data_5ZX2
# 
_entry.id   5ZX2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ZX2         
WWPDB D_1300007035 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ZX2 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, L.'    1 ?                   
'Zhang, Y.' 2 0000-0002-1778-8389 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                1153 
_citation.page_last                 1153 
_citation.title                     'Structural basis for transcription initiation by bacterial ECF sigma factors.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-09096-y 
_citation.pdbx_database_id_PubMed   30858373 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, L.'     1 ?                   
primary 'Fang, C.'   2 ?                   
primary 'Zhuang, N.' 3 ?                   
primary 'Wang, T.'   4 ?                   
primary 'Zhang, Y.'  5 0000-0002-1778-8389 
# 
_cell.length_a           129.824 
_cell.length_b           164.027 
_cell.length_c           214.792 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           5ZX2 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         5ZX2 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase subunit alpha' 40279.039  2  2.7.7.6 ? ? ? 
2  polymer     man 'DNA-directed RNA polymerase subunit beta'  129602.344 1  2.7.7.6 ? ? ? 
3  polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
147068.094 1  2.7.7.6 ? ? ? 
4  polymer     man 'DNA-directed RNA polymerase subunit omega' 11851.140  1  2.7.7.6 ? ? ? 
5  polymer     man 'ECF RNA polymerase sigma factor SigH'      24382.180  1  ?       ? ? ? 
6  polymer     syn 'DNA (48-MER)'                              14847.496  1  ?       ? ? ? 
7  polymer     syn 'DNA (47-MER)'                              14576.343  1  ?       ? ? ? 
8  polymer     syn 
;RNA (5'-R(*CP*CP*CP*UP*CP*GP*A)-3')
;
2156.347   1  ?       ? ? ? 
9  non-polymer syn 'ZINC ION'                                  65.409     2  ?       ? ? ? 
10 water       nat water                                       18.015     47 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha'                                     
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'                                        
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega'                                     
5 'ECF sigma factor SigH,Alternative RNA polymerase sigma factor SigH,RNA polymerase sigma-H factor,Sigma-H factor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGHHHHHHHHHHSSGHIEGRHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGV
LHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELV
VERGRGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELF
GLARELNVEAEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKI
KLHQLGLSLKDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL
;
;MGHHHHHHHHHHSSGHIEGRHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGV
LHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELV
VERGRGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELF
GLARELNVEAEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKI
KLHQLGLSLKDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MVLADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVG
GLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKG
TFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWT
SEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHV
GEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERM
TTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMC
PIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRK
AGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVA
EESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIM
PWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVG
KVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDK
LAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLPDELL
EAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHAR
STGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVL
LKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MVLADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVG
GLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKG
TFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWT
SEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHV
GEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERM
TTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMC
PIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRK
AGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVA
EESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIM
PWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVG
KVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDK
LAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLPDELL
EAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHAR
STGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVL
LKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MVLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCG
VEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVER
KAVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDEN
LYRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPV
IPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQ
RPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILM
LSSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQ
LRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDA
GFYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPI
ITIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVD
VSQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQ
VKVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARV
PRGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPH
EVLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGE
PAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEAR
AAAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MVLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCG
VEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVER
KAVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDEN
LYRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPV
IPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQ
RPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILM
LSSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQ
LRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDA
GFYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPI
ITIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVD
VSQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQ
VKVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARV
PRGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPH
EVLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGE
PAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEAR
AAAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;GAMADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNL
KAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYY
ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
;
;GAMADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNL
KAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYY
ADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
;
F   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DA)(DA)(DC)(DA)(DG)(DT)(DT)(DG)(DC)(DG)(DA)(DC)(DT)(DT)(DA)(DG)(DA)
(DC)(DG)(DT)(DG)(DG)(DT)(DT)(DG)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DC)(DT)(DA)
(DT)(DA)(DC)(DT)(DC)(DT)(DC)(DC)
;
CGGAACAGTTGCGACTTAGACGTGGTTGTGGGAGCTGCTATACTCTCC G   ? 
7 polydeoxyribonucleotide no no 
;(DG)(DG)(DA)(DG)(DA)(DG)(DT)(DA)(DT)(DA)(DG)(DG)(DT)(DC)(DG)(DA)(DG)(DG)(DG)(DT)
(DG)(DT)(DA)(DC)(DC)(DA)(DC)(DG)(DT)(DC)(DT)(DA)(DA)(DG)(DT)(DC)(DG)(DC)(DA)(DA)
(DC)(DT)(DG)(DT)(DT)(DC)(DC)
;
GGAGAGTATAGGTCGAGGGTGTACCACGTCTAAGTCGCAACTGTTCC H   ? 
8 polyribonucleotide      no no CCCUCGA CCCUCGA I   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    HIS n 
1 4    HIS n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   HIS n 
1 12   HIS n 
1 13   SER n 
1 14   SER n 
1 15   GLY n 
1 16   HIS n 
1 17   ILE n 
1 18   GLU n 
1 19   GLY n 
1 20   ARG n 
1 21   HIS n 
1 22   MET n 
1 23   LEU n 
1 24   ILE n 
1 25   SER n 
1 26   GLN n 
1 27   ARG n 
1 28   PRO n 
1 29   THR n 
1 30   LEU n 
1 31   SER n 
1 32   GLU n 
1 33   ASP n 
1 34   VAL n 
1 35   LEU n 
1 36   THR n 
1 37   ASP n 
1 38   ASN n 
1 39   ARG n 
1 40   SER n 
1 41   GLN n 
1 42   PHE n 
1 43   VAL n 
1 44   ILE n 
1 45   GLU n 
1 46   PRO n 
1 47   LEU n 
1 48   GLU n 
1 49   PRO n 
1 50   GLY n 
1 51   PHE n 
1 52   GLY n 
1 53   TYR n 
1 54   THR n 
1 55   LEU n 
1 56   GLY n 
1 57   ASN n 
1 58   SER n 
1 59   LEU n 
1 60   ARG n 
1 61   ARG n 
1 62   THR n 
1 63   LEU n 
1 64   LEU n 
1 65   SER n 
1 66   SER n 
1 67   ILE n 
1 68   PRO n 
1 69   GLY n 
1 70   ALA n 
1 71   ALA n 
1 72   VAL n 
1 73   THR n 
1 74   SER n 
1 75   ILE n 
1 76   ARG n 
1 77   ILE n 
1 78   ASP n 
1 79   GLY n 
1 80   VAL n 
1 81   LEU n 
1 82   HIS n 
1 83   GLU n 
1 84   PHE n 
1 85   THR n 
1 86   THR n 
1 87   VAL n 
1 88   PRO n 
1 89   GLY n 
1 90   VAL n 
1 91   LYS n 
1 92   GLU n 
1 93   ASP n 
1 94   VAL n 
1 95   THR n 
1 96   GLU n 
1 97   ILE n 
1 98   ILE n 
1 99   LEU n 
1 100  ASN n 
1 101  LEU n 
1 102  LYS n 
1 103  SER n 
1 104  LEU n 
1 105  VAL n 
1 106  VAL n 
1 107  SER n 
1 108  SER n 
1 109  GLU n 
1 110  GLU n 
1 111  ASP n 
1 112  GLU n 
1 113  PRO n 
1 114  VAL n 
1 115  THR n 
1 116  MET n 
1 117  TYR n 
1 118  LEU n 
1 119  ARG n 
1 120  LYS n 
1 121  GLN n 
1 122  GLY n 
1 123  PRO n 
1 124  GLY n 
1 125  GLU n 
1 126  VAL n 
1 127  THR n 
1 128  ALA n 
1 129  GLY n 
1 130  ASP n 
1 131  ILE n 
1 132  VAL n 
1 133  PRO n 
1 134  PRO n 
1 135  ALA n 
1 136  GLY n 
1 137  VAL n 
1 138  THR n 
1 139  VAL n 
1 140  HIS n 
1 141  ASN n 
1 142  PRO n 
1 143  GLY n 
1 144  MET n 
1 145  HIS n 
1 146  ILE n 
1 147  ALA n 
1 148  THR n 
1 149  LEU n 
1 150  ASN n 
1 151  ASP n 
1 152  LYS n 
1 153  GLY n 
1 154  LYS n 
1 155  LEU n 
1 156  GLU n 
1 157  VAL n 
1 158  GLU n 
1 159  LEU n 
1 160  VAL n 
1 161  VAL n 
1 162  GLU n 
1 163  ARG n 
1 164  GLY n 
1 165  ARG n 
1 166  GLY n 
1 167  TYR n 
1 168  VAL n 
1 169  PRO n 
1 170  ALA n 
1 171  VAL n 
1 172  GLN n 
1 173  ASN n 
1 174  ARG n 
1 175  ALA n 
1 176  SER n 
1 177  GLY n 
1 178  ALA n 
1 179  GLU n 
1 180  ILE n 
1 181  GLY n 
1 182  ARG n 
1 183  ILE n 
1 184  PRO n 
1 185  VAL n 
1 186  ASP n 
1 187  SER n 
1 188  ILE n 
1 189  TYR n 
1 190  SER n 
1 191  PRO n 
1 192  VAL n 
1 193  LEU n 
1 194  LYS n 
1 195  VAL n 
1 196  THR n 
1 197  TYR n 
1 198  LYS n 
1 199  VAL n 
1 200  ASP n 
1 201  ALA n 
1 202  THR n 
1 203  ARG n 
1 204  VAL n 
1 205  GLU n 
1 206  GLN n 
1 207  ARG n 
1 208  THR n 
1 209  ASP n 
1 210  PHE n 
1 211  ASP n 
1 212  LYS n 
1 213  LEU n 
1 214  ILE n 
1 215  LEU n 
1 216  ASP n 
1 217  VAL n 
1 218  GLU n 
1 219  THR n 
1 220  LYS n 
1 221  ASN n 
1 222  SER n 
1 223  ILE n 
1 224  SER n 
1 225  PRO n 
1 226  ARG n 
1 227  ASP n 
1 228  ALA n 
1 229  LEU n 
1 230  ALA n 
1 231  SER n 
1 232  ALA n 
1 233  GLY n 
1 234  LYS n 
1 235  THR n 
1 236  LEU n 
1 237  VAL n 
1 238  GLU n 
1 239  LEU n 
1 240  PHE n 
1 241  GLY n 
1 242  LEU n 
1 243  ALA n 
1 244  ARG n 
1 245  GLU n 
1 246  LEU n 
1 247  ASN n 
1 248  VAL n 
1 249  GLU n 
1 250  ALA n 
1 251  GLU n 
1 252  GLY n 
1 253  ILE n 
1 254  GLU n 
1 255  ILE n 
1 256  GLY n 
1 257  PRO n 
1 258  SER n 
1 259  PRO n 
1 260  ALA n 
1 261  GLU n 
1 262  ALA n 
1 263  ASP n 
1 264  HIS n 
1 265  ILE n 
1 266  ALA n 
1 267  SER n 
1 268  PHE n 
1 269  ALA n 
1 270  LEU n 
1 271  PRO n 
1 272  ILE n 
1 273  ASP n 
1 274  ASP n 
1 275  LEU n 
1 276  ASP n 
1 277  LEU n 
1 278  THR n 
1 279  VAL n 
1 280  ARG n 
1 281  SER n 
1 282  TYR n 
1 283  ASN n 
1 284  CYS n 
1 285  LEU n 
1 286  LYS n 
1 287  ARG n 
1 288  GLU n 
1 289  GLY n 
1 290  VAL n 
1 291  HIS n 
1 292  THR n 
1 293  VAL n 
1 294  GLY n 
1 295  GLU n 
1 296  LEU n 
1 297  VAL n 
1 298  ALA n 
1 299  ARG n 
1 300  THR n 
1 301  GLU n 
1 302  SER n 
1 303  ASP n 
1 304  LEU n 
1 305  LEU n 
1 306  ASP n 
1 307  ILE n 
1 308  ARG n 
1 309  ASN n 
1 310  PHE n 
1 311  GLY n 
1 312  GLN n 
1 313  LYS n 
1 314  SER n 
1 315  ILE n 
1 316  ASP n 
1 317  GLU n 
1 318  VAL n 
1 319  LYS n 
1 320  ILE n 
1 321  LYS n 
1 322  LEU n 
1 323  HIS n 
1 324  GLN n 
1 325  LEU n 
1 326  GLY n 
1 327  LEU n 
1 328  SER n 
1 329  LEU n 
1 330  LYS n 
1 331  ASP n 
1 332  SER n 
1 333  PRO n 
1 334  PRO n 
1 335  SER n 
1 336  PHE n 
1 337  ASP n 
1 338  PRO n 
1 339  SER n 
1 340  GLU n 
1 341  VAL n 
1 342  ALA n 
1 343  GLY n 
1 344  TYR n 
1 345  ASP n 
1 346  VAL n 
1 347  ALA n 
1 348  THR n 
1 349  GLY n 
1 350  THR n 
1 351  TRP n 
1 352  SER n 
1 353  THR n 
1 354  GLU n 
1 355  GLY n 
1 356  ALA n 
1 357  TYR n 
1 358  ASP n 
1 359  GLU n 
1 360  GLN n 
1 361  ASP n 
1 362  TYR n 
1 363  ALA n 
1 364  GLU n 
1 365  THR n 
1 366  GLU n 
1 367  GLN n 
1 368  LEU n 
2 1    MET n 
2 2    VAL n 
2 3    LEU n 
2 4    ALA n 
2 5    ASP n 
2 6    SER n 
2 7    ARG n 
2 8    GLN n 
2 9    SER n 
2 10   LYS n 
2 11   THR n 
2 12   ALA n 
2 13   ALA n 
2 14   SER n 
2 15   PRO n 
2 16   SER n 
2 17   PRO n 
2 18   SER n 
2 19   ARG n 
2 20   PRO n 
2 21   GLN n 
2 22   SER n 
2 23   SER n 
2 24   SER n 
2 25   ASN n 
2 26   ASN n 
2 27   SER n 
2 28   VAL n 
2 29   PRO n 
2 30   GLY n 
2 31   ALA n 
2 32   PRO n 
2 33   ASN n 
2 34   ARG n 
2 35   VAL n 
2 36   SER n 
2 37   PHE n 
2 38   ALA n 
2 39   LYS n 
2 40   LEU n 
2 41   ARG n 
2 42   GLU n 
2 43   PRO n 
2 44   LEU n 
2 45   GLU n 
2 46   VAL n 
2 47   PRO n 
2 48   GLY n 
2 49   LEU n 
2 50   LEU n 
2 51   ASP n 
2 52   VAL n 
2 53   GLN n 
2 54   THR n 
2 55   ASP n 
2 56   SER n 
2 57   PHE n 
2 58   GLU n 
2 59   TRP n 
2 60   LEU n 
2 61   ILE n 
2 62   GLY n 
2 63   SER n 
2 64   PRO n 
2 65   ARG n 
2 66   TRP n 
2 67   ARG n 
2 68   GLU n 
2 69   SER n 
2 70   ALA n 
2 71   ALA n 
2 72   GLU n 
2 73   ARG n 
2 74   GLY n 
2 75   ASP n 
2 76   VAL n 
2 77   ASN n 
2 78   PRO n 
2 79   VAL n 
2 80   GLY n 
2 81   GLY n 
2 82   LEU n 
2 83   GLU n 
2 84   GLU n 
2 85   VAL n 
2 86   LEU n 
2 87   TYR n 
2 88   GLU n 
2 89   LEU n 
2 90   SER n 
2 91   PRO n 
2 92   ILE n 
2 93   GLU n 
2 94   ASP n 
2 95   PHE n 
2 96   SER n 
2 97   GLY n 
2 98   SER n 
2 99   MET n 
2 100  SER n 
2 101  LEU n 
2 102  SER n 
2 103  PHE n 
2 104  SER n 
2 105  ASP n 
2 106  PRO n 
2 107  ARG n 
2 108  PHE n 
2 109  ASP n 
2 110  ASP n 
2 111  VAL n 
2 112  LYS n 
2 113  ALA n 
2 114  PRO n 
2 115  VAL n 
2 116  ASP n 
2 117  GLU n 
2 118  CYS n 
2 119  LYS n 
2 120  ASP n 
2 121  LYS n 
2 122  ASP n 
2 123  MET n 
2 124  THR n 
2 125  TYR n 
2 126  ALA n 
2 127  ALA n 
2 128  PRO n 
2 129  LEU n 
2 130  PHE n 
2 131  VAL n 
2 132  THR n 
2 133  ALA n 
2 134  GLU n 
2 135  PHE n 
2 136  ILE n 
2 137  ASN n 
2 138  ASN n 
2 139  ASN n 
2 140  THR n 
2 141  GLY n 
2 142  GLU n 
2 143  ILE n 
2 144  LYS n 
2 145  SER n 
2 146  GLN n 
2 147  THR n 
2 148  VAL n 
2 149  PHE n 
2 150  MET n 
2 151  GLY n 
2 152  ASP n 
2 153  PHE n 
2 154  PRO n 
2 155  MET n 
2 156  MET n 
2 157  THR n 
2 158  GLU n 
2 159  LYS n 
2 160  GLY n 
2 161  THR n 
2 162  PHE n 
2 163  ILE n 
2 164  ILE n 
2 165  ASN n 
2 166  GLY n 
2 167  THR n 
2 168  GLU n 
2 169  ARG n 
2 170  VAL n 
2 171  VAL n 
2 172  VAL n 
2 173  SER n 
2 174  GLN n 
2 175  LEU n 
2 176  VAL n 
2 177  ARG n 
2 178  SER n 
2 179  PRO n 
2 180  GLY n 
2 181  VAL n 
2 182  TYR n 
2 183  PHE n 
2 184  ASP n 
2 185  GLU n 
2 186  THR n 
2 187  ILE n 
2 188  ASP n 
2 189  LYS n 
2 190  SER n 
2 191  THR n 
2 192  ASP n 
2 193  LYS n 
2 194  THR n 
2 195  LEU n 
2 196  HIS n 
2 197  SER n 
2 198  VAL n 
2 199  LYS n 
2 200  VAL n 
2 201  ILE n 
2 202  PRO n 
2 203  SER n 
2 204  ARG n 
2 205  GLY n 
2 206  ALA n 
2 207  TRP n 
2 208  LEU n 
2 209  GLU n 
2 210  PHE n 
2 211  ASP n 
2 212  VAL n 
2 213  ASP n 
2 214  LYS n 
2 215  ARG n 
2 216  ASP n 
2 217  THR n 
2 218  VAL n 
2 219  GLY n 
2 220  VAL n 
2 221  ARG n 
2 222  ILE n 
2 223  ASP n 
2 224  ARG n 
2 225  LYS n 
2 226  ARG n 
2 227  ARG n 
2 228  GLN n 
2 229  PRO n 
2 230  VAL n 
2 231  THR n 
2 232  VAL n 
2 233  LEU n 
2 234  LEU n 
2 235  LYS n 
2 236  ALA n 
2 237  LEU n 
2 238  GLY n 
2 239  TRP n 
2 240  THR n 
2 241  SER n 
2 242  GLU n 
2 243  GLN n 
2 244  ILE n 
2 245  VAL n 
2 246  GLU n 
2 247  ARG n 
2 248  PHE n 
2 249  GLY n 
2 250  PHE n 
2 251  SER n 
2 252  GLU n 
2 253  ILE n 
2 254  MET n 
2 255  ARG n 
2 256  SER n 
2 257  THR n 
2 258  LEU n 
2 259  GLU n 
2 260  LYS n 
2 261  ASP n 
2 262  ASN n 
2 263  THR n 
2 264  VAL n 
2 265  GLY n 
2 266  THR n 
2 267  ASP n 
2 268  GLU n 
2 269  ALA n 
2 270  LEU n 
2 271  LEU n 
2 272  ASP n 
2 273  ILE n 
2 274  TYR n 
2 275  ARG n 
2 276  LYS n 
2 277  LEU n 
2 278  ARG n 
2 279  PRO n 
2 280  GLY n 
2 281  GLU n 
2 282  PRO n 
2 283  PRO n 
2 284  THR n 
2 285  LYS n 
2 286  GLU n 
2 287  SER n 
2 288  ALA n 
2 289  GLN n 
2 290  THR n 
2 291  LEU n 
2 292  LEU n 
2 293  GLU n 
2 294  ASN n 
2 295  LEU n 
2 296  PHE n 
2 297  PHE n 
2 298  LYS n 
2 299  GLU n 
2 300  LYS n 
2 301  ARG n 
2 302  TYR n 
2 303  ASP n 
2 304  LEU n 
2 305  ALA n 
2 306  ARG n 
2 307  VAL n 
2 308  GLY n 
2 309  ARG n 
2 310  TYR n 
2 311  LYS n 
2 312  VAL n 
2 313  ASN n 
2 314  LYS n 
2 315  LYS n 
2 316  LEU n 
2 317  GLY n 
2 318  LEU n 
2 319  HIS n 
2 320  VAL n 
2 321  GLY n 
2 322  GLU n 
2 323  PRO n 
2 324  ILE n 
2 325  THR n 
2 326  SER n 
2 327  SER n 
2 328  THR n 
2 329  LEU n 
2 330  THR n 
2 331  GLU n 
2 332  GLU n 
2 333  ASP n 
2 334  VAL n 
2 335  VAL n 
2 336  ALA n 
2 337  THR n 
2 338  ILE n 
2 339  GLU n 
2 340  TYR n 
2 341  LEU n 
2 342  VAL n 
2 343  ARG n 
2 344  LEU n 
2 345  HIS n 
2 346  GLU n 
2 347  GLY n 
2 348  GLN n 
2 349  THR n 
2 350  THR n 
2 351  MET n 
2 352  THR n 
2 353  VAL n 
2 354  PRO n 
2 355  GLY n 
2 356  GLY n 
2 357  VAL n 
2 358  GLU n 
2 359  VAL n 
2 360  PRO n 
2 361  VAL n 
2 362  GLU n 
2 363  THR n 
2 364  ASP n 
2 365  ASP n 
2 366  ILE n 
2 367  ASP n 
2 368  HIS n 
2 369  PHE n 
2 370  GLY n 
2 371  ASN n 
2 372  ARG n 
2 373  ARG n 
2 374  LEU n 
2 375  ARG n 
2 376  THR n 
2 377  VAL n 
2 378  GLY n 
2 379  GLU n 
2 380  LEU n 
2 381  ILE n 
2 382  GLN n 
2 383  ASN n 
2 384  GLN n 
2 385  ILE n 
2 386  ARG n 
2 387  VAL n 
2 388  GLY n 
2 389  MET n 
2 390  SER n 
2 391  ARG n 
2 392  MET n 
2 393  GLU n 
2 394  ARG n 
2 395  VAL n 
2 396  VAL n 
2 397  ARG n 
2 398  GLU n 
2 399  ARG n 
2 400  MET n 
2 401  THR n 
2 402  THR n 
2 403  GLN n 
2 404  ASP n 
2 405  VAL n 
2 406  GLU n 
2 407  ALA n 
2 408  ILE n 
2 409  THR n 
2 410  PRO n 
2 411  GLN n 
2 412  THR n 
2 413  LEU n 
2 414  ILE n 
2 415  ASN n 
2 416  ILE n 
2 417  ARG n 
2 418  PRO n 
2 419  VAL n 
2 420  VAL n 
2 421  ALA n 
2 422  ALA n 
2 423  ILE n 
2 424  LYS n 
2 425  GLU n 
2 426  PHE n 
2 427  PHE n 
2 428  GLY n 
2 429  THR n 
2 430  SER n 
2 431  GLN n 
2 432  LEU n 
2 433  SER n 
2 434  GLN n 
2 435  PHE n 
2 436  MET n 
2 437  ASP n 
2 438  GLN n 
2 439  ASN n 
2 440  ASN n 
2 441  PRO n 
2 442  LEU n 
2 443  SER n 
2 444  GLY n 
2 445  LEU n 
2 446  THR n 
2 447  HIS n 
2 448  LYS n 
2 449  ARG n 
2 450  ARG n 
2 451  LEU n 
2 452  SER n 
2 453  ALA n 
2 454  LEU n 
2 455  GLY n 
2 456  PRO n 
2 457  GLY n 
2 458  GLY n 
2 459  LEU n 
2 460  SER n 
2 461  ARG n 
2 462  GLU n 
2 463  ARG n 
2 464  ALA n 
2 465  GLY n 
2 466  LEU n 
2 467  GLU n 
2 468  VAL n 
2 469  ARG n 
2 470  ASP n 
2 471  VAL n 
2 472  HIS n 
2 473  PRO n 
2 474  SER n 
2 475  HIS n 
2 476  TYR n 
2 477  GLY n 
2 478  ARG n 
2 479  MET n 
2 480  CYS n 
2 481  PRO n 
2 482  ILE n 
2 483  GLU n 
2 484  THR n 
2 485  PRO n 
2 486  GLU n 
2 487  GLY n 
2 488  PRO n 
2 489  ASN n 
2 490  ILE n 
2 491  GLY n 
2 492  LEU n 
2 493  ILE n 
2 494  GLY n 
2 495  SER n 
2 496  LEU n 
2 497  SER n 
2 498  VAL n 
2 499  TYR n 
2 500  ALA n 
2 501  ARG n 
2 502  VAL n 
2 503  ASN n 
2 504  PRO n 
2 505  PHE n 
2 506  GLY n 
2 507  PHE n 
2 508  ILE n 
2 509  GLU n 
2 510  THR n 
2 511  PRO n 
2 512  TYR n 
2 513  ARG n 
2 514  LYS n 
2 515  VAL n 
2 516  VAL n 
2 517  ASP n 
2 518  GLY n 
2 519  VAL n 
2 520  VAL n 
2 521  SER n 
2 522  ASP n 
2 523  GLU n 
2 524  ILE n 
2 525  VAL n 
2 526  TYR n 
2 527  LEU n 
2 528  THR n 
2 529  ALA n 
2 530  ASP n 
2 531  GLU n 
2 532  GLU n 
2 533  ASP n 
2 534  ARG n 
2 535  HIS n 
2 536  VAL n 
2 537  VAL n 
2 538  ALA n 
2 539  GLN n 
2 540  ALA n 
2 541  ASN n 
2 542  SER n 
2 543  PRO n 
2 544  ILE n 
2 545  ASP n 
2 546  ALA n 
2 547  ASP n 
2 548  GLY n 
2 549  ARG n 
2 550  PHE n 
2 551  VAL n 
2 552  GLU n 
2 553  PRO n 
2 554  ARG n 
2 555  VAL n 
2 556  LEU n 
2 557  VAL n 
2 558  ARG n 
2 559  ARG n 
2 560  LYS n 
2 561  ALA n 
2 562  GLY n 
2 563  GLU n 
2 564  VAL n 
2 565  GLU n 
2 566  TYR n 
2 567  VAL n 
2 568  PRO n 
2 569  SER n 
2 570  SER n 
2 571  GLU n 
2 572  VAL n 
2 573  ASP n 
2 574  TYR n 
2 575  MET n 
2 576  ASP n 
2 577  VAL n 
2 578  SER n 
2 579  PRO n 
2 580  ARG n 
2 581  GLN n 
2 582  MET n 
2 583  VAL n 
2 584  SER n 
2 585  VAL n 
2 586  ALA n 
2 587  THR n 
2 588  ALA n 
2 589  MET n 
2 590  ILE n 
2 591  PRO n 
2 592  PHE n 
2 593  LEU n 
2 594  GLU n 
2 595  HIS n 
2 596  ASP n 
2 597  ASP n 
2 598  ALA n 
2 599  ASN n 
2 600  ARG n 
2 601  ALA n 
2 602  LEU n 
2 603  MET n 
2 604  GLY n 
2 605  ALA n 
2 606  ASN n 
2 607  MET n 
2 608  GLN n 
2 609  ARG n 
2 610  GLN n 
2 611  ALA n 
2 612  VAL n 
2 613  PRO n 
2 614  LEU n 
2 615  VAL n 
2 616  ARG n 
2 617  SER n 
2 618  GLU n 
2 619  ALA n 
2 620  PRO n 
2 621  LEU n 
2 622  VAL n 
2 623  GLY n 
2 624  THR n 
2 625  GLY n 
2 626  MET n 
2 627  GLU n 
2 628  LEU n 
2 629  ARG n 
2 630  ALA n 
2 631  ALA n 
2 632  ILE n 
2 633  ASP n 
2 634  ALA n 
2 635  GLY n 
2 636  ASP n 
2 637  VAL n 
2 638  VAL n 
2 639  VAL n 
2 640  ALA n 
2 641  GLU n 
2 642  GLU n 
2 643  SER n 
2 644  GLY n 
2 645  VAL n 
2 646  ILE n 
2 647  GLU n 
2 648  GLU n 
2 649  VAL n 
2 650  SER n 
2 651  ALA n 
2 652  ASP n 
2 653  TYR n 
2 654  ILE n 
2 655  THR n 
2 656  VAL n 
2 657  MET n 
2 658  HIS n 
2 659  ASP n 
2 660  ASN n 
2 661  GLY n 
2 662  THR n 
2 663  ARG n 
2 664  ARG n 
2 665  THR n 
2 666  TYR n 
2 667  ARG n 
2 668  MET n 
2 669  ARG n 
2 670  LYS n 
2 671  PHE n 
2 672  ALA n 
2 673  ARG n 
2 674  SER n 
2 675  ASN n 
2 676  HIS n 
2 677  GLY n 
2 678  THR n 
2 679  CYS n 
2 680  ALA n 
2 681  ASN n 
2 682  GLN n 
2 683  CYS n 
2 684  PRO n 
2 685  ILE n 
2 686  VAL n 
2 687  ASP n 
2 688  ALA n 
2 689  GLY n 
2 690  ASP n 
2 691  ARG n 
2 692  VAL n 
2 693  GLU n 
2 694  ALA n 
2 695  GLY n 
2 696  GLN n 
2 697  VAL n 
2 698  ILE n 
2 699  ALA n 
2 700  ASP n 
2 701  GLY n 
2 702  PRO n 
2 703  CYS n 
2 704  THR n 
2 705  ASP n 
2 706  ASP n 
2 707  GLY n 
2 708  GLU n 
2 709  MET n 
2 710  ALA n 
2 711  LEU n 
2 712  GLY n 
2 713  LYS n 
2 714  ASN n 
2 715  LEU n 
2 716  LEU n 
2 717  VAL n 
2 718  ALA n 
2 719  ILE n 
2 720  MET n 
2 721  PRO n 
2 722  TRP n 
2 723  GLU n 
2 724  GLY n 
2 725  HIS n 
2 726  ASN n 
2 727  TYR n 
2 728  GLU n 
2 729  ASP n 
2 730  ALA n 
2 731  ILE n 
2 732  ILE n 
2 733  LEU n 
2 734  SER n 
2 735  ASN n 
2 736  ARG n 
2 737  LEU n 
2 738  VAL n 
2 739  GLU n 
2 740  GLU n 
2 741  ASP n 
2 742  VAL n 
2 743  LEU n 
2 744  THR n 
2 745  SER n 
2 746  ILE n 
2 747  HIS n 
2 748  ILE n 
2 749  GLU n 
2 750  GLU n 
2 751  HIS n 
2 752  GLU n 
2 753  ILE n 
2 754  ASP n 
2 755  ALA n 
2 756  ARG n 
2 757  ASP n 
2 758  THR n 
2 759  LYS n 
2 760  LEU n 
2 761  GLY n 
2 762  ALA n 
2 763  GLU n 
2 764  GLU n 
2 765  ILE n 
2 766  THR n 
2 767  ARG n 
2 768  ASP n 
2 769  ILE n 
2 770  PRO n 
2 771  ASN n 
2 772  ILE n 
2 773  SER n 
2 774  ASP n 
2 775  GLU n 
2 776  VAL n 
2 777  LEU n 
2 778  ALA n 
2 779  ASP n 
2 780  LEU n 
2 781  ASP n 
2 782  GLU n 
2 783  ARG n 
2 784  GLY n 
2 785  ILE n 
2 786  VAL n 
2 787  ARG n 
2 788  ILE n 
2 789  GLY n 
2 790  ALA n 
2 791  GLU n 
2 792  VAL n 
2 793  ARG n 
2 794  ASP n 
2 795  GLY n 
2 796  ASP n 
2 797  ILE n 
2 798  LEU n 
2 799  VAL n 
2 800  GLY n 
2 801  LYS n 
2 802  VAL n 
2 803  THR n 
2 804  PRO n 
2 805  LYS n 
2 806  GLY n 
2 807  GLU n 
2 808  THR n 
2 809  GLU n 
2 810  LEU n 
2 811  THR n 
2 812  PRO n 
2 813  GLU n 
2 814  GLU n 
2 815  ARG n 
2 816  LEU n 
2 817  LEU n 
2 818  ARG n 
2 819  ALA n 
2 820  ILE n 
2 821  PHE n 
2 822  GLY n 
2 823  GLU n 
2 824  LYS n 
2 825  ALA n 
2 826  ARG n 
2 827  GLU n 
2 828  VAL n 
2 829  ARG n 
2 830  ASP n 
2 831  THR n 
2 832  SER n 
2 833  LEU n 
2 834  LYS n 
2 835  VAL n 
2 836  PRO n 
2 837  HIS n 
2 838  GLY n 
2 839  GLU n 
2 840  SER n 
2 841  GLY n 
2 842  LYS n 
2 843  VAL n 
2 844  ILE n 
2 845  GLY n 
2 846  ILE n 
2 847  ARG n 
2 848  VAL n 
2 849  PHE n 
2 850  SER n 
2 851  ARG n 
2 852  GLU n 
2 853  ASP n 
2 854  GLU n 
2 855  ASP n 
2 856  GLU n 
2 857  LEU n 
2 858  PRO n 
2 859  ALA n 
2 860  GLY n 
2 861  VAL n 
2 862  ASN n 
2 863  GLU n 
2 864  LEU n 
2 865  VAL n 
2 866  ARG n 
2 867  VAL n 
2 868  TYR n 
2 869  VAL n 
2 870  ALA n 
2 871  GLN n 
2 872  LYS n 
2 873  ARG n 
2 874  LYS n 
2 875  ILE n 
2 876  SER n 
2 877  ASP n 
2 878  GLY n 
2 879  ASP n 
2 880  LYS n 
2 881  LEU n 
2 882  ALA n 
2 883  GLY n 
2 884  ARG n 
2 885  HIS n 
2 886  GLY n 
2 887  ASN n 
2 888  LYS n 
2 889  GLY n 
2 890  VAL n 
2 891  ILE n 
2 892  GLY n 
2 893  LYS n 
2 894  ILE n 
2 895  LEU n 
2 896  PRO n 
2 897  VAL n 
2 898  GLU n 
2 899  ASP n 
2 900  MET n 
2 901  PRO n 
2 902  PHE n 
2 903  LEU n 
2 904  ALA n 
2 905  ASP n 
2 906  GLY n 
2 907  THR n 
2 908  PRO n 
2 909  VAL n 
2 910  ASP n 
2 911  ILE n 
2 912  ILE n 
2 913  LEU n 
2 914  ASN n 
2 915  THR n 
2 916  HIS n 
2 917  GLY n 
2 918  VAL n 
2 919  PRO n 
2 920  ARG n 
2 921  ARG n 
2 922  MET n 
2 923  ASN n 
2 924  ILE n 
2 925  GLY n 
2 926  GLN n 
2 927  ILE n 
2 928  LEU n 
2 929  GLU n 
2 930  THR n 
2 931  HIS n 
2 932  LEU n 
2 933  GLY n 
2 934  TRP n 
2 935  CYS n 
2 936  ALA n 
2 937  HIS n 
2 938  SER n 
2 939  GLY n 
2 940  TRP n 
2 941  LYS n 
2 942  VAL n 
2 943  ASP n 
2 944  ALA n 
2 945  ALA n 
2 946  LYS n 
2 947  GLY n 
2 948  VAL n 
2 949  PRO n 
2 950  ASP n 
2 951  TRP n 
2 952  ALA n 
2 953  ALA n 
2 954  ARG n 
2 955  LEU n 
2 956  PRO n 
2 957  ASP n 
2 958  GLU n 
2 959  LEU n 
2 960  LEU n 
2 961  GLU n 
2 962  ALA n 
2 963  GLN n 
2 964  PRO n 
2 965  ASN n 
2 966  ALA n 
2 967  ILE n 
2 968  VAL n 
2 969  SER n 
2 970  THR n 
2 971  PRO n 
2 972  VAL n 
2 973  PHE n 
2 974  ASP n 
2 975  GLY n 
2 976  ALA n 
2 977  GLN n 
2 978  GLU n 
2 979  ALA n 
2 980  GLU n 
2 981  LEU n 
2 982  GLN n 
2 983  GLY n 
2 984  LEU n 
2 985  LEU n 
2 986  SER n 
2 987  CYS n 
2 988  THR n 
2 989  LEU n 
2 990  PRO n 
2 991  ASN n 
2 992  ARG n 
2 993  ASP n 
2 994  GLY n 
2 995  ASP n 
2 996  VAL n 
2 997  LEU n 
2 998  VAL n 
2 999  ASP n 
2 1000 ALA n 
2 1001 ASP n 
2 1002 GLY n 
2 1003 LYS n 
2 1004 ALA n 
2 1005 MET n 
2 1006 LEU n 
2 1007 PHE n 
2 1008 ASP n 
2 1009 GLY n 
2 1010 ARG n 
2 1011 SER n 
2 1012 GLY n 
2 1013 GLU n 
2 1014 PRO n 
2 1015 PHE n 
2 1016 PRO n 
2 1017 TYR n 
2 1018 PRO n 
2 1019 VAL n 
2 1020 THR n 
2 1021 VAL n 
2 1022 GLY n 
2 1023 TYR n 
2 1024 MET n 
2 1025 TYR n 
2 1026 ILE n 
2 1027 MET n 
2 1028 LYS n 
2 1029 LEU n 
2 1030 HIS n 
2 1031 HIS n 
2 1032 LEU n 
2 1033 VAL n 
2 1034 ASP n 
2 1035 ASP n 
2 1036 LYS n 
2 1037 ILE n 
2 1038 HIS n 
2 1039 ALA n 
2 1040 ARG n 
2 1041 SER n 
2 1042 THR n 
2 1043 GLY n 
2 1044 PRO n 
2 1045 TYR n 
2 1046 SER n 
2 1047 MET n 
2 1048 ILE n 
2 1049 THR n 
2 1050 GLN n 
2 1051 GLN n 
2 1052 PRO n 
2 1053 LEU n 
2 1054 GLY n 
2 1055 GLY n 
2 1056 LYS n 
2 1057 ALA n 
2 1058 GLN n 
2 1059 PHE n 
2 1060 GLY n 
2 1061 GLY n 
2 1062 GLN n 
2 1063 ARG n 
2 1064 PHE n 
2 1065 GLY n 
2 1066 GLU n 
2 1067 MET n 
2 1068 GLU n 
2 1069 CYS n 
2 1070 TRP n 
2 1071 ALA n 
2 1072 MET n 
2 1073 GLN n 
2 1074 ALA n 
2 1075 TYR n 
2 1076 GLY n 
2 1077 ALA n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 THR n 
2 1081 LEU n 
2 1082 GLN n 
2 1083 GLU n 
2 1084 LEU n 
2 1085 LEU n 
2 1086 THR n 
2 1087 ILE n 
2 1088 LYS n 
2 1089 SER n 
2 1090 ASP n 
2 1091 ASP n 
2 1092 THR n 
2 1093 VAL n 
2 1094 GLY n 
2 1095 ARG n 
2 1096 VAL n 
2 1097 LYS n 
2 1098 VAL n 
2 1099 TYR n 
2 1100 GLU n 
2 1101 ALA n 
2 1102 ILE n 
2 1103 VAL n 
2 1104 LYS n 
2 1105 GLY n 
2 1106 GLU n 
2 1107 ASN n 
2 1108 ILE n 
2 1109 PRO n 
2 1110 GLU n 
2 1111 PRO n 
2 1112 GLY n 
2 1113 ILE n 
2 1114 PRO n 
2 1115 GLU n 
2 1116 SER n 
2 1117 PHE n 
2 1118 LYS n 
2 1119 VAL n 
2 1120 LEU n 
2 1121 LEU n 
2 1122 LYS n 
2 1123 GLU n 
2 1124 LEU n 
2 1125 GLN n 
2 1126 SER n 
2 1127 LEU n 
2 1128 CYS n 
2 1129 LEU n 
2 1130 ASN n 
2 1131 VAL n 
2 1132 GLU n 
2 1133 VAL n 
2 1134 LEU n 
2 1135 SER n 
2 1136 SER n 
2 1137 ASP n 
2 1138 GLY n 
2 1139 ALA n 
2 1140 ALA n 
2 1141 ILE n 
2 1142 GLU n 
2 1143 LEU n 
2 1144 ARG n 
2 1145 GLU n 
2 1146 GLY n 
2 1147 GLU n 
2 1148 ASP n 
2 1149 GLU n 
2 1150 ASP n 
2 1151 LEU n 
2 1152 GLU n 
2 1153 ARG n 
2 1154 ALA n 
2 1155 ALA n 
2 1156 ALA n 
2 1157 ASN n 
2 1158 LEU n 
2 1159 GLY n 
2 1160 ILE n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 SER n 
2 1164 ARG n 
2 1165 ASN n 
2 1166 GLU n 
2 1167 SER n 
2 1168 ALA n 
2 1169 SER n 
2 1170 VAL n 
2 1171 GLU n 
2 1172 ASP n 
2 1173 LEU n 
2 1174 ALA n 
3 1    MET n 
3 2    VAL n 
3 3    LEU n 
3 4    ASP n 
3 5    VAL n 
3 6    ASN n 
3 7    PHE n 
3 8    PHE n 
3 9    ASP n 
3 10   GLU n 
3 11   LEU n 
3 12   ARG n 
3 13   ILE n 
3 14   GLY n 
3 15   LEU n 
3 16   ALA n 
3 17   THR n 
3 18   ALA n 
3 19   GLU n 
3 20   ASP n 
3 21   ILE n 
3 22   ARG n 
3 23   GLN n 
3 24   TRP n 
3 25   SER n 
3 26   TYR n 
3 27   GLY n 
3 28   GLU n 
3 29   VAL n 
3 30   LYS n 
3 31   LYS n 
3 32   PRO n 
3 33   GLU n 
3 34   THR n 
3 35   ILE n 
3 36   ASN n 
3 37   TYR n 
3 38   ARG n 
3 39   THR n 
3 40   LEU n 
3 41   LYS n 
3 42   PRO n 
3 43   GLU n 
3 44   LYS n 
3 45   ASP n 
3 46   GLY n 
3 47   LEU n 
3 48   PHE n 
3 49   CYS n 
3 50   GLU n 
3 51   LYS n 
3 52   ILE n 
3 53   PHE n 
3 54   GLY n 
3 55   PRO n 
3 56   THR n 
3 57   ARG n 
3 58   ASP n 
3 59   TRP n 
3 60   GLU n 
3 61   CYS n 
3 62   TYR n 
3 63   CYS n 
3 64   GLY n 
3 65   LYS n 
3 66   TYR n 
3 67   LYS n 
3 68   ARG n 
3 69   VAL n 
3 70   ARG n 
3 71   PHE n 
3 72   LYS n 
3 73   GLY n 
3 74   ILE n 
3 75   ILE n 
3 76   CYS n 
3 77   GLU n 
3 78   ARG n 
3 79   CYS n 
3 80   GLY n 
3 81   VAL n 
3 82   GLU n 
3 83   VAL n 
3 84   THR n 
3 85   ARG n 
3 86   ALA n 
3 87   LYS n 
3 88   VAL n 
3 89   ARG n 
3 90   ARG n 
3 91   GLU n 
3 92   ARG n 
3 93   MET n 
3 94   GLY n 
3 95   HIS n 
3 96   ILE n 
3 97   GLU n 
3 98   LEU n 
3 99   ALA n 
3 100  ALA n 
3 101  PRO n 
3 102  VAL n 
3 103  THR n 
3 104  HIS n 
3 105  ILE n 
3 106  TRP n 
3 107  TYR n 
3 108  PHE n 
3 109  LYS n 
3 110  GLY n 
3 111  VAL n 
3 112  PRO n 
3 113  SER n 
3 114  ARG n 
3 115  LEU n 
3 116  GLY n 
3 117  TYR n 
3 118  LEU n 
3 119  LEU n 
3 120  ASP n 
3 121  LEU n 
3 122  ALA n 
3 123  PRO n 
3 124  LYS n 
3 125  ASP n 
3 126  LEU n 
3 127  GLU n 
3 128  LYS n 
3 129  ILE n 
3 130  ILE n 
3 131  TYR n 
3 132  PHE n 
3 133  ALA n 
3 134  ALA n 
3 135  TYR n 
3 136  VAL n 
3 137  ILE n 
3 138  THR n 
3 139  SER n 
3 140  VAL n 
3 141  ASP n 
3 142  GLU n 
3 143  GLU n 
3 144  MET n 
3 145  ARG n 
3 146  HIS n 
3 147  ASN n 
3 148  GLU n 
3 149  LEU n 
3 150  SER n 
3 151  THR n 
3 152  LEU n 
3 153  GLU n 
3 154  ALA n 
3 155  GLU n 
3 156  MET n 
3 157  ALA n 
3 158  VAL n 
3 159  GLU n 
3 160  ARG n 
3 161  LYS n 
3 162  ALA n 
3 163  VAL n 
3 164  GLU n 
3 165  ASP n 
3 166  GLN n 
3 167  ARG n 
3 168  ASP n 
3 169  GLY n 
3 170  GLU n 
3 171  LEU n 
3 172  GLU n 
3 173  ALA n 
3 174  ARG n 
3 175  ALA n 
3 176  GLN n 
3 177  LYS n 
3 178  LEU n 
3 179  GLU n 
3 180  ALA n 
3 181  ASP n 
3 182  LEU n 
3 183  ALA n 
3 184  GLU n 
3 185  LEU n 
3 186  GLU n 
3 187  ALA n 
3 188  GLU n 
3 189  GLY n 
3 190  ALA n 
3 191  LYS n 
3 192  ALA n 
3 193  ASP n 
3 194  ALA n 
3 195  ARG n 
3 196  ARG n 
3 197  LYS n 
3 198  VAL n 
3 199  ARG n 
3 200  ASP n 
3 201  GLY n 
3 202  GLY n 
3 203  GLU n 
3 204  ARG n 
3 205  GLU n 
3 206  MET n 
3 207  ARG n 
3 208  GLN n 
3 209  ILE n 
3 210  ARG n 
3 211  ASP n 
3 212  ARG n 
3 213  ALA n 
3 214  GLN n 
3 215  ARG n 
3 216  GLU n 
3 217  LEU n 
3 218  ASP n 
3 219  ARG n 
3 220  LEU n 
3 221  GLU n 
3 222  ASP n 
3 223  ILE n 
3 224  TRP n 
3 225  SER n 
3 226  THR n 
3 227  PHE n 
3 228  THR n 
3 229  LYS n 
3 230  LEU n 
3 231  ALA n 
3 232  PRO n 
3 233  LYS n 
3 234  GLN n 
3 235  LEU n 
3 236  ILE n 
3 237  VAL n 
3 238  ASP n 
3 239  GLU n 
3 240  ASN n 
3 241  LEU n 
3 242  TYR n 
3 243  ARG n 
3 244  GLU n 
3 245  LEU n 
3 246  VAL n 
3 247  ASP n 
3 248  ARG n 
3 249  TYR n 
3 250  GLY n 
3 251  GLU n 
3 252  TYR n 
3 253  PHE n 
3 254  THR n 
3 255  GLY n 
3 256  ALA n 
3 257  MET n 
3 258  GLY n 
3 259  ALA n 
3 260  GLU n 
3 261  SER n 
3 262  ILE n 
3 263  GLN n 
3 264  LYS n 
3 265  LEU n 
3 266  ILE n 
3 267  GLU n 
3 268  ASN n 
3 269  PHE n 
3 270  ASP n 
3 271  ILE n 
3 272  ASP n 
3 273  ALA n 
3 274  GLU n 
3 275  ALA n 
3 276  GLU n 
3 277  SER n 
3 278  LEU n 
3 279  ARG n 
3 280  ASP n 
3 281  VAL n 
3 282  ILE n 
3 283  ARG n 
3 284  ASN n 
3 285  GLY n 
3 286  LYS n 
3 287  GLY n 
3 288  GLN n 
3 289  LYS n 
3 290  LYS n 
3 291  LEU n 
3 292  ARG n 
3 293  ALA n 
3 294  LEU n 
3 295  LYS n 
3 296  ARG n 
3 297  LEU n 
3 298  LYS n 
3 299  VAL n 
3 300  VAL n 
3 301  ALA n 
3 302  ALA n 
3 303  PHE n 
3 304  GLN n 
3 305  GLN n 
3 306  SER n 
3 307  GLY n 
3 308  ASN n 
3 309  SER n 
3 310  PRO n 
3 311  MET n 
3 312  GLY n 
3 313  MET n 
3 314  VAL n 
3 315  LEU n 
3 316  ASP n 
3 317  ALA n 
3 318  VAL n 
3 319  PRO n 
3 320  VAL n 
3 321  ILE n 
3 322  PRO n 
3 323  PRO n 
3 324  GLU n 
3 325  LEU n 
3 326  ARG n 
3 327  PRO n 
3 328  MET n 
3 329  VAL n 
3 330  GLN n 
3 331  LEU n 
3 332  ASP n 
3 333  GLY n 
3 334  GLY n 
3 335  ARG n 
3 336  PHE n 
3 337  ALA n 
3 338  THR n 
3 339  SER n 
3 340  ASP n 
3 341  LEU n 
3 342  ASN n 
3 343  ASP n 
3 344  LEU n 
3 345  TYR n 
3 346  ARG n 
3 347  ARG n 
3 348  VAL n 
3 349  ILE n 
3 350  ASN n 
3 351  ARG n 
3 352  ASN n 
3 353  ASN n 
3 354  ARG n 
3 355  LEU n 
3 356  LYS n 
3 357  ARG n 
3 358  LEU n 
3 359  ILE n 
3 360  ASP n 
3 361  LEU n 
3 362  GLY n 
3 363  ALA n 
3 364  PRO n 
3 365  GLU n 
3 366  ILE n 
3 367  ILE n 
3 368  VAL n 
3 369  ASN n 
3 370  ASN n 
3 371  GLU n 
3 372  LYS n 
3 373  ARG n 
3 374  MET n 
3 375  LEU n 
3 376  GLN n 
3 377  GLU n 
3 378  SER n 
3 379  VAL n 
3 380  ASP n 
3 381  ALA n 
3 382  LEU n 
3 383  PHE n 
3 384  ASP n 
3 385  ASN n 
3 386  GLY n 
3 387  ARG n 
3 388  ARG n 
3 389  GLY n 
3 390  ARG n 
3 391  PRO n 
3 392  VAL n 
3 393  THR n 
3 394  GLY n 
3 395  PRO n 
3 396  GLY n 
3 397  ASN n 
3 398  ARG n 
3 399  PRO n 
3 400  LEU n 
3 401  LYS n 
3 402  SER n 
3 403  LEU n 
3 404  SER n 
3 405  ASP n 
3 406  LEU n 
3 407  LEU n 
3 408  LYS n 
3 409  GLY n 
3 410  LYS n 
3 411  GLN n 
3 412  GLY n 
3 413  ARG n 
3 414  PHE n 
3 415  ARG n 
3 416  GLN n 
3 417  ASN n 
3 418  LEU n 
3 419  LEU n 
3 420  GLY n 
3 421  LYS n 
3 422  ARG n 
3 423  VAL n 
3 424  ASP n 
3 425  TYR n 
3 426  SER n 
3 427  GLY n 
3 428  ARG n 
3 429  SER n 
3 430  VAL n 
3 431  ILE n 
3 432  VAL n 
3 433  VAL n 
3 434  GLY n 
3 435  PRO n 
3 436  GLN n 
3 437  LEU n 
3 438  LYS n 
3 439  LEU n 
3 440  HIS n 
3 441  GLN n 
3 442  CYS n 
3 443  GLY n 
3 444  LEU n 
3 445  PRO n 
3 446  LYS n 
3 447  LEU n 
3 448  MET n 
3 449  ALA n 
3 450  LEU n 
3 451  GLU n 
3 452  LEU n 
3 453  PHE n 
3 454  LYS n 
3 455  PRO n 
3 456  PHE n 
3 457  VAL n 
3 458  MET n 
3 459  LYS n 
3 460  ARG n 
3 461  LEU n 
3 462  VAL n 
3 463  ASP n 
3 464  LEU n 
3 465  ASN n 
3 466  HIS n 
3 467  ALA n 
3 468  GLN n 
3 469  ASN n 
3 470  ILE n 
3 471  LYS n 
3 472  SER n 
3 473  ALA n 
3 474  LYS n 
3 475  ARG n 
3 476  MET n 
3 477  VAL n 
3 478  GLU n 
3 479  ARG n 
3 480  GLN n 
3 481  ARG n 
3 482  PRO n 
3 483  GLN n 
3 484  VAL n 
3 485  TRP n 
3 486  ASP n 
3 487  VAL n 
3 488  LEU n 
3 489  GLU n 
3 490  GLU n 
3 491  VAL n 
3 492  ILE n 
3 493  ALA n 
3 494  GLU n 
3 495  HIS n 
3 496  PRO n 
3 497  VAL n 
3 498  LEU n 
3 499  LEU n 
3 500  ASN n 
3 501  ARG n 
3 502  ALA n 
3 503  PRO n 
3 504  THR n 
3 505  LEU n 
3 506  HIS n 
3 507  ARG n 
3 508  LEU n 
3 509  GLY n 
3 510  ILE n 
3 511  GLN n 
3 512  ALA n 
3 513  PHE n 
3 514  GLU n 
3 515  PRO n 
3 516  MET n 
3 517  LEU n 
3 518  VAL n 
3 519  GLU n 
3 520  GLY n 
3 521  LYS n 
3 522  ALA n 
3 523  ILE n 
3 524  GLN n 
3 525  LEU n 
3 526  HIS n 
3 527  PRO n 
3 528  LEU n 
3 529  VAL n 
3 530  CYS n 
3 531  GLU n 
3 532  ALA n 
3 533  PHE n 
3 534  ASN n 
3 535  ALA n 
3 536  ASP n 
3 537  PHE n 
3 538  ASP n 
3 539  GLY n 
3 540  ASP n 
3 541  GLN n 
3 542  MET n 
3 543  ALA n 
3 544  VAL n 
3 545  HIS n 
3 546  LEU n 
3 547  PRO n 
3 548  LEU n 
3 549  SER n 
3 550  ALA n 
3 551  GLU n 
3 552  ALA n 
3 553  GLN n 
3 554  ALA n 
3 555  GLU n 
3 556  ALA n 
3 557  ARG n 
3 558  ILE n 
3 559  LEU n 
3 560  MET n 
3 561  LEU n 
3 562  SER n 
3 563  SER n 
3 564  ASN n 
3 565  ASN n 
3 566  ILE n 
3 567  LEU n 
3 568  SER n 
3 569  PRO n 
3 570  ALA n 
3 571  SER n 
3 572  GLY n 
3 573  ARG n 
3 574  PRO n 
3 575  LEU n 
3 576  ALA n 
3 577  MET n 
3 578  PRO n 
3 579  ARG n 
3 580  LEU n 
3 581  ASP n 
3 582  MET n 
3 583  VAL n 
3 584  THR n 
3 585  GLY n 
3 586  LEU n 
3 587  TYR n 
3 588  TYR n 
3 589  LEU n 
3 590  THR n 
3 591  THR n 
3 592  GLU n 
3 593  VAL n 
3 594  PRO n 
3 595  GLY n 
3 596  ASP n 
3 597  THR n 
3 598  GLY n 
3 599  GLU n 
3 600  TYR n 
3 601  GLN n 
3 602  PRO n 
3 603  ALA n 
3 604  SER n 
3 605  GLY n 
3 606  ASP n 
3 607  HIS n 
3 608  PRO n 
3 609  GLU n 
3 610  THR n 
3 611  GLY n 
3 612  VAL n 
3 613  TYR n 
3 614  SER n 
3 615  SER n 
3 616  PRO n 
3 617  ALA n 
3 618  GLU n 
3 619  ALA n 
3 620  ILE n 
3 621  MET n 
3 622  ALA n 
3 623  ALA n 
3 624  ASP n 
3 625  ARG n 
3 626  GLY n 
3 627  VAL n 
3 628  LEU n 
3 629  SER n 
3 630  VAL n 
3 631  ARG n 
3 632  ALA n 
3 633  LYS n 
3 634  ILE n 
3 635  LYS n 
3 636  VAL n 
3 637  ARG n 
3 638  LEU n 
3 639  THR n 
3 640  GLN n 
3 641  LEU n 
3 642  ARG n 
3 643  PRO n 
3 644  PRO n 
3 645  VAL n 
3 646  GLU n 
3 647  ILE n 
3 648  GLU n 
3 649  ALA n 
3 650  GLU n 
3 651  LEU n 
3 652  PHE n 
3 653  GLY n 
3 654  HIS n 
3 655  SER n 
3 656  GLY n 
3 657  TRP n 
3 658  GLN n 
3 659  PRO n 
3 660  GLY n 
3 661  ASP n 
3 662  ALA n 
3 663  TRP n 
3 664  MET n 
3 665  ALA n 
3 666  GLU n 
3 667  THR n 
3 668  THR n 
3 669  LEU n 
3 670  GLY n 
3 671  ARG n 
3 672  VAL n 
3 673  MET n 
3 674  PHE n 
3 675  ASN n 
3 676  GLU n 
3 677  LEU n 
3 678  LEU n 
3 679  PRO n 
3 680  LEU n 
3 681  GLY n 
3 682  TYR n 
3 683  PRO n 
3 684  PHE n 
3 685  VAL n 
3 686  ASN n 
3 687  LYS n 
3 688  GLN n 
3 689  MET n 
3 690  HIS n 
3 691  LYS n 
3 692  LYS n 
3 693  VAL n 
3 694  GLN n 
3 695  ALA n 
3 696  ALA n 
3 697  ILE n 
3 698  ILE n 
3 699  ASN n 
3 700  ASP n 
3 701  LEU n 
3 702  ALA n 
3 703  GLU n 
3 704  ARG n 
3 705  TYR n 
3 706  PRO n 
3 707  MET n 
3 708  ILE n 
3 709  VAL n 
3 710  VAL n 
3 711  ALA n 
3 712  GLN n 
3 713  THR n 
3 714  VAL n 
3 715  ASP n 
3 716  LYS n 
3 717  LEU n 
3 718  LYS n 
3 719  ASP n 
3 720  ALA n 
3 721  GLY n 
3 722  PHE n 
3 723  TYR n 
3 724  TRP n 
3 725  ALA n 
3 726  THR n 
3 727  ARG n 
3 728  SER n 
3 729  GLY n 
3 730  VAL n 
3 731  THR n 
3 732  VAL n 
3 733  SER n 
3 734  MET n 
3 735  ALA n 
3 736  ASP n 
3 737  VAL n 
3 738  LEU n 
3 739  VAL n 
3 740  PRO n 
3 741  PRO n 
3 742  ARG n 
3 743  LYS n 
3 744  LYS n 
3 745  GLU n 
3 746  ILE n 
3 747  LEU n 
3 748  ASP n 
3 749  HIS n 
3 750  TYR n 
3 751  GLU n 
3 752  GLU n 
3 753  ARG n 
3 754  ALA n 
3 755  ASP n 
3 756  LYS n 
3 757  VAL n 
3 758  GLU n 
3 759  LYS n 
3 760  GLN n 
3 761  PHE n 
3 762  GLN n 
3 763  ARG n 
3 764  GLY n 
3 765  ALA n 
3 766  LEU n 
3 767  ASN n 
3 768  HIS n 
3 769  ASP n 
3 770  GLU n 
3 771  ARG n 
3 772  ASN n 
3 773  GLU n 
3 774  ALA n 
3 775  LEU n 
3 776  VAL n 
3 777  GLU n 
3 778  ILE n 
3 779  TRP n 
3 780  LYS n 
3 781  GLU n 
3 782  ALA n 
3 783  THR n 
3 784  ASP n 
3 785  GLU n 
3 786  VAL n 
3 787  GLY n 
3 788  GLN n 
3 789  ALA n 
3 790  LEU n 
3 791  ARG n 
3 792  GLU n 
3 793  HIS n 
3 794  TYR n 
3 795  PRO n 
3 796  ASP n 
3 797  ASP n 
3 798  ASN n 
3 799  PRO n 
3 800  ILE n 
3 801  ILE n 
3 802  THR n 
3 803  ILE n 
3 804  VAL n 
3 805  ASP n 
3 806  SER n 
3 807  GLY n 
3 808  ALA n 
3 809  THR n 
3 810  GLY n 
3 811  ASN n 
3 812  PHE n 
3 813  THR n 
3 814  GLN n 
3 815  THR n 
3 816  ARG n 
3 817  THR n 
3 818  LEU n 
3 819  ALA n 
3 820  GLY n 
3 821  MET n 
3 822  LYS n 
3 823  GLY n 
3 824  LEU n 
3 825  VAL n 
3 826  THR n 
3 827  ASN n 
3 828  PRO n 
3 829  LYS n 
3 830  GLY n 
3 831  GLU n 
3 832  PHE n 
3 833  ILE n 
3 834  PRO n 
3 835  ARG n 
3 836  PRO n 
3 837  VAL n 
3 838  LYS n 
3 839  SER n 
3 840  SER n 
3 841  PHE n 
3 842  ARG n 
3 843  GLU n 
3 844  GLY n 
3 845  LEU n 
3 846  THR n 
3 847  VAL n 
3 848  LEU n 
3 849  GLU n 
3 850  TYR n 
3 851  PHE n 
3 852  ILE n 
3 853  ASN n 
3 854  THR n 
3 855  HIS n 
3 856  GLY n 
3 857  ALA n 
3 858  ARG n 
3 859  LYS n 
3 860  GLY n 
3 861  LEU n 
3 862  ALA n 
3 863  ASP n 
3 864  THR n 
3 865  ALA n 
3 866  LEU n 
3 867  ARG n 
3 868  THR n 
3 869  ALA n 
3 870  ASP n 
3 871  SER n 
3 872  GLY n 
3 873  TYR n 
3 874  LEU n 
3 875  THR n 
3 876  ARG n 
3 877  ARG n 
3 878  LEU n 
3 879  VAL n 
3 880  ASP n 
3 881  VAL n 
3 882  SER n 
3 883  GLN n 
3 884  ASP n 
3 885  VAL n 
3 886  ILE n 
3 887  VAL n 
3 888  ARG n 
3 889  GLU n 
3 890  HIS n 
3 891  ASP n 
3 892  CYS n 
3 893  GLN n 
3 894  THR n 
3 895  GLU n 
3 896  ARG n 
3 897  GLY n 
3 898  ILE n 
3 899  VAL n 
3 900  VAL n 
3 901  GLU n 
3 902  LEU n 
3 903  ALA n 
3 904  GLU n 
3 905  ARG n 
3 906  ALA n 
3 907  PRO n 
3 908  ASP n 
3 909  GLY n 
3 910  THR n 
3 911  LEU n 
3 912  ILE n 
3 913  ARG n 
3 914  ASP n 
3 915  PRO n 
3 916  TYR n 
3 917  ILE n 
3 918  GLU n 
3 919  THR n 
3 920  SER n 
3 921  ALA n 
3 922  TYR n 
3 923  ALA n 
3 924  ARG n 
3 925  THR n 
3 926  LEU n 
3 927  GLY n 
3 928  THR n 
3 929  ASP n 
3 930  ALA n 
3 931  VAL n 
3 932  ASP n 
3 933  GLU n 
3 934  ALA n 
3 935  GLY n 
3 936  ASN n 
3 937  VAL n 
3 938  ILE n 
3 939  VAL n 
3 940  GLU n 
3 941  ARG n 
3 942  GLY n 
3 943  GLN n 
3 944  ASP n 
3 945  LEU n 
3 946  GLY n 
3 947  ASP n 
3 948  PRO n 
3 949  GLU n 
3 950  ILE n 
3 951  ASP n 
3 952  ALA n 
3 953  LEU n 
3 954  LEU n 
3 955  ALA n 
3 956  ALA n 
3 957  GLY n 
3 958  ILE n 
3 959  THR n 
3 960  GLN n 
3 961  VAL n 
3 962  LYS n 
3 963  VAL n 
3 964  ARG n 
3 965  SER n 
3 966  VAL n 
3 967  LEU n 
3 968  THR n 
3 969  CYS n 
3 970  ALA n 
3 971  THR n 
3 972  SER n 
3 973  THR n 
3 974  GLY n 
3 975  VAL n 
3 976  CYS n 
3 977  ALA n 
3 978  THR n 
3 979  CYS n 
3 980  TYR n 
3 981  GLY n 
3 982  ARG n 
3 983  SER n 
3 984  MET n 
3 985  ALA n 
3 986  THR n 
3 987  GLY n 
3 988  LYS n 
3 989  LEU n 
3 990  VAL n 
3 991  ASP n 
3 992  ILE n 
3 993  GLY n 
3 994  GLU n 
3 995  ALA n 
3 996  VAL n 
3 997  GLY n 
3 998  ILE n 
3 999  VAL n 
3 1000 ALA n 
3 1001 ALA n 
3 1002 GLN n 
3 1003 SER n 
3 1004 ILE n 
3 1005 GLY n 
3 1006 GLU n 
3 1007 PRO n 
3 1008 GLY n 
3 1009 THR n 
3 1010 GLN n 
3 1011 LEU n 
3 1012 THR n 
3 1013 MET n 
3 1014 ARG n 
3 1015 THR n 
3 1016 PHE n 
3 1017 HIS n 
3 1018 GLN n 
3 1019 GLY n 
3 1020 GLY n 
3 1021 VAL n 
3 1022 GLY n 
3 1023 GLU n 
3 1024 ASP n 
3 1025 ILE n 
3 1026 THR n 
3 1027 GLY n 
3 1028 GLY n 
3 1029 LEU n 
3 1030 PRO n 
3 1031 ARG n 
3 1032 VAL n 
3 1033 GLN n 
3 1034 GLU n 
3 1035 LEU n 
3 1036 PHE n 
3 1037 GLU n 
3 1038 ALA n 
3 1039 ARG n 
3 1040 VAL n 
3 1041 PRO n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LYS n 
3 1045 ALA n 
3 1046 PRO n 
3 1047 ILE n 
3 1048 ALA n 
3 1049 ASP n 
3 1050 VAL n 
3 1051 THR n 
3 1052 GLY n 
3 1053 ARG n 
3 1054 VAL n 
3 1055 ARG n 
3 1056 LEU n 
3 1057 GLU n 
3 1058 ASP n 
3 1059 GLY n 
3 1060 GLU n 
3 1061 ARG n 
3 1062 PHE n 
3 1063 TYR n 
3 1064 LYS n 
3 1065 ILE n 
3 1066 THR n 
3 1067 ILE n 
3 1068 VAL n 
3 1069 PRO n 
3 1070 ASP n 
3 1071 ASP n 
3 1072 GLY n 
3 1073 GLY n 
3 1074 GLU n 
3 1075 GLU n 
3 1076 VAL n 
3 1077 VAL n 
3 1078 TYR n 
3 1079 ASP n 
3 1080 LYS n 
3 1081 ILE n 
3 1082 SER n 
3 1083 LYS n 
3 1084 ARG n 
3 1085 GLN n 
3 1086 ARG n 
3 1087 LEU n 
3 1088 ARG n 
3 1089 VAL n 
3 1090 PHE n 
3 1091 LYS n 
3 1092 HIS n 
3 1093 GLU n 
3 1094 ASP n 
3 1095 GLY n 
3 1096 SER n 
3 1097 GLU n 
3 1098 ARG n 
3 1099 VAL n 
3 1100 LEU n 
3 1101 SER n 
3 1102 ASP n 
3 1103 GLY n 
3 1104 ASP n 
3 1105 HIS n 
3 1106 VAL n 
3 1107 GLU n 
3 1108 VAL n 
3 1109 GLY n 
3 1110 GLN n 
3 1111 GLN n 
3 1112 LEU n 
3 1113 MET n 
3 1114 GLU n 
3 1115 GLY n 
3 1116 SER n 
3 1117 ALA n 
3 1118 ASP n 
3 1119 PRO n 
3 1120 HIS n 
3 1121 GLU n 
3 1122 VAL n 
3 1123 LEU n 
3 1124 ARG n 
3 1125 VAL n 
3 1126 GLN n 
3 1127 GLY n 
3 1128 PRO n 
3 1129 ARG n 
3 1130 GLU n 
3 1131 VAL n 
3 1132 GLN n 
3 1133 ILE n 
3 1134 HIS n 
3 1135 LEU n 
3 1136 VAL n 
3 1137 ARG n 
3 1138 GLU n 
3 1139 VAL n 
3 1140 GLN n 
3 1141 GLU n 
3 1142 VAL n 
3 1143 TYR n 
3 1144 ARG n 
3 1145 ALA n 
3 1146 GLN n 
3 1147 GLY n 
3 1148 VAL n 
3 1149 SER n 
3 1150 ILE n 
3 1151 HIS n 
3 1152 ASP n 
3 1153 LYS n 
3 1154 HIS n 
3 1155 ILE n 
3 1156 GLU n 
3 1157 VAL n 
3 1158 ILE n 
3 1159 VAL n 
3 1160 ARG n 
3 1161 GLN n 
3 1162 MET n 
3 1163 LEU n 
3 1164 ARG n 
3 1165 ARG n 
3 1166 VAL n 
3 1167 THR n 
3 1168 ILE n 
3 1169 ILE n 
3 1170 ASP n 
3 1171 SER n 
3 1172 GLY n 
3 1173 SER n 
3 1174 THR n 
3 1175 GLU n 
3 1176 PHE n 
3 1177 LEU n 
3 1178 PRO n 
3 1179 GLY n 
3 1180 SER n 
3 1181 LEU n 
3 1182 ILE n 
3 1183 ASP n 
3 1184 ARG n 
3 1185 ALA n 
3 1186 GLU n 
3 1187 PHE n 
3 1188 GLU n 
3 1189 ALA n 
3 1190 GLU n 
3 1191 ASN n 
3 1192 ARG n 
3 1193 ARG n 
3 1194 VAL n 
3 1195 VAL n 
3 1196 ALA n 
3 1197 GLU n 
3 1198 GLY n 
3 1199 GLY n 
3 1200 GLU n 
3 1201 PRO n 
3 1202 ALA n 
3 1203 ALA n 
3 1204 GLY n 
3 1205 ARG n 
3 1206 PRO n 
3 1207 VAL n 
3 1208 LEU n 
3 1209 MET n 
3 1210 GLY n 
3 1211 ILE n 
3 1212 THR n 
3 1213 LYS n 
3 1214 ALA n 
3 1215 SER n 
3 1216 LEU n 
3 1217 ALA n 
3 1218 THR n 
3 1219 ASP n 
3 1220 SER n 
3 1221 TRP n 
3 1222 LEU n 
3 1223 SER n 
3 1224 ALA n 
3 1225 ALA n 
3 1226 SER n 
3 1227 PHE n 
3 1228 GLN n 
3 1229 GLU n 
3 1230 THR n 
3 1231 THR n 
3 1232 ARG n 
3 1233 VAL n 
3 1234 LEU n 
3 1235 THR n 
3 1236 ASP n 
3 1237 ALA n 
3 1238 ALA n 
3 1239 ILE n 
3 1240 ASN n 
3 1241 CYS n 
3 1242 ARG n 
3 1243 SER n 
3 1244 ASP n 
3 1245 LYS n 
3 1246 LEU n 
3 1247 ASN n 
3 1248 GLY n 
3 1249 LEU n 
3 1250 LYS n 
3 1251 GLU n 
3 1252 ASN n 
3 1253 VAL n 
3 1254 ILE n 
3 1255 ILE n 
3 1256 GLY n 
3 1257 LYS n 
3 1258 LEU n 
3 1259 ILE n 
3 1260 PRO n 
3 1261 ALA n 
3 1262 GLY n 
3 1263 THR n 
3 1264 GLY n 
3 1265 ILE n 
3 1266 ASN n 
3 1267 ARG n 
3 1268 TYR n 
3 1269 ARG n 
3 1270 ASN n 
3 1271 ILE n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 GLN n 
3 1275 PRO n 
3 1276 THR n 
3 1277 GLU n 
3 1278 GLU n 
3 1279 ALA n 
3 1280 ARG n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 ALA n 
3 1284 TYR n 
3 1285 THR n 
3 1286 ILE n 
3 1287 PRO n 
3 1288 SER n 
3 1289 TYR n 
3 1290 GLU n 
3 1291 ASP n 
3 1292 GLN n 
3 1293 TYR n 
3 1294 TYR n 
3 1295 SER n 
3 1296 PRO n 
3 1297 ASP n 
3 1298 PHE n 
3 1299 GLY n 
3 1300 ALA n 
3 1301 ALA n 
3 1302 THR n 
3 1303 GLY n 
3 1304 ALA n 
3 1305 ALA n 
3 1306 VAL n 
3 1307 PRO n 
3 1308 LEU n 
3 1309 ASP n 
3 1310 ASP n 
3 1311 TYR n 
3 1312 GLY n 
3 1313 TYR n 
3 1314 SER n 
3 1315 ASP n 
3 1316 TYR n 
3 1317 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    GLY n 
5 2    ALA n 
5 3    MET n 
5 4    ALA n 
5 5    ASP n 
5 6    ILE n 
5 7    ASP n 
5 8    GLY n 
5 9    VAL n 
5 10   THR n 
5 11   GLY n 
5 12   SER n 
5 13   ALA n 
5 14   GLY n 
5 15   LEU n 
5 16   GLN n 
5 17   PRO n 
5 18   GLY n 
5 19   PRO n 
5 20   SER n 
5 21   GLU n 
5 22   GLU n 
5 23   THR n 
5 24   ASP n 
5 25   GLU n 
5 26   GLU n 
5 27   LEU n 
5 28   THR n 
5 29   ALA n 
5 30   ARG n 
5 31   PHE n 
5 32   GLU n 
5 33   ARG n 
5 34   ASP n 
5 35   ALA n 
5 36   ILE n 
5 37   PRO n 
5 38   LEU n 
5 39   LEU n 
5 40   ASP n 
5 41   GLN n 
5 42   LEU n 
5 43   TYR n 
5 44   GLY n 
5 45   GLY n 
5 46   ALA n 
5 47   LEU n 
5 48   ARG n 
5 49   MET n 
5 50   THR n 
5 51   ARG n 
5 52   ASN n 
5 53   PRO n 
5 54   ALA n 
5 55   ASP n 
5 56   ALA n 
5 57   GLU n 
5 58   ASP n 
5 59   LEU n 
5 60   LEU n 
5 61   GLN n 
5 62   GLU n 
5 63   THR n 
5 64   MET n 
5 65   VAL n 
5 66   LYS n 
5 67   ALA n 
5 68   TYR n 
5 69   ALA n 
5 70   GLY n 
5 71   PHE n 
5 72   ARG n 
5 73   SER n 
5 74   PHE n 
5 75   ARG n 
5 76   HIS n 
5 77   GLY n 
5 78   THR n 
5 79   ASN n 
5 80   LEU n 
5 81   LYS n 
5 82   ALA n 
5 83   TRP n 
5 84   LEU n 
5 85   TYR n 
5 86   ARG n 
5 87   ILE n 
5 88   LEU n 
5 89   THR n 
5 90   ASN n 
5 91   THR n 
5 92   TYR n 
5 93   ILE n 
5 94   ASN n 
5 95   SER n 
5 96   TYR n 
5 97   ARG n 
5 98   LYS n 
5 99   LYS n 
5 100  GLN n 
5 101  ARG n 
5 102  GLN n 
5 103  PRO n 
5 104  ALA n 
5 105  GLU n 
5 106  TYR n 
5 107  PRO n 
5 108  THR n 
5 109  GLU n 
5 110  GLN n 
5 111  ILE n 
5 112  THR n 
5 113  ASP n 
5 114  TRP n 
5 115  GLN n 
5 116  LEU n 
5 117  ALA n 
5 118  SER n 
5 119  ASN n 
5 120  ALA n 
5 121  GLU n 
5 122  HIS n 
5 123  SER n 
5 124  SER n 
5 125  THR n 
5 126  GLY n 
5 127  LEU n 
5 128  ARG n 
5 129  SER n 
5 130  ALA n 
5 131  GLU n 
5 132  VAL n 
5 133  GLU n 
5 134  ALA n 
5 135  LEU n 
5 136  GLU n 
5 137  ALA n 
5 138  LEU n 
5 139  PRO n 
5 140  ASP n 
5 141  THR n 
5 142  GLU n 
5 143  ILE n 
5 144  LYS n 
5 145  GLU n 
5 146  ALA n 
5 147  LEU n 
5 148  GLN n 
5 149  ALA n 
5 150  LEU n 
5 151  PRO n 
5 152  GLU n 
5 153  GLU n 
5 154  PHE n 
5 155  ARG n 
5 156  MET n 
5 157  ALA n 
5 158  VAL n 
5 159  TYR n 
5 160  TYR n 
5 161  ALA n 
5 162  ASP n 
5 163  VAL n 
5 164  GLU n 
5 165  GLY n 
5 166  PHE n 
5 167  PRO n 
5 168  TYR n 
5 169  LYS n 
5 170  GLU n 
5 171  ILE n 
5 172  ALA n 
5 173  GLU n 
5 174  ILE n 
5 175  MET n 
5 176  ASP n 
5 177  THR n 
5 178  PRO n 
5 179  ILE n 
5 180  GLY n 
5 181  THR n 
5 182  VAL n 
5 183  MET n 
5 184  SER n 
5 185  ARG n 
5 186  LEU n 
5 187  HIS n 
5 188  ARG n 
5 189  GLY n 
5 190  ARG n 
5 191  ARG n 
5 192  GLN n 
5 193  LEU n 
5 194  ARG n 
5 195  GLY n 
5 196  LEU n 
5 197  LEU n 
5 198  ALA n 
5 199  ASP n 
5 200  VAL n 
5 201  ALA n 
5 202  ARG n 
5 203  ASP n 
5 204  ARG n 
5 205  GLY n 
5 206  PHE n 
5 207  ALA n 
5 208  ARG n 
5 209  GLY n 
5 210  GLU n 
5 211  GLN n 
5 212  ALA n 
5 213  HIS n 
5 214  GLU n 
5 215  GLY n 
5 216  VAL n 
5 217  SER n 
5 218  SER n 
6 1    DC  n 
6 2    DG  n 
6 3    DG  n 
6 4    DA  n 
6 5    DA  n 
6 6    DC  n 
6 7    DA  n 
6 8    DG  n 
6 9    DT  n 
6 10   DT  n 
6 11   DG  n 
6 12   DC  n 
6 13   DG  n 
6 14   DA  n 
6 15   DC  n 
6 16   DT  n 
6 17   DT  n 
6 18   DA  n 
6 19   DG  n 
6 20   DA  n 
6 21   DC  n 
6 22   DG  n 
6 23   DT  n 
6 24   DG  n 
6 25   DG  n 
6 26   DT  n 
6 27   DT  n 
6 28   DG  n 
6 29   DT  n 
6 30   DG  n 
6 31   DG  n 
6 32   DG  n 
6 33   DA  n 
6 34   DG  n 
6 35   DC  n 
6 36   DT  n 
6 37   DG  n 
6 38   DC  n 
6 39   DT  n 
6 40   DA  n 
6 41   DT  n 
6 42   DA  n 
6 43   DC  n 
6 44   DT  n 
6 45   DC  n 
6 46   DT  n 
6 47   DC  n 
6 48   DC  n 
7 1    DG  n 
7 2    DG  n 
7 3    DA  n 
7 4    DG  n 
7 5    DA  n 
7 6    DG  n 
7 7    DT  n 
7 8    DA  n 
7 9    DT  n 
7 10   DA  n 
7 11   DG  n 
7 12   DG  n 
7 13   DT  n 
7 14   DC  n 
7 15   DG  n 
7 16   DA  n 
7 17   DG  n 
7 18   DG  n 
7 19   DG  n 
7 20   DT  n 
7 21   DG  n 
7 22   DT  n 
7 23   DA  n 
7 24   DC  n 
7 25   DC  n 
7 26   DA  n 
7 27   DC  n 
7 28   DG  n 
7 29   DT  n 
7 30   DC  n 
7 31   DT  n 
7 32   DA  n 
7 33   DA  n 
7 34   DG  n 
7 35   DT  n 
7 36   DC  n 
7 37   DG  n 
7 38   DC  n 
7 39   DA  n 
7 40   DA  n 
7 41   DC  n 
7 42   DT  n 
7 43   DG  n 
7 44   DT  n 
7 45   DT  n 
7 46   DC  n 
7 47   DC  n 
8 1    C   n 
8 2    C   n 
8 3    C   n 
8 4    U   n 
8 5    C   n 
8 6    G   n 
8 7    A   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 368  ? ? 'rpoA, Rv3457c, MTCY13E12.10c'      ? H37Rv ? ? ? ? 'Mycobacterium tuberculosis H37Rv' 
83332 ? ? 25618 ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pACYCduet ? ? 
2 1 sample 'Biological sequence' 1 1174 ? ? 'rpoB, Rv0667, MTCI376.08c'         ? H37Rv ? ? ? ? 'Mycobacterium tuberculosis H37Rv' 
83332 ? ? 25618 ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pETduet   ? ? 
3 1 sample 'Biological sequence' 1 1317 ? ? 'rpoC, Rv0668, MTCI376.07c'         ? H37Rv ? ? ? ? 'Mycobacterium tuberculosis H37Rv' 
83332 ? ? 25618 ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pETduet   ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'         ? H37Rv ? ? ? ? 'Mycobacterium tuberculosis H37Rv' 
83332 ? ? 25618 ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pACYCduet ? ? 
5 1 sample 'Biological sequence' 1 218  ? ? 'sigH, rpoE, Rv3223c, MTCY07D11.03' ? H37Rv ? ? ? ? 'Mycobacterium tuberculosis H37Rv' 
83332 ? ? 25618 ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pTOLO-EX5 ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 48 'synthetic construct' ? 32630 ? 
7 1 sample 1 47 'synthetic construct' ? 32630 ? 
8 1 sample 1 7  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;LADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGL
EEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTF
IINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTSE
QIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHVGE
PITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTT
QDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPI
ETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAG
EVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAEE
SGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLLVAIMPW
EGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKV
TPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDGDKLA
GRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLPDELLEA
QPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARST
GPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLK
ELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
7 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;LDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVE
VTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKA
VEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENLY
RELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVIP
PELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKS
LSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQRP
QVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLS
SNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQLR
PPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAGF
YWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPIIT
IVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVS
QDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQVK
VRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVPR
GKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHEV
LRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEPA
AGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARAA
AYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
2 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGH_MYCTU P9WGH9 ? 5 
;MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKA
WLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYAD
VEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
;
1 
6 PDB 5ZX2       5ZX2   ? 6 ? 1 
7 PDB 5ZX2       5ZX2   ? 7 ? 1 
8 PDB 5ZX2       5ZX2   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ZX2 A 22 ? 368  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 5ZX2 B 22 ? 368  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 5ZX2 C 3  ? 1174 ? P9WGY9 7 ? 1178 ? 7 1178 
4 3 5ZX2 D 3  ? 1317 ? P9WGY7 2 ? 1316 ? 2 1316 
5 4 5ZX2 E 1  ? 110  ? P9WGY5 1 ? 110  ? 0 109  
6 5 5ZX2 F 3  ? 218  ? P9WGH9 1 ? 216  ? 1 216  
7 6 5ZX2 G 1  ? 48   ? 5ZX2   1 ? 48   ? 1 48   
8 7 5ZX2 H 1  ? 47   ? 5ZX2   1 ? 47   ? 1 47   
9 8 5ZX2 I 1  ? 7    ? 5ZX2   1 ? 7    ? 1 7    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ZX2 MET A 1  ? UNP P9WGZ1 ? ? 'expression tag' -20 1  
1 5ZX2 GLY A 2  ? UNP P9WGZ1 ? ? 'expression tag' -19 2  
1 5ZX2 HIS A 3  ? UNP P9WGZ1 ? ? 'expression tag' -18 3  
1 5ZX2 HIS A 4  ? UNP P9WGZ1 ? ? 'expression tag' -17 4  
1 5ZX2 HIS A 5  ? UNP P9WGZ1 ? ? 'expression tag' -16 5  
1 5ZX2 HIS A 6  ? UNP P9WGZ1 ? ? 'expression tag' -15 6  
1 5ZX2 HIS A 7  ? UNP P9WGZ1 ? ? 'expression tag' -14 7  
1 5ZX2 HIS A 8  ? UNP P9WGZ1 ? ? 'expression tag' -13 8  
1 5ZX2 HIS A 9  ? UNP P9WGZ1 ? ? 'expression tag' -12 9  
1 5ZX2 HIS A 10 ? UNP P9WGZ1 ? ? 'expression tag' -11 10 
1 5ZX2 HIS A 11 ? UNP P9WGZ1 ? ? 'expression tag' -10 11 
1 5ZX2 HIS A 12 ? UNP P9WGZ1 ? ? 'expression tag' -9  12 
1 5ZX2 SER A 13 ? UNP P9WGZ1 ? ? 'expression tag' -8  13 
1 5ZX2 SER A 14 ? UNP P9WGZ1 ? ? 'expression tag' -7  14 
1 5ZX2 GLY A 15 ? UNP P9WGZ1 ? ? 'expression tag' -6  15 
1 5ZX2 HIS A 16 ? UNP P9WGZ1 ? ? 'expression tag' -5  16 
1 5ZX2 ILE A 17 ? UNP P9WGZ1 ? ? 'expression tag' -4  17 
1 5ZX2 GLU A 18 ? UNP P9WGZ1 ? ? 'expression tag' -3  18 
1 5ZX2 GLY A 19 ? UNP P9WGZ1 ? ? 'expression tag' -2  19 
1 5ZX2 ARG A 20 ? UNP P9WGZ1 ? ? 'expression tag' -1  20 
1 5ZX2 HIS A 21 ? UNP P9WGZ1 ? ? 'expression tag' 0   21 
2 5ZX2 MET B 1  ? UNP P9WGZ1 ? ? 'expression tag' -20 22 
2 5ZX2 GLY B 2  ? UNP P9WGZ1 ? ? 'expression tag' -19 23 
2 5ZX2 HIS B 3  ? UNP P9WGZ1 ? ? 'expression tag' -18 24 
2 5ZX2 HIS B 4  ? UNP P9WGZ1 ? ? 'expression tag' -17 25 
2 5ZX2 HIS B 5  ? UNP P9WGZ1 ? ? 'expression tag' -16 26 
2 5ZX2 HIS B 6  ? UNP P9WGZ1 ? ? 'expression tag' -15 27 
2 5ZX2 HIS B 7  ? UNP P9WGZ1 ? ? 'expression tag' -14 28 
2 5ZX2 HIS B 8  ? UNP P9WGZ1 ? ? 'expression tag' -13 29 
2 5ZX2 HIS B 9  ? UNP P9WGZ1 ? ? 'expression tag' -12 30 
2 5ZX2 HIS B 10 ? UNP P9WGZ1 ? ? 'expression tag' -11 31 
2 5ZX2 HIS B 11 ? UNP P9WGZ1 ? ? 'expression tag' -10 32 
2 5ZX2 HIS B 12 ? UNP P9WGZ1 ? ? 'expression tag' -9  33 
2 5ZX2 SER B 13 ? UNP P9WGZ1 ? ? 'expression tag' -8  34 
2 5ZX2 SER B 14 ? UNP P9WGZ1 ? ? 'expression tag' -7  35 
2 5ZX2 GLY B 15 ? UNP P9WGZ1 ? ? 'expression tag' -6  36 
2 5ZX2 HIS B 16 ? UNP P9WGZ1 ? ? 'expression tag' -5  37 
2 5ZX2 ILE B 17 ? UNP P9WGZ1 ? ? 'expression tag' -4  38 
2 5ZX2 GLU B 18 ? UNP P9WGZ1 ? ? 'expression tag' -3  39 
2 5ZX2 GLY B 19 ? UNP P9WGZ1 ? ? 'expression tag' -2  40 
2 5ZX2 ARG B 20 ? UNP P9WGZ1 ? ? 'expression tag' -1  41 
2 5ZX2 HIS B 21 ? UNP P9WGZ1 ? ? 'expression tag' 0   42 
3 5ZX2 MET C 1  ? UNP P9WGY9 ? ? 'expression tag' 5   43 
3 5ZX2 VAL C 2  ? UNP P9WGY9 ? ? 'expression tag' 6   44 
4 5ZX2 MET D 1  ? UNP P9WGY7 ? ? 'expression tag' 0   45 
4 5ZX2 VAL D 2  ? UNP P9WGY7 ? ? 'expression tag' 1   46 
6 5ZX2 GLY F 1  ? UNP P9WGH9 ? ? 'expression tag' -1  47 
6 5ZX2 ALA F 2  ? UNP P9WGH9 ? ? 'expression tag' 0   48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ZX2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.79 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.84 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2% Tacsimate pH 5.0, 0.1 M Sodium citrate pH5.6, 16 % PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-12-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.entry_id                     5ZX2 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   113375 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.800 
_reflns.pdbx_Rmerge_I_obs            0.164 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.900 
_reflns.B_iso_Wilson_estimate        60.590 
_reflns.pdbx_redundancy              8.500 
_reflns.pdbx_Rrim_I_all              0.175 
_reflns.pdbx_Rpim_I_all              0.059 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_netI_over_av_sigmaI     ? 
_reflns.pdbx_number_measured_all     963049 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_chi_squared             1.106 
_reflns.Rmerge_F_all                 ? 
_reflns.Rmerge_F_obs                 ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.observed_criterion_I_max     ? 
_reflns.observed_criterion_I_min     ? 
_reflns.pdbx_d_res_high_opt          ? 
_reflns.pdbx_d_res_low_opt           ? 
_reflns.details                      ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  2.800 2.850  ? ? 5564 ? 1.430 ? ? 0.870 8.400 ? ? ? ? ? ? ? ? 99.500  1.524 0.518 0.547 
1 2  2.850 2.900  ? ? 5600 ? 1.241 ? ? 0.876 8.600 ? ? ? ? ? ? ? ? 99.800  1.322 0.447 0.639 
1 3  2.900 2.960  ? ? 5642 ? 1.110 ? ? 0.899 8.800 ? ? ? ? ? ? ? ? 100.000 1.180 0.398 0.691 
1 4  2.960 3.020  ? ? 5610 ? 0.942 ? ? 0.913 8.800 ? ? ? ? ? ? ? ? 100.000 1.001 0.337 0.768 
1 5  3.020 3.080  ? ? 5611 ? 0.798 ? ? 0.932 8.700 ? ? ? ? ? ? ? ? 100.000 0.849 0.287 0.814 
1 6  3.080 3.150  ? ? 5635 ? 0.669 ? ? 0.945 8.600 ? ? ? ? ? ? ? ? 99.900  0.712 0.242 0.852 
1 7  3.150 3.230  ? ? 5621 ? 0.549 ? ? 0.993 8.500 ? ? ? ? ? ? ? ? 100.000 0.585 0.201 0.883 
1 8  3.230 3.320  ? ? 5627 ? 0.433 ? ? 1.029 8.400 ? ? ? ? ? ? ? ? 99.900  0.462 0.159 0.931 
1 9  3.320 3.420  ? ? 5663 ? 0.348 ? ? 1.084 7.900 ? ? ? ? ? ? ? ? 99.800  0.373 0.132 0.943 
1 10 3.420 3.530  ? ? 5598 ? 0.273 ? ? 1.166 7.800 ? ? ? ? ? ? ? ? 99.500  0.293 0.103 0.964 
1 11 3.530 3.650  ? ? 5655 ? 0.241 ? ? 1.213 9.000 ? ? ? ? ? ? ? ? 100.000 0.256 0.085 0.977 
1 12 3.650 3.800  ? ? 5660 ? 0.192 ? ? 1.237 9.000 ? ? ? ? ? ? ? ? 100.000 0.203 0.067 0.985 
1 13 3.800 3.970  ? ? 5647 ? 0.162 ? ? 1.170 8.900 ? ? ? ? ? ? ? ? 100.000 0.172 0.057 0.989 
1 14 3.970 4.180  ? ? 5679 ? 0.132 ? ? 1.249 8.700 ? ? ? ? ? ? ? ? 100.000 0.141 0.047 0.991 
1 15 4.180 4.440  ? ? 5691 ? 0.115 ? ? 1.277 8.600 ? ? ? ? ? ? ? ? 100.000 0.122 0.041 0.993 
1 16 4.440 4.790  ? ? 5686 ? 0.100 ? ? 1.283 8.300 ? ? ? ? ? ? ? ? 99.700  0.106 0.036 0.994 
1 17 4.790 5.270  ? ? 5691 ? 0.094 ? ? 1.205 7.600 ? ? ? ? ? ? ? ? 99.400  0.101 0.035 0.994 
1 18 5.270 6.030  ? ? 5745 ? 0.092 ? ? 1.295 8.900 ? ? ? ? ? ? ? ? 100.000 0.097 0.032 0.995 
1 19 6.030 7.590  ? ? 5809 ? 0.075 ? ? 1.273 8.600 ? ? ? ? ? ? ? ? 99.900  0.080 0.027 0.997 
1 20 7.590 50.000 ? ? 5941 ? 0.053 ? ? 1.199 7.600 ? ? ? ? ? ? ? ? 98.100  0.057 0.020 0.997 
# 
_refine.entry_id                                 5ZX2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.8000 
_refine.ls_d_res_low                             36.9410 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7800 
_refine.ls_number_reflns_obs                     112969 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2207 
_refine.ls_R_factor_R_work                       0.2200 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2546 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 2.0200 
_refine.ls_number_reflns_R_free                  2283 
_refine.ls_number_reflns_R_work                  110686 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               66.0881 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.3700 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      5TW1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                221.220 
_refine.B_iso_min                                23.340 
_refine.pdbx_overall_phase_error                 27.8700 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.8000 
_refine_hist.d_res_low                        36.9410 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               25858 
_refine_hist.pdbx_number_residues_total       3199 
_refine_hist.pdbx_B_iso_mean_ligand           69.22 
_refine_hist.pdbx_B_iso_mean_solvent          43.00 
_refine_hist.pdbx_number_atoms_protein        23744 
_refine_hist.pdbx_number_atoms_nucleic_acid   2065 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           26477 0.005  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          36330 0.621  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     4154  0.044  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      4428  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 15793 18.183 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
2.8000 2.8609  16 100.0000 6823 . 0.3403 0.3801 . 141 0.0000 6964 . 'X-RAY DIFFRACTION' . 
2.8609 2.9274  16 100.0000 6854 . 0.3262 0.3670 . 142 0.0000 6996 . 'X-RAY DIFFRACTION' . 
2.9274 3.0006  16 100.0000 6858 . 0.3145 0.3410 . 141 0.0000 6999 . 'X-RAY DIFFRACTION' . 
3.0006 3.0817  16 100.0000 6842 . 0.3080 0.3164 . 142 0.0000 6984 . 'X-RAY DIFFRACTION' . 
3.0817 3.1723  16 100.0000 6891 . 0.3012 0.3367 . 141 0.0000 7032 . 'X-RAY DIFFRACTION' . 
3.1723 3.2746  16 100.0000 6852 . 0.2885 0.3090 . 142 0.0000 6994 . 'X-RAY DIFFRACTION' . 
3.2746 3.3916  16 100.0000 6860 . 0.2637 0.3285 . 140 0.0000 7000 . 'X-RAY DIFFRACTION' . 
3.3916 3.5273  16 100.0000 6869 . 0.2428 0.2705 . 143 0.0000 7012 . 'X-RAY DIFFRACTION' . 
3.5273 3.6877  16 100.0000 6880 . 0.2308 0.2904 . 141 0.0000 7021 . 'X-RAY DIFFRACTION' . 
3.6877 3.8819  16 100.0000 6932 . 0.2227 0.2730 . 143 0.0000 7075 . 'X-RAY DIFFRACTION' . 
3.8819 4.1248  16 100.0000 6922 . 0.1992 0.2540 . 144 0.0000 7066 . 'X-RAY DIFFRACTION' . 
4.1248 4.4428  16 100.0000 6929 . 0.1832 0.2498 . 142 0.0000 7071 . 'X-RAY DIFFRACTION' . 
4.4428 4.8890  16 100.0000 6947 . 0.1748 0.2251 . 144 0.0000 7091 . 'X-RAY DIFFRACTION' . 
4.8890 5.5943  16 100.0000 6957 . 0.1955 0.2356 . 143 0.0000 7100 . 'X-RAY DIFFRACTION' . 
5.5943 7.0403  16 100.0000 7052 . 0.2086 0.2150 . 146 0.0000 7198 . 'X-RAY DIFFRACTION' . 
7.0403 36.9440 16 99.0000  7218 . 0.1726 0.1722 . 148 0.0000 7366 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                     5ZX2 
_struct.title                        
'Mycobacterium tuberculosis RNA polymerase transcription initiation complex with ECF sigma factor sigma H and 7nt RNA' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, ECF RNA polymerase sigma factor SigH/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ZX2 
_struct_keywords.text            
'Mycobacterium tuberculosis, RNA polymerase, sigma H, transcription initiation, TRANSCRIPTION-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 9  ? 
L N N 10 ? 
