ASP D CA 1 
ATOM 7467  C C  . ASP D 2 73  ? 136.292 118.374 50.537  1.00 66.79  ? 73  ASP D C  1 
ATOM 7468  O O  . ASP D 2 73  ? 136.045 119.526 50.902  1.00 66.79  ? 73  ASP D O  1 
ATOM 7469  N N  . LEU D 2 74  ? 135.993 117.936 49.322  1.00 53.59  ? 74  LEU D N  1 
ATOM 7470  C CA . LEU D 2 74  ? 135.729 118.860 48.235  1.00 53.59  ? 74  LEU D CA 1 
ATOM 7471  C C  . LEU D 2 74  ? 134.323 119.432 48.313  1.00 53.59  ? 74  LEU D C  1 
ATOM 7472  O O  . LEU D 2 74  ? 133.591 119.257 49.288  1.00 53.59  ? 74  LEU D O  1 
ATOM 7473  N N  . MET D 2 75  ? 133.955 120.133 47.250  1.00 53.33  ? 75  MET D N  1 
ATOM 7474  C CA . MET D 2 75  ? 132.723 120.858 47.132  1.00 53.33  ? 75  MET D CA 1 
ATOM 7475  C C  . MET D 2 75  ? 132.158 120.571 45.750  1.00 53.33  ? 75  MET D C  1 
ATOM 7476  O O  . MET D 2 75  ? 132.816 120.866 44.746  1.00 53.33  ? 75  MET D O  1 
ATOM 7477  N N  . PRO D 2 76  ? 130.930 120.057 45.665  1.00 50.67  ? 76  PRO D N  1 
ATOM 7478  C CA . PRO D 2 76  ? 130.480 119.341 44.456  1.00 50.67  ? 76  PRO D CA 1 
ATOM 7479  C C  . PRO D 2 76  ? 130.370 120.114 43.155  1.00 50.67  ? 76  PRO D C  1 
ATOM 7480  O O  . PRO D 2 76  ? 129.822 119.587 42.188  1.00 50.67  ? 76  PRO D O  1 
ATOM 7481  N N  . HIS D 2 77  ? 130.850 121.349 43.108  1.00 49.78  ? 77  HIS D N  1 
ATOM 7482  C CA . HIS D 2 77  ? 131.146 121.962 41.828  1.00 49.78  ? 77  HIS D CA 1 
ATOM 7483  C C  . HIS D 2 77  ? 132.617 122.265 41.630  1.00 49.78  ? 77  HIS D C  1 
ATOM 7484  O O  . HIS D 2 77  ? 132.944 123.037 40.728  1.00 49.78  ? 77  HIS D O  1 
ATOM 7485  N N  . ASP D 2 78  ? 133.510 121.712 42.438  1.00 53.68  ? 78  ASP D N  1 
ATOM 7486  C CA . ASP D 2 78  ? 134.907 122.096 42.313  1.00 53.68  ? 78  ASP D CA 1 
ATOM 7487  C C  . ASP D 2 78  ? 135.699 121.205 41.380  1.00 53.68  ? 78  ASP D C  1 
ATOM 7488  O O  . ASP D 2 78  ? 136.530 121.704 40.620  1.00 53.68  ? 78  ASP D O  1 
ATOM 7489  N N  . LEU D 2 79  ? 135.511 119.896 41.429  1.00 44.29  ? 79  LEU D N  1 
ATOM 7490  C CA . LEU D 2 79  ? 136.250 119.064 40.491  1.00 44.29  ? 79  LEU D CA 1 
ATOM 7491  C C  . LEU D 2 79  ? 135.624 119.096 39.111  1.00 44.29  ? 79  LEU D C  1 
ATOM 7492  O O  . LEU D 2 79  ? 136.261 118.688 38.138  1.00 44.29  ? 79  LEU D O  1 
ATOM 7493  N N  . ALA D 2 80  ? 134.395 119.602 39.006  1.00 37.43  ? 80  ALA D N  1 
ATOM 7494  C CA . ALA D 2 80  ? 133.916 120.120 37.733  1.00 37.43  ? 80  ALA D CA 1 
ATOM 7495  C C  . ALA D 2 80  ? 134.885 121.128 37.156  1.00 37.43  ? 80  ALA D C  1 
ATOM 7496  O O  . ALA D 2 80  ? 135.312 120.996 36.003  1.00 37.43  ? 80  ALA D O  1 
ATOM 7497  N N  . ARG D 2 81  ? 135.266 122.105 37.970  1.00 44.30  ? 81  ARG D N  1 
ATOM 7498  C CA . ARG D 2 81  ? 136.217 123.126 37.566  1.00 44.30  ? 81  ARG D CA 1 
ATOM 7499  C C  . ARG D 2 81  ? 137.577 122.528 37.279  1.00 44.30  ? 81  ARG D C  1 
ATOM 7500  O O  . ARG D 2 81  ? 138.259 122.964 36.348  1.00 44.30  ? 81  ARG D O  1 
ATOM 7501  N N  . ALA D 2 82  ? 137.970 121.509 38.038  1.00 40.97  ? 82  ALA D N  1 
ATOM 7502  C CA . ALA D 2 82  ? 139.266 120.882 37.799  1.00 40.97  ? 82  ALA D CA 1 
ATOM 7503  C C  . ALA D 2 82  ? 139.292 120.159 36.460  1.00 40.97  ? 82  ALA D C  1 
ATOM 7504  O O  . ALA D 2 82  ? 140.225 120.344 35.669  1.00 40.97  ? 82  ALA D O  1 
ATOM 7505  N N  . ALA D 2 83  ? 138.256 119.366 36.176  1.00 32.00  ? 83  ALA D N  1 
ATOM 7506  C CA . ALA D 2 83  ? 138.185 118.638 34.918  1.00 32.00  ? 83  ALA D CA 1 
ATOM 7507  C C  . ALA D 2 83  ? 138.062 119.585 33.745  1.00 32.00  ? 83  ALA D C  1 
ATOM 7508  O O  . ALA D 2 83  ? 138.646 119.353 32.684  1.00 32.00  ? 83  ALA D O  1 
ATOM 7509  N N  . LEU D 2 84  ? 137.361 120.689 33.935  1.00 37.01  ? 84  LEU D N  1 
ATOM 7510  C CA . LEU D 2 84  ? 137.179 121.619 32.835  1.00 37.01  ? 84  LEU D CA 1 
ATOM 7511  C C  . LEU D 2 84  ? 138.456 122.408 32.556  1.00 37.01  ? 84  LEU D C  1 
ATOM 7512  O O  . LEU D 2 84  ? 138.789 122.646 31.390  1.00 37.01  ? 84  LEU D O  1 
ATOM 7513  N N  . THR D 2 85  ? 139.195 122.804 33.598  1.00 41.18  ? 85  THR D N  1 
ATOM 7514  C CA . THR D 2 85  ? 140.492 123.436 33.376  1.00 41.18  ? 85  THR D CA 1 
ATOM 7515  C C  . THR D 2 85  ? 141.473 122.476 32.738  1.00 41.18  ? 85  THR D C  1 
ATOM 7516  O O  . THR D 2 85  ? 142.299 122.879 31.914  1.00 41.18  ? 85  THR D O  1 
ATOM 7517  N N  . GLY D 2 86  ? 141.405 121.203 33.115  1.00 40.70  ? 86  GLY D N  1 
ATOM 7518  C CA . GLY D 2 86  ? 142.230 120.215 32.451  1.00 40.70  ? 86  GLY D CA 1 
ATOM 7519  C C  . GLY D 2 86  ? 141.864 120.041 30.995  1.00 40.70  ? 86  GLY D C  1 
ATOM 7520  O O  . GLY D 2 86  ? 142.733 119.772 30.164  1.00 40.70  ? 86  GLY D O  1 
ATOM 7521  N N  . LEU D 2 87  ? 140.581 120.197 30.668  1.00 40.07  ? 87  LEU D N  1 
ATOM 7522  C CA . LEU D 2 87  ? 140.193 120.210 29.267  1.00 40.07  ? 87  LEU D CA 1 
ATOM 7523  C C  . LEU D 2 87  ? 140.767 121.420 28.570  1.00 40.07  ? 87  LEU D C  1 
ATOM 7524  O O  . LEU D 2 87  ? 141.216 121.322 27.427  1.00 40.07  ? 87  LEU D O  1 
ATOM 7525  N N  . LEU D 2 88  ? 140.785 122.560 29.245  1.00 43.20  ? 88  LEU D N  1 
ATOM 7526  C CA . LEU D 2 88  ? 141.397 123.730 28.633  1.00 43.20  ? 88  LEU D CA 1 
ATOM 7527  C C  . LEU D 2 88  ? 142.906 123.737 28.756  1.00 43.20  ? 88  LEU D C  1 
ATOM 7528  O O  . LEU D 2 88  ? 143.540 124.711 28.341  1.00 43.20  ? 88  LEU D O  1 
ATOM 7529  N N  . HIS D 2 89  ? 143.499 122.692 29.314  1.00 45.81  ? 89  HIS D N  1 
ATOM 7530  C CA . HIS D 2 89  ? 144.947 122.639 29.346  1.00 45.81  ? 89  HIS D CA 1 
ATOM 7531  C C  . HIS D 2 89  ? 145.527 121.931 28.135  1.00 45.81  ? 89  HIS D C  1 
ATOM 7532  O O  . HIS D 2 89  ? 146.616 122.294 27.683  1.00 45.81  ? 89  HIS D O  1 
ATOM 7533  N N  . ARG D 2 90  ? 144.847 120.919 27.606  1.00 40.60  ? 90  ARG D N  1 
ATOM 7534  C CA . ARG D 2 90  ? 145.390 120.153 26.496  1.00 40.60  ? 90  ARG D CA 1 
ATOM 7535  C C  . ARG D 2 90  ? 144.654 120.390 25.196  1.00 40.60  ? 90  ARG D C  1 
ATOM 7536  O O  . ARG D 2 90  ? 144.849 119.634 24.241  1.00 40.60  ? 90  ARG D O  1 
ATOM 7537  N N  . THR D 2 91  ? 143.827 121.422 25.117  1.00 58.41  ? 91  THR D N  1 
ATOM 7538  C CA . THR D 2 91  ? 143.118 121.655 23.876  1.00 58.41  ? 91  THR D CA 1 
ATOM 7539  C C  . THR D 2 91  ? 143.599 122.874 23.111  1.00 58.41  ? 91  THR D C  1 
ATOM 7540  O O  . THR D 2 91  ? 143.317 122.964 21.915  1.00 58.41  ? 91  THR D O  1 
ATOM 7541  N N  . SER D 2 92  ? 144.294 123.813 23.767  1.00 64.31  ? 92  SER D N  1 
ATOM 7542  C CA . SER D 2 92  ? 144.841 125.048 23.177  1.00 64.31  ? 92  SER D CA 1 
ATOM 7543  C C  . SER D 2 92  ? 143.794 125.908 22.453  1.00 64.31  ? 92  SER D C  1 
ATOM 7544  O O  . SER D 2 92  ? 144.147 126.771 21.647  1.00 64.31  ? 92  SER D O  1 
ATOM 7545  N N  . VAL D 2 93  ? 142.510 125.710 22.731  1.00 63.20  ? 93  VAL D N  1 
ATOM 7546  C CA . VAL D 2 93  ? 141.434 126.411 22.039  1.00 63.20  ? 93  VAL D CA 1 
ATOM 7547  C C  . VAL D 2 93  ? 141.309 127.779 22.690  1.00 63.20  ? 93  VAL D C  1 
ATOM 7548  O O  . VAL D 2 93  ? 141.478 127.882 23.912  1.00 63.20  ? 93  VAL D O  1 
ATOM 7549  N N  . PRO D 2 94  ? 141.109 128.849 21.923  1.00 60.12  ? 94  PRO D N  1 
ATOM 7550  C CA . PRO D 2 94  ? 140.740 130.136 22.527  1.00 60.12  ? 94  PRO D CA 1 
ATOM 7551  C C  . PRO D 2 94  ? 139.455 130.000 23.327  1.00 60.12  ? 94  PRO D C  1 
ATOM 7552  O O  . PRO D 2 94  ? 138.495 129.369 22.892  1.00 60.12  ? 94  PRO D O  1 
ATOM 7553  N N  . LYS D 2 95  ? 139.445 130.600 24.508  1.00 46.67  ? 95  LYS D N  1 
ATOM 7554  C CA . LYS D 2 95  ? 138.373 130.399 25.469  1.00 46.67  ? 95  LYS D CA 1 
ATOM 7555  C C  . LYS D 2 95  ? 137.087 131.120 25.095  1.00 46.67  ? 95  LYS D C  1 
ATOM 7556  O O  . LYS D 2 95  ? 136.111 131.043 25.844  1.00 46.67  ? 95  LYS D O  1 
ATOM 7557  N N  . GLU D 2 96  ? 137.068 131.829 23.973  1.00 51.52  ? 96  GLU D N  1 
ATOM 7558  C CA . GLU D 2 96  ? 135.891 132.525 23.492  1.00 51.52  ? 96  GLU D CA 1 
ATOM 7559  C C  . GLU D 2 96  ? 135.237 131.812 22.323  1.00 51.52  ? 96  GLU D C  1 
ATOM 7560  O O  . GLU D 2 96  ? 134.217 132.283 21.817  1.00 51.52  ? 96  GLU D O  1 
ATOM 7561  N N  . VAL D 2 97  ? 135.809 130.701 21.877  1.00 48.00  ? 97  VAL D N  1 
ATOM 7562  C CA . VAL D 2 97  ? 135.308 129.984 20.717  1.00 48.00  ? 97  VAL D CA 1 
ATOM 7563  C C  . VAL D 2 97  ? 134.382 128.891 21.213  1.00 48.00  ? 97  VAL D C  1 
ATOM 7564  O O  . VAL D 2 97  ? 133.395 128.558 20.551  1.00 48.00  ? 97  VAL D O  1 
ATOM 7565  N N  . VAL D 2 98  ? 134.681 128.352 22.399  1.00 46.84  ? 98  VAL D N  1 
ATOM 7566  C CA . VAL D 2 98  ? 133.858 127.338 23.054  1.00 46.84  ? 98  VAL D CA 1 
ATOM 7567  C C  . VAL D 2 98  ? 132.465 127.896 23.291  1.00 46.84  ? 98  VAL D C  1 
ATOM 7568  O O  . VAL D 2 98  ? 132.297 128.987 23.835  1.00 46.84  ? 98  VAL D O  1 
ATOM 7569  N N  . ASP D 2 99  ? 131.456 127.210 22.779  1.00 40.96  ? 99  ASP D N  1 
ATOM 7570  C CA . ASP D 2 99  ? 130.187 127.898 22.636  1.00 40.96  ? 99  ASP D CA 1 
ATOM 7571  C C  . ASP D 2 99  ? 129.233 127.633 23.790  1.00 40.96  ? 99  ASP D C  1 
ATOM 7572  O O  . ASP D 2 99  ? 128.809 128.569 24.470  1.00 40.96  ? 99  ASP D O  1 
ATOM 7573  N N  . TYR D 2 100 ? 128.870 126.382 24.012  1.00 34.86  ? 100 TYR D N  1 
ATOM 7574  C CA . TYR D 2 100 ? 127.685 126.067 24.801  1.00 34.86  ? 100 TYR D CA 1 
ATOM 7575  C C  . TYR D 2 100 ? 127.951 124.864 25.686  1.00 34.86  ? 100 TYR D C  1 
ATOM 7576  O O  . TYR D 2 100 ? 127.635 123.742 25.306  1.00 34.86  ? 100 TYR D O  1 
ATOM 7577  N N  . ILE D 2 101 ? 128.478 125.087 26.883  1.00 29.13  ? 101 ILE D N  1 
ATOM 7578  C CA . ILE D 2 101 ? 128.910 123.964 27.703  1.00 29.13  ? 101 ILE D CA 1 
ATOM 7579  C C  . ILE D 2 101 ? 127.703 123.426 28.448  1.00 29.13  ? 101 ILE D C  1 
ATOM 7580  O O  . ILE D 2 101 ? 126.818 124.186 28.834  1.00 29.13  ? 101 ILE D O  1 
ATOM 7581  N N  . ILE D 2 102 ? 127.623 122.108 28.591  1.00 29.44  ? 102 ILE D N  1 
ATOM 7582  C CA . ILE D 2 102 ? 126.534 121.452 29.297  1.00 29.44  ? 102 ILE D CA 1 
ATOM 7583  C C  . ILE D 2 102 ? 127.105 120.329 30.136  1.00 29.44  ? 102 ILE D C  1 
ATOM 7584  O O  . ILE D 2 102 ? 127.940 119.550 29.673  1.00 29.44  ? 102 ILE D O  1 
ATOM 7585  N N  . PHE D 2 103 ? 126.682 120.261 31.375  1.00 25.88  ? 103 PHE D N  1 
ATOM 7586  C CA . PHE D 2 103 ? 127.179 119.260 32.299  1.00 25.88  ? 103 PHE D CA 1 
ATOM 7587  C C  . PHE D 2 103 ? 126.051 118.347 32.717  1.00 25.88  ? 103 PHE D C  1 
ATOM 7588  O O  . PHE D 2 103 ? 124.959 118.390 32.165  1.00 25.88  ? 103 PHE D O  1 
ATOM 7589  N N  . GLY D 2 104 ? 126.326 117.502 33.691  1.00 26.31  ? 104 GLY D N  1 
ATOM 7590  C CA . GLY D 2 104 ? 125.256 116.708 34.227  1.00 26.31  ? 104 GLY D CA 1 
ATOM 7591  C C  . GLY D 2 104 ? 125.584 116.084 35.556  1.00 26.31  ? 104 GLY D C  1 
ATOM 7592  O O  . GLY D 2 104 ? 126.593 115.400 35.693  1.00 26.31  ? 104 GLY D O  1 
ATOM 7593  N N  . THR D 2 105 ? 124.728 116.296 36.536  1.00 31.92  ? 105 THR D N  1 
ATOM 7594  C CA . THR D 2 105 ? 124.911 115.781 37.875  1.00 31.92  ? 105 THR D CA 1 
ATOM 7595  C C  . THR D 2 105 ? 123.803 114.787 38.171  1.00 31.92  ? 105 THR D C  1 
ATOM 7596  O O  . THR D 2 105 ? 123.088 114.345 37.275  1.00 31.92  ? 105 THR D O  1 
ATOM 7597  N N  . VAL D 2 106 ? 123.681 114.402 39.432  1.00 47.58  ? 106 VAL D N  1 
ATOM 7598  C CA . VAL D 2 106 ? 122.523 113.633 39.860  1.00 47.58  ? 106 VAL D CA 1 
ATOM 7599  C C  . VAL D 2 106 ? 122.067 114.140 41.224  1.00 47.58  ? 106 VAL D C  1 
ATOM 7600  O O  . VAL D 2 106 ? 120.922 113.936 41.631  1.00 47.58  ? 106 VAL D O  1 
ATOM 7601  N N  . ILE D 2 107 ? 122.946 114.844 41.924  1.00 54.19  ? 107 ILE D N  1 
ATOM 7602  C CA . ILE D 2 107 ? 122.682 115.208 43.309  1.00 54.19  ? 107 ILE D CA 1 
ATOM 7603  C C  . ILE D 2 107 ? 122.104 116.608 43.433  1.00 54.19  ? 107 ILE D C  1 
ATOM 7604  O O  . ILE D 2 107 ? 121.178 116.822 44.222  1.00 54.19  ? 107 ILE D O  1 
ATOM 7605  N N  . GLN D 2 108 ? 122.640 117.548 42.649  1.00 54.16  ? 108 GLN D N  1 
ATOM 7606  C CA . GLN D 2 108 ? 122.182 118.935 42.563  1.00 54.16  ? 108 GLN D CA 1 
ATOM 7607  C C  . GLN D 2 108 ? 122.314 119.633 43.919  1.00 54.16  ? 108 GLN D C  1 
ATOM 7608  O O  . GLN D 2 108 ? 121.341 119.838 44.644  1.00 54.16  ? 108 GLN D O  1 
ATOM 7609  N N  . GLU D 2 109 ? 123.573 119.911 44.272  1.00 62.59  ? 109 GLU D N  1 
ATOM 7610  C CA . GLU D 2 109 ? 123.922 120.640 45.487  1.00 62.59  ? 109 GLU D CA 1 
ATOM 7611  C C  . GLU D 2 109 ? 123.252 122.004 45.503  1.00 62.59  ? 109 GLU D C  1 
ATOM 7612  O O  . GLU D 2 109 ? 123.669 122.908 44.780  1.00 62.59  ? 109 GLU D O  1 
ATOM 7613  N N  . VAL D 2 110 ? 122.246 122.178 46.364  1.00 64.84  ? 110 VAL D N  1 
ATOM 7614  C CA . VAL D 2 110 ? 121.233 123.200 46.113  1.00 64.84  ? 110 VAL D CA 1 
ATOM 7615  C C  . VAL D 2 110 ? 121.642 124.579 46.597  1.00 64.84  ? 110 VAL D C  1 
ATOM 7616  O O  . VAL D 2 110 ? 120.925 125.554 46.338  1.00 64.84  ? 110 VAL D O  1 
ATOM 7617  N N  . LYS D 2 111 ? 122.780 124.703 47.279  1.00 61.69  ? 111 LYS D N  1 
ATOM 7618  C CA . LYS D 2 111 ? 123.315 126.033 47.531  1.00 61.69  ? 111 LYS D CA 1 
ATOM 7619  C C  . LYS D 2 111 ? 123.690 126.715 46.226  1.00 61.69  ? 111 LYS D C  1 
ATOM 7620  O O  . LYS D 2 111 ? 123.514 127.928 46.077  1.00 61.69  ? 111 LYS D O  1 
ATOM 7621  N N  . THR D 2 112 ? 124.142 125.941 45.248  1.00 59.99  ? 112 THR D N  1 
ATOM 7622  C CA . THR D 2 112 ? 124.351 126.451 43.902  1.00 59.99  ? 112 THR D CA 1 
ATOM 7623  C C  . THR D 2 112 ? 123.721 125.501 42.892  1.00 59.99  ? 112 THR D C  1 
ATOM 7624  O O  . THR D 2 112 ? 124.315 124.485 42.524  1.00 59.99  ? 112 THR D O  1 
ATOM 7625  N N  . SER D 2 113 ? 122.536 125.866 42.410  1.00 56.11  ? 113 SER D N  1 
ATOM 7626  C CA . SER D 2 113 ? 121.896 125.162 41.311  1.00 56.11  ? 113 SER D CA 1 
ATOM 7627  C C  . SER D 2 113 ? 122.631 125.443 40.003  1.00 56.11  ? 113 SER D C  1 
ATOM 7628  O O  . SER D 2 113 ? 123.624 126.173 39.976  1.00 56.11  ? 113 SER D O  1 
ATOM 7629  N N  . ASN D 2 114 ? 122.139 124.805 38.933  1.00 38.72  ? 114 ASN D N  1 
ATOM 7630  C CA . ASN D 2 114 ? 122.634 124.768 37.550  1.00 38.72  ? 114 ASN D CA 1 
ATOM 7631  C C  . ASN D 2 114 ? 124.152 124.846 37.421  1.00 38.72  ? 114 ASN D C  1 
ATOM 7632  O O  . ASN D 2 114 ? 124.690 125.786 36.826  1.00 38.72  ? 114 ASN D O  1 
ATOM 7633  N N  . VAL D 2 115 ? 124.815 123.807 37.948  1.00 35.72  ? 115 VAL D N  1 
ATOM 7634  C CA . VAL D 2 115 ? 126.251 123.629 38.180  1.00 35.72  ? 115 VAL D CA 1 
ATOM 7635  C C  . VAL D 2 115 ? 127.129 124.203 37.080  1.00 35.72  ? 115 VAL D C  1 
ATOM 7636  O O  . VAL D 2 115 ? 128.112 124.900 37.354  1.00 35.72  ? 115 VAL D O  1 
ATOM 7637  N N  . ALA D 2 116 ? 126.719 123.974 35.839  1.00 41.83  ? 116 ALA D N  1 
ATOM 7638  C CA . ALA D 2 116 ? 127.530 124.306 34.681  1.00 41.83  ? 116 ALA D CA 1 
ATOM 7639  C C  . ALA D 2 116 ? 127.768 125.801 34.517  1.00 41.83  ? 116 ALA D C  1 
ATOM 7640  O O  . ALA D 2 116 ? 128.841 126.182 34.049  1.00 41.83  ? 116 ALA D O  1 
ATOM 7641  N N  . ARG D 2 117 ? 126.809 126.652 34.909  1.00 42.74  ? 117 ARG D N  1 
ATOM 7642  C CA . ARG D 2 117 ? 126.956 128.101 34.726  1.00 42.74  ? 117 ARG D CA 1 
ATOM 7643  C C  . ARG D 2 117 ? 128.136 128.647 35.506  1.00 42.74  ? 117 ARG D C  1 
ATOM 7644  O O  . ARG D 2 117 ? 129.103 129.165 34.929  1.00 42.74  ? 117 ARG D O  1 
ATOM 7645  N N  . GLU D 2 118 ? 128.103 128.495 36.820  1.00 45.63  ? 118 GLU D N  1 
ATOM 7646  C CA . GLU D 2 118 ? 129.209 128.998 37.614  1.00 45.63  ? 118 GLU D CA 1 
ATOM 7647  C C  . GLU D 2 118 ? 130.415 128.084 37.516  1.00 45.63  ? 118 GLU D C  1 
ATOM 7648  O O  . GLU D 2 118 ? 131.538 128.497 37.803  1.00 45.63  ? 118 GLU D O  1 
ATOM 7649  N N  . ALA D 2 119 ? 130.211 126.832 37.110  1.00 37.97  ? 119 ALA D N  1 
ATOM 7650  C CA . ALA D 2 119 ? 131.354 125.948 36.942  1.00 37.97  ? 119 ALA D CA 1 
ATOM 7651  C C  . ALA D 2 119 ? 132.127 126.242 35.675  1.00 37.97  ? 119 ALA D C  1 
ATOM 7652  O O  . ALA D 2 119 ? 133.271 125.806 35.555  1.00 37.97  ? 119 ALA D O  1 
ATOM 7653  N N  . ALA D 2 120 ? 131.523 126.936 34.723  1.00 36.30  ? 120 ALA D N  1 
ATOM 7654  C CA . ALA D 2 120 ? 132.268 127.507 33.617  1.00 36.30  ? 120 ALA D CA 1 
ATOM 7655  C C  . ALA D 2 120 ? 132.787 128.884 33.949  1.00 36.30  ? 120 ALA D C  1 
ATOM 7656  O O  . ALA D 2 120 ? 133.850 129.272 33.456  1.00 36.30  ? 120 ALA D O  1 
ATOM 7657  N N  . LEU D 2 121 ? 132.062 129.633 34.777  1.00 40.46  ? 121 LEU D N  1 
ATOM 7658  C CA . LEU D 2 121 ? 132.562 130.945 35.152  1.00 40.46  ? 121 LEU D CA 1 
ATOM 7659  C C  . LEU D 2 121 ? 133.764 130.832 36.082  1.00 40.46  ? 121 LEU D C  1 
ATOM 7660  O O  . LEU D 2 121 ? 134.606 131.734 36.114  1.00 40.46  ? 121 LEU D O  1 
ATOM 7661  N N  . GLY D 2 122 ? 133.877 129.731 36.809  1.00 39.45  ? 122 GLY D N  1 
ATOM 7662  C CA . GLY D 2 122 ? 134.962 129.540 37.743  1.00 39.45  ? 122 GLY D CA 1 
ATOM 7663  C C  . GLY D 2 122 ? 136.277 129.289 37.047  1.00 39.45  ? 122 GLY D C  1 
ATOM 7664  O O  . GLY D 2 122 ? 137.328 129.721 37.518  1.00 39.45  ? 122 GLY D O  1 
ATOM 7665  N N  . ALA D 2 123 ? 136.230 128.615 35.909  1.00 38.73  ? 123 ALA D N  1 
ATOM 7666  C CA . ALA D 2 123 ? 137.430 128.355 35.136  1.00 38.73  ? 123 ALA D CA 1 
ATOM 7667  C C  . ALA D 2 123 ? 137.763 129.471 34.183  1.00 38.73  ? 123 ALA D C  1 
ATOM 7668  O O  . ALA D 2 123 ? 138.517 129.254 33.234  1.00 38.73  ? 123 ALA D O  1 
ATOM 7669  N N  . GLY D 2 124 ? 137.208 130.655 34.402  1.00 42.39  ? 124 GLY D N  1 
ATOM 7670  C CA . GLY D 2 124 ? 137.617 131.812 33.645  1.00 42.39  ? 124 GLY D CA 1 
ATOM 7671  C C  . GLY D 2 124 ? 137.131 131.850 32.222  1.00 42.39  ? 124 GLY D C  1 
ATOM 7672  O O  . GLY D 2 124 ? 137.749 132.520 31.394  1.00 42.39  ? 124 GLY D O  1 
ATOM 7673  N N  . PHE D 2 125 ? 136.057 131.135 31.905  1.00 41.14  ? 125 PHE D N  1 
ATOM 7674  C CA . PHE D 2 125 ? 135.488 131.233 30.573  1.00 41.14  ? 125 PHE D CA 1 
ATOM 7675  C C  . PHE D 2 125 ? 134.911 132.615 30.313  1.00 41.14  ? 125 PHE D C  1 
ATOM 7676  O O  . PHE D 2 125 ? 134.511 133.338 31.228  1.00 41.14  ? 125 PHE D O  1 
ATOM 7677  N N  . SER D 2 126 ? 134.905 132.987 29.038  1.00 43.91  ? 126 SER D N  1 
ATOM 7678  C CA . SER D 2 126 ? 134.123 134.133 28.626  1.00 43.91  ? 126 SER D CA 1 
ATOM 7679  C C  . SER D 2 126 ? 132.661 133.828 28.865  1.00 43.91  ? 126 SER D C  1 
ATOM 7680  O O  . SER D 2 126 ? 132.157 132.764 28.510  1.00 43.91  ? 126 SER D O  1 
ATOM 7681  N N  . ASP D 2 127 ? 131.986 134.766 29.497  1.00 50.34  ? 127 ASP D N  1 
ATOM 7682  C CA . ASP D 2 127 ? 130.678 134.496 30.047  1.00 50.34  ? 127 ASP D CA 1 
ATOM 7683  C C  . ASP D 2 127 ? 129.566 134.778 29.059  1.00 50.34  ? 127 ASP D C  1 
ATOM 7684  O O  . ASP D 2 127 ? 128.405 134.903 29.460  1.00 50.34  ? 127 ASP D O  1 
ATOM 7685  N N  . LYS D 2 128 ? 129.891 134.873 27.779  1.00 50.63  ? 128 LYS D N  1 
ATOM 7686  C CA . LYS D 2 128 ? 128.889 134.848 26.718  1.00 50.63  ? 128 LYS D CA 1 
ATOM 7687  C C  . LYS D 2 128 ? 128.725 133.425 26.198  1.00 50.63  ? 128 LYS D C  1 
ATOM 7688  O O  . LYS D 2 128 ? 128.774 133.156 25.000  1.00 50.63  ? 128 LYS D O  1 
ATOM 7689  N N  . THR D 2 129 ? 128.558 132.490 27.134  1.00 40.74  ? 129 THR D N  1 
ATOM 7690  C CA . THR D 2 129 ? 128.461 131.059 26.850  1.00 40.74  ? 129 THR D CA 1 
ATOM 7691  C C  . THR D 2 129 ? 127.380 130.503 27.756  1.00 40.74  ? 129 THR D C  1 
ATOM 7692  O O  . THR D 2 129 ? 127.626 130.263 28.946  1.00 40.74  ? 129 THR D O  1 
ATOM 7693  N N  . PRO D 2 130 ? 126.187 130.283 27.240  1.00 34.66  ? 130 PRO D N  1 
ATOM 7694  C CA . PRO D 2 130 ? 125.104 129.770 28.076  1.00 34.66  ? 130 PRO D CA 1 
ATOM 7695  C C  . PRO D 2 130 ? 125.319 128.313 28.424  1.00 34.66  ? 130 PRO D C  1 
ATOM 7696  O O  . PRO D 2 130 ? 126.020 127.587 27.726  1.00 34.66  ? 130 PRO D O  1 
ATOM 7697  N N  . ALA D 2 131 ? 124.704 127.885 29.518  1.00 36.91  ? 131 ALA D N  1 
ATOM 7698  C CA . ALA D 2 131 ? 124.951 126.548 30.022  1.00 36.91  ? 131 ALA D CA 1 
ATOM 7699  C C  . ALA D 2 131 ? 123.717 126.005 30.696  1.00 36.91  ? 131 ALA D C  1 
ATOM 7700  O O  . ALA D 2 131 ? 122.877 126.764 31.166  1.00 36.91  ? 131 ALA D O  1 
ATOM 7701  N N  . HIS D 2 132 ? 123.625 124.684 30.762  1.00 72.35  ? 132 HIS D N  1 
ATOM 7702  C CA . HIS D 2 132 ? 122.629 124.067 31.612  1.00 72.35  ? 132 HIS D CA 1 
ATOM 7703  C C  . HIS D 2 132 ? 123.096 122.697 32.048  1.00 72.35  ? 132 HIS D C  1 
ATOM 7704  O O  . HIS D 2 132 ? 123.981 122.106 31.440  1.00 72.35  ? 132 HIS D O  1 
ATOM 7705  N N  . THR D 2 133 ? 122.482 122.188 33.101  1.00 38.64  ? 133 THR D N  1 
ATOM 7706  C CA . THR D 2 133 ? 122.733 120.827 33.524  1.00 38.64  ? 133 THR D CA 1 
ATOM 7707  C C  . THR D 2 133 ? 121.637 119.934 32.990  1.00 38.64  ? 133 THR D C  1 
ATOM 7708  O O  . THR D 2 133 ? 120.593 120.417 32.567  1.00 38.64  ? 133 THR D O  1 
ATOM 7709  N N  . VAL D 2 134 ? 121.900 118.635 32.977  1.00 26.33  ? 134 VAL D N  1 
ATOM 7710  C CA . VAL D 2 134 ? 120.947 117.631 32.547  1.00 26.33  ? 134 VAL D CA 1 
ATOM 7711  C C  . VAL D 2 134 ? 121.055 116.501 33.545  1.00 26.33  ? 134 VAL D C  1 
ATOM 7712  O O  . VAL D 2 134 ? 122.115 115.885 33.671  1.00 26.33  ? 134 VAL D O  1 
ATOM 7713  N N  . THR D 2 135 ? 119.989 116.241 34.274  1.00 29.78  ? 135 THR D N  1 
ATOM 7714  C CA . THR D 2 135 ? 120.026 115.256 35.338  1.00 29.78  ? 135 THR D CA 1 
ATOM 7715  C C  . THR D 2 135 ? 119.225 114.027 34.958  1.00 29.78  ? 135 THR D C  1 
ATOM 7716  O O  . THR D 2 135 ? 118.009 114.103 34.788  1.00 29.78  ? 135 THR D O  1 
ATOM 7717  N N  . MET D 2 136 ? 119.916 112.902 34.823  1.00 33.33  ? 136 MET D N  1 
ATOM 7718  C CA . MET D 2 136 ? 119.273 111.601 34.847  1.00 33.33  ? 136 MET D CA 1 
ATOM 7719  C C  . MET D 2 136 ? 119.813 110.786 35.995  1.00 33.33  ? 136 MET D C  1 
ATOM 7720  O O  . MET D 2 136 ? 120.563 111.294 36.829  1.00 33.33  ? 136 MET D O  1 
ATOM 7721  N N  . ALA D 2 137 ? 119.452 109.512 36.035  1.00 45.06  ? 137 ALA D N  1 
ATOM 7722  C CA . ALA D 2 137 ? 119.936 108.666 37.110  1.00 45.06  ? 137 ALA D CA 1 
ATOM 7723  C C  . ALA D 2 137 ? 121.403 108.340 36.915  1.00 45.06  ? 137 ALA D C  1 
ATOM 7724  O O  . ALA D 2 137 ? 122.249 108.733 37.720  1.00 45.06  ? 137 ALA D O  1 
ATOM 7725  N N  . CYS D 2 138 ? 121.728 107.651 35.834  1.00 41.71  ? 138 CYS D N  1 
ATOM 7726  C CA . CYS D 2 138 ? 123.040 107.045 35.715  1.00 41.71  ? 138 CYS D CA 1 
ATOM 7727  C C  . CYS D 2 138 ? 123.772 107.400 34.443  1.00 41.71  ? 138 CYS D C  1 
ATOM 7728  O O  . CYS D 2 138 ? 125.005 107.395 34.446  1.00 41.71  ? 138 CYS D O  1 
ATOM 7729  N N  . ILE D 2 139 ? 123.076 107.753 33.377  1.00 32.28  ? 139 ILE D N  1 
ATOM 7730  C CA . ILE D 2 139 ? 123.739 108.049 32.121  1.00 32.28  ? 139 ILE D CA 1 
ATOM 7731  C C  . ILE D 2 139 ? 123.553 109.519 31.800  1.00 32.28  ? 139 ILE D C  1 
ATOM 7732  O O  . ILE D 2 139 ? 123.460 109.902 30.630  1.00 32.28  ? 139 ILE D O  1 
ATOM 7733  N N  . SER D 2 140 ? 123.519 110.334 32.856  1.00 30.52  ? 140 SER D N  1 
ATOM 7734  C CA . SER D 2 140 ? 123.489 111.787 32.811  1.00 30.52  ? 140 SER D CA 1 
ATOM 7735  C C  . SER D 2 140 ? 124.496 112.383 31.853  1.00 30.52  ? 140 SER D C  1 
ATOM 7736  O O  . SER D 2 140 ? 124.129 112.930 30.815  1.00 30.52  ? 140 SER D O  1 
ATOM 7737  N N  . ALA D 2 141 ? 125.766 112.242 32.160  1.00 37.64  ? 141 ALA D N  1 
ATOM 7738  C CA . ALA D 2 141 ? 126.730 112.309 31.090  1.00 37.64  ? 141 ALA D CA 1 
ATOM 7739  C C  . ALA D 2 141 ? 126.523 111.070 30.250  1.00 37.64  ? 141 ALA D C  1 
ATOM 7740  O O  . ALA D 2 141 ? 126.334 109.985 30.796  1.00 37.64  ? 141 ALA D O  1 
ATOM 7741  N N  . ASN D 2 142 ? 126.556 111.259 28.922  1.00 37.41  ? 142 ASN D N  1 
ATOM 7742  C CA . ASN D 2 142 ? 126.095 110.382 27.836  1.00 37.41  ? 142 ASN D CA 1 
ATOM 7743  C C  . ASN D 2 142 ? 124.575 110.468 27.749  1.00 37.41  ? 142 ASN D C  1 
ATOM 7744  O O  . ASN D 2 142 ? 123.921 109.631 27.128  1.00 37.41  ? 142 ASN D O  1 
ATOM 7745  N N  . GLN D 2 143 ? 124.001 111.482 28.384  1.00 37.39  ? 143 GLN D N  1 
ATOM 7746  C CA . GLN D 2 143 ? 122.866 112.176 27.801  1.00 37.39  ? 143 GLN D CA 1 
ATOM 7747  C C  . GLN D 2 143 ? 123.306 113.566 27.411  1.00 37.39  ? 143 GLN D C  1 
ATOM 7748  O O  . GLN D 2 143 ? 122.641 114.232 26.616  1.00 37.39  ? 143 GLN D O  1 
ATOM 7749  N N  . ALA D 2 144 ? 124.440 113.989 27.952  1.00 37.70  ? 144 ALA D N  1 
ATOM 7750  C CA . ALA D 2 144 ? 125.009 115.276 27.615  1.00 37.70  ? 144 ALA D CA 1 
ATOM 7751  C C  . ALA D 2 144 ? 125.480 115.306 26.171  1.00 37.70  ? 144 ALA D C  1 
ATOM 7752  O O  . ALA D 2 144 ? 125.183 116.252 25.434  1.00 37.70  ? 144 ALA D O  1 
ATOM 7753  N N  . MET D 2 145 ? 126.187 114.266 25.738  1.00 37.01  ? 145 MET D N  1 
ATOM 7754  C CA . MET D 2 145 ? 126.689 114.250 24.374  1.00 37.01  ? 145 MET D CA 1 
ATOM 7755  C C  . MET D 2 145 ? 125.570 114.161 23.357  1.00 37.01  ? 145 MET D C  1 
ATOM 7756  O O  . MET D 2 145 ? 125.689 114.717 22.266  1.00 37.01  ? 145 MET D O  1 
ATOM 7757  N N  . THR D 2 146 ? 124.467 113.497 23.689  1.00 39.15  ? 146 THR D N  1 
ATOM 7758  C CA . THR D 2 146 ? 123.443 113.328 22.674  1.00 39.15  ? 146 THR D CA 1 
ATOM 7759  C C  . THR D 2 146 ? 122.610 114.599 22.520  1.00 39.15  ? 146 THR D C  1 
ATOM 7760  O O  . THR D 2 146 ? 122.234 114.969 21.403  1.00 39.15  ? 146 THR D O  1 
ATOM 7761  N N  . THR D 2 147 ? 122.389 115.347 23.603  1.00 38.20  ? 147 THR D N  1 
ATOM 7762  C CA . THR D 2 147 ? 121.737 116.632 23.401  1.00 38.20  ? 147 THR D CA 1 
ATOM 7763  C C  . THR D 2 147 ? 122.698 117.636 22.796  1.00 38.20  ? 147 THR D C  1 
ATOM 7764  O O  . THR D 2 147 ? 122.261 118.533 22.075  1.00 38.20  ? 147 THR D O  1 
ATOM 7765  N N  . GLY D 2 148 ? 124.002 117.442 22.983  1.00 38.14  ? 148 GLY D N  1 
ATOM 7766  C CA . GLY D 2 148 ? 124.956 118.294 22.303  1.00 38.14  ? 148 GLY D CA 1 
ATOM 7767  C C  . GLY D 2 148 ? 124.993 118.035 20.811  1.00 38.14  ? 148 GLY D C  1 
ATOM 7768  O O  . GLY D 2 148 ? 125.058 118.970 20.011  1.00 38.14  ? 148 GLY D O  1 
ATOM 7769  N N  . VAL D 2 149 ? 124.944 116.765 20.415  1.00 37.02  ? 149 VAL D N  1 
ATOM 7770  C CA . VAL D 2 149 ? 125.004 116.475 18.993  1.00 37.02  ? 149 VAL D CA 1 
ATOM 7771  C C  . VAL D 2 149 ? 123.687 116.857 18.340  1.00 37.02  ? 149 VAL D C  1 
ATOM 7772  O O  . VAL D 2 149 ? 123.663 117.274 17.174  1.00 37.02  ? 149 VAL D O  1 
ATOM 7773  N N  . GLY D 2 150 ? 122.589 116.824 19.097  1.00 38.62  ? 150 GLY D N  1 
ATOM 7774  C CA . GLY D 2 150 ? 121.359 117.401 18.593  1.00 38.62  ? 150 GLY D CA 1 
ATOM 7775  C C  . GLY D 2 150 ? 121.454 118.906 18.455  1.00 38.62  ? 150 GLY D C  1 
ATOM 7776  O O  . GLY D 2 150 ? 120.883 119.492 17.531  1.00 38.62  ? 150 GLY D O  1 
ATOM 7777  N N  . LEU D 2 151 ? 122.196 119.547 19.354  1.00 37.24  ? 151 LEU D N  1 
ATOM 7778  C CA . LEU D 2 151 ? 122.357 120.989 19.279  1.00 37.24  ? 151 LEU D CA 1 
ATOM 7779  C C  . LEU D 2 151 ? 123.227 121.377 18.093  1.00 37.24  ? 151 LEU D C  1 
ATOM 7780  O O  . LEU D 2 151 ? 123.023 122.434 17.493  1.00 37.24  ? 151 LEU D O  1 
ATOM 7781  N N  . ILE D 2 152 ? 124.195 120.538 17.748  1.00 39.21  ? 152 ILE D N  1 
ATOM 7782  C CA . ILE D 2 152 ? 125.078 120.844 16.631  1.00 39.21  ? 152 ILE D CA 1 
ATOM 7783  C C  . ILE D 2 152 ? 124.378 120.598 15.312  1.00 39.21  ? 152 ILE D C  1 
ATOM 7784  O O  . ILE D 2 152 ? 124.357 121.465 14.431  1.00 39.21  ? 152 ILE D O  1 
ATOM 7785  N N  . ALA D 2 153 ? 123.771 119.420 15.164  1.00 45.13  ? 153 ALA D N  1 
ATOM 7786  C CA . ALA D 2 153 ? 123.159 119.037 13.901  1.00 45.13  ? 153 ALA D CA 1 
ATOM 7787  C C  . ALA D 2 153 ? 121.920 119.856 13.565  1.00 45.13  ? 153 ALA D C  1 
ATOM 7788  O O  . ALA D 2 153 ? 121.462 119.806 12.419  1.00 45.13  ? 153 ALA D O  1 
ATOM 7789  N N  . SER D 2 154 ? 121.379 120.613 14.524  1.00 48.27  ? 154 SER D N  1 
ATOM 7790  C CA . SER D 2 154 ? 120.400 121.640 14.198  1.00 48.27  ? 154 SER D CA 1 
ATOM 7791  C C  . SER D 2 154 ? 121.005 122.757 13.371  1.00 48.27  ? 154 SER D C  1 
ATOM 7792  O O  . SER D 2 154 ? 120.271 123.461 12.672  1.00 48.27  ? 154 SER D O  1 
ATOM 7793  N N  . GLY D 2 155 ? 122.315 122.946 13.445  1.00 48.92  ? 155 GLY D N  1 
ATOM 7794  C CA . GLY D 2 155 ? 122.958 123.941 12.619  1.00 48.92  ? 155 GLY D CA 1 
ATOM 7795  C C  . GLY D 2 155 ? 122.772 125.355 13.109  1.00 48.92  ? 155 GLY D C  1 
ATOM 7796  O O  . GLY D 2 155 ? 122.381 126.228 12.328  1.00 48.92  ? 155 GLY D O  1 
ATOM 7797  N N  . GLN D 2 156 ? 123.026 125.609 14.392  1.00 58.64  ? 156 GLN D N  1 
ATOM 7798  C CA . GLN D 2 156 ? 123.013 126.974 14.888  1.00 58.64  ? 156 GLN D CA 1 
ATOM 7799  C C  . GLN D 2 156 ? 124.251 127.369 15.678  1.00 58.64  ? 156 GLN D C  1 
ATOM 7800  O O  . GLN D 2 156 ? 124.501 128.570 15.813  1.00 58.64  ? 156 GLN D O  1 
ATOM 7801  N N  . CYS D 2 157 ? 125.030 126.428 16.199  1.00 58.32  ? 157 CYS D N  1 
ATOM 7802  C CA . CYS D 2 157 ? 126.133 126.773 17.081  1.00 58.32  ? 157 CYS D CA 1 
ATOM 7803  C C  . CYS D 2 157 ? 127.411 126.106 16.598  1.00 58.32  ? 157 CYS D C  1 
ATOM 7804  O O  . CYS D 2 157 ? 127.493 125.593 15.479  1.00 58.32  ? 157 CYS D O  1 
ATOM 7805  N N  . ASP D 2 158 ? 128.434 126.159 17.446  1.00 55.15  ? 158 ASP D N  1 
ATOM 7806  C CA . ASP D 2 158 ? 129.781 125.840 17.002  1.00 55.15  ? 158 ASP D CA 1 
ATOM 7807  C C  . ASP D 2 158 ? 130.374 124.624 17.693  1.00 55.15  ? 158 ASP D C  1 
ATOM 7808  O O  . ASP D 2 158 ? 130.713 123.652 17.016  1.00 55.15  ? 158 ASP D O  1 
ATOM 7809  N N  . VAL D 2 159 ? 130.512 124.645 19.020  1.00 40.95  ? 159 VAL D N  1 
ATOM 7810  C CA . VAL D 2 159 ? 131.200 123.596 19.766  1.00 40.95  ? 159 VAL D CA 1 
ATOM 7811  C C  . VAL D 2 159 ? 130.529 123.405 21.115  1.00 40.95  ? 159 VAL D C  1 
ATOM 7812  O O  . VAL D 2 159 ? 129.908 124.313 21.659  1.00 40.95  ? 159 VAL D O  1 
ATOM 7813  N N  . ILE D 2 160 ? 130.678 122.207 21.660  1.00 30.26  ? 160 ILE D N  1 
ATOM 7814  C CA . ILE D 2 160 ? 129.965 121.766 22.849  1.00 30.26  ? 160 ILE D CA 1 
ATOM 7815  C C  . ILE D 2 160 ? 130.993 121.236 23.829  1.00 30.26  ? 160 ILE D C  1 
ATOM 7816  O O  . ILE D 2 160 ? 131.964 120.598 23.421  1.00 30.26  ? 160 ILE D O  1 
ATOM 7817  N N  . VAL D 2 161 ? 130.812 121.510 25.097  1.00 27.45  ? 161 VAL D N  1 
ATOM 7818  C CA . VAL D 2 161 ? 131.513 120.770 26.125  1.00 27.45  ? 161 VAL D CA 1 
ATOM 7819  C C  . VAL D 2 161 ? 130.498 119.916 26.854  1.00 27.45  ? 161 VAL D C  1 
ATOM 7820  O O  . VAL D 2 161 ? 129.444 120.408 27.253  1.00 27.45  ? 161 VAL D O  1 
ATOM 7821  N N  . ALA D 2 162 ? 130.788 118.640 27.004  1.00 17.99  ? 162 ALA D N  1 
ATOM 7822  C CA . ALA D 2 162 ? 129.892 117.745 27.707  1.00 17.99  ? 162 ALA D CA 1 
ATOM 7823  C C  . ALA D 2 162 ? 130.649 117.059 28.822  1.00 17.99  ? 162 ALA D C  1 
ATOM 7824  O O  . ALA D 2 162 ? 131.729 116.515 28.597  1.00 17.99  ? 162 ALA D O  1 
ATOM 7825  N N  . GLY D 2 163 ? 130.084 117.075 30.020  1.00 31.41  ? 163 GLY D N  1 
ATOM 7826  C CA . GLY D 2 163 ? 130.794 116.509 31.150  1.00 31.41  ? 163 GLY D CA 1 
ATOM 7827  C C  . GLY D 2 163 ? 129.842 116.035 32.221  1.00 31.41  ? 163 GLY D C  1 
ATOM 7828  O O  . GLY D 2 163 ? 128.670 116.405 32.254  1.00 31.41  ? 163 GLY D O  1 
ATOM 7829  N N  . GLY D 2 164 ? 130.378 115.219 33.120  1.00 27.73  ? 164 GLY D N  1 
ATOM 7830  C CA . GLY D 2 164 ? 129.585 114.633 34.183  1.00 27.73  ? 164 GLY D CA 1 
ATOM 7831  C C  . GLY D 2 164 ? 130.378 114.627 35.466  1.00 27.73  ? 164 GLY D C  1 
ATOM 7832  O O  . GLY D 2 164 ? 131.538 114.226 35.494  1.00 27.73  ? 164 GLY D O  1 
ATOM 7833  N N  . VAL D 2 165 ? 129.761 115.152 36.519  1.00 31.26  ? 165 VAL D N  1 
ATOM 7834  C CA . VAL D 2 165 ? 130.483 115.540 37.724  1.00 31.26  ? 165 VAL D CA 1 
ATOM 7835  C C  . VAL D 2 165 ? 129.699 115.135 38.950  1.00 31.26  ? 165 VAL D C  1 
ATOM 7836  O O  . VAL D 2 165 ? 128.610 115.672 39.160  1.00 31.26  ? 165 VAL D O  1 
ATOM 7837  N N  . GLU D 2 166 ? 130.226 114.248 39.799  1.00 37.90  ? 166 GLU D N  1 
ATOM 7838  C CA . GLU D 2 166 ? 129.543 114.062 41.075  1.00 37.90  ? 166 GLU D CA 1 
ATOM 7839  C C  . GLU D 2 166 ? 130.430 113.522 42.178  1.00 37.90  ? 166 GLU D C  1 
ATOM 7840  O O  . GLU D 2 166 ? 131.545 113.037 41.951  1.00 37.90  ? 166 GLU D O  1 
ATOM 7841  N N  . LEU D 2 167 ? 129.885 113.624 43.384  1.00 47.61  ? 167 LEU D N  1 
ATOM 7842  C CA . LEU D 2 167 ? 130.522 113.230 44.627  1.00 47.61  ? 167 LEU D CA 1 
ATOM 7843  C C  . LEU D 2 167 ? 129.457 112.551 45.462  1.00 47.61  ? 167 LEU D C  1 
ATOM 7844  O O  . LEU D 2 167 ? 128.549 113.218 45.963  1.00 47.61  ? 167 LEU D O  1 
ATOM 7845  N N  . MET D 2 168 ? 129.568 111.244 45.635  1.00 60.35  ? 168 MET D N  1 
ATOM 7846  C CA . MET D 2 168 ? 128.643 110.607 46.556  1.00 60.35  ? 168 MET D CA 1 
ATOM 7847  C C  . MET D 2 168 ? 129.160 110.595 47.980  1.00 60.35  ? 168 MET D C  1 
ATOM 7848  O O  . MET D 2 168 ? 128.570 109.920 48.826  1.00 60.35  ? 168 MET D O  1 
ATOM 7849  N N  . SER D 2 169 ? 130.238 111.326 48.258  1.00 66.96  ? 169 SER D N  1 
ATOM 7850  C CA . SER D 2 169 ? 130.739 111.456 49.616  1.00 66.96  ? 169 SER D CA 1 
ATOM 7851  C C  . SER D 2 169 ? 129.772 112.218 50.515  1.00 66.96  ? 169 SER D C  1 
ATOM 7852  O O  . SER D 2 169 ? 129.393 111.696 51.569  1.00 66.96  ? 169 SER D O  1 
ATOM 7853  N N  . ASP D 2 170 ? 129.365 113.430 50.142  1.00 78.94  ? 170 ASP D N  1 
ATOM 7854  C CA . ASP D 2 170 ? 128.333 114.143 50.895  1.00 78.94  ? 170 ASP D CA 1 
ATOM 7855  C C  . ASP D 2 170 ? 126.976 114.025 50.209  1.00 78.94  ? 170 ASP D C  1 
ATOM 7856  O O  . ASP D 2 170 ? 126.568 114.869 49.421  1.00 78.94  ? 170 ASP D O  1 
ATOM 7857  N N  . VAL D 2 171 ? 126.278 112.944 50.540  1.00 78.44  ? 171 VAL D N  1 
ATOM 7858  C CA . VAL D 2 171 ? 124.893 112.767 50.117  1.00 78.44  ? 171 VAL D CA 1 
ATOM 7859  C C  . VAL D 2 171 ? 124.021 113.765 50.865  1.00 78.44  ? 171 VAL D C  1 
ATOM 7860  O O  . VAL D 2 171 ? 124.317 114.110 52.016  1.00 78.44  ? 171 VAL D O  1 
ATOM 7861  N N  . PRO D 2 172 ? 122.974 114.275 50.245  1.00 80.67  ? 172 PRO D N  1 
ATOM 7862  C CA . PRO D 2 172 ? 122.109 115.242 50.923  1.00 80.67  ? 172 PRO D CA 1 
ATOM 7863  C C  . PRO D 2 172 ? 121.162 114.622 51.928  1.00 80.67  ? 172 PRO D C  1 
ATOM 7864  O O  . PRO D 2 172 ? 120.154 114.028 51.548  1.00 80.67  ? 172 PRO D O  1 
ATOM 7865  N N  . ILE D 2 173 ? 121.445 114.784 53.215  1.00 81.14  ? 173 ILE D N  1 
ATOM 7866  C CA . ILE D 2 173 ? 120.546 114.319 54.262  1.00 81.14  ? 173 ILE D CA 1 
ATOM 7867  C C  . ILE D 2 173 ? 119.722 115.522 54.708  1.00 81.14  ? 173 ILE D C  1 
ATOM 7868  O O  . ILE D 2 173 ? 120.198 116.397 55.431  1.00 81.14  ? 173 ILE D O  1 
ATOM 7869  N N  . ARG D 2 174 ? 118.485 115.575 54.242  1.00 79.09  ? 174 ARG D N  1 
ATOM 7870  C CA . ARG D 2 174 ? 117.639 116.731 54.468  1.00 79.09  ? 174 ARG D CA 1 
ATOM 7871  C C  . ARG D 2 174 ? 116.696 116.533 55.635  1.00 79.09  ? 174 ARG D C  1 
ATOM 7872  O O  . ARG D 2 174 ? 116.440 115.415 56.085  1.00 79.09  ? 174 ARG D O  1 
ATOM 7873  N N  . HIS D 2 175 ? 116.138 117.651 56.090  1.00 79.69  ? 175 HIS D N  1 
ATOM 7874  C CA . HIS D 2 175 ? 115.926 117.838 57.516  1.00 79.69  ? 175 HIS D CA 1 
ATOM 7875  C C  . HIS D 2 175 ? 114.665 117.129 57.989  1.00 79.69  ? 175 HIS D C  1 
ATOM 7876  O O  . HIS D 2 175 ? 114.739 116.209 58.804  1.00 79.69  ? 175 HIS D O  1 
ATOM 7877  N N  . SER D 2 176 ? 113.502 117.540 57.483  1.00 83.86  ? 176 SER D N  1 
ATOM 7878  C CA . SER D 2 176 ? 112.276 116.745 57.520  1.00 83.86  ? 176 SER D CA 1 
ATOM 7879  C C  . SER D 2 176 ? 111.274 117.408 56.595  1.00 83.86  ? 176 SER D C  1 
ATOM 7880  O O  . SER D 2 176 ? 111.483 118.525 56.126  1.00 83.86  ? 176 SER D O  1 
ATOM 7881  N N  . ARG D 2 177 ? 110.166 116.715 56.363  1.00 89.34  ? 177 ARG D N  1 
ATOM 7882  C CA . ARG D 2 177 ? 109.050 117.297 55.634  1.00 89.34  ? 177 ARG D CA 1 
ATOM 7883  C C  . ARG D 2 177 ? 108.368 118.418 56.406  1.00 89.34  ? 177 ARG D C  1 
ATOM 7884  O O  . ARG D 2 177 ? 107.896 119.380 55.790  1.00 89.34  ? 177 ARG D O  1 
ATOM 7885  N N  . LYS D 2 178 ? 108.353 118.355 57.733  1.00 91.99  ? 178 LYS D N  1 
ATOM 7886  C CA . LYS D 2 178 ? 107.522 119.259 58.516  1.00 91.99  ? 178 LYS D CA 1 
ATOM 7887  C C  . LYS D 2 178 ? 108.289 120.223 59.416  1.00 91.99  ? 178 LYS D C  1 
ATOM 7888  O O  . LYS D 2 178 ? 107.740 121.270 59.766  1.00 91.99  ? 178 LYS D O  1 
ATOM 7889  N N  . MET D 2 179 ? 109.533 119.915 59.810  1.00 98.63  ? 179 MET D N  1 
ATOM 7890  C CA . MET D 2 179 ? 110.355 120.926 60.481  1.00 98.63  ? 179 MET D CA 1 
ATOM 7891  C C  . MET D 2 179 ? 110.674 122.098 59.569  1.00 98.63  ? 179 MET D C  1 
ATOM 7892  O O  . MET D 2 179 ? 110.832 123.222 60.048  1.00 98.63  ? 179 MET D O  1 
ATOM 7893  N N  . ARG D 2 180 ? 110.733 121.870 58.261  1.00 88.82  ? 180 ARG D N  1 
ATOM 7894  C CA . ARG D 2 180 ? 111.029 122.956 57.339  1.00 88.82  ? 180 ARG D CA 1 
ATOM 7895  C C  . ARG D 2 180 ? 109.852 123.920 57.197  1.00 88.82  ? 180 ARG D C  1 
ATOM 7896  O O  . ARG D 2 180 ? 110.009 125.008 56.629  1.00 88.82  ? 180 ARG D O  1 
ATOM 7897  N N  . LYS D 2 181 ? 108.682 123.567 57.752  1.00 103.64 ? 181 LYS D N  1 
ATOM 7898  C CA . LYS D 2 181 ? 107.593 124.530 57.897  1.00 103.64 ? 181 LYS D CA 1 
ATOM 7899  C C  . LYS D 2 181 ? 107.944 125.651 58.873  1.00 103.64 ? 181 LYS D C  1 
ATOM 7900  O O  . LYS D 2 181 ? 107.323 126.725 58.833  1.00 103.64 ? 181 LYS D O  1 
ATOM 7901  N N  . LEU D 2 182 ? 108.993 125.469 59.691  1.00 104.86 ? 182 LEU D N  1 
ATOM 7902  C CA . LEU D 2 182 ? 109.532 126.577 60.472  1.00 104.86 ? 182 LEU D CA 1 
ATOM 7903  C C  . LEU D 2 182 ? 110.237 127.624 59.612  1.00 104.86 ? 182 LEU D C  1 
ATOM 7904  O O  . LEU D 2 182 ? 110.712 128.628 60.151  1.00 104.86 ? 182 LEU D O  1 
ATOM 7905  N N  . MET D 2 183 ? 110.285 127.429 58.286  1.00 113.68 ? 183 MET D N  1 
ATOM 7906  C CA . MET D 2 183 ? 110.579 128.511 57.351  1.00 113.68 ? 183 MET D CA 1 
ATOM 7907  C C  . MET D 2 183 ? 109.561 129.651 57.465  1.00 113.68 ? 183 MET D C  1 
ATOM 7908  O O  . MET D 2 183 ? 109.865 130.797 57.107  1.00 113.68 ? 183 MET D O  1 
ATOM 7909  N N  . LEU D 2 184 ? 108.359 129.372 57.989  1.00 108.17 ? 184 LEU D N  1 
ATOM 7910  C CA . LEU D 2 184 ? 107.411 130.429 58.334  1.00 108.17 ? 184 LEU D CA 1 
ATOM 7911  C C  . LEU D 2 184 ? 107.928 131.373 59.420  1.00 108.17 ? 184 LEU D C  1 
ATOM 7912  O O  . LEU D 2 184 ? 107.476 132.519 59.507  1.00 108.17 ? 184 LEU D O  1 
ATOM 7913  N N  . ASP D 2 185 ? 108.883 130.920 60.238  1.00 106.25 ? 185 ASP D N  1 
ATOM 7914  C CA . ASP D 2 185 ? 109.540 131.794 61.203  1.00 106.25 ? 185 ASP D CA 1 
ATOM 7915  C C  . ASP D 2 185 ? 110.359 132.894 60.552  1.00 106.25 ? 185 ASP D C  1 
ATOM 7916  O O  . ASP D 2 185 ? 110.529 133.956 61.156  1.00 106.25 ? 185 ASP D O  1 
ATOM 7917  N N  . LEU D 2 186 ? 110.880 132.666 59.354  1.00 98.01  ? 186 LEU D N  1 
ATOM 7918  C CA . LEU D 2 186 ? 111.814 133.597 58.744  1.00 98.01  ? 186 LEU D CA 1 
ATOM 7919  C C  . LEU D 2 186 ? 111.107 134.367 57.635  1.00 98.01  ? 186 LEU D C  1 
ATOM 7920  O O  . LEU D 2 186 ? 111.397 135.539 57.398  1.00 98.01  ? 186 LEU D O  1 
ATOM 7921  N N  . GLY D 2 193 ? 105.853 139.702 67.066  1.00 119.39 ? 193 GLY D N  1 
ATOM 7922  C CA . GLY D 2 193 ? 106.715 138.969 67.974  1.00 119.39 ? 193 GLY D CA 1 
ATOM 7923  C C  . GLY D 2 193 ? 105.999 137.818 68.648  1.00 119.39 ? 193 GLY D C  1 
ATOM 7924  O O  . GLY D 2 193 ? 106.623 136.956 69.261  1.00 119.39 ? 193 GLY D O  1 
ATOM 7925  N N  . GLN D 2 194 ? 104.670 137.821 68.539  1.00 125.13 ? 194 GLN D N  1 
ATOM 7926  C CA . GLN D 2 194 ? 103.879 136.732 69.098  1.00 125.13 ? 194 GLN D CA 1 
ATOM 7927  C C  . GLN D 2 194 ? 103.614 135.662 68.047  1.00 125.13 ? 194 GLN D C  1 
ATOM 7928  O O  . GLN D 2 194 ? 103.435 134.486 68.379  1.00 125.13 ? 194 GLN D O  1 
ATOM 7929  N N  . ARG D 2 195 ? 103.586 136.048 66.770  1.00 126.08 ? 195 ARG D N  1 
ATOM 7930  C CA . ARG D 2 195 ? 103.432 135.051 65.715  1.00 126.08 ? 195 ARG D CA 1 
ATOM 7931  C C  . ARG D 2 195 ? 104.682 134.187 65.589  1.00 126.08 ? 195 ARG D C  1 
ATOM 7932  O O  . ARG D 2 195 ? 104.586 132.982 65.309  1.00 126.08 ? 195 ARG D O  1 
ATOM 7933  N N  . LEU D 2 196 ? 105.856 134.775 65.863  1.00 127.02 ? 196 LEU D N  1 
ATOM 7934  C CA . LEU D 2 196 ? 107.095 134.006 65.973  1.00 127.02 ? 196 LEU D CA 1 
ATOM 7935  C C  . LEU D 2 196 ? 107.015 132.990 67.106  1.00 127.02 ? 196 LEU D C  1 
ATOM 7936  O O  . LEU D 2 196 ? 107.677 131.948 67.064  1.00 127.02 ? 196 LEU D O  1 
ATOM 7937  N N  . SER D 2 197 ? 106.212 133.279 68.129  1.00 121.32 ? 197 SER D N  1 
ATOM 7938  C CA . SER D 2 197 ? 105.993 132.300 69.181  1.00 121.32 ? 197 SER D CA 1 
ATOM 7939  C C  . SER D 2 197 ? 104.968 131.260 68.759  1.00 121.32 ? 197 SER D C  1 
ATOM 7940  O O  . SER D 2 197 ? 105.149 130.066 69.025  1.00 121.32 ? 197 SER D O  1 
ATOM 7941  N N  . LEU D 2 198 ? 103.890 131.684 68.092  1.00 117.86 ? 198 LEU D N  1 
ATOM 7942  C CA . LEU D 2 198 ? 102.772 130.769 67.892  1.00 117.86 ? 198 LEU D CA 1 
ATOM 7943  C C  . LEU D 2 198 ? 103.075 129.759 66.799  1.00 117.86 ? 198 LEU D C  1 
ATOM 7944  O O  . LEU D 2 198 ? 102.471 128.681 66.763  1.00 117.86 ? 198 LEU D O  1 
ATOM 7945  N N  . ILE D 2 199 ? 103.995 130.089 65.891  1.00 117.99 ? 199 ILE D N  1 
ATOM 7946  C CA . ILE D 2 199 ? 104.469 129.071 64.956  1.00 117.99 ? 199 ILE D CA 1 
ATOM 7947  C C  . ILE D 2 199 ? 105.299 128.032 65.702  1.00 117.99 ? 199 ILE D C  1 
ATOM 7948  O O  . ILE D 2 199 ? 105.232 126.832 65.411  1.00 117.99 ? 199 ILE D O  1 