M N N 10 ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PHE A 51   ? ILE A 67   ? PHE A 30   ILE A 46   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 93   ? LYS A 102  ? ASP A 72   LYS A 81   1 ? 10 
HELX_P HELX_P3   AA3 GLY A 129  ? ILE A 131  ? GLY A 108  ILE A 110  5 ? 3  
HELX_P HELX_P4   AA4 GLN A 172  ? SER A 176  ? GLN A 151  SER A 155  5 ? 5  
HELX_P HELX_P5   AA5 SER A 224  ? GLY A 241  ? SER A 203  GLY A 220  1 ? 18 
HELX_P HELX_P6   AA6 GLY B 50   ? SER B 66   ? GLY B 29   SER B 45   1 ? 17 
HELX_P HELX_P7   AA7 ASP B 93   ? SER B 103  ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P8   AA8 GLY B 129  ? ILE B 131  ? GLY B 108  ILE B 110  5 ? 3  
HELX_P HELX_P9   AA9 ALA B 170  ? ARG B 174  ? ALA B 149  ARG B 153  5 ? 5  
HELX_P HELX_P10  AB1 SER B 224  ? GLU B 245  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P11  AB2 LEU C 50   ? GLY C 62   ? LEU C 54   GLY C 66   1 ? 13 
HELX_P HELX_P12  AB3 SER C 63   ? GLY C 74   ? SER C 67   GLY C 78   1 ? 12 
HELX_P HELX_P13  AB4 GLY C 80   ? SER C 90   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P14  AB5 PRO C 114  ? ASP C 122  ? PRO C 118  ASP C 126  1 ? 9  
HELX_P HELX_P15  AB6 PRO C 229  ? LEU C 237  ? PRO C 233  LEU C 241  1 ? 9  
HELX_P HELX_P16  AB7 THR C 240  ? GLY C 249  ? THR C 244  GLY C 253  1 ? 10 
HELX_P HELX_P17  AB8 SER C 251  ? ASP C 261  ? SER C 255  ASP C 265  1 ? 11 
HELX_P HELX_P18  AB9 GLY C 265  ? ARG C 278  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P19  AC1 THR C 284  ? PHE C 296  ? THR C 288  PHE C 300  1 ? 13 
HELX_P HELX_P20  AC2 ALA C 305  ? GLY C 317  ? ALA C 309  GLY C 321  1 ? 13 
HELX_P HELX_P21  AC3 THR C 330  ? GLY C 347  ? THR C 334  GLY C 351  1 ? 18 
HELX_P HELX_P22  AC4 THR C 376  ? GLN C 403  ? THR C 380  GLN C 407  1 ? 28 
HELX_P HELX_P23  AC5 THR C 409  ? ILE C 414  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P24  AC6 ILE C 416  ? SER C 430  ? ILE C 420  SER C 434  1 ? 15 
HELX_P HELX_P25  AC7 ASN C 440  ? ARG C 449  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P26  AC8 HIS C 472  ? TYR C 476  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P27  AC9 THR C 528  ? ARG C 534  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P28  AD1 ALA C 586  ? ILE C 590  ? ALA C 590  ILE C 594  5 ? 5  
HELX_P HELX_P29  AD2 PHE C 592  ? ASP C 596  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P30  AD3 ASP C 597  ? ARG C 609  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P31  AD4 MET C 626  ? GLY C 635  ? MET C 630  GLY C 639  1 ? 10 
HELX_P HELX_P32  AD5 ASN C 735  ? GLU C 740  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P33  AD6 GLY C 806  ? LEU C 810  ? GLY C 810  LEU C 814  5 ? 5  
HELX_P HELX_P34  AD7 THR C 811  ? PHE C 821  ? THR C 815  PHE C 825  1 ? 11 
HELX_P HELX_P35  AD8 PRO C 896  ? MET C 900  ? PRO C 900  MET C 904  5 ? 5  
HELX_P HELX_P36  AD9 ASN C 914  ? MET C 922  ? ASN C 918  MET C 926  5 ? 9  
HELX_P HELX_P37  AE1 ILE C 924  ? GLY C 939  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P38  AE2 PRO C 956  ? LEU C 959  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P39  AE3 GLN C 977  ? LEU C 985  ? GLN C 981  LEU C 989  1 ? 9  
HELX_P HELX_P40  AE4 LEU C 1032 ? ILE C 1037 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P41  AE5 GLY C 1065 ? GLY C 1076 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P42  AE6 ALA C 1077 ? THR C 1086 ? ALA C 1081 THR C 1090 1 ? 10 
HELX_P HELX_P43  AE7 ASP C 1091 ? LYS C 1104 ? ASP C 1095 LYS C 1108 1 ? 14 
HELX_P HELX_P44  AE8 PRO C 1114 ? SER C 1126 ? PRO C 1118 SER C 1130 1 ? 13 
HELX_P HELX_P45  AE9 GLU C 1147 ? LEU C 1158 ? GLU C 1151 LEU C 1162 1 ? 12 
HELX_P HELX_P46  AF1 THR D 17   ? SER D 25   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P47  AF2 CYS D 49   ? GLY D 54   ? CYS D 48   GLY D 53   1 ? 6  
HELX_P HELX_P48  AF3 ARG D 68   ? LYS D 72   ? ARG D 67   LYS D 71   5 ? 5  
HELX_P HELX_P49  AF4 LYS D 87   ? ARG D 92   ? LYS D 86   ARG D 91   1 ? 6  
HELX_P HELX_P50  AF5 ILE D 105  ? PHE D 108  ? ILE D 104  PHE D 107  5 ? 4  
HELX_P HELX_P51  AF6 SER D 113  ? ASP D 120  ? SER D 112  ASP D 119  1 ? 8  
HELX_P HELX_P52  AF7 ALA D 122  ? TYR D 131  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P53  AF8 ASP D 141  ? GLU D 188  ? ASP D 140  GLU D 187  1 ? 48 
HELX_P HELX_P54  AF9 ALA D 192  ? LYS D 229  ? ALA D 191  LYS D 228  1 ? 38 
HELX_P HELX_P55  AG1 ASP D 238  ? ARG D 248  ? ASP D 237  ARG D 247  1 ? 11 
HELX_P HELX_P56  AG2 TYR D 249  ? GLU D 251  ? TYR D 248  GLU D 250  5 ? 3  
HELX_P HELX_P57  AG3 MET D 257  ? ASN D 268  ? MET D 256  ASN D 267  1 ? 12 
HELX_P HELX_P58  AG4 ASP D 270  ? GLY D 285  ? ASP D 269  GLY D 284  1 ? 16 
HELX_P HELX_P59  AG5 GLY D 287  ? GLN D 305  ? GLY D 286  GLN D 304  1 ? 19 
HELX_P HELX_P60  AG6 SER D 309  ? GLY D 312  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P61  AG7 PRO D 322  ? ARG D 326  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P62  AG8 ASP D 340  ? LEU D 361  ? ASP D 339  LEU D 360  1 ? 22 
HELX_P HELX_P63  AG9 PRO D 364  ? ASP D 384  ? PRO D 363  ASP D 383  1 ? 21 
HELX_P HELX_P64  AH1 GLY D 394  ? ARG D 398  ? GLY D 393  ARG D 397  5 ? 5  
HELX_P HELX_P65  AH2 SER D 402  ? LYS D 408  ? SER D 401  LYS D 407  1 ? 7  
HELX_P HELX_P66  AH3 GLY D 412  ? LEU D 418  ? GLY D 411  LEU D 417  1 ? 7  
HELX_P HELX_P67  AH4 LYS D 446  ? PHE D 453  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P68  AH5 PHE D 453  ? LEU D 464  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P69  AH6 ASN D 469  ? ARG D 479  ? ASN D 468  ARG D 478  1 ? 11 
HELX_P HELX_P70  AH7 GLN D 483  ? ALA D 493  ? GLN D 482  ALA D 492  1 ? 11 
HELX_P HELX_P71  AH8 HIS D 506  ? LEU D 508  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P72  AH9 HIS D 526  ? LEU D 528  ? HIS D 525  LEU D 527  5 ? 3  
HELX_P HELX_P73  AI1 VAL D 529  ? ASN D 534  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P74  AI2 SER D 549  ? LEU D 559  ? SER D 548  LEU D 558  1 ? 11 
HELX_P HELX_P75  AI3 LEU D 561  ? ASN D 565  ? LEU D 560  ASN D 564  5 ? 5  
HELX_P HELX_P76  AI4 LEU D 580  ? THR D 591  ? LEU D 579  THR D 590  1 ? 12 
HELX_P HELX_P77  AI5 SER D 615  ? ARG D 625  ? SER D 614  ARG D 624  1 ? 11 
HELX_P HELX_P78  AI6 PRO D 644  ? PHE D 652  ? PRO D 643  PHE D 651  1 ? 9  
HELX_P HELX_P79  AI7 LEU D 669  ? LEU D 678  ? LEU D 668  LEU D 677  1 ? 10 
HELX_P HELX_P80  AI8 HIS D 690  ? TYR D 705  ? HIS D 689  TYR D 704  1 ? 16 
HELX_P HELX_P81  AI9 PRO D 706  ? ARG D 727  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P82  AJ1 ARG D 742  ? ARG D 763  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P83  AJ2 ASN D 767  ? TYR D 794  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P84  AJ3 ASN D 798  ? SER D 806  ? ASN D 797  SER D 805  1 ? 9  
HELX_P HELX_P85  AJ4 ASN D 811  ? GLY D 820  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P86  AJ5 THR D 846  ? GLN D 883  ? THR D 845  GLN D 882  1 ? 38 
HELX_P HELX_P87  AJ6 GLY D 946  ? ALA D 956  ? GLY D 945  ALA D 955  1 ? 11 
HELX_P HELX_P88  AJ7 ALA D 977  ? GLY D 981  ? ALA D 976  GLY D 980  1 ? 5  
HELX_P HELX_P89  AJ8 ALA D 995  ? GLU D 1006 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P90  AJ9 PRO D 1007 ? LEU D 1011 ? PRO D 1006 LEU D 1010 5 ? 5  
HELX_P HELX_P91  AK1 GLY D 1028 ? GLU D 1037 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P92  AK2 ASP D 1118 ? GLY D 1127 ? ASP D 1117 GLY D 1126 1 ? 10 
HELX_P HELX_P93  AK3 GLY D 1127 ? GLN D 1146 ? GLY D 1126 GLN D 1145 1 ? 20 
HELX_P HELX_P94  AK4 HIS D 1151 ? LEU D 1163 ? HIS D 1150 LEU D 1162 1 ? 13 
HELX_P HELX_P95  AK5 ARG D 1184 ? GLU D 1190 ? ARG D 1183 GLU D 1189 1 ? 7  
HELX_P HELX_P96  AK6 GLY D 1210 ? ALA D 1217 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P97  AK7 SER D 1220 ? SER D 1226 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P98  AK8 GLU D 1229 ? ASN D 1240 ? GLU D 1228 ASN D 1239 1 ? 12 
HELX_P HELX_P99  AK9 GLY D 1248 ? GLY D 1256 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P100 AL1 ALA D 1261 ? GLY D 1264 ? ALA D 1260 GLY D 1263 5 ? 4  
HELX_P HELX_P101 AL2 ILE D 1265 ? ASN D 1270 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P102 AL3 THR D 1276 ? ALA D 1282 ? THR D 1275 ALA D 1281 1 ? 7  
HELX_P HELX_P103 AL4 LEU E 33   ? ASN E 37   ? LEU E 32   ASN E 36   5 ? 5  
HELX_P HELX_P104 AL5 PRO E 39   ? VAL E 47   ? PRO E 38   VAL E 46   1 ? 9  
HELX_P HELX_P105 AL6 SER E 49   ? GLN E 70   ? SER E 48   GLN E 69   1 ? 22 
HELX_P HELX_P106 AL7 LYS E 90   ? ALA E 101  ? LYS E 89   ALA E 100  1 ? 12 
HELX_P HELX_P107 AL8 GLU F 25   ? ALA F 35   ? GLU F 23   ALA F 33   1 ? 11 
HELX_P HELX_P108 AL9 LEU F 38   ? ARG F 51   ? LEU F 36   ARG F 49   1 ? 14 
HELX_P HELX_P109 AM1 ASN F 52   ? GLY F 70   ? ASN F 50   GLY F 68   1 ? 19 
HELX_P HELX_P110 AM2 PHE F 71   ? PHE F 74   ? PHE F 69   PHE F 72   5 ? 4  
HELX_P HELX_P111 AM3 ASN F 79   ? GLN F 102  ? ASN F 77   GLN F 100  1 ? 24 
HELX_P HELX_P112 AM4 THR F 112  ? GLU F 121  ? THR F 110  GLU F 119  1 ? 10 
HELX_P HELX_P113 AM5 SER F 129  ? ALA F 137  ? SER F 127  ALA F 135  1 ? 9  
HELX_P HELX_P114 AM6 ASP F 140  ? LEU F 150  ? ASP F 138  LEU F 148  1 ? 11 
HELX_P HELX_P115 AM7 PRO F 151  ? VAL F 163  ? PRO F 149  VAL F 161  1 ? 13 
HELX_P HELX_P116 AM8 PRO F 167  ? ASP F 176  ? PRO F 165  ASP F 174  1 ? 10 
HELX_P HELX_P117 AM9 PRO F 178  ? LEU F 197  ? PRO F 176  LEU F 195  1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CYS 61  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 60  D ZN 2001 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc2  metalc ? ? D CYS 63  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 62  D ZN 2001 1_555 ? ? ? ? ? ? ?            2.076 ? 
metalc3  metalc ? ? D CYS 76  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 75  D ZN 2001 1_555 ? ? ? ? ? ? ?            2.104 ? 
metalc4  metalc ? ? D CYS 79  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 78  D ZN 2001 1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc5  metalc ? ? D CYS 892 SG ? ? ? 1_555 K ZN .  ZN ? ? D CYS 891 D ZN 2002 1_555 ? ? ? ? ? ? ?            2.183 ? 
metalc6  metalc ? ? D CYS 969 SG ? ? ? 1_555 K ZN .  ZN ? ? D CYS 968 D ZN 2002 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc7  metalc ? ? D CYS 976 SG ? ? ? 1_555 K ZN .  ZN ? ? D CYS 975 D ZN 2002 1_555 ? ? ? ? ? ? ?            2.131 ? 
metalc8  metalc ? ? D CYS 979 SG ? ? ? 1_555 K ZN .  ZN ? ? D CYS 978 D ZN 2002 1_555 ? ? ? ? ? ? ?            2.100 ? 
hydrog1  hydrog ? ? G DG  2   N1 ? ? ? 1_555 H DC 47 N3 ? ? G DG  2   H DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DG  2   N2 ? ? ? 1_555 H DC 47 O2 ? ? G DG  2   H DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  2   O6 ? ? ? 1_555 H DC 47 N4 ? ? G DG  2   H DC 47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DG  3   N1 ? ? ? 1_555 H DC 46 N3 ? ? G DG  3   H DC 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DG  3   N2 ? ? ? 1_555 H DC 46 O2 ? ? G DG  3   H DC 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DG  3   O6 ? ? ? 1_555 H DC 46 N4 ? ? G DG  3   H DC 46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  4   N1 ? ? ? 1_555 H DT 45 N3 ? ? G DA  4   H DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DA  4   N6 ? ? ? 1_555 H DT 45 O4 ? ? G DA  4   H DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DA  5   N1 ? ? ? 1_555 H DT 44 N3 ? ? G DA  5   H DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DA  5   N6 ? ? ? 1_555 H DT 44 O4 ? ? G DA  5   H DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DC  6   N3 ? ? ? 1_555 H DG 43 N1 ? ? G DC  6   H DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DC  6   N4 ? ? ? 1_555 H DG 43 O6 ? ? G DC  6   H DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DC  6   O2 ? ? ? 1_555 H DG 43 N2 ? ? G DC  6   H DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DG  8   N1 ? ? ? 1_555 H DC 41 N3 ? ? G DG  8   H DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DG  8   N2 ? ? ? 1_555 H DC 41 O2 ? ? G DG  8   H DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DG  8   O6 ? ? ? 1_555 H DC 41 N4 ? ? G DG  8   H DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DT  9   N3 ? ? ? 1_555 H DA 40 N1 ? ? G DT  9   H DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DT  9   O4 ? ? ? 1_555 H DA 40 N6 ? ? G DT  9   H DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DT  10  N3 ? ? ? 1_555 H DA 39 N1 ? ? G DT  10  H DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DT  10  O4 ? ? ? 1_555 H DA 39 N6 ? ? G DT  10  H DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DG  11  N1 ? ? ? 1_555 H DC 38 N3 ? ? G DG  11  H DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DG  11  N2 ? ? ? 1_555 H DC 38 O2 ? ? G DG  11  H DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DG  11  O6 ? ? ? 1_555 H DC 38 N4 ? ? G DG  11  H DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G DC  12  N3 ? ? ? 1_555 H DG 37 N1 ? ? G DC  12  H DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DC  12  N4 ? ? ? 1_555 H DG 37 O6 ? ? G DC  12  H DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DC  12  O2 ? ? ? 1_555 H DG 37 N2 ? ? G DC  12  H DG 37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G DG  13  N1 ? ? ? 1_555 H DC 36 N3 ? ? G DG  13  H DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G DG  13  N2 ? ? ? 1_555 H DC 36 O2 ? ? G DG  13  H DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G DG  13  O6 ? ? ? 1_555 H DC 36 N4 ? ? G DG  13  H DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G DA  14  N1 ? ? ? 1_555 H DT 35 N3 ? ? G DA  14  H DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G DA  14  N6 ? ? ? 1_555 H DT 35 O4 ? ? G DA  14  H DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G DC  15  N3 ? ? ? 1_555 H DG 34 N1 ? ? G DC  15  H DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G DC  15  N4 ? ? ? 1_555 H DG 34 O6 ? ? G DC  15  H DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G DC  15  O2 ? ? ? 1_555 H DG 34 N2 ? ? G DC  15  H DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? G DT  16  O4 ? ? ? 1_555 H DA 33 N6 ? ? G DT  16  H DA 33   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog36 hydrog ? ? G DT  17  N3 ? ? ? 1_555 H DA 32 N1 ? ? G DT  17  H DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? G DT  17  O4 ? ? ? 1_555 H DA 32 N6 ? ? G DT  17  H DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? G DA  18  N1 ? ? ? 1_555 H DT 31 N3 ? ? G DA  18  H DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? G DA  18  N6 ? ? ? 1_555 H DT 31 O4 ? ? G DA  18  H DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? G DG  19  N1 ? ? ? 1_555 H DC 30 N3 ? ? G DG  19  H DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? G DG  19  N2 ? ? ? 1_555 H DC 30 O2 ? ? G DG  19  H DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? G DG  19  O6 ? ? ? 1_555 H DC 30 N4 ? ? G DG  19  H DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? G DA  20  N1 ? ? ? 1_555 H DT 29 N3 ? ? G DA  20  H DT 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? G DA  20  N6 ? ? ? 1_555 H DT 29 O4 ? ? G DA  20  H DT 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? G DC  21  N3 ? ? ? 1_555 H DG 28 N1 ? ? G DC  21  H DG 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? G DC  21  N4 ? ? ? 1_555 H DG 28 O6 ? ? G DC  21  H DG 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? G DC  21  O2 ? ? ? 1_555 H DG 28 N2 ? ? G DC  21  H DG 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? G DG  22  N1 ? ? ? 1_555 H DC 27 N3 ? ? G DG  22  H DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? G DG  22  N2 ? ? ? 1_555 H DC 27 O2 ? ? G DG  22  H DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? G DG  22  O6 ? ? ? 1_555 H DC 27 N4 ? ? G DG  22  H DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? G DT  23  N3 ? ? ? 1_555 H DA 26 N1 ? ? G DT  23  H DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? G DT  23  O4 ? ? ? 1_555 H DA 26 N6 ? ? G DT  23  H DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? G DG  24  N1 ? ? ? 1_555 H DC 25 N3 ? ? G DG  24  H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? G DG  24  N2 ? ? ? 1_555 H DC 25 O2 ? ? G DG  24  H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? G DG  24  O6 ? ? ? 1_555 H DC 25 N4 ? ? G DG  24  H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? G DG  25  N1 ? ? ? 1_555 H DC 24 N3 ? ? G DG  25  H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? G DG  25  N2 ? ? ? 1_555 H DC 24 O2 ? ? G DG  25  H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? G DG  25  O6 ? ? ? 1_555 H DC 24 N4 ? ? G DG  25  H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? G DC  38  O2 ? ? ? 1_555 H DG 11 N2 ? ? G DC  38  H DG 11   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog60 hydrog ? ? G DT  39  N3 ? ? ? 1_555 H DA 10 N1 ? ? G DT  39  H DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? G DT  39  O4 ? ? ? 1_555 H DA 10 N6 ? ? G DT  39  H DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? G DA  40  N1 ? ? ? 1_555 H DT 9  N3 ? ? G DA  40  H DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? G DA  40  N6 ? ? ? 1_555 H DT 9  O4 ? ? G DA  40  H DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? G DT  41  N3 ? ? ? 1_555 H DA 8  N1 ? ? G DT  41  H DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? G DT  41  O4 ? ? ? 1_555 H DA 8  N6 ? ? G DT  41  H DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? G DA  42  N1 ? ? ? 1_555 H DT 7  N3 ? ? G DA  42  H DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? G DA  42  N6 ? ? ? 1_555 H DT 7  O4 ? ? G DA  42  H DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? G DC  43  N3 ? ? ? 1_555 H DG 6  N1 ? ? G DC  43  H DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? G DC  43  N4 ? ? ? 1_555 H DG 6  O6 ? ? G DC  43  H DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? G DC  43  O2 ? ? ? 1_555 H DG 6  N2 ? ? G DC  43  H DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? G DT  44  N3 ? ? ? 1_555 H DA 5  N1 ? ? G DT  44  H DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? G DT  44  O4 ? ? ? 1_555 H DA 5  N6 ? ? G DT  44  H DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? G DC  45  N3 ? ? ? 1_555 H DG 4  N1 ? ? G DC  45  H DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? G DC  45  N4 ? ? ? 1_555 H DG 4  O6 ? ? G DC  45  H DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? G DC  45  O2 ? ? ? 1_555 H DG 4  N2 ? ? G DC  45  H DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? G DT  46  N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT  46  H DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ? ? G DT  46  O4 ? ? ? 1_555 H DA 3  N6 ? ? G DT  46  H DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ? ? G DC  47  N3 ? ? ? 1_555 H DG 2  N2 ? ? G DC  47  H DG 2    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog79 hydrog ? ? G DC  48  N3 ? ? ? 1_555 H DG 1  N1 ? ? G DC  48  H DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80 hydrog ? ? G DC  48  N4 ? ? ? 1_555 H DG 1  O6 ? ? G DC  48  H DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81 hydrog ? ? G DC  48  O2 ? ? ? 1_555 H DG 1  N2 ? ? G DC  48  H DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82 hydrog ? ? H DT  13  N3 ? ? ? 1_555 I A  7  N1 ? ? H DT  13  I A  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83 hydrog ? ? H DT  13  O4 ? ? ? 1_555 I A  7  N6 ? ? H DT  13  I A  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84 hydrog ? ? H DC  14  N3 ? ? ? 1_555 I G  6  N1 ? ? H DC  14  I G  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85 hydrog ? ? H DC  14  N4 ? ? ? 1_555 I G  6  O6 ? ? H DC  14  I G  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86 hydrog ? ? H DC  14  O2 ? ? ? 1_555 I G  6  N2 ? ? H DC  14  I G  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87 hydrog ? ? H DG  15  N1 ? ? ? 1_555 I C  5  N3 ? ? H DG  15  I C  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88 hydrog ? ? H DG  15  N2 ? ? ? 1_555 I C  5  O2 ? ? H DG  15  I C  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89 hydrog ? ? H DG  15  O6 ? ? ? 1_555 I C  5  N4 ? ? H DG  15  I C  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90 hydrog ? ? H DA  16  N1 ? ? ? 1_555 I U  4  N3 ? ? H DA  16  I U  4    1_555 ? ? ? ? ? ? 'DA-U PAIR'  ?     ? 
hydrog91 hydrog ? ? H DG  17  N1 ? ? ? 1_555 I C  3  N3 ? ? H DG  17  I C  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92 hydrog ? ? H DG  17  N2 ? ? ? 1_555 I C  3  O2 ? ? H DG  17  I C  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93 hydrog ? ? H DG  17  O6 ? ? ? 1_555 I C  3  N4 ? ? H DG  17  I C  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94 hydrog ? ? H DG  18  N1 ? ? ? 1_555 I C  2  N3 ? ? H DG  18  I C  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95 hydrog ? ? H DG  18  N2 ? ? ? 1_555 I C  2  O2 ? ? H DG  18  I C  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96 hydrog ? ? H DG  18  O6 ? ? ? 1_555 I C  2  N4 ? ? H DG  18  I C  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97 hydrog ? ? H DG  19  N1 ? ? ? 1_555 I C  1  N3 ? ? H DG  19  I C  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98 hydrog ? ? H DG  19  N2 ? ? ? 1_555 I C  1  O2 ? ? H DG  19  I C  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99 hydrog ? ? H DG  19  O6 ? ? ? 1_555 I C  1  N4 ? ? H DG  19  I C  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 45  A . ? GLU 24  A PRO 46  A ? PRO 25  A 1 -7.35 
2 GLY 122 A . ? GLY 101 A PRO 123 A ? PRO 102 A 1 -0.11 
3 GLU 45  B . ? GLU 24  B PRO 46  B ? PRO 25  B 1 -6.58 
4 SER 90  C . ? SER 94  C PRO 91  C ? PRO 95  C 1 -8.30 
5 VAL 111 D . ? VAL 110 D PRO 112 D ? PRO 111 D 1 0.02  
6 ALA 502 D . ? ALA 501 D PRO 503 D ? PRO 502 D 1 -1.42 
7 ASN 37  E . ? ASN 36  E PRO 38  E ? PRO 37  E 1 -1.68 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 3 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 8 ? 
AC6 ? 5 ? 
AC7 ? 3 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 3 ? 
AD7 ? 3 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 4 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC5 6 7 ? parallel      
AC5 7 8 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? parallel      
AD7 1 2 ? parallel      
AD7 2 3 ? anti-parallel 
AD8 1 2 ? parallel      
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? parallel      
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 29   ? VAL A 34   ? THR A 8    VAL A 13   
AA1 2 ARG A 39   ? LEU A 47   ? ARG A 18   LEU A 26   
AA1 3 PHE A 210  ? THR A 219  ? PHE A 189  THR A 198  
AA1 4 VAL A 192  ? THR A 202  ? VAL A 171  THR A 181  
AA2 1 VAL A 114  ? GLN A 121  ? VAL A 93   GLN A 100  
AA2 2 LYS A 154  ? ARG A 165  ? LYS A 133  ARG A 144  
AA2 3 PRO A 68   ? ILE A 77   ? PRO A 47   ILE A 56   
AA2 4 ILE A 183  ? PRO A 184  ? ILE A 162  PRO A 163  
AA3 1 VAL A 106  ? SER A 108  ? VAL A 85   SER A 87   
AA3 2 VAL A 137  ? VAL A 139  ? VAL A 116  VAL A 118  
AA4 1 GLY A 124  ? THR A 127  ? GLY A 103  THR A 106  
AA4 2 HIS A 145  ? LEU A 149  ? HIS A 124  LEU A 128  
AA5 1 TYR A 167  ? VAL A 168  ? TYR A 146  VAL A 147  
AA5 2 SER A 187  ? ILE A 188  ? SER A 166  ILE A 167  
AA6 1 THR B 29   ? VAL B 34   ? THR B 8    VAL B 13   
AA6 2 ARG B 39   ? LEU B 47   ? ARG B 18   LEU B 26   
AA6 3 ARG B 207  ? THR B 219  ? ARG B 186  THR B 198  
AA6 4 VAL B 192  ? VAL B 204  ? VAL B 171  VAL B 183  
AA7 1 VAL B 114  ? GLN B 121  ? VAL B 93   GLN B 100  
AA7 2 LYS B 154  ? ARG B 165  ? LYS B 133  ARG B 144  
AA7 3 PRO B 68   ? ILE B 77   ? PRO B 47   ILE B 56   
AA7 4 ARG B 182  ? PRO B 184  ? ARG B 161  PRO B 163  
AA8 1 VAL B 106  ? SER B 108  ? VAL B 85   SER B 87   
AA8 2 VAL B 137  ? VAL B 139  ? VAL B 116  VAL B 118  
AA9 1 GLY B 124  ? THR B 127  ? GLY B 103  THR B 106  
AA9 2 HIS B 145  ? LEU B 149  ? HIS B 124  LEU B 128  
AB1 1 TYR B 167  ? VAL B 168  ? TYR B 146  VAL B 147  
AB1 2 SER B 187  ? ILE B 188  ? SER B 166  ILE B 167  
AB2 1 VAL C 35   ? SER C 36   ? VAL C 39   SER C 40   
AB2 2 VAL C 968  ? SER C 969  ? VAL C 972  SER C 973  
AB2 3 VAL C 622  ? GLY C 623  ? VAL C 626  GLY C 627  
AB3 1 ILE C 92   ? GLU C 93   ? ILE C 96   GLU C 97   
AB3 2 MET C 99   ? PHE C 108  ? MET C 103  PHE C 112  
AB3 3 ALA C 126  ? ASN C 137  ? ALA C 130  ASN C 141  
AB3 4 ILE C 143  ? PRO C 154  ? ILE C 147  PRO C 158  
AB4 1 PHE C 162  ? ILE C 164  ? PHE C 166  ILE C 168  
AB4 2 THR C 167  ? VAL C 171  ? THR C 171  VAL C 175  
AB4 3 SER C 433  ? PHE C 435  ? SER C 437  PHE C 439  
AB5 1 ARG C 372  ? ARG C 375  ? ARG C 376  ARG C 379  
AB5 2 SER C 173  ? ARG C 177  ? SER C 177  ARG C 181  
AB5 3 ARG C 450  ? SER C 452  ? ARG C 454  SER C 456  
AB5 4 ILE C 493  ? SER C 495  ? ILE C 497  SER C 499  
AB6 1 GLY C 180  ? THR C 186  ? GLY C 184  THR C 190  
AB6 2 LEU C 195  ? ILE C 201  ? LEU C 199  ILE C 205  
AB6 3 LEU C 208  ? VAL C 212  ? LEU C 212  VAL C 216  
AB6 4 VAL C 218  ? ILE C 222  ? VAL C 222  ILE C 226  
AB7 1 THR C 350  ? MET C 351  ? THR C 354  MET C 355  
AB7 2 VAL C 359  ? PRO C 360  ? VAL C 363  PRO C 364  
AB8 1 ARG C 501  ? VAL C 502  ? ARG C 505  VAL C 506  
AB8 2 ILE C 508  ? VAL C 516  ? ILE C 512  VAL C 520  
AB8 3 VAL C 519  ? LEU C 527  ? VAL C 523  LEU C 531  
AB9 1 ARG C 501  ? VAL C 502  ? ARG C 505  VAL C 506  
AB9 2 ILE C 508  ? VAL C 516  ? ILE C 512  VAL C 520  
AB9 3 TYR C 574  ? ASP C 576  ? TYR C 578  ASP C 580  
AB9 4 VAL C 537  ? ALA C 538  ? VAL C 541  ALA C 542  
AB9 5 ARG C 554  ? ARG C 558  ? ARG C 558  ARG C 562  
AB9 6 VAL C 564  ? PRO C 568  ? VAL C 568  PRO C 572  
AC1 1 VAL C 638  ? VAL C 639  ? VAL C 642  VAL C 643  
AC1 2 VAL C 697  ? ASP C 700  ? VAL C 701  ASP C 704  
AC1 3 CYS C 683  ? PRO C 684  ? CYS C 687  PRO C 688  
AC2 1 ARG C 663  ? ARG C 667  ? ARG C 667  ARG C 671  
AC2 2 TYR C 653  ? HIS C 658  ? TYR C 657  HIS C 662  
AC2 3 GLY C 644  ? VAL C 649  ? GLY C 648  VAL C 653  
AC2 4 ARG C 691  ? VAL C 692  ? ARG C 695  VAL C 696  
AC3 1 ALA C 672  ? ARG C 673  ? ALA C 676  ARG C 677  
AC3 2 CYS C 679  ? ALA C 680  ? CYS C 683  ALA C 684  
AC4 1 THR C 704  ? ASP C 705  ? THR C 708  ASP C 709  
AC4 2 GLU C 708  ? MET C 709  ? GLU C 712  MET C 713  
AC5 1 LYS C 1003 ? ALA C 1004 ? LYS C 1007 ALA C 1008 
AC5 2 VAL C 1019 ? LYS C 1028 ? VAL C 1023 LYS C 1032 
AC5 3 LYS C 880  ? ALA C 882  ? LYS C 884  ALA C 886  
AC5 4 LYS C 888  ? LEU C 895  ? LYS C 892  LEU C 899  
AC5 5 ILE C 731  ? SER C 734  ? ILE C 735  SER C 738  
AC5 6 ILE C 911  ? LEU C 913  ? ILE C 915  LEU C 917  
AC5 7 LYS C 713  ? ILE C 719  ? LYS C 717  ILE C 723  
AC5 8 VAL C 1019 ? LYS C 1028 ? VAL C 1023 LYS C 1032 
AC6 1 GLY C 761  ? ALA C 762  ? GLY C 765  ALA C 766  
AC6 2 SER C 745  ? THR C 758  ? SER C 749  THR C 762  
AC6 3 VAL C 861  ? ARG C 873  ? VAL C 865  ARG C 877  
AC6 4 SER C 840  ? SER C 850  ? SER C 844  SER C 854  
AC6 5 GLU C 791  ? ARG C 793  ? GLU C 795  ARG C 797  
AC7 1 GLU C 764  ? ILE C 765  ? GLU C 768  ILE C 769  
AC7 2 LYS C 801  ? PRO C 804  ? LYS C 805  PRO C 808  
AC7 3 VAL C 828  ? ASP C 830  ? VAL C 832  ASP C 834  
AC8 1 ILE C 797  ? VAL C 799  ? ILE C 801  VAL C 803  
AC8 2 LEU C 833  ? LYS C 834  ? LEU C 837  LYS C 838  
AC9 1 TRP C 940  ? LYS C 941  ? TRP C 944  LYS C 945  
AC9 2 GLU C 961  ? ALA C 962  ? GLU C 965  ALA C 966  
AD1 1 HIS C 1038 ? ARG C 1040 ? HIS C 1042 ARG C 1044 
AD1 2 SER D 426  ? VAL D 433  ? SER D 425  VAL D 432  
AD1 3 GLN D 541  ? HIS D 545  ? GLN D 540  HIS D 544  
AD1 4 VAL D 497  ? ASN D 500  ? VAL D 496  ASN D 499  
AD1 5 ILE D 510  ? VAL D 518  ? ILE D 509  VAL D 517  
AD1 6 GLN D 441  ? PRO D 445  ? GLN D 440  PRO D 444  
AD1 7 ILE D 523  ? LEU D 525  ? ILE D 522  LEU D 524  
AD1 8 SER D 426  ? VAL D 433  ? SER D 425  VAL D 432  
AD2 1 GLN C 1062 ? PHE C 1064 ? GLN C 1066 PHE C 1068 
AD2 2 LYS D 421  ? VAL D 423  ? LYS D 420  VAL D 422  
AD3 1 GLU C 1132 ? LEU C 1134 ? GLU C 1136 LEU C 1138 
AD3 2 GLU D 10   ? ARG D 12   ? GLU D 9    ARG D 11   
AD3 3 SER D 1243 ? ASP D 1244 ? SER D 1242 ASP D 1243 
AD4 1 GLY D 94   ? THR D 103  ? GLY D 93   THR D 102  
AD4 2 VAL D 314  ? VAL D 320  ? VAL D 313  VAL D 319  
AD5 1 LEU D 235  ? ILE D 236  ? LEU D 234  ILE D 235  
AD5 2 TYR D 135  ? VAL D 140  ? TYR D 134  VAL D 139  
AD5 3 PHE D 253  ? ALA D 256  ? PHE D 252  ALA D 255  
AD6 1 MET D 328  ? GLN D 330  ? MET D 327  GLN D 329  
AD6 2 PHE D 336  ? SER D 339  ? PHE D 335  SER D 338  
AD6 3 GLU F 105  ? THR F 108  ? GLU F 103  THR F 106  
AD7 1 VAL D 612  ? TYR D 613  ? VAL D 611  TYR D 612  
AD7 2 LYS D 633  ? LEU D 638  ? LYS D 632  LEU D 637  
AD7 3 TRP D 663  ? THR D 668  ? TRP D 662  THR D 667  
AD8 1 VAL D 887  ? GLU D 889  ? VAL D 886  GLU D 888  
AD8 2 VAL D 975  ? CYS D 976  ? VAL D 974  CYS D 975  
AD9 1 ILE D 898  ? GLU D 901  ? ILE D 897  GLU D 900  
AD9 2 GLN D 960  ? ARG D 964  ? GLN D 959  ARG D 963  
AD9 3 THR D 925  ? LEU D 926  ? THR D 924  LEU D 925  
AE1 1 ALA D 903  ? ARG D 905  ? ALA D 902  ARG D 904  
AE1 2 LEU D 911  ? ARG D 913  ? LEU D 910  ARG D 912  
AE2 1 LYS D 1044 ? ALA D 1045 ? LYS D 1043 ALA D 1044 
AE2 2 SER D 1116 ? ALA D 1117 ? SER D 1115 ALA D 1116 
AE3 1 VAL D 1076 ? ILE D 1081 ? VAL D 1075 ILE D 1080 
AE3 2 TYR D 1063 ? PRO D 1069 ? TYR D 1062 PRO D 1068 
AE3 3 GLY D 1052 ? LEU D 1056 ? GLY D 1051 LEU D 1055 
AE3 4 HIS D 1105 ? VAL D 1106 ? HIS D 1104 VAL D 1105 
AE4 1 ARG D 1086 ? LEU D 1087 ? ARG D 1085 LEU D 1086 
AE4 2 MET D 1113 ? GLU D 1114 ? MET D 1112 GLU D 1113 
AE5 1 VAL D 1089 ? LYS D 1091 ? VAL D 1088 LYS D 1090 
AE5 2 GLU D 1097 ? VAL D 1099 ? GLU D 1096 VAL D 1098 
AE6 1 LEU D 1181 ? ASP D 1183 ? LEU D 1180 ASP D 1182 
AE6 2 ARG D 1165 ? ILE D 1168 ? ARG D 1164 ILE D 1167 
AE6 3 GLY D 1204 ? PRO D 1206 ? GLY D 1203 PRO D 1205 
AE7 1 ALA D 1272 ? PRO D 1275 ? ALA D 1271 PRO D 1274 
AE7 2 LEU E 104  ? THR E 107  ? LEU E 103  THR E 106  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 33   ? N ASP A 12   O GLN A 41   ? O GLN A 20   
AA1 2 3 N LEU A 47   ? N LEU A 26   O ASP A 211  ? O ASP A 190  
AA1 3 4 O GLU A 218  ? O GLU A 197  N LEU A 193  ? N LEU A 172  
AA2 1 2 N VAL A 114  ? N VAL A 93   O VAL A 161  ? O VAL A 140  
AA2 2 3 O GLY A 164  ? O GLY A 143  N GLY A 69   ? N GLY A 48   
AA2 3 4 N ILE A 75   ? N ILE A 54   O ILE A 183  ? O ILE A 162  
AA3 1 2 N SER A 107  ? N SER A 86   O THR A 138  ? O THR A 117  
AA4 1 2 N GLY A 124  ? N GLY A 103  O LEU A 149  ? O LEU A 128  
AA5 1 2 N VAL A 168  ? N VAL A 147  O SER A 187  ? O SER A 166  
AA6 1 2 N THR B 29   ? N THR B 8    O GLU B 45   ? O GLU B 24   
AA6 2 3 N LEU B 47   ? N LEU B 26   O ASP B 211  ? O ASP B 190  
AA6 3 4 O ARG B 207  ? O ARG B 186  N VAL B 204  ? N VAL B 183  
AA7 1 2 N LEU B 118  ? N LEU B 97   O VAL B 157  ? O VAL B 136  
AA7 2 3 O GLU B 158  ? O GLU B 137  N ARG B 76   ? N ARG B 55   
AA7 3 4 N ILE B 75   ? N ILE B 54   O ILE B 183  ? O ILE B 162  
AA8 1 2 N SER B 107  ? N SER B 86   O THR B 138  ? O THR B 117  
AA9 1 2 N GLY B 124  ? N GLY B 103  O LEU B 149  ? O LEU B 128  
AB1 1 2 N VAL B 168  ? N VAL B 147  O SER B 187  ? O SER B 166  
AB2 1 2 N VAL C 35   ? N VAL C 39   O SER C 969  ? O SER C 973  
AB2 2 3 O VAL C 968  ? O VAL C 972  N GLY C 623  ? N GLY C 627  
AB3 1 2 N ILE C 92   ? N ILE C 96   O LEU C 101  ? O LEU C 105  
AB3 2 3 N ARG C 107  ? N ARG C 111  O PHE C 130  ? O PHE C 134  
AB3 3 4 N ALA C 127  ? N ALA C 131  O PHE C 153  ? O PHE C 157  
AB4 1 2 N PHE C 162  ? N PHE C 166  O ARG C 169  ? O ARG C 173  
AB4 2 3 N VAL C 170  ? N VAL C 174  O GLN C 434  ? O GLN C 438  
AB5 1 2 O ARG C 373  ? O ARG C 377  N VAL C 176  ? N VAL C 180  
AB5 2 3 N LEU C 175  ? N LEU C 179  O SER C 452  ? O SER C 456  
AB5 3 4 N LEU C 451  ? N LEU C 455  O GLY C 494  ? O GLY C 498  
AB6 1 2 N ASP C 184  ? N ASP C 188  O SER C 197  ? O SER C 201  
AB6 2 3 N VAL C 200  ? N VAL C 204  O LEU C 208  ? O LEU C 212  
AB6 3 4 N ASP C 211  ? N ASP C 215  O GLY C 219  ? O GLY C 223  
AB7 1 2 N MET C 351  ? N MET C 355  O VAL C 359  ? O VAL C 363  
AB8 1 2 N ARG C 501  ? N ARG C 505  O GLU C 509  ? O GLU C 513  
AB8 2 3 N THR C 510  ? N THR C 514  O LEU C 527  ? O LEU C 531  
AB9 1 2 N ARG C 501  ? N ARG C 505  O GLU C 509  ? O GLU C 513  
AB9 2 3 N ARG C 513  ? N ARG C 517  O MET C 575  ? O MET C 579  
AB9 3 4 O ASP C 576  ? O ASP C 580  N ALA C 538  ? N ALA C 542  
AB9 4 5 N VAL C 537  ? N VAL C 541  O ARG C 558  ? O ARG C 562  
AB9 5 6 N VAL C 555  ? N VAL C 559  O VAL C 567  ? O VAL C 571  
AC1 1 2 N VAL C 638  ? N VAL C 642  O ILE C 698  ? O ILE C 702  
AC1 2 3 O ASP C 700  ? O ASP C 704  N CYS C 683  ? N CYS C 687  
AC2 1 2 O TYR C 666  ? O TYR C 670  N ILE C 654  ? N ILE C 658  
AC2 2 3 O MET C 657  ? O MET C 661  N VAL C 645  ? N VAL C 649  
AC2 3 4 N GLY C 644  ? N GLY C 648  O VAL C 692  ? O VAL C 696  
AC3 1 2 N ALA C 672  ? N ALA C 676  O ALA C 680  ? O ALA C 684  
AC4 1 2 N ASP C 705  ? N ASP C 709  O GLU C 708  ? O GLU C 712  
AC5 1 2 N ALA C 1004 ? N ALA C 1008 O VAL C 1019 ? O VAL C 1023 
AC5 2 3 O MET C 1027 ? O MET C 1031 N ALA C 882  ? N ALA C 886  
AC5 3 4 N LEU C 881  ? N LEU C 885  O GLY C 889  ? O GLY C 893  
AC5 4 5 O LEU C 895  ? O LEU C 899  N LEU C 733  ? N LEU C 737  
AC5 5 6 N ILE C 732  ? N ILE C 736  O ILE C 912  ? O ILE C 916  
AC5 6 7 O ILE C 911  ? O ILE C 915  N LEU C 716  ? N LEU C 720  
AC5 7 8 N VAL C 717  ? N VAL C 721  O GLY C 1022 ? O GLY C 1026 
AC6 1 2 O GLY C 761  ? O GLY C 765  N THR C 758  ? N THR C 762  
AC6 2 3 N ILE C 753  ? N ILE C 757  O VAL C 865  ? O VAL C 869  
AC6 3 4 O LEU C 864  ? O LEU C 868  N PHE C 849  ? N PHE C 853  
AC6 4 5 O GLY C 841  ? O GLY C 845  N VAL C 792  ? N VAL C 796  
AC7 1 2 N GLU C 764  ? N GLU C 768  O VAL C 802  ? O VAL C 806  
AC7 2 3 N THR C 803  ? N THR C 807  O ARG C 829  ? O ARG C 833  
AC8 1 2 N LEU C 798  ? N LEU C 802  O LEU C 833  ? O LEU C 837  
AC9 1 2 N TRP C 940  ? N TRP C 944  O ALA C 962  ? O ALA C 966  
AD1 1 2 N HIS C 1038 ? N HIS C 1042 O ARG D 428  ? O ARG D 427  
AD1 2 3 N SER D 429  ? N SER D 428  O MET D 542  ? O MET D 541  
AD1 3 4 O HIS D 545  ? O HIS D 544  N LEU D 498  ? N LEU D 497  
AD1 4 5 N LEU D 499  ? N LEU D 498  O GLN D 511  ? O GLN D 510  
AD1 5 6 O MET D 516  ? O MET D 515  N LEU D 444  ? N LEU D 443  
AD1 6 7 N GLY D 443  ? N GLY D 442  O GLN D 524  ? O GLN D 523  
AD1 7 8 O ILE D 523  ? O ILE D 522  N VAL D 432  ? N VAL D 431  
AD2 1 2 N PHE C 1064 ? N PHE C 1068 O LYS D 421  ? O LYS D 420  
AD3 1 2 N LEU C 1134 ? N LEU C 1138 O GLU D 10   ? O GLU D 9    
AD3 2 3 N LEU D 11   ? N LEU D 10   O ASP D 1244 ? O ASP D 1243 
AD4 1 2 N VAL D 102  ? N VAL D 101  O LEU D 315  ? O LEU D 314  
AD5 1 2 O ILE D 236  ? O ILE D 235  N TYR D 135  ? N TYR D 134  
AD5 2 3 N SER D 139  ? N SER D 138  O THR D 254  ? O THR D 253  
AD6 1 2 N VAL D 329  ? N VAL D 328  O ALA D 337  ? O ALA D 336  
AD6 2 3 N THR D 338  ? N THR D 337  O THR F 108  ? O THR F 106  
AD7 1 2 N TYR D 613  ? N TYR D 612  O LYS D 635  ? O LYS D 634  
AD7 2 3 N VAL D 636  ? N VAL D 635  O ALA D 665  ? O ALA D 664  
AD8 1 2 N ARG D 888  ? N ARG D 887  O VAL D 975  ? O VAL D 974  
AD9 1 2 N VAL D 900  ? N VAL D 899  O VAL D 961  ? O VAL D 960  
AD9 2 3 O ARG D 964  ? O ARG D 963  N THR D 925  ? N THR D 924  
AE1 1 2 N GLU D 904  ? N GLU D 903  O ILE D 912  ? O ILE D 911  
AE2 1 2 N ALA D 1045 ? N ALA D 1044 O SER D 1116 ? O SER D 1115 
AE3 1 2 O TYR D 1078 ? O TYR D 1077 N ILE D 1065 ? N ILE D 1064 
AE3 2 3 O VAL D 1068 ? O VAL D 1067 N ARG D 1053 ? N ARG D 1052 
AE3 3 4 N GLY D 1052 ? N GLY D 1051 O VAL D 1106 ? O VAL D 1105 
AE4 1 2 N ARG D 1086 ? N ARG D 1085 O GLU D 1114 ? O GLU D 1113 
AE5 1 2 N PHE D 1090 ? N PHE D 1089 O ARG D 1098 ? O ARG D 1097 
AE6 1 2 O ILE D 1182 ? O ILE D 1181 N VAL D 1166 ? N VAL D 1165 
AE6 2 3 N THR D 1167 ? N THR D 1166 O ARG D 1205 ? O ARG D 1204 
AE7 1 2 N GLN D 1274 ? N GLN D 1273 O GLU E 105  ? O GLU E 104  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN 2001 ? 4 'binding site for residue ZN D 2001' 
AC2 Software D ZN 2002 ? 4 'binding site for residue ZN D 2002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS D 61  ? CYS D 60  . ? 1_555 ? 
2 AC1 4 CYS D 63  ? CYS D 62  . ? 1_555 ? 
3 AC1 4 CYS D 76  ? CYS D 75  . ? 1_555 ? 
4 AC1 4 CYS D 79  ? CYS D 78  . ? 1_555 ? 
5 AC2 4 CYS D 892 ? CYS D 891 . ? 1_555 ? 
6 AC2 4 CYS D 969 ? CYS D 968 . ? 1_555 ? 
7 AC2 4 CYS D 976 ? CYS D 975 . ? 1_555 ? 
8 AC2 4 CYS D 979 ? CYS D 978 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5ZX2 
_atom_sites.fract_transf_matrix[1][1]   0.007703 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006097 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004656 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLN A 1  26   ? 100.272 1.310   -23.522  1.00 70.49  ?  5    GLN A N     1 
ATOM   2     C  CA    . GLN A 1  26   ? 99.872  2.495   -24.271  1.00 67.84  ?  5    GLN A CA    1 
ATOM   3     C  C     . GLN A 1  26   ? 98.364  2.701   -24.211  1.00 74.80  ?  5    GLN A C     1 
ATOM   4     O  O     . GLN A 1  26   ? 97.592  1.759   -24.390  1.00 76.13  ?  5    GLN A O     1 
ATOM   5     C  CB    . GLN A 1  26   ? 100.324 2.386   -25.726  1.00 66.79  ?  5    GLN A CB    1 
ATOM   6     C  CG    . GLN A 1  26   ? 99.909  3.562   -26.587  1.00 66.30  ?  5    GLN A CG    1 
ATOM   7     C  CD    . GLN A 1  26   ? 100.161 3.317   -28.058  1.00 69.43  ?  5    GLN A CD    1 
ATOM   8     O  OE1   . GLN A 1  26   ? 100.677 2.268   -28.443  1.00 71.25  ?  5    GLN A OE1   1 
ATOM   9     N  NE2   . GLN A 1  26   ? 99.793  4.284   -28.890  1.00 62.33  ?  5    GLN A NE2   1 
ATOM   10    N  N     . ARG A 1  27   ? 97.948  3.939   -23.964  1.00 74.25  ?  6    ARG A N     1 
ATOM   11    C  CA    . ARG A 1  27   ? 96.522  4.210   -23.877  1.00 74.01  ?  6    ARG A CA    1 
ATOM   12    C  C     . ARG A 1  27   ? 95.941  4.528   -25.252  1.00 71.14  ?  6    ARG A C     1 
ATOM   13    O  O     . ARG A 1  27   ? 96.619  5.116   -26.101  1.00 68.45  ?  6    ARG A O     1 
ATOM   14    C  CB    . ARG A 1  27   ? 96.261  5.373   -22.926  1.00 78.19  ?  6    ARG A CB    1 
ATOM   15    C  CG    . ARG A 1  27   ? 96.268  4.977   -21.460  1.00 85.31  ?  6    ARG A CG    1 
ATOM   16    C  CD    . ARG A 1  27   ? 96.060  6.181   -20.558  1.00 96.52  ?  6    ARG A CD    1 
ATOM   17    N  NE    . ARG A 1  27   ? 95.762  5.784   -19.185  1.00 107.72 ?  6    ARG A NE    1 
ATOM   18    C  CZ    . ARG A 1  27   ? 95.673  6.629   -18.164  1.00 110.31 ?  6    ARG A CZ    1 
ATOM   19    N  NH1   . ARG A 1  27   ? 95.394  6.177   -16.949  1.00 108.73 ?  6    ARG A NH1   1 
ATOM   20    N  NH2   . ARG A 1  27   ? 95.869  7.927   -18.355  1.00 112.90 ?  6    ARG A NH2   1 
ATOM   21    N  N     . PRO A 1  28   ? 94.688  4.149   -25.491  1.00 68.94  ?  7    PRO A N     1 
ATOM   22    C  CA    . PRO A 1  28   ? 94.079  4.390   -26.801  1.00 61.64  ?  7    PRO A CA    1 
ATOM   23    C  C     . PRO A 1  28   ? 93.752  5.859   -27.012  1.00 62.24  ?  7    PRO A C     1 
ATOM   24    O  O     . PRO A 1  28   ? 93.611  6.642   -26.071  1.00 60.30  ?  7    PRO A O     1 
ATOM   25    C  CB    . PRO A 1  28   ? 92.804  3.547   -26.754  1.00 60.10  ?  7    PRO A CB    1 
ATOM   26    C  CG    . PRO A 1  28   ? 92.451  3.516   -25.309  1.00 60.97  ?  7    PRO A CG    1 
ATOM   27    C  CD    . PRO A 1  28   ? 93.763  3.461   -24.574  1.00 67.88  ?  7    PRO A CD    1 
ATOM   28    N  N     . THR A 1  29   ? 93.623  6.223   -28.286  1.00 63.13  ?  8    THR A N     1 
ATOM   29    C  CA    . THR A 1  29   ? 93.320  7.589   -28.678  1.00 59.64  ?  8    THR A CA    1 
ATOM   30    C  C     . THR A 1  29   ? 92.252  7.586   -29.763  1.00 55.59  ?  8    THR A C     1 
ATOM   31    O  O     . THR A 1  29   ? 92.049  6.593   -30.472  1.00 57.35  ?  8    THR A O     1 
ATOM   32    C  CB    . THR A 1  29   ? 94.567  8.338   -29.168  1.00 58.33  ?  8    THR A CB    1 
ATOM   33    O  OG1   . THR A 1  29   ? 95.220  7.574   -30.190  1.00 55.26  ?  8    THR A OG1   1 
ATOM   34    C  CG2   . THR A 1  29   ? 95.533  8.581   -28.018  1.00 58.67  ?  8    THR A CG2   1 
ATOM   35    N  N     . LEU A 1  30   ? 91.585  8.734   -29.881  1.00 55.13  ?  9    LEU A N     1 
ATOM   36    C  CA    . LEU A 1  30   ? 90.440  8.930   -30.761  1.00 53.46  ?  9    LEU A CA    1 
ATOM   37    C  C     . LEU A 1  30   ? 90.700  10.146  -31.634  1.00 49.49  ?  9    LEU A C     1 
ATOM   38    O  O     . LEU A 1  30   ? 90.799  11.266  -31.125  1.00 49.29  ?  9    LEU A O     1 
ATOM   39    C  CB    . LEU A 1  30   ? 89.159  9.120   -29.942  1.00 52.73  ?  9    LEU A CB    1 
ATOM   40    C  CG    . LEU A 1  30   ? 87.976  9.842   -30.590  1.00 54.31  ?  9    LEU A CG    1 
ATOM   41    C  CD1   . LEU A 1  30   ? 87.415  9.034   -31.740  1.00 57.26  ?  9    LEU A CD1   1 
ATOM   42    C  CD2   . LEU A 1  30   ? 86.897  10.131  -29.559  1.00 53.14  ?  9    LEU A CD2   1 
ATOM   43    N  N     . SER A 1  31   ? 90.808  9.930   -32.941  1.00 50.60  ?  10   SER A N     1 
ATOM   44    C  CA    . SER A 1  31   ? 91.050  11.003  -33.893  1.00 52.14  ?  10   SER A CA    1 
ATOM   45    C  C     . SER A 1  31   ? 89.901  11.075  -34.888  1.00 56.70  ?  10   SER A C     1 
ATOM   46    O  O     . SER A 1  31   ? 89.413  10.045  -35.360  1.00 54.28  ?  10   SER A O     1 
ATOM   47    C  CB    . SER A 1  31   ? 92.369  10.798  -34.638  1.00 50.99  ?  10   SER A CB    1 
ATOM   48    O  OG    . SER A 1  31   ? 92.279  9.705   -35.534  1.00 50.41  ?  10   SER A OG    1 
ATOM   49    N  N     . GLU A 1  32   ? 89.477  12.294  -35.208  1.00 58.78  ?  11   GLU A N     1 
ATOM   50    C  CA    . GLU A 1  32   ? 88.385  12.520  -36.143  1.00 54.68  ?  11   GLU A CA    1 
ATOM   51    C  C     . GLU A 1  32   ? 88.926  12.886  -37.518  1.00 56.66  ?  11   GLU A C     1 
ATOM   52    O  O     . GLU A 1  32   ? 89.846  13.699  -37.641  1.00 59.68  ?  11   GLU A O     1 
ATOM   53    C  CB    . GLU A 1  32   ? 87.454  13.629  -35.650  1.00 53.94  ?  11   GLU A CB    1 
ATOM   54    C  CG    . GLU A 1  32   ? 86.509  14.140  -36.728  1.00 54.17  ?  11   GLU A CG    1 
ATOM   55    C  CD    . GLU A 1  32   ? 85.504  15.144  -36.213  1.00 54.17  ?  11   GLU A CD    1 
ATOM   56    O  OE1   . GLU A 1  32   ? 84.401  15.227  -36.790  1.00 53.00  ?  11   GLU A OE1   1 
ATOM   57    O  OE2   . GLU A 1  32   ? 85.813  15.851  -35.234  1.00 56.34  ?  11   GLU A OE2   1 
ATOM   58    N  N     . ASP A 1  33   ? 88.346  12.277  -38.548  1.00 56.93  ?  12   ASP A N     1 
ATOM   59    C  CA    . ASP A 1  33   ? 88.627  12.618  -39.938  1.00 60.48  ?  12   ASP A CA    1 
ATOM   60    C  C     . ASP A 1  33   ? 87.292  12.891  -40.619  1.00 60.04  ?  12   ASP A C     1 
ATOM   61    O  O     . ASP A 1  33   ? 86.476  11.978  -40.776  1.00 59.57  ?  12   ASP A O     1 
ATOM   62    C  CB    . ASP A 1  33   ? 89.385  11.490  -40.636  1.00 57.75  ?  12   ASP A CB    1 
ATOM   63    C  CG    . ASP A 1  33   ? 90.066  11.947  -41.904  1.00 73.63  ?  12   ASP A CG    1 
ATOM   64    O  OD1   . ASP A 1  33   ? 91.216  12.432  -41.820  1.00 80.33  ?  12   ASP A OD1   1 
ATOM   65    O  OD2   . ASP A 1  33   ? 89.454  11.823  -42.985  1.00 74.44  ?  12   ASP A OD2   1 
ATOM   66    N  N     . VAL A 1  34   ? 87.066  14.137  -41.025  1.00 59.07  ?  13   VAL A N     1 
ATOM   67    C  CA    . VAL A 1  34   ? 85.771  14.524  -41.572  1.00 54.82  ?  13   VAL A CA    1 
ATOM   68    C  C     . VAL A 1  34   ? 85.722  14.180  -43.054  1.00 51.70  ?  13   VAL A C     1 
ATOM   69    O  O     . VAL A 1  34   ? 86.727  14.271  -43.769  1.00 51.32  ?  13   VAL A O     1 
ATOM   70    C  CB    . VAL A 1  34   ? 85.492  16.021  -41.321  1.00 48.60  ?  13   VAL A CB    1 
ATOM   71    C  CG1   . VAL A 1  34   ? 85.948  16.424  -39.925  1.00 44.86  ?  13   VAL A CG1   1 
ATOM   72    C  CG2   . VAL A 1  34   ? 86.135  16.900  -42.382  1.00 47.29  ?  13   VAL A CG2   1 
ATOM   73    N  N     . LEU A 1  35   ? 84.550  13.742  -43.512  1.00 48.59  ?  14   LEU A N     1 
ATOM   74    C  CA    . LEU A 1  35   ? 84.326  13.430  -44.916  1.00 48.20  ?  14   LEU A CA    1 
ATOM   75    C  C     . LEU A 1  35   ? 83.482  14.501  -45.593  1.00 51.54  ?  14   LEU A C     1 
ATOM   76    O  O     . LEU A 1  35   ? 83.940  15.156  -46.532  1.00 60.57  ?  14   LEU A O     1 
ATOM   77    C  CB    . LEU A 1  35   ? 83.660  12.057  -45.049  1.00 51.81  ?  14   LEU A CB    1 
ATOM   78    C  CG    . LEU A 1  35   ? 84.437  10.884  -44.456  1.00 52.39  ?  14   LEU A CG    1 
ATOM   79    C  CD1   . LEU A 1  35   ? 83.571  9.639   -44.446  1.00 47.65  ?  14   LEU A CD1   1 
ATOM   80    C  CD2   . LEU A 1  35   ? 85.719  10.644  -45.233  1.00 52.54  ?  14   LEU A CD2   1 
ATOM   81    N  N     . THR A 1  36   ? 82.246  14.673  -45.150  1.00 50.06  ?  15   THR A N     1 
ATOM   82    C  CA    . THR A 1  36   ? 81.393  15.790  -45.517  1.00 49.69  ?  15   THR A CA    1 
ATOM   83    C  C     . THR A 1  36   ? 81.113  16.612  -44.265  1.00 49.87  ?  15   THR A C     1 
ATOM   84    O  O     . THR A 1  36   ? 81.631  16.330  -43.183  1.00 52.24  ?  15   THR A O     1 
ATOM   85    C  CB    . THR A 1  36   ? 80.089  15.304  -46.154  1.00 51.86  ?  15   THR A CB    1 
ATOM   86    O  OG1   . THR A 1  36   ? 79.261  14.705  -45.149  1.00 52.82  ?  15   THR A OG1   1 
ATOM   87    C  CG2   . THR A 1  36   ? 80.376  14.281  -47.238  1.00 46.35  ?  15   THR A CG2   1 
ATOM   88    N  N     . ASP A 1  37   ? 80.281  17.642  -44.412  1.00 49.76  ?  16   ASP A N     1 
ATOM   89    C  CA    . ASP A 1  37   ? 79.939  18.450  -43.249  1.00 51.36  ?  16   ASP A CA    1 
ATOM   90    C  C     . ASP A 1  37   ? 79.054  17.686  -42.273  1.00 51.13  ?  16   ASP A C     1 
ATOM   91    O  O     . ASP A 1  37   ? 79.092  17.955  -41.068  1.00 51.81  ?  16   ASP A O     1 
ATOM   92    C  CB    . ASP A 1  37   ? 79.263  19.748  -43.689  1.00 56.57  ?  16   ASP A CB    1 
ATOM   93    C  CG    . ASP A 1  37   ? 80.238  20.728  -44.315  1.00 61.03  ?  16   ASP A CG    1 
ATOM   94    O  OD1   . ASP A 1  37   ? 81.459  20.575  -44.095  1.00 63.86  ?  16   ASP A OD1   1 
ATOM   95    O  OD2   . ASP A 1  37   ? 79.785  21.654  -45.021  1.00 60.88  ?  16   ASP A OD2   1 
ATOM   96    N  N     . ASN A 1  38   ? 78.230  16.763  -42.768  1.00 50.36  ?  17   ASN A N     1 
ATOM   97    C  CA    . ASN A 1  38   ? 77.385  15.936  -41.915  1.00 53.27  ?  17   ASN A CA    1 
ATOM   98    C  C     . ASN A 1  38   ? 77.920  14.524  -41.677  1.00 48.92  ?  17   ASN A C     1 
ATOM   99    O  O     . ASN A 1  38   ? 77.239  13.734  -41.019  1.00 48.65  ?  17   ASN A O     1 
ATOM   100   C  CB    . ASN A 1  38   ? 75.964  15.867  -42.486  1.00 52.61  ?  17   ASN A CB    1 
ATOM   101   C  CG    . ASN A 1  38   ? 75.944  15.748  -43.990  1.00 55.73  ?  17   ASN A CG    1 
ATOM   102   O  OD1   . ASN A 1  38   ? 76.689  14.965  -44.572  1.00 60.06  ?  17   ASN A OD1   1 
ATOM   103   N  ND2   . ASN A 1  38   ? 75.092  16.536  -44.632  1.00 56.43  ?  17   ASN A ND2   1 
ATOM   104   N  N     . ARG A 1  39   ? 79.098  14.172  -42.196  1.00 48.02  ?  18   ARG A N     1 
ATOM   105   C  CA    . ARG A 1  39   ? 79.605  12.811  -42.039  1.00 46.76  ?  18   ARG A CA    1 
ATOM   106   C  C     . ARG A 1  39   ? 81.079  12.827  -41.656  1.00 50.47  ?  18   ARG A C     1 
ATOM   107   O  O     . ARG A 1  39   ? 81.887  13.497  -42.306  1.00 54.05  ?  18   ARG A O     1 
ATOM   108   C  CB    . ARG A 1  39   ? 79.405  11.994  -43.322  1.00 46.97  ?  18   ARG A CB    1 
ATOM   109   C  CG    . ARG A 1  39   ? 79.626  10.495  -43.145  1.00 45.28  ?  18   ARG A CG    1 
ATOM   110   C  CD    . ARG A 1  39   ? 79.484  9.736   -44.460  1.00 44.64  ?  18   ARG A CD    1 
ATOM   111   N  NE    . ARG A 1  39   ? 79.943  8.353   -44.344  1.00 45.27  ?  18   ARG A NE    1 
ATOM   112   C  CZ    . ARG A 1  39   ? 80.157  7.544   -45.377  1.00 45.07  ?  18   ARG A CZ    1 
ATOM   113   N  NH1   . ARG A 1  39   ? 79.956  7.973   -46.613  1.00 47.92  ?  18   ARG A NH1   1 
ATOM   114   N  NH2   . ARG A 1  39   ? 80.578  6.306   -45.175  1.00 39.61  ?  18   ARG A NH2   1 
ATOM   115   N  N     . SER A 1  40   ? 81.425  12.072  -40.612  1.00 49.47  ?  19   SER A N     1 
ATOM   116   C  CA    . SER A 1  40   ? 82.800  11.983  -40.141  1.00 50.43  ?  19   SER A CA    1 
ATOM   117   C  C     . SER A 1  40   ? 83.118  10.561  -39.699  1.00 48.94  ?  19   SER A C     1 
ATOM   118   O  O     . SER A 1  40   ? 82.237  9.811   -39.267  1.00 49.53  ?  19   SER A O     1 
ATOM   119   C  CB    . SER A 1  40   ? 83.071  12.949  -38.978  1.00 48.92  ?  19   SER A CB    1 
ATOM   120   O  OG    . SER A 1  40   ? 83.110  14.295  -39.418  1.00 51.11  ?  19   SER A OG    1 
ATOM   121   N  N     . GLN A 1  41   ? 84.395  10.205  -39.809  1.00 50.88  ?  20   GLN A N     1 
ATOM   122   C  CA    . GLN A 1  41   ? 84.938  8.962   -39.284  1.00 47.49  ?  20   GLN A CA    1 
ATOM   123   C  C     . GLN A 1  41   ? 85.757  9.250   -38.034  1.00 50.17  ?  20   GLN A C     1 
ATOM   124   O  O     . GLN A 1  41   ? 86.342  10.325  -37.887  1.00 53.84  ?  20   GLN A O     1 
ATOM   125   C  CB    . GLN A 1  41   ? 85.810  8.248   -40.317  1.00 45.11  ?  20   GLN A CB    1 
ATOM   126   C  CG    . GLN A 1  41   ? 85.042  7.336   -41.248  1.00 45.98  ?  20   GLN A CG    1 
ATOM   127   C  CD    . GLN A 1  41   ? 85.913  6.756   -42.335  1.00 47.43  ?  20   GLN A CD    1 
ATOM   128   O  OE1   . GLN A 1  41   ? 87.070  7.143   -42.490  1.00 51.48  ?  20   GLN A OE1   1 
ATOM   129   N  NE2   . GLN A 1  41   ? 85.363  5.821   -43.099  1.00 45.86  ?  20   GLN A NE2   1 
ATOM   130   N  N     . PHE A 1  42   ? 85.775  8.285   -37.122  1.00 46.21  ?  21   PHE A N     1 
ATOM   131   C  CA    . PHE A 1  42   ? 86.459  8.430   -35.844  1.00 49.26  ?  21   PHE A CA    1 
ATOM   132   C  C     . PHE A 1  42   ? 87.243  7.157   -35.574  1.00 46.72  ?  21   PHE A C     1 
ATOM   133   O  O     . PHE A 1  42   ? 86.657  6.077   -35.490  1.00 46.01  ?  21   PHE A O     1 
ATOM   134   C  CB    . PHE A 1  42   ? 85.461  8.702   -34.716  1.00 48.10  ?  21   PHE A CB    1 
ATOM   135   C  CG    . PHE A 1  42   ? 84.672  9.965   -34.898  1.00 48.67  ?  21   PHE A CG    1 
ATOM   136   C  CD1   . PHE A 1  42   ? 83.502  9.966   -35.635  1.00 47.41  ?  21   PHE A CD1   1 
ATOM   137   C  CD2   . PHE A 1  42   ? 85.099  11.151  -34.329  1.00 52.58  ?  21   PHE A CD2   1 
ATOM   138   C  CE1   . PHE A 1  42   ? 82.775  11.126  -35.805  1.00 50.69  ?  21   PHE A CE1   1 
ATOM   139   C  CE2   . PHE A 1  42   ? 84.374  12.313  -34.493  1.00 51.43  ?  21   PHE A CE2   1 
ATOM   140   C  CZ    . PHE A 1  42   ? 83.212  12.301  -35.233  1.00 53.75  ?  21   PHE A CZ    1 
ATOM   141   N  N     . VAL A 1  43   ? 88.558  7.281   -35.433  1.00 50.31  ?  22   VAL A N     1 
ATOM   142   C  CA    . VAL A 1  43   ? 89.431  6.134   -35.222  1.00 50.43  ?  22   VAL A CA    1 
ATOM   143   C  C     . VAL A 1  43   ? 89.814  6.072   -33.752  1.00 50.44  ?  22   VAL A C     1 
ATOM   144   O  O     . VAL A 1  43   ? 90.249  7.073   -33.168  1.00 49.36  ?  22   VAL A O     1 
ATOM   145   C  CB    . VAL A 1  43   ? 90.679  6.209   -36.115  1.00 45.88  ?  22   VAL A CB    1 
ATOM   146   C  CG1   . VAL A 1  43   ? 91.419  4.888   -36.088  1.00 45.77  ?  22   VAL A CG1   1 
ATOM   147   C  CG2   . VAL A 1  43   ? 90.289  6.580   -37.534  1.00 45.11  ?  22   VAL A CG2   1 
ATOM   148   N  N     . ILE A 1  44   ? 89.637  4.899   -33.153  1.00 47.83  ?  23   ILE A N     1 
ATOM   149   C  CA    . ILE A 1  44   ? 90.022  4.630   -31.776  1.00 47.33  ?  23   ILE A CA    1 
ATOM   150   C  C     . ILE A 1  44   ? 91.022  3.487   -31.812  1.00 48.52  ?  23   ILE A C     1 
ATOM   151   O  O     . ILE A 1  44   ? 90.670  2.359   -32.188  1.00 46.99  ?  23   ILE A O     1 
ATOM   152   C  CB    . ILE A 1  44   ? 88.816  4.279   -30.898  1.00 48.45  ?  23   ILE A CB    1 
ATOM   153   C  CG1   . ILE A 1  44   ? 87.780  5.402   -30.953  1.00 47.59  ?  23   ILE A CG1   1 
ATOM   154   C  CG2   . ILE A 1  44   ? 89.259  4.018   -29.469  1.00 49.16  ?  23   ILE A CG2   1 
ATOM   155   C  CD1   . ILE A 1  44   ? 86.612  5.196   -30.027  1.00 40.23  ?  23   ILE A CD1   1 
ATOM   156   N  N     . GLU A 1  45   ? 92.273  3.780   -31.469  1.00 53.89  ?  24   GLU A N     1 
ATOM   157   C  CA    . GLU A 1  45   ? 93.282  2.727   -31.394  1.00 54.83  ?  24   GLU A CA    1 
ATOM   158   C  C     . GLU A 1  45   ? 94.366  3.025   -30.357  1.00 56.01  ?  24   GLU A C     1 
ATOM   159   O  O     . GLU A 1  45   ? 94.619  4.182   -30.046  1.00 55.73  ?  24   GLU A O     1 
ATOM   160   C  CB    . GLU A 1  45   ? 93.910  2.500   -32.773  1.00 53.38  ?  24   GLU A CB    1 
ATOM   161   C  CG    . GLU A 1  45   ? 94.726  3.651   -33.307  1.00 55.74  ?  24   GLU A CG    1 
ATOM   162   C  CD    . GLU A 1  45   ? 95.334  3.329   -34.655  1.00 59.73  ?  24   GLU A CD    1 
ATOM   163   O  OE1   . GLU A 1  45   ? 95.727  2.162   -34.862  1.00 59.10  ?  24   GLU A OE1   1 
ATOM   164   O  OE2   . GLU A 1  45   ? 95.407  4.235   -35.511  1.00 58.87  ?  24   GLU A OE2   1 
ATOM   165   N  N     . PRO A 1  46   ? 95.012  1.975   -29.822  1.00 59.65  ?  25   PRO A N     1 
ATOM   166   C  CA    . PRO A 1  46   ? 94.642  0.579   -30.051  1.00 55.63  ?  25   PRO A CA    1 
ATOM   167   C  C     . PRO A 1  46   ? 93.691  0.052   -28.991  1.00 52.76  ?  25   PRO A C     1 
ATOM   168   O  O     . PRO A 1  46   ? 93.430  0.718   -27.993  1.00 51.64  ?  25   PRO A O     1 
ATOM   169   C  CB    . PRO A 1  46   ? 95.987  -0.156  -29.988  1.00 56.25  ?  25   PRO A CB    1 
ATOM   170   C  CG    . PRO A 1  46   ? 96.998  0.864   -29.454  1.00 58.12  ?  25   PRO A CG    1 
ATOM   171   C  CD    . PRO A 1  46   ? 96.231  2.069   -29.009  1.00 61.01  ?  25   PRO A CD    1 
ATOM   172   N  N     . LEU A 1  47   ? 93.218  -1.171  -29.194  1.00 52.39  ?  26   LEU A N     1 
ATOM   173   C  CA    . LEU A 1  47   ? 92.283  -1.812  -28.286  1.00 50.23  ?  26   LEU A CA    1 
ATOM   174   C  C     . LEU A 1  47   ? 92.621  -3.290  -28.230  1.00 49.08  ?  26   LEU A C     1 
ATOM   175   O  O     . LEU A 1  47   ? 93.080  -3.868  -29.219  1.00 49.20  ?  26   LEU A O     1 
ATOM   176   C  CB    . LEU A 1  47   ? 90.828  -1.614  -28.738  1.00 51.93  ?  26   LEU A CB    1 
ATOM   177   C  CG    . LEU A 1  47   ? 90.336  -0.178  -28.936  1.00 47.62  ?  26   LEU A CG    1 
ATOM   178   C  CD1   . LEU A 1  47   ? 89.155  -0.141  -29.888  1.00 45.79  ?  26   LEU A CD1   1 
ATOM   179   C  CD2   . LEU A 1  47   ? 89.972  0.453   -27.604  1.00 47.76  ?  26   LEU A CD2   1 
ATOM   180   N  N     . GLU A 1  48   ? 92.405  -3.890  -27.067  1.00 49.07  ?  27   GLU A N     1 
ATOM   181   C  CA    . GLU A 1  48   ? 92.655  -5.314  -26.915  1.00 54.96  ?  27   GLU A CA    1 
ATOM   182   C  C     . GLU A 1  48   ? 91.891  -6.085  -27.990  1.00 54.19  ?  27   GLU A C     1 
ATOM   183   O  O     . GLU A 1  48   ? 90.766  -5.709  -28.336  1.00 56.98  ?  27   GLU A O     1 
ATOM   184   C  CB    . GLU A 1  48   ? 92.234  -5.784  -25.521  1.00 59.61  ?  27   GLU A CB    1 
ATOM   185   C  CG    . GLU A 1  48   ? 92.886  -5.016  -24.383  1.00 62.25  ?  27   GLU A CG    1 
ATOM   186   C  CD    . GLU A 1  48   ? 94.398  -5.141  -24.379  1.00 69.52  ?  27   GLU A CD    1 
ATOM   187   O  OE1   . GLU A 1  48   ? 94.915  -6.189  -24.823  1.00 68.53  ?  27   GLU A OE1   1 
ATOM   188   O  OE2   . GLU A 1  48   ? 95.070  -4.185  -23.936  1.00 69.22  ?  27   GLU A OE2   1 
ATOM   189   N  N     . PRO A 1  49   ? 92.473  -7.138  -28.557  1.00 52.77  ?  28   PRO A N     1 
ATOM   190   C  CA    . PRO A 1  49   ? 91.815  -7.825  -29.676  1.00 54.97  ?  28   PRO A CA    1 
ATOM   191   C  C     . PRO A 1  49   ? 90.448  -8.367  -29.281  1.00 53.24  ?  28   PRO A C     1 
ATOM   192   O  O     . PRO A 1  49   ? 90.271  -8.940  -28.205  1.00 50.46  ?  28   PRO A O     1 
ATOM   193   C  CB    . PRO A 1  49   ? 92.795  -8.949  -30.032  1.00 55.79  ?  28   PRO A CB    1 
ATOM   194   C  CG    . PRO A 1  49   ? 93.684  -9.084  -28.846  1.00 56.14  ?  28   PRO A CG    1 
ATOM   195   C  CD    . PRO A 1  49   ? 93.772  -7.738  -28.220  1.00 54.13  ?  28   PRO A CD    1 
ATOM   196   N  N     . GLY A 1  50   ? 89.474  -8.163  -30.169  1.00 51.86  ?  29   GLY A N     1 
ATOM   197   C  CA    . GLY A 1  50   ? 88.095  -8.516  -29.910  1.00 53.81  ?  29   GLY A CA    1 
ATOM   198   C  C     . GLY A 1  50   ? 87.252  -7.408  -29.315  1.00 54.79  ?  29   GLY A C     1 
ATOM   199   O  O     . GLY A 1  50   ? 86.029  -7.566  -29.216  1.00 56.05  ?  29   GLY A O     1 
ATOM   200   N  N     . PHE A 1  51   ? 87.862  -6.293  -28.924  1.00 53.89  ?  30   PHE A N     1 
ATOM   201   C  CA    . PHE A 1  51   ? 87.179  -5.216  -28.223  1.00 51.19  ?  30   PHE A CA    1 
ATOM   202   C  C     . PHE A 1  51   ? 86.537  -4.192  -29.150  1.00 51.19  ?  30   PHE A C     1 
ATOM   203   O  O     . PHE A 1  51   ? 85.712  -3.398  -28.690  1.00 50.10  ?  30   PHE A O     1 
ATOM   204   C  CB    . PHE A 1  51   ? 88.169  -4.495  -27.306  1.00 56.56  ?  30   PHE A CB    1 
ATOM   205   C  CG    . PHE A 1  51   ? 87.617  -4.153  -25.962  1.00 59.03  ?  30   PHE A CG    1 
ATOM   206   C  CD1   . PHE A 1  51   ? 86.778  -3.072  -25.802  1.00 55.40  ?  30   PHE A CD1   1 
ATOM   207   C  CD2   . PHE A 1  51   ? 87.955  -4.901  -24.852  1.00 61.49  ?  30   PHE A CD2   1 
ATOM   208   C  CE1   . PHE A 1  51   ? 86.273  -2.747  -24.567  1.00 55.56  ?  30   PHE A CE1   1 
ATOM   209   C  CE2   . PHE A 1  51   ? 87.455  -4.581  -23.613  1.00 59.62  ?  30   PHE A CE2   1 
ATOM   210   C  CZ    . PHE A 1  51   ? 86.613  -3.501  -23.472  1.00 58.80  ?  30   PHE A CZ    1 
ATOM   211   N  N     . GLY A 1  52   ? 86.885  -4.188  -30.436  1.00 50.96  ?  31   GLY A N     1 
ATOM   212   C  CA    . GLY A 1  52   ? 86.435  -3.108  -31.301  1.00 45.94  ?  31   GLY A CA    1 
ATOM   213   C  C     . GLY A 1  52   ? 84.949  -3.171  -31.595  1.00 41.79  ?  31   GLY A C     1 
ATOM   214   O  O     . GLY A 1  52   ? 84.239  -2.165  -31.499  1.00 45.29  ?  31   GLY A O     1 
ATOM   215   N  N     . TYR A 1  53   ? 84.459  -4.360  -31.951  1.00 43.74  ?  32   TYR A N     1 
ATOM   216   C  CA    . TYR A 1  53   ? 83.071  -4.509  -32.375  1.00 39.54  ?  32   TYR A CA    1 
ATOM   217   C  C     . TYR A 1  53   ? 82.103  -4.065  -31.286  1.00 43.58  ?  32   TYR A C     1 
ATOM   218   O  O     . TYR A 1  53   ? 81.207  -3.250  -31.531  1.00 43.17  ?  32   TYR A O     1 
ATOM   219   C  CB    . TYR A 1  53   ? 82.810  -5.959  -32.778  1.00 41.51  ?  32   TYR A CB    1 
ATOM   220   C  CG    . TYR A 1  53   ? 83.372  -6.315  -34.132  1.00 40.01  ?  32   TYR A CG    1 
ATOM   221   C  CD1   . TYR A 1  53   ? 83.353  -5.400  -35.168  1.00 39.21  ?  32   TYR A CD1   1 
ATOM   222   C  CD2   . TYR A 1  53   ? 83.928  -7.562  -34.372  1.00 41.46  ?  32   TYR A CD2   1 
ATOM   223   C  CE1   . TYR A 1  53   ? 83.864  -5.716  -36.410  1.00 39.17  ?  32   TYR A CE1   1 
ATOM   224   C  CE2   . TYR A 1  53   ? 84.443  -7.887  -35.613  1.00 41.03  ?  32   TYR A CE2   1 
ATOM   225   C  CZ    . TYR A 1  53   ? 84.406  -6.959  -36.628  1.00 39.49  ?  32   TYR A CZ    1 
ATOM   226   O  OH    . TYR A 1  53   ? 84.915  -7.272  -37.865  1.00 38.96  ?  32   TYR A OH    1 
ATOM   227   N  N     . THR A 1  54   ? 82.272  -4.586  -30.070  1.00 46.45  ?  33   THR A N     1 
ATOM   228   C  CA    . THR A 1  54   ? 81.329  -4.270  -29.004  1.00 43.72  ?  33   THR A CA    1 
ATOM   229   C  C     . THR A 1  54   ? 81.397  -2.801  -28.598  1.00 42.98  ?  33   THR A C     1 
ATOM   230   O  O     . THR A 1  54   ? 80.391  -2.240  -28.149  1.00 45.56  ?  33   THR A O     1 
ATOM   231   C  CB    . THR A 1  54   ? 81.576  -5.180  -27.800  1.00 41.21  ?  33   THR A CB    1 
ATOM   232   O  OG1   . THR A 1  54   ? 80.694  -4.818  -26.735  1.00 42.36  ?  33   THR A OG1   1 
ATOM   233   C  CG2   . THR A 1  54   ? 83.014  -5.073  -27.325  1.00 45.85  ?  33   THR A CG2   1 
ATOM   234   N  N     . LEU A 1  55   ? 82.559  -2.161  -28.748  1.00 46.56  ?  34   LEU A N     1 
ATOM   235   C  CA    . LEU A 1  55   ? 82.662  -0.735  -28.449  1.00 44.59  ?  34   LEU A CA    1 
ATOM   236   C  C     . LEU A 1  55   ? 81.946  0.102   -29.498  1.00 42.82  ?  34   LEU A C     1 
ATOM   237   O  O     . LEU A 1  55   ? 81.078  0.924   -29.172  1.00 43.02  ?  34   LEU A O     1 
ATOM   238   C  CB    . LEU A 1  55   ? 84.124  -0.316  -28.365  1.00 48.04  ?  34   LEU A CB    1 
ATOM   239   C  CG    . LEU A 1  55   ? 84.848  -0.597  -27.056  1.00 56.86  ?  34   LEU A CG    1 
ATOM   240   C  CD1   . LEU A 1  55   ? 86.174  0.141   -27.039  1.00 61.63  ?  34   LEU A CD1   1 
ATOM   241   C  CD2   . LEU A 1  55   ? 83.987  -0.209  -25.866  1.00 56.95  ?  34   LEU A CD2   1 
ATOM   242   N  N     . GLY A 1  56   ? 82.307  -0.090  -30.767  1.00 43.00  ?  35   GLY A N     1 
ATOM   243   C  CA    . GLY A 1  56   ? 81.635  0.631   -31.829  1.00 43.80  ?  35   GLY A CA    1 
ATOM   244   C  C     . GLY A 1  56   ? 80.140  0.405   -31.825  1.00 42.04  ?  35   GLY A C     1 
ATOM   245   O  O     . GLY A 1  56   ? 79.372  1.289   -32.211  1.00 41.50  ?  35   GLY A O     1 
ATOM   246   N  N     . ASN A 1  57   ? 79.703  -0.769  -31.373  1.00 40.31  ?  36   ASN A N     1 
ATOM   247   C  CA    . ASN A 1  57   ? 78.271  -1.012  -31.316  1.00 40.19  ?  36   ASN A CA    1 
ATOM   248   C  C     . ASN A 1  57   ? 77.632  -0.376  -30.094  1.00 41.30  ?  36   ASN A C     1 
ATOM   249   O  O     . ASN A 1  57   ? 76.493  0.073   -30.175  1.00 40.18  ?  36   ASN A O     1 
ATOM   250   C  CB    . ASN A 1  57   ? 77.967  -2.499  -31.340  1.00 38.79  ?  36   ASN A CB    1 
ATOM   251   C  CG    . ASN A 1  57   ? 76.482  -2.773  -31.448  1.00 43.13  ?  36   ASN A CG    1 
ATOM   252   O  OD1   . ASN A 1  57   ? 75.831  -3.127  -30.467  1.00 46.84  ?  36   ASN A OD1   1 
ATOM   253   N  ND2   . ASN A 1  57   ? 75.933  -2.588  -32.641  1.00 43.01  ?  36   ASN A ND2   1 
ATOM   254   N  N     . SER A 1  58   ? 78.317  -0.341  -28.950  1.00 40.99  ?  37   SER A N     1 
ATOM   255   C  CA    . SER A 1  58   ? 77.780  0.436   -27.836  1.00 41.39  ?  37   SER A CA    1 
ATOM   256   C  C     . SER A 1  58   ? 77.569  1.886   -28.253  1.00 42.39  ?  37   SER A C     1 
ATOM   257   O  O     . SER A 1  58   ? 76.512  2.482   -27.986  1.00 41.43  ?  37   SER A O     1 
ATOM   258   C  CB    . SER A 1  58   ? 78.713  0.352   -26.630  1.00 43.12  ?  37   SER A CB    1 
ATOM   259   O  OG    . SER A 1  58   ? 78.759  -0.964  -26.111  1.00 46.99  ?  37   SER A OG    1 
ATOM   260   N  N     . LEU A 1  59   ? 78.551  2.452   -28.959  1.00 41.93  ?  38   LEU A N     1 
ATOM   261   C  CA    . LEU A 1  59   ? 78.420  3.819   -29.448  1.00 40.97  ?  38   LEU A CA    1 
ATOM   262   C  C     . LEU A 1  59   ? 77.284  3.945   -30.455  1.00 39.83  ?  38   LEU A C     1 
ATOM   263   O  O     . LEU A 1  59   ? 76.507  4.901   -30.399  1.00 40.20  ?  38   LEU A O     1 
ATOM   264   C  CB    . LEU A 1  59   ? 79.743  4.280   -30.057  1.00 40.98  ?  38   LEU A CB    1 
ATOM   265   C  CG    . LEU A 1  59   ? 80.864  4.472   -29.035  1.00 38.82  ?  38   LEU A CG    1 
ATOM   266   C  CD1   . LEU A 1  59   ? 82.206  4.594   -29.724  1.00 43.24  ?  38   LEU A CD1   1 
ATOM   267   C  CD2   . LEU A 1  59   ? 80.588  5.693   -28.179  1.00 37.73  ?  38   LEU A CD2   1 
ATOM   268   N  N     . ARG A 1  60   ? 77.167  2.990   -31.382  1.00 39.08  ?  39   ARG A N     1 
ATOM   269   C  CA    . ARG A 1  60   ? 76.090  3.040   -32.368  1.00 35.15  ?  39   ARG A CA    1 
ATOM   270   C  C     . ARG A 1  60   ? 74.724  2.978   -31.696  1.00 37.61  ?  39   ARG A C     1 
ATOM   271   O  O     . ARG A 1  60   ? 73.820  3.754   -32.023  1.00 40.79  ?  39   ARG A O     1 
ATOM   272   C  CB    . ARG A 1  60   ? 76.242  1.896   -33.368  1.00 32.26  ?  39   ARG A CB    1 
ATOM   273   C  CG    . ARG A 1  60   ? 75.122  1.810   -34.390  1.00 32.38  ?  39   ARG A CG    1 
ATOM   274   C  CD    . ARG A 1  60   ? 75.366  0.670   -35.357  1.00 34.33  ?  39   ARG A CD    1 
ATOM   275   N  NE    . ARG A 1  60   ? 74.432  0.663   -36.477  1.00 34.46  ?  39   ARG A NE    1 
ATOM   276   C  CZ    . ARG A 1  60   ? 73.288  -0.013  -36.494  1.00 34.89  ?  39   ARG A CZ    1 
ATOM   277   N  NH1   . ARG A 1  60   ? 72.927  -0.736  -35.444  1.00 35.59  ?  39   ARG A NH1   1 
ATOM   278   N  NH2   . ARG A 1  60   ? 72.506  0.035   -37.561  1.00 33.67  ?  39   ARG A NH2   1 
ATOM   279   N  N     . ARG A 1  61   ? 74.558  2.046   -30.758  1.00 40.38  ?  40   ARG A N     1 
ATOM   280   C  CA    . ARG A 1  61   ? 73.303  1.929   -30.027  1.00 40.27  ?  40   ARG A CA    1 
ATOM   281   C  C     . ARG A 1  61   ? 72.946  3.237   -29.345  1.00 39.38  ?  40   ARG A C     1 
ATOM   282   O  O     . ARG A 1  61   ? 71.792  3.674   -29.395  1.00 42.00  ?  40   ARG A O     1 
ATOM   283   C  CB    . ARG A 1  61   ? 73.394  0.812   -28.991  1.00 43.69  ?  40   ARG A CB    1 
ATOM   284   C  CG    . ARG A 1  61   ? 73.733  -0.558  -29.534  1.00 41.35  ?  40   ARG A CG    1 
ATOM   285   C  CD    . ARG A 1  61   ? 72.616  -1.150  -30.335  1.00 46.61  ?  40   ARG A CD    1 
ATOM   286   N  NE    . ARG A 1  61   ? 71.425  -1.359  -29.521  1.00 56.95  ?  40   ARG A NE    1 
ATOM   287   C  CZ    . ARG A 1  61   ? 71.303  -2.301  -28.595  1.00 44.32  ?  40   ARG A CZ    1 
ATOM   288   N  NH1   . ARG A 1  61   ? 70.179  -2.410  -27.907  1.00 40.83  ?  40   ARG A NH1   1 
ATOM   289   N  NH2   . ARG A 1  61   ? 72.306  -3.127  -28.352  1.00 55.07  ?  40   ARG A NH2   1 
ATOM   290   N  N     . THR A 1  62   ? 73.921  3.879   -28.698  1.00 39.91  ?  41   THR A N     1 
ATOM   291   C  CA    . THR A 1  62   ? 73.608  5.148   -28.048  1.00 41.04  ?  41   THR A CA    1 
ATOM   292   C  C     . THR A 1  62   ? 73.317  6.250   -29.064  1.00 41.22  ?  41   THR A C     1 
ATOM   293   O  O     . THR A 1  62   ? 72.480  7.121   -28.805  1.00 41.94  ?  41   THR A O     1 
ATOM   294   C  CB    . THR A 1  62   ? 74.746  5.553   -27.116  1.00 42.38  ?  41   THR A CB    1 
ATOM   295   O  OG1   . THR A 1  62   ? 74.986  4.493   -26.184  1.00 43.59  ?  41   THR A OG1   1 
ATOM   296   C  CG2   . THR A 1  62   ? 74.382  6.808   -26.342  1.00 44.83  ?  41   THR A CG2   1 
ATOM   297   N  N     . LEU A 1  63   ? 73.966  6.210   -30.229  1.00 39.05  ?  42   LEU A N     1 
ATOM   298   C  CA    . LEU A 1  63   ? 73.782  7.262   -31.225  1.00 38.42  ?  42   LEU A CA    1 
ATOM   299   C  C     . LEU A 1  63   ? 72.399  7.194   -31.859  1.00 43.35  ?  42   LEU A C     1 
ATOM   300   O  O     . LEU A 1  63   ? 71.713  8.214   -31.988  1.00 45.66  ?  42   LEU A O     1 
ATOM   301   C  CB    . LEU A 1  63   ? 74.863  7.166   -32.299  1.00 38.68  ?  42   LEU A CB    1 
ATOM   302   C  CG    . LEU A 1  63   ? 76.250  7.712   -31.962  1.00 41.28  ?  42   LEU A CG    1 
ATOM   303   C  CD1   . LEU A 1  63   ? 77.263  7.212   -32.974  1.00 37.10  ?  42   LEU A CD1   1 
ATOM   304   C  CD2   . LEU A 1  63   ? 76.237  9.229   -31.924  1.00 38.66  ?  42   LEU A CD2   1 
ATOM   305   N  N     . LEU A 1  64   ? 71.973  6.000   -32.269  1.00 44.14  ?  43   LEU A N     1 
ATOM   306   C  CA    . LEU A 1  64   ? 70.697  5.862   -32.960  1.00 41.64  ?  43   LEU A CA    1 
ATOM   307   C  C     . LEU A 1  64   ? 69.495  6.104   -32.057  1.00 41.80  ?  43   LEU A C     1 
ATOM   308   O  O     . LEU A 1  64   ? 68.377  6.225   -32.568  1.00 42.05  ?  43   LEU A O     1 
ATOM   309   C  CB    . LEU A 1  64   ? 70.596  4.476   -33.589  1.00 36.59  ?  43   LEU A CB    1 
ATOM   310   C  CG    . LEU A 1  64   ? 71.503  4.264   -34.796  1.00 34.23  ?  43   LEU A CG    1 
ATOM   311   C  CD1   . LEU A 1  64   ? 71.306  2.877   -35.375  1.00 34.04  ?  43   LEU A CD1   1 
ATOM   312   C  CD2   . LEU A 1  64   ? 71.234  5.328   -35.838  1.00 34.93  ?  43   LEU A CD2   1 
ATOM   313   N  N     . SER A 1  65   ? 69.694  6.196   -30.745  1.00 40.32  ?  44   SER A N     1 
ATOM   314   C  CA    . SER A 1  65   ? 68.590  6.269   -29.795  1.00 39.10  ?  44   SER A CA    1 
ATOM   315   C  C     . SER A 1  65   ? 68.633  7.536   -28.952  1.00 43.14  ?  44   SER A C     1 
ATOM   316   O  O     . SER A 1  65   ? 67.667  8.303   -28.958  1.00 49.34  ?  44   SER A O     1 
ATOM   317   C  CB    . SER A 1  65   ? 68.582  5.023   -28.900  1.00 38.78  ?  44   SER A CB    1 
ATOM   318   O  OG    . SER A 1  65   ? 69.670  5.025   -27.995  1.00 45.26  ?  44   SER A OG    1 
ATOM   319   N  N     . SER A 1  66   ? 69.706  7.759   -28.197  1.00 42.66  ?  45   SER A N     1 
ATOM   320   C  CA    . SER A 1  66   ? 69.715  8.699   -27.085  1.00 43.94  ?  45   SER A CA    1 
ATOM   321   C  C     . SER A 1  66   ? 70.248  10.091  -27.426  1.00 45.56  ?  45   SER A C     1 
ATOM   322   O  O     . SER A 1  66   ? 70.404  10.909  -26.516  1.00 49.01  ?  45   SER A O     1 
ATOM   323   C  CB    . SER A 1  66   ? 70.519  8.107   -25.932  1.00 46.22  ?  45   SER A CB    1 
ATOM   324   O  OG    . SER A 1  66   ? 69.996  6.845   -25.560  1.00 51.21  ?  45   SER A OG    1 
ATOM   325   N  N     . ILE A 1  67   ? 70.547  10.385  -28.683  1.00 44.25  ?  46   ILE A N     1 
ATOM   326   C  CA    . ILE A 1  67   ? 71.151  11.681  -29.010  1.00 43.77  ?  46   ILE A CA    1 
ATOM   327   C  C     . ILE A 1  67   ? 70.072  12.760  -28.980  1.00 46.00  ?  46   ILE A C     1 
ATOM   328   O  O     . ILE A 1  67   ? 69.063  12.636  -29.690  1.00 49.29  ?  46   ILE A O     1 
ATOM   329   C  CB    . ILE A 1  67   ? 71.841  11.633  -30.366  1.00 42.80  ?  46   ILE A CB    1 
ATOM   330   C  CG1   . ILE A 1  67   ? 73.005  10.644  -30.334  1.00 40.04  ?  46   ILE A CG1   1 
ATOM   331   C  CG2   . ILE A 1  67   ? 72.334  13.015  -30.754  1.00 42.77  ?  46   ILE A CG2   1 
ATOM   332   C  CD1   . ILE A 1  67   ? 73.825  10.694  -29.068  1.00 41.30  ?  46   ILE A CD1   1 
ATOM   333   N  N     . PRO A 1  68   ? 70.251  13.825  -28.200  1.00 48.19  ?  47   PRO A N     1 
ATOM   334   C  CA    . PRO A 1  68   ? 69.204  14.848  -28.086  1.00 50.82  ?  47   PRO A CA    1 
ATOM   335   C  C     . PRO A 1  68   ? 69.037  15.651  -29.366  1.00 47.34  ?  47   PRO A C     1 
ATOM   336   O  O     . PRO A 1  68   ? 69.976  15.834  -30.143  1.00 47.39  ?  47   PRO A O     1 
ATOM   337   C  CB    . PRO A 1  68   ? 69.701  15.740  -26.940  1.00 54.02  ?  47   PRO A CB    1 
ATOM   338   C  CG    . PRO A 1  68   ? 70.747  14.936  -26.238  1.00 57.38  ?  47   PRO A CG    1 
ATOM   339   C  CD    . PRO A 1  68   ? 71.376  14.087  -27.291  1.00 50.26  ?  47   PRO A CD    1 
ATOM   340   N  N     . GLY A 1  69   ? 67.826  16.160  -29.559  1.00 46.79  ?  48   GLY A N     1 
ATOM   341   C  CA    . GLY A 1  69   ? 67.492  16.883  -30.765  1.00 44.20  ?  48   GLY A CA    1 
ATOM   342   C  C     . GLY A 1  69   ? 66.221  17.684  -30.590  1.00 44.38  ?  48   GLY A C     1 
ATOM   343   O  O     . GLY A 1  69   ? 65.741  17.890  -29.474  1.00 46.79  ?  48   GLY A O     1 
ATOM   344   N  N     . ALA A 1  70   ? 65.684  18.146  -31.716  1.00 43.14  ?  49   ALA A N     1 
ATOM   345   C  CA    . ALA A 1  70   ? 64.478  18.959  -31.717  1.00 40.97  ?  49   ALA A CA    1 
ATOM   346   C  C     . ALA A 1  70   ? 63.592  18.570  -32.889  1.00 40.70  ?  49   ALA A C     1 
ATOM   347   O  O     . ALA A 1  70   ? 64.088  18.238  -33.970  1.00 40.36  ?  49   ALA A O     1 
ATOM   348   C  CB    . ALA A 1  70   ? 64.814  20.453  -31.787  1.00 41.82  ?  49   ALA A CB    1 
ATOM   349   N  N     . ALA A 1  71   ? 62.281  18.620  -32.669  1.00 39.93  ?  50   ALA A N     1 
ATOM   350   C  CA    . ALA A 1  71   ? 61.317  18.237  -33.692  1.00 39.33  ?  50   ALA A CA    1 
ATOM   351   C  C     . ALA A 1  71   ? 59.990  18.926  -33.410  1.00 39.05  ?  50   ALA A C     1 
ATOM   352   O  O     . ALA A 1  71   ? 59.745  19.417  -32.307  1.00 39.13  ?  50   ALA A O     1 
ATOM   353   C  CB    . ALA A 1  71   ? 61.133  16.717  -33.752  1.00 34.99  ?  50   ALA A CB    1 
ATOM   354   N  N     . VAL A 1  72   ? 59.135  18.951  -34.431  1.00 38.32  ?  51   VAL A N     1 
ATOM   355   C  CA    . VAL A 1  72   ? 57.815  19.554  -34.294  1.00 37.62  ?  51   VAL A CA    1 
ATOM   356   C  C     . VAL A 1  72   ? 56.926  18.653  -33.447  1.00 41.50  ?  51   VAL A C     1 
ATOM   357   O  O     . VAL A 1  72   ? 56.819  17.444  -33.696  1.00 41.36  ?  51   VAL A O     1 
ATOM   358   C  CB    . VAL A 1  72   ? 57.194  19.807  -35.675  1.00 36.85  ?  51   VAL A CB    1 
ATOM   359   C  CG1   . VAL A 1  72   ? 55.752  20.250  -35.533  1.00 40.21  ?  51   VAL A CG1   1 
ATOM   360   C  CG2   . VAL A 1  72   ? 57.999  20.841  -36.438  1.00 34.69  ?  51   VAL A CG2   1 
ATOM   361   N  N     . THR A 1  73   ? 56.311  19.234  -32.415  1.00 41.10  ?  52   THR A N     1 
ATOM   362   C  CA    . THR A 1  73   ? 55.355  18.504  -31.589  1.00 40.00  ?  52   THR A CA    1 
ATOM   363   C  C     . THR A 1  73   ? 53.961  18.490  -32.206  1.00 43.07  ?  52   THR A C     1 