ATOM 7949  N N  . SER D 2 200 ? 106.022 128.460 66.734  1.00 121.76 ? 200 SER D N  1 
ATOM 7950  C CA . SER D 2 200 ? 106.845 127.523 67.490  1.00 121.76 ? 200 SER D CA 1 
ATOM 7951  C C  . SER D 2 200 ? 106.037 126.785 68.551  1.00 121.76 ? 200 SER D C  1 
ATOM 7952  O O  . SER D 2 200 ? 106.573 125.907 69.239  1.00 121.76 ? 200 SER D O  1 
ATOM 7953  N N  . LYS D 2 201 ? 104.754 127.131 68.706  1.00 124.89 ? 201 LYS D N  1 
ATOM 7954  C CA . LYS D 2 201 ? 103.959 126.568 69.799  1.00 124.89 ? 201 LYS D CA 1 
ATOM 7955  C C  . LYS D 2 201 ? 103.638 125.097 69.580  1.00 124.89 ? 201 LYS D C  1 
ATOM 7956  O O  . LYS D 2 201 ? 103.576 124.325 70.543  1.00 124.89 ? 201 LYS D O  1 
ATOM 7957  N N  . PHE D 2 202 ? 103.405 124.685 68.337  1.00 131.22 ? 202 PHE D N  1 
ATOM 7958  C CA . PHE D 2 202 ? 103.057 123.289 68.074  1.00 131.22 ? 202 PHE D CA 1 
ATOM 7959  C C  . PHE D 2 202 ? 104.331 122.485 67.822  1.00 131.22 ? 202 PHE D C  1 
ATOM 7960  O O  . PHE D 2 202 ? 105.066 122.681 66.855  1.00 131.22 ? 202 PHE D O  1 
ATOM 7961  N N  . ARG D 2 203 ? 104.607 121.578 68.753  1.00 124.96 ? 203 ARG D N  1 
ATOM 7962  C CA . ARG D 2 203 ? 105.797 120.746 68.702  1.00 124.96 ? 203 ARG D CA 1 
ATOM 7963  C C  . ARG D 2 203 ? 105.652 119.499 69.555  1.00 124.96 ? 203 ARG D C  1 
ATOM 7964  O O  . ARG D 2 203 ? 105.219 119.559 70.709  1.00 124.96 ? 203 ARG D O  1 
ATOM 7965  N N  . PHE D 2 204 ? 105.975 118.366 68.945  1.00 120.84 ? 204 PHE D N  1 
ATOM 7966  C CA . PHE D 2 204 ? 106.351 117.157 69.651  1.00 120.84 ? 204 PHE D CA 1 
ATOM 7967  C C  . PHE D 2 204 ? 107.714 116.721 69.128  1.00 120.84 ? 204 PHE D C  1 
ATOM 7968  O O  . PHE D 2 204 ? 108.397 117.476 68.434  1.00 120.84 ? 204 PHE D O  1 
ATOM 7969  N N  . ASN D 2 205 ? 108.147 115.522 69.516  1.00 118.98 ? 205 ASN D N  1 
ATOM 7970  C CA . ASN D 2 205 ? 109.428 114.998 69.043  1.00 118.98 ? 205 ASN D CA 1 
ATOM 7971  C C  . ASN D 2 205 ? 109.228 114.295 67.700  1.00 118.98 ? 205 ASN D C  1 
ATOM 7972  O O  . ASN D 2 205 ? 108.949 113.098 67.616  1.00 118.98 ? 205 ASN D O  1 
ATOM 7973  N N  . PHE D 2 206 ? 109.378 115.078 66.631  1.00 105.74 ? 206 PHE D N  1 
ATOM 7974  C CA . PHE D 2 206 ? 109.270 114.579 65.263  1.00 105.74 ? 206 PHE D CA 1 
ATOM 7975  C C  . PHE D 2 206 ? 110.509 114.997 64.469  1.00 105.74 ? 206 PHE D C  1 
ATOM 7976  O O  . PHE D 2 206 ? 110.474 115.090 63.243  1.00 105.74 ? 206 PHE D O  1 
ATOM 7977  N N  . LEU D 2 207 ? 111.620 115.215 65.163  1.00 97.36  ? 207 LEU D N  1 
ATOM 7978  C CA . LEU D 2 207 ? 112.892 115.490 64.507  1.00 97.36  ? 207 LEU D CA 1 
ATOM 7979  C C  . LEU D 2 207 ? 113.457 114.173 64.001  1.00 97.36  ? 207 LEU D C  1 
ATOM 7980  O O  . LEU D 2 207 ? 113.773 113.282 64.800  1.00 97.36  ? 207 LEU D O  1 
ATOM 7981  N N  . ALA D 2 208 ? 113.574 114.049 62.684  1.00 100.55 ? 208 ALA D N  1 
ATOM 7982  C CA . ALA D 2 208 ? 114.161 112.876 62.053  1.00 100.55 ? 208 ALA D CA 1 
ATOM 7983  C C  . ALA D 2 208 ? 114.641 113.272 60.670  1.00 100.55 ? 208 ALA D C  1 
ATOM 7984  O O  . ALA D 2 208 ? 113.833 113.658 59.821  1.00 100.55 ? 208 ALA D O  1 
ATOM 7985  N N  . PRO D 2 209 ? 115.937 113.175 60.406  1.00 94.41  ? 209 PRO D N  1 
ATOM 7986  C CA . PRO D 2 209 ? 116.422 113.442 59.050  1.00 94.41  ? 209 PRO D CA 1 
ATOM 7987  C C  . PRO D 2 209 ? 116.098 112.314 58.086  1.00 94.41  ? 209 PRO D C  1 
ATOM 7988  O O  . PRO D 2 209 ? 116.580 111.191 58.251  1.00 94.41  ? 209 PRO D O  1 
ATOM 7989  N N  . GLU D 2 210 ? 115.271 112.595 57.082  1.00 94.02  ? 210 GLU D N  1 
ATOM 7990  C CA . GLU D 2 210 ? 114.918 111.561 56.123  1.00 94.02  ? 210 GLU D CA 1 
ATOM 7991  C C  . GLU D 2 210 ? 116.033 111.395 55.101  1.00 94.02  ? 210 GLU D C  1 
ATOM 7992  O O  . GLU D 2 210 ? 116.690 112.361 54.705  1.00 94.02  ? 210 GLU D O  1 
ATOM 7993  N N  . LEU D 2 211 ? 116.250 110.166 54.690  1.00 91.48  ? 211 LEU D N  1 
ATOM 7994  C CA . LEU D 2 211 ? 117.461 109.798 53.989  1.00 91.48  ? 211 LEU D CA 1 
ATOM 7995  C C  . LEU D 2 211 ? 117.214 109.617 52.502  1.00 91.48  ? 211 LEU D C  1 
ATOM 7996  O O  . LEU D 2 211 ? 116.156 109.120 52.104  1.00 91.48  ? 211 LEU D O  1 
ATOM 7997  N N  . PRO D 2 212 ? 118.167 109.996 51.661  1.00 89.61  ? 212 PRO D N  1 
ATOM 7998  C CA . PRO D 2 212 ? 118.038 109.752 50.214  1.00 89.61  ? 212 PRO D CA 1 
ATOM 7999  C C  . PRO D 2 212 ? 118.419 108.323 49.855  1.00 89.61  ? 212 PRO D C  1 
ATOM 8000  O O  . PRO D 2 212 ? 119.435 108.057 49.206  1.00 89.61  ? 212 PRO D O  1 
ATOM 8001  N N  . ALA D 2 213 ? 117.593 107.381 50.299  1.00 94.81  ? 213 ALA D N  1 
ATOM 8002  C CA . ALA D 2 213 ? 117.850 105.965 50.068  1.00 94.81  ? 213 ALA D CA 1 
ATOM 8003  C C  . ALA D 2 213 ? 117.678 105.675 48.587  1.00 94.81  ? 213 ALA D C  1 
ATOM 8004  O O  . ALA D 2 213 ? 116.573 105.795 48.050  1.00 94.81  ? 213 ALA D O  1 
ATOM 8005  N N  . VAL D 2 214 ? 118.775 105.318 47.925  1.00 86.49  ? 214 VAL D N  1 
ATOM 8006  C CA . VAL D 2 214 ? 118.753 105.163 46.477  1.00 86.49  ? 214 VAL D CA 1 
ATOM 8007  C C  . VAL D 2 214 ? 117.989 103.882 46.153  1.00 86.49  ? 214 VAL D C  1 
ATOM 8008  O O  . VAL D 2 214 ? 118.505 102.766 46.266  1.00 86.49  ? 214 VAL D O  1 
ATOM 8009  N N  . SER D 2 215 ? 116.722 104.054 45.785  1.00 73.37  ? 215 SER D N  1 
ATOM 8010  C CA . SER D 2 215 ? 115.792 102.946 45.660  1.00 73.37  ? 215 SER D CA 1 
ATOM 8011  C C  . SER D 2 215 ? 114.925 103.038 44.416  1.00 73.37  ? 215 SER D C  1 
ATOM 8012  O O  . SER D 2 215 ? 114.007 102.230 44.267  1.00 73.37  ? 215 SER D O  1 
ATOM 8013  N N  . GLU D 2 216 ? 115.143 104.039 43.552  1.00 66.16  ? 216 GLU D N  1 
ATOM 8014  C CA . GLU D 2 216 ? 114.478 104.326 42.269  1.00 66.16  ? 216 GLU D CA 1 
ATOM 8015  C C  . GLU D 2 216 ? 113.005 104.718 42.390  1.00 66.16  ? 216 GLU D C  1 
ATOM 8016  O O  . GLU D 2 216 ? 112.396 105.118 41.393  1.00 66.16  ? 216 GLU D O  1 
ATOM 8017  N N  . PHE D 2 217 ? 112.410 104.564 43.576  1.00 52.08  ? 217 PHE D N  1 
ATOM 8018  C CA . PHE D 2 217 ? 111.106 105.073 44.003  1.00 52.08  ? 217 PHE D CA 1 
ATOM 8019  C C  . PHE D 2 217 ? 109.904 104.544 43.221  1.00 52.08  ? 217 PHE D C  1 
ATOM 8020  O O  . PHE D 2 217 ? 108.776 104.600 43.715  1.00 52.08  ? 217 PHE D O  1 
ATOM 8021  N N  . SER D 2 218 ? 110.108 103.969 42.044  1.00 54.55  ? 218 SER D N  1 
ATOM 8022  C CA . SER D 2 218 ? 109.007 103.417 41.277  1.00 54.55  ? 218 SER D CA 1 
ATOM 8023  C C  . SER D 2 218 ? 108.622 102.033 41.757  1.00 54.55  ? 218 SER D C  1 
ATOM 8024  O O  . SER D 2 218 ? 107.525 101.559 41.456  1.00 54.55  ? 218 SER D O  1 
ATOM 8025  N N  . THR D 2 219 ? 109.515 101.391 42.498  1.00 58.70  ? 219 THR D N  1 
ATOM 8026  C CA . THR D 2 219 ? 109.302 100.062 43.032  1.00 58.70  ? 219 THR D CA 1 
ATOM 8027  C C  . THR D 2 219 ? 109.821 99.898  44.448  1.00 58.70  ? 219 THR D C  1 
ATOM 8028  O O  . THR D 2 219 ? 109.718 98.795  44.995  1.00 58.70  ? 219 THR D O  1 
ATOM 8029  N N  . SER D 2 220 ? 110.396 100.953 45.030  1.00 61.65  ? 220 SER D N  1 
ATOM 8030  C CA . SER D 2 220 ? 110.702 101.063 46.461  1.00 61.65  ? 220 SER D CA 1 
ATOM 8031  C C  . SER D 2 220 ? 111.655 99.975  46.947  1.00 61.65  ? 220 SER D C  1 
ATOM 8032  O O  . SER D 2 220 ? 111.465 99.402  48.021  1.00 61.65  ? 220 SER D O  1 
ATOM 8033  N N  . GLU D 2 221 ? 112.676 99.678  46.154  1.00 59.99  ? 221 GLU D N  1 
ATOM 8034  C CA . GLU D 2 221 ? 113.685 98.696  46.513  1.00 59.99  ? 221 GLU D CA 1 
ATOM 8035  C C  . GLU D 2 221 ? 115.001 99.045  45.834  1.00 59.99  ? 221 GLU D C  1 
ATOM 8036  O O  . GLU D 2 221 ? 115.013 99.598  44.735  1.00 59.99  ? 221 GLU D O  1 
ATOM 8037  N N  . THR D 2 222 ? 116.109 98.701  46.491  1.00 59.28  ? 222 THR D N  1 
ATOM 8038  C CA . THR D 2 222 ? 117.417 99.236  46.132  1.00 59.28  ? 222 THR D CA 1 
ATOM 8039  C C  . THR D 2 222 ? 117.924 98.637  44.824  1.00 59.28  ? 222 THR D C  1 
ATOM 8040  O O  . THR D 2 222 ? 117.248 97.860  44.149  1.00 59.28  ? 222 THR D O  1 
ATOM 8041  N N  . MET D 2 223 ? 119.150 99.009  44.478  1.00 52.14  ? 223 MET D N  1 
ATOM 8042  C CA . MET D 2 223 ? 119.745 98.562  43.230  1.00 52.14  ? 223 MET D CA 1 
ATOM 8043  C C  . MET D 2 223 ? 120.032 97.070  43.273  1.00 52.14  ? 223 MET D C  1 
ATOM 8044  O O  . MET D 2 223 ? 119.905 96.372  42.260  1.00 52.14  ? 223 MET D O  1 
ATOM 8045  N N  . GLY D 2 224 ? 120.351 96.560  44.458  1.00 54.40  ? 224 GLY D N  1 
ATOM 8046  C CA . GLY D 2 224 ? 120.904 95.225  44.551  1.00 54.40  ? 224 GLY D CA 1 
ATOM 8047  C C  . GLY D 2 224 ? 119.861 94.132  44.476  1.00 54.40  ? 224 GLY D C  1 
ATOM 8048  O O  . GLY D 2 224 ? 120.152 93.027  44.007  1.00 54.40  ? 224 GLY D O  1 
ATOM 8049  N N  . HIS D 2 225 ? 118.648 94.406  44.966  1.00 54.12  ? 225 HIS D N  1 
ATOM 8050  C CA . HIS D 2 225 ? 117.570 93.438  44.821  1.00 54.12  ? 225 HIS D CA 1 
ATOM 8051  C C  . HIS D 2 225 ? 117.278 93.164  43.356  1.00 54.12  ? 225 HIS D C  1 
ATOM 8052  O O  . HIS D 2 225 ? 117.236 92.007  42.934  1.00 54.12  ? 225 HIS D O  1 
ATOM 8053  N N  . SER D 2 226 ? 117.136 94.210  42.553  1.00 53.53  ? 226 SER D N  1 
ATOM 8054  C CA . SER D 2 226 ? 116.883 94.001  41.134  1.00 53.53  ? 226 SER D CA 1 
ATOM 8055  C C  . SER D 2 226 ? 118.112 93.427  40.448  1.00 53.53  ? 226 SER D C  1 
ATOM 8056  O O  . SER D 2 226 ? 117.990 92.637  39.498  1.00 53.53  ? 226 SER D O  1 
ATOM 8057  N N  . ALA D 2 227 ? 119.295 93.770  40.968  1.00 53.48  ? 227 ALA D N  1 
ATOM 8058  C CA . ALA D 2 227 ? 120.539 93.229  40.444  1.00 53.48  ? 227 ALA D CA 1 
ATOM 8059  C C  . ALA D 2 227 ? 120.587 91.716  40.567  1.00 53.48  ? 227 ALA D C  1 
ATOM 8060  O O  . ALA D 2 227 ? 120.733 91.019  39.558  1.00 53.48  ? 227 ALA D O  1 
ATOM 8061  N N  . ASP D 2 228 ? 120.410 91.173  41.769  1.00 57.28  ? 228 ASP D N  1 
ATOM 8062  C CA . ASP D 2 228 ? 120.562 89.729  41.881  1.00 57.28  ? 228 ASP D CA 1 
ATOM 8063  C C  . ASP D 2 228 ? 119.314 88.999  41.410  1.00 57.28  ? 228 ASP D C  1 
ATOM 8064  O O  . ASP D 2 228 ? 119.376 87.807  41.111  1.00 57.28  ? 228 ASP D O  1 
ATOM 8065  N N  . ARG D 2 229 ? 118.176 89.697  41.310  1.00 52.46  ? 229 ARG D N  1 
ATOM 8066  C CA . ARG D 2 229 ? 117.023 89.098  40.640  1.00 52.46  ? 229 ARG D CA 1 
ATOM 8067  C C  . ARG D 2 229 ? 117.329 88.798  39.186  1.00 52.46  ? 229 ARG D C  1 
ATOM 8068  O O  . ARG D 2 229 ? 117.188 87.657  38.736  1.00 52.46  ? 229 ARG D O  1 
ATOM 8069  N N  . LEU D 2 230 ? 117.756 89.817  38.436  1.00 57.07  ? 230 LEU D N  1 
ATOM 8070  C CA . LEU D 2 230 ? 118.088 89.597  37.038  1.00 57.07  ? 230 LEU D CA 1 
ATOM 8071  C C  . LEU D 2 230 ? 119.297 88.696  36.890  1.00 57.07  ? 230 LEU D C  1 
ATOM 8072  O O  . LEU D 2 230 ? 119.415 88.000  35.879  1.00 57.07  ? 230 LEU D O  1 
ATOM 8073  N N  . ALA D 2 231 ? 120.181 88.680  37.882  1.00 55.44  ? 231 ALA D N  1 
ATOM 8074  C CA . ALA D 2 231 ? 121.316 87.779  37.830  1.00 55.44  ? 231 ALA D CA 1 
ATOM 8075  C C  . ALA D 2 231 ? 120.884 86.334  37.990  1.00 55.44  ? 231 ALA D C  1 
ATOM 8076  O O  . ALA D 2 231 ? 121.268 85.479  37.188  1.00 55.44  ? 231 ALA D O  1 
ATOM 8077  N N  . ALA D 2 232 ? 120.082 86.040  39.003  1.00 55.91  ? 232 ALA D N  1 
ATOM 8078  C CA . ALA D 2 232 ? 119.665 84.671  39.219  1.00 55.91  ? 232 ALA D CA 1 
ATOM 8079  C C  . ALA D 2 232 ? 118.653 84.206  38.189  1.00 55.91  ? 232 ALA D C  1 
ATOM 8080  O O  . ALA D 2 232 ? 118.543 83.000  37.955  1.00 55.91  ? 232 ALA D O  1 
ATOM 8081  N N  . ALA D 2 233 ? 117.945 85.134  37.548  1.00 57.21  ? 233 ALA D N  1 
ATOM 8082  C CA . ALA D 2 233 ? 116.876 84.741  36.642  1.00 57.21  ? 233 ALA D CA 1 
ATOM 8083  C C  . ALA D 2 233 ? 117.411 84.157  35.348  1.00 57.21  ? 233 ALA D C  1 
ATOM 8084  O O  . ALA D 2 233 ? 116.703 83.406  34.675  1.00 57.21  ? 233 ALA D O  1 
ATOM 8085  N N  . PHE D 2 234 ? 118.644 84.483  34.980  1.00 61.55  ? 234 PHE D N  1 
ATOM 8086  C CA . PHE D 2 234 ? 119.219 83.960  33.753  1.00 61.55  ? 234 PHE D CA 1 
ATOM 8087  C C  . PHE D 2 234 ? 120.349 82.975  34.015  1.00 61.55  ? 234 PHE D C  1 
ATOM 8088  O O  . PHE D 2 234 ? 121.331 82.962  33.266  1.00 61.55  ? 234 PHE D O  1 
ATOM 8089  N N  . ALA D 2 235 ? 120.226 82.173  35.080  1.00 66.37  ? 235 ALA D N  1 
ATOM 8090  C CA . ALA D 2 235 ? 121.018 80.958  35.314  1.00 66.37  ? 235 ALA D CA 1 
ATOM 8091  C C  . ALA D 2 235 ? 122.512 81.253  35.423  1.00 66.37  ? 235 ALA D C  1 
ATOM 8092  O O  . ALA D 2 235 ? 123.337 80.713  34.689  1.00 66.37  ? 235 ALA D O  1 
ATOM 8093  N N  . VAL D 2 236 ? 122.844 82.131  36.352  1.00 67.40  ? 236 VAL D N  1 
ATOM 8094  C CA . VAL D 2 236 ? 124.217 82.559  36.558  1.00 67.40  ? 236 VAL D CA 1 
ATOM 8095  C C  . VAL D 2 236 ? 124.712 81.932  37.849  1.00 67.40  ? 236 VAL D C  1 
ATOM 8096  O O  . VAL D 2 236 ? 124.177 82.204  38.927  1.00 67.40  ? 236 VAL D O  1 
ATOM 8097  N N  . SER D 2 237 ? 125.722 81.078  37.751  1.00 70.28  ? 237 SER D N  1 
ATOM 8098  C CA . SER D 2 237 ? 126.287 80.515  38.962  1.00 70.28  ? 237 SER D CA 1 
ATOM 8099  C C  . SER D 2 237 ? 127.252 81.508  39.591  1.00 70.28  ? 237 SER D C  1 
ATOM 8100  O O  . SER D 2 237 ? 127.639 82.506  38.986  1.00 70.28  ? 237 SER D O  1 
ATOM 8101  N N  . ARG D 2 238 ? 127.646 81.210  40.825  1.00 66.62  ? 238 ARG D N  1 
ATOM 8102  C CA . ARG D 2 238 ? 128.586 82.065  41.537  1.00 66.62  ? 238 ARG D CA 1 
ATOM 8103  C C  . ARG D 2 238 ? 129.974 81.988  40.921  1.00 66.62  ? 238 ARG D C  1 
ATOM 8104  O O  . ARG D 2 238 ? 130.703 82.987  40.906  1.00 66.62  ? 238 ARG D O  1 
ATOM 8105  N N  . LEU D 2 239 ? 130.349 80.823  40.396  1.00 70.18  ? 239 LEU D N  1 
ATOM 8106  C CA . LEU D 2 239 ? 131.653 80.685  39.762  1.00 70.18  ? 239 LEU D CA 1 
ATOM 8107  C C  . LEU D 2 239 ? 131.689 81.396  38.422  1.00 70.18  ? 239 LEU D C  1 
ATOM 8108  O O  . LEU D 2 239 ? 132.685 82.044  38.084  1.00 70.18  ? 239 LEU D O  1 
ATOM 8109  N N  . GLU D 2 240 ? 130.614 81.287  37.644  1.00 79.03  ? 240 GLU D N  1 
ATOM 8110  C CA . GLU D 2 240 ? 130.561 81.969  36.361  1.00 79.03  ? 240 GLU D CA 1 
ATOM 8111  C C  . GLU D 2 240 ? 130.436 83.476  36.519  1.00 79.03  ? 240 GLU D C  1 
ATOM 8112  O O  . GLU D 2 240 ? 130.831 84.216  35.616  1.00 79.03  ? 240 GLU D O  1 
ATOM 8113  N N  . GLN D 2 241 ? 129.914 83.945  37.644  1.00 71.89  ? 241 GLN D N  1 
ATOM 8114  C CA . GLN D 2 241 ? 129.720 85.367  37.870  1.00 71.89  ? 241 GLN D CA 1 
ATOM 8115  C C  . GLN D 2 241 ? 131.010 86.060  38.276  1.00 71.89  ? 241 GLN D C  1 
ATOM 8116  O O  . GLN D 2 241 ? 131.072 87.291  38.283  1.00 71.89  ? 241 GLN D O  1 
ATOM 8117  N N  . ASP D 2 242 ? 132.064 85.314  38.567  1.00 73.69  ? 242 ASP D N  1 
ATOM 8118  C CA . ASP D 2 242 ? 133.266 85.934  39.076  1.00 73.69  ? 242 ASP D CA 1 
ATOM 8119  C C  . ASP D 2 242 ? 134.499 85.702  38.229  1.00 73.69  ? 242 ASP D C  1 
ATOM 8120  O O  . ASP D 2 242 ? 135.536 86.317  38.505  1.00 73.69  ? 242 ASP D O  1 
ATOM 8121  N N  . GLU D 2 243 ? 134.415 84.854  37.203  1.00 71.16  ? 243 GLU D N  1 
ATOM 8122  C CA . GLU D 2 243 ? 135.378 84.903  36.111  1.00 71.16  ? 243 GLU D CA 1 
ATOM 8123  C C  . GLU D 2 243 ? 135.462 86.308  35.535  1.00 71.16  ? 243 GLU D C  1 
ATOM 8124  O O  . GLU D 2 243 ? 136.558 86.837  35.302  1.00 71.16  ? 243 GLU D O  1 
ATOM 8125  N N  . TYR D 2 244 ? 134.307 86.945  35.349  1.00 67.75  ? 244 TYR D N  1 
ATOM 8126  C CA . TYR D 2 244 ? 134.293 88.305  34.843  1.00 67.75  ? 244 TYR D CA 1 
ATOM 8127  C C  . TYR D 2 244 ? 134.840 89.284  35.867  1.00 67.75  ? 244 TYR D C  1 
ATOM 8128  O O  . TYR D 2 244 ? 135.459 90.285  35.489  1.00 67.75  ? 244 TYR D O  1 
ATOM 8129  N N  . ALA D 2 245 ? 134.633 89.016  37.153  1.00 65.79  ? 245 ALA D N  1 
ATOM 8130  C CA . ALA D 2 245 ? 135.199 89.879  38.181  1.00 65.79  ? 245 ALA D CA 1 
ATOM 8131  C C  . ALA D 2 245 ? 136.714 89.786  38.198  1.00 65.79  ? 245 ALA D C  1 
ATOM 8132  O O  . ALA D 2 245 ? 137.402 90.779  38.455  1.00 65.79  ? 245 ALA D O  1 
ATOM 8133  N N  . LEU D 2 246 ? 137.241 88.599  37.920  1.00 60.71  ? 246 LEU D N  1 
ATOM 8134  C CA . LEU D 2 246 ? 138.681 88.424  37.807  1.00 60.71  ? 246 LEU D CA 1 
ATOM 8135  C C  . LEU D 2 246 ? 139.225 89.167  36.597  1.00 60.71  ? 246 LEU D C  1 
ATOM 8136  O O  . LEU D 2 246 ? 140.282 89.802  36.681  1.00 60.71  ? 246 LEU D O  1 
ATOM 8137  N N  . ARG D 2 247 ? 138.511 89.093  35.471  1.00 60.01  ? 247 ARG D N  1 
ATOM 8138  C CA . ARG D 2 247 ? 138.929 89.805  34.265  1.00 60.01  ? 247 ARG D CA 1 
ATOM 8139  C C  . ARG D 2 247 ? 138.949 91.310  34.474  1.00 60.01  ? 247 ARG D C  1 
ATOM 8140  O O  . ARG D 2 247 ? 139.923 91.984  34.116  1.00 60.01  ? 247 ARG D O  1 
ATOM 8141  N N  . SER D 2 248 ? 137.899 91.852  35.088  1.00 62.43  ? 248 SER D N  1 
ATOM 8142  C CA . SER D 2 248 ? 137.748 93.298  35.183  1.00 62.43  ? 248 SER D CA 1 
ATOM 8143  C C  . SER D 2 248 ? 138.678 93.940  36.199  1.00 62.43  ? 248 SER D C  1 
ATOM 8144  O O  . SER D 2 248 ? 138.570 95.146  36.425  1.00 62.43  ? 248 SER D O  1 
ATOM 8145  N N  . HIS D 2 249 ? 139.558 93.181  36.836  1.00 58.58  ? 249 HIS D N  1 
ATOM 8146  C CA . HIS D 2 249 ? 140.706 93.752  37.509  1.00 58.58  ? 249 HIS D CA 1 
ATOM 8147  C C  . HIS D 2 249 ? 142.016 93.321  36.887  1.00 58.58  ? 249 HIS D C  1 
ATOM 8148  O O  . HIS D 2 249 ? 142.971 94.110  36.873  1.00 58.58  ? 249 HIS D O  1 
ATOM 8149  N N  . SER D 2 250 ? 142.080 92.082  36.384  1.00 57.72  ? 250 SER D N  1 
ATOM 8150  C CA . SER D 2 250 ? 143.308 91.559  35.808  1.00 57.72  ? 250 SER D CA 1 
ATOM 8151  C C  . SER D 2 250 ? 143.712 92.333  34.574  1.00 57.72  ? 250 SER D C  1 
ATOM 8152  O O  . SER D 2 250 ? 144.905 92.517  34.319  1.00 57.72  ? 250 SER D O  1 
ATOM 8153  N N  . LEU D 2 251 ? 142.742 92.816  33.816  1.00 55.50  ? 251 LEU D N  1 
ATOM 8154  C CA . LEU D 2 251 ? 143.103 93.672  32.703  1.00 55.50  ? 251 LEU D CA 1 
ATOM 8155  C C  . LEU D 2 251 ? 143.429 95.074  33.175  1.00 55.50  ? 251 LEU D C  1 
ATOM 8156  O O  . LEU D 2 251 ? 144.276 95.740  32.574  1.00 55.50  ? 251 LEU D O  1 
ATOM 8157  N N  . ALA D 2 252 ? 142.793 95.517  34.259  1.00 59.99  ? 252 ALA D N  1 
ATOM 8158  C CA . ALA D 2 252 ? 142.910 96.908  34.677  1.00 59.99  ? 252 ALA D CA 1 
ATOM 8159  C C  . ALA D 2 252 ? 144.289 97.210  35.227  1.00 59.99  ? 252 ALA D C  1 
ATOM 8160  O O  . ALA D 2 252 ? 144.845 98.287  34.970  1.00 59.99  ? 252 ALA D O  1 
ATOM 8161  N N  . LYS D 2 253 ? 144.848 96.273  35.989  1.00 64.70  ? 253 LYS D N  1 
ATOM 8162  C CA . LYS D 2 253 ? 146.178 96.500  36.545  1.00 64.70  ? 253 LYS D CA 1 
ATOM 8163  C C  . LYS D 2 253 ? 147.228 96.517  35.446  1.00 64.70  ? 253 LYS D C  1 
ATOM 8164  O O  . LYS D 2 253 ? 148.160 97.322  35.490  1.00 64.70  ? 253 LYS D O  1 
ATOM 8165  N N  . LYS D 2 254 ? 147.057 95.680  34.422  1.00 63.20  ? 254 LYS D N  1 
ATOM 8166  C CA . LYS D 2 254 ? 147.959 95.723  33.278  1.00 63.20  ? 254 LYS D CA 1 
ATOM 8167  C C  . LYS D 2 254 ? 147.777 97.008  32.482  1.00 63.20  ? 254 LYS D C  1 
ATOM 8168  O O  . LYS D 2 254 ? 148.750 97.542  31.933  1.00 63.20  ? 254 LYS D O  1 
ATOM 8169  N N  . ALA D 2 255 ? 146.550 97.526  32.442  1.00 58.55  ? 255 ALA D N  1 
ATOM 8170  C CA . ALA D 2 255 ? 146.284 98.768  31.729  1.00 58.55  ? 255 ALA D CA 1 
ATOM 8171  C C  . ALA D 2 255 ? 146.955 99.948  32.405  1.00 58.55  ? 255 ALA D C  1 
ATOM 8172  O O  . ALA D 2 255 ? 147.518 100.818 31.734  1.00 58.55  ? 255 ALA D O  1 
ATOM 8173  N N  . GLN D 2 256 ? 146.912 99.997  33.731  1.00 62.65  ? 256 GLN D N  1 
ATOM 8174  C CA . GLN D 2 256 ? 147.677 101.026 34.417  1.00 62.65  ? 256 GLN D CA 1 
ATOM 8175  C C  . GLN D 2 256 ? 149.164 100.737 34.412  1.00 62.65  ? 256 GLN D C  1 
ATOM 8176  O O  . GLN D 2 256 ? 149.958 101.669 34.567  1.00 62.65  ? 256 GLN D O  1 
ATOM 8177  N N  . ASP D 2 257 ? 149.558 99.473  34.241  1.00 80.12  ? 257 ASP D N  1 
ATOM 8178  C CA . ASP D 2 257 ? 150.976 99.133  34.216  1.00 80.12  ? 257 ASP D CA 1 
ATOM 8179  C C  . ASP D 2 257 ? 151.637 99.643  32.946  1.00 80.12  ? 257 ASP D C  1 
ATOM 8180  O O  . ASP D 2 257 ? 152.724 100.231 33.001  1.00 80.12  ? 257 ASP D O  1 
ATOM 8181  N N  . GLU D 2 258 ? 151.006 99.427  31.793  1.00 76.07  ? 258 GLU D N  1 
ATOM 8182  C CA . GLU D 2 258 ? 151.589 99.967  30.577  1.00 76.07  ? 258 GLU D CA 1 
ATOM 8183  C C  . GLU D 2 258 ? 151.404 101.475 30.503  1.00 76.07  ? 258 GLU D C  1 
ATOM 8184  O O  . GLU D 2 258 ? 152.213 102.162 29.874  1.00 76.07  ? 258 GLU D O  1 
ATOM 8185  N N  . GLY D 2 259 ? 150.393 102.011 31.177  1.00 74.09  ? 259 GLY D N  1 
ATOM 8186  C CA . GLY D 2 259 ? 150.305 103.447 31.352  1.00 74.09  ? 259 GLY D CA 1 
ATOM 8187  C C  . GLY D 2 259 ? 149.878 104.214 30.125  1.00 74.09  ? 259 GLY D C  1 
ATOM 8188  O O  . GLY D 2 259 ? 150.187 105.401 30.005  1.00 74.09  ? 259 GLY D O  1 
ATOM 8189  N N  . LEU D 2 260 ? 149.171 103.569 29.208  1.00 62.31  ? 260 LEU D N  1 
ATOM 8190  C CA . LEU D 2 260 ? 148.650 104.273 28.050  1.00 62.31  ? 260 LEU D CA 1 
ATOM 8191  C C  . LEU D 2 260 ? 147.188 104.641 28.191  1.00 62.31  ? 260 LEU D C  1 
ATOM 8192  O O  . LEU D 2 260 ? 146.621 105.230 27.267  1.00 62.31  ? 260 LEU D O  1 
ATOM 8193  N N  . LEU D 2 261 ? 146.553 104.310 29.310  1.00 49.82  ? 261 LEU D N  1 
ATOM 8194  C CA . LEU D 2 261 ? 145.250 104.895 29.574  1.00 49.82  ? 261 LEU D CA 1 
ATOM 8195  C C  . LEU D 2 261 ? 145.481 106.345 29.964  1.00 49.82  ? 261 LEU D C  1 
ATOM 8196  O O  . LEU D 2 261 ? 145.597 106.671 31.148  1.00 49.82  ? 261 LEU D O  1 
ATOM 8197  N N  . SER D 2 262 ? 145.572 107.217 28.969  1.00 52.21  ? 262 SER D N  1 
ATOM 8198  C CA . SER D 2 262 ? 146.101 108.559 29.141  1.00 52.21  ? 262 SER D CA 1 
ATOM 8199  C C  . SER D 2 262 ? 145.017 109.579 28.900  1.00 52.21  ? 262 SER D C  1 
ATOM 8200  O O  . SER D 2 262 ? 145.197 110.576 28.201  1.00 52.21  ? 262 SER D O  1 
ATOM 8201  N N  . ASP D 2 263 ? 143.860 109.328 29.474  1.00 43.76  ? 263 ASP D N  1 
ATOM 8202  C CA . ASP D 2 263 ? 142.764 110.273 29.464  1.00 43.76  ? 263 ASP D CA 1 
ATOM 8203  C C  . ASP D 2 263 ? 142.619 110.900 30.835  1.00 43.76  ? 263 ASP D C  1 
ATOM 8204  O O  . ASP D 2 263 ? 141.528 111.268 31.260  1.00 43.76  ? 263 ASP D O  1 
ATOM 8205  N N  . VAL D 2 264 ? 143.731 111.019 31.548  1.00 37.45  ? 264 VAL D N  1 
ATOM 8206  C CA . VAL D 2 264 ? 143.721 111.403 32.948  1.00 37.45  ? 264 VAL D CA 1 
ATOM 8207  C C  . VAL D 2 264 ? 144.561 112.649 33.126  1.00 37.45  ? 264 VAL D C  1 
ATOM 8208  O O  . VAL D 2 264 ? 145.748 112.655 32.791  1.00 37.45  ? 264 VAL D O  1 
ATOM 8209  N N  . VAL D 2 265 ? 143.951 113.700 33.654  1.00 38.76  ? 265 VAL D N  1 
ATOM 8210  C CA . VAL D 2 265 ? 144.703 114.835 34.165  1.00 38.76  ? 265 VAL D CA 1 
ATOM 8211  C C  . VAL D 2 265 ? 144.850 114.612 35.666  1.00 38.76  ? 265 VAL D C  1 
ATOM 8212  O O  . VAL D 2 265 ? 144.016 113.925 36.267  1.00 38.76  ? 265 VAL D O  1 
ATOM 8213  N N  . PRO D 2 266 ? 145.935 115.039 36.284  1.00 45.58  ? 266 PRO D N  1 
ATOM 8214  C CA . PRO D 2 266 ? 145.918 115.187 37.733  1.00 45.58  ? 266 PRO D CA 1 
ATOM 8215  C C  . PRO D 2 266 ? 145.567 116.612 38.103  1.00 45.58  ? 266 PRO D C  1 
ATOM 8216  O O  . PRO D 2 266 ? 145.730 117.546 37.319  1.00 45.58  ? 266 PRO D O  1 
ATOM 8217  N N  . PHE D 2 267 ? 145.052 116.768 39.312  1.00 55.01  ? 267 PHE D N  1 
ATOM 8218  C CA . PHE D 2 267 ? 144.977 118.075 39.939  1.00 55.01  ? 267 PHE D CA 1 
ATOM 8219  C C  . PHE D 2 267 ? 145.249 117.853 41.413  1.00 55.01  ? 267 PHE D C  1 
ATOM 8220  O O  . PHE D 2 267 ? 145.226 116.714 41.877  1.00 55.01  ? 267 PHE D O  1 
ATOM 8221  N N  . LYS D 2 268 ? 145.496 118.929 42.150  1.00 66.09  ? 268 LYS D N  1 
ATOM 8222  C CA . LYS D 2 268 ? 145.741 118.776 43.574  1.00 66.09  ? 268 LYS D CA 1 
ATOM 8223  C C  . LYS D 2 268 ? 144.454 119.034 44.344  1.00 66.09  ? 268 LYS D C  1 
ATOM 8224  O O  . LYS D 2 268 ? 143.744 120.010 44.092  1.00 66.09  ? 268 LYS D O  1 
ATOM 8225  N N  . VAL D 2 269 ? 144.149 118.144 45.276  1.00 74.91  ? 269 VAL D N  1 
ATOM 8226  C CA . VAL D 2 269 ? 143.076 118.375 46.233  1.00 74.91  ? 269 VAL D CA 1 
ATOM 8227  C C  . VAL D 2 269 ? 143.569 119.443 47.199  1.00 74.91  ? 269 VAL D C  1 
ATOM 8228  O O  . VAL D 2 269 ? 144.677 119.328 47.732  1.00 74.91  ? 269 VAL D O  1 
ATOM 8229  N N  . PRO D 2 270 ? 142.809 120.517 47.407  1.00 77.44  ? 270 PRO D N  1 
ATOM 8230  C CA . PRO D 2 270 ? 143.349 121.659 48.164  1.00 77.44  ? 270 PRO D CA 1 
ATOM 8231  C C  . PRO D 2 270 ? 143.560 121.382 49.641  1.00 77.44  ? 270 PRO D C  1 
ATOM 8232  O O  . PRO D 2 270 ? 144.431 121.993 50.270  1.00 77.44  ? 270 PRO D O  1 
ATOM 8233  N N  . GLY D 2 271 ? 142.813 120.449 50.207  1.00 87.60  ? 271 GLY D N  1 
ATOM 8234  C CA . GLY D 2 271 ? 142.973 120.189 51.619  1.00 87.60  ? 271 GLY D CA 1 
ATOM 8235  C C  . GLY D 2 271 ? 144.043 119.163 51.917  1.00 87.60  ? 271 GLY D C  1 
ATOM 8236  O O  . GLY D 2 271 ? 144.843 119.353 52.835  1.00 87.60  ? 271 GLY D O  1 
ATOM 8237  N N  . LYS D 2 272 ? 144.095 118.091 51.135  1.00 86.83  ? 272 LYS D N  1 
ATOM 8238  C CA . LYS D 2 272 ? 145.032 117.016 51.429  1.00 86.83  ? 272 LYS D CA 1 
ATOM 8239  C C  . LYS D 2 272 ? 146.207 117.064 50.473  1.00 86.83  ? 272 LYS D C  1 
ATOM 8240  O O  . LYS D 2 272 ? 146.267 117.934 49.602  1.00 86.83  ? 272 LYS D O  1 
ATOM 8241  N N  . ASP D 2 273 ? 147.147 116.141 50.663  1.00 104.41 ? 273 ASP D N  1 
ATOM 8242  C CA . ASP D 2 273 ? 148.541 116.430 50.359  1.00 104.41 ? 273 ASP D CA 1 
ATOM 8243  C C  . ASP D 2 273 ? 148.896 116.660 48.895  1.00 104.41 ? 273 ASP D C  1 
ATOM 8244  O O  . ASP D 2 273 ? 149.103 117.813 48.505  1.00 104.41 ? 273 ASP D O  1 
ATOM 8245  N N  . THR D 2 274 ? 148.923 115.626 48.057  1.00 87.23  ? 274 THR D N  1 
ATOM 8246  C CA . THR D 2 274 ? 149.735 115.857 46.869  1.00 87.23  ? 274 THR D CA 1 
ATOM 8247  C C  . THR D 2 274 ? 148.996 115.876 45.542  1.00 87.23  ? 274 THR D C  1 
ATOM 8248  O O  . THR D 2 274 ? 148.835 116.932 44.926  1.00 87.23  ? 274 THR D O  1 
ATOM 8249  N N  . VAL D 2 275 ? 148.530 114.716 45.106  1.00 71.21  ? 275 VAL D N  1 
ATOM 8250  C CA . VAL D 2 275 ? 148.003 114.521 43.762  1.00 71.21  ? 275 VAL D CA 1 
ATOM 8251  C C  . VAL D 2 275 ? 146.964 113.431 43.845  1.00 71.21  ? 275 VAL D C  1 
ATOM 8252  O O  . VAL D 2 275 ? 146.639 112.951 44.933  1.00 71.21  ? 275 VAL D O  1 
ATOM 8253  N N  . THR D 2 276 ? 146.429 113.042 42.697  1.00 62.04  ? 276 THR D N  1 
ATOM 8254  C CA . THR D 2 276 ? 145.579 111.867 42.624  1.00 62.04  ? 276 THR D CA 1 
ATOM 8255  C C  . THR D 2 276 ? 145.923 110.953 41.449  1.00 62.04  ? 276 THR D C  1 
ATOM 8256  O O  . THR D 2 276 ? 146.466 111.392 40.431  1.00 62.04  ? 276 THR D O  1 
ATOM 8257  N N  . LYS D 2 277 ? 145.622 109.668 41.617  1.00 56.22  ? 277 LYS D N  1 
ATOM 8258  C CA . LYS D 2 277 ? 145.608 108.672 40.555  1.00 56.22  ? 277 LYS D CA 1 
ATOM 8259  C C  . LYS D 2 277 ? 144.726 107.542 41.069  1.00 56.22  ? 277 LYS D C  1 
ATOM 8260  O O  . LYS D 2 277 ? 144.629 107.332 42.279  1.00 56.22  ? 277 LYS D O  1 
ATOM 8261  N N  . ASP D 2 278 ? 144.087 106.832 40.133  1.00 54.46  ? 278 ASP D N  1 
ATOM 8262  C CA . ASP D 2 278 ? 142.951 105.942 40.377  1.00 54.46  ? 278 ASP D CA 1 
ATOM 8263  C C  . ASP D 2 278 ? 143.244 104.877 41.428  1.00 54.46  ? 278 ASP D C  1 
ATOM 8264  O O  . ASP D 2 278 ? 144.375 104.425 41.593  1.00 54.46  ? 278 ASP D O  1 
ATOM 8265  N N  . ASN D 2 279 ? 142.201 104.482 42.153  1.00 52.21  ? 279 ASN D N  1 
ATOM 8266  C CA . ASN D 2 279 ? 142.433 103.799 43.416  1.00 52.21  ? 279 ASN D CA 1 
ATOM 8267  C C  . ASN D 2 279 ? 141.686 102.481 43.509  1.00 52.21  ? 279 ASN D C  1 
ATOM 8268  O O  . ASN D 2 279 ? 142.061 101.600 44.284  1.00 52.21  ? 279 ASN D O  1 
ATOM 8269  N N  . GLY D 2 280 ? 140.636 102.327 42.719  1.00 55.82  ? 280 GLY D N  1 
ATOM 8270  C CA . GLY D 2 280 ? 139.775 101.169 42.858  1.00 55.82  ? 280 GLY D CA 1 
ATOM 8271  C C  . GLY D 2 280 ? 140.307 99.872  42.288  1.00 55.82  ? 280 GLY D C  1 
ATOM 8272  O O  . GLY D 2 280 ? 139.535 98.918  42.159  1.00 55.82  ? 280 GLY D O  1 
ATOM 8273  N N  . ILE D 2 281 ? 141.582 99.799  41.937  1.00 59.65  ? 281 ILE D N  1 
ATOM 8274  C CA . ILE D 2 281 ? 142.117 98.629  41.257  1.00 59.65  ? 281 ILE D CA 1 
ATOM 8275  C C  . ILE D 2 281 ? 142.798 97.717  42.266  1.00 59.65  ? 281 ILE D C  1 
ATOM 8276  O O  . ILE D 2 281 ? 143.814 98.083  42.864  1.00 59.65  ? 281 ILE D O  1 
ATOM 8277  N N  . ARG D 2 282 ? 142.240 96.521  42.457  1.00 72.55  ? 282 ARG D N  1 
ATOM 8278  C CA . ARG D 2 282 ? 142.913 95.520  43.240  1.00 72.55  ? 282 ARG D CA 1 
ATOM 8279  C C  . ARG D 2 282 ? 142.644 94.140  42.653  1.00 72.55  ? 282 ARG D C  1 
ATOM 8280  O O  . ARG D 2 282 ? 141.481 93.802  42.384  1.00 72.55  ? 282 ARG D O  1 
ATOM 8281  N N  . PRO D 2 283 ? 143.684 93.372  42.355  1.00 78.90  ? 283 PRO D N  1 
ATOM 8282  C CA . PRO D 2 283 ? 143.490 91.994  41.901  1.00 78.90  ? 283 PRO D CA 1 
ATOM 8283  C C  . PRO D 2 283 ? 143.564 90.999  43.046  1.00 78.90  ? 283 PRO D C  1 
ATOM 8284  O O  . PRO D 2 283 ? 144.246 91.206  44.050  1.00 78.90  ? 283 PRO D O  1 
ATOM 8285  N N  . SER D 2 284 ? 142.841 89.895  42.879  1.00 87.10  ? 284 SER D N  1 
ATOM 8286  C CA . SER D 2 284 ? 142.845 88.821  43.861  1.00 87.10  ? 284 SER D CA 1 
ATOM 8287  C C  . SER D 2 284 ? 142.592 87.503  43.141  1.00 87.10  ? 284 SER D C  1 
ATOM 8288  O O  . SER D 2 284 ? 142.461 87.459  41.915  1.00 87.10  ? 284 SER D O  1 
ATOM 8289  N N  . SER D 2 285 ? 142.517 86.426  43.914  1.00 92.20  ? 285 SER D N  1 
ATOM 8290  C CA . SER D 2 285 ? 142.235 85.107  43.373  1.00 92.20  ? 285 SER D CA 1 
ATOM 8291  C C  . SER D 2 285 ? 140.775 84.751  43.602  1.00 92.20  ? 285 SER D C  1 
ATOM 8292  O O  . SER D 2 285 ? 140.069 85.384  44.387  1.00 92.20  ? 285 SER D O  1 
ATOM 8293  N N  . LEU D 2 286 ? 140.337 83.698  42.913  1.00 87.61  ? 286 LEU D N  1 
ATOM 8294  C CA . LEU D 2 286 ? 138.935 83.305  42.970  1.00 87.61  ? 286 LEU D CA 1 
ATOM 8295  C C  . LEU D 2 286 ? 138.586 82.718  44.326  1.00 87.61  ? 286 LEU D C  1 
ATOM 8296  O O  . LEU D 2 286 ? 137.471 82.908  44.825  1.00 87.61  ? 286 LEU D O  1 
ATOM 8297  N N  . GLU D 2 287 ? 139.533 82.015  44.943  1.00 96.69  ? 287 GLU D N  1 
ATOM 8298  C CA . GLU D 2 287 ? 139.294 81.457  46.262  1.00 96.69  ? 287 GLU D CA 1 
ATOM 8299  C C  . GLU D 2 287 ? 139.234 82.534  47.327  1.00 96.69  ? 287 GLU D C  1 
ATOM 8300  O O  . GLU D 2 287 ? 138.602 82.329  48.366  1.00 96.69  ? 287 GLU D O  1 
ATOM 8301  N N  . GLN D 2 288 ? 139.861 83.679  47.092  1.00 104.37 ? 288 GLN D N  1 
ATOM 8302  C CA . GLN D 2 288 ? 139.798 84.778  48.032  1.00 104.37 ? 288 GLN D CA 1 
ATOM 8303  C C  . GLN D 2 288 ? 138.637 85.713  47.746  1.00 104.37 ? 288 GLN D C  1 
ATOM 8304  O O  . GLN D 2 288 ? 138.615 86.838  48.253  1.00 104.37 ? 288 GLN D O  1 
ATOM 8305  N N  . MET D 2 289 ? 137.675 85.273  46.951  1.00 88.58  ? 289 MET D N  1 
ATOM 8306  C CA . MET D 2 289 ? 136.488 86.063  46.696  1.00 88.58  ? 289 MET D CA 1 
ATOM 8307  C C  . MET D 2 289 ? 135.209 85.415  47.177  1.00 88.58  ? 289 MET D C  1 
ATOM 8308  O O  . MET D 2 289 ? 134.331 86.123  47.670  1.00 88.58  ? 289 MET D O  1 
ATOM 8309  N N  . ALA D 2 290 ? 135.083 84.092  47.067  1.00 81.92  ? 290 ALA D N  1 
ATOM 8310  C CA . ALA D 2 290 ? 133.850 83.421  47.456  1.00 81.92  ? 290 ALA D CA 1 
ATOM 8311  C C  . ALA D 2 290 ? 133.625 83.412  48.961  1.00 81.92  ? 290 ALA D C  1 
ATOM 8312  O O  . ALA D 2 290 ? 132.509 83.121  49.400  1.00 81.92  ? 290 ALA D O  1 
ATOM 8313  N N  . LYS D 2 291 ? 134.647 83.726  49.755  1.00 78.35  ? 291 LYS D N  1 
ATOM 8314  C CA . LYS D 2 291 ? 134.474 83.818  51.196  1.00 78.35  ? 291 LYS D CA 1 
ATOM 8315  C C  . LYS D 2 291 ? 133.720 85.078  51.597  1.00 78.35  ? 291 LYS D C  1 
ATOM 8316  O O  . LYS D 2 291 ? 133.123 85.112  52.680  1.00 78.35  ? 291 LYS D O  1 
ATOM 8317  N N  . LEU D 2 292 ? 133.712 86.102  50.744  1.00 79.29  ? 292 LEU D N  1 
ATOM 8318  C CA . LEU D 2 292 ? 133.040 87.353  51.074  1.00 79.29  ? 292 LEU D CA 1 
ATOM 8319  C C  . LEU D 2 292 ? 131.535 87.136  51.093  1.00 79.29  ? 292 LEU D C  1 
ATOM 8320  O O  . LEU D 2 292 ? 130.923 86.872  50.054  1.00 79.29  ? 292 LEU D O  1 
ATOM 8321  N N  . LYS D 2 293 ? 130.949 87.238  52.276  1.00 69.46  ? 293 LYS D N  1 
ATOM 8322  C CA . LYS D 2 293 ? 129.538 86.947  52.436  1.00 69.46  ? 293 LYS D CA 1 
ATOM 8323  C C  . LYS D 2 293 ? 128.702 88.080  51.849  1.00 69.46  ? 293 LYS D C  1 
ATOM 8324  O O  . LYS D 2 293 ? 128.995 89.251  52.092  1.00 69.46  ? 293 LYS D O  1 
ATOM 8325  N N  . PRO D 2 294 ? 127.672 87.761  51.061  1.00 69.29  ? 294 PRO D N  1 
ATOM 8326  C CA . PRO D 2 294 ? 126.950 88.806  50.328  1.00 69.29  ? 294 PRO D CA 1 
ATOM 8327  C C  . PRO D 2 294 ? 126.128 89.690  51.239  1.00 69.29  ? 294 PRO D C  1 
ATOM 8328  O O  . PRO D 2 294 ? 125.586 89.239  52.248  1.00 69.29  ? 294 PRO D O  1 
ATOM 8329  N N  . ALA D 2 295 ? 126.044 90.966  50.870  1.00 69.09  ? 295 ALA D N  1 
ATOM 8330  C CA . ALA D 2 295 ? 125.425 91.975  51.714  1.00 69.09  ? 295 ALA D CA 1 
ATOM 8331  C C  . ALA D 2 295 ? 124.050 92.409  51.250  1.00 69.09  ? 295 ALA D C  1 
ATOM 8332  O O  . ALA D 2 295 ? 123.235 92.802  52.085  1.00 69.09  ? 295 ALA D O  1 
ATOM 8333  N N  . PHE D 2 296 ? 123.765 92.351  49.949  1.00 60.90  ? 296 PHE D N  1 
ATOM 8334  C CA . PHE D 2 296 ? 122.492 92.839  49.438  1.00 60.90  ? 296 PHE D CA 1 
ATOM 8335  C C  . PHE D 2 296 ? 121.318 91.934  49.756  1.00 60.90  ? 296 PHE D C  1 
ATOM 8336  O O  . PHE D 2 296 ? 120.176 92.397  49.688  1.00 60.90  ? 296 PHE D O  1 
ATOM 8337  N N  . ILE D 2 297 ? 121.552 90.678  50.115  1.00 57.47  ? 297 ILE D N  1 
ATOM 8338  C CA . ILE D 2 297 ? 120.476 89.742  50.391  1.00 57.47  ? 297 ILE D CA 1 
ATOM 8339  C C  . ILE D 2 297 ? 121.029 88.682  51.341  1.00 57.47  ? 297 ILE D C  1 
ATOM 8340  O O  . ILE D 2 297 ? 122.214 88.677  51.669  1.00 57.47  ? 297 ILE D O  1 
ATOM 8341  N N  . LYS D 2 298 ? 120.149 87.822  51.852  1.00 69.61  ? 298 LYS D N  1 
ATOM 8342  C CA . LYS D 2 298 ? 120.540 86.727  52.729  1.00 69.61  ? 298 LYS D CA 1 
ATOM 8343  C C  . LYS D 2 298 ? 121.439 85.761  51.961  1.00 69.61  ? 298 LYS D C  1 
ATOM 8344  O O  . LYS D 2 298 ? 121.268 85.597  50.753  1.00 69.61  ? 298 LYS D O  1 
ATOM 8345  N N  . PRO D 2 299 ? 122.387 85.078  52.646  1.00 72.84  ? 299 PRO D N  1 
ATOM 8346  C CA . PRO D 2 299 ? 123.419 84.276  51.960  1.00 72.84  ? 299 PRO D CA 1 
ATOM 8347  C C  . PRO D 2 299 ? 123.067 83.231  50.905  1.00 72.84  ? 299 PRO D C  1 
ATOM 8348  O O  . PRO D 2 299 ? 123.984 82.603  50.369  1.00 72.84  ? 299 PRO D O  1 
ATOM 8349  N N  . TYR D 2 300 ? 121.800 83.014  50.580  1.00 69.52  ? 300 TYR D N  1 
ATOM 8350  C CA . TYR D 2 300 ? 121.527 82.209  49.399  1.00 69.52  ? 300 TYR D CA 1 
ATOM 8351  C C  . TYR D 2 300 ? 121.807 82.947  48.094  1.00 69.52  ? 300 TYR D C  1 
ATOM 8352  O O  . TYR D 2 300 ? 122.067 82.296  47.079  1.00 69.52  ? 300 TYR D O  1 
ATOM 8353  N N  . GLY D 2 301 ? 121.774 84.279  48.092  1.00 65.40  ? 301 GLY D N  1 
ATOM 8354  C CA . GLY D 2 301 ? 121.940 85.058  46.881  1.00 65.40  ? 301 GLY D CA 1 
ATOM 8355  C C  . GLY D 2 301 ? 123.371 85.092  46.378  1.00 65.40  ? 301 GLY D C  1 
ATOM 8356  O O  . GLY D 2 301 ? 124.263 84.418  46.891  1.00 65.40  ? 301 GLY D O  1 
ATOM 8357  N N  . THR D 2 302 ? 123.591 85.918  45.349  1.00 69.94  ? 302 THR D N  1 
ATOM 8358  C CA . THR D 2 302 ? 124.829 85.807  44.586  1.00 69.94  ? 302 THR D CA 1 
ATOM 8359  C C  . THR D 2 302 ? 125.411 87.151  44.150  1.00 69.94  ? 302 THR D C  1 
ATOM 8360  O O  . THR D 2 302 ? 126.044 87.242  43.094  1.00 69.94  ? 302 THR D O  1 
ATOM 8361  N N  . VAL D 2 303 ? 125.244 88.199  44.945  1.00 69.87  ? 303 VAL D N  1 
ATOM 8362  C CA . VAL D 2 303 ? 125.902 89.471  44.682  1.00 69.87  ? 303 VAL D CA 1 
ATOM 8363  C C  . VAL D 2 303 ? 126.549 89.939  45.971  1.00 69.87  ? 303 VAL D C  1 
ATOM 8364  O O  . VAL D 2 303 ? 125.851 90.206  46.955  1.00 69.87  ? 303 VAL D O  1 
ATOM 8365  N N  . THR D 2 304 ? 127.872 90.038  45.973  1.00 77.86  ? 304 THR D N  1 
ATOM 8366  C CA . THR D 2 304 ? 128.603 90.537  47.125  1.00 77.86  ? 304 THR D CA 1 
ATOM 8367  C C  . THR D 2 304 ? 129.356 91.799  46.742  1.00 77.86  ? 304 THR D C  1 
ATOM 8368  O O  . THR D 2 304 ? 129.452 92.162  45.571  1.00 77.86  ? 304 THR D O  1 
ATOM 8369  N N  . ALA D 2 305 ? 129.919 92.455  47.755  1.00 81.25  ? 305 ALA D N  1 
ATOM 8370  C CA . ALA D 2 305 ? 130.581 93.738  47.559  1.00 81.25  ? 305 ALA D CA 1 
ATOM 8371  C C  . ALA D 2 305 ? 131.905 93.632  46.816  1.00 81.25  ? 305 ALA D C  1 
ATOM 8372  O O  . ALA D 2 305 ? 132.434 94.667  46.398  1.00 81.25  ? 305 ALA D O  1 
ATOM 8373  N N  . ALA D 2 306 ? 132.462 92.432  46.656  1.00 77.39  ? 306 ALA D N  1 
ATOM 8374  C CA . ALA D 2 306 ? 133.693 92.292  45.890  1.00 77.39  ? 306 ALA D CA 1 
ATOM 8375  C C  . ALA D 2 306 ? 133.441 92.556  44.420  1.00 77.39  ? 306 ALA D C  1 
ATOM 8376  O O  . ALA D 2 306 ? 134.068 93.426  43.813  1.00 77.39  ? 306 ALA D O  1 
ATOM 8377  N N  . ASN D 2 307 ? 132.521 91.811  43.834  1.00 72.82  ? 307 ASN D N  1 
ATOM 8378  C CA . ASN D 2 307 ? 132.200 91.980  42.424  1.00 72.82  ? 307 ASN D CA 1 
ATOM 8379  C C  . ASN D 2 307 ? 131.024 92.925  42.218  1.00 72.82  ? 307 ASN D C  1 
ATOM 8380  O O  . ASN D 2 307 ? 130.080 92.628  41.494  1.00 72.82  ? 307 ASN D O  1 
ATOM 8381  N N  . SER D 2 308 ? 131.081 94.100  42.833  1.00 76.58  ? 308 SER D N  1 
ATOM 8382  C CA . SER D 2 308 ? 129.984 95.048  42.734  1.00 76.58  ? 308 SER D CA 1 
ATOM 8383  C C  . SER D 2 308 ? 130.542 96.456  42.783  1.00 76.58  ? 308 SER D C  1 
ATOM 8384  O O  . SER D 2 308 ? 131.667 96.675  43.235  1.00 76.58  ? 308 SER D O  1 
ATOM 8385  N N  . SER D 2 309 ? 129.762 97.397  42.269  1.00 58.32  ? 309 SER D N  1 
ATOM 8386  C CA . SER D 2 309 ? 130.194 98.777  42.238  1.00 58.32  ? 309 SER D CA 1 
ATOM 8387  C C  . SER D 2 309 ? 130.299 99.335  43.646  1.00 58.32  ? 309 SER D C  1 
ATOM 8388  O O  . SER D 2 309 ? 129.716 98.817  44.598  1.00 58.32  ? 309 SER D O  1 
ATOM 8389  N N  . PHE D 2 310 ? 131.066 100.400 43.771  1.00 53.26  ? 310 PHE D N  1 
ATOM 8390  C CA . PHE D 2 310 ? 131.291 101.017 45.059  1.00 53.26  ? 310 PHE D CA 1 
ATOM 8391  C C  . PHE D 2 310 ? 131.141 102.519 44.922  1.00 53.26  ? 310 PHE D C  1 
ATOM 8392  O O  . PHE D 2 310 ? 131.252 103.077 43.830  1.00 53.26  ? 310 PHE D O  1 
ATOM 8393  N N  . LEU D 2 311 ? 130.869 103.155 46.053  1.00 54.27  ? 311 LEU D N  1 
ATOM 8394  C CA . LEU D 2 311 ? 130.620 104.586 46.090  1.00 54.27  ? 311 LEU D CA 1 
ATOM 8395  C C  . LEU D 2 311 ? 131.901 105.330 45.755  1.00 54.27  ? 311 LEU D C  1 
ATOM 8396  O O  . LEU D 2 311 ? 132.824 105.383 46.572  1.00 54.27  ? 311 LEU D O  1 
ATOM 8397  N N  . THR D 2 312 ? 131.978 105.881 44.546  1.00 50.24  ? 312 THR D N  1 
ATOM 8398  C CA . THR D 2 312 ? 133.167 106.625 44.160  1.00 50.24  ? 312 THR D CA 1 
ATOM 8399  C C  . THR D 2 312 ? 132.826 107.962 43.538  1.00 50.24  ? 312 THR D C  1 
ATOM 8400  O O  . THR D 2 312 ? 131.697 108.178 43.093  1.00 50.24  ? 312 THR D O  1 
ATOM 8401  N N  . ASP D 2 313 ? 133.798 108.864 43.488  1.00 50.90  ? 313 ASP D N  1 
ATOM 8402  C CA . ASP D 2 313 ? 133.530 110.247 43.146  1.00 50.90  ? 313 ASP D CA 1 
ATOM 8403  C C  . ASP D 2 313 ? 134.471 110.656 42.029  1.00 50.90  ? 313 ASP D C  1 
ATOM 8404  O O  . ASP D 2 313 ? 135.574 110.125 41.913  1.00 50.90  ? 313 ASP D O  1 
ATOM 8405  N N  . GLY D 2 314 ? 134.051 111.612 41.213  1.00 36.03  ? 314 GLY D N  1 
ATOM 8406  C CA . GLY D 2 314 ? 134.873 112.043 40.101  1.00 36.03  ? 314 GLY D CA 1 
ATOM 8407  C C  . GLY D 2 314 ? 134.082 112.816 39.069  1.00 36.03  ? 314 GLY D C  1 
ATOM 8408  O O  . GLY D 2 314 ? 132.874 113.015 39.179  1.00 36.03  ? 314 GLY D O  1 
ATOM 8409  N N  . ALA D 2 315 ? 134.808 113.258 38.049  1.00 26.43  ? 315 ALA D N  1 
ATOM 8410  C CA . ALA D 2 315 ? 134.238 114.104 37.019  1.00 26.43  ? 315 ALA D CA 1 
ATOM 8411  C C  . ALA D 2 315 ? 134.851 113.742 35.683  1.00 26.43  ? 315 ALA D C  1 
ATOM 8412  O O  . ALA D 2 315 ? 135.810 112.976 35.603  1.00 26.43  ? 315 ALA D O  1 
ATOM 8413  N N  . SER D 2 316 ? 134.292 114.315 34.628  1.00 31.38  ? 316 SER D N  1 
ATOM 8414  C CA . SER D 2 316 ? 134.771 114.055 33.283  1.00 31.38  ? 316 SER D CA 1 
ATOM 8415  C C  . SER D 2 316 ? 134.251 115.138 32.367  1.00 31.38  ? 316 SER D C  1 
ATOM 8416  O O  . SER D 2 316 ? 133.202 115.721 32.627  1.00 31.38  ? 316 SER D O  1 
ATOM 8417  N N  . ALA D 2 317 ? 134.964 115.356 31.272  1.00 23.00  ? 317 ALA D N  1 
ATOM 8418  C CA . ALA D 2 317 ? 134.544 116.320 30.275  1.00 23.00  ? 317 ALA D CA 1 
ATOM 8419  C C  . ALA D 2 317 ? 135.154 115.931 28.946  1.00 23.00  ? 317 ALA D C  1 
ATOM 8420  O O  . ALA D 2 317 ? 136.021 115.064 28.877  1.00 23.00  ? 317 ALA D O  1 
ATOM 8421  N N  . MET D 2 318 ? 134.693 116.583 27.890  1.00 17.72  ? 318 MET D N  1 
ATOM 8422  C CA . MET D 2 318 ? 135.270 116.377 26.572  1.00 17.72  ? 318 MET D CA 1 
ATOM 8423  C C  . MET D 2 318 ? 135.010 117.633 25.759  1.00 17.72  ? 318 MET D C  1 
ATOM 8424  O O  . MET D 2 318 ? 134.661 118.677 26.312  1.00 17.72  ? 318 MET D O  1 
ATOM 8425  N N  . LEU D 2 319 ? 135.195 117.548 24.453  1.00 30.20  ? 319 LEU D N  1 
ATOM 8426  C CA . LEU D 2 319 ? 134.811 118.639 23.585  1.00 30.20  ? 319 LEU D CA 1 
ATOM 8427  C C  . LEU D 2 319 ? 134.213 118.034 22.336  1.00 30.20  ? 319 LEU D C  1 
ATOM 8428  O O  . LEU D 2 319 ? 134.719 117.033 21.829  1.00 30.20  ? 319 LEU D O  1 
ATOM 8429  N N  . ILE D 2 320 ? 133.144 118.636 21.838  1.00 36.55  ? 320 ILE D N  1 
ATOM 8430  C CA . ILE D 2 320 ? 132.468 118.148 20.648  1.00 36.55  ? 320 ILE D CA 1 
ATOM 8431  C C  . ILE D 2 320 ? 132.395 119.267 19.628  1.00 36.55  ? 320 ILE D C  1 
ATOM 8432  O O  . ILE D 2 320 ? 131.811 120.322 19.891  1.00 36.55  ? 320 ILE D O  1 
ATOM 8433  N N  . MET D 2 321 ? 132.942 119.011 18.455  1.00 62.06  ? 321 MET D N  1 
ATOM 8434  C CA . MET D 2 321 ? 133.223 120.024 17.462  1.00 62.06  ? 321 MET D CA 1 
ATOM 8435  C C  . MET D 2 321 ? 132.452 119.670 16.208  1.00 62.06  ? 321 MET D C  1 
ATOM 8436  O O  . MET D 2 321 ? 132.194 118.496 15.937  1.00 62.06  ? 321 MET D O  1 
ATOM 8437  N N  . ALA D 2 322 ? 132.052 120.683 15.459  1.00 62.33  ? 322 ALA D N  1 
ATOM 8438  C CA . ALA D 2 322 ? 131.620 120.419 14.100  1.00 62.33  ? 322 ALA D CA 1 
ATOM 8439  C C  . ALA D 2 322 ? 132.837 120.056 13.269  1.00 62.33  ? 322 ALA D C  1 
ATOM 8440  O O  . ALA D 2 322 ? 133.938 120.542 13.524  1.00 62.33  ? 322 ALA D O  1 
ATOM 8441  N N  . GLU D 2 323 ? 132.643 119.180 12.278  1.00 67.08  ? 323 GLU D N  1 
ATOM 8442  C CA . GLU D 2 323 ? 133.788 118.709 11.506  1.00 67.08  ? 323 GLU D CA 1 
ATOM 8443  C C  . GLU D 2 323 ? 134.395 119.814 10.655  1.00 67.08  ? 323 GLU D C  1 
ATOM 8444  O O  . GLU D 2 323 ? 135.620 119.872 10.506  1.00 67.08  ? 323 GLU D O  1 
ATOM 8445  N N  . GLU D 2 324 ? 133.570 120.712 10.117  1.00 79.26  ? 324 GLU D N  1 
ATOM 8446  C CA . GLU D 2 324 ? 134.104 121.714 9.204   1.00 79.26  ? 324 GLU D CA 1 
ATOM 8447  C C  . GLU D 2 324 ? 134.952 122.744 9.942   1.00 79.26  ? 324 GLU D C  1 
ATOM 8448  O O  . GLU D 2 324 ? 136.005 123.152 9.442   1.00 79.26  ? 324 GLU D O  1 
ATOM 8449  N N  . LYS D 2 325 ? 134.573 123.118 11.163  1.00 75.08  ? 325 LYS D N  1 
ATOM 8450  C CA . LYS D 2 325 ? 135.489 123.972 11.907  1.00 75.08  ? 325 LYS D CA 1 
ATOM 8451  C C  . LYS D 2 325 ? 136.631 123.171 12.525  1.00 75.08  ? 325 LYS D C  1 
ATOM 8452  O O  . LYS D 2 325 ? 137.702 123.731 12.780  1.00 75.08  ? 325 LYS D O  1 
ATOM 8453  N N  . ALA D 2 326 ? 136.461 121.861 12.700  1.00 77.28  ? 326 ALA D N  1 
ATOM 8454  C CA . ALA D 2 326 ? 137.582 121.038 13.140  1.00 77.28  ? 326 ALA D CA 1 
ATOM 8455  C C  . ALA D 2 326 ? 138.661 120.952 12.070  1.00 77.28  ? 326 ALA D C  1 
ATOM 8456  O O  . ALA D 2 326 ? 139.852 120.871 12.387  1.00 77.28  ? 326 ALA D O  1 
ATOM 8457  N N  . LEU D 2 327 ? 138.271 120.979 10.802  1.00 86.66  ? 327 LEU D N  1 
ATOM 8458  C CA . LEU D 2 327 ? 139.253 121.020 9.730   1.00 86.66  ? 327 LEU D CA 1 
ATOM 8459  C C  . LEU D 2 327 ? 139.652 122.433 9.340   1.00 86.66  ? 327 LEU D C  1 
ATOM 8460  O O  . LEU D 2 327 ? 140.693 122.607 8.701   1.00 86.66  ? 327 LEU D O  1 
ATOM 8461  N N  . ALA D 2 328 ? 138.864 123.441 9.709   1.00 90.04  ? 328 ALA D N  1 
ATOM 8462  C CA . ALA D 2 328 ? 139.245 124.819 9.439   1.00 90.04  ? 328 ALA D CA 1 
ATOM 8463  C C  . ALA D 2 328 ? 140.251 125.338 10.459  1.00 90.04  ? 328 ALA D C  1 
ATOM 8464  O O  . ALA D 2 328 ? 141.231 125.989 10.089  1.00 90.04  ? 328 ALA D O  1 
ATOM 8465  N N  . MET D 2 329 ? 140.027 125.061 11.741  1.00 89.73  ? 329 MET D N  1 
ATOM 8466  C CA . MET D 2 329 ? 141.000 125.458 12.747  1.00 89.73  ? 329 MET D CA 1 
ATOM 8467  C C  . MET D 2 329 ? 142.231 124.566 12.687  1.00 89.73  ? 329 MET D C  1 
ATOM 8468  O O  . MET D 2 329 ? 143.363 125.056 12.747  1.00 89.73  ? 329 MET D O  1 
ATOM 8469  N N  . GLY D 2 330 ? 142.034 123.266 12.559  1.00 78.50  ? 330 GLY D N  1 
ATOM 8470  C CA . GLY D 2 330 ? 143.115 122.344 12.328  1.00 78.50  ? 330 GLY D CA 1 
ATOM 8471  C C  . GLY D 2 330 ? 143.455 121.387 13.453  1.00 78.50  ? 330 GLY D C  1 
ATOM 8472  O O  . GLY D 2 330 ? 144.581 120.878 13.479  1.00 78.50  ? 330 GLY D O  1 
ATOM 8473  N N  . TYR D 2 331 ? 142.535 121.124 14.373  1.00 74.42  ? 331 TYR D N  1 
ATOM 8474  C CA . TYR D 2 331 ? 142.793 120.135 15.403  1.00 74.42  ? 331 TYR D CA 1 
ATOM 8475  C C  . TYR D 2 331 ? 142.621 118.737 14.851  1.00 74.42  ? 331 TYR D C  1 
ATOM 8476  O O  . TYR D 2 331 ? 141.725 118.476 14.047  1.00 74.42  ? 331 TYR D O  1 
ATOM 8477  N N  . LYS D 2 332 ? 143.481 117.838 15.286  1.00 58.50  ? 332 LYS D N  1 
ATOM 8478  C CA . LYS D 2 332 ? 143.361 116.458 14.867  1.00 58.50  ? 332 LYS D CA 1 
ATOM 8479  C C  . LYS D 2 332 ? 142.271 115.786 15.687  1.00 58.50  ? 332 LYS D C  1 
ATOM 8480  O O  . LYS D 2 332 ? 142.402 115.688 16.910  1.00 58.50  ? 332 LYS D O  1 
ATOM 8481  N N  . PRO D 2 333 ? 141.207 115.315 15.068  1.00 44.64  ? 333 PRO D N  1 
ATOM 8482  C CA . PRO D 2 333 ? 140.062 114.787 15.813  1.00 44.64  ? 333 PRO D CA 1 
ATOM 8483  C C  . PRO D 2 333 ? 140.314 113.425 16.422  1.00 44.64  ? 333 PRO D C  1 
ATOM 8484  O O  . PRO D 2 333 ? 141.436 112.923 16.395  1.00 44.64  ? 333 PRO D O  1 
ATOM 8485  N N  . LYS D 2 334 ? 139.289 112.814 16.982  1.00 37.93  ? 334 LYS D N  1 
ATOM 8486  C CA . LYS D 2 334 ? 139.397 111.407 17.330  1.00 37.93  ? 334 LYS D CA 1 
ATOM 8487  C C  . LYS D 2 334 ? 138.383 110.526 16.636  1.00 37.93  ? 334 LYS D C  1 
ATOM 8488  O O  . LYS D 2 334 ? 138.737 109.449 16.173  1.00 37.93  ? 334 LYS D O  1 
ATOM 8489  N N  . ALA D 2 335 ? 137.130 110.945 16.552  1.00 44.11  ? 335 ALA D N  1 
ATOM 8490  C CA . ALA D 2 335 ? 136.084 110.033 16.130  1.00 44.11  ? 335 ALA D CA 1 
ATOM 8491  C C  . ALA D 2 335 ? 134.938 110.827 15.538  1.00 44.11  ? 335 ALA D C  1 
ATOM 8492  O O  . ALA D 2 335 ? 134.785 112.017 15.805  1.00 44.11  ? 335 ALA D O  1 
ATOM 8493  N N  . TYR D 2 336 ? 134.121 110.155 14.746  1.00 50.73  ? 336 TYR D N  1 
ATOM 8494  C CA . TYR D 2 336 ? 132.825 110.730 14.434  1.00 50.73  ? 336 TYR D CA 1 
ATOM 8495  C C  . TYR D 2 336 ? 131.874 110.346 15.552  1.00 50.73  ? 336 TYR D C  1 
ATOM 8496  O O  . TYR D 2 336 ? 132.245 109.680 16.520  1.00 50.73  ? 336 TYR D O  1 
ATOM 8497  N N  . LEU D 2 337 ? 130.623 110.743 15.428  1.00 46.04  ? 337 LEU D N  1 
ATOM 8498  C CA . LEU D 2 337 ? 129.625 110.396 16.414  1.00 46.04  ? 337 LEU D CA 1 
ATOM 8499  C C  . LEU D 2 337 ? 128.307 110.175 15.697  1.00 46.04  ? 337 LEU D C  1 
ATOM 8500  O O  . LEU D 2 337 ? 127.510 111.101 15.549  1.00 46.04  ? 337 LEU D O  1 
ATOM 8501  N N  . ARG D 2 338 ? 128.070 108.942 15.285  1.00 48.91  ? 338 ARG D N  1 
ATOM 8502  C CA . ARG D 2 338 ? 126.936 108.609 14.444  1.00 48.91  ? 338 ARG D CA 1 
ATOM 8503  C C  . ARG D 2 338 ? 125.730 108.316 15.352  1.00 48.91  ? 338 ARG D C  1 
ATOM 8504  O O  . ARG D 2 338 ? 125.631 108.858 16.454  1.00 48.91  ? 338 ARG D O  1 
ATOM 8505  N N  . ASP D 2 339 ? 124.779 107.527 14.843  1.00 59.33  ? 339 ASP D N  1 
ATOM 8506  C CA . ASP D 2 339 ? 123.428 107.391 15.394  1.00 59.33  ? 339 ASP D CA 1 
ATOM 8507  C C  . ASP D 2 339 ? 123.369 106.975 16.861  1.00 59.33  ? 339 ASP D C  1 
ATOM 8508  O O  . ASP D 2 339 ? 124.344 106.483 17.432  1.00 59.33  ? 339 ASP D O  1 
ATOM 8509  N N  . PHE D 2 340 ? 122.189 107.152 17.454  1.00 45.71  ? 340 PHE D N  1 
ATOM 8510  C CA . PHE D 2 340 ? 121.960 106.928 18.880  1.00 45.71  ? 340 PHE D CA 1 
ATOM 8511  C C  . PHE D 2 340 ? 120.496 106.560 19.114  1.00 45.71  ? 340 PHE D C  1 
ATOM 8512  O O  . PHE D 2 340 ? 119.566 107.300 18.812  1.00 45.71  ? 340 PHE D O  1 
ATOM 8513  N N  . MET D 2 341 ? 120.291 105.336 19.571  1.00 46.79  ? 341 MET D N  1 
ATOM 8514  C CA . MET D 2 341 ? 118.966 104.988 20.050  1.00 46.79  ? 341 MET D CA 1 
ATOM 8515  C C  . MET D 2 341 ? 118.932 105.215 21.547  1.00 46.79  ? 341 MET D C  1 
ATOM 8516  O O  . MET D 2 341 ? 119.964 105.232 22.213  1.00 46.79  ? 341 MET D O  1 
ATOM 8517  N N  . TYR D 2 342 ? 117.741 105.412 22.077  1.00 35.13  ? 342 TYR D N  1 
ATOM 8518  C CA . TYR D 2 342 ? 117.639 105.874 23.446  1.00 35.13  ? 342 TYR D CA 1 
ATOM 8519  C C  . TYR D 2 342 ? 116.301 105.384 23.989  1.00 35.13  ? 342 TYR D C  1 
ATOM 8520  O O  . TYR D 2 342 ? 115.277 106.015 23.737  1.00 35.13  ? 342 TYR D O  1 
ATOM 8521  N N  . VAL D 2 343 ? 116.308 104.269 24.726  1.00 36.59  ? 343 VAL D N  1 
ATOM 8522  C CA . VAL D 2 343 ? 115.072 103.565 25.047  1.00 36.59  ? 343 VAL D CA 1 
ATOM 8523  C C  . VAL D 2 343 ? 115.034 103.225 26.531  1.00 36.59  ? 343 VAL D C  1 
ATOM 8524  O O  . VAL D 2 343 ? 116.056 103.217 27.220  1.00 36.59  ? 343 VAL D O  1 
ATOM 8525  N N  . SER D 2 344 ? 113.830 102.954 27.022  1.00 45.99  ? 344 SER D N  1 
ATOM 8526  C CA . SER D 2 344 ? 113.552 102.697 28.424  1.00 45.99  ? 344 SER D CA 1 
ATOM 8527  C C  . SER D 2 344 ? 112.855 101.354 28.596  1.00 45.99  ? 344 SER D C  1 
ATOM 8528  O O  . SER D 2 344 ? 112.253 100.817 27.669  1.00 45.99  ? 344 SER D O  1 
ATOM 8529  N N  . GLN D 2 345 ? 112.898 100.837 29.820  1.00 52.41  ? 345 GLN D N  1 
ATOM 8530  C CA . GLN D 2 345 ? 112.311 99.548  30.143  1.00 52.41  ? 345 GLN D CA 1 
ATOM 8531  C C  . GLN D 2 345 ? 111.482 99.679  31.409  1.00 52.41  ? 345 GLN D C  1 
ATOM 8532  O O  . GLN D 2 345 ? 111.809 100.453 32.311  1.00 52.41  ? 345 GLN D O  1 
ATOM 8533  N N  . ASP D 2 346 ? 110.408 98.896  31.464  1.00 55.14  ? 346 ASP D N  1 
ATOM 8534  C CA . ASP D 2 346 ? 109.443 98.988  32.549  1.00 55.14  ? 346 ASP D CA 1 
ATOM 8535  C C  . ASP D 2 346 ? 110.054 98.490  33.854  1.00 55.14  ? 346 ASP D C  1 
ATOM 8536  O O  . ASP D 2 346 ? 110.437 97.326  33.950  1.00 55.14  ? 346 ASP D O  1 
ATOM 8537  N N  . PRO D 2 347 ? 110.098 99.316  34.887  1.00 45.57  ? 347 PRO D N  1 
ATOM 8538  C CA . PRO D 2 347 ? 110.933 99.006  36.051  1.00 45.57  ? 347 PRO D CA 1 
ATOM 8539  C C  . PRO D 2 347 ? 110.344 98.002  37.018  1.00 45.57  ? 347 PRO D C  1 
ATOM 8540  O O  . PRO D 2 347 ? 110.696 98.017  38.197  1.00 45.57  ? 347 PRO D O  1 
ATOM 8541  N N  . LYS D 2 348 ? 109.402 97.188  36.584  1.00 57.95  ? 348 LYS D N  1 
ATOM 8542  C CA . LYS D 2 348 ? 109.014 96.049  37.394  1.00 57.95  ? 348 LYS D CA 1 
ATOM 8543  C C  . LYS D 2 348 ? 109.746 94.773  37.023  1.00 57.95  ? 348 LYS D C  1 
ATOM 8544  O O  . LYS D 2 348 ? 110.173 94.046  37.919  1.00 57.95  ? 348 LYS D O  1 
ATOM 8545  N N  . ASP D 2 349 ? 109.929 94.488  35.736  1.00 66.32  ? 349 ASP D N  1 
ATOM 8546  C CA . ASP D 2 349 ? 110.598 93.261  35.328  1.00 66.32  ? 349 ASP D CA 1 
ATOM 8547  C C  . ASP D 2 349 ? 112.049 93.493  34.922  1.00 66.32  ? 349 ASP D C  1 
ATOM 8548  O O  . ASP D 2 349 ? 112.974 93.008  35.579  1.00 66.32  ? 349 ASP D O  1 
ATOM 8549  N N  . GLN D 2 350 ? 112.264 94.263  33.868  1.00 60.34  ? 350 GLN D N  1 
ATOM 8550  C CA . GLN D 2 350 ? 113.582 94.405  33.266  1.00 60.34  ? 350 GLN D CA 1 
ATOM 8551  C C  . GLN D 2 350 ? 114.179 95.701  33.780  1.00 60.34  ? 350 GLN D C  1 
ATOM 8552  O O  . GLN D 2 350 ? 114.254 96.692  33.060  1.00 60.34  ? 350 GLN D O  1 
ATOM 8553  N N  . LEU D 2 351 ? 114.614 95.699  35.032  1.00 49.95  ? 351 LEU D N  1 
ATOM 8554  C CA . LEU D 2 351 ? 115.126 96.935  35.605  1.00 49.95  ? 351 LEU D CA 1 
ATOM 8555  C C  . LEU D 2 351 ? 116.511 97.232  35.068  1.00 49.95  ? 351 LEU D C  1 
ATOM 8556  O O  . LEU D 2 351 ? 116.775 98.324  34.559  1.00 49.95  ? 351 LEU D O  1 
ATOM 8557  N N  . LEU D 2 352 ? 117.418 96.271  35.187  1.00 49.04  ? 352 LEU D N  1 
ATOM 8558  C CA . LEU D 2 352 ? 118.775 96.436  34.700  1.00 49.04  ? 352 LEU D CA 1 
ATOM 8559  C C  . LEU D 2 352 ? 119.027 95.614  33.460  1.00 49.04  ? 352 LEU D C  1 
ATOM 8560  O O  . LEU D 2 352 ? 120.135 95.125  33.256  1.00 49.04  ? 352 LEU D O  1 
ATOM 8561  N N  . LEU D 2 353 ? 118.006 95.439  32.634  1.00 54.74  ? 353 LEU D N  1 
ATOM 8562  C CA . LEU D 2 353 ? 118.191 94.906  31.296  1.00 54.74  ? 353 LEU D CA 1 
ATOM 8563  C C  . LEU D 2 353 ? 118.275 96.131  30.397  1.00 54.74  ? 353 LEU D C  1 
ATOM 8564  O O  . LEU D 2 353 ? 117.444 96.377  29.523  1.00 54.74  ? 353 LEU D O  1 
ATOM 8565  N N  . GLY D 2 354 ? 119.278 96.950  30.659  1.00 53.44  ? 354 GLY D N  1 
ATOM 8566  C CA . GLY D 2 354 ? 119.412 98.215  29.985  1.00 53.44  ? 354 GLY D CA 1 
ATOM 8567  C C  . GLY D 2 354 ? 119.847 98.128  28.539  1.00 53.44  ? 354 GLY D C  1 
ATOM 8568  O O  . GLY D 2 354 ? 119.059 98.413  27.634  1.00 53.44  ? 354 GLY D O  1 
ATOM 8569  N N  . PRO D 2 355 ? 121.105 97.723  28.276  1.00 49.62  ? 355 PRO D N  1 
ATOM 8570  C CA . PRO D 2 355 ? 121.635 97.856  26.917  1.00 49.62  ? 355 PRO D CA 1 
ATOM 8571  C C  . PRO D 2 355 ? 121.021 96.916  25.902  1.00 49.62  ? 355 PRO D C  1 
ATOM 8572  O O  . PRO D 2 355 ? 120.710 97.321  24.780  1.00 49.62  ? 355 PRO D O  1 
ATOM 8573  N N  . THR D 2 356 ? 120.806 95.671  26.281  1.00 54.02  ? 356 THR D N  1 
ATOM 8574  C CA . THR D 2 356 ? 120.508 94.682  25.266  1.00 54.02  ? 356 THR D CA 1 
ATOM 8575  C C  . THR D 2 356 ? 119.043 94.599  24.906  1.00 54.02  ? 356 THR D C  1 
ATOM 8576  O O  . THR D 2 356 ? 118.626 93.600  24.321  1.00 54.02  ? 356 THR D O  1 
ATOM 8577  N N  . TYR D 2 357 ? 118.247 95.594  25.257  1.00 59.94  ? 357 TYR D N  1 
ATOM 8578  C CA . TYR D 2 357 ? 116.989 95.796  24.571  1.00 59.94  ? 357 TYR D CA 1 
ATOM 8579  C C  . TYR D 2 357 ? 117.103 96.955  23.588  1.00 59.94  ? 357 TYR D C  1 
ATOM 8580  O O  . TYR D 2 357 ? 116.226 97.147  22.745  1.00 59.94  ? 357 TYR D O  1 
ATOM 8581  N N  . ALA D 2 358 ? 118.198 97.702  23.656  1.00 52.21  ? 358 ALA D N  1 
ATOM 8582  C CA . ALA D 2 358 ? 118.416 98.881  22.831  1.00 52.21  ? 358 ALA D CA 1 
ATOM 8583  C C  . ALA D 2 358 ? 119.312 98.645  21.627  1.00 52.21  ? 358 ALA D C  1 
ATOM 8584  O O  . ALA D 2 358 ? 119.147 99.324  20.611  1.00 52.21  ? 358 ALA D O  1 
ATOM 8585  N N  . THR D 2 359 ? 120.266 97.720  21.720  1.00 56.07  ? 359 THR D N  1 
ATOM 8586  C CA . THR D 2 359 ? 121.230 97.532  20.637  1.00 56.07  ? 359 THR D CA 1 
ATOM 8587  C C  . THR D 2 359 ? 120.661 97.087  19.286  1.00 56.07  ? 359 THR D C  1 
ATOM 8588  O O  . THR D 2 359 ? 121.066 97.684  18.274  1.00 56.07  ? 359 THR D O  1 
ATOM 8589  N N  . PRO D 2 360 ? 119.727 96.130  19.162  1.00 67.35  ? 360 PRO D N  1 
ATOM 8590  C CA . PRO D 2 360 ? 119.244 95.821  17.811  1.00 67.35  ? 360 PRO D CA 1 
ATOM 8591  C C  . PRO D 2 360 ? 118.284 96.851  17.279  1.00 67.35  ? 360 PRO D C  1 
ATOM 8592  O O  . PRO D 2 360 ? 117.843 96.727  16.132  1.00 67.35  ? 360 PRO D O  1 
ATOM 8593  N N  . LYS D 2 361 ? 117.924 97.843  18.079  1.00 61.48  ? 361 LYS D N  1 
ATOM 8594  C CA . LYS D 2 361 ? 117.214 98.998  17.576  1.00 61.48  ? 361 LYS D CA 1 
ATOM 8595  C C  . LYS D 2 361 ? 118.150 100.068 17.041  1.00 61.48  ? 361 LYS D C  1 
ATOM 8596  O O  . LYS D 2 361 ? 117.696 100.948 16.303  1.00 61.48  ? 361 LYS D O  1 
ATOM 8597  N N  . VAL D 2 362 ? 119.438 100.016 17.371  1.00 55.72  ? 362 VAL D N  1 
ATOM 8598  C CA . VAL D 2 362 ? 120.372 100.964 16.786  1.00 55.72  ? 362 VAL D CA 1 
ATOM 8599  C C  . VAL D 2 362 ? 121.160 100.344 15.638  1.00 55.72  ? 362 VAL D C  1 
ATOM 8600  O O  . VAL D 2 362 ? 121.612 101.081 14.747  1.00 55.72  ? 362 VAL D O  1 
ATOM 8601  N N  . LEU D 2 363 ? 121.289 99.015  15.596  1.00 62.52  ? 363 LEU D N  1 
ATOM 8602  C CA . LEU D 2 363 ? 121.975 98.401  14.468  1.00 62.52  ? 363 LEU D CA 1 
ATOM 8603  C C  . LEU D 2 363 ? 121.164 98.551  13.192  1.00 62.52  ? 363 LEU D C  1 
ATOM 8604  O O  . LEU D 2 363 ? 121.706 98.898  12.138  1.00 62.52  ? 363 LEU D O  1 
ATOM 8605  N N  . GLU D 2 364 ? 119.859 98.325  13.282  1.00 68.41  ? 364 GLU D N  1 
ATOM 8606  C CA . GLU D 2 364 ? 118.997 98.524  12.129  1.00 68.41  ? 364 GLU D CA 1 
ATOM 8607  C C  . GLU D 2 364 ? 118.829 100.007 11.832  1.00 68.41  ? 364 GLU D C  1 
ATOM 8608  O O  . GLU D 2 364 ? 118.546 100.382 10.689  1.00 68.41  ? 364 GLU D O  1 
ATOM 8609  N N  . LYS D 2 365 ? 119.007 100.856 12.844  1.00 60.08  ? 365 LYS D N  1 
ATOM 8610  C CA . LYS D 2 365 ? 118.971 102.294 12.617  1.00 60.08  ? 365 LYS D CA 1 
ATOM 8611  C C  . LYS D 2 365 ? 120.147 102.739 11.767  1.00 60.08  ? 365 LYS D C  1 
ATOM 8612  O O  . LYS D 2 365 ? 119.986 103.544 10.845  1.00 60.08  ? 365 LYS D O  1 
ATOM 8613  N N  . ALA D 2 366 ? 121.331 102.212 12.048  1.00 63.03  ? 366 ALA D N  1 
ATOM 8614  C CA . ALA D 2 366 ? 122.488 102.565 11.242  1.00 63.03  ? 366 ALA D CA 1 
ATOM 8615  C C  . ALA D 2 366 ? 122.561 101.776 9.945   1.00 63.03  ? 366 ALA D C  1 
ATOM 8616  O O  . ALA D 2 366 ? 123.142 102.260 8.968   1.00 63.03  ? 366 ALA D O  1 
ATOM 8617  N N  . GLY D 2 367 ? 121.981 100.581 9.908   1.00 71.39  ? 367 GLY D N  1 
ATOM 8618  C CA . GLY D 2 367 ? 122.039 99.766  8.711   1.00 71.39  ? 367 GLY D CA 1 
ATOM 8619  C C  . GLY D 2 367 ? 123.306 98.948  8.601   1.00 71.39  ? 367 GLY D C  1 
ATOM 8620  O O  . GLY D 2 367 ? 124.078 99.115  7.653   1.00 71.39  ? 367 GLY D O  1 
ATOM 8621  N N  . LEU D 2 368 ? 123.531 98.068  9.571   1.00 79.41  ? 368 LEU D N  1 
ATOM 8622  C CA . LEU D 2 368 ? 124.683 97.177  9.581   1.00 79.41  ? 368 LEU D CA 1 
ATOM 8623  C C  . LEU D 2 368 ? 124.337 95.967  10.438  1.00 79.41  ? 368 LEU D C  1 
ATOM 8624  O O  . LEU D 2 368 ? 123.186 95.786  10.841  1.00 79.41  ? 368 LEU D O  1 
ATOM 8625  N N  . THR D 2 369 ? 125.334 95.137  10.727  1.00 98.74  ? 369 THR D N  1 
ATOM 8626  C CA . THR D 2 369 ? 125.105 93.906  11.468  1.00 98.74  ? 369 THR D CA 1 
ATOM 8627  C C  . THR D 2 369 ? 125.996 93.820  12.695  1.00 98.74  ? 369 THR D C  1 
ATOM 8628  O O  . THR D 2 369 ? 127.011 94.513  12.804  1.00 98.74  ? 369 THR D O  1 
ATOM 8629  N N  . MET D 2 370 ? 125.590 92.947  13.608  1.00 93.36  ? 370 MET D N  1 
ATOM 8630  C CA . MET D 2 370 ? 126.153 92.801  14.942  1.00 93.36  ? 370 MET D CA 1 
ATOM 8631  C C  . MET D 2 370 ? 127.595 92.324  14.939  1.00 93.36  ? 370 MET D C  1 
ATOM 8632  O O  . MET D 2 370 ? 128.470 92.987  15.503  1.00 93.36  ? 370 MET D O  1 
ATOM 8633  N N  . ASN D 2 371 ? 127.849 91.187  14.285  1.00 99.97  ? 371 ASN D N  1 
ATOM 8634  C CA . ASN D 2 371 ? 129.136 90.508  14.424  1.00 99.97  ? 371 ASN D CA 1 
ATOM 8635  C C  . ASN D 2 371 ? 130.255 91.272  13.738  1.00 99.97  ? 371 ASN D C  1 
ATOM 8636  O O  . ASN D 2 371 ? 131.434 91.065  14.037  1.00 99.97  ? 371 ASN D O  1 
ATOM 8637  N N  . ASP D 2 372 ? 129.902 92.153  12.813  1.00 107.17 ? 372 ASP D N  1 
ATOM 8638  C CA . ASP D 2 372 ? 130.880 92.917  12.062  1.00 107.17 ? 372 ASP D CA 1 
ATOM 8639  C C  . ASP D 2 372 ? 131.123 94.281  12.690  1.00 107.17 ? 372 ASP D C  1 
ATOM 8640  O O  . ASP D 2 372 ? 131.595 95.207  12.028  1.00 107.17 ? 372 ASP D O  1 
ATOM 8641  N N  . ILE D 2 373 ? 130.818 94.407  13.977  1.00 84.23  ? 373 ILE D N  1 
ATOM 8642  C CA . ILE D 2 373 ? 131.306 95.529  14.764  1.00 84.23  ? 373 ILE D CA 1 
ATOM 8643  C C  . ILE D 2 373 ? 132.735 95.172  15.149  1.00 84.23  ? 373 ILE D C  1 
ATOM 8644  O O  . ILE D 2 373 ? 133.147 94.014  15.026  1.00 84.23  ? 373 ILE D O  1 
ATOM 8645  N N  . ASP D 2 374 ? 133.511 96.162  15.571  1.00 84.36  ? 374 ASP D N  1 
ATOM 8646  C CA . ASP D 2 374 ? 134.926 95.892  15.734  1.00 84.36  ? 374 ASP D CA 1 
ATOM 8647  C C  . ASP D 2 374 ? 135.338 95.887  17.192  1.00 84.36  ? 374 ASP D C  1 
ATOM 8648  O O  . ASP D 2 374 ? 136.269 95.168  17.557  1.00 84.36  ? 374 ASP D O  1 
ATOM 8649  N N  . ALA D 2 375 ? 134.651 96.651  18.035  1.00 67.02  ? 375 ALA D N  1 
ATOM 8650  C CA . ALA D 2 375 ? 135.046 96.767  19.435  1.00 67.02  ? 375 ALA D CA 1 
ATOM 8651  C C  . ALA D 2 375 ? 133.856 97.284  20.228  1.00 67.02  ? 375 ALA D C  1 
ATOM 8652  O O  . ALA D 2 375 ? 133.518 98.463  20.130  1.00 67.02  ? 375 ALA D O  1 
ATOM 8653  N N  . PHE D 2 376 ? 133.268 96.424  21.045  1.00 63.89  ? 376 PHE D N  1 
ATOM 8654  C CA . PHE D 2 376 ? 132.298 96.925  21.992  1.00 63.89  ? 376 PHE D CA 1 
ATOM 8655  C C  . PHE D 2 376 ? 132.994 97.634  23.128  1.00 63.89  ? 376 PHE D C  1 
ATOM 8656  O O  . PHE D 2 376 ? 134.214 97.600  23.261  1.00 63.89  ? 376 PHE D O  1 
ATOM 8657  N N  . GLU D 2 377 ? 132.183 98.286  23.943  1.00 51.68  ? 377 GLU D N  1 
ATOM 8658  C CA . GLU D 2 377 ? 132.370 98.284  25.387  1.00 51.68  ? 377 GLU D CA 1 
ATOM 8659  C C  . GLU D 2 377 ? 131.015 98.537  26.019  1.00 51.68  ? 377 GLU D C  1 
ATOM 8660  O O  . GLU D 2 377 ? 130.378 99.550  25.751  1.00 51.68  ? 377 GLU D O  1 
ATOM 8661  N N  . PHE D 2 378 ? 130.515 97.547  26.729  1.00 46.20  ? 378 PHE D N  1 
ATOM 8662  C CA . PHE D 2 378 ? 129.290 97.699  27.482  1.00 46.20  ? 378 PHE D CA 1 
ATOM 8663  C C  . PHE D 2 378 ? 129.621 98.179  28.881  1.00 46.20  ? 378 PHE D C  1 
ATOM 8664  O O  . PHE D 2 378 ? 130.596 97.739  29.495  1.00 46.20  ? 378 PHE D O  1 
ATOM 8665  N N  . HIS D 2 379 ? 128.793 99.067  29.390  1.00 46.35  ? 379 HIS D N  1 
ATOM 8666  C CA . HIS D 2 379 ? 128.944 99.535  30.745  1.00 46.35  ? 379 HIS D CA 1 
ATOM 8667  C C  . HIS D 2 379 ? 128.368 98.510  31.704  1.00 46.35  ? 379 HIS D C  1 
ATOM 8668  O O  . HIS D 2 379 ? 127.412 97.802  31.382  1.00 46.35  ? 379 HIS D O  1 
ATOM 8669  N N  . GLU D 2 380 ? 128.963 98.423  32.886  1.00 55.06  ? 380 GLU D N  1 
ATOM 8670  C CA . GLU D 2 380 ? 128.480 97.526  33.917  1.00 55.06  ? 380 GLU D CA 1 
ATOM 8671  C C  . GLU D 2 380 ? 128.034 98.359  35.102  1.00 55.06  ? 380 GLU D C  1 
ATOM 8672  O O  . GLU D 2 380 ? 128.410 99.519  35.247  1.00 55.06  ? 380 GLU D O  1 
ATOM 8673  N N  . ALA D 2 381 ? 127.229 97.755  35.959  1.00 56.24  ? 381 ALA D N  1 
ATOM 8674  C CA . ALA D 2 381 ? 127.075 98.256  37.313  1.00 56.24  ? 381 ALA D CA 1 
ATOM 8675  C C  . ALA D 2 381 ? 127.153 97.140  38.321  1.00 56.24  ? 381 ALA D C  1 
ATOM 8676  O O  . ALA D 2 381 ? 127.322 97.411  39.510  1.00 56.24  ? 381 ALA D O  1 
ATOM 8677  N N  . PHE D 2 382 ? 127.036 95.900  37.885  1.00 57.93  ? 382 PHE D N  1 
ATOM 8678  C CA . PHE D 2 382 ? 127.195 94.740  38.731  1.00 57.93  ? 382 PHE D CA 1 
ATOM 8679  C C  . PHE D 2 382 ? 127.837 93.655  37.898  1.00 57.93  ? 382 PHE D C  1 
ATOM 8680  O O  . PHE D 2 382 ? 127.659 93.602  36.681  1.00 57.93  ? 382 PHE D O  1 
ATOM 8681  N N  . SER D 2 383 ? 128.599 92.803  38.557  1.00 64.63  ? 383 SER D N  1 
ATOM 8682  C CA . SER D 2 383 ? 129.045 91.598  37.892  1.00 64.63  ? 383 SER D CA 1 
ATOM 8683  C C  . SER D 2 383 ? 127.845 90.719  37.626  1.00 64.63  ? 383 SER D C  1 
ATOM 8684  O O  . SER D 2 383 ? 126.864 90.736  38.370  1.00 64.63  ? 383 SER D O  1 
ATOM 8685  N N  . GLY D 2 384 ? 127.901 89.981  36.539  1.00 60.53  ? 384 GLY D N  1 
ATOM 8686  C CA . GLY D 2 384 ? 126.824 89.063  36.281  1.00 60.53  ? 384 GLY D CA 1 
ATOM 8687  C C  . GLY D 2 384 ? 125.741 89.679  35.435  1.00 60.53  ? 384 GLY D C  1 
ATOM 8688  O O  . GLY D 2 384 ? 125.283 89.043  34.478  1.00 60.53  ? 384 GLY D O  1 
ATOM 8689  N N  . GLN D 2 385 ? 125.326 90.902  35.810  1.00 56.03  ? 385 GLN D N  1 
ATOM 8690  C CA . GLN D 2 385 ? 124.470 91.738  34.977  1.00 56.03  ? 385 GLN D CA 1 
ATOM 8691  C C  . GLN D 2 385 ? 124.966 91.793  33.553  1.00 56.03  ? 385 GLN D C  1 
ATOM 8692  O O  . GLN D 2 385 ? 124.193 91.619  32.612  1.00 56.03  ? 385 GLN D O  1 
ATOM 8693  N N  . ILE D 2 386 ? 126.268 91.986  33.378  1.00 63.04  ? 386 ILE D N  1 
ATOM 8694  C CA . ILE D 2 386 ? 126.796 92.063  32.031  1.00 63.04  ? 386 ILE D CA 1 
ATOM 8695  C C  . ILE D 2 386 ? 126.889 90.680  31.401  1.00 63.04  ? 386 ILE D C  1 
ATOM 8696  O O  . ILE D 2 386 ? 126.840 90.548  30.172  1.00 63.04  ? 386 ILE D O  1 
ATOM 8697  N N  . LEU D 2 387 ? 126.961 89.618  32.202  1.00 63.56  ? 387 LEU D N  1 
ATOM 8698  C CA . LEU D 2 387 ? 126.951 88.316  31.561  1.00 63.56  ? 387 LEU D CA 1 
ATOM 8699  C C  . LEU D 2 387 ? 125.539 87.790  31.444  1.00 63.56  ? 387 LEU D C  1 
ATOM 8700  O O  . LEU D 2 387 ? 125.278 86.900  30.633  1.00 63.56  ? 387 LEU D O  1 
ATOM 8701  N N  . ALA D 2 388 ? 124.624 88.313  32.240  1.00 60.70  ? 388 ALA D N  1 
ATOM 8702  C CA . ALA D 2 388 ? 123.227 88.128  31.905  1.00 60.70  ? 388 ALA D CA 1 
ATOM 8703  C C  . ALA D 2 388 ? 122.857 88.885  30.647  1.00 60.70  ? 388 ALA D C  1 
ATOM 8704  O O  . ALA D 2 388 ? 122.031 88.410  29.865  1.00 60.70  ? 388 ALA D O  1 
ATOM 8705  N N  . ASN D 2 389 ? 123.492 90.023  30.411  1.00 61.50  ? 389 ASN D N  1 
ATOM 8706  C CA . ASN D 2 389 ? 123.458 90.683  29.123  1.00 61.50  ? 389 ASN D CA 1 
ATOM 8707  C C  . ASN D 2 389 ? 124.412 90.054  28.125  1.00 61.50  ? 389 ASN D C  1 
ATOM 8708  O O  . ASN D 2 389 ? 124.591 90.596  27.032  1.00 61.50  ? 389 ASN D O  1 
ATOM 8709  N N  . PHE D 2 390 ? 125.044 88.952  28.483  1.00 66.16  ? 390 PHE D N  1 
ATOM 8710  C CA . PHE D 2 390 ? 125.540 88.005  27.510  1.00 66.16  ? 390 PHE D CA 1 
ATOM 8711  C C  . PHE D 2 390 ? 124.643 86.801  27.351  1.00 66.16  ? 390 PHE D C  1 
ATOM 8712  O O  . PHE D 2 390 ? 124.463 86.326  26.233  1.00 66.16  ? 390 PHE D O  1 
ATOM 8713  N N  . LYS D 2 391 ? 124.087 86.285  28.434  1.00 64.91  ? 391 LYS D N  1 
ATOM 8714  C CA . LYS D 2 391 ? 123.434 84.993  28.397  1.00 64.91  ? 391 LYS D CA 1 
ATOM 8715  C C  . LYS D 2 391 ? 122.071 85.035  27.734  1.00 64.91  ? 391 LYS D C  1 
ATOM 8716  O O  . LYS D 2 391 ? 121.744 84.117  26.981  1.00 64.91  ? 391 LYS D O  1 
ATOM 8717  N N  . ALA D 2 392 ? 121.295 86.092  27.948  1.00 68.50  ? 392 ALA D N  1 
ATOM 8718  C CA . ALA D 2 392 ? 119.896 86.110  27.549  1.00 68.50  ? 392 ALA D CA 1 
ATOM 8719  C C  . ALA D 2 392 ? 119.688 86.147  26.050  1.00 68.50  ? 392 ALA D C  1 
ATOM 8720  O O  . ALA D 2 392 ? 118.778 85.493  25.544  1.00 68.50  ? 392 ALA D O  1 
ATOM 8721  N N  . MET D 2 393 ? 120.524 86.867  25.340  1.00 72.94  ? 393 MET D N  1 
ATOM 8722  C CA . MET D 2 393 ? 120.352 87.112  23.925  1.00 72.94  ? 393 MET D CA 1 
ATOM 8723  C C  . MET D 2 393 ? 121.256 86.244  23.081  1.00 72.94  ? 393 MET D C  1 
ATOM 8724  O O  . MET D 2 393 ? 121.190 86.318  21.852  1.00 72.94  ? 393 MET D O  1 
ATOM 8725  N N  . ASP D 2 394 ? 122.069 85.402  23.712  1.00 82.75  ? 394 ASP D N  1 
ATOM 8726  C CA . ASP D 2 394 ? 122.662 84.261  23.035  1.00 82.75  ? 394 ASP D CA 1 
ATOM 8727  C C  . ASP D 2 394 ? 121.719 83.075  22.993  1.00 82.75  ? 394 ASP D C  1 
ATOM 8728  O O  . ASP D 2 394 ? 122.170 81.946  22.789  1.00 82.75  ? 394 ASP D O  1 
ATOM 8729  N N  . SER D 2 395 ? 120.431 83.305  23.215  1.00 88.18  ? 395 SER D N  1 
ATOM 8730  C CA . SER D 2 395 ? 119.395 82.305  23.071  1.00 88.18  ? 395 SER D CA 1 
ATOM 8731  C C  . SER D 2 395 ? 118.135 82.971  22.540  1.00 88.18  ? 395 SER D C  1 
ATOM 8732  O O  . SER D 2 395 ? 118.057 84.194  22.399  1.00 88.18  ? 395 SER D O  1 
ATOM 8733  N N  . ASP D 2 396 ? 117.142 82.139  22.259  1.00 83.46  ? 396 ASP D N  1 
ATOM 8734  C CA . ASP D 2 396 ? 115.838 82.586  21.815  1.00 83.46  ? 396 ASP D CA 1 
ATOM 8735  C C  . ASP D 2 396 ? 114.996 82.980  23.021  1.00 83.46  ? 396 ASP D C  1 
ATOM 8736  O O  . ASP D 2 396 ? 115.511 83.290  24.097  1.00 83.46  ? 396 ASP D O  1 
ATOM 8737  N N  . TRP D 2 397 ? 113.689 83.093  22.796  1.00 78.07  ? 397 TRP D N  1 
ATOM 8738  C CA . TRP D 2 397 ? 112.607 83.240  23.774  1.00 78.07  ? 397 TRP D CA 1 
ATOM 8739  C C  . TRP D 2 397 ? 112.608 84.624  24.425  1.00 78.07  ? 397 TRP D C  1 
ATOM 8740  O O  . TRP D 2 397 ? 111.587 85.021  24.988  1.00 78.07  ? 397 TRP D O  1 
ATOM 8741  N N  . PHE D 2 398 ? 113.648 85.423  24.269  1.00 73.86  ? 398 PHE D N  1 
ATOM 8742  C CA . PHE D 2 398 ? 113.654 86.698  24.956  1.00 73.86  ? 398 PHE D CA 1 
ATOM 8743  C C  . PHE D 2 398 ? 113.489 87.859  24.011  1.00 73.86  ? 398 PHE D C  1 
ATOM 8744  O O  . PHE D 2 398 ? 112.783 88.815  24.342  1.00 73.86  ? 398 PHE D O  1 
ATOM 8745  N N  . ALA D 2 399 ? 114.129 87.801  22.850  1.00 91.33  ? 399 ALA D N  1 
ATOM 8746  C CA . ALA D 2 399 ? 113.707 88.659  21.760  1.00 91.33  ? 399 ALA D CA 1 
ATOM 8747  C C  . ALA D 2 399 ? 112.303 88.280  21.326  1.00 91.33  ? 399 ALA D C  1 
ATOM 8748  O O  . ALA D 2 399 ? 111.462 89.152  21.077  1.00 91.33  ? 399 ALA D O  1 
ATOM 8749  N N  . GLU D 2 400 ? 112.020 86.980  21.295  1.00 85.95  ? 400 GLU D N  1 
ATOM 8750  C CA . GLU D 2 400 ? 110.650 86.504  21.217  1.00 85.95  ? 400 GLU D CA 1 
ATOM 8751  C C  . GLU D 2 400 ? 109.892 86.992  22.438  1.00 85.95  ? 400 GLU D C  1 
ATOM 8752  O O  . GLU D 2 400 ? 110.472 87.140  23.516  1.00 85.95  ? 400 GLU D O  1 
ATOM 8753  N N  . ASN D 2 401 ? 108.627 87.342  22.239  1.00 77.75  ? 401 ASN D N  1 
ATOM 8754  C CA . ASN D 2 401 ? 107.671 87.787  23.246  1.00 77.75  ? 401 ASN D CA 1 
ATOM 8755  C C  . ASN D 2 401 ? 108.040 89.118  23.893  1.00 77.75  ? 401 ASN D C  1 
ATOM 8756  O O  . ASN D 2 401 ? 107.388 89.488  24.874  1.00 77.75  ? 401 ASN D O  1 
ATOM 8757  N N  . TYR D 2 402 ? 109.062 89.836  23.424  1.00 75.22  ? 402 TYR D N  1 
ATOM 8758  C CA . TYR D 2 402 ? 109.288 91.193  23.915  1.00 75.22  ? 402 TYR D CA 1 
ATOM 8759  C C  . TYR D 2 402 ? 109.599 92.107  22.743  1.00 75.22  ? 402 TYR D C  1 
ATOM 8760  O O  . TYR D 2 402 ? 109.811 93.302  22.945  1.00 75.22  ? 402 TYR D O  1 
ATOM 8761  N N  . MET D 2 403 ? 109.615 91.539  21.538  1.00 89.06  ? 403 MET D N  1 
ATOM 8762  C CA . MET D 2 403 ? 109.442 92.229  20.261  1.00 89.06  ? 403 MET D CA 1 
ATOM 8763  C C  . MET D 2 403 ? 109.178 91.108  19.265  1.00 89.06  ? 403 MET D C  1 
ATOM 8764  O O  . MET D 2 403 ? 109.054 89.952  19.675  1.00 89.06  ? 403 MET D O  1 
ATOM 8765  N N  . GLY D 2 404 ? 109.130 91.398  17.975  1.00 100.24 ? 404 GLY D N  1 
ATOM 8766  C CA . GLY D 2 404 ? 108.676 90.404  17.019  1.00 100.24 ? 404 GLY D CA 1 
ATOM 8767  C C  . GLY D 2 404 ? 109.752 89.957  16.057  1.00 100.24 ? 404 GLY D C  1 
ATOM 8768  O O  . GLY D 2 404 ? 110.282 90.752  15.278  1.00 100.24 ? 404 GLY D O  1 
ATOM 8769  N N  . ARG D 2 405 ? 110.074 88.660  16.122  1.00 102.18 ? 405 ARG D N  1 
ATOM 8770  C CA . ARG D 2 405 ? 110.787 87.930  15.065  1.00 102.18 ? 405 ARG D CA 1 
ATOM 8771  C C  . ARG D 2 405 ? 112.191 88.476  14.791  1.00 102.18 ? 405 ARG D C  1 
ATOM 8772  O O  . ARG D 2 405 ? 112.435 89.209  13.830  1.00 102.18 ? 405 ARG D O  1 
ATOM 8773  N N  . LYS D 2 406 ? 113.093 88.209  15.722  1.00 99.90  ? 406 LYS D N  1 
ATOM 8774  C CA . LYS D 2 406 ? 114.527 88.232  15.489  1.00 99.90  ? 406 LYS D CA 1 
ATOM 8775  C C  . LYS D 2 406 ? 115.082 86.973  16.129  1.00 99.90  ? 406 LYS D C  1 
ATOM 8776  O O  . LYS D 2 406 ? 114.359 86.268  16.839  1.00 99.90  ? 406 LYS D O  1 
ATOM 8777  N N  . THR D 2 407 ? 116.337 86.667  15.845  1.00 116.65 ? 407 THR D N  1 
ATOM 8778  C CA . THR D 2 407 ? 117.047 85.599  16.530  1.00 116.65 ? 407 THR D CA 1 
ATOM 8779  C C  . THR D 2 407 ? 118.491 86.019  16.737  1.00 116.65 ? 407 THR D C  1 
ATOM 8780  O O  . THR D 2 407 ? 119.156 86.442  15.785  1.00 116.65 ? 407 THR D O  1 
ATOM 8781  N N  . LYS D 2 408 ? 118.938 85.968  17.995  1.00 108.94 ? 408 LYS D N  1 
ATOM 8782  C CA . LYS D 2 408 ? 120.349 86.067  18.376  1.00 108.94 ? 408 LYS D CA 1 
ATOM 8783  C C  . LYS D 2 408 ? 120.984 87.383  17.936  1.00 108.94 ? 408 LYS D C  1 
ATOM 8784  O O  . LYS D 2 408 ? 122.135 87.431  17.501  1.00 108.94 ? 408 LYS D O  1 
ATOM 8785  N N  . VAL D 2 409 ? 120.222 88.469  18.060  1.00 97.78  ? 409 VAL D N  1 
ATOM 8786  C CA . VAL D 2 409 ? 120.714 89.757  17.580  1.00 97.78  ? 409 VAL D CA 1 
ATOM 8787  C C  . VAL D 2 409 ? 121.740 90.338  18.536  1.00 97.78  ? 409 VAL D C  1 
ATOM 8788  O O  . VAL D 2 409 ? 122.423 91.316  18.218  1.00 97.78  ? 409 VAL D O  1 
ATOM 8789  N N  . GLY D 2 410 ? 121.863 89.758  19.718  1.00 92.94  ? 410 GLY D N  1 
ATOM 8790  C CA . GLY D 2 410 ? 123.060 89.979  20.490  1.00 92.94  ? 410 GLY D CA 1 
ATOM 8791  C C  . GLY D 2 410 ? 123.946 88.753  20.459  1.00 92.94  ? 410 GLY D C  1 
ATOM 8792  O O  . GLY D 2 410 ? 123.600 87.722  21.038  1.00 92.94  ? 410 GLY D O  1 
ATOM 8793  N N  . LEU D 2 411 ? 125.078 88.834  19.766  1.00 85.91  ? 411 LEU D N  1 
ATOM 8794  C CA . LEU D 2 411 ? 126.135 87.839  19.902  1.00 85.91  ? 411 LEU D CA 1 
ATOM 8795  C C  . LEU D 2 411 ? 127.449 88.595  20.048  1.00 85.91  ? 411 LEU D C  1 
ATOM 8796  O O  . LEU D 2 411 ? 128.144 88.822  19.039  1.00 85.91  ? 411 LEU D O  1 
ATOM 8797  N N  . PRO D 2 412 ? 127.812 89.052  21.242  1.00 71.84  ? 412 PRO D N  1 
ATOM 8798  C CA . PRO D 2 412 ? 129.142 89.610  21.431  1.00 71.84  ? 412 PRO D CA 1 
ATOM 8799  C C  . PRO D 2 412 ? 130.153 88.505  21.665  1.00 71.84  ? 412 PRO D C  1 
ATOM 8800  O O  . PRO D 2 412 ? 129.980 87.660  22.555  1.00 71.84  ? 412 PRO D O  1 
ATOM 8801  N N  . PRO D 2 413 ? 131.221 88.461  20.868  1.00 70.33  ? 413 PRO D N  1 
ATOM 8802  C CA . PRO D 2 413 ? 132.128 87.310  20.923  1.00 70.33  ? 413 PRO D CA 1 
ATOM 8803  C C  . PRO D 2 413 ? 133.125 87.345  22.061  1.00 70.33  ? 413 PRO D C  1 
ATOM 8804  O O  . PRO D 2 413 ? 134.071 86.546  22.022  1.00 70.33  ? 413 PRO D O  1 
ATOM 8805  N N  . LEU D 2 414 ? 133.025 88.313  22.982  1.00 74.38  ? 414 LEU D N  1 
ATOM 8806  C CA . LEU D 2 414 ? 133.733 88.346  24.279  1.00 74.38  ? 414 LEU D CA 1 
ATOM 8807  C C  . LEU D 2 414 ? 135.222 88.677  24.141  1.00 74.38  ? 414 LEU D C  1 
ATOM 8808  O O  . LEU D 2 414 ? 135.895 89.032  25.108  1.00 74.38  ? 414 LEU D O  1 
ATOM 8809  N N  . GLU D 2 415 ? 135.727 88.636  22.915  1.00 73.78  ? 415 GLU D N  1 
ATOM 8810  C CA . GLU D 2 415 ? 137.144 88.858  22.678  1.00 73.78  ? 415 GLU D CA 1 
ATOM 8811  C C  . GLU D 2 415 ? 137.365 90.334  22.458  1.00 73.78  ? 415 GLU D C  1 
ATOM 8812  O O  . GLU D 2 415 ? 138.393 90.891  22.844  1.00 73.78  ? 415 GLU D O  1 
ATOM 8813  N N  . LYS D 2 416 ? 136.384 90.976  21.854  1.00 71.26  ? 416 LYS D N  1 
ATOM 8814  C CA . LYS D 2 416 ? 136.483 92.373  21.473  1.00 71.26  ? 416 LYS D CA 1 
ATOM 8815  C C  . LYS D 2 416 ? 135.732 93.216  22.491  1.00 71.26  ? 416 LYS D C  1 
ATOM 8816  O O  . LYS D 2 416 ? 135.251 94.313  22.207  1.00 71.26  ? 416 LYS D O  1 
ATOM 8817  N N  . PHE D 2 417 ? 135.649 92.683  23.701  1.00 64.05  ? 417 PHE D N  1 
ATOM 8818  C CA . PHE D 2 417 ? 134.936 93.278  24.814  1.00 64.05  ? 417 PHE D CA 1 
ATOM 8819  C C  . PHE D 2 417 ? 135.917 94.144  25.610  1.00 64.05  ? 417 PHE D C  1 
ATOM 8820  O O  . PHE D 2 417 ? 136.935 94.590  25.080  1.00 64.05  ? 417 PHE D O  1 
ATOM 8821  N N  . ASN D 2 418 ? 135.630 94.345  26.889  1.00 55.76  ? 418 ASN D N  1 
ATOM 8822  C CA . ASN D 2 418 ? 136.014 95.464  27.732  1.00 55.76  ? 418 ASN D CA 1 
ATOM 8823  C C  . ASN D 2 418 ? 137.479 95.525  28.124  1.00 55.76  ? 418 ASN D C  1 
ATOM 8824  O O  . ASN D 2 418 ? 137.788 95.941  29.243  1.00 55.76  ? 418 ASN D O  1 
ATOM 8825  N N  . ASN D 2 419 ? 138.371 95.010  27.267  1.00 58.62  ? 419 ASN D N  1 
ATOM 8826  C CA . ASN D 2 419 ? 139.812 94.835  27.458  1.00 58.62  ? 419 ASN D CA 1 
ATOM 8827  C C  . ASN D 2 419 ? 140.528 95.941  28.226  1.00 58.62  ? 419 ASN D C  1 
ATOM 8828  O O  . ASN D 2 419 ? 141.263 95.659  29.172  1.00 58.62  ? 419 ASN D O  1 
ATOM 8829  N N  . TRP D 2 420 ? 140.298 97.197  27.877  1.00 58.86  ? 420 TRP D N  1 
ATOM 8830  C CA . TRP D 2 420 ? 140.706 98.245  28.796  1.00 58.86  ? 420 TRP D CA 1 
ATOM 8831  C C  . TRP D 2 420 ? 139.570 98.323  29.792  1.00 58.86  ? 420 TRP D C  1 
ATOM 8832  O O  . TRP D 2 420 ? 138.504 98.831  29.437  1.00 58.86  ? 420 TRP D O  1 
ATOM 8833  N N  . GLY D 2 421 ? 139.755 97.741  30.979  1.00 56.50  ? 421 GLY D N  1 
ATOM 8834  C CA . GLY D 2 421 ? 138.717 97.498  31.973  1.00 56.50  ? 421 GLY D CA 1 
ATOM 8835  C C  . GLY D 2 421 ? 137.708 98.591  32.255  1.00 56.50  ? 421 GLY D C  1 
ATOM 8836  O O  . GLY D 2 421 ? 138.082 99.706  32.622  1.00 56.50  ? 421 GLY D O  1 
ATOM 8837  N N  . GLY D 2 422 ? 136.426 98.275  32.084  1.00 55.43  ? 422 GLY D N  1 
ATOM 8838  C CA . GLY D 2 422 ? 135.371 99.269  32.127  1.00 55.43  ? 422 GLY D CA 1 
ATOM 8839  C C  . GLY D 2 422 ? 134.925 99.567  33.540  1.00 55.43  ? 422 GLY D C  1 
ATOM 8840  O O  . GLY D 2 422 ? 135.748 99.938  34.377  1.00 55.43  ? 422 GLY D O  1 
ATOM 8841  N N  . SER D 2 423 ? 133.636 99.438  33.833  1.00 55.29  ? 423 SER D N  1 
ATOM 8842  C CA . SER D 2 423 ? 133.245 99.558  35.225  1.00 55.29  ? 423 SER D CA 1 
ATOM 8843  C C  . SER D 2 423 ? 133.683 98.311  35.986  1.00 55.29  ? 423 SER D C  1 
ATOM 8844  O O  . SER D 2 423 ? 134.050 97.294  35.392  1.00 55.29  ? 423 SER D O  1 
ATOM 8845  N N  . LEU D 2 424 ? 133.699 98.446  37.322  1.00 56.91  ? 424 LEU D N  1 
ATOM 8846  C CA . LEU D 2 424 ? 134.319 97.581  38.336  1.00 56.91  ? 424 LEU D CA 1 
ATOM 8847  C C  . LEU D 2 424 ? 135.836 97.618  38.299  1.00 56.91  ? 424 LEU D C  1 
ATOM 8848  O O  . LEU D 2 424 ? 136.493 97.055  39.177  1.00 56.91  ? 424 LEU D O  1 
ATOM 8849  N N  . SER D 2 425 ? 136.412 98.277  37.309  1.00 58.43  ? 425 SER D N  1 
ATOM 8850  C CA . SER D 2 425 ? 137.856 98.340  37.231  1.00 58.43  ? 425 SER D CA 1 
ATOM 8851  C C  . SER D 2 425 ? 138.342 99.552  37.998  1.00 58.43  ? 425 SER D C  1 
ATOM 8852  O O  . SER D 2 425 ? 139.059 99.429  38.993  1.00 58.43  ? 425 SER D O  1 
ATOM 8853  N N  . LEU D 2 426 ? 137.910 100.721 37.571  1.00 47.73  ? 426 LEU D N  1 
ATOM 8854  C CA . LEU D 2 426 ? 138.281 101.965 38.212  1.00 47.73  ? 426 LEU D CA 1 
ATOM 8855  C C  . LEU D 2 426 ? 137.057 102.682 38.761  1.00 47.73  ? 426 LEU D C  1 
ATOM 8856  O O  . LEU D 2 426 ? 136.984 103.907 38.760  1.00 47.73  ? 426 LEU D O  1 
ATOM 8857  N N  . GLY D 2 427 ? 136.093 101.921 39.240  1.00 50.12  ? 427 GLY D N  1 
ATOM 8858  C CA . GLY D 2 427 ? 134.940 102.494 39.889  1.00 50.12  ? 427 GLY D CA 1 
ATOM 8859  C C  . GLY D 2 427 ? 133.879 102.960 38.926  1.00 50.12  ? 427 GLY D C  1 
ATOM 8860  O O  . GLY D 2 427 ? 134.097 103.186 37.736  1.00 50.12  ? 427 GLY D O  1 
ATOM 8861  N N  . HIS D 2 428 ? 132.701 103.116 39.481  1.00 50.08  ? 428 HIS D N  1 
ATOM 8862  C CA . HIS D 2 428 ? 131.528 103.572 38.739  1.00 50.08  ? 428 HIS D CA 1 
ATOM 8863  C C  . HIS D 2 428 ? 131.001 104.808 39.426  1.00 50.08  ? 428 HIS D C  1 
ATOM 8864  O O  . HIS D 2 428 ? 130.321 104.714 40.459  1.00 50.08  ? 428 HIS D O  1 
ATOM 8865  N N  . PRO D 2 429 ? 131.371 105.988 38.952  1.00 46.39  ? 429 PRO D N  1 
ATOM 8866  C CA . PRO D 2 429 ? 130.680 107.195 39.388  1.00 46.39  ? 429 PRO D CA 1 
ATOM 8867  C C  . PRO D 2 429 ? 129.234 107.140 38.948  1.00 46.39  ? 429 PRO D C  1 
ATOM 8868  O O  . PRO D 2 429 ? 128.888 106.550 37.926  1.00 46.39  ? 429 PRO D O  1 
ATOM 8869  N N  . PHE D 2 430 ? 128.380 107.763 39.751  1.00 46.70  ? 430 PHE D N  1 
ATOM 8870  C CA . PHE D 2 430 ? 126.950 107.512 39.646  1.00 46.70  ? 430 PHE D CA 1 
ATOM 8871  C C  . PHE D 2 430 ? 126.315 108.251 38.483  1.00 46.70  ? 430 PHE D C  1 
ATOM 8872  O O  . PHE D 2 430 ? 125.282 107.809 37.981  1.00 46.70  ? 430 PHE D O  1 
ATOM 8873  N N  . GLY D 2 431 ? 126.913 109.349 38.046  1.00 40.13  ? 431 GLY D N  1 
ATOM 8874  C CA . GLY D 2 431 ? 126.444 110.118 36.914  1.00 40.13  ? 431 GLY D CA 1 
ATOM 8875  C C  . GLY D 2 431 ? 127.571 110.675 36.068  1.00 40.13  ? 431 GLY D C  1 
ATOM 8876  O O  . GLY D 2 431 ? 127.446 111.764 35.510  1.00 40.13  ? 431 GLY D O  1 
ATOM 8877  N N  . ALA D 2 432 ? 128.689 109.971 35.980  1.00 40.89  ? 432 ALA D N  1 
ATOM 8878  C CA . ALA D 2 432 ? 129.786 110.476 35.167  1.00 40.89  ? 432 ALA D CA 1 
ATOM 8879  C C  . ALA D 2 432 ? 130.366 109.425 34.238  1.00 40.89  ? 432 ALA D C  1 
ATOM 8880  O O  . ALA D 2 432 ? 131.231 109.757 33.419  1.00 40.89  ? 432 ALA D O  1 
ATOM 8881  N N  . THR D 2 433 ? 129.939 108.177 34.346  1.00 45.68  ? 433 THR D N  1 
ATOM 8882  C CA . THR D 2 433 ? 130.344 107.195 33.368  1.00 45.68  ? 433 THR D CA 1 
ATOM 8883  C C  . THR D 2 433 ? 129.668 107.493 32.043  1.00 45.68  ? 433 THR D C  1 
ATOM 8884  O O  . THR D 2 433 ? 128.652 108.179 31.972  1.00 45.68  ? 433 THR D O  1 
ATOM 8885  N N  . GLY D 2 434 ? 130.229 106.947 30.984  1.00 43.53  ? 434 GLY D N  1 
ATOM 8886  C CA . GLY D 2 434 ? 129.788 107.338 29.671  1.00 43.53  ? 434 GLY D CA 1 
ATOM 8887  C C  . GLY D 2 434 ? 130.741 108.364 29.111  1.00 43.53  ? 434 GLY D C  1 
ATOM 8888  O O  . GLY D 2 434 ? 131.372 108.131 28.078  1.00 43.53  ? 434 GLY D O  1 
ATOM 8889  N N  . CYS D 2 435 ? 130.902 109.489 29.806  1.00 37.83  ? 435 CYS D N  1 
ATOM 8890  C CA . CYS D 2 435 ? 131.891 110.460 29.360  1.00 37.83  ? 435 CYS D CA 1 
ATOM 8891  C C  . CYS D 2 435 ? 133.285 110.110 29.848  1.00 37.83  ? 435 CYS D C  1 
ATOM 8892  O O  . CYS D 2 435 ? 134.206 110.909 29.694  1.00 37.83  ? 435 CYS D O  1 
ATOM 8893  N N  . ARG D 2 436 ? 133.449 108.962 30.494  1.00 40.06  ? 436 ARG D N  1 
ATOM 8894  C CA . ARG D 2 436 ? 134.677 108.217 30.278  1.00 40.06  ? 436 ARG D CA 1 
ATOM 8895  C C  . ARG D 2 436 ? 134.603 107.426 28.984  1.00 40.06  ? 436 ARG D C  1 
ATOM 8896  O O  . ARG D 2 436 ? 135.537 107.478 28.179  1.00 40.06  ? 436 ARG D O  1 
ATOM 8897  N N  . LEU D 2 437 ? 133.488 106.735 28.750  1.00 38.79  ? 437 LEU D N  1 
ATOM 8898  C CA . LEU D 2 437 ? 133.459 105.559 27.893  1.00 38.79  ? 437 LEU D CA 1 
ATOM 8899  C C  . LEU D 2 437 ? 133.716 105.854 26.433  1.00 38.79  ? 437 LEU D C  1 
ATOM 8900  O O  . LEU D 2 437 ? 134.201 104.976 25.716  1.00 38.79  ? 437 LEU D O  1 
ATOM 8901  N N  . VAL D 2 438 ? 133.490 107.083 25.989  1.00 31.00  ? 438 VAL D N  1 
ATOM 8902  C CA . VAL D 2 438 ? 133.622 107.351 24.569  1.00 31.00  ? 438 VAL D CA 1 
ATOM 8903  C C  . VAL D 2 438 ? 135.082 107.399 24.155  1.00 31.00  ? 438 VAL D C  1 
ATOM 8904  O O  . VAL D 2 438 ? 135.463 106.826 23.130  1.00 31.00  ? 438 VAL D O  1 
ATOM 8905  N N  . MET D 2 439 ? 135.937 108.016 24.964  1.00 37.86  ? 439 MET D N  1 
ATOM 8906  C CA . MET D 2 439 ? 137.360 108.001 24.635  1.00 37.86  ? 439 MET D CA 1 
ATOM 8907  C C  . MET D 2 439 ? 137.959 106.629 24.867  1.00 37.86  ? 439 MET D C  1 
ATOM 8908  O O  . MET D 2 439 ? 138.898 106.227 24.171  1.00 37.86  ? 439 MET D O  1 
ATOM 8909  N N  . ALA D 2 440 ? 137.402 105.882 25.817  1.00 40.47  ? 440 ALA D N  1 
ATOM 8910  C CA . ALA D 2 440 ? 137.815 104.505 26.012  1.00 40.47  ? 440 ALA D CA 1 
ATOM 8911  C C  . ALA D 2 440 ? 137.330 103.604 24.895  1.00 40.47  ? 440 ALA D C  1 