ATOM   364   O  O     . THR A 1  73   ? 53.304  17.444  -32.254  1.00 45.22  ?  52   THR A O     1 
ATOM   365   C  CB    . THR A 1  73   ? 55.311  19.118  -30.190  1.00 43.62  ?  52   THR A CB    1 
ATOM   366   O  OG1   . THR A 1  73   ? 56.368  18.571  -29.395  1.00 50.17  ?  52   THR A OG1   1 
ATOM   367   C  CG2   . THR A 1  73   ? 53.975  18.852  -29.513  1.00 45.70  ?  52   THR A CG2   1 
ATOM   368   N  N     . SER A 1  74   ? 53.497  19.639  -32.689  1.00 40.86  ?  53   SER A N     1 
ATOM   369   C  CA    . SER A 1  74   ? 52.119  19.785  -33.133  1.00 38.32  ?  53   SER A CA    1 
ATOM   370   C  C     . SER A 1  74   ? 52.039  20.954  -34.098  1.00 35.49  ?  53   SER A C     1 
ATOM   371   O  O     . SER A 1  74   ? 52.956  21.771  -34.182  1.00 37.81  ?  53   SER A O     1 
ATOM   372   C  CB    . SER A 1  74   ? 51.170  19.997  -31.951  1.00 41.01  ?  53   SER A CB    1 
ATOM   373   O  OG    . SER A 1  74   ? 51.685  20.965  -31.057  1.00 41.18  ?  53   SER A OG    1 
ATOM   374   N  N     . ILE A 1  75   ? 50.938  21.010  -34.849  1.00 32.72  ?  54   ILE A N     1 
ATOM   375   C  CA    . ILE A 1  75   ? 50.680  22.120  -35.757  1.00 34.24  ?  54   ILE A CA    1 
ATOM   376   C  C     . ILE A 1  75   ? 49.219  22.532  -35.641  1.00 36.58  ?  54   ILE A C     1 
ATOM   377   O  O     . ILE A 1  75   ? 48.369  21.784  -35.156  1.00 41.28  ?  54   ILE A O     1 
ATOM   378   C  CB    . ILE A 1  75   ? 51.012  21.794  -37.232  1.00 32.23  ?  54   ILE A CB    1 
ATOM   379   C  CG1   . ILE A 1  75   ? 49.878  21.004  -37.877  1.00 34.93  ?  54   ILE A CG1   1 
ATOM   380   C  CG2   . ILE A 1  75   ? 52.318  21.037  -37.352  1.00 32.78  ?  54   ILE A CG2   1 
ATOM   381   C  CD1   . ILE A 1  75   ? 50.028  20.866  -39.366  1.00 36.61  ?  54   ILE A CD1   1 
ATOM   382   N  N     . ARG A 1  76   ? 48.942  23.754  -36.088  1.00 37.64  ?  55   ARG A N     1 
ATOM   383   C  CA    . ARG A 1  76   ? 47.588  24.284  -36.160  1.00 38.16  ?  55   ARG A CA    1 
ATOM   384   C  C     . ARG A 1  76   ? 47.445  24.983  -37.500  1.00 37.21  ?  55   ARG A C     1 
ATOM   385   O  O     . ARG A 1  76   ? 48.170  25.937  -37.774  1.00 40.05  ?  55   ARG A O     1 
ATOM   386   C  CB    . ARG A 1  76   ? 47.316  25.250  -35.002  1.00 41.97  ?  55   ARG A CB    1 
ATOM   387   C  CG    . ARG A 1  76   ? 45.859  25.365  -34.598  1.00 53.83  ?  55   ARG A CG    1 
ATOM   388   C  CD    . ARG A 1  76   ? 45.720  25.506  -33.087  1.00 60.60  ?  55   ARG A CD    1 
ATOM   389   N  NE    . ARG A 1  76   ? 44.323  25.486  -32.660  1.00 65.57  ?  55   ARG A NE    1 
ATOM   390   C  CZ    . ARG A 1  76   ? 43.922  25.263  -31.412  1.00 66.94  ?  55   ARG A CZ    1 
ATOM   391   N  NH1   . ARG A 1  76   ? 44.811  25.030  -30.455  1.00 64.00  ?  55   ARG A NH1   1 
ATOM   392   N  NH2   . ARG A 1  76   ? 42.627  25.267  -31.120  1.00 65.37  ?  55   ARG A NH2   1 
ATOM   393   N  N     . ILE A 1  77   ? 46.532  24.514  -38.340  1.00 37.90  ?  56   ILE A N     1 
ATOM   394   C  CA    . ILE A 1  77   ? 46.292  25.120  -39.644  1.00 37.61  ?  56   ILE A CA    1 
ATOM   395   C  C     . ILE A 1  77   ? 44.964  25.858  -39.596  1.00 43.62  ?  56   ILE A C     1 
ATOM   396   O  O     . ILE A 1  77   ? 43.975  25.346  -39.059  1.00 42.18  ?  56   ILE A O     1 
ATOM   397   C  CB    . ILE A 1  77   ? 46.304  24.075  -40.774  1.00 35.16  ?  56   ILE A CB    1 
ATOM   398   C  CG1   . ILE A 1  77   ? 47.594  23.261  -40.733  1.00 36.08  ?  56   ILE A CG1   1 
ATOM   399   C  CG2   . ILE A 1  77   ? 46.151  24.743  -42.126  1.00 37.00  ?  56   ILE A CG2   1 
ATOM   400   C  CD1   . ILE A 1  77   ? 47.656  22.186  -41.792  1.00 36.51  ?  56   ILE A CD1   1 
ATOM   401   N  N     . ASP A 1  78   ? 44.947  27.068  -40.146  1.00 46.76  ?  57   ASP A N     1 
ATOM   402   C  CA    . ASP A 1  78   ? 43.750  27.895  -40.112  1.00 47.18  ?  57   ASP A CA    1 
ATOM   403   C  C     . ASP A 1  78   ? 42.690  27.315  -41.038  1.00 47.41  ?  57   ASP A C     1 
ATOM   404   O  O     . ASP A 1  78   ? 42.940  27.109  -42.230  1.00 45.26  ?  57   ASP A O     1 
ATOM   405   C  CB    . ASP A 1  78   ? 44.086  29.328  -40.510  1.00 47.91  ?  57   ASP A CB    1 
ATOM   406   C  CG    . ASP A 1  78   ? 42.858  30.206  -40.610  1.00 57.56  ?  57   ASP A CG    1 
ATOM   407   O  OD1   . ASP A 1  78   ? 42.317  30.594  -39.555  1.00 61.41  ?  57   ASP A OD1   1 
ATOM   408   O  OD2   . ASP A 1  78   ? 42.435  30.511  -41.744  1.00 60.40  ?  57   ASP A OD2   1 
ATOM   409   N  N     . GLY A 1  79   ? 41.508  27.053  -40.489  1.00 47.45  ?  58   GLY A N     1 
ATOM   410   C  CA    . GLY A 1  79   ? 40.396  26.544  -41.257  1.00 46.04  ?  58   GLY A CA    1 
ATOM   411   C  C     . GLY A 1  79   ? 40.198  25.045  -41.193  1.00 48.34  ?  58   GLY A C     1 
ATOM   412   O  O     . GLY A 1  79   ? 39.172  24.559  -41.681  1.00 49.10  ?  58   GLY A O     1 
ATOM   413   N  N     . VAL A 1  80   ? 41.141  24.298  -40.619  1.00 44.34  ?  59   VAL A N     1 
ATOM   414   C  CA    . VAL A 1  80   ? 41.026  22.850  -40.486  1.00 42.06  ?  59   VAL A CA    1 
ATOM   415   C  C     . VAL A 1  80   ? 41.113  22.493  -39.007  1.00 39.97  ?  59   VAL A C     1 
ATOM   416   O  O     . VAL A 1  80   ? 41.954  23.032  -38.279  1.00 42.25  ?  59   VAL A O     1 
ATOM   417   C  CB    . VAL A 1  80   ? 42.091  22.110  -41.322  1.00 39.70  ?  59   VAL A CB    1 
ATOM   418   C  CG1   . VAL A 1  80   ? 42.227  22.747  -42.696  1.00 40.23  ?  59   VAL A CG1   1 
ATOM   419   C  CG2   . VAL A 1  80   ? 43.429  22.054  -40.620  1.00 40.79  ?  59   VAL A CG2   1 
ATOM   420   N  N     . LEU A 1  81   ? 40.181  21.662  -38.545  1.00 40.71  ?  60   LEU A N     1 
ATOM   421   C  CA    . LEU A 1  81   ? 40.154  21.205  -37.162  1.00 42.49  ?  60   LEU A CA    1 
ATOM   422   C  C     . LEU A 1  81   ? 40.710  19.798  -36.974  1.00 43.22  ?  60   LEU A C     1 
ATOM   423   O  O     . LEU A 1  81   ? 40.832  19.342  -35.833  1.00 42.71  ?  60   LEU A O     1 
ATOM   424   C  CB    . LEU A 1  81   ? 38.723  21.276  -36.619  1.00 42.43  ?  60   LEU A CB    1 
ATOM   425   C  CG    . LEU A 1  81   ? 38.064  22.659  -36.648  1.00 41.29  ?  60   LEU A CG    1 
ATOM   426   C  CD1   . LEU A 1  81   ? 37.329  22.907  -37.960  1.00 45.56  ?  60   LEU A CD1   1 
ATOM   427   C  CD2   . LEU A 1  81   ? 37.130  22.832  -35.466  1.00 46.73  ?  60   LEU A CD2   1 
ATOM   428   N  N     . HIS A 1  82   ? 41.053  19.103  -38.054  1.00 39.39  ?  61   HIS A N     1 
ATOM   429   C  CA    . HIS A 1  82   ? 41.599  17.756  -37.962  1.00 36.99  ?  61   HIS A CA    1 
ATOM   430   C  C     . HIS A 1  82   ? 42.366  17.468  -39.242  1.00 38.32  ?  61   HIS A C     1 
ATOM   431   O  O     . HIS A 1  82   ? 42.236  18.177  -40.242  1.00 36.55  ?  61   HIS A O     1 
ATOM   432   C  CB    . HIS A 1  82   ? 40.509  16.709  -37.715  1.00 37.95  ?  61   HIS A CB    1 
ATOM   433   C  CG    . HIS A 1  82   ? 39.430  16.704  -38.749  1.00 36.59  ?  61   HIS A CG    1 
ATOM   434   N  ND1   . HIS A 1  82   ? 39.615  16.200  -40.016  1.00 32.97  ?  61   HIS A ND1   1 
ATOM   435   C  CD2   . HIS A 1  82   ? 38.151  17.141  -38.701  1.00 38.43  ?  61   HIS A CD2   1 
ATOM   436   C  CE1   . HIS A 1  82   ? 38.498  16.331  -40.706  1.00 37.47  ?  61   HIS A CE1   1 
ATOM   437   N  NE2   . HIS A 1  82   ? 37.594  16.899  -39.931  1.00 38.03  ?  61   HIS A NE2   1 
ATOM   438   N  N     . GLU A 1  83   ? 43.169  16.408  -39.198  1.00 37.10  ?  62   GLU A N     1 
ATOM   439   C  CA    . GLU A 1  83   ? 44.182  16.184  -40.218  1.00 37.69  ?  62   GLU A CA    1 
ATOM   440   C  C     . GLU A 1  83   ? 43.663  15.514  -41.482  1.00 36.67  ?  62   GLU A C     1 
ATOM   441   O  O     . GLU A 1  83   ? 44.396  15.477  -42.473  1.00 38.24  ?  62   GLU A O     1 
ATOM   442   C  CB    . GLU A 1  83   ? 45.322  15.355  -39.639  1.00 38.13  ?  62   GLU A CB    1 
ATOM   443   C  CG    . GLU A 1  83   ? 44.899  14.023  -39.080  1.00 38.94  ?  62   GLU A CG    1 
ATOM   444   C  CD    . GLU A 1  83   ? 45.977  13.408  -38.223  1.00 53.13  ?  62   GLU A CD    1 
ATOM   445   O  OE1   . GLU A 1  83   ? 45.792  13.348  -36.989  1.00 61.08  ?  62   GLU A OE1   1 
ATOM   446   O  OE2   . GLU A 1  83   ? 47.019  13.006  -38.782  1.00 50.42  ?  62   GLU A OE2   1 
ATOM   447   N  N     . PHE A 1  84   ? 42.444  14.984  -41.498  1.00 36.77  ?  63   PHE A N     1 
ATOM   448   C  CA    . PHE A 1  84   ? 41.926  14.355  -42.709  1.00 36.65  ?  63   PHE A CA    1 
ATOM   449   C  C     . PHE A 1  84   ? 40.959  15.339  -43.350  1.00 41.05  ?  63   PHE A C     1 
ATOM   450   O  O     . PHE A 1  84   ? 39.770  15.352  -43.029  1.00 37.25  ?  63   PHE A O     1 
ATOM   451   C  CB    . PHE A 1  84   ? 41.241  13.033  -42.381  1.00 36.25  ?  63   PHE A CB    1 
ATOM   452   C  CG    . PHE A 1  84   ? 41.898  12.268  -41.266  1.00 33.86  ?  63   PHE A CG    1 
ATOM   453   C  CD1   . PHE A 1  84   ? 42.907  11.358  -41.532  1.00 35.40  ?  63   PHE A CD1   1 
ATOM   454   C  CD2   . PHE A 1  84   ? 41.506  12.457  -39.953  1.00 32.76  ?  63   PHE A CD2   1 
ATOM   455   C  CE1   . PHE A 1  84   ? 43.512  10.657  -40.508  1.00 38.89  ?  63   PHE A CE1   1 
ATOM   456   C  CE2   . PHE A 1  84   ? 42.104  11.761  -38.928  1.00 36.32  ?  63   PHE A CE2   1 
ATOM   457   C  CZ    . PHE A 1  84   ? 43.110  10.858  -39.205  1.00 39.35  ?  63   PHE A CZ    1 
ATOM   458   N  N     . THR A 1  85   ? 41.454  16.074  -44.344  1.00 38.11  ?  64   THR A N     1 
ATOM   459   C  CA    . THR A 1  85   ? 40.733  17.183  -44.956  1.00 36.49  ?  64   THR A CA    1 
ATOM   460   C  C     . THR A 1  85   ? 41.656  17.889  -45.934  1.00 33.76  ?  64   THR A C     1 
ATOM   461   O  O     . THR A 1  85   ? 42.827  17.523  -46.064  1.00 33.20  ?  64   THR A O     1 
ATOM   462   C  CB    . THR A 1  85   ? 40.214  18.176  -43.912  1.00 37.45  ?  64   THR A CB    1 
ATOM   463   O  OG1   . THR A 1  85   ? 39.293  19.082  -44.532  1.00 43.65  ?  64   THR A OG1   1 
ATOM   464   C  CG2   . THR A 1  85   ? 41.355  18.960  -43.303  1.00 33.66  ?  64   THR A CG2   1 
ATOM   465   N  N     . THR A 1  86   ? 41.144  18.897  -46.627  1.00 33.80  ?  65   THR A N     1 
ATOM   466   C  CA    . THR A 1  86   ? 41.941  19.661  -47.567  1.00 35.23  ?  65   THR A CA    1 
ATOM   467   C  C     . THR A 1  86   ? 41.926  21.136  -47.194  1.00 35.07  ?  65   THR A C     1 
ATOM   468   O  O     . THR A 1  86   ? 41.106  21.593  -46.394  1.00 35.73  ?  65   THR A O     1 
ATOM   469   C  CB    . THR A 1  86   ? 41.434  19.479  -49.000  1.00 37.40  ?  65   THR A CB    1 
ATOM   470   O  OG1   . THR A 1  86   ? 40.114  20.018  -49.110  1.00 37.92  ?  65   THR A OG1   1 
ATOM   471   C  CG2   . THR A 1  86   ? 41.400  18.003  -49.363  1.00 36.17  ?  65   THR A CG2   1 
ATOM   472   N  N     . VAL A 1  87   ? 42.880  21.863  -47.750  1.00 34.69  ?  66   VAL A N     1 
ATOM   473   C  CA    . VAL A 1  87   ? 42.928  23.321  -47.690  1.00 35.00  ?  66   VAL A CA    1 
ATOM   474   C  C     . VAL A 1  87   ? 42.601  23.852  -49.079  1.00 35.30  ?  66   VAL A C     1 
ATOM   475   O  O     . VAL A 1  87   ? 43.194  23.388  -50.058  1.00 37.73  ?  66   VAL A O     1 
ATOM   476   C  CB    . VAL A 1  87   ? 44.300  23.833  -47.217  1.00 35.13  ?  66   VAL A CB    1 
ATOM   477   C  CG1   . VAL A 1  87   ? 44.311  25.345  -47.167  1.00 37.28  ?  66   VAL A CG1   1 
ATOM   478   C  CG2   . VAL A 1  87   ? 44.630  23.255  -45.853  1.00 38.00  ?  66   VAL A CG2   1 
ATOM   479   N  N     . PRO A 1  88   ? 41.650  24.773  -49.216  1.00 34.85  ?  67   PRO A N     1 
ATOM   480   C  CA    . PRO A 1  88   ? 41.286  25.271  -50.550  1.00 33.76  ?  67   PRO A CA    1 
ATOM   481   C  C     . PRO A 1  88   ? 42.492  25.823  -51.298  1.00 34.71  ?  67   PRO A C     1 
ATOM   482   O  O     . PRO A 1  88   ? 43.254  26.637  -50.772  1.00 34.68  ?  67   PRO A O     1 
ATOM   483   C  CB    . PRO A 1  88   ? 40.263  26.370  -50.246  1.00 29.59  ?  67   PRO A CB    1 
ATOM   484   C  CG    . PRO A 1  88   ? 39.742  26.046  -48.895  1.00 31.90  ?  67   PRO A CG    1 
ATOM   485   C  CD    . PRO A 1  88   ? 40.867  25.418  -48.150  1.00 34.52  ?  67   PRO A CD    1 
ATOM   486   N  N     . GLY A 1  89   ? 42.657  25.372  -52.539  1.00 34.12  ?  68   GLY A N     1 
ATOM   487   C  CA    . GLY A 1  89   ? 43.730  25.835  -53.389  1.00 34.92  ?  68   GLY A CA    1 
ATOM   488   C  C     . GLY A 1  89   ? 45.074  25.180  -53.164  1.00 40.02  ?  68   GLY A C     1 
ATOM   489   O  O     . GLY A 1  89   ? 46.032  25.520  -53.870  1.00 43.54  ?  68   GLY A O     1 
ATOM   490   N  N     . VAL A 1  90   ? 45.185  24.258  -52.215  1.00 41.57  ?  69   VAL A N     1 
ATOM   491   C  CA    . VAL A 1  90   ? 46.434  23.565  -51.928  1.00 37.85  ?  69   VAL A CA    1 
ATOM   492   C  C     . VAL A 1  90   ? 46.373  22.170  -52.532  1.00 40.38  ?  69   VAL A C     1 
ATOM   493   O  O     . VAL A 1  90   ? 45.365  21.465  -52.401  1.00 42.46  ?  69   VAL A O     1 
ATOM   494   C  CB    . VAL A 1  90   ? 46.695  23.509  -50.412  1.00 34.66  ?  69   VAL A CB    1 
ATOM   495   C  CG1   . VAL A 1  90   ? 48.040  22.872  -50.126  1.00 35.49  ?  69   VAL A CG1   1 
ATOM   496   C  CG2   . VAL A 1  90   ? 46.629  24.904  -49.826  1.00 35.73  ?  69   VAL A CG2   1 
ATOM   497   N  N     . LYS A 1  91   ? 47.455  21.771  -53.200  1.00 38.60  ?  70   LYS A N     1 
ATOM   498   C  CA    . LYS A 1  91   ? 47.446  20.518  -53.948  1.00 39.60  ?  70   LYS A CA    1 
ATOM   499   C  C     . LYS A 1  91   ? 47.510  19.299  -53.032  1.00 38.47  ?  70   LYS A C     1 
ATOM   500   O  O     . LYS A 1  91   ? 46.808  18.311  -53.266  1.00 38.17  ?  70   LYS A O     1 
ATOM   501   C  CB    . LYS A 1  91   ? 48.603  20.496  -54.944  1.00 38.29  ?  70   LYS A CB    1 
ATOM   502   C  CG    . LYS A 1  91   ? 48.697  19.205  -55.722  1.00 38.13  ?  70   LYS A CG    1 
ATOM   503   C  CD    . LYS A 1  91   ? 49.811  19.253  -56.742  1.00 41.90  ?  70   LYS A CD    1 
ATOM   504   C  CE    . LYS A 1  91   ? 50.000  17.901  -57.399  1.00 43.95  ?  70   LYS A CE    1 
ATOM   505   N  NZ    . LYS A 1  91   ? 50.875  17.987  -58.594  1.00 44.63  ?  70   LYS A NZ    1 
ATOM   506   N  N     . GLU A 1  92   ? 48.342  19.342  -52.000  1.00 38.34  ?  71   GLU A N     1 
ATOM   507   C  CA    . GLU A 1  92   ? 48.466  18.233  -51.068  1.00 38.18  ?  71   GLU A CA    1 
ATOM   508   C  C     . GLU A 1  92   ? 47.477  18.407  -49.927  1.00 35.36  ?  71   GLU A C     1 
ATOM   509   O  O     . GLU A 1  92   ? 47.323  19.506  -49.393  1.00 36.72  ?  71   GLU A O     1 
ATOM   510   C  CB    . GLU A 1  92   ? 49.889  18.148  -50.513  1.00 41.37  ?  71   GLU A CB    1 
ATOM   511   C  CG    . GLU A 1  92   ? 50.986  18.062  -51.567  1.00 43.81  ?  71   GLU A CG    1 
ATOM   512   C  CD    . GLU A 1  92   ? 51.433  19.419  -52.075  1.00 43.54  ?  71   GLU A CD    1 
ATOM   513   O  OE1   . GLU A 1  92   ? 50.887  20.440  -51.609  1.00 42.42  ?  71   GLU A OE1   1 
ATOM   514   O  OE2   . GLU A 1  92   ? 52.332  19.465  -52.940  1.00 44.97  ?  71   GLU A OE2   1 
ATOM   515   N  N     . ASP A 1  93   ? 46.810  17.320  -49.546  1.00 33.08  ?  72   ASP A N     1 
ATOM   516   C  CA    . ASP A 1  93   ? 45.900  17.409  -48.416  1.00 32.60  ?  72   ASP A CA    1 
ATOM   517   C  C     . ASP A 1  93   ? 46.702  17.537  -47.123  1.00 34.18  ?  72   ASP A C     1 
ATOM   518   O  O     . ASP A 1  93   ? 47.933  17.595  -47.123  1.00 35.00  ?  72   ASP A O     1 
ATOM   519   C  CB    . ASP A 1  93   ? 44.944  16.217  -48.389  1.00 36.56  ?  72   ASP A CB    1 
ATOM   520   C  CG    . ASP A 1  93   ? 45.650  14.880  -48.520  1.00 42.92  ?  72   ASP A CG    1 
ATOM   521   O  OD1   . ASP A 1  93   ? 46.156  14.368  -47.501  1.00 44.00  ?  72   ASP A OD1   1 
ATOM   522   O  OD2   . ASP A 1  93   ? 45.667  14.324  -49.637  1.00 44.42  ?  72   ASP A OD2   1 
ATOM   523   N  N     . VAL A 1  94   ? 45.993  17.610  -45.998  1.00 31.90  ?  73   VAL A N     1 
ATOM   524   C  CA    . VAL A 1  94   ? 46.666  17.894  -44.736  1.00 32.42  ?  73   VAL A CA    1 
ATOM   525   C  C     . VAL A 1  94   ? 47.525  16.714  -44.307  1.00 33.95  ?  73   VAL A C     1 
ATOM   526   O  O     . VAL A 1  94   ? 48.613  16.894  -43.750  1.00 36.34  ?  73   VAL A O     1 
ATOM   527   C  CB    . VAL A 1  94   ? 45.636  18.276  -43.659  1.00 34.29  ?  73   VAL A CB    1 
ATOM   528   C  CG1   . VAL A 1  94   ? 46.327  18.575  -42.343  1.00 33.09  ?  73   VAL A CG1   1 
ATOM   529   C  CG2   . VAL A 1  94   ? 44.829  19.471  -44.117  1.00 36.36  ?  73   VAL A CG2   1 
ATOM   530   N  N     . THR A 1  95   ? 47.060  15.490  -44.564  1.00 34.69  ?  74   THR A N     1 
ATOM   531   C  CA    . THR A 1  95   ? 47.848  14.310  -44.220  1.00 33.15  ?  74   THR A CA    1 
ATOM   532   C  C     . THR A 1  95   ? 49.164  14.284  -44.988  1.00 36.40  ?  74   THR A C     1 
ATOM   533   O  O     . THR A 1  95   ? 50.230  14.035  -44.406  1.00 41.47  ?  74   THR A O     1 
ATOM   534   C  CB    . THR A 1  95   ? 47.021  13.050  -44.483  1.00 36.29  ?  74   THR A CB    1 
ATOM   535   O  OG1   . THR A 1  95   ? 46.264  12.728  -43.311  1.00 37.97  ?  74   THR A OG1   1 
ATOM   536   C  CG2   . THR A 1  95   ? 47.902  11.871  -44.857  1.00 41.02  ?  74   THR A CG2   1 
ATOM   537   N  N     . GLU A 1  96   ? 49.119  14.571  -46.289  1.00 36.96  ?  75   GLU A N     1 
ATOM   538   C  CA    . GLU A 1  96   ? 50.352  14.624  -47.065  1.00 38.32  ?  75   GLU A CA    1 
ATOM   539   C  C     . GLU A 1  96   ? 51.248  15.768  -46.605  1.00 38.40  ?  75   GLU A C     1 
ATOM   540   O  O     . GLU A 1  96   ? 52.475  15.624  -46.567  1.00 41.37  ?  75   GLU A O     1 
ATOM   541   C  CB    . GLU A 1  96   ? 50.039  14.756  -48.550  1.00 37.69  ?  75   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1  96   ? 51.278  14.677  -49.415  1.00 42.82  ?  75   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1  96   ? 50.960  14.666  -50.889  1.00 52.13  ?  75   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1  96   ? 51.889  14.887  -51.695  1.00 52.72  ?  75   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1  96   ? 49.784  14.440  -51.241  1.00 50.72  ?  75   GLU A OE2   1 
ATOM   546   N  N     . ILE A 1  97   ? 50.657  16.911  -46.250  1.00 35.94  ?  76   ILE A N     1 
ATOM   547   C  CA    . ILE A 1  97   ? 51.449  18.026  -45.738  1.00 35.14  ?  76   ILE A CA    1 
ATOM   548   C  C     . ILE A 1  97   ? 52.185  17.616  -44.472  1.00 37.26  ?  76   ILE A C     1 
ATOM   549   O  O     . ILE A 1  97   ? 53.366  17.931  -44.295  1.00 41.03  ?  76   ILE A O     1 
ATOM   550   C  CB    . ILE A 1  97   ? 50.557  19.258  -45.495  1.00 38.95  ?  76   ILE A CB    1 
ATOM   551   C  CG1   . ILE A 1  97   ? 50.130  19.886  -46.820  1.00 39.51  ?  76   ILE A CG1   1 
ATOM   552   C  CG2   . ILE A 1  97   ? 51.277  20.278  -44.625  1.00 26.59  ?  76   ILE A CG2   1 
ATOM   553   C  CD1   . ILE A 1  97   ? 49.036  20.917  -46.673  1.00 33.89  ?  76   ILE A CD1   1 
ATOM   554   N  N     . ILE A 1  98   ? 51.503  16.909  -43.570  1.00 37.29  ?  77   ILE A N     1 
ATOM   555   C  CA    . ILE A 1  98   ? 52.149  16.479  -42.335  1.00 34.66  ?  77   ILE A CA    1 
ATOM   556   C  C     . ILE A 1  98   ? 53.267  15.489  -42.636  1.00 34.24  ?  77   ILE A C     1 
ATOM   557   O  O     . ILE A 1  98   ? 54.350  15.547  -42.034  1.00 33.63  ?  77   ILE A O     1 
ATOM   558   C  CB    . ILE A 1  98   ? 51.103  15.897  -41.367  1.00 33.02  ?  77   ILE A CB    1 
ATOM   559   C  CG1   . ILE A 1  98   ? 50.056  16.961  -41.035  1.00 33.65  ?  77   ILE A CG1   1 
ATOM   560   C  CG2   . ILE A 1  98   ? 51.764  15.406  -40.098  1.00 38.01  ?  77   ILE A CG2   1 
ATOM   561   C  CD1   . ILE A 1  98   ? 48.946  16.479  -40.137  1.00 33.03  ?  77   ILE A CD1   1 
ATOM   562   N  N     . LEU A 1  99   ? 53.035  14.581  -43.590  1.00 34.97  ?  78   LEU A N     1 
ATOM   563   C  CA    . LEU A 1  99   ? 54.108  13.695  -44.026  1.00 37.90  ?  78   LEU A CA    1 
ATOM   564   C  C     . LEU A 1  99   ? 55.317  14.487  -44.507  1.00 37.37  ?  78   LEU A C     1 
ATOM   565   O  O     . LEU A 1  99   ? 56.459  14.147  -44.179  1.00 55.12  ?  78   LEU A O     1 
ATOM   566   C  CB    . LEU A 1  99   ? 53.612  12.758  -45.126  1.00 40.26  ?  78   LEU A CB    1 
ATOM   567   C  CG    . LEU A 1  99   ? 52.845  11.526  -44.645  1.00 51.45  ?  78   LEU A CG    1 
ATOM   568   C  CD1   . LEU A 1  99   ? 52.420  10.666  -45.823  1.00 50.83  ?  78   LEU A CD1   1 
ATOM   569   C  CD2   . LEU A 1  99   ? 53.692  10.723  -43.669  1.00 50.08  ?  78   LEU A CD2   1 
ATOM   570   N  N     . ASN A 1  100  ? 55.087  15.551  -45.277  1.00 37.64  ?  79   ASN A N     1 
ATOM   571   C  CA    . ASN A 1  100  ? 56.198  16.374  -45.744  1.00 37.13  ?  79   ASN A CA    1 
ATOM   572   C  C     . ASN A 1  100  ? 56.893  17.082  -44.589  1.00 34.25  ?  79   ASN A C     1 
ATOM   573   O  O     . ASN A 1  100  ? 58.120  17.219  -44.587  1.00 35.38  ?  79   ASN A O     1 
ATOM   574   C  CB    . ASN A 1  100  ? 55.706  17.388  -46.772  1.00 32.96  ?  79   ASN A CB    1 
ATOM   575   C  CG    . ASN A 1  100  ? 55.265  16.736  -48.059  1.00 34.97  ?  79   ASN A CG    1 
ATOM   576   O  OD1   . ASN A 1  100  ? 55.562  15.571  -48.307  1.00 36.09  ?  79   ASN A OD1   1 
ATOM   577   N  ND2   . ASN A 1  100  ? 54.559  17.486  -48.891  1.00 37.66  ?  79   ASN A ND2   1 
ATOM   578   N  N     . LEU A 1  101  ? 56.129  17.530  -43.595  1.00 33.81  ?  80   LEU A N     1 
ATOM   579   C  CA    . LEU A 1  101  ? 56.717  18.228  -42.462  1.00 34.22  ?  80   LEU A CA    1 
ATOM   580   C  C     . LEU A 1  101  ? 57.495  17.299  -41.547  1.00 37.56  ?  80   LEU A C     1 
ATOM   581   O  O     . LEU A 1  101  ? 58.300  17.778  -40.742  1.00 36.78  ?  80   LEU A O     1 
ATOM   582   C  CB    . LEU A 1  101  ? 55.634  18.948  -41.664  1.00 33.61  ?  80   LEU A CB    1 
ATOM   583   C  CG    . LEU A 1  101  ? 54.974  20.133  -42.362  1.00 30.01  ?  80   LEU A CG    1 
ATOM   584   C  CD1   . LEU A 1  101  ? 53.959  20.790  -41.444  1.00 28.90  ?  80   LEU A CD1   1 
ATOM   585   C  CD2   . LEU A 1  101  ? 56.023  21.129  -42.807  1.00 34.52  ?  80   LEU A CD2   1 
ATOM   586   N  N     . LYS A 1  102  ? 57.272  15.987  -41.634  1.00 42.34  ?  81   LYS A N     1 
ATOM   587   C  CA    . LYS A 1  102  ? 58.109  15.076  -40.859  1.00 42.88  ?  81   LYS A CA    1 
ATOM   588   C  C     . LYS A 1  102  ? 59.563  15.084  -41.320  1.00 43.64  ?  81   LYS A C     1 
ATOM   589   O  O     . LYS A 1  102  ? 60.440  14.667  -40.559  1.00 45.42  ?  81   LYS A O     1 
ATOM   590   C  CB    . LYS A 1  102  ? 57.542  13.659  -40.911  1.00 37.67  ?  81   LYS A CB    1 
ATOM   591   C  CG    . LYS A 1  102  ? 56.578  13.366  -39.775  1.00 48.18  ?  81   LYS A CG    1 
ATOM   592   C  CD    . LYS A 1  102  ? 55.830  12.061  -39.989  1.00 56.36  ?  81   LYS A CD    1 
ATOM   593   C  CE    . LYS A 1  102  ? 56.766  10.866  -39.952  1.00 51.75  ?  81   LYS A CE    1 
ATOM   594   N  NZ    . LYS A 1  102  ? 56.039  9.614   -40.282  1.00 51.57  ?  81   LYS A NZ    1 
ATOM   595   N  N     . SER A 1  103  ? 59.838  15.559  -42.536  1.00 42.42  ?  82   SER A N     1 
ATOM   596   C  CA    . SER A 1  103  ? 61.203  15.664  -43.035  1.00 36.44  ?  82   SER A CA    1 
ATOM   597   C  C     . SER A 1  103  ? 61.923  16.916  -42.553  1.00 38.55  ?  82   SER A C     1 
ATOM   598   O  O     . SER A 1  103  ? 63.118  17.063  -42.827  1.00 40.18  ?  82   SER A O     1 
ATOM   599   C  CB    . SER A 1  103  ? 61.210  15.639  -44.563  1.00 34.40  ?  82   SER A CB    1 
ATOM   600   O  OG    . SER A 1  103  ? 60.608  14.461  -45.058  1.00 42.36  ?  82   SER A OG    1 
ATOM   601   N  N     . LEU A 1  104  ? 61.230  17.820  -41.865  1.00 39.77  ?  83   LEU A N     1 
ATOM   602   C  CA    . LEU A 1  104  ? 61.870  19.008  -41.318  1.00 38.49  ?  83   LEU A CA    1 
ATOM   603   C  C     . LEU A 1  104  ? 63.017  18.625  -40.396  1.00 39.70  ?  83   LEU A C     1 
ATOM   604   O  O     . LEU A 1  104  ? 62.870  17.761  -39.528  1.00 40.94  ?  83   LEU A O     1 
ATOM   605   C  CB    . LEU A 1  104  ? 60.855  19.846  -40.544  1.00 41.55  ?  83   LEU A CB    1 
ATOM   606   C  CG    . LEU A 1  104  ? 60.104  20.984  -41.229  1.00 40.79  ?  83   LEU A CG    1 
ATOM   607   C  CD1   . LEU A 1  104  ? 59.169  21.629  -40.223  1.00 37.64  ?  83   LEU A CD1   1 
ATOM   608   C  CD2   . LEU A 1  104  ? 61.074  22.002  -41.790  1.00 40.79  ?  83   LEU A CD2   1 
ATOM   609   N  N     . VAL A 1  105  ? 64.162  19.269  -40.586  1.00 40.49  ?  84   VAL A N     1 
ATOM   610   C  CA    . VAL A 1  105  ? 65.269  19.187  -39.642  1.00 43.55  ?  84   VAL A CA    1 
ATOM   611   C  C     . VAL A 1  105  ? 65.381  20.548  -38.968  1.00 42.67  ?  84   VAL A C     1 
ATOM   612   O  O     . VAL A 1  105  ? 65.498  21.579  -39.640  1.00 42.12  ?  84   VAL A O     1 
ATOM   613   C  CB    . VAL A 1  105  ? 66.581  18.757  -40.320  1.00 43.16  ?  84   VAL A CB    1 
ATOM   614   C  CG1   . VAL A 1  105  ? 66.892  19.611  -41.525  1.00 48.08  ?  84   VAL A CG1   1 
ATOM   615   C  CG2   . VAL A 1  105  ? 67.726  18.795  -39.329  1.00 46.40  ?  84   VAL A CG2   1 
ATOM   616   N  N     . VAL A 1  106  ? 65.309  20.551  -37.642  1.00 40.87  ?  85   VAL A N     1 
ATOM   617   C  CA    . VAL A 1  106  ? 65.132  21.770  -36.866  1.00 41.12  ?  85   VAL A CA    1 
ATOM   618   C  C     . VAL A 1  106  ? 65.976  21.673  -35.605  1.00 44.29  ?  85   VAL A C     1 
ATOM   619   O  O     . VAL A 1  106  ? 66.019  20.624  -34.955  1.00 45.98  ?  85   VAL A O     1 
ATOM   620   C  CB    . VAL A 1  106  ? 63.641  21.993  -36.530  1.00 40.74  ?  85   VAL A CB    1 
ATOM   621   C  CG1   . VAL A 1  106  ? 63.472  22.679  -35.186  1.00 40.89  ?  85   VAL A CG1   1 
ATOM   622   C  CG2   . VAL A 1  106  ? 62.967  22.796  -37.631  1.00 43.86  ?  85   VAL A CG2   1 
ATOM   623   N  N     . SER A 1  107  ? 66.652  22.767  -35.260  1.00 45.13  ?  86   SER A N     1 
ATOM   624   C  CA    . SER A 1  107  ? 67.482  22.825  -34.064  1.00 44.69  ?  86   SER A CA    1 
ATOM   625   C  C     . SER A 1  107  ? 67.007  23.960  -33.171  1.00 44.99  ?  86   SER A C     1 
ATOM   626   O  O     . SER A 1  107  ? 66.929  25.106  -33.613  1.00 44.77  ?  86   SER A O     1 
ATOM   627   C  CB    . SER A 1  107  ? 68.952  23.019  -34.428  1.00 47.40  ?  86   SER A CB    1 
ATOM   628   O  OG    . SER A 1  107  ? 69.103  24.101  -35.328  1.00 49.13  ?  86   SER A OG    1 
ATOM   629   N  N     . SER A 1  108  ? 66.710  23.649  -31.913  1.00 46.24  ?  87   SER A N     1 
ATOM   630   C  CA    . SER A 1  108  ? 66.135  24.620  -30.992  1.00 47.04  ?  87   SER A CA    1 
ATOM   631   C  C     . SER A 1  108  ? 66.961  24.687  -29.719  1.00 49.11  ?  87   SER A C     1 
ATOM   632   O  O     . SER A 1  108  ? 67.281  23.652  -29.129  1.00 50.04  ?  87   SER A O     1 
ATOM   633   C  CB    . SER A 1  108  ? 64.687  24.266  -30.656  1.00 48.28  ?  87   SER A CB    1 
ATOM   634   O  OG    . SER A 1  108  ? 64.265  24.937  -29.484  1.00 58.38  ?  87   SER A OG    1 
ATOM   635   N  N     . GLU A 1  109  ? 67.301  25.903  -29.300  1.00 53.80  ?  88   GLU A N     1 
ATOM   636   C  CA    . GLU A 1  109  ? 68.043  26.135  -28.070  1.00 60.24  ?  88   GLU A CA    1 
ATOM   637   C  C     . GLU A 1  109  ? 67.151  26.484  -26.887  1.00 61.14  ?  88   GLU A C     1 
ATOM   638   O  O     . GLU A 1  109  ? 67.666  26.708  -25.788  1.00 65.00  ?  88   GLU A O     1 
ATOM   639   C  CB    . GLU A 1  109  ? 69.062  27.259  -28.277  1.00 61.41  ?  88   GLU A CB    1 
ATOM   640   C  CG    . GLU A 1  109  ? 70.042  27.014  -29.406  1.00 67.37  ?  88   GLU A CG    1 
ATOM   641   C  CD    . GLU A 1  109  ? 70.958  28.197  -29.645  1.00 74.81  ?  88   GLU A CD    1 
ATOM   642   O  OE1   . GLU A 1  109  ? 70.740  29.259  -29.022  1.00 75.79  ?  88   GLU A OE1   1 
ATOM   643   O  OE2   . GLU A 1  109  ? 71.897  28.065  -30.458  1.00 75.49  ?  88   GLU A OE2   1 
ATOM   644   N  N     . GLU A 1  110  ? 65.834  26.533  -27.076  1.00 62.36  ?  89   GLU A N     1 
ATOM   645   C  CA    . GLU A 1  110  ? 64.979  27.161  -26.077  1.00 68.68  ?  89   GLU A CA    1 
ATOM   646   C  C     . GLU A 1  110  ? 64.692  26.261  -24.882  1.00 69.54  ?  89   GLU A C     1 
ATOM   647   O  O     . GLU A 1  110  ? 64.464  26.771  -23.779  1.00 73.43  ?  89   GLU A O     1 
ATOM   648   C  CB    . GLU A 1  110  ? 63.673  27.619  -26.725  1.00 69.39  ?  89   GLU A CB    1 
ATOM   649   C  CG    . GLU A 1  110  ? 63.865  28.674  -27.810  1.00 70.12  ?  89   GLU A CG    1 
ATOM   650   C  CD    . GLU A 1  110  ? 64.165  30.065  -27.261  1.00 73.23  ?  89   GLU A CD    1 
ATOM   651   O  OE1   . GLU A 1  110  ? 64.666  30.186  -26.122  1.00 69.72  ?  89   GLU A OE1   1 
ATOM   652   O  OE2   . GLU A 1  110  ? 63.889  31.049  -27.977  1.00 74.02  ?  89   GLU A OE2   1 
ATOM   653   N  N     . ASP A 1  111  ? 64.693  24.942  -25.071  1.00 69.64  ?  90   ASP A N     1 
ATOM   654   C  CA    . ASP A 1  111  ? 64.454  23.992  -23.981  1.00 72.65  ?  90   ASP A CA    1 
ATOM   655   C  C     . ASP A 1  111  ? 63.096  24.231  -23.322  1.00 66.58  ?  90   ASP A C     1 
ATOM   656   O  O     . ASP A 1  111  ? 62.954  24.148  -22.101  1.00 68.84  ?  90   ASP A O     1 
ATOM   657   C  CB    . ASP A 1  111  ? 65.579  24.040  -22.944  1.00 70.36  ?  90   ASP A CB    1 
ATOM   658   N  N     . GLU A 1  112  ? 62.094  24.523  -24.148  1.00 64.59  ?  91   GLU A N     1 
ATOM   659   C  CA    . GLU A 1  112  ? 60.700  24.705  -23.761  1.00 63.12  ?  91   GLU A CA    1 
ATOM   660   C  C     . GLU A 1  112  ? 59.912  24.960  -25.039  1.00 58.83  ?  91   GLU A C     1 
ATOM   661   O  O     . GLU A 1  112  ? 60.497  25.378  -26.045  1.00 61.17  ?  91   GLU A O     1 
ATOM   662   C  CB    . GLU A 1  112  ? 60.530  25.856  -22.766  1.00 64.01  ?  91   GLU A CB    1 
ATOM   663   C  CG    . GLU A 1  112  ? 60.612  27.235  -23.377  1.00 73.69  ?  91   GLU A CG    1 
ATOM   664   C  CD    . GLU A 1  112  ? 60.056  28.301  -22.457  1.00 82.46  ?  91   GLU A CD    1 
ATOM   665   O  OE1   . GLU A 1  112  ? 59.556  27.942  -21.369  1.00 86.04  ?  91   GLU A OE1   1 
ATOM   666   O  OE2   . GLU A 1  112  ? 60.115  29.494  -22.822  1.00 83.08  ?  91   GLU A OE2   1 
ATOM   667   N  N     . PRO A 1  113  ? 58.605  24.703  -25.058  1.00 53.33  ?  92   PRO A N     1 
ATOM   668   C  CA    . PRO A 1  113  ? 57.860  24.800  -26.319  1.00 51.10  ?  92   PRO A CA    1 
ATOM   669   C  C     . PRO A 1  113  ? 57.889  26.212  -26.883  1.00 48.62  ?  92   PRO A C     1 
ATOM   670   O  O     . PRO A 1  113  ? 57.617  27.188  -26.181  1.00 49.18  ?  92   PRO A O     1 
ATOM   671   C  CB    . PRO A 1  113  ? 56.442  24.375  -25.925  1.00 55.48  ?  92   PRO A CB    1 
ATOM   672   C  CG    . PRO A 1  113  ? 56.616  23.575  -24.682  1.00 58.73  ?  92   PRO A CG    1 
ATOM   673   C  CD    . PRO A 1  113  ? 57.757  24.212  -23.960  1.00 59.66  ?  92   PRO A CD    1 
ATOM   674   N  N     . VAL A 1  114  ? 58.222  26.311  -28.168  1.00 46.07  ?  93   VAL A N     1 
ATOM   675   C  CA    . VAL A 1  114  ? 58.255  27.585  -28.870  1.00 43.17  ?  93   VAL A CA    1 
ATOM   676   C  C     . VAL A 1  114  ? 57.462  27.416  -30.158  1.00 41.18  ?  93   VAL A C     1 
ATOM   677   O  O     . VAL A 1  114  ? 57.153  26.299  -30.573  1.00 43.65  ?  93   VAL A O     1 
ATOM   678   C  CB    . VAL A 1  114  ? 59.699  28.055  -29.150  1.00 43.92  ?  93   VAL A CB    1 
ATOM   679   C  CG1   . VAL A 1  114  ? 60.240  27.422  -30.422  1.00 45.83  ?  93   VAL A CG1   1 
ATOM   680   C  CG2   . VAL A 1  114  ? 59.773  29.574  -29.198  1.00 56.99  ?  93   VAL A CG2   1 
ATOM   681   N  N     . THR A 1  115  ? 57.109  28.534  -30.786  1.00 36.54  ?  94   THR A N     1 
ATOM   682   C  CA    . THR A 1  115  ? 56.176  28.490  -31.905  1.00 41.05  ?  94   THR A CA    1 
ATOM   683   C  C     . THR A 1  115  ? 56.757  29.170  -33.135  1.00 44.14  ?  94   THR A C     1 
ATOM   684   O  O     . THR A 1  115  ? 57.272  30.288  -33.051  1.00 43.85  ?  94   THR A O     1 
ATOM   685   C  CB    . THR A 1  115  ? 54.840  29.135  -31.532  1.00 43.11  ?  94   THR A CB    1 
ATOM   686   O  OG1   . THR A 1  115  ? 54.363  28.564  -30.308  1.00 43.50  ?  94   THR A OG1   1 
ATOM   687   C  CG2   . THR A 1  115  ? 53.814  28.885  -32.621  1.00 44.21  ?  94   THR A CG2   1 
ATOM   688   N  N     . MET A 1  116  ? 56.650  28.491  -34.272  1.00 43.85  ?  95   MET A N     1 
ATOM   689   C  CA    . MET A 1  116  ? 57.039  28.992  -35.579  1.00 41.00  ?  95   MET A CA    1 
ATOM   690   C  C     . MET A 1  116  ? 55.789  29.218  -36.415  1.00 43.32  ?  95   MET A C     1 
ATOM   691   O  O     . MET A 1  116  ? 54.763  28.565  -36.213  1.00 45.03  ?  95   MET A O     1 
ATOM   692   C  CB    . MET A 1  116  ? 57.958  28.005  -36.298  1.00 38.27  ?  95   MET A CB    1 
ATOM   693   C  CG    . MET A 1  116  ? 58.917  27.271  -35.390  1.00 39.28  ?  95   MET A CG    1 
ATOM   694   S  SD    . MET A 1  116  ? 59.744  25.934  -36.261  1.00 48.71  ?  95   MET A SD    1 
ATOM   695   C  CE    . MET A 1  116  ? 60.693  26.848  -37.447  1.00 43.22  ?  95   MET A CE    1 
ATOM   696   N  N     . TYR A 1  117  ? 55.876  30.149  -37.357  1.00 44.04  ?  96   TYR A N     1 
ATOM   697   C  CA    . TYR A 1  117  ? 54.714  30.557  -38.127  1.00 44.06  ?  96   TYR A CA    1 
ATOM   698   C  C     . TYR A 1  117  ? 54.996  30.448  -39.616  1.00 45.00  ?  96   TYR A C     1 
ATOM   699   O  O     . TYR A 1  117  ? 56.132  30.608  -40.068  1.00 43.84  ?  96   TYR A O     1 
ATOM   700   C  CB    . TYR A 1  117  ? 54.291  31.979  -37.764  1.00 47.15  ?  96   TYR A CB    1 
ATOM   701   C  CG    . TYR A 1  117  ? 53.856  32.102  -36.324  1.00 53.38  ?  96   TYR A CG    1 
ATOM   702   C  CD1   . TYR A 1  117  ? 52.539  31.870  -35.956  1.00 54.93  ?  96   TYR A CD1   1 
ATOM   703   C  CD2   . TYR A 1  117  ? 54.765  32.427  -35.329  1.00 51.96  ?  96   TYR A CD2   1 
ATOM   704   C  CE1   . TYR A 1  117  ? 52.135  31.971  -34.640  1.00 54.75  ?  96   TYR A CE1   1 
ATOM   705   C  CE2   . TYR A 1  117  ? 54.370  32.530  -34.008  1.00 55.16  ?  96   TYR A CE2   1 
ATOM   706   C  CZ    . TYR A 1  117  ? 53.055  32.302  -33.670  1.00 57.08  ?  96   TYR A CZ    1 
ATOM   707   O  OH    . TYR A 1  117  ? 52.659  32.403  -32.357  1.00 54.93  ?  96   TYR A OH    1 
ATOM   708   N  N     . LEU A 1  118  ? 53.940  30.146  -40.367  1.00 42.85  ?  97   LEU A N     1 
ATOM   709   C  CA    . LEU A 1  118  ? 54.001  30.032  -41.818  1.00 41.91  ?  97   LEU A CA    1 
ATOM   710   C  C     . LEU A 1  118  ? 52.770  30.706  -42.399  1.00 47.19  ?  97   LEU A C     1 
ATOM   711   O  O     . LEU A 1  118  ? 51.646  30.292  -42.111  1.00 49.68  ?  97   LEU A O     1 
ATOM   712   C  CB    . LEU A 1  118  ? 54.067  28.563  -42.240  1.00 39.15  ?  97   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1  118  ? 54.157  28.242  -43.729  1.00 40.49  ?  97   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1  118  ? 55.504  28.641  -44.272  1.00 44.00  ?  97   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1  118  ? 53.908  26.766  -43.961  1.00 41.83  ?  97   LEU A CD2   1 
ATOM   716   N  N     . ARG A 1  119  ? 52.972  31.744  -43.205  1.00 46.73  ?  98   ARG A N     1 
ATOM   717   C  CA    . ARG A 1  119  ? 51.868  32.419  -43.878  1.00 44.05  ?  98   ARG A CA    1 
ATOM   718   C  C     . ARG A 1  119  ? 52.275  32.667  -45.317  1.00 45.49  ?  98   ARG A C     1 
ATOM   719   O  O     . ARG A 1  119  ? 53.251  33.378  -45.568  1.00 54.25  ?  98   ARG A O     1 
ATOM   720   C  CB    . ARG A 1  119  ? 51.507  33.732  -43.179  1.00 48.20  ?  98   ARG A CB    1 
ATOM   721   C  CG    . ARG A 1  119  ? 50.812  33.548  -41.842  1.00 58.66  ?  98   ARG A CG    1 
ATOM   722   C  CD    . ARG A 1  119  ? 51.267  34.578  -40.825  1.00 67.47  ?  98   ARG A CD    1 
ATOM   723   N  NE    . ARG A 1  119  ? 50.730  34.300  -39.496  1.00 74.54  ?  98   ARG A NE    1 
ATOM   724   C  CZ    . ARG A 1  119  ? 51.225  34.801  -38.368  1.00 76.71  ?  98   ARG A CZ    1 
ATOM   725   N  NH1   . ARG A 1  119  ? 52.279  35.606  -38.401  1.00 70.21  ?  98   ARG A NH1   1 
ATOM   726   N  NH2   . ARG A 1  119  ? 50.672  34.491  -37.204  1.00 75.08  ?  98   ARG A NH2   1 
ATOM   727   N  N     . LYS A 1  120  ? 51.539  32.086  -46.259  1.00 44.46  ?  99   LYS A N     1 
ATOM   728   C  CA    . LYS A 1  120  ? 51.888  32.251  -47.661  1.00 45.28  ?  99   LYS A CA    1 
ATOM   729   C  C     . LYS A 1  120  ? 50.617  32.299  -48.490  1.00 45.14  ?  99   LYS A C     1 
ATOM   730   O  O     . LYS A 1  120  ? 49.669  31.551  -48.234  1.00 52.12  ?  99   LYS A O     1 
ATOM   731   C  CB    . LYS A 1  120  ? 52.804  31.120  -48.143  1.00 49.80  ?  99   LYS A CB    1 
ATOM   732   C  CG    . LYS A 1  120  ? 53.374  31.302  -49.547  1.00 50.78  ?  99   LYS A CG    1 
ATOM   733   C  CD    . LYS A 1  120  ? 54.872  31.583  -49.510  1.00 53.45  ?  99   LYS A CD    1 
ATOM   734   C  CE    . LYS A 1  120  ? 55.526  31.348  -50.868  1.00 51.75  ?  99   LYS A CE    1 
ATOM   735   N  NZ    . LYS A 1  120  ? 54.978  32.228  -51.937  1.00 52.59  ?  99   LYS A NZ    1 
ATOM   736   N  N     . GLN A 1  121  ? 50.609  33.186  -49.478  1.00 43.26  ?  100  GLN A N     1 
ATOM   737   C  CA    . GLN A 1  121  ? 49.505  33.337  -50.411  1.00 44.15  ?  100  GLN A CA    1 
ATOM   738   C  C     . GLN A 1  121  ? 49.949  32.884  -51.792  1.00 44.86  ?  100  GLN A C     1 
ATOM   739   O  O     . GLN A 1  121  ? 51.056  33.207  -52.234  1.00 45.60  ?  100  GLN A O     1 
ATOM   740   C  CB    . GLN A 1  121  ? 49.026  34.789  -50.461  1.00 43.58  ?  100  GLN A CB    1 
ATOM   741   C  CG    . GLN A 1  121  ? 48.109  35.108  -51.628  1.00 48.49  ?  100  GLN A CG    1 
ATOM   742   C  CD    . GLN A 1  121  ? 46.714  34.561  -51.443  1.00 51.19  ?  100  GLN A CD    1 
ATOM   743   O  OE1   . GLN A 1  121  ? 46.089  34.767  -50.404  1.00 58.32  ?  100  GLN A OE1   1 
ATOM   744   N  NE2   . GLN A 1  121  ? 46.214  33.858  -52.453  1.00 47.73  ?  100  GLN A NE2   1 
ATOM   745   N  N     . GLY A 1  122  ? 49.087  32.135  -52.468  1.00 44.65  ?  101  GLY A N     1 
ATOM   746   C  CA    . GLY A 1  122  ? 49.415  31.582  -53.766  1.00 46.01  ?  101  GLY A CA    1 
ATOM   747   C  C     . GLY A 1  122  ? 49.413  32.591  -54.897  1.00 49.03  ?  101  GLY A C     1 
ATOM   748   O  O     . GLY A 1  122  ? 49.001  33.733  -54.711  1.00 50.78  ?  101  GLY A O     1 
ATOM   749   N  N     . PRO A 1  123  ? 49.869  32.165  -56.084  1.00 48.70  ?  102  PRO A N     1 
ATOM   750   C  CA    . PRO A 1  123  ? 50.345  30.795  -56.270  1.00 47.54  ?  102  PRO A CA    1 
ATOM   751   C  C     . PRO A 1  123  ? 51.829  30.657  -55.965  1.00 50.52  ?  102  PRO A C     1 
ATOM   752   O  O     . PRO A 1  123  ? 52.497  31.659  -55.714  1.00 59.89  ?  102  PRO A O     1 
ATOM   753   C  CB    . PRO A 1  123  ? 50.073  30.528  -57.757  1.00 49.99  ?  102  PRO A CB    1 
ATOM   754   C  CG    . PRO A 1  123  ? 49.646  31.869  -58.359  1.00 52.98  ?  102  PRO A CG    1 
ATOM   755   C  CD    . PRO A 1  123  ? 49.916  32.925  -57.339  1.00 52.84  ?  102  PRO A CD    1 
ATOM   756   N  N     . GLY A 1  124  ? 52.338  29.438  -55.989  1.00 46.57  ?  103  GLY A N     1 
ATOM   757   C  CA    . GLY A 1  124  ? 53.753  29.218  -55.816  1.00 45.31  ?  103  GLY A CA    1 
ATOM   758   C  C     . GLY A 1  124  ? 54.003  27.943  -55.048  1.00 46.67  ?  103  GLY A C     1 
ATOM   759   O  O     . GLY A 1  124  ? 53.092  27.170  -54.765  1.00 44.88  ?  103  GLY A O     1 
ATOM   760   N  N     . GLU A 1  125  ? 55.263  27.736  -54.688  1.00 46.30  ?  104  GLU A N     1 
ATOM   761   C  CA    . GLU A 1  125  ? 55.670  26.606  -53.871  1.00 46.20  ?  104  GLU A CA    1 
ATOM   762   C  C     . GLU A 1  125  ? 55.976  27.096  -52.464  1.00 46.60  ?  104  GLU A C     1 
ATOM   763   O  O     . GLU A 1  125  ? 56.741  28.048  -52.286  1.00 47.40  ?  104  GLU A O     1 
ATOM   764   C  CB    . GLU A 1  125  ? 56.890  25.905  -54.472  1.00 47.69  ?  104  GLU A CB    1 
ATOM   765   C  CG    . GLU A 1  125  ? 57.351  24.679  -53.700  1.00 49.05  ?  104  GLU A CG    1 
ATOM   766   C  CD    . GLU A 1  125  ? 58.523  23.982  -54.362  1.00 55.12  ?  104  GLU A CD    1 
ATOM   767   O  OE1   . GLU A 1  125  ? 59.099  23.062  -53.746  1.00 52.28  ?  104  GLU A OE1   1 
ATOM   768   O  OE2   . GLU A 1  125  ? 58.868  24.355  -55.502  1.00 59.57  ?  104  GLU A OE2   1 
ATOM   769   N  N     . VAL A 1  126  ? 55.359  26.463  -51.476  1.00 45.39  ?  105  VAL A N     1 
ATOM   770   C  CA    . VAL A 1  126  ? 55.704  26.680  -50.078  1.00 44.19  ?  105  VAL A CA    1 
ATOM   771   C  C     . VAL A 1  126  ? 56.761  25.657  -49.694  1.00 43.09  ?  105  VAL A C     1 
ATOM   772   O  O     . VAL A 1  126  ? 56.535  24.446  -49.804  1.00 45.18  ?  105  VAL A O     1 
ATOM   773   C  CB    . VAL A 1  126  ? 54.473  26.562  -49.169  1.00 43.20  ?  105  VAL A CB    1 
ATOM   774   C  CG1   . VAL A 1  126  ? 54.863  26.838  -47.724  1.00 44.81  ?  105  VAL A CG1   1 
ATOM   775   C  CG2   . VAL A 1  126  ? 53.385  27.512  -49.624  1.00 45.75  ?  105  VAL A CG2   1 
ATOM   776   N  N     . THR A 1  127  ? 57.911  26.146  -49.245  1.00 42.21  ?  106  THR A N     1 
ATOM   777   C  CA    . THR A 1  127  ? 59.027  25.327  -48.806  1.00 42.56  ?  106  THR A CA    1 
ATOM   778   C  C     . THR A 1  127  ? 59.374  25.689  -47.370  1.00 41.78  ?  106  THR A C     1 
ATOM   779   O  O     . THR A 1  127  ? 58.922  26.702  -46.835  1.00 43.11  ?  106  THR A O     1 
ATOM   780   C  CB    . THR A 1  127  ? 60.256  25.509  -49.707  1.00 43.42  ?  106  THR A CB    1 
ATOM   781   O  OG1   . THR A 1  127  ? 60.940  26.712  -49.343  1.00 42.99  ?  106  THR A OG1   1 
ATOM   782   C  CG2   . THR A 1  127  ? 59.848  25.588  -51.167  1.00 46.34  ?  106  THR A CG2   1 
ATOM   783   N  N     . ALA A 1  128  ? 60.174  24.830  -46.737  1.00 43.38  ?  107  ALA A N     1 
ATOM   784   C  CA    . ALA A 1  128  ? 60.557  25.048  -45.347  1.00 44.20  ?  107  ALA A CA    1 
ATOM   785   C  C     . ALA A 1  128  ? 61.253  26.384  -45.133  1.00 47.75  ?  107  ALA A C     1 
ATOM   786   O  O     . ALA A 1  128  ? 61.293  26.874  -44.000  1.00 48.53  ?  107  ALA A O     1 
ATOM   787   C  CB    . ALA A 1  128  ? 61.454  23.911  -44.868  1.00 45.99  ?  107  ALA A CB    1 
ATOM   788   N  N     . GLY A 1  129  ? 61.809  26.983  -46.188  1.00 47.81  ?  108  GLY A N     1 
ATOM   789   C  CA    . GLY A 1  129  ? 62.358  28.320  -46.055  1.00 46.99  ?  108  GLY A CA    1 
ATOM   790   C  C     . GLY A 1  129  ? 61.310  29.355  -45.698  1.00 48.51  ?  108  GLY A C     1 
ATOM   791   O  O     . GLY A 1  129  ? 61.608  30.337  -45.015  1.00 52.19  ?  108  GLY A O     1 
ATOM   792   N  N     . ASP A 1  130  ? 60.068  29.144  -46.135  1.00 45.24  ?  109  ASP A N     1 
ATOM   793   C  CA    . ASP A 1  130  ? 59.000  30.092  -45.855  1.00 46.92  ?  109  ASP A CA    1 
ATOM   794   C  C     . ASP A 1  130  ? 58.581  30.099  -44.393  1.00 47.25  ?  109  ASP A C     1 
ATOM   795   O  O     . ASP A 1  130  ? 57.788  30.961  -44.002  1.00 50.74  ?  109  ASP A O     1 
ATOM   796   C  CB    . ASP A 1  130  ? 57.792  29.790  -46.739  1.00 49.39  ?  109  ASP A CB    1 
ATOM   797   C  CG    . ASP A 1  130  ? 58.096  29.948  -48.210  1.00 53.69  ?  109  ASP A CG    1 
ATOM   798   O  OD1   . ASP A 1  130  ? 58.927  30.812  -48.553  1.00 55.35  ?  109  ASP A OD1   1 
ATOM   799   O  OD2   . ASP A 1  130  ? 57.507  29.210  -49.026  1.00 51.46  ?  109  ASP A OD2   1 
ATOM   800   N  N     . ILE A 1  131  ? 59.076  29.168  -43.580  1.00 45.54  ?  110  ILE A N     1 
ATOM   801   C  CA    . ILE A 1  131  ? 58.755  29.186  -42.161  1.00 46.02  ?  110  ILE A CA    1 
ATOM   802   C  C     . ILE A 1  131  ? 59.518  30.315  -41.487  1.00 44.10  ?  110  ILE A C     1 
ATOM   803   O  O     . ILE A 1  131  ? 60.694  30.559  -41.786  1.00 43.30  ?  110  ILE A O     1 
ATOM   804   C  CB    . ILE A 1  131  ? 59.088  27.835  -41.508  1.00 44.54  ?  110  ILE A CB    1 
ATOM   805   C  CG1   . ILE A 1  131  ? 58.456  26.687  -42.291  1.00 43.82  ?  110  ILE A CG1   1 
ATOM   806   C  CG2   . ILE A 1  131  ? 58.597  27.811  -40.076  1.00 41.08  ?  110  ILE A CG2   1 
ATOM   807   C  CD1   . ILE A 1  131  ? 58.712  25.327  -41.683  1.00 39.21  ?  110  ILE A CD1   1 
ATOM   808   N  N     . VAL A 1  132  ? 58.852  31.017  -40.577  1.00 42.25  ?  111  VAL A N     1 
ATOM   809   C  CA    . VAL A 1  132  ? 59.530  32.041  -39.791  1.00 39.62  ?  111  VAL A CA    1 
ATOM   810   C  C     . VAL A 1  132  ? 59.783  31.486  -38.395  1.00 39.25  ?  111  VAL A C     1 
ATOM   811   O  O     . VAL A 1  132  ? 58.867  31.444  -37.563  1.00 38.07  ?  111  VAL A O     1 
ATOM   812   C  CB    . VAL A 1  132  ? 58.707  33.336  -39.742  1.00 35.40  ?  111  VAL A CB    1 
ATOM   813   C  CG1   . VAL A 1  132  ? 59.456  34.410  -38.978  1.00 41.07  ?  111  VAL A CG1   1 
ATOM   814   C  CG2   . VAL A 1  132  ? 58.379  33.802  -41.149  1.00 33.22  ?  111  VAL A CG2   1 
ATOM   815   N  N     . PRO A 1  133  ? 61.006  31.068  -38.093  1.00 40.05  ?  112  PRO A N     1 
ATOM   816   C  CA    . PRO A 1  133  ? 61.320  30.587  -36.751  1.00 40.27  ?  112  PRO A CA    1 
ATOM   817   C  C     . PRO A 1  133  ? 61.550  31.741  -35.795  1.00 43.10  ?  112  PRO A C     1 
ATOM   818   O  O     . PRO A 1  133  ? 62.095  32.784  -36.185  1.00 43.94  ?  112  PRO A O     1 
ATOM   819   C  CB    . PRO A 1  133  ? 62.606  29.780  -36.966  1.00 41.13  ?  112  PRO A CB    1 
ATOM   820   C  CG    . PRO A 1  133  ? 63.245  30.416  -38.140  1.00 44.24  ?  112  PRO A CG    1 
ATOM   821   C  CD    . PRO A 1  133  ? 62.128  30.884  -39.027  1.00 43.15  ?  112  PRO A CD    1 
ATOM   822   N  N     . PRO A 1  134  ? 61.170  31.590  -34.532  1.00 41.50  ?  113  PRO A N     1 
ATOM   823   C  CA    . PRO A 1  134  ? 61.594  32.555  -33.518  1.00 44.24  ?  113  PRO A CA    1 
ATOM   824   C  C     . PRO A 1  134  ? 63.091  32.455  -33.279  1.00 45.59  ?  113  PRO A C     1 
ATOM   825   O  O     . PRO A 1  134  ? 63.743  31.479  -33.650  1.00 46.05  ?  113  PRO A O     1 
ATOM   826   C  CB    . PRO A 1  134  ? 60.804  32.136  -32.275  1.00 43.59  ?  113  PRO A CB    1 
ATOM   827   C  CG    . PRO A 1  134  ? 60.518  30.697  -32.493  1.00 42.02  ?  113  PRO A CG    1 
ATOM   828   C  CD    . PRO A 1  134  ? 60.295  30.552  -33.968  1.00 44.98  ?  113  PRO A CD    1 
ATOM   829   N  N     . ALA A 1  135  ? 63.637  33.496  -32.659  1.00 47.70  ?  114  ALA A N     1 
ATOM   830   C  CA    . ALA A 1  135  ? 65.052  33.491  -32.324  1.00 46.15  ?  114  ALA A CA    1 
ATOM   831   C  C     . ALA A 1  135  ? 65.362  32.329  -31.392  1.00 50.07  ?  114  ALA A C     1 
ATOM   832   O  O     . ALA A 1  135  ? 64.663  32.113  -30.399  1.00 50.36  ?  114  ALA A O     1 
ATOM   833   C  CB    . ALA A 1  135  ? 65.447  34.816  -31.674  1.00 49.60  ?  114  ALA A CB    1 
ATOM   834   N  N     . GLY A 1  136  ? 66.406  31.571  -31.723  1.00 49.17  ?  115  GLY A N     1 
ATOM   835   C  CA    . GLY A 1  136  ? 66.814  30.420  -30.944  1.00 52.86  ?  115  GLY A CA    1 
ATOM   836   C  C     . GLY A 1  136  ? 66.518  29.082  -31.586  1.00 51.38  ?  115  GLY A C     1 
ATOM   837   O  O     . GLY A 1  136  ? 66.981  28.055  -31.074  1.00 52.86  ?  115  GLY A O     1 
ATOM   838   N  N     . VAL A 1  137  ? 65.766  29.055  -32.683  1.00 44.85  ?  116  VAL A N     1 
ATOM   839   C  CA    . VAL A 1  137  ? 65.471  27.828  -33.408  1.00 46.13  ?  116  VAL A CA    1 
ATOM   840   C  C     . VAL A 1  137  ? 65.792  28.063  -34.878  1.00 44.91  ?  116  VAL A C     1 
ATOM   841   O  O     . VAL A 1  137  ? 65.761  29.196  -35.365  1.00 46.62  ?  116  VAL A O     1 
ATOM   842   C  CB    . VAL A 1  137  ? 64.003  27.379  -33.202  1.00 44.76  ?  116  VAL A CB    1 
ATOM   843   C  CG1   . VAL A 1  137  ? 63.053  28.374  -33.798  1.00 45.42  ?  116  VAL A CG1   1 
ATOM   844   C  CG2   . VAL A 1  137  ? 63.762  25.994  -33.777  1.00 47.64  ?  116  VAL A CG2   1 
ATOM   845   N  N     . THR A 1  138  ? 66.121  26.983  -35.583  1.00 46.99  ?  117  THR A N     1 
ATOM   846   C  CA    . THR A 1  138  ? 66.690  27.061  -36.918  1.00 47.16  ?  117  THR A CA    1 
ATOM   847   C  C     . THR A 1  138  ? 66.138  25.946  -37.792  1.00 44.68  ?  117  THR A C     1 
ATOM   848   O  O     . THR A 1  138  ? 66.053  24.791  -37.361  1.00 46.84  ?  117  THR A O     1 
ATOM   849   C  CB    . THR A 1  138  ? 68.221  26.966  -36.867  1.00 45.34  ?  117  THR A CB    1 
ATOM   850   O  OG1   . THR A 1  138  ? 68.739  28.016  -36.043  1.00 43.53  ?  117  THR A OG1   1 
ATOM   851   C  CG2   . THR A 1  138  ? 68.816  27.078  -38.260  1.00 43.01  ?  117  THR A CG2   1 
ATOM   852   N  N     . VAL A 1  139  ? 65.771  26.312  -39.019  1.00 44.40  ?  118  VAL A N     1 
ATOM   853   C  CA    . VAL A 1  139  ? 65.363  25.381  -40.065  1.00 43.38  ?  118  VAL A CA    1 
ATOM   854   C  C     . VAL A 1  139  ? 66.563  25.141  -40.968  1.00 45.97  ?  118  VAL A C     1 
ATOM   855   O  O     . VAL A 1  139  ? 67.095  26.085  -41.564  1.00 51.94  ?  118  VAL A O     1 
ATOM   856   C  CB    . VAL A 1  139  ? 64.179  25.932  -40.873  1.00 40.82  ?  118  VAL A CB    1 
ATOM   857   C  CG1   . VAL A 1  139  ? 63.872  25.022  -42.047  1.00 46.51  ?  118  VAL A CG1   1 
ATOM   858   C  CG2   . VAL A 1  139  ? 62.967  26.096  -39.990  1.00 37.02  ?  118  VAL A CG2   1 
ATOM   859   N  N     . HIS A 1  140  ? 66.996  23.888  -41.072  1.00 44.13  ?  119  HIS A N     1 
ATOM   860   C  CA    . HIS A 1  140  ? 68.256  23.570  -41.730  1.00 48.85  ?  119  HIS A CA    1 
ATOM   861   C  C     . HIS A 1  140  ? 68.118  23.092  -43.172  1.00 52.93  ?  119  HIS A C     1 
ATOM   862   O  O     . HIS A 1  140  ? 69.140  22.857  -43.821  1.00 61.37  ?  119  HIS A O     1 
ATOM   863   C  CB    . HIS A 1  140  ? 69.016  22.532  -40.908  1.00 48.97  ?  119  HIS A CB    1 
ATOM   864   C  CG    . HIS A 1  140  ? 69.468  23.046  -39.580  1.00 46.76  ?  119  HIS A CG    1 
ATOM   865   N  ND1   . HIS A 1  140  ? 70.675  23.685  -39.404  1.00 47.06  ?  119  HIS A ND1   1 
ATOM   866   C  CD2   . HIS A 1  140  ? 68.867  23.038  -38.368  1.00 45.80  ?  119  HIS A CD2   1 
ATOM   867   C  CE1   . HIS A 1  140  ? 70.804  24.037  -38.138  1.00 48.51  ?  119  HIS A CE1   1 
ATOM   868   N  NE2   . HIS A 1  140  ? 69.720  23.657  -37.489  1.00 45.37  ?  119  HIS A NE2   1 
ATOM   869   N  N     . ASN A 1  141  ? 66.905  22.946  -43.698  1.00 47.59  ?  120  ASN A N     1 
ATOM   870   C  CA    . ASN A 1  141  ? 66.700  22.558  -45.094  1.00 47.36  ?  120  ASN A CA    1 
ATOM   871   C  C     . ASN A 1  141  ? 65.681  23.503  -45.713  1.00 50.91  ?  120  ASN A C     1 
ATOM   872   O  O     . ASN A 1  141  ? 64.490  23.180  -45.812  1.00 50.98  ?  120  ASN A O     1 
ATOM   873   C  CB    . ASN A 1  141  ? 66.262  21.097  -45.218  1.00 46.91  ?  120  ASN A CB    1 
ATOM   874   C  CG    . ASN A 1  141  ? 65.270  20.695  -44.156  1.00 49.84  ?  120  ASN A CG    1 
ATOM   875   O  OD1   . ASN A 1  141  ? 64.901  21.498  -43.301  1.00 51.24  ?  120  ASN A OD1   1 
ATOM   876   N  ND2   . ASN A 1  141  ? 64.835  19.439  -44.195  1.00 44.99  ?  120  ASN A ND2   1 
ATOM   877   N  N     . PRO A 1  142  ? 66.124  24.681  -46.159  1.00 50.76  ?  121  PRO A N     1 
ATOM   878   C  CA    . PRO A 1  142  ? 65.172  25.688  -46.652  1.00 49.11  ?  121  PRO A CA    1 
ATOM   879   C  C     . PRO A 1  142  ? 64.462  25.289  -47.931  1.00 51.53  ?  121  PRO A C     1 
ATOM   880   O  O     . PRO A 1  142  ? 63.389  25.834  -48.216  1.00 52.31  ?  121  PRO A O     1 
ATOM   881   C  CB    . PRO A 1  142  ? 66.053  26.926  -46.876  1.00 49.35  ?  121  PRO A CB    1 
ATOM   882   C  CG    . PRO A 1  142  ? 67.334  26.645  -46.143  1.00 53.27  ?  121  PRO A CG    1 
ATOM   883   C  CD    . PRO A 1  142  ? 67.511  25.165  -46.191  1.00 48.93  ?  121  PRO A CD    1 
ATOM   884   N  N     . GLY A 1  143  ? 65.017  24.368  -48.710  1.00 49.38  ?  122  GLY A N     1 
ATOM   885   C  CA    . GLY A 1  143  ? 64.411  23.961  -49.956  1.00 50.08  ?  122  GLY A CA    1 
ATOM   886   C  C     . GLY A 1  143  ? 63.437  22.811  -49.867  1.00 53.99  ?  122  GLY A C     1 
ATOM   887   O  O     . GLY A 1  143  ? 62.899  22.392  -50.896  1.00 56.72  ?  122  GLY A O     1 
ATOM   888   N  N     . MET A 1  144  ? 63.190  22.284  -48.670  1.00 49.84  ?  123  MET A N     1 
ATOM   889   C  CA    . MET A 1  144  ? 62.292  21.147  -48.527  1.00 48.73  ?  123  MET A CA    1 
ATOM   890   C  C     . MET A 1  144  ? 60.879  21.522  -48.952  1.00 47.54  ?  123  MET A C     1 
ATOM   891   O  O     . MET A 1  144  ? 60.310  22.501  -48.463  1.00 44.68  ?  123  MET A O     1 
ATOM   892   C  CB    . MET A 1  144  ? 62.288  20.653  -47.083  1.00 43.98  ?  123  MET A CB    1 
ATOM   893   C  CG    . MET A 1  144  ? 61.441  19.418  -46.863  1.00 39.43  ?  123  MET A CG    1 
ATOM   894   S  SD    . MET A 1  144  ? 61.029  19.179  -45.130  1.00 41.77  ?  123  MET A SD    1 
ATOM   895   C  CE    . MET A 1  144  ? 59.738  20.395  -44.920  1.00 39.00  ?  123  MET A CE    1 
ATOM   896   N  N     . HIS A 1  145  ? 60.314  20.731  -49.861  1.00 45.80  ?  124  HIS A N     1 
ATOM   897   C  CA    . HIS A 1  145  ? 58.962  20.980  -50.338  1.00 41.33  ?  124  HIS A CA    1 
ATOM   898   C  C     . HIS A 1  145  ? 57.965  20.810  -49.202  1.00 38.27  ?  124  HIS A C     1 
ATOM   899   O  O     . HIS A 1  145  ? 58.065  19.881  -48.400  1.00 40.65  ?  124  HIS A O     1 
ATOM   900   C  CB    . HIS A 1  145  ? 58.623  20.024  -51.481  1.00 43.47  ?  124  HIS A CB    1 
ATOM   901   C  CG    . HIS A 1  145  ? 57.306  20.299  -52.137  1.00 46.63  ?  124  HIS A CG    1 
ATOM   902   N  ND1   . HIS A 1  145  ? 57.202  20.796  -53.418  1.00 49.40  ?  124  HIS A ND1   1 
ATOM   903   C  CD2   . HIS A 1  145  ? 56.037  20.138  -51.693  1.00 43.92  ?  124  HIS A CD2   1 
ATOM   904   C  CE1   . HIS A 1  145  ? 55.927  20.931  -53.734  1.00 46.74  ?  124  HIS A CE1   1 
ATOM   905   N  NE2   . HIS A 1  145  ? 55.200  20.539  -52.705  1.00 44.38  ?  124  HIS A NE2   1 
ATOM   906   N  N     . ILE A 1  146  ? 57.004  21.726  -49.127  1.00 39.03  ?  125  ILE A N     1 
ATOM   907   C  CA    . ILE A 1  146  ? 55.938  21.627  -48.140  1.00 38.30  ?  125  ILE A CA    1 
ATOM   908   C  C     . ILE A 1  146  ? 54.607  21.522  -48.866  1.00 40.39  ?  125  ILE A C     1 
ATOM   909   O  O     . ILE A 1  146  ? 53.876  20.540  -48.700  1.00 38.35  ?  125  ILE A O     1 
ATOM   910   C  CB    . ILE A 1  146  ? 55.944  22.809  -47.157  1.00 36.75  ?  125  ILE A CB    1 
ATOM   911   C  CG1   . ILE A 1  146  ? 57.169  22.735  -46.251  1.00 38.53  ?  125  ILE A CG1   1 
ATOM   912   C  CG2   . ILE A 1  146  ? 54.680  22.798  -46.319  1.00 34.50  ?  125  ILE A CG2   1 
ATOM   913   C  CD1   . ILE A 1  146  ? 57.148  23.732  -45.120  1.00 37.83  ?  125  ILE A CD1   1 
ATOM   914   N  N     . ALA A 1  147  ? 54.265  22.540  -49.652  1.00 42.67  ?  126  ALA A N     1 
ATOM   915   C  CA    . ALA A 1  147  ? 52.985  22.517  -50.344  1.00 40.05  ?  126  ALA A CA    1 
ATOM   916   C  C     . ALA A 1  147  ? 53.102  23.228  -51.682  1.00 41.43  ?  126  ALA A C     1 
ATOM   917   O  O     . ALA A 1  147  ? 54.068  23.941  -51.947  1.00 42.47  ?  126  ALA A O     1 
ATOM   918   C  CB    . ALA A 1  147  ? 51.879  23.148  -49.495  1.00 38.97  ?  126  ALA A CB    1 
ATOM   919   N  N     . THR A 1  148  ? 52.107  22.996  -52.533  1.00 41.31  ?  127  THR A N     1 
ATOM   920   C  CA    . THR A 1  148  ? 51.963  23.684  -53.808  1.00 41.12  ?  127  THR A CA    1 
ATOM   921   C  C     . THR A 1  148  ? 50.638  24.431  -53.804  1.00 43.38  ?  127  THR A C     1 
ATOM   922   O  O     . THR A 1  148  ? 49.602  23.857  -53.458  1.00 47.44  ?  127  THR A O     1 
ATOM   923   C  CB    . THR A 1  148  ? 52.025  22.700  -54.976  1.00 42.72  ?  127  THR A CB    1 
ATOM   924   O  OG1   . THR A 1  148  ? 53.359  22.196  -55.106  1.00 49.37  ?  127  THR A OG1   1 
ATOM   925   C  CG2   . THR A 1  148  ? 51.614  23.376  -56.272  1.00 42.33  ?  127  THR A CG2   1 
ATOM   926   N  N     . LEU A 1  149  ? 50.674  25.707  -54.173  1.00 45.93  ?  128  LEU A N     1 
ATOM   927   C  CA    . LEU A 1  149  ? 49.514  26.586  -54.108  1.00 43.09  ?  128  LEU A CA    1 
ATOM   928   C  C     . LEU A 1  149  ? 49.222  27.171  -55.480  1.00 44.33  ?  128  LEU A C     1 
ATOM   929   O  O     . LEU A 1  149  ? 50.143  27.505  -56.232  1.00 47.28  ?  128  LEU A O     1 
ATOM   930   C  CB    . LEU A 1  149  ? 49.735  27.726  -53.110  1.00 41.68  ?  128  LEU A CB    1 
ATOM   931   C  CG    . LEU A 1  149  ? 49.473  27.520  -51.617  1.00 40.56  ?  128  LEU A CG    1 
ATOM   932   C  CD1   . LEU A 1  149  ? 50.235  26.338  -51.058  1.00 41.02  ?  128  LEU A CD1   1 
ATOM   933   C  CD2   . LEU A 1  149  ? 49.844  28.784  -50.863  1.00 45.56  ?  128  LEU A CD2   1 
ATOM   934   N  N     . ASN A 1  150  ? 47.939  27.295  -55.798  1.00 43.52  ?  129  ASN A N     1 
ATOM   935   C  CA    . ASN A 1  150  ? 47.488  28.019  -56.972  1.00 46.01  ?  129  ASN A CA    1 
ATOM   936   C  C     . ASN A 1  150  ? 46.936  29.377  -56.537  1.00 48.17  ?  129  ASN A C     1 
ATOM   937   O  O     . ASN A 1  150  ? 47.021  29.760  -55.366  1.00 45.62  ?  129  ASN A O     1 
ATOM   938   C  CB    . ASN A 1  150  ? 46.472  27.192  -57.769  1.00 45.71  ?  129  ASN A CB    1 
ATOM   939   C  CG    . ASN A 1  150  ? 45.222  26.855  -56.978  1.00 44.81  ?  129  ASN A CG    1 
ATOM   940   O  OD1   . ASN A 1  150  ? 45.006  27.353  -55.877  1.00 46.80  ?  129  ASN A OD1   1 
ATOM   941   N  ND2   . ASN A 1  150  ? 44.381  26.006  -57.552  1.00 42.16  ?  129  ASN A ND2   1 
ATOM   942   N  N     . ASP A 1  151  ? 46.369  30.118  -57.493  1.00 53.23  ?  130  ASP A N     1 
ATOM   943   C  CA    . ASP A 1  151  ? 45.943  31.490  -57.230  1.00 51.72  ?  130  ASP A CA    1 
ATOM   944   C  C     . ASP A 1  151  ? 44.980  31.587  -56.053  1.00 52.84  ?  130  ASP A C     1 
ATOM   945   O  O     . ASP A 1  151  ? 44.950  32.614  -55.366  1.00 57.09  ?  130  ASP A O     1 
ATOM   946   C  CB    . ASP A 1  151  ? 45.307  32.085  -58.485  1.00 51.98  ?  130  ASP A CB    1 
ATOM   947   C  CG    . ASP A 1  151  ? 46.317  32.328  -59.587  1.00 63.90  ?  130  ASP A CG    1 
ATOM   948   O  OD1   . ASP A 1  151  ? 46.536  31.418  -60.413  1.00 66.73  ?  130  ASP A OD1   1 
ATOM   949   O  OD2   . ASP A 1  151  ? 46.899  33.432  -59.624  1.00 68.26  ?  130  ASP A OD2   1 
ATOM   950   N  N     . LYS A 1  152  ? 44.198  30.542  -55.795  1.00 47.87  ?  131  LYS A N     1 
ATOM   951   C  CA    . LYS A 1  152  ? 43.218  30.567  -54.718  1.00 46.21  ?  131  LYS A CA    1 
ATOM   952   C  C     . LYS A 1  152  ? 43.744  29.989  -53.412  1.00 42.54  ?  131  LYS A C     1 
ATOM   953   O  O     . LYS A 1  152  ? 43.024  30.008  -52.410  1.00 40.26  ?  131  LYS A O     1 
ATOM   954   C  CB    . LYS A 1  152  ? 41.957  29.807  -55.137  1.00 41.82  ?  131  LYS A CB    1 
ATOM   955   C  CG    . LYS A 1  152  ? 41.427  30.210  -56.495  1.00 43.36  ?  131  LYS A CG    1 
ATOM   956   C  CD    . LYS A 1  152  ? 40.305  29.296  -56.943  1.00 49.32  ?  131  LYS A CD    1 
ATOM   957   C  CE    . LYS A 1  152  ? 39.904  29.599  -58.374  1.00 58.03  ?  131  LYS A CE    1 
ATOM   958   N  NZ    . LYS A 1  152  ? 38.851  28.674  -58.871  1.00 59.92  ?  131  LYS A NZ    1 
ATOM   959   N  N     . GLY A 1  153  ? 44.973  29.479  -53.394  1.00 42.01  ?  132  GLY A N     1 
ATOM   960   C  CA    . GLY A 1  153  ? 45.485  28.831  -52.200  1.00 42.51  ?  132  GLY A CA    1 
ATOM   961   C  C     . GLY A 1  153  ? 46.072  29.820  -51.206  1.00 44.16  ?  132  GLY A C     1 
ATOM   962   O  O     . GLY A 1  153  ? 46.710  30.804  -51.574  1.00 50.34  ?  132  GLY A O     1 
ATOM   963   N  N     . LYS A 1  154  ? 45.865  29.527  -49.927  1.00 45.45  ?  133  LYS A N     1 
ATOM   964   C  CA    . LYS A 1  154  ? 46.450  30.282  -48.830  1.00 48.14  ?  133  LYS A CA    1 
ATOM   965   C  C     . LYS A 1  154  ? 46.777  29.307  -47.712  1.00 46.45  ?  133  LYS A C     1 
ATOM   966   O  O     . LYS A 1  154  ? 45.991  28.399  -47.433  1.00 49.91  ?  133  LYS A O     1 
ATOM   967   C  CB    . LYS A 1  154  ? 45.498  31.372  -48.317  1.00 48.31  ?  133  LYS A CB    1 
ATOM   968   C  CG    . LYS A 1  154  ? 46.000  32.091  -47.077  1.00 48.68  ?  133  LYS A CG    1 
ATOM   969   C  CD    . LYS A 1  154  ? 44.865  32.685  -46.269  1.00 51.74  ?  133  LYS A CD    1 
ATOM   970   C  CE    . LYS A 1  154  ? 45.374  33.209  -44.934  1.00 60.55  ?  133  LYS A CE    1 
ATOM   971   N  NZ    . LYS A 1  154  ? 44.269  33.682  -44.057  1.00 73.24  ?  133  LYS A NZ    1 
ATOM   972   N  N     . LEU A 1  155  ? 47.929  29.487  -47.072  1.00 44.80  ?  134  LEU A N     1 
ATOM   973   C  CA    . LEU A 1  155  ? 48.366  28.568  -46.028  1.00 44.87  ?  134  LEU A CA    1 
ATOM   974   C  C     . LEU A 1  155  ? 48.835  29.354  -44.814  1.00 48.89  ?  134  LEU A C     1 
ATOM   975   O  O     . LEU A 1  155  ? 49.766  30.161  -44.915  1.00 51.92  ?  134  LEU A O     1 
ATOM   976   C  CB    . LEU A 1  155  ? 49.474  27.645  -46.537  1.00 48.59  ?  134  LEU A CB    1 
ATOM   977   C  CG    . LEU A 1  155  ? 49.577  26.303  -45.813  1.00 48.67  ?  134  LEU A CG    1 
ATOM   978   C  CD1   . LEU A 1  155  ? 48.269  25.535  -45.917  1.00 48.53  ?  134  LEU A CD1   1 
ATOM   979   C  CD2   . LEU A 1  155  ? 50.724  25.480  -46.367  1.00 43.16  ?  134  LEU A CD2   1 
ATOM   980   N  N     . GLU A 1  156  ? 48.185  29.115  -43.675  1.00 49.12  ?  135  GLU A N     1 
ATOM   981   C  CA    . GLU A 1  156  ? 48.525  29.739  -42.399  1.00 51.65  ?  135  GLU A CA    1 
ATOM   982   C  C     . GLU A 1  156  ? 48.661  28.634  -41.358  1.00 49.42  ?  135  GLU A C     1 
ATOM   983   O  O     . GLU A 1  156  ? 47.666  28.002  -40.988  1.00 45.41  ?  135  GLU A O     1 
ATOM   984   C  CB    . GLU A 1  156  ? 47.455  30.751  -41.994  1.00 57.74  ?  135  GLU A CB    1 
ATOM   985   C  CG    . GLU A 1  156  ? 47.858  31.686  -40.871  1.00 66.37  ?  135  GLU A CG    1 
ATOM   986   C  CD    . GLU A 1  156  ? 46.710  32.561  -40.410  1.00 70.30  ?  135  GLU A CD    1 
ATOM   987   O  OE1   . GLU A 1  156  ? 46.345  32.481  -39.218  1.00 70.48  ?  135  GLU A OE1   1 
ATOM   988   O  OE2   . GLU A 1  156  ? 46.165  33.318  -41.242  1.00 72.84  ?  135  GLU A OE2   1 
ATOM   989   N  N     . VAL A 1  157  ? 49.882  28.419  -40.866  1.00 45.24  ?  136  VAL A N     1 
ATOM   990   C  CA    . VAL A 1  157  ? 50.227  27.254  -40.057  1.00 40.10  ?  136  VAL A CA    1 
ATOM   991   C  C     . VAL A 1  157  ? 51.064  27.696  -38.864  1.00 41.62  ?  136  VAL A C     1 
ATOM   992   O  O     . VAL A 1  157  ? 52.011  28.471  -39.017  1.00 45.24  ?  136  VAL A O     1 
ATOM   993   C  CB    . VAL A 1  157  ? 51.005  26.203  -40.875  1.00 37.80  ?  136  VAL A CB    1 
ATOM   994   C  CG1   . VAL A 1  157  ? 51.272  24.967  -40.036  1.00 35.99  ?  136  VAL A CG1   1 
ATOM   995   C  CG2   . VAL A 1  157  ? 50.264  25.841  -42.152  1.00 39.86  ?  136  VAL A CG2   1 
ATOM   996   N  N     . GLU A 1  158  ? 50.720  27.196  -37.682  1.00 43.49  ?  137  GLU A N     1 
ATOM   997   C  CA    . GLU A 1  158  ? 51.556  27.289  -36.495  1.00 45.33  ?  137  GLU A CA    1 
ATOM   998   C  C     . GLU A 1  158  ? 52.224  25.942  -36.249  1.00 41.39  ?  137  GLU A C     1 
ATOM   999   O  O     . GLU A 1  158  ? 51.592  24.893  -36.391  1.00 37.42  ?  137  GLU A O     1 
ATOM   1000  C  CB    . GLU A 1  158  ? 50.736  27.679  -35.266  1.00 44.96  ?  137  GLU A CB    1 
ATOM   1001  C  CG    . GLU A 1  158  ? 49.949  28.960  -35.398  1.00 54.20  ?  137  GLU A CG    1 
ATOM   1002  C  CD    . GLU A 1  158  ? 49.087  29.225  -34.180  1.00 66.91  ?  137  GLU A CD    1 
ATOM   1003  O  OE1   . GLU A 1  158  ? 49.140  28.413  -33.231  1.00 63.99  ?  137  GLU A OE1   1 
ATOM   1004  O  OE2   . GLU A 1  158  ? 48.357  30.239  -34.171  1.00 66.16  ?  137  GLU A OE2   1 
ATOM   1005  N  N     . LEU A 1  159  ? 53.499  25.974  -35.869  1.00 40.28  ?  138  LEU A N     1 
ATOM   1006  C  CA    . LEU A 1  159  ? 54.273  24.761  -35.637  1.00 37.76  ?  138  LEU A CA    1 
ATOM   1007  C  C     . LEU A 1  159  ? 54.967  24.873  -34.291  1.00 39.06  ?  138  LEU A C     1 
ATOM   1008  O  O     . LEU A 1  159  ? 55.811  25.752  -34.102  1.00 41.75  ?  138  LEU A O     1 
ATOM   1009  C  CB    . LEU A 1  159  ? 55.299  24.533  -36.750  1.00 34.29  ?  138  LEU A CB    1 
ATOM   1010  C  CG    . LEU A 1  159  ? 54.767  24.473  -38.182  1.00 34.49  ?  138  LEU A CG    1 
ATOM   1011  C  CD1   . LEU A 1  159  ? 54.731  25.855  -38.812  1.00 40.02  ?  138  LEU A CD1   1 
ATOM   1012  C  CD2   . LEU A 1  159  ? 55.590  23.518  -39.025  1.00 33.94  ?  138  LEU A CD2   1 
ATOM   1013  N  N     . VAL A 1  160  ? 54.625  23.990  -33.370  1.00 38.21  ?  139  VAL A N     1 
ATOM   1014  C  CA    . VAL A 1  160  ? 55.227  23.983  -32.042  1.00 40.09  ?  139  VAL A CA    1 
ATOM   1015  C  C     . VAL A 1  160  ? 56.472  23.111  -32.068  1.00 40.08  ?  139  VAL A C     1 
ATOM   1016  O  O     . VAL A 1  160  ? 56.471  22.019  -32.644  1.00 44.18  ?  139  VAL A O     1 
ATOM   1017  C  CB    . VAL A 1  160  ? 54.218  23.494  -30.988  1.00 36.61  ?  139  VAL A CB    1 
ATOM   1018  C  CG1   . VAL A 1  160  ? 54.855  23.476  -29.611  1.00 42.05  ?  139  VAL A CG1   1 
ATOM   1019  C  CG2   . VAL A 1  160  ? 52.988  24.379  -30.993  1.00 40.19  ?  139  VAL A CG2   1 
ATOM   1020  N  N     . VAL A 1  161  ? 57.543  23.595  -31.445  1.00 40.18  ?  140  VAL A N     1 
ATOM   1021  C  CA    . VAL A 1  161  ? 58.830  22.914  -31.428  1.00 41.63  ?  140  VAL A CA    1 
ATOM   1022  C  C     . VAL A 1  161  ? 59.282  22.755  -29.984  1.00 44.94  ?  140  VAL A C     1 
ATOM   1023  O  O     . VAL A 1  161  ? 59.213  23.707  -29.195  1.00 45.68  ?  140  VAL A O     1 
ATOM   1024  C  CB    . VAL A 1  161  ? 59.889  23.670  -32.252  1.00 39.68  ?  140  VAL A CB    1 
ATOM   1025  C  CG1   . VAL A 1  161  ? 61.275  23.116  -31.981  1.00 40.44  ?  140  VAL A CG1   1 
ATOM   1026  C  CG2   . VAL A 1  161  ? 59.564  23.564  -33.725  1.00 39.08  ?  140  VAL A CG2   1 
ATOM   1027  N  N     . GLU A 1  162  ? 59.731  21.548  -29.647  1.00 45.35  ?  141  GLU A N     1 
ATOM   1028  C  CA    . GLU A 1  162  ? 60.239  21.189  -28.334  1.00 46.78  ?  141  GLU A CA    1 
ATOM   1029  C  C     . GLU A 1  162  ? 61.526  20.392  -28.495  1.00 45.45  ?  141  GLU A C     1 
ATOM   1030  O  O     . GLU A 1  162  ? 61.882  19.956  -29.593  1.00 41.91  ?  141  GLU A O     1 
ATOM   1031  C  CB    . GLU A 1  162  ? 59.216  20.370  -27.540  1.00 48.36  ?  141  GLU A CB    1 
ATOM   1032  C  CG    . GLU A 1  162  ? 58.021  21.153  -27.057  1.00 54.25  ?  141  GLU A CG    1 
ATOM   1033  C  CD    . GLU A 1  162  ? 56.970  20.263  -26.434  1.00 61.16  ?  141  GLU A CD    1 
ATOM   1034  O  OE1   . GLU A 1  162  ? 56.195  19.643  -27.189  1.00 59.34  ?  141  GLU A OE1   1 
ATOM   1035  O  OE2   . GLU A 1  162  ? 56.927  20.171  -25.190  1.00 67.54  ?  141  GLU A OE2   1 
ATOM   1036  N  N     . ARG A 1  163  ? 62.225  20.206  -27.381  1.00 48.93  ?  142  ARG A N     1 
ATOM   1037  C  CA    . ARG A 1  163  ? 63.464  19.444  -27.339  1.00 50.13  ?  142  ARG A CA    1 
ATOM   1038  C  C     . ARG A 1  163  ? 63.223  18.089  -26.686  1.00 54.23  ?  142  ARG A C     1 
ATOM   1039  O  O     . ARG A 1  163  ? 62.493  17.987  -25.695  1.00 54.57  ?  142  ARG A O     1 
ATOM   1040  C  CB    . ARG A 1  163  ? 64.552  20.204  -26.575  1.00 55.55  ?  142  ARG A CB    1 
ATOM   1041  C  CG    . ARG A 1  163  ? 65.088  21.423  -27.302  1.00 56.11  ?  142  ARG A CG    1 
ATOM   1042  C  CD    . ARG A 1  163  ? 66.323  21.996  -26.614  1.00 60.02  ?  142  ARG A CD    1 
ATOM   1043  N  NE    . ARG A 1  163  ? 67.377  20.999  -26.434  1.00 65.51  ?  142  ARG A NE    1 
ATOM   1044  C  CZ    . ARG A 1  163  ? 68.178  20.565  -27.404  1.00 62.99  ?  142  ARG A CZ    1 
ATOM   1045  N  NH1   . ARG A 1  163  ? 68.047  21.029  -28.639  1.00 57.17  ?  142  ARG A NH1   1 
ATOM   1046  N  NH2   . ARG A 1  163  ? 69.109  19.659  -27.140  1.00 59.72  ?  142  ARG A NH2   1 
ATOM   1047  N  N     . GLY A 1  164  ? 63.844  17.058  -27.243  1.00 52.14  ?  143  GLY A N     1 
ATOM   1048  C  CA    . GLY A 1  164  ? 63.694  15.720  -26.710  1.00 53.08  ?  143  GLY A CA    1 
ATOM   1049  C  C     . GLY A 1  164  ? 64.709  14.781  -27.321  1.00 50.90  ?  143  GLY A C     1 
ATOM   1050  O  O     . GLY A 1  164  ? 65.654  15.205  -27.987  1.00 52.39  ?  143  GLY A O     1 
ATOM   1051  N  N     . ARG A 1  165  ? 64.499  13.488  -27.087  1.00 49.34  ?  144  ARG A N     1 
ATOM   1052  C  CA    . ARG A 1  165  ? 65.381  12.465  -27.624  1.00 49.26  ?  144  ARG A CA    1 
ATOM   1053  C  C     . ARG A 1  165  ? 64.555  11.283  -28.106  1.00 48.23  ?  144  ARG A C     1 
ATOM   1054  O  O     . ARG A 1  165  ? 63.465  11.012  -27.595  1.00 43.48  ?  144  ARG A O     1 
ATOM   1055  C  CB    . ARG A 1  165  ? 66.408  11.997  -26.586  1.00 51.11  ?  144  ARG A CB    1 
ATOM   1056  C  CG    . ARG A 1  165  ? 65.833  11.070  -25.541  1.00 57.61  ?  144  ARG A CG    1 
ATOM   1057  C  CD    . ARG A 1  165  ? 66.708  10.992  -24.310  1.00 64.84  ?  144  ARG A CD    1 
ATOM   1058  N  NE    . ARG A 1  165  ? 66.124  10.104  -23.312  1.00 69.25  ?  144  ARG A NE    1 
ATOM   1059  C  CZ    . ARG A 1  165  ? 66.330  10.209  -22.006  1.00 75.13  ?  144  ARG A CZ    1 
ATOM   1060  N  NH1   . ARG A 1  165  ? 67.103  11.174  -21.532  1.00 81.37  ?  144  ARG A NH1   1 
ATOM   1061  N  NH2   . ARG A 1  165  ? 65.755  9.356   -21.172  1.00 78.81  ?  144  ARG A NH2   1 
ATOM   1062  N  N     . GLY A 1  166  ? 65.090  10.585  -29.102  1.00 48.34  ?  145  GLY A N     1 
ATOM   1063  C  CA    . GLY A 1  166  ? 64.405  9.415   -29.616  1.00 48.68  ?  145  GLY A CA    1 
ATOM   1064  C  C     . GLY A 1  166  ? 63.180  9.792   -30.425  1.00 44.44  ?  145  GLY A C     1 
ATOM   1065  O  O     . GLY A 1  166  ? 63.174  10.765  -31.185  1.00 42.67  ?  145  GLY A O     1 
ATOM   1066  N  N     . TYR A 1  167  ? 62.122  9.003   -30.257  1.00 45.93  ?  146  TYR A N     1 
ATOM   1067  C  CA    . TYR A 1  167  ? 60.883  9.159   -31.008  1.00 45.09  ?  146  TYR A CA    1 
ATOM   1068  C  C     . TYR A 1  167  ? 59.718  9.064   -30.037  1.00 41.62  ?  146  TYR A C     1 
ATOM   1069  O  O     . TYR A 1  167  ? 59.552  8.041   -29.367  1.00 44.65  ?  146  TYR A O     1 
ATOM   1070  C  CB    . TYR A 1  167  ? 60.777  8.090   -32.103  1.00 45.28  ?  146  TYR A CB    1 
ATOM   1071  C  CG    . TYR A 1  167  ? 59.371  7.760   -32.550  1.00 42.87  ?  146  TYR A CG    1 
ATOM   1072  C  CD1   . TYR A 1  167  ? 58.748  8.494   -33.548  1.00 41.99  ?  146  TYR A CD1   1 
ATOM   1073  C  CD2   . TYR A 1  167  ? 58.676  6.695   -31.992  1.00 43.04  ?  146  TYR A CD2   1 
ATOM   1074  C  CE1   . TYR A 1  167  ? 57.467  8.189   -33.964  1.00 43.19  ?  146  TYR A CE1   1 
ATOM   1075  C  CE2   . TYR A 1  167  ? 57.395  6.385   -32.398  1.00 43.61  ?  146  TYR A CE2   1 
ATOM   1076  C  CZ    . TYR A 1  167  ? 56.795  7.134   -33.385  1.00 43.53  ?  146  TYR A CZ    1 
ATOM   1077  O  OH    . TYR A 1  167  ? 55.518  6.827   -33.795  1.00 43.42  ?  146  TYR A OH    1 
ATOM   1078  N  N     . VAL A 1  168  ? 58.933  10.127  -29.942  1.00 38.17  ?  147  VAL A N     1 
ATOM   1079  C  CA    . VAL A 1  168  ? 57.699  10.122  -29.163  1.00 41.49  ?  147  VAL A CA    1 
ATOM   1080  C  C     . VAL A 1  168  ? 56.529  10.286  -30.128  1.00 42.24  ?  147  VAL A C     1 
ATOM   1081  O  O     . VAL A 1  168  ? 56.480  11.274  -30.873  1.00 41.27  ?  147  VAL A O     1 
ATOM   1082  C  CB    . VAL A 1  168  ? 57.688  11.209  -28.075  1.00 38.32  ?  147  VAL A CB    1 
ATOM   1083  C  CG1   . VAL A 1  168  ? 58.088  12.547  -28.637  1.00 49.43  ?  147  VAL A CG1   1 
ATOM   1084  C  CG2   . VAL A 1  168  ? 56.313  11.294  -27.438  1.00 42.16  ?  147  VAL A CG2   1 
ATOM   1085  N  N     . PRO A 1  169  ? 55.594  9.342   -30.176  1.00 44.55  ?  148  PRO A N     1 
ATOM   1086  C  CA    . PRO A 1  169  ? 54.414  9.515   -31.025  1.00 43.35  ?  148  PRO A CA    1 
ATOM   1087  C  C     . PRO A 1  169  ? 53.537  10.652  -30.525  1.00 42.31  ?  148  PRO A C     1 
ATOM   1088  O  O     . PRO A 1  169  ? 53.672  11.130  -29.398  1.00 43.25  ?  148  PRO A O     1 
ATOM   1089  C  CB    . PRO A 1  169  ? 53.696  8.168   -30.911  1.00 41.94  ?  148  PRO A CB    1 
ATOM   1090  C  CG    . PRO A 1  169  ? 54.110  7.652   -29.580  1.00 40.80  ?  148  PRO A CG    1 
ATOM   1091  C  CD    . PRO A 1  169  ? 55.529  8.101   -29.389  1.00 40.83  ?  148  PRO A CD    1 
ATOM   1092  N  N     . ALA A 1  170  ? 52.622  11.075  -31.396  1.00 44.28  ?  149  ALA A N     1 
ATOM   1093  C  CA    . ALA A 1  170  ? 51.808  12.258  -31.146  1.00 47.42  ?  149  ALA A CA    1 
ATOM   1094  C  C     . ALA A 1  170  ? 51.132  12.192  -29.784  1.00 49.69  ?  149  ALA A C     1 
ATOM   1095  O  O     . ALA A 1  170  ? 50.458  11.213  -29.454  1.00 52.90  ?  149  ALA A O     1 
ATOM   1096  C  CB    . ALA A 1  170  ? 50.758  12.402  -32.246  1.00 45.46  ?  149  ALA A CB    1 
ATOM   1097  N  N     . VAL A 1  171  ? 51.310  13.248  -28.998  1.00 49.87  ?  150  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1  171  ? 50.758  13.302  -27.650  1.00 51.66  ?  150  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1  171  ? 49.282  13.655  -27.753  1.00 64.98  ?  150  VAL A C     1 
ATOM   1100  O  O     . VAL A 1  171  ? 48.923  14.730  -28.245  1.00 65.36  ?  150  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1  171  ? 51.513  14.318  -26.784  1.00 50.49  ?  150  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1  171  ? 50.902  14.388  -25.394  1.00 56.12  ?  150  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1  171  ? 52.987  13.956  -26.709  1.00 49.83  ?  150  VAL A CG2   1 
ATOM   1104  N  N     . GLN A 1  172  ? 48.426  12.756  -27.276  1.00 73.89  ?  151  GLN A N     1 
ATOM   1105  C  CA    . GLN A 1  172  ? 46.990  12.935  -27.422  1.00 74.68  ?  151  GLN A CA    1 
ATOM   1106  C  C     . GLN A 1  172  ? 46.525  14.183  -26.681  1.00 80.83  ?  151  GLN A C     1 
ATOM   1107  O  O     . GLN A 1  172  ? 47.094  14.577  -25.659  1.00 84.01  ?  151  GLN A O     1 
ATOM   1108  C  CB    . GLN A 1  172  ? 46.252  11.701  -26.908  1.00 73.20  ?  151  GLN A CB    1 
ATOM   1109  C  CG    . GLN A 1  172  ? 46.562  10.439  -27.696  1.00 81.23  ?  151  GLN A CG    1 
ATOM   1110  C  CD    . GLN A 1  172  ? 45.887  9.207   -27.126  1.00 92.13  ?  151  GLN A CD    1 
ATOM   1111  O  OE1   . GLN A 1  172  ? 44.660  9.108   -27.107  1.00 90.69  ?  151  GLN A OE1   1 
ATOM   1112  N  NE2   . GLN A 1  172  ? 46.689  8.259   -26.654  1.00 87.61  ?  151  GLN A NE2   1 
ATOM   1113  N  N     . ASN A 1  173  ? 45.481  14.815  -27.220  1.00 84.94  ?  152  ASN A N     1 
ATOM   1114  C  CA    . ASN A 1  173  ? 44.981  16.050  -26.629  1.00 86.85  ?  152  ASN A CA    1 
ATOM   1115  C  C     . ASN A 1  173  ? 44.375  15.813  -25.253  1.00 89.65  ?  152  ASN A C     1 
ATOM   1116  O  O     . ASN A 1  173  ? 44.354  16.729  -24.425  1.00 89.19  ?  152  ASN A O     1 
ATOM   1117  C  CB    . ASN A 1  173  ? 43.958  16.702  -27.557  1.00 87.72  ?  152  ASN A CB    1 
ATOM   1118  C  CG    . ASN A 1  173  ? 44.523  16.993  -28.933  1.00 80.35  ?  152  ASN A CG    1 
ATOM   1119  O  OD1   . ASN A 1  173  ? 44.370  16.197  -29.859  1.00 80.92  ?  152  ASN A OD1   1 
ATOM   1120  N  ND2   . ASN A 1  173  ? 45.183  18.135  -29.073  1.00 68.39  ?  152  ASN A ND2   1 
ATOM   1121  N  N     . ARG A 1  174  ? 43.873  14.603  -24.989  1.00 90.67  ?  153  ARG A N     1 
ATOM   1122  C  CA    . ARG A 1  174  ? 43.378  14.296  -23.651  1.00 93.88  ?  153  ARG A CA    1 
ATOM   1123  C  C     . ARG A 1  174  ? 44.513  14.224  -22.640  1.00 93.62  ?  153  ARG A C     1 
ATOM   1124  O  O     . ARG A 1  174  ? 44.314  14.546  -21.463  1.00 94.04  ?  153  ARG A O     1 
ATOM   1125  C  CB    . ARG A 1  174  ? 42.586  12.989  -23.661  1.00 100.00 ?  153  ARG A CB    1 
ATOM   1126  C  CG    . ARG A 1  174  ? 41.077  13.181  -23.739  1.00 106.60 ?  153  ARG A CG    1 
ATOM   1127  C  CD    . ARG A 1  174  ? 40.516  13.755  -22.441  1.00 110.08 ?  153  ARG A CD    1 
ATOM   1128  N  NE    . ARG A 1  174  ? 40.490  12.766  -21.365  1.00 109.67 ?  153  ARG A NE    1 
ATOM   1129  C  CZ    . ARG A 1  174  ? 40.050  13.010  -20.134  1.00 107.11 ?  153  ARG A CZ    1 
ATOM   1130  N  NH1   . ARG A 1  174  ? 39.599  14.215  -19.815  1.00 102.43 ?  153  ARG A NH1   1 
ATOM   1131  N  NH2   . ARG A 1  174  ? 40.062  12.049  -19.221  1.00 111.14 ?  153  ARG A NH2   1 
ATOM   1132  N  N     . ALA A 1  175  ? 45.704  13.806  -23.074  1.00 92.64  ?  154  ALA A N     1 
ATOM   1133  C  CA    . ALA A 1  175  ? 46.884  13.890  -22.223  1.00 87.52  ?  154  ALA A CA    1 
ATOM   1134  C  C     . ALA A 1  175  ? 47.344  15.325  -22.012  1.00 87.10  ?  154  ALA A C     1 
ATOM   1135  O  O     . ALA A 1  175  ? 48.162  15.573  -21.121  1.00 79.55  ?  154  ALA A O     1 
ATOM   1136  C  CB    . ALA A 1  175  ? 48.024  13.064  -22.819  1.00 79.28  ?  154  ALA A CB    1 
ATOM   1137  N  N     . SER A 1  176  ? 46.839  16.263  -22.803  1.00 89.87  ?  155  SER A N     1 
ATOM   1138  C  CA    . SER A 1  176  ? 47.157  17.678  -22.701  1.00 90.51  ?  155  SER A CA    1 
ATOM   1139  C  C     . SER A 1  176  ? 45.899  18.455  -22.323  1.00 92.67  ?  155  SER A C     1 
ATOM   1140  O  O     . SER A 1  176  ? 44.839  17.883  -22.057  1.00 93.57  ?  155  SER A O     1 
ATOM   1141  C  CB    . SER A 1  176  ? 47.743  18.197  -24.018  1.00 85.03  ?  155  SER A CB    1 
ATOM   1142  O  OG    . SER A 1  176  ? 48.648  17.263  -24.578  1.00 81.57  ?  155  SER A OG    1 
ATOM   1143  N  N     . GLY A 1  177  ? 46.032  19.776  -22.281  1.00 90.16  ?  156  GLY A N     1 
ATOM   1144  C  CA    . GLY A 1  177  ? 44.880  20.641  -22.139  1.00 88.04  ?  156  GLY A CA    1 
ATOM   1145  C  C     . GLY A 1  177  ? 44.542  21.277  -23.469  1.00 89.77  ?  156  GLY A C     1 
ATOM   1146  O  O     . GLY A 1  177  ? 43.834  22.287  -23.532  1.00 90.62  ?  156  GLY A O     1 
ATOM   1147  N  N     . ALA A 1  178  ? 45.054  20.682  -24.543  1.00 89.37  ?  157  ALA A N     1 
ATOM   1148  C  CA    . ALA A 1  178  ? 44.927  21.261  -25.869  1.00 84.05  ?  157  ALA A CA    1 
ATOM   1149  C  C     . ALA A 1  178  ? 43.475  21.251  -26.334  1.00 80.96  ?  157  ALA A C     1 
ATOM   1150  O  O     . ALA A 1  178  ? 42.650  20.449  -25.889  1.00 75.58  ?  157  ALA A O     1 
ATOM   1151  C  CB    . ALA A 1  178  ? 45.803  20.505  -26.867  1.00 75.64  ?  157  ALA A CB    1 
ATOM   1152  N  N     . GLU A 1  179  ? 43.170  22.167  -27.245  1.00 78.79  ?  158  GLU A N     1 
ATOM   1153  C  CA    . GLU A 1  179  ? 41.839  22.312  -27.801  1.00 73.93  ?  158  GLU A CA    1 
ATOM   1154  C  C     . GLU A 1  179  ? 41.755  21.569  -29.133  1.00 66.84  ?  158  GLU A C     1 
ATOM   1155  O  O     . GLU A 1  179  ? 42.688  20.872  -29.540  1.00 67.78  ?  158  GLU A O     1 
ATOM   1156  C  CB    . GLU A 1  179  ? 41.494  23.795  -27.927  1.00 75.45  ?  158  GLU A CB    1 
ATOM   1157  C  CG    . GLU A 1  179  ? 41.566  24.546  -26.604  1.00 78.20  ?  158  GLU A CG    1 
ATOM   1158  C  CD    . GLU A 1  179  ? 40.663  23.947  -25.540  1.00 83.30  ?  158  GLU A CD    1 
ATOM   1159  O  OE1   . GLU A 1  179  ? 39.555  23.482  -25.884  1.00 81.97  ?  158  GLU A OE1   1 
ATOM   1160  O  OE2   . GLU A 1  179  ? 41.064  23.937  -24.357  1.00 88.14  ?  158  GLU A OE2   1 
ATOM   1161  N  N     . ILE A 1  180  ? 40.627  21.724  -29.829  1.00 62.90  ?  159  ILE A N     1 
ATOM   1162  C  CA    . ILE A 1  180  ? 40.319  20.838  -30.948  1.00 61.05  ?  159  ILE A CA    1 
ATOM   1163  C  C     . ILE A 1  180  ? 41.157  21.178  -32.177  1.00 60.63  ?  159  ILE A C     1 
ATOM   1164  O  O     . ILE A 1  180  ? 41.548  20.279  -32.935  1.00 61.85  ?  159  ILE A O     1 
ATOM   1165  C  CB    . ILE A 1  180  ? 38.806  20.880  -31.246  1.00 56.74  ?  159  ILE A CB    1 
ATOM   1166  C  CG1   . ILE A 1  180  ? 38.073  19.775  -30.478  1.00 56.00  ?  159  ILE A CG1   1 
ATOM   1167  C  CG2   . ILE A 1  180  ? 38.527  20.753  -32.736  1.00 50.02  ?  159  ILE A CG2   1 
ATOM   1168  C  CD1   . ILE A 1  180  ? 38.145  19.897  -28.967  1.00 59.87  ?  159  ILE A CD1   1 
ATOM   1169  N  N     . GLY A 1  181  ? 41.470  22.456  -32.390  1.00 57.09  ?  160  GLY A N     1 
ATOM   1170  C  CA    . GLY A 1  181  ? 42.215  22.841  -33.579  1.00 59.54  ?  160  GLY A CA    1 
ATOM   1171  C  C     . GLY A 1  181  ? 43.625  22.288  -33.649  1.00 57.04  ?  160  GLY A C     1 
ATOM   1172  O  O     . GLY A 1  181  ? 44.208  22.248  -34.738  1.00 48.57  ?  160  GLY A O     1 
ATOM   1173  N  N     . ARG A 1  182  ? 44.181  21.859  -32.519  1.00 56.53  ?  161  ARG A N     1 
ATOM   1174  C  CA    . ARG A 1  182  ? 45.557  21.385  -32.471  1.00 49.64  ?  161  ARG A CA    1 
ATOM   1175  C  C     . ARG A 1  182  ? 45.668  19.975  -33.036  1.00 46.06  ?  161  ARG A C     1 
ATOM   1176  O  O     . ARG A 1  182  ? 44.841  19.108  -32.748  1.00 48.17  ?  161  ARG A O     1 
ATOM   1177  C  CB    . ARG A 1  182  ? 46.071  21.427  -31.031  1.00 52.89  ?  161  ARG A CB    1 
ATOM   1178  C  CG    . ARG A 1  182  ? 47.409  20.755  -30.810  1.00 50.74  ?  161  ARG A CG    1 
ATOM   1179  C  CD    . ARG A 1  182  ? 48.295  21.564  -29.875  1.00 56.91  ?  161  ARG A CD    1 
ATOM   1180  N  NE    . ARG A 1  182  ? 48.802  22.774  -30.519  1.00 59.21  ?  161  ARG A NE    1 
ATOM   1181  C  CZ    . ARG A 1  182  ? 48.387  24.005  -30.241  1.00 61.55  ?  161  ARG A CZ    1 
ATOM   1182  N  NH1   . ARG A 1  182  ? 47.460  24.204  -29.315  1.00 70.29  ?  161  ARG A NH1   1 
ATOM   1183  N  NH2   . ARG A 1  182  ? 48.905  25.039  -30.887  1.00 58.55  ?  161  ARG A NH2   1 
ATOM   1184  N  N     . ILE A 1  183  ? 46.708  19.750  -33.836  1.00 42.50  ?  162  ILE A N     1 
ATOM   1185  C  CA    . ILE A 1  183  ? 46.934  18.481  -34.527  1.00 38.68  ?  162  ILE A CA    1 
ATOM   1186  C  C     . ILE A 1  183  ? 48.294  17.927  -34.119  1.00 37.72  ?  162  ILE A C     1 
ATOM   1187  O  O     . ILE A 1  183  ? 49.313  18.282  -34.726  1.00 39.59  ?  162  ILE A O     1 
ATOM   1188  C  CB    . ILE A 1  183  ? 46.848  18.651  -36.052  1.00 36.37  ?  162  ILE A CB    1 
ATOM   1189  C  CG1   . ILE A 1  183  ? 45.461  19.136  -36.467  1.00 41.90  ?  162  ILE A CG1   1 
ATOM   1190  C  CG2   . ILE A 1  183  ? 47.176  17.348  -36.762  1.00 34.08  ?  162  ILE A CG2   1 
ATOM   1191  C  CD1   . ILE A 1  183  ? 45.284  19.234  -37.965  1.00 41.42  ?  162  ILE A CD1   1 
ATOM   1192  N  N     . PRO A 1  184  ? 48.363  17.079  -33.095  1.00 38.75  ?  163  PRO A N     1 
ATOM   1193  C  CA    . PRO A 1  184  ? 49.660  16.539  -32.668  1.00 38.83  ?  163  PRO A CA    1 
ATOM   1194  C  C     . PRO A 1  184  ? 50.328  15.734  -33.772  1.00 40.36  ?  163  PRO A C     1 
ATOM   1195  O  O     . PRO A 1  184  ? 49.672  15.176  -34.653  1.00 47.18  ?  163  PRO A O     1 
ATOM   1196  C  CB    . PRO A 1  184  ? 49.299  15.653  -31.472  1.00 44.44  ?  163  PRO A CB    1 
ATOM   1197  C  CG    . PRO A 1  184  ? 47.978  16.171  -30.998  1.00 48.68  ?  163  PRO A CG    1 
ATOM   1198  C  CD    . PRO A 1  184  ? 47.263  16.629  -32.228  1.00 43.24  ?  163  PRO A CD    1 
ATOM   1199  N  N     . VAL A 1  185  ? 51.655  15.680  -33.717  1.00 39.00  ?  164  VAL A N     1 
ATOM   1200  C  CA    . VAL A 1  185  ? 52.458  15.045  -34.752  1.00 40.67  ?  164  VAL A CA    1 
ATOM   1201  C  C     . VAL A 1  185  ? 53.475  14.126  -34.088  1.00 41.39  ?  164  VAL A C     1 
ATOM   1202  O  O     . VAL A 1  185  ? 53.907  14.364  -32.956  1.00 43.18  ?  164  VAL A O     1 
ATOM   1203  C  CB    . VAL A 1  185  ? 53.148  16.103  -35.650  1.00 38.90  ?  164  VAL A CB    1 
ATOM   1204  C  CG1   . VAL A 1  185  ? 54.109  15.462  -36.640  1.00 50.32  ?  164  VAL A CG1   1 
ATOM   1205  C  CG2   . VAL A 1  185  ? 52.110  16.912  -36.398  1.00 37.66  ?  164  VAL A CG2   1 
ATOM   1206  N  N     . ASP A 1  186  ? 53.825  13.046  -34.785  1.00 42.49  ?  165  ASP A N     1 
ATOM   1207  C  CA    . ASP A 1  186  ? 54.908  12.183  -34.336  1.00 42.50  ?  165  ASP A CA    1 
ATOM   1208  C  C     . ASP A 1  186  ? 56.226  12.939  -34.388  1.00 39.88  ?  165  ASP A C     1 
ATOM   1209  O  O     . ASP A 1  186  ? 56.574  13.530  -35.414  1.00 41.26  ?  165  ASP A O     1 
ATOM   1210  C  CB    . ASP A 1  186  ? 54.990  10.930  -35.203  1.00 43.53  ?  165  ASP A CB    1 
ATOM   1211  C  CG    . ASP A 1  186  ? 53.753  10.080  -35.108  1.00 43.59  ?  165  ASP A CG    1 
ATOM   1212  O  OD1   . ASP A 1  186  ? 53.231  9.915   -33.986  1.00 41.98  ?  165  ASP A OD1   1 
ATOM   1213  O  OD2   . ASP A 1  186  ? 53.301  9.582   -36.157  1.00 45.96  ?  165  ASP A OD2   1 
ATOM   1214  N  N     . SER A 1  187  ? 56.961  12.912  -33.285  1.00 39.47  ?  166  SER A N     1 
ATOM   1215  C  CA    . SER A 1  187  ? 58.194  13.672  -33.140  1.00 36.91  ?  166  SER A CA    1 
ATOM   1216  C  C     . SER A 1  187  ? 59.376  12.719  -33.261  1.00 36.92  ?  166  SER A C     1 
ATOM   1217  O  O     . SER A 1  187  ? 59.568  11.849  -32.408  1.00 38.20  ?  166  SER A O     1 
ATOM   1218  C  CB    . SER A 1  187  ? 58.213  14.401  -31.800  1.00 39.69  ?  166  SER A CB    1 
ATOM   1219  O  OG    . SER A 1  187  ? 56.899  14.548  -31.289  1.00 44.23  ?  166  SER A OG    1 
ATOM   1220  N  N     . ILE A 1  188  ? 60.165  12.881  -34.317  1.00 36.68  ?  167  ILE A N     1 
ATOM   1221  C  CA    . ILE A 1  188  ? 61.428  12.171  -34.459  1.00 35.84  ?  167  ILE A CA    1 
ATOM   1222  C  C     . ILE A 1  188  ? 62.521  13.170  -34.102  1.00 39.86  ?  167  ILE A C     1 
ATOM   1223  O  O     . ILE A 1  188  ? 62.867  14.046  -34.897  1.00 40.50  ?  167  ILE A O     1 
ATOM   1224  C  CB    . ILE A 1  188  ? 61.608  11.615  -35.872  1.00 37.64  ?  167  ILE A CB    1 
ATOM   1225  C  CG1   . ILE A 1  188  ? 60.497  10.616  -36.195  1.00 39.01  ?  167  ILE A CG1   1 
ATOM   1226  C  CG2   . ILE A 1  188  ? 62.977  10.975  -36.023  1.00 37.12  ?  167  ILE A CG2   1 
ATOM   1227  C  CD1   . ILE A 1  188  ? 60.506  10.149  -37.629  1.00 44.22  ?  167  ILE A CD1   1 
ATOM   1228  N  N     . TYR A 1  189  ? 63.089  13.018  -32.906  1.00 41.41  ?  168  TYR A N     1 
ATOM   1229  C  CA    . TYR A 1  189  ? 64.084  13.966  -32.422  1.00 40.35  ?  168  TYR A CA    1 
ATOM   1230  C  C     . TYR A 1  189  ? 65.482  13.671  -32.940  1.00 44.00  ?  168  TYR A C     1 
ATOM   1231  O  O     . TYR A 1  189  ? 66.259  14.606  -33.159  1.00 47.06  ?  168  TYR A O     1 
ATOM   1232  C  CB    . TYR A 1  189  ? 64.109  13.976  -30.896  1.00 41.78  ?  168  TYR A CB    1 
ATOM   1233  C  CG    . TYR A 1  189  ? 62.902  14.610  -30.254  1.00 42.53  ?  168  TYR A CG    1 
ATOM   1234  C  CD1   . TYR A 1  189  ? 62.791  15.986  -30.148  1.00 44.19  ?  168  TYR A CD1   1 
ATOM   1235  C  CD2   . TYR A 1  189  ? 61.882  13.834  -29.739  1.00 42.88  ?  168  TYR A CD2   1 
ATOM   1236  C  CE1   . TYR A 1  189  ? 61.692  16.570  -29.556  1.00 42.79  ?  168  TYR A CE1   1 
ATOM   1237  C  CE2   . TYR A 1  189  ? 60.784  14.412  -29.145  1.00 41.02  ?  168  TYR A CE2   1 
ATOM   1238  C  CZ    . TYR A 1  189  ? 60.692  15.778  -29.055  1.00 42.54  ?  168  TYR A CZ    1 
ATOM   1239  O  OH    . TYR A 1  189  ? 59.594  16.351  -28.461  1.00 44.67  ?  168  TYR A OH    1 
ATOM   1240  N  N     . SER A 1  190  ? 65.817  12.400  -33.135  1.00 44.84  ?  169  SER A N     1 
ATOM   1241  C  CA    . SER A 1  190  ? 67.204  11.985  -33.300  1.00 41.62  ?  169  SER A CA    1 
ATOM   1242  C  C     . SER A 1  190  ? 67.860  12.712  -34.467  1.00 39.77  ?  169  SER A C     1 
ATOM   1243  O  O     . SER A 1  190  ? 67.398  12.582  -35.609  1.00 41.75  ?  169  SER A O     1 
ATOM   1244  C  CB    . SER A 1  190  ? 67.286  10.477  -33.509  1.00 44.05  ?  169  SER A CB    1 
ATOM   1245  O  OG    . SER A 1  190  ? 68.625  10.025  -33.404  1.00 47.76  ?  169  SER A OG    1 
ATOM   1246  N  N     . PRO A 1  191  ? 68.906  13.503  -34.224  1.00 37.94  ?  170  PRO A N     1 
ATOM   1247  C  CA    . PRO A 1  191  ? 69.589  14.183  -35.331  1.00 40.30  ?  170  PRO A CA    1 
ATOM   1248  C  C     . PRO A 1  191  ? 70.452  13.271  -36.177  1.00 43.14  ?  170  PRO A C     1 
ATOM   1249  O  O     . PRO A 1  191  ? 70.782  13.647  -37.308  1.00 48.09  ?  170  PRO A O     1 
ATOM   1250  C  CB    . PRO A 1  191  ? 70.439  15.249  -34.624  1.00 42.80  ?  170  PRO A CB    1 
ATOM   1251  C  CG    . PRO A 1  191  ? 70.256  15.019  -33.138  1.00 43.11  ?  170  PRO A CG    1 
ATOM   1252  C  CD    . PRO A 1  191  ? 69.610  13.691  -32.951  1.00 41.27  ?  170  PRO A CD    1 
ATOM   1253  N  N     . VAL A 1  192  ? 70.850  12.105  -35.676  1.00 41.87  ?  171  VAL A N     1 
ATOM   1254  C  CA    . VAL A 1  192  ? 71.785  11.264  -36.413  1.00 43.08  ?  171  VAL A CA    1 
ATOM   1255  C  C     . VAL A 1  192  ? 71.045  10.529  -37.521  1.00 41.53  ?  171  VAL A C     1 
ATOM   1256  O  O     . VAL A 1  192  ? 69.841  10.272  -37.437  1.00 39.91  ?  171  VAL A O     1 
ATOM   1257  C  CB    . VAL A 1  192  ? 72.524  10.288  -35.473  1.00 42.92  ?  171  VAL A CB    1 
ATOM   1258  C  CG1   . VAL A 1  192  ? 72.957  11.002  -34.198  1.00 41.02  ?  171  VAL A CG1   1 
ATOM   1259  C  CG2   . VAL A 1  192  ? 71.673  9.071   -35.165  1.00 44.77  ?  171  VAL A CG2   1 
ATOM   1260  N  N     . LEU A 1  193  ? 71.777  10.198  -38.581  1.00 41.71  ?  172  LEU A N     1 
ATOM   1261  C  CA    . LEU A 1  193  ? 71.192  9.613   -39.780  1.00 38.18  ?  172  LEU A CA    1 
ATOM   1262  C  C     . LEU A 1  193  ? 71.613  8.156   -39.933  1.00 37.61  ?  172  LEU A C     1 
ATOM   1263  O  O     . LEU A 1  193  ? 70.793  7.259   -39.740  1.00 41.15  ?  172  LEU A O     1 
ATOM   1264  C  CB    . LEU A 1  193  ? 71.581  10.439  -41.007  1.00 39.28  ?  172  LEU A CB    1 
ATOM   1265  C  CG    . LEU A 1  193  ? 70.603  10.440  -42.176  1.00 41.17  ?  172  LEU A CG    1 
ATOM   1266  C  CD1   . LEU A 1  193  ? 69.255  10.967  -41.728  1.00 40.73  ?  172  LEU A CD1   1 
ATOM   1267  C  CD2   . LEU A 1  193  ? 71.154  11.271  -43.315  1.00 47.71  ?  172  LEU A CD2   1 
ATOM   1268  N  N     . LYS A 1  194  ? 72.873  7.889   -40.265  1.00 39.27  ?  173  LYS A N     1 
ATOM   1269  C  CA    . LYS A 1  194  ? 73.341  6.526   -40.488  1.00 38.24  ?  173  LYS A CA    1 
ATOM   1270  C  C     . LYS A 1  194  ? 74.671  6.320   -39.782  1.00 38.28  ?  173  LYS A C     1 
ATOM   1271  O  O     . LYS A 1  194  ? 75.573  7.154   -39.896  1.00 45.54  ?  173  LYS A O     1 
ATOM   1272  C  CB    . LYS A 1  194  ? 73.478  6.225   -41.984  1.00 39.08  ?  173  LYS A CB    1 
ATOM   1273  C  CG    . LYS A 1  194  ? 73.931  4.813   -42.290  1.00 38.09  ?  173  LYS A CG    1 
ATOM   1274  C  CD    . LYS A 1  194  ? 73.824  4.496   -43.771  1.00 37.61  ?  173  LYS A CD    1 
ATOM   1275  C  CE    . LYS A 1  194  ? 72.381  4.317   -44.197  1.00 42.93  ?  173  LYS A CE    1 
ATOM   1276  N  NZ    . LYS A 1  194  ? 72.275  3.861   -45.609  1.00 48.20  ?  173  LYS A NZ    1 
ATOM   1277  N  N     . VAL A 1  195  ? 74.791  5.209   -39.059  1.00 36.55  ?  174  VAL A N     1 
ATOM   1278  C  CA    . VAL A 1  195  ? 75.967  4.907   -38.253  1.00 34.07  ?  174  VAL A CA    1 
ATOM   1279  C  C     . VAL A 1  195  ? 76.419  3.486   -38.550  1.00 35.35  ?  174  VAL A C     1 
ATOM   1280  O  O     . VAL A 1  195  ? 75.595  2.570   -38.644  1.00 35.31  ?  174  VAL A O     1 
ATOM   1281  C  CB    . VAL A 1  195  ? 75.681  5.079   -36.747  1.00 33.46  ?  174  VAL A CB    1 
ATOM   1282  C  CG1   . VAL A 1  195  ? 76.869  4.622   -35.920  1.00 31.55  ?  174  VAL A CG1   1 
ATOM   1283  C  CG2   . VAL A 1  195  ? 75.335  6.523   -36.433  1.00 35.64  ?  174  VAL A CG2   1 
ATOM   1284  N  N     . THR A 1  196  ? 77.728  3.302   -38.699  1.00 36.46  ?  175  THR A N     1 
ATOM   1285  C  CA    . THR A 1  196  ? 78.294  1.971   -38.875  1.00 33.96  ?  175  THR A CA    1 
ATOM   1286  C  C     . THR A 1  196  ? 79.697  1.966   -38.289  1.00 35.10  ?  175  THR A C     1 
ATOM   1287  O  O     . THR A 1  196  ? 80.156  2.958   -37.722  1.00 38.74  ?  175  THR A O     1 
ATOM   1288  C  CB    . THR A 1  196  ? 78.311  1.556   -40.347  1.00 34.11  ?  175  THR A CB    1 
ATOM   1289  O  OG1   . THR A 1  196  ? 78.802  0.216   -40.460  1.00 34.61  ?  175  THR A OG1   1 
ATOM   1290  C  CG2   . THR A 1  196  ? 79.201  2.479   -41.150  1.00 35.72  ?  175  THR A CG2   1 
ATOM   1291  N  N     . TYR A 1  197  ? 80.373  0.828   -38.412  1.00 33.96  ?  176  TYR A N     1 
ATOM   1292  C  CA    . TYR A 1  197  ? 81.751  0.732   -37.958  1.00 36.24  ?  176  TYR A CA    1 
ATOM   1293  C  C     . TYR A 1  197  ? 82.431  -0.428  -38.663  1.00 37.28  ?  176  TYR A C     1 
ATOM   1294  O  O     . TYR A 1  197  ? 81.781  -1.276  -39.277  1.00 41.66  ?  176  TYR A O     1 
ATOM   1295  C  CB    . TYR A 1  197  ? 81.838  0.561   -36.439  1.00 35.64  ?  176  TYR A CB    1 
ATOM   1296  C  CG    . TYR A 1  197  ? 80.990  -0.559  -35.902  1.00 34.98  ?  176  TYR A CG    1 
ATOM   1297  C  CD1   . TYR A 1  197  ? 81.374  -1.883  -36.054  1.00 36.09  ?  176  TYR A CD1   1 
ATOM   1298  C  CD2   . TYR A 1  197  ? 79.807  -0.296  -35.230  1.00 36.89  ?  176  TYR A CD2   1 
ATOM   1299  C  CE1   . TYR A 1  197  ? 80.598  -2.912  -35.565  1.00 38.32  ?  176  TYR A CE1   1 
ATOM   1300  C  CE2   . TYR A 1  197  ? 79.027  -1.320  -34.736  1.00 36.52  ?  176  TYR A CE2   1 
ATOM   1301  C  CZ    . TYR A 1  197  ? 79.429  -2.623  -34.907  1.00 37.29  ?  176  TYR A CZ    1 
ATOM   1302  O  OH    . TYR A 1  197  ? 78.661  -3.642  -34.417  1.00 37.84  ?  176  TYR A OH    1 
ATOM   1303  N  N     . LYS A 1  198  ? 83.757  -0.436  -38.580  1.00 42.42  ?  177  LYS A N     1 
ATOM   1304  C  CA    . LYS A 1  198  ? 84.534  -1.614  -38.929  1.00 47.21  ?  177  LYS A CA    1 
ATOM   1305  C  C     . LYS A 1  198  ? 85.782  -1.623  -38.064  1.00 44.63  ?  177  LYS A C     1 
ATOM   1306  O  O     . LYS A 1  198  ? 86.150  -0.609  -37.471  1.00 43.69  ?  177  LYS A O     1 
ATOM   1307  C  CB    . LYS A 1  198  ? 84.891  -1.648  -40.418  1.00 48.03  ?  177  LYS A CB    1 
ATOM   1308  C  CG    . LYS A 1  198  ? 85.777  -0.519  -40.884  1.00 50.25  ?  177  LYS A CG    1 
ATOM   1309  C  CD    . LYS A 1  198  ? 86.188  -0.722  -42.336  1.00 62.44  ?  177  LYS A CD    1 
ATOM   1310  C  CE    . LYS A 1  198  ? 85.013  -0.535  -43.284  1.00 68.94  ?  177  LYS A CE    1 
ATOM   1311  N  NZ    . LYS A 1  198  ? 84.626  0.900   -43.403  1.00 79.65  ?  177  LYS A NZ    1 
ATOM   1312  N  N     . VAL A 1  199  ? 86.416  -2.786  -37.968  1.00 47.74  ?  178  VAL A N     1 
ATOM   1313  C  CA    . VAL A 1  199  ? 87.656  -2.904  -37.213  1.00 50.62  ?  178  VAL A CA    1 
ATOM   1314  C  C     . VAL A 1  199  ? 88.742  -3.454  -38.124  1.00 52.43  ?  178  VAL A C     1 
ATOM   1315  O  O     . VAL A 1  199  ? 88.486  -4.252  -39.031  1.00 52.25  ?  178  VAL A O     1 
ATOM   1316  C  CB    . VAL A 1  199  ? 87.510  -3.781  -35.950  1.00 46.38  ?  178  VAL A CB    1 
ATOM   1317  C  CG1   . VAL A 1  199  ? 86.313  -3.337  -35.125  1.00 45.66  ?  178  VAL A CG1   1 
ATOM   1318  C  CG2   . VAL A 1  199  ? 87.417  -5.251  -36.313  1.00 51.74  ?  178  VAL A CG2   1 
ATOM   1319  N  N     . ASP A 1  200  ? 89.962  -2.984  -37.891  1.00 54.57  ?  179  ASP A N     1 
ATOM   1320  C  CA    . ASP A 1  200  ? 91.166  -3.534  -38.498  1.00 54.92  ?  179  ASP A CA    1 
ATOM   1321  C  C     . ASP A 1  200  ? 91.910  -4.279  -37.399  1.00 59.07  ?  179  ASP A C     1 
ATOM   1322  O  O     . ASP A 1  200  ? 92.406  -3.662  -36.451  1.00 61.92  ?  179  ASP A O     1 
ATOM   1323  C  CB    . ASP A 1  200  ? 92.024  -2.435  -39.118  1.00 53.30  ?  179  ASP A CB    1 
ATOM   1324  C  CG    . ASP A 1  200  ? 91.372  -1.806  -40.332  1.00 59.91  ?  179  ASP A CG    1 
ATOM   1325  O  OD1   . ASP A 1  200  ? 90.543  -2.482  -40.976  1.00 65.44  ?  179  ASP A OD1   1 
ATOM   1326  O  OD2   . ASP A 1  200  ? 91.685  -0.639  -40.648  1.00 56.44  ?  179  ASP A OD2   1 
ATOM   1327  N  N     . ALA A 1  201  ? 91.965  -5.602  -37.515  1.00 60.93  ?  180  ALA A N     1 
ATOM   1328  C  CA    . ALA A 1  201  ? 92.550  -6.458  -36.492  1.00 64.99  ?  180  ALA A CA    1 
ATOM   1329  C  C     . ALA A 1  201  ? 93.964  -6.845  -36.905  1.00 68.60  ?  180  ALA A C     1 
ATOM   1330  O  O     . ALA A 1  201  ? 94.161  -7.448  -37.965  1.00 70.82  ?  180  ALA A O     1 
ATOM   1331  C  CB    . ALA A 1  201  ? 91.694  -7.704  -36.273  1.00 69.73  ?  180  ALA A CB    1 
ATOM   1332  N  N     . THR A 1  202  ? 94.937  -6.501  -36.069  1.00 68.46  ?  181  THR A N     1 
ATOM   1333  C  CA    . THR A 1  202  ? 96.329  -6.853  -36.321  1.00 72.31  ?  181  THR A CA    1 
ATOM   1334  C  C     . THR A 1  202  ? 96.797  -7.941  -35.358  1.00 69.16  ?  181  THR A C     1 
ATOM   1335  O  O     . THR A 1  202  ? 96.663  -7.809  -34.140  1.00 69.51  ?  181  THR A O     1 
ATOM   1336  C  CB    . THR A 1  202  ? 97.253  -5.630  -36.192  1.00 66.84  ?  181  THR A CB    1 
ATOM   1337  N  N     . ARG A 1  207  ? 101.659 -3.112  -32.584  1.00 79.16  ?  186  ARG A N     1 
ATOM   1338  C  CA    . ARG A 1  207  ? 102.107 -3.741  -31.348  1.00 87.67  ?  186  ARG A CA    1 
ATOM   1339  C  C     . ARG A 1  207  ? 102.282 -5.245  -31.542  1.00 92.28  ?  186  ARG A C     1 
ATOM   1340  O  O     . ARG A 1  207  ? 103.089 -5.685  -32.360  1.00 91.10  ?  186  ARG A O     1 
ATOM   1341  C  CB    . ARG A 1  207  ? 101.118 -3.460  -30.215  1.00 80.04  ?  186  ARG A CB    1 
ATOM   1342  N  N     . THR A 1  208  ? 101.526 -6.031  -30.778  1.00 88.80  ?  187  THR A N     1 
ATOM   1343  C  CA    . THR A 1  208  ? 101.486 -7.479  -30.949  1.00 85.72  ?  187  THR A CA    1 
ATOM   1344  C  C     . THR A 1  208  ? 100.167 -7.889  -31.592  1.00 86.06  ?  187  THR A C     1 
ATOM   1345  O  O     . THR A 1  208  ? 100.140 -8.231  -32.777  1.00 84.78  ?  187  THR A O     1 
ATOM   1346  C  CB    . THR A 1  208  ? 101.701 -8.189  -29.609  1.00 84.99  ?  187  THR A CB    1 
ATOM   1347  O  OG1   . THR A 1  208  ? 100.776 -7.681  -28.640  1.00 81.40  ?  187  THR A OG1   1 
ATOM   1348  C  CG2   . THR A 1  208  ? 103.122 -7.963  -29.111  1.00 82.35  ?  187  THR A CG2   1 
ATOM   1349  N  N     . ASP A 1  209  ? 99.064  -7.848  -30.847  1.00 84.04  ?  188  ASP A N     1 
ATOM   1350  C  CA    . ASP A 1  209  ? 97.723  -8.062  -31.383  1.00 77.77  ?  188  ASP A CA    1 
ATOM   1351  C  C     . ASP A 1  209  ? 96.827  -6.954  -30.851  1.00 69.80  ?  188  ASP A C     1 
ATOM   1352  O  O     . ASP A 1  209  ? 96.732  -6.765  -29.635  1.00 69.51  ?  188  ASP A O     1 
ATOM   1353  C  CB    . ASP A 1  209  ? 97.170  -9.435  -30.985  1.00 74.08  ?  188  ASP A CB    1 
ATOM   1354  C  CG    . ASP A 1  209  ? 97.582  -10.539 -31.943  1.00 75.60  ?  188  ASP A CG    1 
ATOM   1355  O  OD1   . ASP A 1  209  ? 98.681  -10.459 -32.525  1.00 80.08  ?  188  ASP A OD1   1 
ATOM   1356  O  OD2   . ASP A 1  209  ? 96.801  -11.496 -32.114  1.00 70.74  ?  188  ASP A OD2   1 
ATOM   1357  N  N     . PHE A 1  210  ? 96.180  -6.218  -31.752  1.00 64.86  ?  189  PHE A N     1 
ATOM   1358  C  CA    . PHE A 1  210  ? 95.329  -5.116  -31.325  1.00 62.48  ?  189  PHE A CA    1 
ATOM   1359  C  C     . PHE A 1  210  ? 94.239  -4.878  -32.359  1.00 63.35  ?  189  PHE A C     1 
ATOM   1360  O  O     . PHE A 1  210  ? 94.337  -5.314  -33.508  1.00 63.79  ?  189  PHE A O     1 
ATOM   1361  C  CB    . PHE A 1  210  ? 96.137  -3.833  -31.091  1.00 61.46  ?  189  PHE A CB    1 
ATOM   1362  C  CG    . PHE A 1  210  ? 96.656  -3.197  -32.352  1.00 66.33  ?  189  PHE A CG    1 
ATOM   1363  C  CD1   . PHE A 1  210  ? 97.845  -3.621  -32.921  1.00 70.98  ?  189  PHE A CD1   1 
ATOM   1364  C  CD2   . PHE A 1  210  ? 95.962  -2.162  -32.959  1.00 63.48  ?  189  PHE A CD2   1 
ATOM   1365  C  CE1   . PHE A 1  210  ? 98.326  -3.032  -34.075  1.00 69.26  ?  189  PHE A CE1   1 
ATOM   1366  C  CE2   . PHE A 1  210  ? 96.436  -1.573  -34.113  1.00 63.64  ?  189  PHE A CE2   1 
ATOM   1367  C  CZ    . PHE A 1  210  ? 97.620  -2.008  -34.672  1.00 70.52  ?  189  PHE A CZ    1 
ATOM   1368  N  N     . ASP A 1  211  ? 93.195  -4.171  -31.932  1.00 59.14  ?  190  ASP A N     1 
ATOM   1369  C  CA    . ASP A 1  211  ? 92.051  -3.854  -32.776  1.00 54.70  ?  190  ASP A CA    1 
ATOM   1370  C  C     . ASP A 1  211  ? 91.953  -2.349  -32.966  1.00 50.77  ?  190  ASP A C     1 
ATOM   1371  O  O     . ASP A 1  211  ? 92.035  -1.590  -31.997  1.00 50.52  ?  190  ASP A O     1 
ATOM   1372  C  CB    . ASP A 1  211  ? 90.751  -4.389  -32.171  1.00 54.73  ?  190  ASP A CB    1 
ATOM   1373  C  CG    . ASP A 1  211  ? 90.539  -5.856  -32.457  1.00 60.56  ?  190  ASP A CG    1 
ATOM   1374  O  OD1   . ASP A 1  211  ? 91.162  -6.370  -33.408  1.00 66.43  ?  190  ASP A OD1   1 
ATOM   1375  O  OD2   . ASP A 1  211  ? 89.745  -6.495  -31.741  1.00 58.41  ?  190  ASP A OD2   1 
ATOM   1376  N  N     . LYS A 1  212  ? 91.769  -1.928  -34.213  1.00 49.57  ?  191  LYS A N     1 
ATOM   1377  C  CA    . LYS A 1  212  ? 91.590  -0.526  -34.566  1.00 51.73  ?  191  LYS A CA    1 
ATOM   1378  C  C     . LYS A 1  212  ? 90.133  -0.301  -34.945  1.00 49.69  ?  191  LYS A C     1 
ATOM   1379  O  O     . LYS A 1  212  ? 89.630  -0.937  -35.876  1.00 49.41  ?  191  LYS A O     1 
ATOM   1380  C  CB    . LYS A 1  212  ? 92.512  -0.131  -35.718  1.00 52.16  ?  191  LYS A CB    1 
ATOM   1381  C  CG    . LYS A 1  212  ? 92.337  1.299   -36.186  1.00 52.80  ?  191  LYS A CG    1 
ATOM   1382  C  CD    . LYS A 1  212  ? 93.475  1.724   -37.095  1.00 57.13  ?  191  LYS A CD    1 
ATOM   1383  C  CE    . LYS A 1  212  ? 93.347  1.131   -38.483  1.00 59.61  ?  191  LYS A CE    1 
ATOM   1384  N  NZ    . LYS A 1  212  ? 92.620  2.045   -39.402  1.00 56.29  ?  191  LYS A NZ    1 
ATOM   1385  N  N     . LEU A 1  213  ? 89.463  0.600   -34.234  1.00 47.89  ?  192  LEU A N     1 
ATOM   1386  C  CA    . LEU A 1  213  ? 88.046  0.858   -34.457  1.00 45.39  ?  192  LEU A CA    1 
ATOM   1387  C  C     . LEU A 1  213  ? 87.867  2.074   -35.356  1.00 47.32  ?  192  LEU A C     1 
ATOM   1388  O  O     . LEU A 1  213  ? 88.408  3.145   -35.073  1.00 49.09  ?  192  LEU A O     1 
ATOM   1389  C  CB    . LEU A 1  213  ? 87.322  1.071   -33.128  1.00 45.15  ?  192  LEU A CB    1 
ATOM   1390  C  CG    . LEU A 1  213  ? 85.834  1.414   -33.198  1.00 41.41  ?  192  LEU A CG    1 
ATOM   1391  C  CD1   . LEU A 1  213  ? 85.058  0.343   -33.945  1.00 39.60  ?  192  LEU A CD1   1 
ATOM   1392  C  CD2   . LEU A 1  213  ? 85.278  1.602   -31.801  1.00 40.16  ?  192  LEU A CD2   1 
ATOM   1393  N  N     . ILE A 1  214  ? 87.116  1.904   -36.441  1.00 45.45  ?  193  ILE A N     1 
ATOM   1394  C  CA    . ILE A 1  214  ? 86.732  3.001   -37.324  1.00 41.81  ?  193  ILE A CA    1 
ATOM   1395  C  C     . ILE A 1  214  ? 85.219  3.145   -37.241  1.00 39.06  ?  193  ILE A C     1 
ATOM   1396  O  O     . ILE A 1  214  ? 84.477  2.285   -37.735  1.00 40.41  ?  193  ILE A O     1 
ATOM   1397  C  CB    . ILE A 1  214  ? 87.184  2.777   -38.773  1.00 40.90  ?  193  ILE A CB    1 
ATOM   1398  C  CG1   . ILE A 1  214  ? 88.706  2.652   -38.852  1.00 45.04  ?  193  ILE A CG1   1 
ATOM   1399  C  CG2   . ILE A 1  214  ? 86.708  3.914   -39.657  1.00 39.74  ?  193  ILE A CG2   1 
ATOM   1400  C  CD1   . ILE A 1  214  ? 89.212  1.228   -38.833  1.00 49.64  ?  193  ILE A CD1   1 
ATOM   1401  N  N     . LEU A 1  215  ? 84.765  4.236   -36.632  1.00 38.50  ?  194  LEU A N     1 
ATOM   1402  C  CA    . LEU A 1  215  ? 83.351  4.508   -36.409  1.00 38.10  ?  194  LEU A CA    1 
ATOM   1403  C  C     . LEU A 1  215  ? 82.883  5.568   -37.396  1.00 40.98  ?  194  LEU A C     1 
ATOM   1404  O  O     . LEU A 1  215  ? 83.438  6.666   -37.437  1.00 45.93  ?  194  LEU A O     1 
ATOM   1405  C  CB    . LEU A 1  215  ? 83.120  4.972   -34.973  1.00 36.34  ?  194  LEU A CB    1 
ATOM   1406  C  CG    . LEU A 1  215  ? 81.678  5.259   -34.569  1.00 37.00  ?  194  LEU A CG    1 
ATOM   1407  C  CD1   . LEU A 1  215  ? 80.838  4.005   -34.698  1.00 37.78  ?  194  LEU A CD1   1 
ATOM   1408  C  CD2   . LEU A 1  215  ? 81.626  5.797   -33.152  1.00 39.21  ?  194  LEU A CD2   1 
ATOM   1409  N  N     . ASP A 1  216  ? 81.859  5.246   -38.176  1.00 40.27  ?  195  ASP A N     1 
ATOM   1410  C  CA    . ASP A 1  216  ? 81.362  6.111   -39.239  1.00 35.43  ?  195  ASP A CA    1 
ATOM   1411  C  C     . ASP A 1  216  ? 80.020  6.694   -38.814  1.00 37.47  ?  195  ASP A C     1 
ATOM   1412  O  O     . ASP A 1  216  ? 79.051  5.950   -38.621  1.00 41.71  ?  195  ASP A O     1 
ATOM   1413  C  CB    . ASP A 1  216  ? 81.239  5.323   -40.543  1.00 37.81  ?  195  ASP A CB    1 
ATOM   1414  C  CG    . ASP A 1  216  ? 80.907  6.194   -41.737  1.00 42.33  ?  195  ASP A CG    1 
ATOM   1415  O  OD1   . ASP A 1  216  ? 80.007  7.051   -41.637  1.00 43.22  ?  195  ASP A OD1   1 
ATOM   1416  O  OD2   . ASP A 1  216  ? 81.543  6.008   -42.794  1.00 45.74  ?  195  ASP A OD2   1 
ATOM   1417  N  N     . VAL A 1  217  ? 79.964  8.019   -38.683  1.00 39.11  ?  196  VAL A N     1 
ATOM   1418  C  CA    . VAL A 1  217  ? 78.781  8.721   -38.200  1.00 38.38  ?  196  VAL A CA    1 
ATOM   1419  C  C     . VAL A 1  217  ? 78.313  9.700   -39.267  1.00 42.28  ?  196  VAL A C     1 
ATOM   1420  O  O     . VAL A 1  217  ? 79.107  10.500  -39.776  1.00 43.50  ?  196  VAL A O     1 
ATOM   1421  C  CB    . VAL A 1  217  ? 79.058  9.460   -36.878  1.00 38.55  ?  196  VAL A CB    1 
ATOM   1422  C  CG1   . VAL A 1  217  ? 77.797  10.140  -36.374  1.00 35.64  ?  196  VAL A CG1   1 
ATOM   1423  C  CG2   . VAL A 1  217  ? 79.604  8.502   -35.838  1.00 39.79  ?  196  VAL A CG2   1 
ATOM   1424  N  N     . GLU A 1  218  ? 77.026  9.631   -39.603  1.00 40.42  ?  197  GLU A N     1 
ATOM   1425  C  CA    . GLU A 1  218  ? 76.381  10.593  -40.489  1.00 40.54  ?  197  GLU A CA    1 
ATOM   1426  C  C     . GLU A 1  218  ? 75.145  11.132  -39.790  1.00 43.53  ?  197  GLU A C     1 
ATOM   1427  O  O     . GLU A 1  218  ? 74.240  10.364  -39.445  1.00 45.06  ?  197  GLU A O     1 
ATOM   1428  C  CB    . GLU A 1  218  ? 75.997  9.970   -41.830  1.00 40.90  ?  197  GLU A CB    1 
ATOM   1429  C  CG    . GLU A 1  218  ? 75.328  10.961  -42.764  1.00 44.09  ?  197  GLU A CG    1 
ATOM   1430  C  CD    . GLU A 1  218  ? 74.888  10.342  -44.071  1.00 46.32  ?  197  GLU A CD    1 
ATOM   1431  O  OE1   . GLU A 1  218  ? 74.531  9.148   -44.076  1.00 42.77  ?  197  GLU A OE1   1 
ATOM   1432  O  OE2   . GLU A 1  218  ? 74.896  11.053  -45.096  1.00 50.99  ?  197  GLU A OE2   1 
ATOM   1433  N  N     . THR A 1  219  ? 75.115  12.439  -39.578  1.00 44.58  ?  198  THR A N     1 
ATOM   1434  C  CA    . THR A 1  219  ? 74.002  13.134  -38.952  1.00 44.30  ?  198  THR A CA    1 
ATOM   1435  C  C     . THR A 1  219  ? 73.211  13.892  -40.011  1.00 43.95  ?  198  THR A C     1 
ATOM   1436  O  O     . THR A 1  219  ? 73.534  13.873  -41.201  1.00 45.68  ?  198  THR A O     1 
ATOM   1437  C  CB    . THR A 1  219  ? 74.504  14.093  -37.869  1.00 43.00  ?  198  THR A CB    1 
ATOM   1438  O  OG1   . THR A 1  219  ? 75.323  15.103  -38.469  1.00 44.28  ?  198  THR A OG1   1 
ATOM   1439  C  CG2   . THR A 1  219  ? 75.316  13.349  -36.829  1.00 41.95  ?  198  THR A CG2   1 
ATOM   1440  N  N     . LYS A 1  220  ? 72.155  14.558  -39.561  1.00 43.71  ?  199  LYS A N     1 
ATOM   1441  C  CA    . LYS A 1  220  ? 71.490  15.556  -40.376  1.00 45.50  ?  199  LYS A CA    1 
ATOM   1442  C  C     . LYS A 1  220  ? 72.212  16.886  -40.189  1.00 48.63  ?  199  LYS A C     1 
ATOM   1443  O  O     . LYS A 1  220  ? 73.135  17.008  -39.380  1.00 53.49  ?  199  LYS A O     1 
ATOM   1444  C  CB    . LYS A 1  220  ? 70.015  15.648  -39.998  1.00 43.69  ?  199  LYS A CB    1 
ATOM   1445  C  CG    . LYS A 1  220  ? 69.292  14.314  -40.043  1.00 43.48  ?  199  LYS A CG    1 
ATOM   1446  C  CD    . LYS A 1  220  ? 68.021  14.337  -39.215  1.00 43.88  ?  199  LYS A CD    1 
ATOM   1447  C  CE    . LYS A 1  220  ? 67.383  12.961  -39.149  1.00 43.10  ?  199  LYS A CE    1 
ATOM   1448  N  NZ    . LYS A 1  220  ? 66.128  12.969  -38.356  1.00 48.61  ?  199  LYS A NZ    1 
ATOM   1449  N  N     . ASN A 1  221  ? 71.778  17.912  -40.915  1.00 46.79  ?  200  ASN A N     1 
ATOM   1450  C  CA    . ASN A 1  221  ? 72.430  19.206  -40.756  1.00 49.90  ?  200  ASN A CA    1 
ATOM   1451  C  C     . ASN A 1  221  ? 72.133  19.851  -39.411  1.00 46.99  ?  200  ASN A C     1 
ATOM   1452  O  O     . ASN A 1  221  ? 72.681  20.919  -39.129  1.00 47.24  ?  200  ASN A O     1 
ATOM   1453  C  CB    . ASN A 1  221  ? 72.029  20.150  -41.888  1.00 51.22  ?  200  ASN A CB    1 
ATOM   1454  C  CG    . ASN A 1  221  ? 72.785  19.873  -43.171  1.00 56.69  ?  200  ASN A CG    1 
ATOM   1455  O  OD1   . ASN A 1  221  ? 73.815  19.199  -43.163  1.00 59.16  ?  200  ASN A OD1   1 
ATOM   1456  N  ND2   . ASN A 1  221  ? 72.281  20.398  -44.280  1.00 55.38  ?  200  ASN A ND2   1 
ATOM   1457  N  N     . SER A 1  222  ? 71.276  19.237  -38.592  1.00 49.36  ?  201  SER A N     1 
ATOM   1458  C  CA    . SER A 1  222  ? 70.959  19.792  -37.281  1.00 47.81  ?  201  SER A CA    1 
ATOM   1459  C  C     . SER A 1  222  ? 72.213  19.974  -36.436  1.00 48.31  ?  201  SER A C     1 
ATOM   1460  O  O     . SER A 1  222  ? 72.466  21.063  -35.911  1.00 56.29  ?  201  SER A O     1 
ATOM   1461  C  CB    . SER A 1  222  ? 69.954  18.895  -36.562  1.00 49.60  ?  201  SER A CB    1 
ATOM   1462  O  OG    . SER A 1  222  ? 69.769  19.314  -35.223  1.00 53.41  ?  201  SER A OG    1 
ATOM   1463  N  N     . ILE A 1  223  ? 73.010  18.914  -36.279  1.00 46.52  ?  202  ILE A N     1 
ATOM   1464  C  CA    . ILE A 1  223  ? 74.246  18.975  -35.507  1.00 50.93  ?  202  ILE A CA    1 
ATOM   1465  C  C     . ILE A 1  223  ? 75.345  18.241  -36.266  1.00 45.52  ?  202  ILE A C     1 
ATOM   1466  O  O     . ILE A 1  223  ? 75.096  17.534  -37.243  1.00 45.41  ?  202  ILE A O     1 
ATOM   1467  C  CB    . ILE A 1  223  ? 74.096  18.393  -34.083  1.00 49.42  ?  202  ILE A CB    1 
ATOM   1468  C  CG1   . ILE A 1  223  ? 73.832  16.891  -34.129  1.00 44.36  ?  202  ILE A CG1   1 
ATOM   1469  C  CG2   . ILE A 1  223  ? 72.990  19.104  -33.312  1.00 52.85  ?  202  ILE A CG2   1 
ATOM   1470  C  CD1   . ILE A 1  223  ? 73.748  16.267  -32.758  1.00 43.37  ?  202  ILE A CD1   1 
ATOM   1471  N  N     . SER A 1  224  ? 76.556  18.429  -35.814  1.00 45.38  ?  203  SER A N     1 
ATOM   1472  C  CA    . SER A 1  224  ? 77.765  17.851  -36.374  1.00 45.72  ?  203  SER A CA    1 
ATOM   1473  C  C     . SER A 1  224  ? 78.015  16.465  -35.792  1.00 46.59  ?  203  SER A C     1 
ATOM   1474  O  O     . SER A 1  224  ? 77.667  16.199  -34.638  1.00 46.06  ?  203  SER A O     1 
ATOM   1475  C  CB    . SER A 1  224  ? 78.966  18.746  -36.084  1.00 45.79  ?  203  SER A CB    1 
ATOM   1476  O  OG    . SER A 1  224  ? 79.269  18.753  -34.700  1.00 46.73  ?  203  SER A OG    1 
ATOM   1477  N  N     . PRO A 1  225  ? 78.617  15.570  -36.583  1.00 45.15  ?  204  PRO A N     1 
ATOM   1478  C  CA    . PRO A 1  225  ? 78.944  14.230  -36.062  1.00 47.62  ?  204  PRO A CA    1 
ATOM   1479  C  C     . PRO A 1  225  ? 79.760  14.268  -34.783  1.00 48.93  ?  204  PRO A C     1 
ATOM   1480  O  O     . PRO A 1  225  ? 79.536  13.463  -33.868  1.00 51.30  ?  204  PRO A O     1 
ATOM   1481  C  CB    . PRO A 1  225  ? 79.730  13.598  -37.218  1.00 48.53  ?  204  PRO A CB    1 
ATOM   1482  C  CG    . PRO A 1  225  ? 79.267  14.327  -38.435  1.00 47.02  ?  204  PRO A CG    1 
ATOM   1483  C  CD    . PRO A 1  225  ? 78.989  15.727  -37.998  1.00 44.02  ?  204  PRO A CD    1 
ATOM   1484  N  N     . ARG A 1  226  ? 80.703  15.205  -34.707  1.00 46.77  ?  205  ARG A N     1 
ATOM   1485  C  CA    . ARG A 1  226  ? 81.533  15.381  -33.522  1.00 46.08  ?  205  ARG A CA    1 
ATOM   1486  C  C     . ARG A 1  226  ? 80.688  15.554  -32.265  1.00 45.97  ?  205  ARG A C     1 
ATOM   1487  O  O     . ARG A 1  226  ? 80.944  14.922  -31.233  1.00 45.14  ?  205  ARG A O     1 
ATOM   1488  C  CB    . ARG A 1  226  ? 82.437  16.591  -33.752  1.00 50.16  ?  205  ARG A CB    1 
ATOM   1489  C  CG    . ARG A 1  226  ? 83.492  16.872  -32.713  1.00 51.91  ?  205  ARG A CG    1 
ATOM   1490  C  CD    . ARG A 1  226  ? 84.421  17.960  -33.233  1.00 52.64  ?  205  ARG A CD    1 
ATOM   1491  N  NE    . ARG A 1  226  ? 83.727  18.866  -34.150  1.00 60.87  ?  205  ARG A NE    1 
ATOM   1492  C  CZ    . ARG A 1  226  ? 83.950  18.935  -35.461  1.00 61.37  ?  205  ARG A CZ    1 
ATOM   1493  N  NH1   . ARG A 1  226  ? 83.260  19.787  -36.206  1.00 63.90  ?  205  ARG A NH1   1 
ATOM   1494  N  NH2   . ARG A 1  226  ? 84.859  18.157  -36.027  1.00 52.06  ?  205  ARG A NH2   1 
ATOM   1495  N  N     . ASP A 1  227  ? 79.662  16.404  -32.340  1.00 48.19  ?  206  ASP A N     1 
ATOM   1496  C  CA    . ASP A 1  227  ? 78.846  16.691  -31.164  1.00 48.17  ?  206  ASP A CA    1 
ATOM   1497  C  C     . ASP A 1  227  ? 77.963  15.508  -30.794  1.00 48.56  ?  206  ASP A C     1 
ATOM   1498  O  O     . ASP A 1  227  ? 77.763  15.223  -29.606  1.00 49.19  ?  206  ASP A O     1 
ATOM   1499  C  CB    . ASP A 1  227  ? 77.996  17.935  -31.410  1.00 46.65  ?  206  ASP A CB    1 
ATOM   1500  C  CG    . ASP A 1  227  ? 78.822  19.198  -31.464  1.00 52.42  ?  206  ASP A CG    1 
ATOM   1501  O  OD1   . ASP A 1  227  ? 79.842  19.267  -30.748  1.00 53.60  ?  206  ASP A OD1   1 
ATOM   1502  O  OD2   . ASP A 1  227  ? 78.453  20.122  -32.217  1.00 55.99  ?  206  ASP A OD2   1 
ATOM   1503  N  N     . ALA A 1  228  ? 77.410  14.820  -31.794  1.00 48.37  ?  207  ALA A N     1 
ATOM   1504  C  CA    . ALA A 1  228  ? 76.613  13.629  -31.525  1.00 44.50  ?  207  ALA A CA    1 
ATOM   1505  C  C     . ALA A 1  228  ? 77.442  12.576  -30.803  1.00 46.55  ?  207  ALA A C     1 
ATOM   1506  O  O     . ALA A 1  228  ? 77.011  12.010  -29.790  1.00 46.73  ?  207  ALA A O     1 
ATOM   1507  C  CB    . ALA A 1  228  ? 76.051  13.074  -32.833  1.00 43.90  ?  207  ALA A CB    1 
ATOM   1508  N  N     . LEU A 1  229  ? 78.652  12.315  -31.304  1.00 47.52  ?  208  LEU A N     1 
ATOM   1509  C  CA    . LEU A 1  229  ? 79.541  11.389  -30.615  1.00 47.15  ?  208  LEU A CA    1 
ATOM   1510  C  C     . LEU A 1  229  ? 79.902  11.890  -29.224  1.00 48.04  ?  208  LEU A C     1 
ATOM   1511  O  O     . LEU A 1  229  ? 80.085  11.085  -28.305  1.00 51.74  ?  208  LEU A O     1 
ATOM   1512  C  CB    . LEU A 1  229  ? 80.801  11.154  -31.444  1.00 45.49  ?  208  LEU A CB    1 
ATOM   1513  C  CG    . LEU A 1  229  ? 81.795  10.141  -30.876  1.00 46.89  ?  208  LEU A CG    1 
ATOM   1514  C  CD1   . LEU A 1  229  ? 81.080  8.876   -30.440  1.00 43.88  ?  208  LEU A CD1   1 
ATOM   1515  C  CD2   . LEU A 1  229  ? 82.860  9.820   -31.906  1.00 48.12  ?  208  LEU A CD2   1 
ATOM   1516  N  N     . ALA A 1  230  ? 79.997  13.207  -29.041  1.00 47.99  ?  209  ALA A N     1 
ATOM   1517  C  CA    . ALA A 1  230  ? 80.325  13.738  -27.723  1.00 49.99  ?  209  ALA A CA    1 
ATOM   1518  C  C     . ALA A 1  230  ? 79.208  13.463  -26.721  1.00 52.27  ?  209  ALA A C     1 
ATOM   1519  O  O     . ALA A 1  230  ? 79.465  13.019  -25.595  1.00 54.87  ?  209  ALA A O     1 
ATOM   1520  C  CB    . ALA A 1  230  ? 80.615  15.234  -27.821  1.00 51.27  ?  209  ALA A CB    1 
ATOM   1521  N  N     . SER A 1  231  ? 77.956  13.713  -27.115  1.00 50.66  ?  210  SER A N     1 
ATOM   1522  C  CA    . SER A 1  231  ? 76.842  13.463  -26.206  1.00 51.88  ?  210  SER A CA    1 
ATOM   1523  C  C     . SER A 1  231  ? 76.659  11.973  -25.953  1.00 54.10  ?  210  SER A C     1 
ATOM   1524  O  O     . SER A 1  231  ? 76.315  11.564  -24.836  1.00 55.67  ?  210  SER A O     1 
ATOM   1525  C  CB    . SER A 1  231  ? 75.559  14.075  -26.759  1.00 52.06  ?  210  SER A CB    1 
ATOM   1526  O  OG    . SER A 1  231  ? 75.055  13.327  -27.844  1.00 49.15  ?  210  SER A OG    1 
ATOM   1527  N  N     . ALA A 1  232  ? 76.873  11.146  -26.981  1.00 52.48  ?  211  ALA A N     1 
ATOM   1528  C  CA    . ALA A 1  232  ? 76.935  9.707   -26.753  1.00 49.37  ?  211  ALA A CA    1 
ATOM   1529  C  C     . ALA A 1  232  ? 77.983  9.376   -25.701  1.00 51.94  ?  211  ALA A C     1 
ATOM   1530  O  O     . ALA A 1  232  ? 77.746  8.554   -24.807  1.00 53.89  ?  211  ALA A O     1 
ATOM   1531  C  CB    . ALA A 1  232  ? 77.240  8.979   -28.060  1.00 46.05  ?  211  ALA A CB    1 
ATOM   1532  N  N     . GLY A 1  233  ? 79.140  10.034  -25.779  1.00 52.85  ?  212  GLY A N     1 
ATOM   1533  C  CA    . GLY A 1  233  ? 80.185  9.803   -24.800  1.00 55.23  ?  212  GLY A CA    1 
ATOM   1534  C  C     . GLY A 1  233  ? 79.772  10.180  -23.392  1.00 54.32  ?  212  GLY A C     1 
ATOM   1535  O  O     . GLY A 1  233  ? 80.073  9.462   -22.440  1.00 54.72  ?  212  GLY A O     1 
ATOM   1536  N  N     . LYS A 1  234  ? 79.088  11.315  -23.235  1.00 53.34  ?  213  LYS A N     1 
ATOM   1537  C  CA    . LYS A 1  234  ? 78.621  11.694  -21.904  1.00 56.46  ?  213  LYS A CA    1 
ATOM   1538  C  C     . LYS A 1  234  ? 77.614  10.682  -21.372  1.00 57.30  ?  213  LYS A C     1 
ATOM   1539  O  O     . LYS A 1  234  ? 77.702  10.245  -20.216  1.00 59.13  ?  213  LYS A O     1 
ATOM   1540  C  CB    . LYS A 1  234  ? 78.007  13.092  -21.925  1.00 61.43  ?  213  LYS A CB    1 
ATOM   1541  C  CG    . LYS A 1  234  ? 77.488  13.526  -20.563  1.00 67.84  ?  213  LYS A CG    1 
ATOM   1542  C  CD    . LYS A 1  234  ? 76.566  14.726  -20.659  1.00 78.36  ?  213  LYS A CD    1 
ATOM   1543  C  CE    . LYS A 1  234  ? 75.835  14.955  -19.344  1.00 85.74  ?  213  LYS A CE    1 
ATOM   1544  N  NZ    . LYS A 1  234  ? 74.813  16.031  -19.455  1.00 80.74  ?  213  LYS A NZ    1 
ATOM   1545  N  N     . THR A 1  235  ? 76.645  10.299  -22.209  1.00 59.33  ?  214  THR A N     1 
ATOM   1546  C  CA    . THR A 1  235  ? 75.637  9.328   -21.796  1.00 60.83  ?  214  THR A CA    1 
ATOM   1547  C  C     . THR A 1  235  ? 76.283  8.027   -21.333  1.00 59.09  ?  214  THR A C     1 
ATOM   1548  O  O     . THR A 1  235  ? 75.959  7.505   -20.259  1.00 59.93  ?  214  THR A O     1 
ATOM   1549  C  CB    . THR A 1  235  ? 74.660  9.065   -22.945  1.00 57.45  ?  214  THR A CB    1 
ATOM   1550  O  OG1   . THR A 1  235  ? 73.912  10.254  -23.227  1.00 55.73  ?  214  THR A OG1   1 
ATOM   1551  C  CG2   . THR A 1  235  ? 73.704  7.941   -22.590  1.00 51.97  ?  214  THR A CG2   1 
ATOM   1552  N  N     . LEU A 1  236  ? 77.216  7.496   -22.126  1.00 57.19  ?  215  LEU A N     1 
ATOM   1553  C  CA    . LEU A 1  236  ? 77.853  6.234   -21.765  1.00 56.19  ?  215  LEU A CA    1 
ATOM   1554  C  C     . LEU A 1  236  ? 78.763  6.388   -20.554  1.00 56.90  ?  215  LEU A C     1 
ATOM   1555  O  O     . LEU A 1  236  ? 78.854  5.478   -19.725  1.00 56.96  ?  215  LEU A O     1 
ATOM   1556  C  CB    . LEU A 1  236  ? 78.635  5.681   -22.953  1.00 54.22  ?  215  LEU A CB    1 
ATOM   1557  C  CG    . LEU A 1  236  ? 77.777  5.175   -24.108  1.00 49.54  ?  215  LEU A CG    1 
ATOM   1558  C  CD1   . LEU A 1  236  ? 78.654  4.690   -25.243  1.00 46.90  ?  215  LEU A CD1   1 
ATOM   1559  C  CD2   . LEU A 1  236  ? 76.855  4.072   -23.625  1.00 51.68  ?  215  LEU A CD2   1 
ATOM   1560  N  N     . VAL A 1  237  ? 79.457  7.520   -20.439  1.00 55.88  ?  216  VAL A N     1 
ATOM   1561  C  CA    . VAL A 1  237  ? 80.335  7.737   -19.292  1.00 54.53  ?  216  VAL A CA    1 
ATOM   1562  C  C     . VAL A 1  237  ? 79.529  7.721   -18.004  1.00 55.16  ?  216  VAL A C     1 
ATOM   1563  O  O     . VAL A 1  237  ? 79.877  7.032   -17.039  1.00 57.91  ?  216  VAL A O     1 
ATOM   1564  C  CB    . VAL A 1  237  ? 81.121  9.051   -19.450  1.00 55.28  ?  216  VAL A CB    1 
ATOM   1565  C  CG1   . VAL A 1  237  ? 81.534  9.591   -18.090  1.00 55.03  ?  216  VAL A CG1   1 
ATOM   1566  C  CG2   . VAL A 1  237  ? 82.347  8.828   -20.307  1.00 54.34  ?  216  VAL A CG2   1 
ATOM   1567  N  N     . GLU A 1  238  ? 78.431  8.474   -17.972  1.00 57.44  ?  217  GLU A N     1 
ATOM   1568  C  CA    . GLU A 1  238  ? 77.616  8.483   -16.766  1.00 62.25  ?  217  GLU A CA    1 
ATOM   1569  C  C     . GLU A 1  238  ? 76.942  7.137   -16.536  1.00 64.81  ?  217  GLU A C     1 
ATOM   1570  O  O     . GLU A 1  238  ? 76.767  6.722   -15.385  1.00 66.06  ?  217  GLU A O     1 
ATOM   1571  C  CB    . GLU A 1  238  ? 76.578  9.596   -16.846  1.00 65.50  ?  217  GLU A CB    1 
ATOM   1572  C  CG    . GLU A 1  238  ? 76.472  10.404  -15.576  1.00 74.70  ?  217  GLU A CG    1 
ATOM   1573  C  CD    . GLU A 1  238  ? 75.371  11.429  -15.644  1.00 89.46  ?  217  GLU A CD    1 
ATOM   1574  O  OE1   . GLU A 1  238  ? 75.057  11.881  -16.764  1.00 90.58  ?  217  GLU A OE1   1 
ATOM   1575  O  OE2   . GLU A 1  238  ? 74.816  11.772  -14.580  1.00 93.75  ?  217  GLU A OE2   1 
ATOM   1576  N  N     . LEU A 1  239  ? 76.577  6.437   -17.612  1.00 67.45  ?  218  LEU A N     1 
ATOM   1577  C  CA    . LEU A 1  239  ? 75.868  5.169   -17.468  1.00 65.35  ?  218  LEU A CA    1 
ATOM   1578  C  C     . LEU A 1  239  ? 76.783  4.081   -16.915  1.00 64.58  ?  218  LEU A C     1 
ATOM   1579  O  O     . LEU A 1  239  ? 76.439  3.405   -15.938  1.00 63.80  ?  218  LEU A O     1 
ATOM   1580  C  CB    . LEU A 1  239  ? 75.279  4.753   -18.815  1.00 61.33  ?  218  LEU A CB    1 
ATOM   1581  C  CG    . LEU A 1  239  ? 74.025  3.886   -18.772  1.00 57.75  ?  218  LEU A CG    1 
ATOM   1582  C  CD1   . LEU A 1  239  ? 72.996  4.489   -17.835  1.00 60.28  ?  218  LEU A CD1   1 
ATOM   1583  C  CD2   . LEU A 1  239  ? 73.456  3.749   -20.167  1.00 59.93  ?  218  LEU A CD2   1 
ATOM   1584  N  N     . PHE A 1  240  ? 77.955  3.896   -17.526  1.00 63.47  ?  219  PHE A N     1 
ATOM   1585  C  CA    . PHE A 1  240  ? 78.920  2.916   -17.045  1.00 62.02  ?  219  PHE A CA    1 
ATOM   1586  C  C     . PHE A 1  240  ? 79.513  3.283   -15.694  1.00 63.76  ?  219  PHE A C     1 
ATOM   1587  O  O     . PHE A 1  240  ? 80.182  2.442   -15.087  1.00 68.12  ?  219  PHE A O     1 
ATOM   1588  C  CB    . PHE A 1  240  ? 80.045  2.727   -18.062  1.00 55.68  ?  219  PHE A CB    1 
ATOM   1589  C  CG    . PHE A 1  240  ? 79.659  1.880   -19.235  1.00 56.92  ?  219  PHE A CG    1 
ATOM   1590  C  CD1   . PHE A 1  240  ? 79.427  0.525   -19.079  1.00 56.60  ?  219  PHE A CD1   1 
ATOM   1591  C  CD2   . PHE A 1  240  ? 79.528  2.433   -20.494  1.00 54.90  ?  219  PHE A CD2   1 
ATOM   1592  C  CE1   . PHE A 1  240  ? 79.069  -0.260  -20.155  1.00 52.73  ?  219  PHE A CE1   1 
ATOM   1593  C  CE2   . PHE A 1  240  ? 79.167  1.652   -21.571  1.00 52.35  ?  219  PHE A CE2   1 
ATOM   1594  C  CZ    . PHE A 1  240  ? 78.943  0.305   -21.403  1.00 52.43  ?  219  PHE A CZ    1 
ATOM   1595  N  N     . GLY A 1  241  ? 79.293  4.506   -15.213  1.00 63.85  ?  220  GLY A N     1 
ATOM   1596  C  CA    . GLY A 1  241  ? 79.672  4.834   -13.850  1.00 66.33  ?  220  GLY A CA    1 
ATOM   1597  C  C     . GLY A 1  241  ? 78.948  4.023   -12.796  1.00 69.07  ?  220  GLY A C     1 
ATOM   1598  O  O     . GLY A 1  241  ? 79.395  3.998   -11.644  1.00 67.65  ?  220  GLY A O     1 
ATOM   1599  N  N     . LEU A 1  242  ? 77.842  3.367   -13.164  1.00 70.40  ?  221  LEU A N     1 
ATOM   1600  C  CA    . LEU A 1  242  ? 77.141  2.488   -12.232  1.00 72.57  ?  221  LEU A CA    1 
ATOM   1601  C  C     . LEU A 1  242  ? 77.992  1.286   -11.849  1.00 73.56  ?  221  LEU A C     1 
ATOM   1602  O  O     . LEU A 1  242  ? 77.918  0.811   -10.710  1.00 75.32  ?  221  LEU A O     1 
ATOM   1603  C  CB    . LEU A 1  242  ? 75.816  2.037   -12.839  1.00 72.71  ?  221  LEU A CB    1 
ATOM   1604  C  CG    . LEU A 1  242  ? 74.810  3.169   -13.037  1.00 68.85  ?  221  LEU A CG    1 
ATOM   1605  C  CD1   . LEU A 1  242  ? 73.663  2.716   -13.917  1.00 67.07  ?  221  LEU A CD1   1 
ATOM   1606  C  CD2   . LEU A 1  242  ? 74.298  3.652   -11.690  1.00 73.00  ?  221  LEU A CD2   1 
ATOM   1607  N  N     . ALA A 1  243  ? 78.812  0.793   -12.771  1.00 69.72  ?  222  ALA A N     1 
ATOM   1608  C  CA    . ALA A 1  243  ? 79.874  -0.142  -12.430  1.00 64.23  ?  222  ALA A CA    1 
ATOM   1609  C  C     . ALA A 1  243  ? 81.091  0.713   -12.110  1.00 70.98  ?  222  ALA A C     1 
ATOM   1610  O  O     . ALA A 1  243  ? 81.681  1.325   -13.005  1.00 74.81  ?  222  ALA A O     1 
ATOM   1611  C  CB    . ALA A 1  243  ? 80.146  -1.111  -13.575  1.00 63.54  ?  222  ALA A CB    1 
ATOM   1612  N  N     . ARG A 1  244  ? 81.465  0.747   -10.836  1.00 73.25  ?  223  ARG A N     1 
ATOM   1613  C  CA    . ARG A 1  244  ? 82.289  1.823   -10.293  1.00 72.77  ?  223  ARG A CA    1 
ATOM   1614  C  C     . ARG A 1  244  ? 83.643  1.969   -10.978  1.00 74.73  ?  223  ARG A C     1 
ATOM   1615  O  O     . ARG A 1  244  ? 83.950  3.027   -11.533  1.00 71.58  ?  223  ARG A O     1 
ATOM   1616  C  CB    . ARG A 1  244  ? 82.481  1.610   -8.791   1.00 70.26  ?  223  ARG A CB    1 
ATOM   1617  C  CG    . ARG A 1  244  ? 81.170  1.425   -8.045   1.00 67.84  ?  223  ARG A CG    1 
ATOM   1618  C  CD    . ARG A 1  244  ? 80.199  2.543   -8.383   1.00 68.15  ?  223  ARG A CD    1 
ATOM   1619  N  NE    . ARG A 1  244  ? 78.814  2.186   -8.089   1.00 74.99  ?  223  ARG A NE    1 
ATOM   1620  C  CZ    . ARG A 1  244  ? 77.769  2.951   -8.390   1.00 79.06  ?  223  ARG A CZ    1 
ATOM   1621  N  NH1   . ARG A 1  244  ? 76.541  2.551   -8.088   1.00 85.02  ?  223  ARG A NH1   1 
ATOM   1622  N  NH2   . ARG A 1  244  ? 77.950  4.117   -8.995   1.00 74.69  ?  223  ARG A NH2   1 
ATOM   1623  N  N     . MET B 1  22   ? 68.825  14.120  -22.893  1.00 81.01  ?  1    MET B N     1 
ATOM   1624  C  CA    . MET B 1  22   ? 67.796  15.142  -22.745  1.00 90.63  ?  1    MET B CA    1 
ATOM   1625  C  C     . MET B 1  22   ? 67.113  15.056  -21.386  1.00 98.57  ?  1    MET B C     1 
ATOM   1626  O  O     . MET B 1  22   ? 67.287  15.930  -20.536  1.00 100.45 ?  1    MET B O     1 
ATOM   1627  C  CB    . MET B 1  22   ? 66.755  15.018  -23.859  1.00 82.04  ?  1    MET B CB    1 
ATOM   1628  C  CG    . MET B 1  22   ? 65.532  15.903  -23.671  1.00 80.81  ?  1    MET B CG    1 
ATOM   1629  S  SD    . MET B 1  22   ? 65.950  17.644  -23.500  1.00 92.44  ?  1    MET B SD    1 
ATOM   1630  C  CE    . MET B 1  22   ? 66.916  17.901  -24.988  1.00 70.02  ?  1    MET B CE    1 
ATOM   1631  N  N     . LEU B 1  23   ? 66.335  13.997  -21.188  1.00 97.16  ?  2    LEU B N     1 
ATOM   1632  C  CA    . LEU B 1  23   ? 65.570  13.820  -19.962  1.00 97.67  ?  2    LEU B CA    1 
ATOM   1633  C  C     . LEU B 1  23   ? 66.471  13.237  -18.874  1.00 99.54  ?  2    LEU B C     1 
ATOM   1634  O  O     . LEU B 1  23   ? 67.688  13.113  -19.034  1.00 94.42  ?  2    LEU B O     1 
ATOM   1635  C  CB    . LEU B 1  23   ? 64.354  12.937  -20.226  1.00 92.72  ?  2    LEU B CB    1 
ATOM   1636  C  CG    . LEU B 1  23   ? 63.497  13.314  -21.436  1.00 91.25  ?  2    LEU B CG    1 
ATOM   1637  C  CD1   . LEU B 1  23   ? 62.345  12.334  -21.603  1.00 88.42  ?  2    LEU B CD1   1 
ATOM   1638  C  CD2   . LEU B 1  23   ? 62.982  14.738  -21.308  1.00 94.81  ?  2    LEU B CD2   1 
ATOM   1639  N  N     . ILE B 1  24   ? 65.870  12.880  -17.743  1.00 99.02  ?  3    ILE B N     1 
ATOM   1640  C  CA    . ILE B 1  24   ? 66.563  12.215  -16.647  1.00 99.37  ?  3    ILE B CA    1 
ATOM   1641  C  C     . ILE B 1  24   ? 65.764  10.972  -16.293  1.00 99.66  ?  3    ILE B C     1 
ATOM   1642  O  O     . ILE B 1  24   ? 64.620  11.077  -15.836  1.00 101.50 ?  3    ILE B O     1 
ATOM   1643  C  CB    . ILE B 1  24   ? 66.721  13.128  -15.420  1.00 97.07  ?  3    ILE B CB    1 
ATOM   1644  N  N     . SER B 1  25   ? 66.356  9.802   -16.507  1.00 97.70  ?  4    SER B N     1 
ATOM   1645  C  CA    . SER B 1  25   ? 65.656  8.556   -16.247  1.00 100.51 ?  4    SER B CA    1 
ATOM   1646  C  C     . SER B 1  25   ? 65.625  8.272   -14.748  1.00 100.59 ?  4    SER B C     1 
ATOM   1647  O  O     . SER B 1  25   ? 66.189  9.007   -13.933  1.00 100.13 ?  4    SER B O     1 
ATOM   1648  C  CB    . SER B 1  25   ? 66.318  7.409   -17.006  1.00 96.26  ?  4    SER B CB    1 
ATOM   1649  N  N     . GLN B 1  26   ? 64.954  7.186   -14.379  1.00 97.44  ?  5    GLN B N     1 
ATOM   1650  C  CA    . GLN B 1  26   ? 65.002  6.718   -13.002  1.00 91.46  ?  5    GLN B CA    1 
ATOM   1651  C  C     . GLN B 1  26   ? 66.362  6.084   -12.752  1.00 88.08  ?  5    GLN B C     1 
ATOM   1652  O  O     . GLN B 1  26   ? 66.811  5.240   -13.532  1.00 87.07  ?  5    GLN B O     1 
ATOM   1653  C  CB    . GLN B 1  26   ? 63.880  5.718   -12.737  1.00 86.94  ?  5    GLN B CB    1 
ATOM   1654  C  CG    . GLN B 1  26   ? 62.621  5.973   -13.553  1.00 96.65  ?  5    GLN B CG    1 
ATOM   1655  C  CD    . GLN B 1  26   ? 62.066  7.372   -13.363  1.00 96.58  ?  5    GLN B CD    1 
ATOM   1656  O  OE1   . GLN B 1  26   ? 62.149  7.946   -12.277  1.00 98.32  ?  5    GLN B OE1   1 
ATOM   1657  N  NE2   . GLN B 1  26   ? 61.501  7.932   -14.427  1.00 92.93  ?  5    GLN B NE2   1 
ATOM   1658  N  N     . ARG B 1  27   ? 67.022  6.500   -11.680  1.00 83.44  ?  6    ARG B N     1 
ATOM   1659  C  CA    . ARG B 1  27   ? 68.409  6.113   -11.463  1.00 83.26  ?  6    ARG B CA    1 
ATOM   1660  C  C     . ARG B 1  27   ? 68.518  4.603   -11.291  1.00 79.00  ?  6    ARG B C     1 
ATOM   1661  O  O     . ARG B 1  27   ? 67.956  4.053   -10.331  1.00 77.58  ?  6    ARG B O     1 
ATOM   1662  C  CB    . ARG B 1  27   ? 68.987  6.824   -10.242  1.00 83.58  ?  6    ARG B CB    1 
ATOM   1663  C  CG    . ARG B 1  27   ? 70.466  6.545   -10.017  1.00 79.15  ?  6    ARG B CG    1 
ATOM   1664  C  CD    . ARG B 1  27   ? 71.292  7.820   -10.065  1.00 84.95  ?  6    ARG B CD    1 
ATOM   1665  N  NE    . ARG B 1  27   ? 71.042  8.682   -8.914   1.00 91.04  ?  6    ARG B NE    1 
ATOM   1666  C  CZ    . ARG B 1  27   ? 71.589  9.882   -8.744   1.00 91.98  ?  6    ARG B CZ    1 
ATOM   1667  N  NH1   . ARG B 1  27   ? 72.419  10.370  -9.656   1.00 93.36  ?  6    ARG B NH1   1 
ATOM   1668  N  NH2   . ARG B 1  27   ? 71.305  10.596  -7.663   1.00 88.39  ?  6    ARG B NH2   1 
ATOM   1669  N  N     . PRO B 1  28   ? 69.209  3.901   -12.185  1.00 73.08  ?  7    PRO B N     1 
ATOM   1670  C  CA    . PRO B 1  28   ? 69.376  2.458   -12.013  1.00 70.64  ?  7    PRO B CA    1 
ATOM   1671  C  C     . PRO B 1  28   ? 70.310  2.156   -10.857  1.00 70.34  ?  7    PRO B C     1 
ATOM   1672  O  O     . PRO B 1  28   ? 71.235  2.913   -10.557  1.00 68.24  ?  7    PRO B O     1 
ATOM   1673  C  CB    . PRO B 1  28   ? 69.983  2.005   -13.346  1.00 67.12  ?  7    PRO B CB    1 
ATOM   1674  C  CG    . PRO B 1  28   ? 69.794  3.160   -14.287  1.00 68.60  ?  7    PRO B CG    1 
ATOM   1675  C  CD    . PRO B 1  28   ? 69.823  4.377   -13.432  1.00 72.76  ?  7    PRO B CD    1 
ATOM   1676  N  N     . THR B 1  29   ? 70.058  1.029   -10.205  1.00 66.42  ?  8    THR B N     1 
ATOM   1677  C  CA    . THR B 1  29   ? 70.873  0.580   -9.092   1.00 62.83  ?  8    THR B CA    1 
ATOM   1678  C  C     . THR B 1  29   ? 71.647  -0.670  -9.485   1.00 62.78  ?  8    THR B C     1 
ATOM   1679  O  O     . THR B 1  29   ? 71.219  -1.448  -10.348  1.00 65.36  ?  8    THR B O     1 
ATOM   1680  C  CB    . THR B 1  29   ? 70.018  0.296   -7.854   1.00 62.47  ?  8    THR B CB    1 
ATOM   1681  O  OG1   . THR B 1  29   ? 69.066  -0.730  -8.155   1.00 69.39  ?  8    THR B OG1   1 
ATOM   1682  C  CG2   . THR B 1  29   ? 69.281  1.552   -7.418   1.00 59.94  ?  8    THR B CG2   1 
ATOM   1683  N  N     . LEU B 1  30   ? 72.809  -0.827  -8.858   1.00 58.22  ?  9    LEU B N     1 
ATOM   1684  C  CA    . LEU B 1  30   ? 73.632  -2.020  -8.968   1.00 56.91  ?  9    LEU B CA    1 
ATOM   1685  C  C     . LEU B 1  30   ? 73.527  -2.811  -7.673   1.00 59.79  ?  9    LEU B C     1 
ATOM   1686  O  O     . LEU B 1  30   ? 73.580  -2.239  -6.581   1.00 63.24  ?  9    LEU B O     1 
ATOM   1687  C  CB    . LEU B 1  30   ? 75.094  -1.658  -9.247   1.00 54.34  ?  9    LEU B CB    1 
ATOM   1688  C  CG    . LEU B 1  30   ? 76.121  -2.788  -9.162   1.00 54.45  ?  9    LEU B CG    1 
ATOM   1689  C  CD1   . LEU B 1  30   ? 75.781  -3.906  -10.131  1.00 56.08  ?  9    LEU B CD1   1 
ATOM   1690  C  CD2   . LEU B 1  30   ? 77.523  -2.263  -9.423   1.00 57.90  ?  9    LEU B CD2   1 
ATOM   1691  N  N     . SER B 1  31   ? 73.360  -4.125  -7.800   1.00 60.78  ?  10   SER B N     1 
ATOM   1692  C  CA    . SER B 1  31   ? 73.248  -4.999  -6.643   1.00 58.25  ?  10   SER B CA    1 
ATOM   1693  C  C     . SER B 1  31   ? 74.082  -6.247  -6.878   1.00 57.74  ?  10   SER B C     1 
ATOM   1694  O  O     . SER B 1  31   ? 74.296  -6.666  -8.018   1.00 59.17  ?  10   SER B O     1 
ATOM   1695  C  CB    . SER B 1  31   ? 71.792  -5.387  -6.363   1.00 56.53  ?  10   SER B CB    1 
ATOM   1696  O  OG    . SER B 1  31   ? 70.946  -4.254  -6.419   1.00 67.83  ?  10   SER B OG    1 
ATOM   1697  N  N     . GLU B 1  32   ? 74.546  -6.842  -5.784   1.00 56.64  ?  11   GLU B N     1 
ATOM   1698  C  CA    . GLU B 1  32   ? 75.406  -8.012  -5.844   1.00 58.05  ?  11   GLU B CA    1 
ATOM   1699  C  C     . GLU B 1  32   ? 74.855  -9.109  -4.953   1.00 57.95  ?  11   GLU B C     1 
ATOM   1700  O  O     . GLU B 1  32   ? 74.579  -8.876  -3.772   1.00 60.22  ?  11   GLU B O     1 
ATOM   1701  C  CB    . GLU B 1  32   ? 76.833  -7.677  -5.414   1.00 59.12  ?  11   GLU B CB    1 
ATOM   1702  C  CG    . GLU B 1  32   ? 77.696  -8.903  -5.210   1.00 62.45  ?  11   GLU B CG    1 
ATOM   1703  C  CD    . GLU B 1  32   ? 79.046  -8.565  -4.628   1.00 69.74  ?  11   GLU B CD    1 
ATOM   1704  O  OE1   . GLU B 1  32   ? 80.047  -9.192  -5.037   1.00 70.32  ?  11   GLU B OE1   1 
ATOM   1705  O  OE2   . GLU B 1  32   ? 79.100  -7.666  -3.764   1.00 70.08  ?  11   GLU B OE2   1 
ATOM   1706  N  N     . ASP B 1  33   ? 74.702  -10.300 -5.518   1.00 56.79  ?  12   ASP B N     1 
ATOM   1707  C  CA    . ASP B 1  33   ? 74.433  -11.508 -4.753   1.00 59.22  ?  12   ASP B CA    1 
ATOM   1708  C  C     . ASP B 1  33   ? 75.652  -12.409 -4.876   1.00 60.26  ?  12   ASP B C     1 
ATOM   1709  O  O     . ASP B 1  33   ? 75.995  -12.851 -5.979   1.00 59.34  ?  12   ASP B O     1 
ATOM   1710  C  CB    . ASP B 1  33   ? 73.175  -12.218 -5.250   1.00 65.35  ?  12   ASP B CB    1 
ATOM   1711  C  CG    . ASP B 1  33   ? 72.662  -13.243 -4.260   1.00 72.15  ?  12   ASP B CG    1 
ATOM   1712  O  OD1   . ASP B 1  33   ? 72.728  -12.975 -3.041   1.00 70.98  ?  12   ASP B OD1   1 
ATOM   1713  O  OD2   . ASP B 1  33   ? 72.198  -14.316 -4.697   1.00 76.57  ?  12   ASP B OD2   1 
ATOM   1714  N  N     . VAL B 1  34   ? 76.306  -12.671 -3.750   1.00 59.57  ?  13   VAL B N     1 
ATOM   1715  C  CA    . VAL B 1  34   ? 77.555  -13.420 -3.735   1.00 61.11  ?  13   VAL B CA    1 
ATOM   1716  C  C     . VAL B 1  34   ? 77.204  -14.902 -3.713   1.00 62.34  ?  13   VAL B C     1 
ATOM   1717  O  O     . VAL B 1  34   ? 76.622  -15.398 -2.746   1.00 62.08  ?  13   VAL B O     1 
ATOM   1718  C  CB    . VAL B 1  34   ? 78.419  -13.029 -2.532   1.00 58.23  ?  13   VAL B CB    1 
ATOM   1719  C  CG1   . VAL B 1  34   ? 79.598  -13.965 -2.393   1.00 60.27  ?  13   VAL B CG1   1 
ATOM   1720  C  CG2   . VAL B 1  34   ? 78.886  -11.589 -2.666   1.00 57.02  ?  13   VAL B CG2   1 
ATOM   1721  N  N     . LEU B 1  35   ? 77.547  -15.609 -4.792   1.00 61.59  ?  14   LEU B N     1 
ATOM   1722  C  CA    . LEU B 1  35   ? 77.272  -17.040 -4.865   1.00 65.17  ?  14   LEU B CA    1 
ATOM   1723  C  C     . LEU B 1  35   ? 78.331  -17.854 -4.130   1.00 70.09  ?  14   LEU B C     1 
ATOM   1724  O  O     . LEU B 1  35   ? 78.003  -18.719 -3.312   1.00 69.87  ?  14   LEU B O     1 
ATOM   1725  C  CB    . LEU B 1  35   ? 77.171  -17.471 -6.327   1.00 64.66  ?  14   LEU B CB    1 
ATOM   1726  C  CG    . LEU B 1  35   ? 76.081  -16.748 -7.119   1.00 62.87  ?  14   LEU B CG    1 
ATOM   1727  C  CD1   . LEU B 1  35   ? 76.055  -17.217 -8.563   1.00 63.14  ?  14   LEU B CD1   1 
ATOM   1728  C  CD2   . LEU B 1  35   ? 74.725  -16.950 -6.462   1.00 66.61  ?  14   LEU B CD2   1 
ATOM   1729  N  N     . THR B 1  36   ? 79.605  -17.592 -4.415   1.00 68.11  ?  15   THR B N     1 
ATOM   1730  C  CA    . THR B 1  36   ? 80.730  -18.199 -3.710   1.00 67.33  ?  15   THR B CA    1 
ATOM   1731  C  C     . THR B 1  36   ? 81.779  -17.113 -3.510   1.00 67.72  ?  15   THR B C     1 
ATOM   1732  O  O     . THR B 1  36   ? 81.548  -15.939 -3.811   1.00 69.73  ?  15   THR B O     1 
ATOM   1733  C  CB    . THR B 1  36   ? 81.325  -19.400 -4.464   1.00 65.45  ?  15   THR B CB    1 
ATOM   1734  O  OG1   . THR B 1  36   ? 82.248  -18.936 -5.457   1.00 65.09  ?  15   THR B OG1   1 
ATOM   1735  C  CG2   . THR B 1  36   ? 80.247  -20.243 -5.136   1.00 60.78  ?  15   THR B CG2   1 
ATOM   1736  N  N     . ASP B 1  37   ? 82.952  -17.504 -3.011   1.00 67.86  ?  16   ASP B N     1 
ATOM   1737  C  CA    . ASP B 1  37   ? 84.015  -16.527 -2.802   1.00 70.61  ?  16   ASP B CA    1 
ATOM   1738  C  C     . ASP B 1  37   ? 84.514  -15.961 -4.126   1.00 69.96  ?  16   ASP B C     1 
ATOM   1739  O  O     . ASP B 1  37   ? 84.825  -14.768 -4.220   1.00 69.12  ?  16   ASP B O     1 
ATOM   1740  C  CB    . ASP B 1  37   ? 85.167  -17.161 -2.026   1.00 73.75  ?  16   ASP B CB    1 
ATOM   1741  C  CG    . ASP B 1  37   ? 84.687  -18.037 -0.890   1.00 78.90  ?  16   ASP B CG    1 
ATOM   1742  O  OD1   . ASP B 1  37   ? 84.369  -17.497 0.190    1.00 79.85  ?  16   ASP B OD1   1 
ATOM   1743  O  OD2   . ASP B 1  37   ? 84.631  -19.270 -1.078   1.00 80.52  ?  16   ASP B OD2   1 
ATOM   1744  N  N     . ASN B 1  38   ? 84.620  -16.803 -5.151   1.00 70.23  ?  17   ASN B N     1 
ATOM   1745  C  CA    . ASN B 1  38   ? 85.110  -16.392 -6.460   1.00 71.20  ?  17   ASN B CA    1 
ATOM   1746  C  C     . ASN B 1  38   ? 84.005  -16.113 -7.471   1.00 67.12  ?  17   ASN B C     1 
ATOM   1747  O  O     . ASN B 1  38   ? 84.311  -15.805 -8.626   1.00 63.48  ?  17   ASN B O     1 
ATOM   1748  C  CB    . ASN B 1  38   ? 86.060  -17.454 -7.017   1.00 70.16  ?  17   ASN B CB    1 
ATOM   1749  C  CG    . ASN B 1  38   ? 87.342  -17.555 -6.223   1.00 73.32  ?  17   ASN B CG    1 
ATOM   1750  O  OD1   . ASN B 1  38   ? 87.802  -16.572 -5.643   1.00 78.58  ?  17   ASN B OD1   1 
ATOM   1751  N  ND2   . ASN B 1  38   ? 87.927  -18.745 -6.189   1.00 76.18  ?  17   ASN B ND2   1 
ATOM   1752  N  N     . ARG B 1  39   ? 82.738  -16.223 -7.082   1.00 66.11  ?  18   ARG B N     1 
ATOM   1753  C  CA    . ARG B 1  39   ? 81.633  -16.075 -8.018   1.00 65.34  ?  18   ARG B CA    1 
ATOM   1754  C  C     . ARG B 1  39   ? 80.605  -15.106 -7.459   1.00 64.81  ?  18   ARG B C     1 
ATOM   1755  O  O     . ARG B 1  39   ? 80.341  -15.095 -6.254   1.00 66.62  ?  18   ARG B O     1 
ATOM   1756  C  CB    . ARG B 1  39   ? 80.967  -17.422 -8.304   1.00 63.00  ?  18   ARG B CB    1 
ATOM   1757  C  CG    . ARG B 1  39   ? 80.191  -17.465 -9.604   1.00 58.65  ?  18   ARG B CG    1 
ATOM   1758  C  CD    . ARG B 1  39   ? 79.240  -18.645 -9.631   1.00 63.59  ?  18   ARG B CD    1 
ATOM   1759  N  NE    . ARG B 1  39   ? 78.751  -18.922 -10.978  1.00 65.27  ?  18   ARG B NE    1 
ATOM   1760  C  CZ    . ARG B 1  39   ? 77.637  -19.593 -11.243  1.00 62.69  ?  18   ARG B CZ    1 
ATOM   1761  N  NH1   . ARG B 1  39   ? 76.882  -20.044 -10.252  1.00 64.96  ?  18   ARG B NH1   1 
ATOM   1762  N  NH2   . ARG B 1  39   ? 77.270  -19.801 -12.499  1.00 62.17  ?  18   ARG B NH2   1 
ATOM   1763  N  N     . SER B 1  40   ? 80.022  -14.294 -8.339   1.00 63.81  ?  19   SER B N     1 
ATOM   1764  C  CA    . SER B 1  40   ? 78.960  -13.395 -7.916   1.00 60.88  ?  19   SER B CA    1 
ATOM   1765  C  C     . SER B 1  40   ? 78.067  -13.053 -9.097   1.00 58.80  ?  19   SER B C     1 
ATOM   1766  O  O     . SER B 1  40   ? 78.467  -13.146 -10.262  1.00 59.21  ?  19   SER B O     1 
ATOM   1767  C  CB    . SER B 1  40   ? 79.517  -12.111 -7.290   1.00 57.65  ?  19   SER B CB    1 
ATOM   1768  O  OG    . SER B 1  40   ? 80.171  -12.382 -6.065   1.00 62.86  ?  19   SER B OG    1 
ATOM   1769  N  N     . GLN B 1  41   ? 76.841  -12.656 -8.769   1.00 55.09  ?  20   GLN B N     1 
ATOM   1770  C  CA    . GLN B 1  41   ? 75.906  -12.084 -9.723   1.00 50.48  ?  20   GLN B CA    1 
ATOM   1771  C  C     . GLN B 1  41   ? 75.708  -10.611 -9.407   1.00 55.68  ?  20   GLN B C     1 
ATOM   1772  O  O     . GLN B 1  41   ? 75.686  -10.213 -8.239   1.00 59.53  ?  20   GLN B O     1 
ATOM   1773  C  CB    . GLN B 1  41   ? 74.554  -12.796 -9.685   1.00 52.36  ?  20   GLN B CB    1 
ATOM   1774  C  CG    . GLN B 1  41   ? 74.530  -14.152 -10.349  1.00 57.32  ?  20   GLN B CG    1 
ATOM   1775  C  CD    . GLN B 1  41   ? 73.122  -14.684 -10.486  1.00 58.41  ?  20   GLN B CD    1 
ATOM   1776  O  OE1   . GLN B 1  41   ? 72.151  -13.938 -10.348  1.00 53.08  ?  20   GLN B OE1   1 
ATOM   1777  N  NE2   . GLN B 1  41   ? 72.999  -15.979 -10.755  1.00 56.79  ?  20   GLN B NE2   1 
ATOM   1778  N  N     . PHE B 1  42   ? 75.570  -9.807  -10.453  1.00 54.26  ?  21   PHE B N     1 
ATOM   1779  C  CA    . PHE B 1  42   ? 75.280  -8.389  -10.328  1.00 52.56  ?  21   PHE B CA    1 
ATOM   1780  C  C     . PHE B 1  42   ? 74.057  -8.067  -11.167  1.00 51.91  ?  21   PHE B C     1 
ATOM   1781  O  O     . PHE B 1  42   ? 73.887  -8.615  -12.259  1.00 52.43  ?  21   PHE B O     1 
ATOM   1782  C  CB    . PHE B 1  42   ? 76.462  -7.532  -10.785  1.00 55.13  ?  21   PHE B CB    1 
ATOM   1783  C  CG    . PHE B 1  42   ? 77.722  -7.774  -10.011  1.00 53.65  ?  21   PHE B CG    1 
ATOM   1784  C  CD1   . PHE B 1  42   ? 77.892  -7.225  -8.755   1.00 56.53  ?  21   PHE B CD1   1 
ATOM   1785  C  CD2   . PHE B 1  42   ? 78.741  -8.538  -10.543  1.00 50.06  ?  21   PHE B CD2   1 
ATOM   1786  C  CE1   . PHE B 1  42   ? 79.052  -7.440  -8.043   1.00 59.50  ?  21   PHE B CE1   1 
ATOM   1787  C  CE2   . PHE B 1  42   ? 79.902  -8.756  -9.831   1.00 54.94  ?  21   PHE B CE2   1 
ATOM   1788  C  CZ    . PHE B 1  42   ? 80.056  -8.208  -8.581   1.00 61.54  ?  21   PHE B CZ    1 
ATOM   1789  N  N     . VAL B 1  43   ? 73.201  -7.188  -10.659  1.00 53.48  ?  22   VAL B N     1 
ATOM   1790  C  CA    . VAL B 1  43   ? 72.033  -6.735  -11.403  1.00 57.42  ?  22   VAL B CA    1 
ATOM   1791  C  C     . VAL B 1  43   ? 72.053  -5.216  -11.466  1.00 54.92  ?  22   VAL B C     1 
ATOM   1792  O  O     . VAL B 1  43   ? 72.243  -4.546  -10.445  1.00 54.85  ?  22   VAL B O     1 
ATOM   1793  C  CB    . VAL B 1  43   ? 70.712  -7.244  -10.789  1.00 56.62  ?  22   VAL B CB    1 
ATOM   1794  C  CG1   . VAL B 1  43   ? 70.563  -8.738  -11.034  1.00 53.25  ?  22   VAL B CG1   1 
ATOM   1795  C  CG2   . VAL B 1  43   ? 70.651  -6.946  -9.305   1.00 59.94  ?  22   VAL B CG2   1 
ATOM   1796  N  N     . ILE B 1  44   ? 71.885  -4.681  -12.671  1.00 52.75  ?  23   ILE B N     1 
ATOM   1797  C  CA    . ILE B 1  44   ? 71.729  -3.253  -12.907  1.00 56.51  ?  23   ILE B CA    1 
ATOM   1798  C  C     . ILE B 1  44   ? 70.310  -3.028  -13.404  1.00 58.88  ?  23   ILE B C     1 
ATOM   1799  O  O     . ILE B 1  44   ? 69.898  -3.634  -14.402  1.00 58.62  ?  23   ILE B O     1 
ATOM   1800  C  CB    . ILE B 1  44   ? 72.757  -2.735  -13.926  1.00 57.06  ?  23   ILE B CB    1 
ATOM   1801  C  CG1   . ILE B 1  44   ? 74.177  -2.977  -13.415  1.00 50.76  ?  23   ILE B CG1   1 
ATOM   1802  C  CG2   . ILE B 1  44   ? 72.516  -1.262  -14.219  1.00 56.78  ?  23   ILE B CG2   1 
ATOM   1803  C  CD1   . ILE B 1  44   ? 75.246  -2.664  -14.428  1.00 46.53  ?  23   ILE B CD1   1 
ATOM   1804  N  N     . GLU B 1  45   ? 69.577  -2.141  -12.735  1.00 63.11  ?  24   GLU B N     1 
ATOM   1805  C  CA    . GLU B 1  45   ? 68.130  -2.079  -12.945  1.00 62.37  ?  24   GLU B CA    1 
ATOM   1806  C  C     . GLU B 1  45   ? 67.451  -0.930  -12.203  1.00 66.33  ?  24   GLU B C     1 
ATOM   1807  O  O     . GLU B 1  45   ? 67.835  -0.602  -11.082  1.00 67.69  ?  24   GLU B O     1 
ATOM   1808  C  CB    . GLU B 1  45   ? 67.507  -3.413  -12.511  1.00 60.64  ?  24   GLU B CB    1 
ATOM   1809  C  CG    . GLU B 1  45   ? 66.110  -3.332  -11.923  1.00 67.21  ?  24   GLU B CG    1 
ATOM   1810  C  CD    . GLU B 1  45   ? 65.763  -4.554  -11.096  1.00 71.28  ?  24   GLU B CD    1 
ATOM   1811  O  OE1   . GLU B 1  45   ? 66.697  -5.233  -10.623  1.00 69.32  ?  24   GLU B OE1   1 
ATOM   1812  O  OE2   . GLU B 1  45   ? 64.558  -4.835  -10.919  1.00 74.72  ?  24   GLU B OE2   1 
ATOM   1813  N  N     . PRO B 1  46   ? 66.431  -0.312  -12.827  1.00 65.86  ?  25   PRO B N     1 
ATOM   1814  C  CA    . PRO B 1  46   ? 65.959  -0.513  -14.202  1.00 61.34  ?  25   PRO B CA    1 
ATOM   1815  C  C     . PRO B 1  46   ? 66.779  0.249   -15.235  1.00 61.54  ?  25   PRO B C     1 
ATOM   1816  O  O     . PRO B 1  46   ? 67.371  1.269   -14.901  1.00 62.25  ?  25   PRO B O     1 
ATOM   1817  C  CB    . PRO B 1  46   ? 64.534  0.027   -14.152  1.00 60.82  ?  25   PRO B CB    1 
ATOM   1818  C  CG    . PRO B 1  46   ? 64.619  1.132   -13.168  1.00 60.81  ?  25   PRO B CG    1 