ATOM 8912  O O  . ALA D 2 440 ? 137.742 102.447 24.827  1.00 40.47  ? 440 ALA D O  1 
ATOM 8913  N N  . ALA D 2 441 ? 136.417 104.081 24.065  1.00 39.08  ? 441 ALA D N  1 
ATOM 8914  C CA . ALA D 2 441 ? 136.183 103.407 22.801  1.00 39.08  ? 441 ALA D CA 1 
ATOM 8915  C C  . ALA D 2 441 ? 137.130 103.930 21.730  1.00 39.08  ? 441 ALA D C  1 
ATOM 8916  O O  . ALA D 2 441 ? 137.670 103.158 20.934  1.00 39.08  ? 441 ALA D O  1 
ATOM 8917  N N  . ALA D 2 442 ? 137.364 105.242 21.729  1.00 43.92  ? 442 ALA D N  1 
ATOM 8918  C CA . ALA D 2 442 ? 138.006 105.901 20.598  1.00 43.92  ? 442 ALA D CA 1 
ATOM 8919  C C  . ALA D 2 442 ? 139.490 105.579 20.526  1.00 43.92  ? 442 ALA D C  1 
ATOM 8920  O O  . ALA D 2 442 ? 139.986 105.099 19.496  1.00 43.92  ? 442 ALA D O  1 
ATOM 8921  N N  . ASN D 2 443 ? 140.218 105.853 21.606  1.00 53.63  ? 443 ASN D N  1 
ATOM 8922  C CA . ASN D 2 443 ? 141.640 105.557 21.607  1.00 53.63  ? 443 ASN D CA 1 
ATOM 8923  C C  . ASN D 2 443 ? 141.887 104.065 21.533  1.00 53.63  ? 443 ASN D C  1 
ATOM 8924  O O  . ASN D 2 443 ? 142.877 103.630 20.935  1.00 53.63  ? 443 ASN D O  1 
ATOM 8925  N N  . ARG D 2 444 ? 140.940 103.285 22.045  1.00 58.06  ? 444 ARG D N  1 
ATOM 8926  C CA . ARG D 2 444 ? 141.006 101.842 21.935  1.00 58.06  ? 444 ARG D CA 1 
ATOM 8927  C C  . ARG D 2 444 ? 140.919 101.373 20.501  1.00 58.06  ? 444 ARG D C  1 
ATOM 8928  O O  . ARG D 2 444 ? 141.818 100.659 20.044  1.00 58.06  ? 444 ARG D O  1 
ATOM 8929  N N  . LEU D 2 445 ? 139.908 101.796 19.752  1.00 59.18  ? 445 LEU D N  1 
ATOM 8930  C CA . LEU D 2 445 ? 139.808 101.220 18.423  1.00 59.18  ? 445 LEU D CA 1 
ATOM 8931  C C  . LEU D 2 445 ? 140.771 101.891 17.456  1.00 59.18  ? 445 LEU D C  1 
ATOM 8932  O O  . LEU D 2 445 ? 141.024 101.355 16.373  1.00 59.18  ? 445 LEU D O  1 
ATOM 8933  N N  . ARG D 2 446 ? 141.346 103.032 17.832  1.00 58.45  ? 446 ARG D N  1 
ATOM 8934  C CA . ARG D 2 446 ? 142.514 103.495 17.093  1.00 58.45  ? 446 ARG D CA 1 
ATOM 8935  C C  . ARG D 2 446 ? 143.720 102.598 17.356  1.00 58.45  ? 446 ARG D C  1 
ATOM 8936  O O  . ARG D 2 446 ? 144.518 102.348 16.444  1.00 58.45  ? 446 ARG D O  1 
ATOM 8937  N N  . LYS D 2 447 ? 143.858 102.099 18.592  1.00 62.09  ? 447 LYS D N  1 
ATOM 8938  C CA . LYS D 2 447 ? 145.063 101.367 18.982  1.00 62.09  ? 447 LYS D CA 1 
ATOM 8939  C C  . LYS D 2 447 ? 145.216 100.066 18.206  1.00 62.09  ? 447 LYS D C  1 
ATOM 8940  O O  . LYS D 2 447 ? 146.293 99.780  17.672  1.00 62.09  ? 447 LYS D O  1 
ATOM 8941  N N  . GLU D 2 448 ? 144.160 99.275  18.116  1.00 73.48  ? 448 GLU D N  1 
ATOM 8942  C CA . GLU D 2 448 ? 144.147 98.173  17.168  1.00 73.48  ? 448 GLU D CA 1 
ATOM 8943  C C  . GLU D 2 448 ? 143.560 98.669  15.854  1.00 73.48  ? 448 GLU D C  1 
ATOM 8944  O O  . GLU D 2 448 ? 143.412 99.870  15.628  1.00 73.48  ? 448 GLU D O  1 
ATOM 8945  N N  . GLY D 2 449 ? 143.225 97.746  14.961  1.00 90.37  ? 449 GLY D N  1 
ATOM 8946  C CA . GLY D 2 449 ? 142.498 98.072  13.757  1.00 90.37  ? 449 GLY D CA 1 
ATOM 8947  C C  . GLY D 2 449 ? 141.016 98.250  14.010  1.00 90.37  ? 449 GLY D C  1 
ATOM 8948  O O  . GLY D 2 449 ? 140.566 98.529  15.121  1.00 90.37  ? 449 GLY D O  1 
ATOM 8949  N N  . GLY D 2 450 ? 140.245 98.081  12.947  1.00 96.49  ? 450 GLY D N  1 
ATOM 8950  C CA . GLY D 2 450 ? 138.811 98.240  13.040  1.00 96.49  ? 450 GLY D CA 1 
ATOM 8951  C C  . GLY D 2 450 ? 138.406 99.682  12.845  1.00 96.49  ? 450 GLY D C  1 
ATOM 8952  O O  . GLY D 2 450 ? 139.224 100.600 12.843  1.00 96.49  ? 450 GLY D O  1 
ATOM 8953  N N  . GLN D 2 451 ? 137.108 99.883  12.640  1.00 79.38  ? 451 GLN D N  1 
ATOM 8954  C CA . GLN D 2 451 ? 136.626 101.238 12.422  1.00 79.38  ? 451 GLN D CA 1 
ATOM 8955  C C  . GLN D 2 451 ? 135.334 101.594 13.132  1.00 79.38  ? 451 GLN D C  1 
ATOM 8956  O O  . GLN D 2 451 ? 135.078 102.787 13.301  1.00 79.38  ? 451 GLN D O  1 
ATOM 8957  N N  . TYR D 2 452 ? 134.507 100.651 13.559  1.00 73.08  ? 452 TYR D N  1 
ATOM 8958  C CA . TYR D 2 452 ? 133.264 100.989 14.231  1.00 73.08  ? 452 TYR D CA 1 
ATOM 8959  C C  . TYR D 2 452 ? 133.268 100.424 15.640  1.00 73.08  ? 452 TYR D C  1 
ATOM 8960  O O  . TYR D 2 452 ? 134.085 99.565  15.973  1.00 73.08  ? 452 TYR D O  1 
ATOM 8961  N N  . GLY D 2 453 ? 132.345 100.904 16.468  1.00 56.29  ? 453 GLY D N  1 
ATOM 8962  C CA . GLY D 2 453 ? 132.154 100.286 17.768  1.00 56.29  ? 453 GLY D CA 1 
ATOM 8963  C C  . GLY D 2 453 ? 131.045 100.911 18.585  1.00 56.29  ? 453 GLY D C  1 
ATOM 8964  O O  . GLY D 2 453 ? 130.946 102.133 18.635  1.00 56.29  ? 453 GLY D O  1 
ATOM 8965  N N  . LEU D 2 454 ? 130.207 100.115 19.234  1.00 45.60  ? 454 LEU D N  1 
ATOM 8966  C CA . LEU D 2 454 ? 129.081 100.662 19.970  1.00 45.60  ? 454 LEU D CA 1 
ATOM 8967  C C  . LEU D 2 454 ? 129.413 100.792 21.443  1.00 45.60  ? 454 LEU D C  1 
ATOM 8968  O O  . LEU D 2 454 ? 130.103 99.946  22.012  1.00 45.60  ? 454 LEU D O  1 
ATOM 8969  N N  . VAL D 2 455 ? 128.907 101.854 22.051  1.00 38.76  ? 455 VAL D N  1 
ATOM 8970  C CA . VAL D 2 455 ? 128.913 102.035 23.493  1.00 38.76  ? 455 VAL D CA 1 
ATOM 8971  C C  . VAL D 2 455 ? 127.473 102.007 23.971  1.00 38.76  ? 455 VAL D C  1 
ATOM 8972  O O  . VAL D 2 455 ? 126.588 102.609 23.353  1.00 38.76  ? 455 VAL D O  1 
ATOM 8973  N N  . ALA D 2 456 ? 127.233 101.277 25.056  1.00 37.97  ? 456 ALA D N  1 
ATOM 8974  C CA . ALA D 2 456 ? 125.891 101.070 25.562  1.00 37.97  ? 456 ALA D CA 1 
ATOM 8975  C C  . ALA D 2 456 ? 125.950 100.961 27.073  1.00 37.97  ? 456 ALA D C  1 
ATOM 8976  O O  . ALA D 2 456 ? 126.865 100.348 27.624  1.00 37.97  ? 456 ALA D O  1 
ATOM 8977  N N  . ALA D 2 457 ? 124.951 101.535 27.729  1.00 38.68  ? 457 ALA D N  1 
ATOM 8978  C CA . ALA D 2 457 ? 124.957 101.651 29.174  1.00 38.68  ? 457 ALA D CA 1 
ATOM 8979  C C  . ALA D 2 457 ? 123.542 101.512 29.702  1.00 38.68  ? 457 ALA D C  1 
ATOM 8980  O O  . ALA D 2 457 ? 122.566 101.793 29.004  1.00 38.68  ? 457 ALA D O  1 
ATOM 8981  N N  . CYS D 2 458 ? 123.445 101.096 30.959  1.00 47.57  ? 458 CYS D N  1 
ATOM 8982  C CA . CYS D 2 458 ? 122.171 100.867 31.618  1.00 47.57  ? 458 CYS D CA 1 
ATOM 8983  C C  . CYS D 2 458 ? 122.029 101.875 32.736  1.00 47.57  ? 458 CYS D C  1 
ATOM 8984  O O  . CYS D 2 458 ? 123.030 102.312 33.304  1.00 47.57  ? 458 CYS D O  1 
ATOM 8985  N N  . ALA D 2 459 ? 120.800 102.254 33.039  1.00 52.83  ? 459 ALA D N  1 
ATOM 8986  C CA . ALA D 2 459 ? 120.548 103.295 34.017  1.00 52.83  ? 459 ALA D CA 1 
ATOM 8987  C C  . ALA D 2 459 ? 119.548 102.831 35.061  1.00 52.83  ? 459 ALA D C  1 
ATOM 8988  O O  . ALA D 2 459 ? 118.698 101.978 34.800  1.00 52.83  ? 459 ALA D O  1 
ATOM 8989  N N  . ALA D 2 460 ? 119.646 103.430 36.240  1.00 50.69  ? 460 ALA D N  1 
ATOM 8990  C CA . ALA D 2 460 ? 118.753 103.136 37.354  1.00 50.69  ? 460 ALA D CA 1 
ATOM 8991  C C  . ALA D 2 460 ? 117.377 103.711 37.062  1.00 50.69  ? 460 ALA D C  1 
ATOM 8992  O O  . ALA D 2 460 ? 117.091 104.864 37.379  1.00 50.69  ? 460 ALA D O  1 
ATOM 8993  N N  . GLY D 2 461 ? 116.499 102.906 36.492  1.00 49.98  ? 461 GLY D N  1 
ATOM 8994  C CA . GLY D 2 461 ? 115.170 103.403 36.225  1.00 49.98  ? 461 GLY D CA 1 
ATOM 8995  C C  . GLY D 2 461 ? 114.604 102.841 34.948  1.00 49.98  ? 461 GLY D C  1 
ATOM 8996  O O  . GLY D 2 461 ? 113.433 103.052 34.625  1.00 49.98  ? 461 GLY D O  1 
ATOM 8997  N N  . GLY D 2 462 ? 115.435 102.128 34.207  1.00 56.38  ? 462 GLY D N  1 
ATOM 8998  C CA . GLY D 2 462 ? 115.000 101.423 33.032  1.00 56.38  ? 462 GLY D CA 1 
ATOM 8999  C C  . GLY D 2 462 ? 115.511 101.998 31.736  1.00 56.38  ? 462 GLY D C  1 
ATOM 9000  O O  . GLY D 2 462 ? 115.432 101.315 30.710  1.00 56.38  ? 462 GLY D O  1 
ATOM 9001  N N  . GLN D 2 463 ? 116.014 103.231 31.744  1.00 47.72  ? 463 GLN D N  1 
ATOM 9002  C CA . GLN D 2 463 ? 116.558 103.808 30.525  1.00 47.72  ? 463 GLN D CA 1 
ATOM 9003  C C  . GLN D 2 463 ? 117.825 103.098 30.107  1.00 47.72  ? 463 GLN D C  1 
ATOM 9004  O O  . GLN D 2 463 ? 118.671 102.765 30.936  1.00 47.72  ? 463 GLN D O  1 
ATOM 9005  N N  . GLY D 2 464 ? 117.961 102.879 28.805  1.00 43.45  ? 464 GLY D N  1 
ATOM 9006  C CA . GLY D 2 464 ? 119.183 102.379 28.229  1.00 43.45  ? 464 GLY D CA 1 
ATOM 9007  C C  . GLY D 2 464 ? 119.834 103.469 27.407  1.00 43.45  ? 464 GLY D C  1 
ATOM 9008  O O  . GLY D 2 464 ? 119.290 104.547 27.215  1.00 43.45  ? 464 GLY D O  1 
ATOM 9009  N N  . HIS D 2 465 ? 121.027 103.168 26.925  1.00 39.84  ? 465 HIS D N  1 
ATOM 9010  C CA . HIS D 2 465 ? 121.681 104.082 26.013  1.00 39.84  ? 465 HIS D CA 1 
ATOM 9011  C C  . HIS D 2 465 ? 122.589 103.284 25.107  1.00 39.84  ? 465 HIS D C  1 
ATOM 9012  O O  . HIS D 2 465 ? 123.278 102.382 25.574  1.00 39.84  ? 465 HIS D O  1 
ATOM 9013  N N  . ALA D 2 466 ? 122.614 103.635 23.830  1.00 43.05  ? 466 ALA D N  1 
ATOM 9014  C CA . ALA D 2 466 ? 123.436 102.907 22.879  1.00 43.05  ? 466 ALA D CA 1 
ATOM 9015  C C  . ALA D 2 466 ? 123.711 103.798 21.687  1.00 43.05  ? 466 ALA D C  1 
ATOM 9016  O O  . ALA D 2 466 ? 122.780 104.368 21.117  1.00 43.05  ? 466 ALA D O  1 
ATOM 9017  N N  . MET D 2 467 ? 124.977 103.910 21.311  1.00 47.14  ? 467 MET D N  1 
ATOM 9018  C CA . MET D 2 467 ? 125.344 104.746 20.179  1.00 47.14  ? 467 MET D CA 1 
ATOM 9019  C C  . MET D 2 467 ? 126.631 104.219 19.578  1.00 47.14  ? 467 MET D C  1 
ATOM 9020  O O  . MET D 2 467 ? 127.489 103.703 20.298  1.00 47.14  ? 467 MET D O  1 
ATOM 9021  N N  . ILE D 2 468 ? 126.750 104.306 18.268  1.00 44.95  ? 468 ILE D N  1 
ATOM 9022  C CA . ILE D 2 468 ? 127.925 103.789 17.588  1.00 44.95  ? 468 ILE D CA 1 
ATOM 9023  C C  . ILE D 2 468 ? 128.905 104.920 17.375  1.00 44.95  ? 468 ILE D C  1 
ATOM 9024  O O  . ILE D 2 468 ? 128.519 106.079 17.202  1.00 44.95  ? 468 ILE D O  1 
ATOM 9025  N N  . VAL D 2 469 ? 130.183 104.584 17.437  1.00 50.84  ? 469 VAL D N  1 
ATOM 9026  C CA . VAL D 2 469 ? 131.282 105.524 17.348  1.00 50.84  ? 469 VAL D CA 1 
ATOM 9027  C C  . VAL D 2 469 ? 132.241 104.984 16.303  1.00 50.84  ? 469 VAL D C  1 
ATOM 9028  O O  . VAL D 2 469 ? 132.602 103.802 16.333  1.00 50.84  ? 469 VAL D O  1 
ATOM 9029  N N  . GLU D 2 470 ? 132.640 105.834 15.376  1.00 60.43  ? 470 GLU D N  1 
ATOM 9030  C CA . GLU D 2 470 ? 133.426 105.439 14.225  1.00 60.43  ? 470 GLU D CA 1 
ATOM 9031  C C  . GLU D 2 470 ? 134.862 105.894 14.488  1.00 60.43  ? 470 GLU D C  1 
ATOM 9032  O O  . GLU D 2 470 ? 135.110 106.701 15.372  1.00 60.43  ? 470 GLU D O  1 
ATOM 9033  N N  . ALA D 2 471 ? 135.824 105.368 13.733  1.00 59.46  ? 471 ALA D N  1 
ATOM 9034  C CA . ALA D 2 471 ? 137.239 105.651 13.965  1.00 59.46  ? 471 ALA D CA 1 
ATOM 9035  C C  . ALA D 2 471 ? 137.655 107.019 13.447  1.00 59.46  ? 471 ALA D C  1 
ATOM 9036  O O  . ALA D 2 471 ? 136.807 107.835 13.080  1.00 59.46  ? 471 ALA D O  1 
ATOM 9037  N N  . TYR D 2 472 ? 138.958 107.286 13.415  1.00 59.31  ? 472 TYR D N  1 
ATOM 9038  C CA . TYR D 2 472 ? 139.399 108.610 13.045  1.00 59.31  ? 472 TYR D CA 1 
ATOM 9039  C C  . TYR D 2 472 ? 139.277 108.785 11.541  1.00 59.31  ? 472 TYR D C  1 
ATOM 9040  O O  . TYR D 2 472 ? 139.446 107.830 10.785  1.00 59.31  ? 472 TYR D O  1 
ATOM 9041  N N  . PRO D 2 473 ? 138.935 109.993 11.086  1.00 58.76  ? 473 PRO D N  1 
ATOM 9042  C CA . PRO D 2 473 ? 138.572 110.159 9.668   1.00 58.76  ? 473 PRO D CA 1 
ATOM 9043  C C  . PRO D 2 473 ? 139.732 110.006 8.699   1.00 58.76  ? 473 PRO D C  1 
ATOM 9044  O O  . PRO D 2 473 ? 139.511 109.878 7.489   1.00 58.76  ? 473 PRO D O  1 
ATOM 9045  N N  . LYS D 2 474 ? 140.961 109.994 9.191   1.00 69.23  ? 474 LYS D N  1 
ATOM 9046  C CA . LYS D 2 474 ? 142.097 109.703 8.335   1.00 69.23  ? 474 LYS D CA 1 
ATOM 9047  C C  . LYS D 2 474 ? 142.196 108.194 8.182   1.00 69.23  ? 474 LYS D C  1 
ATOM 9048  O O  . LYS D 2 474 ? 141.619 107.448 8.964   1.00 69.23  ? 474 LYS D O  1 
ATOM 9049  N N  . THR E 1 37  ? 150.994 177.363 132.543 1.00 106.43 ? 37  THR E N  1 
ATOM 9050  C CA . THR E 1 37  ? 151.855 176.304 133.046 1.00 106.43 ? 37  THR E CA 1 
ATOM 9051  C C  . THR E 1 37  ? 151.162 174.947 132.940 1.00 106.43 ? 37  THR E C  1 
ATOM 9052  O O  . THR E 1 37  ? 150.964 174.417 131.852 1.00 106.43 ? 37  THR E O  1 
ATOM 9053  N N  . ARG E 1 38  ? 150.807 174.376 134.085 1.00 95.94  ? 38  ARG E N  1 
ATOM 9054  C CA . ARG E 1 38  ? 150.069 173.123 134.141 1.00 95.94  ? 38  ARG E CA 1 
ATOM 9055  C C  . ARG E 1 38  ? 148.883 173.399 135.049 1.00 95.94  ? 38  ARG E C  1 
ATOM 9056  O O  . ARG E 1 38  ? 148.916 173.093 136.243 1.00 95.94  ? 38  ARG E O  1 
ATOM 9057  N N  . THR E 1 39  ? 147.838 173.979 134.478 1.00 96.24  ? 39  THR E N  1 
ATOM 9058  C CA . THR E 1 39  ? 146.649 174.309 135.245 1.00 96.24  ? 39  THR E CA 1 
ATOM 9059  C C  . THR E 1 39  ? 145.532 173.305 135.037 1.00 96.24  ? 39  THR E C  1 
ATOM 9060  O O  . THR E 1 39  ? 144.702 173.113 135.931 1.00 96.24  ? 39  THR E O  1 
ATOM 9061  N N  . HIS E 1 40  ? 145.486 172.671 133.872 1.00 92.19  ? 40  HIS E N  1 
ATOM 9062  C CA . HIS E 1 40  ? 144.430 171.720 133.579 1.00 92.19  ? 40  HIS E CA 1 
ATOM 9063  C C  . HIS E 1 40  ? 144.996 170.458 132.956 1.00 92.19  ? 40  HIS E C  1 
ATOM 9064  O O  . HIS E 1 40  ? 144.375 169.394 133.021 1.00 92.19  ? 40  HIS E O  1 
ATOM 9065  N N  . ILE E 1 41  ? 146.169 170.569 132.345 1.00 88.19  ? 41  ILE E N  1 
ATOM 9066  C CA . ILE E 1 41  ? 146.804 169.465 131.640 1.00 88.19  ? 41  ILE E CA 1 
ATOM 9067  C C  . ILE E 1 41  ? 148.176 169.242 132.255 1.00 88.19  ? 41  ILE E C  1 
ATOM 9068  O O  . ILE E 1 41  ? 148.871 170.200 132.603 1.00 88.19  ? 41  ILE E O  1 
ATOM 9069  N N  . ASN E 1 42  ? 148.560 167.979 132.391 1.00 82.58  ? 42  ASN E N  1 
ATOM 9070  C CA . ASN E 1 42  ? 149.854 167.627 132.944 1.00 82.58  ? 42  ASN E CA 1 
ATOM 9071  C C  . ASN E 1 42  ? 150.222 166.229 132.491 1.00 82.58  ? 42  ASN E C  1 
ATOM 9072  O O  . ASN E 1 42  ? 149.361 165.444 132.099 1.00 82.58  ? 42  ASN E O  1 
ATOM 9073  N N  . TYR E 1 43  ? 151.504 165.919 132.583 1.00 80.03  ? 43  TYR E N  1 
ATOM 9074  C CA . TYR E 1 43  ? 151.983 164.564 132.388 1.00 80.03  ? 43  TYR E CA 1 
ATOM 9075  C C  . TYR E 1 43  ? 153.079 164.261 133.386 1.00 80.03  ? 43  TYR E C  1 
ATOM 9076  O O  . TYR E 1 43  ? 153.455 165.091 134.209 1.00 80.03  ? 43  TYR E O  1 
ATOM 9077  N N  . GLY E 1 44  ? 153.613 163.057 133.268 1.00 92.40  ? 44  GLY E N  1 
ATOM 9078  C CA . GLY E 1 44  ? 154.839 162.700 133.939 1.00 92.40  ? 44  GLY E CA 1 
ATOM 9079  C C  . GLY E 1 44  ? 155.620 161.720 133.094 1.00 92.40  ? 44  GLY E C  1 
ATOM 9080  O O  . GLY E 1 44  ? 155.371 161.589 131.893 1.00 92.40  ? 44  GLY E O  1 
ATOM 9081  N N  . VAL E 1 45  ? 156.568 161.024 133.706 1.00 100.31 ? 45  VAL E N  1 
ATOM 9082  C CA . VAL E 1 45  ? 157.320 159.977 133.034 1.00 100.31 ? 45  VAL E CA 1 
ATOM 9083  C C  . VAL E 1 45  ? 157.093 158.665 133.773 1.00 100.31 ? 45  VAL E C  1 
ATOM 9084  O O  . VAL E 1 45  ? 157.308 158.579 134.988 1.00 100.31 ? 45  VAL E O  1 
ATOM 9085  N N  . LYS E 1 46  ? 156.594 157.665 133.053 1.00 93.45  ? 46  LYS E N  1 
ATOM 9086  C CA . LYS E 1 46  ? 156.527 156.293 133.554 1.00 93.45  ? 46  LYS E CA 1 
ATOM 9087  C C  . LYS E 1 46  ? 156.615 155.416 132.307 1.00 93.45  ? 46  LYS E C  1 
ATOM 9088  O O  . LYS E 1 46  ? 155.889 155.616 131.331 1.00 93.45  ? 46  LYS E O  1 
ATOM 9089  N N  . GLY E 1 47  ? 157.572 154.497 132.314 1.00 104.61 ? 47  GLY E N  1 
ATOM 9090  C CA . GLY E 1 47  ? 157.883 153.738 131.118 1.00 104.61 ? 47  GLY E CA 1 
ATOM 9091  C C  . GLY E 1 47  ? 158.511 154.573 130.025 1.00 104.61 ? 47  GLY E C  1 
ATOM 9092  O O  . GLY E 1 47  ? 158.562 154.128 128.868 1.00 104.61 ? 47  GLY E O  1 
ATOM 9093  N N  . ASP E 1 48  ? 159.005 155.769 130.381 1.00 108.93 ? 48  ASP E N  1 
ATOM 9094  C CA . ASP E 1 48  ? 159.460 156.809 129.455 1.00 108.93 ? 48  ASP E CA 1 
ATOM 9095  C C  . ASP E 1 48  ? 158.368 157.138 128.433 1.00 108.93 ? 48  ASP E C  1 
ATOM 9096  O O  . ASP E 1 48  ? 158.615 157.253 127.232 1.00 108.93 ? 48  ASP E O  1 
ATOM 9097  N N  . VAL E 1 49  ? 157.134 157.252 128.926 1.00 98.01  ? 49  VAL E N  1 
ATOM 9098  C CA . VAL E 1 49  ? 155.961 157.525 128.106 1.00 98.01  ? 49  VAL E CA 1 
ATOM 9099  C C  . VAL E 1 49  ? 155.194 158.691 128.732 1.00 98.01  ? 49  VAL E C  1 
ATOM 9100  O O  . VAL E 1 49  ? 154.929 158.718 129.934 1.00 98.01  ? 49  VAL E O  1 
ATOM 9101  N N  . ALA E 1 50  ? 154.839 159.662 127.893 1.00 83.81  ? 50  ALA E N  1 
ATOM 9102  C CA . ALA E 1 50  ? 154.213 160.912 128.323 1.00 83.81  ? 50  ALA E CA 1 
ATOM 9103  C C  . ALA E 1 50  ? 152.718 160.680 128.511 1.00 83.81  ? 50  ALA E C  1 
ATOM 9104  O O  . ALA E 1 50  ? 151.969 160.548 127.539 1.00 83.81  ? 50  ALA E O  1 
ATOM 9105  N N  . VAL E 1 51  ? 152.286 160.653 129.765 1.00 79.21  ? 51  VAL E N  1 
ATOM 9106  C CA . VAL E 1 51  ? 150.890 160.410 130.107 1.00 79.21  ? 51  VAL E CA 1 
ATOM 9107  C C  . VAL E 1 51  ? 150.198 161.758 130.341 1.00 79.21  ? 51  VAL E C  1 
ATOM 9108  O O  . VAL E 1 51  ? 149.913 162.199 131.456 1.00 79.21  ? 51  VAL E O  1 
ATOM 9109  N N  . VAL E 1 52  ? 149.858 162.418 129.246 1.00 75.47  ? 52  VAL E N  1 
ATOM 9110  C CA . VAL E 1 52  ? 149.154 163.687 129.365 1.00 75.47  ? 52  VAL E CA 1 
ATOM 9111  C C  . VAL E 1 52  ? 147.709 163.434 129.778 1.00 75.47  ? 52  VAL E C  1 
ATOM 9112  O O  . VAL E 1 52  ? 147.003 162.584 129.213 1.00 75.47  ? 52  VAL E O  1 
ATOM 9113  N N  . ARG E 1 53  ? 147.285 164.156 130.807 1.00 71.24  ? 53  ARG E N  1 
ATOM 9114  C CA . ARG E 1 53  ? 145.996 163.954 131.441 1.00 71.24  ? 53  ARG E CA 1 
ATOM 9115  C C  . ARG E 1 53  ? 145.146 165.200 131.291 1.00 71.24  ? 53  ARG E C  1 
ATOM 9116  O O  . ARG E 1 53  ? 145.666 166.316 131.230 1.00 71.24  ? 53  ARG E O  1 
ATOM 9117  N N  . ILE E 1 54  ? 143.838 165.002 131.226 1.00 78.86  ? 54  ILE E N  1 
ATOM 9118  C CA . ILE E 1 54  ? 142.888 166.079 131.004 1.00 78.86  ? 54  ILE E CA 1 
ATOM 9119  C C  . ILE E 1 54  ? 141.997 166.184 132.228 1.00 78.86  ? 54  ILE E C  1 
ATOM 9120  O O  . ILE E 1 54  ? 141.419 165.186 132.672 1.00 78.86  ? 54  ILE E O  1 
ATOM 9121  N N  . ASN E 1 55  ? 141.894 167.387 132.778 1.00 95.05  ? 55  ASN E N  1 
ATOM 9122  C CA . ASN E 1 55  ? 141.071 167.614 133.951 1.00 95.05  ? 55  ASN E CA 1 
ATOM 9123  C C  . ASN E 1 55  ? 140.706 169.088 133.987 1.00 95.05  ? 55  ASN E C  1 
ATOM 9124  O O  . ASN E 1 55  ? 141.404 169.923 133.412 1.00 95.05  ? 55  ASN E O  1 
ATOM 9125  N N  . SER E 1 56  ? 139.602 169.393 134.651 1.00 97.01  ? 56  SER E N  1 
ATOM 9126  C CA . SER E 1 56  ? 139.181 170.776 134.871 1.00 97.01  ? 56  SER E CA 1 
ATOM 9127  C C  . SER E 1 56  ? 138.323 170.789 136.122 1.00 97.01  ? 56  SER E C  1 
ATOM 9128  O O  . SER E 1 56  ? 137.128 170.463 136.072 1.00 97.01  ? 56  SER E O  1 
ATOM 9129  N N  . PRO E 1 57  ? 138.891 171.173 137.269 1.00 107.20 ? 57  PRO E N  1 
ATOM 9130  C CA . PRO E 1 57  ? 138.171 171.033 138.543 1.00 107.20 ? 57  PRO E CA 1 
ATOM 9131  C C  . PRO E 1 57  ? 137.080 172.062 138.759 1.00 107.20 ? 57  PRO E C  1 
ATOM 9132  O O  . PRO E 1 57  ? 136.300 171.918 139.711 1.00 107.20 ? 57  PRO E O  1 
ATOM 9133  N N  . ASN E 1 58  ? 137.006 173.089 137.915 1.00 111.06 ? 58  ASN E N  1 
ATOM 9134  C CA . ASN E 1 58  ? 136.075 174.184 138.143 1.00 111.06 ? 58  ASN E CA 1 
ATOM 9135  C C  . ASN E 1 58  ? 134.646 173.744 137.859 1.00 111.06 ? 58  ASN E C  1 
ATOM 9136  O O  . ASN E 1 58  ? 133.786 173.763 138.747 1.00 111.06 ? 58  ASN E O  1 
ATOM 9137  N N  . SER E 1 59  ? 134.382 173.322 136.630 1.00 96.64  ? 59  SER E N  1 
ATOM 9138  C CA . SER E 1 59  ? 133.096 172.751 136.281 1.00 96.64  ? 59  SER E CA 1 
ATOM 9139  C C  . SER E 1 59  ? 133.083 171.268 136.632 1.00 96.64  ? 59  SER E C  1 
ATOM 9140  O O  . SER E 1 59  ? 134.088 170.693 137.055 1.00 96.64  ? 59  SER E O  1 
ATOM 9141  N N  . LYS E 1 60  ? 131.926 170.636 136.456 1.00 85.85  ? 60  LYS E N  1 
ATOM 9142  C CA . LYS E 1 60  ? 131.854 169.196 136.656 1.00 85.85  ? 60  LYS E CA 1 
ATOM 9143  C C  . LYS E 1 60  ? 132.422 168.464 135.449 1.00 85.85  ? 60  LYS E C  1 
ATOM 9144  O O  . LYS E 1 60  ? 133.075 167.429 135.596 1.00 85.85  ? 60  LYS E O  1 
ATOM 9145  N N  . VAL E 1 61  ? 132.166 168.978 134.253 1.00 83.87  ? 61  VAL E N  1 
ATOM 9146  C CA . VAL E 1 61  ? 132.620 168.365 133.015 1.00 83.87  ? 61  VAL E CA 1 
ATOM 9147  C C  . VAL E 1 61  ? 133.640 169.278 132.361 1.00 83.87  ? 61  VAL E C  1 
ATOM 9148  O O  . VAL E 1 61  ? 133.674 170.486 132.613 1.00 83.87  ? 61  VAL E O  1 
ATOM 9149  N N  . ASN E 1 62  ? 134.489 168.690 131.527 1.00 86.66  ? 62  ASN E N  1 
ATOM 9150  C CA . ASN E 1 62  ? 135.540 169.453 130.870 1.00 86.66  ? 62  ASN E CA 1 
ATOM 9151  C C  . ASN E 1 62  ? 135.117 169.860 129.469 1.00 86.66  ? 62  ASN E C  1 
ATOM 9152  O O  . ASN E 1 62  ? 134.520 169.071 128.732 1.00 86.66  ? 62  ASN E O  1 
ATOM 9153  N N  . THR E 1 63  ? 135.426 171.096 129.105 1.00 97.80  ? 63  THR E N  1 
ATOM 9154  C CA . THR E 1 63  ? 134.991 171.678 127.848 1.00 97.80  ? 63  THR E CA 1 
ATOM 9155  C C  . THR E 1 63  ? 136.195 172.103 127.030 1.00 97.80  ? 63  THR E C  1 
ATOM 9156  O O  . THR E 1 63  ? 137.167 172.634 127.575 1.00 97.80  ? 63  THR E O  1 
ATOM 9157  N N  . LEU E 1 64  ? 136.122 171.869 125.728 1.00 96.66  ? 64  LEU E N  1 
ATOM 9158  C CA . LEU E 1 64  ? 137.079 172.453 124.808 1.00 96.66  ? 64  LEU E CA 1 
ATOM 9159  C C  . LEU E 1 64  ? 136.912 173.963 124.811 1.00 96.66  ? 64  LEU E C  1 
ATOM 9160  O O  . LEU E 1 64  ? 135.810 174.471 124.602 1.00 96.66  ? 64  LEU E O  1 
ATOM 9161  N N  . SER E 1 65  ? 138.001 174.685 125.056 1.00 110.88 ? 65  SER E N  1 
ATOM 9162  C CA . SER E 1 65  ? 137.930 176.137 125.082 1.00 110.88 ? 65  SER E CA 1 
ATOM 9163  C C  . SER E 1 65  ? 139.250 176.721 124.615 1.00 110.88 ? 65  SER E C  1 
ATOM 9164  O O  . SER E 1 65  ? 140.253 176.019 124.472 1.00 110.88 ? 65  SER E O  1 
ATOM 9165  N N  . LYS E 1 66  ? 139.232 178.037 124.389 1.00 117.10 ? 66  LYS E N  1 
ATOM 9166  C CA . LYS E 1 66  ? 140.471 178.778 124.191 1.00 117.10 ? 66  LYS E CA 1 
ATOM 9167  C C  . LYS E 1 66  ? 141.338 178.699 125.435 1.00 117.10 ? 66  LYS E C  1 
ATOM 9168  O O  . LYS E 1 66  ? 142.566 178.587 125.345 1.00 117.10 ? 66  LYS E O  1 
ATOM 9169  N N  . GLU E 1 67  ? 140.709 178.714 126.601 1.00 118.75 ? 67  GLU E N  1 
ATOM 9170  C CA . GLU E 1 67  ? 141.371 178.573 127.881 1.00 118.75 ? 67  GLU E CA 1 
ATOM 9171  C C  . GLU E 1 67  ? 141.911 177.215 128.102 1.00 118.75 ? 67  GLU E C  1 
ATOM 9172  O O  . GLU E 1 67  ? 142.606 177.090 129.094 1.00 118.75 ? 67  GLU E O  1 
ATOM 9173  N N  . LEU E 1 68  ? 141.625 176.203 127.289 1.00 112.06 ? 68  LEU E N  1 
ATOM 9174  C CA . LEU E 1 68  ? 142.303 174.916 127.369 1.00 112.06 ? 68  LEU E CA 1 
ATOM 9175  C C  . LEU E 1 68  ? 143.411 174.770 126.344 1.00 112.06 ? 68  LEU E C  1 
ATOM 9176  O O  . LEU E 1 68  ? 144.497 174.301 126.681 1.00 112.06 ? 68  LEU E O  1 
ATOM 9177  N N  . HIS E 1 69  ? 143.169 175.184 125.100 1.00 110.18 ? 69  HIS E N  1 
ATOM 9178  C CA . HIS E 1 69  ? 144.208 175.120 124.082 1.00 110.18 ? 69  HIS E CA 1 
ATOM 9179  C C  . HIS E 1 69  ? 145.350 176.082 124.353 1.00 110.18 ? 69  HIS E C  1 
ATOM 9180  O O  . HIS E 1 69  ? 146.471 175.814 123.915 1.00 110.18 ? 69  HIS E O  1 
ATOM 9181  N N  . SER E 1 70  ? 145.099 177.152 125.121 1.00 114.56 ? 70  SER E N  1 
ATOM 9182  C CA . SER E 1 70  ? 146.133 178.109 125.506 1.00 114.56 ? 70  SER E CA 1 
ATOM 9183  C C  . SER E 1 70  ? 147.251 177.476 126.322 1.00 114.56 ? 70  SER E C  1 
ATOM 9184  O O  . SER E 1 70  ? 148.331 178.068 126.432 1.00 114.56 ? 70  SER E O  1 
ATOM 9185  N N  . GLU E 1 71  ? 147.012 176.308 126.916 1.00 116.67 ? 71  GLU E N  1 
ATOM 9186  C CA . GLU E 1 71  ? 148.066 175.509 127.508 1.00 116.67 ? 71  GLU E CA 1 
ATOM 9187  C C  . GLU E 1 71  ? 148.255 174.161 126.837 1.00 116.67 ? 71  GLU E C  1 
ATOM 9188  O O  . GLU E 1 71  ? 149.341 173.586 126.943 1.00 116.67 ? 71  GLU E O  1 
ATOM 9189  N N  . PHE E 1 72  ? 147.252 173.660 126.117 1.00 96.76  ? 72  PHE E N  1 
ATOM 9190  C CA . PHE E 1 72  ? 147.394 172.440 125.336 1.00 96.76  ? 72  PHE E CA 1 
ATOM 9191  C C  . PHE E 1 72  ? 148.339 172.635 124.160 1.00 96.76  ? 72  PHE E C  1 
ATOM 9192  O O  . PHE E 1 72  ? 148.820 171.649 123.595 1.00 96.76  ? 72  PHE E O  1 
ATOM 9193  N N  . SER E 1 73  ? 148.600 173.885 123.778 1.00 103.28 ? 73  SER E N  1 
ATOM 9194  C CA . SER E 1 73  ? 149.581 174.168 122.745 1.00 103.28 ? 73  SER E CA 1 
ATOM 9195  C C  . SER E 1 73  ? 150.985 173.818 123.214 1.00 103.28 ? 73  SER E C  1 
ATOM 9196  O O  . SER E 1 73  ? 151.629 172.914 122.673 1.00 103.28 ? 73  SER E O  1 
ATOM 9197  N N  . GLU E 1 74  ? 151.455 174.477 124.271 1.00 106.42 ? 74  GLU E N  1 
ATOM 9198  C CA . GLU E 1 74  ? 152.867 174.435 124.630 1.00 106.42 ? 74  GLU E CA 1 
ATOM 9199  C C  . GLU E 1 74  ? 153.244 173.201 125.433 1.00 106.42 ? 74  GLU E C  1 
ATOM 9200  O O  . GLU E 1 74  ? 154.277 173.196 126.115 1.00 106.42 ? 74  GLU E O  1 
ATOM 9201  N N  . VAL E 1 75  ? 152.466 172.130 125.333 1.00 98.65  ? 75  VAL E N  1 
ATOM 9202  C CA . VAL E 1 75  ? 152.878 170.853 125.866 1.00 98.65  ? 75  VAL E CA 1 
ATOM 9203  C C  . VAL E 1 75  ? 153.331 169.872 124.783 1.00 98.65  ? 75  VAL E C  1 
ATOM 9204  O O  . VAL E 1 75  ? 154.425 169.309 124.906 1.00 98.65  ? 75  VAL E O  1 
ATOM 9205  N N  . MET E 1 76  ? 152.572 169.700 123.695 1.00 98.42  ? 76  MET E N  1 
ATOM 9206  C CA . MET E 1 76  ? 152.967 168.724 122.683 1.00 98.42  ? 76  MET E CA 1 
ATOM 9207  C C  . MET E 1 76  ? 154.194 169.146 121.900 1.00 98.42  ? 76  MET E C  1 
ATOM 9208  O O  . MET E 1 76  ? 154.890 168.281 121.368 1.00 98.42  ? 76  MET E O  1 
ATOM 9209  N N  . ASN E 1 77  ? 154.484 170.442 121.831 1.00 106.54 ? 77  ASN E N  1 
ATOM 9210  C CA . ASN E 1 77  ? 155.744 170.861 121.239 1.00 106.54 ? 77  ASN E CA 1 
ATOM 9211  C C  . ASN E 1 77  ? 156.925 170.427 122.093 1.00 106.54 ? 77  ASN E C  1 
ATOM 9212  O O  . ASN E 1 77  ? 157.971 170.060 121.555 1.00 106.54 ? 77  ASN E O  1 
ATOM 9213  N N  . GLU E 1 78  ? 156.766 170.463 123.418 1.00 109.10 ? 78  GLU E N  1 
ATOM 9214  C CA . GLU E 1 78  ? 157.785 169.923 124.310 1.00 109.10 ? 78  GLU E CA 1 
ATOM 9215  C C  . GLU E 1 78  ? 157.857 168.414 124.181 1.00 109.10 ? 78  GLU E C  1 
ATOM 9216  O O  . GLU E 1 78  ? 158.938 167.823 124.296 1.00 109.10 ? 78  GLU E O  1 
ATOM 9217  N N  . ILE E 1 79  ? 156.712 167.775 123.936 1.00 102.44 ? 79  ILE E N  1 
ATOM 9218  C CA . ILE E 1 79  ? 156.721 166.367 123.562 1.00 102.44 ? 79  ILE E CA 1 
ATOM 9219  C C  . ILE E 1 79  ? 157.450 166.189 122.242 1.00 102.44 ? 79  ILE E C  1 
ATOM 9220  O O  . ILE E 1 79  ? 158.222 165.242 122.059 1.00 102.44 ? 79  ILE E O  1 
ATOM 9221  N N  . TRP E 1 80  ? 157.272 167.131 121.326 1.00 109.18 ? 80  TRP E N  1 
ATOM 9222  C CA . TRP E 1 80  ? 157.978 167.094 120.060 1.00 109.18 ? 80  TRP E CA 1 
ATOM 9223  C C  . TRP E 1 80  ? 159.395 167.631 120.189 1.00 109.18 ? 80  TRP E C  1 
ATOM 9224  O O  . TRP E 1 80  ? 160.200 167.453 119.272 1.00 109.18 ? 80  TRP E O  1 
ATOM 9225  N N  . ALA E 1 81  ? 159.718 168.285 121.307 1.00 110.03 ? 81  ALA E N  1 
ATOM 9226  C CA . ALA E 1 81  ? 161.086 168.691 121.594 1.00 110.03 ? 81  ALA E CA 1 
ATOM 9227  C C  . ALA E 1 81  ? 161.834 167.671 122.432 1.00 110.03 ? 81  ALA E C  1 
ATOM 9228  O O  . ALA E 1 81  ? 162.992 167.914 122.785 1.00 110.03 ? 81  ALA E O  1 
ATOM 9229  N N  . SER E 1 82  ? 161.203 166.554 122.769 1.00 112.90 ? 82  SER E N  1 
ATOM 9230  C CA . SER E 1 82  ? 161.858 165.498 123.521 1.00 112.90 ? 82  SER E CA 1 
ATOM 9231  C C  . SER E 1 82  ? 162.343 164.396 122.593 1.00 112.90 ? 82  SER E C  1 
ATOM 9232  O O  . SER E 1 82  ? 161.963 164.318 121.423 1.00 112.90 ? 82  SER E O  1 
ATOM 9233  N N  . ASP E 1 83  ? 163.201 163.541 123.140 1.00 108.05 ? 83  ASP E N  1 
ATOM 9234  C CA . ASP E 1 83  ? 163.679 162.367 122.437 1.00 108.05 ? 83  ASP E CA 1 
ATOM 9235  C C  . ASP E 1 83  ? 163.668 161.101 123.270 1.00 108.05 ? 83  ASP E C  1 
ATOM 9236  O O  . ASP E 1 83  ? 163.612 160.013 122.688 1.00 108.05 ? 83  ASP E O  1 
ATOM 9237  N N  . GLN E 1 84  ? 163.723 161.201 124.600 1.00 105.45 ? 84  GLN E N  1 
ATOM 9238  C CA . GLN E 1 84  ? 163.683 160.005 125.433 1.00 105.45 ? 84  GLN E CA 1 
ATOM 9239  C C  . GLN E 1 84  ? 162.321 159.344 125.355 1.00 105.45 ? 84  GLN E C  1 
ATOM 9240  O O  . GLN E 1 84  ? 162.220 158.134 125.123 1.00 105.45 ? 84  GLN E O  1 
ATOM 9241  N N  . ILE E 1 85  ? 161.274 160.130 125.516 1.00 97.79  ? 85  ILE E N  1 
ATOM 9242  C CA . ILE E 1 85  ? 159.918 159.639 125.363 1.00 97.79  ? 85  ILE E CA 1 
ATOM 9243  C C  . ILE E 1 85  ? 159.698 159.328 123.893 1.00 97.79  ? 85  ILE E C  1 
ATOM 9244  O O  . ILE E 1 85  ? 160.064 160.115 123.015 1.00 97.79  ? 85  ILE E O  1 
ATOM 9245  N N  . ARG E 1 86  ? 159.157 158.150 123.616 1.00 94.91  ? 86  ARG E N  1 
ATOM 9246  C CA . ARG E 1 86  ? 158.986 157.702 122.246 1.00 94.91  ? 86  ARG E CA 1 
ATOM 9247  C C  . ARG E 1 86  ? 157.530 157.417 121.922 1.00 94.91  ? 86  ARG E C  1 
ATOM 9248  O O  . ARG E 1 86  ? 157.227 156.984 120.803 1.00 94.91  ? 86  ARG E O  1 
ATOM 9249  N N  . SER E 1 87  ? 156.622 157.652 122.869 1.00 90.72  ? 87  SER E N  1 
ATOM 9250  C CA . SER E 1 87  ? 155.189 157.514 122.645 1.00 90.72  ? 87  SER E CA 1 
ATOM 9251  C C  . SER E 1 87  ? 154.464 158.274 123.741 1.00 90.72  ? 87  SER E C  1 
ATOM 9252  O O  . SER E 1 87  ? 154.978 158.412 124.852 1.00 90.72  ? 87  SER E O  1 
ATOM 9253  N N  . ALA E 1 88  ? 153.272 158.762 123.429 1.00 74.93  ? 88  ALA E N  1 
ATOM 9254  C CA . ALA E 1 88  ? 152.514 159.544 124.389 1.00 74.93  ? 88  ALA E CA 1 
ATOM 9255  C C  . ALA E 1 88  ? 151.060 159.115 124.359 1.00 74.93  ? 88  ALA E C  1 
ATOM 9256  O O  . ALA E 1 88  ? 150.610 158.489 123.399 1.00 74.93  ? 88  ALA E O  1 
ATOM 9257  N N  . VAL E 1 89  ? 150.330 159.447 125.420 1.00 67.86  ? 89  VAL E N  1 
ATOM 9258  C CA . VAL E 1 89  ? 148.925 159.093 125.536 1.00 67.86  ? 89  VAL E CA 1 
ATOM 9259  C C  . VAL E 1 89  ? 148.192 160.127 126.383 1.00 67.86  ? 89  VAL E C  1 
ATOM 9260  O O  . VAL E 1 89  ? 148.633 160.516 127.464 1.00 67.86  ? 89  VAL E O  1 
ATOM 9261  N N  . LEU E 1 90  ? 147.057 160.578 125.861 1.00 63.95  ? 90  LEU E N  1 
ATOM 9262  C CA . LEU E 1 90  ? 146.209 161.529 126.555 1.00 63.95  ? 90  LEU E CA 1 
ATOM 9263  C C  . LEU E 1 90  ? 144.966 160.837 127.074 1.00 63.95  ? 90  LEU E C  1 
ATOM 9264  O O  . LEU E 1 90  ? 144.495 159.860 126.488 1.00 63.95  ? 90  LEU E O  1 
ATOM 9265  N N  . ILE E 1 91  ? 144.461 161.345 128.190 1.00 70.91  ? 91  ILE E N  1 
ATOM 9266  C CA . ILE E 1 91  ? 143.298 160.765 128.849 1.00 70.91  ? 91  ILE E CA 1 
ATOM 9267  C C  . ILE E 1 91  ? 142.638 161.829 129.719 1.00 70.91  ? 91  ILE E C  1 
ATOM 9268  O O  . ILE E 1 91  ? 143.284 162.801 130.118 1.00 70.91  ? 91  ILE E O  1 
ATOM 9269  N N  . SER E 1 92  ? 141.337 161.688 129.956 1.00 79.58  ? 92  SER E N  1 
ATOM 9270  C CA . SER E 1 92  ? 140.628 162.523 130.920 1.00 79.58  ? 92  SER E CA 1 
ATOM 9271  C C  . SER E 1 92  ? 140.651 161.845 132.280 1.00 79.58  ? 92  SER E C  1 
ATOM 9272  O O  . SER E 1 92  ? 139.874 160.934 132.554 1.00 79.58  ? 92  SER E O  1 
ATOM 9273  N N  . SER E 1 93  ? 141.539 162.316 133.156 1.00 80.91  ? 93  SER E N  1 
ATOM 9274  C CA . SER E 1 93  ? 141.652 161.722 134.483 1.00 80.91  ? 93  SER E CA 1 
ATOM 9275  C C  . SER E 1 93  ? 140.471 162.061 135.378 1.00 80.91  ? 93  SER E C  1 
ATOM 9276  O O  . SER E 1 93  ? 140.248 161.368 136.376 1.00 80.91  ? 93  SER E O  1 
ATOM 9277  N N  . LYS E 1 94  ? 139.737 163.117 135.068 1.00 79.64  ? 94  LYS E N  1 
ATOM 9278  C CA . LYS E 1 94  ? 138.466 163.350 135.725 1.00 79.64  ? 94  LYS E CA 1 
ATOM 9279  C C  . LYS E 1 94  ? 137.477 162.263 135.316 1.00 79.64  ? 94  LYS E C  1 
ATOM 9280  O O  . LYS E 1 94  ? 137.418 161.896 134.140 1.00 79.64  ? 94  LYS E O  1 
ATOM 9281  N N  . PRO E 1 95  ? 136.719 161.705 136.256 1.00 73.62  ? 95  PRO E N  1 
ATOM 9282  C CA . PRO E 1 95  ? 135.695 160.731 135.880 1.00 73.62  ? 95  PRO E CA 1 
ATOM 9283  C C  . PRO E 1 95  ? 134.560 161.391 135.122 1.00 73.62  ? 95  PRO E C  1 
ATOM 9284  O O  . PRO E 1 95  ? 134.345 162.601 135.208 1.00 73.62  ? 95  PRO E O  1 
ATOM 9285  N N  . GLY E 1 96  ? 133.841 160.577 134.358 1.00 75.63  ? 96  GLY E N  1 
ATOM 9286  C CA . GLY E 1 96  ? 132.715 161.077 133.601 1.00 75.63  ? 96  GLY E CA 1 
ATOM 9287  C C  . GLY E 1 96  ? 132.983 161.130 132.115 1.00 75.63  ? 96  GLY E C  1 
ATOM 9288  O O  . GLY E 1 96  ? 133.500 160.169 131.545 1.00 75.63  ? 96  GLY E O  1 
ATOM 9289  N N  . CYS E 1 97  ? 132.646 162.253 131.484 1.00 78.39  ? 97  CYS E N  1 
ATOM 9290  C CA . CYS E 1 97  ? 132.748 162.415 130.041 1.00 78.39  ? 97  CYS E CA 1 
ATOM 9291  C C  . CYS E 1 97  ? 134.199 162.619 129.627 1.00 78.39  ? 97  CYS E C  1 
ATOM 9292  O O  . CYS E 1 97  ? 135.080 162.858 130.455 1.00 78.39  ? 97  CYS E O  1 
ATOM 9293  N N  . PHE E 1 98  ? 134.456 162.547 128.320 1.00 72.25  ? 98  PHE E N  1 
ATOM 9294  C CA . PHE E 1 98  ? 135.826 162.731 127.847 1.00 72.25  ? 98  PHE E CA 1 
ATOM 9295  C C  . PHE E 1 98  ? 136.193 164.210 127.804 1.00 72.25  ? 98  PHE E C  1 
ATOM 9296  O O  . PHE E 1 98  ? 136.974 164.686 128.630 1.00 72.25  ? 98  PHE E O  1 
ATOM 9297  N N  . ILE E 1 99  ? 135.598 164.953 126.869 1.00 80.46  ? 99  ILE E N  1 
ATOM 9298  C CA . ILE E 1 99  ? 135.540 166.410 126.861 1.00 80.46  ? 99  ILE E CA 1 
ATOM 9299  C C  . ILE E 1 99  ? 134.168 166.794 126.325 1.00 80.46  ? 99  ILE E C  1 
ATOM 9300  O O  . ILE E 1 99  ? 133.376 165.940 125.924 1.00 80.46  ? 99  ILE E O  1 
ATOM 9301  N N  . ALA E 1 100 ? 133.887 168.084 126.306 1.00 94.95  ? 100 ALA E N  1 
ATOM 9302  C CA . ALA E 1 100 ? 132.638 168.542 125.727 1.00 94.95  ? 100 ALA E CA 1 
ATOM 9303  C C  . ALA E 1 100 ? 132.845 168.831 124.245 1.00 94.95  ? 100 ALA E C  1 
ATOM 9304  O O  . ALA E 1 100 ? 133.865 168.473 123.655 1.00 94.95  ? 100 ALA E O  1 
ATOM 9305  N N  . GLY E 1 101 ? 131.867 169.479 123.625 1.00 97.38  ? 101 GLY E N  1 
ATOM 9306  C CA . GLY E 1 101 ? 132.047 169.975 122.279 1.00 97.38  ? 101 GLY E CA 1 
ATOM 9307  C C  . GLY E 1 101 ? 132.591 171.383 122.312 1.00 97.38  ? 101 GLY E C  1 
ATOM 9308  O O  . GLY E 1 101 ? 133.494 171.686 123.097 1.00 97.38  ? 101 GLY E O  1 
ATOM 9309  N N  . ALA E 1 102 ? 132.055 172.251 121.462 1.00 111.75 ? 102 ALA E N  1 
ATOM 9310  C CA . ALA E 1 102 ? 132.350 173.668 121.580 1.00 111.75 ? 102 ALA E CA 1 
ATOM 9311  C C  . ALA E 1 102 ? 131.711 174.205 122.848 1.00 111.75 ? 102 ALA E C  1 
ATOM 9312  O O  . ALA E 1 102 ? 130.554 173.902 123.149 1.00 111.75 ? 102 ALA E O  1 
ATOM 9313  N N  . ASP E 1 103 ? 132.481 174.977 123.608 1.00 123.61 ? 103 ASP E N  1 
ATOM 9314  C CA . ASP E 1 103 ? 132.016 175.446 124.902 1.00 123.61 ? 103 ASP E CA 1 
ATOM 9315  C C  . ASP E 1 103 ? 130.917 176.468 124.695 1.00 123.61 ? 103 ASP E C  1 
ATOM 9316  O O  . ASP E 1 103 ? 131.112 177.457 123.981 1.00 123.61 ? 103 ASP E O  1 
ATOM 9317  N N  . ILE E 1 104 ? 129.791 176.236 125.365 1.00 127.44 ? 104 ILE E N  1 
ATOM 9318  C CA . ILE E 1 104 ? 128.477 176.713 124.958 1.00 127.44 ? 104 ILE E CA 1 
ATOM 9319  C C  . ILE E 1 104 ? 128.444 178.232 124.996 1.00 127.44 ? 104 ILE E C  1 
ATOM 9320  O O  . ILE E 1 104 ? 127.844 178.870 124.127 1.00 127.44 ? 104 ILE E O  1 
ATOM 9321  N N  . ASN E 1 105 ? 129.156 178.821 125.953 1.00 130.88 ? 105 ASN E N  1 
ATOM 9322  C CA . ASN E 1 105 ? 129.253 180.268 126.061 1.00 130.88 ? 105 ASN E CA 1 
ATOM 9323  C C  . ASN E 1 105 ? 130.495 180.843 125.387 1.00 130.88 ? 105 ASN E C  1 
ATOM 9324  O O  . ASN E 1 105 ? 130.890 181.968 125.701 1.00 130.88 ? 105 ASN E O  1 
ATOM 9325  N N  . MET E 1 106 ? 131.121 180.111 124.473 1.00 127.05 ? 106 MET E N  1 
ATOM 9326  C CA . MET E 1 106 ? 132.252 180.648 123.726 1.00 127.05 ? 106 MET E CA 1 
ATOM 9327  C C  . MET E 1 106 ? 132.002 180.730 122.236 1.00 127.05 ? 106 MET E C  1 
ATOM 9328  O O  . MET E 1 106 ? 132.455 181.674 121.589 1.00 127.05 ? 106 MET E O  1 
ATOM 9329  N N  . LEU E 1 107 ? 131.317 179.747 121.663 1.00 121.35 ? 107 LEU E N  1 
ATOM 9330  C CA . LEU E 1 107 ? 130.840 179.934 120.305 1.00 121.35 ? 107 LEU E CA 1 
ATOM 9331  C C  . LEU E 1 107 ? 129.646 180.871 120.291 1.00 121.35 ? 107 LEU E C  1 
ATOM 9332  O O  . LEU E 1 107 ? 129.430 181.584 119.308 1.00 121.35 ? 107 LEU E O  1 
ATOM 9333  N N  . ALA E 1 108 ? 128.881 180.909 121.376 1.00 120.22 ? 108 ALA E N  1 
ATOM 9334  C CA . ALA E 1 108 ? 127.833 181.907 121.494 1.00 120.22 ? 108 ALA E CA 1 
ATOM 9335  C C  . ALA E 1 108 ? 128.356 183.227 122.027 1.00 120.22 ? 108 ALA E C  1 
ATOM 9336  O O  . ALA E 1 108 ? 127.574 184.175 122.153 1.00 120.22 ? 108 ALA E O  1 
ATOM 9337  N N  . ALA E 1 109 ? 129.641 183.304 122.364 1.00 128.01 ? 109 ALA E N  1 
ATOM 9338  C CA . ALA E 1 109 ? 130.251 184.591 122.647 1.00 128.01 ? 109 ALA E CA 1 
ATOM 9339  C C  . ALA E 1 109 ? 130.250 185.420 121.373 1.00 128.01 ? 109 ALA E C  1 
ATOM 9340  O O  . ALA E 1 109 ? 130.886 185.055 120.380 1.00 128.01 ? 109 ALA E O  1 
ATOM 9341  N N  . CYS E 1 110 ? 129.503 186.517 121.400 1.00 143.48 ? 110 CYS E N  1 
ATOM 9342  C CA . CYS E 1 110 ? 129.201 187.273 120.194 1.00 143.48 ? 110 CYS E CA 1 
ATOM 9343  C C  . CYS E 1 110 ? 130.436 188.005 119.681 1.00 143.48 ? 110 CYS E C  1 
ATOM 9344  O O  . CYS E 1 110 ? 131.016 188.843 120.380 1.00 143.48 ? 110 CYS E O  1 
ATOM 9345  N N  . LYS E 1 111 ? 130.868 187.652 118.474 1.00 147.69 ? 111 LYS E N  1 
ATOM 9346  C CA . LYS E 1 111 ? 131.978 188.358 117.862 1.00 147.69 ? 111 LYS E CA 1 
ATOM 9347  C C  . LYS E 1 111 ? 131.703 188.461 116.366 1.00 147.69 ? 111 LYS E C  1 
ATOM 9348  O O  . LYS E 1 111 ? 130.878 187.722 115.825 1.00 147.69 ? 111 LYS E O  1 
ATOM 9349  N N  . THR E 1 112 ? 132.414 189.373 115.704 1.00 147.96 ? 112 THR E N  1 
ATOM 9350  C CA . THR E 1 112 ? 132.169 189.699 114.310 1.00 147.96 ? 112 THR E CA 1 
ATOM 9351  C C  . THR E 1 112 ? 132.722 188.573 113.425 1.00 147.96 ? 112 THR E C  1 
ATOM 9352  O O  . THR E 1 112 ? 133.456 187.689 113.880 1.00 147.96 ? 112 THR E O  1 
ATOM 9353  N N  . LEU E 1 113 ? 132.352 188.624 112.143 1.00 140.91 ? 113 LEU E N  1 
ATOM 9354  C CA . LEU E 1 113 ? 132.455 187.486 111.236 1.00 140.91 ? 113 LEU E CA 1 
ATOM 9355  C C  . LEU E 1 113 ? 133.897 187.092 110.944 1.00 140.91 ? 113 LEU E C  1 
ATOM 9356  O O  . LEU E 1 113 ? 134.213 185.897 110.880 1.00 140.91 ? 113 LEU E O  1 
ATOM 9357  N N  . GLN E 1 114 ? 134.779 188.072 110.749 1.00 138.88 ? 114 GLN E N  1 
ATOM 9358  C CA . GLN E 1 114 ? 136.167 187.747 110.447 1.00 138.88 ? 114 GLN E CA 1 
ATOM 9359  C C  . GLN E 1 114 ? 136.856 187.073 111.628 1.00 138.88 ? 114 GLN E C  1 
ATOM 9360  O O  . GLN E 1 114 ? 137.694 186.191 111.432 1.00 138.88 ? 114 GLN E O  1 
ATOM 9361  N N  . GLU E 1 115 ? 136.476 187.413 112.857 1.00 136.39 ? 115 GLU E N  1 
ATOM 9362  C CA . GLU E 1 115 ? 137.108 186.754 113.990 1.00 136.39 ? 115 GLU E CA 1 
ATOM 9363  C C  . GLU E 1 115 ? 136.506 185.375 114.236 1.00 136.39 ? 115 GLU E C  1 
ATOM 9364  O O  . GLU E 1 115 ? 137.225 184.456 114.641 1.00 136.39 ? 115 GLU E O  1 
ATOM 9365  N N  . VAL E 1 116 ? 135.206 185.204 113.989 1.00 128.59 ? 116 VAL E N  1 
ATOM 9366  C CA . VAL E 1 116 ? 134.609 183.891 114.183 1.00 128.59 ? 116 VAL E CA 1 
ATOM 9367  C C  . VAL E 1 116 ? 135.032 182.940 113.075 1.00 128.59 ? 116 VAL E C  1 
ATOM 9368  O O  . VAL E 1 116 ? 135.021 181.719 113.275 1.00 128.59 ? 116 VAL E O  1 
ATOM 9369  N N  . THR E 1 117 ? 135.456 183.453 111.922 1.00 129.60 ? 117 THR E N  1 
ATOM 9370  C CA . THR E 1 117 ? 136.080 182.551 110.971 1.00 129.60 ? 117 THR E CA 1 
ATOM 9371  C C  . THR E 1 117 ? 137.575 182.404 111.210 1.00 129.60 ? 117 THR E C  1 
ATOM 9372  O O  . THR E 1 117 ? 138.131 181.352 110.884 1.00 129.60 ? 117 THR E O  1 
ATOM 9373  N N  . GLN E 1 118 ? 138.226 183.389 111.837 1.00 126.53 ? 118 GLN E N  1 
ATOM 9374  C CA . GLN E 1 118 ? 139.638 183.241 112.167 1.00 126.53 ? 118 GLN E CA 1 
ATOM 9375  C C  . GLN E 1 118 ? 139.841 182.194 113.250 1.00 126.53 ? 118 GLN E C  1 
ATOM 9376  O O  . GLN E 1 118 ? 140.786 181.402 113.177 1.00 126.53 ? 118 GLN E O  1 
ATOM 9377  N N  . LEU E 1 119 ? 138.973 182.181 114.263 1.00 123.64 ? 119 LEU E N  1 
ATOM 9378  C CA . LEU E 1 119 ? 139.100 181.182 115.317 1.00 123.64 ? 119 LEU E CA 1 
ATOM 9379  C C  . LEU E 1 119 ? 138.799 179.794 114.783 1.00 123.64 ? 119 LEU E C  1 
ATOM 9380  O O  . LEU E 1 119 ? 139.499 178.835 115.111 1.00 123.64 ? 119 LEU E O  1 
ATOM 9381  N N  . SER E 1 120 ? 137.791 179.678 113.931 1.00 115.24 ? 120 SER E N  1 
ATOM 9382  C CA . SER E 1 120 ? 137.427 178.404 113.338 1.00 115.24 ? 120 SER E CA 1 
ATOM 9383  C C  . SER E 1 120 ? 138.306 178.030 112.156 1.00 115.24 ? 120 SER E C  1 
ATOM 9384  O O  . SER E 1 120 ? 138.054 176.999 111.528 1.00 115.24 ? 120 SER E O  1 
ATOM 9385  N N  . GLN E 1 121 ? 139.278 178.866 111.798 1.00 121.28 ? 121 GLN E N  1 
ATOM 9386  C CA . GLN E 1 121 ? 140.360 178.440 110.922 1.00 121.28 ? 121 GLN E CA 1 
ATOM 9387  C C  . GLN E 1 121 ? 141.608 178.082 111.723 1.00 121.28 ? 121 GLN E C  1 
ATOM 9388  O O  . GLN E 1 121 ? 142.395 177.221 111.317 1.00 121.28 ? 121 GLN E O  1 
ATOM 9389  N N  . GLU E 1 122 ? 141.796 178.731 112.868 1.00 117.58 ? 122 GLU E N  1 
ATOM 9390  C CA . GLU E 1 122 ? 142.912 178.395 113.739 1.00 117.58 ? 122 GLU E CA 1 
ATOM 9391  C C  . GLU E 1 122 ? 142.651 177.098 114.494 1.00 117.58 ? 122 GLU E C  1 
ATOM 9392  O O  . GLU E 1 122 ? 143.596 176.392 114.865 1.00 117.58 ? 122 GLU E O  1 
ATOM 9393  N N  . ALA E 1 123 ? 141.379 176.752 114.686 1.00 107.22 ? 123 ALA E N  1 