ATOM   1819  C  CD    . PRO B 1  46   ? 65.601  0.676   -12.116  1.00 65.86  ?  25   PRO B CD    1 
ATOM   1820  N  N     . LEU B 1  47   ? 66.794  -0.224  -16.476  1.00 60.91  ?  26   LEU B N     1 
ATOM   1821  C  CA    . LEU B 1  47   ? 67.460  0.468   -17.569  1.00 58.36  ?  26   LEU B CA    1 
ATOM   1822  C  C     . LEU B 1  47   ? 66.438  0.855   -18.624  1.00 60.41  ?  26   LEU B C     1 
ATOM   1823  O  O     . LEU B 1  47   ? 65.495  0.103   -18.889  1.00 60.93  ?  26   LEU B O     1 
ATOM   1824  C  CB    . LEU B 1  47   ? 68.547  -0.400  -18.203  1.00 53.48  ?  26   LEU B CB    1 
ATOM   1825  C  CG    . LEU B 1  47   ? 69.804  -0.651  -17.378  1.00 55.44  ?  26   LEU B CG    1 
ATOM   1826  C  CD1   . LEU B 1  47   ? 70.683  -1.663  -18.084  1.00 55.28  ?  26   LEU B CD1   1 
ATOM   1827  C  CD2   . LEU B 1  47   ? 70.554  0.647   -17.155  1.00 61.04  ?  26   LEU B CD2   1 
ATOM   1828  N  N     . GLU B 1  48   ? 66.626  2.028   -19.219  1.00 59.62  ?  27   GLU B N     1 
ATOM   1829  C  CA    . GLU B 1  48   ? 65.781  2.424   -20.333  1.00 59.22  ?  27   GLU B CA    1 
ATOM   1830  C  C     . GLU B 1  48   ? 65.856  1.361   -21.425  1.00 59.17  ?  27   GLU B C     1 
ATOM   1831  O  O     . GLU B 1  48   ? 66.939  0.831   -21.697  1.00 57.99  ?  27   GLU B O     1 
ATOM   1832  C  CB    . GLU B 1  48   ? 66.209  3.786   -20.878  1.00 62.51  ?  27   GLU B CB    1 
ATOM   1833  C  CG    . GLU B 1  48   ? 66.036  4.919   -19.880  1.00 71.49  ?  27   GLU B CG    1 
ATOM   1834  C  CD    . GLU B 1  48   ? 66.172  6.288   -20.513  1.00 76.13  ?  27   GLU B CD    1 
ATOM   1835  O  OE1   . GLU B 1  48   ? 66.980  6.436   -21.454  1.00 74.77  ?  27   GLU B OE1   1 
ATOM   1836  O  OE2   . GLU B 1  48   ? 65.462  7.216   -20.076  1.00 78.66  ?  27   GLU B OE2   1 
ATOM   1837  N  N     . PRO B 1  49   ? 64.731  1.012   -22.048  1.00 61.92  ?  28   PRO B N     1 
ATOM   1838  C  CA    . PRO B 1  49   ? 64.700  -0.160  -22.933  1.00 62.89  ?  28   PRO B CA    1 
ATOM   1839  C  C     . PRO B 1  49   ? 65.754  -0.087  -24.028  1.00 60.08  ?  28   PRO B C     1 
ATOM   1840  O  O     . PRO B 1  49   ? 65.883  0.919   -24.728  1.00 57.22  ?  28   PRO B O     1 
ATOM   1841  C  CB    . PRO B 1  49   ? 63.281  -0.124  -23.509  1.00 64.77  ?  28   PRO B CB    1 
ATOM   1842  C  CG    . PRO B 1  49   ? 62.480  0.572   -22.459  1.00 63.11  ?  28   PRO B CG    1 
ATOM   1843  C  CD    . PRO B 1  49   ? 63.397  1.611   -21.877  1.00 61.71  ?  28   PRO B CD    1 
ATOM   1844  N  N     . GLY B 1  50   ? 66.512  -1.172  -24.165  1.00 57.90  ?  29   GLY B N     1 
ATOM   1845  C  CA    . GLY B 1  50   ? 67.581  -1.273  -25.126  1.00 52.35  ?  29   GLY B CA    1 
ATOM   1846  C  C     . GLY B 1  50   ? 68.969  -1.074  -24.554  1.00 54.66  ?  29   GLY B C     1 
ATOM   1847  O  O     . GLY B 1  50   ? 69.940  -1.546  -25.153  1.00 53.26  ?  29   GLY B O     1 
ATOM   1848  N  N     . PHE B 1  51   ? 69.087  -0.404  -23.406  1.00 55.10  ?  30   PHE B N     1 
ATOM   1849  C  CA    . PHE B 1  51   ? 70.395  -0.126  -22.822  1.00 51.34  ?  30   PHE B CA    1 
ATOM   1850  C  C     . PHE B 1  51   ? 71.033  -1.347  -22.178  1.00 46.88  ?  30   PHE B C     1 
ATOM   1851  O  O     . PHE B 1  51   ? 72.255  -1.356  -21.980  1.00 43.78  ?  30   PHE B O     1 
ATOM   1852  C  CB    . PHE B 1  51   ? 70.291  0.993   -21.784  1.00 55.58  ?  30   PHE B CB    1 
ATOM   1853  C  CG    . PHE B 1  51   ? 70.532  2.363   -22.346  1.00 57.02  ?  30   PHE B CG    1 
ATOM   1854  C  CD1   . PHE B 1  51   ? 71.730  2.665   -22.968  1.00 53.48  ?  30   PHE B CD1   1 
ATOM   1855  C  CD2   . PHE B 1  51   ? 69.568  3.349   -22.245  1.00 61.53  ?  30   PHE B CD2   1 
ATOM   1856  C  CE1   . PHE B 1  51   ? 71.961  3.922   -23.485  1.00 52.81  ?  30   PHE B CE1   1 
ATOM   1857  C  CE2   . PHE B 1  51   ? 69.793  4.609   -22.760  1.00 60.18  ?  30   PHE B CE2   1 
ATOM   1858  C  CZ    . PHE B 1  51   ? 70.992  4.895   -23.380  1.00 55.66  ?  30   PHE B CZ    1 
ATOM   1859  N  N     . GLY B 1  52   ? 70.242  -2.366  -21.840  1.00 45.64  ?  31   GLY B N     1 
ATOM   1860  C  CA    . GLY B 1  52   ? 70.818  -3.583  -21.298  1.00 43.62  ?  31   GLY B CA    1 
ATOM   1861  C  C     . GLY B 1  52   ? 71.786  -4.240  -22.261  1.00 44.45  ?  31   GLY B C     1 
ATOM   1862  O  O     . GLY B 1  52   ? 72.831  -4.754  -21.854  1.00 46.86  ?  31   GLY B O     1 
ATOM   1863  N  N     . TYR B 1  53   ? 71.461  -4.223  -23.553  1.00 41.71  ?  32   TYR B N     1 
ATOM   1864  C  CA    . TYR B 1  53   ? 72.367  -4.787  -24.543  1.00 41.65  ?  32   TYR B CA    1 
ATOM   1865  C  C     . TYR B 1  53   ? 73.508  -3.837  -24.878  1.00 44.84  ?  32   TYR B C     1 
ATOM   1866  O  O     . TYR B 1  53   ? 74.580  -4.289  -25.294  1.00 48.76  ?  32   TYR B O     1 
ATOM   1867  C  CB    . TYR B 1  53   ? 71.593  -5.166  -25.803  1.00 44.23  ?  32   TYR B CB    1 
ATOM   1868  C  CG    . TYR B 1  53   ? 70.543  -6.217  -25.538  1.00 48.98  ?  32   TYR B CG    1 
ATOM   1869  C  CD1   . TYR B 1  53   ? 69.253  -5.861  -25.177  1.00 47.38  ?  32   TYR B CD1   1 
ATOM   1870  C  CD2   . TYR B 1  53   ? 70.848  -7.568  -25.623  1.00 49.51  ?  32   TYR B CD2   1 
ATOM   1871  C  CE1   . TYR B 1  53   ? 68.295  -6.815  -24.921  1.00 47.15  ?  32   TYR B CE1   1 
ATOM   1872  C  CE2   . TYR B 1  53   ? 69.893  -8.533  -25.371  1.00 50.23  ?  32   TYR B CE2   1 
ATOM   1873  C  CZ    . TYR B 1  53   ? 68.617  -8.149  -25.021  1.00 52.14  ?  32   TYR B CZ    1 
ATOM   1874  O  OH    . TYR B 1  53   ? 67.658  -9.104  -24.765  1.00 54.97  ?  32   TYR B OH    1 
ATOM   1875  N  N     . THR B 1  54   ? 73.307  -2.531  -24.698  1.00 45.47  ?  33   THR B N     1 
ATOM   1876  C  CA    . THR B 1  54   ? 74.394  -1.588  -24.934  1.00 46.06  ?  33   THR B CA    1 
ATOM   1877  C  C     . THR B 1  54   ? 75.466  -1.712  -23.860  1.00 48.38  ?  33   THR B C     1 
ATOM   1878  O  O     . THR B 1  54   ? 76.657  -1.544  -24.142  1.00 50.86  ?  33   THR B O     1 
ATOM   1879  C  CB    . THR B 1  54   ? 73.855  -0.161  -24.986  1.00 47.96  ?  33   THR B CB    1 
ATOM   1880  O  OG1   . THR B 1  54   ? 73.559  0.282   -23.659  1.00 57.64  ?  33   THR B OG1   1 
ATOM   1881  C  CG2   . THR B 1  54   ? 72.587  -0.114  -25.804  1.00 46.55  ?  33   THR B CG2   1 
ATOM   1882  N  N     . LEU B 1  55   ? 75.061  -1.982  -22.618  1.00 45.72  ?  34   LEU B N     1 
ATOM   1883  C  CA    . LEU B 1  55   ? 76.039  -2.231  -21.565  1.00 45.36  ?  34   LEU B CA    1 
ATOM   1884  C  C     . LEU B 1  55   ? 76.548  -3.668  -21.561  1.00 47.00  ?  34   LEU B C     1 
ATOM   1885  O  O     . LEU B 1  55   ? 77.686  -3.911  -21.151  1.00 47.96  ?  34   LEU B O     1 
ATOM   1886  C  CB    . LEU B 1  55   ? 75.441  -1.906  -20.199  1.00 45.05  ?  34   LEU B CB    1 
ATOM   1887  C  CG    . LEU B 1  55   ? 74.718  -0.569  -20.055  1.00 49.86  ?  34   LEU B CG    1 
ATOM   1888  C  CD1   . LEU B 1  55   ? 74.283  -0.363  -18.614  1.00 50.63  ?  34   LEU B CD1   1 
ATOM   1889  C  CD2   . LEU B 1  55   ? 75.589  0.576   -20.526  1.00 51.94  ?  34   LEU B CD2   1 
ATOM   1890  N  N     . GLY B 1  56   ? 75.734  -4.625  -22.000  1.00 47.04  ?  35   GLY B N     1 
ATOM   1891  C  CA    . GLY B 1  56   ? 76.001  -6.022  -21.707  1.00 47.99  ?  35   GLY B CA    1 
ATOM   1892  C  C     . GLY B 1  56   ? 77.244  -6.638  -22.318  1.00 47.71  ?  35   GLY B C     1 
ATOM   1893  O  O     . GLY B 1  56   ? 78.130  -7.099  -21.589  1.00 50.09  ?  35   GLY B O     1 
ATOM   1894  N  N     . ASN B 1  57   ? 77.340  -6.636  -23.649  1.00 46.80  ?  36   ASN B N     1 
ATOM   1895  C  CA    . ASN B 1  57   ? 78.490  -7.267  -24.287  1.00 47.01  ?  36   ASN B CA    1 
ATOM   1896  C  C     . ASN B 1  57   ? 79.765  -6.478  -24.036  1.00 45.82  ?  36   ASN B C     1 
ATOM   1897  O  O     . ASN B 1  57   ? 80.842  -7.070  -23.906  1.00 43.86  ?  36   ASN B O     1 
ATOM   1898  C  CB    . ASN B 1  57   ? 78.248  -7.429  -25.787  1.00 47.77  ?  36   ASN B CB    1 
ATOM   1899  C  CG    . ASN B 1  57   ? 79.301  -8.294  -26.457  1.00 48.23  ?  36   ASN B CG    1 
ATOM   1900  O  OD1   . ASN B 1  57   ? 79.998  -9.064  -25.798  1.00 53.35  ?  36   ASN B OD1   1 
ATOM   1901  N  ND2   . ASN B 1  57   ? 79.419  -8.172  -27.773  1.00 44.00  ?  36   ASN B ND2   1 
ATOM   1902  N  N     . SER B 1  58   ? 79.664  -5.151  -23.952  1.00 45.05  ?  37   SER B N     1 
ATOM   1903  C  CA    . SER B 1  58   ? 80.839  -4.341  -23.655  1.00 45.01  ?  37   SER B CA    1 
ATOM   1904  C  C     . SER B 1  58   ? 81.339  -4.596  -22.240  1.00 46.52  ?  37   SER B C     1 
ATOM   1905  O  O     . SER B 1  58   ? 82.550  -4.600  -21.996  1.00 48.15  ?  37   SER B O     1 
ATOM   1906  C  CB    . SER B 1  58   ? 80.522  -2.862  -23.863  1.00 43.33  ?  37   SER B CB    1 
ATOM   1907  O  OG    . SER B 1  58   ? 80.400  -2.563  -25.243  1.00 42.45  ?  37   SER B OG    1 
ATOM   1908  N  N     . LEU B 1  59   ? 80.425  -4.822  -21.298  1.00 47.41  ?  38   LEU B N     1 
ATOM   1909  C  CA    . LEU B 1  59   ? 80.839  -5.129  -19.935  1.00 43.57  ?  38   LEU B CA    1 
ATOM   1910  C  C     . LEU B 1  59   ? 81.439  -6.523  -19.840  1.00 46.55  ?  38   LEU B C     1 
ATOM   1911  O  O     . LEU B 1  59   ? 82.418  -6.734  -19.116  1.00 53.74  ?  38   LEU B O     1 
ATOM   1912  C  CB    . LEU B 1  59   ? 79.659  -4.992  -18.980  1.00 45.66  ?  38   LEU B CB    1 
ATOM   1913  C  CG    . LEU B 1  59   ? 79.676  -3.710  -18.157  1.00 49.09  ?  38   LEU B CG    1 
ATOM   1914  C  CD1   . LEU B 1  59   ? 78.547  -3.714  -17.146  1.00 51.71  ?  38   LEU B CD1   1 
ATOM   1915  C  CD2   . LEU B 1  59   ? 81.019  -3.555  -17.468  1.00 51.18  ?  38   LEU B CD2   1 
ATOM   1916  N  N     . ARG B 1  60   ? 80.870  -7.489  -20.561  1.00 44.26  ?  39   ARG B N     1 
ATOM   1917  C  CA    . ARG B 1  60   ? 81.432  -8.834  -20.533  1.00 42.74  ?  39   ARG B CA    1 
ATOM   1918  C  C     . ARG B 1  60   ? 82.825  -8.861  -21.151  1.00 45.89  ?  39   ARG B C     1 
ATOM   1919  O  O     . ARG B 1  60   ? 83.779  -9.359  -20.539  1.00 50.71  ?  39   ARG B O     1 
ATOM   1920  C  CB    . ARG B 1  60   ? 80.503  -9.805  -21.256  1.00 43.91  ?  39   ARG B CB    1 
ATOM   1921  C  CG    . ARG B 1  60   ? 81.047  -11.208 -21.312  1.00 43.43  ?  39   ARG B CG    1 
ATOM   1922  C  CD    . ARG B 1  60   ? 80.101  -12.146 -22.007  1.00 41.45  ?  39   ARG B CD    1 
ATOM   1923  N  NE    . ARG B 1  60   ? 80.738  -13.435 -22.237  1.00 43.40  ?  39   ARG B NE    1 
ATOM   1924  C  CZ    . ARG B 1  60   ? 81.548  -13.688 -23.257  1.00 48.80  ?  39   ARG B CZ    1 
ATOM   1925  N  NH1   . ARG B 1  60   ? 81.817  -12.737 -24.140  1.00 50.69  ?  39   ARG B NH1   1 
ATOM   1926  N  NH2   . ARG B 1  60   ? 82.087  -14.889 -23.394  1.00 47.90  ?  39   ARG B NH2   1 
ATOM   1927  N  N     . ARG B 1  61   ? 82.963  -8.320  -22.364  1.00 49.50  ?  40   ARG B N     1 
ATOM   1928  C  CA    . ARG B 1  61   ? 84.265  -8.313  -23.022  1.00 51.39  ?  40   ARG B CA    1 
ATOM   1929  C  C     . ARG B 1  61   ? 85.268  -7.443  -22.278  1.00 50.67  ?  40   ARG B C     1 
ATOM   1930  O  O     . ARG B 1  61   ? 86.473  -7.709  -22.334  1.00 52.72  ?  40   ARG B O     1 
ATOM   1931  C  CB    . ARG B 1  61   ? 84.126  -7.838  -24.467  1.00 48.84  ?  40   ARG B CB    1 
ATOM   1932  C  CG    . ARG B 1  61   ? 85.279  -8.259  -25.359  1.00 52.53  ?  40   ARG B CG    1 
ATOM   1933  C  CD    . ARG B 1  61   ? 85.320  -9.771  -25.498  1.00 56.59  ?  40   ARG B CD    1 
ATOM   1934  N  NE    . ARG B 1  61   ? 84.104  -10.284 -26.122  1.00 62.97  ?  40   ARG B NE    1 
ATOM   1935  C  CZ    . ARG B 1  61   ? 84.010  -10.637 -27.400  1.00 59.46  ?  40   ARG B CZ    1 
ATOM   1936  N  NH1   . ARG B 1  61   ? 85.066  -10.546 -28.195  1.00 51.87  ?  40   ARG B NH1   1 
ATOM   1937  N  NH2   . ARG B 1  61   ? 82.861  -11.090 -27.881  1.00 56.61  ?  40   ARG B NH2   1 
ATOM   1938  N  N     . THR B 1  62   ? 84.801  -6.404  -21.582  1.00 48.11  ?  41   THR B N     1 
ATOM   1939  C  CA    . THR B 1  62   ? 85.711  -5.601  -20.772  1.00 50.24  ?  41   THR B CA    1 
ATOM   1940  C  C     . THR B 1  62   ? 86.209  -6.393  -19.574  1.00 52.26  ?  41   THR B C     1 
ATOM   1941  O  O     . THR B 1  62   ? 87.409  -6.406  -19.280  1.00 53.58  ?  41   THR B O     1 
ATOM   1942  C  CB    . THR B 1  62   ? 85.029  -4.317  -20.304  1.00 53.03  ?  41   THR B CB    1 
ATOM   1943  O  OG1   . THR B 1  62   ? 84.462  -3.634  -21.426  1.00 59.09  ?  41   THR B OG1   1 
ATOM   1944  C  CG2   . THR B 1  62   ? 86.036  -3.408  -19.626  1.00 48.58  ?  41   THR B CG2   1 
ATOM   1945  N  N     . LEU B 1  63   ? 85.295  -7.057  -18.865  1.00 49.52  ?  42   LEU B N     1 
ATOM   1946  C  CA    . LEU B 1  63   ? 85.699  -7.902  -17.749  1.00 46.15  ?  42   LEU B CA    1 
ATOM   1947  C  C     . LEU B 1  63   ? 86.695  -8.963  -18.196  1.00 49.69  ?  42   LEU B C     1 
ATOM   1948  O  O     . LEU B 1  63   ? 87.675  -9.238  -17.495  1.00 55.06  ?  42   LEU B O     1 
ATOM   1949  C  CB    . LEU B 1  63   ? 84.473  -8.552  -17.115  1.00 44.08  ?  42   LEU B CB    1 
ATOM   1950  C  CG    . LEU B 1  63   ? 83.627  -7.634  -16.238  1.00 48.72  ?  42   LEU B CG    1 
ATOM   1951  C  CD1   . LEU B 1  63   ? 82.235  -8.210  -16.057  1.00 47.83  ?  42   LEU B CD1   1 
ATOM   1952  C  CD2   . LEU B 1  63   ? 84.301  -7.429  -14.896  1.00 51.02  ?  42   LEU B CD2   1 
ATOM   1953  N  N     . LEU B 1  64   ? 86.473  -9.559  -19.367  1.00 50.62  ?  43   LEU B N     1 
ATOM   1954  C  CA    . LEU B 1  64   ? 87.364  -10.623 -19.818  1.00 50.77  ?  43   LEU B CA    1 
ATOM   1955  C  C     . LEU B 1  64   ? 88.720  -10.082 -20.261  1.00 51.98  ?  43   LEU B C     1 
ATOM   1956  O  O     . LEU B 1  64   ? 89.763  -10.540 -19.784  1.00 54.96  ?  43   LEU B O     1 
ATOM   1957  C  CB    . LEU B 1  64   ? 86.702  -11.416 -20.944  1.00 54.04  ?  43   LEU B CB    1 
ATOM   1958  C  CG    . LEU B 1  64   ? 86.234  -12.820 -20.559  1.00 52.72  ?  43   LEU B CG    1 
ATOM   1959  C  CD1   . LEU B 1  64   ? 85.328  -12.781 -19.343  1.00 46.56  ?  43   LEU B CD1   1 
ATOM   1960  C  CD2   . LEU B 1  64   ? 85.530  -13.484 -21.727  1.00 55.19  ?  43   LEU B CD2   1 
ATOM   1961  N  N     . SER B 1  65   ? 88.733  -9.126  -21.194  1.00 54.90  ?  44   SER B N     1 
ATOM   1962  C  CA    . SER B 1  65   ? 89.971  -8.749  -21.869  1.00 55.14  ?  44   SER B CA    1 
ATOM   1963  C  C     . SER B 1  65   ? 90.700  -7.539  -21.286  1.00 51.80  ?  44   SER B C     1 
ATOM   1964  O  O     . SER B 1  65   ? 91.850  -7.305  -21.665  1.00 52.13  ?  44   SER B O     1 
ATOM   1965  C  CB    . SER B 1  65   ? 89.686  -8.473  -23.351  1.00 55.82  ?  44   SER B CB    1 
ATOM   1966  O  OG    . SER B 1  65   ? 88.976  -9.545  -23.943  1.00 56.78  ?  44   SER B OG    1 
ATOM   1967  N  N     . SER B 1  66   ? 90.078  -6.745  -20.416  1.00 52.73  ?  45   SER B N     1 
ATOM   1968  C  CA    . SER B 1  66   ? 90.666  -5.458  -20.051  1.00 55.49  ?  45   SER B CA    1 
ATOM   1969  C  C     . SER B 1  66   ? 91.362  -5.415  -18.695  1.00 52.40  ?  45   SER B C     1 
ATOM   1970  O  O     . SER B 1  66   ? 91.934  -4.376  -18.356  1.00 53.60  ?  45   SER B O     1 
ATOM   1971  C  CB    . SER B 1  66   ? 89.606  -4.355  -20.109  1.00 60.54  ?  45   SER B CB    1 
ATOM   1972  O  OG    . SER B 1  66   ? 89.662  -3.687  -21.357  1.00 62.85  ?  45   SER B OG    1 
ATOM   1973  N  N     . ILE B 1  67   ? 91.341  -6.480  -17.910  1.00 53.63  ?  46   ILE B N     1 
ATOM   1974  C  CA    . ILE B 1  67   ? 91.909  -6.465  -16.562  1.00 55.65  ?  46   ILE B CA    1 
ATOM   1975  C  C     . ILE B 1  67   ? 93.282  -7.126  -16.605  1.00 60.21  ?  46   ILE B C     1 
ATOM   1976  O  O     . ILE B 1  67   ? 93.392  -8.262  -17.084  1.00 58.44  ?  46   ILE B O     1 
ATOM   1977  C  CB    . ILE B 1  67   ? 90.996  -7.166  -15.541  1.00 50.98  ?  46   ILE B CB    1 
ATOM   1978  C  CG1   . ILE B 1  67   ? 89.632  -6.480  -15.494  1.00 50.98  ?  46   ILE B CG1   1 
ATOM   1979  C  CG2   . ILE B 1  67   ? 91.625  -7.130  -14.162  1.00 48.76  ?  46   ILE B CG2   1 
ATOM   1980  C  CD1   . ILE B 1  67   ? 88.733  -6.984  -14.391  1.00 49.29  ?  46   ILE B CD1   1 
ATOM   1981  N  N     . PRO B 1  68   ? 94.333  -6.462  -16.132  1.00 59.22  ?  47   PRO B N     1 
ATOM   1982  C  CA    . PRO B 1  68   ? 95.666  -7.065  -16.161  1.00 56.45  ?  47   PRO B CA    1 
ATOM   1983  C  C     . PRO B 1  68   ? 95.837  -8.122  -15.084  1.00 55.68  ?  47   PRO B C     1 
ATOM   1984  O  O     . PRO B 1  68   ? 95.294  -8.024  -13.982  1.00 54.34  ?  47   PRO B O     1 
ATOM   1985  C  CB    . PRO B 1  68   ? 96.591  -5.869  -15.909  1.00 56.02  ?  47   PRO B CB    1 
ATOM   1986  C  CG    . PRO B 1  68   ? 95.769  -4.956  -15.069  1.00 54.33  ?  47   PRO B CG    1 
ATOM   1987  C  CD    . PRO B 1  68   ? 94.353  -5.104  -15.561  1.00 55.03  ?  47   PRO B CD    1 
ATOM   1988  N  N     . GLY B 1  69   ? 96.620  -9.144  -15.423  1.00 53.99  ?  48   GLY B N     1 
ATOM   1989  C  CA    . GLY B 1  69   ? 96.936  -10.214 -14.504  1.00 53.41  ?  48   GLY B CA    1 
ATOM   1990  C  C     . GLY B 1  69   ? 98.260  -10.841 -14.881  1.00 58.77  ?  48   GLY B C     1 
ATOM   1991  O  O     . GLY B 1  69   ? 98.917  -10.422 -15.835  1.00 60.25  ?  48   GLY B O     1 
ATOM   1992  N  N     . ALA B 1  70   ? 98.649  -11.862 -14.122  1.00 57.39  ?  49   ALA B N     1 
ATOM   1993  C  CA    . ALA B 1  70   ? 99.915  -12.551 -14.323  1.00 57.11  ?  49   ALA B CA    1 
ATOM   1994  C  C     . ALA B 1  70   ? 99.659  -13.996 -14.722  1.00 52.39  ?  49   ALA B C     1 
ATOM   1995  O  O     . ALA B 1  70   ? 98.721  -14.630 -14.229  1.00 50.87  ?  49   ALA B O     1 
ATOM   1996  C  CB    . ALA B 1  70   ? 100.778 -12.502 -13.060  1.00 63.24  ?  49   ALA B CB    1 
ATOM   1997  N  N     . ALA B 1  71   ? 100.500 -14.518 -15.612  1.00 50.67  ?  50   ALA B N     1 
ATOM   1998  C  CA    . ALA B 1  71   ? 100.307 -15.874 -16.098  1.00 47.94  ?  50   ALA B CA    1 
ATOM   1999  C  C     . ALA B 1  71   ? 101.636 -16.470 -16.531  1.00 51.20  ?  50   ALA B C     1 
ATOM   2000  O  O     . ALA B 1  71   ? 102.599 -15.758 -16.830  1.00 53.05  ?  50   ALA B O     1 
ATOM   2001  C  CB    . ALA B 1  71   ? 99.313  -15.917 -17.261  1.00 45.68  ?  50   ALA B CB    1 
ATOM   2002  N  N     . VAL B 1  72   ? 101.666 -17.798 -16.564  1.00 50.29  ?  51   VAL B N     1 
ATOM   2003  C  CA    . VAL B 1  72   ? 102.800 -18.538 -17.096  1.00 49.56  ?  51   VAL B CA    1 
ATOM   2004  C  C     . VAL B 1  72   ? 102.757 -18.480 -18.616  1.00 51.48  ?  51   VAL B C     1 
ATOM   2005  O  O     . VAL B 1  72   ? 101.702 -18.649 -19.235  1.00 55.43  ?  51   VAL B O     1 
ATOM   2006  C  CB    . VAL B 1  72   ? 102.786 -19.989 -16.584  1.00 47.32  ?  51   VAL B CB    1 
ATOM   2007  C  CG1   . VAL B 1  72   ? 103.911 -20.792 -17.212  1.00 49.03  ?  51   VAL B CG1   1 
ATOM   2008  C  CG2   . VAL B 1  72   ? 102.892 -20.016 -15.068  1.00 47.02  ?  51   VAL B CG2   1 
ATOM   2009  N  N     . THR B 1  73   ? 103.915 -18.235 -19.218  1.00 52.32  ?  52   THR B N     1 
ATOM   2010  C  CA    . THR B 1  73   ? 104.055 -18.049 -20.654  1.00 54.48  ?  52   THR B CA    1 
ATOM   2011  C  C     . THR B 1  73   ? 104.765 -19.227 -21.307  1.00 58.06  ?  52   THR B C     1 
ATOM   2012  O  O     . THR B 1  73   ? 104.213 -19.870 -22.202  1.00 59.71  ?  52   THR B O     1 
ATOM   2013  C  CB    . THR B 1  73   ? 104.803 -16.741 -20.930  1.00 59.26  ?  52   THR B CB    1 
ATOM   2014  O  OG1   . THR B 1  73   ? 104.054 -15.646 -20.391  1.00 60.50  ?  52   THR B OG1   1 
ATOM   2015  C  CG2   . THR B 1  73   ? 104.990 -16.537 -22.418  1.00 62.99  ?  52   THR B CG2   1 
ATOM   2016  N  N     . SER B 1  74   ? 106.002 -19.500 -20.909  1.00 58.17  ?  53   SER B N     1 
ATOM   2017  C  CA    . SER B 1  74   ? 106.726 -20.676 -21.356  1.00 59.64  ?  53   SER B CA    1 
ATOM   2018  C  C     . SER B 1  74   ? 107.209 -21.451 -20.141  1.00 59.65  ?  53   SER B C     1 
ATOM   2019  O  O     . SER B 1  74   ? 107.265 -20.924 -19.027  1.00 56.47  ?  53   SER B O     1 
ATOM   2020  C  CB    . SER B 1  74   ? 107.917 -20.303 -22.246  1.00 66.04  ?  53   SER B CB    1 
ATOM   2021  O  OG    . SER B 1  74   ? 108.831 -19.477 -21.543  1.00 65.86  ?  53   SER B OG    1 
ATOM   2022  N  N     . ILE B 1  75   ? 107.552 -22.719 -20.363  1.00 62.37  ?  54   ILE B N     1 
ATOM   2023  C  CA    . ILE B 1  75   ? 108.157 -23.538 -19.322  1.00 61.86  ?  54   ILE B CA    1 
ATOM   2024  C  C     . ILE B 1  75   ? 109.335 -24.304 -19.902  1.00 64.06  ?  54   ILE B C     1 
ATOM   2025  O  O     . ILE B 1  75   ? 109.347 -24.676 -21.080  1.00 65.66  ?  54   ILE B O     1 
ATOM   2026  C  CB    . ILE B 1  75   ? 107.158 -24.521 -18.668  1.00 58.22  ?  54   ILE B CB    1 
ATOM   2027  C  CG1   . ILE B 1  75   ? 106.475 -25.385 -19.728  1.00 60.18  ?  54   ILE B CG1   1 
ATOM   2028  C  CG2   . ILE B 1  75   ? 106.144 -23.776 -17.813  1.00 58.38  ?  54   ILE B CG2   1 
ATOM   2029  C  CD1   . ILE B 1  75   ? 105.601 -26.469 -19.148  1.00 56.10  ?  54   ILE B CD1   1 
ATOM   2030  N  N     . ARG B 1  76   ? 110.337 -24.518 -19.057  1.00 64.22  ?  55   ARG B N     1 
ATOM   2031  C  CA    . ARG B 1  76   ? 111.452 -25.412 -19.330  1.00 63.98  ?  55   ARG B CA    1 
ATOM   2032  C  C     . ARG B 1  76   ? 111.343 -26.596 -18.386  1.00 62.03  ?  55   ARG B C     1 
ATOM   2033  O  O     . ARG B 1  76   ? 111.186 -26.409 -17.178  1.00 62.41  ?  55   ARG B O     1 
ATOM   2034  C  CB    . ARG B 1  76   ? 112.794 -24.705 -19.123  1.00 68.69  ?  55   ARG B CB    1 
ATOM   2035  C  CG    . ARG B 1  76   ? 113.099 -23.608 -20.118  1.00 72.32  ?  55   ARG B CG    1 
ATOM   2036  C  CD    . ARG B 1  76   ? 113.513 -24.190 -21.453  1.00 73.42  ?  55   ARG B CD    1 
ATOM   2037  N  NE    . ARG B 1  76   ? 114.712 -25.016 -21.349  1.00 68.96  ?  55   ARG B NE    1 
ATOM   2038  C  CZ    . ARG B 1  76   ? 115.947 -24.564 -21.534  1.00 63.06  ?  55   ARG B CZ    1 
ATOM   2039  N  NH1   . ARG B 1  76   ? 116.148 -23.289 -21.832  1.00 66.53  ?  55   ARG B NH1   1 
ATOM   2040  N  NH2   . ARG B 1  76   ? 116.980 -25.386 -21.422  1.00 58.54  ?  55   ARG B NH2   1 
ATOM   2041  N  N     . ILE B 1  77   ? 111.412 -27.806 -18.927  1.00 58.55  ?  56   ILE B N     1 
ATOM   2042  C  CA    . ILE B 1  77   ? 111.418 -29.019 -18.119  1.00 61.67  ?  56   ILE B CA    1 
ATOM   2043  C  C     . ILE B 1  77   ? 112.705 -29.767 -18.427  1.00 65.68  ?  56   ILE B C     1 
ATOM   2044  O  O     . ILE B 1  77   ? 112.892 -30.262 -19.546  1.00 67.75  ?  56   ILE B O     1 
ATOM   2045  C  CB    . ILE B 1  77   ? 110.188 -29.898 -18.381  1.00 59.81  ?  56   ILE B CB    1 
ATOM   2046  C  CG1   . ILE B 1  77   ? 108.925 -29.218 -17.857  1.00 59.73  ?  56   ILE B CG1   1 
ATOM   2047  C  CG2   . ILE B 1  77   ? 110.360 -31.262 -17.735  1.00 62.46  ?  56   ILE B CG2   1 
ATOM   2048  C  CD1   . ILE B 1  77   ? 107.669 -30.016 -18.096  1.00 56.83  ?  56   ILE B CD1   1 
ATOM   2049  N  N     . ASP B 1  78   ? 113.593 -29.848 -17.440  1.00 63.77  ?  57   ASP B N     1 
ATOM   2050  C  CA    . ASP B 1  78   ? 114.838 -30.578 -17.620  1.00 66.04  ?  57   ASP B CA    1 
ATOM   2051  C  C     . ASP B 1  78   ? 114.546 -32.049 -17.883  1.00 64.46  ?  57   ASP B C     1 
ATOM   2052  O  O     . ASP B 1  78   ? 113.810 -32.694 -17.131  1.00 61.68  ?  57   ASP B O     1 
ATOM   2053  C  CB    . ASP B 1  78   ? 115.726 -30.419 -16.386  1.00 73.02  ?  57   ASP B CB    1 
ATOM   2054  C  CG    . ASP B 1  78   ? 117.063 -31.128 -16.527  1.00 81.96  ?  57   ASP B CG    1 
ATOM   2055  O  OD1   . ASP B 1  78   ? 117.432 -31.496 -17.663  1.00 86.19  ?  57   ASP B OD1   1 
ATOM   2056  O  OD2   . ASP B 1  78   ? 117.751 -31.309 -15.500  1.00 81.92  ?  57   ASP B OD2   1 
ATOM   2057  N  N     . GLY B 1  79   ? 115.117 -32.573 -18.961  1.00 61.06  ?  58   GLY B N     1 
ATOM   2058  C  CA    . GLY B 1  79   ? 114.932 -33.958 -19.340  1.00 67.77  ?  58   GLY B CA    1 
ATOM   2059  C  C     . GLY B 1  79   ? 114.044 -34.173 -20.544  1.00 72.13  ?  58   GLY B C     1 
ATOM   2060  O  O     . GLY B 1  79   ? 113.956 -35.309 -21.027  1.00 67.05  ?  58   GLY B O     1 
ATOM   2061  N  N     . VAL B 1  80   ? 113.374 -33.136 -21.042  1.00 69.73  ?  59   VAL B N     1 
ATOM   2062  C  CA    . VAL B 1  80   ? 112.585 -33.228 -22.265  1.00 71.56  ?  59   VAL B CA    1 
ATOM   2063  C  C     . VAL B 1  80   ? 113.091 -32.167 -23.232  1.00 68.76  ?  59   VAL B C     1 
ATOM   2064  O  O     . VAL B 1  80   ? 113.268 -31.003 -22.854  1.00 63.15  ?  59   VAL B O     1 
ATOM   2065  C  CB    . VAL B 1  80   ? 111.074 -33.082 -21.996  1.00 70.16  ?  59   VAL B CB    1 
ATOM   2066  C  CG1   . VAL B 1  80   ? 110.750 -31.752 -21.348  1.00 66.58  ?  59   VAL B CG1   1 
ATOM   2067  C  CG2   . VAL B 1  80   ? 110.284 -33.262 -23.284  1.00 71.62  ?  59   VAL B CG2   1 
ATOM   2068  N  N     . LEU B 1  81   ? 113.355 -32.580 -24.469  1.00 70.11  ?  60   LEU B N     1 
ATOM   2069  C  CA    . LEU B 1  81   ? 113.999 -31.701 -25.434  1.00 73.12  ?  60   LEU B CA    1 
ATOM   2070  C  C     . LEU B 1  81   ? 113.253 -31.686 -26.760  1.00 73.45  ?  60   LEU B C     1 
ATOM   2071  O  O     . LEU B 1  81   ? 112.708 -30.654 -27.163  1.00 73.29  ?  60   LEU B O     1 
ATOM   2072  C  CB    . LEU B 1  81   ? 115.449 -32.135 -25.649  1.00 74.49  ?  60   LEU B CB    1 
ATOM   2073  C  CG    . LEU B 1  81   ? 116.475 -31.024 -25.859  1.00 72.32  ?  60   LEU B CG    1 
ATOM   2074  C  CD1   . LEU B 1  81   ? 116.636 -30.204 -24.588  1.00 65.81  ?  60   LEU B CD1   1 
ATOM   2075  C  CD2   . LEU B 1  81   ? 117.807 -31.611 -26.299  1.00 70.15  ?  60   LEU B CD2   1 
ATOM   2076  N  N     . HIS B 1  82   ? 113.231 -32.827 -27.449  1.00 73.00  ?  61   HIS B N     1 
ATOM   2077  C  CA    . HIS B 1  82   ? 112.687 -32.913 -28.799  1.00 76.81  ?  61   HIS B CA    1 
ATOM   2078  C  C     . HIS B 1  82   ? 111.280 -33.500 -28.813  1.00 79.45  ?  61   HIS B C     1 
ATOM   2079  O  O     . HIS B 1  82   ? 110.328 -32.819 -29.203  1.00 81.67  ?  61   HIS B O     1 
ATOM   2080  C  CB    . HIS B 1  82   ? 113.634 -33.731 -29.686  1.00 78.80  ?  61   HIS B CB    1 
ATOM   2081  C  CG    . HIS B 1  82   ? 115.008 -33.145 -29.792  1.00 74.66  ?  61   HIS B CG    1 
ATOM   2082  N  ND1   . HIS B 1  82   ? 115.317 -31.887 -29.323  1.00 72.07  ?  61   HIS B ND1   1 
ATOM   2083  C  CD2   . HIS B 1  82   ? 116.156 -33.646 -30.308  1.00 69.00  ?  61   HIS B CD2   1 
ATOM   2084  C  CE1   . HIS B 1  82   ? 116.595 -31.637 -29.546  1.00 67.51  ?  61   HIS B CE1   1 
ATOM   2085  N  NE2   . HIS B 1  82   ? 117.127 -32.688 -30.143  1.00 66.68  ?  61   HIS B NE2   1 
ATOM   2086  N  N     . GLU B 1  83   ? 111.128 -34.758 -28.408  1.00 82.79  ?  62   GLU B N     1 
ATOM   2087  C  CA    . GLU B 1  83   ? 109.806 -35.354 -28.288  1.00 84.27  ?  62   GLU B CA    1 
ATOM   2088  C  C     . GLU B 1  83   ? 109.234 -35.022 -26.915  1.00 78.50  ?  62   GLU B C     1 
ATOM   2089  O  O     . GLU B 1  83   ? 109.892 -35.234 -25.891  1.00 74.31  ?  62   GLU B O     1 
ATOM   2090  C  CB    . GLU B 1  83   ? 109.848 -36.870 -28.514  1.00 83.98  ?  62   GLU B CB    1 
ATOM   2091  C  CG    . GLU B 1  83   ? 110.534 -37.699 -27.431  1.00 84.30  ?  62   GLU B CG    1 
ATOM   2092  C  CD    . GLU B 1  83   ? 112.030 -37.811 -27.628  1.00 92.75  ?  62   GLU B CD    1 
ATOM   2093  O  OE1   . GLU B 1  83   ? 112.503 -37.558 -28.755  1.00 91.41  ?  62   GLU B OE1   1 
ATOM   2094  O  OE2   . GLU B 1  83   ? 112.733 -38.158 -26.654  1.00 95.83  ?  62   GLU B OE2   1 
ATOM   2095  N  N     . PHE B 1  84   ? 108.030 -34.462 -26.895  1.00 74.65  ?  63   PHE B N     1 
ATOM   2096  C  CA    . PHE B 1  84   ? 107.341 -34.178 -25.643  1.00 70.88  ?  63   PHE B CA    1 
ATOM   2097  C  C     . PHE B 1  84   ? 106.248 -35.227 -25.505  1.00 72.09  ?  63   PHE B C     1 
ATOM   2098  O  O     . PHE B 1  84   ? 105.189 -35.121 -26.129  1.00 72.45  ?  63   PHE B O     1 
ATOM   2099  C  CB    . PHE B 1  84   ? 106.767 -32.764 -25.643  1.00 69.43  ?  63   PHE B CB    1 
ATOM   2100  C  CG    . PHE B 1  84   ? 107.622 -31.766 -26.368  1.00 70.77  ?  63   PHE B CG    1 
ATOM   2101  C  CD1   . PHE B 1  84   ? 108.622 -31.080 -25.705  1.00 69.24  ?  63   PHE B CD1   1 
ATOM   2102  C  CD2   . PHE B 1  84   ? 107.428 -31.518 -27.717  1.00 72.27  ?  63   PHE B CD2   1 
ATOM   2103  C  CE1   . PHE B 1  84   ? 109.412 -30.164 -26.370  1.00 66.23  ?  63   PHE B CE1   1 
ATOM   2104  C  CE2   . PHE B 1  84   ? 108.215 -30.605 -28.388  1.00 71.91  ?  63   PHE B CE2   1 
ATOM   2105  C  CZ    . PHE B 1  84   ? 109.208 -29.927 -27.713  1.00 71.35  ?  63   PHE B CZ    1 
ATOM   2106  N  N     . THR B 1  85   ? 106.506 -36.232 -24.673  1.00 74.40  ?  64   THR B N     1 
ATOM   2107  C  CA    . THR B 1  85   ? 105.519 -37.262 -24.389  1.00 69.97  ?  64   THR B CA    1 
ATOM   2108  C  C     . THR B 1  85   ? 105.464 -37.547 -22.897  1.00 69.92  ?  64   THR B C     1 
ATOM   2109  O  O     . THR B 1  85   ? 104.509 -37.165 -22.216  1.00 72.45  ?  64   THR B O     1 
ATOM   2110  C  CB    . THR B 1  85   ? 105.843 -38.542 -25.161  1.00 73.57  ?  64   THR B CB    1 
ATOM   2111  O  OG1   . THR B 1  85   ? 107.236 -38.845 -25.019  1.00 72.14  ?  64   THR B OG1   1 
ATOM   2112  C  CG2   . THR B 1  85   ? 105.511 -38.379 -26.636  1.00 73.88  ?  64   THR B CG2   1 
ATOM   2113  N  N     . THR B 1  86   ? 106.512 -38.185 -22.382  1.00 68.01  ?  65   THR B N     1 
ATOM   2114  C  CA    . THR B 1  86   ? 106.555 -38.647 -21.005  1.00 68.37  ?  65   THR B CA    1 
ATOM   2115  C  C     . THR B 1  86   ? 107.828 -38.154 -20.339  1.00 69.19  ?  65   THR B C     1 
ATOM   2116  O  O     . THR B 1  86   ? 108.858 -37.962 -20.991  1.00 74.13  ?  65   THR B O     1 
ATOM   2117  C  CB    . THR B 1  86   ? 106.500 -40.181 -20.915  1.00 67.51  ?  65   THR B CB    1 
ATOM   2118  O  OG1   . THR B 1  86   ? 107.591 -40.744 -21.653  1.00 68.34  ?  65   THR B OG1   1 
ATOM   2119  C  CG2   . THR B 1  86   ? 105.190 -40.709 -21.478  1.00 70.37  ?  65   THR B CG2   1 
ATOM   2120  N  N     . VAL B 1  87   ? 107.746 -37.952 -19.034  1.00 68.60  ?  66   VAL B N     1 
ATOM   2121  C  CA    . VAL B 1  87   ? 108.892 -37.590 -18.208  1.00 68.01  ?  66   VAL B CA    1 
ATOM   2122  C  C     . VAL B 1  87   ? 109.252 -38.807 -17.365  1.00 71.24  ?  66   VAL B C     1 
ATOM   2123  O  O     . VAL B 1  87   ? 108.400 -39.307 -16.619  1.00 71.13  ?  66   VAL B O     1 
ATOM   2124  C  CB    . VAL B 1  87   ? 108.593 -36.372 -17.321  1.00 65.52  ?  66   VAL B CB    1 
ATOM   2125  C  CG1   . VAL B 1  87   ? 109.816 -36.007 -16.500  1.00 61.47  ?  66   VAL B CG1   1 
ATOM   2126  C  CG2   . VAL B 1  87   ? 108.148 -35.197 -18.173  1.00 65.19  ?  66   VAL B CG2   1 
ATOM   2127  N  N     . PRO B 1  88   ? 110.474 -39.326 -17.461  1.00 73.23  ?  67   PRO B N     1 
ATOM   2128  C  CA    . PRO B 1  88   ? 110.841 -40.498 -16.657  1.00 72.06  ?  67   PRO B CA    1 
ATOM   2129  C  C     . PRO B 1  88   ? 110.779 -40.182 -15.170  1.00 71.65  ?  67   PRO B C     1 
ATOM   2130  O  O     . PRO B 1  88   ? 111.271 -39.148 -14.714  1.00 68.01  ?  67   PRO B O     1 
ATOM   2131  C  CB    . PRO B 1  88   ? 112.271 -40.809 -17.116  1.00 65.91  ?  67   PRO B CB    1 
ATOM   2132  C  CG    . PRO B 1  88   ? 112.777 -39.523 -17.683  1.00 67.89  ?  67   PRO B CG    1 
ATOM   2133  C  CD    . PRO B 1  88   ? 111.586 -38.860 -18.305  1.00 69.43  ?  67   PRO B CD    1 
ATOM   2134  N  N     . GLY B 1  89   ? 110.155 -41.082 -14.416  1.00 69.95  ?  68   GLY B N     1 
ATOM   2135  C  CA    . GLY B 1  89   ? 109.992 -40.886 -12.992  1.00 70.23  ?  68   GLY B CA    1 
ATOM   2136  C  C     . GLY B 1  89   ? 108.830 -40.008 -12.594  1.00 69.67  ?  68   GLY B C     1 
ATOM   2137  O  O     . GLY B 1  89   ? 108.687 -39.701 -11.405  1.00 70.17  ?  68   GLY B O     1 
ATOM   2138  N  N     . VAL B 1  90   ? 108.001 -39.585 -13.544  1.00 69.28  ?  69   VAL B N     1 
ATOM   2139  C  CA    . VAL B 1  90   ? 106.812 -38.792 -13.265  1.00 63.24  ?  69   VAL B CA    1 
ATOM   2140  C  C     . VAL B 1  90   ? 105.605 -39.524 -13.831  1.00 66.39  ?  69   VAL B C     1 
ATOM   2141  O  O     . VAL B 1  90   ? 105.651 -40.046 -14.951  1.00 66.63  ?  69   VAL B O     1 
ATOM   2142  C  CB    . VAL B 1  90   ? 106.919 -37.370 -13.853  1.00 59.39  ?  69   VAL B CB    1 
ATOM   2143  C  CG1   . VAL B 1  90   ? 105.678 -36.559 -13.517  1.00 62.43  ?  69   VAL B CG1   1 
ATOM   2144  C  CG2   . VAL B 1  90   ? 108.160 -36.673 -13.333  1.00 65.03  ?  69   VAL B CG2   1 
ATOM   2145  N  N     . LYS B 1  91   ? 104.526 -39.572 -13.048  1.00 63.05  ?  70   LYS B N     1 
ATOM   2146  C  CA    . LYS B 1  91   ? 103.305 -40.222 -13.512  1.00 64.71  ?  70   LYS B CA    1 
ATOM   2147  C  C     . LYS B 1  91   ? 102.635 -39.408 -14.611  1.00 68.87  ?  70   LYS B C     1 
ATOM   2148  O  O     . LYS B 1  91   ? 102.275 -39.946 -15.664  1.00 70.49  ?  70   LYS B O     1 
ATOM   2149  C  CB    . LYS B 1  91   ? 102.349 -40.435 -12.338  1.00 69.71  ?  70   LYS B CB    1 
ATOM   2150  C  CG    . LYS B 1  91   ? 100.993 -41.001 -12.722  1.00 73.02  ?  70   LYS B CG    1 
ATOM   2151  C  CD    . LYS B 1  91   ? 100.023 -40.926 -11.553  1.00 75.82  ?  70   LYS B CD    1 
ATOM   2152  C  CE    . LYS B 1  91   ? 98.635  -41.416 -11.940  1.00 82.17  ?  70   LYS B CE    1 
ATOM   2153  N  NZ    . LYS B 1  91   ? 98.617  -42.873 -12.251  1.00 84.12  ?  70   LYS B NZ    1 
ATOM   2154  N  N     . GLU B 1  92   ? 102.462 -38.107 -14.386  1.00 67.01  ?  71   GLU B N     1 
ATOM   2155  C  CA    . GLU B 1  92   ? 101.828 -37.253 -15.379  1.00 65.62  ?  71   GLU B CA    1 
ATOM   2156  C  C     . GLU B 1  92   ? 102.721 -37.094 -16.600  1.00 67.00  ?  71   GLU B C     1 
ATOM   2157  O  O     . GLU B 1  92   ? 103.944 -36.979 -16.485  1.00 65.26  ?  71   GLU B O     1 
ATOM   2158  C  CB    . GLU B 1  92   ? 101.519 -35.878 -14.787  1.00 63.89  ?  71   GLU B CB    1 
ATOM   2159  C  CG    . GLU B 1  92   ? 100.467 -35.876 -13.695  1.00 65.47  ?  71   GLU B CG    1 
ATOM   2160  C  CD    . GLU B 1  92   ? 101.030 -36.223 -12.335  1.00 62.75  ?  71   GLU B CD    1 
ATOM   2161  O  OE1   . GLU B 1  92   ? 102.255 -36.431 -12.231  1.00 62.16  ?  71   GLU B OE1   1 
ATOM   2162  O  OE2   . GLU B 1  92   ? 100.246 -36.282 -11.367  1.00 63.79  ?  71   GLU B OE2   1 
ATOM   2163  N  N     . ASP B 1  93   ? 102.105 -37.089 -17.779  1.00 70.36  ?  72   ASP B N     1 
ATOM   2164  C  CA    . ASP B 1  93   ? 102.854 -36.827 -18.995  1.00 69.38  ?  72   ASP B CA    1 
ATOM   2165  C  C     . ASP B 1  93   ? 103.017 -35.320 -19.183  1.00 64.39  ?  72   ASP B C     1 
ATOM   2166  O  O     . ASP B 1  93   ? 102.541 -34.513 -18.381  1.00 62.27  ?  72   ASP B O     1 
ATOM   2167  C  CB    . ASP B 1  93   ? 102.180 -37.491 -20.196  1.00 68.81  ?  72   ASP B CB    1 
ATOM   2168  C  CG    . ASP B 1  93   ? 100.682 -37.278 -20.226  1.00 73.28  ?  72   ASP B CG    1 
ATOM   2169  O  OD1   . ASP B 1  93   ? 100.185 -36.399 -19.497  1.00 78.40  ?  72   ASP B OD1   1 
ATOM   2170  O  OD2   . ASP B 1  93   ? 100.000 -37.990 -20.992  1.00 71.07  ?  72   ASP B OD2   1 
ATOM   2171  N  N     . VAL B 1  94   ? 103.702 -34.938 -20.262  1.00 62.84  ?  73   VAL B N     1 
ATOM   2172  C  CA    . VAL B 1  94   ? 104.089 -33.541 -20.459  1.00 62.92  ?  73   VAL B CA    1 
ATOM   2173  C  C     . VAL B 1  94   ? 102.861 -32.639 -20.485  1.00 63.72  ?  73   VAL B C     1 
ATOM   2174  O  O     . VAL B 1  94   ? 102.760 -31.668 -19.724  1.00 62.17  ?  73   VAL B O     1 
ATOM   2175  C  CB    . VAL B 1  94   ? 104.914 -33.397 -21.750  1.00 63.75  ?  73   VAL B CB    1 
ATOM   2176  C  CG1   . VAL B 1  94   ? 105.305 -31.947 -21.968  1.00 59.56  ?  73   VAL B CG1   1 
ATOM   2177  C  CG2   . VAL B 1  94   ? 106.141 -34.291 -21.701  1.00 65.85  ?  73   VAL B CG2   1 
ATOM   2178  N  N     . THR B 1  95   ? 101.906 -32.955 -21.359  1.00 66.58  ?  74   THR B N     1 
ATOM   2179  C  CA    . THR B 1  95   ? 100.784 -32.055 -21.597  1.00 65.84  ?  74   THR B CA    1 
ATOM   2180  C  C     . THR B 1  95   ? 99.878  -31.936 -20.378  1.00 61.94  ?  74   THR B C     1 
ATOM   2181  O  O     . THR B 1  95   ? 99.213  -30.910 -20.202  1.00 59.49  ?  74   THR B O     1 
ATOM   2182  C  CB    . THR B 1  95   ? 100.005 -32.538 -22.814  1.00 65.84  ?  74   THR B CB    1 
ATOM   2183  O  OG1   . THR B 1  95   ? 99.089  -33.567 -22.421  1.00 61.67  ?  74   THR B OG1   1 
ATOM   2184  C  CG2   . THR B 1  95   ? 100.980 -33.106 -23.833  1.00 60.69  ?  74   THR B CG2   1 
ATOM   2185  N  N     . GLU B 1  96   ? 99.840  -32.961 -19.525  1.00 61.68  ?  75   GLU B N     1 
ATOM   2186  C  CA    . GLU B 1  96   ? 99.086  -32.842 -18.284  1.00 57.60  ?  75   GLU B CA    1 
ATOM   2187  C  C     . GLU B 1  96   ? 99.787  -31.922 -17.294  1.00 55.21  ?  75   GLU B C     1 
ATOM   2188  O  O     . GLU B 1  96   ? 99.122  -31.191 -16.551  1.00 54.13  ?  75   GLU B O     1 
ATOM   2189  C  CB    . GLU B 1  96   ? 98.860  -34.220 -17.670  1.00 60.22  ?  75   GLU B CB    1 
ATOM   2190  C  CG    . GLU B 1  96   ? 97.909  -34.223 -16.492  1.00 66.42  ?  75   GLU B CG    1 
ATOM   2191  C  CD    . GLU B 1  96   ? 97.414  -35.614 -16.157  1.00 75.36  ?  75   GLU B CD    1 
ATOM   2192  O  OE1   . GLU B 1  96   ? 97.963  -36.587 -16.715  1.00 73.82  ?  75   GLU B OE1   1 
ATOM   2193  O  OE2   . GLU B 1  96   ? 96.473  -35.733 -15.343  1.00 78.65  ?  75   GLU B OE2   1 
ATOM   2194  N  N     . ILE B 1  97   ? 101.121 -31.946 -17.263  1.00 55.55  ?  76   ILE B N     1 
ATOM   2195  C  CA    . ILE B 1  97   ? 101.856 -30.959 -16.478  1.00 56.77  ?  76   ILE B CA    1 
ATOM   2196  C  C     . ILE B 1  97   ? 101.571 -29.560 -17.002  1.00 56.95  ?  76   ILE B C     1 
ATOM   2197  O  O     . ILE B 1  97   ? 101.418 -28.608 -16.228  1.00 53.34  ?  76   ILE B O     1 
ATOM   2198  C  CB    . ILE B 1  97   ? 103.364 -31.271 -16.497  1.00 57.73  ?  76   ILE B CB    1 
ATOM   2199  C  CG1   . ILE B 1  97   ? 103.625 -32.688 -15.992  1.00 58.85  ?  76   ILE B CG1   1 
ATOM   2200  C  CG2   . ILE B 1  97   ? 104.131 -30.260 -15.656  1.00 56.40  ?  76   ILE B CG2   1 
ATOM   2201  C  CD1   . ILE B 1  97   ? 105.066 -33.112 -16.104  1.00 58.83  ?  76   ILE B CD1   1 
ATOM   2202  N  N     . ILE B 1  98   ? 101.491 -29.416 -18.327  1.00 58.08  ?  77   ILE B N     1 
ATOM   2203  C  CA    . ILE B 1  98   ? 101.136 -28.128 -18.914  1.00 54.81  ?  77   ILE B CA    1 
ATOM   2204  C  C     . ILE B 1  98   ? 99.753  -27.693 -18.450  1.00 56.25  ?  77   ILE B C     1 
ATOM   2205  O  O     . ILE B 1  98   ? 99.544  -26.531 -18.083  1.00 57.55  ?  77   ILE B O     1 
ATOM   2206  C  CB    . ILE B 1  98   ? 101.220 -28.203 -20.448  1.00 55.98  ?  77   ILE B CB    1 
ATOM   2207  C  CG1   . ILE B 1  98   ? 102.624 -28.623 -20.881  1.00 57.75  ?  77   ILE B CG1   1 
ATOM   2208  C  CG2   . ILE B 1  98   ? 100.838 -26.870 -21.068  1.00 54.61  ?  77   ILE B CG2   1 
ATOM   2209  C  CD1   . ILE B 1  98   ? 102.735 -28.943 -22.351  1.00 59.71  ?  77   ILE B CD1   1 
ATOM   2210  N  N     . LEU B 1  99   ? 98.786  -28.617 -18.458  1.00 53.98  ?  78   LEU B N     1 
ATOM   2211  C  CA    . LEU B 1  99   ? 97.448  -28.290 -17.975  1.00 49.70  ?  78   LEU B CA    1 
ATOM   2212  C  C     . LEU B 1  99   ? 97.477  -27.848 -16.521  1.00 50.99  ?  78   LEU B C     1 
ATOM   2213  O  O     . LEU B 1  99   ? 96.835  -26.858 -16.152  1.00 51.07  ?  78   LEU B O     1 
ATOM   2214  C  CB    . LEU B 1  99   ? 96.516  -29.488 -18.135  1.00 50.20  ?  78   LEU B CB    1 
ATOM   2215  C  CG    . LEU B 1  99   ? 96.051  -29.851 -19.543  1.00 50.42  ?  78   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B 1  99   ? 95.024  -30.961 -19.471  1.00 47.46  ?  78   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B 1  99   ? 95.486  -28.633 -20.246  1.00 49.97  ?  78   LEU B CD2   1 
ATOM   2218  N  N     . ASN B 1  100  ? 98.212  -28.574 -15.677  1.00 51.29  ?  79   ASN B N     1 
ATOM   2219  C  CA    . ASN B 1  100  ? 98.269  -28.222 -14.263  1.00 52.98  ?  79   ASN B CA    1 
ATOM   2220  C  C     . ASN B 1  100  ? 98.960  -26.885 -14.044  1.00 55.34  ?  79   ASN B C     1 
ATOM   2221  O  O     . ASN B 1  100  ? 98.645  -26.177 -13.082  1.00 54.54  ?  79   ASN B O     1 
ATOM   2222  C  CB    . ASN B 1  100  ? 98.977  -29.324 -13.482  1.00 53.50  ?  79   ASN B CB    1 
ATOM   2223  C  CG    . ASN B 1  100  ? 98.242  -30.640 -13.552  1.00 54.32  ?  79   ASN B CG    1 
ATOM   2224  O  OD1   . ASN B 1  100  ? 97.014  -30.674 -13.529  1.00 56.08  ?  79   ASN B OD1   1 
ATOM   2225  N  ND2   . ASN B 1  100  ? 98.986  -31.731 -13.650  1.00 54.35  ?  79   ASN B ND2   1 
ATOM   2226  N  N     . LEU B 1  101  ? 99.891  -26.519 -14.925  1.00 56.37  ?  80   LEU B N     1 
ATOM   2227  C  CA    . LEU B 1  101  ? 100.586 -25.246 -14.781  1.00 53.41  ?  80   LEU B CA    1 
ATOM   2228  C  C     . LEU B 1  101  ? 99.734  -24.079 -15.262  1.00 53.49  ?  80   LEU B C     1 
ATOM   2229  O  O     . LEU B 1  101  ? 99.729  -23.017 -14.633  1.00 54.27  ?  80   LEU B O     1 
ATOM   2230  C  CB    . LEU B 1  101  ? 101.916 -25.290 -15.531  1.00 51.58  ?  80   LEU B CB    1 
ATOM   2231  C  CG    . LEU B 1  101  ? 102.975 -26.194 -14.900  1.00 51.85  ?  80   LEU B CG    1 
ATOM   2232  C  CD1   . LEU B 1  101  ? 104.270 -26.138 -15.686  1.00 52.48  ?  80   LEU B CD1   1 
ATOM   2233  C  CD2   . LEU B 1  101  ? 103.205 -25.813 -13.447  1.00 52.18  ?  80   LEU B CD2   1 
ATOM   2234  N  N     . LYS B 1  102  ? 99.005  -24.252 -16.369  1.00 52.82  ?  81   LYS B N     1 
ATOM   2235  C  CA    . LYS B 1  102  ? 98.145  -23.174 -16.850  1.00 51.96  ?  81   LYS B CA    1 
ATOM   2236  C  C     . LYS B 1  102  ? 97.094  -22.795 -15.818  1.00 53.50  ?  81   LYS B C     1 
ATOM   2237  O  O     . LYS B 1  102  ? 96.613  -21.657 -15.812  1.00 53.89  ?  81   LYS B O     1 
ATOM   2238  C  CB    . LYS B 1  102  ? 97.476  -23.571 -18.165  1.00 49.87  ?  81   LYS B CB    1 
ATOM   2239  C  CG    . LYS B 1  102  ? 98.441  -23.736 -19.321  1.00 53.40  ?  81   LYS B CG    1 
ATOM   2240  C  CD    . LYS B 1  102  ? 97.741  -23.592 -20.663  1.00 47.19  ?  81   LYS B CD    1 
ATOM   2241  C  CE    . LYS B 1  102  ? 96.783  -24.729 -20.934  1.00 45.04  ?  81   LYS B CE    1 
ATOM   2242  N  NZ    . LYS B 1  102  ? 96.177  -24.596 -22.285  1.00 45.85  ?  81   LYS B NZ    1 
ATOM   2243  N  N     . SER B 1  103  ? 96.740  -23.721 -14.931  1.00 50.85  ?  82   SER B N     1 
ATOM   2244  C  CA    . SER B 1  103  ? 95.777  -23.454 -13.874  1.00 50.92  ?  82   SER B CA    1 
ATOM   2245  C  C     . SER B 1  103  ? 96.409  -22.804 -12.651  1.00 56.87  ?  82   SER B C     1 
ATOM   2246  O  O     . SER B 1  103  ? 95.708  -22.570 -11.662  1.00 57.75  ?  82   SER B O     1 
ATOM   2247  C  CB    . SER B 1  103  ? 95.078  -24.751 -13.467  1.00 51.20  ?  82   SER B CB    1 
ATOM   2248  O  OG    . SER B 1  103  ? 94.509  -25.395 -14.593  1.00 52.62  ?  82   SER B OG    1 
ATOM   2249  N  N     . LEU B 1  104  ? 97.707  -22.517 -12.692  1.00 57.84  ?  83   LEU B N     1 
ATOM   2250  C  CA    . LEU B 1  104  ? 98.393  -21.898 -11.566  1.00 56.38  ?  83   LEU B CA    1 
ATOM   2251  C  C     . LEU B 1  104  ? 98.032  -20.420 -11.487  1.00 56.52  ?  83   LEU B C     1 
ATOM   2252  O  O     . LEU B 1  104  ? 98.105  -19.698 -12.485  1.00 55.24  ?  83   LEU B O     1 
ATOM   2253  C  CB    . LEU B 1  104  ? 99.904  -22.077 -11.708  1.00 59.85  ?  83   LEU B CB    1 
ATOM   2254  C  CG    . LEU B 1  104  ? 100.793 -21.884 -10.481  1.00 64.18  ?  83   LEU B CG    1 
ATOM   2255  C  CD1   . LEU B 1  104  ? 101.998 -22.798 -10.589  1.00 69.65  ?  83   LEU B CD1   1 
ATOM   2256  C  CD2   . LEU B 1  104  ? 101.238 -20.437 -10.353  1.00 65.84  ?  83   LEU B CD2   1 
ATOM   2257  N  N     . VAL B 1  105  ? 97.648  -19.976 -10.294  1.00 57.43  ?  84   VAL B N     1 
ATOM   2258  C  CA    . VAL B 1  105  ? 97.178  -18.616 -10.063  1.00 55.53  ?  84   VAL B CA    1 
ATOM   2259  C  C     . VAL B 1  105  ? 98.315  -17.816 -9.449   1.00 58.03  ?  84   VAL B C     1 
ATOM   2260  O  O     . VAL B 1  105  ? 98.812  -18.157 -8.370   1.00 61.23  ?  84   VAL B O     1 
ATOM   2261  C  CB    . VAL B 1  105  ? 95.943  -18.601 -9.150   1.00 57.01  ?  84   VAL B CB    1 
ATOM   2262  C  CG1   . VAL B 1  105  ? 95.425  -17.188 -8.988   1.00 56.21  ?  84   VAL B CG1   1 
ATOM   2263  C  CG2   . VAL B 1  105  ? 94.865  -19.520 -9.703   1.00 57.67  ?  84   VAL B CG2   1 
ATOM   2264  N  N     . VAL B 1  106  ? 98.714  -16.737 -10.119  1.00 61.28  ?  85   VAL B N     1 
ATOM   2265  C  CA    . VAL B 1  106  ? 99.898  -15.980 -9.735   1.00 62.39  ?  85   VAL B CA    1 
ATOM   2266  C  C     . VAL B 1  106  ? 99.673  -14.495 -9.996   1.00 62.19  ?  85   VAL B C     1 
ATOM   2267  O  O     . VAL B 1  106  ? 98.972  -14.104 -10.933  1.00 62.16  ?  85   VAL B O     1 
ATOM   2268  C  CB    . VAL B 1  106  ? 101.145 -16.500 -10.488  1.00 60.86  ?  85   VAL B CB    1 
ATOM   2269  C  CG1   . VAL B 1  106  ? 100.980 -16.319 -11.990  1.00 59.86  ?  85   VAL B CG1   1 
ATOM   2270  C  CG2   . VAL B 1  106  ? 102.411 -15.828 -9.982   1.00 66.07  ?  85   VAL B CG2   1 
ATOM   2271  N  N     . SER B 1  107  ? 100.266 -13.664 -9.138   1.00 64.64  ?  86   SER B N     1 
ATOM   2272  C  CA    . SER B 1  107  ? 100.264 -12.215 -9.283   1.00 65.98  ?  86   SER B CA    1 
ATOM   2273  C  C     . SER B 1  107  ? 101.702 -11.724 -9.358   1.00 68.33  ?  86   SER B C     1 
ATOM   2274  O  O     . SER B 1  107  ? 102.583 -12.274 -8.695   1.00 69.86  ?  86   SER B O     1 
ATOM   2275  C  CB    . SER B 1  107  ? 99.548  -11.540 -8.111   1.00 62.30  ?  86   SER B CB    1 
ATOM   2276  O  OG    . SER B 1  107  ? 98.328  -12.193 -7.812   1.00 65.03  ?  86   SER B OG    1 
ATOM   2277  N  N     . SER B 1  108  ? 101.941 -10.686 -10.158  1.00 71.71  ?  87   SER B N     1 
ATOM   2278  C  CA    . SER B 1  108  ? 103.293 -10.175 -10.357  1.00 72.82  ?  87   SER B CA    1 
ATOM   2279  C  C     . SER B 1  108  ? 103.283 -8.657  -10.439  1.00 76.50  ?  87   SER B C     1 
ATOM   2280  O  O     . SER B 1  108  ? 102.443 -8.075  -11.131  1.00 77.04  ?  87   SER B O     1 
ATOM   2281  C  CB    . SER B 1  108  ? 103.920 -10.759 -11.626  1.00 69.39  ?  87   SER B CB    1 
ATOM   2282  O  OG    . SER B 1  108  ? 105.121 -10.083 -11.949  1.00 67.84  ?  87   SER B OG    1 
ATOM   2283  N  N     . GLU B 1  109  ? 104.221 -8.025  -9.735   1.00 78.23  ?  88   GLU B N     1 
ATOM   2284  C  CA    . GLU B 1  109  ? 104.397 -6.579  -9.759   1.00 77.20  ?  88   GLU B CA    1 
ATOM   2285  C  C     . GLU B 1  109  ? 105.486 -6.122  -10.721  1.00 73.93  ?  88   GLU B C     1 
ATOM   2286  O  O     . GLU B 1  109  ? 105.686 -4.914  -10.876  1.00 73.54  ?  88   GLU B O     1 
ATOM   2287  C  CB    . GLU B 1  109  ? 104.723 -6.063  -8.351   1.00 76.43  ?  88   GLU B CB    1 
ATOM   2288  C  CG    . GLU B 1  109  ? 103.547 -6.018  -7.382   1.00 81.23  ?  88   GLU B CG    1 
ATOM   2289  C  CD    . GLU B 1  109  ? 103.250 -7.358  -6.729   1.00 87.07  ?  88   GLU B CD    1 
ATOM   2290  O  OE1   . GLU B 1  109  ? 103.345 -8.398  -7.410   1.00 84.98  ?  88   GLU B OE1   1 
ATOM   2291  O  OE2   . GLU B 1  109  ? 102.920 -7.369  -5.524   1.00 88.79  ?  88   GLU B OE2   1 
ATOM   2292  N  N     . GLU B 1  110  ? 106.182 -7.050  -11.378  1.00 74.62  ?  89   GLU B N     1 
ATOM   2293  C  CA    . GLU B 1  110  ? 107.443 -6.710  -12.030  1.00 79.06  ?  89   GLU B CA    1 
ATOM   2294  C  C     . GLU B 1  110  ? 107.262 -6.019  -13.375  1.00 80.71  ?  89   GLU B C     1 
ATOM   2295  O  O     . GLU B 1  110  ? 108.162 -5.288  -13.805  1.00 86.76  ?  89   GLU B O     1 
ATOM   2296  C  CB    . GLU B 1  110  ? 108.291 -7.967  -12.208  1.00 76.71  ?  89   GLU B CB    1 
ATOM   2297  N  N     . ASP B 1  111  ? 106.152 -6.273  -14.073  1.00 77.27  ?  90   ASP B N     1 
ATOM   2298  C  CA    . ASP B 1  111  ? 105.863 -5.662  -15.370  1.00 83.46  ?  90   ASP B CA    1 
ATOM   2299  C  C     . ASP B 1  111  ? 106.849 -6.107  -16.448  1.00 81.91  ?  90   ASP B C     1 
ATOM   2300  O  O     . ASP B 1  111  ? 106.671 -5.791  -17.628  1.00 79.25  ?  90   ASP B O     1 
ATOM   2301  C  CB    . ASP B 1  111  ? 105.848 -4.133  -15.262  1.00 86.24  ?  90   ASP B CB    1 
ATOM   2302  N  N     . GLU B 1  112  ? 107.890 -6.835  -16.053  1.00 80.25  ?  91   GLU B N     1 
ATOM   2303  C  CA    . GLU B 1  112  ? 108.841 -7.476  -16.942  1.00 79.78  ?  91   GLU B CA    1 
ATOM   2304  C  C     . GLU B 1  112  ? 108.838 -8.977  -16.674  1.00 77.98  ?  91   GLU B C     1 
ATOM   2305  O  O     . GLU B 1  112  ? 108.532 -9.403  -15.556  1.00 78.98  ?  91   GLU B O     1 
ATOM   2306  C  CB    . GLU B 1  112  ? 110.256 -6.916  -16.747  1.00 80.86  ?  91   GLU B CB    1 
ATOM   2307  N  N     . PRO B 1  113  ? 109.152 -9.800  -17.674  1.00 73.11  ?  92   PRO B N     1 
ATOM   2308  C  CA    . PRO B 1  113  ? 109.093 -11.254 -17.472  1.00 71.34  ?  92   PRO B CA    1 
ATOM   2309  C  C     . PRO B 1  113  ? 110.018 -11.700 -16.349  1.00 76.76  ?  92   PRO B C     1 
ATOM   2310  O  O     . PRO B 1  113  ? 111.143 -11.215 -16.215  1.00 83.38  ?  92   PRO B O     1 
ATOM   2311  C  CB    . PRO B 1  113  ? 109.537 -11.818 -18.827  1.00 68.74  ?  92   PRO B CB    1 
ATOM   2312  C  CG    . PRO B 1  113  ? 109.239 -10.731 -19.802  1.00 71.86  ?  92   PRO B CG    1 
ATOM   2313  C  CD    . PRO B 1  113  ? 109.489 -9.451  -19.064  1.00 71.97  ?  92   PRO B CD    1 
ATOM   2314  N  N     . VAL B 1  114  ? 109.525 -12.625 -15.527  1.00 71.36  ?  93   VAL B N     1 
ATOM   2315  C  CA    . VAL B 1  114  ? 110.256 -13.112 -14.362  1.00 68.81  ?  93   VAL B CA    1 
ATOM   2316  C  C     . VAL B 1  114  ? 110.234 -14.631 -14.370  1.00 69.43  ?  93   VAL B C     1 
ATOM   2317  O  O     . VAL B 1  114  ? 109.170 -15.238 -14.517  1.00 67.17  ?  93   VAL B O     1 
ATOM   2318  C  CB    . VAL B 1  114  ? 109.659 -12.578 -13.047  1.00 64.47  ?  93   VAL B CB    1 
ATOM   2319  C  CG1   . VAL B 1  114  ? 110.405 -13.156 -11.863  1.00 65.94  ?  93   VAL B CG1   1 
ATOM   2320  C  CG2   . VAL B 1  114  ? 109.715 -11.069 -13.019  1.00 68.17  ?  93   VAL B CG2   1 
ATOM   2321  N  N     . THR B 1  115  ? 111.400 -15.243 -14.194  1.00 69.93  ?  94   THR B N     1 
ATOM   2322  C  CA    . THR B 1  115  ? 111.517 -16.693 -14.159  1.00 69.01  ?  94   THR B CA    1 
ATOM   2323  C  C     . THR B 1  115  ? 111.511 -17.180 -12.716  1.00 68.62  ?  94   THR B C     1 
ATOM   2324  O  O     . THR B 1  115  ? 112.226 -16.639 -11.867  1.00 72.78  ?  94   THR B O     1 
ATOM   2325  C  CB    . THR B 1  115  ? 112.791 -17.159 -14.864  1.00 70.12  ?  94   THR B CB    1 
ATOM   2326  O  OG1   . THR B 1  115  ? 113.935 -16.681 -14.149  1.00 86.37  ?  94   THR B OG1   1 
ATOM   2327  C  CG2   . THR B 1  115  ? 112.831 -16.627 -16.288  1.00 66.51  ?  94   THR B CG2   1 
ATOM   2328  N  N     . MET B 1  116  ? 110.692 -18.190 -12.446  1.00 65.93  ?  95   MET B N     1 
ATOM   2329  C  CA    . MET B 1  116  ? 110.672 -18.901 -11.182  1.00 67.97  ?  95   MET B CA    1 
ATOM   2330  C  C     . MET B 1  116  ? 111.065 -20.348 -11.433  1.00 67.94  ?  95   MET B C     1 
ATOM   2331  O  O     . MET B 1  116  ? 110.922 -20.867 -12.544  1.00 66.38  ?  95   MET B O     1 
ATOM   2332  C  CB    . MET B 1  116  ? 109.291 -18.850 -10.525  1.00 67.79  ?  95   MET B CB    1 
ATOM   2333  C  CG    . MET B 1  116  ? 108.460 -17.648 -10.906  1.00 69.27  ?  95   MET B CG    1 
ATOM   2334  S  SD    . MET B 1  116  ? 106.759 -17.871 -10.368  1.00 75.71  ?  95   MET B SD    1 
ATOM   2335  C  CE    . MET B 1  116  ? 106.356 -19.393 -11.220  1.00 69.97  ?  95   MET B CE    1 
ATOM   2336  N  N     . TYR B 1  117  ? 111.559 -21.002 -10.389  1.00 69.82  ?  96   TYR B N     1 
ATOM   2337  C  CA    . TYR B 1  117  ? 112.102 -22.343 -10.511  1.00 69.99  ?  96   TYR B CA    1 
ATOM   2338  C  C     . TYR B 1  117  ? 111.363 -23.309 -9.596   1.00 64.65  ?  96   TYR B C     1 
ATOM   2339  O  O     . TYR B 1  117  ? 110.879 -22.933 -8.525   1.00 63.68  ?  96   TYR B O     1 
ATOM   2340  C  CB    . TYR B 1  117  ? 113.600 -22.352 -10.194  1.00 69.42  ?  96   TYR B CB    1 
ATOM   2341  C  CG    . TYR B 1  117  ? 114.417 -21.540 -11.171  1.00 69.45  ?  96   TYR B CG    1 
ATOM   2342  C  CD1   . TYR B 1  117  ? 114.823 -22.082 -12.382  1.00 71.83  ?  96   TYR B CD1   1 
ATOM   2343  C  CD2   . TYR B 1  117  ? 114.777 -20.230 -10.887  1.00 68.38  ?  96   TYR B CD2   1 
ATOM   2344  C  CE1   . TYR B 1  117  ? 115.568 -21.347 -13.282  1.00 72.84  ?  96   TYR B CE1   1 
ATOM   2345  C  CE2   . TYR B 1  117  ? 115.523 -19.485 -11.782  1.00 75.38  ?  96   TYR B CE2   1 
ATOM   2346  C  CZ    . TYR B 1  117  ? 115.915 -20.049 -12.978  1.00 79.33  ?  96   TYR B CZ    1 
ATOM   2347  O  OH    . TYR B 1  117  ? 116.658 -19.314 -13.873  1.00 85.39  ?  96   TYR B OH    1 
ATOM   2348  N  N     . LEU B 1  118  ? 111.272 -24.560 -10.044  1.00 63.93  ?  97   LEU B N     1 
ATOM   2349  C  CA    . LEU B 1  118  ? 110.658 -25.630 -9.267   1.00 67.53  ?  97   LEU B CA    1 
ATOM   2350  C  C     . LEU B 1  118  ? 111.520 -26.874 -9.400   1.00 70.09  ?  97   LEU B C     1 
ATOM   2351  O  O     . LEU B 1  118  ? 111.785 -27.325 -10.516  1.00 70.29  ?  97   LEU B O     1 
ATOM   2352  C  CB    . LEU B 1  118  ? 109.231 -25.912 -9.748   1.00 70.14  ?  97   LEU B CB    1 
ATOM   2353  C  CG    . LEU B 1  118  ? 108.539 -27.138 -9.152   1.00 69.37  ?  97   LEU B CG    1 
ATOM   2354  C  CD1   . LEU B 1  118  ? 108.350 -26.970 -7.654   1.00 70.54  ?  97   LEU B CD1   1 
ATOM   2355  C  CD2   . LEU B 1  118  ? 107.207 -27.392 -9.837   1.00 64.86  ?  97   LEU B CD2   1 
ATOM   2356  N  N     . ARG B 1  119  ? 111.967 -27.422 -8.272   1.00 69.07  ?  98   ARG B N     1 
ATOM   2357  C  CA    . ARG B 1  119  ? 112.749 -28.651 -8.275   1.00 71.33  ?  98   ARG B CA    1 
ATOM   2358  C  C     . ARG B 1  119  ? 112.335 -29.507 -7.090   1.00 68.81  ?  98   ARG B C     1 
ATOM   2359  O  O     . ARG B 1  119  ? 112.251 -29.008 -5.964   1.00 69.47  ?  98   ARG B O     1 
ATOM   2360  C  CB    . ARG B 1  119  ? 114.256 -28.359 -8.212   1.00 76.39  ?  98   ARG B CB    1 
ATOM   2361  C  CG    . ARG B 1  119  ? 114.795 -27.532 -9.374   1.00 82.29  ?  98   ARG B CG    1 
ATOM   2362  C  CD    . ARG B 1  119  ? 116.292 -27.289 -9.246   1.00 87.90  ?  98   ARG B CD    1 
ATOM   2363  N  NE    . ARG B 1  119  ? 116.800 -26.413 -10.300  1.00 92.86  ?  98   ARG B NE    1 
ATOM   2364  C  CZ    . ARG B 1  119  ? 117.015 -25.109 -10.152  1.00 90.61  ?  98   ARG B CZ    1 
ATOM   2365  N  NH1   . ARG B 1  119  ? 117.479 -24.393 -11.167  1.00 85.85  ?  98   ARG B NH1   1 
ATOM   2366  N  NH2   . ARG B 1  119  ? 116.771 -24.521 -8.989   1.00 89.56  ?  98   ARG B NH2   1 
ATOM   2367  N  N     . LYS B 1  120  ? 112.075 -30.790 -7.341   1.00 66.04  ?  99   LYS B N     1 
ATOM   2368  C  CA    . LYS B 1  120  ? 111.799 -31.721 -6.256   1.00 70.01  ?  99   LYS B CA    1 
ATOM   2369  C  C     . LYS B 1  120  ? 112.312 -33.103 -6.635   1.00 70.22  ?  99   LYS B C     1 
ATOM   2370  O  O     . LYS B 1  120  ? 112.304 -33.487 -7.807   1.00 68.40  ?  99   LYS B O     1 
ATOM   2371  C  CB    . LYS B 1  120  ? 110.305 -31.778 -5.908   1.00 70.24  ?  99   LYS B CB    1 
ATOM   2372  C  CG    . LYS B 1  120  ? 110.011 -32.554 -4.629   1.00 70.59  ?  99   LYS B CG    1 
ATOM   2373  C  CD    . LYS B 1  120  ? 108.648 -32.221 -4.054   1.00 69.95  ?  99   LYS B CD    1 
ATOM   2374  C  CE    . LYS B 1  120  ? 108.431 -32.929 -2.725   1.00 72.06  ?  99   LYS B CE    1 
ATOM   2375  N  NZ    . LYS B 1  120  ? 107.176 -32.494 -2.055   1.00 69.41  ?  99   LYS B NZ    1 
ATOM   2376  N  N     . GLN B 1  121  ? 112.754 -33.845 -5.622   1.00 69.37  ?  100  GLN B N     1 
ATOM   2377  C  CA    . GLN B 1  121  ? 113.391 -35.140 -5.793   1.00 71.21  ?  100  GLN B CA    1 
ATOM   2378  C  C     . GLN B 1  121  ? 112.679 -36.173 -4.929   1.00 72.19  ?  100  GLN B C     1 
ATOM   2379  O  O     . GLN B 1  121  ? 111.893 -35.834 -4.041   1.00 65.86  ?  100  GLN B O     1 
ATOM   2380  C  CB    . GLN B 1  121  ? 114.887 -35.066 -5.424   1.00 77.67  ?  100  GLN B CB    1 
ATOM   2381  C  CG    . GLN B 1  121  ? 115.709 -36.317 -5.725   1.00 78.27  ?  100  GLN B CG    1 
ATOM   2382  C  CD    . GLN B 1  121  ? 116.640 -36.141 -6.904   1.00 83.33  ?  100  GLN B CD    1 
ATOM   2383  O  OE1   . GLN B 1  121  ? 117.416 -35.188 -6.959   1.00 82.65  ?  100  GLN B OE1   1 
ATOM   2384  N  NE2   . GLN B 1  121  ? 116.570 -37.064 -7.856   1.00 83.27  ?  100  GLN B NE2   1 
ATOM   2385  N  N     . GLY B 1  122  ? 112.951 -37.444 -5.215   1.00 79.65  ?  101  GLY B N     1 
ATOM   2386  C  CA    . GLY B 1  122  ? 112.474 -38.533 -4.400   1.00 72.25  ?  101  GLY B CA    1 
ATOM   2387  C  C     . GLY B 1  122  ? 110.994 -38.776 -4.585   1.00 72.48  ?  101  GLY B C     1 
ATOM   2388  O  O     . GLY B 1  122  ? 110.328 -38.109 -5.380   1.00 77.21  ?  101  GLY B O     1 
ATOM   2389  N  N     . PRO B 1  123  ? 110.450 -39.743 -3.853   1.00 71.30  ?  102  PRO B N     1 
ATOM   2390  C  CA    . PRO B 1  123  ? 109.013 -40.007 -3.947   1.00 71.68  ?  102  PRO B CA    1 
ATOM   2391  C  C     . PRO B 1  123  ? 108.222 -38.896 -3.282   1.00 71.33  ?  102  PRO B C     1 
ATOM   2392  O  O     . PRO B 1  123  ? 108.659 -38.294 -2.298   1.00 69.31  ?  102  PRO B O     1 
ATOM   2393  C  CB    . PRO B 1  123  ? 108.838 -41.336 -3.198   1.00 66.96  ?  102  PRO B CB    1 
ATOM   2394  C  CG    . PRO B 1  123  ? 110.227 -41.816 -2.870   1.00 65.16  ?  102  PRO B CG    1 
ATOM   2395  C  CD    . PRO B 1  123  ? 111.103 -40.612 -2.864   1.00 65.69  ?  102  PRO B CD    1 
ATOM   2396  N  N     . GLY B 1  124  ? 107.055 -38.614 -3.832   1.00 68.05  ?  103  GLY B N     1 
ATOM   2397  C  CA    . GLY B 1  124  ? 106.150 -37.681 -3.197   1.00 68.94  ?  103  GLY B CA    1 
ATOM   2398  C  C     . GLY B 1  124  ? 105.335 -36.924 -4.222   1.00 65.70  ?  103  GLY B C     1 
ATOM   2399  O  O     . GLY B 1  124  ? 105.355 -37.226 -5.407   1.00 61.91  ?  103  GLY B O     1 
ATOM   2400  N  N     . GLU B 1  125  ? 104.619 -35.920 -3.728   1.00 66.32  ?  104  GLU B N     1 
ATOM   2401  C  CA    . GLU B 1  125  ? 103.721 -35.113 -4.539   1.00 62.19  ?  104  GLU B CA    1 
ATOM   2402  C  C     . GLU B 1  125  ? 104.297 -33.715 -4.708   1.00 61.16  ?  104  GLU B C     1 
ATOM   2403  O  O     . GLU B 1  125  ? 104.658 -33.065 -3.723   1.00 62.64  ?  104  GLU B O     1 
ATOM   2404  C  CB    . GLU B 1  125  ? 102.334 -35.033 -3.902   1.00 61.74  ?  104  GLU B CB    1 
ATOM   2405  C  CG    . GLU B 1  125  ? 101.338 -34.234 -4.713   1.00 64.14  ?  104  GLU B CG    1 
ATOM   2406  C  CD    . GLU B 1  125  ? 100.161 -33.766 -3.889   1.00 68.48  ?  104  GLU B CD    1 
ATOM   2407  O  OE1   . GLU B 1  125  ? 100.347 -33.504 -2.683   1.00 71.23  ?  104  GLU B OE1   1 
ATOM   2408  O  OE2   . GLU B 1  125  ? 99.049  -33.660 -4.446   1.00 69.68  ?  104  GLU B OE2   1 
ATOM   2409  N  N     . VAL B 1  126  ? 104.377 -33.262 -5.953   1.00 59.89  ?  105  VAL B N     1 
ATOM   2410  C  CA    . VAL B 1  126  ? 104.833 -31.918 -6.283   1.00 60.67  ?  105  VAL B CA    1 
ATOM   2411  C  C     . VAL B 1  126  ? 103.609 -31.028 -6.434   1.00 58.92  ?  105  VAL B C     1 
ATOM   2412  O  O     . VAL B 1  126  ? 102.743 -31.284 -7.281   1.00 59.81  ?  105  VAL B O     1 
ATOM   2413  C  CB    . VAL B 1  126  ? 105.680 -31.910 -7.565   1.00 56.78  ?  105  VAL B CB    1 
ATOM   2414  C  CG1   . VAL B 1  126  ? 106.123 -30.495 -7.890   1.00 58.16  ?  105  VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B 1  126  ? 106.878 -32.826 -7.411   1.00 62.29  ?  105  VAL B CG2   1 
ATOM   2416  N  N     . THR B 1  127  ? 103.542 -29.981 -5.619   1.00 56.22  ?  106  THR B N     1 
ATOM   2417  C  CA    . THR B 1  127  ? 102.443 -29.031 -5.619   1.00 58.40  ?  106  THR B CA    1 
ATOM   2418  C  C     . THR B 1  127  ? 102.983 -27.629 -5.860   1.00 61.13  ?  106  THR B C     1 
ATOM   2419  O  O     . THR B 1  127  ? 104.184 -27.373 -5.752   1.00 64.01  ?  106  THR B O     1 
ATOM   2420  C  CB    . THR B 1  127  ? 101.666 -29.064 -4.297   1.00 62.00  ?  106  THR B CB    1 
ATOM   2421  O  OG1   . THR B 1  127  ? 102.428 -28.403 -3.279   1.00 64.69  ?  106  THR B OG1   1 
ATOM   2422  C  CG2   . THR B 1  127  ? 101.390 -30.494 -3.869   1.00 60.38  ?  106  THR B CG2   1 
ATOM   2423  N  N     . ALA B 1  128  ? 102.069 -26.716 -6.195   1.00 61.35  ?  107  ALA B N     1 
ATOM   2424  C  CA    . ALA B 1  128  ? 102.440 -25.320 -6.396   1.00 63.27  ?  107  ALA B CA    1 
ATOM   2425  C  C     . ALA B 1  128  ? 103.077 -24.704 -5.159   1.00 66.26  ?  107  ALA B C     1 
ATOM   2426  O  O     . ALA B 1  128  ? 103.814 -23.720 -5.282   1.00 66.85  ?  107  ALA B O     1 
ATOM   2427  C  CB    . ALA B 1  128  ? 101.214 -24.507 -6.810   1.00 64.99  ?  107  ALA B CB    1 
ATOM   2428  N  N     . GLY B 1  129  ? 102.813 -25.254 -3.973   1.00 66.63  ?  108  GLY B N     1 
ATOM   2429  C  CA    . GLY B 1  129  ? 103.463 -24.768 -2.770   1.00 67.73  ?  108  GLY B CA    1 
ATOM   2430  C  C     . GLY B 1  129  ? 104.964 -24.957 -2.770   1.00 69.45  ?  108  GLY B C     1 
ATOM   2431  O  O     . GLY B 1  129  ? 105.671 -24.245 -2.050   1.00 70.87  ?  108  GLY B O     1 
ATOM   2432  N  N     . ASP B 1  130  ? 105.470 -25.899 -3.564   1.00 69.83  ?  109  ASP B N     1 
ATOM   2433  C  CA    . ASP B 1  130  ? 106.903 -26.136 -3.652   1.00 69.93  ?  109  ASP B CA    1 
ATOM   2434  C  C     . ASP B 1  130  ? 107.632 -25.087 -4.479   1.00 70.15  ?  109  ASP B C     1 
ATOM   2435  O  O     . ASP B 1  130  ? 108.863 -25.015 -4.401   1.00 74.15  ?  109  ASP B O     1 
ATOM   2436  C  CB    . ASP B 1  130  ? 107.172 -27.524 -4.237   1.00 68.52  ?  109  ASP B CB    1 
ATOM   2437  C  CG    . ASP B 1  130  ? 106.822 -28.636 -3.276   1.00 70.87  ?  109  ASP B CG    1 
ATOM   2438  O  OD1   . ASP B 1  130  ? 106.826 -28.384 -2.054   1.00 74.24  ?  109  ASP B OD1   1 
ATOM   2439  O  OD2   . ASP B 1  130  ? 106.546 -29.761 -3.740   1.00 69.61  ?  109  ASP B OD2   1 
ATOM   2440  N  N     . ILE B 1  131  ? 106.914 -24.286 -5.268   1.00 72.59  ?  110  ILE B N     1 
ATOM   2441  C  CA    . ILE B 1  131  ? 107.560 -23.219 -6.023   1.00 75.83  ?  110  ILE B CA    1 
ATOM   2442  C  C     . ILE B 1  131  ? 108.188 -22.220 -5.060   1.00 78.94  ?  110  ILE B C     1 
ATOM   2443  O  O     . ILE B 1  131  ? 107.575 -21.823 -4.060   1.00 79.83  ?  110  ILE B O     1 
ATOM   2444  C  CB    . ILE B 1  131  ? 106.557 -22.528 -6.961   1.00 74.62  ?  110  ILE B CB    1 
ATOM   2445  C  CG1   . ILE B 1  131  ? 106.483 -23.244 -8.311   1.00 71.72  ?  110  ILE B CG1   1 
ATOM   2446  C  CG2   . ILE B 1  131  ? 106.908 -21.055 -7.156   1.00 74.41  ?  110  ILE B CG2   1 
ATOM   2447  C  CD1   . ILE B 1  131  ? 105.656 -24.500 -8.290   1.00 72.55  ?  110  ILE B CD1   1 
ATOM   2448  N  N     . VAL B 1  132  ? 109.420 -21.821 -5.354   1.00 80.74  ?  111  VAL B N     1 
ATOM   2449  C  CA    . VAL B 1  132  ? 110.079 -20.730 -4.643   1.00 81.99  ?  111  VAL B CA    1 
ATOM   2450  C  C     . VAL B 1  132  ? 109.805 -19.446 -5.423   1.00 79.80  ?  111  VAL B C     1 
ATOM   2451  O  O     . VAL B 1  132  ? 110.386 -19.262 -6.511   1.00 78.77  ?  111  VAL B O     1 
ATOM   2452  C  CB    . VAL B 1  132  ? 111.583 -20.987 -4.480   1.00 78.96  ?  111  VAL B CB    1 
ATOM   2453  C  CG1   . VAL B 1  132  ? 112.191 -21.597 -5.751   1.00 75.37  ?  111  VAL B CG1   1 
ATOM   2454  C  CG2   . VAL B 1  132  ? 112.314 -19.704 -4.079   1.00 78.23  ?  111  VAL B CG2   1 
ATOM   2455  N  N     . PRO B 1  133  ? 108.926 -18.576 -4.953   1.00 77.73  ?  112  PRO B N     1 
ATOM   2456  C  CA    . PRO B 1  133  ? 108.632 -17.346 -5.677   1.00 77.81  ?  112  PRO B CA    1 
ATOM   2457  C  C     . PRO B 1  133  ? 109.784 -16.366 -5.571   1.00 78.95  ?  112  PRO B C     1 
ATOM   2458  O  O     . PRO B 1  133  ? 110.312 -16.130 -4.474   1.00 81.26  ?  112  PRO B O     1 
ATOM   2459  C  CB    . PRO B 1  133  ? 107.379 -16.813 -4.974   1.00 81.86  ?  112  PRO B CB    1 
ATOM   2460  C  CG    . PRO B 1  133  ? 107.487 -17.341 -3.586   1.00 86.27  ?  112  PRO B CG    1 
ATOM   2461  C  CD    . PRO B 1  133  ? 108.144 -18.688 -3.706   1.00 78.87  ?  112  PRO B CD    1 
ATOM   2462  N  N     . PRO B 1  134  ? 110.202 -15.770 -6.682   1.00 79.94  ?  113  PRO B N     1 
ATOM   2463  C  CA    . PRO B 1  134  ? 111.084 -14.606 -6.599   1.00 82.77  ?  113  PRO B CA    1 
ATOM   2464  C  C     . PRO B 1  134  ? 110.338 -13.426 -6.002   1.00 81.51  ?  113  PRO B C     1 
ATOM   2465  O  O     . PRO B 1  134  ? 109.109 -13.411 -5.917   1.00 78.59  ?  113  PRO B O     1 
ATOM   2466  C  CB    . PRO B 1  134  ? 111.479 -14.345 -8.058   1.00 77.83  ?  113  PRO B CB    1 
ATOM   2467  C  CG    . PRO B 1  134  ? 110.440 -15.047 -8.868   1.00 76.65  ?  113  PRO B CG    1 
ATOM   2468  C  CD    . PRO B 1  134  ? 110.013 -16.229 -8.065   1.00 75.11  ?  113  PRO B CD    1 
ATOM   2469  N  N     . ALA B 1  135  ? 111.107 -12.434 -5.562   1.00 84.40  ?  114  ALA B N     1 
ATOM   2470  C  CA    . ALA B 1  135  ? 110.516 -11.271 -4.917   1.00 83.72  ?  114  ALA B CA    1 
ATOM   2471  C  C     . ALA B 1  135  ? 109.573 -10.554 -5.873   1.00 83.14  ?  114  ALA B C     1 
ATOM   2472  O  O     . ALA B 1  135  ? 109.953 -10.196 -6.991   1.00 81.95  ?  114  ALA B O     1 
ATOM   2473  C  CB    . ALA B 1  135  ? 111.610 -10.319 -4.437   1.00 78.46  ?  114  ALA B CB    1 
ATOM   2474  N  N     . GLY B 1  136  ? 108.336 -10.352 -5.431   1.00 83.30  ?  115  GLY B N     1 
ATOM   2475  C  CA    . GLY B 1  136  ? 107.349 -9.644  -6.214   1.00 85.91  ?  115  GLY B CA    1 
ATOM   2476  C  C     . GLY B 1  136  ? 106.315 -10.497 -6.914   1.00 84.81  ?  115  GLY B C     1 
ATOM   2477  O  O     . GLY B 1  136  ? 105.543 -9.960  -7.715   1.00 83.83  ?  115  GLY B O     1 
ATOM   2478  N  N     . VAL B 1  137  ? 106.280 -11.805 -6.660   1.00 81.17  ?  116  VAL B N     1 
ATOM   2479  C  CA    . VAL B 1  137  ? 105.240 -12.664 -7.210   1.00 74.96  ?  116  VAL B CA    1 
ATOM   2480  C  C     . VAL B 1  137  ? 104.603 -13.445 -6.071   1.00 74.78  ?  116  VAL B C     1 
ATOM   2481  O  O     . VAL B 1  137  ? 105.219 -13.674 -5.025   1.00 80.45  ?  116  VAL B O     1 
ATOM   2482  C  CB    . VAL B 1  137  ? 105.765 -13.619 -8.311   1.00 72.25  ?  116  VAL B CB    1 
ATOM   2483  C  CG1   . VAL B 1  137  ? 107.033 -13.071 -8.947   1.00 77.99  ?  116  VAL B CG1   1 
ATOM   2484  C  CG2   . VAL B 1  137  ? 105.980 -15.025 -7.772   1.00 71.78  ?  116  VAL B CG2   1 
ATOM   2485  N  N     . THR B 1  138  ? 103.348 -13.840 -6.274   1.00 73.43  ?  117  THR B N     1 
ATOM   2486  C  CA    . THR B 1  138  ? 102.579 -14.540 -5.252   1.00 68.66  ?  117  THR B CA    1 
ATOM   2487  C  C     . THR B 1  138  ? 101.824 -15.686 -5.902   1.00 65.10  ?  117  THR B C     1 
ATOM   2488  O  O     . THR B 1  138  ? 101.065 -15.470 -6.850   1.00 66.35  ?  117  THR B O     1 
ATOM   2489  C  CB    . THR B 1  138  ? 101.602 -13.593 -4.552   1.00 64.46  ?  117  THR B CB    1 
ATOM   2490  O  OG1   . THR B 1  138  ? 102.300 -12.419 -4.121   1.00 70.18  ?  117  THR B OG1   1 
ATOM   2491  C  CG2   . THR B 1  138  ? 100.973 -14.276 -3.350   1.00 60.41  ?  117  THR B CG2   1 
ATOM   2492  N  N     . VAL B 1  139  ? 102.029 -16.896 -5.396   1.00 60.81  ?  118  VAL B N     1 
ATOM   2493  C  CA    . VAL B 1  139  ? 101.237 -18.049 -5.803   1.00 61.85  ?  118  VAL B CA    1 
ATOM   2494  C  C     . VAL B 1  139  ? 100.069 -18.173 -4.835   1.00 62.47  ?  118  VAL B C     1 
ATOM   2495  O  O     . VAL B 1  139  ? 100.268 -18.369 -3.631   1.00 62.41  ?  118  VAL B O     1 
ATOM   2496  C  CB    . VAL B 1  139  ? 102.082 -19.329 -5.827   1.00 63.15  ?  118  VAL B CB    1 
ATOM   2497  C  CG1   . VAL B 1  139  ? 101.215 -20.526 -6.175   1.00 61.06  ?  118  VAL B CG1   1 
ATOM   2498  C  CG2   . VAL B 1  139  ? 103.221 -19.185 -6.822   1.00 61.65  ?  118  VAL B CG2   1 
ATOM   2499  N  N     . HIS B 1  140  ? 98.851  -18.033 -5.354   1.00 61.97  ?  119  HIS B N     1 
ATOM   2500  C  CA    . HIS B 1  140  ? 97.667  -17.995 -4.507   1.00 63.06  ?  119  HIS B CA    1 
ATOM   2501  C  C     . HIS B 1  140  ? 97.069  -19.366 -4.227   1.00 61.05  ?  119  HIS B C     1 
ATOM   2502  O  O     . HIS B 1  140  ? 96.260  -19.491 -3.300   1.00 63.03  ?  119  HIS B O     1 
ATOM   2503  C  CB    . HIS B 1  140  ? 96.602  -17.100 -5.144   1.00 63.20  ?  119  HIS B CB    1 
ATOM   2504  C  CG    . HIS B 1  140  ? 97.087  -15.719 -5.456   1.00 62.21  ?  119  HIS B CG    1 
ATOM   2505  N  ND1   . HIS B 1  140  ? 96.845  -14.642 -4.632   1.00 63.24  ?  119  HIS B ND1   1 
ATOM   2506  C  CD2   . HIS B 1  140  ? 97.806  -15.242 -6.499   1.00 62.70  ?  119  HIS B CD2   1 
ATOM   2507  C  CE1   . HIS B 1  140  ? 97.390  -13.559 -5.156   1.00 63.96  ?  119  HIS B CE1   1 
ATOM   2508  N  NE2   . HIS B 1  140  ? 97.980  -13.896 -6.289   1.00 64.66  ?  119  HIS B NE2   1 
ATOM   2509  N  N     . ASN B 1  141  ? 97.455  -20.397 -4.978   1.00 58.12  ?  120  ASN B N     1 
ATOM   2510  C  CA    . ASN B 1  141  ? 96.913  -21.745 -4.816   1.00 64.14  ?  120  ASN B CA    1 
ATOM   2511  C  C     . ASN B 1  141  ? 98.052  -22.731 -4.572   1.00 66.96  ?  120  ASN B C     1 
ATOM   2512  O  O     . ASN B 1  141  ? 98.304  -23.623 -5.393   1.00 62.83  ?  120  ASN B O     1 
ATOM   2513  C  CB    . ASN B 1  141  ? 96.088  -22.153 -6.035   1.00 66.85  ?  120  ASN B CB    1 
ATOM   2514  C  CG    . ASN B 1  141  ? 96.838  -21.960 -7.339   1.00 64.07  ?  120  ASN B CG    1 
ATOM   2515  O  OD1   . ASN B 1  141  ? 97.685  -21.077 -7.454   1.00 63.86  ?  120  ASN B OD1   1 
ATOM   2516  N  ND2   . ASN B 1  141  ? 96.531  -22.790 -8.327   1.00 61.04  ?  120  ASN B ND2   1 
ATOM   2517  N  N     . PRO B 1  142  ? 98.747  -22.613 -3.436   1.00 67.69  ?  121  PRO B N     1 
ATOM   2518  C  CA    . PRO B 1  142  ? 99.920  -23.472 -3.210   1.00 63.02  ?  121  PRO B CA    1 
ATOM   2519  C  C     . PRO B 1  142  ? 99.583  -24.947 -3.139   1.00 62.93  ?  121  PRO B C     1 
ATOM   2520  O  O     . PRO B 1  142  ? 100.401 -25.781 -3.545   1.00 65.08  ?  121  PRO B O     1 
ATOM   2521  C  CB    . PRO B 1  142  ? 100.478 -22.958 -1.874   1.00 65.51  ?  121  PRO B CB    1 
ATOM   2522  C  CG    . PRO B 1  142  ? 99.847  -21.611 -1.672   1.00 68.26  ?  121  PRO B CG    1 
ATOM   2523  C  CD    . PRO B 1  142  ? 98.497  -21.722 -2.293   1.00 64.59  ?  121  PRO B CD    1 
ATOM   2524  N  N     . GLY B 1  143  ? 98.401  -25.297 -2.640   1.00 60.43  ?  122  GLY B N     1 
ATOM   2525  C  CA    . GLY B 1  143  ? 98.017  -26.688 -2.535   1.00 59.84  ?  122  GLY B CA    1 
ATOM   2526  C  C     . GLY B 1  143  ? 97.678  -27.366 -3.842   1.00 58.57  ?  122  GLY B C     1 
ATOM   2527  O  O     . GLY B 1  143  ? 97.347  -28.555 -3.831   1.00 60.89  ?  122  GLY B O     1 
ATOM   2528  N  N     . MET B 1  144  ? 97.751  -26.656 -4.964   1.00 56.05  ?  123  MET B N     1 
ATOM   2529  C  CA    . MET B 1  144  ? 97.372  -27.242 -6.241   1.00 58.11  ?  123  MET B CA    1 
ATOM   2530  C  C     . MET B 1  144  ? 98.347  -28.342 -6.636   1.00 56.93  ?  123  MET B C     1 
ATOM   2531  O  O     . MET B 1  144  ? 99.563  -28.134 -6.655   1.00 58.35  ?  123  MET B O     1 
ATOM   2532  C  CB    . MET B 1  144  ? 97.324  -26.175 -7.330   1.00 59.67  ?  123  MET B CB    1 
ATOM   2533  C  CG    . MET B 1  144  ? 96.835  -26.705 -8.665   1.00 59.30  ?  123  MET B CG    1 
ATOM   2534  S  SD    . MET B 1  144  ? 97.198  -25.600 -10.036  1.00 69.11  ?  123  MET B SD    1 
ATOM   2535  C  CE    . MET B 1  144  ? 98.984  -25.630 -10.010  1.00 62.83  ?  123  MET B CE    1 
ATOM   2536  N  N     . HIS B 1  145  ? 97.807  -29.511 -6.961   1.00 57.79  ?  124  HIS B N     1 
ATOM   2537  C  CA    . HIS B 1  145  ? 98.629  -30.634 -7.382   1.00 55.93  ?  124  HIS B CA    1 
ATOM   2538  C  C     . HIS B 1  145  ? 99.256  -30.351 -8.742   1.00 55.89  ?  124  HIS B C     1 
ATOM   2539  O  O     . HIS B 1  145  ? 98.561  -29.974 -9.689   1.00 56.17  ?  124  HIS B O     1 
ATOM   2540  C  CB    . HIS B 1  145  ? 97.782  -31.904 -7.437   1.00 56.03  ?  124  HIS B CB    1 
ATOM   2541  C  CG    . HIS B 1  145  ? 98.498  -33.085 -8.011   1.00 61.76  ?  124  HIS B CG    1 
ATOM   2542  N  ND1   . HIS B 1  145  ? 99.307  -33.904 -7.255   1.00 63.78  ?  124  HIS B ND1   1 
ATOM   2543  C  CD2   . HIS B 1  145  ? 98.525  -33.586 -9.268   1.00 63.79  ?  124  HIS B CD2   1 
ATOM   2544  C  CE1   . HIS B 1  145  ? 99.801  -34.860 -8.021   1.00 63.10  ?  124  HIS B CE1   1 
ATOM   2545  N  NE2   . HIS B 1  145  ? 99.343  -34.689 -9.248   1.00 61.97  ?  124  HIS B NE2   1 
ATOM   2546  N  N     . ILE B 1  146  ? 100.572 -30.536 -8.838   1.00 60.53  ?  125  ILE B N     1 
ATOM   2547  C  CA    . ILE B 1  146  ? 101.285 -30.315 -10.091  1.00 59.83  ?  125  ILE B CA    1 
ATOM   2548  C  C     . ILE B 1  146  ? 101.686 -31.657 -10.686  1.00 58.47  ?  125  ILE B C     1 
ATOM   2549  O  O     . ILE B 1  146  ? 101.284 -31.994 -11.804  1.00 57.84  ?  125  ILE B O     1 
ATOM   2550  C  CB    . ILE B 1  146  ? 102.507 -29.400 -9.902   1.00 56.88  ?  125  ILE B CB    1 
ATOM   2551  C  CG1   . ILE B 1  146  ? 102.062 -28.006 -9.455   1.00 55.65  ?  125  ILE B CG1   1 
ATOM   2552  C  CG2   . ILE B 1  146  ? 103.299 -29.306 -11.195  1.00 54.61  ?  125  ILE B CG2   1 
ATOM   2553  C  CD1   . ILE B 1  146  ? 103.149 -26.964 -9.526   1.00 56.32  ?  125  ILE B CD1   1 
ATOM   2554  N  N     . ALA B 1  147  ? 102.500 -32.423 -9.963   1.00 59.70  ?  126  ALA B N     1 
ATOM   2555  C  CA    . ALA B 1  147  ? 102.905 -33.738 -10.444  1.00 62.23  ?  126  ALA B CA    1 
ATOM   2556  C  C     . ALA B 1  147  ? 103.028 -34.694 -9.266   1.00 61.98  ?  126  ALA B C     1 
ATOM   2557  O  O     . ALA B 1  147  ? 102.816 -34.320 -8.110   1.00 62.26  ?  126  ALA B O     1 
ATOM   2558  C  CB    . ALA B 1  147  ? 104.213 -33.654 -11.234  1.00 63.57  ?  126  ALA B CB    1 
ATOM   2559  N  N     . THR B 1  148  ? 103.365 -35.946 -9.572   1.00 59.70  ?  127  THR B N     1 
ATOM   2560  C  CA    . THR B 1  148  ? 103.647 -36.948 -8.554   1.00 62.42  ?  127  THR B CA    1 
ATOM   2561  C  C     . THR B 1  148  ? 104.827 -37.791 -9.017   1.00 62.54  ?  127  THR B C     1 
ATOM   2562  O  O     . THR B 1  148  ? 104.876 -38.222 -10.173  1.00 60.61  ?  127  THR B O     1 
ATOM   2563  C  CB    . THR B 1  148  ? 102.415 -37.821 -8.258   1.00 63.75  ?  127  THR B CB    1 
ATOM   2564  O  OG1   . THR B 1  148  ? 102.776 -38.899 -7.386   1.00 68.12  ?  127  THR B OG1   1 
ATOM   2565  C  CG2   . THR B 1  148  ? 101.813 -38.381 -9.531   1.00 66.75  ?  127  THR B CG2   1 
ATOM   2566  N  N     . LEU B 1  149  ? 105.778 -38.007 -8.113   1.00 63.09  ?  128  LEU B N     1 
ATOM   2567  C  CA    . LEU B 1  149  ? 107.085 -38.565 -8.428   1.00 63.51  ?  128  LEU B CA    1 
ATOM   2568  C  C     . LEU B 1  149  ? 107.328 -39.845 -7.644   1.00 65.73  ?  128  LEU B C     1 
ATOM   2569  O  O     . LEU B 1  149  ? 106.951 -39.949 -6.470   1.00 65.28  ?  128  LEU B O     1 
ATOM   2570  C  CB    . LEU B 1  149  ? 108.202 -37.567 -8.097   1.00 61.56  ?  128  LEU B CB    1 
ATOM   2571  C  CG    . LEU B 1  149  ? 108.650 -36.506 -9.101   1.00 63.74  ?  128  LEU B CG    1 
ATOM   2572  C  CD1   . LEU B 1  149  ? 107.479 -35.721 -9.664   1.00 64.34  ?  128  LEU B CD1   1 
ATOM   2573  C  CD2   . LEU B 1  149  ? 109.637 -35.574 -8.423   1.00 68.00  ?  128  LEU B CD2   1 
ATOM   2574  N  N     . ASN B 1  150  ? 107.986 -40.805 -8.294   1.00 66.42  ?  129  ASN B N     1 
ATOM   2575  C  CA    . ASN B 1  150  ? 108.476 -41.999 -7.625   1.00 71.29  ?  129  ASN B CA    1 
ATOM   2576  C  C     . ASN B 1  150  ? 109.879 -41.727 -7.081   1.00 72.55  ?  129  ASN B C     1 
ATOM   2577  O  O     . ASN B 1  150  ? 110.369 -40.595 -7.103   1.00 71.14  ?  129  ASN B O     1 
ATOM   2578  C  CB    . ASN B 1  150  ? 108.431 -43.204 -8.568   1.00 73.24  ?  129  ASN B CB    1 
ATOM   2579  C  CG    . ASN B 1  150  ? 109.321 -43.044 -9.795   1.00 74.92  ?  129  ASN B CG    1 
ATOM   2580  O  OD1   . ASN B 1  150  ? 110.117 -42.113 -9.895   1.00 76.00  ?  129  ASN B OD1   1 
ATOM   2581  N  ND2   . ASN B 1  150  ? 109.189 -43.972 -10.736  1.00 70.63  ?  129  ASN B ND2   1 
ATOM   2582  N  N     . ASP B 1  151  ? 110.551 -42.770 -6.594   1.00 72.62  ?  130  ASP B N     1 
ATOM   2583  C  CA    . ASP B 1  151  ? 111.853 -42.583 -5.962   1.00 71.77  ?  130  ASP B CA    1 
ATOM   2584  C  C     . ASP B 1  151  ? 112.960 -42.298 -6.969   1.00 74.14  ?  130  ASP B C     1 
ATOM   2585  O  O     . ASP B 1  151  ? 113.904 -41.567 -6.649   1.00 70.54  ?  130  ASP B O     1 
ATOM   2586  C  CB    . ASP B 1  151  ? 112.208 -43.812 -5.121   1.00 70.43  ?  130  ASP B CB    1 
ATOM   2587  C  CG    . ASP B 1  151  ? 112.150 -45.101 -5.915   1.00 69.28  ?  130  ASP B CG    1 
ATOM   2588  O  OD1   . ASP B 1  151  ? 111.478 -45.125 -6.967   1.00 69.73  ?  130  ASP B OD1   1 
ATOM   2589  O  OD2   . ASP B 1  151  ? 112.772 -46.092 -5.485   1.00 67.64  ?  130  ASP B OD2   1 
ATOM   2590  N  N     . LYS B 1  152  ? 112.874 -42.861 -8.175   1.00 79.21  ?  131  LYS B N     1 
ATOM   2591  C  CA    . LYS B 1  152  ? 113.939 -42.709 -9.159   1.00 79.14  ?  131  LYS B CA    1 
ATOM   2592  C  C     . LYS B 1  152  ? 113.886 -41.379 -9.902   1.00 78.95  ?  131  LYS B C     1 
ATOM   2593  O  O     . LYS B 1  152  ? 114.911 -40.942 -10.430  1.00 83.54  ?  131  LYS B O     1 
ATOM   2594  C  CB    . LYS B 1  152  ? 113.888 -43.859 -10.168  1.00 74.89  ?  131  LYS B CB    1 
ATOM   2595  N  N     . GLY B 1  153  ? 112.722 -40.733 -9.959   1.00 73.19  ?  132  GLY B N     1 
ATOM   2596  C  CA    . GLY B 1  153  ? 112.544 -39.535 -10.749  1.00 74.80  ?  132  GLY B CA    1 
ATOM   2597  C  C     . GLY B 1  153  ? 112.739 -38.247 -9.971   1.00 76.67  ?  132  GLY B C     1 
ATOM   2598  O  O     . GLY B 1  153  ? 112.628 -38.205 -8.748   1.00 77.39  ?  132  GLY B O     1 
ATOM   2599  N  N     . LYS B 1  154  ? 113.037 -37.184 -10.714  1.00 75.12  ?  133  LYS B N     1 
ATOM   2600  C  CA    . LYS B 1  154  ? 113.112 -35.837 -10.171  1.00 73.51  ?  133  LYS B CA    1 
ATOM   2601  C  C     . LYS B 1  154  ? 112.482 -34.882 -11.172  1.00 72.11  ?  133  LYS B C     1 
ATOM   2602  O  O     . LYS B 1  154  ? 112.488 -35.134 -12.380  1.00 73.91  ?  133  LYS B O     1 
ATOM   2603  C  CB    . LYS B 1  154  ? 114.555 -35.405 -9.872   1.00 74.62  ?  133  LYS B CB    1 
ATOM   2604  C  CG    . LYS B 1  154  ? 115.402 -35.165 -11.111  1.00 79.30  ?  133  LYS B CG    1 
ATOM   2605  C  CD    . LYS B 1  154  ? 116.785 -34.652 -10.752  1.00 89.84  ?  133  LYS B CD    1 
ATOM   2606  C  CE    . LYS B 1  154  ? 117.610 -34.382 -12.000  1.00 99.20  ?  133  LYS B CE    1 
ATOM   2607  N  NZ    . LYS B 1  154  ? 118.988 -33.926 -11.671  1.00 99.35  ?  133  LYS B NZ    1 
ATOM   2608  N  N     . LEU B 1  155  ? 111.930 -33.786 -10.662  1.00 67.23  ?  134  LEU B N     1 
ATOM   2609  C  CA    . LEU B 1  155  ? 111.266 -32.791 -11.495  1.00 64.56  ?  134  LEU B CA    1 
ATOM   2610  C  C     . LEU B 1  155  ? 111.989 -31.462 -11.333  1.00 65.65  ?  134  LEU B C     1 
ATOM   2611  O  O     . LEU B 1  155  ? 111.954 -30.854 -10.256  1.00 64.69  ?  134  LEU B O     1 
ATOM   2612  C  CB    . LEU B 1  155  ? 109.789 -32.665 -11.128  1.00 62.71  ?  134  LEU B CB    1 
ATOM   2613  C  CG    . LEU B 1  155  ? 108.927 -31.908 -12.137  1.00 59.44  ?  134  LEU B CG    1 
ATOM   2614  C  CD1   . LEU B 1  155  ? 109.032 -32.545 -13.512  1.00 58.85  ?  134  LEU B CD1   1 
ATOM   2615  C  CD2   . LEU B 1  155  ? 107.484 -31.871 -11.672  1.00 57.90  ?  134  LEU B CD2   1 
ATOM   2616  N  N     . GLU B 1  156  ? 112.650 -31.024 -12.400  1.00 66.44  ?  135  GLU B N     1 
ATOM   2617  C  CA    . GLU B 1  156  ? 113.278 -29.710 -12.474  1.00 72.51  ?  135  GLU B CA    1 
ATOM   2618  C  C     . GLU B 1  156  ? 112.623 -28.966 -13.629  1.00 71.35  ?  135  GLU B C     1 
ATOM   2619  O  O     . GLU B 1  156  ? 112.783 -29.351 -14.792  1.00 69.20  ?  135  GLU B O     1 
ATOM   2620  C  CB    . GLU B 1  156  ? 114.788 -29.824 -12.672  1.00 80.99  ?  135  GLU B CB    1 
ATOM   2621  C  CG    . GLU B 1  156  ? 115.495 -28.485 -12.805  1.00 83.78  ?  135  GLU B CG    1 
ATOM   2622  C  CD    . GLU B 1  156  ? 116.986 -28.629 -13.023  1.00 84.88  ?  135  GLU B CD    1 
ATOM   2623  O  OE1   . GLU B 1  156  ? 117.486 -29.773 -12.995  1.00 87.54  ?  135  GLU B OE1   1 
ATOM   2624  O  OE2   . GLU B 1  156  ? 117.659 -27.596 -13.224  1.00 83.93  ?  135  GLU B OE2   1 
ATOM   2625  N  N     . VAL B 1  157  ? 111.884 -27.909 -13.309  1.00 67.32  ?  136  VAL B N     1 
ATOM   2626  C  CA    . VAL B 1  157  ? 111.073 -27.198 -14.287  1.00 66.59  ?  136  VAL B CA    1 
ATOM   2627  C  C     . VAL B 1  157  ? 111.169 -25.702 -14.021  1.00 64.79  ?  136  VAL B C     1 
ATOM   2628  O  O     . VAL B 1  157  ? 111.076 -25.258 -12.872  1.00 64.66  ?  136  VAL B O     1 
ATOM   2629  C  CB    . VAL B 1  157  ? 109.606 -27.675 -14.263  1.00 66.02  ?  136  VAL B CB    1 
ATOM   2630  C  CG1   . VAL B 1  157  ? 109.113 -27.801 -12.836  1.00 66.04  ?  136  VAL B CG1   1 
ATOM   2631  C  CG2   . VAL B 1  157  ? 108.715 -26.736 -15.062  1.00 62.44  ?  136  VAL B CG2   1 
ATOM   2632  N  N     . GLU B 1  158  ? 111.370 -24.934 -15.087  1.00 65.79  ?  137  GLU B N     1 
ATOM   2633  C  CA    . GLU B 1  158  ? 111.475 -23.484 -15.040  1.00 65.18  ?  137  GLU B CA    1 
ATOM   2634  C  C     . GLU B 1  158  ? 110.217 -22.868 -15.637  1.00 64.80  ?  137  GLU B C     1 
ATOM   2635  O  O     . GLU B 1  158  ? 109.660 -23.396 -16.603  1.00 64.33  ?  137  GLU B O     1 
ATOM   2636  C  CB    . GLU B 1  158  ? 112.716 -23.018 -15.807  1.00 69.03  ?  137  GLU B CB    1 
ATOM   2637  C  CG    . GLU B 1  158  ? 112.703 -21.566 -16.241  1.00 72.33  ?  137  GLU B CG    1 
ATOM   2638  C  CD    . GLU B 1  158  ? 113.702 -21.293 -17.347  1.00 76.70  ?  137  GLU B CD    1 
ATOM   2639  O  OE1   . GLU B 1  158  ? 114.587 -22.146 -17.572  1.00 72.19  ?  137  GLU B OE1   1 
ATOM   2640  O  OE2   . GLU B 1  158  ? 113.594 -20.231 -17.997  1.00 76.05  ?  137  GLU B OE2   1 
ATOM   2641  N  N     . LEU B 1  159  ? 109.764 -21.758 -15.059  1.00 63.88  ?  138  LEU B N     1 
ATOM   2642  C  CA    . LEU B 1  159  ? 108.549 -21.090 -15.507  1.00 60.54  ?  138  LEU B CA    1 
ATOM   2643  C  C     . LEU B 1  159  ? 108.835 -19.615 -15.740  1.00 63.03  ?  138  LEU B C     1 
ATOM   2644  O  O     . LEU B 1  159  ? 109.467 -18.965 -14.905  1.00 65.01  ?  138  LEU B O     1 
ATOM   2645  C  CB    . LEU B 1  159  ? 107.417 -21.250 -14.485  1.00 59.02  ?  138  LEU B CB    1 
ATOM   2646  C  CG    . LEU B 1  159  ? 106.968 -22.672 -14.143  1.00 59.23  ?  138  LEU B CG    1 
ATOM   2647  C  CD1   . LEU B 1  159  ? 107.774 -23.247 -12.989  1.00 61.31  ?  138  LEU B CD1   1 
ATOM   2648  C  CD2   . LEU B 1  159  ? 105.483 -22.697 -13.830  1.00 62.60  ?  138  LEU B CD2   1 
ATOM   2649  N  N     . VAL B 1  160  ? 108.372 -19.088 -16.868  1.00 60.41  ?  139  VAL B N     1 
ATOM   2650  C  CA    . VAL B 1  160  ? 108.503 -17.671 -17.188  1.00 57.33  ?  139  VAL B CA    1 
ATOM   2651  C  C     . VAL B 1  160  ? 107.125 -17.041 -17.050  1.00 56.66  ?  139  VAL B C     1 
ATOM   2652  O  O     . VAL B 1  160  ? 106.243 -17.273 -17.881  1.00 58.04  ?  139  VAL B O     1 
ATOM   2653  C  CB    . VAL B 1  160  ? 109.071 -17.452 -18.596  1.00 58.55  ?  139  VAL B CB    1 
ATOM   2654  C  CG1   . VAL B 1  160  ? 109.183 -15.966 -18.891  1.00 59.83  ?  139  VAL B CG1   1 
ATOM   2655  C  CG2   . VAL B 1  160  ? 110.418 -18.137 -18.738  1.00 63.74  ?  139  VAL B CG2   1 
ATOM   2656  N  N     . VAL B 1  161  ? 106.944 -16.227 -16.019  1.00 57.50  ?  140  VAL B N     1 
ATOM   2657  C  CA    . VAL B 1  161  ? 105.670 -15.580 -15.722  1.00 57.69  ?  140  VAL B CA    1 
ATOM   2658  C  C     . VAL B 1  161  ? 105.730 -14.132 -16.180  1.00 59.25  ?  140  VAL B C     1 
ATOM   2659  O  O     . VAL B 1  161  ? 106.742 -13.445 -15.980  1.00 64.49  ?  140  VAL B O     1 
ATOM   2660  C  CB    . VAL B 1  161  ? 105.346 -15.673 -14.219  1.00 57.31  ?  140  VAL B CB    1 
ATOM   2661  C  CG1   . VAL B 1  161  ? 104.112 -14.855 -13.880  1.00 56.63  ?  140  VAL B CG1   1 
ATOM   2662  C  CG2   . VAL B 1  161  ? 105.158 -17.122 -13.809  1.00 56.32  ?  140  VAL B CG2   1 
ATOM   2663  N  N     . GLU B 1  162  ? 104.649 -13.664 -16.802  1.00 59.28  ?  141  GLU B N     1 
ATOM   2664  C  CA    . GLU B 1  162  ? 104.549 -12.288 -17.268  1.00 60.83  ?  141  GLU B CA    1 
ATOM   2665  C  C     . GLU B 1  162  ? 103.213 -11.694 -16.838  1.00 60.24  ?  141  GLU B C     1 
ATOM   2666  O  O     . GLU B 1  162  ? 102.378 -12.356 -16.212  1.00 59.33  ?  141  GLU B O     1 
ATOM   2667  C  CB    . GLU B 1  162  ? 104.689 -12.196 -18.793  1.00 59.93  ?  141  GLU B CB    1 
ATOM   2668  C  CG    . GLU B 1  162  ? 105.882 -12.922 -19.374  1.00 62.95  ?  141  GLU B CG    1 
ATOM   2669  C  CD    . GLU B 1  162  ? 106.042 -12.655 -20.856  1.00 68.14  ?  141  GLU B CD    1 
ATOM   2670  O  OE1   . GLU B 1  162  ? 105.807 -11.504 -21.280  1.00 68.40  ?  141  GLU B OE1   1 
ATOM   2671  O  OE2   . GLU B 1  162  ? 106.394 -13.595 -21.598  1.00 68.32  ?  141  GLU B OE2   1 
ATOM   2672  N  N     . ARG B 1  163  ? 103.020 -10.426 -17.193  1.00 59.87  ?  142  ARG B N     1 
ATOM   2673  C  CA    . ARG B 1  163  ? 101.757 -9.726  -17.024  1.00 62.09  ?  142  ARG B CA    1 
ATOM   2674  C  C     . ARG B 1  163  ? 101.127 -9.484  -18.388  1.00 59.83  ?  142  ARG B C     1 
ATOM   2675  O  O     . ARG B 1  163  ? 101.822 -9.337  -19.396  1.00 60.76  ?  142  ARG B O     1 
ATOM   2676  C  CB    . ARG B 1  163  ? 101.941 -8.387  -16.305  1.00 62.15  ?  142  ARG B CB    1 
ATOM   2677  C  CG    . ARG B 1  163  ? 102.533 -8.487  -14.915  1.00 68.43  ?  142  ARG B CG    1 
ATOM   2678  C  CD    . ARG B 1  163  ? 102.408 -7.165  -14.175  1.00 72.95  ?  142  ARG B CD    1 
ATOM   2679  N  NE    . ARG B 1  163  ? 101.018 -6.838  -13.874  1.00 69.91  ?  142  ARG B NE    1 
ATOM   2680  C  CZ    . ARG B 1  163  ? 100.637 -5.828  -13.099  1.00 74.10  ?  142  ARG B CZ    1 
ATOM   2681  N  NH1   . ARG B 1  163  ? 101.543 -5.040  -12.538  1.00 79.93  ?  142  ARG B NH1   1 
ATOM   2682  N  NH2   . ARG B 1  163  ? 99.348  -5.608  -12.879  1.00 72.86  ?  142  ARG B NH2   1 
ATOM   2683  N  N     . GLY B 1  164  ? 99.803  -9.453  -18.410  1.00 56.28  ?  143  GLY B N     1 
ATOM   2684  C  CA    . GLY B 1  164  ? 99.100  -9.215  -19.650  1.00 56.22  ?  143  GLY B CA    1 
ATOM   2685  C  C     . GLY B 1  164  ? 97.617  -9.069  -19.411  1.00 56.46  ?  143  GLY B C     1 
ATOM   2686  O  O     . GLY B 1  164  ? 97.156  -8.965  -18.272  1.00 57.92  ?  143  GLY B O     1 
ATOM   2687  N  N     . ARG B 1  165  ? 96.872  -9.068  -20.510  1.00 50.96  ?  144  ARG B N     1 
ATOM   2688  C  CA    . ARG B 1  165  ? 95.428  -8.919  -20.475  1.00 50.73  ?  144  ARG B CA    1 
ATOM   2689  C  C     . ARG B 1  165  ? 94.788  -10.002 -21.326  1.00 51.90  ?  144  ARG B C     1 
ATOM   2690  O  O     . ARG B 1  165  ? 95.291  -10.336 -22.402  1.00 50.51  ?  144  ARG B O     1 
ATOM   2691  C  CB    . ARG B 1  165  ? 94.998  -7.537  -20.980  1.00 53.89  ?  144  ARG B CB    1 
ATOM   2692  C  CG    . ARG B 1  165  ? 95.654  -6.365  -20.268  1.00 58.15  ?  144  ARG B CG    1 
ATOM   2693  C  CD    . ARG B 1  165  ? 95.185  -5.044  -20.857  1.00 62.20  ?  144  ARG B CD    1 
ATOM   2694  N  NE    . ARG B 1  165  ? 96.039  -3.920  -20.482  1.00 60.19  ?  144  ARG B NE    1 
ATOM   2695  C  CZ    . ARG B 1  165  ? 95.802  -3.106  -19.459  1.00 60.95  ?  144  ARG B CZ    1 
ATOM   2696  N  NH1   . ARG B 1  165  ? 94.734  -3.287  -18.697  1.00 62.18  ?  144  ARG B NH1   1 
ATOM   2697  N  NH2   . ARG B 1  165  ? 96.633  -2.108  -19.198  1.00 64.62  ?  144  ARG B NH2   1 
ATOM   2698  N  N     . GLY B 1  166  ? 93.684  -10.554 -20.831  1.00 50.58  ?  145  GLY B N     1 
ATOM   2699  C  CA    . GLY B 1  166  ? 92.924  -11.544 -21.565  1.00 49.38  ?  145  GLY B CA    1 
ATOM   2700  C  C     . GLY B 1  166  ? 93.569  -12.910 -21.655  1.00 48.66  ?  145  GLY B C     1 
ATOM   2701  O  O     . GLY B 1  166  ? 94.136  -13.412 -20.679  1.00 49.80  ?  145  GLY B O     1 
ATOM   2702  N  N     . TYR B 1  167  ? 93.471  -13.529 -22.826  1.00 46.66  ?  146  TYR B N     1 
ATOM   2703  C  CA    . TYR B 1  167  ? 93.975  -14.875 -23.065  1.00 44.07  ?  146  TYR B CA    1 
ATOM   2704  C  C     . TYR B 1  167  ? 94.735  -14.873 -24.382  1.00 49.72  ?  146  TYR B C     1 
ATOM   2705  O  O     . TYR B 1  167  ? 94.142  -14.637 -25.437  1.00 53.65  ?  146  TYR B O     1 
ATOM   2706  C  CB    . TYR B 1  167  ? 92.815  -15.877 -23.093  1.00 43.57  ?  146  TYR B CB    1 
ATOM   2707  C  CG    . TYR B 1  167  ? 93.149  -17.270 -23.579  1.00 44.20  ?  146  TYR B CG    1 
ATOM   2708  C  CD1   . TYR B 1  167  ? 93.577  -18.251 -22.697  1.00 44.02  ?  146  TYR B CD1   1 
ATOM   2709  C  CD2   . TYR B 1  167  ? 93.003  -17.611 -24.914  1.00 42.84  ?  146  TYR B CD2   1 
ATOM   2710  C  CE1   . TYR B 1  167  ? 93.871  -19.524 -23.135  1.00 44.19  ?  146  TYR B CE1   1 
ATOM   2711  C  CE2   . TYR B 1  167  ? 93.298  -18.880 -25.362  1.00 45.24  ?  146  TYR B CE2   1 
ATOM   2712  C  CZ    . TYR B 1  167  ? 93.728  -19.834 -24.468  1.00 43.73  ?  146  TYR B CZ    1 
ATOM   2713  O  OH    . TYR B 1  167  ? 94.018  -21.102 -24.911  1.00 37.37  ?  146  TYR B OH    1 
ATOM   2714  N  N     . VAL B 1  168  ? 96.036  -15.114 -24.324  1.00 50.63  ?  147  VAL B N     1 
ATOM   2715  C  CA    . VAL B 1  168  ? 96.880  -15.179 -25.516  1.00 51.34  ?  147  VAL B CA    1 
ATOM   2716  C  C     . VAL B 1  168  ? 97.165  -16.644 -25.827  1.00 52.75  ?  147  VAL B C     1 
ATOM   2717  O  O     . VAL B 1  168  ? 97.478  -17.411 -24.905  1.00 50.69  ?  147  VAL B O     1 
ATOM   2718  C  CB    . VAL B 1  168  ? 98.184  -14.370 -25.353  1.00 47.59  ?  147  VAL B CB    1 
ATOM   2719  C  CG1   . VAL B 1  168  ? 97.864  -12.953 -24.905  1.00 45.33  ?  147  VAL B CG1   1 
ATOM   2720  C  CG2   . VAL B 1  168  ? 99.152  -15.028 -24.390  1.00 52.97  ?  147  VAL B CG2   1 
ATOM   2721  N  N     . PRO B 1  169  ? 97.010  -17.081 -27.073  1.00 56.49  ?  148  PRO B N     1 
ATOM   2722  C  CA    . PRO B 1  169  ? 97.271  -18.488 -27.402  1.00 54.92  ?  148  PRO B CA    1 
ATOM   2723  C  C     . PRO B 1  169  ? 98.746  -18.840 -27.307  1.00 60.01  ?  148  PRO B C     1 
ATOM   2724  O  O     . PRO B 1  169  ? 99.580  -17.989 -26.982  1.00 60.03  ?  148  PRO B O     1 
ATOM   2725  C  CB    . PRO B 1  169  ? 96.761  -18.617 -28.845  1.00 58.83  ?  148  PRO B CB    1 
ATOM   2726  C  CG    . PRO B 1  169  ? 96.000  -17.357 -29.122  1.00 60.51  ?  148  PRO B CG    1 
ATOM   2727  C  CD    . PRO B 1  169  ? 96.576  -16.309 -28.245  1.00 58.99  ?  148  PRO B CD    1 
ATOM   2728  N  N     . ALA B 1  170  ? 99.078  -20.097 -27.606  1.00 62.56  ?  149  ALA B N     1 
ATOM   2729  C  CA    . ALA B 1  170  ? 100.457 -20.554 -27.473  1.00 63.66  ?  149  ALA B CA    1 
ATOM   2730  C  C     . ALA B 1  170  ? 101.336 -19.998 -28.586  1.00 70.93  ?  149  ALA B C     1 
ATOM   2731  O  O     . ALA B 1  170  ? 102.448 -19.523 -28.330  1.00 72.16  ?  149  ALA B O     1 
ATOM   2732  C  CB    . ALA B 1  170  ? 100.504 -22.081 -27.465  1.00 62.25  ?  149  ALA B CB    1 
ATOM   2733  N  N     . VAL B 1  171  ? 100.853 -20.048 -29.831  1.00 75.94  ?  150  VAL B N     1 
ATOM   2734  C  CA    . VAL B 1  171  ? 101.682 -19.665 -30.971  1.00 77.28  ?  150  VAL B CA    1 
ATOM   2735  C  C     . VAL B 1  171  ? 102.133 -18.215 -30.857  1.00 79.46  ?  150  VAL B C     1 
ATOM   2736  O  O     . VAL B 1  171  ? 103.211 -17.852 -31.343  1.00 82.04  ?  150  VAL B O     1 
ATOM   2737  C  CB    . VAL B 1  171  ? 100.930 -19.927 -32.293  1.00 77.67  ?  150  VAL B CB    1 
ATOM   2738  C  CG1   . VAL B 1  171  ? 99.729  -19.003 -32.431  1.00 74.73  ?  150  VAL B CG1   1 
ATOM   2739  C  CG2   . VAL B 1  171  ? 101.869 -19.785 -33.484  1.00 77.07  ?  150  VAL B CG2   1 
ATOM   2740  N  N     . GLN B 1  172  ? 101.337 -17.368 -30.201  1.00 76.94  ?  151  GLN B N     1 
ATOM   2741  C  CA    . GLN B 1  172  ? 101.766 -15.994 -29.975  1.00 80.20  ?  151  GLN B CA    1 
ATOM   2742  C  C     . GLN B 1  172  ? 102.862 -15.904 -28.923  1.00 78.50  ?  151  GLN B C     1 
ATOM   2743  O  O     . GLN B 1  172  ? 103.522 -14.866 -28.820  1.00 81.92  ?  151  GLN B O     1 
ATOM   2744  C  CB    . GLN B 1  172  ? 100.574 -15.126 -29.574  1.00 75.86  ?  151  GLN B CB    1 
ATOM   2745  C  CG    . GLN B 1  172  ? 99.483  -15.067 -30.626  1.00 73.08  ?  151  GLN B CG    1 
ATOM   2746  C  CD    . GLN B 1  172  ? 98.796  -13.720 -30.674  1.00 79.61  ?  151  GLN B CD    1 
ATOM   2747  O  OE1   . GLN B 1  172  ? 99.326  -12.723 -30.184  1.00 82.17  ?  151  GLN B OE1   1 
ATOM   2748  N  NE2   . GLN B 1  172  ? 97.610  -13.682 -31.270  1.00 78.52  ?  151  GLN B NE2   1 
ATOM   2749  N  N     . ASN B 1  173  ? 103.072 -16.963 -28.147  1.00 72.96  ?  152  ASN B N     1 
ATOM   2750  C  CA    . ASN B 1  173  ? 104.155 -17.014 -27.177  1.00 74.17  ?  152  ASN B CA    1 
ATOM   2751  C  C     . ASN B 1  173  ? 105.415 -17.670 -27.728  1.00 78.14  ?  152  ASN B C     1 
ATOM   2752  O  O     . ASN B 1  173  ? 106.375 -17.859 -26.976  1.00 75.68  ?  152  ASN B O     1 
ATOM   2753  C  CB    . ASN B 1  173  ? 103.699 -17.744 -25.910  1.00 70.71  ?  152  ASN B CB    1 
ATOM   2754  C  CG    . ASN B 1  173  ? 102.845 -16.871 -25.013  1.00 67.74  ?  152  ASN B CG    1 
ATOM   2755  O  OD1   . ASN B 1  173  ? 102.916 -15.646 -25.077  1.00 69.64  ?  152  ASN B OD1   1 
ATOM   2756  N  ND2   . ASN B 1  173  ? 102.044 -17.497 -24.162  1.00 62.16  ?  152  ASN B ND2   1 
ATOM   2757  N  N     . ARG B 1  174  ? 105.433 -18.029 -29.010  1.00 80.77  ?  153  ARG B N     1 
ATOM   2758  C  CA    . ARG B 1  174  ? 106.621 -18.611 -29.624  1.00 81.66  ?  153  ARG B CA    1 
ATOM   2759  C  C     . ARG B 1  174  ? 107.651 -17.517 -29.873  1.00 88.86  ?  153  ARG B C     1 
ATOM   2760  O  O     . ARG B 1  174  ? 107.367 -16.532 -30.562  1.00 89.28  ?  153  ARG B O     1 
ATOM   2761  C  CB    . ARG B 1  174  ? 106.270 -19.312 -30.935  1.00 78.45  ?  153  ARG B CB    1 
ATOM   2762  C  CG    . ARG B 1  174  ? 105.439 -20.562 -30.767  1.00 84.77  ?  153  ARG B CG    1 
ATOM   2763  C  CD    . ARG B 1  174  ? 105.169 -21.225 -32.104  1.00 89.26  ?  153  ARG B CD    1 
ATOM   2764  N  NE    . ARG B 1  174  ? 104.202 -22.309 -31.972  1.00 93.68  ?  153  ARG B NE    1 
ATOM   2765  C  CZ    . ARG B 1  174  ? 104.524 -23.564 -31.679  1.00 100.45 ?  153  ARG B CZ    1 
ATOM   2766  N  NH1   . ARG B 1  174  ? 105.793 -23.900 -31.490  1.00 99.89  ?  153  ARG B NH1   1 
ATOM   2767  N  NH2   . ARG B 1  174  ? 103.575 -24.485 -31.576  1.00 105.64 ?  153  ARG B NH2   1 
ATOM   2768  N  N     . ALA B 1  175  ? 108.845 -17.690 -29.316  1.00 90.08  ?  154  ALA B N     1 
ATOM   2769  C  CA    . ALA B 1  175  ? 109.923 -16.743 -29.541  1.00 89.04  ?  154  ALA B CA    1 
ATOM   2770  C  C     . ALA B 1  175  ? 110.599 -17.029 -30.875  1.00 91.65  ?  154  ALA B C     1 
ATOM   2771  O  O     . ALA B 1  175  ? 110.760 -18.185 -31.272  1.00 89.71  ?  154  ALA B O     1 
ATOM   2772  C  CB    . ALA B 1  175  ? 110.944 -16.810 -28.405  1.00 89.78  ?  154  ALA B CB    1 
ATOM   2773  N  N     . SER B 1  176  ? 110.979 -15.960 -31.577  1.00 96.38  ?  155  SER B N     1 
ATOM   2774  C  CA    . SER B 1  176  ? 111.677 -16.132 -32.846  1.00 96.63  ?  155  SER B CA    1 
ATOM   2775  C  C     . SER B 1  176  ? 113.087 -16.668 -32.635  1.00 94.61  ?  155  SER B C     1 
ATOM   2776  O  O     . SER B 1  176  ? 113.632 -17.344 -33.514  1.00 96.57  ?  155  SER B O     1 
ATOM   2777  C  CB    . SER B 1  176  ? 111.709 -14.807 -33.605  1.00 102.22 ?  155  SER B CB    1 
ATOM   2778  O  OG    . SER B 1  176  ? 110.402 -14.276 -33.750  1.00 99.10  ?  155  SER B OG    1 
ATOM   2779  N  N     . GLY B 1  177  ? 113.690 -16.367 -31.488  1.00 91.97  ?  156  GLY B N     1 
ATOM   2780  C  CA    . GLY B 1  177  ? 114.975 -16.916 -31.103  1.00 93.73  ?  156  GLY B CA    1 
ATOM   2781  C  C     . GLY B 1  177  ? 114.849 -18.012 -30.064  1.00 93.32  ?  156  GLY B C     1 
ATOM   2782  O  O     . GLY B 1  177  ? 115.789 -18.259 -29.302  1.00 91.51  ?  156  GLY B O     1 
ATOM   2783  N  N     . ALA B 1  178  ? 113.684 -18.664 -30.025  1.00 92.04  ?  157  ALA B N     1 
ATOM   2784  C  CA    . ALA B 1  178  ? 113.313 -19.530 -28.910  1.00 87.42  ?  157  ALA B CA    1 
ATOM   2785  C  C     . ALA B 1  178  ? 114.379 -20.576 -28.619  1.00 81.16  ?  157  ALA B C     1 
ATOM   2786  O  O     . ALA B 1  178  ? 115.023 -21.108 -29.526  1.00 79.36  ?  157  ALA B O     1 
ATOM   2787  C  CB    . ALA B 1  178  ? 111.980 -20.222 -29.202  1.00 88.62  ?  157  ALA B CB    1 
ATOM   2788  N  N     . GLU B 1  179  ? 114.559 -20.860 -27.334  1.00 74.66  ?  158  GLU B N     1 
ATOM   2789  C  CA    . GLU B 1  179  ? 115.544 -21.830 -26.889  1.00 71.61  ?  158  GLU B CA    1 
ATOM   2790  C  C     . GLU B 1  179  ? 115.047 -23.248 -27.126  1.00 67.72  ?  158  GLU B C     1 
ATOM   2791  O  O     . GLU B 1  179  ? 113.842 -23.508 -27.174  1.00 71.64  ?  158  GLU B O     1 
ATOM   2792  C  CB    . GLU B 1  179  ? 115.843 -21.635 -25.406  1.00 72.68  ?  158  GLU B CB    1 
ATOM   2793  C  CG    . GLU B 1  179  ? 115.775 -20.191 -24.958  1.00 76.10  ?  158  GLU B CG    1 
ATOM   2794  C  CD    . GLU B 1  179  ? 116.071 -20.030 -23.485  1.00 78.61  ?  158  GLU B CD    1 
ATOM   2795  O  OE1   . GLU B 1  179  ? 116.077 -21.050 -22.764  1.00 74.85  ?  158  GLU B OE1   1 
ATOM   2796  O  OE2   . GLU B 1  179  ? 116.304 -18.884 -23.048  1.00 82.20  ?  158  GLU B OE2   1 
ATOM   2797  N  N     . ILE B 1  180  ? 115.996 -24.172 -27.276  1.00 65.65  ?  159  ILE B N     1 
ATOM   2798  C  CA    . ILE B 1  180  ? 115.648 -25.583 -27.362  1.00 64.57  ?  159  ILE B CA    1 
ATOM   2799  C  C     . ILE B 1  180  ? 115.067 -26.035 -26.031  1.00 65.08  ?  159  ILE B C     1 
ATOM   2800  O  O     . ILE B 1  180  ? 115.541 -25.639 -24.957  1.00 64.97  ?  159  ILE B O     1 
ATOM   2801  C  CB    . ILE B 1  180  ? 116.878 -26.422 -27.750  1.00 59.86  ?  159  ILE B CB    1 
ATOM   2802  C  CG1   . ILE B 1  180  ? 117.407 -25.980 -29.111  1.00 56.06  ?  159  ILE B CG1   1 
ATOM   2803  C  CG2   . ILE B 1  180  ? 116.530 -27.900 -27.789  1.00 57.25  ?  159  ILE B CG2   1 
ATOM   2804  C  CD1   . ILE B 1  180  ? 116.375 -26.060 -30.208  1.00 58.69  ?  159  ILE B CD1   1 
ATOM   2805  N  N     . GLY B 1  181  ? 114.021 -26.855 -26.095  1.00 65.69  ?  160  GLY B N     1 
ATOM   2806  C  CA    . GLY B 1  181  ? 113.366 -27.346 -24.906  1.00 68.55  ?  160  GLY B CA    1 
ATOM   2807  C  C     . GLY B 1  181  ? 112.376 -26.395 -24.278  1.00 67.41  ?  160  GLY B C     1 
ATOM   2808  O  O     . GLY B 1  181  ? 111.649 -26.801 -23.363  1.00 71.11  ?  160  GLY B O     1 
ATOM   2809  N  N     . ARG B 1  182  ? 112.322 -25.144 -24.726  1.00 64.50  ?  161  ARG B N     1 
ATOM   2810  C  CA    . ARG B 1  182  ? 111.336 -24.201 -24.220  1.00 63.33  ?  161  ARG B CA    1 
ATOM   2811  C  C     . ARG B 1  182  ? 109.980 -24.525 -24.827  1.00 63.27  ?  161  ARG B C     1 
ATOM   2812  O  O     . ARG B 1  182  ? 109.838 -24.571 -26.054  1.00 61.44  ?  161  ARG B O     1 
ATOM   2813  C  CB    . ARG B 1  182  ? 111.746 -22.768 -24.542  1.00 66.59  ?  161  ARG B CB    1 
ATOM   2814  C  CG    . ARG B 1  182  ? 110.657 -21.747 -24.275  1.00 64.11  ?  161  ARG B CG    1 
ATOM   2815  C  CD    . ARG B 1  182  ? 111.245 -20.448 -23.770  1.00 70.15  ?  161  ARG B CD    1 
ATOM   2816  N  NE    . ARG B 1  182  ? 111.874 -20.620 -22.465  1.00 72.99  ?  161  ARG B NE    1 
ATOM   2817  C  CZ    . ARG B 1  182  ? 112.521 -19.659 -21.816  1.00 74.20  ?  161  ARG B CZ    1 
ATOM   2818  N  NH1   . ARG B 1  182  ? 112.628 -18.452 -22.354  1.00 75.16  ?  161  ARG B NH1   1 
ATOM   2819  N  NH2   . ARG B 1  182  ? 113.063 -19.905 -20.630  1.00 69.87  ?  161  ARG B NH2   1 
ATOM   2820  N  N     . ILE B 1  183  ? 108.994 -24.758 -23.974  1.00 64.10  ?  162  ILE B N     1 
ATOM   2821  C  CA    . ILE B 1  183  ? 107.641 -25.102 -24.401  1.00 62.28  ?  162  ILE B CA    1 
ATOM   2822  C  C     . ILE B 1  183  ? 106.753 -23.886 -24.167  1.00 64.60  ?  162  ILE B C     1 
ATOM   2823  O  O     . ILE B 1  183  ? 106.573 -23.470 -23.014  1.00 65.22  ?  162  ILE B O     1 
ATOM   2824  C  CB    . ILE B 1  183  ? 107.102 -26.330 -23.650  1.00 63.46  ?  162  ILE B CB    1 
ATOM   2825  C  CG1   . ILE B 1  183  ? 108.063 -27.511 -23.809  1.00 68.88  ?  162  ILE B CG1   1 
ATOM   2826  C  CG2   . ILE B 1  183  ? 105.725 -26.704 -24.165  1.00 62.72  ?  162  ILE B CG2   1 
ATOM   2827  C  CD1   . ILE B 1  183  ? 107.594 -28.773 -23.124  1.00 68.38  ?  162  ILE B CD1   1 
ATOM   2828  N  N     . PRO B 1  184  ? 106.211 -23.269 -25.215  1.00 64.73  ?  163  PRO B N     1 
ATOM   2829  C  CA    . PRO B 1  184  ? 105.241 -22.191 -25.015  1.00 62.92  ?  163  PRO B CA    1 
ATOM   2830  C  C     . PRO B 1  184  ? 103.869 -22.743 -24.659  1.00 59.20  ?  163  PRO B C     1 
ATOM   2831  O  O     . PRO B 1  184  ? 103.446 -23.788 -25.160  1.00 56.77  ?  163  PRO B O     1 
ATOM   2832  C  CB    . PRO B 1  184  ? 105.224 -21.475 -26.371  1.00 64.99  ?  163  PRO B CB    1 
ATOM   2833  C  CG    . PRO B 1  184  ? 105.742 -22.488 -27.368  1.00 62.56  ?  163  PRO B CG    1 
ATOM   2834  C  CD    . PRO B 1  184  ? 106.307 -23.671 -26.628  1.00 61.26  ?  163  PRO B CD    1 
ATOM   2835  N  N     . VAL B 1  185  ? 103.165 -22.021 -23.794  1.00 55.72  ?  164  VAL B N     1 
ATOM   2836  C  CA    . VAL B 1  185  ? 101.850 -22.440 -23.338  1.00 57.00  ?  164  VAL B CA    1 
ATOM   2837  C  C     . VAL B 1  185  ? 100.852 -21.324 -23.608  1.00 54.75  ?  164  VAL B C     1 
ATOM   2838  O  O     . VAL B 1  185  ? 101.215 -20.163 -23.808  1.00 54.44  ?  164  VAL B O     1 
ATOM   2839  C  CB    . VAL B 1  185  ? 101.841 -22.820 -21.841  1.00 57.33  ?  164  VAL B CB    1 
ATOM   2840  C  CG1   . VAL B 1  185  ? 102.999 -23.747 -21.515  1.00 58.07  ?  164  VAL B CG1   1 
ATOM   2841  C  CG2   . VAL B 1  185  ? 101.878 -21.576 -20.969  1.00 55.70  ?  164  VAL B CG2   1 
ATOM   2842  N  N     . ASP B 1  186  ? 99.578  -21.698 -23.630  1.00 52.46  ?  165  ASP B N     1 
ATOM   2843  C  CA    . ASP B 1  186  ? 98.516  -20.707 -23.604  1.00 49.37  ?  165  ASP B CA    1 
ATOM   2844  C  C     . ASP B 1  186  ? 98.535  -19.995 -22.260  1.00 49.62  ?  165  ASP B C     1 
ATOM   2845  O  O     . ASP B 1  186  ? 98.704  -20.620 -21.212  1.00 50.98  ?  165  ASP B O     1 
ATOM   2846  C  CB    . ASP B 1  186  ? 97.160  -21.371 -23.834  1.00 50.79  ?  165  ASP B CB    1 
ATOM   2847  C  CG    . ASP B 1  186  ? 97.170  -22.325 -25.011  1.00 55.46  ?  165  ASP B CG    1 
ATOM   2848  O  OD1   . ASP B 1  186  ? 97.665  -21.940 -26.087  1.00 57.70  ?  165  ASP B OD1   1 
ATOM   2849  O  OD2   . ASP B 1  186  ? 96.685  -23.465 -24.858  1.00 55.26  ?  165  ASP B OD2   1 
ATOM   2850  N  N     . SER B 1  187  ? 98.380  -18.679 -22.290  1.00 46.33  ?  166  SER B N     1 
ATOM   2851  C  CA    . SER B 1  187  ? 98.469  -17.865 -21.087  1.00 44.55  ?  166  SER B CA    1 
ATOM   2852  C  C     . SER B 1  187  ? 97.103  -17.284 -20.768  1.00 44.44  ?  166  SER B C     1 
ATOM   2853  O  O     . SER B 1  187  ? 96.486  -16.638 -21.620  1.00 47.75  ?  166  SER B O     1 
ATOM   2854  C  CB    . SER B 1  187  ? 99.493  -16.742 -21.259  1.00 48.77  ?  166  SER B CB    1 
ATOM   2855  O  OG    . SER B 1  187  ? 100.722 -17.242 -21.753  1.00 56.22  ?  166  SER B OG    1 
ATOM   2856  N  N     . ILE B 1  188  ? 96.635  -17.507 -19.548  1.00 41.98  ?  167  ILE B N     1 
ATOM   2857  C  CA    . ILE B 1  188  ? 95.426  -16.861 -19.064  1.00 40.74  ?  167  ILE B CA    1 
ATOM   2858  C  C     . ILE B 1  188  ? 95.891  -15.732 -18.157  1.00 46.07  ?  167  ILE B C     1 
ATOM   2859  O  O     . ILE B 1  188  ? 96.184  -15.942 -16.978  1.00 49.66  ?  167  ILE B O     1 
ATOM   2860  C  CB    . ILE B 1  188  ? 94.518  -17.844 -18.323  1.00 40.13  ?  167  ILE B CB    1 
ATOM   2861  C  CG1   . ILE B 1  188  ? 94.136  -19.008 -19.236  1.00 40.95  ?  167  ILE B CG1   1 
ATOM   2862  C  CG2   . ILE B 1  188  ? 93.278  -17.137 -17.794  1.00 45.34  ?  167  ILE B CG2   1 
ATOM   2863  C  CD1   . ILE B 1  188  ? 93.420  -20.129 -18.520  1.00 43.74  ?  167  ILE B CD1   1 
ATOM   2864  N  N     . TYR B 1  189  ? 95.892  -14.515 -18.693  1.00 46.92  ?  168  TYR B N     1 
ATOM   2865  C  CA    . TYR B 1  189  ? 96.227  -13.355 -17.881  1.00 47.53  ?  168  TYR B CA    1 
ATOM   2866  C  C     . TYR B 1  189  ? 95.019  -12.889 -17.091  1.00 51.93  ?  168  TYR B C     1 
ATOM   2867  O  O     . TYR B 1  189  ? 95.152  -12.453 -15.943  1.00 55.39  ?  168  TYR B O     1 
ATOM   2868  C  CB    . TYR B 1  189  ? 96.746  -12.221 -18.760  1.00 51.01  ?  168  TYR B CB    1 
ATOM   2869  C  CG    . TYR B 1  189  ? 98.036  -12.511 -19.490  1.00 52.61  ?  168  TYR B CG    1 
ATOM   2870  C  CD1   . TYR B 1  189  ? 99.247  -12.559 -18.813  1.00 52.50  ?  168  TYR B CD1   1 
ATOM   2871  C  CD2   . TYR B 1  189  ? 98.046  -12.705 -20.863  1.00 53.08  ?  168  TYR B CD2   1 
ATOM   2872  C  CE1   . TYR B 1  189  ? 100.429 -12.810 -19.482  1.00 53.04  ?  168  TYR B CE1   1 
ATOM   2873  C  CE2   . TYR B 1  189  ? 99.222  -12.955 -21.539  1.00 55.69  ?  168  TYR B CE2   1 
ATOM   2874  C  CZ    . TYR B 1  189  ? 100.410 -13.008 -20.846  1.00 53.95  ?  168  TYR B CZ    1 
ATOM   2875  O  OH    . TYR B 1  189  ? 101.582 -13.259 -21.522  1.00 49.32  ?  168  TYR B OH    1 
ATOM   2876  N  N     . SER B 1  190  ? 93.843  -12.984 -17.700  1.00 52.59  ?  169  SER B N     1 
ATOM   2877  C  CA    . SER B 1  190  ? 92.601  -12.494 -17.133  1.00 50.13  ?  169  SER B CA    1 
ATOM   2878  C  C     . SER B 1  190  ? 92.360  -13.103 -15.756  1.00 49.41  ?  169  SER B C     1 
ATOM   2879  O  O     . SER B 1  190  ? 92.312  -14.334 -15.630  1.00 49.80  ?  169  SER B O     1 
ATOM   2880  C  CB    . SER B 1  190  ? 91.442  -12.829 -18.065  1.00 50.47  ?  169  SER B CB    1 
ATOM   2881  O  OG    . SER B 1  190  ? 90.199  -12.593 -17.432  1.00 53.51  ?  169  SER B OG    1 
ATOM   2882  N  N     . PRO B 1  191  ? 92.231  -12.289 -14.709  1.00 48.89  ?  170  PRO B N     1 
ATOM   2883  C  CA    . PRO B 1  191  ? 91.859  -12.836 -13.398  1.00 49.84  ?  170  PRO B CA    1 
ATOM   2884  C  C     . PRO B 1  191  ? 90.429  -13.344 -13.332  1.00 54.48  ?  170  PRO B C     1 
ATOM   2885  O  O     . PRO B 1  191  ? 90.104  -14.081 -12.395  1.00 59.95  ?  170  PRO B O     1 
ATOM   2886  C  CB    . PRO B 1  191  ? 92.071  -11.650 -12.449  1.00 48.52  ?  170  PRO B CB    1 
ATOM   2887  C  CG    . PRO B 1  191  ? 92.965  -10.711 -13.193  1.00 51.96  ?  170  PRO B CG    1 
ATOM   2888  C  CD    . PRO B 1  191  ? 92.606  -10.870 -14.630  1.00 49.22  ?  170  PRO B CD    1 
ATOM   2889  N  N     . VAL B 1  192  ? 89.561  -12.969 -14.270  1.00 51.53  ?  171  VAL B N     1 
ATOM   2890  C  CA    . VAL B 1  192  ? 88.184  -13.452 -14.292  1.00 52.91  ?  171  VAL B CA    1 
ATOM   2891  C  C     . VAL B 1  192  ? 88.107  -14.647 -15.233  1.00 51.18  ?  171  VAL B C     1 
ATOM   2892  O  O     . VAL B 1  192  ? 88.615  -14.601 -16.361  1.00 48.21  ?  171  VAL B O     1 
ATOM   2893  C  CB    . VAL B 1  192  ? 87.195  -12.337 -14.688  1.00 55.24  ?  171  VAL B CB    1 
ATOM   2894  C  CG1   . VAL B 1  192  ? 87.442  -11.088 -13.853  1.00 50.66  ?  171  VAL B CG1   1 
ATOM   2895  C  CG2   . VAL B 1  192  ? 87.263  -12.008 -16.166  1.00 56.42  ?  171  VAL B CG2   1 
ATOM   2896  N  N     . LEU B 1  193  ? 87.537  -15.747 -14.739  1.00 53.09  ?  172  LEU B N     1 
ATOM   2897  C  CA    . LEU B 1  193  ? 87.488  -16.976 -15.521  1.00 51.84  ?  172  LEU B CA    1 
ATOM   2898  C  C     . LEU B 1  193  ? 86.309  -17.008 -16.487  1.00 48.33  ?  172  LEU B C     1 
ATOM   2899  O  O     . LEU B 1  193  ? 86.470  -17.395 -17.649  1.00 45.02  ?  172  LEU B O     1 
ATOM   2900  C  CB    . LEU B 1  193  ? 87.441  -18.184 -14.585  1.00 54.26  ?  172  LEU B CB    1 
ATOM   2901  C  CG    . LEU B 1  193  ? 88.776  -18.845 -14.237  1.00 51.47  ?  172  LEU B CG    1 
ATOM   2902  C  CD1   . LEU B 1  193  ? 89.910  -17.842 -14.253  1.00 48.75  ?  172  LEU B CD1   1 
ATOM   2903  C  CD2   . LEU B 1  193  ? 88.685  -19.526 -12.882  1.00 58.38  ?  172  LEU B CD2   1 
ATOM   2904  N  N     . LYS B 1  194  ? 85.120  -16.623 -16.032  1.00 47.48  ?  173  LYS B N     1 
ATOM   2905  C  CA    . LYS B 1  194  ? 83.933  -16.808 -16.854  1.00 43.95  ?  173  LYS B CA    1 
ATOM   2906  C  C     . LYS B 1  194  ? 82.947  -15.684 -16.593  1.00 45.75  ?  173  LYS B C     1 
ATOM   2907  O  O     . LYS B 1  194  ? 82.728  -15.304 -15.443  1.00 50.36  ?  173  LYS B O     1 
ATOM   2908  C  CB    . LYS B 1  194  ? 83.283  -18.164 -16.564  1.00 44.19  ?  173  LYS B CB    1 
ATOM   2909  C  CG    . LYS B 1  194  ? 82.229  -18.589 -17.565  1.00 46.94  ?  173  LYS B CG    1 
ATOM   2910  C  CD    . LYS B 1  194  ? 81.840  -20.036 -17.337  1.00 48.91  ?  173  LYS B CD    1 
ATOM   2911  C  CE    . LYS B 1  194  ? 80.826  -20.509 -18.356  1.00 55.76  ?  173  LYS B CE    1 
ATOM   2912  N  NZ    . LYS B 1  194  ? 80.478  -21.942 -18.143  1.00 69.42  ?  173  LYS B NZ    1 
ATOM   2913  N  N     . VAL B 1  195  ? 82.343  -15.164 -17.658  1.00 45.15  ?  174  VAL B N     1 
ATOM   2914  C  CA    . VAL B 1  195  ? 81.334  -14.116 -17.536  1.00 46.13  ?  174  VAL B CA    1 
ATOM   2915  C  C     . VAL B 1  195  ? 80.216  -14.390 -18.530  1.00 43.38  ?  174  VAL B C     1 
ATOM   2916  O  O     . VAL B 1  195  ? 80.469  -14.600 -19.720  1.00 42.94  ?  174  VAL B O     1 
ATOM   2917  C  CB    . VAL B 1  195  ? 81.917  -12.707 -17.765  1.00 40.91  ?  174  VAL B CB    1 
ATOM   2918  C  CG1   . VAL B 1  195  ? 80.800  -11.686 -17.816  1.00 41.13  ?  174  VAL B CG1   1 
ATOM   2919  C  CG2   . VAL B 1  195  ? 82.895  -12.345 -16.664  1.00 43.60  ?  174  VAL B CG2   1 
ATOM   2920  N  N     . THR B 1  196  ? 78.980  -14.386 -18.042  1.00 44.83  ?  175  THR B N     1 
ATOM   2921  C  CA    . THR B 1  196  ? 77.808  -14.444 -18.899  1.00 42.98  ?  175  THR B CA    1 
ATOM   2922  C  C     . THR B 1  196  ? 76.861  -13.324 -18.495  1.00 43.23  ?  175  THR B C     1 
ATOM   2923  O  O     . THR B 1  196  ? 76.916  -12.816 -17.374  1.00 44.13  ?  175  THR B O     1 
ATOM   2924  C  CB    . THR B 1  196  ? 77.107  -15.808 -18.816  1.00 43.50  ?  175  THR B CB    1 
ATOM   2925  O  OG1   . THR B 1  196  ? 76.252  -15.974 -19.952  1.00 53.82  ?  175  THR B OG1   1 
ATOM   2926  C  CG2   . THR B 1  196  ? 76.277  -15.913 -17.547  1.00 41.54  ?  175  THR B CG2   1 
ATOM   2927  N  N     . TYR B 1  197  ? 76.003  -12.919 -19.425  1.00 43.40  ?  176  TYR B N     1 
ATOM   2928  C  CA    . TYR B 1  197  ? 75.080  -11.828 -19.153  1.00 46.61  ?  176  TYR B CA    1 
ATOM   2929  C  C     . TYR B 1  197  ? 73.720  -12.129 -19.764  1.00 44.64  ?  176  TYR B C     1 
ATOM   2930  O  O     . TYR B 1  197  ? 73.614  -12.822 -20.779  1.00 46.33  ?  176  TYR B O     1 
ATOM   2931  C  CB    . TYR B 1  197  ? 75.618  -10.485 -19.675  1.00 45.25  ?  176  TYR B CB    1 
ATOM   2932  C  CG    . TYR B 1  197  ? 75.522  -10.290 -21.171  1.00 43.26  ?  176  TYR B CG    1 
ATOM   2933  C  CD1   . TYR B 1  197  ? 76.482  -10.809 -22.024  1.00 42.22  ?  176  TYR B CD1   1 
ATOM   2934  C  CD2   . TYR B 1  197  ? 74.480  -9.563  -21.727  1.00 45.33  ?  176  TYR B CD2   1 
ATOM   2935  C  CE1   . TYR B 1  197  ? 76.398  -10.623 -23.390  1.00 44.38  ?  176  TYR B CE1   1 
ATOM   2936  C  CE2   . TYR B 1  197  ? 74.388  -9.373  -23.090  1.00 46.54  ?  176  TYR B CE2   1 
ATOM   2937  C  CZ    . TYR B 1  197  ? 75.349  -9.903  -23.917  1.00 48.21  ?  176  TYR B CZ    1 
ATOM   2938  O  OH    . TYR B 1  197  ? 75.257  -9.711  -25.275  1.00 52.58  ?  176  TYR B OH    1 
ATOM   2939  N  N     . LYS B 1  198  ? 72.681  -11.595 -19.128  1.00 42.47  ?  177  LYS B N     1 
ATOM   2940  C  CA    . LYS B 1  198  ? 71.312  -11.750 -19.592  1.00 42.72  ?  177  LYS B CA    1 
ATOM   2941  C  C     . LYS B 1  198  ? 70.579  -10.431 -19.411  1.00 49.47  ?  177  LYS B C     1 
ATOM   2942  O  O     . LYS B 1  198  ? 70.849  -9.681  -18.471  1.00 49.05  ?  177  LYS B O     1 
ATOM   2943  C  CB    . LYS B 1  198  ? 70.583  -12.865 -18.832  1.00 44.65  ?  177  LYS B CB    1 
ATOM   2944  C  CG    . LYS B 1  198  ? 69.350  -13.394 -19.533  1.00 53.61  ?  177  LYS B CG    1 
ATOM   2945  C  CD    . LYS B 1  198  ? 68.641  -14.436 -18.685  1.00 62.67  ?  177  LYS B CD    1 
ATOM   2946  C  CE    . LYS B 1  198  ? 67.561  -15.147 -19.479  1.00 60.36  ?  177  LYS B CE    1 
ATOM   2947  N  NZ    . LYS B 1  198  ? 66.609  -14.185 -20.091  1.00 64.00  ?  177  LYS B NZ    1 
ATOM   2948  N  N     . VAL B 1  199  ? 69.651  -10.149 -20.319  1.00 51.98  ?  178  VAL B N     1 
ATOM   2949  C  CA    . VAL B 1  199  ? 68.826  -8.948  -20.250  1.00 51.05  ?  178  VAL B CA    1 
ATOM   2950  C  C     . VAL B 1  199  ? 67.383  -9.395  -20.077  1.00 52.36  ?  178  VAL B C     1 
ATOM   2951  O  O     . VAL B 1  199  ? 66.793  -9.980  -20.994  1.00 52.43  ?  178  VAL B O     1 
ATOM   2952  C  CB    . VAL B 1  199  ? 68.982  -8.062  -21.493  1.00 46.67  ?  178  VAL B CB    1 
ATOM   2953  C  CG1   . VAL B 1  199  ? 68.309  -6.717  -21.270  1.00 48.82  ?  178  VAL B CG1   1 
ATOM   2954  C  CG2   . VAL B 1  199  ? 70.448  -7.882  -21.843  1.00 43.93  ?  178  VAL B CG2   1 
ATOM   2955  N  N     . ASP B 1  200  ? 66.815  -9.125  -18.908  1.00 53.08  ?  179  ASP B N     1 
ATOM   2956  C  CA    . ASP B 1  200  ? 65.411  -9.388  -18.650  1.00 56.47  ?  179  ASP B CA    1 
ATOM   2957  C  C     . ASP B 1  200  ? 64.617  -8.090  -18.752  1.00 57.23  ?  179  ASP B C     1 
ATOM   2958  O  O     . ASP B 1  200  ? 65.162  -7.006  -18.967  1.00 56.50  ?  179  ASP B O     1 
ATOM   2959  C  CB    . ASP B 1  200  ? 65.222  -10.036 -17.278  1.00 56.32  ?  179  ASP B CB    1 
ATOM   2960  C  CG    . ASP B 1  200  ? 65.655  -11.484 -17.254  1.00 61.83  ?  179  ASP B CG    1 
ATOM   2961  O  OD1   . ASP B 1  200  ? 65.791  -12.080 -18.342  1.00 62.27  ?  179  ASP B OD1   1 
ATOM   2962  O  OD2   . ASP B 1  200  ? 65.850  -12.030 -16.149  1.00 66.71  ?  179  ASP B OD2   1 
ATOM   2963  N  N     . ALA B 1  201  ? 63.307  -8.206  -18.578  1.00 60.14  ?  180  ALA B N     1 
ATOM   2964  C  CA    . ALA B 1  201  ? 62.407  -7.065  -18.619  1.00 65.97  ?  180  ALA B CA    1 
ATOM   2965  C  C     . ALA B 1  201  ? 61.947  -6.739  -17.208  1.00 65.45  ?  180  ALA B C     1 
ATOM   2966  O  O     . ALA B 1  201  ? 61.484  -7.623  -16.480  1.00 65.73  ?  180  ALA B O     1 
ATOM   2967  C  CB    . ALA B 1  201  ? 61.203  -7.341  -19.520  1.00 66.06  ?  180  ALA B CB    1 
ATOM   2968  N  N     . THR B 1  202  ? 62.090  -5.477  -16.826  1.00 64.08  ?  181  THR B N     1 
ATOM   2969  C  CA    . THR B 1  202  ? 61.525  -4.951  -15.598  1.00 65.22  ?  181  THR B CA    1 
ATOM   2970  C  C     . THR B 1  202  ? 60.455  -3.927  -15.936  1.00 68.53  ?  181  THR B C     1 
ATOM   2971  O  O     . THR B 1  202  ? 60.446  -3.320  -17.015  1.00 67.72  ?  181  THR B O     1 
ATOM   2972  C  CB    . THR B 1  202  ? 62.588  -4.308  -14.700  1.00 66.87  ?  181  THR B CB    1 
ATOM   2973  O  OG1   . THR B 1  202  ? 63.484  -3.522  -15.494  1.00 65.99  ?  181  THR B OG1   1 
ATOM   2974  C  CG2   . THR B 1  202  ? 63.359  -5.373  -13.942  1.00 70.14  ?  181  THR B CG2   1 
ATOM   2975  N  N     . ARG B 1  203  ? 59.545  -3.760  -14.988  1.00 68.50  ?  182  ARG B N     1 
ATOM   2976  C  CA    . ARG B 1  203  ? 58.370  -2.926  -15.154  1.00 66.70  ?  182  ARG B CA    1 
ATOM   2977  C  C     . ARG B 1  203  ? 58.603  -1.602  -14.440  1.00 67.57  ?  182  ARG B C     1 
ATOM   2978  O  O     . ARG B 1  203  ? 58.928  -1.585  -13.248  1.00 64.39  ?  182  ARG B O     1 
ATOM   2979  C  CB    . ARG B 1  203  ? 57.142  -3.647  -14.598  1.00 67.11  ?  182  ARG B CB    1 
ATOM   2980  C  CG    . ARG B 1  203  ? 55.829  -3.213  -15.194  1.00 70.34  ?  182  ARG B CG    1 
ATOM   2981  C  CD    . ARG B 1  203  ? 55.129  -2.245  -14.285  1.00 67.96  ?  182  ARG B CD    1 
ATOM   2982  N  NE    . ARG B 1  203  ? 54.774  -2.837  -13.003  1.00 65.03  ?  182  ARG B NE    1 
ATOM   2983  C  CZ    . ARG B 1  203  ? 54.230  -2.158  -12.001  1.00 65.91  ?  182  ARG B CZ    1 
ATOM   2984  N  NH1   . ARG B 1  203  ? 53.981  -0.862  -12.134  1.00 63.29  ?  182  ARG B NH1   1 
ATOM   2985  N  NH2   . ARG B 1  203  ? 53.938  -2.772  -10.865  1.00 66.39  ?  182  ARG B NH2   1 
ATOM   2986  N  N     . VAL B 1  204  ? 58.473  -0.503  -15.174  1.00 67.90  ?  183  VAL B N     1 
ATOM   2987  C  CA    . VAL B 1  204  ? 58.479  0.835   -14.597  1.00 67.90  ?  183  VAL B CA    1 
ATOM   2988  C  C     . VAL B 1  204  ? 57.151  1.480   -14.966  1.00 71.45  ?  183  VAL B C     1 
ATOM   2989  O  O     . VAL B 1  204  ? 56.930  1.842   -16.129  1.00 71.78  ?  183  VAL B O     1 
ATOM   2990  C  CB    . VAL B 1  204  ? 59.667  1.673   -15.091  1.00 64.98  ?  183  VAL B CB    1 
ATOM   2991  C  CG1   . VAL B 1  204  ? 59.503  3.127   -14.679  1.00 76.29  ?  183  VAL B CG1   1 
ATOM   2992  C  CG2   . VAL B 1  204  ? 60.965  1.109   -14.537  1.00 66.07  ?  183  VAL B CG2   1 
ATOM   2993  N  N     . GLU B 1  205  ? 56.275  1.641   -13.970  1.00 74.65  ?  184  GLU B N     1 
ATOM   2994  C  CA    . GLU B 1  205  ? 54.940  2.202   -14.164  1.00 75.64  ?  184  GLU B CA    1 
ATOM   2995  C  C     . GLU B 1  205  ? 54.196  1.476   -15.279  1.00 72.51  ?  184  GLU B C     1 
ATOM   2996  O  O     . GLU B 1  205  ? 53.931  0.278   -15.165  1.00 70.83  ?  184  GLU B O     1 
ATOM   2997  C  CB    . GLU B 1  205  ? 55.037  3.705   -14.421  1.00 78.10  ?  184  GLU B CB    1 
ATOM   2998  C  CG    . GLU B 1  205  ? 55.486  4.470   -13.192  1.00 83.54  ?  184  GLU B CG    1 
ATOM   2999  C  CD    . GLU B 1  205  ? 56.274  5.714   -13.531  1.00 94.41  ?  184  GLU B CD    1 
ATOM   3000  O  OE1   . GLU B 1  205  ? 56.920  6.276   -12.620  1.00 97.93  ?  184  GLU B OE1   1 
ATOM   3001  O  OE2   . GLU B 1  205  ? 56.251  6.125   -14.709  1.00 96.37  ?  184  GLU B OE2   1 
ATOM   3002  N  N     . GLN B 1  206  ? 53.836  2.172   -16.355  1.00 70.49  ?  185  GLN B N     1 
ATOM   3003  C  CA    . GLN B 1  206  ? 53.095  1.507   -17.419  1.00 66.86  ?  185  GLN B CA    1 
ATOM   3004  C  C     . GLN B 1  206  ? 53.987  0.691   -18.344  1.00 68.75  ?  185  GLN B C     1 
ATOM   3005  O  O     . GLN B 1  206  ? 53.472  -0.150  -19.090  1.00 68.98  ?  185  GLN B O     1 
ATOM   3006  C  CB    . GLN B 1  206  ? 52.306  2.528   -18.238  1.00 67.96  ?  185  GLN B CB    1 
ATOM   3007  C  CG    . GLN B 1  206  ? 51.289  3.307   -17.424  1.00 73.04  ?  185  GLN B CG    1 
ATOM   3008  C  CD    . GLN B 1  206  ? 50.173  3.875   -18.275  1.00 75.38  ?  185  GLN B CD    1 
ATOM   3009  O  OE1   . GLN B 1  206  ? 50.071  3.577   -19.465  1.00 78.90  ?  185  GLN B OE1   1 
ATOM   3010  N  NE2   . GLN B 1  206  ? 49.325  4.696   -17.667  1.00 70.60  ?  185  GLN B NE2   1 
ATOM   3011  N  N     . ARG B 1  207  ? 55.300  0.900   -18.307  1.00 71.26  ?  186  ARG B N     1 
ATOM   3012  C  CA    . ARG B 1  207  ? 56.216  0.242   -19.231  1.00 69.46  ?  186  ARG B CA    1 
ATOM   3013  C  C     . ARG B 1  207  ? 56.758  -1.042  -18.613  1.00 68.63  ?  186  ARG B C     1 
ATOM   3014  O  O     . ARG B 1  207  ? 57.451  -1.002  -17.591  1.00 68.55  ?  186  ARG B O     1 
ATOM   3015  C  CB    . ARG B 1  207  ? 57.360  1.180   -19.606  1.00 65.58  ?  186  ARG B CB    1 
ATOM   3016  C  CG    . ARG B 1  207  ? 56.921  2.363   -20.441  1.00 68.51  ?  186  ARG B CG    1 
ATOM   3017  C  CD    . ARG B 1  207  ? 56.187  1.909   -21.691  1.00 72.86  ?  186  ARG B CD    1 
ATOM   3018  N  NE    . ARG B 1  207  ? 57.044  1.133   -22.582  1.00 75.61  ?  186  ARG B NE    1 
ATOM   3019  C  CZ    . ARG B 1  207  ? 57.878  1.671   -23.466  1.00 76.29  ?  186  ARG B CZ    1 
ATOM   3020  N  NH1   . ARG B 1  207  ? 57.969  2.988   -23.570  1.00 78.84  ?  186  ARG B NH1   1 
ATOM   3021  N  NH2   . ARG B 1  207  ? 58.622  0.899   -24.243  1.00 72.61  ?  186  ARG B NH2   1 
ATOM   3022  N  N     . THR B 1  208  ? 56.439  -2.176  -19.234  1.00 66.96  ?  187  THR B N     1 
ATOM   3023  C  CA    . THR B 1  208  ? 56.911  -3.479  -18.788  1.00 67.13  ?  187  THR B CA    1 
ATOM   3024  C  C     . THR B 1  208  ? 58.149  -3.954  -19.537  1.00 65.69  ?  187  THR B C     1 
ATOM   3025  O  O     . THR B 1  208  ? 58.689  -5.012  -19.204  1.00 63.68  ?  187  THR B O     1 
ATOM   3026  C  CB    . THR B 1  208  ? 55.795  -4.522  -18.940  1.00 62.10  ?  187  THR B CB    1 
ATOM   3027  O  OG1   . THR B 1  208  ? 55.632  -4.850  -20.324  1.00 62.60  ?  187  THR B OG1   1 
ATOM   3028  C  CG2   . THR B 1  208  ? 54.479  -3.977  -18.410  1.00 53.83  ?  187  THR B CG2   1 
ATOM   3029  N  N     . ASP B 1  209  ? 58.606  -3.207  -20.540  1.00 64.65  ?  188  ASP B N     1 
ATOM   3030  C  CA    . ASP B 1  209  ? 59.719  -3.606  -21.391  1.00 65.83  ?  188  ASP B CA    1 
ATOM   3031  C  C     . ASP B 1  209  ? 61.061  -3.032  -20.947  1.00 64.85  ?  188  ASP B C     1 
ATOM   3032  O  O     . ASP B 1  209  ? 62.026  -3.095  -21.715  1.00 63.99  ?  188  ASP B O     1 
ATOM   3033  C  CB    . ASP B 1  209  ? 59.438  -3.244  -22.850  1.00 63.81  ?  188  ASP B CB    1 
ATOM   3034  C  CG    . ASP B 1  209  ? 58.815  -1.886  -23.001  1.00 65.66  ?  188  ASP B CG    1 
ATOM   3035  O  OD1   . ASP B 1  209  ? 58.260  -1.372  -22.009  1.00 66.69  ?  188  ASP B OD1   1 
ATOM   3036  O  OD2   . ASP B 1  209  ? 58.871  -1.337  -24.120  1.00 66.84  ?  188  ASP B OD2   1 
ATOM   3037  N  N     . PHE B 1  210  ? 61.139  -2.432  -19.760  1.00 63.14  ?  189  PHE B N     1 
ATOM   3038  C  CA    . PHE B 1  210  ? 62.407  -1.877  -19.309  1.00 63.54  ?  189  PHE B CA    1 
ATOM   3039  C  C     . PHE B 1  210  ? 63.462  -2.976  -19.198  1.00 64.11  ?  189  PHE B C     1 
ATOM   3040  O  O     . PHE B 1  210  ? 63.153  -4.166  -19.129  1.00 61.30  ?  189  PHE B O     1 
ATOM   3041  C  CB    . PHE B 1  210  ? 62.239  -1.170  -17.966  1.00 63.25  ?  189  PHE B CB    1 
ATOM   3042  C  CG    . PHE B 1  210  ? 62.103  0.318   -18.081  1.00 64.00  ?  189  PHE B CG    1 
ATOM   3043  C  CD1   . PHE B 1  210  ? 61.060  0.876   -18.799  1.00 64.22  ?  189  PHE B CD1   1 
ATOM   3044  C  CD2   . PHE B 1  210  ? 63.013  1.160   -17.466  1.00 62.40  ?  189  PHE B CD2   1 
ATOM   3045  C  CE1   . PHE B 1  210  ? 60.930  2.244   -18.907  1.00 63.25  ?  189  PHE B CE1   1 
ATOM   3046  C  CE2   . PHE B 1  210  ? 62.888  2.531   -17.569  1.00 65.25  ?  189  PHE B CE2   1 
ATOM   3047  C  CZ    . PHE B 1  210  ? 61.844  3.074   -18.290  1.00 64.49  ?  189  PHE B CZ    1 
ATOM   3048  N  N     . ASP B 1  211  ? 64.726  -2.566  -19.234  1.00 61.73  ?  190  ASP B N     1 
ATOM   3049  C  CA    . ASP B 1  211  ? 65.847  -3.495  -19.285  1.00 59.39  ?  190  ASP B CA    1 
ATOM   3050  C  C     . ASP B 1  211  ? 66.435  -3.714  -17.898  1.00 58.12  ?  190  ASP B C     1 
ATOM   3051  O  O     . ASP B 1  211  ? 66.640  -2.758  -17.144  1.00 55.40  ?  190  ASP B O     1 
ATOM   3052  C  CB    . ASP B 1  211  ? 66.929  -2.984  -20.236  1.00 55.97  ?  190  ASP B CB    1 
ATOM   3053  C  CG    . ASP B 1  211  ? 66.675  -3.380  -21.673  1.00 57.99  ?  190  ASP B CG    1 
ATOM   3054  O  OD1   . ASP B 1  211  ? 65.557  -3.846  -21.977  1.00 59.45  ?  190  ASP B OD1   1 
ATOM   3055  O  OD2   . ASP B 1  211  ? 67.594  -3.224  -22.502  1.00 56.51  ?  190  ASP B OD2   1 
ATOM   3056  N  N     . LYS B 1  212  ? 66.699  -4.976  -17.570  1.00 59.70  ?  191  LYS B N     1 
ATOM   3057  C  CA    . LYS B 1  212  ? 67.434  -5.357  -16.371  1.00 56.80  ?  191  LYS B CA    1 
ATOM   3058  C  C     . LYS B 1  212  ? 68.622  -6.207  -16.788  1.00 55.16  ?  191  LYS B C     1 
ATOM   3059  O  O     . LYS B 1  212  ? 68.455  -7.205  -17.496  1.00 53.07  ?  191  LYS B O     1 
ATOM   3060  C  CB    . LYS B 1  212  ? 66.557  -6.134  -15.389  1.00 59.92  ?  191  LYS B CB    1 
ATOM   3061  C  CG    . LYS B 1  212  ? 67.323  -6.651  -14.182  1.00 60.00  ?  191  LYS B CG    1 
ATOM   3062  C  CD    . LYS B 1  212  ? 66.424  -7.370  -13.189  1.00 63.96  ?  191  LYS B CD    1 
ATOM   3063  C  CE    . LYS B 1  212  ? 66.030  -8.750  -13.682  1.00 63.06  ?  191  LYS B CE    1 
ATOM   3064  N  NZ    . LYS B 1  212  ? 65.313  -9.519  -12.629  1.00 58.74  ?  191  LYS B NZ    1 
ATOM   3065  N  N     . LEU B 1  213  ? 69.814  -5.818  -16.350  1.00 58.16  ?  192  LEU B N     1 
ATOM   3066  C  CA    . LEU B 1  213  ? 71.045  -6.483  -16.756  1.00 53.48  ?  192  LEU B CA    1 
ATOM   3067  C  C     . LEU B 1  213  ? 71.542  -7.380  -15.629  1.00 50.20  ?  192  LEU B C     1 
ATOM   3068  O  O     . LEU B 1  213  ? 71.748  -6.914  -14.504  1.00 50.87  ?  192  LEU B O     1 
ATOM   3069  C  CB    . LEU B 1  213  ? 72.112  -5.461  -17.139  1.00 46.79  ?  192  LEU B CB    1 
ATOM   3070  C  CG    . LEU B 1  213  ? 73.447  -6.038  -17.602  1.00 44.23  ?  192  LEU B CG    1 
ATOM   3071  C  CD1   . LEU B 1  213  ? 73.239  -7.058  -18.704  1.00 45.44  ?  192  LEU B CD1   1 
ATOM   3072  C  CD2   . LEU B 1  213  ? 74.355  -4.920  -18.073  1.00 46.16  ?  192  LEU B CD2   1 
ATOM   3073  N  N     . ILE B 1  214  ? 71.728  -8.661  -15.933  1.00 46.38  ?  193  ILE B N     1 
ATOM   3074  C  CA    . ILE B 1  214  ? 72.300  -9.627  -15.004  1.00 48.36  ?  193  ILE B CA    1 
ATOM   3075  C  C     . ILE B 1  214  ? 73.665  -10.045 -15.531  1.00 50.18  ?  193  ILE B C     1 
ATOM   3076  O  O     . ILE B 1  214  ? 73.799  -10.425 -16.701  1.00 49.77  ?  193  ILE B O     1 
ATOM   3077  C  CB    . ILE B 1  214  ? 71.392  -10.854 -14.820  1.00 49.13  ?  193  ILE B CB    1 
ATOM   3078  C  CG1   . ILE B 1  214  ? 69.974  -10.422 -14.450  1.00 53.96  ?  193  ILE B CG1   1 
ATOM   3079  C  CG2   . ILE B 1  214  ? 71.956  -11.770 -13.749  1.00 49.09  ?  193  ILE B CG2   1 
ATOM   3080  C  CD1   . ILE B 1  214  ? 69.025  -11.580 -14.248  1.00 56.06  ?  193  ILE B CD1   1 
ATOM   3081  N  N     . LEU B 1  215  ? 74.672  -9.970  -14.666  1.00 49.67  ?  194  LEU B N     1 
ATOM   3082  C  CA    . LEU B 1  215  ? 76.031  -10.393 -14.973  1.00 47.82  ?  194  LEU B CA    1 
ATOM   3083  C  C     . LEU B 1  215  ? 76.429  -11.483 -13.991  1.00 48.81  ?  194  LEU B C     1 
ATOM   3084  O  O     . LEU B 1  215  ? 76.479  -11.243 -12.781  1.00 50.42  ?  194  LEU B O     1 
ATOM   3085  C  CB    . LEU B 1  215  ? 77.007  -9.219  -14.888  1.00 45.03  ?  194  LEU B CB    1 
ATOM   3086  C  CG    . LEU B 1  215  ? 76.923  -8.148  -15.972  1.00 40.83  ?  194  LEU B CG    1 
ATOM   3087  C  CD1   . LEU B 1  215  ? 77.601  -6.884  -15.493  1.00 41.52  ?  194  LEU B CD1   1 
ATOM   3088  C  CD2   . LEU B 1  215  ? 77.565  -8.643  -17.252  1.00 41.74  ?  194  LEU B CD2   1 
ATOM   3089  N  N     . ASP B 1  216  ? 76.699  -12.673 -14.508  1.00 47.32  ?  195  ASP B N     1 
ATOM   3090  C  CA    . ASP B 1  216  ? 77.228  -13.777 -13.718  1.00 49.93  ?  195  ASP B CA    1 
ATOM   3091  C  C     . ASP B 1  216  ? 78.723  -13.844 -13.997  1.00 48.83  ?  195  ASP B C     1 
ATOM   3092  O  O     . ASP B 1  216  ? 79.136  -14.149 -15.122  1.00 47.58  ?  195  ASP B O     1 
ATOM   3093  C  CB    . ASP B 1  216  ? 76.529  -15.087 -14.075  1.00 56.25  ?  195  ASP B CB    1 
ATOM   3094  C  CG    . ASP B 1  216  ? 76.687  -16.148 -13.005  1.00 58.95  ?  195  ASP B CG    1 
ATOM   3095  O  OD1   . ASP B 1  216  ? 77.819  -16.350 -12.518  1.00 60.61  ?  195  ASP B OD1   1 
ATOM   3096  O  OD2   . ASP B 1  216  ? 75.672  -16.778 -12.647  1.00 57.52  ?  195  ASP B OD2   1 
ATOM   3097  N  N     . VAL B 1  217  ? 79.532  -13.539 -12.986  1.00 51.23  ?  196  VAL B N     1 
ATOM   3098  C  CA    . VAL B 1  217  ? 80.972  -13.400 -13.164  1.00 52.66  ?  196  VAL B CA    1 
ATOM   3099  C  C     . VAL B 1  217  ? 81.692  -14.245 -12.123  1.00 56.77  ?  196  VAL B C     1 
ATOM   3100  O  O     . VAL B 1  217  ? 81.408  -14.145 -10.923  1.00 58.58  ?  196  VAL B O     1 
ATOM   3101  C  CB    . VAL B 1  217  ? 81.413  -11.926 -13.086  1.00 51.04  ?  196  VAL B CB    1 
ATOM   3102  C  CG1   . VAL B 1  217  ? 80.628  -11.202 -12.022  1.00 55.46  ?  196  VAL B CG1   1 
ATOM   3103  C  CG2   . VAL B 1  217  ? 82.906  -11.821 -12.819  1.00 55.37  ?  196  VAL B CG2   1 
ATOM   3104  N  N     . GLU B 1  218  ? 82.614  -15.083 -12.593  1.00 57.37  ?  197  GLU B N     1 
ATOM   3105  C  CA    . GLU B 1  218  ? 83.443  -15.938 -11.757  1.00 58.16  ?  197  GLU B CA    1 
ATOM   3106  C  C     . GLU B 1  218  ? 84.904  -15.662 -12.070  1.00 56.08  ?  197  GLU B C     1 
ATOM   3107  O  O     . GLU B 1  218  ? 85.313  -15.694 -13.238  1.00 54.77  ?  197  GLU B O     1 
ATOM   3108  C  CB    . GLU B 1  218  ? 83.133  -17.418 -11.984  1.00 60.51  ?  197  GLU B CB    1 
ATOM   3109  C  CG    . GLU B 1  218  ? 84.093  -18.351 -11.265  1.00 63.78  ?  197  GLU B CG    1 
ATOM   3110  C  CD    . GLU B 1  218  ? 83.797  -19.815 -11.522  1.00 72.22  ?  197  GLU B CD    1 
ATOM   3111  O  OE1   . GLU B 1  218  ? 82.665  -20.133 -11.940  1.00 73.95  ?  197  GLU B OE1   1 
ATOM   3112  O  OE2   . GLU B 1  218  ? 84.701  -20.648 -11.306  1.00 70.57  ?  197  GLU B OE2   1 
ATOM   3113  N  N     . THR B 1  219  ? 85.681  -15.405 -11.027  1.00 59.68  ?  198  THR B N     1 
ATOM   3114  C  CA    . THR B 1  219  ? 87.076  -15.012 -11.126  1.00 59.30  ?  198  THR B CA    1 
ATOM   3115  C  C     . THR B 1  219  ? 87.958  -16.061 -10.458  1.00 60.62  ?  198  THR B C     1 
ATOM   3116  O  O     . THR B 1  219  ? 87.481  -17.060 -9.918   1.00 63.97  ?  198  THR B O     1 
ATOM   3117  C  CB    . THR B 1  219  ? 87.298  -13.646 -10.473  1.00 58.86  ?  198  THR B CB    1 
ATOM   3118  O  OG1   . THR B 1  219  ? 87.265  -13.792 -9.048   1.00 63.22  ?  198  THR B OG1   1 
ATOM   3119  C  CG2   . THR B 1  219  ? 86.204  -12.681 -10.884  1.00 58.74  ?  198  THR B CG2   1 
ATOM   3120  N  N     . LYS B 1  220  ? 89.264  -15.818 -10.499  1.00 61.03  ?  199  LYS B N     1 
ATOM   3121  C  CA    . LYS B 1  220  ? 90.198  -16.567 -9.679   1.00 60.24  ?  199  LYS B CA    1 
ATOM   3122  C  C     . LYS B 1  220  ? 90.166  -16.022 -8.255   1.00 63.41  ?  199  LYS B C     1 
ATOM   3123  O  O     . LYS B 1  220  ? 89.392  -15.121 -7.925   1.00 64.63  ?  199  LYS B O     1 
ATOM   3124  C  CB    . LYS B 1  220  ? 91.601  -16.499 -10.276  1.00 59.28  ?  199  LYS B CB    1 
ATOM   3125  C  CG    . LYS B 1  220  ? 91.866  -17.556 -11.329  1.00 60.09  ?  199  LYS B CG    1 
ATOM   3126  C  CD    . LYS B 1  220  ? 93.196  -17.350 -12.036  1.00 58.05  ?  199  LYS B CD    1 
ATOM   3127  C  CE    . LYS B 1  220  ? 93.078  -16.377 -13.190  1.00 52.47  ?  199  LYS B CE    1 
ATOM   3128  N  NZ    . LYS B 1  220  ? 94.260  -16.457 -14.095  1.00 54.57  ?  199  LYS B NZ    1 
ATOM   3129  N  N     . ASN B 1  221  ? 91.017  -16.567 -7.394   1.00 64.31  ?  200  ASN B N     1 
ATOM   3130  C  CA    . ASN B 1  221  ? 91.124  -16.036 -6.043   1.00 66.19  ?  200  ASN B CA    1 
ATOM   3131  C  C     . ASN B 1  221  ? 92.060  -14.838 -5.959   1.00 66.61  ?  200  ASN B C     1 
ATOM   3132  O  O     . ASN B 1  221  ? 92.270  -14.311 -4.862   1.00 68.37  ?  200  ASN B O     1 
ATOM   3133  C  CB    . ASN B 1  221  ? 91.575  -17.131 -5.074   1.00 65.33  ?  200  ASN B CB    1 
ATOM   3134  C  CG    . ASN B 1  221  ? 92.566  -18.087 -5.697   1.00 69.87  ?  200  ASN B CG    1 
ATOM   3135  O  OD1   . ASN B 1  221  ? 92.466  -18.420 -6.877   1.00 70.74  ?  200  ASN B OD1   1 
ATOM   3136  N  ND2   . ASN B 1  221  ? 93.530  -18.538 -4.905   1.00 68.02  ?  200  ASN B ND2   1 
ATOM   3137  N  N     . SER B 1  222  ? 92.627  -14.401 -7.087   1.00 62.87  ?  201  SER B N     1 
ATOM   3138  C  CA    . SER B 1  222  ? 93.413  -13.173 -7.095   1.00 59.37  ?  201  SER B CA    1 
ATOM   3139  C  C     . SER B 1  222  ? 92.530  -11.962 -6.823   1.00 64.16  ?  201  SER B C     1 
ATOM   3140  O  O     . SER B 1  222  ? 92.869  -11.106 -5.998   1.00 66.25  ?  201  SER B O     1 
ATOM   3141  C  CB    . SER B 1  222  ? 94.130  -13.016 -8.435   1.00 54.17  ?  201  SER B CB    1 
ATOM   3142  O  OG    . SER B 1  222  ? 94.227  -14.255 -9.109   1.00 58.71  ?  201  SER B OG    1 
ATOM   3143  N  N     . ILE B 1  223  ? 91.393  -11.874 -7.511   1.00 62.49  ?  202  ILE B N     1 
ATOM   3144  C  CA    . ILE B 1  223  ? 90.471  -10.759 -7.361   1.00 62.34  ?  202  ILE B CA    1 
ATOM   3145  C  C     . ILE B 1  223  ? 89.114  -11.296 -6.928   1.00 64.29  ?  202  ILE B C     1 
ATOM   3146  O  O     . ILE B 1  223  ? 88.782  -12.465 -7.131   1.00 65.25  ?  202  ILE B O     1 
ATOM   3147  C  CB    . ILE B 1  223  ? 90.328  -9.936  -8.659   1.00 58.97  ?  202  ILE B CB    1 
ATOM   3148  C  CG1   . ILE B 1  223  ? 91.674  -9.790  -9.362   1.00 60.36  ?  202  ILE B CG1   1 
ATOM   3149  C  CG2   . ILE B 1  223  ? 89.769  -8.553  -8.365   1.00 63.48  ?  202  ILE B CG2   1 
ATOM   3150  C  CD1   . ILE B 1  223  ? 91.668  -8.739  -10.453  1.00 62.09  ?  202  ILE B CD1   1 
ATOM   3151  N  N     . SER B 1  224  ? 88.339  -10.423 -6.313   1.00 64.90  ?  203  SER B N     1 
ATOM   3152  C  CA    . SER B 1  224  ? 86.923  -10.639 -6.080   1.00 63.14  ?  203  SER B CA    1 
ATOM   3153  C  C     . SER B 1  224  ? 86.127  -10.166 -7.286   1.00 62.67  ?  203  SER B C     1 
ATOM   3154  O  O     . SER B 1  224  ? 86.617  -9.369  -8.091   1.00 65.81  ?  203  SER B O     1 
ATOM   3155  C  CB    . SER B 1  224  ? 86.479  -9.887  -4.829   1.00 65.44  ?  203  SER B CB    1 
ATOM   3156  O  OG    . SER B 1  224  ? 86.716  -8.497  -4.965   1.00 65.01  ?  203  SER B OG    1 
ATOM   3157  N  N     . PRO B 1  225  ? 84.900  -10.657 -7.463   1.00 59.42  ?  204  PRO B N     1 
ATOM   3158  C  CA    . PRO B 1  225  ? 84.064  -10.119 -8.549   1.00 59.79  ?  204  PRO B CA    1 
ATOM   3159  C  C     . PRO B 1  225  ? 83.817  -8.624  -8.430   1.00 61.20  ?  204  PRO B C     1 
ATOM   3160  O  O     . PRO B 1  225  ? 83.774  -7.925  -9.451   1.00 61.85  ?  204  PRO B O     1 
ATOM   3161  C  CB    . PRO B 1  225  ? 82.768  -10.930 -8.417   1.00 60.66  ?  204  PRO B CB    1 
ATOM   3162  C  CG    . PRO B 1  225  ? 83.195  -12.208 -7.780   1.00 59.77  ?  204  PRO B CG    1 
ATOM   3163  C  CD    . PRO B 1  225  ? 84.286  -11.834 -6.823   1.00 59.65  ?  204  PRO B CD    1 
ATOM   3164  N  N     . ARG B 1  226  ? 83.667  -8.116  -7.204   1.00 62.33  ?  205  ARG B N     1 
ATOM   3165  C  CA    . ARG B 1  226  ? 83.424  -6.691  -6.992   1.00 64.25  ?  205  ARG B CA    1 
ATOM   3166  C  C     . ARG B 1  226  ? 84.514  -5.841  -7.630   1.00 64.25  ?  205  ARG B C     1 
ATOM   3167  O  O     . ARG B 1  226  ? 84.238  -4.969  -8.463   1.00 63.89  ?  205  ARG B O     1 
ATOM   3168  C  CB    . ARG B 1  226  ? 83.336  -6.396  -5.495   1.00 69.00  ?  205  ARG B CB    1 
ATOM   3169  C  CG    . ARG B 1  226  ? 81.993  -6.678  -4.870   1.00 71.20  ?  205  ARG B CG    1 
ATOM   3170  C  CD    . ARG B 1  226  ? 82.156  -7.303  -3.498   1.00 73.64  ?  205  ARG B CD    1 
ATOM   3171  N  NE    . ARG B 1  226  ? 82.587  -8.694  -3.591   1.00 74.11  ?  205  ARG B NE    1 
ATOM   3172  C  CZ    . ARG B 1  226  ? 82.490  -9.572  -2.598   1.00 79.14  ?  205  ARG B CZ    1 
ATOM   3173  N  NH1   . ARG B 1  226  ? 82.908  -10.820 -2.770   1.00 77.99  ?  205  ARG B NH1   1 
ATOM   3174  N  NH2   . ARG B 1  226  ? 81.967  -9.204  -1.436   1.00 75.33  ?  205  ARG B NH2   1 
ATOM   3175  N  N     . ASP B 1  227  ? 85.768  -6.080  -7.242   1.00 62.67  ?  206  ASP B N     1 
ATOM   3176  C  CA    . ASP B 1  227  ? 86.864  -5.259  -7.741   1.00 66.63  ?  206  ASP B CA    1 
ATOM   3177  C  C     . ASP B 1  227  ? 87.057  -5.428  -9.241   1.00 66.33  ?  206  ASP B C     1 
ATOM   3178  O  O     . ASP B 1  227  ? 87.501  -4.492  -9.915   1.00 67.85  ?  206  ASP B O     1 
ATOM   3179  C  CB    . ASP B 1  227  ? 88.150  -5.595  -6.991   1.00 74.16  ?  206  ASP B CB    1 
ATOM   3180  C  CG    . ASP B 1  227  ? 88.023  -5.376  -5.497   1.00 78.22  ?  206  ASP B CG    1 
ATOM   3181  O  OD1   . ASP B 1  227  ? 88.140  -4.213  -5.056   1.00 78.79  ?  206  ASP B OD1   1 
ATOM   3182  O  OD2   . ASP B 1  227  ? 87.805  -6.365  -4.766   1.00 75.79  ?  206  ASP B OD2   1 
ATOM   3183  N  N     . ALA B 1  228  ? 86.731  -6.602  -9.781   1.00 64.47  ?  207  ALA B N     1 
ATOM   3184  C  CA    . ALA B 1  228  ? 86.786  -6.787  -11.226  1.00 63.24  ?  207  ALA B CA    1 
ATOM   3185  C  C     . ALA B 1  228  ? 85.761  -5.904  -11.925  1.00 62.20  ?  207  ALA B C     1 
ATOM   3186  O  O     . ALA B 1  228  ? 86.077  -5.220  -12.907  1.00 63.11  ?  207  ALA B O     1 
ATOM   3187  C  CB    . ALA B 1  228  ? 86.564  -8.258  -11.576  1.00 59.77  ?  207  ALA B CB    1 
ATOM   3188  N  N     . LEU B 1  229  ? 84.523  -5.899  -11.422  1.00 59.78  ?  208  LEU B N     1 
ATOM   3189  C  CA    . LEU B 1  229  ? 83.502  -5.030  -11.994  1.00 59.18  ?  208  LEU B CA    1 
ATOM   3190  C  C     . LEU B 1  229  ? 83.904  -3.566  -11.883  1.00 62.49  ?  208  LEU B C     1 
ATOM   3191  O  O     . LEU B 1  229  ? 83.726  -2.792  -12.831  1.00 66.31  ?  208  LEU B O     1 
ATOM   3192  C  CB    . LEU B 1  229  ? 82.160  -5.274  -11.305  1.00 58.21  ?  208  LEU B CB    1 
ATOM   3193  C  CG    . LEU B 1  229  ? 80.937  -4.622  -11.952  1.00 57.19  ?  208  LEU B CG    1 
ATOM   3194  C  CD1   . LEU B 1  229  ? 80.742  -5.139  -13.368  1.00 52.91  ?  208  LEU B CD1   1 
ATOM   3195  C  CD2   . LEU B 1  229  ? 79.696  -4.869  -11.114  1.00 58.35  ?  208  LEU B CD2   1 
ATOM   3196  N  N     . ALA B 1  230  ? 84.464  -3.170  -10.738  1.00 61.30  ?  209  ALA B N     1 
ATOM   3197  C  CA    . ALA B 1  230  ? 84.890  -1.785  -10.564  1.00 60.77  ?  209  ALA B CA    1 
ATOM   3198  C  C     . ALA B 1  230  ? 86.004  -1.418  -11.537  1.00 61.72  ?  209  ALA B C     1 
ATOM   3199  O  O     . ALA B 1  230  ? 86.029  -0.303  -12.071  1.00 64.49  ?  209  ALA B O     1 
ATOM   3200  C  CB    . ALA B 1  230  ? 85.335  -1.553  -9.121   1.00 58.04  ?  209  ALA B CB    1 
ATOM   3201  N  N     . SER B 1  231  ? 86.933  -2.343  -11.782  1.00 60.74  ?  210  SER B N     1 
ATOM   3202  C  CA    . SER B 1  231  ? 88.023  -2.073  -12.716  1.00 63.03  ?  210  SER B CA    1 
ATOM   3203  C  C     . SER B 1  231  ? 87.502  -1.926  -14.140  1.00 63.83  ?  210  SER B C     1 
ATOM   3204  O  O     . SER B 1  231  ? 87.872  -0.984  -14.857  1.00 63.74  ?  210  SER B O     1 
ATOM   3205  C  CB    . SER B 1  231  ? 89.067  -3.186  -12.637  1.00 59.50  ?  210  SER B CB    1 
ATOM   3206  O  OG    . SER B 1  231  ? 90.007  -3.075  -13.691  1.00 62.71  ?  210  SER B OG    1 
ATOM   3207  N  N     . ALA B 1  232  ? 86.644  -2.856  -14.568  1.00 62.79  ?  211  ALA B N     1 
ATOM   3208  C  CA    . ALA B 1  232  ? 86.056  -2.763  -15.901  1.00 62.32  ?  211  ALA B CA    1 
ATOM   3209  C  C     . ALA B 1  232  ? 85.270  -1.469  -16.063  1.00 62.78  ?  211  ALA B C     1 
ATOM   3210  O  O     . ALA B 1  232  ? 85.328  -0.822  -17.118  1.00 63.53  ?  211  ALA B O     1 
ATOM   3211  C  CB    . ALA B 1  232  ? 85.163  -3.975  -16.164  1.00 58.41  ?  211  ALA B CB    1 
ATOM   3212  N  N     . GLY B 1  233  ? 84.535  -1.072  -15.024  1.00 63.75  ?  212  GLY B N     1 
ATOM   3213  C  CA    . GLY B 1  233  ? 83.825  0.194   -15.076  1.00 64.74  ?  212  GLY B CA    1 
ATOM   3214  C  C     . GLY B 1  233  ? 84.759  1.381   -15.199  1.00 64.56  ?  212  GLY B C     1 
ATOM   3215  O  O     . GLY B 1  233  ? 84.487  2.320   -15.950  1.00 62.49  ?  212  GLY B O     1 
ATOM   3216  N  N     . LYS B 1  234  ? 85.871  1.357   -14.464  1.00 65.34  ?  213  LYS B N     1 
ATOM   3217  C  CA    . LYS B 1  234  ? 86.856  2.429   -14.566  1.00 65.12  ?  213  LYS B CA    1 
ATOM   3218  C  C     . LYS B 1  234  ? 87.371  2.562   -15.994  1.00 64.78  ?  213  LYS B C     1 
ATOM   3219  O  O     . LYS B 1  234  ? 87.256  3.628   -16.618  1.00 64.60  ?  213  LYS B O     1 
ATOM   3220  C  CB    . LYS B 1  234  ? 88.005  2.166   -13.590  1.00 68.28  ?  213  LYS B CB    1 
ATOM   3221  C  CG    . LYS B 1  234  ? 89.224  3.055   -13.776  1.00 70.03  ?  213  LYS B CG    1 
ATOM   3222  C  CD    . LYS B 1  234  ? 90.277  2.755   -12.719  1.00 70.21  ?  213  LYS B CD    1 
ATOM   3223  C  CE    . LYS B 1  234  ? 91.628  3.345   -13.085  1.00 68.63  ?  213  LYS B CE    1 
ATOM   3224  N  NZ    . LYS B 1  234  ? 91.568  4.819   -13.258  1.00 72.95  ?  213  LYS B NZ    1 
ATOM   3225  N  N     . THR B 1  235  ? 87.921  1.474   -16.542  1.00 65.19  ?  214  THR B N     1 
ATOM   3226  C  CA    . THR B 1  235  ? 88.512  1.563   -17.874  1.00 65.90  ?  214  THR B CA    1 
ATOM   3227  C  C     . THR B 1  235  ? 87.465  1.883   -18.938  1.00 62.91  ?  214  THR B C     1 
ATOM   3228  O  O     . THR B 1  235  ? 87.788  2.515   -19.952  1.00 64.62  ?  214  THR B O     1 
ATOM   3229  C  CB    . THR B 1  235  ? 89.256  0.272   -18.217  1.00 66.06  ?  214  THR B CB    1 
ATOM   3230  O  OG1   . THR B 1  235  ? 88.322  -0.801  -18.368  1.00 67.19  ?  214  THR B OG1   1 
ATOM   3231  C  CG2   . THR B 1  235  ? 90.241  -0.078  -17.113  1.00 69.34  ?  214  THR B CG2   1 
ATOM   3232  N  N     . LEU B 1  236  ? 86.210  1.479   -18.725  1.00 58.94  ?  215  LEU B N     1 
ATOM   3233  C  CA    . LEU B 1  236  ? 85.161  1.877   -19.659  1.00 56.16  ?  215  LEU B CA    1 
ATOM   3234  C  C     . LEU B 1  236  ? 84.872  3.370   -19.565  1.00 57.31  ?  215  LEU B C     1 
ATOM   3235  O  O     . LEU B 1  236  ? 84.750  4.049   -20.593  1.00 56.66  ?  215  LEU B O     1 
ATOM   3236  C  CB    . LEU B 1  236  ? 83.893  1.066   -19.408  1.00 55.85  ?  215  LEU B CB    1 
ATOM   3237  C  CG    . LEU B 1  236  ? 83.875  -0.320  -20.052  1.00 53.59  ?  215  LEU B CG    1 
ATOM   3238  C  CD1   . LEU B 1  236  ? 82.626  -1.076  -19.652  1.00 53.00  ?  215  LEU B CD1   1 
ATOM   3239  C  CD2   . LEU B 1  236  ? 83.971  -0.204  -21.565  1.00 53.26  ?  215  LEU B CD2   1 
ATOM   3240  N  N     . VAL B 1  237  ? 84.766  3.900   -18.344  1.00 59.64  ?  216  VAL B N     1 
ATOM   3241  C  CA    . VAL B 1  237  ? 84.510  5.327   -18.162  1.00 58.73  ?  216  VAL B CA    1 
ATOM   3242  C  C     . VAL B 1  237  ? 85.604  6.155   -18.823  1.00 57.70  ?  216  VAL B C     1 
ATOM   3243  O  O     . VAL B 1  237  ? 85.332  7.196   -19.431  1.00 58.27  ?  216  VAL B O     1 
ATOM   3244  C  CB    . VAL B 1  237  ? 84.366  5.662   -16.666  1.00 56.61  ?  216  VAL B CB    1 
ATOM   3245  C  CG1   . VAL B 1  237  ? 84.497  7.159   -16.432  1.00 52.35  ?  216  VAL B CG1   1 
ATOM   3246  C  CG2   . VAL B 1  237  ? 83.032  5.168   -16.143  1.00 59.49  ?  216  VAL B CG2   1 
ATOM   3247  N  N     . GLU B 1  238  ? 86.854  5.704   -18.729  1.00 57.41  ?  217  GLU B N     1 
ATOM   3248  C  CA    . GLU B 1  238  ? 87.915  6.387   -19.464  1.00 61.32  ?  217  GLU B CA    1 
ATOM   3249  C  C     . GLU B 1  238  ? 87.703  6.259   -20.970  1.00 58.67  ?  217  GLU B C     1 
ATOM   3250  O  O     . GLU B 1  238  ? 87.733  7.260   -21.706  1.00 61.63  ?  217  GLU B O     1 
ATOM   3251  C  CB    . GLU B 1  238  ? 89.275  5.828   -19.051  1.00 66.30  ?  217  GLU B CB    1 
ATOM   3252  C  CG    . GLU B 1  238  ? 89.561  5.973   -17.563  1.00 70.23  ?  217  GLU B CG    1 
ATOM   3253  C  CD    . GLU B 1  238  ? 90.852  5.300   -17.141  1.00 80.89  ?  217  GLU B CD    1 
ATOM   3254  O  OE1   . GLU B 1  238  ? 91.564  4.768   -18.019  1.00 84.39  ?  217  GLU B OE1   1 
ATOM   3255  O  OE2   . GLU B 1  238  ? 91.152  5.302   -15.928  1.00 81.98  ?  217  GLU B OE2   1 
ATOM   3256  N  N     . LEU B 1  239  ? 87.450  5.033   -21.438  1.00 58.68  ?  218  LEU B N     1 
ATOM   3257  C  CA    . LEU B 1  239  ? 87.330  4.780   -22.871  1.00 56.91  ?  218  LEU B CA    1 
ATOM   3258  C  C     . LEU B 1  239  ? 86.285  5.682   -23.515  1.00 57.26  ?  218  LEU B C     1 
ATOM   3259  O  O     . LEU B 1  239  ? 86.562  6.354   -24.513  1.00 59.47  ?  218  LEU B O     1 
ATOM   3260  C  CB    . LEU B 1  239  ? 86.997  3.310   -23.114  1.00 56.55  ?  218  LEU B CB    1 
ATOM   3261  C  CG    . LEU B 1  239  ? 88.121  2.513   -23.768  1.00 57.15  ?  218  LEU B CG    1 
ATOM   3262  C  CD1   . LEU B 1  239  ? 87.756  1.047   -23.840  1.00 58.29  ?  218  LEU B CD1   1 
ATOM   3263  C  CD2   . LEU B 1  239  ? 88.418  3.067   -25.152  1.00 57.59  ?  218  LEU B CD2   1 
ATOM   3264  N  N     . PHE B 1  240  ? 85.072  5.711   -22.962  1.00 56.89  ?  219  PHE B N     1 
ATOM   3265  C  CA    . PHE B 1  240  ? 84.048  6.588   -23.515  1.00 55.05  ?  219  PHE B CA    1 
ATOM   3266  C  C     . PHE B 1  240  ? 84.259  8.041   -23.120  1.00 56.57  ?  219  PHE B C     1 
ATOM   3267  O  O     . PHE B 1  240  ? 83.686  8.936   -23.754  1.00 57.13  ?  219  PHE B O     1 
ATOM   3268  C  CB    . PHE B 1  240  ? 82.662  6.098   -23.096  1.00 51.35  ?  219  PHE B CB    1 
ATOM   3269  C  CG    . PHE B 1  240  ? 82.273  4.808   -23.751  1.00 51.73  ?  219  PHE B CG    1 
ATOM   3270  C  CD1   . PHE B 1  240  ? 82.385  4.662   -25.123  1.00 50.86  ?  219  PHE B CD1   1 
ATOM   3271  C  CD2   . PHE B 1  240  ? 81.839  3.730   -23.003  1.00 52.22  ?  219  PHE B CD2   1 
ATOM   3272  C  CE1   . PHE B 1  240  ? 82.048  3.476   -25.739  1.00 48.89  ?  219  PHE B CE1   1 
ATOM   3273  C  CE2   . PHE B 1  240  ? 81.504  2.541   -23.615  1.00 51.51  ?  219  PHE B CE2   1 