ATOM 9394  C CA . ALA E 1 123 ? 141.016 175.667 115.588 1.00 107.22 ? 123 ALA E CA 1 
ATOM 9395  C C  . ALA E 1 123 ? 141.383 174.304 115.034 1.00 107.22 ? 123 ALA E C  1 
ATOM 9396  O O  . ALA E 1 123 ? 141.504 173.341 115.794 1.00 107.22 ? 123 ALA E O  1 
ATOM 9397  N N  . GLN E 1 124 ? 141.556 174.192 113.731 1.00 107.39 ? 124 GLN E N  1 
ATOM 9398  C CA . GLN E 1 124 ? 141.993 172.938 113.150 1.00 107.39 ? 124 GLN E CA 1 
ATOM 9399  C C  . GLN E 1 124 ? 143.450 172.955 112.752 1.00 107.39 ? 124 GLN E C  1 
ATOM 9400  O O  . GLN E 1 124 ? 143.989 171.893 112.435 1.00 107.39 ? 124 GLN E O  1 
ATOM 9401  N N  . ARG E 1 125 ? 144.078 174.134 112.729 1.00 108.78 ? 125 ARG E N  1 
ATOM 9402  C CA . ARG E 1 125 ? 145.511 174.211 112.465 1.00 108.78 ? 125 ARG E CA 1 
ATOM 9403  C C  . ARG E 1 125 ? 146.289 173.482 113.553 1.00 108.78 ? 125 ARG E C  1 
ATOM 9404  O O  . ARG E 1 125 ? 147.271 172.780 113.278 1.00 108.78 ? 125 ARG E O  1 
ATOM 9405  N N  . ILE E 1 126 ? 145.811 173.572 114.789 1.00 104.65 ? 126 ILE E N  1 
ATOM 9406  C CA . ILE E 1 126 ? 146.407 172.813 115.872 1.00 104.65 ? 126 ILE E CA 1 
ATOM 9407  C C  . ILE E 1 126 ? 146.099 171.325 115.771 1.00 104.65 ? 126 ILE E C  1 
ATOM 9408  O O  . ILE E 1 126 ? 146.756 170.518 116.434 1.00 104.65 ? 126 ILE E O  1 
ATOM 9409  N N  . VAL E 1 127 ? 145.114 170.939 114.961 1.00 100.73 ? 127 VAL E N  1 
ATOM 9410  C CA . VAL E 1 127 ? 144.830 169.526 114.747 1.00 100.73 ? 127 VAL E CA 1 
ATOM 9411  C C  . VAL E 1 127 ? 145.707 168.974 113.634 1.00 100.73 ? 127 VAL E C  1 
ATOM 9412  O O  . VAL E 1 127 ? 146.278 167.875 113.747 1.00 100.73 ? 127 VAL E O  1 
ATOM 9413  N N  . GLU E 1 128 ? 145.863 169.755 112.563 1.00 106.97 ? 128 GLU E N  1 
ATOM 9414  C CA . GLU E 1 128 ? 146.843 169.452 111.530 1.00 106.97 ? 128 GLU E CA 1 
ATOM 9415  C C  . GLU E 1 128 ? 148.281 169.595 112.017 1.00 106.97 ? 128 GLU E C  1 
ATOM 9416  O O  . GLU E 1 128 ? 149.208 169.276 111.267 1.00 106.97 ? 128 GLU E O  1 
ATOM 9417  N N  . LYS E 1 129 ? 148.507 170.109 113.220 1.00 101.33 ? 129 LYS E N  1 
ATOM 9418  C CA . LYS E 1 129 ? 149.789 169.860 113.863 1.00 101.33 ? 129 LYS E CA 1 
ATOM 9419  C C  . LYS E 1 129 ? 149.961 168.380 114.179 1.00 101.33 ? 129 LYS E C  1 
ATOM 9420  O O  . LYS E 1 129 ? 150.890 167.731 113.691 1.00 101.33 ? 129 LYS E O  1 
ATOM 9421  N N  . LEU E 1 130 ? 149.057 167.815 114.972 1.00 103.00 ? 130 LEU E N  1 
ATOM 9422  C CA . LEU E 1 130 ? 149.392 166.558 115.622 1.00 103.00 ? 130 LEU E CA 1 
ATOM 9423  C C  . LEU E 1 130 ? 148.900 165.330 114.881 1.00 103.00 ? 130 LEU E C  1 
ATOM 9424  O O  . LEU E 1 130 ? 149.247 164.216 115.286 1.00 103.00 ? 130 LEU E O  1 
ATOM 9425  N N  . GLU E 1 131 ? 148.109 165.482 113.822 1.00 101.43 ? 131 GLU E N  1 
ATOM 9426  C CA . GLU E 1 131 ? 147.474 164.304 113.237 1.00 101.43 ? 131 GLU E CA 1 
ATOM 9427  C C  . GLU E 1 131 ? 148.480 163.480 112.428 1.00 101.43 ? 131 GLU E C  1 
ATOM 9428  O O  . GLU E 1 131 ? 148.233 162.310 112.118 1.00 101.43 ? 131 GLU E O  1 
ATOM 9429  N N  . LYS E 1 132 ? 149.623 164.078 112.066 1.00 95.95  ? 132 LYS E N  1 
ATOM 9430  C CA . LYS E 1 132 ? 150.658 163.384 111.299 1.00 95.95  ? 132 LYS E CA 1 
ATOM 9431  C C  . LYS E 1 132 ? 152.029 163.529 111.940 1.00 95.95  ? 132 LYS E C  1 
ATOM 9432  O O  . LYS E 1 132 ? 152.986 163.926 111.271 1.00 95.95  ? 132 LYS E O  1 
ATOM 9433  N N  . SER E 1 133 ? 152.138 163.242 113.228 1.00 98.88  ? 133 SER E N  1 
ATOM 9434  C CA . SER E 1 133 ? 153.425 163.384 113.883 1.00 98.88  ? 133 SER E CA 1 
ATOM 9435  C C  . SER E 1 133 ? 154.365 162.244 113.516 1.00 98.88  ? 133 SER E C  1 
ATOM 9436  O O  . SER E 1 133 ? 153.949 161.126 113.202 1.00 98.88  ? 133 SER E O  1 
ATOM 9437  N N  . THR E 1 134 ? 155.660 162.551 113.572 1.00 86.42  ? 134 THR E N  1 
ATOM 9438  C CA . THR E 1 134 ? 156.688 161.522 113.496 1.00 86.42  ? 134 THR E CA 1 
ATOM 9439  C C  . THR E 1 134 ? 156.605 160.579 114.686 1.00 86.42  ? 134 THR E C  1 
ATOM 9440  O O  . THR E 1 134 ? 156.627 159.354 114.529 1.00 86.42  ? 134 THR E O  1 
ATOM 9441  N N  . LYS E 1 135 ? 156.510 161.134 115.871 1.00 85.26  ? 135 LYS E N  1 
ATOM 9442  C CA . LYS E 1 135 ? 156.271 160.367 117.076 1.00 85.26  ? 135 LYS E CA 1 
ATOM 9443  C C  . LYS E 1 135 ? 154.793 160.049 117.184 1.00 85.26  ? 135 LYS E C  1 
ATOM 9444  O O  . LYS E 1 135 ? 153.999 160.962 117.438 1.00 85.26  ? 135 LYS E O  1 
ATOM 9445  N N  . PRO E 1 136 ? 154.380 158.801 117.021 1.00 76.27  ? 136 PRO E N  1 
ATOM 9446  C CA . PRO E 1 136 ? 152.954 158.479 117.023 1.00 76.27  ? 136 PRO E CA 1 
ATOM 9447  C C  . PRO E 1 136 ? 152.388 158.544 118.431 1.00 76.27  ? 136 PRO E C  1 
ATOM 9448  O O  . PRO E 1 136 ? 153.107 158.523 119.428 1.00 76.27  ? 136 PRO E O  1 
ATOM 9449  N N  . ILE E 1 137 ? 151.065 158.626 118.495 1.00 66.82  ? 137 ILE E N  1 
ATOM 9450  C CA . ILE E 1 137 ? 150.381 158.926 119.739 1.00 66.82  ? 137 ILE E CA 1 
ATOM 9451  C C  . ILE E 1 137 ? 149.119 158.078 119.778 1.00 66.82  ? 137 ILE E C  1 
ATOM 9452  O O  . ILE E 1 137 ? 148.683 157.531 118.763 1.00 66.82  ? 137 ILE E O  1 
ATOM 9453  N N  . VAL E 1 138 ? 148.556 157.928 120.972 1.00 60.53  ? 138 VAL E N  1 
ATOM 9454  C CA . VAL E 1 138 ? 147.353 157.136 121.164 1.00 60.53  ? 138 VAL E CA 1 
ATOM 9455  C C  . VAL E 1 138 ? 146.421 157.895 122.097 1.00 60.53  ? 138 VAL E C  1 
ATOM 9456  O O  . VAL E 1 138 ? 146.853 158.441 123.120 1.00 60.53  ? 138 VAL E O  1 
ATOM 9457  N N  . ALA E 1 139 ? 145.162 158.004 121.704 1.00 62.03  ? 139 ALA E N  1 
ATOM 9458  C CA . ALA E 1 139 ? 144.166 158.596 122.572 1.00 62.03  ? 139 ALA E CA 1 
ATOM 9459  C C  . ALA E 1 139 ? 143.333 157.489 123.188 1.00 62.03  ? 139 ALA E C  1 
ATOM 9460  O O  . ALA E 1 139 ? 143.473 156.318 122.846 1.00 62.03  ? 139 ALA E O  1 
ATOM 9461  N N  . ALA E 1 140 ? 142.426 157.864 124.078 1.00 65.85  ? 140 ALA E N  1 
ATOM 9462  C CA . ALA E 1 140 ? 141.598 156.880 124.748 1.00 65.85  ? 140 ALA E CA 1 
ATOM 9463  C C  . ALA E 1 140 ? 140.250 157.501 125.055 1.00 65.85  ? 140 ALA E C  1 
ATOM 9464  O O  . ALA E 1 140 ? 140.125 158.722 125.151 1.00 65.85  ? 140 ALA E O  1 
ATOM 9465  N N  . ILE E 1 141 ? 139.233 156.657 125.189 1.00 62.73  ? 141 ILE E N  1 
ATOM 9466  C CA . ILE E 1 141 ? 137.879 157.132 125.432 1.00 62.73  ? 141 ILE E CA 1 
ATOM 9467  C C  . ILE E 1 141 ? 137.275 156.346 126.579 1.00 62.73  ? 141 ILE E C  1 
ATOM 9468  O O  . ILE E 1 141 ? 137.133 155.122 126.491 1.00 62.73  ? 141 ILE E O  1 
ATOM 9469  N N  . ASN E 1 142 ? 136.923 157.046 127.652 1.00 63.59  ? 142 ASN E N  1 
ATOM 9470  C CA . ASN E 1 142 ? 136.152 156.482 128.754 1.00 63.59  ? 142 ASN E CA 1 
ATOM 9471  C C  . ASN E 1 142 ? 135.064 157.461 129.172 1.00 63.59  ? 142 ASN E C  1 
ATOM 9472  O O  . ASN E 1 142 ? 134.897 157.785 130.347 1.00 63.59  ? 142 ASN E O  1 
ATOM 9473  N N  . GLY E 1 143 ? 134.316 157.975 128.212 1.00 68.83  ? 143 GLY E N  1 
ATOM 9474  C CA . GLY E 1 143 ? 133.243 158.872 128.580 1.00 68.83  ? 143 GLY E CA 1 
ATOM 9475  C C  . GLY E 1 143 ? 132.374 159.190 127.394 1.00 68.83  ? 143 GLY E C  1 
ATOM 9476  O O  . GLY E 1 143 ? 132.565 158.660 126.302 1.00 68.83  ? 143 GLY E O  1 
ATOM 9477  N N  . SER E 1 144 ? 131.407 160.073 127.625 1.00 79.82  ? 144 SER E N  1 
ATOM 9478  C CA . SER E 1 144 ? 130.544 160.528 126.544 1.00 79.82  ? 144 SER E CA 1 
ATOM 9479  C C  . SER E 1 144 ? 131.312 161.569 125.731 1.00 79.82  ? 144 SER E C  1 
ATOM 9480  O O  . SER E 1 144 ? 131.172 162.782 125.907 1.00 79.82  ? 144 SER E O  1 
ATOM 9481  N N  . CYS E 1 145 ? 132.162 161.072 124.833 1.00 80.32  ? 145 CYS E N  1 
ATOM 9482  C CA . CYS E 1 145 ? 132.871 161.942 123.907 1.00 80.32  ? 145 CYS E CA 1 
ATOM 9483  C C  . CYS E 1 145 ? 131.896 162.481 122.878 1.00 80.32  ? 145 CYS E C  1 
ATOM 9484  O O  . CYS E 1 145 ? 131.246 161.711 122.164 1.00 80.32  ? 145 CYS E O  1 
ATOM 9485  N N  . LEU E 1 146 ? 131.792 163.801 122.804 1.00 83.92  ? 146 LEU E N  1 
ATOM 9486  C CA . LEU E 1 146 ? 130.822 164.432 121.932 1.00 83.92  ? 146 LEU E CA 1 
ATOM 9487  C C  . LEU E 1 146 ? 131.388 165.742 121.404 1.00 83.92  ? 146 LEU E C  1 
ATOM 9488  O O  . LEU E 1 146 ? 132.170 166.420 122.075 1.00 83.92  ? 146 LEU E O  1 
ATOM 9489  N N  . GLY E 1 147 ? 131.003 166.071 120.178 1.00 82.09  ? 147 GLY E N  1 
ATOM 9490  C CA . GLY E 1 147 ? 131.321 167.350 119.584 1.00 82.09  ? 147 GLY E CA 1 
ATOM 9491  C C  . GLY E 1 147 ? 132.706 167.389 118.988 1.00 82.09  ? 147 GLY E C  1 
ATOM 9492  O O  . GLY E 1 147 ? 133.043 166.581 118.120 1.00 82.09  ? 147 GLY E O  1 
ATOM 9493  N N  . GLY E 1 148 ? 133.529 168.318 119.465 1.00 86.40  ? 148 GLY E N  1 
ATOM 9494  C CA . GLY E 1 148 ? 134.884 168.435 118.970 1.00 86.40  ? 148 GLY E CA 1 
ATOM 9495  C C  . GLY E 1 148 ? 135.823 167.353 119.448 1.00 86.40  ? 148 GLY E C  1 
ATOM 9496  O O  . GLY E 1 148 ? 136.960 167.293 118.965 1.00 86.40  ? 148 GLY E O  1 
ATOM 9497  N N  . GLY E 1 149 ? 135.377 166.504 120.377 1.00 90.07  ? 149 GLY E N  1 
ATOM 9498  C CA . GLY E 1 149 ? 136.225 165.441 120.886 1.00 90.07  ? 149 GLY E CA 1 
ATOM 9499  C C  . GLY E 1 149 ? 136.594 164.413 119.842 1.00 90.07  ? 149 GLY E C  1 
ATOM 9500  O O  . GLY E 1 149 ? 137.703 163.871 119.870 1.00 90.07  ? 149 GLY E O  1 
ATOM 9501  N N  . LEU E 1 150 ? 135.687 164.152 118.899 1.00 86.03  ? 150 LEU E N  1 
ATOM 9502  C CA . LEU E 1 150 ? 136.025 163.299 117.768 1.00 86.03  ? 150 LEU E CA 1 
ATOM 9503  C C  . LEU E 1 150 ? 137.105 163.945 116.917 1.00 86.03  ? 150 LEU E C  1 
ATOM 9504  O O  . LEU E 1 150 ? 137.948 163.247 116.339 1.00 86.03  ? 150 LEU E O  1 
ATOM 9505  N N  . GLU E 1 151 ? 137.094 165.285 116.853 1.00 91.85  ? 151 GLU E N  1 
ATOM 9506  C CA . GLU E 1 151 ? 138.200 166.046 116.288 1.00 91.85  ? 151 GLU E CA 1 
ATOM 9507  C C  . GLU E 1 151 ? 139.510 165.684 116.958 1.00 91.85  ? 151 GLU E C  1 
ATOM 9508  O O  . GLU E 1 151 ? 140.534 165.518 116.292 1.00 91.85  ? 151 GLU E O  1 
ATOM 9509  N N  . VAL E 1 152 ? 139.493 165.546 118.278 1.00 82.38  ? 152 VAL E N  1 
ATOM 9510  C CA . VAL E 1 152 ? 140.691 165.083 118.948 1.00 82.38  ? 152 VAL E CA 1 
ATOM 9511  C C  . VAL E 1 152 ? 140.836 163.584 118.751 1.00 82.38  ? 152 VAL E C  1 
ATOM 9512  O O  . VAL E 1 152 ? 141.955 163.080 118.605 1.00 82.38  ? 152 VAL E O  1 
ATOM 9513  N N  . ALA E 1 153 ? 139.721 162.859 118.657 1.00 80.59  ? 153 ALA E N  1 
ATOM 9514  C CA . ALA E 1 153 ? 139.795 161.404 118.665 1.00 80.59  ? 153 ALA E CA 1 
ATOM 9515  C C  . ALA E 1 153 ? 140.298 160.863 117.340 1.00 80.59  ? 153 ALA E C  1 
ATOM 9516  O O  . ALA E 1 153 ? 141.325 160.181 117.282 1.00 80.59  ? 153 ALA E O  1 
ATOM 9517  N N  . ILE E 1 154 ? 139.589 161.159 116.254 1.00 85.32  ? 154 ILE E N  1 
ATOM 9518  C CA . ILE E 1 154 ? 139.895 160.460 115.020 1.00 85.32  ? 154 ILE E CA 1 
ATOM 9519  C C  . ILE E 1 154 ? 141.071 161.105 114.290 1.00 85.32  ? 154 ILE E C  1 
ATOM 9520  O O  . ILE E 1 154 ? 141.582 160.546 113.313 1.00 85.32  ? 154 ILE E O  1 
ATOM 9521  N N  . SER E 1 155 ? 141.552 162.255 114.764 1.00 88.75  ? 155 SER E N  1 
ATOM 9522  C CA . SER E 1 155 ? 142.820 162.771 114.263 1.00 88.75  ? 155 SER E CA 1 
ATOM 9523  C C  . SER E 1 155 ? 143.991 161.921 114.712 1.00 88.75  ? 155 SER E C  1 
ATOM 9524  O O  . SER E 1 155 ? 145.043 161.944 114.068 1.00 88.75  ? 155 SER E O  1 
ATOM 9525  N N  . CYS E 1 156 ? 143.831 161.182 115.802 1.00 87.34  ? 156 CYS E N  1 
ATOM 9526  C CA . CYS E 1 156 ? 144.869 160.305 116.310 1.00 87.34  ? 156 CYS E CA 1 
ATOM 9527  C C  . CYS E 1 156 ? 145.053 159.094 115.404 1.00 87.34  ? 156 CYS E C  1 
ATOM 9528  O O  . CYS E 1 156 ? 144.279 158.844 114.478 1.00 87.34  ? 156 CYS E O  1 
ATOM 9529  N N  . GLN E 1 157 ? 146.094 158.320 115.687 1.00 79.31  ? 157 GLN E N  1 
ATOM 9530  C CA . GLN E 1 157 ? 146.396 157.150 114.889 1.00 79.31  ? 157 GLN E CA 1 
ATOM 9531  C C  . GLN E 1 157 ? 145.660 155.908 115.353 1.00 79.31  ? 157 GLN E C  1 
ATOM 9532  O O  . GLN E 1 157 ? 145.556 154.952 114.578 1.00 79.31  ? 157 GLN E O  1 
ATOM 9533  N N  . TYR E 1 158 ? 145.115 155.920 116.568 1.00 69.60  ? 158 TYR E N  1 
ATOM 9534  C CA . TYR E 1 158 ? 144.678 154.693 117.227 1.00 69.60  ? 158 TYR E CA 1 
ATOM 9535  C C  . TYR E 1 158 ? 143.954 155.079 118.502 1.00 69.60  ? 158 TYR E C  1 
ATOM 9536  O O  . TYR E 1 158 ? 144.599 155.541 119.445 1.00 69.60  ? 158 TYR E O  1 
ATOM 9537  N N  . ARG E 1 159 ? 142.648 154.882 118.568 1.00 73.12  ? 159 ARG E N  1 
ATOM 9538  C CA . ARG E 1 159 ? 141.947 155.193 119.799 1.00 73.12  ? 159 ARG E CA 1 
ATOM 9539  C C  . ARG E 1 159 ? 141.375 153.925 120.402 1.00 73.12  ? 159 ARG E C  1 
ATOM 9540  O O  . ARG E 1 159 ? 141.295 152.885 119.747 1.00 73.12  ? 159 ARG E O  1 
ATOM 9541  N N  . ILE E 1 160 ? 140.997 154.028 121.671 1.00 59.10  ? 160 ILE E N  1 
ATOM 9542  C CA . ILE E 1 160 ? 140.629 152.884 122.492 1.00 59.10  ? 160 ILE E CA 1 
ATOM 9543  C C  . ILE E 1 160 ? 139.502 153.294 123.433 1.00 59.10  ? 160 ILE E C  1 
ATOM 9544  O O  . ILE E 1 160 ? 139.526 154.380 124.023 1.00 59.10  ? 160 ILE E O  1 
ATOM 9545  N N  . ALA E 1 161 ? 138.493 152.432 123.543 1.00 59.10  ? 161 ALA E N  1 
ATOM 9546  C CA . ALA E 1 161 ? 137.219 152.794 124.139 1.00 59.10  ? 161 ALA E CA 1 
ATOM 9547  C C  . ALA E 1 161 ? 136.774 151.759 125.158 1.00 59.10  ? 161 ALA E C  1 
ATOM 9548  O O  . ALA E 1 161 ? 137.206 150.604 125.142 1.00 59.10  ? 161 ALA E O  1 
ATOM 9549  N N  . THR E 1 162 ? 135.866 152.191 126.029 1.00 64.05  ? 162 THR E N  1 
ATOM 9550  C CA . THR E 1 162 ? 135.388 151.406 127.157 1.00 64.05  ? 162 THR E CA 1 
ATOM 9551  C C  . THR E 1 162 ? 133.936 151.018 126.940 1.00 64.05  ? 162 THR E C  1 
ATOM 9552  O O  . THR E 1 162 ? 133.068 151.888 126.868 1.00 64.05  ? 162 THR E O  1 
ATOM 9553  N N  . LYS E 1 163 ? 133.673 149.719 126.865 1.00 70.33  ? 163 LYS E N  1 
ATOM 9554  C CA . LYS E 1 163 ? 132.344 149.217 126.525 1.00 70.33  ? 163 LYS E CA 1 
ATOM 9555  C C  . LYS E 1 163 ? 131.441 149.279 127.751 1.00 70.33  ? 163 LYS E C  1 
ATOM 9556  O O  . LYS E 1 163 ? 131.448 148.371 128.582 1.00 70.33  ? 163 LYS E O  1 
ATOM 9557  N N  . ASP E 1 164 ? 130.652 150.345 127.864 1.00 71.69  ? 164 ASP E N  1 
ATOM 9558  C CA . ASP E 1 164 ? 129.588 150.445 128.864 1.00 71.69  ? 164 ASP E CA 1 
ATOM 9559  C C  . ASP E 1 164 ? 128.551 151.450 128.372 1.00 71.69  ? 164 ASP E C  1 
ATOM 9560  O O  . ASP E 1 164 ? 128.731 152.095 127.335 1.00 71.69  ? 164 ASP E O  1 
ATOM 9561  N N  . ARG E 1 165 ? 127.465 151.591 129.133 1.00 75.60  ? 165 ARG E N  1 
ATOM 9562  C CA . ARG E 1 165 ? 126.360 152.439 128.698 1.00 75.60  ? 165 ARG E CA 1 
ATOM 9563  C C  . ARG E 1 165 ? 126.703 153.914 128.829 1.00 75.60  ? 165 ARG E C  1 
ATOM 9564  O O  . ARG E 1 165 ? 126.168 154.748 128.090 1.00 75.60  ? 165 ARG E O  1 
ATOM 9565  N N  . LYS E 1 166 ? 127.580 154.253 129.773 1.00 72.37  ? 166 LYS E N  1 
ATOM 9566  C CA . LYS E 1 166 ? 127.867 155.654 130.046 1.00 72.37  ? 166 LYS E CA 1 
ATOM 9567  C C  . LYS E 1 166 ? 128.664 156.287 128.917 1.00 72.37  ? 166 LYS E C  1 
ATOM 9568  O O  . LYS E 1 166 ? 128.359 157.404 128.490 1.00 72.37  ? 166 LYS E O  1 
ATOM 9569  N N  . THR E 1 167 ? 129.681 155.595 128.418 1.00 74.76  ? 167 THR E N  1 
ATOM 9570  C CA . THR E 1 167 ? 130.411 156.067 127.248 1.00 74.76  ? 167 THR E CA 1 
ATOM 9571  C C  . THR E 1 167 ? 129.517 155.966 126.031 1.00 74.76  ? 167 THR E C  1 
ATOM 9572  O O  . THR E 1 167 ? 129.051 154.880 125.681 1.00 74.76  ? 167 THR E O  1 
ATOM 9573  N N  . VAL E 1 168 ? 129.236 157.107 125.421 1.00 83.82  ? 168 VAL E N  1 
ATOM 9574  C CA . VAL E 1 168 ? 128.622 157.160 124.109 1.00 83.82  ? 168 VAL E CA 1 
ATOM 9575  C C  . VAL E 1 168 ? 129.508 158.028 123.237 1.00 83.82  ? 168 VAL E C  1 
ATOM 9576  O O  . VAL E 1 168 ? 130.330 158.807 123.722 1.00 83.82  ? 168 VAL E O  1 
ATOM 9577  N N  . LEU E 1 169 ? 129.338 157.883 121.933 1.00 86.69  ? 169 LEU E N  1 
ATOM 9578  C CA . LEU E 1 169 ? 130.157 158.584 120.958 1.00 86.69  ? 169 LEU E CA 1 
ATOM 9579  C C  . LEU E 1 169 ? 129.196 159.157 119.926 1.00 86.69  ? 169 LEU E C  1 
ATOM 9580  O O  . LEU E 1 169 ? 128.607 158.413 119.137 1.00 86.69  ? 169 LEU E O  1 
ATOM 9581  N N  . GLY E 1 170 ? 128.993 160.472 119.980 1.00 90.55  ? 170 GLY E N  1 
ATOM 9582  C CA . GLY E 1 170 ? 128.085 161.135 119.075 1.00 90.55  ? 170 GLY E CA 1 
ATOM 9583  C C  . GLY E 1 170 ? 128.652 162.469 118.637 1.00 90.55  ? 170 GLY E C  1 
ATOM 9584  O O  . GLY E 1 170 ? 129.595 162.990 119.225 1.00 90.55  ? 170 GLY E O  1 
ATOM 9585  N N  . THR E 1 171 ? 128.058 163.017 117.578 1.00 100.62 ? 171 THR E N  1 
ATOM 9586  C CA . THR E 1 171 ? 128.467 164.306 117.025 1.00 100.62 ? 171 THR E CA 1 
ATOM 9587  C C  . THR E 1 171 ? 127.305 165.284 117.120 1.00 100.62 ? 171 THR E C  1 
ATOM 9588  O O  . THR E 1 171 ? 126.485 165.377 116.197 1.00 100.62 ? 171 THR E O  1 
ATOM 9589  N N  . PRO E 1 172 ? 127.189 166.026 118.212 1.00 105.27 ? 172 PRO E N  1 
ATOM 9590  C CA . PRO E 1 172 ? 126.217 167.117 118.248 1.00 105.27 ? 172 PRO E CA 1 
ATOM 9591  C C  . PRO E 1 172 ? 126.698 168.280 117.410 1.00 105.27 ? 172 PRO E C  1 
ATOM 9592  O O  . PRO E 1 172 ? 127.315 169.228 117.900 1.00 105.27 ? 172 PRO E O  1 
ATOM 9593  N N  . GLU E 1 173 ? 126.454 168.166 116.112 1.00 104.22 ? 173 GLU E N  1 
ATOM 9594  C CA . GLU E 1 173 ? 126.766 169.201 115.139 1.00 104.22 ? 173 GLU E CA 1 
ATOM 9595  C C  . GLU E 1 173 ? 125.509 169.766 114.500 1.00 104.22 ? 173 GLU E C  1 
ATOM 9596  O O  . GLU E 1 173 ? 125.307 170.983 114.500 1.00 104.22 ? 173 GLU E O  1 
ATOM 9597  N N  . VAL E 1 174 ? 124.661 168.913 113.941 1.00 96.17  ? 174 VAL E N  1 
ATOM 9598  C CA . VAL E 1 174 ? 123.458 169.422 113.316 1.00 96.17  ? 174 VAL E CA 1 
ATOM 9599  C C  . VAL E 1 174 ? 122.387 169.679 114.352 1.00 96.17  ? 174 VAL E C  1 
ATOM 9600  O O  . VAL E 1 174 ? 121.465 170.460 114.106 1.00 96.17  ? 174 VAL E O  1 
ATOM 9601  N N  . LEU E 1 175 ? 122.487 169.050 115.523 1.00 101.85 ? 175 LEU E N  1 
ATOM 9602  C CA . LEU E 1 175 ? 121.483 169.267 116.551 1.00 101.85 ? 175 LEU E CA 1 
ATOM 9603  C C  . LEU E 1 175 ? 121.547 170.663 117.129 1.00 101.85 ? 175 LEU E C  1 
ATOM 9604  O O  . LEU E 1 175 ? 120.517 171.183 117.565 1.00 101.85 ? 175 LEU E O  1 
ATOM 9605  N N  . LEU E 1 176 ? 122.711 171.291 117.130 1.00 93.27  ? 176 LEU E N  1 
ATOM 9606  C CA . LEU E 1 176 ? 122.688 172.722 117.348 1.00 93.27  ? 176 LEU E CA 1 
ATOM 9607  C C  . LEU E 1 176 ? 122.819 173.481 116.039 1.00 93.27  ? 176 LEU E C  1 
ATOM 9608  O O  . LEU E 1 176 ? 122.701 174.709 116.033 1.00 93.27  ? 176 LEU E O  1 
ATOM 9609  N N  . GLY E 1 177 ? 123.025 172.775 114.933 1.00 98.19  ? 177 GLY E N  1 
ATOM 9610  C CA . GLY E 1 177 ? 123.022 173.404 113.632 1.00 98.19  ? 177 GLY E CA 1 
ATOM 9611  C C  . GLY E 1 177 ? 124.288 174.130 113.254 1.00 98.19  ? 177 GLY E C  1 
ATOM 9612  O O  . GLY E 1 177 ? 124.284 175.362 113.172 1.00 98.19  ? 177 GLY E O  1 
ATOM 9613  N N  . ALA E 1 178 ? 125.378 173.412 113.024 1.00 99.81  ? 178 ALA E N  1 
ATOM 9614  C CA . ALA E 1 178 ? 126.643 174.039 112.671 1.00 99.81  ? 178 ALA E CA 1 
ATOM 9615  C C  . ALA E 1 178 ? 127.445 173.039 111.846 1.00 99.81  ? 178 ALA E C  1 
ATOM 9616  O O  . ALA E 1 178 ? 126.881 172.101 111.272 1.00 99.81  ? 178 ALA E O  1 
ATOM 9617  N N  . LEU E 1 179 ? 128.738 173.280 111.732 1.00 99.79  ? 179 LEU E N  1 
ATOM 9618  C CA . LEU E 1 179 ? 129.729 172.318 111.293 1.00 99.79  ? 179 LEU E CA 1 
ATOM 9619  C C  . LEU E 1 179 ? 130.754 172.216 112.417 1.00 99.79  ? 179 LEU E C  1 
ATOM 9620  O O  . LEU E 1 179 ? 130.890 173.162 113.199 1.00 99.79  ? 179 LEU E O  1 
ATOM 9621  N N  . PRO E 1 180 ? 131.491 171.070 112.560 1.00 99.97  ? 180 PRO E N  1 
ATOM 9622  C CA . PRO E 1 180 ? 132.084 170.769 113.875 1.00 99.97  ? 180 PRO E CA 1 
ATOM 9623  C C  . PRO E 1 180 ? 133.266 171.649 114.261 1.00 99.97  ? 180 PRO E C  1 
ATOM 9624  O O  . PRO E 1 180 ? 133.677 172.521 113.488 1.00 99.97  ? 180 PRO E O  1 
ATOM 9625  N N  . GLY E 1 181 ? 133.814 171.406 115.457 1.00 99.26  ? 181 GLY E N  1 
ATOM 9626  C CA . GLY E 1 181 ? 134.740 172.346 116.069 1.00 99.26  ? 181 GLY E CA 1 
ATOM 9627  C C  . GLY E 1 181 ? 136.069 172.483 115.355 1.00 99.26  ? 181 GLY E C  1 
ATOM 9628  O O  . GLY E 1 181 ? 136.749 173.504 115.500 1.00 99.26  ? 181 GLY E O  1 
ATOM 9629  N N  . ALA E 1 182 ? 136.469 171.468 114.590 1.00 100.74 ? 182 ALA E N  1 
ATOM 9630  C CA . ALA E 1 182 ? 137.654 171.608 113.756 1.00 100.74 ? 182 ALA E CA 1 
ATOM 9631  C C  . ALA E 1 182 ? 137.497 170.948 112.392 1.00 100.74 ? 182 ALA E C  1 
ATOM 9632  O O  . ALA E 1 182 ? 138.507 170.707 111.722 1.00 100.74 ? 182 ALA E O  1 
ATOM 9633  N N  . GLY E 1 183 ? 136.276 170.653 111.963 1.00 95.78  ? 183 GLY E N  1 
ATOM 9634  C CA . GLY E 1 183 ? 136.050 170.149 110.627 1.00 95.78  ? 183 GLY E CA 1 
ATOM 9635  C C  . GLY E 1 183 ? 136.593 168.758 110.399 1.00 95.78  ? 183 GLY E C  1 
ATOM 9636  O O  . GLY E 1 183 ? 137.365 168.531 109.466 1.00 95.78  ? 183 GLY E O  1 
ATOM 9637  N N  . GLY E 1 184 ? 136.198 167.820 111.245 1.00 94.51  ? 184 GLY E N  1 
ATOM 9638  C CA . GLY E 1 184 ? 136.610 166.444 111.105 1.00 94.51  ? 184 GLY E CA 1 
ATOM 9639  C C  . GLY E 1 184 ? 135.910 165.708 110.000 1.00 94.51  ? 184 GLY E C  1 
ATOM 9640  O O  . GLY E 1 184 ? 136.320 164.612 109.616 1.00 94.51  ? 184 GLY E O  1 
ATOM 9641  N N  . THR E 1 185 ? 134.873 166.317 109.435 1.00 97.07  ? 185 THR E N  1 
ATOM 9642  C CA . THR E 1 185 ? 134.120 165.728 108.347 1.00 97.07  ? 185 THR E CA 1 
ATOM 9643  C C  . THR E 1 185 ? 134.911 165.629 107.054 1.00 97.07  ? 185 THR E C  1 
ATOM 9644  O O  . THR E 1 185 ? 134.403 165.054 106.092 1.00 97.07  ? 185 THR E O  1 
ATOM 9645  N N  . GLN E 1 186 ? 136.116 166.186 106.988 1.00 96.36  ? 186 GLN E N  1 
ATOM 9646  C CA . GLN E 1 186 ? 136.990 165.949 105.856 1.00 96.36  ? 186 GLN E CA 1 
ATOM 9647  C C  . GLN E 1 186 ? 137.987 164.834 106.124 1.00 96.36  ? 186 GLN E C  1 
ATOM 9648  O O  . GLN E 1 186 ? 138.920 164.649 105.338 1.00 96.36  ? 186 GLN E O  1 
ATOM 9649  N N  . ARG E 1 187 ? 137.827 164.098 107.224 1.00 90.26  ? 187 ARG E N  1 
ATOM 9650  C CA . ARG E 1 187 ? 138.571 162.850 107.343 1.00 90.26  ? 187 ARG E CA 1 
ATOM 9651  C C  . ARG E 1 187 ? 137.764 161.730 107.986 1.00 90.26  ? 187 ARG E C  1 
ATOM 9652  O O  . ARG E 1 187 ? 138.279 160.618 108.128 1.00 90.26  ? 187 ARG E O  1 
ATOM 9653  N N  . LEU E 1 188 ? 136.520 161.990 108.386 1.00 86.18  ? 188 LEU E N  1 
ATOM 9654  C CA . LEU E 1 188 ? 135.616 160.870 108.652 1.00 86.18  ? 188 LEU E CA 1 
ATOM 9655  C C  . LEU E 1 188 ? 135.375 159.979 107.433 1.00 86.18  ? 188 LEU E C  1 
ATOM 9656  O O  . LEU E 1 188 ? 135.585 158.760 107.556 1.00 86.18  ? 188 LEU E O  1 
ATOM 9657  N N  . PRO E 1 189 ? 134.961 160.471 106.253 1.00 85.21  ? 189 PRO E N  1 
ATOM 9658  C CA . PRO E 1 189 ? 134.711 159.526 105.160 1.00 85.21  ? 189 PRO E CA 1 
ATOM 9659  C C  . PRO E 1 189 ? 135.968 159.027 104.499 1.00 85.21  ? 189 PRO E C  1 
ATOM 9660  O O  . PRO E 1 189 ? 135.912 158.041 103.759 1.00 85.21  ? 189 PRO E O  1 
ATOM 9661  N N  . LYS E 1 190 ? 137.099 159.687 104.730 1.00 86.55  ? 190 LYS E N  1 
ATOM 9662  C CA . LYS E 1 190 ? 138.384 159.087 104.409 1.00 86.55  ? 190 LYS E CA 1 
ATOM 9663  C C  . LYS E 1 190 ? 138.617 157.836 105.244 1.00 86.55  ? 190 LYS E C  1 
ATOM 9664  O O  . LYS E 1 190 ? 139.258 156.883 104.786 1.00 86.55  ? 190 LYS E O  1 
ATOM 9665  N N  . MET E 1 191 ? 138.052 157.804 106.448 1.00 93.23  ? 191 MET E N  1 
ATOM 9666  C CA . MET E 1 191 ? 138.279 156.750 107.425 1.00 93.23  ? 191 MET E CA 1 
ATOM 9667  C C  . MET E 1 191 ? 137.192 155.684 107.371 1.00 93.23  ? 191 MET E C  1 
ATOM 9668  O O  . MET E 1 191 ? 137.484 154.501 107.181 1.00 93.23  ? 191 MET E O  1 
ATOM 9669  N N  . VAL E 1 192 ? 135.938 156.083 107.557 1.00 88.46  ? 192 VAL E N  1 
ATOM 9670  C CA . VAL E 1 192 ? 134.870 155.099 107.664 1.00 88.46  ? 192 VAL E CA 1 
ATOM 9671  C C  . VAL E 1 192 ? 134.043 155.080 106.382 1.00 88.46  ? 192 VAL E C  1 
ATOM 9672  O O  . VAL E 1 192 ? 133.545 154.024 105.978 1.00 88.46  ? 192 VAL E O  1 
ATOM 9673  N N  . GLY E 1 193 ? 133.948 156.214 105.687 1.00 92.63  ? 193 GLY E N  1 
ATOM 9674  C CA . GLY E 1 193 ? 133.248 156.226 104.414 1.00 92.63  ? 193 GLY E CA 1 
ATOM 9675  C C  . GLY E 1 193 ? 132.142 157.249 104.258 1.00 92.63  ? 193 GLY E C  1 
ATOM 9676  O O  . GLY E 1 193 ? 131.531 157.671 105.242 1.00 92.63  ? 193 GLY E O  1 
ATOM 9677  N N  . VAL E 1 194 ? 131.907 157.671 103.009 1.00 89.27  ? 194 VAL E N  1 
ATOM 9678  C CA . VAL E 1 194 ? 130.782 158.563 102.724 1.00 89.27  ? 194 VAL E CA 1 
ATOM 9679  C C  . VAL E 1 194 ? 129.429 157.964 103.087 1.00 89.27  ? 194 VAL E C  1 
ATOM 9680  O O  . VAL E 1 194 ? 128.704 158.581 103.875 1.00 89.27  ? 194 VAL E O  1 
ATOM 9681  N N  . PRO E 1 195 ? 129.028 156.771 102.588 1.00 99.97  ? 195 PRO E N  1 
ATOM 9682  C CA . PRO E 1 195 ? 127.671 156.319 102.927 1.00 99.97  ? 195 PRO E CA 1 
ATOM 9683  C C  . PRO E 1 195 ? 127.563 155.779 104.330 1.00 99.97  ? 195 PRO E C  1 
ATOM 9684  O O  . PRO E 1 195 ? 126.451 155.700 104.862 1.00 99.97  ? 195 PRO E O  1 
ATOM 9685  N N  . ALA E 1 196 ? 128.678 155.394 104.941 1.00 99.11  ? 196 ALA E N  1 
ATOM 9686  C CA . ALA E 1 196 ? 128.645 154.864 106.290 1.00 99.11  ? 196 ALA E CA 1 
ATOM 9687  C C  . ALA E 1 196 ? 128.362 155.935 107.327 1.00 99.11  ? 196 ALA E C  1 
ATOM 9688  O O  . ALA E 1 196 ? 127.426 155.779 108.115 1.00 99.11  ? 196 ALA E O  1 
ATOM 9689  N N  . ALA E 1 197 ? 129.110 157.029 107.321 1.00 100.62 ? 197 ALA E N  1 
ATOM 9690  C CA . ALA E 1 197 ? 128.886 158.083 108.283 1.00 100.62 ? 197 ALA E CA 1 
ATOM 9691  C C  . ALA E 1 197 ? 128.045 159.213 107.742 1.00 100.62 ? 197 ALA E C  1 
ATOM 9692  O O  . ALA E 1 197 ? 127.793 160.172 108.481 1.00 100.62 ? 197 ALA E O  1 
ATOM 9693  N N  . LEU E 1 198 ? 127.614 159.148 106.486 1.00 97.00  ? 198 LEU E N  1 
ATOM 9694  C CA . LEU E 1 198 ? 126.729 160.181 105.991 1.00 97.00  ? 198 LEU E CA 1 
ATOM 9695  C C  . LEU E 1 198 ? 125.377 160.101 106.676 1.00 97.00  ? 198 LEU E C  1 
ATOM 9696  O O  . LEU E 1 198 ? 124.761 161.136 106.918 1.00 97.00  ? 198 LEU E O  1 
ATOM 9697  N N  . ASP E 1 199 ? 124.939 158.906 107.061 1.00 105.35 ? 199 ASP E N  1 
ATOM 9698  C CA . ASP E 1 199 ? 123.814 158.778 107.972 1.00 105.35 ? 199 ASP E CA 1 
ATOM 9699  C C  . ASP E 1 199 ? 124.239 158.834 109.426 1.00 105.35 ? 199 ASP E C  1 
ATOM 9700  O O  . ASP E 1 199 ? 123.519 158.327 110.286 1.00 105.35 ? 199 ASP E O  1 
ATOM 9701  N N  . MET E 1 200 ? 125.394 159.414 109.724 1.00 100.54 ? 200 MET E N  1 
ATOM 9702  C CA . MET E 1 200 ? 125.798 159.617 111.103 1.00 100.54 ? 200 MET E CA 1 
ATOM 9703  C C  . MET E 1 200 ? 125.947 161.094 111.415 1.00 100.54 ? 200 MET E C  1 
ATOM 9704  O O  . MET E 1 200 ? 125.391 161.574 112.405 1.00 100.54 ? 200 MET E O  1 
ATOM 9705  N N  . MET E 1 201 ? 126.679 161.832 110.583 1.00 94.96  ? 201 MET E N  1 
ATOM 9706  C CA . MET E 1 201 ? 127.132 163.143 111.030 1.00 94.96  ? 201 MET E CA 1 
ATOM 9707  C C  . MET E 1 201 ? 126.019 164.177 110.921 1.00 94.96  ? 201 MET E C  1 
ATOM 9708  O O  . MET E 1 201 ? 126.080 165.236 111.554 1.00 94.96  ? 201 MET E O  1 
ATOM 9709  N N  . LEU E 1 202 ? 124.979 163.890 110.145 1.00 87.74  ? 202 LEU E N  1 
ATOM 9710  C CA . LEU E 1 202 ? 123.812 164.756 110.159 1.00 87.74  ? 202 LEU E CA 1 
ATOM 9711  C C  . LEU E 1 202 ? 122.533 164.043 110.558 1.00 87.74  ? 202 LEU E C  1 
ATOM 9712  O O  . LEU E 1 202 ? 121.450 164.611 110.399 1.00 87.74  ? 202 LEU E O  1 
ATOM 9713  N N  . THR E 1 203 ? 122.613 162.825 111.078 1.00 94.04  ? 203 THR E N  1 
ATOM 9714  C CA . THR E 1 203 ? 121.433 162.326 111.762 1.00 94.04  ? 203 THR E CA 1 
ATOM 9715  C C  . THR E 1 203 ? 121.376 162.826 113.195 1.00 94.04  ? 203 THR E C  1 
ATOM 9716  O O  . THR E 1 203 ? 120.327 162.713 113.835 1.00 94.04  ? 203 THR E O  1 
ATOM 9717  N N  . GLY E 1 204 ? 122.482 163.365 113.708 1.00 90.60  ? 204 GLY E N  1 
ATOM 9718  C CA . GLY E 1 204 ? 122.552 163.888 115.057 1.00 90.60  ? 204 GLY E CA 1 
ATOM 9719  C C  . GLY E 1 204 ? 122.768 162.858 116.147 1.00 90.60  ? 204 GLY E C  1 
ATOM 9720  O O  . GLY E 1 204 ? 123.389 163.156 117.168 1.00 90.60  ? 204 GLY E O  1 
ATOM 9721  N N  . ARG E 1 205 ? 122.282 161.641 115.937 1.00 89.39  ? 205 ARG E N  1 
ATOM 9722  C CA . ARG E 1 205 ? 122.167 160.672 117.009 1.00 89.39  ? 205 ARG E CA 1 
ATOM 9723  C C  . ARG E 1 205 ? 123.509 160.015 117.296 1.00 89.39  ? 205 ARG E C  1 
ATOM 9724  O O  . ARG E 1 205 ? 124.354 159.842 116.418 1.00 89.39  ? 205 ARG E O  1 
ATOM 9725  N N  . SER E 1 206 ? 123.691 159.649 118.556 1.00 88.07  ? 206 SER E N  1 
ATOM 9726  C CA . SER E 1 206 ? 124.931 159.089 119.057 1.00 88.07  ? 206 SER E CA 1 
ATOM 9727  C C  . SER E 1 206 ? 124.920 157.577 118.894 1.00 88.07  ? 206 SER E C  1 
ATOM 9728  O O  . SER E 1 206 ? 123.885 156.965 118.625 1.00 88.07  ? 206 SER E O  1 
ATOM 9729  N N  . ILE E 1 207 ? 126.091 156.964 119.054 1.00 90.28  ? 207 ILE E N  1 
ATOM 9730  C CA . ILE E 1 207 ? 126.247 155.518 118.975 1.00 90.28  ? 207 ILE E CA 1 
ATOM 9731  C C  . ILE E 1 207 ? 126.956 155.074 120.244 1.00 90.28  ? 207 ILE E C  1 
ATOM 9732  O O  . ILE E 1 207 ? 127.883 155.746 120.702 1.00 90.28  ? 207 ILE E O  1 
ATOM 9733  N N  . ARG E 1 208 ? 126.539 153.948 120.812 1.00 87.71  ? 208 ARG E N  1 
ATOM 9734  C CA . ARG E 1 208 ? 127.324 153.382 121.895 1.00 87.71  ? 208 ARG E CA 1 
ATOM 9735  C C  . ARG E 1 208 ? 128.592 152.742 121.352 1.00 87.71  ? 208 ARG E C  1 
ATOM 9736  O O  . ARG E 1 208 ? 128.765 152.563 120.146 1.00 87.71  ? 208 ARG E O  1 
ATOM 9737  N N  . ALA E 1 209 ? 129.473 152.361 122.269 1.00 79.62  ? 209 ALA E N  1 
ATOM 9738  C CA . ALA E 1 209 ? 130.780 151.856 121.888 1.00 79.62  ? 209 ALA E CA 1 
ATOM 9739  C C  . ALA E 1 209 ? 130.732 150.470 121.266 1.00 79.62  ? 209 ALA E C  1 
ATOM 9740  O O  . ALA E 1 209 ? 131.745 150.029 120.717 1.00 79.62  ? 209 ALA E O  1 
ATOM 9741  N N  . ASP E 1 210 ? 129.600 149.775 121.338 1.00 85.99  ? 210 ASP E N  1 
ATOM 9742  C CA . ASP E 1 210 ? 129.550 148.417 120.817 1.00 85.99  ? 210 ASP E CA 1 
ATOM 9743  C C  . ASP E 1 210 ? 129.542 148.413 119.293 1.00 85.99  ? 210 ASP E C  1 
ATOM 9744  O O  . ASP E 1 210 ? 130.294 147.657 118.668 1.00 85.99  ? 210 ASP E O  1 
ATOM 9745  N N  . ARG E 1 211 ? 128.713 149.253 118.676 1.00 85.13  ? 211 ARG E N  1 
ATOM 9746  C CA . ARG E 1 211 ? 128.666 149.309 117.221 1.00 85.13  ? 211 ARG E CA 1 
ATOM 9747  C C  . ARG E 1 211 ? 129.837 150.058 116.613 1.00 85.13  ? 211 ARG E C  1 
ATOM 9748  O O  . ARG E 1 211 ? 129.988 150.031 115.392 1.00 85.13  ? 211 ARG E O  1 
ATOM 9749  N N  . ALA E 1 212 ? 130.658 150.728 117.418 1.00 78.80  ? 212 ALA E N  1 
ATOM 9750  C CA . ALA E 1 212 ? 131.758 151.493 116.855 1.00 78.80  ? 212 ALA E CA 1 
ATOM 9751  C C  . ALA E 1 212 ? 132.885 150.603 116.353 1.00 78.80  ? 212 ALA E C  1 
ATOM 9752  O O  . ALA E 1 212 ? 133.686 151.045 115.524 1.00 78.80  ? 212 ALA E O  1 
ATOM 9753  N N  . LYS E 1 213 ? 132.959 149.360 116.824 1.00 78.03  ? 213 LYS E N  1 
ATOM 9754  C CA . LYS E 1 213 ? 133.918 148.421 116.259 1.00 78.03  ? 213 LYS E CA 1 
ATOM 9755  C C  . LYS E 1 213 ? 133.468 147.953 114.885 1.00 78.03  ? 213 LYS E C  1 
ATOM 9756  O O  . LYS E 1 213 ? 134.259 147.932 113.937 1.00 78.03  ? 213 LYS E O  1 
ATOM 9757  N N  . LYS E 1 214 ? 132.195 147.570 114.761 1.00 79.19  ? 214 LYS E N  1 
ATOM 9758  C CA . LYS E 1 214 ? 131.667 147.150 113.468 1.00 79.19  ? 214 LYS E CA 1 
ATOM 9759  C C  . LYS E 1 214 ? 131.592 148.315 112.498 1.00 79.19  ? 214 LYS E C  1 
ATOM 9760  O O  . LYS E 1 214 ? 131.643 148.115 111.281 1.00 79.19  ? 214 LYS E O  1 
ATOM 9761  N N  . MET E 1 215 ? 131.465 149.532 113.016 1.00 82.29  ? 215 MET E N  1 
ATOM 9762  C CA . MET E 1 215 ? 131.579 150.708 112.170 1.00 82.29  ? 215 MET E CA 1 
ATOM 9763  C C  . MET E 1 215 ? 133.030 150.939 111.788 1.00 82.29  ? 215 MET E C  1 
ATOM 9764  O O  . MET E 1 215 ? 133.367 151.023 110.603 1.00 82.29  ? 215 MET E O  1 
ATOM 9765  N N  . GLY E 1 216 ? 133.908 151.013 112.781 1.00 81.07  ? 216 GLY E N  1 
ATOM 9766  C CA . GLY E 1 216 ? 135.328 151.096 112.541 1.00 81.07  ? 216 GLY E CA 1 
ATOM 9767  C C  . GLY E 1 216 ? 136.017 152.349 113.030 1.00 81.07  ? 216 GLY E C  1 
ATOM 9768  O O  . GLY E 1 216 ? 137.182 152.562 112.676 1.00 81.07  ? 216 GLY E O  1 
ATOM 9769  N N  . LEU E 1 217 ? 135.347 153.188 113.816 1.00 79.04  ? 217 LEU E N  1 
ATOM 9770  C CA . LEU E 1 217 ? 136.002 154.376 114.340 1.00 79.04  ? 217 LEU E CA 1 
ATOM 9771  C C  . LEU E 1 217 ? 137.030 153.972 115.375 1.00 79.04  ? 217 LEU E C  1 
ATOM 9772  O O  . LEU E 1 217 ? 138.234 154.147 115.171 1.00 79.04  ? 217 LEU E O  1 
ATOM 9773  N N  . VAL E 1 218 ? 136.567 153.404 116.459 1.00 80.42  ? 218 VAL E N  1 
ATOM 9774  C CA . VAL E 1 218 ? 137.459 152.802 117.423 1.00 80.42  ? 218 VAL E CA 1 
ATOM 9775  C C  . VAL E 1 218 ? 137.582 151.328 117.068 1.00 80.42  ? 218 VAL E C  1 
ATOM 9776  O O  . VAL E 1 218 ? 136.672 150.723 116.497 1.00 80.42  ? 218 VAL E O  1 
ATOM 9777  N N  . ASP E 1 219 ? 138.742 150.757 117.340 1.00 74.59  ? 219 ASP E N  1 
ATOM 9778  C CA . ASP E 1 219 ? 139.002 149.393 116.930 1.00 74.59  ? 219 ASP E CA 1 
ATOM 9779  C C  . ASP E 1 219 ? 139.041 148.391 118.066 1.00 74.59  ? 219 ASP E C  1 
ATOM 9780  O O  . ASP E 1 219 ? 138.516 147.288 117.911 1.00 74.59  ? 219 ASP E O  1 
ATOM 9781  N N  . GLN E 1 220 ? 139.620 148.737 119.203 1.00 71.11  ? 220 GLN E N  1 
ATOM 9782  C CA . GLN E 1 220 ? 139.751 147.794 120.300 1.00 71.11  ? 220 GLN E CA 1 
ATOM 9783  C C  . GLN E 1 220 ? 138.798 148.212 121.403 1.00 71.11  ? 220 GLN E C  1 
ATOM 9784  O O  . GLN E 1 220 ? 138.539 149.404 121.589 1.00 71.11  ? 220 GLN E O  1 
ATOM 9785  N N  . LEU E 1 221 ? 138.233 147.233 122.091 1.00 68.97  ? 221 LEU E N  1 
ATOM 9786  C CA . LEU E 1 221 ? 137.373 147.524 123.219 1.00 68.97  ? 221 LEU E CA 1 
ATOM 9787  C C  . LEU E 1 221 ? 137.986 146.970 124.491 1.00 68.97  ? 221 LEU E C  1 
ATOM 9788  O O  . LEU E 1 221 ? 138.798 146.045 124.470 1.00 68.97  ? 221 LEU E O  1 
ATOM 9789  N N  . VAL E 1 222 ? 137.577 147.543 125.613 1.00 64.67  ? 222 VAL E N  1 
ATOM 9790  C CA . VAL E 1 222 ? 137.915 146.987 126.910 1.00 64.67  ? 222 VAL E CA 1 
ATOM 9791  C C  . VAL E 1 222 ? 136.779 147.293 127.873 1.00 64.67  ? 222 VAL E C  1 
ATOM 9792  O O  . VAL E 1 222 ? 136.351 148.436 128.028 1.00 64.67  ? 222 VAL E O  1 
ATOM 9793  N N  . GLU E 1 223 ? 136.272 146.275 128.475 1.00 63.40  ? 223 GLU E N  1 
ATOM 9794  C CA . GLU E 1 223 ? 135.161 146.410 129.395 1.00 63.40  ? 223 GLU E CA 1 
ATOM 9795  C C  . GLU E 1 223 ? 135.649 146.943 130.732 1.00 63.40  ? 223 GLU E C  1 
ATOM 9796  O O  . GLU E 1 223 ? 136.810 146.760 131.090 1.00 63.40  ? 223 GLU E O  1 
ATOM 9797  N N  . PRO E 1 224 ? 134.804 147.646 131.492 1.00 69.76  ? 224 PRO E N  1 
ATOM 9798  C CA . PRO E 1 224 ? 135.278 148.216 132.757 1.00 69.76  ? 224 PRO E CA 1 
ATOM 9799  C C  . PRO E 1 224 ? 135.429 147.161 133.831 1.00 69.76  ? 224 PRO E C  1 
ATOM 9800  O O  . PRO E 1 224 ? 135.218 145.972 133.581 1.00 69.76  ? 224 PRO E O  1 
ATOM 9801  N N  . LEU E 1 225 ? 135.776 147.578 135.040 1.00 65.18  ? 225 LEU E N  1 
ATOM 9802  C CA . LEU E 1 225 ? 136.033 146.643 136.124 1.00 65.18  ? 225 LEU E CA 1 
ATOM 9803  C C  . LEU E 1 225 ? 135.048 146.892 137.247 1.00 65.18  ? 225 LEU E C  1 
ATOM 9804  O O  . LEU E 1 225 ? 134.376 147.926 137.269 1.00 65.18  ? 225 LEU E O  1 
ATOM 9805  N N  . GLY E 1 226 ? 134.955 145.941 138.163 1.00 67.86  ? 226 GLY E N  1 
ATOM 9806  C CA . GLY E 1 226 ? 134.165 146.115 139.351 1.00 67.86  ? 226 GLY E CA 1 
ATOM 9807  C C  . GLY E 1 226 ? 135.030 146.488 140.534 1.00 67.86  ? 226 GLY E C  1 
ATOM 9808  O O  . GLY E 1 226 ? 135.607 147.574 140.589 1.00 67.86  ? 226 GLY E O  1 
ATOM 9809  N N  . PRO E 1 227 ? 135.169 145.574 141.479 1.00 64.90  ? 227 PRO E N  1 
ATOM 9810  C CA . PRO E 1 227 ? 135.826 145.899 142.750 1.00 64.90  ? 227 PRO E CA 1 
ATOM 9811  C C  . PRO E 1 227 ? 137.331 146.028 142.631 1.00 64.90  ? 227 PRO E C  1 
ATOM 9812  O O  . PRO E 1 227 ? 137.957 145.278 141.879 1.00 64.90  ? 227 PRO E O  1 
ATOM 9813  N N  . GLY E 1 228 ? 137.929 146.960 143.376 1.00 61.68  ? 228 GLY E N  1 
ATOM 9814  C CA . GLY E 1 228 ? 139.362 147.142 143.350 1.00 61.68  ? 228 GLY E CA 1 
ATOM 9815  C C  . GLY E 1 228 ? 139.915 147.381 144.741 1.00 61.68  ? 228 GLY E C  1 
ATOM 9816  O O  . GLY E 1 228 ? 139.181 147.434 145.725 1.00 61.68  ? 228 GLY E O  1 
ATOM 9817  N N  . LEU E 1 229 ? 141.239 147.529 144.800 1.00 66.76  ? 229 LEU E N  1 
ATOM 9818  C CA . LEU E 1 229 ? 141.879 147.949 146.041 1.00 66.76  ? 229 LEU E CA 1 
ATOM 9819  C C  . LEU E 1 229 ? 141.612 149.424 146.292 1.00 66.76  ? 229 LEU E C  1 
ATOM 9820  O O  . LEU E 1 229 ? 141.772 149.922 147.411 1.00 66.76  ? 229 LEU E O  1 
ATOM 9821  N N  . LYS E 1 230 ? 141.267 150.146 145.236 1.00 69.02  ? 230 LYS E N  1 
ATOM 9822  C CA . LYS E 1 230 ? 140.816 151.527 145.232 1.00 69.02  ? 230 LYS E CA 1 
ATOM 9823  C C  . LYS E 1 230 ? 139.340 151.482 144.822 1.00 69.02  ? 230 LYS E C  1 
ATOM 9824  O O  . LYS E 1 230 ? 138.897 150.409 144.392 1.00 69.02  ? 230 LYS E O  1 
ATOM 9825  N N  . PRO E 1 231 ? 138.543 152.548 145.008 1.00 72.01  ? 231 PRO E N  1 
ATOM 9826  C CA . PRO E 1 231 ? 137.076 152.465 144.784 1.00 72.01  ? 231 PRO E CA 1 
ATOM 9827  C C  . PRO E 1 231 ? 136.718 152.091 143.355 1.00 72.01  ? 231 PRO E C  1 
ATOM 9828  O O  . PRO E 1 231 ? 137.478 152.390 142.424 1.00 72.01  ? 231 PRO E O  1 
ATOM 9829  N N  . PRO E 1 232 ? 135.570 151.447 143.135 1.00 72.83  ? 232 PRO E N  1 
ATOM 9830  C CA . PRO E 1 232 ? 135.377 150.608 141.940 1.00 72.83  ? 232 PRO E CA 1 
ATOM 9831  C C  . PRO E 1 232 ? 135.197 151.340 140.621 1.00 72.83  ? 232 PRO E C  1 
ATOM 9832  O O  . PRO E 1 232 ? 134.773 150.705 139.654 1.00 72.83  ? 232 PRO E O  1 
ATOM 9833  N N  . GLU E 1 233 ? 135.459 152.626 140.553 1.00 73.81  ? 233 GLU E N  1 
ATOM 9834  C CA . GLU E 1 233 ? 135.494 153.316 139.271 1.00 73.81  ? 233 GLU E CA 1 
ATOM 9835  C C  . GLU E 1 233 ? 136.792 154.069 139.040 1.00 73.81  ? 233 GLU E C  1 
ATOM 9836  O O  . GLU E 1 233 ? 137.181 154.244 137.881 1.00 73.81  ? 233 GLU E O  1 
ATOM 9837  N N  . GLU E 1 234 ? 137.496 154.483 140.094 1.00 80.18  ? 234 GLU E N  1 
ATOM 9838  C CA . GLU E 1 234 ? 138.769 155.173 139.952 1.00 80.18  ? 234 GLU E CA 1 
ATOM 9839  C C  . GLU E 1 234 ? 139.852 154.267 139.382 1.00 80.18  ? 234 GLU E C  1 
ATOM 9840  O O  . GLU E 1 234 ? 140.791 154.765 138.754 1.00 80.18  ? 234 GLU E O  1 
ATOM 9841  N N  . ARG E 1 235 ? 139.735 152.949 139.542 1.00 68.35  ? 235 ARG E N  1 
ATOM 9842  C CA . ARG E 1 235 ? 140.744 152.095 138.933 1.00 68.35  ? 235 ARG E CA 1 
ATOM 9843  C C  . ARG E 1 235 ? 140.504 151.959 137.443 1.00 68.35  ? 235 ARG E C  1 
ATOM 9844  O O  . ARG E 1 235 ? 141.456 151.848 136.670 1.00 68.35  ? 235 ARG E O  1 
ATOM 9845  N N  . THR E 1 236 ? 139.242 151.996 137.019 1.00 67.40  ? 236 THR E N  1 
ATOM 9846  C CA . THR E 1 236 ? 138.937 151.817 135.606 1.00 67.40  ? 236 THR E CA 1 
ATOM 9847  C C  . THR E 1 236 ? 139.430 152.991 134.780 1.00 67.40  ? 236 THR E C  1 
ATOM 9848  O O  . THR E 1 236 ? 139.759 152.829 133.603 1.00 67.40  ? 236 THR E O  1 
ATOM 9849  N N  . ILE E 1 237 ? 139.510 154.175 135.380 1.00 66.90  ? 237 ILE E N  1 
ATOM 9850  C CA . ILE E 1 237 ? 140.124 155.284 134.672 1.00 66.90  ? 237 ILE E CA 1 
ATOM 9851  C C  . ILE E 1 237 ? 141.639 155.198 134.761 1.00 66.90  ? 237 ILE E C  1 
ATOM 9852  O O  . ILE E 1 237 ? 142.337 155.775 133.922 1.00 66.90  ? 237 ILE E O  1 
ATOM 9853  N N  . GLU E 1 238 ? 142.172 154.455 135.731 1.00 69.91  ? 238 GLU E N  1 
ATOM 9854  C CA . GLU E 1 238 ? 143.605 154.248 135.852 1.00 69.91  ? 238 GLU E CA 1 
ATOM 9855  C C  . GLU E 1 238 ? 144.023 152.889 135.323 1.00 69.91  ? 238 GLU E C  1 
ATOM 9856  O O  . GLU E 1 238 ? 145.196 152.525 135.417 1.00 69.91  ? 238 GLU E O  1 
ATOM 9857  N N  . TYR E 1 239 ? 143.076 152.124 134.797 1.00 56.32  ? 239 TYR E N  1 
ATOM 9858  C CA . TYR E 1 239 ? 143.383 150.883 134.107 1.00 56.32  ? 239 TYR E CA 1 
ATOM 9859  C C  . TYR E 1 239 ? 143.760 151.127 132.664 1.00 56.32  ? 239 TYR E C  1 
ATOM 9860  O O  . TYR E 1 239 ? 144.625 150.428 132.126 1.00 56.32  ? 239 TYR E O  1 
ATOM 9861  N N  . LEU E 1 240 ? 143.138 152.122 132.039 1.00 61.53  ? 240 LEU E N  1 
ATOM 9862  C CA . LEU E 1 240 ? 143.358 152.395 130.630 1.00 61.53  ? 240 LEU E CA 1 
ATOM 9863  C C  . LEU E 1 240 ? 144.733 152.947 130.356 1.00 61.53  ? 240 LEU E C  1 
ATOM 9864  O O  . LEU E 1 240 ? 145.215 152.821 129.231 1.00 61.53  ? 240 LEU E O  1 
ATOM 9865  N N  . GLU E 1 241 ? 145.357 153.556 131.357 1.00 74.71  ? 241 GLU E N  1 
ATOM 9866  C CA . GLU E 1 241 ? 146.702 154.085 131.199 1.00 74.71  ? 241 GLU E CA 1 
ATOM 9867  C C  . GLU E 1 241 ? 147.686 152.972 130.877 1.00 74.71  ? 241 GLU E C  1 
ATOM 9868  O O  . GLU E 1 241 ? 148.529 153.101 129.985 1.00 74.71  ? 241 GLU E O  1 
ATOM 9869  N N  . GLU E 1 242 ? 147.542 151.838 131.543 1.00 75.25  ? 242 GLU E N  1 
ATOM 9870  C CA . GLU E 1 242 ? 148.474 150.746 131.320 1.00 75.25  ? 242 GLU E CA 1 
ATOM 9871  C C  . GLU E 1 242 ? 148.152 149.932 130.076 1.00 75.25  ? 242 GLU E C  1 
ATOM 9872  O O  . GLU E 1 242 ? 149.082 149.444 129.424 1.00 75.25  ? 242 GLU E O  1 
ATOM 9873  N N  . VAL E 1 243 ? 146.878 149.800 129.706 1.00 62.62  ? 243 VAL E N  1 
ATOM 9874  C CA . VAL E 1 243 ? 146.562 149.186 128.423 1.00 62.62  ? 243 VAL E CA 1 
ATOM 9875  C C  . VAL E 1 243 ? 147.043 150.078 127.292 1.00 62.62  ? 243 VAL E C  1 