ATOM   3274  C  CZ    . PHE B 1  240  ? 81.606  2.414   -24.984  1.00 51.17  ?  219  PHE B CZ    1 
ATOM   3275  N  N     . GLY B 1  241  ? 85.078  8.293   -22.098  1.00 58.89  ?  220  GLY B N     1 
ATOM   3276  C  CA    . GLY B 1  241  ? 85.533  9.647   -21.847  1.00 58.16  ?  220  GLY B CA    1 
ATOM   3277  C  C     . GLY B 1  241  ? 86.307  10.216  -23.016  1.00 56.89  ?  220  GLY B C     1 
ATOM   3278  O  O     . GLY B 1  241  ? 86.278  11.428  -23.253  1.00 57.55  ?  220  GLY B O     1 
ATOM   3279  N  N     . LEU B 1  242  ? 87.008  9.356   -23.763  1.00 56.34  ?  221  LEU B N     1 
ATOM   3280  C  CA    . LEU B 1  242  ? 87.623  9.804   -25.011  1.00 56.44  ?  221  LEU B CA    1 
ATOM   3281  C  C     . LEU B 1  242  ? 86.604  10.468  -25.931  1.00 57.91  ?  221  LEU B C     1 
ATOM   3282  O  O     . LEU B 1  242  ? 86.916  11.453  -26.608  1.00 60.18  ?  221  LEU B O     1 
ATOM   3283  C  CB    . LEU B 1  242  ? 88.287  8.634   -25.736  1.00 55.60  ?  221  LEU B CB    1 
ATOM   3284  C  CG    . LEU B 1  242  ? 89.652  8.150   -25.252  1.00 54.94  ?  221  LEU B CG    1 
ATOM   3285  C  CD1   . LEU B 1  242  ? 90.167  7.063   -26.176  1.00 51.92  ?  221  LEU B CD1   1 
ATOM   3286  C  CD2   . LEU B 1  242  ? 90.634  9.305   -25.177  1.00 60.89  ?  221  LEU B CD2   1 
ATOM   3287  N  N     . ALA B 1  243  ? 85.382  9.934   -25.982  1.00 59.30  ?  222  ALA B N     1 
ATOM   3288  C  CA    . ALA B 1  243  ? 84.346  10.534  -26.816  1.00 57.70  ?  222  ALA B CA    1 
ATOM   3289  C  C     . ALA B 1  243  ? 83.718  11.749  -26.145  1.00 57.88  ?  222  ALA B C     1 
ATOM   3290  O  O     . ALA B 1  243  ? 83.472  12.766  -26.804  1.00 56.73  ?  222  ALA B O     1 
ATOM   3291  C  CB    . ALA B 1  243  ? 83.272  9.500   -27.150  1.00 51.43  ?  222  ALA B CB    1 
ATOM   3292  N  N     . ARG B 1  244  ? 83.446  11.654  -24.841  1.00 55.53  ?  223  ARG B N     1 
ATOM   3293  C  CA    . ARG B 1  244  ? 82.905  12.792  -24.106  1.00 55.37  ?  223  ARG B CA    1 
ATOM   3294  C  C     . ARG B 1  244  ? 83.755  14.041  -24.300  1.00 58.52  ?  223  ARG B C     1 
ATOM   3295  O  O     . ARG B 1  244  ? 83.224  15.142  -24.482  1.00 59.95  ?  223  ARG B O     1 
ATOM   3296  C  CB    . ARG B 1  244  ? 82.805  12.448  -22.621  1.00 56.28  ?  223  ARG B CB    1 
ATOM   3297  C  CG    . ARG B 1  244  ? 82.809  13.655  -21.700  1.00 61.66  ?  223  ARG B CG    1 
ATOM   3298  C  CD    . ARG B 1  244  ? 81.449  14.322  -21.650  1.00 65.95  ?  223  ARG B CD    1 
ATOM   3299  N  NE    . ARG B 1  244  ? 81.450  15.506  -20.795  1.00 71.63  ?  223  ARG B NE    1 
ATOM   3300  C  CZ    . ARG B 1  244  ? 81.478  15.470  -19.466  1.00 76.90  ?  223  ARG B CZ    1 
ATOM   3301  N  NH1   . ARG B 1  244  ? 81.519  14.307  -18.830  1.00 70.43  ?  223  ARG B NH1   1 
ATOM   3302  N  NH2   . ARG B 1  244  ? 81.474  16.599  -18.771  1.00 81.26  ?  223  ARG B NH2   1 
ATOM   3303  N  N     . GLU B 1  245  ? 85.080  13.887  -24.286  1.00 57.73  ?  224  GLU B N     1 
ATOM   3304  C  CA    . GLU B 1  245  ? 85.966  15.044  -24.309  1.00 60.38  ?  224  GLU B CA    1 
ATOM   3305  C  C     . GLU B 1  245  ? 85.974  15.776  -25.646  1.00 59.52  ?  224  GLU B C     1 
ATOM   3306  O  O     . GLU B 1  245  ? 86.524  16.880  -25.713  1.00 61.68  ?  224  GLU B O     1 
ATOM   3307  C  CB    . GLU B 1  245  ? 87.389  14.618  -23.958  1.00 62.27  ?  224  GLU B CB    1 
ATOM   3308  C  CG    . GLU B 1  245  ? 88.118  13.950  -25.102  1.00 66.14  ?  224  GLU B CG    1 
ATOM   3309  C  CD    . GLU B 1  245  ? 89.403  13.289  -24.661  1.00 72.71  ?  224  GLU B CD    1 
ATOM   3310  O  OE1   . GLU B 1  245  ? 89.786  13.461  -23.484  1.00 72.71  ?  224  GLU B OE1   1 
ATOM   3311  O  OE2   . GLU B 1  245  ? 90.026  12.593  -25.491  1.00 73.82  ?  224  GLU B OE2   1 
ATOM   3312  N  N     . LEU B 1  246  ? 85.403  15.194  -26.704  1.00 55.77  ?  225  LEU B N     1 
ATOM   3313  C  CA    . LEU B 1  246  ? 85.330  15.896  -27.982  1.00 54.45  ?  225  LEU B CA    1 
ATOM   3314  C  C     . LEU B 1  246  ? 84.636  17.241  -27.823  1.00 56.56  ?  225  LEU B C     1 
ATOM   3315  O  O     . LEU B 1  246  ? 85.095  18.260  -28.351  1.00 61.32  ?  225  LEU B O     1 
ATOM   3316  C  CB    . LEU B 1  246  ? 84.605  15.036  -29.015  1.00 54.88  ?  225  LEU B CB    1 
ATOM   3317  C  CG    . LEU B 1  246  ? 85.419  13.960  -29.729  1.00 49.61  ?  225  LEU B CG    1 
ATOM   3318  C  CD1   . LEU B 1  246  ? 84.488  12.961  -30.390  1.00 48.73  ?  225  LEU B CD1   1 
ATOM   3319  C  CD2   . LEU B 1  246  ? 86.337  14.592  -30.757  1.00 45.48  ?  225  LEU B CD2   1 
ATOM   3320  N  N     . ASN B 1  247  ? 83.508  17.255  -27.119  1.00 54.85  ?  226  ASN B N     1 
ATOM   3321  C  CA    . ASN B 1  247  ? 82.878  18.490  -26.674  1.00 55.04  ?  226  ASN B CA    1 
ATOM   3322  C  C     . ASN B 1  247  ? 82.360  18.274  -25.263  1.00 57.60  ?  226  ASN B C     1 
ATOM   3323  O  O     . ASN B 1  247  ? 81.531  17.389  -25.038  1.00 59.42  ?  226  ASN B O     1 
ATOM   3324  C  CB    . ASN B 1  247  ? 81.743  18.902  -27.614  1.00 56.24  ?  226  ASN B CB    1 
ATOM   3325  C  CG    . ASN B 1  247  ? 80.995  20.122  -27.125  1.00 60.42  ?  226  ASN B CG    1 
ATOM   3326  O  OD1   . ASN B 1  247  ? 81.490  20.875  -26.288  1.00 62.27  ?  226  ASN B OD1   1 
ATOM   3327  N  ND2   . ASN B 1  247  ? 79.795  20.327  -27.649  1.00 60.10  ?  226  ASN B ND2   1 
ATOM   3328  N  N     . VAL B 1  248  ? 82.831  19.087  -24.316  1.00 60.41  ?  227  VAL B N     1 
ATOM   3329  C  CA    . VAL B 1  248  ? 82.323  18.987  -22.953  1.00 59.33  ?  227  VAL B CA    1 
ATOM   3330  C  C     . VAL B 1  248  ? 81.011  19.741  -22.794  1.00 62.60  ?  227  VAL B C     1 
ATOM   3331  O  O     . VAL B 1  248  ? 80.279  19.504  -21.826  1.00 69.71  ?  227  VAL B O     1 
ATOM   3332  C  CB    . VAL B 1  248  ? 83.370  19.492  -21.947  1.00 61.64  ?  227  VAL B CB    1 
ATOM   3333  C  CG1   . VAL B 1  248  ? 83.022  19.046  -20.534  1.00 64.26  ?  227  VAL B CG1   1 
ATOM   3334  C  CG2   . VAL B 1  248  ? 84.753  18.995  -22.334  1.00 63.64  ?  227  VAL B CG2   1 
ATOM   3335  N  N     . GLU B 1  249  ? 80.683  20.634  -23.727  1.00 61.67  ?  228  GLU B N     1 
ATOM   3336  C  CA    . GLU B 1  249  ? 79.387  21.297  -23.722  1.00 64.77  ?  228  GLU B CA    1 
ATOM   3337  C  C     . GLU B 1  249  ? 78.256  20.393  -24.190  1.00 62.90  ?  228  GLU B C     1 
ATOM   3338  O  O     . GLU B 1  249  ? 77.088  20.738  -23.982  1.00 60.73  ?  228  GLU B O     1 
ATOM   3339  C  CB    . GLU B 1  249  ? 79.419  22.542  -24.612  1.00 74.55  ?  228  GLU B CB    1 
ATOM   3340  C  CG    . GLU B 1  249  ? 80.315  23.662  -24.128  1.00 76.48  ?  228  GLU B CG    1 
ATOM   3341  C  CD    . GLU B 1  249  ? 80.391  24.796  -25.132  1.00 86.24  ?  228  GLU B CD    1 
ATOM   3342  O  OE1   . GLU B 1  249  ? 80.722  24.527  -26.307  1.00 83.20  ?  228  GLU B OE1   1 
ATOM   3343  O  OE2   . GLU B 1  249  ? 80.103  25.951  -24.755  1.00 87.22  ?  228  GLU B OE2   1 
ATOM   3344  N  N     . ALA B 1  250  ? 78.572  19.261  -24.815  1.00 62.27  ?  229  ALA B N     1 
ATOM   3345  C  CA    . ALA B 1  250  ? 77.549  18.420  -25.422  1.00 62.39  ?  229  ALA B CA    1 
ATOM   3346  C  C     . ALA B 1  250  ? 76.618  17.850  -24.360  1.00 63.59  ?  229  ALA B C     1 
ATOM   3347  O  O     . ALA B 1  250  ? 77.066  17.350  -23.325  1.00 65.70  ?  229  ALA B O     1 
ATOM   3348  C  CB    . ALA B 1  250  ? 78.193  17.292  -26.221  1.00 56.15  ?  229  ALA B CB    1 
ATOM   3349  N  N     . GLU B 1  251  ? 75.321  17.924  -24.629  1.00 61.87  ?  230  GLU B N     1 
ATOM   3350  C  CA    . GLU B 1  251  ? 74.287  17.538  -23.682  1.00 65.96  ?  230  GLU B CA    1 
ATOM   3351  C  C     . GLU B 1  251  ? 73.851  16.101  -23.931  1.00 66.05  ?  230  GLU B C     1 
ATOM   3352  O  O     . GLU B 1  251  ? 73.651  15.692  -25.076  1.00 61.03  ?  230  GLU B O     1 
ATOM   3353  C  CB    . GLU B 1  251  ? 73.084  18.476  -23.801  1.00 71.65  ?  230  GLU B CB    1 
ATOM   3354  C  CG    . GLU B 1  251  ? 71.889  18.072  -22.967  1.00 73.53  ?  230  GLU B CG    1 
ATOM   3355  C  CD    . GLU B 1  251  ? 70.583  18.362  -23.669  1.00 78.93  ?  230  GLU B CD    1 
ATOM   3356  O  OE1   . GLU B 1  251  ? 70.622  18.854  -24.817  1.00 78.09  ?  230  GLU B OE1   1 
ATOM   3357  O  OE2   . GLU B 1  251  ? 69.519  18.094  -23.076  1.00 83.46  ?  230  GLU B OE2   1 
ATOM   3358  N  N     . GLY B 1  252  ? 73.676  15.345  -22.850  1.00 67.73  ?  231  GLY B N     1 
ATOM   3359  C  CA    . GLY B 1  252  ? 73.285  13.958  -22.956  1.00 64.33  ?  231  GLY B CA    1 
ATOM   3360  C  C     . GLY B 1  252  ? 72.473  13.545  -21.750  1.00 71.43  ?  231  GLY B C     1 
ATOM   3361  O  O     . GLY B 1  252  ? 72.191  14.349  -20.860  1.00 77.00  ?  231  GLY B O     1 
ATOM   3362  N  N     . ILE B 1  253  ? 72.082  12.269  -21.736  1.00 70.72  ?  232  ILE B N     1 
ATOM   3363  C  CA    . ILE B 1  253  ? 71.269  11.750  -20.644  1.00 69.86  ?  232  ILE B CA    1 
ATOM   3364  C  C     . ILE B 1  253  ? 72.041  11.856  -19.342  1.00 77.61  ?  232  ILE B C     1 
ATOM   3365  O  O     . ILE B 1  253  ? 73.197  11.426  -19.246  1.00 79.77  ?  232  ILE B O     1 
ATOM   3366  C  CB    . ILE B 1  253  ? 70.857  10.299  -20.923  1.00 67.96  ?  232  ILE B CB    1 
ATOM   3367  C  CG1   . ILE B 1  253  ? 70.180  10.187  -22.287  1.00 67.04  ?  232  ILE B CG1   1 
ATOM   3368  C  CG2   . ILE B 1  253  ? 69.940  9.788   -19.825  1.00 75.48  ?  232  ILE B CG2   1 
ATOM   3369  C  CD1   . ILE B 1  253  ? 69.635  8.811   -22.571  1.00 67.68  ?  232  ILE B CD1   1 
ATOM   3370  N  N     . GLU B 1  254  ? 71.404  12.434  -18.328  1.00 80.29  ?  233  GLU B N     1 
ATOM   3371  C  CA    . GLU B 1  254  ? 72.006  12.583  -17.011  1.00 87.61  ?  233  GLU B CA    1 
ATOM   3372  C  C     . GLU B 1  254  ? 71.028  12.059  -15.973  1.00 91.40  ?  233  GLU B C     1 
ATOM   3373  O  O     . GLU B 1  254  ? 69.921  12.590  -15.839  1.00 96.74  ?  233  GLU B O     1 
ATOM   3374  C  CB    . GLU B 1  254  ? 72.373  14.044  -16.734  1.00 92.75  ?  233  GLU B CB    1 
ATOM   3375  C  CG    . GLU B 1  254  ? 73.150  14.254  -15.446  1.00 96.39  ?  233  GLU B CG    1 
ATOM   3376  C  CD    . GLU B 1  254  ? 74.216  15.326  -15.572  1.00 100.41 ?  233  GLU B CD    1 
ATOM   3377  O  OE1   . GLU B 1  254  ? 74.182  16.092  -16.559  1.00 99.41  ?  233  GLU B OE1   1 
ATOM   3378  O  OE2   . GLU B 1  254  ? 75.094  15.399  -14.686  1.00 105.35 ?  233  GLU B OE2   1 
ATOM   3379  N  N     . ILE B 1  255  ? 71.433  11.020  -15.251  1.00 85.87  ?  234  ILE B N     1 
ATOM   3380  C  CA    . ILE B 1  255  ? 70.579  10.414  -14.238  1.00 88.21  ?  234  ILE B CA    1 
ATOM   3381  C  C     . ILE B 1  255  ? 71.425  9.656   -13.225  1.00 83.65  ?  234  ILE B C     1 
ATOM   3382  O  O     . ILE B 1  255  ? 71.858  10.218  -12.221  1.00 83.88  ?  234  ILE B O     1 
ATOM   3383  C  CB    . ILE B 1  255  ? 69.530  9.488   -14.876  1.00 94.01  ?  234  ILE B CB    1 
ATOM   3384  N  N     . SER C 2  24   ? 56.590  -3.299  -72.398  1.00 68.58  ?  28   SER C N     1 
ATOM   3385  C  CA    . SER C 2  24   ? 56.779  -2.568  -71.151  1.00 70.17  ?  28   SER C CA    1 
ATOM   3386  C  C     . SER C 2  24   ? 55.575  -1.674  -70.844  1.00 82.33  ?  28   SER C C     1 
ATOM   3387  O  O     . SER C 2  24   ? 55.726  -0.598  -70.262  1.00 78.85  ?  28   SER C O     1 
ATOM   3388  C  CB    . SER C 2  24   ? 58.062  -1.735  -71.215  1.00 60.36  ?  28   SER C CB    1 
ATOM   3389  O  OG    . SER C 2  24   ? 59.189  -2.553  -71.485  1.00 55.66  ?  28   SER C OG    1 
ATOM   3390  N  N     . ASN C 2  25   ? 54.386  -2.136  -71.245  1.00 82.07  ?  29   ASN C N     1 
ATOM   3391  C  CA    . ASN C 2  25   ? 53.122  -1.429  -71.013  1.00 77.95  ?  29   ASN C CA    1 
ATOM   3392  C  C     . ASN C 2  25   ? 53.125  -0.049  -71.674  1.00 73.63  ?  29   ASN C C     1 
ATOM   3393  O  O     . ASN C 2  25   ? 52.756  0.959   -71.068  1.00 64.99  ?  29   ASN C O     1 
ATOM   3394  C  CB    . ASN C 2  25   ? 52.819  -1.322  -69.515  1.00 74.22  ?  29   ASN C CB    1 
ATOM   3395  C  CG    . ASN C 2  25   ? 51.438  -1.846  -69.159  1.00 74.79  ?  29   ASN C CG    1 
ATOM   3396  O  OD1   . ASN C 2  25   ? 50.556  -1.940  -70.014  1.00 74.23  ?  29   ASN C OD1   1 
ATOM   3397  N  ND2   . ASN C 2  25   ? 51.244  -2.189  -67.891  1.00 64.68  ?  29   ASN C ND2   1 
ATOM   3398  N  N     . ASN C 2  26   ? 53.524  -0.017  -72.945  1.00 74.02  ?  30   ASN C N     1 
ATOM   3399  C  CA    . ASN C 2  26   ? 53.711  1.232   -73.676  1.00 72.86  ?  30   ASN C CA    1 
ATOM   3400  C  C     . ASN C 2  26   ? 52.430  1.781   -74.289  1.00 67.21  ?  30   ASN C C     1 
ATOM   3401  O  O     . ASN C 2  26   ? 52.470  2.854   -74.900  1.00 64.53  ?  30   ASN C O     1 
ATOM   3402  C  CB    . ASN C 2  26   ? 54.750  1.040   -74.783  1.00 77.96  ?  30   ASN C CB    1 
ATOM   3403  C  CG    . ASN C 2  26   ? 56.105  0.638   -74.247  1.00 81.19  ?  30   ASN C CG    1 
ATOM   3404  O  OD1   . ASN C 2  26   ? 56.604  -0.448  -74.541  1.00 88.19  ?  30   ASN C OD1   1 
ATOM   3405  N  ND2   . ASN C 2  26   ? 56.712  1.516   -73.455  1.00 77.03  ?  30   ASN C ND2   1 
ATOM   3406  N  N     . SER C 2  27   ? 51.306  1.087   -74.155  1.00 64.43  ?  31   SER C N     1 
ATOM   3407  C  CA    . SER C 2  27   ? 50.064  1.525   -74.776  1.00 65.78  ?  31   SER C CA    1 
ATOM   3408  C  C     . SER C 2  27   ? 49.264  2.488   -73.909  1.00 61.21  ?  31   SER C C     1 
ATOM   3409  O  O     . SER C 2  27   ? 48.193  2.935   -74.332  1.00 61.27  ?  31   SER C O     1 
ATOM   3410  C  CB    . SER C 2  27   ? 49.206  0.310   -75.133  1.00 68.43  ?  31   SER C CB    1 
ATOM   3411  O  OG    . SER C 2  27   ? 49.293  -0.685  -74.129  1.00 71.43  ?  31   SER C OG    1 
ATOM   3412  N  N     . VAL C 2  28   ? 49.747  2.816   -72.720  1.00 56.35  ?  32   VAL C N     1 
ATOM   3413  C  CA    . VAL C 2  28   ? 49.090  3.753   -71.815  1.00 51.00  ?  32   VAL C CA    1 
ATOM   3414  C  C     . VAL C 2  28   ? 49.980  4.985   -71.685  1.00 48.91  ?  32   VAL C C     1 
ATOM   3415  O  O     . VAL C 2  28   ? 51.129  4.866   -71.243  1.00 47.33  ?  32   VAL C O     1 
ATOM   3416  C  CB    . VAL C 2  28   ? 48.817  3.119   -70.442  1.00 48.69  ?  32   VAL C CB    1 
ATOM   3417  C  CG1   . VAL C 2  28   ? 48.257  4.152   -69.484  1.00 48.33  ?  32   VAL C CG1   1 
ATOM   3418  C  CG2   . VAL C 2  28   ? 47.861  1.947   -70.586  1.00 44.90  ?  32   VAL C CG2   1 
ATOM   3419  N  N     . PRO C 2  29   ? 49.504  6.173   -72.055  1.00 44.28  ?  33   PRO C N     1 
ATOM   3420  C  CA    . PRO C 2  29   ? 50.362  7.360   -71.994  1.00 41.22  ?  33   PRO C CA    1 
ATOM   3421  C  C     . PRO C 2  29   ? 50.706  7.726   -70.559  1.00 42.42  ?  33   PRO C C     1 
ATOM   3422  O  O     . PRO C 2  29   ? 49.886  7.589   -69.649  1.00 44.06  ?  33   PRO C O     1 
ATOM   3423  C  CB    . PRO C 2  29   ? 49.512  8.448   -72.660  1.00 43.28  ?  33   PRO C CB    1 
ATOM   3424  C  CG    . PRO C 2  29   ? 48.429  7.711   -73.392  1.00 42.37  ?  33   PRO C CG    1 
ATOM   3425  C  CD    . PRO C 2  29   ? 48.169  6.491   -72.583  1.00 43.87  ?  33   PRO C CD    1 
ATOM   3426  N  N     . GLY C 2  30   ? 51.936  8.194   -70.365  1.00 40.48  ?  34   GLY C N     1 
ATOM   3427  C  CA    . GLY C 2  30   ? 52.401  8.584   -69.053  1.00 38.87  ?  34   GLY C CA    1 
ATOM   3428  C  C     . GLY C 2  30   ? 52.655  7.446   -68.095  1.00 40.18  ?  34   GLY C C     1 
ATOM   3429  O  O     . GLY C 2  30   ? 52.989  7.703   -66.933  1.00 41.88  ?  34   GLY C O     1 
ATOM   3430  N  N     . ALA C 2  31   ? 52.506  6.204   -68.537  1.00 41.80  ?  35   ALA C N     1 
ATOM   3431  C  CA    . ALA C 2  31   ? 52.736  5.071   -67.660  1.00 41.67  ?  35   ALA C CA    1 
ATOM   3432  C  C     . ALA C 2  31   ? 54.210  5.002   -67.272  1.00 43.78  ?  35   ALA C C     1 
ATOM   3433  O  O     . ALA C 2  31   ? 55.085  5.211   -68.118  1.00 46.67  ?  35   ALA C O     1 
ATOM   3434  C  CB    . ALA C 2  31   ? 52.317  3.773   -68.344  1.00 42.28  ?  35   ALA C CB    1 
ATOM   3435  N  N     . PRO C 2  32   ? 54.517  4.714   -66.008  1.00 45.09  ?  36   PRO C N     1 
ATOM   3436  C  CA    . PRO C 2  32   ? 55.920  4.625   -65.602  1.00 43.25  ?  36   PRO C CA    1 
ATOM   3437  C  C     . PRO C 2  32   ? 56.616  3.514   -66.366  1.00 41.32  ?  36   PRO C C     1 
ATOM   3438  O  O     . PRO C 2  32   ? 56.029  2.468   -66.643  1.00 53.81  ?  36   PRO C O     1 
ATOM   3439  C  CB    . PRO C 2  32   ? 55.838  4.322   -64.103  1.00 38.68  ?  36   PRO C CB    1 
ATOM   3440  C  CG    . PRO C 2  32   ? 54.519  3.673   -63.929  1.00 38.09  ?  36   PRO C CG    1 
ATOM   3441  C  CD    . PRO C 2  32   ? 53.603  4.317   -64.925  1.00 42.56  ?  36   PRO C CD    1 
ATOM   3442  N  N     . ASN C 2  33   ? 57.874  3.749   -66.717  1.00 43.58  ?  37   ASN C N     1 
ATOM   3443  C  CA    . ASN C 2  33   ? 58.591  2.789   -67.537  1.00 42.36  ?  37   ASN C CA    1 
ATOM   3444  C  C     . ASN C 2  33   ? 59.036  1.635   -66.653  1.00 38.89  ?  37   ASN C C     1 
ATOM   3445  O  O     . ASN C 2  33   ? 59.857  1.813   -65.749  1.00 38.83  ?  37   ASN C O     1 
ATOM   3446  C  CB    . ASN C 2  33   ? 59.787  3.453   -68.214  1.00 40.53  ?  37   ASN C CB    1 
ATOM   3447  C  CG    . ASN C 2  33   ? 60.462  2.548   -69.220  1.00 41.40  ?  37   ASN C CG    1 
ATOM   3448  O  OD1   . ASN C 2  33   ? 59.825  1.690   -69.829  1.00 44.61  ?  37   ASN C OD1   1 
ATOM   3449  N  ND2   . ASN C 2  33   ? 61.762  2.734   -69.398  1.00 39.10  ?  37   ASN C ND2   1 
ATOM   3450  N  N     . ARG C 2  34   ? 58.498  0.454   -66.926  1.00 38.28  ?  38   ARG C N     1 
ATOM   3451  C  CA    . ARG C 2  34   ? 58.817  -0.758  -66.186  1.00 36.20  ?  38   ARG C CA    1 
ATOM   3452  C  C     . ARG C 2  34   ? 59.348  -1.754  -67.204  1.00 39.02  ?  38   ARG C C     1 
ATOM   3453  O  O     . ARG C 2  34   ? 58.603  -2.210  -68.075  1.00 42.43  ?  38   ARG C O     1 
ATOM   3454  C  CB    . ARG C 2  34   ? 57.588  -1.292  -65.454  1.00 32.90  ?  38   ARG C CB    1 
ATOM   3455  C  CG    . ARG C 2  34   ? 57.885  -2.382  -64.460  1.00 34.89  ?  38   ARG C CG    1 
ATOM   3456  C  CD    . ARG C 2  34   ? 56.641  -2.836  -63.727  1.00 32.74  ?  38   ARG C CD    1 
ATOM   3457  N  NE    . ARG C 2  34   ? 56.284  -1.944  -62.631  1.00 31.87  ?  38   ARG C NE    1 
ATOM   3458  C  CZ    . ARG C 2  34   ? 56.705  -2.092  -61.382  1.00 32.32  ?  38   ARG C CZ    1 
ATOM   3459  N  NH1   . ARG C 2  34   ? 57.503  -3.091  -61.067  1.00 34.02  ?  38   ARG C NH1   1 
ATOM   3460  N  NH2   . ARG C 2  34   ? 56.330  -1.241  -60.444  1.00 32.45  ?  38   ARG C NH2   1 
ATOM   3461  N  N     . VAL C 2  35   ? 60.631  -2.073  -67.109  1.00 38.25  ?  39   VAL C N     1 
ATOM   3462  C  CA    . VAL C 2  35   ? 61.277  -2.888  -68.128  1.00 36.66  ?  39   VAL C CA    1 
ATOM   3463  C  C     . VAL C 2  35   ? 60.942  -4.349  -67.878  1.00 37.95  ?  39   VAL C C     1 
ATOM   3464  O  O     . VAL C 2  35   ? 61.037  -4.839  -66.746  1.00 39.26  ?  39   VAL C O     1 
ATOM   3465  C  CB    . VAL C 2  35   ? 62.794  -2.654  -68.135  1.00 38.41  ?  39   VAL C CB    1 
ATOM   3466  C  CG1   . VAL C 2  35   ? 63.367  -3.022  -69.490  1.00 41.89  ?  39   VAL C CG1   1 
ATOM   3467  C  CG2   . VAL C 2  35   ? 63.105  -1.208  -67.789  1.00 42.33  ?  39   VAL C CG2   1 
ATOM   3468  N  N     . SER C 2  36   ? 60.552  -5.048  -68.934  1.00 41.07  ?  40   SER C N     1 
ATOM   3469  C  CA    . SER C 2  36   ? 60.055  -6.408  -68.823  1.00 35.30  ?  40   SER C CA    1 
ATOM   3470  C  C     . SER C 2  36   ? 61.134  -7.411  -69.206  1.00 39.07  ?  40   SER C C     1 
ATOM   3471  O  O     . SER C 2  36   ? 61.892  -7.196  -70.156  1.00 39.50  ?  40   SER C O     1 
ATOM   3472  C  CB    . SER C 2  36   ? 58.826  -6.605  -69.709  1.00 38.75  ?  40   SER C CB    1 
ATOM   3473  O  OG    . SER C 2  36   ? 58.243  -7.875  -69.485  1.00 42.07  ?  40   SER C OG    1 
ATOM   3474  N  N     . PHE C 2  37   ? 61.188  -8.511  -68.459  1.00 38.01  ?  41   PHE C N     1 
ATOM   3475  C  CA    . PHE C 2  37   ? 62.019  -9.654  -68.807  1.00 35.79  ?  41   PHE C CA    1 
ATOM   3476  C  C     . PHE C 2  37   ? 61.361  -10.564 -69.829  1.00 36.65  ?  41   PHE C C     1 
ATOM   3477  O  O     . PHE C 2  37   ? 61.956  -11.578 -70.198  1.00 39.77  ?  41   PHE C O     1 
ATOM   3478  C  CB    . PHE C 2  37   ? 62.348  -10.479 -67.563  1.00 33.37  ?  41   PHE C CB    1 
ATOM   3479  C  CG    . PHE C 2  37   ? 63.355  -9.847  -66.657  1.00 31.19  ?  41   PHE C CG    1 
ATOM   3480  C  CD1   . PHE C 2  37   ? 62.960  -8.964  -65.672  1.00 29.98  ?  41   PHE C CD1   1 
ATOM   3481  C  CD2   . PHE C 2  37   ? 64.698  -10.151 -66.775  1.00 32.30  ?  41   PHE C CD2   1 
ATOM   3482  C  CE1   . PHE C 2  37   ? 63.885  -8.389  -64.829  1.00 30.02  ?  41   PHE C CE1   1 
ATOM   3483  C  CE2   . PHE C 2  37   ? 65.628  -9.577  -65.935  1.00 26.92  ?  41   PHE C CE2   1 
ATOM   3484  C  CZ    . PHE C 2  37   ? 65.221  -8.696  -64.961  1.00 27.65  ?  41   PHE C CZ    1 
ATOM   3485  N  N     . ALA C 2  38   ? 60.151  -10.241 -70.274  1.00 38.29  ?  42   ALA C N     1 
ATOM   3486  C  CA    . ALA C 2  38   ? 59.412  -11.139 -71.149  1.00 39.96  ?  42   ALA C CA    1 
ATOM   3487  C  C     . ALA C 2  38   ? 60.172  -11.377 -72.445  1.00 40.28  ?  42   ALA C C     1 
ATOM   3488  O  O     . ALA C 2  38   ? 60.581  -10.433 -73.124  1.00 42.93  ?  42   ALA C O     1 
ATOM   3489  C  CB    . ALA C 2  38   ? 58.029  -10.565 -71.446  1.00 37.08  ?  42   ALA C CB    1 
ATOM   3490  N  N     . LYS C 2  39   ? 60.393  -12.649 -72.766  1.00 38.26  ?  43   LYS C N     1 
ATOM   3491  C  CA    . LYS C 2  39   ? 60.942  -12.998 -74.067  1.00 39.11  ?  43   LYS C CA    1 
ATOM   3492  C  C     . LYS C 2  39   ? 59.865  -13.055 -75.138  1.00 41.79  ?  43   LYS C C     1 
ATOM   3493  O  O     . LYS C 2  39   ? 60.143  -12.765 -76.306  1.00 43.70  ?  43   LYS C O     1 
ATOM   3494  C  CB    . LYS C 2  39   ? 61.678  -14.335 -73.995  1.00 40.19  ?  43   LYS C CB    1 
ATOM   3495  C  CG    . LYS C 2  39   ? 63.094  -14.236 -73.465  1.00 40.72  ?  43   LYS C CG    1 
ATOM   3496  C  CD    . LYS C 2  39   ? 63.113  -14.008 -71.973  1.00 38.93  ?  43   LYS C CD    1 
ATOM   3497  C  CE    . LYS C 2  39   ? 64.498  -13.645 -71.498  1.00 39.76  ?  43   LYS C CE    1 
ATOM   3498  N  NZ    . LYS C 2  39   ? 64.539  -13.555 -70.018  1.00 40.58  ?  43   LYS C NZ    1 
ATOM   3499  N  N     . LEU C 2  40   ? 58.647  -13.430 -74.763  1.00 45.65  ?  44   LEU C N     1 
ATOM   3500  C  CA    . LEU C 2  40   ? 57.567  -13.600 -75.721  1.00 50.92  ?  44   LEU C CA    1 
ATOM   3501  C  C     . LEU C 2  40   ? 56.887  -12.272 -76.026  1.00 54.25  ?  44   LEU C C     1 
ATOM   3502  O  O     . LEU C 2  40   ? 56.786  -11.388 -75.172  1.00 56.72  ?  44   LEU C O     1 
ATOM   3503  C  CB    . LEU C 2  40   ? 56.537  -14.598 -75.192  1.00 50.14  ?  44   LEU C CB    1 
ATOM   3504  C  CG    . LEU C 2  40   ? 57.042  -16.008 -74.890  1.00 49.42  ?  44   LEU C CG    1 
ATOM   3505  C  CD1   . LEU C 2  40   ? 55.954  -16.822 -74.219  1.00 53.12  ?  44   LEU C CD1   1 
ATOM   3506  C  CD2   . LEU C 2  40   ? 57.524  -16.694 -76.159  1.00 51.57  ?  44   LEU C CD2   1 
ATOM   3507  N  N     . ARG C 2  41   ? 56.418  -12.143 -77.261  1.00 55.29  ?  45   ARG C N     1 
ATOM   3508  C  CA    . ARG C 2  41   ? 55.653  -10.984 -77.696  1.00 57.52  ?  45   ARG C CA    1 
ATOM   3509  C  C     . ARG C 2  41   ? 54.167  -11.306 -77.607  1.00 58.72  ?  45   ARG C C     1 
ATOM   3510  O  O     . ARG C 2  41   ? 53.726  -12.350 -78.098  1.00 58.63  ?  45   ARG C O     1 
ATOM   3511  C  CB    . ARG C 2  41   ? 56.030  -10.590 -79.124  1.00 57.62  ?  45   ARG C CB    1 
ATOM   3512  C  CG    . ARG C 2  41   ? 55.292  -9.380  -79.650  1.00 64.84  ?  45   ARG C CG    1 
ATOM   3513  C  CD    . ARG C 2  41   ? 55.621  -9.131  -81.109  1.00 68.19  ?  45   ARG C CD    1 
ATOM   3514  N  NE    . ARG C 2  41   ? 54.774  -8.091  -81.685  1.00 85.59  ?  45   ARG C NE    1 
ATOM   3515  C  CZ    . ARG C 2  41   ? 53.613  -8.324  -82.290  1.00 84.26  ?  45   ARG C CZ    1 
ATOM   3516  N  NH1   . ARG C 2  41   ? 53.157  -9.565  -82.402  1.00 70.45  ?  45   ARG C NH1   1 
ATOM   3517  N  NH2   . ARG C 2  41   ? 52.907  -7.316  -82.786  1.00 87.17  ?  45   ARG C NH2   1 
ATOM   3518  N  N     . GLU C 2  42   ? 53.400  -10.413 -76.980  1.00 59.43  ?  46   GLU C N     1 
ATOM   3519  C  CA    . GLU C 2  42   ? 51.967  -10.620 -76.819  1.00 59.85  ?  46   GLU C CA    1 
ATOM   3520  C  C     . GLU C 2  42   ? 51.231  -9.939  -77.964  1.00 59.76  ?  46   GLU C C     1 
ATOM   3521  O  O     . GLU C 2  42   ? 51.147  -8.702  -77.983  1.00 59.89  ?  46   GLU C O     1 
ATOM   3522  C  CB    . GLU C 2  42   ? 51.493  -10.074 -75.480  1.00 58.61  ?  46   GLU C CB    1 
ATOM   3523  C  CG    . GLU C 2  42   ? 51.854  -10.956 -74.298  1.00 60.05  ?  46   GLU C CG    1 
ATOM   3524  C  CD    . GLU C 2  42   ? 51.360  -10.400 -72.978  1.00 59.78  ?  46   GLU C CD    1 
ATOM   3525  O  OE1   . GLU C 2  42   ? 51.343  -9.160  -72.828  1.00 60.82  ?  46   GLU C OE1   1 
ATOM   3526  O  OE2   . GLU C 2  42   ? 50.989  -11.201 -72.093  1.00 49.91  ?  46   GLU C OE2   1 
ATOM   3527  N  N     . PRO C 2  43   ? 50.682  -10.687 -78.924  1.00 57.51  ?  47   PRO C N     1 
ATOM   3528  C  CA    . PRO C 2  43   ? 50.029  -10.046 -80.074  1.00 58.61  ?  47   PRO C CA    1 
ATOM   3529  C  C     . PRO C 2  43   ? 48.721  -9.354  -79.738  1.00 54.29  ?  47   PRO C C     1 
ATOM   3530  O  O     . PRO C 2  43   ? 48.245  -8.548  -80.545  1.00 55.43  ?  47   PRO C O     1 
ATOM   3531  C  CB    . PRO C 2  43   ? 49.804  -11.214 -81.041  1.00 61.26  ?  47   PRO C CB    1 
ATOM   3532  C  CG    . PRO C 2  43   ? 49.694  -12.405 -80.152  1.00 56.80  ?  47   PRO C CG    1 
ATOM   3533  C  CD    . PRO C 2  43   ? 50.639  -12.156 -79.011  1.00 55.39  ?  47   PRO C CD    1 
ATOM   3534  N  N     . LEU C 2  44   ? 48.117  -9.646  -78.590  1.00 53.71  ?  48   LEU C N     1 
ATOM   3535  C  CA    . LEU C 2  44   ? 46.785  -9.155  -78.268  1.00 52.81  ?  48   LEU C CA    1 
ATOM   3536  C  C     . LEU C 2  44   ? 46.812  -8.424  -76.937  1.00 53.26  ?  48   LEU C C     1 
ATOM   3537  O  O     . LEU C 2  44   ? 47.369  -8.928  -75.957  1.00 56.76  ?  48   LEU C O     1 
ATOM   3538  C  CB    . LEU C 2  44   ? 45.782  -10.308 -78.217  1.00 48.47  ?  48   LEU C CB    1 
ATOM   3539  C  CG    . LEU C 2  44   ? 44.325  -9.954  -77.938  1.00 44.70  ?  48   LEU C CG    1 
ATOM   3540  C  CD1   . LEU C 2  44   ? 43.733  -9.166  -79.095  1.00 52.41  ?  48   LEU C CD1   1 
ATOM   3541  C  CD2   . LEU C 2  44   ? 43.534  -11.215 -77.685  1.00 44.62  ?  48   LEU C CD2   1 
ATOM   3542  N  N     . GLU C 2  45   ? 46.205  -7.243  -76.903  1.00 51.84  ?  49   GLU C N     1 
ATOM   3543  C  CA    . GLU C 2  45   ? 46.130  -6.472  -75.676  1.00 50.38  ?  49   GLU C CA    1 
ATOM   3544  C  C     . GLU C 2  45   ? 45.072  -7.057  -74.747  1.00 46.20  ?  49   GLU C C     1 
ATOM   3545  O  O     . GLU C 2  45   ? 44.141  -7.743  -75.174  1.00 46.32  ?  49   GLU C O     1 
ATOM   3546  C  CB    . GLU C 2  45   ? 45.813  -5.010  -75.981  1.00 53.41  ?  49   GLU C CB    1 
ATOM   3547  C  CG    . GLU C 2  45   ? 46.330  -4.033  -74.943  1.00 60.00  ?  49   GLU C CG    1 
ATOM   3548  C  CD    . GLU C 2  45   ? 46.124  -2.592  -75.357  1.00 72.55  ?  49   GLU C CD    1 
ATOM   3549  O  OE1   . GLU C 2  45   ? 44.962  -2.132  -75.367  1.00 73.63  ?  49   GLU C OE1   1 
ATOM   3550  O  OE2   . GLU C 2  45   ? 47.124  -1.924  -75.692  1.00 74.63  ?  49   GLU C OE2   1 
ATOM   3551  N  N     . VAL C 2  46   ? 45.230  -6.783  -73.461  1.00 45.00  ?  50   VAL C N     1 
ATOM   3552  C  CA    . VAL C 2  46   ? 44.248  -7.255  -72.481  1.00 44.02  ?  50   VAL C CA    1 
ATOM   3553  C  C     . VAL C 2  46   ? 42.951  -6.475  -72.661  1.00 42.73  ?  50   VAL C C     1 
ATOM   3554  O  O     . VAL C 2  46   ? 42.975  -5.233  -72.670  1.00 50.94  ?  50   VAL C O     1 
ATOM   3555  C  CB    . VAL C 2  46   ? 44.794  -7.094  -71.064  1.00 44.50  ?  50   VAL C CB    1 
ATOM   3556  C  CG1   . VAL C 2  46   ? 43.704  -7.357  -70.042  1.00 40.51  ?  50   VAL C CG1   1 
ATOM   3557  C  CG2   . VAL C 2  46   ? 45.967  -8.032  -70.846  1.00 45.12  ?  50   VAL C CG2   1 
ATOM   3558  N  N     . PRO C 2  47   ? 41.810  -7.140  -72.815  1.00 42.77  ?  51   PRO C N     1 
ATOM   3559  C  CA    . PRO C 2  47   ? 40.542  -6.417  -72.944  1.00 40.51  ?  51   PRO C CA    1 
ATOM   3560  C  C     . PRO C 2  47   ? 40.199  -5.700  -71.650  1.00 40.18  ?  51   PRO C C     1 
ATOM   3561  O  O     . PRO C 2  47   ? 40.775  -5.953  -70.592  1.00 42.02  ?  51   PRO C O     1 
ATOM   3562  C  CB    . PRO C 2  47   ? 39.535  -7.524  -73.260  1.00 37.55  ?  51   PRO C CB    1 
ATOM   3563  C  CG    . PRO C 2  47   ? 40.135  -8.752  -72.666  1.00 38.57  ?  51   PRO C CG    1 
ATOM   3564  C  CD    . PRO C 2  47   ? 41.619  -8.601  -72.836  1.00 41.83  ?  51   PRO C CD    1 
ATOM   3565  N  N     . GLY C 2  48   ? 39.254  -4.769  -71.754  1.00 40.57  ?  52   GLY C N     1 
ATOM   3566  C  CA    . GLY C 2  48   ? 38.778  -4.062  -70.583  1.00 38.37  ?  52   GLY C CA    1 
ATOM   3567  C  C     . GLY C 2  48   ? 38.279  -5.032  -69.538  1.00 34.65  ?  52   GLY C C     1 
ATOM   3568  O  O     . GLY C 2  48   ? 37.402  -5.851  -69.815  1.00 36.12  ?  52   GLY C O     1 
ATOM   3569  N  N     . LEU C 2  49   ? 38.832  -4.954  -68.330  1.00 34.20  ?  53   LEU C N     1 
ATOM   3570  C  CA    . LEU C 2  49   ? 38.576  -5.980  -67.330  1.00 35.56  ?  53   LEU C CA    1 
ATOM   3571  C  C     . LEU C 2  49   ? 37.171  -5.917  -66.751  1.00 34.68  ?  53   LEU C C     1 
ATOM   3572  O  O     . LEU C 2  49   ? 36.761  -6.862  -66.070  1.00 35.67  ?  53   LEU C O     1 
ATOM   3573  C  CB    . LEU C 2  49   ? 39.615  -5.882  -66.217  1.00 32.84  ?  53   LEU C CB    1 
ATOM   3574  C  CG    . LEU C 2  49   ? 41.032  -6.145  -66.731  1.00 30.90  ?  53   LEU C CG    1 
ATOM   3575  C  CD1   . LEU C 2  49   ? 42.055  -6.027  -65.619  1.00 32.54  ?  53   LEU C CD1   1 
ATOM   3576  C  CD2   . LEU C 2  49   ? 41.101  -7.505  -67.396  1.00 29.51  ?  53   LEU C CD2   1 
ATOM   3577  N  N     . LEU C 2  50   ? 36.432  -4.841  -66.993  1.00 33.45  ?  54   LEU C N     1 
ATOM   3578  C  CA    . LEU C 2  50   ? 35.045  -4.745  -66.568  1.00 30.26  ?  54   LEU C CA    1 
ATOM   3579  C  C     . LEU C 2  50   ? 34.057  -5.090  -67.671  1.00 34.04  ?  54   LEU C C     1 
ATOM   3580  O  O     . LEU C 2  50   ? 32.850  -5.029  -67.434  1.00 35.64  ?  54   LEU C O     1 
ATOM   3581  C  CB    . LEU C 2  50   ? 34.758  -3.345  -66.031  1.00 31.23  ?  54   LEU C CB    1 
ATOM   3582  C  CG    . LEU C 2  50   ? 35.521  -3.032  -64.748  1.00 34.37  ?  54   LEU C CG    1 
ATOM   3583  C  CD1   . LEU C 2  50   ? 35.156  -1.656  -64.226  1.00 38.75  ?  54   LEU C CD1   1 
ATOM   3584  C  CD2   . LEU C 2  50   ? 35.240  -4.097  -63.711  1.00 30.51  ?  54   LEU C CD2   1 
ATOM   3585  N  N     . ASP C 2  51   ? 34.539  -5.462  -68.860  1.00 35.94  ?  55   ASP C N     1 
ATOM   3586  C  CA    . ASP C 2  51   ? 33.645  -5.755  -69.977  1.00 34.99  ?  55   ASP C CA    1 
ATOM   3587  C  C     . ASP C 2  51   ? 32.643  -6.850  -69.643  1.00 35.38  ?  55   ASP C C     1 
ATOM   3588  O  O     . ASP C 2  51   ? 31.563  -6.899  -70.239  1.00 42.08  ?  55   ASP C O     1 
ATOM   3589  C  CB    . ASP C 2  51   ? 34.451  -6.154  -71.211  1.00 35.19  ?  55   ASP C CB    1 
ATOM   3590  C  CG    . ASP C 2  51   ? 35.155  -4.981  -71.851  1.00 42.54  ?  55   ASP C CG    1 
ATOM   3591  O  OD1   . ASP C 2  51   ? 35.234  -3.913  -71.209  1.00 42.59  ?  55   ASP C OD1   1 
ATOM   3592  O  OD2   . ASP C 2  51   ? 35.634  -5.128  -72.994  1.00 43.45  ?  55   ASP C OD2   1 
ATOM   3593  N  N     . VAL C 2  52   ? 32.979  -7.736  -68.705  1.00 33.73  ?  56   VAL C N     1 
ATOM   3594  C  CA    . VAL C 2  52   ? 32.031  -8.765  -68.299  1.00 30.92  ?  56   VAL C CA    1 
ATOM   3595  C  C     . VAL C 2  52   ? 30.836  -8.138  -67.596  1.00 35.22  ?  56   VAL C C     1 
ATOM   3596  O  O     . VAL C 2  52   ? 29.712  -8.648  -67.688  1.00 40.45  ?  56   VAL C O     1 
ATOM   3597  C  CB    . VAL C 2  52   ? 32.732  -9.820  -67.422  1.00 29.07  ?  56   VAL C CB    1 
ATOM   3598  C  CG1   . VAL C 2  52   ? 33.279  -9.192  -66.150  1.00 29.97  ?  56   VAL C CG1   1 
ATOM   3599  C  CG2   . VAL C 2  52   ? 31.788  -10.969 -67.103  1.00 28.25  ?  56   VAL C CG2   1 
ATOM   3600  N  N     . GLN C 2  53   ? 31.045  -7.019  -66.906  1.00 34.01  ?  57   GLN C N     1 
ATOM   3601  C  CA    . GLN C 2  53   ? 29.933  -6.295  -66.304  1.00 35.82  ?  57   GLN C CA    1 
ATOM   3602  C  C     . GLN C 2  53   ? 29.286  -5.351  -67.312  1.00 37.40  ?  57   GLN C C     1 
ATOM   3603  O  O     . GLN C 2  53   ? 28.105  -5.493  -67.643  1.00 37.26  ?  57   GLN C O     1 
ATOM   3604  C  CB    . GLN C 2  53   ? 30.413  -5.529  -65.070  1.00 34.09  ?  57   GLN C CB    1 
ATOM   3605  C  CG    . GLN C 2  53   ? 30.695  -6.405  -63.863  1.00 32.36  ?  57   GLN C CG    1 
ATOM   3606  C  CD    . GLN C 2  53   ? 29.430  -6.908  -63.197  1.00 36.06  ?  57   GLN C CD    1 
ATOM   3607  O  OE1   . GLN C 2  53   ? 28.441  -6.183  -63.090  1.00 37.19  ?  57   GLN C OE1   1 
ATOM   3608  N  NE2   . GLN C 2  53   ? 29.456  -8.153  -62.743  1.00 31.53  ?  57   GLN C NE2   1 
ATOM   3609  N  N     . THR C 2  54   ? 30.056  -4.381  -67.810  1.00 37.74  ?  58   THR C N     1 
ATOM   3610  C  CA    . THR C 2  54   ? 29.490  -3.318  -68.638  1.00 37.91  ?  58   THR C CA    1 
ATOM   3611  C  C     . THR C 2  54   ? 28.885  -3.861  -69.927  1.00 43.92  ?  58   THR C C     1 
ATOM   3612  O  O     . THR C 2  54   ? 27.822  -3.401  -70.359  1.00 45.50  ?  58   THR C O     1 
ATOM   3613  C  CB    . THR C 2  54   ? 30.559  -2.275  -68.959  1.00 34.26  ?  58   THR C CB    1 
ATOM   3614  O  OG1   . THR C 2  54   ? 31.480  -2.810  -69.915  1.00 35.83  ?  58   THR C OG1   1 
ATOM   3615  C  CG2   . THR C 2  54   ? 31.309  -1.885  -67.703  1.00 32.54  ?  58   THR C CG2   1 
ATOM   3616  N  N     . ASP C 2  55   ? 29.550  -4.826  -70.566  1.00 41.10  ?  59   ASP C N     1 
ATOM   3617  C  CA    . ASP C 2  55   ? 29.022  -5.378  -71.811  1.00 41.73  ?  59   ASP C CA    1 
ATOM   3618  C  C     . ASP C 2  55   ? 27.644  -5.987  -71.604  1.00 44.27  ?  59   ASP C C     1 
ATOM   3619  O  O     . ASP C 2  55   ? 26.742  -5.802  -72.429  1.00 45.05  ?  59   ASP C O     1 
ATOM   3620  C  CB    . ASP C 2  55   ? 29.982  -6.422  -72.377  1.00 41.16  ?  59   ASP C CB    1 
ATOM   3621  C  CG    . ASP C 2  55   ? 31.106  -5.805  -73.170  1.00 46.18  ?  59   ASP C CG    1 
ATOM   3622  O  OD1   . ASP C 2  55   ? 31.308  -4.579  -73.051  1.00 48.85  ?  59   ASP C OD1   1 
ATOM   3623  O  OD2   . ASP C 2  55   ? 31.788  -6.547  -73.908  1.00 41.42  ?  59   ASP C OD2   1 
ATOM   3624  N  N     . SER C 2  56   ? 27.464  -6.717  -70.504  1.00 43.47  ?  60   SER C N     1 
ATOM   3625  C  CA    . SER C 2  56   ? 26.181  -7.351  -70.235  1.00 39.78  ?  60   SER C CA    1 
ATOM   3626  C  C     . SER C 2  56   ? 25.089  -6.314  -70.015  1.00 43.65  ?  60   SER C C     1 
ATOM   3627  O  O     . SER C 2  56   ? 23.985  -6.438  -70.556  1.00 47.12  ?  60   SER C O     1 
ATOM   3628  C  CB    . SER C 2  56   ? 26.305  -8.268  -69.021  1.00 38.60  ?  60   SER C CB    1 
ATOM   3629  O  OG    . SER C 2  56   ? 25.070  -8.881  -68.717  1.00 44.89  ?  60   SER C OG    1 
ATOM   3630  N  N     . PHE C 2  57   ? 25.383  -5.276  -69.230  1.00 43.35  ?  61   PHE C N     1 
ATOM   3631  C  CA    . PHE C 2  57   ? 24.373  -4.271  -68.928  1.00 42.31  ?  61   PHE C CA    1 
ATOM   3632  C  C     . PHE C 2  57   ? 24.102  -3.366  -70.123  1.00 44.19  ?  61   PHE C C     1 
ATOM   3633  O  O     . PHE C 2  57   ? 22.979  -2.878  -70.284  1.00 47.08  ?  61   PHE C O     1 
ATOM   3634  C  CB    . PHE C 2  57   ? 24.804  -3.450  -67.717  1.00 42.19  ?  61   PHE C CB    1 
ATOM   3635  C  CG    . PHE C 2  57   ? 23.716  -2.590  -67.150  1.00 43.39  ?  61   PHE C CG    1 
ATOM   3636  C  CD1   . PHE C 2  57   ? 22.759  -3.128  -66.310  1.00 43.46  ?  61   PHE C CD1   1 
ATOM   3637  C  CD2   . PHE C 2  57   ? 23.655  -1.243  -67.446  1.00 41.45  ?  61   PHE C CD2   1 
ATOM   3638  C  CE1   . PHE C 2  57   ? 21.760  -2.339  -65.783  1.00 42.89  ?  61   PHE C CE1   1 
ATOM   3639  C  CE2   . PHE C 2  57   ? 22.662  -0.451  -66.918  1.00 41.63  ?  61   PHE C CE2   1 
ATOM   3640  C  CZ    . PHE C 2  57   ? 21.711  -0.998  -66.090  1.00 42.38  ?  61   PHE C CZ    1 
ATOM   3641  N  N     . GLU C 2  58   ? 25.108  -3.128  -70.967  1.00 44.53  ?  62   GLU C N     1 
ATOM   3642  C  CA    . GLU C 2  58   ? 24.870  -2.355  -72.179  1.00 45.53  ?  62   GLU C CA    1 
ATOM   3643  C  C     . GLU C 2  58   ? 23.931  -3.083  -73.129  1.00 47.41  ?  62   GLU C C     1 
ATOM   3644  O  O     . GLU C 2  58   ? 23.185  -2.439  -73.873  1.00 53.40  ?  62   GLU C O     1 
ATOM   3645  C  CB    . GLU C 2  58   ? 26.193  -2.036  -72.872  1.00 48.69  ?  62   GLU C CB    1 
ATOM   3646  C  CG    . GLU C 2  58   ? 26.987  -0.929  -72.201  1.00 52.30  ?  62   GLU C CG    1 
ATOM   3647  C  CD    . GLU C 2  58   ? 28.342  -0.710  -72.842  1.00 62.89  ?  62   GLU C CD    1 
ATOM   3648  O  OE1   . GLU C 2  58   ? 28.663  -1.423  -73.815  1.00 67.06  ?  62   GLU C OE1   1 
ATOM   3649  O  OE2   . GLU C 2  58   ? 29.087  0.173   -72.373  1.00 64.37  ?  62   GLU C OE2   1 
ATOM   3650  N  N     . TRP C 2  59   ? 23.951  -4.417  -73.120  1.00 46.20  ?  63   TRP C N     1 
ATOM   3651  C  CA    . TRP C 2  59   ? 22.981  -5.170  -73.909  1.00 51.28  ?  63   TRP C CA    1 
ATOM   3652  C  C     . TRP C 2  59   ? 21.583  -5.052  -73.319  1.00 49.50  ?  63   TRP C C     1 
ATOM   3653  O  O     . TRP C 2  59   ? 20.594  -4.985  -74.057  1.00 52.41  ?  63   TRP C O     1 
ATOM   3654  C  CB    . TRP C 2  59   ? 23.402  -6.635  -74.000  1.00 51.41  ?  63   TRP C CB    1 
ATOM   3655  C  CG    . TRP C 2  59   ? 22.287  -7.561  -74.379  1.00 50.90  ?  63   TRP C CG    1 
ATOM   3656  C  CD1   . TRP C 2  59   ? 21.833  -7.825  -75.636  1.00 55.15  ?  63   TRP C CD1   1 
ATOM   3657  C  CD2   . TRP C 2  59   ? 21.491  -8.354  -73.491  1.00 48.37  ?  63   TRP C CD2   1 
ATOM   3658  N  NE1   . TRP C 2  59   ? 20.802  -8.729  -75.586  1.00 52.57  ?  63   TRP C NE1   1 
ATOM   3659  C  CE2   . TRP C 2  59   ? 20.573  -9.069  -74.280  1.00 48.22  ?  63   TRP C CE2   1 
ATOM   3660  C  CE3   . TRP C 2  59   ? 21.463  -8.525  -72.104  1.00 46.54  ?  63   TRP C CE3   1 
ATOM   3661  C  CZ2   . TRP C 2  59   ? 19.640  -9.940  -73.731  1.00 47.39  ?  63   TRP C CZ2   1 
ATOM   3662  C  CZ3   . TRP C 2  59   ? 20.536  -9.390  -71.562  1.00 44.60  ?  63   TRP C CZ3   1 
ATOM   3663  C  CH2   . TRP C 2  59   ? 19.638  -10.086 -72.373  1.00 47.40  ?  63   TRP C CH2   1 
ATOM   3664  N  N     . LEU C 2  60   ? 21.482  -5.027  -71.990  1.00 47.29  ?  64   LEU C N     1 
ATOM   3665  C  CA    . LEU C 2  60   ? 20.186  -4.865  -71.342  1.00 45.66  ?  64   LEU C CA    1 
ATOM   3666  C  C     . LEU C 2  60   ? 19.538  -3.544  -71.739  1.00 47.44  ?  64   LEU C C     1 
ATOM   3667  O  O     . LEU C 2  60   ? 18.359  -3.500  -72.105  1.00 51.28  ?  64   LEU C O     1 
ATOM   3668  C  CB    . LEU C 2  60   ? 20.359  -4.951  -69.829  1.00 42.41  ?  64   LEU C CB    1 
ATOM   3669  C  CG    . LEU C 2  60   ? 19.101  -4.819  -68.982  1.00 39.10  ?  64   LEU C CG    1 
ATOM   3670  C  CD1   . LEU C 2  60   ? 18.137  -5.940  -69.303  1.00 41.06  ?  64   LEU C CD1   1 
ATOM   3671  C  CD2   . LEU C 2  60   ? 19.475  -4.825  -67.519  1.00 39.54  ?  64   LEU C CD2   1 
ATOM   3672  N  N     . ILE C 2  61   ? 20.305  -2.455  -71.680  1.00 50.19  ?  65   ILE C N     1 
ATOM   3673  C  CA    . ILE C 2  61   ? 19.786  -1.141  -72.041  1.00 50.36  ?  65   ILE C CA    1 
ATOM   3674  C  C     . ILE C 2  61   ? 19.622  -1.013  -73.550  1.00 53.20  ?  65   ILE C C     1 
ATOM   3675  O  O     . ILE C 2  61   ? 18.762  -0.263  -74.028  1.00 57.60  ?  65   ILE C O     1 
ATOM   3676  C  CB    . ILE C 2  61   ? 20.713  -0.051  -71.469  1.00 50.95  ?  65   ILE C CB    1 
ATOM   3677  C  CG1   . ILE C 2  61   ? 20.482  0.118   -69.970  1.00 48.67  ?  65   ILE C CG1   1 
ATOM   3678  C  CG2   . ILE C 2  61   ? 20.531  1.282   -72.183  1.00 60.55  ?  65   ILE C CG2   1 
ATOM   3679  C  CD1   . ILE C 2  61   ? 21.215  1.302   -69.396  1.00 51.81  ?  65   ILE C CD1   1 
ATOM   3680  N  N     . GLY C 2  62   ? 20.405  -1.755  -74.324  1.00 53.46  ?  66   GLY C N     1 
ATOM   3681  C  CA    . GLY C 2  62   ? 20.434  -1.540  -75.755  1.00 58.14  ?  66   GLY C CA    1 
ATOM   3682  C  C     . GLY C 2  62   ? 21.216  -0.287  -76.078  1.00 61.12  ?  66   GLY C C     1 
ATOM   3683  O  O     . GLY C 2  62   ? 20.773  0.559   -76.860  1.00 64.69  ?  66   GLY C O     1 
ATOM   3684  N  N     . SER C 2  63   ? 22.386  -0.161  -75.460  1.00 61.52  ?  67   SER C N     1 
ATOM   3685  C  CA    . SER C 2  63   ? 23.194  1.037   -75.593  1.00 60.24  ?  67   SER C CA    1 
ATOM   3686  C  C     . SER C 2  63   ? 23.772  1.142   -77.004  1.00 67.41  ?  67   SER C C     1 
ATOM   3687  O  O     . SER C 2  63   ? 24.012  0.127   -77.664  1.00 68.81  ?  67   SER C O     1 
ATOM   3688  C  CB    . SER C 2  63   ? 24.320  1.019   -74.563  1.00 58.99  ?  67   SER C CB    1 
ATOM   3689  O  OG    . SER C 2  63   ? 25.105  2.194   -74.616  1.00 68.77  ?  67   SER C OG    1 
ATOM   3690  N  N     . PRO C 2  64   ? 23.987  2.366   -77.497  1.00 69.86  ?  68   PRO C N     1 
ATOM   3691  C  CA    . PRO C 2  64   ? 24.615  2.519   -78.820  1.00 71.64  ?  68   PRO C CA    1 
ATOM   3692  C  C     . PRO C 2  64   ? 25.967  1.837   -78.928  1.00 75.76  ?  68   PRO C C     1 
ATOM   3693  O  O     . PRO C 2  64   ? 26.302  1.322   -80.002  1.00 78.27  ?  68   PRO C O     1 
ATOM   3694  C  CB    . PRO C 2  64   ? 24.734  4.042   -78.979  1.00 72.69  ?  68   PRO C CB    1 
ATOM   3695  C  CG    . PRO C 2  64   ? 24.575  4.599   -77.594  1.00 67.80  ?  68   PRO C CG    1 
ATOM   3696  C  CD    . PRO C 2  64   ? 23.635  3.666   -76.906  1.00 66.40  ?  68   PRO C CD    1 
ATOM   3697  N  N     . ARG C 2  65   ? 26.756  1.827   -77.849  1.00 75.65  ?  69   ARG C N     1 
ATOM   3698  C  CA    . ARG C 2  65   ? 27.987  1.044   -77.838  1.00 75.96  ?  69   ARG C CA    1 
ATOM   3699  C  C     . ARG C 2  65   ? 27.702  -0.410  -78.185  1.00 76.49  ?  69   ARG C C     1 
ATOM   3700  O  O     . ARG C 2  65   ? 28.369  -1.003  -79.041  1.00 77.35  ?  69   ARG C O     1 
ATOM   3701  C  CB    . ARG C 2  65   ? 28.660  1.126   -76.469  1.00 75.59  ?  69   ARG C CB    1 
ATOM   3702  C  CG    . ARG C 2  65   ? 28.786  2.512   -75.880  1.00 80.76  ?  69   ARG C CG    1 
ATOM   3703  C  CD    . ARG C 2  65   ? 29.624  2.443   -74.615  1.00 83.47  ?  69   ARG C CD    1 
ATOM   3704  N  NE    . ARG C 2  65   ? 30.948  1.891   -74.894  1.00 84.84  ?  69   ARG C NE    1 
ATOM   3705  C  CZ    . ARG C 2  65   ? 31.785  1.434   -73.968  1.00 82.93  ?  69   ARG C CZ    1 
ATOM   3706  N  NH1   . ARG C 2  65   ? 32.969  0.955   -74.325  1.00 84.69  ?  69   ARG C NH1   1 
ATOM   3707  N  NH2   . ARG C 2  65   ? 31.439  1.447   -72.688  1.00 80.26  ?  69   ARG C NH2   1 
ATOM   3708  N  N     . TRP C 2  66   ? 26.709  -1.001  -77.518  1.00 70.65  ?  70   TRP C N     1 
ATOM   3709  C  CA    . TRP C 2  66   ? 26.339  -2.379  -77.810  1.00 71.40  ?  70   TRP C CA    1 
ATOM   3710  C  C     . TRP C 2  66   ? 25.867  -2.531  -79.250  1.00 74.35  ?  70   TRP C C     1 
ATOM   3711  O  O     . TRP C 2  66   ? 26.157  -3.541  -79.900  1.00 76.14  ?  70   TRP C O     1 
ATOM   3712  C  CB    . TRP C 2  66   ? 25.262  -2.847  -76.834  1.00 64.12  ?  70   TRP C CB    1 
ATOM   3713  C  CG    . TRP C 2  66   ? 24.517  -4.032  -77.323  1.00 63.07  ?  70   TRP C CG    1 
ATOM   3714  C  CD1   . TRP C 2  66   ? 24.899  -5.335  -77.233  1.00 66.46  ?  70   TRP C CD1   1 
ATOM   3715  C  CD2   . TRP C 2  66   ? 23.255  -4.029  -77.995  1.00 68.42  ?  70   TRP C CD2   1 
ATOM   3716  N  NE1   . TRP C 2  66   ? 23.952  -6.147  -77.806  1.00 63.45  ?  70   TRP C NE1   1 
ATOM   3717  C  CE2   . TRP C 2  66   ? 22.932  -5.367  -78.282  1.00 68.39  ?  70   TRP C CE2   1 
ATOM   3718  C  CE3   . TRP C 2  66   ? 22.366  -3.022  -78.381  1.00 69.56  ?  70   TRP C CE3   1 
ATOM   3719  C  CZ2   . TRP C 2  66   ? 21.759  -5.726  -78.936  1.00 72.54  ?  70   TRP C CZ2   1 
ATOM   3720  C  CZ3   . TRP C 2  66   ? 21.202  -3.379  -79.030  1.00 69.15  ?  70   TRP C CZ3   1 
ATOM   3721  C  CH2   . TRP C 2  66   ? 20.908  -4.719  -79.301  1.00 71.77  ?  70   TRP C CH2   1 
ATOM   3722  N  N     . ARG C 2  67   ? 25.144  -1.535  -79.769  1.00 76.52  ?  71   ARG C N     1 
ATOM   3723  C  CA    . ARG C 2  67   ? 24.680  -1.602  -81.152  1.00 78.68  ?  71   ARG C CA    1 
ATOM   3724  C  C     . ARG C 2  67   ? 25.851  -1.671  -82.122  1.00 81.88  ?  71   ARG C C     1 
ATOM   3725  O  O     . ARG C 2  67   ? 25.873  -2.510  -83.029  1.00 84.92  ?  71   ARG C O     1 
ATOM   3726  C  CB    . ARG C 2  67   ? 23.794  -0.400  -81.474  1.00 77.38  ?  71   ARG C CB    1 
ATOM   3727  C  CG    . ARG C 2  67   ? 22.493  -0.371  -80.706  1.00 77.02  ?  71   ARG C CG    1 
ATOM   3728  C  CD    . ARG C 2  67   ? 21.516  0.625   -81.305  1.00 70.93  ?  71   ARG C CD    1 
ATOM   3729  N  NE    . ARG C 2  67   ? 20.346  0.790   -80.451  1.00 71.72  ?  71   ARG C NE    1 
ATOM   3730  C  CZ    . ARG C 2  67   ? 19.316  -0.048  -80.428  1.00 72.76  ?  71   ARG C CZ    1 
ATOM   3731  N  NH1   . ARG C 2  67   ? 19.305  -1.116  -81.216  1.00 67.31  ?  71   ARG C NH1   1 
ATOM   3732  N  NH2   . ARG C 2  67   ? 18.295  0.180   -79.614  1.00 74.44  ?  71   ARG C NH2   1 
ATOM   3733  N  N     . GLU C 2  68   ? 26.834  -0.786  -81.948  1.00 82.06  ?  72   GLU C N     1 
ATOM   3734  C  CA    . GLU C 2  68   ? 27.999  -0.792  -82.826  1.00 82.32  ?  72   GLU C CA    1 
ATOM   3735  C  C     . GLU C 2  68   ? 28.745  -2.117  -82.734  1.00 83.40  ?  72   GLU C C     1 
ATOM   3736  O  O     . GLU C 2  68   ? 29.093  -2.719  -83.756  1.00 89.30  ?  72   GLU C O     1 
ATOM   3737  C  CB    . GLU C 2  68   ? 28.918  0.377   -82.475  1.00 85.94  ?  72   GLU C CB    1 
ATOM   3738  C  CG    . GLU C 2  68   ? 28.230  1.729   -82.543  1.00 89.45  ?  72   GLU C CG    1 
ATOM   3739  C  CD    . GLU C 2  68   ? 28.951  2.789   -81.737  1.00 94.73  ?  72   GLU C CD    1 
ATOM   3740  O  OE1   . GLU C 2  68   ? 30.107  2.545   -81.332  1.00 96.45  ?  72   GLU C OE1   1 
ATOM   3741  O  OE2   . GLU C 2  68   ? 28.356  3.862   -81.501  1.00 93.01  ?  72   GLU C OE2   1 
ATOM   3742  N  N     . SER C 2  69   ? 28.992  -2.592  -81.510  1.00 81.82  ?  73   SER C N     1 
ATOM   3743  C  CA    . SER C 2  69   ? 29.632  -3.892  -81.345  1.00 87.02  ?  73   SER C CA    1 
ATOM   3744  C  C     . SER C 2  69   ? 28.766  -5.010  -81.905  1.00 89.86  ?  73   SER C C     1 
ATOM   3745  O  O     . SER C 2  69   ? 29.293  -6.000  -82.425  1.00 95.83  ?  73   SER C O     1 
ATOM   3746  C  CB    . SER C 2  69   ? 29.936  -4.152  -79.870  1.00 87.73  ?  73   SER C CB    1 
ATOM   3747  O  OG    . SER C 2  69   ? 28.774  -4.581  -79.182  1.00 89.39  ?  73   SER C OG    1 
ATOM   3748  N  N     . ALA C 2  70   ? 27.442  -4.876  -81.807  1.00 88.83  ?  74   ALA C N     1 
ATOM   3749  C  CA    . ALA C 2  70   ? 26.556  -5.851  -82.433  1.00 91.51  ?  74   ALA C CA    1 
ATOM   3750  C  C     . ALA C 2  70   ? 26.715  -5.828  -83.946  1.00 96.61  ?  74   ALA C C     1 
ATOM   3751  O  O     . ALA C 2  70   ? 26.831  -6.879  -84.585  1.00 101.25 ?  74   ALA C O     1 
ATOM   3752  C  CB    . ALA C 2  70   ? 25.104  -5.581  -82.038  1.00 88.17  ?  74   ALA C CB    1 
ATOM   3753  N  N     . ALA C 2  71   ? 26.735  -4.631  -84.536  1.00 94.92  ?  75   ALA C N     1 
ATOM   3754  C  CA    . ALA C 2  71   ? 26.977  -4.521  -85.970  1.00 98.09  ?  75   ALA C CA    1 
ATOM   3755  C  C     . ALA C 2  71   ? 28.355  -5.050  -86.344  1.00 100.50 ?  75   ALA C C     1 
ATOM   3756  O  O     . ALA C 2  71   ? 28.535  -5.592  -87.441  1.00 101.78 ?  75   ALA C O     1 
ATOM   3757  C  CB    . ALA C 2  71   ? 26.823  -3.069  -86.421  1.00 101.27 ?  75   ALA C CB    1 
ATOM   3758  N  N     . GLU C 2  72   ? 29.335  -4.907  -85.448  1.00 100.56 ?  76   GLU C N     1 
ATOM   3759  C  CA    . GLU C 2  72   ? 30.663  -5.454  -85.704  1.00 95.89  ?  76   GLU C CA    1 
ATOM   3760  C  C     . GLU C 2  72   ? 30.622  -6.975  -85.784  1.00 101.26 ?  76   GLU C C     1 
ATOM   3761  O  O     . GLU C 2  72   ? 31.079  -7.567  -86.768  1.00 102.63 ?  76   GLU C O     1 
ATOM   3762  C  CB    . GLU C 2  72   ? 31.637  -4.994  -84.619  1.00 93.48  ?  76   GLU C CB    1 
ATOM   3763  N  N     . ARG C 2  73   ? 30.067  -7.627  -84.758  1.00 103.49 ?  77   ARG C N     1 
ATOM   3764  C  CA    . ARG C 2  73   ? 29.890  -9.075  -84.777  1.00 102.55 ?  77   ARG C CA    1 
ATOM   3765  C  C     . ARG C 2  73   ? 28.890  -9.537  -85.829  1.00 101.67 ?  77   ARG C C     1 
ATOM   3766  O  O     . ARG C 2  73   ? 28.751  -10.746 -86.037  1.00 100.79 ?  77   ARG C O     1 
ATOM   3767  C  CB    . ARG C 2  73   ? 29.434  -9.577  -83.405  1.00 100.31 ?  77   ARG C CB    1 
ATOM   3768  C  CG    . ARG C 2  73   ? 30.538  -9.752  -82.373  1.00 97.65  ?  77   ARG C CG    1 
ATOM   3769  C  CD    . ARG C 2  73   ? 30.113  -10.780 -81.332  1.00 96.86  ?  77   ARG C CD    1 
ATOM   3770  N  NE    . ARG C 2  73   ? 31.049  -10.894 -80.217  1.00 92.27  ?  77   ARG C NE    1 
ATOM   3771  C  CZ    . ARG C 2  73   ? 30.844  -10.365 -79.015  1.00 90.44  ?  77   ARG C CZ    1 
ATOM   3772  N  NH1   . ARG C 2  73   ? 29.733  -9.683  -78.769  1.00 87.91  ?  77   ARG C NH1   1 
ATOM   3773  N  NH2   . ARG C 2  73   ? 31.748  -10.521 -78.056  1.00 78.45  ?  77   ARG C NH2   1 
ATOM   3774  N  N     . GLY C 2  74   ? 28.190  -8.613  -86.480  1.00 102.41 ?  78   GLY C N     1 
ATOM   3775  C  CA    . GLY C 2  74   ? 27.121  -8.948  -87.398  1.00 104.99 ?  78   GLY C CA    1 
ATOM   3776  C  C     . GLY C 2  74   ? 25.785  -8.818  -86.701  1.00 112.07 ?  78   GLY C C     1 
ATOM   3777  O  O     . GLY C 2  74   ? 25.675  -9.135  -85.513  1.00 111.12 ?  78   GLY C O     1 
ATOM   3778  N  N     . ASP C 2  75   ? 24.755  -8.385  -87.420  1.00 114.94 ?  79   ASP C N     1 
ATOM   3779  C  CA    . ASP C 2  75   ? 23.490  -8.024  -86.799  1.00 113.14 ?  79   ASP C CA    1 
ATOM   3780  C  C     . ASP C 2  75   ? 22.417  -9.044  -87.160  1.00 114.65 ?  79   ASP C C     1 
ATOM   3781  O  O     . ASP C 2  75   ? 22.215  -9.368  -88.335  1.00 115.25 ?  79   ASP C O     1 
ATOM   3782  C  CB    . ASP C 2  75   ? 23.067  -6.602  -87.189  1.00 111.03 ?  79   ASP C CB    1 
ATOM   3783  C  CG    . ASP C 2  75   ? 22.401  -6.530  -88.543  1.00 115.34 ?  79   ASP C CG    1 
ATOM   3784  O  OD1   . ASP C 2  75   ? 23.117  -6.379  -89.554  1.00 116.11 ?  79   ASP C OD1   1 
ATOM   3785  O  OD2   . ASP C 2  75   ? 21.155  -6.614  -88.594  1.00 114.11 ?  79   ASP C OD2   1 
ATOM   3786  N  N     . VAL C 2  76   ? 21.757  -9.562  -86.129  1.00 116.57 ?  80   VAL C N     1 
ATOM   3787  C  CA    . VAL C 2  76   ? 20.660  -10.518 -86.219  1.00 116.17 ?  80   VAL C CA    1 
ATOM   3788  C  C     . VAL C 2  76   ? 19.361  -9.720  -86.226  1.00 112.95 ?  80   VAL C C     1 
ATOM   3789  O  O     . VAL C 2  76   ? 18.277  -10.267 -85.988  1.00 113.89 ?  80   VAL C O     1 
ATOM   3790  C  CB    . VAL C 2  76   ? 20.722  -11.547 -85.073  1.00 111.35 ?  80   VAL C CB    1 
ATOM   3791  C  CG1   . VAL C 2  76   ? 19.840  -12.752 -85.369  1.00 108.13 ?  80   VAL C CG1   1 
ATOM   3792  C  CG2   . VAL C 2  76   ? 22.159  -12.001 -84.861  1.00 112.09 ?  80   VAL C CG2   1 
ATOM   3793  N  N     . ASN C 2  77   ? 19.474  -8.406  -86.480  1.00 110.91 ?  81   ASN C N     1 
ATOM   3794  C  CA    . ASN C 2  77   ? 18.525  -7.366  -86.098  1.00 108.92 ?  81   ASN C CA    1 
ATOM   3795  C  C     . ASN C 2  77   ? 18.529  -7.303  -84.579  1.00 107.14 ?  81   ASN C C     1 
ATOM   3796  O  O     . ASN C 2  77   ? 17.531  -7.635  -83.927  1.00 103.08 ?  81   ASN C O     1 
ATOM   3797  C  CB    . ASN C 2  77   ? 17.119  -7.631  -86.646  1.00 102.34 ?  81   ASN C CB    1 
ATOM   3798  N  N     . PRO C 2  78   ? 19.651  -6.882  -83.994  1.00 105.10 ?  82   PRO C N     1 
ATOM   3799  C  CA    . PRO C 2  78   ? 19.853  -7.053  -82.553  1.00 94.37  ?  82   PRO C CA    1 
ATOM   3800  C  C     . PRO C 2  78   ? 18.812  -6.306  -81.739  1.00 84.06  ?  82   PRO C C     1 
ATOM   3801  O  O     . PRO C 2  78   ? 18.435  -5.176  -82.055  1.00 82.65  ?  82   PRO C O     1 
ATOM   3802  C  CB    . PRO C 2  78   ? 21.257  -6.483  -82.328  1.00 95.12  ?  82   PRO C CB    1 
ATOM   3803  C  CG    . PRO C 2  78   ? 21.431  -5.489  -83.427  1.00 94.31  ?  82   PRO C CG    1 
ATOM   3804  C  CD    . PRO C 2  78   ? 20.714  -6.070  -84.610  1.00 102.34 ?  82   PRO C CD    1 
ATOM   3805  N  N     . VAL C 2  79   ? 18.345  -6.961  -80.684  1.00 76.09  ?  83   VAL C N     1 
ATOM   3806  C  CA    . VAL C 2  79   ? 17.382  -6.391  -79.755  1.00 73.82  ?  83   VAL C CA    1 
ATOM   3807  C  C     . VAL C 2  79   ? 18.009  -6.382  -78.370  1.00 67.49  ?  83   VAL C C     1 
ATOM   3808  O  O     . VAL C 2  79   ? 18.655  -7.353  -77.963  1.00 63.36  ?  83   VAL C O     1 
ATOM   3809  C  CB    . VAL C 2  79   ? 16.055  -7.178  -79.759  1.00 74.51  ?  83   VAL C CB    1 
ATOM   3810  C  CG1   . VAL C 2  79   ? 15.279  -6.890  -81.032  1.00 78.77  ?  83   VAL C CG1   1 
ATOM   3811  C  CG2   . VAL C 2  79   ? 16.321  -8.670  -79.630  1.00 75.62  ?  83   VAL C CG2   1 
ATOM   3812  N  N     . GLY C 2  80   ? 17.833  -5.278  -77.657  1.00 65.15  ?  84   GLY C N     1 
ATOM   3813  C  CA    . GLY C 2  80   ? 18.346  -5.178  -76.310  1.00 58.33  ?  84   GLY C CA    1 
ATOM   3814  C  C     . GLY C 2  80   ? 17.639  -6.125  -75.363  1.00 54.05  ?  84   GLY C C     1 
ATOM   3815  O  O     . GLY C 2  80   ? 16.672  -6.804  -75.706  1.00 55.56  ?  84   GLY C O     1 
ATOM   3816  N  N     . GLY C 2  81   ? 18.152  -6.175  -74.134  1.00 52.06  ?  85   GLY C N     1 
ATOM   3817  C  CA    . GLY C 2  81   ? 17.503  -6.981  -73.114  1.00 49.05  ?  85   GLY C CA    1 
ATOM   3818  C  C     . GLY C 2  81   ? 16.084  -6.523  -72.844  1.00 50.06  ?  85   GLY C C     1 
ATOM   3819  O  O     . GLY C 2  81   ? 15.154  -7.331  -72.794  1.00 50.29  ?  85   GLY C O     1 
ATOM   3820  N  N     . LEU C 2  82   ? 15.898  -5.212  -72.679  1.00 54.72  ?  86   LEU C N     1 
ATOM   3821  C  CA    . LEU C 2  82   ? 14.557  -4.672  -72.487  1.00 49.94  ?  86   LEU C CA    1 
ATOM   3822  C  C     . LEU C 2  82   ? 13.706  -4.844  -73.737  1.00 53.40  ?  86   LEU C C     1 
ATOM   3823  O  O     . LEU C 2  82   ? 12.525  -5.196  -73.643  1.00 50.39  ?  86   LEU C O     1 
ATOM   3824  C  CB    . LEU C 2  82   ? 14.637  -3.199  -72.099  1.00 49.08  ?  86   LEU C CB    1 
ATOM   3825  C  CG    . LEU C 2  82   ? 14.674  -2.909  -70.604  1.00 52.02  ?  86   LEU C CG    1 
ATOM   3826  C  CD1   . LEU C 2  82   ? 14.727  -1.412  -70.369  1.00 55.37  ?  86   LEU C CD1   1 
ATOM   3827  C  CD2   . LEU C 2  82   ? 13.459  -3.517  -69.931  1.00 50.31  ?  86   LEU C CD2   1 
ATOM   3828  N  N     . GLU C 2  83   ? 14.287  -4.591  -74.913  1.00 56.06  ?  87   GLU C N     1 
ATOM   3829  C  CA    . GLU C 2  83   ? 13.531  -4.702  -76.157  1.00 55.84  ?  87   GLU C CA    1 
ATOM   3830  C  C     . GLU C 2  83   ? 12.967  -6.102  -76.337  1.00 55.18  ?  87   GLU C C     1 
ATOM   3831  O  O     . GLU C 2  83   ? 11.813  -6.269  -76.747  1.00 59.04  ?  87   GLU C O     1 
ATOM   3832  C  CB    . GLU C 2  83   ? 14.419  -4.338  -77.345  1.00 62.14  ?  87   GLU C CB    1 
ATOM   3833  C  CG    . GLU C 2  83   ? 15.243  -3.084  -77.152  1.00 65.72  ?  87   GLU C CG    1 
ATOM   3834  C  CD    . GLU C 2  83   ? 16.056  -2.739  -78.381  1.00 72.69  ?  87   GLU C CD    1 
ATOM   3835  O  OE1   . GLU C 2  83   ? 15.836  -3.370  -79.435  1.00 73.39  ?  87   GLU C OE1   1 
ATOM   3836  O  OE2   . GLU C 2  83   ? 16.917  -1.839  -78.295  1.00 73.25  ?  87   GLU C OE2   1 
ATOM   3837  N  N     . GLU C 2  84   ? 13.771  -7.122  -76.038  1.00 55.80  ?  88   GLU C N     1 
ATOM   3838  C  CA    . GLU C 2  84   ? 13.311  -8.497  -76.184  1.00 55.38  ?  88   GLU C CA    1 
ATOM   3839  C  C     . GLU C 2  84   ? 12.144  -8.790  -75.251  1.00 52.18  ?  88   GLU C C     1 
ATOM   3840  O  O     . GLU C 2  84   ? 11.169  -9.437  -75.650  1.00 55.30  ?  88   GLU C O     1 
ATOM   3841  C  CB    . GLU C 2  84   ? 14.469  -9.456  -75.922  1.00 53.75  ?  88   GLU C CB    1 
ATOM   3842  C  CG    . GLU C 2  84   ? 14.110  -10.919 -76.012  1.00 53.83  ?  88   GLU C CG    1 
ATOM   3843  C  CD    . GLU C 2  84   ? 15.287  -11.809 -75.684  1.00 57.21  ?  88   GLU C CD    1 
ATOM   3844  O  OE1   . GLU C 2  84   ? 16.427  -11.300 -75.686  1.00 49.93  ?  88   GLU C OE1   1 
ATOM   3845  O  OE2   . GLU C 2  84   ? 15.074  -13.010 -75.417  1.00 60.88  ?  88   GLU C OE2   1 
ATOM   3846  N  N     . VAL C 2  85   ? 12.222  -8.317  -74.006  1.00 49.62  ?  89   VAL C N     1 
ATOM   3847  C  CA    . VAL C 2  85   ? 11.128  -8.529  -73.063  1.00 50.11  ?  89   VAL C CA    1 
ATOM   3848  C  C     . VAL C 2  85   ? 9.863   -7.843  -73.554  1.00 48.65  ?  89   VAL C C     1 
ATOM   3849  O  O     . VAL C 2  85   ? 8.757   -8.380  -73.426  1.00 51.36  ?  89   VAL C O     1 
ATOM   3850  C  CB    . VAL C 2  85   ? 11.529  -8.042  -71.658  1.00 49.56  ?  89   VAL C CB    1 
ATOM   3851  C  CG1   . VAL C 2  85   ? 10.331  -8.064  -70.722  1.00 48.75  ?  89   VAL C CG1   1 
ATOM   3852  C  CG2   . VAL C 2  85   ? 12.647  -8.899  -71.102  1.00 47.43  ?  89   VAL C CG2   1 
ATOM   3853  N  N     . LEU C 2  86   ? 10.004  -6.652  -74.138  1.00 49.99  ?  90   LEU C N     1 
ATOM   3854  C  CA    . LEU C 2  86   ? 8.833   -5.928  -74.619  1.00 50.22  ?  90   LEU C CA    1 
ATOM   3855  C  C     . LEU C 2  86   ? 8.222   -6.588  -75.848  1.00 56.24  ?  90   LEU C C     1 
ATOM   3856  O  O     . LEU C 2  86   ? 6.999   -6.560  -76.016  1.00 63.75  ?  90   LEU C O     1 
ATOM   3857  C  CB    . LEU C 2  86   ? 9.199   -4.478  -74.926  1.00 49.87  ?  90   LEU C CB    1 
ATOM   3858  C  CG    . LEU C 2  86   ? 9.619   -3.623  -73.731  1.00 49.42  ?  90   LEU C CG    1 
ATOM   3859  C  CD1   . LEU C 2  86   ? 9.952   -2.211  -74.176  1.00 50.12  ?  90   LEU C CD1   1 
ATOM   3860  C  CD2   . LEU C 2  86   ? 8.531   -3.617  -72.674  1.00 48.83  ?  90   LEU C CD2   1 
ATOM   3861  N  N     . TYR C 2  87   ? 9.043   -7.181  -76.715  1.00 53.52  ?  91   TYR C N     1 
ATOM   3862  C  CA    . TYR C 2  87   ? 8.503   -7.771  -77.935  1.00 55.68  ?  91   TYR C CA    1 
ATOM   3863  C  C     . TYR C 2  87   ? 7.854   -9.124  -77.668  1.00 58.32  ?  91   TYR C C     1 
ATOM   3864  O  O     . TYR C 2  87   ? 6.823   -9.446  -78.268  1.00 60.10  ?  91   TYR C O     1 
ATOM   3865  C  CB    . TYR C 2  87   ? 9.600   -7.890  -78.990  1.00 59.53  ?  91   TYR C CB    1 
ATOM   3866  C  CG    . TYR C 2  87   ? 10.019  -6.553  -79.553  1.00 72.72  ?  91   TYR C CG    1 
ATOM   3867  C  CD1   . TYR C 2  87   ? 9.215   -5.432  -79.389  1.00 72.26  ?  91   TYR C CD1   1 
ATOM   3868  C  CD2   . TYR C 2  87   ? 11.213  -6.406  -80.245  1.00 74.69  ?  91   TYR C CD2   1 
ATOM   3869  C  CE1   . TYR C 2  87   ? 9.587   -4.204  -79.895  1.00 74.21  ?  91   TYR C CE1   1 
ATOM   3870  C  CE2   . TYR C 2  87   ? 11.594  -5.179  -80.758  1.00 73.85  ?  91   TYR C CE2   1 
ATOM   3871  C  CZ    . TYR C 2  87   ? 10.776  -4.082  -80.579  1.00 78.90  ?  91   TYR C CZ    1 
ATOM   3872  O  OH    . TYR C 2  87   ? 11.146  -2.857  -81.085  1.00 89.15  ?  91   TYR C OH    1 
ATOM   3873  N  N     . GLU C 2  88   ? 8.437   -9.928  -76.779  1.00 58.07  ?  92   GLU C N     1 
ATOM   3874  C  CA    . GLU C 2  88   ? 7.779   -11.168 -76.385  1.00 56.97  ?  92   GLU C CA    1 
ATOM   3875  C  C     . GLU C 2  88   ? 6.479   -10.889 -75.647  1.00 56.16  ?  92   GLU C C     1 
ATOM   3876  O  O     . GLU C 2  88   ? 5.528   -11.673 -75.743  1.00 59.76  ?  92   GLU C O     1 
ATOM   3877  C  CB    . GLU C 2  88   ? 8.713   -12.011 -75.517  1.00 55.40  ?  92   GLU C CB    1 
ATOM   3878  N  N     . LEU C 2  89   ? 6.420   -9.776  -74.915  1.00 52.96  ?  93   LEU C N     1 
ATOM   3879  C  CA    . LEU C 2  89   ? 5.207   -9.429  -74.186  1.00 55.19  ?  93   LEU C CA    1 
ATOM   3880  C  C     . LEU C 2  89   ? 4.107   -8.970  -75.132  1.00 59.93  ?  93   LEU C C     1 
ATOM   3881  O  O     . LEU C 2  89   ? 2.944   -9.357  -74.975  1.00 64.68  ?  93   LEU C O     1 
ATOM   3882  C  CB    . LEU C 2  89   ? 5.518   -8.345  -73.160  1.00 56.85  ?  93   LEU C CB    1 
ATOM   3883  C  CG    . LEU C 2  89   ? 4.391   -7.947  -72.214  1.00 58.30  ?  93   LEU C CG    1 
ATOM   3884  C  CD1   . LEU C 2  89   ? 4.034   -9.109  -71.307  1.00 64.37  ?  93   LEU C CD1   1 
ATOM   3885  C  CD2   . LEU C 2  89   ? 4.808   -6.736  -71.408  1.00 57.07  ?  93   LEU C CD2   1 
ATOM   3886  N  N     . SER C 2  90   ? 4.453   -8.149  -76.116  1.00 61.05  ?  94   SER C N     1 
ATOM   3887  C  CA    . SER C 2  90   ? 3.482   -7.643  -77.077  1.00 63.67  ?  94   SER C CA    1 
ATOM   3888  C  C     . SER C 2  90   ? 3.079   -8.718  -78.080  1.00 68.80  ?  94   SER C C     1 
ATOM   3889  O  O     . SER C 2  90   ? 3.888   -9.575  -78.433  1.00 67.93  ?  94   SER C O     1 
ATOM   3890  C  CB    . SER C 2  90   ? 4.047   -6.428  -77.818  1.00 63.82  ?  94   SER C CB    1 
ATOM   3891  O  OG    . SER C 2  90   ? 4.191   -5.315  -76.953  1.00 61.38  ?  94   SER C OG    1 
ATOM   3892  N  N     . PRO C 2  91   ? 1.819   -8.677  -78.542  1.00 73.87  ?  95   PRO C N     1 
ATOM   3893  C  CA    . PRO C 2  91   ? 0.752   -7.803  -78.045  1.00 67.00  ?  95   PRO C CA    1 
ATOM   3894  C  C     . PRO C 2  91   ? 0.079   -8.340  -76.786  1.00 64.70  ?  95   PRO C C     1 
ATOM   3895  O  O     . PRO C 2  91   ? 0.038   -9.552  -76.586  1.00 61.45  ?  95   PRO C O     1 
ATOM   3896  C  CB    . PRO C 2  91   ? -0.231  -7.775  -79.209  1.00 66.52  ?  95   PRO C CB    1 
ATOM   3897  C  CG    . PRO C 2  91   ? -0.101  -9.131  -79.804  1.00 68.52  ?  95   PRO C CG    1 
ATOM   3898  C  CD    . PRO C 2  91   ? 1.352   -9.517  -79.660  1.00 74.05  ?  95   PRO C CD    1 
ATOM   3899  N  N     . ILE C 2  92   ? -0.449  -7.449  -75.956  1.00 63.66  ?  96   ILE C N     1 
ATOM   3900  C  CA    . ILE C 2  92   ? -1.314  -7.832  -74.848  1.00 67.92  ?  96   ILE C CA    1 
ATOM   3901  C  C     . ILE C 2  92   ? -2.745  -7.700  -75.344  1.00 74.29  ?  96   ILE C C     1 
ATOM   3902  O  O     . ILE C 2  92   ? -3.236  -6.588  -75.563  1.00 73.39  ?  96   ILE C O     1 
ATOM   3903  C  CB    . ILE C 2  92   ? -1.071  -6.967  -73.605  1.00 67.72  ?  96   ILE C CB    1 
ATOM   3904  C  CG1   . ILE C 2  92   ? 0.361   -7.150  -73.111  1.00 66.90  ?  96   ILE C CG1   1 
ATOM   3905  C  CG2   . ILE C 2  92   ? -2.060  -7.326  -72.508  1.00 68.70  ?  96   ILE C CG2   1 
ATOM   3906  C  CD1   . ILE C 2  92   ? 0.719   -8.588  -72.863  1.00 69.29  ?  96   ILE C CD1   1 
ATOM   3907  N  N     . GLU C 2  93   ? -3.422  -8.830  -75.512  1.00 77.64  ?  97   GLU C N     1 
ATOM   3908  C  CA    . GLU C 2  93   ? -4.750  -8.863  -76.102  1.00 78.05  ?  97   GLU C CA    1 
ATOM   3909  C  C     . GLU C 2  93   ? -5.795  -9.234  -75.060  1.00 78.82  ?  97   GLU C C     1 
ATOM   3910  O  O     . GLU C 2  93   ? -5.519  -9.969  -74.108  1.00 78.73  ?  97   GLU C O     1 
ATOM   3911  C  CB    . GLU C 2  93   ? -4.815  -9.859  -77.263  1.00 80.45  ?  97   GLU C CB    1 
ATOM   3912  C  CG    . GLU C 2  93   ? -4.133  -9.388  -78.535  1.00 83.57  ?  97   GLU C CG    1 
ATOM   3913  C  CD    . GLU C 2  93   ? -4.117  -10.456 -79.613  1.00 84.66  ?  97   GLU C CD    1 
ATOM   3914  O  OE1   . GLU C 2  93   ? -4.356  -11.636 -79.283  1.00 86.41  ?  97   GLU C OE1   1 
ATOM   3915  O  OE2   . GLU C 2  93   ? -3.867  -10.116 -80.789  1.00 79.66  ?  97   GLU C OE2   1 
ATOM   3916  N  N     . ASP C 2  94   ? -6.997  -8.703  -75.248  1.00 86.20  ?  98   ASP C N     1 
ATOM   3917  C  CA    . ASP C 2  94   ? -8.144  -9.170  -74.490  1.00 94.29  ?  98   ASP C CA    1 
ATOM   3918  C  C     . ASP C 2  94   ? -8.466  -10.606 -74.883  1.00 94.71  ?  98   ASP C C     1 
ATOM   3919  O  O     . ASP C 2  94   ? -8.226  -11.031 -76.017  1.00 94.11  ?  98   ASP C O     1 
ATOM   3920  C  CB    . ASP C 2  94   ? -9.349  -8.264  -74.742  1.00 91.82  ?  98   ASP C CB    1 
ATOM   3921  C  CG    . ASP C 2  94   ? -10.536 -8.614  -73.872  1.00 96.49  ?  98   ASP C CG    1 
ATOM   3922  O  OD1   . ASP C 2  94   ? -10.324 -9.150  -72.765  1.00 101.13 ?  98   ASP C OD1   1 
ATOM   3923  O  OD2   . ASP C 2  94   ? -11.681 -8.351  -74.295  1.00 97.18  ?  98   ASP C OD2   1 
ATOM   3924  N  N     . PHE C 2  95   ? -9.012  -11.365 -73.929  1.00 96.22  ?  99   PHE C N     1 
ATOM   3925  C  CA    . PHE C 2  95   ? -9.333  -12.762 -74.201  1.00 100.08 ?  99   PHE C CA    1 
ATOM   3926  C  C     . PHE C 2  95   ? -10.380 -12.906 -75.297  1.00 99.02  ?  99   PHE C C     1 
ATOM   3927  O  O     . PHE C 2  95   ? -10.550 -14.004 -75.838  1.00 95.53  ?  99   PHE C O     1 
ATOM   3928  C  CB    . PHE C 2  95   ? -9.806  -13.456 -72.922  1.00 105.20 ?  99   PHE C CB    1 
ATOM   3929  C  CG    . PHE C 2  95   ? -11.246 -13.203 -72.591  1.00 107.78 ?  99   PHE C CG    1 
ATOM   3930  C  CD1   . PHE C 2  95   ? -11.669 -11.944 -72.200  1.00 105.69 ?  99   PHE C CD1   1 
ATOM   3931  C  CD2   . PHE C 2  95   ? -12.176 -14.227 -72.661  1.00 108.40 ?  99   PHE C CD2   1 
ATOM   3932  C  CE1   . PHE C 2  95   ? -12.994 -11.708 -71.894  1.00 107.56 ?  99   PHE C CE1   1 
ATOM   3933  C  CE2   . PHE C 2  95   ? -13.502 -13.998 -72.355  1.00 111.58 ?  99   PHE C CE2   1 
ATOM   3934  C  CZ    . PHE C 2  95   ? -13.911 -12.736 -71.973  1.00 112.48 ?  99   PHE C CZ    1 
ATOM   3935  N  N     . SER C 2  96   ? -11.083 -11.827 -75.635  1.00 97.93  ?  100  SER C N     1 
ATOM   3936  C  CA    . SER C 2  96   ? -12.015 -11.808 -76.752  1.00 94.95  ?  100  SER C CA    1 
ATOM   3937  C  C     . SER C 2  96   ? -11.390 -11.273 -78.033  1.00 91.52  ?  100  SER C C     1 
ATOM   3938  O  O     . SER C 2  96   ? -12.082 -11.184 -79.052  1.00 92.02  ?  100  SER C O     1 
ATOM   3939  C  CB    . SER C 2  96   ? -13.246 -10.969 -76.398  1.00 89.60  ?  100  SER C CB    1 
ATOM   3940  O  OG    . SER C 2  96   ? -12.898 -9.608  -76.216  1.00 85.37  ?  100  SER C OG    1 
ATOM   3941  N  N     . GLY C 2  97   ? -10.109 -10.910 -78.008  1.00 90.85  ?  101  GLY C N     1 
ATOM   3942  C  CA    . GLY C 2  97   ? -9.487  -10.290 -79.161  1.00 86.32  ?  101  GLY C CA    1 
ATOM   3943  C  C     . GLY C 2  97   ? -10.043 -8.935  -79.532  1.00 88.42  ?  101  GLY C C     1 
ATOM   3944  O  O     . GLY C 2  97   ? -9.793  -8.463  -80.646  1.00 89.54  ?  101  GLY C O     1 
ATOM   3945  N  N     . SER C 2  98   ? -10.788 -8.292  -78.633  1.00 87.68  ?  102  SER C N     1 
ATOM   3946  C  CA    . SER C 2  98   ? -11.425 -7.017  -78.934  1.00 89.30  ?  102  SER C CA    1 
ATOM   3947  C  C     . SER C 2  98   ? -10.456 -5.844  -78.886  1.00 92.03  ?  102  SER C C     1 
ATOM   3948  O  O     . SER C 2  98   ? -10.710 -4.819  -79.527  1.00 92.86  ?  102  SER C O     1 
ATOM   3949  C  CB    . SER C 2  98   ? -12.575 -6.766  -77.956  1.00 93.90  ?  102  SER C CB    1 
ATOM   3950  O  OG    . SER C 2  98   ? -12.109 -6.781  -76.617  1.00 98.02  ?  102  SER C OG    1 
ATOM   3951  N  N     . MET C 2  99   ? -9.359  -5.969  -78.145  1.00 93.97  ?  103  MET C N     1 
ATOM   3952  C  CA    . MET C 2  99   ? -8.439  -4.861  -77.948  1.00 91.60  ?  103  MET C CA    1 
ATOM   3953  C  C     . MET C 2  99   ? -7.038  -5.408  -77.731  1.00 88.66  ?  103  MET C C     1 
ATOM   3954  O  O     . MET C 2  99   ? -6.856  -6.561  -77.330  1.00 89.82  ?  103  MET C O     1 
ATOM   3955  C  CB    . MET C 2  99   ? -8.872  -3.995  -76.765  1.00 86.63  ?  103  MET C CB    1 
ATOM   3956  C  CG    . MET C 2  99   ? -9.434  -4.806  -75.621  1.00 86.59  ?  103  MET C CG    1 
ATOM   3957  S  SD    . MET C 2  99   ? -10.070 -3.818  -74.262  1.00 86.58  ?  103  MET C SD    1 
ATOM   3958  C  CE    . MET C 2  99   ? -11.172 -5.014  -73.515  1.00 92.21  ?  103  MET C CE    1 
ATOM   3959  N  N     . SER C 2  100  ? -6.044  -4.564  -77.996  1.00 84.84  ?  104  SER C N     1 
ATOM   3960  C  CA    . SER C 2  100  ? -4.655  -4.976  -77.870  1.00 82.82  ?  104  SER C CA    1 
ATOM   3961  C  C     . SER C 2  100  ? -3.812  -3.804  -77.391  1.00 79.89  ?  104  SER C C     1 
ATOM   3962  O  O     . SER C 2  100  ? -4.109  -2.643  -77.683  1.00 82.44  ?  104  SER C O     1 
ATOM   3963  C  CB    . SER C 2  100  ? -4.103  -5.513  -79.196  1.00 83.71  ?  104  SER C CB    1 
ATOM   3964  O  OG    . SER C 2  100  ? -4.046  -4.490  -80.172  1.00 89.18  ?  104  SER C OG    1 
ATOM   3965  N  N     . LEU C 2  101  ? -2.753  -4.129  -76.654  1.00 77.98  ?  105  LEU C N     1 
ATOM   3966  C  CA    . LEU C 2  101  ? -1.810  -3.150  -76.130  1.00 70.72  ?  105  LEU C CA    1 
ATOM   3967  C  C     . LEU C 2  101  ? -0.400  -3.611  -76.459  1.00 69.60  ?  105  LEU C C     1 
ATOM   3968  O  O     . LEU C 2  101  ? -0.056  -4.774  -76.226  1.00 69.27  ?  105  LEU C O     1 
ATOM   3969  C  CB    . LEU C 2  101  ? -1.977  -2.981  -74.620  1.00 63.83  ?  105  LEU C CB    1 
ATOM   3970  C  CG    . LEU C 2  101  ? -1.022  -2.014  -73.927  1.00 59.98  ?  105  LEU C CG    1 
ATOM   3971  C  CD1   . LEU C 2  101  ? -1.209  -0.604  -74.460  1.00 71.86  ?  105  LEU C CD1   1 
ATOM   3972  C  CD2   . LEU C 2  101  ? -1.235  -2.059  -72.425  1.00 57.96  ?  105  LEU C CD2   1 
ATOM   3973  N  N     . SER C 2  102  ? 0.413   -2.707  -77.000  1.00 68.02  ?  106  SER C N     1 
ATOM   3974  C  CA    . SER C 2  102  ? 1.755   -3.046  -77.445  1.00 67.19  ?  106  SER C CA    1 
ATOM   3975  C  C     . SER C 2  102  ? 2.752   -1.999  -76.971  1.00 70.18  ?  106  SER C C     1 
ATOM   3976  O  O     . SER C 2  102  ? 2.436   -0.810  -76.880  1.00 70.23  ?  106  SER C O     1 
ATOM   3977  C  CB    . SER C 2  102  ? 1.818   -3.173  -78.970  1.00 67.54  ?  106  SER C CB    1 
ATOM   3978  O  OG    . SER C 2  102  ? 0.970   -4.213  -79.422  1.00 71.06  ?  106  SER C OG    1 
ATOM   3979  N  N     . PHE C 2  103  ? 3.964   -2.461  -76.673  1.00 67.00  ?  107  PHE C N     1 
ATOM   3980  C  CA    . PHE C 2  103  ? 5.055   -1.615  -76.216  1.00 62.34  ?  107  PHE C CA    1 
ATOM   3981  C  C     . PHE C 2  103  ? 6.173   -1.611  -77.248  1.00 63.94  ?  107  PHE C C     1 
ATOM   3982  O  O     . PHE C 2  103  ? 6.430   -2.618  -77.913  1.00 67.73  ?  107  PHE C O     1 
ATOM   3983  C  CB    . PHE C 2  103  ? 5.616   -2.098  -74.877  1.00 58.75  ?  107  PHE C CB    1 
ATOM   3984  C  CG    . PHE C 2  103  ? 4.586   -2.250  -73.803  1.00 57.78  ?  107  PHE C CG    1 
ATOM   3985  C  CD1   . PHE C 2  103  ? 3.848   -3.416  -73.694  1.00 55.66  ?  107  PHE C CD1   1 
ATOM   3986  C  CD2   . PHE C 2  103  ? 4.368   -1.238  -72.888  1.00 58.19  ?  107  PHE C CD2   1 
ATOM   3987  C  CE1   . PHE C 2  103  ? 2.905   -3.564  -72.701  1.00 55.69  ?  107  PHE C CE1   1 
ATOM   3988  C  CE2   . PHE C 2  103  ? 3.424   -1.381  -71.892  1.00 62.23  ?  107  PHE C CE2   1 
ATOM   3989  C  CZ    . PHE C 2  103  ? 2.692   -2.546  -71.798  1.00 60.13  ?  107  PHE C CZ    1 
ATOM   3990  N  N     . SER C 2  104  ? 6.839   -0.468  -77.374  1.00 65.75  ?  108  SER C N     1 
ATOM   3991  C  CA    . SER C 2  104  ? 7.974   -0.363  -78.277  1.00 66.87  ?  108  SER C CA    1 
ATOM   3992  C  C     . SER C 2  104  ? 8.836   0.817   -77.862  1.00 69.94  ?  108  SER C C     1 
ATOM   3993  O  O     . SER C 2  104  ? 8.389   1.714   -77.141  1.00 68.65  ?  108  SER C O     1 
ATOM   3994  C  CB    . SER C 2  104  ? 7.521   -0.210  -79.732  1.00 73.95  ?  108  SER C CB    1 
ATOM   3995  O  OG    . SER C 2  104  ? 8.632   -0.059  -80.596  1.00 83.03  ?  108  SER C OG    1 
ATOM   3996  N  N     . ASP C 2  105  ? 10.085  0.796   -78.330  1.00 70.42  ?  109  ASP C N     1 
ATOM   3997  C  CA    . ASP C 2  105  ? 11.001  1.929   -78.264  1.00 67.12  ?  109  ASP C CA    1 
ATOM   3998  C  C     . ASP C 2  105  ? 11.204  2.424   -76.835  1.00 65.48  ?  109  ASP C C     1 
ATOM   3999  O  O     . ASP C 2  105  ? 10.740  3.518   -76.489  1.00 66.32  ?  109  ASP C O     1 
ATOM   4000  C  CB    . ASP C 2  105  ? 10.475  3.058   -79.153  1.00 73.49  ?  109  ASP C CB    1 
ATOM   4001  C  CG    . ASP C 2  105  ? 11.463  4.195   -79.308  1.00 77.35  ?  109  ASP C CG    1 