ATOM 9876  O O  . VAL E 1 243 ? 147.531 149.609 126.255 1.00 62.62  ? 243 VAL E O  1 
ATOM 9877  N N  . ALA E 1 244 ? 146.989 151.382 127.512 1.00 65.96  ? 244 ALA E N  1 
ATOM 9878  C CA . ALA E 1 244 ? 147.532 152.312 126.547 1.00 65.96  ? 244 ALA E CA 1 
ATOM 9879  C C  . ALA E 1 244 ? 149.043 152.217 126.469 1.00 65.96  ? 244 ALA E C  1 
ATOM 9880  O O  . ALA E 1 244 ? 149.601 152.280 125.375 1.00 65.96  ? 244 ALA E O  1 
ATOM 9881  N N  . ILE E 1 245 ? 149.725 152.033 127.597 1.00 71.29  ? 245 ILE E N  1 
ATOM 9882  C CA . ILE E 1 245 ? 151.180 151.995 127.538 1.00 71.29  ? 245 ILE E CA 1 
ATOM 9883  C C  . ILE E 1 245 ? 151.651 150.652 126.988 1.00 71.29  ? 245 ILE E C  1 
ATOM 9884  O O  . ILE E 1 245 ? 152.756 150.539 126.444 1.00 71.29  ? 245 ILE E O  1 
ATOM 9885  N N  . THR E 1 246 ? 150.814 149.615 127.087 1.00 65.64  ? 246 THR E N  1 
ATOM 9886  C CA . THR E 1 246 ? 151.213 148.349 126.485 1.00 65.64  ? 246 THR E CA 1 
ATOM 9887  C C  . THR E 1 246 ? 150.829 148.306 125.016 1.00 65.64  ? 246 THR E C  1 
ATOM 9888  O O  . THR E 1 246 ? 151.331 147.471 124.262 1.00 65.64  ? 246 THR E O  1 
ATOM 9889  N N  . PHE E 1 247 ? 149.940 149.195 124.584 1.00 60.92  ? 247 PHE E N  1 
ATOM 9890  C CA . PHE E 1 247 ? 149.825 149.421 123.152 1.00 60.92  ? 247 PHE E CA 1 
ATOM 9891  C C  . PHE E 1 247 ? 150.936 150.329 122.665 1.00 60.92  ? 247 PHE E C  1 
ATOM 9892  O O  . PHE E 1 247 ? 151.368 150.235 121.515 1.00 60.92  ? 247 PHE E O  1 
ATOM 9893  N N  . ALA E 1 248 ? 151.455 151.170 123.551 1.00 72.17  ? 248 ALA E N  1 
ATOM 9894  C CA . ALA E 1 248 ? 152.224 152.329 123.119 1.00 72.17  ? 248 ALA E CA 1 
ATOM 9895  C C  . ALA E 1 248 ? 153.629 151.949 122.694 1.00 72.17  ? 248 ALA E C  1 
ATOM 9896  O O  . ALA E 1 248 ? 154.126 152.438 121.673 1.00 72.17  ? 248 ALA E O  1 
ATOM 9897  N N  . LYS E 1 249 ? 154.288 151.090 123.473 1.00 71.86  ? 249 LYS E N  1 
ATOM 9898  C CA . LYS E 1 249 ? 155.628 150.646 123.115 1.00 71.86  ? 249 LYS E CA 1 
ATOM 9899  C C  . LYS E 1 249 ? 155.599 149.818 121.838 1.00 71.86  ? 249 LYS E C  1 
ATOM 9900  O O  . LYS E 1 249 ? 156.549 149.845 121.047 1.00 71.86  ? 249 LYS E O  1 
ATOM 9901  N N  . GLY E 1 250 ? 154.488 149.121 121.596 1.00 77.89  ? 250 GLY E N  1 
ATOM 9902  C CA . GLY E 1 250 ? 154.350 148.369 120.362 1.00 77.89  ? 250 GLY E CA 1 
ATOM 9903  C C  . GLY E 1 250 ? 154.206 149.257 119.143 1.00 77.89  ? 250 GLY E C  1 
ATOM 9904  O O  . GLY E 1 250 ? 154.577 148.868 118.035 1.00 77.89  ? 250 GLY E O  1 
ATOM 9905  N N  . LEU E 1 251 ? 153.670 150.463 119.328 1.00 78.13  ? 251 LEU E N  1 
ATOM 9906  C CA . LEU E 1 251 ? 153.536 151.371 118.197 1.00 78.13  ? 251 LEU E CA 1 
ATOM 9907  C C  . LEU E 1 251 ? 154.874 151.951 117.787 1.00 78.13  ? 251 LEU E C  1 
ATOM 9908  O O  . LEU E 1 251 ? 155.080 152.281 116.615 1.00 78.13  ? 251 LEU E O  1 
ATOM 9909  N N  . ALA E 1 252 ? 155.792 152.092 118.738 1.00 87.31  ? 252 ALA E N  1 
ATOM 9910  C CA . ALA E 1 252 ? 157.074 152.706 118.423 1.00 87.31  ? 252 ALA E CA 1 
ATOM 9911  C C  . ALA E 1 252 ? 157.946 151.763 117.606 1.00 87.31  ? 252 ALA E C  1 
ATOM 9912  O O  . ALA E 1 252 ? 158.683 152.201 116.716 1.00 87.31  ? 252 ALA E O  1 
ATOM 9913  N N  . ASP E 1 253 ? 157.870 150.464 117.884 1.00 93.79  ? 253 ASP E N  1 
ATOM 9914  C CA . ASP E 1 253 ? 158.673 149.522 117.119 1.00 93.79  ? 253 ASP E CA 1 
ATOM 9915  C C  . ASP E 1 253 ? 157.812 148.647 116.222 1.00 93.79  ? 253 ASP E C  1 
ATOM 9916  O O  . ASP E 1 253 ? 158.281 147.609 115.743 1.00 93.79  ? 253 ASP E O  1 
ATOM 9917  N N  . LYS E 1 254 ? 156.551 149.029 116.032 1.00 90.39  ? 254 LYS E N  1 
ATOM 9918  C CA . LYS E 1 254 ? 155.705 148.603 114.921 1.00 90.39  ? 254 LYS E CA 1 
ATOM 9919  C C  . LYS E 1 254 ? 155.362 147.121 114.962 1.00 90.39  ? 254 LYS E C  1 
ATOM 9920  O O  . LYS E 1 254 ? 155.298 146.478 113.914 1.00 90.39  ? 254 LYS E O  1 
ATOM 9921  N N  . LYS E 1 255 ? 155.146 146.545 116.145 1.00 91.79  ? 255 LYS E N  1 
ATOM 9922  C CA . LYS E 1 255 ? 154.704 145.157 116.188 1.00 91.79  ? 255 LYS E CA 1 
ATOM 9923  C C  . LYS E 1 255 ? 153.243 145.032 115.787 1.00 91.79  ? 255 LYS E C  1 
ATOM 9924  O O  . LYS E 1 255 ? 152.810 143.971 115.327 1.00 91.79  ? 255 LYS E O  1 
ATOM 9925  N N  . ILE E 1 256 ? 152.465 146.094 115.963 1.00 99.21  ? 256 ILE E N  1 
ATOM 9926  C CA . ILE E 1 256 ? 151.076 146.131 115.526 1.00 99.21  ? 256 ILE E CA 1 
ATOM 9927  C C  . ILE E 1 256 ? 150.923 147.309 114.568 1.00 99.21  ? 256 ILE E C  1 
ATOM 9928  O O  . ILE E 1 256 ? 151.654 148.301 114.676 1.00 99.21  ? 256 ILE E O  1 
ATOM 9929  N N  . SER E 1 257 ? 150.013 147.168 113.577 1.00 117.65 ? 257 SER E N  1 
ATOM 9930  C CA . SER E 1 257 ? 149.891 148.148 112.501 1.00 117.65 ? 257 SER E CA 1 
ATOM 9931  C C  . SER E 1 257 ? 148.538 148.838 112.546 1.00 117.65 ? 257 SER E C  1 
ATOM 9932  O O  . SER E 1 257 ? 147.544 148.214 112.944 1.00 117.65 ? 257 SER E O  1 
ATOM 9933  N N  . PRO E 1 258 ? 148.493 150.118 112.150 1.00 121.66 ? 258 PRO E N  1 
ATOM 9934  C CA . PRO E 1 258 ? 147.264 150.912 112.130 1.00 121.66 ? 258 PRO E CA 1 
ATOM 9935  C C  . PRO E 1 258 ? 146.561 150.813 110.781 1.00 121.66 ? 258 PRO E C  1 
ATOM 9936  O O  . PRO E 1 258 ? 145.998 151.799 110.306 1.00 121.66 ? 258 PRO E O  1 
ATOM 9937  N N  . LYS E 1 259 ? 146.600 149.631 110.173 1.00 126.77 ? 259 LYS E N  1 
ATOM 9938  C CA . LYS E 1 259 ? 145.968 149.412 108.877 1.00 126.77 ? 259 LYS E CA 1 
ATOM 9939  C C  . LYS E 1 259 ? 144.454 149.281 109.008 1.00 126.77 ? 259 LYS E C  1 
ATOM 9940  O O  . LYS E 1 259 ? 143.729 150.275 108.975 1.00 126.77 ? 259 LYS E O  1 
ATOM 9941  N N  . ARG E 1 260 ? 143.982 148.047 109.154 1.00 125.73 ? 260 ARG E N  1 
ATOM 9942  C CA . ARG E 1 260 ? 142.555 147.785 109.288 1.00 125.73 ? 260 ARG E CA 1 
ATOM 9943  C C  . ARG E 1 260 ? 141.968 148.528 110.484 1.00 125.73 ? 260 ARG E C  1 
ATOM 9944  O O  . ARG E 1 260 ? 140.925 149.172 110.376 1.00 125.73 ? 260 ARG E O  1 
ATOM 9945  N N  . GLU E 1 266 ? 131.796 144.377 105.131 1.00 102.52 ? 266 GLU E N  1 
ATOM 9946  C CA . GLU E 1 266 ? 132.184 143.988 103.786 1.00 102.52 ? 266 GLU E CA 1 
ATOM 9947  C C  . GLU E 1 266 ? 131.341 144.731 102.773 1.00 102.52 ? 266 GLU E C  1 
ATOM 9948  O O  . GLU E 1 266 ? 131.405 144.457 101.580 1.00 102.52 ? 266 GLU E O  1 
ATOM 9949  N N  . LYS E 1 267 ? 130.546 145.676 103.257 1.00 102.21 ? 267 LYS E N  1 
ATOM 9950  C CA . LYS E 1 267 ? 129.756 146.536 102.389 1.00 102.21 ? 267 LYS E CA 1 
ATOM 9951  C C  . LYS E 1 267 ? 130.510 147.775 101.953 1.00 102.21 ? 267 LYS E C  1 
ATOM 9952  O O  . LYS E 1 267 ? 130.415 148.170 100.790 1.00 102.21 ? 267 LYS E O  1 
ATOM 9953  N N  . LEU E 1 268 ? 131.259 148.397 102.856 1.00 103.02 ? 268 LEU E N  1 
ATOM 9954  C CA . LEU E 1 268 ? 132.075 149.544 102.487 1.00 103.02 ? 268 LEU E CA 1 
ATOM 9955  C C  . LEU E 1 268 ? 133.245 149.160 101.597 1.00 103.02 ? 268 LEU E C  1 
ATOM 9956  O O  . LEU E 1 268 ? 133.685 149.987 100.795 1.00 103.02 ? 268 LEU E O  1 
ATOM 9957  N N  . THR E 1 269 ? 133.742 147.926 101.709 1.00 101.44 ? 269 THR E N  1 
ATOM 9958  C CA . THR E 1 269 ? 134.803 147.469 100.829 1.00 101.44 ? 269 THR E CA 1 
ATOM 9959  C C  . THR E 1 269 ? 134.312 147.315 99.404  1.00 101.44 ? 269 THR E C  1 
ATOM 9960  O O  . THR E 1 269 ? 135.111 147.428 98.471  1.00 101.44 ? 269 THR E O  1 
ATOM 9961  N N  . ALA E 1 270 ? 133.015 147.068 99.221  1.00 105.54 ? 270 ALA E N  1 
ATOM 9962  C CA . ALA E 1 270 ? 132.433 147.170 97.892  1.00 105.54 ? 270 ALA E CA 1 
ATOM 9963  C C  . ALA E 1 270 ? 132.455 148.610 97.406  1.00 105.54 ? 270 ALA E C  1 
ATOM 9964  O O  . ALA E 1 270 ? 132.671 148.870 96.217  1.00 105.54 ? 270 ALA E O  1 
ATOM 9965  N N  . TYR E 1 271 ? 132.251 149.564 98.312  1.00 107.22 ? 271 TYR E N  1 
ATOM 9966  C CA . TYR E 1 271 ? 132.314 150.957 97.902  1.00 107.22 ? 271 TYR E CA 1 
ATOM 9967  C C  . TYR E 1 271 ? 133.743 151.458 97.761  1.00 107.22 ? 271 TYR E C  1 
ATOM 9968  O O  . TYR E 1 271 ? 133.991 152.318 96.905  1.00 107.22 ? 271 TYR E O  1 
ATOM 9969  N N  . ALA E 1 272 ? 134.684 150.860 98.508  1.00 113.12 ? 272 ALA E N  1 
ATOM 9970  C CA . ALA E 1 272 ? 135.965 151.438 98.929  1.00 113.12 ? 272 ALA E CA 1 
ATOM 9971  C C  . ALA E 1 272 ? 136.782 152.076 97.816  1.00 113.12 ? 272 ALA E C  1 
ATOM 9972  O O  . ALA E 1 272 ? 137.515 153.032 98.084  1.00 113.12 ? 272 ALA E O  1 
ATOM 9973  N N  . MET E 1 273 ? 136.670 151.593 96.586  1.00 121.05 ? 273 MET E N  1 
ATOM 9974  C CA . MET E 1 273 ? 137.316 152.243 95.457  1.00 121.05 ? 273 MET E CA 1 
ATOM 9975  C C  . MET E 1 273 ? 136.305 152.682 94.413  1.00 121.05 ? 273 MET E C  1 
ATOM 9976  O O  . MET E 1 273 ? 136.678 153.347 93.439  1.00 121.05 ? 273 MET E O  1 
ATOM 9977  N N  . THR E 1 274 ? 135.035 152.366 94.608  1.00 115.32 ? 274 THR E N  1 
ATOM 9978  C CA . THR E 1 274 ? 134.066 152.419 93.528  1.00 115.32 ? 274 THR E CA 1 
ATOM 9979  C C  . THR E 1 274 ? 133.207 153.662 93.699  1.00 115.32 ? 274 THR E C  1 
ATOM 9980  O O  . THR E 1 274 ? 132.131 153.609 94.295  1.00 115.32 ? 274 THR E O  1 
ATOM 9981  N N  . ILE E 1 275 ? 133.706 154.780 93.180  1.00 124.68 ? 275 ILE E N  1 
ATOM 9982  C CA . ILE E 1 275 ? 132.874 155.912 92.775  1.00 124.68 ? 275 ILE E CA 1 
ATOM 9983  C C  . ILE E 1 275 ? 133.547 156.660 91.618  1.00 124.68 ? 275 ILE E C  1 
ATOM 9984  O O  . ILE E 1 275 ? 134.223 157.679 91.825  1.00 124.68 ? 275 ILE E O  1 
ATOM 9985  N N  . PRO E 1 276 ? 133.478 156.166 90.383  1.00 137.04 ? 276 PRO E N  1 
ATOM 9986  C CA . PRO E 1 276 ? 133.861 157.044 89.267  1.00 137.04 ? 276 PRO E CA 1 
ATOM 9987  C C  . PRO E 1 276 ? 132.694 157.814 88.668  1.00 137.04 ? 276 PRO E C  1 
ATOM 9988  O O  . PRO E 1 276 ? 132.864 158.938 88.184  1.00 137.04 ? 276 PRO E O  1 
ATOM 9989  N N  . PHE E 1 277 ? 131.500 157.228 88.721  1.00 138.37 ? 277 PHE E N  1 
ATOM 9990  C CA . PHE E 1 277 ? 130.377 157.729 87.938  1.00 138.37 ? 277 PHE E CA 1 
ATOM 9991  C C  . PHE E 1 277 ? 129.078 157.828 88.723  1.00 138.37 ? 277 PHE E C  1 
ATOM 9992  O O  . PHE E 1 277 ? 128.229 158.653 88.365  1.00 138.37 ? 277 PHE E O  1 
ATOM 9993  N N  . VAL E 1 278 ? 128.931 157.117 89.849  1.00 128.10 ? 278 VAL E N  1 
ATOM 9994  C CA . VAL E 1 278 ? 127.706 157.149 90.651  1.00 128.10 ? 278 VAL E CA 1 
ATOM 9995  C C  . VAL E 1 278 ? 127.648 158.384 91.537  1.00 128.10 ? 278 VAL E C  1 
ATOM 9996  O O  . VAL E 1 278 ? 126.764 158.483 92.401  1.00 128.10 ? 278 VAL E O  1 
ATOM 9997  N N  . ARG E 1 279 ? 128.568 159.333 91.312  1.00 135.55 ? 279 ARG E N  1 
ATOM 9998  C CA . ARG E 1 279 ? 128.817 160.493 92.168  1.00 135.55 ? 279 ARG E CA 1 
ATOM 9999  C C  . ARG E 1 279 ? 127.557 161.305 92.432  1.00 135.55 ? 279 ARG E C  1 
ATOM 10000 O O  . ARG E 1 279 ? 127.114 161.399 93.580  1.00 135.55 ? 279 ARG E O  1 
ATOM 10001 N N  . GLN E 1 280 ? 126.945 161.849 91.380  1.00 126.78 ? 280 GLN E N  1 
ATOM 10002 C CA . GLN E 1 280 ? 125.680 162.574 91.509  1.00 126.78 ? 280 GLN E CA 1 
ATOM 10003 C C  . GLN E 1 280 ? 124.558 161.663 92.000  1.00 126.78 ? 280 GLN E C  1 
ATOM 10004 O O  . GLN E 1 280 ? 123.654 162.104 92.719  1.00 126.78 ? 280 GLN E O  1 
ATOM 10005 N N  . GLN E 1 281 ? 124.627 160.379 91.660  1.00 131.53 ? 281 GLN E N  1 
ATOM 10006 C CA . GLN E 1 281 ? 123.607 159.392 91.983  1.00 131.53 ? 281 GLN E CA 1 
ATOM 10007 C C  . GLN E 1 281 ? 123.755 158.819 93.383  1.00 131.53 ? 281 GLN E C  1 
ATOM 10008 O O  . GLN E 1 281 ? 123.293 157.705 93.644  1.00 131.53 ? 281 GLN E O  1 
ATOM 10009 N N  . VAL E 1 282 ? 124.425 159.540 94.278  1.00 111.80 ? 282 VAL E N  1 
ATOM 10010 C CA . VAL E 1 282 ? 124.339 159.301 95.708  1.00 111.80 ? 282 VAL E CA 1 
ATOM 10011 C C  . VAL E 1 282 ? 123.918 160.555 96.459  1.00 111.80 ? 282 VAL E C  1 
ATOM 10012 O O  . VAL E 1 282 ? 122.941 160.534 97.223  1.00 111.80 ? 282 VAL E O  1 
ATOM 10013 N N  . TYR E 1 283 ? 124.600 161.677 96.221  1.00 115.38 ? 283 TYR E N  1 
ATOM 10014 C CA . TYR E 1 283 ? 124.229 162.872 96.965  1.00 115.38 ? 283 TYR E CA 1 
ATOM 10015 C C  . TYR E 1 283 ? 122.985 163.529 96.381  1.00 115.38 ? 283 TYR E C  1 
ATOM 10016 O O  . TYR E 1 283 ? 122.390 164.388 97.025  1.00 115.38 ? 283 TYR E O  1 
ATOM 10017 N N  . LYS E 1 284 ? 122.541 163.121 95.193  1.00 109.71 ? 284 LYS E N  1 
ATOM 10018 C CA . LYS E 1 284 ? 121.216 163.552 94.757  1.00 109.71 ? 284 LYS E CA 1 
ATOM 10019 C C  . LYS E 1 284 ? 120.129 162.811 95.520  1.00 109.71 ? 284 LYS E C  1 
ATOM 10020 O O  . LYS E 1 284 ? 119.127 163.413 95.942  1.00 109.71 ? 284 LYS E O  1 
ATOM 10021 N N  . LYS E 1 285 ? 120.320 161.500 95.701  1.00 111.79 ? 285 LYS E N  1 
ATOM 10022 C CA . LYS E 1 285 ? 119.430 160.699 96.531  1.00 111.79 ? 285 LYS E CA 1 
ATOM 10023 C C  . LYS E 1 285 ? 119.397 161.226 97.952  1.00 111.79 ? 285 LYS E C  1 
ATOM 10024 O O  . LYS E 1 285 ? 118.344 161.211 98.588  1.00 111.79 ? 285 LYS E O  1 
ATOM 10025 N N  . VAL E 1 286 ? 120.524 161.740 98.438  1.00 103.58 ? 286 VAL E N  1 
ATOM 10026 C CA . VAL E 1 286 ? 120.545 162.391 99.741  1.00 103.58 ? 286 VAL E CA 1 
ATOM 10027 C C  . VAL E 1 286 ? 119.959 163.807 99.704  1.00 103.58 ? 286 VAL E C  1 
ATOM 10028 O O  . VAL E 1 286 ? 119.318 164.239 100.677 1.00 103.58 ? 286 VAL E O  1 
ATOM 10029 N N  . GLU E 1 287 ? 120.146 164.529 98.596  1.00 106.47 ? 287 GLU E N  1 
ATOM 10030 C CA . GLU E 1 287 ? 119.617 165.871 98.390  1.00 106.47 ? 287 GLU E CA 1 
ATOM 10031 C C  . GLU E 1 287 ? 118.109 165.908 98.495  1.00 106.47 ? 287 GLU E C  1 
ATOM 10032 O O  . GLU E 1 287 ? 117.547 166.858 99.049  1.00 106.47 ? 287 GLU E O  1 
ATOM 10033 N N  . GLU E 1 288 ? 117.444 164.883 97.985  1.00 107.40 ? 288 GLU E N  1 
ATOM 10034 C CA . GLU E 1 288 ? 116.005 164.864 98.179  1.00 107.40 ? 288 GLU E CA 1 
ATOM 10035 C C  . GLU E 1 288 ? 115.638 164.085 99.439  1.00 107.40 ? 288 GLU E C  1 
ATOM 10036 O O  . GLU E 1 288 ? 114.520 164.226 99.946  1.00 107.40 ? 288 GLU E O  1 
ATOM 10037 N N  . LYS E 1 289 ? 116.582 163.317 100.001 1.00 103.19 ? 289 LYS E N  1 
ATOM 10038 C CA . LYS E 1 289 ? 116.352 162.659 101.288 1.00 103.19 ? 289 LYS E CA 1 
ATOM 10039 C C  . LYS E 1 289 ? 116.208 163.653 102.425 1.00 103.19 ? 289 LYS E C  1 
ATOM 10040 O O  . LYS E 1 289 ? 115.355 163.476 103.302 1.00 103.19 ? 289 LYS E O  1 
ATOM 10041 N N  . VAL E 1 290 ? 117.042 164.688 102.432 1.00 101.23 ? 290 VAL E N  1 
ATOM 10042 C CA . VAL E 1 290 ? 117.020 165.630 103.537 1.00 101.23 ? 290 VAL E CA 1 
ATOM 10043 C C  . VAL E 1 290 ? 115.771 166.501 103.479 1.00 101.23 ? 290 VAL E C  1 
ATOM 10044 O O  . VAL E 1 290 ? 115.275 166.951 104.518 1.00 101.23 ? 290 VAL E O  1 
ATOM 10045 N N  . ARG E 1 291 ? 115.199 166.685 102.297 1.00 101.32 ? 291 ARG E N  1 
ATOM 10046 C CA . ARG E 1 291 ? 113.982 167.457 102.166 1.00 101.32 ? 291 ARG E CA 1 
ATOM 10047 C C  . ARG E 1 291 ? 112.734 166.594 102.127 1.00 101.32 ? 291 ARG E C  1 
ATOM 10048 O O  . ARG E 1 291 ? 111.631 167.144 102.060 1.00 101.32 ? 291 ARG E O  1 
ATOM 10049 N N  . LYS E 1 292 ? 112.873 165.268 102.115 1.00 110.65 ? 292 LYS E N  1 
ATOM 10050 C CA . LYS E 1 292 ? 111.731 164.417 102.424 1.00 110.65 ? 292 LYS E CA 1 
ATOM 10051 C C  . LYS E 1 292 ? 111.647 164.078 103.908 1.00 110.65 ? 292 LYS E C  1 
ATOM 10052 O O  . LYS E 1 292 ? 110.543 163.886 104.425 1.00 110.65 ? 292 LYS E O  1 
ATOM 10053 N N  . GLN E 1 293 ? 112.778 164.014 104.617 1.00 105.36 ? 293 GLN E N  1 
ATOM 10054 C CA . GLN E 1 293 ? 112.720 163.786 106.057 1.00 105.36 ? 293 GLN E CA 1 
ATOM 10055 C C  . GLN E 1 293 ? 112.209 165.018 106.778 1.00 105.36 ? 293 GLN E C  1 
ATOM 10056 O O  . GLN E 1 293 ? 111.128 165.008 107.375 1.00 105.36 ? 293 GLN E O  1 
ATOM 10057 N N  . THR E 1 294 ? 112.970 166.095 106.719 1.00 106.25 ? 294 THR E N  1 
ATOM 10058 C CA . THR E 1 294 ? 112.487 167.391 107.146 1.00 106.25 ? 294 THR E CA 1 
ATOM 10059 C C  . THR E 1 294 ? 111.885 168.074 105.935 1.00 106.25 ? 294 THR E C  1 
ATOM 10060 O O  . THR E 1 294 ? 111.658 167.458 104.896 1.00 106.25 ? 294 THR E O  1 
ATOM 10061 N N  . LYS E 1 295 ? 111.637 169.357 106.057 1.00 112.74 ? 295 LYS E N  1 
ATOM 10062 C CA . LYS E 1 295 ? 111.256 170.178 104.929 1.00 112.74 ? 295 LYS E CA 1 
ATOM 10063 C C  . LYS E 1 295 ? 112.435 171.071 104.573 1.00 112.74 ? 295 LYS E C  1 
ATOM 10064 O O  . LYS E 1 295 ? 113.424 171.166 105.304 1.00 112.74 ? 295 LYS E O  1 
ATOM 10065 N N  . GLY E 1 296 ? 112.311 171.761 103.453 1.00 120.13 ? 296 GLY E N  1 
ATOM 10066 C CA . GLY E 1 296 ? 113.413 172.546 102.960 1.00 120.13 ? 296 GLY E CA 1 
ATOM 10067 C C  . GLY E 1 296 ? 113.755 173.803 103.722 1.00 120.13 ? 296 GLY E C  1 
ATOM 10068 O O  . GLY E 1 296 ? 114.694 174.493 103.322 1.00 120.13 ? 296 GLY E O  1 
ATOM 10069 N N  . LEU E 1 297 ? 113.051 174.154 104.796 1.00 111.41 ? 297 LEU E N  1 
ATOM 10070 C CA . LEU E 1 297 ? 113.378 175.394 105.483 1.00 111.41 ? 297 LEU E CA 1 
ATOM 10071 C C  . LEU E 1 297 ? 114.289 175.185 106.680 1.00 111.41 ? 297 LEU E C  1 
ATOM 10072 O O  . LEU E 1 297 ? 114.202 175.935 107.659 1.00 111.41 ? 297 LEU E O  1 
ATOM 10073 N N  . TYR E 1 298 ? 115.168 174.185 106.608 1.00 106.14 ? 298 TYR E N  1 
ATOM 10074 C CA . TYR E 1 298 ? 116.387 174.097 107.406 1.00 106.14 ? 298 TYR E CA 1 
ATOM 10075 C C  . TYR E 1 298 ? 117.560 174.446 106.501 1.00 106.14 ? 298 TYR E C  1 
ATOM 10076 O O  . TYR E 1 298 ? 118.082 173.568 105.800 1.00 106.14 ? 298 TYR E O  1 
ATOM 10077 N N  . PRO E 1 299 ? 118.034 175.695 106.470 1.00 98.15  ? 299 PRO E N  1 
ATOM 10078 C CA . PRO E 1 299 ? 119.301 175.958 105.771 1.00 98.15  ? 299 PRO E CA 1 
ATOM 10079 C C  . PRO E 1 299 ? 120.545 175.501 106.521 1.00 98.15  ? 299 PRO E C  1 
ATOM 10080 O O  . PRO E 1 299 ? 121.652 175.778 106.057 1.00 98.15  ? 299 PRO E O  1 
ATOM 10081 N N  . ALA E 1 300 ? 120.424 174.814 107.649 1.00 89.57  ? 300 ALA E N  1 
ATOM 10082 C CA . ALA E 1 300 ? 121.614 174.289 108.308 1.00 89.57  ? 300 ALA E CA 1 
ATOM 10083 C C  . ALA E 1 300 ? 122.202 173.027 107.666 1.00 89.57  ? 300 ALA E C  1 
ATOM 10084 O O  . ALA E 1 300 ? 123.350 173.090 107.216 1.00 89.57  ? 300 ALA E O  1 
ATOM 10085 N N  . PRO E 1 301 ? 121.507 171.877 107.577 1.00 86.05  ? 301 PRO E N  1 
ATOM 10086 C CA . PRO E 1 301 ? 122.248 170.622 107.379 1.00 86.05  ? 301 PRO E CA 1 
ATOM 10087 C C  . PRO E 1 301 ? 122.767 170.401 105.972 1.00 86.05  ? 301 PRO E C  1 
ATOM 10088 O O  . PRO E 1 301 ? 123.805 169.751 105.823 1.00 86.05  ? 301 PRO E O  1 
ATOM 10089 N N  . LEU E 1 302 ? 122.111 170.939 104.940 1.00 93.83  ? 302 LEU E N  1 
ATOM 10090 C CA . LEU E 1 302 ? 122.655 170.851 103.587 1.00 93.83  ? 302 LEU E CA 1 
ATOM 10091 C C  . LEU E 1 302 ? 123.959 171.613 103.450 1.00 93.83  ? 302 LEU E C  1 
ATOM 10092 O O  . LEU E 1 302 ? 124.788 171.279 102.598 1.00 93.83  ? 302 LEU E O  1 
ATOM 10093 N N  . LYS E 1 303 ? 124.177 172.602 104.300 1.00 94.69  ? 303 LYS E N  1 
ATOM 10094 C CA . LYS E 1 303 ? 125.441 173.295 104.355 1.00 94.69  ? 303 LYS E CA 1 
ATOM 10095 C C  . LYS E 1 303 ? 126.526 172.506 105.071 1.00 94.69  ? 303 LYS E C  1 
ATOM 10096 O O  . LYS E 1 303 ? 127.594 173.078 105.308 1.00 94.69  ? 303 LYS E O  1 
ATOM 10097 N N  . ILE E 1 304 ? 126.330 171.231 105.420 1.00 99.44  ? 304 ILE E N  1 
ATOM 10098 C CA . ILE E 1 304 ? 127.500 170.384 105.621 1.00 99.44  ? 304 ILE E CA 1 
ATOM 10099 C C  . ILE E 1 304 ? 127.607 169.380 104.485 1.00 99.44  ? 304 ILE E C  1 
ATOM 10100 O O  . ILE E 1 304 ? 128.615 168.665 104.387 1.00 99.44  ? 304 ILE E O  1 
ATOM 10101 N N  . ILE E 1 305 ? 126.586 169.292 103.642 1.00 101.24 ? 305 ILE E N  1 
ATOM 10102 C CA . ILE E 1 305 ? 126.649 168.397 102.502 1.00 101.24 ? 305 ILE E CA 1 
ATOM 10103 C C  . ILE E 1 305 ? 127.605 168.941 101.460 1.00 101.24 ? 305 ILE E C  1 
ATOM 10104 O O  . ILE E 1 305 ? 128.431 168.202 100.917 1.00 101.24 ? 305 ILE E O  1 
ATOM 10105 N N  . ASP E 1 306 ? 127.543 170.254 101.216 1.00 104.17 ? 306 ASP E N  1 
ATOM 10106 C CA . ASP E 1 306 ? 128.432 170.931 100.277 1.00 104.17 ? 306 ASP E CA 1 
ATOM 10107 C C  . ASP E 1 306 ? 129.899 170.797 100.652 1.00 104.17 ? 306 ASP E C  1 
ATOM 10108 O O  . ASP E 1 306 ? 130.762 170.885 99.776  1.00 104.17 ? 306 ASP E O  1 
ATOM 10109 N N  . VAL E 1 307 ? 130.186 170.617 101.937 1.00 104.45 ? 307 VAL E N  1 
ATOM 10110 C CA . VAL E 1 307 ? 131.519 170.216 102.350 1.00 104.45 ? 307 VAL E CA 1 
ATOM 10111 C C  . VAL E 1 307 ? 131.863 168.861 101.755 1.00 104.45 ? 307 VAL E C  1 
ATOM 10112 O O  . VAL E 1 307 ? 132.792 168.738 100.948 1.00 104.45 ? 307 VAL E O  1 
ATOM 10113 N N  . VAL E 1 308 ? 131.075 167.838 102.090 1.00 104.30 ? 308 VAL E N  1 
ATOM 10114 C CA . VAL E 1 308 ? 131.421 166.496 101.654 1.00 104.30 ? 308 VAL E CA 1 
ATOM 10115 C C  . VAL E 1 308 ? 131.114 166.317 100.173 1.00 104.30 ? 308 VAL E C  1 
ATOM 10116 O O  . VAL E 1 308 ? 131.627 165.389 99.540  1.00 104.30 ? 308 VAL E O  1 
ATOM 10117 N N  . LYS E 1 309 ? 130.315 167.210 99.591  1.00 113.70 ? 309 LYS E N  1 
ATOM 10118 C CA . LYS E 1 309 ? 130.209 167.301 98.144  1.00 113.70 ? 309 LYS E CA 1 
ATOM 10119 C C  . LYS E 1 309 ? 131.476 167.847 97.506  1.00 113.70 ? 309 LYS E C  1 
ATOM 10120 O O  . LYS E 1 309 ? 131.896 167.343 96.459  1.00 113.70 ? 309 LYS E O  1 
ATOM 10121 N N  . THR E 1 310 ? 132.105 168.851 98.114  1.00 118.96 ? 310 THR E N  1 
ATOM 10122 C CA . THR E 1 310 ? 133.325 169.408 97.558  1.00 118.96 ? 310 THR E CA 1 
ATOM 10123 C C  . THR E 1 310 ? 134.589 168.770 98.099  1.00 118.96 ? 310 THR E C  1 
ATOM 10124 O O  . THR E 1 310 ? 135.637 168.891 97.459  1.00 118.96 ? 310 THR E O  1 
ATOM 10125 N N  . GLY E 1 311 ? 134.523 168.112 99.255  1.00 120.86 ? 311 GLY E N  1 
ATOM 10126 C CA . GLY E 1 311 ? 135.686 167.400 99.751  1.00 120.86 ? 311 GLY E CA 1 
ATOM 10127 C C  . GLY E 1 311 ? 136.079 166.247 98.856  1.00 120.86 ? 311 GLY E C  1 
ATOM 10128 O O  . GLY E 1 311 ? 137.266 166.025 98.601  1.00 120.86 ? 311 GLY E O  1 
ATOM 10129 N N  . ILE E 1 312 ? 135.095 165.515 98.345  1.00 117.48 ? 312 ILE E N  1 
ATOM 10130 C CA . ILE E 1 312 ? 135.369 164.563 97.287  1.00 117.48 ? 312 ILE E CA 1 
ATOM 10131 C C  . ILE E 1 312 ? 135.631 165.335 95.999  1.00 117.48 ? 312 ILE E C  1 
ATOM 10132 O O  . ILE E 1 312 ? 135.148 166.465 95.825  1.00 117.48 ? 312 ILE E O  1 
ATOM 10133 N N  . GLU E 1 313 ? 136.535 164.794 95.173  1.00 136.39 ? 313 GLU E N  1 
ATOM 10134 C CA . GLU E 1 313 ? 136.819 165.153 93.781  1.00 136.39 ? 313 GLU E CA 1 
ATOM 10135 C C  . GLU E 1 313 ? 137.581 166.475 93.654  1.00 136.39 ? 313 GLU E C  1 
ATOM 10136 O O  . GLU E 1 313 ? 138.128 166.784 92.591  1.00 136.39 ? 313 GLU E O  1 
ATOM 10137 N N  . GLN E 1 314 ? 137.707 167.230 94.726  1.00 121.17 ? 314 GLN E N  1 
ATOM 10138 C CA . GLN E 1 314 ? 138.443 168.475 94.649  1.00 121.17 ? 314 GLN E CA 1 
ATOM 10139 C C  . GLN E 1 314 ? 139.592 168.432 95.642  1.00 121.17 ? 314 GLN E C  1 
ATOM 10140 O O  . GLN E 1 314 ? 139.897 167.383 96.217  1.00 121.17 ? 314 GLN E O  1 
ATOM 10141 N N  . GLY E 1 315 ? 140.252 169.575 95.816  1.00 124.56 ? 315 GLY E N  1 
ATOM 10142 C CA . GLY E 1 315 ? 141.392 169.683 96.704  1.00 124.56 ? 315 GLY E CA 1 
ATOM 10143 C C  . GLY E 1 315 ? 141.041 169.440 98.155  1.00 124.56 ? 315 GLY E C  1 
ATOM 10144 O O  . GLY E 1 315 ? 140.333 170.240 98.770  1.00 124.56 ? 315 GLY E O  1 
ATOM 10145 N N  . SER E 1 316 ? 141.531 168.324 98.699  1.00 121.12 ? 316 SER E N  1 
ATOM 10146 C CA . SER E 1 316 ? 141.176 167.927 100.056 1.00 121.12 ? 316 SER E CA 1 
ATOM 10147 C C  . SER E 1 316 ? 141.790 168.869 101.079 1.00 121.12 ? 316 SER E C  1 
ATOM 10148 O O  . SER E 1 316 ? 141.084 169.409 101.937 1.00 121.12 ? 316 SER E O  1 
ATOM 10149 N N  . ASP E 1 317 ? 143.106 169.082 100.996 1.00 121.40 ? 317 ASP E N  1 
ATOM 10150 C CA . ASP E 1 317 ? 143.760 170.059 101.860 1.00 121.40 ? 317 ASP E CA 1 
ATOM 10151 C C  . ASP E 1 317 ? 143.295 171.473 101.550 1.00 121.40 ? 317 ASP E C  1 
ATOM 10152 O O  . ASP E 1 317 ? 143.194 172.306 102.457 1.00 121.40 ? 317 ASP E O  1 
ATOM 10153 N N  . ALA E 1 318 ? 142.991 171.754 100.282 1.00 117.01 ? 318 ALA E N  1 
ATOM 10154 C CA . ALA E 1 318 ? 142.341 173.007 99.932  1.00 117.01 ? 318 ALA E CA 1 
ATOM 10155 C C  . ALA E 1 318 ? 140.907 173.059 100.429 1.00 117.01 ? 318 ALA E C  1 
ATOM 10156 O O  . ALA E 1 318 ? 140.347 174.151 100.563 1.00 117.01 ? 318 ALA E O  1 
ATOM 10157 N N  . GLY E 1 319 ? 140.300 171.909 100.699 1.00 108.70 ? 319 GLY E N  1 
ATOM 10158 C CA . GLY E 1 319 ? 138.950 171.893 101.211 1.00 108.70 ? 319 GLY E CA 1 
ATOM 10159 C C  . GLY E 1 319 ? 138.813 172.248 102.664 1.00 108.70 ? 319 GLY E C  1 
ATOM 10160 O O  . GLY E 1 319 ? 137.691 172.451 103.123 1.00 108.70 ? 319 GLY E O  1 
ATOM 10161 N N  . TYR E 1 320 ? 139.908 172.332 103.409 1.00 106.02 ? 320 TYR E N  1 
ATOM 10162 C CA . TYR E 1 320 ? 139.835 172.660 104.824 1.00 106.02 ? 320 TYR E CA 1 
ATOM 10163 C C  . TYR E 1 320 ? 139.621 174.142 105.091 1.00 106.02 ? 320 TYR E C  1 
ATOM 10164 O O  . TYR E 1 320 ? 139.575 174.544 106.256 1.00 106.02 ? 320 TYR E O  1 
ATOM 10165 N N  . LEU E 1 321 ? 139.496 174.963 104.054 1.00 102.45 ? 321 LEU E N  1 
ATOM 10166 C CA . LEU E 1 321 ? 139.200 176.371 104.229 1.00 102.45 ? 321 LEU E CA 1 
ATOM 10167 C C  . LEU E 1 321 ? 137.862 176.780 103.649 1.00 102.45 ? 321 LEU E C  1 
ATOM 10168 O O  . LEU E 1 321 ? 137.519 177.964 103.719 1.00 102.45 ? 321 LEU E O  1 
ATOM 10169 N N  . CYS E 1 322 ? 137.107 175.850 103.071 1.00 111.26 ? 322 CYS E N  1 
ATOM 10170 C CA . CYS E 1 322 ? 135.774 176.196 102.601 1.00 111.26 ? 322 CYS E CA 1 
ATOM 10171 C C  . CYS E 1 322 ? 134.842 176.430 103.775 1.00 111.26 ? 322 CYS E C  1 
ATOM 10172 O O  . CYS E 1 322 ? 134.086 177.403 103.789 1.00 111.26 ? 322 CYS E O  1 
ATOM 10173 N N  . GLU E 1 323 ? 134.917 175.566 104.786 1.00 103.62 ? 323 GLU E N  1 
ATOM 10174 C CA . GLU E 1 323 ? 134.056 175.673 105.953 1.00 103.62 ? 323 GLU E CA 1 
ATOM 10175 C C  . GLU E 1 323 ? 134.393 176.878 106.809 1.00 103.62 ? 323 GLU E C  1 
ATOM 10176 O O  . GLU E 1 323 ? 133.555 177.310 107.606 1.00 103.62 ? 323 GLU E O  1 
ATOM 10177 N N  . SER E 1 324 ? 135.600 177.424 106.658 1.00 109.89 ? 324 SER E N  1 
ATOM 10178 C CA . SER E 1 324 ? 135.906 178.732 107.217 1.00 109.89 ? 324 SER E CA 1 
ATOM 10179 C C  . SER E 1 324 ? 135.049 179.811 106.585 1.00 109.89 ? 324 SER E C  1 
ATOM 10180 O O  . SER E 1 324 ? 134.701 180.795 107.243 1.00 109.89 ? 324 SER E O  1 
ATOM 10181 N N  . GLN E 1 325 ? 134.699 179.649 105.320 1.00 107.53 ? 325 GLN E N  1 
ATOM 10182 C CA . GLN E 1 325 ? 133.712 180.523 104.718 1.00 107.53 ? 325 GLN E CA 1 
ATOM 10183 C C  . GLN E 1 325 ? 132.295 180.017 104.921 1.00 107.53 ? 325 GLN E C  1 
ATOM 10184 O O  . GLN E 1 325 ? 131.370 180.562 104.310 1.00 107.53 ? 325 GLN E O  1 
ATOM 10185 N N  . LYS E 1 326 ? 132.102 178.986 105.742 1.00 109.87 ? 326 LYS E N  1 
ATOM 10186 C CA . LYS E 1 326 ? 130.767 178.459 105.990 1.00 109.87 ? 326 LYS E CA 1 
ATOM 10187 C C  . LYS E 1 326 ? 130.359 178.498 107.451 1.00 109.87 ? 326 LYS E C  1 
ATOM 10188 O O  . LYS E 1 326 ? 129.226 178.879 107.741 1.00 109.87 ? 326 LYS E O  1 
ATOM 10189 N N  . PHE E 1 327 ? 131.261 178.130 108.371 1.00 106.26 ? 327 PHE E N  1 
ATOM 10190 C CA . PHE E 1 327 ? 130.936 178.096 109.797 1.00 106.26 ? 327 PHE E CA 1 
ATOM 10191 C C  . PHE E 1 327 ? 130.568 179.471 110.319 1.00 106.26 ? 327 PHE E C  1 
ATOM 10192 O O  . PHE E 1 327 ? 129.672 179.604 111.156 1.00 106.26 ? 327 PHE E O  1 
ATOM 10193 N N  . GLY E 1 328 ? 131.238 180.508 109.822 1.00 109.76 ? 328 GLY E N  1 
ATOM 10194 C CA . GLY E 1 328 ? 130.863 181.860 110.179 1.00 109.76 ? 328 GLY E CA 1 
ATOM 10195 C C  . GLY E 1 328 ? 129.525 182.282 109.622 1.00 109.76 ? 328 GLY E C  1 
ATOM 10196 O O  . GLY E 1 328 ? 128.870 183.151 110.202 1.00 109.76 ? 328 GLY E O  1 
ATOM 10197 N N  . GLU E 1 329 ? 129.095 181.673 108.519 1.00 111.70 ? 329 GLU E N  1 
ATOM 10198 C CA . GLU E 1 329 ? 127.783 181.994 107.982 1.00 111.70 ? 329 GLU E CA 1 
ATOM 10199 C C  . GLU E 1 329 ? 126.679 181.419 108.860 1.00 111.70 ? 329 GLU E C  1 
ATOM 10200 O O  . GLU E 1 329 ? 125.891 182.166 109.454 1.00 111.70 ? 329 GLU E O  1 
ATOM 10201 N N  . LEU E 1 330 ? 126.631 180.093 108.999 1.00 103.85 ? 330 LEU E N  1 
ATOM 10202 C CA . LEU E 1 330 ? 125.457 179.488 109.614 1.00 103.85 ? 330 LEU E CA 1 
ATOM 10203 C C  . LEU E 1 330 ? 125.474 179.546 111.135 1.00 103.85 ? 330 LEU E C  1 
ATOM 10204 O O  . LEU E 1 330 ? 124.523 179.079 111.765 1.00 103.85 ? 330 LEU E O  1 
ATOM 10205 N N  . VAL E 1 331 ? 126.518 180.100 111.746 1.00 101.54 ? 331 VAL E N  1 
ATOM 10206 C CA . VAL E 1 331 ? 126.433 180.458 113.155 1.00 101.54 ? 331 VAL E CA 1 
ATOM 10207 C C  . VAL E 1 331 ? 125.931 181.879 113.330 1.00 101.54 ? 331 VAL E C  1 
ATOM 10208 O O  . VAL E 1 331 ? 125.119 182.138 114.231 1.00 101.54 ? 331 VAL E O  1 
ATOM 10209 N N  . MET E 1 332 ? 126.294 182.788 112.437 1.00 109.44 ? 332 MET E N  1 
ATOM 10210 C CA . MET E 1 332 ? 125.868 184.174 112.536 1.00 109.44 ? 332 MET E CA 1 
ATOM 10211 C C  . MET E 1 332 ? 124.577 184.424 111.763 1.00 109.44 ? 332 MET E C  1 
ATOM 10212 O O  . MET E 1 332 ? 124.371 185.509 111.217 1.00 109.44 ? 332 MET E O  1 
ATOM 10213 N N  . THR E 1 333 ? 123.703 183.428 111.709 1.00 97.27  ? 333 THR E N  1 
ATOM 10214 C CA . THR E 1 333 ? 122.447 183.528 110.990 1.00 97.27  ? 333 THR E CA 1 
ATOM 10215 C C  . THR E 1 333 ? 121.265 183.476 111.948 1.00 97.27  ? 333 THR E C  1 
ATOM 10216 O O  . THR E 1 333 ? 121.405 183.240 113.150 1.00 97.27  ? 333 THR E O  1 
ATOM 10217 N N  . LYS E 1 334 ? 120.084 183.699 111.379 1.00 94.91  ? 334 LYS E N  1 
ATOM 10218 C CA . LYS E 1 334 ? 118.827 183.699 112.107 1.00 94.91  ? 334 LYS E CA 1 
ATOM 10219 C C  . LYS E 1 334 ? 118.170 182.337 112.148 1.00 94.91  ? 334 LYS E C  1 
ATOM 10220 O O  . LYS E 1 334 ? 116.995 182.243 112.513 1.00 94.91  ? 334 LYS E O  1 
ATOM 10221 N N  . GLU E 1 335 ? 118.881 181.285 111.756 1.00 98.55  ? 335 GLU E N  1 
ATOM 10222 C CA . GLU E 1 335 ? 118.320 179.948 111.877 1.00 98.55  ? 335 GLU E CA 1 
ATOM 10223 C C  . GLU E 1 335 ? 118.546 179.395 113.276 1.00 98.55  ? 335 GLU E C  1 
ATOM 10224 O O  . GLU E 1 335 ? 117.600 179.014 113.969 1.00 98.55  ? 335 GLU E O  1 
ATOM 10225 N N  . SER E 1 336 ? 119.800 179.356 113.713 1.00 90.09  ? 336 SER E N  1 
ATOM 10226 C CA . SER E 1 336 ? 120.149 178.692 114.956 1.00 90.09  ? 336 SER E CA 1 
ATOM 10227 C C  . SER E 1 336 ? 120.706 179.642 116.001 1.00 90.09  ? 336 SER E C  1 
ATOM 10228 O O  . SER E 1 336 ? 121.391 179.192 116.919 1.00 90.09  ? 336 SER E O  1 
ATOM 10229 N N  . LYS E 1 337 ? 120.436 180.944 115.881 1.00 90.37  ? 337 LYS E N  1 
ATOM 10230 C CA . LYS E 1 337 ? 120.963 181.885 116.864 1.00 90.37  ? 337 LYS E CA 1 
ATOM 10231 C C  . LYS E 1 337 ? 120.327 181.661 118.227 1.00 90.37  ? 337 LYS E C  1 
ATOM 10232 O O  . LYS E 1 337 ? 121.018 181.666 119.250 1.00 90.37  ? 337 LYS E O  1 
ATOM 10233 N N  . ALA E 1 338 ? 119.021 181.440 118.255 1.00 91.63  ? 338 ALA E N  1 
ATOM 10234 C CA . ALA E 1 338 ? 118.320 181.115 119.484 1.00 91.63  ? 338 ALA E CA 1 
ATOM 10235 C C  . ALA E 1 338 ? 118.409 179.643 119.837 1.00 91.63  ? 338 ALA E C  1 
ATOM 10236 O O  . ALA E 1 338 ? 117.910 179.237 120.894 1.00 91.63  ? 338 ALA E O  1 
ATOM 10237 N N  . LEU E 1 339 ? 119.029 178.838 118.980 1.00 90.26  ? 339 LEU E N  1 
ATOM 10238 C CA . LEU E 1 339 ? 119.140 177.422 119.273 1.00 90.26  ? 339 LEU E CA 1 
ATOM 10239 C C  . LEU E 1 339 ? 120.131 177.193 120.404 1.00 90.26  ? 339 LEU E C  1 
ATOM 10240 O O  . LEU E 1 339 ? 119.985 176.241 121.179 1.00 90.26  ? 339 LEU E O  1 
ATOM 10241 N N  . MET E 1 340 ? 121.103 178.094 120.551 1.00 107.06 ? 340 MET E N  1 
ATOM 10242 C CA . MET E 1 340 ? 121.999 178.039 121.702 1.00 107.06 ? 340 MET E CA 1 
ATOM 10243 C C  . MET E 1 340 ? 121.232 178.306 122.993 1.00 107.06 ? 340 MET E C  1 
ATOM 10244 O O  . MET E 1 340 ? 121.475 177.661 124.016 1.00 107.06 ? 340 MET E O  1 
ATOM 10245 N N  . GLY E 1 341 ? 120.284 179.249 122.960 1.00 99.94  ? 341 GLY E N  1 
ATOM 10246 C CA . GLY E 1 341 ? 119.455 179.502 124.129 1.00 99.94  ? 341 GLY E CA 1 
ATOM 10247 C C  . GLY E 1 341 ? 118.521 178.352 124.426 1.00 99.94  ? 341 GLY E C  1 
ATOM 10248 O O  . GLY E 1 341 ? 118.242 178.064 125.595 1.00 99.94  ? 341 GLY E O  1 
ATOM 10249 N N  . LEU E 1 342 ? 118.041 177.678 123.375 1.00 93.92  ? 342 LEU E N  1 
ATOM 10250 C CA . LEU E 1 342 ? 117.316 176.427 123.556 1.00 93.92  ? 342 LEU E CA 1 
ATOM 10251 C C  . LEU E 1 342 ? 118.181 175.392 124.259 1.00 93.92  ? 342 LEU E C  1 
ATOM 10252 O O  . LEU E 1 342 ? 117.693 174.646 125.110 1.00 93.92  ? 342 LEU E O  1 
ATOM 10253 N N  . TYR E 1 343 ? 119.474 175.347 123.939 1.00 90.87  ? 343 TYR E N  1 
ATOM 10254 C CA . TYR E 1 343 ? 120.325 174.364 124.599 1.00 90.87  ? 343 TYR E CA 1 
ATOM 10255 C C  . TYR E 1 343 ? 120.653 174.761 126.030 1.00 90.87  ? 343 TYR E C  1 
ATOM 10256 O O  . TYR E 1 343 ? 120.791 173.887 126.893 1.00 90.87  ? 343 TYR E O  1 
ATOM 10257 N N  . HIS E 1 344 ? 120.810 176.061 126.286 1.00 95.36  ? 344 HIS E N  1 
ATOM 10258 C CA . HIS E 1 344 ? 120.986 176.536 127.654 1.00 95.36  ? 344 HIS E CA 1 
ATOM 10259 C C  . HIS E 1 344 ? 119.790 176.185 128.514 1.00 95.36  ? 344 HIS E C  1 
ATOM 10260 O O  . HIS E 1 344 ? 119.946 175.775 129.665 1.00 95.36  ? 344 HIS E O  1 
ATOM 10261 N N  . GLY E 1 345 ? 118.587 176.333 127.974 1.00 92.89  ? 345 GLY E N  1 
ATOM 10262 C CA . GLY E 1 345 ? 117.419 175.918 128.724 1.00 92.89  ? 345 GLY E CA 1 
ATOM 10263 C C  . GLY E 1 345 ? 117.277 174.413 128.820 1.00 92.89  ? 345 GLY E C  1 
ATOM 10264 O O  . GLY E 1 345 ? 116.741 173.899 129.807 1.00 92.89  ? 345 GLY E O  1 
ATOM 10265 N N  . GLN E 1 346 ? 117.742 173.695 127.795 1.00 90.69  ? 346 GLN E N  1 
ATOM 10266 C CA . GLN E 1 346 ? 117.715 172.240 127.796 1.00 90.69  ? 346 GLN E CA 1 
ATOM 10267 C C  . GLN E 1 346 ? 118.571 171.677 128.912 1.00 90.69  ? 346 GLN E C  1 
ATOM 10268 O O  . GLN E 1 346 ? 118.166 170.743 129.610 1.00 90.69  ? 346 GLN E O  1 
ATOM 10269 N N  . VAL E 1 347 ? 119.756 172.242 129.102 1.00 99.14  ? 347 VAL E N  1 
ATOM 10270 C CA . VAL E 1 347 ? 120.586 171.805 130.214 1.00 99.14  ? 347 VAL E CA 1 
ATOM 10271 C C  . VAL E 1 347 ? 120.108 172.455 131.510 1.00 99.14  ? 347 VAL E C  1 
ATOM 10272 O O  . VAL E 1 347 ? 120.275 171.897 132.599 1.00 99.14  ? 347 VAL E O  1 
ATOM 10273 N N  . LEU E 1 348 ? 119.446 173.608 131.408 1.00 92.19  ? 348 LEU E N  1 
ATOM 10274 C CA . LEU E 1 348 ? 119.117 174.407 132.582 1.00 92.19  ? 348 LEU E CA 1 
ATOM 10275 C C  . LEU E 1 348 ? 117.945 173.833 133.358 1.00 92.19  ? 348 LEU E C  1 
ATOM 10276 O O  . LEU E 1 348 ? 117.846 174.059 134.567 1.00 92.19  ? 348 LEU E O  1 
ATOM 10277 N N  . CYS E 1 349 ? 117.057 173.108 132.696 1.00 93.89  ? 349 CYS E N  1 
ATOM 10278 C CA . CYS E 1 349 ? 115.915 172.509 133.359 1.00 93.89  ? 349 CYS E CA 1 
ATOM 10279 C C  . CYS E 1 349 ? 116.075 171.018 133.582 1.00 93.89  ? 349 CYS E C  1 
ATOM 10280 O O  . CYS E 1 349 ? 115.150 170.378 134.084 1.00 93.89  ? 349 CYS E O  1 
ATOM 10281 N N  . LYS E 1 350 ? 117.213 170.446 133.219 1.00 86.49  ? 350 LYS E N  1 
ATOM 10282 C CA . LYS E 1 350 ? 117.604 169.139 133.737 1.00 86.49  ? 350 LYS E CA 1 
ATOM 10283 C C  . LYS E 1 350 ? 118.418 169.314 135.014 1.00 86.49  ? 350 LYS E C  1 
ATOM 10284 O O  . LYS E 1 350 ? 119.570 168.906 135.121 1.00 86.49  ? 350 LYS E O  1 
ATOM 10285 N N  . LYS E 1 351 ? 117.789 169.956 135.987 1.00 85.73  ? 351 LYS E N  1 
ATOM 10286 C CA . LYS E 1 351 ? 118.414 170.264 137.258 1.00 85.73  ? 351 LYS E CA 1 
ATOM 10287 C C  . LYS E 1 351 ? 117.323 170.223 138.316 1.00 85.73  ? 351 LYS E C  1 
ATOM 10288 O O  . LYS E 1 351 ? 116.158 170.499 138.025 1.00 85.73  ? 351 LYS E O  1 
ATOM 10289 N N  . ASN E 1 352 ? 117.707 169.842 139.535 1.00 84.76  ? 352 ASN E N  1 
ATOM 10290 C CA . ASN E 1 352 ? 116.740 169.621 140.606 1.00 84.76  ? 352 ASN E CA 1 
ATOM 10291 C C  . ASN E 1 352 ? 116.037 170.916 140.994 1.00 84.76  ? 352 ASN E C  1 
ATOM 10292 O O  . ASN E 1 352 ? 114.814 170.935 141.172 1.00 84.76  ? 352 ASN E O  1 
ATOM 10293 N N  . LYS E 1 353 ? 116.815 171.973 141.239 1.00 83.78  ? 353 LYS E N  1 
ATOM 10294 C CA . LYS E 1 353 ? 116.401 173.374 141.322 1.00 83.78  ? 353 LYS E CA 1 
ATOM 10295 C C  . LYS E 1 353 ? 115.602 173.682 142.589 1.00 83.78  ? 353 LYS E C  1 
ATOM 10296 O O  . LYS E 1 353 ? 115.422 174.850 142.942 1.00 83.78  ? 353 LYS E O  1 
ATOM 10297 N N  . PHE E 1 354 ? 115.204 172.666 143.338 1.00 85.09  ? 354 PHE E N  1 
ATOM 10298 C CA . PHE E 1 354 ? 114.510 172.866 144.602 1.00 85.09  ? 354 PHE E CA 1 
ATOM 10299 C C  . PHE E 1 354 ? 115.333 172.236 145.717 1.00 85.09  ? 354 PHE E C  1 
ATOM 10300 O O  . PHE E 1 354 ? 115.052 171.114 146.145 1.00 85.09  ? 354 PHE E O  1 
ATOM 10301 N N  . GLY E 1 355 ? 116.329 172.980 146.197 1.00 99.68  ? 355 GLY E N  1 
ATOM 10302 C CA . GLY E 1 355 ? 117.046 172.623 147.411 1.00 99.68  ? 355 GLY E CA 1 
ATOM 10303 C C  . GLY E 1 355 ? 117.815 171.326 147.300 1.00 99.68  ? 355 GLY E C  1 
ATOM 10304 O O  . GLY E 1 355 ? 118.723 171.175 146.476 1.00 99.68  ? 355 GLY E O  1 
ATOM 10305 N N  . ALA E 1 356 ? 117.442 170.377 148.144 1.00 111.66 ? 356 ALA E N  1 
ATOM 10306 C CA . ALA E 1 356 ? 117.964 169.022 148.162 1.00 111.66 ? 356 ALA E CA 1 
ATOM 10307 C C  . ALA E 1 356 ? 116.791 168.060 148.223 1.00 111.66 ? 356 ALA E C  1 
ATOM 10308 O O  . ALA E 1 356 ? 115.756 168.371 148.822 1.00 111.66 ? 356 ALA E O  1 
ATOM 10309 N N  . PRO E 1 357 ? 116.906 166.891 147.598 1.00 109.95 ? 357 PRO E N  1 
ATOM 10310 C CA . PRO E 1 357 ? 115.817 165.916 147.695 1.00 109.95 ? 357 PRO E CA 1 
ATOM 10311 C C  . PRO E 1 357 ? 115.781 165.294 149.081 1.00 109.95 ? 357 PRO E C  1 
ATOM 10312 O O  . PRO E 1 357 ? 116.779 164.773 149.578 1.00 109.95 ? 357 PRO E O  1 
ATOM 10313 N N  . GLN E 1 358 ? 114.623 165.383 149.720 1.00 103.56 ? 358 GLN E N  1 
ATOM 10314 C CA . GLN E 1 358 ? 114.443 164.814 151.043 1.00 103.56 ? 358 GLN E CA 1 
ATOM 10315 C C  . GLN E 1 358 ? 113.471 163.658 150.930 1.00 103.56 ? 358 GLN E C  1 
ATOM 10316 O O  . GLN E 1 358 ? 112.379 163.808 150.378 1.00 103.56 ? 358 GLN E O  1 
ATOM 10317 N N  . LYS E 1 359 ? 113.900 162.504 151.451 1.00 111.36 ? 359 LYS E N  1 
ATOM 10318 C CA . LYS E 1 359 ? 113.101 161.284 151.560 1.00 111.36 ? 359 LYS E CA 1 
ATOM 10319 C C  . LYS E 1 359 ? 112.623 160.817 150.191 1.00 111.36 ? 359 LYS E C  1 
ATOM 10320 O O  . LYS E 1 359 ? 111.431 160.910 149.886 1.00 111.36 ? 359 LYS E O  1 
ATOM 10321 N N  . ASP E 1 360 ? 113.557 160.349 149.362 1.00 104.93 ? 360 ASP E N  1 
ATOM 10322 C CA . ASP E 1 360 ? 113.288 160.022 147.969 1.00 104.93 ? 360 ASP E CA 1 
ATOM 10323 C C  . ASP E 1 360 ? 112.302 158.867 147.840 1.00 104.93 ? 360 ASP E C  1 
ATOM 10324 O O  . ASP E 1 360 ? 112.161 158.024 148.729 1.00 104.93 ? 360 ASP E O  1 
ATOM 10325 N N  . VAL E 1 361 ? 111.615 158.838 146.710 1.00 93.57  ? 361 VAL E N  1 
ATOM 10326 C CA . VAL E 1 361 ? 110.574 157.862 146.485 1.00 93.57  ? 361 VAL E CA 1 
ATOM 10327 C C  . VAL E 1 361 ? 111.210 156.578 145.985 1.00 93.57  ? 361 VAL E C  1 
ATOM 10328 O O  . VAL E 1 361 ? 112.307 156.563 145.419 1.00 93.57  ? 361 VAL E O  1 
ATOM 10329 N N  . LYS E 1 362 ? 110.528 155.472 146.247 1.00 82.75  ? 362 LYS E N  1 
ATOM 10330 C CA . LYS E 1 362 ? 110.889 154.192 145.657 1.00 82.75  ? 362 LYS E CA 1 
ATOM 10331 C C  . LYS E 1 362 ? 109.697 153.439 145.101 1.00 82.75  ? 362 LYS E C  1 
ATOM 10332 O O  . LYS E 1 362 ? 109.890 152.554 144.261 1.00 82.75  ? 362 LYS E O  1 
ATOM 10333 N N  . HIS E 1 363 ? 108.479 153.749 145.531 1.00 74.22  ? 363 HIS E N  1 
ATOM 10334 C CA . HIS E 1 363 ? 107.281 153.079 145.064 1.00 74.22  ? 363 HIS E CA 1 
ATOM 10335 C C  . HIS E 1 363 ? 106.400 154.084 144.336 1.00 74.22  ? 363 HIS E C  1 
ATOM 10336 O O  . HIS E 1 363 ? 106.526 155.296 144.518 1.00 74.22  ? 363 HIS E O  1 
ATOM 10337 N N  . LEU E 1 364 ? 105.520 153.576 143.484 1.00 59.88  ? 364 LEU E N  1 
ATOM 10338 C CA . LEU E 1 364 ? 104.552 154.408 142.792 1.00 59.88  ? 364 LEU E CA 1 
ATOM 10339 C C  . LEU E 1 364 ? 103.171 153.800 142.929 1.00 59.88  ? 364 LEU E C  1 
ATOM 10340 O O  . LEU E 1 364 ? 103.000 152.693 143.442 1.00 59.88  ? 364 LEU E O  1 
ATOM 10341 N N  . ALA E 1 365 ? 102.181 154.535 142.439 1.00 63.64  ? 365 ALA E N  1 
ATOM 10342 C CA . ALA E 1 365 ? 100.793 154.105 142.526 1.00 63.64  ? 365 ALA E CA 1 
ATOM 10343 C C  . ALA E 1 365 ? 100.049 154.790 141.391 1.00 63.64  ? 365 ALA E C  1 
ATOM 10344 O O  . ALA E 1 365 ? 99.782  155.990 141.460 1.00 63.64  ? 365 ALA E O  1 
ATOM 10345 N N  . ILE E 1 366 ? 99.726  154.030 140.360 1.00 65.21  ? 366 ILE E N  1 
ATOM 10346 C CA . ILE E 1 366 ? 99.155  154.589 139.148 1.00 65.21  ? 366 ILE E CA 1 
ATOM 10347 C C  . ILE E 1 366 ? 97.691  154.204 139.091 1.00 65.21  ? 366 ILE E C  1 
ATOM 10348 O O  . ILE E 1 366 ? 97.341  153.066 138.768 1.00 65.21  ? 366 ILE E O  1 
ATOM 10349 N N  . LEU E 1 367 ? 96.841  155.167 139.387 1.00 74.55  ? 367 LEU E N  1 
ATOM 10350 C CA . LEU E 1 367 ? 95.413  154.942 139.511 1.00 74.55  ? 367 LEU E CA 1 
ATOM 10351 C C  . LEU E 1 367 ? 94.792  155.006 138.127 1.00 74.55  ? 367 LEU E C  1 
ATOM 10352 O O  . LEU E 1 367 ? 94.515  156.091 137.615 1.00 74.55  ? 367 LEU E O  1 
ATOM 10353 N N  . GLY E 1 368 ? 94.578  153.848 137.519 1.00 82.13  ? 368 GLY E N  1 
ATOM 10354 C CA . GLY E 1 368 ? 93.922  153.820 136.230 1.00 82.13  ? 368 GLY E CA 1 
ATOM 10355 C C  . GLY E 1 368 ? 94.819  153.402 135.087 1.00 82.13  ? 368 GLY E C  1 
ATOM 10356 O O  . GLY E 1 368 ? 95.851  154.027 134.838 1.00 82.13  ? 368 GLY E O  1 
ATOM 10357 N N  . ALA E 1 369 ? 94.426  152.352 134.373 1.00 85.59  ? 369 ALA E N  1 
ATOM 10358 C CA . ALA E 1 369 ? 95.139  151.913 133.183 1.00 85.59  ? 369 ALA E CA 1 
ATOM 10359 C C  . ALA E 1 369 ? 94.711  152.772 132.003 1.00 85.59  ? 369 ALA E C  1 
ATOM 10360 O O  . ALA E 1 369 ? 94.071  153.814 132.157 1.00 85.59  ? 369 ALA E O  1 
ATOM 10361 N N  . GLY E 1 370 ? 95.059  152.347 130.800 1.00 81.75  ? 370 GLY E N  1 
ATOM 10362 C CA . GLY E 1 370 ? 94.640  153.092 129.636 1.00 81.75  ? 370 GLY E CA 1 
ATOM 10363 C C  . GLY E 1 370 ? 95.805  153.510 128.777 1.00 81.75  ? 370 GLY E C  1 
ATOM 10364 O O  . GLY E 1 370 ? 96.660  152.688 128.441 1.00 81.75  ? 370 GLY E O  1 
ATOM 10365 N N  . LEU E 1 371 ? 95.859  154.788 128.421 1.00 76.19  ? 371 LEU E N  1 
ATOM 10366 C CA . LEU E 1 371 ? 96.911  155.281 127.549 1.00 76.19  ? 371 LEU E CA 1 
ATOM 10367 C C  . LEU E 1 371 ? 97.915  156.162 128.262 1.00 76.19  ? 371 LEU E C  1 
ATOM 10368 O O  . LEU E 1 371 ? 99.085  156.178 127.884 1.00 76.19  ? 371 LEU E O  1 
ATOM 10369 N N  . MET E 1 372 ? 97.505  156.874 129.296 1.00 69.13  ? 372 MET E N  1 
ATOM 10370 C CA . MET E 1 372 ? 98.490  157.581 130.092 1.00 69.13  ? 372 MET E CA 1 
ATOM 10371 C C  . MET E 1 372 ? 99.108  156.706 131.164 1.00 69.13  ? 372 MET E C  1 
ATOM 10372 O O  . MET E 1 372 ? 100.326 156.728 131.336 1.00 69.13  ? 372 MET E O  1 
ATOM 10373 N N  . GLY E 1 373 ? 98.299  155.940 131.883 1.00 70.18  ? 373 GLY E N  1 
ATOM 10374 C CA . GLY E 1 373 ? 98.771  155.202 133.034 1.00 70.18  ? 373 GLY E CA 1 
ATOM 10375 C C  . GLY E 1 373 ? 99.761  154.122 132.676 1.00 70.18  ? 373 GLY E C  1 
ATOM 10376 O O  . GLY E 1 373 ? 100.895 154.123 133.165 1.00 70.18  ? 373 GLY E O  1 
ATOM 10377 N N  . ALA E 1 374 ? 99.351  153.225 131.776 1.00 69.64  ? 374 ALA E N  1 
ATOM 10378 C CA . ALA E 1 374 ? 100.288 152.280 131.186 1.00 69.64  ? 374 ALA E CA 1 
ATOM 10379 C C  . ALA E 1 374 ? 101.347 153.004 130.381 1.00 69.64  ? 374 ALA E C  1 
ATOM 10380 O O  . ALA E 1 374 ? 102.493 152.544 130.305 1.00 69.64  ? 374 ALA E O  1 
ATOM 10381 N N  . GLY E 1 375 ? 100.992 154.163 129.831 1.00 64.45  ? 375 GLY E N  1 
ATOM 10382 C CA . GLY E 1 375 ? 101.972 154.990 129.166 1.00 64.45  ? 375 GLY E CA 1 
ATOM 10383 C C  . GLY E 1 375 ? 103.078 155.462 130.091 1.00 64.45  ? 375 GLY E C  1 
ATOM 10384 O O  . GLY E 1 375 ? 104.254 155.226 129.820 1.00 64.45  ? 375 GLY E O  1 
ATOM 10385 N N  . ILE E 1 376 ? 102.730 156.115 131.203 1.00 61.35  ? 376 ILE E N  1 
ATOM 10386 C CA . ILE E 1 376 ? 103.820 156.607 132.039 1.00 61.35  ? 376 ILE E CA 1 
ATOM 10387 C C  . ILE E 1 376 ? 104.472 155.467 132.791 1.00 61.35  ? 376 ILE E C  1 
ATOM 10388 O O  . ILE E 1 376 ? 105.609 155.610 133.239 1.00 61.35  ? 376 ILE E O  1 
ATOM 10389 N N  . ALA E 1 377 ? 103.787 154.335 132.927 1.00 63.73  ? 377 ALA E N  1 
ATOM 10390 C CA . ALA E 1 377 ? 104.449 153.148 133.439 1.00 63.73  ? 377 ALA E CA 1 
ATOM 10391 C C  . ALA E 1 377 ? 105.516 152.651 132.479 1.00 63.73  ? 377 ALA E C  1 
ATOM 10392 O O  . ALA E 1 377 ? 106.537 152.128 132.927 1.00 63.73  ? 377 ALA E O  1 
ATOM 10393 N N  . GLN E 1 378 ? 105.310 152.826 131.167 1.00 62.62  ? 378 GLN E N  1 
ATOM 10394 C CA . GLN E 1 378 ? 106.281 152.386 130.166 1.00 62.62  ? 378 GLN E CA 1 
ATOM 10395 C C  . GLN E 1 378 ? 107.627 153.088 130.298 1.00 62.62  ? 378 GLN E C  1 
ATOM 10396 O O  . GLN E 1 378 ? 108.650 152.509 129.925 1.00 62.62  ? 378 GLN E O  1 
ATOM 10397 N N  . VAL E 1 379 ? 107.669 154.285 130.870 1.00 65.03  ? 379 VAL E N  1 
ATOM 10398 C CA . VAL E 1 379 ? 108.926 154.992 131.029 1.00 65.03  ? 379 VAL E CA 1 
ATOM 10399 C C  . VAL E 1 379 ? 109.403 154.988 132.477 1.00 65.03  ? 379 VAL E C  1 
ATOM 10400 O O  . VAL E 1 379 ? 110.621 155.004 132.713 1.00 65.03  ? 379 VAL E O  1 
ATOM 10401 N N  . SER E 1 380 ? 108.500 154.910 133.452 1.00 71.66  ? 380 SER E N  1 
ATOM 10402 C CA . SER E 1 380 ? 108.870 155.009 134.856 1.00 71.66  ? 380 SER E CA 1 
ATOM 10403 C C  . SER E 1 380 ? 109.171 153.664 135.485 1.00 71.66  ? 380 SER E C  1 
ATOM 10404 O O  . SER E 1 380 ? 109.118 153.548 136.713 1.00 71.66  ? 380 SER E O  1 
ATOM 10405 N N  . VAL E 1 381 ? 109.484 152.643 134.694 1.00 66.17  ? 381 VAL E N  1 
ATOM 10406 C CA . VAL E 1 381 ? 109.692 151.326 135.252 1.00 66.17  ? 381 VAL E CA 1 
ATOM 10407 C C  . VAL E 1 381 ? 111.128 150.840 135.093 1.00 66.17  ? 381 VAL E C  1 
ATOM 10408 O O  . VAL E 1 381 ? 111.608 150.094 135.952 1.00 66.17  ? 381 VAL E O  1 
ATOM 10409 N N  . ASP E 1 382 ? 111.857 151.290 134.073 1.00 74.90  ? 382 ASP E N  1 
ATOM 10410 C CA . ASP E 1 382 ? 113.119 150.634 133.775 1.00 74.90  ? 382 ASP E CA 1 
ATOM 10411 C C  . ASP E 1 382 ? 114.243 151.051 134.707 1.00 74.90  ? 382 ASP E C  1 
ATOM 10412 O O  . ASP E 1 382 ? 115.007 150.194 135.154 1.00 74.90  ? 382 ASP E O  1 
ATOM 10413 N N  . LYS E 1 383 ? 114.329 152.330 135.054 1.00 73.29  ? 383 LYS E N  1 
ATOM 10414 C CA . LYS E 1 383 ? 115.473 152.852 135.782 1.00 73.29  ? 383 LYS E CA 1 
ATOM 10415 C C  . LYS E 1 383 ? 115.232 152.910 137.276 1.00 73.29  ? 383 LYS E C  1 
ATOM 10416 O O  . LYS E 1 383 ? 115.663 153.855 137.948 1.00 73.29  ? 383 LYS E O  1 
ATOM 10417 N N  . GLY E 1 384 ? 114.543 151.911 137.810 1.00 83.41  ? 384 GLY E N  1 
ATOM 10418 C CA . GLY E 1 384 ? 114.526 151.690 139.236 1.00 83.41  ? 384 GLY E CA 1 
ATOM 10419 C C  . GLY E 1 384 ? 113.437 152.412 139.985 1.00 83.41  ? 384 GLY E C  1 
ATOM 10420 O O  . GLY E 1 384 ? 113.714 153.202 140.889 1.00 83.41  ? 384 GLY E O  1 
ATOM 10421 N N  . LEU E 1 385 ? 112.190 152.165 139.604 1.00 73.69  ? 385 LEU E N  1 
ATOM 10422 C CA . LEU E 1 385 ? 111.045 152.638 140.365 1.00 73.69  ? 385 LEU E CA 1 
ATOM 10423 C C  . LEU E 1 385 ? 110.046 151.497 140.444 1.00 73.69  ? 385 LEU E C  1 
ATOM 10424 O O  . LEU E 1 385 ? 109.579 151.017 139.409 1.00 73.69  ? 385 LEU E O  1 
ATOM 10425 N N  . LYS E 1 386 ? 109.741 151.044 141.656 1.00 68.00  ? 386 LYS E N  1 
ATOM 10426 C CA . LYS E 1 386 ? 108.678 150.064 141.840 1.00 68.00  ? 386 LYS E CA 1 
ATOM 10427 C C  . LYS E 1 386 ? 107.321 150.699 141.561 1.00 68.00  ? 386 LYS E C  1 
ATOM 10428 O O  . LYS E 1 386 ? 107.021 151.791 142.048 1.00 68.00  ? 386 LYS E O  1 
ATOM 10429 N N  . THR E 1 387 ? 106.504 150.028 140.748 1.00 59.22  ? 387 THR E N  1 
ATOM 10430 C CA . THR E 1 387 ? 105.206 150.579 140.373 1.00 59.22  ? 387 THR E CA 1 
ATOM 10431 C C  . THR E 1 387 ? 104.091 149.573 140.595 1.00 59.22  ? 387 THR E C  1 
ATOM 10432 O O  . THR E 1 387 ? 104.293 148.362 140.458 1.00 59.22  ? 387 THR E O  1 
ATOM 10433 N N  . ILE E 1 388 ? 102.908 150.089 140.906 1.00 58.82  ? 388 ILE E N  1 
ATOM 10434 C CA . ILE E 1 388 ? 101.681 149.311 140.987 1.00 58.82  ? 388 ILE E CA 1 
ATOM 10435 C C  . ILE E 1 388 ? 100.641 149.998 140.119 1.00 58.82  ? 388 ILE E C  1 
ATOM 10436 O O  . ILE E 1 388 ? 100.429 151.209 140.238 1.00 58.82  ? 388 ILE E O  1 
ATOM 10437 N N  . LEU E 1 389 ? 99.991  149.236 139.248 1.00 60.68  ? 389 LEU E N  1 
ATOM 10438 C CA . LEU E 1 389 ? 99.110  149.794 138.227 1.00 60.68  ? 389 LEU E CA 1 
ATOM 10439 C C  . LEU E 1 389 ? 97.664  149.406 138.539 1.00 60.68  ? 389 LEU E C  1 
ATOM 10440 O O  . LEU E 1 389 ? 97.246  148.271 138.304 1.00 60.68  ? 389 LEU E O  1 
ATOM 10441 N N  . LYS E 1 390 ? 96.897  150.365 139.045 1.00 80.65  ? 390 LYS E N  1 
ATOM 10442 C CA . LYS E 1 390 ? 95.488  150.155 139.346 1.00 80.65  ? 390 LYS E CA 1 
ATOM 10443 C C  . LYS E 1 390 ? 94.659  150.087 138.072 1.00 80.65  ? 390 LYS E C  1 
ATOM 10444 O O  . LYS E 1 390 ? 94.900  150.823 137.116 1.00 80.65  ? 390 LYS E O  1 
ATOM 10445 N N  . ASP E 1 391 ? 93.679  149.193 138.065 1.00 97.29  ? 391 ASP E N  1 
ATOM 10446 C CA . ASP E 1 391 ? 92.689  149.117 137.005 1.00 97.29  ? 391 ASP E CA 1 
ATOM 10447 C C  . ASP E 1 391 ? 91.344  148.866 137.674 1.00 97.29  ? 391 ASP E C  1 
ATOM 10448 O O  . ASP E 1 391 ? 91.266  148.657 138.886 1.00 97.29  ? 391 ASP E O  1 
ATOM 10449 N N  . ALA E 1 392 ? 90.276  148.911 136.881 1.00 107.77 ? 392 ALA E N  1 
ATOM 10450 C CA . ALA E 1 392 ? 88.946  148.570 137.374 1.00 107.77 ? 392 ALA E CA 1 
ATOM 10451 C C  . ALA E 1 392 ? 88.669  147.076 137.238 1.00 107.77 ? 392 ALA E C  1 
ATOM 10452 O O  . ALA E 1 392 ? 88.415  146.393 138.234 1.00 107.77 ? 392 ALA E O  1 
ATOM 10453 N N  . THR E 1 393 ? 88.701  146.559 136.016 1.00 101.64 ? 393 THR E N  1 
ATOM 10454 C CA . THR E 1 393 ? 88.529  145.136 135.772 1.00 101.64 ? 393 THR E CA 1 
ATOM 10455 C C  . THR E 1 393 ? 89.741  144.610 135.021 1.00 101.64 ? 393 THR E C  1 
ATOM 10456 O O  . THR E 1 393 ? 90.637  145.365 134.638 1.00 101.64 ? 393 THR E O  1 
ATOM 10457 N N  . LEU E 1 394 ? 89.750  143.294 134.805 1.00 87.91  ? 394 LEU E N  1 
ATOM 10458 C CA . LEU E 1 394 ? 90.816  142.650 134.050 1.00 87.91  ? 394 LEU E CA 1 
ATOM 10459 C C  . LEU E 1 394 ? 90.840  143.092 132.603 1.00 87.91  ? 394 LEU E C  1 
ATOM 10460 O O  . LEU E 1 394 ? 91.916  143.156 132.000 1.00 87.91  ? 394 LEU E O  1 
ATOM 10461 N N  . THR E 1 395 ? 89.680  143.459 132.062 1.00 103.92 ? 395 THR E N  1 
ATOM 10462 C CA . THR E 1 395 ? 89.426  143.717 130.651 1.00 103.92 ? 395 THR E CA 1 
ATOM 10463 C C  . THR E 1 395 ? 90.254  144.857 130.066 1.00 103.92 ? 395 THR E C  1 
ATOM 10464 O O  . THR E 1 395 ? 90.215  145.047 128.847 1.00 103.92 ? 395 THR E O  1 
ATOM 10465 N N  . ALA E 1 396 ? 90.986  145.622 130.878 1.00 92.38  ? 396 ALA E N  1 
ATOM 10466 C CA . ALA E 1 396 ? 91.852  146.671 130.363 1.00 92.38  ? 396 ALA E CA 1 
ATOM 10467 C C  . ALA E 1 396 ? 93.315  146.507 130.772 1.00 92.38  ? 396 ALA E C  1 
ATOM 10468 O O  . ALA E 1 396 ? 94.144  147.332 130.384 1.00 92.38  ? 396 ALA E O  1 
ATOM 10469 N N  . LEU E 1 397 ? 93.666  145.477 131.543 1.00 78.94  ? 397 LEU E N  1 
ATOM 10470 C CA . LEU E 1 397 ? 95.081  145.236 131.798 1.00 78.94  ? 397 LEU E CA 1 
ATOM 10471 C C  . LEU E 1 397 ? 95.770  144.572 130.624 1.00 78.94  ? 397 LEU E C  1 
ATOM 10472 O O  . LEU E 1 397 ? 96.987  144.724 130.468 1.00 78.94  ? 397 LEU E O  1 
ATOM 10473 N N  . ASP E 1 398 ? 95.019  143.810 129.835 1.00 87.23  ? 398 ASP E N  1 
ATOM 10474 C CA . ASP E 1 398 ? 95.511  143.291 128.567 1.00 87.23  ? 398 ASP E CA 1 
ATOM 10475 C C  . ASP E 1 398 ? 95.891  144.408 127.608 1.00 87.23  ? 398 ASP E C  1 
ATOM 10476 O O  . ASP E 1 398 ? 96.900  144.307 126.907 1.00 87.23  ? 398 ASP E O  1 
ATOM 10477 N N  . ARG E 1 399 ? 95.113  145.482 127.578 1.00 80.91  ? 399 ARG E N  1 
ATOM 10478 C CA . ARG E 1 399 ? 95.528  146.672 126.858 1.00 80.91  ? 399 ARG E CA 1 
ATOM 10479 C C  . ARG E 1 399 ? 96.579  147.439 127.646 1.00 80.91  ? 399 ARG E C  1 
ATOM 10480 O O  . ARG E 1 399 ? 97.295  148.266 127.075 1.00 80.91  ? 399 ARG E O  1 
ATOM 10481 N N  . GLY E 1 400 ? 96.729  147.131 128.930 1.00 71.16  ? 400 GLY E N  1 
ATOM 10482 C CA . GLY E 1 400 ? 97.747  147.736 129.760 1.00 71.16  ? 400 GLY E CA 1 
ATOM 10483 C C  . GLY E 1 400 ? 99.155  147.226 129.541 1.00 71.16  ? 400 GLY E C  1 
ATOM 10484 O O  . GLY E 1 400 ? 99.996  147.953 129.004 1.00 71.16  ? 400 GLY E O  1 
ATOM 10485 N N  . GLN E 1 401 ? 99.418  145.973 129.914 1.00 70.30  ? 401 GLN E N  1 
ATOM 10486 C CA . GLN E 1 401 ? 100.792 145.482 129.922 1.00 70.30  ? 401 GLN E CA 1 
ATOM 10487 C C  . GLN E 1 401 ? 101.328 145.304 128.508 1.00 70.30  ? 401 GLN E C  1 
ATOM 10488 O O  . GLN E 1 401 ? 102.526 145.489 128.264 1.00 70.30  ? 401 GLN E O  1 
ATOM 10489 N N  . GLN E 1 402 ? 100.445 145.062 127.542 1.00 66.78  ? 402 GLN E N  1 
ATOM 10490 C CA . GLN E 1 402 ? 100.850 145.062 126.141 1.00 66.78  ? 402 GLN E CA 1 
ATOM 10491 C C  . GLN E 1 402 ? 101.256 146.427 125.605 1.00 66.78  ? 402 GLN E C  1 
ATOM 10492 O O  . GLN E 1 402 ? 101.485 146.532 124.401 1.00 66.78  ? 402 GLN E O  1 
ATOM 10493 N N  . GLN E 1 403 ? 101.294 147.482 126.409 1.00 65.51  ? 403 GLN E N  1 
ATOM 10494 C CA . GLN E 1 403 ? 102.111 148.637 126.039 1.00 65.51  ? 403 GLN E CA 1 
ATOM 10495 C C  . GLN E 1 403 ? 103.487 148.456 126.667 1.00 65.51  ? 403 GLN E C  1 
ATOM 10496 O O  . GLN E 1 403 ? 104.493 148.389 125.955 1.00 65.51  ? 403 GLN E O  1 
ATOM 10497 N N  . VAL E 1 404 ? 103.528 148.253 127.990 1.00 58.03  ? 404 VAL E N  1 
ATOM 10498 C CA . VAL E 1 404 ? 104.785 148.212 128.735 1.00 58.03  ? 404 VAL E CA 1 
ATOM 10499 C C  . VAL E 1 404 ? 105.623 146.991 128.389 1.00 58.03  ? 404 VAL E C  1 
ATOM 10500 O O  . VAL E 1 404 ? 106.785 146.897 128.789 1.00 58.03  ? 404 VAL E O  1 
ATOM 10501 N N  . PHE E 1 405 ? 105.069 146.053 127.642 1.00 58.17  ? 405 PHE E N  1 
ATOM 10502 C CA . PHE E 1 405 ? 105.864 145.010 127.036 1.00 58.17  ? 405 PHE E CA 1 
ATOM 10503 C C  . PHE E 1 405 ? 106.191 145.307 125.577 1.00 58.17  ? 405 PHE E C  1 
ATOM 10504 O O  . PHE E 1 405 ? 107.353 145.180 125.182 1.00 58.17  ? 405 PHE E O  1 
ATOM 10505 N N  . LYS E 1 406 ? 105.207 145.749 124.779 1.00 61.86  ? 406 LYS E N  1 
ATOM 10506 C CA . LYS E 1 406 ? 105.434 145.905 123.341 1.00 61.86  ? 406 LYS E CA 1 
ATOM 10507 C C  . LYS E 1 406 ? 106.355 147.068 123.048 1.00 61.86  ? 406 LYS E C  1 
ATOM 10508 O O  . LYS E 1 406 ? 107.264 146.948 122.223 1.00 61.86  ? 406 LYS E O  1 
ATOM 10509 N N  . GLY E 1 407 ? 106.177 148.171 123.748 1.00 60.86  ? 407 GLY E N  1 
ATOM 10510 C CA . GLY E 1 407 ? 107.140 149.239 123.684 1.00 60.86  ? 407 GLY E CA 1 
ATOM 10511 C C  . GLY E 1 407 ? 108.395 149.016 124.489 1.00 60.86  ? 407 GLY E C  1 
ATOM 10512 O O  . GLY E 1 407 ? 109.154 149.962 124.711 1.00 60.86  ? 407 GLY E O  1 
ATOM 10513 N N  . LEU E 1 408 ? 108.648 147.790 124.932 1.00 57.86  ? 408 LEU E N  1 
ATOM 10514 C CA . LEU E 1 408 ? 109.863 147.459 125.649 1.00 57.86  ? 408 LEU E CA 1 
ATOM 10515 C C  . LEU E 1 408 ? 110.756 146.513 124.868 1.00 57.86  ? 408 LEU E C  1 
ATOM 10516 O O  . LEU E 1 408 ? 111.959 146.752 124.783 1.00 57.86  ? 408 LEU E O  1 
ATOM 10517 N N  . ASN E 1 409 ? 110.206 145.443 124.287 1.00 63.54  ? 409 ASN E N  1 
ATOM 10518 C CA . ASN E 1 409 ? 111.073 144.455 123.656 1.00 63.54  ? 409 ASN E CA 1 
ATOM 10519 C C  . ASN E 1 409 ? 111.570 144.915 122.298 1.00 63.54  ? 409 ASN E C  1 
ATOM 10520 O O  . ASN E 1 409 ? 112.540 144.356 121.782 1.00 63.54  ? 409 ASN E O  1 
ATOM 10521 N N  . ASP E 1 410 ? 110.927 145.918 121.702 1.00 68.06  ? 410 ASP E N  1 
ATOM 10522 C CA . ASP E 1 410 ? 111.558 146.594 120.575 1.00 68.06  ? 410 ASP E CA 1 
ATOM 10523 C C  . ASP E 1 410 ? 112.882 147.217 120.993 1.00 68.06  ? 410 ASP E C  1 
ATOM 10524 O O  . ASP E 1 410 ? 113.841 147.233 120.211 1.00 68.06  ? 410 ASP E O  1 
ATOM 10525 N N  . LYS E 1 411 ? 112.948 147.677 122.245 1.00 62.90  ? 411 LYS E N  1 
ATOM 10526 C CA . LYS E 1 411 ? 114.192 148.095 122.869 1.00 62.90  ? 411 LYS E CA 1 
ATOM 10527 C C  . LYS E 1 411 ? 115.228 146.980 122.879 1.00 62.90  ? 411 LYS E C  1 
ATOM 10528 O O  . LYS E 1 411 ? 116.416 147.248 122.675 1.00 62.90  ? 411 LYS E O  1 
ATOM 10529 N N  . VAL E 1 412 ? 114.817 145.726 123.096 1.00 62.93  ? 412 VAL E N  1 
ATOM 10530 C CA . VAL E 1 412 ? 115.801 144.652 122.992 1.00 62.93  ? 412 VAL E CA 1 
ATOM 10531 C C  . VAL E 1 412 ? 115.865 144.131 121.565 1.00 62.93  ? 412 VAL E C  1 
ATOM 10532 O O  . VAL E 1 412 ? 116.796 143.388 121.220 1.00 62.93  ? 412 VAL E O  1 
ATOM 10533 N N  . LYS E 1 413 ? 114.929 144.533 120.706 1.00 67.40  ? 413 LYS E N  1 
ATOM 10534 C CA . LYS E 1 413 ? 115.038 144.200 119.296 1.00 67.40  ? 413 LYS E CA 1 
ATOM 10535 C C  . LYS E 1 413 ? 116.039 145.101 118.593 1.00 67.40  ? 413 LYS E C  1 
ATOM 10536 O O  . LYS E 1 413 ? 116.626 144.698 117.586 1.00 67.40  ? 413 LYS E O  1 
ATOM 10537 N N  . LYS E 1 414 ? 116.282 146.292 119.124 1.00 68.76  ? 414 LYS E N  1 
ATOM 10538 C CA . LYS E 1 414 ? 117.346 147.149 118.630 1.00 68.76  ? 414 LYS E CA 1 
ATOM 10539 C C  . LYS E 1 414 ? 118.633 146.985 119.420 1.00 68.76  ? 414 LYS E C  1 
ATOM 10540 O O  . LYS E 1 414 ? 119.525 147.829 119.299 1.00 68.76  ? 414 LYS E O  1 
ATOM 10541 N N  . LYS E 1 415 ? 118.719 145.940 120.252 1.00 61.91  ? 415 LYS E N  1 
ATOM 10542 C CA . LYS E 1 415 ? 119.929 145.531 120.981 1.00 61.91  ? 415 LYS E CA 1 
ATOM 10543 C C  . LYS E 1 415 ? 120.428 146.604 121.946 1.00 61.91  ? 415 LYS E C  1 
ATOM 10544 O O  . LYS E 1 415 ? 121.610 146.644 122.288 1.00 61.91  ? 415 LYS E O  1 
ATOM 10545 N N  . ALA E 1 416 ? 119.529 147.469 122.406 1.00 64.58  ? 416 ALA E N  1 
ATOM 10546 C CA . ALA E 1 416 ? 119.897 148.499 123.364 1.00 64.58  ? 416 ALA E CA 1 
ATOM 10547 C C  . ALA E 1 416 ? 119.911 147.994 124.798 1.00 64.58  ? 416 ALA E C  1 
ATOM 10548 O O  . ALA E 1 416 ? 120.411 148.700 125.678 1.00 64.58  ? 416 ALA E O  1 
ATOM 10549 N N  . LEU E 1 417 ? 119.362 146.811 125.058 1.00 60.77  ? 417 LEU E N  1 
ATOM 10550 C CA . LEU E 1 417 ? 119.394 146.199 126.378 1.00 60.77  ? 417 LEU E CA 1 
ATOM 10551 C C  . LEU E 1 417 ? 119.691 144.717 126.222 1.00 60.77  ? 417 LEU E C  1 
ATOM 10552 O O  . LEU E 1 417 ? 119.713 144.180 125.115 1.00 60.77  ? 417 LEU E O  1 
ATOM 10553 N N  . THR E 1 418 ? 119.935 144.056 127.342 1.00 50.64  ? 418 THR E N  1 
ATOM 10554 C CA . THR E 1 418 ? 120.100 142.618 127.286 1.00 50.64  ? 418 THR E CA 1 
ATOM 10555 C C  . THR E 1 418 ? 118.738 141.946 127.308 1.00 50.64  ? 418 THR E C  1 
ATOM 10556 O O  . THR E 1 418 ? 117.732 142.543 127.693 1.00 50.64  ? 418 THR E O  1 
ATOM 10557 N N  . SER E 1 419 ? 118.716 140.678 126.902 1.00 47.63  ? 419 SER E N  1 
ATOM 10558 C CA . SER E 1 419 ? 117.459 139.942 126.896 1.00 47.63  ? 419 SER E CA 1 
ATOM 10559 C C  . SER E 1 419 ? 117.015 139.586 128.300 1.00 47.63  ? 419 SER E C  1 
ATOM 10560 O O  . SER E 1 419 ? 115.827 139.348 128.526 1.00 47.63  ? 419 SER E O  1 
ATOM 10561 N N  . PHE E 1 420 ? 117.942 139.539 129.249 1.00 46.09  ? 420 PHE E N  1 
ATOM 10562 C CA . PHE E 1 420 ? 117.563 139.155 130.599 1.00 46.09  ? 420 PHE E CA 1 
ATOM 10563 C C  . PHE E 1 420 ? 117.007 140.330 131.384 1.00 46.09  ? 420 PHE E C  1 
ATOM 10564 O O  . PHE E 1 420 ? 115.952 140.214 132.013 1.00 46.09  ? 420 PHE E O  1 
ATOM 10565 N N  . GLU E 1 421 ? 117.722 141.459 131.379 1.00 52.04  ? 421 GLU E N  1 
ATOM 10566 C CA . GLU E 1 421 ? 117.346 142.598 132.212 1.00 52.04  ? 421 GLU E CA 1 
ATOM 10567 C C  . GLU E 1 421 ? 116.021 143.200 131.780 1.00 52.04  ? 421 GLU E C  1 
ATOM 10568 O O  . GLU E 1 421 ? 115.346 143.841 132.596 1.00 52.04  ? 421 GLU E O  1 
ATOM 10569 N N  . ARG E 1 422 ? 115.675 143.030 130.497 1.00 49.44  ? 422 ARG E N  1 
ATOM 10570 C CA . ARG E 1 422 ? 114.327 143.202 129.960 1.00 49.44  ? 422 ARG E CA 1 
ATOM 10571 C C  . ARG E 1 422 ? 113.259 142.682 130.898 1.00 49.44  ? 422 ARG E C  1 
ATOM 10572 O O  . ARG E 1 422 ? 112.309 143.386 131.259 1.00 49.44  ? 422 ARG E O  1 
ATOM 10573 N N  . ASP E 1 423 ? 113.421 141.445 131.322 1.00 50.37  ? 423 ASP E N  1 
ATOM 10574 C CA . ASP E 1 423 ? 112.324 140.798 131.995 1.00 50.37  ? 423 ASP E CA 1 
ATOM 10575 C C  . ASP E 1 423 ? 112.297 141.134 133.478 1.00 50.37  ? 423 ASP E C  1 
ATOM 10576 O O  . ASP E 1 423 ? 111.222 141.129 134.081 1.00 50.37  ? 423 ASP E O  1 
ATOM 10577 N N  . SER E 1 424 ? 113.438 141.485 134.077 1.00 46.89  ? 424 SER E N  1 
ATOM 10578 C CA . SER E 1 424 ? 113.398 142.020 135.436 1.00 46.89  ? 424 SER E CA 1 
ATOM 10579 C C  . SER E 1 424 ? 112.765 143.403 135.456 1.00 46.89  ? 424 SER E C  1 
ATOM 10580 O O  . SER E 1 424 ? 112.028 143.744 136.394 1.00 46.89  ? 424 SER E O  1 
ATOM 10581 N N  . ILE E 1 425 ? 113.043 144.204 134.422 1.00 48.48  ? 425 ILE E N  1 
ATOM 10582 C CA . ILE E 1 425 ? 112.380 145.492 134.242 1.00 48.48  ? 425 ILE E CA 1 
ATOM 10583 C C  . ILE E 1 425 ? 110.876 145.314 134.111 1.00 48.48  ? 425 ILE E C  1 
ATOM 10584 O O  . ILE E 1 425 ? 110.095 146.059 134.714 1.00 48.48  ? 425 ILE E O  1 
ATOM 10585 N N  . PHE E 1 426 ? 110.447 144.302 133.359 1.00 50.46  ? 426 PHE E N  1 
ATOM 10586 C CA . PHE E 1 426 ? 109.018 144.032 133.252 1.00 50.46  ? 426 PHE E CA 1 
ATOM 10587 C C  . PHE E 1 426 ? 108.430 143.566 134.576 1.00 50.46  ? 426 PHE E C  1 
ATOM 10588 O O  . PHE E 1 426 ? 107.294 143.914 134.909 1.00 50.46  ? 426 PHE E O  1 
ATOM 10589 N N  . SER E 1 427 ? 109.169 142.767 135.330 1.00 46.88  ? 427 SER E N  1 
ATOM 10590 C CA . SER E 1 427 ? 108.646 142.239 136.579 1.00 46.88  ? 427 SER E CA 1 
ATOM 10591 C C  . SER E 1 427 ? 108.801 143.198 137.747 1.00 46.88  ? 427 SER E C  1 
ATOM 10592 O O  . SER E 1 427 ? 108.426 142.839 138.866 1.00 46.88  ? 427 SER E O  1 
ATOM 10593 N N  . ASN E 1 428 ? 109.353 144.394 137.538 1.00 48.57  ? 428 ASN E N  1 
ATOM 10594 C CA . ASN E 1 428 ? 109.200 145.422 138.564 1.00 48.57  ? 428 ASN E CA 1 
ATOM 10595 C C  . ASN E 1 428 ? 107.791 145.990 138.613 1.00 48.57  ? 428 ASN E C  1 
ATOM 10596 O O  . ASN E 1 428 ? 107.455 146.687 139.569 1.00 48.57  ? 428 ASN E O  1 
ATOM 10597 N N  . LEU E 1 429 ? 106.980 145.734 137.599 1.00 48.70  ? 429 LEU E N  1 
ATOM 10598 C CA . LEU E 1 429 ? 105.641 146.295 137.466 1.00 48.70  ? 429 LEU E CA 1 
ATOM 10599 C C  . LEU E 1 429 ? 104.613 145.226 137.778 1.00 48.70  ? 429 LEU E C  1 
ATOM 10600 O O  . LEU E 1 429 ? 104.423 144.302 136.991 1.00 48.70  ? 429 LEU E O  1 
ATOM 10601 N N  . THR E 1 430 ? 103.950 145.354 138.914 1.00 64.20  ? 430 THR E N  1 
ATOM 10602 C CA . THR E 1 430 ? 102.826 144.490 139.228 1.00 64.20  ? 430 THR E CA 1 
ATOM 10603 C C  . THR E 1 430 ? 101.534 145.241 138.975 1.00 64.20  ? 430 THR E C  1 
ATOM 10604 O O  . THR E 1 430 ? 101.477 146.463 139.096 1.00 64.20  ? 430 THR E O  1 
ATOM 10605 N N  . GLY E 1 431 ? 100.498 144.500 138.623 1.00 65.75  ? 431 GLY E N  1 
ATOM 10606 C CA . GLY E 1 431 ? 99.209  145.120 138.457 1.00 65.75  ? 431 GLY E CA 1 
ATOM 10607 C C  . GLY E 1 431 ? 98.210  144.562 139.437 1.00 65.75  ? 431 GLY E C  1 
ATOM 10608 O O  . GLY E 1 431 ? 97.815  143.400 139.330 1.00 65.75  ? 431 GLY E O  1 
ATOM 10609 N N  . GLN E 1 432 ? 97.790  145.373 140.400 1.00 73.95  ? 432 GLN E N  1 
ATOM 10610 C CA . GLN E 1 432 ? 96.766  144.925 141.322 1.00 73.95  ? 432 GLN E CA 1 
ATOM 10611 C C  . GLN E 1 432 ? 95.399  145.039 140.675 1.00 73.95  ? 432 GLN E C  1 
ATOM 10612 O O  . GLN E 1 432 ? 95.242  145.502 139.543 1.00 73.95  ? 432 GLN E O  1 
ATOM 10613 N N  . LEU E 1 433 ? 94.391  144.609 141.417 1.00 79.31  ? 433 LEU E N  1 
ATOM 10614 C CA . LEU E 1 433 ? 93.011  144.796 141.011 1.00 79.31  ? 433 LEU E CA 1 
ATOM 10615 C C  . LEU E 1 433 ? 92.264  145.721 141.950 1.00 79.31  ? 433 LEU E C  1 
ATOM 10616 O O  . LEU E 1 433 ? 91.586  146.640 141.483 1.00 79.31  ? 433 LEU E O  1 
ATOM 10617 N N  . ASP E 1 434 ? 92.367  145.522 143.264 1.00 92.25  ? 434 ASP E N  1 
ATOM 10618 C CA . ASP E 1 434 ? 91.572  146.405 144.097 1.00 92.25  ? 434 ASP E CA 1 
ATOM 10619 C C  . ASP E 1 434 ? 92.401  147.350 144.951 1.00 92.25  ? 434 ASP E C  1 
ATOM 10620 O O  . ASP E 1 434 ? 92.556  148.516 144.579 1.00 92.25  ? 434 ASP E O  1 
ATOM 10621 N N  . TYR E 1 435 ? 93.004  146.871 146.054 1.00 92.78  ? 435 TYR E N  1 
ATOM 10622 C CA . TYR E 1 435 ? 93.733  147.796 146.919 1.00 92.78  ? 435 TYR E CA 1 
ATOM 10623 C C  . TYR E 1 435 ? 94.909  147.226 147.697 1.00 92.78  ? 435 TYR E C  1 
ATOM 10624 O O  . TYR E 1 435 ? 95.547  147.999 148.413 1.00 92.78  ? 435 TYR E O  1 
ATOM 10625 N N  . GLN E 1 436 ? 95.233  145.941 147.613 1.00 96.82  ? 436 GLN E N  1 
ATOM 10626 C CA . GLN E 1 436 ? 96.098  145.351 148.639 1.00 96.82  ? 436 GLN E CA 1 
ATOM 10627 C C  . GLN E 1 436 ? 97.565  145.684 148.360 1.00 96.82  ? 436 GLN E C  1 
ATOM 10628 O O  . GLN E 1 436 ? 98.251  145.010 147.591 1.00 96.82  ? 436 GLN E O  1 
ATOM 10629 N N  . GLY E 1 437 ? 98.053  146.745 148.994 1.00 98.73  ? 437 GLY E N  1 
ATOM 10630 C CA . GLY E 1 437 ? 99.440  147.122 148.821 1.00 98.73  ? 437 GLY E CA 1 
ATOM 10631 C C  . GLY E 1 437 ? 99.723  148.611 148.806 1.00 98.73  ? 437 GLY E C  1 
ATOM 10632 O O  . GLY E 1 437 ? 100.885 149.019 148.723 1.00 98.73  ? 437 GLY E O  1 
ATOM 10633 N N  . PHE E 1 438 ? 98.688  149.441 148.904 1.00 98.68  ? 438 PHE E N  1 
ATOM 10634 C CA . PHE E 1 438 ? 98.908  150.880 148.940 1.00 98.68  ? 438 PHE E CA 1 
ATOM 10635 C C  . PHE E 1 438 ? 99.365  151.381 150.297 1.00 98.68  ? 438 PHE E C  1 
ATOM 10636 O O  . PHE E 1 438 ? 99.635  152.576 150.435 1.00 98.68  ? 438 PHE E O  1 
ATOM 10637 N N  . GLU E 1 439 ? 99.453  150.513 151.301 1.00 102.36 ? 439 GLU E N  1 
ATOM 10638 C CA . GLU E 1 439 ? 100.035 150.930 152.566 1.00 102.36 ? 439 GLU E CA 1 
ATOM 10639 C C  . GLU E 1 439 ? 101.541 151.087 152.458 1.00 102.36 ? 439 GLU E C  1 
ATOM 10640 O O  . GLU E 1 439 ? 102.153 151.770 153.282 1.00 102.36 ? 439 GLU E O  1 
ATOM 10641 N N  . LYS E 1 440 ? 102.155 150.456 151.471 1.00 91.62  ? 440 LYS E N  1 
ATOM 10642 C CA . LYS E 1 440 ? 103.582 150.603 151.263 1.00 91.62  ? 440 LYS E CA 1 
ATOM 10643 C C  . LYS E 1 440 ? 103.909 151.742 150.319 1.00 91.62  ? 440 LYS E C  1 
ATOM 10644 O O  . LYS E 1 440 ? 105.075 152.133 150.218 1.00 91.62  ? 440 LYS E O  1 
ATOM 10645 N N  . ALA E 1 441 ? 102.906 152.282 149.638 1.00 88.19  ? 441 ALA E N  1 
ATOM 10646 C CA . ALA E 1 441 ? 103.135 153.297 148.626 1.00 88.19  ? 441 ALA E CA 1 
ATOM 10647 C C  . ALA E 1 441 ? 103.452 154.642 149.261 1.00 88.19  ? 441 ALA E C  1 
ATOM 10648 O O  . ALA E 1 441 ? 103.059 154.932 150.392 1.00 88.19  ? 441 ALA E O  1 
ATOM 10649 N N  . ASP E 1 442 ? 104.170 155.470 148.513 1.00 84.86  ? 442 ASP E N  1 
ATOM 10650 C CA . ASP E 1 442 ? 104.546 156.789 148.982 1.00 84.86  ? 442 ASP E CA 1 
ATOM 10651 C C  . ASP E 1 442 ? 104.317 157.891 147.959 1.00 84.86  ? 442 ASP E C  1 
ATOM 10652 O O  . ASP E 1 442 ? 104.579 159.057 148.268 1.00 84.86  ? 442 ASP E O  1 
ATOM 10653 N N  . MET E 1 443 ? 103.835 157.566 146.762 1.00 75.99  ? 443 MET E N  1 
ATOM 10654 C CA . MET E 1 443 ? 103.530 158.591 145.774 1.00 75.99  ? 443 MET E CA 1 
ATOM 10655 C C  . MET E 1 443 ? 102.474 158.041 144.832 1.00 75.99  ? 443 MET E C  1 
ATOM 10656 O O  . MET E 1 443 ? 102.633 156.944 144.297 1.00 75.99  ? 443 MET E O  1 
ATOM 10657 N N  . VAL E 1 444 ? 101.405 158.801 144.634 1.00 71.98  ? 444 VAL E N  1 
ATOM 10658 C CA . VAL E 1 444 ? 100.223 158.349 143.914 1.00 71.98  ? 444 VAL E CA 1 
ATOM 10659 C C  . VAL E 1 444 ? 100.023 159.261 142.714 1.00 71.98  ? 444 VAL E C  1 
ATOM 10660 O O  . VAL E 1 444 ? 100.114 160.486 142.846 1.00 71.98  ? 444 VAL E O  1 
ATOM 10661 N N  . ILE E 1 445 ? 99.745  158.676 141.552 1.00 71.08  ? 445 ILE E N  1 
ATOM 10662 C CA . ILE E 1 445 ? 99.398  159.444 140.362 1.00 71.08  ? 445 ILE E CA 1 
ATOM 10663 C C  . ILE E 1 445 ? 98.083  158.925 139.801 1.00 71.08  ? 445 ILE E C  1 
ATOM 10664 O O  . ILE E 1 445 ? 97.990  157.761 139.394 1.00 71.08  ? 445 ILE E O  1 
ATOM 10665 N N  . GLU E 1 446 ? 97.076  159.785 139.783 1.00 82.42  ? 446 GLU E N  1 
ATOM 10666 C CA . GLU E 1 446 ? 95.807  159.500 139.141 1.00 82.42  ? 446 GLU E CA 1 
ATOM 10667 C C  . GLU E 1 446 ? 95.984  159.464 137.630 1.00 82.42  ? 446 GLU E C  1 
ATOM 10668 O O  . GLU E 1 446 ? 96.821  160.169 137.071 1.00 82.42  ? 446 GLU E O  1 
ATOM 10669 N N  . ALA E 1 447 ? 95.201  158.608 136.967 1.00 88.08  ? 447 ALA E N  1 
ATOM 10670 C CA . ALA E 1 447 ? 95.230  158.540 135.511 1.00 88.08  ? 447 ALA E CA 1 
ATOM 10671 C C  . ALA E 1 447 ? 93.851  158.341 134.894 1.00 88.08  ? 447 ALA E C  1 
ATOM 10672 O O  . ALA E 1 447 ? 93.763  157.961 133.721 1.00 88.08  ? 447 ALA E O  1 
ATOM 10673 N N  . VAL E 1 448 ? 92.776  158.569 135.648 1.00 96.70  ? 448 VAL E N  1 
ATOM 10674 C CA . VAL E 1 448 ? 91.438  158.281 135.151 1.00 96.70  ? 448 VAL E CA 1 
ATOM 10675 C C  . VAL E 1 448 ? 91.050  159.356 134.143 1.00 96.70  ? 448 VAL E C  1 
ATOM 10676 O O  . VAL E 1 448 ? 91.566  160.481 134.182 1.00 96.70  ? 448 VAL E O  1 
ATOM 10677 N N  . PHE E 1 449 ? 90.189  158.982 133.187 1.00 120.23 ? 449 PHE E N  1 
ATOM 10678 C CA . PHE E 1 449 ? 89.654  159.923 132.212 1.00 120.23 ? 449 PHE E CA 1 
ATOM 10679 C C  . PHE E 1 449 ? 88.947  161.080 132.899 1.00 120.23 ? 449 PHE E C  1 
ATOM 10680 O O  . PHE E 1 449 ? 88.213  160.895 133.873 1.00 120.23 ? 449 PHE E O  1 
ATOM 10681 N N  . GLU E 1 450 ? 89.170  162.275 132.357 1.00 121.43 ? 450 GLU E N  1 
ATOM 10682 C CA . GLU E 1 450 ? 88.953  163.511 133.094 1.00 121.43 ? 450 GLU E CA 1 
ATOM 10683 C C  . GLU E 1 450 ? 87.473  163.775 133.340 1.00 121.43 ? 450 GLU E C  1 
ATOM 10684 O O  . GLU E 1 450 ? 86.645  163.684 132.429 1.00 121.43 ? 450 GLU E O  1 
ATOM 10685 N N  . ASP E 1 451 ? 87.159  164.082 134.595 1.00 121.29 ? 451 ASP E N  1 
ATOM 10686 C CA . ASP E 1 451 ? 85.851  164.525 135.037 1.00 121.29 ? 451 ASP E CA 1 
ATOM 10687 C C  . ASP E 1 451 ? 86.051  165.228 136.369 1.00 121.29 ? 451 ASP E C  1 
ATOM 10688 O O  . ASP E 1 451 ? 86.966  164.909 137.129 1.00 121.29 ? 451 ASP E O  1 
ATOM 10689 N N  . LEU E 1 452 ? 85.177  166.183 136.655 1.00 109.61 ? 452 LEU E N  1 
ATOM 10690 C CA . LEU E 1 452 ? 85.236  166.910 137.915 1.00 109.61 ? 452 LEU E CA 1 
ATOM 10691 C C  . LEU E 1 452 ? 84.481  166.188 139.013 1.00 109.61 ? 452 LEU E C  1 
ATOM 10692 O O  . LEU E 1 452 ? 84.789  166.360 140.196 1.00 109.61 ? 452 LEU E O  1 
ATOM 10693 N N  . SER E 1 453 ? 83.529  165.354 138.645 1.00 112.73 ? 453 SER E N  1 
ATOM 10694 C CA . SER E 1 453 ? 82.617  164.738 139.586 1.00 112.73 ? 453 SER E CA 1 
ATOM 10695 C C  . SER E 1 453 ? 83.091  163.401 140.110 1.00 112.73 ? 453 SER E C  1 
ATOM 10696 O O  . SER E 1 453 ? 83.053  163.187 141.321 1.00 112.73 ? 453 SER E O  1 
ATOM 10697 N N  . LEU E 1 454 ? 83.534  162.497 139.240 1.00 112.73 ? 454 LEU E N  1 
ATOM 10698 C CA . LEU E 1 454 ? 83.892  161.160 139.694 1.00 112.73 ? 454 LEU E CA 1 
ATOM 10699 C C  . LEU E 1 454 ? 85.219  161.159 140.440 1.00 112.73 ? 454 LEU E C  1 
ATOM 10700 O O  . LEU E 1 454 ? 85.358  160.477 141.460 1.00 112.73 ? 454 LEU E O  1 
ATOM 10701 N N  . LYS E 1 455 ? 86.184  161.947 139.970 1.00 110.68 ? 455 LYS E N  1 
ATOM 10702 C CA . LYS E 1 455 ? 87.493  162.011 140.618 1.00 110.68 ? 455 LYS E CA 1 
ATOM 10703 C C  . LYS E 1 455 ? 87.406  162.686 141.971 1.00 110.68 ? 455 LYS E C  1 
ATOM 10704 O O  . LYS E 1 455 ? 88.197  162.378 142.870 1.00 110.68 ? 455 LYS E O  1 
ATOM 10705 N N  . HIS E 1 456 ? 86.440  163.597 142.121 1.00 121.43 ? 456 HIS E N  1 
ATOM 10706 C CA . HIS E 1 456 ? 86.112  164.208 143.402 1.00 121.43 ? 456 HIS E CA 1 
ATOM 10707 C C  . HIS E 1 456 ? 85.796  163.163 144.463 1.00 121.43 ? 456 HIS E C  1 
ATOM 10708 O O  . HIS E 1 456 ? 86.167  163.334 145.625 1.00 121.43 ? 456 HIS E O  1 
ATOM 10709 N N  . ARG E 1 457 ? 85.143  162.068 144.077 1.00 117.48 ? 457 ARG E N  1 
ATOM 10710 C CA . ARG E 1 457 ? 84.936  160.931 144.964 1.00 117.48 ? 457 ARG E CA 1 
ATOM 10711 C C  . ARG E 1 457 ? 86.139  160.003 145.022 1.00 117.48 ? 457 ARG E C  1 
ATOM 10712 O O  . ARG E 1 457 ? 86.456  159.481 146.100 1.00 117.48 ? 457 ARG E O  1 
ATOM 10713 N N  . VAL E 1 458 ? 86.804  159.807 143.879 1.00 111.85 ? 458 VAL E N  1 
ATOM 10714 C CA . VAL E 1 458 ? 87.902  158.845 143.759 1.00 111.85 ? 458 VAL E CA 1 
ATOM 10715 C C  . VAL E 1 458 ? 89.068  159.225 144.664 1.00 111.85 ? 458 VAL E C  1 
ATOM 10716 O O  . VAL E 1 458 ? 89.707  158.367 145.289 1.00 111.85 ? 458 VAL E O  1 
ATOM 10717 N N  . LEU E 1 459 ? 89.302  160.522 144.812 1.00 114.62 ? 459 LEU E N  1 
ATOM 10718 C CA . LEU E 1 459 ? 90.264  160.982 145.797 1.00 114.62 ? 459 LEU E CA 1 
ATOM 10719 C C  . LEU E 1 459 ? 89.774  160.749 147.220 1.00 114.62 ? 459 LEU E C  1 
ATOM 10720 O O  . LEU E 1 459 ? 90.593  160.663 148.142 1.00 114.62 ? 459 LEU E O  1 
ATOM 10721 N N  . LYS E 1 460 ? 88.461  160.627 147.419 1.00 117.72 ? 460 LYS E N  1 
ATOM 10722 C CA . LYS E 1 460 ? 87.945  160.444 148.768 1.00 117.72 ? 460 LYS E CA 1 
ATOM 10723 C C  . LYS E 1 460 ? 87.875  158.979 149.179 1.00 117.72 ? 460 LYS E C  1 
ATOM 10724 O O  . LYS E 1 460 ? 87.767  158.696 150.375 1.00 117.72 ? 460 LYS E O  1 
ATOM 10725 N N  . GLU E 1 461 ? 87.909  158.030 148.238 1.00 113.66 ? 461 GLU E N  1 
ATOM 10726 C CA . GLU E 1 461 ? 87.989  156.649 148.718 1.00 113.66 ? 461 GLU E CA 1 
ATOM 10727 C C  . GLU E 1 461 ? 89.398  156.079 148.670 1.00 113.66 ? 461 GLU E C  1 
ATOM 10728 O O  . GLU E 1 461 ? 89.647  155.030 149.270 1.00 113.66 ? 461 GLU E O  1 
ATOM 10729 N N  . VAL E 1 462 ? 90.329  156.746 147.997 1.00 106.91 ? 462 VAL E N  1 
ATOM 10730 C CA . VAL E 1 462 ? 91.698  156.256 147.880 1.00 106.91 ? 462 VAL E CA 1 
ATOM 10731 C C  . VAL E 1 462 ? 92.529  157.259 148.673 1.00 106.91 ? 462 VAL E C  1 
ATOM 10732 O O  . VAL E 1 462 ? 93.577  157.741 148.232 1.00 106.91 ? 462 VAL E O  1 
ATOM 10733 N N  . GLU E 1 463 ? 91.981  157.690 149.799 1.00 113.58 ? 463 GLU E N  1 
ATOM 10734 C CA . GLU E 1 463 ? 92.768  158.453 150.748 1.00 113.58 ? 463 GLU E CA 1 
ATOM 10735 C C  . GLU E 1 463 ? 93.082  157.680 152.016 1.00 113.58 ? 463 GLU E C  1 
ATOM 10736 O O  . GLU E 1 463 ? 94.053  158.014 152.701 1.00 113.58 ? 463 GLU E O  1 
ATOM 10737 N N  . ALA E 1 464 ? 92.288  156.666 152.348 1.00 108.39 ? 464 ALA E N  1 
ATOM 10738 C CA . ALA E 1 464 ? 92.367  156.093 153.683 1.00 108.39 ? 464 ALA E CA 1 
ATOM 10739 C C  . ALA E 1 464 ? 93.412  154.992 153.797 1.00 108.39 ? 464 ALA E C  1 
ATOM 10740 O O  . ALA E 1 464 ? 93.929  154.753 154.893 1.00 108.39 ? 464 ALA E O  1 
ATOM 10741 N N  . VAL E 1 465 ? 93.751  154.322 152.700 1.00 105.48 ? 465 VAL E N  1 
ATOM 10742 C CA . VAL E 1 465 ? 94.614  153.148 152.784 1.00 105.48 ? 465 VAL E CA 1 
ATOM 10743 C C  . VAL E 1 465 ? 96.022  153.567 152.357 1.00 105.48 ? 465 VAL E C  1 
ATOM 10744 O O  . VAL E 1 465 ? 96.858  152.749 151.951 1.00 105.48 ? 465 VAL E O  1 
ATOM 10745 N N  . ILE E 1 466 ? 96.314  154.853 152.504 1.00 103.83 ? 466 ILE E N  1 
ATOM 10746 C CA . ILE E 1 466 ? 97.585  155.425 152.072 1.00 103.83 ? 466 ILE E CA 1 
ATOM 10747 C C  . ILE E 1 466 ? 98.209  156.154 153.257 1.00 103.83 ? 466 ILE E C  1 
ATOM 10748 O O  . ILE E 1 466 ? 97.491  156.844 153.992 1.00 103.83 ? 466 ILE E O  1 
ATOM 10749 N N  . PRO E 1 467 ? 99.529  156.007 153.504 1.00 103.25 ? 467 PRO E N  1 
ATOM 10750 C CA . PRO E 1 467 ? 100.172 156.724 154.617 1.00 103.25 ? 467 PRO E CA 1 
ATOM 10751 C C  . PRO E 1 467 ? 100.165 158.240 154.476 1.00 103.25 ? 467 PRO E C  1 
ATOM 10752 O O  . PRO E 1 467 ? 99.765  158.780 153.441 1.00 103.25 ? 467 PRO E O  1 
ATOM 10753 N N  . ASP E 1 468 ? 100.623 158.940 155.510 1.00 108.47 ? 468 ASP E N  1 
ATOM 10754 C CA . ASP E 1 468 ? 100.531 160.391 155.514 1.00 108.47 ? 468 ASP E CA 1 
ATOM 10755 C C  . ASP E 1 468 ? 101.715 161.082 154.858 1.00 108.47 ? 468 ASP E C  1 
ATOM 10756 O O  . ASP E 1 468 ? 101.581 162.238 154.448 1.00 108.47 ? 468 ASP E O  1 
ATOM 10757 N N  . HIS E 1 469 ? 102.862 160.423 154.745 1.00 100.93 ? 469 HIS E N  1 
ATOM 10758 C CA . HIS E 1 469 ? 103.999 161.036 154.059 1.00 100.93 ? 469 HIS E CA 1 
ATOM 10759 C C  . HIS E 1 469 ? 104.003 160.678 152.576 1.00 100.93 ? 469 HIS E C  1 
ATOM 10760 O O  . HIS E 1 469 ? 105.009 160.288 151.990 1.00 100.93 ? 469 HIS E O  1 
ATOM 10761 N N  . CYS E 1 470 ? 102.867 160.868 151.936 1.00 93.57  ? 470 CYS E N  1 
ATOM 10762 C CA . CYS E 1 470 ? 102.684 160.466 150.560 1.00 93.57  ? 470 CYS E CA 1 
ATOM 10763 C C  . CYS E 1 470 ? 102.633 161.695 149.673 1.00 93.57  ? 470 CYS E C  1 
ATOM 10764 O O  . CYS E 1 470 ? 102.855 162.822 150.122 1.00 93.57  ? 470 CYS E O  1 
ATOM 10765 N N  . ILE E 1 471 ? 102.351 161.471 148.398 1.00 77.42  ? 471 ILE E N  1 
ATOM 10766 C CA . ILE E 1 471 ? 102.040 162.533 147.454 1.00 77.42  ? 471 ILE E CA 1 
ATOM 10767 C C  . ILE E 1 471 ? 100.879 162.067 146.606 1.00 77.42  ? 471 ILE E C  1 
ATOM 10768 O O  . ILE E 1 471 ? 100.954 161.013 145.968 1.00 77.42  ? 471 ILE E O  1 
ATOM 10769 N N  . PHE E 1 472 ? 99.812  162.837 146.593 1.00 75.55  ? 472 PHE E N  1 
ATOM 10770 C CA . PHE E 1 472 ? 98.771  162.655 145.606 1.00 75.55  ? 472 PHE E CA 1 
ATOM 10771 C C  . PHE E 1 472 ? 99.078  163.565 144.427 1.00 75.55  ? 472 PHE E C  1 
ATOM 10772 O O  . PHE E 1 472 ? 99.536  164.693 144.613 1.00 75.55  ? 472 PHE E O  1 
ATOM 10773 N N  . ALA E 1 473 ? 98.867  163.067 143.216 1.00 75.86  ? 473 ALA E N  1 
ATOM 10774 C CA . ALA E 1 473 ? 99.031  163.909 142.044 1.00 75.86  ? 473 ALA E CA 1 
ATOM 10775 C C  . ALA E 1 473 ? 98.085  163.416 140.968 1.00 75.86  ? 473 ALA E C  1 
ATOM 10776 O O  . ALA E 1 473 ? 97.571  162.301 141.042 1.00 75.86  ? 473 ALA E O  1 
ATOM 10777 N N  . SER E 1 474 ? 97.854  164.251 139.958 1.00 79.40  ? 474 SER E N  1 
ATOM 10778 C CA . SER E 1 474 ? 96.900  163.892 138.921 1.00 79.40  ? 474 SER E CA 1 
ATOM 10779 C C  . SER E 1 474 ? 97.331  164.487 137.594 1.00 79.40  ? 474 SER E C  1 
ATOM 10780 O O  . SER E 1 474 ? 97.882  165.589 137.550 1.00 79.40  ? 474 SER E O  1 
ATOM 10781 N N  . ASN E 1 475 ? 97.084  163.754 136.517 1.00 79.73  ? 475 ASN E N  1 
ATOM 10782 C CA . ASN E 1 475 ? 97.322  164.271 135.174 1.00 79.73  ? 475 ASN E CA 1 
ATOM 10783 C C  . ASN E 1 475 ? 96.026  164.779 134.545 1.00 79.73  ? 475 ASN E C  1 
ATOM 10784 O O  . ASN E 1 475 ? 95.558  164.296 133.517 1.00 79.73  ? 475 ASN E O  1 
ATOM 10785 N N  . THR E 1 476 ? 95.446  165.787 135.184 1.00 82.18  ? 476 THR E N  1 
ATOM 10786 C CA . THR E 1 476 ? 94.371  166.523 134.541 1.00 82.18  ? 476 THR E CA 1 
ATOM 10787 C C  . THR E 1 476 ? 94.908  167.297 133.351 1.00 82.18  ? 476 THR E C  1 
ATOM 10788 O O  . THR E 1 476 ? 96.101  167.600 133.261 1.00 82.18  ? 476 THR E O  1 
ATOM 10789 N N  . SER E 1 477 ? 94.025  167.587 132.416 1.00 88.98  ? 477 SER E N  1 
ATOM 10790 C CA . SER E 1 477 ? 94.382  168.443 131.308 1.00 88.98  ? 477 SER E CA 1 
ATOM 10791 C C  . SER E 1 477 ? 93.585  169.731 131.295 1.00 88.98  ? 477 SER E C  1 
ATOM 10792 O O  . SER E 1 477 ? 94.076  170.741 130.785 1.00 88.98  ? 477 SER E O  1 
ATOM 10793 N N  . ALA E 1 478 ? 92.382  169.724 131.859 1.00 107.33 ? 478 ALA E N  1 
ATOM 10794 C CA . ALA E 1 478 ? 91.506  170.883 131.780 1.00 107.33 ? 478 ALA E CA 1 
ATOM 10795 C C  . ALA E 1 478 ? 91.207  171.485 133.144 1.00 107.33 ? 478 ALA E C  1 
ATOM 10796 O O  . ALA E 1 478 ? 91.499  172.665 133.367 1.00 107.33 ? 478 ALA E O  1 
ATOM 10797 N N  . LEU E 1 479 ? 90.674  170.730 134.041 1.00 105.47 ? 479 LEU E N  1 
ATOM 10798 C CA . LEU E 1 479 ? 90.153  171.435 135.196 1.00 105.47 ? 479 LEU E CA 1 
ATOM 10799 C C  . LEU E 1 479 ? 91.229  171.567 136.265 1.00 105.47 ? 479 LEU E C  1 
ATOM 10800 O O  . LEU E 1 479 ? 92.011  170.638 136.481 1.00 105.47 ? 479 LEU E O  1 
ATOM 10801 N N  . PRO E 1 480 ? 91.296  172.724 136.928 1.00 105.88 ? 480 PRO E N  1 
ATOM 10802 C CA . PRO E 1 480 ? 92.431  172.996 137.818 1.00 105.88 ? 480 PRO E CA 1 
ATOM 10803 C C  . PRO E 1 480 ? 92.405  172.215 139.119 1.00 105.88 ? 480 PRO E C  1 
ATOM 10804 O O  . PRO E 1 480 ? 91.388  171.630 139.501 1.00 105.88 ? 480 PRO E O  1 
ATOM 10805 N N  . ILE E 1 481 ? 93.536  172.230 139.816 1.00 100.04 ? 481 ILE E N  1 
ATOM 10806 C CA . ILE E 1 481 ? 93.712  171.427 141.014 1.00 100.04 ? 481 ILE E CA 1 
ATOM 10807 C C  . ILE E 1 481 ? 93.236  172.150 142.265 1.00 100.04 ? 481 ILE E C  1 
ATOM 10808 O O  . ILE E 1 481 ? 92.724  171.495 143.185 1.00 100.04 ? 481 ILE E O  1 
ATOM 10809 N N  . SER E 1 482 ? 93.309  173.482 142.295 1.00 101.27 ? 482 SER E N  1 
ATOM 10810 C CA . SER E 1 482 ? 92.833  174.232 143.453 1.00 101.27 ? 482 SER E CA 1 
ATOM 10811 C C  . SER E 1 482 ? 91.323  174.124 143.626 1.00 101.27 ? 482 SER E C  1 
ATOM 10812 O O  . SER E 1 482 ? 90.807  174.366 144.721 1.00 101.27 ? 482 SER E O  1 
ATOM 10813 N N  . GLU E 1 483 ? 90.606  173.749 142.575 1.00 104.34 ? 483 GLU E N  1 
ATOM 10814 C CA . GLU E 1 483 ? 89.216  173.356 142.703 1.00 104.34 ? 483 GLU E CA 1 
ATOM 10815 C C  . GLU E 1 483 ? 89.055  171.996 143.363 1.00 104.34 ? 483 GLU E C  1 
ATOM 10816 O O  . GLU E 1 483 ? 87.994  171.721 143.930 1.00 104.34 ? 483 GLU E O  1 
ATOM 10817 N N  . ILE E 1 484 ? 90.076  171.144 143.314 1.00 104.23 ? 484 ILE E N  1 
ATOM 10818 C CA . ILE E 1 484 ? 89.999  169.836 143.951 1.00 104.23 ? 484 ILE E CA 1 
ATOM 10819 C C  . ILE E 1 484 ? 91.036  169.646 145.045 1.00 104.23 ? 484 ILE E C  1 
ATOM 10820 O O  . ILE E 1 484 ? 91.161  168.527 145.567 1.00 104.23 ? 484 ILE E O  1 
ATOM 10821 N N  . ALA E 1 485 ? 91.802  170.676 145.401 1.00 112.47 ? 485 ALA E N  1 
ATOM 10822 C CA . ALA E 1 485 ? 92.774  170.586 146.481 1.00 112.47 ? 485 ALA E CA 1 
ATOM 10823 C C  . ALA E 1 485 ? 92.173  170.939 147.834 1.00 112.47 ? 485 ALA E C  1 
ATOM 10824 O O  . ALA E 1 485 ? 92.874  170.902 148.849 1.00 112.47 ? 485 ALA E O  1 
ATOM 10825 N N  . ALA E 1 486 ? 90.887  171.274 147.876 1.00 111.36 ? 486 ALA E N  1 
ATOM 10826 C CA . ALA E 1 486 ? 90.234  171.647 149.122 1.00 111.36 ? 486 ALA E CA 1 
ATOM 10827 C C  . ALA E 1 486 ? 89.316  170.561 149.657 1.00 111.36 ? 486 ALA E C  1 
ATOM 10828 O O  . ALA E 1 486 ? 88.420  170.862 150.451 1.00 111.36 ? 486 ALA E O  1 
ATOM 10829 N N  . VAL E 1 487 ? 89.515  169.311 149.250 1.00 114.68 ? 487 VAL E N  1 
ATOM 10830 C CA . VAL E 1 487 ? 88.606  168.229 149.580 1.00 114.68 ? 487 VAL E CA 1 
ATOM 10831 C C  . VAL E 1 487 ? 89.250  167.219 150.520 1.00 114.68 ? 487 VAL E C  1 
ATOM 10832 O O  . VAL E 1 487 ? 88.623  166.775 151.484 1.00 114.68 ? 487 VAL E O  1 
ATOM 10833 N N  . SER E 1 488 ? 90.508  166.870 150.271 1.00 120.28 ? 488 SER E N  1 
ATOM 10834 C CA . SER E 1 488 ? 91.152  165.753 150.944 1.00 120.28 ? 488 SER E CA 1 
ATOM 10835 C C  . SER E 1 488 ? 91.491  166.081 152.397 1.00 120.28 ? 488 SER E C  1 
ATOM 10836 O O  . SER E 1 488 ? 91.307  167.202 152.879 1.00 120.28 ? 488 SER E O  1 
ATOM 10837 N N  . LYS E 1 489 ? 91.985  165.059 153.100 1.00 116.54 ? 489 LYS E N  1 
ATOM 10838 C CA . LYS E 1 489 ? 92.419  165.239 154.479 1.00 116.54 ? 489 LYS E CA 1 
ATOM 10839 C C  . LYS E 1 489 ? 93.682  166.078 154.559 1.00 116.54 ? 489 LYS E C  1 
ATOM 10840 O O  . LYS E 1 489 ? 93.761  167.001 155.375 1.00 116.54 ? 489 LYS E O  1 
ATOM 10841 N N  . ARG E 1 490 ? 94.668  165.783 153.724 1.00 110.40 ? 490 ARG E N  1 
ATOM 10842 C CA . ARG E 1 490 ? 95.880  166.576 153.698 1.00 110.40 ? 490 ARG E CA 1 
ATOM 10843 C C  . ARG E 1 490 ? 95.784  167.633 152.609 1.00 110.40 ? 490 ARG E C  1 
ATOM 10844 O O  . ARG E 1 490 ? 95.327  167.347 151.494 1.00 110.40 ? 490 ARG E O  1 
ATOM 10845 N N  . PRO E 1 491 ? 96.084  168.871 152.927 1.00 93.15  ? 491 PRO E N  1 
ATOM 10846 C CA . PRO E 1 491 ? 95.975  169.927 151.920 1.00 93.15  ? 491 PRO E CA 1 
ATOM 10847 C C  . PRO E 1 491 ? 97.256  170.162 151.141 1.00 93.15  ? 491 PRO E C  1 
ATOM 10848 O O  . PRO E 1 491 ? 97.221  170.638 150.004 1.00 93.15  ? 491 PRO E O  1 
ATOM 10849 N N  . GLU E 1 492 ? 98.393  169.825 151.735 1.00 102.35 ? 492 GLU E N  1 
ATOM 10850 C CA . GLU E 1 492 ? 99.667  170.297 151.229 1.00 102.35 ? 492 GLU E CA 1 
ATOM 10851 C C  . GLU E 1 492 ? 100.432 169.242 150.457 1.00 102.35 ? 492 GLU E C  1 
ATOM 10852 O O  . GLU E 1 492 ? 101.398 169.583 149.770 1.00 102.35 ? 492 GLU E O  1 
ATOM 10853 N N  . LYS E 1 493 ? 100.031 167.978 150.550 1.00 90.03  ? 493 LYS E N  1 
ATOM 10854 C CA . LYS E 1 493 ? 100.759 166.889 149.920 1.00 90.03  ? 493 LYS E CA 1 
ATOM 10855 C C  . LYS E 1 493 ? 100.166 166.524 148.572 1.00 90.03  ? 493 LYS E C  1 
ATOM 10856 O O  . LYS E 1 493 ? 100.223 165.361 148.165 1.00 90.03  ? 493 LYS E O  1 
ATOM 10857 N N  . VAL E 1 494 ? 99.570  167.489 147.881 1.00 84.11  ? 494 VAL E N  1 
ATOM 10858 C CA . VAL E 1 494 ? 98.970  167.261 146.576 1.00 84.11  ? 494 VAL E CA 1 
ATOM 10859 C C  . VAL E 1 494 ? 99.581  168.246 145.599 1.00 84.11  ? 494 VAL E C  1 
ATOM 10860 O O  . VAL E 1 494 ? 99.460  169.463 145.775 1.00 84.11  ? 494 VAL E O  1 
ATOM 10861 N N  . ILE E 1 495 ? 100.229 167.725 144.569 1.00 82.19  ? 495 ILE E N  1 
ATOM 10862 C CA . ILE E 1 495 ? 100.674 168.519 143.453 1.00 82.19  ? 495 ILE E CA 1 
ATOM 10863 C C  . ILE E 1 495 ? 99.972  168.005 142.207 1.00 82.19  ? 495 ILE E C  1 
ATOM 10864 O O  . ILE E 1 495 ? 99.070  167.178 142.272 1.00 82.19  ? 495 ILE E O  1 
ATOM 10865 N N  . GLY E 1 496 ? 100.381 168.509 141.054 1.00 78.42  ? 496 GLY E N  1 
ATOM 10866 C CA . GLY E 1 496 ? 99.953  167.970 139.777 1.00 78.42  ? 496 GLY E CA 1 
ATOM 10867 C C  . GLY E 1 496 ? 101.155 167.652 138.906 1.00 78.42  ? 496 GLY E C  1 
ATOM 10868 O O  . GLY E 1 496 ? 102.160 168.361 138.943 1.00 78.42  ? 496 GLY E O  1 
ATOM 10869 N N  . MET E 1 497 ? 101.035 166.584 138.128 1.00 74.29  ? 497 MET E N  1 
ATOM 10870 C CA . MET E 1 497 ? 101.995 166.255 137.084 1.00 74.29  ? 497 MET E CA 1 
ATOM 10871 C C  . MET E 1 497 ? 101.208 165.977 135.822 1.00 74.29  ? 497 MET E C  1 
ATOM 10872 O O  . MET E 1 497 ? 100.490 164.980 135.752 1.00 74.29  ? 497 MET E O  1 
ATOM 10873 N N  . HIS E 1 498 ? 101.336 166.841 134.830 1.00 74.43  ? 498 HIS E N  1 
ATOM 10874 C CA . HIS E 1 498 ? 100.737 166.589 133.534 1.00 74.43  ? 498 HIS E CA 1 
ATOM 10875 C C  . HIS E 1 498 ? 101.812 166.075 132.590 1.00 74.43  ? 498 HIS E C  1 
ATOM 10876 O O  . HIS E 1 498 ? 102.919 166.626 132.532 1.00 74.43  ? 498 HIS E O  1 
ATOM 10877 N N  . TYR E 1 499 ? 101.489 165.011 131.880 1.00 63.84  ? 499 TYR E N  1 
ATOM 10878 C CA . TYR E 1 499 ? 102.348 164.401 130.888 1.00 63.84  ? 499 TYR E CA 1 
ATOM 10879 C C  . TYR E 1 499 ? 101.910 164.861 129.508 1.00 63.84  ? 499 TYR E C  1 
ATOM 10880 O O  . TYR E 1 499 ? 101.134 165.806 129.365 1.00 63.84  ? 499 TYR E O  1 
ATOM 10881 N N  . PHE E 1 500 ? 102.437 164.221 128.474 1.00 66.59  ? 500 PHE E N  1 
ATOM 10882 C CA . PHE E 1 500 ? 101.963 164.437 127.118 1.00 66.59  ? 500 PHE E CA 1 
ATOM 10883 C C  . PHE E 1 500 ? 101.755 163.083 126.457 1.00 66.59  ? 500 PHE E C  1 
ATOM 10884 O O  . PHE E 1 500 ? 102.181 162.059 126.991 1.00 66.59  ? 500 PHE E O  1 
ATOM 10885 N N  . SER E 1 501 ? 101.089 163.073 125.299 1.00 83.34  ? 501 SER E N  1 
ATOM 10886 C CA . SER E 1 501 ? 100.330 161.868 124.973 1.00 83.34  ? 501 SER E CA 1 
ATOM 10887 C C  . SER E 1 501 ? 101.135 160.659 124.464 1.00 83.34  ? 501 SER E C  1 
ATOM 10888 O O  . SER E 1 501 ? 101.064 159.627 125.140 1.00 83.34  ? 501 SER E O  1 
ATOM 10889 N N  . PRO E 1 502 ? 101.929 160.675 123.343 1.00 85.91  ? 502 PRO E N  1 
ATOM 10890 C CA . PRO E 1 502 ? 102.867 159.519 123.333 1.00 85.91  ? 502 PRO E CA 1 
ATOM 10891 C C  . PRO E 1 502 ? 104.071 159.761 124.237 1.00 85.91  ? 502 PRO E C  1 
ATOM 10892 O O  . PRO E 1 502 ? 104.974 160.543 123.971 1.00 85.91  ? 502 PRO E O  1 
ATOM 10893 N N  . VAL E 1 503 ? 104.073 159.019 125.335 1.00 77.60  ? 503 VAL E N  1 
ATOM 10894 C CA . VAL E 1 503 ? 104.972 159.273 126.449 1.00 77.60  ? 503 VAL E CA 1 
ATOM 10895 C C  . VAL E 1 503 ? 106.410 158.882 126.160 1.00 77.60  ? 503 VAL E C  1 
ATOM 10896 O O  . VAL E 1 503 ? 107.328 159.353 126.838 1.00 77.60  ? 503 VAL E O  1 
ATOM 10897 N N  . ASP E 1 504 ? 106.647 158.000 125.196 1.00 91.32  ? 504 ASP E N  1 
ATOM 10898 C CA . ASP E 1 504 ? 108.011 157.563 124.964 1.00 91.32  ? 504 ASP E CA 1 
ATOM 10899 C C  . ASP E 1 504 ? 108.773 158.588 124.145 1.00 91.32  ? 504 ASP E C  1 
ATOM 10900 O O  . ASP E 1 504 ? 109.885 158.984 124.508 1.00 91.32  ? 504 ASP E O  1 
ATOM 10901 N N  . LYS E 1 505 ? 108.178 159.045 123.043 1.00 92.52  ? 505 LYS E N  1 
ATOM 10902 C CA . LYS E 1 505 ? 108.939 159.846 122.094 1.00 92.52  ? 505 LYS E CA 1 
ATOM 10903 C C  . LYS E 1 505 ? 109.186 161.252 122.621 1.00 92.52  ? 505 LYS E C  1 
ATOM 10904 O O  . LYS E 1 505 ? 110.339 161.693 122.668 1.00 92.52  ? 505 LYS E O  1 
ATOM 10905 N N  . MET E 1 506 ? 108.140 161.952 123.061 1.00 87.04  ? 506 MET E N  1 
ATOM 10906 C CA . MET E 1 506 ? 108.345 163.282 123.614 1.00 87.04  ? 506 MET E CA 1 
ATOM 10907 C C  . MET E 1 506 ? 108.974 163.184 124.996 1.00 87.04  ? 506 MET E C  1 
ATOM 10908 O O  . MET E 1 506 ? 109.008 162.119 125.616 1.00 87.04  ? 506 MET E O  1 
ATOM 10909 N N  . GLN E 1 507 ? 109.517 164.303 125.460 1.00 78.50  ? 507 GLN E N  1 
ATOM 10910 C CA . GLN E 1 507 ? 110.575 164.218 126.447 1.00 78.50  ? 507 GLN E CA 1 
ATOM 10911 C C  . GLN E 1 507 ? 110.397 165.269 127.541 1.00 78.50  ? 507 GLN E C  1 
ATOM 10912 O O  . GLN E 1 507 ? 111.358 165.743 128.143 1.00 78.50  ? 507 GLN E O  1 
ATOM 10913 N N  . LEU E 1 508 ? 109.161 165.593 127.900 1.00 72.73  ? 508 LEU E N  1 
ATOM 10914 C CA . LEU E 1 508 ? 109.025 166.520 129.016 1.00 72.73  ? 508 LEU E CA 1 
ATOM 10915 C C  . LEU E 1 508 ? 107.780 166.255 129.837 1.00 72.73  ? 508 LEU E C  1 
ATOM 10916 O O  . LEU E 1 508 ? 106.846 165.578 129.402 1.00 72.73  ? 508 LEU E O  1 
ATOM 10917 N N  . LEU E 1 509 ? 107.812 166.806 131.040 1.00 71.27  ? 509 LEU E N  1 
ATOM 10918 C CA . LEU E 1 509 ? 106.728 166.814 131.998 1.00 71.27  ? 509 LEU E CA 1 
ATOM 10919 C C  . LEU E 1 509 ? 106.268 168.244 132.177 1.00 71.27  ? 509 LEU E C  1 
ATOM 10920 O O  . LEU E 1 509 ? 106.839 169.163 131.586 1.00 71.27  ? 509 LEU E O  1 
ATOM 10921 N N  . GLU E 1 510 ? 105.243 168.433 133.002 1.00 80.80  ? 510 GLU E N  1 
ATOM 10922 C CA . GLU E 1 510 ? 104.963 169.750 133.556 1.00 80.80  ? 510 GLU E CA 1 
ATOM 10923 C C  . GLU E 1 510 ? 104.345 169.617 134.935 1.00 80.80  ? 510 GLU E C  1 
ATOM 10924 O O  . GLU E 1 510 ? 103.557 168.700 135.187 1.00 80.80  ? 510 GLU E O  1 
ATOM 10925 N N  . ILE E 1 511 ? 104.714 170.536 135.819 1.00 75.64  ? 511 ILE E N  1 
ATOM 10926 C CA . ILE E 1 511 ? 104.334 170.494 137.220 1.00 75.64  ? 511 ILE E CA 1 
ATOM 10927 C C  . ILE E 1 511 ? 103.243 171.520 137.472 1.00 75.64  ? 511 ILE E C  1 
ATOM 10928 O O  . ILE E 1 511 ? 103.253 172.624 136.919 1.00 75.64  ? 511 ILE E O  1 
ATOM 10929 N N  . ILE E 1 512 ? 102.286 171.135 138.305 1.00 86.74  ? 512 ILE E N  1 
ATOM 10930 C CA . ILE E 1 512 ? 101.162 171.965 138.683 1.00 86.74  ? 512 ILE E CA 1 
ATOM 10931 C C  . ILE E 1 512 ? 101.276 172.210 140.178 1.00 86.74  ? 512 ILE E C  1 
ATOM 10932 O O  . ILE E 1 512 ? 101.217 171.263 140.971 1.00 86.74  ? 512 ILE E O  1 
ATOM 10933 N N  . THR E 1 513 ? 101.461 173.470 140.564 1.00 97.68  ? 513 THR E N  1 
ATOM 10934 C CA . THR E 1 513 ? 101.817 173.850 141.927 1.00 97.68  ? 513 THR E CA 1 
ATOM 10935 C C  . THR E 1 513 ? 100.779 174.804 142.496 1.00 97.68  ? 513 THR E C  1 
ATOM 10936 O O  . THR E 1 513 ? 100.630 175.928 142.009 1.00 97.68  ? 513 THR E O  1 
ATOM 10937 N N  . THR E 1 514 ? 100.119 174.384 143.569 1.00 104.58 ? 514 THR E N  1 
ATOM 10938 C CA . THR E 1 514 ? 99.056  175.154 144.200 1.00 104.58 ? 514 THR E CA 1 
ATOM 10939 C C  . THR E 1 514 ? 99.638  176.278 145.054 1.00 104.58 ? 514 THR E C  1 
ATOM 10940 O O  . THR E 1 514 ? 100.827 176.601 145.003 1.00 104.58 ? 514 THR E O  1 
ATOM 10941 N N  . GLU E 1 515 ? 98.777  176.893 145.860 1.00 102.35 ? 515 GLU E N  1 
ATOM 10942 C CA . GLU E 1 515 ? 99.260  177.741 146.937 1.00 102.35 ? 515 GLU E CA 1 
ATOM 10943 C C  . GLU E 1 515 ? 99.921  176.907 148.022 1.00 102.35 ? 515 GLU E C  1 
ATOM 10944 O O  . GLU E 1 515 ? 100.929 177.315 148.607 1.00 102.35 ? 515 GLU E O  1 
ATOM 10945 N N  . LYS E 1 516 ? 99.387  175.720 148.279 1.00 103.59 ? 516 LYS E N  1 
ATOM 10946 C CA . LYS E 1 516 ? 99.713  174.959 149.474 1.00 103.59 ? 516 LYS E CA 1 
ATOM 10947 C C  . LYS E 1 516 ? 100.844 173.962 149.282 1.00 103.59 ? 516 LYS E C  1 
ATOM 10948 O O  . LYS E 1 516 ? 101.104 173.173 150.193 1.00 103.59 ? 516 LYS E O  1 
ATOM 10949 N N  . THR E 1 517 ? 101.509 173.953 148.135 1.00 106.77 ? 517 THR E N  1 
ATOM 10950 C CA . THR E 1 517 ? 102.573 172.979 147.909 1.00 106.77 ? 517 THR E CA 1 
ATOM 10951 C C  . THR E 1 517 ? 103.800 173.372 148.716 1.00 106.77 ? 517 THR E C  1 
ATOM 10952 O O  . THR E 1 517 ? 104.345 174.465 148.552 1.00 106.77 ? 517 THR E O  1 
ATOM 10953 N N  . SER E 1 518 ? 104.230 172.482 149.605 1.00 100.30 ? 518 SER E N  1 
ATOM 10954 C CA . SER E 1 518 ? 105.446 172.709 150.364 1.00 100.30 ? 518 SER E CA 1 
ATOM 10955 C C  . SER E 1 518 ? 106.665 172.597 149.464 1.00 100.30 ? 518 SER E C  1 
ATOM 10956 O O  . SER E 1 518 ? 106.615 172.042 148.362 1.00 100.30 ? 518 SER E O  1 
ATOM 10957 N N  . LYS E 1 519 ? 107.777 173.140 149.958 1.00 106.31 ? 519 LYS E N  1 
ATOM 10958 C CA . LYS E 1 519 ? 109.045 172.989 149.262 1.00 106.31 ? 519 LYS E CA 1 
ATOM 10959 C C  . LYS E 1 519 ? 109.483 171.538 149.214 1.00 106.31 ? 519 LYS E C  1 
ATOM 10960 O O  . LYS E 1 519 ? 110.060 171.103 148.210 1.00 106.31 ? 519 LYS E O  1 
ATOM 10961 N N  . ASP E 1 520 ? 109.204 170.777 150.271 1.00 100.57 ? 520 ASP E N  1 
ATOM 10962 C CA . ASP E 1 520 ? 109.572 169.370 150.267 1.00 100.57 ? 520 ASP E CA 1 
ATOM 10963 C C  . ASP E 1 520 ? 108.710 168.588 149.289 1.00 100.57 ? 520 ASP E C  1 
ATOM 10964 O O  . ASP E 1 520 ? 109.199 167.674 148.616 1.00 100.57 ? 520 ASP E O  1 
ATOM 10965 N N  . THR E 1 521 ? 107.429 168.954 149.181 1.00 88.31  ? 521 THR E N  1 
ATOM 10966 C CA . THR E 1 521 ? 106.542 168.311 148.220 1.00 88.31  ? 521 THR E CA 1 
ATOM 10967 C C  . THR E 1 521 ? 106.991 168.586 146.796 1.00 88.31  ? 521 THR E C  1 
ATOM 10968 O O  . THR E 1 521 ? 107.044 167.675 145.965 1.00 88.31  ? 521 THR E O  1 
ATOM 10969 N N  . SER E 1 522 ? 107.356 169.834 146.514 1.00 88.90  ? 522 SER E N  1 
ATOM 10970 C CA . SER E 1 522 ? 107.780 170.200 145.170 1.00 88.90  ? 522 SER E CA 1 
ATOM 10971 C C  . SER E 1 522 ? 109.109 169.558 144.816 1.00 88.90  ? 522 SER E C  1 
ATOM 10972 O O  . SER E 1 522 ? 109.294 169.081 143.688 1.00 88.90  ? 522 SER E O  1 
ATOM 10973 N N  . ALA E 1 523 ? 110.041 169.533 145.769 1.00 88.29  ? 523 ALA E N  1 
ATOM 10974 C CA . ALA E 1 523 ? 111.335 168.913 145.524 1.00 88.29  ? 523 ALA E CA 1 
ATOM 10975 C C  . ALA E 1 523 ? 111.191 167.415 145.325 1.00 88.29  ? 523 ALA E C  1 
ATOM 10976 O O  . ALA E 1 523 ? 111.825 166.836 144.438 1.00 88.29  ? 523 ALA E O  1 
ATOM 10977 N N  . SER E 1 524 ? 110.335 166.777 146.120 1.00 81.00  ? 524 SER E N  1 
ATOM 10978 C CA . SER E 1 524 ? 110.085 165.356 145.959 1.00 81.00  ? 524 SER E CA 1 
ATOM 10979 C C  . SER E 1 524 ? 109.379 165.054 144.651 1.00 81.00  ? 524 SER E C  1 
ATOM 10980 O O  . SER E 1 524 ? 109.565 163.975 144.087 1.00 81.00  ? 524 SER E O  1 
ATOM 10981 N N  . ALA E 1 525 ? 108.582 165.987 144.150 1.00 70.90  ? 525 ALA E N  1 
ATOM 10982 C CA . ALA E 1 525 ? 107.971 165.784 142.848 1.00 70.90  ? 525 ALA E CA 1 
ATOM 10983 C C  . ALA E 1 525 ? 109.013 165.867 141.746 1.00 70.90  ? 525 ALA E C  1 
ATOM 10984 O O  . ALA E 1 525 ? 109.117 164.973 140.896 1.00 70.90  ? 525 ALA E O  1 
ATOM 10985 N N  . VAL E 1 526 ? 109.832 166.919 141.770 1.00 72.01  ? 526 VAL E N  1 
ATOM 10986 C CA . VAL E 1 526 ? 110.777 167.107 140.680 1.00 72.01  ? 526 VAL E CA 1 
ATOM 10987 C C  . VAL E 1 526 ? 111.924 166.122 140.769 1.00 72.01  ? 526 VAL E C  1 
ATOM 10988 O O  . VAL E 1 526 ? 112.648 165.937 139.785 1.00 72.01  ? 526 VAL E O  1 
ATOM 10989 N N  . ALA E 1 527 ? 112.094 165.466 141.918 1.00 70.93  ? 527 ALA E N  1 
ATOM 10990 C CA . ALA E 1 527 ? 113.013 164.341 141.980 1.00 70.93  ? 527 ALA E CA 1 
ATOM 10991 C C  . ALA E 1 527 ? 112.531 163.210 141.094 1.00 70.93  ? 527 ALA E C  1 
ATOM 10992 O O  . ALA E 1 527 ? 113.321 162.625 140.349 1.00 70.93  ? 527 ALA E O  1 
ATOM 10993 N N  . VAL E 1 528 ? 111.227 162.932 141.124 1.00 59.99  ? 528 VAL E N  1 
ATOM 10994 C CA . VAL E 1 528 ? 110.655 161.945 140.223 1.00 59.99  ? 528 VAL E CA 1 
ATOM 10995 C C  . VAL E 1 528 ? 110.737 162.453 138.806 1.00 59.99  ? 528 VAL E C  1 
ATOM 10996 O O  . VAL E 1 528 ? 110.922 161.677 137.864 1.00 59.99  ? 528 VAL E O  1 
ATOM 10997 N N  . GLY E 1 529 ? 110.637 163.768 138.643 1.00 63.86  ? 529 GLY E N  1 
ATOM 10998 C CA . GLY E 1 529 ? 110.710 164.355 137.315 1.00 63.86  ? 529 GLY E CA 1 
ATOM 10999 C C  . GLY E 1 529 ? 112.061 164.175 136.647 1.00 63.86  ? 529 GLY E C  1 
ATOM 11000 O O  . GLY E 1 529 ? 112.140 163.831 135.468 1.00 63.86  ? 529 GLY E O  1 
ATOM 11001 N N  . LEU E 1 530 ? 113.145 164.398 137.385 1.00 66.29  ? 530 LEU E N  1 
ATOM 11002 C CA . LEU E 1 530 ? 114.426 164.325 136.693 1.00 66.29  ? 530 LEU E CA 1 
ATOM 11003 C C  . LEU E 1 530 ? 115.041 162.936 136.804 1.00 66.29  ? 530 LEU E C  1 
ATOM 11004 O O  . LEU E 1 530 ? 115.821 162.540 135.932 1.00 66.29  ? 530 LEU E O  1 
ATOM 11005 N N  . LYS E 1 531 ? 114.715 162.178 137.861 1.00 60.00  ? 531 LYS E N  1 
ATOM 11006 C CA . LYS E 1 531 ? 115.056 160.764 137.884 1.00 60.00  ? 531 LYS E CA 1 
ATOM 11007 C C  . LYS E 1 531 ? 114.298 160.016 136.811 1.00 60.00  ? 531 LYS E C  1 
ATOM 11008 O O  . LYS E 1 531 ? 114.796 159.017 136.295 1.00 60.00  ? 531 LYS E O  1 
ATOM 11009 N N  . GLN E 1 532 ? 113.114 160.502 136.458 1.00 59.64  ? 532 GLN E N  1 
ATOM 11010 C CA . GLN E 1 532 ? 112.435 160.042 135.262 1.00 59.64  ? 532 GLN E CA 1 
ATOM 11011 C C  . GLN E 1 532 ? 113.276 160.310 134.026 1.00 59.64  ? 532 GLN E C  1 
ATOM 11012 O O  . GLN E 1 532 ? 113.342 159.475 133.117 1.00 59.64  ? 532 GLN E O  1 
ATOM 11013 N N  . GLY E 1 533 ? 113.966 161.451 133.998 1.00 62.45  ? 533 GLY E N  1 
ATOM 11014 C CA . GLY E 1 533 ? 114.800 161.833 132.878 1.00 62.45  ? 533 GLY E CA 1 
ATOM 11015 C C  . GLY E 1 533 ? 114.202 162.869 131.957 1.00 62.45  ? 533 GLY E C  1 
ATOM 11016 O O  . GLY E 1 533 ? 114.922 163.420 131.122 1.00 62.45  ? 533 GLY E O  1 
ATOM 11017 N N  . LYS E 1 534 ? 112.912 163.136 132.074 1.00 64.40  ? 534 LYS E N  1 
ATOM 11018 C CA . LYS E 1 534 ? 112.212 164.044 131.187 1.00 64.40  ? 534 LYS E CA 1 
ATOM 11019 C C  . LYS E 1 534 ? 112.224 165.459 131.759 1.00 64.40  ? 534 LYS E C  1 
ATOM 11020 O O  . LYS E 1 534 ? 111.877 165.677 132.921 1.00 64.40  ? 534 LYS E O  1 
ATOM 11021 N N  . VAL E 1 535 ? 112.593 166.431 130.912 1.00 67.81  ? 535 VAL E N  1 
ATOM 11022 C CA . VAL E 1 535 ? 113.025 167.745 131.391 1.00 67.81  ? 535 VAL E CA 1 
ATOM 11023 C C  . VAL E 1 535 ? 111.824 168.511 131.931 1.00 67.81  ? 535 VAL E C  1 
ATOM 11024 O O  . VAL E 1 535 ? 110.757 168.568 131.312 1.00 67.81  ? 535 VAL E O  1 
ATOM 11025 N N  . ILE E 1 536 ? 111.992 169.067 133.115 1.00 72.29  ? 536 ILE E N  1 
ATOM 11026 C CA . ILE E 1 536 ? 110.888 169.481 133.960 1.00 72.29  ? 536 ILE E CA 1 
ATOM 11027 C C  . ILE E 1 536 ? 110.708 170.968 133.740 1.00 72.29  ? 536 ILE E C  1 
ATOM 11028 O O  . ILE E 1 536 ? 111.638 171.642 133.288 1.00 72.29  ? 536 ILE E O  1 
ATOM 11029 N N  . ILE E 1 537 ? 109.503 171.461 133.983 1.00 78.47  ? 537 ILE E N  1 
ATOM 11030 C CA . ILE E 1 537 ? 109.265 172.879 134.202 1.00 78.47  ? 537 ILE E CA 1 
ATOM 11031 C C  . ILE E 1 537 ? 108.218 173.024 135.287 1.00 78.47  ? 537 ILE E C  1 
ATOM 11032 O O  . ILE E 1 537 ? 107.254 172.254 135.348 1.00 78.47  ? 537 ILE E O  1 
ATOM 11033 N N  . VAL E 1 538 ? 108.418 173.984 136.135 1.00 81.52  ? 538 VAL E N  1 
ATOM 11034 C CA . VAL E 1 538 ? 107.519 174.261 137.238 1.00 81.52  ? 538 VAL E CA 1 
ATOM 11035 C C  . VAL E 1 538 ? 106.622 175.422 136.843 1.00 81.52  ? 538 VAL E C  1 
ATOM 11036 O O  . VAL E 1 538 ? 107.066 176.379 136.202 1.00 81.52  ? 538 VAL E O  1 
ATOM 11037 N N  . VAL E 1 539 ? 105.333 175.307 137.143 1.00 87.86  ? 539 VAL E N  1 
ATOM 11038 C CA . VAL E 1 539 ? 104.350 176.303 136.737 1.00 87.86  ? 539 VAL E CA 1 
ATOM 11039 C C  . VAL E 1 539 ? 103.440 176.601 137.916 1.00 87.86  ? 539 VAL E C  1 
ATOM 11040 O O  . VAL E 1 539 ? 102.806 175.690 138.460 1.00 87.86  ? 539 VAL E O  1 
ATOM 11041 N N  . LYS E 1 540 ? 103.387 177.869 138.317 1.00 101.67 ? 540 LYS E N  1 
ATOM 11042 C CA . LYS E 1 540 ? 102.318 178.330 139.189 1.00 101.67 ? 540 LYS E CA 1 
ATOM 11043 C C  . LYS E 1 540 ? 101.036 178.451 138.375 1.00 101.67 ? 540 LYS E C  1 
ATOM 11044 O O  . LYS E 1 540 ? 101.030 179.014 137.279 1.00 101.67 ? 540 LYS E O  1 
ATOM 11045 N N  . ASP E 1 541 ? 99.939  177.963 138.940 1.00 105.35 ? 541 ASP E N  1 
ATOM 11046 C CA . ASP E 1 541 ? 98.789  177.544 138.151 1.00 105.35 ? 541 ASP E CA 1 
ATOM 11047 C C  . ASP E 1 541 ? 97.939  178.736 137.715 1.00 105.35 ? 541 ASP E C  1 
ATOM 11048 O O  . ASP E 1 541 ? 98.312  179.902 137.868 1.00 105.35 ? 541 ASP E O  1 
ATOM 11049 N N  . GLY E 1 542 ? 96.761  178.431 137.180 1.00 96.30  ? 542 GLY E N  1 
ATOM 11050 C CA . GLY E 1 542 ? 95.824  179.416 136.702 1.00 96.30  ? 542 GLY E CA 1 
ATOM 11051 C C  . GLY E 1 542 ? 94.676  178.694 136.033 1.00 96.30  ? 542 GLY E C  1 
ATOM 11052 O O  . GLY E 1 542 ? 94.744  177.481 135.817 1.00 96.30  ? 542 GLY E O  1 
ATOM 11053 N N  . PRO E 1 543 ? 93.597  179.406 135.699 1.00 95.32  ? 543 PRO E N  1 
ATOM 11054 C CA . PRO E 1 543 ? 92.437  178.730 135.093 1.00 95.32  ? 543 PRO E CA 1 
ATOM 11055 C C  . PRO E 1 543 ? 92.767  178.298 133.673 1.00 95.32  ? 543 PRO E C  1 
ATOM 11056 O O  . PRO E 1 543 ? 92.721  179.093 132.734 1.00 95.32  ? 543 PRO E O  1 
ATOM 11057 N N  . GLY E 1 544 ? 93.113  177.023 133.531 1.00 91.38  ? 544 GLY E N  1 
ATOM 11058 C CA . GLY E 1 544 ? 93.801  176.575 132.342 1.00 91.38  ? 544 GLY E CA 1 
ATOM 11059 C C  . GLY E 1 544 ? 95.269  176.839 132.603 1.00 91.38  ? 544 GLY E C  1 
ATOM 11060 O O  . GLY E 1 544 ? 95.647  178.007 132.721 1.00 91.38  ? 544 GLY E O  1 
ATOM 11061 N N  . PHE E 1 545 ? 96.121  175.820 132.724 1.00 86.91  ? 545 PHE E N  1 
ATOM 11062 C CA . PHE E 1 545 ? 97.430  176.113 133.293 1.00 86.91  ? 545 PHE E CA 1 
ATOM 11063 C C  . PHE E 1 545 ? 98.410  176.658 132.253 1.00 86.91  ? 545 PHE E C  1 
ATOM 11064 O O  . PHE E 1 545 ? 98.680  177.863 132.236 1.00 86.91  ? 545 PHE E O  1 
ATOM 11065 N N  . TYR E 1 546 ? 98.930  175.825 131.355 1.00 86.70  ? 546 TYR E N  1 
ATOM 11066 C CA . TYR E 1 546 ? 99.839  176.403 130.373 1.00 86.70  ? 546 TYR E CA 1 
ATOM 11067 C C  . TYR E 1 546 ? 99.645  175.860 128.971 1.00 86.70  ? 546 TYR E C  1 
ATOM 11068 O O  . TYR E 1 546 ? 99.484  176.622 128.014 1.00 86.70  ? 546 TYR E O  1 
ATOM 11069 N N  . THR E 1 547 ? 99.576  174.540 128.852 1.00 82.40  ? 547 THR E N  1 
ATOM 11070 C CA . THR E 1 547 ? 99.799  173.940 127.545 1.00 82.40  ? 547 THR E CA 1 
ATOM 11071 C C  . THR E 1 547 ? 98.508  173.793 126.771 1.00 82.40  ? 547 THR E C  1 
ATOM 11072 O O  . THR E 1 547 ? 98.433  174.201 125.612 1.00 82.40  ? 547 THR E O  1 
ATOM 11073 N N  . THR E 1 548 ? 97.472  173.241 127.392 1.00 88.48  ? 548 THR E N  1 
ATOM 11074 C CA . THR E 1 548 ? 96.154  173.344 126.786 1.00 88.48  ? 548 THR E CA 1 
ATOM 11075 C C  . THR E 1 548 ? 95.666  174.782 126.808 1.00 88.48  ? 548 THR E C  1 
ATOM 11076 O O  . THR E 1 548 ? 94.933  175.201 125.901 1.00 88.48  ? 548 THR E O  1 
ATOM 11077 N N  . ARG E 1 549 ? 96.121  175.546 127.809 1.00 96.80  ? 549 ARG E N  1 
ATOM 11078 C CA . ARG E 1 549 ? 95.843  176.974 127.923 1.00 96.80  ? 549 ARG E CA 1 
ATOM 11079 C C  . ARG E 1 549 ? 96.328  177.746 126.701 1.00 96.80  ? 549 ARG E C  1 
ATOM 11080 O O  . ARG E 1 549 ? 95.716  178.744 126.305 1.00 96.80  ? 549 ARG E O  1 
ATOM 11081 N N  . CYS E 1 550 ? 97.416  177.296 126.083 1.00 92.21  ? 550 CYS E N  1 
ATOM 11082 C CA . CYS E 1 550 ? 97.849  177.889 124.827 1.00 92.21  ? 550 CYS E CA 1 
ATOM 11083 C C  . CYS E 1 550 ? 97.448  177.073 123.606 1.00 92.21  ? 550 CYS E C  1 
ATOM 11084 O O  . CYS E 1 550 ? 97.512  177.590 122.489 1.00 92.21  ? 550 CYS E O  1 
ATOM 11085 N N  . LEU E 1 551 ? 97.035  175.822 123.780 1.00 91.80  ? 551 LEU E N  1 
ATOM 11086 C CA . LEU E 1 551 ? 96.734  174.995 122.622 1.00 91.80  ? 551 LEU E CA 1 
ATOM 11087 C C  . LEU E 1 551 ? 95.326  175.231 122.108 1.00 91.80  ? 551 LEU E C  1 
ATOM 11088 O O  . LEU E 1 551 ? 95.110  175.219 120.892 1.00 91.80  ? 551 LEU E O  1 
ATOM 11089 N N  . ALA E 1 552 ? 94.360  175.395 123.005 1.00 100.93 ? 552 ALA E N  1 
ATOM 11090 C CA . ALA E 1 552 ? 92.994  175.671 122.564 1.00 100.93 ? 552 ALA E CA 1 
ATOM 11091 C C  . ALA E 1 552 ? 92.832  177.012 121.848 1.00 100.93 ? 552 ALA E C  1 
ATOM 11092 O O  . ALA E 1 552 ? 92.075  177.060 120.865 1.00 100.93 ? 552 ALA E O  1 
ATOM 11093 N N  . PRO E 1 553 ? 93.507  178.110 122.229 1.00 99.36  ? 553 PRO E N  1 
ATOM 11094 C CA . PRO E 1 553 ? 93.492  179.273 121.330 1.00 99.36  ? 553 PRO E CA 1 
ATOM 11095 C C  . PRO E 1 553 ? 94.285  179.086 120.054 1.00 99.36  ? 553 PRO E C  1 
ATOM 11096 O O  . PRO E 1 553 ? 94.327  180.012 119.238 1.00 99.36  ? 553 PRO E O  1 
ATOM 11097 N N  . MET E 1 554 ? 94.956  177.954 119.868 1.00 106.14 ? 554 MET E N  1 
ATOM 11098 C CA . MET E 1 554 ? 95.396  177.603 118.530 1.00 106.14 ? 554 MET E CA 1 
ATOM 11099 C C  . MET E 1 554 ? 94.407  176.662 117.868 1.00 106.14 ? 554 MET E C  1 
ATOM 11100 O O  . MET E 1 554 ? 94.175  176.759 116.660 1.00 106.14 ? 554 MET E O  1 
ATOM 11101 N N  . MET E 1 555 ? 93.820  175.752 118.636 1.00 106.47 ? 555 MET E N  1 
ATOM 11102 C CA . MET E 1 555 ? 92.980  174.734 118.030 1.00 106.47 ? 555 MET E CA 1 
ATOM 11103 C C  . MET E 1 555 ? 91.643  175.310 117.588 1.00 106.47 ? 555 MET E C  1 
ATOM 11104 O O  . MET E 1 555 ? 91.037  174.807 116.637 1.00 106.47 ? 555 MET E O  1 
ATOM 11105 N N  . SER E 1 556 ? 91.207  176.407 118.211 1.00 106.94 ? 556 SER E N  1 
ATOM 11106 C CA . SER E 1 556 ? 89.910  176.999 117.894 1.00 106.94 ? 556 SER E CA 1 
ATOM 11107 C C  . SER E 1 556 ? 89.887  177.681 116.535 1.00 106.94 ? 556 SER E C  1 
ATOM 11108 O O  . SER E 1 556 ? 88.815  178.069 116.068 1.00 106.94 ? 556 SER E O  1 
ATOM 11109 N N  . GLU E 1 557 ? 91.035  177.835 115.891 1.00 101.65 ? 557 GLU E N  1 
ATOM 11110 C CA . GLU E 1 557 ? 91.109  178.370 114.543 1.00 101.65 ? 557 GLU E CA 1 
ATOM 11111 C C  . GLU E 1 557 ? 91.570  177.317 113.561 1.00 101.65 ? 557 GLU E C  1 
ATOM 11112 O O  . GLU E 1 557 ? 91.727  177.604 112.375 1.00 101.65 ? 557 GLU E O  1 
ATOM 11113 N N  . VAL E 1 558 ? 91.811  176.102 114.038 1.00 104.35 ? 558 VAL E N  1 
ATOM 11114 C CA . VAL E 1 558 ? 91.988  174.986 113.124 1.00 104.35 ? 558 VAL E CA 1 
ATOM 11115 C C  . VAL E 1 558 ? 90.675  174.694 112.417 1.00 104.35 ? 558 VAL E C  1 
ATOM 11116 O O  . VAL E 1 558 ? 90.659  174.216 111.285 1.00 104.35 ? 558 VAL E O  1 
ATOM 11117 N N  . ILE E 1 559 ? 89.547  175.015 113.046 1.00 113.38 ? 559 ILE E N  1 
ATOM 11118 C CA . ILE E 1 559 ? 88.315  174.951 112.274 1.00 113.38 ? 559 ILE E CA 1 
ATOM 11119 C C  . ILE E 1 559 ? 88.190  176.123 111.309 1.00 113.38 ? 559 ILE E C  1 
ATOM 11120 O O  . ILE E 1 559 ? 87.495  176.002 110.292 1.00 113.38 ? 559 ILE E O  1 
ATOM 11121 N N  . ARG E 1 560 ? 88.909  177.223 111.553 1.00 112.85 ? 560 ARG E N  1 
ATOM 11122 C CA . ARG E 1 560 ? 88.691  178.455 110.803 1.00 112.85 ? 560 ARG E CA 1 
ATOM 11123 C C  . ARG E 1 560 ? 89.198  178.375 109.364 1.00 112.85 ? 560 ARG E C  1 
ATOM 11124 O O  . ARG E 1 560 ? 88.675  179.087 108.506 1.00 112.85 ? 560 ARG E O  1 
ATOM 11125 N N  . ILE E 1 561 ? 90.174  177.514 109.058 1.00 121.87 ? 561 ILE E N  1 
ATOM 11126 C CA . ILE E 1 561 ? 90.576  177.392 107.655 1.00 121.87 ? 561 ILE E CA 1 
ATOM 11127 C C  . ILE E 1 561 ? 89.517  176.642 106.870 1.00 121.87 ? 561 ILE E C  1 
ATOM 11128 O O  . ILE E 1 561 ? 89.123  177.078 105.783 1.00 121.87 ? 561 ILE E O  1 
ATOM 11129 N N  . LEU E 1 562 ? 89.024  175.525 107.392 1.00 121.93 ? 562 LEU E N  1 
ATOM 11130 C CA . LEU E 1 562 ? 87.923  174.844 106.734 1.00 121.93 ? 562 LEU E CA 1 
ATOM 11131 C C  . LEU E 1 562 ? 86.578  175.452 107.086 1.00 121.93 ? 562 LEU E C  1 
ATOM 11132 O O  . LEU E 1 562 ? 85.547  174.887 106.721 1.00 121.93 ? 562 LEU E O  1 
ATOM 11133 N N  . GLN E 1 563 ? 86.566  176.596 107.767 1.00 133.70 ? 563 GLN E N  1 
ATOM 11134 C CA . GLN E 1 563 ? 85.329  177.330 107.966 1.00 133.70 ? 563 GLN E CA 1 
ATOM 11135 C C  . GLN E 1 563 ? 84.885  177.997 106.676 1.00 133.70 ? 563 GLN E C  1 
ATOM 11136 O O  . GLN E 1 563 ? 83.685  178.221 106.476 1.00 133.70 ? 563 GLN E O  1 
ATOM 11137 N N  . GLU E 1 564 ? 85.843  178.344 105.814 1.00 136.16 ? 564 GLU E N  1 
ATOM 11138 C CA . GLU E 1 564 ? 85.593  178.745 104.437 1.00 136.16 ? 564 GLU E CA 1 
ATOM 11139 C C  . GLU E 1 564 ? 85.607  177.568 103.466 1.00 136.16 ? 564 GLU E C  1 
ATOM 11140 O O  . GLU E 1 564 ? 84.772  177.527 102.554 1.00 136.16 ? 564 GLU E O  1 
ATOM 11141 N N  . GLY E 1 565 ? 86.458  176.566 103.697 1.00 124.80 ? 565 GLY E N  1 
ATOM 11142 C CA . GLY E 1 565 ? 86.477  175.382 102.863 1.00 124.80 ? 565 GLY E CA 1 
ATOM 11143 C C  . GLY E 1 565 ? 87.584  175.337 101.833 1.00 124.80 ? 565 GLY E C  1 
ATOM 11144 O O  . GLY E 1 565 ? 87.337  175.175 100.630 1.00 124.80 ? 565 GLY E O  1 
ATOM 11145 N N  . VAL E 1 566 ? 88.818  175.446 102.307 1.00 112.43 ? 566 VAL E N  1 
ATOM 11146 C CA . VAL E 1 566 ? 89.975  175.571 101.444 1.00 112.43 ? 566 VAL E CA 1 
ATOM 11147 C C  . VAL E 1 566 ? 90.693  174.236 101.271 1.00 112.43 ? 566 VAL E C  1 
ATOM 11148 O O  . VAL E 1 566 ? 91.896  174.214 101.009 1.00 112.43 ? 566 VAL E O  1 
ATOM 11149 N N  . ASP E 1 567 ? 89.958  173.117 101.419 1.00 113.99 ? 567 ASP E N  1 
ATOM 11150 C CA . ASP E 1 567 ? 90.418  171.743 101.249 1.00 113.99 ? 567 ASP E CA 1 
ATOM 11151 C C  . ASP E 1 567 ? 91.554  171.463 102.223 1.00 113.99 ? 567 ASP E C  1 
ATOM 11152 O O  . ASP E 1 567 ? 92.723  171.477 101.827 1.00 113.99 ? 567 ASP E O  1 
ATOM 11153 N N  . PRO E 1 568 ? 91.246  171.215 103.501 1.00 111.18 ? 568 PRO E N  1 
ATOM 11154 C CA . PRO E 1 568 ? 92.272  171.196 104.556 1.00 111.18 ? 568 PRO E CA 1 
ATOM 11155 C C  . PRO E 1 568 ? 93.321  170.106 104.424 1.00 111.18 ? 568 PRO E C  1 
ATOM 11156 O O  . PRO E 1 568 ? 94.235  170.057 105.253 1.00 111.18 ? 568 PRO E O  1 
ATOM 11157 N N  . LYS E 1 569 ? 93.214  169.221 103.434 1.00 110.21 ? 569 LYS E N  1 
ATOM 11158 C CA . LYS E 1 569 ? 94.360  168.433 103.021 1.00 110.21 ? 569 LYS E CA 1 
ATOM 11159 C C  . LYS E 1 569 ? 95.500  169.319 102.545 1.00 110.21 ? 569 LYS E C  1 
ATOM 11160 O O  . LYS E 1 569 ? 96.663  168.982 102.776 1.00 110.21 ? 569 LYS E O  1 
ATOM 11161 N N  . LYS E 1 570 ? 95.189  170.446 101.900 1.00 109.75 ? 570 LYS E N  1 
ATOM 11162 C CA . LYS E 1 570 ? 96.189  171.455 101.575 1.00 109.75 ? 570 LYS E CA 1 
ATOM 11163 C C  . LYS E 1 570 ? 96.811  172.073 102.816 1.00 109.75 ? 570 LYS E C  1 
ATOM 11164 O O  . LYS E 1 570 ? 97.996  172.430 102.793 1.00 109.75 ? 570 LYS E O  1 
ATOM 11165 N N  . LEU E 1 571 ? 96.043  172.178 103.902 1.00 108.06 ? 571 LEU E N  1 
ATOM 11166 C CA . LEU E 1 571 ? 96.513  172.844 105.107 1.00 108.06 ? 571 LEU E CA 1 
ATOM 11167 C C  . LEU E 1 571 ? 97.655  172.098 105.772 1.00 108.06 ? 571 LEU E C  1 
ATOM 11168 O O  . LEU E 1 571 ? 98.477  172.733 106.436 1.00 108.06 ? 571 LEU E O  1 
ATOM 11169 N N  . ASP E 1 572 ? 97.720  170.780 105.597 1.00 112.00 ? 572 ASP E N  1 
ATOM 11170 C CA . ASP E 1 572 ? 98.824  170.002 106.143 1.00 112.00 ? 572 ASP E CA 1 
ATOM 11171 C C  . ASP E 1 572 ? 100.149 170.447 105.549 1.00 112.00 ? 572 ASP E C  1 
ATOM 11172 O O  . ASP E 1 572 ? 101.092 170.769 106.281 1.00 112.00 ? 572 ASP E O  1 
ATOM 11173 N N  . SER E 1 573 ? 100.217 170.519 104.219 1.00 116.38 ? 573 SER E N  1 
ATOM 11174 C CA . SER E 1 573 ? 101.391 171.065 103.552 1.00 116.38 ? 573 SER E CA 1 
ATOM 11175 C C  . SER E 1 573 ? 101.596 172.527 103.897 1.00 116.38 ? 573 SER E C  1 
ATOM 11176 O O  . SER E 1 573 ? 102.734 172.954 104.104 1.00 116.38 ? 573 SER E O  1 
ATOM 11177 N N  . LEU E 1 574 ? 100.500 173.279 104.020 1.00 112.33 ? 574 LEU E N  1 
ATOM 11178 C CA . LEU E 1 574 ? 100.569 174.713 104.272 1.00 112.33 ? 574 LEU E CA 1 
ATOM 11179 C C  . LEU E 1 574 ? 101.188 175.020 105.628 1.00 112.33 ? 574 LEU E C  1 
ATOM 11180 O O  . LEU E 1 574 ? 101.904 176.016 105.771 1.00 112.33 ? 574 LEU E O  1 
ATOM 11181 N N  . THR E 1 575 ? 100.947 174.171 106.622 1.00 113.64 ? 575 THR E N  1 
ATOM 11182 C CA . THR E 1 575 ? 101.436 174.456 107.964 1.00 113.64 ? 575 THR E CA 1 
ATOM 11183 C C  . THR E 1 575 ? 102.735 173.728 108.261 1.00 113.64 ? 575 THR E C  1 
ATOM 11184 O O  . THR E 1 575 ? 103.562 174.221 109.036 1.00 113.64 ? 575 THR E O  1 
ATOM 11185 N N  . THR E 1 576 ? 102.952 172.566 107.646 1.00 107.11 ? 576 THR E N  1 
ATOM 11186 C CA . THR E 1 576 ? 104.275 171.977 107.740 1.00 107.11 ? 576 THR E CA 1 
ATOM 11187 C C  . THR E 1 576 ? 105.292 172.755 106.926 1.00 107.11 ? 576 THR E C  1 
ATOM 11188 O O  . THR E 1 576 ? 106.494 172.626 107.176 1.00 107.11 ? 576 THR E O  1 
ATOM 11189 N N  . SER E 1 577 ? 104.837 173.563 105.966 1.00 115.53 ? 577 SER E N  1 
ATOM 11190 C CA . SER E 1 577 ? 105.736 174.457 105.257 1.00 115.53 ? 577 SER E CA 1 
ATOM 11191 C C  . SER E 1 577 ? 106.288 175.530 106.182 1.00 115.53 ? 577 SER E C  1 
ATOM 11192 O O  . SER E 1 577 ? 107.455 175.911 106.062 1.00 115.53 ? 577 SER E O  1 
ATOM 11193 N N  . PHE E 1 578 ? 105.474 176.027 107.113 1.00 108.31 ? 578 PHE E N  1 
ATOM 11194 C CA . PHE E 1 578 ? 105.999 177.030 108.027 1.00 108.31 ? 578 PHE E CA 1 
ATOM 11195 C C  . PHE E 1 578 ? 106.928 176.414 109.058 1.00 108.31 ? 578 PHE E C  1 
ATOM 11196 O O  . PHE E 1 578 ? 107.830 177.093 109.560 1.00 108.31 ? 578 PHE E O  1 
ATOM 11197 N N  . GLY E 1 579 ? 106.741 175.140 109.374 1.00 98.62  ? 579 GLY E N  1 
ATOM 11198 C CA . GLY E 1 579 ? 107.725 174.466 110.187 1.00 98.62  ? 579 GLY E CA 1 
ATOM 11199 C C  . GLY E 1 579 ? 107.198 173.467 111.190 1.00 98.62  ? 579 GLY E C  1 
ATOM 11200 O O  . GLY E 1 579 ? 107.989 172.689 111.733 1.00 98.62  ? 579 GLY E O  1 
ATOM 11201 N N  . PHE E 1 580 ? 105.896 173.489 111.462 1.00 97.70  ? 580 PHE E N  1 
ATOM 11202 C CA . PHE E 1 580 ? 105.291 172.554 112.403 1.00 97.70  ? 580 PHE E CA 1 
ATOM 11203 C C  . PHE E 1 580 ? 105.488 171.127 111.913 1.00 97.70  ? 580 PHE E C  1 
ATOM 11204 O O  . PHE E 1 580 ? 105.249 170.851 110.732 1.00 97.70  ? 580 PHE E O  1 
ATOM 11205 N N  . PRO E 1 581 ? 105.992 170.222 112.751 1.00 100.29 ? 581 PRO E N  1 
ATOM 11206 C CA . PRO E 1 581 ? 106.316 168.877 112.266 1.00 100.29 ? 581 PRO E CA 1 
ATOM 11207 C C  . PRO E 1 581 ? 105.103 168.035 111.964 1.00 100.29 ? 581 PRO E C  1 
ATOM 11208 O O  . PRO E 1 581 ? 105.212 167.074 111.194 1.00 100.29 ? 581 PRO E O  1 
ATOM 11209 N N  . VAL E 1 582 ? 103.956 168.344 112.550 1.00 104.06 ? 582 VAL E N  1 
ATOM 11210 C CA . VAL E 1 582 ? 102.733 167.592 112.319 1.00 104.06 ? 582 VAL E CA 1 
ATOM 11211 C C  . VAL E 1 582 ? 101.622 168.574 111.980 1.00 104.06 ? 582 VAL E C  1 
ATOM 11212 O O  . VAL E 1 582 ? 101.549 169.660 112.565 1.00 104.06 ? 582 VAL E O  1 
ATOM 11213 N N  . GLY E 1 583 ? 100.781 168.207 111.012 1.00 112.51 ? 583 GLY E N  1 
ATOM 11214 C CA . GLY E 1 583 ? 99.770  169.122 110.522 1.00 112.51 ? 583 GLY E CA 1 
ATOM 11215 C C  . GLY E 1 583 ? 98.651  169.329 111.521 1.00 112.51 ? 583 GLY E C  1 
ATOM 11216 O O  . GLY E 1 583 ? 98.457  168.540 112.440 1.00 112.51 ? 583 GLY E O  1 
ATOM 11217 N N  . ALA E 1 584 ? 97.911  170.428 111.339 1.00 105.84 ? 584 ALA E N  1 
ATOM 11218 C CA . ALA E 1 584 ? 96.849  170.766 112.282 1.00 105.84 ? 584 ALA E CA 1 
ATOM 11219 C C  . ALA E 1 584 ? 95.700  169.774 112.211 1.00 105.84 ? 584 ALA E C  1 
ATOM 11220 O O  . ALA E 1 584 ? 95.008  169.554 113.212 1.00 105.84 ? 584 ALA E O  1 
ATOM 11221 N N  . ALA E 1 585 ? 95.497  169.158 111.046 1.00 113.39 ? 585 ALA E N  1 
ATOM 11222 C CA . ALA E 1 585 ? 94.617  168.001 110.970 1.00 113.39 ? 585 ALA E CA 1 
ATOM 11223 C C  . ALA E 1 585 ? 95.159  166.853 111.807 1.00 113.39 ? 585 ALA E C  1 
ATOM 11224 O O  . ALA E 1 585 ? 94.407  166.199 112.535 1.00 113.39 ? 585 ALA E O  1 
ATOM 11225 N N  . THR E 1 586 ? 96.470  166.618 111.753 1.00 122.53 ? 586 THR E N  1 
ATOM 11226 C CA . THR E 1 586 ? 97.050  165.595 112.614 1.00 122.53 ? 586 THR E CA 1 
ATOM 11227 C C  . THR E 1 586 ? 97.111  166.061 114.059 1.00 122.53 ? 586 THR E C  1 
ATOM 11228 O O  . THR E 1 586 ? 97.245  165.238 114.967 1.00 122.53 ? 586 THR E O  1 
ATOM 11229 N N  . LEU E 1 587 ? 97.013  167.368 114.296 1.00 117.01 ? 587 LEU E N  1 
ATOM 11230 C CA . LEU E 1 587 ? 96.899  167.843 115.667 1.00 117.01 ? 587 LEU E CA 1 
ATOM 11231 C C  . LEU E 1 587 ? 95.508  167.579 116.229 1.00 117.01 ? 587 LEU E C  1 
ATOM 11232 O O  . LEU E 1 587 ? 95.367  167.256 117.413 1.00 117.01 ? 587 LEU E O  1 
ATOM 11233 N N  . VAL E 1 588 ? 94.464  167.701 115.406 1.00 110.79 ? 588 VAL E N  1 
ATOM 11234 C CA . VAL E 1 588 ? 93.142  167.354 115.919 1.00 110.79 ? 588 VAL E CA 1 
ATOM 11235 C C  . VAL E 1 588 ? 92.927  165.847 115.878 1.00 110.79 ? 588 VAL E C  1 
ATOM 11236 O O  . VAL E 1 588 ? 92.037  165.329 116.561 1.00 110.79 ? 588 VAL E O  1 
ATOM 11237 N N  . ASP E 1 589 ? 93.733  165.125 115.109 1.00 114.92 ? 589 ASP E N  1 
ATOM 11238 C CA . ASP E 1 589 ? 93.757  163.675 115.191 1.00 114.92 ? 589 ASP E CA 1 
ATOM 11239 C C  . ASP E 1 589 ? 94.767  163.193 116.228 1.00 114.92 ? 589 ASP E C  1 
ATOM 11240 O O  . ASP E 1 589 ? 94.915  161.985 116.429 1.00 114.92 ? 589 ASP E O  1 
ATOM 11241 N N  . GLU E 1 590 ? 95.468  164.121 116.875 1.00 117.32 ? 590 GLU E N  1 
ATOM 11242 C CA . GLU E 1 590 ? 96.417  163.879 117.953 1.00 117.32 ? 590 GLU E CA 1 
ATOM 11243 C C  . GLU E 1 590 ? 95.775  163.996 119.321 1.00 117.32 ? 590 GLU E C  1 
ATOM 11244 O O  . GLU E 1 590 ? 96.078  163.208 120.221 1.00 117.32 ? 590 GLU E O  1 
ATOM 11245 N N  . VAL E 1 591 ? 94.869  164.958 119.479 1.00 121.18 ? 591 VAL E N  1 
ATOM 11246 C CA . VAL E 1 591 ? 94.310  165.254 120.786 1.00 121.18 ? 591 VAL E CA 1 
ATOM 11247 C C  . VAL E 1 591 ? 93.224  164.275 121.206 1.00 121.18 ? 591 VAL E C  1 
ATOM 11248 O O  . VAL E 1 591 ? 92.992  164.106 122.408 1.00 121.18 ? 591 VAL E O  1 
ATOM 11249 N N  . GLY E 1 592 ? 92.564  163.612 120.263 1.00 121.29 ? 592 GLY E N  1 
ATOM 11250 C CA . GLY E 1 592 ? 91.404  162.816 120.602 1.00 121.29 ? 592 GLY E CA 1 
ATOM 11251 C C  . GLY E 1 592 ? 90.146  163.648 120.489 1.00 121.29 ? 592 GLY E C  1 
ATOM 11252 O O  . GLY E 1 592 ? 90.056  164.727 121.080 1.00 121.29 ? 592 GLY E O  1 
ATOM 11253 N N  . VAL E 1 593 ? 89.167  163.156 119.729 1.00 123.57 ? 593 VAL E N  1 
ATOM 11254 C CA . VAL E 1 593 ? 88.000  163.964 119.396 1.00 123.57 ? 593 VAL E CA 1 
ATOM 11255 C C  . VAL E 1 593 ? 87.057  164.124 120.587 1.00 123.57 ? 593 VAL E C  1 
ATOM 11256 O O  . VAL E 1 593 ? 86.293  165.097 120.641 1.00 123.57 ? 593 VAL E O  1 
ATOM 11257 N N  . ASP E 1 594 ? 87.128  163.230 121.573 1.00 131.49 ? 594 ASP E N  1 
ATOM 11258 C CA . ASP E 1 594 ? 86.190  163.283 122.684 1.00 131.49 ? 594 ASP E CA 1 
ATOM 11259 C C  . ASP E 1 594 ? 86.554  164.366 123.685 1.00 131.49 ? 594 ASP E C  1 
ATOM 11260 O O  . ASP E 1 594 ? 85.662  165.012 124.243 1.00 131.49 ? 594 ASP E O  1 
ATOM 11261 N N  . VAL E 1 595 ? 87.848  164.589 123.920 1.00 120.29 ? 595 VAL E N  1 
ATOM 11262 C CA . VAL E 1 595 ? 88.250  165.638 124.848 1.00 120.29 ? 595 VAL E CA 1 
ATOM 11263 C C  . VAL E 1 595 ? 88.240  167.007 124.205 1.00 120.29 ? 595 VAL E C  1 
ATOM 11264 O O  . VAL E 1 595 ? 88.433  168.003 124.906 1.00 120.29 ? 595 VAL E O  1 
ATOM 11265 N N  . ALA E 1 596 ? 88.023  167.079 122.890 1.00 116.62 ? 596 ALA E N  1 
ATOM 11266 C CA . ALA E 1 596 ? 88.019  168.363 122.203 1.00 116.62 ? 596 ALA E CA 1 
ATOM 11267 C C  . ALA E 1 596 ? 86.827  169.216 122.613 1.00 116.62 ? 596 ALA E C  1 
ATOM 11268 O O  . ALA E 1 596 ? 86.968  170.431 122.783 1.00 116.62 ? 596 ALA E O  1 
ATOM 11269 N N  . LYS E 1 597 ? 85.662  168.599 122.816 1.00 118.84 ? 597 LYS E N  1 
ATOM 11270 C CA . LYS E 1 597 ? 84.516  169.354 123.301 1.00 118.84 ? 597 LYS E CA 1 
ATOM 11271 C C  . LYS E 1 597 ? 84.728  169.843 124.728 1.00 118.84 ? 597 LYS E C  1 
ATOM 11272 O O  . LYS E 1 597 ? 84.320  170.958 125.062 1.00 118.84 ? 597 LYS E O  1 
ATOM 11273 N N  . HIS E 1 598 ? 85.415  169.065 125.562 1.00 117.53 ? 598 HIS E N  1 
ATOM 11274 C CA . HIS E 1 598 ? 85.649  169.502 126.928 1.00 117.53 ? 598 HIS E CA 1 
ATOM 11275 C C  . HIS E 1 598 ? 86.691  170.602 126.981 1.00 117.53 ? 598 HIS E C  1 
ATOM 11276 O O  . HIS E 1 598 ? 86.536  171.561 127.744 1.00 117.53 ? 598 HIS E O  1 
ATOM 11277 N N  . VAL E 1 599 ? 87.720  170.517 126.137 1.00 114.98 ? 599 VAL E N  1 
ATOM 11278 C CA . VAL E 1 599 ? 88.702  171.588 126.118 1.00 114.98 ? 599 VAL E CA 1 
ATOM 11279 C C  . VAL E 1 599 ? 88.200  172.756 125.285 1.00 114.98 ? 599 VAL E C  1 
ATOM 11280 O O  . VAL E 1 599 ? 88.868  173.789 125.188 1.00 114.98 ? 599 VAL E O  1 
ATOM 11281 N N  . ALA E 1 600 ? 87.040  172.614 124.653 1.00 111.88 ? 600 ALA E N  1 
ATOM 11282 C CA . ALA E 1 600 ? 86.329  173.782 124.168 1.00 111.88 ? 600 ALA E CA 1 
ATOM 11283 C C  . ALA E 1 600 ? 85.467  174.420 125.247 1.00 111.88 ? 600 ALA E C  1 
ATOM 11284 O O  . ALA E 1 600 ? 85.375  175.650 125.303 1.00 111.88 ? 600 ALA E O  1 
ATOM 11285 N N  . GLU E 1 601 ? 84.845  173.615 126.106 1.00 118.03 ? 601 GLU E N  1 
ATOM 11286 C CA . GLU E 1 601 ? 83.886  174.163 127.058 1.00 118.03 ? 601 GLU E CA 1 
ATOM 11287 C C  . GLU E 1 601 ? 84.556  174.676 128.321 1.00 118.03 ? 601 GLU E C  1 
ATOM 11288 O O  . GLU E 1 601 ? 83.955  175.463 129.060 1.00 118.03 ? 601 GLU E O  1 
ATOM 11289 N N  . ASP E 1 602 ? 85.786  174.240 128.587 1.00 122.59 ? 602 ASP E N  1 
ATOM 11290 C CA . ASP E 1 602 ? 86.391  174.476 129.893 1.00 122.59 ? 602 ASP E CA 1 
ATOM 11291 C C  . ASP E 1 602 ? 86.731  175.946 130.111 1.00 122.59 ? 602 ASP E C  1 
ATOM 11292 O O  . ASP E 1 602 ? 86.315  176.548 131.105 1.00 122.59 ? 602 ASP E O  1 
ATOM 11293 N N  . LEU E 1 603 ? 87.468  176.550 129.187 1.00 124.69 ? 603 LEU E N  1 
ATOM 11294 C CA . LEU E 1 603 ? 87.802  177.950 129.350 1.00 124.69 ? 603 LEU E CA 1 
ATOM 11295 C C  . LEU E 1 603 ? 86.753  178.825 128.694 1.00 124.69 ? 603 LEU E C  1 
ATOM 11296 O O  . LEU E 1 603 ? 86.614  179.999 129.056 1.00 124.69 ? 603 LEU E O  1 
ATOM 11297 N N  . GLY E 1 604 ? 85.966  178.243 127.783 1.00 128.22 ? 604 GLY E N  1 
ATOM 11298 C CA . GLY E 1 604 ? 84.756  178.893 127.314 1.00 128.22 ? 604 GLY E CA 1 
ATOM 11299 C C  . GLY E 1 604 ? 83.727  179.071 128.408 1.00 128.22 ? 604 GLY E C  1 
ATOM 11300 O O  . GLY E 1 604 ? 82.834  179.914 128.293 1.00 128.22 ? 604 GLY E O  1 
ATOM 11301 N N  . LYS E 1 605 ? 83.825  178.272 129.473 1.00 132.09 ? 605 LYS E N  1 
ATOM 11302 C CA . LYS E 1 605 ? 83.072  178.563 130.681 1.00 132.09 ? 605 LYS E CA 1 
ATOM 11303 C C  . LYS E 1 605 ? 83.516  179.880 131.312 1.00 132.09 ? 605 LYS E C  1 
ATOM 11304 O O  . LYS E 1 605 ? 82.689  180.588 131.899 1.00 132.09 ? 605 LYS E O  1 
ATOM 11305 N N  . VAL E 1 606 ? 84.789  180.258 131.179 1.00 127.42 ? 606 VAL E N  1 
ATOM 11306 C CA . VAL E 1 606 ? 85.321  181.431 131.868 1.00 127.42 ? 606 VAL E CA 1 
ATOM 11307 C C  . VAL E 1 606 ? 85.538  182.597 130.908 1.00 127.42 ? 606 VAL E C  1 
ATOM 11308 O O  . VAL E 1 606 ? 84.849  183.614 130.992 1.00 127.42 ? 606 VAL E O  1 
ATOM 11309 N N  . PHE E 1 607 ? 86.499  182.470 129.983 1.00 125.90 ? 607 PHE E N  1 
ATOM 11310 C CA . PHE E 1 607 ? 86.717  183.546 129.018 1.00 125.90 ? 607 PHE E CA 1 
ATOM 11311 C C  . PHE E 1 607 ? 87.099  183.029 127.637 1.00 125.90 ? 607 PHE E C  1 
ATOM 11312 O O  . PHE E 1 607 ? 87.648  183.786 126.828 1.00 125.90 ? 607 PHE E O  1 
ATOM 11313 N N  . GLY E 1 608 ? 86.802  181.766 127.336 1.00 134.21 ? 608 GLY E N  1 
ATOM 11314 C CA . GLY E 1 608 ? 87.215  181.221 126.055 1.00 134.21 ? 608 GLY E CA 1 
ATOM 11315 C C  . GLY E 1 608 ? 86.345  181.669 124.899 1.00 134.21 ? 608 GLY E C  1 
ATOM 11316 O O  . GLY E 1 608 ? 86.676  181.427 123.737 1.00 134.21 ? 608 GLY E O  1 
ATOM 11317 N N  . GLU E 1 609 ? 85.228  182.331 125.195 1.00 143.88 ? 609 GLU E N  1 
ATOM 11318 C CA . GLU E 1 609 ? 84.318  182.739 124.136 1.00 143.88 ? 609 GLU E CA 1 
ATOM 11319 C C  . GLU E 1 609 ? 84.796  184.022 123.470 1.00 143.88 ? 609 GLU E C  1 
ATOM 11320 O O  . GLU E 1 609 ? 84.449  184.286 122.314 1.00 143.88 ? 609 GLU E O  1 
ATOM 11321 N N  . ARG