ATOM   4002  O  OD1   . ASP C 2  105  ? 12.678  3.958   -79.149  1.00 77.29  ?  109  ASP C OD1   1 
ATOM   4003  O  OD2   . ASP C 2  105  ? 11.021  5.327   -79.594  1.00 80.00  ?  109  ASP C OD2   1 
ATOM   4004  N  N     . PRO C 2  106  ? 11.874  1.659   -75.975  1.00 59.51  ?  110  PRO C N     1 
ATOM   4005  C  CA    . PRO C 2  106  ? 12.156  2.154   -74.624  1.00 57.75  ?  110  PRO C CA    1 
ATOM   4006  C  C     . PRO C 2  106  ? 13.274  3.183   -74.632  1.00 59.16  ?  110  PRO C C     1 
ATOM   4007  O  O     . PRO C 2  106  ? 14.226  3.094   -75.411  1.00 61.36  ?  110  PRO C O     1 
ATOM   4008  C  CB    . PRO C 2  106  ? 12.566  0.888   -73.865  1.00 53.58  ?  110  PRO C CB    1 
ATOM   4009  C  CG    . PRO C 2  106  ? 13.158  0.020   -74.909  1.00 53.65  ?  110  PRO C CG    1 
ATOM   4010  C  CD    . PRO C 2  106  ? 12.393  0.296   -76.179  1.00 56.82  ?  110  PRO C CD    1 
ATOM   4011  N  N     . ARG C 2  107  ? 13.149  4.170   -73.750  1.00 61.63  ?  111  ARG C N     1 
ATOM   4012  C  CA    . ARG C 2  107  ? 14.139  5.227   -73.614  1.00 58.53  ?  111  ARG C CA    1 
ATOM   4013  C  C     . ARG C 2  107  ? 14.409  5.463   -72.139  1.00 57.48  ?  111  ARG C C     1 
ATOM   4014  O  O     . ARG C 2  107  ? 13.533  5.265   -71.294  1.00 55.04  ?  111  ARG C O     1 
ATOM   4015  C  CB    . ARG C 2  107  ? 13.678  6.536   -74.264  1.00 63.56  ?  111  ARG C CB    1 
ATOM   4016  C  CG    . ARG C 2  107  ? 13.628  6.525   -75.780  1.00 69.58  ?  111  ARG C CG    1 
ATOM   4017  C  CD    . ARG C 2  107  ? 12.415  7.299   -76.267  1.00 74.32  ?  111  ARG C CD    1 
ATOM   4018  N  NE    . ARG C 2  107  ? 11.188  6.536   -76.059  1.00 78.04  ?  111  ARG C NE    1 
ATOM   4019  C  CZ    . ARG C 2  107  ? 9.999   7.075   -75.815  1.00 74.77  ?  111  ARG C CZ    1 
ATOM   4020  N  NH1   . ARG C 2  107  ? 9.868   8.391   -75.732  1.00 75.37  ?  111  ARG C NH1   1 
ATOM   4021  N  NH2   . ARG C 2  107  ? 8.942   6.293   -75.642  1.00 75.15  ?  111  ARG C NH2   1 
ATOM   4022  N  N     . PHE C 2  108  ? 15.628  5.893   -71.838  1.00 54.33  ?  112  PHE C N     1 
ATOM   4023  C  CA    . PHE C 2  108  ? 16.027  6.226   -70.480  1.00 53.76  ?  112  PHE C CA    1 
ATOM   4024  C  C     . PHE C 2  108  ? 16.251  7.726   -70.369  1.00 59.83  ?  112  PHE C C     1 
ATOM   4025  O  O     . PHE C 2  108  ? 16.927  8.323   -71.212  1.00 59.01  ?  112  PHE C O     1 
ATOM   4026  C  CB    . PHE C 2  108  ? 17.291  5.467   -70.075  1.00 49.37  ?  112  PHE C CB    1 
ATOM   4027  C  CG    . PHE C 2  108  ? 17.049  4.024   -69.757  1.00 48.19  ?  112  PHE C CG    1 
ATOM   4028  C  CD1   . PHE C 2  108  ? 16.482  3.655   -68.552  1.00 49.00  ?  112  PHE C CD1   1 
ATOM   4029  C  CD2   . PHE C 2  108  ? 17.386  3.035   -70.662  1.00 49.70  ?  112  PHE C CD2   1 
ATOM   4030  C  CE1   . PHE C 2  108  ? 16.258  2.330   -68.255  1.00 49.91  ?  112  PHE C CE1   1 
ATOM   4031  C  CE2   . PHE C 2  108  ? 17.160  1.706   -70.370  1.00 50.13  ?  112  PHE C CE2   1 
ATOM   4032  C  CZ    . PHE C 2  108  ? 16.597  1.354   -69.164  1.00 49.23  ?  112  PHE C CZ    1 
ATOM   4033  N  N     . ASP C 2  109  ? 15.678  8.327   -69.333  1.00 59.46  ?  113  ASP C N     1 
ATOM   4034  C  CA    . ASP C 2  109  ? 15.854  9.747   -69.077  1.00 63.51  ?  113  ASP C CA    1 
ATOM   4035  C  C     . ASP C 2  109  ? 17.178  9.950   -68.343  1.00 66.50  ?  113  ASP C C     1 
ATOM   4036  O  O     . ASP C 2  109  ? 17.958  9.015   -68.145  1.00 62.24  ?  113  ASP C O     1 
ATOM   4037  C  CB    . ASP C 2  109  ? 14.658  10.290  -68.299  1.00 67.49  ?  113  ASP C CB    1 
ATOM   4038  C  CG    . ASP C 2  109  ? 14.572  11.809  -68.329  1.00 72.99  ?  113  ASP C CG    1 
ATOM   4039  O  OD1   . ASP C 2  109  ? 15.163  12.425  -69.242  1.00 67.65  ?  113  ASP C OD1   1 
ATOM   4040  O  OD2   . ASP C 2  109  ? 13.910  12.384  -67.437  1.00 73.22  ?  113  ASP C OD2   1 
ATOM   4041  N  N     . ASP C 2  110  ? 17.446  11.182  -67.931  1.00 72.98  ?  114  ASP C N     1 
ATOM   4042  C  CA    . ASP C 2  110  ? 18.668  11.485  -67.210  1.00 66.90  ?  114  ASP C CA    1 
ATOM   4043  C  C     . ASP C 2  110  ? 18.651  10.827  -65.834  1.00 62.84  ?  114  ASP C C     1 
ATOM   4044  O  O     . ASP C 2  110  ? 17.602  10.456  -65.302  1.00 63.38  ?  114  ASP C O     1 
ATOM   4045  C  CB    . ASP C 2  110  ? 18.839  12.995  -67.069  1.00 72.19  ?  114  ASP C CB    1 
ATOM   4046  C  CG    . ASP C 2  110  ? 20.287  13.419  -67.103  1.00 77.30  ?  114  ASP C CG    1 
ATOM   4047  O  OD1   . ASP C 2  110  ? 21.092  12.713  -67.745  1.00 77.89  ?  114  ASP C OD1   1 
ATOM   4048  O  OD2   . ASP C 2  110  ? 20.620  14.459  -66.494  1.00 80.12  ?  114  ASP C OD2   1 
ATOM   4049  N  N     . VAL C 2  111  ? 19.842  10.672  -65.261  1.00 59.09  ?  115  VAL C N     1 
ATOM   4050  C  CA    . VAL C 2  111  ? 19.958  10.100  -63.928  1.00 59.52  ?  115  VAL C CA    1 
ATOM   4051  C  C     . VAL C 2  111  ? 19.387  11.073  -62.908  1.00 59.65  ?  115  VAL C C     1 
ATOM   4052  O  O     . VAL C 2  111  ? 19.558  12.294  -63.022  1.00 65.37  ?  115  VAL C O     1 
ATOM   4053  C  CB    . VAL C 2  111  ? 21.426  9.763   -63.623  1.00 59.50  ?  115  VAL C CB    1 
ATOM   4054  C  CG1   . VAL C 2  111  ? 21.529  8.972   -62.333  1.00 62.05  ?  115  VAL C CG1   1 
ATOM   4055  C  CG2   . VAL C 2  111  ? 22.041  8.995   -64.781  1.00 55.82  ?  115  VAL C CG2   1 
ATOM   4056  N  N     . LYS C 2  112  ? 18.697  10.536  -61.901  1.00 55.92  ?  116  LYS C N     1 
ATOM   4057  C  CA    . LYS C 2  112  ? 18.082  11.394  -60.895  1.00 62.54  ?  116  LYS C CA    1 
ATOM   4058  C  C     . LYS C 2  112  ? 19.135  12.119  -60.066  1.00 64.22  ?  116  LYS C C     1 
ATOM   4059  O  O     . LYS C 2  112  ? 19.038  13.332  -59.848  1.00 66.10  ?  116  LYS C O     1 
ATOM   4060  C  CB    . LYS C 2  112  ? 17.153  10.577  -59.997  1.00 66.06  ?  116  LYS C CB    1 
ATOM   4061  C  CG    . LYS C 2  112  ? 15.808  10.255  -60.633  1.00 70.97  ?  116  LYS C CG    1 
ATOM   4062  C  CD    . LYS C 2  112  ? 14.719  10.096  -59.583  1.00 79.26  ?  116  LYS C CD    1 
ATOM   4063  C  CE    . LYS C 2  112  ? 13.345  9.933   -60.222  1.00 76.45  ?  116  LYS C CE    1 
ATOM   4064  N  NZ    . LYS C 2  112  ? 12.979  11.081  -61.099  1.00 65.59  ?  116  LYS C NZ    1 
ATOM   4065  N  N     . ALA C 2  113  ? 20.151  11.400  -59.602  1.00 65.23  ?  117  ALA C N     1 
ATOM   4066  C  CA    . ALA C 2  113  ? 21.165  11.980  -58.737  1.00 65.98  ?  117  ALA C CA    1 
ATOM   4067  C  C     . ALA C 2  113  ? 22.525  11.372  -59.043  1.00 65.88  ?  117  ALA C C     1 
ATOM   4068  O  O     . ALA C 2  113  ? 22.611  10.208  -59.452  1.00 66.32  ?  117  ALA C O     1 
ATOM   4069  C  CB    . ALA C 2  113  ? 20.828  11.763  -57.253  1.00 66.20  ?  117  ALA C CB    1 
ATOM   4070  N  N     . PRO C 2  114  ? 23.600  12.136  -58.863  1.00 64.62  ?  118  PRO C N     1 
ATOM   4071  C  CA    . PRO C 2  114  ? 24.948  11.582  -59.036  1.00 59.92  ?  118  PRO C CA    1 
ATOM   4072  C  C     . PRO C 2  114  ? 25.257  10.533  -57.977  1.00 64.37  ?  118  PRO C C     1 
ATOM   4073  O  O     . PRO C 2  114  ? 24.576  10.410  -56.957  1.00 61.53  ?  118  PRO C O     1 
ATOM   4074  C  CB    . PRO C 2  114  ? 25.859  12.805  -58.899  1.00 62.24  ?  118  PRO C CB    1 
ATOM   4075  C  CG    . PRO C 2  114  ? 24.977  13.972  -59.204  1.00 68.13  ?  118  PRO C CG    1 
ATOM   4076  C  CD    . PRO C 2  114  ? 23.628  13.595  -58.669  1.00 70.81  ?  118  PRO C CD    1 
ATOM   4077  N  N     . VAL C 2  115  ? 26.322  9.772   -58.240  1.00 62.92  ?  119  VAL C N     1 
ATOM   4078  C  CA    . VAL C 2  115  ? 26.616  8.573   -57.455  1.00 60.82  ?  119  VAL C CA    1 
ATOM   4079  C  C     . VAL C 2  115  ? 26.829  8.921   -55.986  1.00 61.66  ?  119  VAL C C     1 
ATOM   4080  O  O     . VAL C 2  115  ? 26.154  8.386   -55.099  1.00 62.55  ?  119  VAL C O     1 
ATOM   4081  C  CB    . VAL C 2  115  ? 27.834  7.835   -58.037  1.00 56.98  ?  119  VAL C CB    1 
ATOM   4082  C  CG1   . VAL C 2  115  ? 28.293  6.748   -57.084  1.00 60.64  ?  119  VAL C CG1   1 
ATOM   4083  C  CG2   . VAL C 2  115  ? 27.493  7.244   -59.393  1.00 47.61  ?  119  VAL C CG2   1 
ATOM   4084  N  N     . ASP C 2  116  ? 27.779  9.816   -55.704  1.00 61.60  ?  120  ASP C N     1 
ATOM   4085  C  CA    . ASP C 2  116  ? 28.064  10.165  -54.315  1.00 67.48  ?  120  ASP C CA    1 
ATOM   4086  C  C     . ASP C 2  116  ? 26.864  10.794  -53.621  1.00 68.53  ?  120  ASP C C     1 
ATOM   4087  O  O     . ASP C 2  116  ? 26.780  10.749  -52.388  1.00 66.27  ?  120  ASP C O     1 
ATOM   4088  C  CB    . ASP C 2  116  ? 29.269  11.102  -54.242  1.00 66.86  ?  120  ASP C CB    1 
ATOM   4089  C  CG    . ASP C 2  116  ? 29.176  12.244  -55.228  1.00 71.93  ?  120  ASP C CG    1 
ATOM   4090  O  OD1   . ASP C 2  116  ? 29.377  11.998  -56.435  1.00 74.67  ?  120  ASP C OD1   1 
ATOM   4091  O  OD2   . ASP C 2  116  ? 28.909  13.386  -54.797  1.00 72.52  ?  120  ASP C OD2   1 
ATOM   4092  N  N     . GLU C 2  117  ? 25.934  11.370  -54.383  1.00 67.06  ?  121  GLU C N     1 
ATOM   4093  C  CA    . GLU C 2  117  ? 24.702  11.878  -53.792  1.00 66.11  ?  121  GLU C CA    1 
ATOM   4094  C  C     . GLU C 2  117  ? 23.863  10.741  -53.222  1.00 65.34  ?  121  GLU C C     1 
ATOM   4095  O  O     . GLU C 2  117  ? 23.376  10.823  -52.088  1.00 63.99  ?  121  GLU C O     1 
ATOM   4096  C  CB    . GLU C 2  117  ? 23.910  12.662  -54.837  1.00 70.03  ?  121  GLU C CB    1 
ATOM   4097  C  CG    . GLU C 2  117  ? 22.611  13.256  -54.327  1.00 80.24  ?  121  GLU C CG    1 
ATOM   4098  C  CD    . GLU C 2  117  ? 22.801  14.615  -53.681  1.00 88.20  ?  121  GLU C CD    1 
ATOM   4099  O  OE1   . GLU C 2  117  ? 23.927  14.913  -53.225  1.00 83.67  ?  121  GLU C OE1   1 
ATOM   4100  O  OE2   . GLU C 2  117  ? 21.822  15.390  -53.642  1.00 90.42  ?  121  GLU C OE2   1 
ATOM   4101  N  N     . CYS C 2  118  ? 23.685  9.669   -53.999  1.00 63.23  ?  122  CYS C N     1 
ATOM   4102  C  CA    . CYS C 2  118  ? 22.920  8.523   -53.518  1.00 59.12  ?  122  CYS C CA    1 
ATOM   4103  C  C     . CYS C 2  118  ? 23.614  7.859   -52.337  1.00 60.73  ?  122  CYS C C     1 
ATOM   4104  O  O     . CYS C 2  118  ? 22.956  7.449   -51.373  1.00 60.28  ?  122  CYS C O     1 
ATOM   4105  C  CB    . CYS C 2  118  ? 22.715  7.517   -54.647  1.00 54.38  ?  122  CYS C CB    1 
ATOM   4106  S  SG    . CYS C 2  118  ? 22.424  8.257   -56.261  1.00 61.19  ?  122  CYS C SG    1 
ATOM   4107  N  N     . LYS C 2  119  ? 24.943  7.737   -52.401  1.00 58.94  ?  123  LYS C N     1 
ATOM   4108  C  CA    . LYS C 2  119  ? 25.696  7.189   -51.277  1.00 57.65  ?  123  LYS C CA    1 
ATOM   4109  C  C     . LYS C 2  119  ? 25.439  7.984   -50.005  1.00 62.15  ?  123  LYS C C     1 
ATOM   4110  O  O     . LYS C 2  119  ? 25.290  7.409   -48.922  1.00 57.92  ?  123  LYS C O     1 
ATOM   4111  C  CB    . LYS C 2  119  ? 27.189  7.180   -51.601  1.00 57.10  ?  123  LYS C CB    1 
ATOM   4112  C  CG    . LYS C 2  119  ? 27.634  6.119   -52.595  1.00 58.11  ?  123  LYS C CG    1 
ATOM   4113  C  CD    . LYS C 2  119  ? 29.016  6.457   -53.146  1.00 64.34  ?  123  LYS C CD    1 
ATOM   4114  C  CE    . LYS C 2  119  ? 29.608  5.321   -53.964  1.00 57.02  ?  123  LYS C CE    1 
ATOM   4115  N  NZ    . LYS C 2  119  ? 30.342  4.339   -53.119  1.00 57.58  ?  123  LYS C NZ    1 
ATOM   4116  N  N     . ASP C 2  120  ? 25.374  9.310   -50.122  1.00 65.56  ?  124  ASP C N     1 
ATOM   4117  C  CA    . ASP C 2  120  ? 25.151  10.166  -48.963  1.00 68.61  ?  124  ASP C CA    1 
ATOM   4118  C  C     . ASP C 2  120  ? 23.702  10.102  -48.494  1.00 68.45  ?  124  ASP C C     1 
ATOM   4119  O  O     . ASP C 2  120  ? 23.436  9.948   -47.297  1.00 69.01  ?  124  ASP C O     1 
ATOM   4120  C  CB    . ASP C 2  120  ? 25.548  11.606  -49.299  1.00 69.93  ?  124  ASP C CB    1 
ATOM   4121  C  CG    . ASP C 2  120  ? 25.668  12.491  -48.067  1.00 76.58  ?  124  ASP C CG    1 
ATOM   4122  O  OD1   . ASP C 2  120  ? 24.765  12.465  -47.204  1.00 70.99  ?  124  ASP C OD1   1 
ATOM   4123  O  OD2   . ASP C 2  120  ? 26.677  13.218  -47.963  1.00 83.65  ?  124  ASP C OD2   1 
ATOM   4124  N  N     . LYS C 2  121  ? 22.756  10.210  -49.421  1.00 64.26  ?  125  LYS C N     1 
ATOM   4125  C  CA    . LYS C 2  121  ? 21.344  10.337  -49.092  1.00 65.61  ?  125  LYS C CA    1 
ATOM   4126  C  C     . LYS C 2  121  ? 20.627  8.996   -48.969  1.00 69.44  ?  125  LYS C C     1 
ATOM   4127  O  O     . LYS C 2  121  ? 19.399  8.981   -48.828  1.00 69.13  ?  125  LYS C O     1 
ATOM   4128  C  CB    . LYS C 2  121  ? 20.645  11.215  -50.133  1.00 65.85  ?  125  LYS C CB    1 
ATOM   4129  C  CG    . LYS C 2  121  ? 20.805  12.710  -49.882  1.00 70.39  ?  125  LYS C CG    1 
ATOM   4130  C  CD    . LYS C 2  121  ? 20.541  13.523  -51.140  1.00 77.25  ?  125  LYS C CD    1 
ATOM   4131  C  CE    . LYS C 2  121  ? 20.424  15.012  -50.836  1.00 81.70  ?  125  LYS C CE    1 
ATOM   4132  N  NZ    . LYS C 2  121  ? 19.058  15.393  -50.376  1.00 77.41  ?  125  LYS C NZ    1 
ATOM   4133  N  N     . ASP C 2  122  ? 21.358  7.878   -49.034  1.00 64.34  ?  126  ASP C N     1 
ATOM   4134  C  CA    . ASP C 2  122  ? 20.771  6.538   -48.938  1.00 59.22  ?  126  ASP C CA    1 
ATOM   4135  C  C     . ASP C 2  122  ? 19.806  6.276   -50.089  1.00 58.13  ?  126  ASP C C     1 
ATOM   4136  O  O     . ASP C 2  122  ? 18.758  5.653   -49.916  1.00 56.23  ?  126  ASP C O     1 
ATOM   4137  C  CB    . ASP C 2  122  ? 20.073  6.319   -47.592  1.00 59.86  ?  126  ASP C CB    1 
ATOM   4138  C  CG    . ASP C 2  122  ? 21.004  5.780   -46.530  1.00 58.24  ?  126  ASP C CG    1 
ATOM   4139  O  OD1   . ASP C 2  122  ? 22.165  6.231   -46.467  1.00 59.19  ?  126  ASP C OD1   1 
ATOM   4140  O  OD2   . ASP C 2  122  ? 20.573  4.899   -45.757  1.00 52.51  ?  126  ASP C OD2   1 
ATOM   4141  N  N     . MET C 2  123  ? 20.163  6.754   -51.274  1.00 60.24  ?  127  MET C N     1 
ATOM   4142  C  CA    . MET C 2  123  ? 19.308  6.642   -52.440  1.00 60.57  ?  127  MET C CA    1 
ATOM   4143  C  C     . MET C 2  123  ? 19.766  5.488   -53.327  1.00 55.49  ?  127  MET C C     1 
ATOM   4144  O  O     . MET C 2  123  ? 20.744  4.793   -53.044  1.00 54.37  ?  127  MET C O     1 
ATOM   4145  C  CB    . MET C 2  123  ? 19.294  7.958   -53.218  1.00 59.87  ?  127  MET C CB    1 
ATOM   4146  C  CG    . MET C 2  123  ? 18.680  9.123   -52.464  1.00 61.95  ?  127  MET C CG    1 
ATOM   4147  S  SD    . MET C 2  123  ? 18.956  10.690  -53.311  1.00 78.35  ?  127  MET C SD    1 
ATOM   4148  C  CE    . MET C 2  123  ? 18.355  10.292  -54.950  1.00 77.05  ?  127  MET C CE    1 
ATOM   4149  N  N     . THR C 2  124  ? 19.038  5.290   -54.419  1.00 53.34  ?  128  THR C N     1 
ATOM   4150  C  CA    . THR C 2  124  ? 19.342  4.271   -55.410  1.00 46.98  ?  128  THR C CA    1 
ATOM   4151  C  C     . THR C 2  124  ? 19.715  4.955   -56.714  1.00 47.25  ?  128  THR C C     1 
ATOM   4152  O  O     . THR C 2  124  ? 18.949  5.776   -57.228  1.00 53.45  ?  128  THR C O     1 
ATOM   4153  C  CB    . THR C 2  124  ? 18.147  3.340   -55.625  1.00 43.85  ?  128  THR C CB    1 
ATOM   4154  O  OG1   . THR C 2  124  ? 17.940  2.545   -54.453  1.00 46.55  ?  128  THR C OG1   1 
ATOM   4155  C  CG2   . THR C 2  124  ? 18.380  2.433   -56.820  1.00 41.73  ?  128  THR C CG2   1 
ATOM   4156  N  N     . TYR C 2  125  ? 20.883  4.618   -57.248  1.00 46.87  ?  129  TYR C N     1 
ATOM   4157  C  CA    . TYR C 2  125  ? 21.309  5.194   -58.514  1.00 49.24  ?  129  TYR C CA    1 
ATOM   4158  C  C     . TYR C 2  125  ? 20.409  4.648   -59.612  1.00 50.58  ?  129  TYR C C     1 
ATOM   4159  O  O     . TYR C 2  125  ? 20.365  3.435   -59.839  1.00 51.53  ?  129  TYR C O     1 
ATOM   4160  C  CB    . TYR C 2  125  ? 22.774  4.845   -58.763  1.00 50.30  ?  129  TYR C CB    1 
ATOM   4161  C  CG    . TYR C 2  125  ? 23.428  5.535   -59.937  1.00 49.22  ?  129  TYR C CG    1 
ATOM   4162  C  CD1   . TYR C 2  125  ? 23.718  6.889   -59.899  1.00 53.21  ?  129  TYR C CD1   1 
ATOM   4163  C  CD2   . TYR C 2  125  ? 23.792  4.821   -61.068  1.00 47.27  ?  129  TYR C CD2   1 
ATOM   4164  C  CE1   . TYR C 2  125  ? 24.331  7.517   -60.967  1.00 54.20  ?  129  TYR C CE1   1 
ATOM   4165  C  CE2   . TYR C 2  125  ? 24.401  5.439   -62.138  1.00 47.53  ?  129  TYR C CE2   1 
ATOM   4166  C  CZ    . TYR C 2  125  ? 24.669  6.787   -62.084  1.00 51.21  ?  129  TYR C CZ    1 
ATOM   4167  O  OH    . TYR C 2  125  ? 25.278  7.403   -63.152  1.00 45.63  ?  129  TYR C OH    1 
ATOM   4168  N  N     . ALA C 2  126  ? 19.698  5.538   -60.300  1.00 55.35  ?  130  ALA C N     1 
ATOM   4169  C  CA    . ALA C 2  126  ? 18.597  5.101   -61.146  1.00 51.50  ?  130  ALA C CA    1 
ATOM   4170  C  C     . ALA C 2  126  ? 18.302  6.154   -62.201  1.00 52.51  ?  130  ALA C C     1 
ATOM   4171  O  O     . ALA C 2  126  ? 18.687  7.318   -62.073  1.00 55.50  ?  130  ALA C O     1 
ATOM   4172  C  CB    . ALA C 2  126  ? 17.340  4.814   -60.318  1.00 47.46  ?  130  ALA C CB    1 
ATOM   4173  N  N     . ALA C 2  127  ? 17.604  5.721   -63.250  1.00 50.23  ?  131  ALA C N     1 
ATOM   4174  C  CA    . ALA C 2  127  ? 17.141  6.587   -64.316  1.00 54.34  ?  131  ALA C CA    1 
ATOM   4175  C  C     . ALA C 2  127  ? 15.712  6.196   -64.666  1.00 58.62  ?  131  ALA C C     1 
ATOM   4176  O  O     . ALA C 2  127  ? 15.373  5.005   -64.643  1.00 57.39  ?  131  ALA C O     1 
ATOM   4177  C  CB    . ALA C 2  127  ? 18.029  6.487   -65.562  1.00 50.05  ?  131  ALA C CB    1 
ATOM   4178  N  N     . PRO C 2  128  ? 14.855  7.168   -64.973  1.00 62.85  ?  132  PRO C N     1 
ATOM   4179  C  CA    . PRO C 2  128  ? 13.474  6.838   -65.344  1.00 58.15  ?  132  PRO C CA    1 
ATOM   4180  C  C     . PRO C 2  128  ? 13.409  6.158   -66.702  1.00 56.91  ?  132  PRO C C     1 
ATOM   4181  O  O     . PRO C 2  128  ? 14.070  6.572   -67.657  1.00 55.28  ?  132  PRO C O     1 
ATOM   4182  C  CB    . PRO C 2  128  ? 12.776  8.204   -65.370  1.00 60.97  ?  132  PRO C CB    1 
ATOM   4183  C  CG    . PRO C 2  128  ? 13.669  9.113   -64.577  1.00 63.59  ?  132  PRO C CG    1 
ATOM   4184  C  CD    . PRO C 2  128  ? 15.054  8.618   -64.829  1.00 59.62  ?  132  PRO C CD    1 
ATOM   4185  N  N     . LEU C 2  129  ? 12.596  5.110   -66.783  1.00 56.64  ?  133  LEU C N     1 
ATOM   4186  C  CA    . LEU C 2  129  ? 12.422  4.347   -68.012  1.00 56.95  ?  133  LEU C CA    1 
ATOM   4187  C  C     . LEU C 2  129  ? 11.090  4.701   -68.658  1.00 56.83  ?  133  LEU C C     1 
ATOM   4188  O  O     . LEU C 2  129  ? 10.041  4.630   -68.011  1.00 58.36  ?  133  LEU C O     1 
ATOM   4189  C  CB    . LEU C 2  129  ? 12.488  2.845   -67.741  1.00 54.09  ?  133  LEU C CB    1 
ATOM   4190  C  CG    . LEU C 2  129  ? 12.075  1.959   -68.917  1.00 53.44  ?  133  LEU C CG    1 
ATOM   4191  C  CD1   . LEU C 2  129  ? 12.948  2.219   -70.135  1.00 52.57  ?  133  LEU C CD1   1 
ATOM   4192  C  CD2   . LEU C 2  129  ? 12.118  0.494   -68.525  1.00 50.96  ?  133  LEU C CD2   1 
ATOM   4193  N  N     . PHE C 2  130  ? 11.138  5.071   -69.934  1.00 57.72  ?  134  PHE C N     1 
ATOM   4194  C  CA    . PHE C 2  130  ? 9.956   5.415   -70.708  1.00 62.55  ?  134  PHE C CA    1 
ATOM   4195  C  C     . PHE C 2  130  ? 9.799   4.441   -71.865  1.00 64.51  ?  134  PHE C C     1 
ATOM   4196  O  O     . PHE C 2  130  ? 10.784  4.050   -72.497  1.00 62.15  ?  134  PHE C O     1 
ATOM   4197  C  CB    . PHE C 2  130  ? 10.039  6.842   -71.252  1.00 62.19  ?  134  PHE C CB    1 
ATOM   4198  C  CG    . PHE C 2  130  ? 10.079  7.892   -70.187  1.00 60.40  ?  134  PHE C CG    1 
ATOM   4199  C  CD1   . PHE C 2  130  ? 9.317   7.762   -69.042  1.00 62.75  ?  134  PHE C CD1   1 
ATOM   4200  C  CD2   . PHE C 2  130  ? 10.887  9.005   -70.327  1.00 63.07  ?  134  PHE C CD2   1 
ATOM   4201  C  CE1   . PHE C 2  130  ? 9.353   8.727   -68.059  1.00 63.20  ?  134  PHE C CE1   1 
ATOM   4202  C  CE2   . PHE C 2  130  ? 10.929  9.972   -69.346  1.00 67.06  ?  134  PHE C CE2   1 
ATOM   4203  C  CZ    . PHE C 2  130  ? 10.161  9.832   -68.210  1.00 68.69  ?  134  PHE C CZ    1 
ATOM   4204  N  N     . VAL C 2  131  ? 8.556   4.052   -72.136  1.00 64.07  ?  135  VAL C N     1 
ATOM   4205  C  CA    . VAL C 2  131  ? 8.228   3.173   -73.247  1.00 65.10  ?  135  VAL C CA    1 
ATOM   4206  C  C     . VAL C 2  131  ? 7.047   3.774   -73.993  1.00 70.45  ?  135  VAL C C     1 
ATOM   4207  O  O     . VAL C 2  131  ? 6.200   4.453   -73.405  1.00 73.04  ?  135  VAL C O     1 
ATOM   4208  C  CB    . VAL C 2  131  ? 7.903   1.735   -72.775  1.00 63.61  ?  135  VAL C CB    1 
ATOM   4209  C  CG1   . VAL C 2  131  ? 7.722   0.801   -73.963  1.00 67.23  ?  135  VAL C CG1   1 
ATOM   4210  C  CG2   . VAL C 2  131  ? 8.994   1.211   -71.862  1.00 63.22  ?  135  VAL C CG2   1 
ATOM   4211  N  N     . THR C 2  132  ? 6.992   3.521   -75.297  1.00 70.22  ?  136  THR C N     1 
ATOM   4212  C  CA    . THR C 2  132  ? 5.867   3.952   -76.118  1.00 72.57  ?  136  THR C CA    1 
ATOM   4213  C  C     . THR C 2  132  ? 4.842   2.827   -76.132  1.00 70.10  ?  136  THR C C     1 
ATOM   4214  O  O     . THR C 2  132  ? 5.074   1.771   -76.728  1.00 66.90  ?  136  THR C O     1 
ATOM   4215  C  CB    . THR C 2  132  ? 6.325   4.296   -77.533  1.00 72.79  ?  136  THR C CB    1 
ATOM   4216  O  OG1   . THR C 2  132  ? 7.244   5.393   -77.486  1.00 79.09  ?  136  THR C OG1   1 
ATOM   4217  C  CG2   . THR C 2  132  ? 5.137   4.675   -78.400  1.00 73.44  ?  136  THR C CG2   1 
ATOM   4218  N  N     . ALA C 2  133  ? 3.706   3.057   -75.481  1.00 72.38  ?  137  ALA C N     1 
ATOM   4219  C  CA    . ALA C 2  133  ? 2.637   2.073   -75.375  1.00 73.89  ?  137  ALA C CA    1 
ATOM   4220  C  C     . ALA C 2  133  ? 1.505   2.487   -76.302  1.00 79.40  ?  137  ALA C C     1 
ATOM   4221  O  O     . ALA C 2  133  ? 0.968   3.593   -76.178  1.00 80.07  ?  137  ALA C O     1 
ATOM   4222  C  CB    . ALA C 2  133  ? 2.140   1.950   -73.936  1.00 69.88  ?  137  ALA C CB    1 
ATOM   4223  N  N     . GLU C 2  134  ? 1.146   1.603   -77.225  1.00 80.58  ?  138  GLU C N     1 
ATOM   4224  C  CA    . GLU C 2  134  ? 0.129   1.879   -78.229  1.00 85.14  ?  138  GLU C CA    1 
ATOM   4225  C  C     . GLU C 2  134  ? -1.057  0.954   -78.000  1.00 85.16  ?  138  GLU C C     1 
ATOM   4226  O  O     . GLU C 2  134  ? -0.920  -0.271  -78.087  1.00 81.22  ?  138  GLU C O     1 
ATOM   4227  C  CB    . GLU C 2  134  ? 0.691   1.692   -79.637  1.00 88.32  ?  138  GLU C CB    1 
ATOM   4228  C  CG    . GLU C 2  134  ? -0.168  2.294   -80.728  1.00 89.79  ?  138  GLU C CG    1 
ATOM   4229  C  CD    . GLU C 2  134  ? 0.318   1.929   -82.113  1.00 94.46  ?  138  GLU C CD    1 
ATOM   4230  O  OE1   . GLU C 2  134  ? 0.510   0.724   -82.376  1.00 94.59  ?  138  GLU C OE1   1 
ATOM   4231  O  OE2   . GLU C 2  134  ? 0.517   2.845   -82.937  1.00 97.62  ?  138  GLU C OE2   1 
ATOM   4232  N  N     . PHE C 2  135  ? -2.214  1.538   -77.706  1.00 88.33  ?  139  PHE C N     1 
ATOM   4233  C  CA    . PHE C 2  135  ? -3.443  0.778   -77.544  1.00 87.04  ?  139  PHE C CA    1 
ATOM   4234  C  C     . PHE C 2  135  ? -4.295  0.890   -78.800  1.00 90.13  ?  139  PHE C C     1 
ATOM   4235  O  O     . PHE C 2  135  ? -4.426  1.970   -79.382  1.00 93.86  ?  139  PHE C O     1 
ATOM   4236  C  CB    . PHE C 2  135  ? -4.244  1.258   -76.335  1.00 86.89  ?  139  PHE C CB    1 
ATOM   4237  C  CG    . PHE C 2  135  ? -5.551  0.551   -76.179  1.00 89.75  ?  139  PHE C CG    1 
ATOM   4238  C  CD1   . PHE C 2  135  ? -5.599  -0.718  -75.631  1.00 88.63  ?  139  PHE C CD1   1 
ATOM   4239  C  CD2   . PHE C 2  135  ? -6.727  1.137   -76.610  1.00 93.25  ?  139  PHE C CD2   1 
ATOM   4240  C  CE1   . PHE C 2  135  ? -6.797  -1.383  -75.501  1.00 90.96  ?  139  PHE C CE1   1 
ATOM   4241  C  CE2   . PHE C 2  135  ? -7.928  0.476   -76.483  1.00 95.15  ?  139  PHE C CE2   1 
ATOM   4242  C  CZ    . PHE C 2  135  ? -7.962  -0.787  -75.931  1.00 94.73  ?  139  PHE C CZ    1 
ATOM   4243  N  N     . ILE C 2  136  ? -4.885  -0.232  -79.205  1.00 91.13  ?  140  ILE C N     1 
ATOM   4244  C  CA    . ILE C 2  136  ? -5.681  -0.315  -80.423  1.00 93.17  ?  140  ILE C CA    1 
ATOM   4245  C  C     . ILE C 2  136  ? -7.017  -0.963  -80.091  1.00 95.53  ?  140  ILE C C     1 
ATOM   4246  O  O     . ILE C 2  136  ? -7.060  -1.987  -79.399  1.00 94.56  ?  140  ILE C O     1 
ATOM   4247  C  CB    . ILE C 2  136  ? -4.954  -1.112  -81.524  1.00 90.85  ?  140  ILE C CB    1 
ATOM   4248  C  CG1   . ILE C 2  136  ? -3.742  -0.334  -82.036  1.00 92.84  ?  140  ILE C CG1   1 
ATOM   4249  C  CG2   . ILE C 2  136  ? -5.900  -1.446  -82.667  1.00 95.65  ?  140  ILE C CG2   1 
ATOM   4250  C  CD1   . ILE C 2  136  ? -3.032  -1.006  -83.188  1.00 95.80  ?  140  ILE C CD1   1 
ATOM   4251  N  N     . ASN C 2  137  ? -8.101  -0.366  -80.576  1.00 98.06  ?  141  ASN C N     1 
ATOM   4252  C  CA    . ASN C 2  137  ? -9.430  -0.957  -80.490  1.00 99.91  ?  141  ASN C CA    1 
ATOM   4253  C  C     . ASN C 2  137  ? -9.710  -1.694  -81.794  1.00 101.48 ?  141  ASN C C     1 
ATOM   4254  O  O     . ASN C 2  137  ? -9.760  -1.074  -82.862  1.00 102.78 ?  141  ASN C O     1 
ATOM   4255  C  CB    . ASN C 2  137  ? -10.492 0.111   -80.233  1.00 99.42  ?  141  ASN C CB    1 
ATOM   4256  C  CG    . ASN C 2  137  ? -11.848 -0.480  -79.895  1.00 100.64 ?  141  ASN C CG    1 
ATOM   4257  O  OD1   . ASN C 2  137  ? -12.060 -1.687  -80.005  1.00 98.96  ?  141  ASN C OD1   1 
ATOM   4258  N  ND2   . ASN C 2  137  ? -12.778 0.374   -79.489  1.00 104.28 ?  141  ASN C ND2   1 
ATOM   4259  N  N     . ASN C 2  138  ? -9.892  -3.013  -81.705  1.00 99.77  ?  142  ASN C N     1 
ATOM   4260  C  CA    . ASN C 2  138  ? -10.088 -3.828  -82.898  1.00 97.63  ?  142  ASN C CA    1 
ATOM   4261  C  C     . ASN C 2  138  ? -11.454 -3.625  -83.542  1.00 99.44  ?  142  ASN C C     1 
ATOM   4262  O  O     . ASN C 2  138  ? -11.689 -4.161  -84.630  1.00 99.90  ?  142  ASN C O     1 
ATOM   4263  C  CB    . ASN C 2  138  ? -9.891  -5.307  -82.561  1.00 100.37 ?  142  ASN C CB    1 
ATOM   4264  N  N     . ASN C 2  139  ? -12.354 -2.878  -82.905  1.00 101.74 ?  143  ASN C N     1 
ATOM   4265  C  CA    . ASN C 2  139  ? -13.657 -2.593  -83.494  1.00 102.21 ?  143  ASN C CA    1 
ATOM   4266  C  C     . ASN C 2  139  ? -13.650 -1.234  -84.180  1.00 102.58 ?  143  ASN C C     1 
ATOM   4267  O  O     . ASN C 2  139  ? -13.690 -1.150  -85.412  1.00 100.87 ?  143  ASN C O     1 
ATOM   4268  C  CB    . ASN C 2  139  ? -14.752 -2.635  -82.427  1.00 96.19  ?  143  ASN C CB    1 
ATOM   4269  C  CG    . ASN C 2  139  ? -14.851 -3.982  -81.750  1.00 94.67  ?  143  ASN C CG    1 
ATOM   4270  O  OD1   . ASN C 2  139  ? -14.493 -5.007  -82.330  1.00 91.83  ?  143  ASN C OD1   1 
ATOM   4271  N  ND2   . ASN C 2  139  ? -15.339 -3.990  -80.516  1.00 96.99  ?  143  ASN C ND2   1 
ATOM   4272  N  N     . THR C 2  140  ? -13.591 -0.166  -83.384  1.00 103.17 ?  144  THR C N     1 
ATOM   4273  C  CA    . THR C 2  140  ? -13.612 1.192   -83.909  1.00 107.00 ?  144  THR C CA    1 
ATOM   4274  C  C     . THR C 2  140  ? -12.377 1.527   -84.737  1.00 110.21 ?  144  THR C C     1 
ATOM   4275  O  O     . THR C 2  140  ? -12.383 2.540   -85.444  1.00 109.14 ?  144  THR C O     1 
ATOM   4276  C  CB    . THR C 2  140  ? -13.745 2.189   -82.754  1.00 107.16 ?  144  THR C CB    1 
ATOM   4277  O  OG1   . THR C 2  140  ? -14.552 1.616   -81.718  1.00 106.32 ?  144  THR C OG1   1 
ATOM   4278  C  CG2   . THR C 2  140  ? -14.394 3.482   -83.226  1.00 110.25 ?  144  THR C CG2   1 
ATOM   4279  N  N     . GLY C 2  141  ? -11.328 0.708   -84.674  1.00 109.88 ?  145  GLY C N     1 
ATOM   4280  C  CA    . GLY C 2  141  ? -10.089 1.008   -85.357  1.00 109.80 ?  145  GLY C CA    1 
ATOM   4281  C  C     . GLY C 2  141  ? -9.303  2.159   -84.774  1.00 110.45 ?  145  GLY C C     1 
ATOM   4282  O  O     . GLY C 2  141  ? -8.228  2.480   -85.295  1.00 108.60 ?  145  GLY C O     1 
ATOM   4283  N  N     . GLU C 2  142  ? -9.802  2.786   -83.713  1.00 110.43 ?  146  GLU C N     1 
ATOM   4284  C  CA    . GLU C 2  142  ? -9.115  3.911   -83.098  1.00 107.61 ?  146  GLU C CA    1 
ATOM   4285  C  C     . GLU C 2  142  ? -7.812  3.460   -82.452  1.00 107.80 ?  146  GLU C C     1 
ATOM   4286  O  O     . GLU C 2  142  ? -7.734  2.384   -81.852  1.00 105.24 ?  146  GLU C O     1 
ATOM   4287  C  CB    . GLU C 2  142  ? -10.016 4.564   -82.054  1.00 105.88 ?  146  GLU C CB    1 
ATOM   4288  C  CG    . GLU C 2  142  ? -10.811 3.556   -81.248  1.00 106.58 ?  146  GLU C CG    1 
ATOM   4289  C  CD    . GLU C 2  142  ? -11.499 4.174   -80.054  1.00 108.30 ?  146  GLU C CD    1 
ATOM   4290  O  OE1   . GLU C 2  142  ? -10.858 4.994   -79.367  1.00 110.27 ?  146  GLU C OE1   1 
ATOM   4291  O  OE2   . GLU C 2  142  ? -12.677 3.841   -79.805  1.00 108.14 ?  146  GLU C OE2   1 
ATOM   4292  N  N     . ILE C 2  143  ? -6.786  4.296   -82.576  1.00 105.48 ?  147  ILE C N     1 
ATOM   4293  C  CA    . ILE C 2  143  ? -5.469  4.030   -82.015  1.00 98.16  ?  147  ILE C CA    1 
ATOM   4294  C  C     . ILE C 2  143  ? -5.153  5.115   -80.998  1.00 98.64  ?  147  ILE C C     1 
ATOM   4295  O  O     . ILE C 2  143  ? -5.483  6.288   -81.205  1.00 106.12 ?  147  ILE C O     1 
ATOM   4296  C  CB    . ILE C 2  143  ? -4.383  3.978   -83.108  1.00 94.27  ?  147  ILE C CB    1 
ATOM   4297  C  CG1   . ILE C 2  143  ? -4.837  3.100   -84.274  1.00 97.47  ?  147  ILE C CG1   1 
ATOM   4298  C  CG2   . ILE C 2  143  ? -3.077  3.455   -82.539  1.00 97.52  ?  147  ILE C CG2   1 
ATOM   4299  C  CD1   . ILE C 2  143  ? -3.823  3.007   -85.392  1.00 93.33  ?  147  ILE C CD1   1 
ATOM   4300  N  N     . LYS C 2  144  ? -4.522  4.722   -79.895  1.00 98.31  ?  148  LYS C N     1 
ATOM   4301  C  CA    . LYS C 2  144  ? -4.039  5.663   -78.893  1.00 95.77  ?  148  LYS C CA    1 
ATOM   4302  C  C     . LYS C 2  144  ? -2.595  5.319   -78.567  1.00 92.44  ?  148  LYS C C     1 
ATOM   4303  O  O     . LYS C 2  144  ? -2.318  4.245   -78.024  1.00 88.45  ?  148  LYS C O     1 
ATOM   4304  C  CB    . LYS C 2  144  ? -4.908  5.630   -77.632  1.00 92.56  ?  148  LYS C CB    1 
ATOM   4305  C  CG    . LYS C 2  144  ? -6.323  6.143   -77.845  1.00 92.32  ?  148  LYS C CG    1 
ATOM   4306  C  CD    . LYS C 2  144  ? -7.104  6.197   -76.541  1.00 100.49 ?  148  LYS C CD    1 
ATOM   4307  C  CE    . LYS C 2  144  ? -8.504  6.757   -76.757  1.00 100.50 ?  148  LYS C CE    1 
ATOM   4308  N  NZ    . LYS C 2  144  ? -9.277  6.832   -75.487  1.00 100.84 ?  148  LYS C NZ    1 
ATOM   4309  N  N     . SER C 2  145  ? -1.682  6.230   -78.894  1.00 92.86  ?  149  SER C N     1 
ATOM   4310  C  CA    . SER C 2  145  ? -0.258  6.055   -78.646  1.00 86.97  ?  149  SER C CA    1 
ATOM   4311  C  C     . SER C 2  145  ? 0.173   7.018   -77.552  1.00 83.46  ?  149  SER C C     1 
ATOM   4312  O  O     . SER C 2  145  ? -0.052  8.228   -77.660  1.00 83.20  ?  149  SER C O     1 
ATOM   4313  C  CB    . SER C 2  145  ? 0.558   6.293   -79.917  1.00 82.57  ?  149  SER C CB    1 
ATOM   4314  O  OG    . SER C 2  145  ? 1.933   6.044   -79.688  1.00 83.73  ?  149  SER C OG    1 
ATOM   4315  N  N     . GLN C 2  146  ? 0.794   6.483   -76.508  1.00 83.64  ?  150  GLN C N     1 
ATOM   4316  C  CA    . GLN C 2  146  ? 1.109   7.249   -75.315  1.00 82.26  ?  150  GLN C CA    1 
ATOM   4317  C  C     . GLN C 2  146  ? 2.552   6.997   -74.903  1.00 84.40  ?  150  GLN C C     1 
ATOM   4318  O  O     . GLN C 2  146  ? 3.224   6.095   -75.409  1.00 83.08  ?  150  GLN C O     1 
ATOM   4319  C  CB    . GLN C 2  146  ? 0.160   6.889   -74.168  1.00 79.54  ?  150  GLN C CB    1 
ATOM   4320  C  CG    . GLN C 2  146  ? -0.419  8.080   -73.442  1.00 80.83  ?  150  GLN C CG    1 
ATOM   4321  C  CD    . GLN C 2  146  ? -1.332  7.665   -72.313  1.00 90.16  ?  150  GLN C CD    1 
ATOM   4322  O  OE1   . GLN C 2  146  ? -1.275  6.530   -71.840  1.00 91.26  ?  150  GLN C OE1   1 
ATOM   4323  N  NE2   . GLN C 2  146  ? -2.197  8.575   -71.884  1.00 92.76  ?  150  GLN C NE2   1 
ATOM   4324  N  N     . THR C 2  147  ? 3.027   7.825   -73.978  1.00 81.82  ?  151  THR C N     1 
ATOM   4325  C  CA    . THR C 2  147  ? 4.317   7.639   -73.331  1.00 79.40  ?  151  THR C CA    1 
ATOM   4326  C  C     . THR C 2  147  ? 4.080   7.289   -71.870  1.00 80.34  ?  151  THR C C     1 
ATOM   4327  O  O     . THR C 2  147  ? 3.391   8.026   -71.155  1.00 80.41  ?  151  THR C O     1 
ATOM   4328  C  CB    . THR C 2  147  ? 5.182   8.895   -73.444  1.00 77.25  ?  151  THR C CB    1 
ATOM   4329  O  OG1   . THR C 2  147  ? 5.564   9.089   -74.811  1.00 86.25  ?  151  THR C OG1   1 
ATOM   4330  C  CG2   . THR C 2  147  ? 6.430   8.759   -72.589  1.00 73.35  ?  151  THR C CG2   1 
ATOM   4331  N  N     . VAL C 2  148  ? 4.642   6.166   -71.432  1.00 75.72  ?  152  VAL C N     1 
ATOM   4332  C  CA    . VAL C 2  148  ? 4.423   5.650   -70.089  1.00 70.54  ?  152  VAL C CA    1 
ATOM   4333  C  C     . VAL C 2  148  ? 5.742   5.660   -69.331  1.00 68.22  ?  152  VAL C C     1 
ATOM   4334  O  O     . VAL C 2  148  ? 6.792   5.319   -69.885  1.00 68.61  ?  152  VAL C O     1 
ATOM   4335  C  CB    . VAL C 2  148  ? 3.821   4.231   -70.122  1.00 66.30  ?  152  VAL C CB    1 
ATOM   4336  C  CG1   . VAL C 2  148  ? 3.313   3.834   -68.746  1.00 65.41  ?  152  VAL C CG1   1 
ATOM   4337  C  CG2   . VAL C 2  148  ? 2.708   4.159   -71.149  1.00 71.30  ?  152  VAL C CG2   1 
ATOM   4338  N  N     . PHE C 2  149  ? 5.680   6.058   -68.064  1.00 66.05  ?  153  PHE C N     1 
ATOM   4339  C  CA    . PHE C 2  149  ? 6.827   6.026   -67.164  1.00 62.07  ?  153  PHE C CA    1 
ATOM   4340  C  C     . PHE C 2  149  ? 6.823   4.674   -66.462  1.00 65.58  ?  153  PHE C C     1 
ATOM   4341  O  O     . PHE C 2  149  ? 5.903   4.368   -65.697  1.00 65.61  ?  153  PHE C O     1 
ATOM   4342  C  CB    . PHE C 2  149  ? 6.746   7.184   -66.171  1.00 61.96  ?  153  PHE C CB    1 
ATOM   4343  C  CG    . PHE C 2  149  ? 7.628   7.029   -64.961  1.00 61.32  ?  153  PHE C CG    1 
ATOM   4344  C  CD1   . PHE C 2  149  ? 8.927   7.499   -64.969  1.00 59.53  ?  153  PHE C CD1   1 
ATOM   4345  C  CD2   . PHE C 2  149  ? 7.144   6.439   -63.805  1.00 59.55  ?  153  PHE C CD2   1 
ATOM   4346  C  CE1   . PHE C 2  149  ? 9.732   7.367   -63.855  1.00 62.19  ?  153  PHE C CE1   1 
ATOM   4347  C  CE2   . PHE C 2  149  ? 7.946   6.300   -62.692  1.00 56.66  ?  153  PHE C CE2   1 
ATOM   4348  C  CZ    . PHE C 2  149  ? 9.239   6.768   -62.716  1.00 62.10  ?  153  PHE C CZ    1 
ATOM   4349  N  N     . MET C 2  150  ? 7.834   3.851   -66.740  1.00 64.29  ?  154  MET C N     1 
ATOM   4350  C  CA    . MET C 2  150  ? 7.856   2.496   -66.206  1.00 61.36  ?  154  MET C CA    1 
ATOM   4351  C  C     . MET C 2  150  ? 8.539   2.377   -64.853  1.00 61.40  ?  154  MET C C     1 
ATOM   4352  O  O     . MET C 2  150  ? 8.353   1.363   -64.172  1.00 61.52  ?  154  MET C O     1 
ATOM   4353  C  CB    . MET C 2  150  ? 8.537   1.555   -67.200  1.00 58.04  ?  154  MET C CB    1 
ATOM   4354  C  CG    . MET C 2  150  ? 7.795   1.444   -68.510  1.00 57.34  ?  154  MET C CG    1 
ATOM   4355  S  SD    . MET C 2  150  ? 6.051   1.104   -68.242  1.00 62.13  ?  154  MET C SD    1 
ATOM   4356  C  CE    . MET C 2  150  ? 6.138   -0.457  -67.373  1.00 54.87  ?  154  MET C CE    1 
ATOM   4357  N  N     . GLY C 2  151  ? 9.323   3.358   -64.451  1.00 60.68  ?  155  GLY C N     1 
ATOM   4358  C  CA    . GLY C 2  151  ? 9.914   3.340   -63.128  1.00 60.91  ?  155  GLY C CA    1 
ATOM   4359  C  C     . GLY C 2  151  ? 11.272  4.005   -63.146  1.00 58.00  ?  155  GLY C C     1 
ATOM   4360  O  O     . GLY C 2  151  ? 11.776  4.420   -64.185  1.00 54.44  ?  155  GLY C O     1 
ATOM   4361  N  N     . ASP C 2  152  ? 11.876  4.061   -61.962  1.00 58.08  ?  156  ASP C N     1 
ATOM   4362  C  CA    . ASP C 2  152  ? 13.255  4.510   -61.820  1.00 59.39  ?  156  ASP C CA    1 
ATOM   4363  C  C     . ASP C 2  152  ? 14.145  3.278   -61.906  1.00 59.02  ?  156  ASP C C     1 
ATOM   4364  O  O     . ASP C 2  152  ? 14.174  2.455   -60.987  1.00 59.36  ?  156  ASP C O     1 
ATOM   4365  C  CB    . ASP C 2  152  ? 13.455  5.253   -60.504  1.00 59.89  ?  156  ASP C CB    1 
ATOM   4366  C  CG    . ASP C 2  152  ? 12.673  6.543   -60.446  1.00 65.40  ?  156  ASP C CG    1 
ATOM   4367  O  OD1   . ASP C 2  152  ? 12.414  7.125   -61.520  1.00 64.43  ?  156  ASP C OD1   1 
ATOM   4368  O  OD2   . ASP C 2  152  ? 12.318  6.975   -59.330  1.00 71.66  ?  156  ASP C OD2   1 
ATOM   4369  N  N     . PHE C 2  153  ? 14.884  3.168   -63.002  1.00 55.01  ?  157  PHE C N     1 
ATOM   4370  C  CA    . PHE C 2  153  ? 15.574  1.935   -63.342  1.00 50.30  ?  157  PHE C CA    1 
ATOM   4371  C  C     . PHE C 2  153  ? 16.974  1.953   -62.748  1.00 51.57  ?  157  PHE C C     1 
ATOM   4372  O  O     . PHE C 2  153  ? 17.784  2.802   -63.138  1.00 51.64  ?  157  PHE C O     1 
ATOM   4373  C  CB    . PHE C 2  153  ? 15.644  1.777   -64.850  1.00 49.87  ?  157  PHE C CB    1 
ATOM   4374  C  CG    . PHE C 2  153  ? 15.990  0.395   -65.302  1.00 52.44  ?  157  PHE C CG    1 
ATOM   4375  C  CD1   . PHE C 2  153  ? 15.020  -0.587  -65.373  1.00 54.72  ?  157  PHE C CD1   1 
ATOM   4376  C  CD2   . PHE C 2  153  ? 17.285  0.078   -65.673  1.00 54.30  ?  157  PHE C CD2   1 
ATOM   4377  C  CE1   . PHE C 2  153  ? 15.338  -1.863  -65.795  1.00 55.05  ?  157  PHE C CE1   1 
ATOM   4378  C  CE2   . PHE C 2  153  ? 17.607  -1.195  -66.096  1.00 49.91  ?  157  PHE C CE2   1 
ATOM   4379  C  CZ    . PHE C 2  153  ? 16.633  -2.165  -66.157  1.00 49.76  ?  157  PHE C CZ    1 
ATOM   4380  N  N     . PRO C 2  154  ? 17.296  1.061   -61.810  1.00 50.34  ?  158  PRO C N     1 
ATOM   4381  C  CA    . PRO C 2  154  ? 18.637  1.068   -61.207  1.00 48.20  ?  158  PRO C CA    1 
ATOM   4382  C  C     . PRO C 2  154  ? 19.722  0.933   -62.264  1.00 45.96  ?  158  PRO C C     1 
ATOM   4383  O  O     . PRO C 2  154  ? 19.676  0.047   -63.119  1.00 45.92  ?  158  PRO C O     1 
ATOM   4384  C  CB    . PRO C 2  154  ? 18.604  -0.140  -60.266  1.00 44.69  ?  158  PRO C CB    1 
ATOM   4385  C  CG    . PRO C 2  154  ? 17.161  -0.294  -59.925  1.00 43.21  ?  158  PRO C CG    1 
ATOM   4386  C  CD    . PRO C 2  154  ? 16.415  0.067   -61.176  1.00 46.65  ?  158  PRO C CD    1 
ATOM   4387  N  N     . MET C 2  155  ? 20.705  1.823   -62.194  1.00 46.58  ?  159  MET C N     1 
ATOM   4388  C  CA    . MET C 2  155  ? 21.689  1.992   -63.250  1.00 46.79  ?  159  MET C CA    1 
ATOM   4389  C  C     . MET C 2  155  ? 23.047  1.460   -62.823  1.00 44.34  ?  159  MET C C     1 
ATOM   4390  O  O     . MET C 2  155  ? 23.441  1.589   -61.660  1.00 42.76  ?  159  MET C O     1 
ATOM   4391  C  CB    . MET C 2  155  ? 21.820  3.465   -63.640  1.00 46.54  ?  159  MET C CB    1 
ATOM   4392  C  CG    . MET C 2  155  ? 20.795  3.908   -64.643  1.00 51.46  ?  159  MET C CG    1 
ATOM   4393  S  SD    . MET C 2  155  ? 21.064  3.095   -66.218  1.00 58.40  ?  159  MET C SD    1 
ATOM   4394  C  CE    . MET C 2  155  ? 19.476  3.349   -66.983  1.00 49.59  ?  159  MET C CE    1 
ATOM   4395  N  N     . MET C 2  156  ? 23.755  0.867   -63.778  1.00 41.53  ?  160  MET C N     1 
ATOM   4396  C  CA    . MET C 2  156  ? 25.135  0.470   -63.561  1.00 41.03  ?  160  MET C CA    1 
ATOM   4397  C  C     . MET C 2  156  ? 26.041  1.684   -63.700  1.00 42.10  ?  160  MET C C     1 
ATOM   4398  O  O     . MET C 2  156  ? 25.934  2.447   -64.666  1.00 40.82  ?  160  MET C O     1 
ATOM   4399  C  CB    . MET C 2  156  ? 25.548  -0.617  -64.549  1.00 40.33  ?  160  MET C CB    1 
ATOM   4400  C  CG    . MET C 2  156  ? 27.020  -0.964  -64.485  1.00 40.32  ?  160  MET C CG    1 
ATOM   4401  S  SD    . MET C 2  156  ? 27.431  -2.473  -65.369  1.00 42.59  ?  160  MET C SD    1 
ATOM   4402  C  CE    . MET C 2  156  ? 26.616  -3.688  -64.347  1.00 38.55  ?  160  MET C CE    1 
ATOM   4403  N  N     . THR C 2  157  ? 26.928  1.862   -62.728  1.00 38.82  ?  161  THR C N     1 
ATOM   4404  C  CA    . THR C 2  157  ? 27.828  2.998   -62.703  1.00 38.88  ?  161  THR C CA    1 
ATOM   4405  C  C     . THR C 2  157  ? 28.952  2.805   -63.718  1.00 39.85  ?  161  THR C C     1 
ATOM   4406  O  O     . THR C 2  157  ? 29.039  1.785   -64.405  1.00 42.55  ?  161  THR C O     1 
ATOM   4407  C  CB    . THR C 2  157  ? 28.381  3.187   -61.296  1.00 38.46  ?  161  THR C CB    1 
ATOM   4408  O  OG1   . THR C 2  157  ? 29.345  2.163   -61.023  1.00 54.84  ?  161  THR C OG1   1 
ATOM   4409  C  CG2   . THR C 2  157  ? 27.260  3.073   -60.293  1.00 36.52  ?  161  THR C CG2   1 
ATOM   4410  N  N     . GLU C 2  158  ? 29.829  3.804   -63.819  1.00 42.12  ?  162  GLU C N     1 
ATOM   4411  C  CA    . GLU C 2  158  ? 30.992  3.682   -64.689  1.00 45.17  ?  162  GLU C CA    1 
ATOM   4412  C  C     . GLU C 2  158  ? 31.930  2.572   -64.240  1.00 46.27  ?  162  GLU C C     1 
ATOM   4413  O  O     . GLU C 2  158  ? 32.671  2.031   -65.067  1.00 46.77  ?  162  GLU C O     1 
ATOM   4414  C  CB    . GLU C 2  158  ? 31.747  5.008   -64.750  1.00 48.14  ?  162  GLU C CB    1 
ATOM   4415  C  CG    . GLU C 2  158  ? 31.071  6.052   -65.607  1.00 59.46  ?  162  GLU C CG    1 
ATOM   4416  C  CD    . GLU C 2  158  ? 30.993  5.635   -67.064  1.00 72.86  ?  162  GLU C CD    1 
ATOM   4417  O  OE1   . GLU C 2  158  ? 31.905  4.918   -67.528  1.00 73.87  ?  162  GLU C OE1   1 
ATOM   4418  O  OE2   . GLU C 2  158  ? 30.019  6.021   -67.744  1.00 74.08  ?  162  GLU C OE2   1 
ATOM   4419  N  N     . LYS C 2  159  ? 31.904  2.223   -62.957  1.00 44.36  ?  163  LYS C N     1 
ATOM   4420  C  CA    . LYS C 2  159  ? 32.751  1.191   -62.382  1.00 42.33  ?  163  LYS C CA    1 
ATOM   4421  C  C     . LYS C 2  159  ? 32.115  -0.192  -62.442  1.00 40.72  ?  163  LYS C C     1 
ATOM   4422  O  O     . LYS C 2  159  ? 32.663  -1.139  -61.868  1.00 40.81  ?  163  LYS C O     1 
ATOM   4423  C  CB    . LYS C 2  159  ? 33.098  1.549   -60.937  1.00 44.98  ?  163  LYS C CB    1 
ATOM   4424  C  CG    . LYS C 2  159  ? 33.851  2.861   -60.805  1.00 49.77  ?  163  LYS C CG    1 
ATOM   4425  C  CD    . LYS C 2  159  ? 34.258  3.127   -59.368  1.00 57.45  ?  163  LYS C CD    1 
ATOM   4426  C  CE    . LYS C 2  159  ? 34.954  4.470   -59.229  1.00 59.58  ?  163  LYS C CE    1 
ATOM   4427  N  NZ    . LYS C 2  159  ? 35.397  4.722   -57.828  1.00 65.33  ?  163  LYS C NZ    1 
ATOM   4428  N  N     . GLY C 2  160  ? 30.968  -0.325  -63.099  1.00 40.23  ?  164  GLY C N     1 
ATOM   4429  C  CA    . GLY C 2  160  ? 30.310  -1.612  -63.195  1.00 35.90  ?  164  GLY C CA    1 
ATOM   4430  C  C     . GLY C 2  160  ? 29.653  -2.065  -61.914  1.00 34.17  ?  164  GLY C C     1 
ATOM   4431  O  O     . GLY C 2  160  ? 29.634  -3.263  -61.626  1.00 37.31  ?  164  GLY C O     1 
ATOM   4432  N  N     . THR C 2  161  ? 29.116  -1.137  -61.130  1.00 36.43  ?  165  THR C N     1 
ATOM   4433  C  CA    . THR C 2  161  ? 28.455  -1.460  -59.879  1.00 37.10  ?  165  THR C CA    1 
ATOM   4434  C  C     . THR C 2  161  ? 27.060  -0.849  -59.874  1.00 39.28  ?  165  THR C C     1 
ATOM   4435  O  O     . THR C 2  161  ? 26.639  -0.185  -60.824  1.00 41.60  ?  165  THR C O     1 
ATOM   4436  C  CB    . THR C 2  161  ? 29.260  -0.958  -58.673  1.00 37.94  ?  165  THR C CB    1 
ATOM   4437  O  OG1   . THR C 2  161  ? 29.467  0.455   -58.787  1.00 40.26  ?  165  THR C OG1   1 
ATOM   4438  C  CG2   . THR C 2  161  ? 30.597  -1.659  -58.595  1.00 37.13  ?  165  THR C CG2   1 
ATOM   4439  N  N     . PHE C 2  162  ? 26.341  -1.086  -58.784  1.00 38.66  ?  166  PHE C N     1 
ATOM   4440  C  CA    . PHE C 2  162  ? 25.045  -0.480  -58.540  1.00 42.71  ?  166  PHE C CA    1 
ATOM   4441  C  C     . PHE C 2  162  ? 25.040  0.102   -57.136  1.00 45.05  ?  166  PHE C C     1 
ATOM   4442  O  O     . PHE C 2  162  ? 25.686  -0.430  -56.230  1.00 46.21  ?  166  PHE C O     1 
ATOM   4443  C  CB    . PHE C 2  162  ? 23.899  -1.494  -58.680  1.00 41.83  ?  166  PHE C CB    1 
ATOM   4444  C  CG    . PHE C 2  162  ? 23.732  -2.044  -60.064  1.00 41.71  ?  166  PHE C CG    1 
ATOM   4445  C  CD1   . PHE C 2  162  ? 22.926  -1.404  -60.984  1.00 41.95  ?  166  PHE C CD1   1 
ATOM   4446  C  CD2   . PHE C 2  162  ? 24.367  -3.214  -60.440  1.00 43.81  ?  166  PHE C CD2   1 
ATOM   4447  C  CE1   . PHE C 2  162  ? 22.765  -1.910  -62.257  1.00 41.87  ?  166  PHE C CE1   1 
ATOM   4448  C  CE2   . PHE C 2  162  ? 24.210  -3.726  -61.713  1.00 41.45  ?  166  PHE C CE2   1 
ATOM   4449  C  CZ    . PHE C 2  162  ? 23.406  -3.070  -62.622  1.00 41.31  ?  166  PHE C CZ    1 
ATOM   4450  N  N     . ILE C 2  163  ? 24.319  1.201   -56.959  1.00 45.98  ?  167  ILE C N     1 
ATOM   4451  C  CA    . ILE C 2  163  ? 24.109  1.786   -55.641  1.00 47.19  ?  167  ILE C CA    1 
ATOM   4452  C  C     . ILE C 2  163  ? 22.641  1.592   -55.295  1.00 45.75  ?  167  ILE C C     1 
ATOM   4453  O  O     . ILE C 2  163  ? 21.757  2.178   -55.930  1.00 46.19  ?  167  ILE C O     1 
ATOM   4454  C  CB    . ILE C 2  163  ? 24.514  3.265   -55.580  1.00 43.88  ?  167  ILE C CB    1 
ATOM   4455  C  CG1   . ILE C 2  163  ? 26.035  3.405   -55.529  1.00 46.61  ?  167  ILE C CG1   1 
ATOM   4456  C  CG2   . ILE C 2  163  ? 23.951  3.906   -54.335  1.00 50.31  ?  167  ILE C CG2   1 
ATOM   4457  C  CD1   . ILE C 2  163  ? 26.720  3.288   -56.857  1.00 47.87  ?  167  ILE C CD1   1 
ATOM   4458  N  N     . ILE C 2  164  ? 22.384  0.747   -54.303  1.00 44.47  ?  168  ILE C N     1 
ATOM   4459  C  CA    . ILE C 2  164  ? 21.039  0.413   -53.857  1.00 45.75  ?  168  ILE C CA    1 
ATOM   4460  C  C     . ILE C 2  164  ? 20.923  0.862   -52.410  1.00 49.92  ?  168  ILE C C     1 
ATOM   4461  O  O     . ILE C 2  164  ? 21.657  0.371   -51.542  1.00 54.17  ?  168  ILE C O     1 
ATOM   4462  C  CB    . ILE C 2  164  ? 20.740  -1.090  -54.001  1.00 46.53  ?  168  ILE C CB    1 
ATOM   4463  C  CG1   . ILE C 2  164  ? 20.174  -1.404  -55.388  1.00 43.76  ?  168  ILE C CG1   1 
ATOM   4464  C  CG2   . ILE C 2  164  ? 19.753  -1.559  -52.941  1.00 48.74  ?  168  ILE C CG2   1 
ATOM   4465  C  CD1   . ILE C 2  164  ? 21.124  -1.178  -56.526  1.00 41.46  ?  168  ILE C CD1   1 
ATOM   4466  N  N     . ASN C 2  165  ? 20.021  1.809   -52.157  1.00 50.24  ?  169  ASN C N     1 
ATOM   4467  C  CA    . ASN C 2  165  ? 19.837  2.380   -50.824  1.00 53.47  ?  169  ASN C CA    1 
ATOM   4468  C  C     . ASN C 2  165  ? 21.145  2.961   -50.292  1.00 51.98  ?  169  ASN C C     1 
ATOM   4469  O  O     . ASN C 2  165  ? 21.441  2.889   -49.098  1.00 51.36  ?  169  ASN C O     1 
ATOM   4470  C  CB    . ASN C 2  165  ? 19.254  1.343   -49.862  1.00 55.73  ?  169  ASN C CB    1 
ATOM   4471  C  CG    . ASN C 2  165  ? 17.961  0.743   -50.376  1.00 54.37  ?  169  ASN C CG    1 
ATOM   4472  O  OD1   . ASN C 2  165  ? 17.239  1.374   -51.147  1.00 49.69  ?  169  ASN C OD1   1 
ATOM   4473  N  ND2   . ASN C 2  165  ? 17.665  -0.482  -49.959  1.00 52.86  ?  169  ASN C ND2   1 
ATOM   4474  N  N     . GLY C 2  166  ? 21.941  3.531   -51.196  1.00 52.58  ?  170  GLY C N     1 
ATOM   4475  C  CA    . GLY C 2  166  ? 23.175  4.195   -50.851  1.00 54.83  ?  170  GLY C CA    1 
ATOM   4476  C  C     . GLY C 2  166  ? 24.402  3.310   -50.840  1.00 51.27  ?  170  GLY C C     1 
ATOM   4477  O  O     . GLY C 2  166  ? 25.516  3.819   -50.997  1.00 52.83  ?  170  GLY C O     1 
ATOM   4478  N  N     . THR C 2  167  ? 24.232  2.003   -50.678  1.00 50.43  ?  171  THR C N     1 
ATOM   4479  C  CA    . THR C 2  167  ? 25.356  1.088   -50.570  1.00 53.33  ?  171  THR C CA    1 
ATOM   4480  C  C     . THR C 2  167  ? 25.717  0.537   -51.941  1.00 50.59  ?  171  THR C C     1 
ATOM   4481  O  O     . THR C 2  167  ? 24.842  0.172   -52.729  1.00 49.90  ?  171  THR C O     1 
ATOM   4482  C  CB    . THR C 2  167  ? 25.022  -0.057  -49.615  1.00 58.36  ?  171  THR C CB    1 
ATOM   4483  O  OG1   . THR C 2  167  ? 24.243  -1.043  -50.303  1.00 61.41  ?  171  THR C OG1   1 
ATOM   4484  C  CG2   . THR C 2  167  ? 24.223  0.468   -48.431  1.00 55.29  ?  171  THR C CG2   1 
ATOM   4485  N  N     . GLU C 2  168  ? 27.014  0.477   -52.219  1.00 48.01  ?  172  GLU C N     1 
ATOM   4486  C  CA    . GLU C 2  168  ? 27.491  0.025   -53.516  1.00 47.00  ?  172  GLU C CA    1 
ATOM   4487  C  C     . GLU C 2  168  ? 27.523  -1.496  -53.574  1.00 45.15  ?  172  GLU C C     1 
ATOM   4488  O  O     . GLU C 2  168  ? 27.984  -2.159  -52.640  1.00 44.73  ?  172  GLU C O     1 
ATOM   4489  C  CB    . GLU C 2  168  ? 28.876  0.595   -53.794  1.00 47.53  ?  172  GLU C CB    1 
ATOM   4490  C  CG    . GLU C 2  168  ? 29.324  0.449   -55.224  1.00 44.95  ?  172  GLU C CG    1 
ATOM   4491  C  CD    . GLU C 2  168  ? 30.516  1.314   -55.525  1.00 48.04  ?  172  GLU C CD    1 
ATOM   4492  O  OE1   . GLU C 2  168  ? 31.060  1.910   -54.575  1.00 48.84  ?  172  GLU C OE1   1 
ATOM   4493  O  OE2   . GLU C 2  168  ? 30.903  1.408   -56.706  1.00 52.72  ?  172  GLU C OE2   1 
ATOM   4494  N  N     . ARG C 2  169  ? 27.037  -2.049  -54.681  1.00 44.07  ?  173  ARG C N     1 
ATOM   4495  C  CA    . ARG C 2  169  ? 26.809  -3.481  -54.779  1.00 43.64  ?  173  ARG C CA    1 
ATOM   4496  C  C     . ARG C 2  169  ? 27.277  -4.006  -56.129  1.00 43.59  ?  173  ARG C C     1 
ATOM   4497  O  O     . ARG C 2  169  ? 27.348  -3.273  -57.118  1.00 42.67  ?  173  ARG C O     1 
ATOM   4498  C  CB    . ARG C 2  169  ? 25.331  -3.815  -54.557  1.00 41.49  ?  173  ARG C CB    1 
ATOM   4499  C  CG    . ARG C 2  169  ? 24.885  -3.615  -53.124  1.00 45.48  ?  173  ARG C CG    1 
ATOM   4500  C  CD    . ARG C 2  169  ? 23.415  -3.928  -52.943  1.00 47.97  ?  173  ARG C CD    1 
ATOM   4501  N  NE    . ARG C 2  169  ? 23.137  -4.357  -51.578  1.00 50.86  ?  173  ARG C NE    1 
ATOM   4502  C  CZ    . ARG C 2  169  ? 23.110  -5.627  -51.192  1.00 53.70  ?  173  ARG C CZ    1 
ATOM   4503  N  NH1   . ARG C 2  169  ? 23.336  -6.592  -52.072  1.00 48.58  ?  173  ARG C NH1   1 
ATOM   4504  N  NH2   . ARG C 2  169  ? 22.854  -5.933  -49.929  1.00 64.22  ?  173  ARG C NH2   1 
ATOM   4505  N  N     . VAL C 2  170  ? 27.591  -5.301  -56.150  1.00 39.60  ?  174  VAL C N     1 
ATOM   4506  C  CA    . VAL C 2  170  ? 28.084  -5.996  -57.334  1.00 36.94  ?  174  VAL C CA    1 
ATOM   4507  C  C     . VAL C 2  170  ? 27.183  -7.191  -57.602  1.00 36.64  ?  174  VAL C C     1 
ATOM   4508  O  O     . VAL C 2  170  ? 26.762  -7.882  -56.668  1.00 36.93  ?  174  VAL C O     1 
ATOM   4509  C  CB    . VAL C 2  170  ? 29.548  -6.454  -57.155  1.00 37.34  ?  174  VAL C CB    1 
ATOM   4510  C  CG1   . VAL C 2  170  ? 29.999  -7.303  -58.332  1.00 33.53  ?  174  VAL C CG1   1 
ATOM   4511  C  CG2   . VAL C 2  170  ? 30.461  -5.259  -56.985  1.00 37.88  ?  174  VAL C CG2   1 
ATOM   4512  N  N     . VAL C 2  171  ? 26.887  -7.433  -58.874  1.00 36.49  ?  175  VAL C N     1 
ATOM   4513  C  CA    . VAL C 2  171  ? 26.116  -8.597  -59.292  1.00 36.29  ?  175  VAL C CA    1 
ATOM   4514  C  C     . VAL C 2  171  ? 27.085  -9.609  -59.888  1.00 33.68  ?  175  VAL C C     1 
ATOM   4515  O  O     . VAL C 2  171  ? 27.602  -9.420  -60.994  1.00 32.47  ?  175  VAL C O     1 
ATOM   4516  C  CB    . VAL C 2  171  ? 25.017  -8.220  -60.291  1.00 33.57  ?  175  VAL C CB    1 
ATOM   4517  C  CG1   . VAL C 2  171  ? 24.191  -9.441  -60.643  1.00 35.26  ?  175  VAL C CG1   1 
ATOM   4518  C  CG2   . VAL C 2  171  ? 24.140  -7.124  -59.715  1.00 40.32  ?  175  VAL C CG2   1 
ATOM   4519  N  N     . VAL C 2  172  ? 27.308  -10.698 -59.167  1.00 30.12  ?  176  VAL C N     1 
ATOM   4520  C  CA    . VAL C 2  172  ? 28.275  -11.707 -59.573  1.00 30.81  ?  176  VAL C CA    1 
ATOM   4521  C  C     . VAL C 2  172  ? 27.665  -12.577 -60.661  1.00 35.97  ?  176  VAL C C     1 
ATOM   4522  O  O     . VAL C 2  172  ? 26.519  -13.024 -60.542  1.00 41.44  ?  176  VAL C O     1 
ATOM   4523  C  CB    . VAL C 2  172  ? 28.709  -12.550 -58.366  1.00 34.22  ?  176  VAL C CB    1 
ATOM   4524  C  CG1   . VAL C 2  172  ? 29.634  -13.666 -58.803  1.00 41.01  ?  176  VAL C CG1   1 
ATOM   4525  C  CG2   . VAL C 2  172  ? 29.379  -11.672 -57.323  1.00 35.09  ?  176  VAL C CG2   1 
ATOM   4526  N  N     . SER C 2  173  ? 28.428  -12.812 -61.728  1.00 33.94  ?  177  SER C N     1 
ATOM   4527  C  CA    . SER C 2  173  ? 27.986  -13.722 -62.774  1.00 34.92  ?  177  SER C CA    1 
ATOM   4528  C  C     . SER C 2  173  ? 27.796  -15.118 -62.200  1.00 36.43  ?  177  SER C C     1 
ATOM   4529  O  O     . SER C 2  173  ? 28.561  -15.563 -61.343  1.00 39.34  ?  177  SER C O     1 
ATOM   4530  C  CB    . SER C 2  173  ? 28.999  -13.753 -63.914  1.00 34.05  ?  177  SER C CB    1 
ATOM   4531  O  OG    . SER C 2  173  ? 29.323  -12.446 -64.336  1.00 36.05  ?  177  SER C OG    1 
ATOM   4532  N  N     . GLN C 2  174  ? 26.764  -15.811 -62.669  1.00 36.12  ?  178  GLN C N     1 
ATOM   4533  C  CA    . GLN C 2  174  ? 26.376  -17.093 -62.102  1.00 39.75  ?  178  GLN C CA    1 
ATOM   4534  C  C     . GLN C 2  174  ? 26.707  -18.225 -63.062  1.00 41.36  ?  178  GLN C C     1 
ATOM   4535  O  O     . GLN C 2  174  ? 26.363  -18.163 -64.246  1.00 43.65  ?  178  GLN C O     1 
ATOM   4536  C  CB    . GLN C 2  174  ? 24.888  -17.124 -61.764  1.00 40.02  ?  178  GLN C CB    1 
ATOM   4537  C  CG    . GLN C 2  174  ? 24.481  -18.401 -61.061  1.00 41.13  ?  178  GLN C CG    1 
ATOM   4538  C  CD    . GLN C 2  174  ? 23.013  -18.448 -60.734  1.00 47.21  ?  178  GLN C CD    1 
ATOM   4539  O  OE1   . GLN C 2  174  ? 22.170  -18.097 -61.555  1.00 49.47  ?  178  GLN C OE1   1 
ATOM   4540  N  NE2   . GLN C 2  174  ? 22.695  -18.882 -59.523  1.00 50.94  ?  178  GLN C NE2   1 
ATOM   4541  N  N     . LEU C 2  175  ? 27.368  -19.253 -62.540  1.00 41.27  ?  179  LEU C N     1 
ATOM   4542  C  CA    . LEU C 2  175  ? 27.620  -20.482 -63.279  1.00 37.48  ?  179  LEU C CA    1 
ATOM   4543  C  C     . LEU C 2  175  ? 26.420  -21.403 -63.120  1.00 42.72  ?  179  LEU C C     1 
ATOM   4544  O  O     . LEU C 2  175  ? 26.091  -21.819 -62.003  1.00 45.51  ?  179  LEU C O     1 
ATOM   4545  C  CB    . LEU C 2  175  ? 28.884  -21.171 -62.773  1.00 36.87  ?  179  LEU C CB    1 
ATOM   4546  C  CG    . LEU C 2  175  ? 30.237  -20.699 -63.292  1.00 35.48  ?  179  LEU C CG    1 
ATOM   4547  C  CD1   . LEU C 2  175  ? 31.336  -21.423 -62.549  1.00 36.81  ?  179  LEU C CD1   1 
ATOM   4548  C  CD2   . LEU C 2  175  ? 30.347  -20.942 -64.784  1.00 35.48  ?  179  LEU C CD2   1 
ATOM   4549  N  N     . VAL C 2  176  ? 25.767  -21.719 -64.232  1.00 43.11  ?  180  VAL C N     1 
ATOM   4550  C  CA    . VAL C 2  176  ? 24.632  -22.619 -64.253  1.00 44.47  ?  180  VAL C CA    1 
ATOM   4551  C  C     . VAL C 2  176  ? 24.834  -23.606 -65.394  1.00 46.54  ?  180  VAL C C     1 
ATOM   4552  O  O     . VAL C 2  176  ? 25.774  -23.493 -66.176  1.00 49.00  ?  180  VAL C O     1 
ATOM   4553  C  CB    . VAL C 2  176  ? 23.296  -21.866 -64.408  1.00 46.92  ?  180  VAL C CB    1 
ATOM   4554  C  CG1   . VAL C 2  176  ? 23.061  -20.947 -63.226  1.00 47.66  ?  180  VAL C CG1   1 
ATOM   4555  C  CG2   . VAL C 2  176  ? 23.290  -21.079 -65.704  1.00 45.92  ?  180  VAL C CG2   1 
ATOM   4556  N  N     . ARG C 2  177  ? 23.926  -24.567 -65.498  1.00 48.61  ?  181  ARG C N     1 
ATOM   4557  C  CA    . ARG C 2  177  ? 23.930  -25.479 -66.628  1.00 50.89  ?  181  ARG C CA    1 
ATOM   4558  C  C     . ARG C 2  177  ? 23.001  -24.928 -67.699  1.00 50.18  ?  181  ARG C C     1 
ATOM   4559  O  O     . ARG C 2  177  ? 21.870  -24.529 -67.405  1.00 50.96  ?  181  ARG C O     1 
ATOM   4560  C  CB    . ARG C 2  177  ? 23.513  -26.889 -66.208  1.00 56.71  ?  181  ARG C CB    1 
ATOM   4561  C  CG    . ARG C 2  177  ? 22.121  -27.007 -65.629  1.00 65.55  ?  181  ARG C CG    1 
ATOM   4562  C  CD    . ARG C 2  177  ? 21.673  -28.452 -65.649  1.00 76.27  ?  181  ARG C CD    1 
ATOM   4563  N  NE    . ARG C 2  177  ? 22.390  -29.260 -64.668  1.00 87.18  ?  181  ARG C NE    1 
ATOM   4564  C  CZ    . ARG C 2  177  ? 22.687  -30.544 -64.834  1.00 88.75  ?  181  ARG C CZ    1 
ATOM   4565  N  NH1   . ARG C 2  177  ? 22.347  -31.166 -65.954  1.00 81.59  ?  181  ARG C NH1   1 
ATOM   4566  N  NH2   . ARG C 2  177  ? 23.335  -31.203 -63.885  1.00 94.95  ?  181  ARG C NH2   1 
ATOM   4567  N  N     . SER C 2  178  ? 23.494  -24.869 -68.929  1.00 50.29  ?  182  SER C N     1 
ATOM   4568  C  CA    . SER C 2  178  ? 22.683  -24.342 -70.006  1.00 52.38  ?  182  SER C CA    1 
ATOM   4569  C  C     . SER C 2  178  ? 21.535  -25.300 -70.306  1.00 54.58  ?  182  SER C C     1 
ATOM   4570  O  O     . SER C 2  178  ? 21.642  -26.504 -70.061  1.00 54.70  ?  182  SER C O     1 
ATOM   4571  C  CB    . SER C 2  178  ? 23.521  -24.132 -71.261  1.00 53.22  ?  182  SER C CB    1 
ATOM   4572  O  OG    . SER C 2  178  ? 23.663  -25.339 -71.982  1.00 60.47  ?  182  SER C OG    1 
ATOM   4573  N  N     . PRO C 2  179  ? 20.417  -24.785 -70.808  1.00 56.76  ?  183  PRO C N     1 
ATOM   4574  C  CA    . PRO C 2  179  ? 19.350  -25.675 -71.268  1.00 59.15  ?  183  PRO C CA    1 
ATOM   4575  C  C     . PRO C 2  179  ? 19.855  -26.608 -72.357  1.00 60.81  ?  183  PRO C C     1 
ATOM   4576  O  O     . PRO C 2  179  ? 20.691  -26.235 -73.182  1.00 63.25  ?  183  PRO C O     1 
ATOM   4577  C  CB    . PRO C 2  179  ? 18.288  -24.707 -71.798  1.00 64.72  ?  183  PRO C CB    1 
ATOM   4578  C  CG    . PRO C 2  179  ? 18.527  -23.450 -71.037  1.00 61.61  ?  183  PRO C CG    1 
ATOM   4579  C  CD    . PRO C 2  179  ? 20.010  -23.371 -70.839  1.00 56.63  ?  183  PRO C CD    1 
ATOM   4580  N  N     . GLY C 2  180  ? 19.347  -27.832 -72.345  1.00 61.79  ?  184  GLY C N     1 
ATOM   4581  C  CA    . GLY C 2  180  ? 19.763  -28.820 -73.321  1.00 61.15  ?  184  GLY C CA    1 
ATOM   4582  C  C     . GLY C 2  180  ? 19.427  -30.218 -72.833  1.00 63.58  ?  184  GLY C C     1 
ATOM   4583  O  O     . GLY C 2  180  ? 18.630  -30.395 -71.915  1.00 63.81  ?  184  GLY C O     1 
ATOM   4584  N  N     . VAL C 2  181  ? 20.060  -31.197 -73.474  1.00 63.40  ?  185  VAL C N     1 
ATOM   4585  C  CA    . VAL C 2  181  ? 19.852  -32.609 -73.180  1.00 60.28  ?  185  VAL C CA    1 
ATOM   4586  C  C     . VAL C 2  181  ? 21.179  -33.200 -72.734  1.00 57.72  ?  185  VAL C C     1 
ATOM   4587  O  O     . VAL C 2  181  ? 22.193  -33.051 -73.425  1.00 61.39  ?  185  VAL C O     1 
ATOM   4588  C  CB    . VAL C 2  181  ? 19.300  -33.365 -74.401  1.00 62.76  ?  185  VAL C CB    1 
ATOM   4589  C  CG1   . VAL C 2  181  ? 19.045  -34.813 -74.047  1.00 70.88  ?  185  VAL C CG1   1 
ATOM   4590  C  CG2   . VAL C 2  181  ? 18.029  -32.705 -74.897  1.00 66.53  ?  185  VAL C CG2   1 
ATOM   4591  N  N     . TYR C 2  182  ? 21.170  -33.877 -71.590  1.00 57.48  ?  186  TYR C N     1 
ATOM   4592  C  CA    . TYR C 2  182  ? 22.393  -34.372 -70.977  1.00 61.36  ?  186  TYR C CA    1 
ATOM   4593  C  C     . TYR C 2  182  ? 22.213  -35.820 -70.558  1.00 65.48  ?  186  TYR C C     1 
ATOM   4594  O  O     . TYR C 2  182  ? 21.269  -36.149 -69.832  1.00 68.42  ?  186  TYR C O     1 
ATOM   4595  C  CB    . TYR C 2  182  ? 22.783  -33.497 -69.787  1.00 59.66  ?  186  TYR C CB    1 
ATOM   4596  C  CG    . TYR C 2  182  ? 22.974  -32.060 -70.197  1.00 60.35  ?  186  TYR C CG    1 
ATOM   4597  C  CD1   . TYR C 2  182  ? 23.894  -31.726 -71.179  1.00 59.48  ?  186  TYR C CD1   1 
ATOM   4598  C  CD2   . TYR C 2  182  ? 22.226  -31.041 -69.627  1.00 59.65  ?  186  TYR C CD2   1 
ATOM   4599  C  CE1   . TYR C 2  182  ? 24.072  -30.423 -71.577  1.00 59.46  ?  186  TYR C CE1   1 
ATOM   4600  C  CE2   . TYR C 2  182  ? 22.401  -29.728 -70.018  1.00 59.68  ?  186  TYR C CE2   1 
ATOM   4601  C  CZ    . TYR C 2  182  ? 23.327  -29.427 -70.995  1.00 57.35  ?  186  TYR C CZ    1 
ATOM   4602  O  OH    . TYR C 2  182  ? 23.514  -28.127 -71.396  1.00 54.67  ?  186  TYR C OH    1 
ATOM   4603  N  N     . PHE C 2  183  ? 23.123  -36.676 -71.012  1.00 64.59  ?  187  PHE C N     1 
ATOM   4604  C  CA    . PHE C 2  183  ? 23.058  -38.110 -70.778  1.00 69.53  ?  187  PHE C CA    1 
ATOM   4605  C  C     . PHE C 2  183  ? 24.107  -38.518 -69.753  1.00 73.35  ?  187  PHE C C     1 
ATOM   4606  O  O     . PHE C 2  183  ? 25.262  -38.089 -69.826  1.00 76.42  ?  187  PHE C O     1 
ATOM   4607  C  CB    . PHE C 2  183  ? 23.266  -38.880 -72.082  1.00 71.88  ?  187  PHE C CB    1 
ATOM   4608  C  CG    . PHE C 2  183  ? 22.263  -38.544 -73.147  1.00 72.56  ?  187  PHE C CG    1 
ATOM   4609  C  CD1   . PHE C 2  183  ? 22.478  -37.484 -74.009  1.00 70.83  ?  187  PHE C CD1   1 
ATOM   4610  C  CD2   . PHE C 2  183  ? 21.104  -39.285 -73.282  1.00 72.34  ?  187  PHE C CD2   1 
ATOM   4611  C  CE1   . PHE C 2  183  ? 21.554  -37.173 -74.986  1.00 70.84  ?  187  PHE C CE1   1 
ATOM   4612  C  CE2   . PHE C 2  183  ? 20.178  -38.978 -74.258  1.00 72.64  ?  187  PHE C CE2   1 
ATOM   4613  C  CZ    . PHE C 2  183  ? 20.402  -37.919 -75.108  1.00 71.23  ?  187  PHE C CZ    1 
ATOM   4614  N  N     . ASP C 2  184  ? 23.698  -39.358 -68.805  1.00 74.55  ?  188  ASP C N     1 
ATOM   4615  C  CA    . ASP C 2  184  ? 24.535  -39.747 -67.678  1.00 77.22  ?  188  ASP C CA    1 
ATOM   4616  C  C     . ASP C 2  184  ? 24.525  -41.262 -67.556  1.00 83.62  ?  188  ASP C C     1 
ATOM   4617  O  O     . ASP C 2  184  ? 23.460  -41.866 -67.395  1.00 91.53  ?  188  ASP C O     1 
ATOM   4618  C  CB    . ASP C 2  184  ? 24.037  -39.098 -66.384  1.00 81.88  ?  188  ASP C CB    1 
ATOM   4619  C  CG    . ASP C 2  184  ? 24.929  -39.397 -65.201  1.00 88.53  ?  188  ASP C CG    1 
ATOM   4620  O  OD1   . ASP C 2  184  ? 26.153  -39.538 -65.399  1.00 90.04  ?  188  ASP C OD1   1 
ATOM   4621  O  OD2   . ASP C 2  184  ? 24.405  -39.488 -64.071  1.00 87.02  ?  188  ASP C OD2   1 
ATOM   4622  N  N     . GLU C 2  185  ? 25.706  -41.870 -67.628  1.00 89.94  ?  189  GLU C N     1 
ATOM   4623  C  CA    . GLU C 2  185  ? 25.865  -43.318 -67.545  1.00 93.74  ?  189  GLU C CA    1 
ATOM   4624  C  C     . GLU C 2  185  ? 26.461  -43.659 -66.187  1.00 94.10  ?  189  GLU C C     1 
ATOM   4625  O  O     . GLU C 2  185  ? 27.634  -43.372 -65.926  1.00 94.24  ?  189  GLU C O     1 
ATOM   4626  C  CB    . GLU C 2  185  ? 26.751  -43.833 -68.674  1.00 91.95  ?  189  GLU C CB    1 
ATOM   4627  C  CG    . GLU C 2  185  ? 27.087  -45.305 -68.589  1.00 96.50  ?  189  GLU C CG    1 
ATOM   4628  C  CD    . GLU C 2  185  ? 28.263  -45.672 -69.467  1.00 94.68  ?  189  GLU C CD    1 
ATOM   4629  O  OE1   . GLU C 2  185  ? 29.327  -46.024 -68.919  1.00 96.42  ?  189  GLU C OE1   1 
ATOM   4630  O  OE2   . GLU C 2  185  ? 28.127  -45.588 -70.706  1.00 92.49  ?  189  GLU C OE2   1 
ATOM   4631  N  N     . THR C 2  186  ? 25.660  -44.280 -65.330  1.00 97.49  ?  190  THR C N     1 
ATOM   4632  C  CA    . THR C 2  186  ? 26.083  -44.647 -63.987  1.00 102.84 ?  190  THR C CA    1 
ATOM   4633  C  C     . THR C 2  186  ? 26.273  -46.158 -63.911  1.00 109.66 ?  190  THR C C     1 
ATOM   4634  O  O     . THR C 2  186  ? 25.322  -46.919 -64.126  1.00 109.60 ?  190  THR C O     1 
ATOM   4635  C  CB    . THR C 2  186  ? 25.069  -44.169 -62.944  1.00 102.57 ?  190  THR C CB    1 
ATOM   4636  O  OG1   . THR C 2  186  ? 25.277  -44.865 -61.709  1.00 109.87 ?  190  THR C OG1   1 
ATOM   4637  C  CG2   . THR C 2  186  ? 23.638  -44.391 -63.426  1.00 101.10 ?  190  THR C CG2   1 
ATOM   4638  N  N     . ILE C 2  187  ? 27.503  -46.581 -63.611  1.00 113.88 ?  191  ILE C N     1 
ATOM   4639  C  CA    . ILE C 2  187  ? 27.821  -47.986 -63.388  1.00 116.51 ?  191  ILE C CA    1 
ATOM   4640  C  C     . ILE C 2  187  ? 27.714  -48.362 -61.911  1.00 121.03 ?  191  ILE C C     1 
ATOM   4641  O  O     . ILE C 2  187  ? 28.040  -49.489 -61.541  1.00 125.38 ?  191  ILE C O     1 
ATOM   4642  C  CB    . ILE C 2  187  ? 29.213  -48.337 -63.932  1.00 115.47 ?  191  ILE C CB    1 
ATOM   4643  N  N     . ASP C 2  188  ? 27.252  -47.441 -61.064  1.00 123.26 ?  192  ASP C N     1 
ATOM   4644  C  CA    . ASP C 2  188  ? 27.316  -47.590 -59.611  1.00 126.92 ?  192  ASP C CA    1 
ATOM   4645  C  C     . ASP C 2  188  ? 26.208  -48.470 -59.038  1.00 129.33 ?  192  ASP C C     1 
ATOM   4646  O  O     . ASP C 2  188  ? 26.136  -48.631 -57.812  1.00 130.36 ?  192  ASP C O     1 
ATOM   4647  C  CB    . ASP C 2  188  ? 27.266  -46.212 -58.942  1.00 129.08 ?  192  ASP C CB    1 
ATOM   4648  N  N     . LYS C 2  189  ? 25.337  -49.023 -59.879  1.00 124.65 ?  193  LYS C N     1 
ATOM   4649  C  CA    . LYS C 2  189  ? 24.305  -49.926 -59.394  1.00 125.89 ?  193  LYS C CA    1 
ATOM   4650  C  C     . LYS C 2  189  ? 24.935  -51.120 -58.687  1.00 129.85 ?  193  LYS C C     1 
ATOM   4651  O  O     . LYS C 2  189  ? 26.029  -51.572 -59.036  1.00 128.85 ?  193  LYS C O     1 
ATOM   4652  C  CB    . LYS C 2  189  ? 23.427  -50.402 -60.551  1.00 122.70 ?  193  LYS C CB    1 
ATOM   4653  N  N     . SER C 2  190  ? 24.230  -51.622 -57.669  1.00 131.44 ?  194  SER C N     1 
ATOM   4654  C  CA    . SER C 2  190  ? 24.755  -52.724 -56.870  1.00 130.77 ?  194  SER C CA    1 
ATOM   4655  C  C     . SER C 2  190  ? 24.995  -53.969 -57.712  1.00 128.70 ?  194  SER C C     1 
ATOM   4656  O  O     . SER C 2  190  ? 25.877  -54.774 -57.392  1.00 128.57 ?  194  SER C O     1 
ATOM   4657  C  CB    . SER C 2  190  ? 23.800  -53.037 -55.719  1.00 133.85 ?  194  SER C CB    1 
ATOM   4658  N  N     . THR C 2  191  ? 24.230  -54.142 -58.791  1.00 127.74 ?  195  THR C N     1 
ATOM   4659  C  CA    . THR C 2  191  ? 24.442  -55.261 -59.699  1.00 125.82 ?  195  THR C CA    1 
ATOM   4660  C  C     . THR C 2  191  ? 25.766  -55.179 -60.444  1.00 127.57 ?  195  THR C C     1 
ATOM   4661  O  O     . THR C 2  191  ? 26.093  -56.120 -61.175  1.00 126.71 ?  195  THR C O     1 
ATOM   4662  C  CB    . THR C 2  191  ? 23.304  -55.350 -60.719  1.00 124.08 ?  195  THR C CB    1 
ATOM   4663  O  OG1   . THR C 2  191  ? 23.022  -54.046 -61.242  1.00 124.32 ?  195  THR C OG1   1 
ATOM   4664  C  CG2   . THR C 2  191  ? 22.055  -55.931 -60.081  1.00 120.15 ?  195  THR C CG2   1 
ATOM   4665  N  N     . ASP C 2  192  ? 26.509  -54.078 -60.303  1.00 126.64 ?  196  ASP C N     1 
ATOM   4666  C  CA    . ASP C 2  192  ? 27.749  -53.783 -61.016  1.00 125.74 ?  196  ASP C CA    1 
ATOM   4667  C  C     . ASP C 2  192  ? 27.477  -53.431 -62.477  1.00 127.18 ?  196  ASP C C     1 
ATOM   4668  O  O     . ASP C 2  192  ? 28.402  -53.028 -63.193  1.00 125.36 ?  196  ASP C O     1 
ATOM   4669  C  CB    . ASP C 2  192  ? 28.762  -54.939 -60.910  1.00 123.96 ?  196  ASP C CB    1 
ATOM   4670  C  CG    . ASP C 2  192  ? 30.057  -54.667 -61.645  1.00 125.64 ?  196  ASP C CG    1 
ATOM   4671  O  OD1   . ASP C 2  192  ? 30.828  -53.794 -61.197  1.00 123.97 ?  196  ASP C OD1   1 
ATOM   4672  O  OD2   . ASP C 2  192  ? 30.305  -55.338 -62.668  1.00 128.60 ?  196  ASP C OD2   1 
ATOM   4673  N  N     . LYS C 2  193  ? 26.232  -53.529 -62.931  1.00 128.08 ?  197  LYS C N     1 
ATOM   4674  C  CA    . LYS C 2  193  ? 25.872  -53.248 -64.312  1.00 126.60 ?  197  LYS C CA    1 
ATOM   4675  C  C     . LYS C 2  193  ? 25.571  -51.768 -64.513  1.00 123.33 ?  197  LYS C C     1 
ATOM   4676  O  O     . LYS C 2  193  ? 25.037  -51.091 -63.630  1.00 122.48 ?  197  LYS C O     1 
ATOM   4677  C  CB    . LYS C 2  193  ? 24.670  -54.091 -64.735  1.00 124.87 ?  197  LYS C CB    1 
ATOM   4678  C  CG    . LYS C 2  193  ? 24.977  -55.574 -64.782  1.00 131.42 ?  197  LYS C CG    1 
ATOM   4679  C  CD    . LYS C 2  193  ? 26.263  -55.824 -65.555  1.00 127.18 ?  197  LYS C CD    1 
ATOM   4680  C  CE    . LYS C 2  193  ? 26.701  -57.274 -65.461  1.00 126.44 ?  197  LYS C CE    1 
ATOM   4681  N  NZ    . LYS C 2  193  ? 27.984  -57.504 -66.181  1.00 128.79 ?  197  LYS C NZ    1 
ATOM   4682  N  N     . THR C 2  194  ? 25.928  -51.273 -65.694  1.00 118.28 ?  198  THR C N     1 
ATOM   4683  C  CA    . THR C 2  194  ? 25.789  -49.861 -66.013  1.00 111.18 ?  198  THR C CA    1 
ATOM   4684  C  C     . THR C 2  194  ? 24.342  -49.502 -66.321  1.00 109.91 ?  198  THR C C     1 
ATOM   4685  O  O     . THR C 2  194  ? 23.626  -50.252 -66.991  1.00 107.13 ?  198  THR C O     1 
ATOM   4686  C  CB    . THR C 2  194  ? 26.667  -49.501 -67.210  1.00 106.60 ?  198  THR C CB    1 
ATOM   4687  O  OG1   . THR C 2  194  ? 26.107  -50.074 -68.399  1.00 104.08 ?  198  THR C OG1   1 
ATOM   4688  C  CG2   . THR C 2  194  ? 28.074  -50.042 -67.017  1.00 109.01 ?  198  THR C CG2   1 
ATOM   4689  N  N     . LEU C 2  195  ? 23.920  -48.339 -65.832  1.00 107.57 ?  199  LEU C N     1 
ATOM   4690  C  CA    . LEU C 2  195  ? 22.634  -47.746 -66.161  1.00 101.18 ?  199  LEU C CA    1 
ATOM   4691  C  C     . LEU C 2  195  ? 22.869  -46.425 -66.879  1.00 98.36  ?  199  LEU C C     1 
ATOM   4692  O  O     . LEU C 2  195  ? 23.930  -45.808 -66.752  1.00 99.34  ?  199  LEU C O     1 
ATOM   4693  C  CB    . LEU C 2  195  ? 21.774  -47.514 -64.910  1.00 100.84 ?  199  LEU C CB    1 
ATOM   4694  C  CG    . LEU C 2  195  ? 20.966  -48.679 -64.334  1.00 102.52 ?  199  LEU C CG    1 
ATOM   4695  C  CD1   . LEU C 2  195  ? 21.869  -49.758 -63.759  1.00 106.87 ?  199  LEU C CD1   1 
ATOM   4696  C  CD2   . LEU C 2  195  ? 20.002  -48.166 -63.278  1.00 101.92 ?  199  LEU C CD2   1 
ATOM   4697  N  N     . HIS C 2  196  ? 21.871  -45.995 -67.647  1.00 97.22  ?  200  HIS C N     1 
ATOM   4698  C  CA    . HIS C 2  196  ? 21.981  -44.788 -68.453  1.00 90.94  ?  200  HIS C CA    1 
ATOM   4699  C  C     . HIS C 2  196  ? 20.783  -43.887 -68.196  1.00 88.45  ?  200  HIS C C     1 
ATOM   4700  O  O     . HIS C 2  196  ? 19.634  -44.332 -68.280  1.00 86.81  ?  200  HIS C O     1 
ATOM   4701  C  CB    . HIS C 2  196  ? 22.092  -45.133 -69.941  1.00 88.59  ?  200  HIS C CB    1 
ATOM   4702  C  CG    . HIS C 2  196  ? 23.354  -45.856 -70.296  1.00 89.05  ?  200  HIS C CG    1 
ATOM   4703  N  ND1   . HIS C 2  196  ? 23.686  -47.082 -69.761  1.00 94.29  ?  200  HIS C ND1   1 
ATOM   4704  C  CD2   . HIS C 2  196  ? 24.372  -45.521 -71.123  1.00 87.59  ?  200  HIS C CD2   1 
ATOM   4705  C  CE1   . HIS C 2  196  ? 24.850  -47.473 -70.247  1.00 95.47  ?  200  HIS C CE1   1 
ATOM   4706  N  NE2   . HIS C 2  196  ? 25.286  -46.544 -71.078  1.00 88.27  ?  200  HIS C NE2   1 
ATOM   4707  N  N     . SER C 2  197  ? 21.058  -42.622 -67.890  1.00 91.22  ?  201  SER C N     1 
ATOM   4708  C  CA    . SER C 2  197  ? 20.042  -41.637 -67.557  1.00 85.72  ?  201  SER C CA    1 
ATOM   4709  C  C     . SER C 2  197  ? 20.150  -40.448 -68.502  1.00 78.33  ?  201  SER C C     1 
ATOM   4710  O  O     . SER C 2  197  ? 21.160  -40.262 -69.185  1.00 79.41  ?  201  SER C O     1 
ATOM   4711  C  CB    . SER C 2  197  ? 20.186  -41.159 -66.106  1.00 81.22  ?  201  SER C CB    1 
ATOM   4712  O  OG    . SER C 2  197  ? 20.550  -42.228 -65.250  1.00 88.52  ?  201  SER C OG    1 
ATOM   4713  N  N     . VAL C 2  198  ? 19.090  -39.646 -68.546  1.00 74.78  ?  202  VAL C N     1 
ATOM   4714  C  CA    . VAL C 2  198  ? 19.078  -38.438 -69.364  1.00 74.31  ?  202  VAL C CA    1 
ATOM   4715  C  C     . VAL C 2  198  ? 18.166  -37.410 -68.708  1.00 78.48  ?  202  VAL C C     1 
ATOM   4716  O  O     . VAL C 2  198  ? 17.138  -37.757 -68.118  1.00 81.15  ?  202  VAL C O     1 
ATOM   4717  C  CB    . VAL C 2  198  ? 18.644  -38.745 -70.814  1.00 74.23  ?  202  VAL C CB    1 
ATOM   4718  C  CG1   . VAL C 2  198  ? 17.359  -39.535 -70.825  1.00 80.28  ?  202  VAL C CG1   1 
ATOM   4719  C  CG2   . VAL C 2  198  ? 18.488  -37.463 -71.618  1.00 73.58  ?  202  VAL C CG2   1 
ATOM   4720  N  N     . LYS C 2  199  ? 18.557  -36.141 -68.804  1.00 75.78  ?  203  LYS C N     1 
ATOM   4721  C  CA    . LYS C 2  199  ? 17.758  -35.026 -68.324  1.00 71.82  ?  203  LYS C CA    1 
ATOM   4722  C  C     . LYS C 2  199  ? 17.549  -34.033 -69.456  1.00 71.94  ?  203  LYS C C     1 
ATOM   4723  O  O     . LYS C 2  199  ? 18.486  -33.709 -70.190  1.00 67.48  ?  203  LYS C O     1 
ATOM   4724  C  CB    . LYS C 2  199  ? 18.431  -34.323 -67.140  1.00 78.93  ?  203  LYS C CB    1 
ATOM   4725  C  CG    . LYS C 2  199  ? 18.593  -35.187 -65.908  1.00 84.58  ?  203  LYS C CG    1 
ATOM   4726  C  CD    . LYS C 2  199  ? 19.464  -34.500 -64.869  1.00 90.24  ?  203  LYS C CD    1 
ATOM   4727  C  CE    . LYS C 2  199  ? 19.634  -35.370 -63.637  1.00 100.79 ?  203  LYS C CE    1 
ATOM   4728  N  NZ    . LYS C 2  199  ? 20.644  -34.812 -62.699  1.00 101.31 ?  203  LYS C NZ    1 
ATOM   4729  N  N     . VAL C 2  200  ? 16.316  -33.560 -69.596  1.00 75.12  ?  204  VAL C N     1 
ATOM   4730  C  CA    . VAL C 2  200  ? 15.980  -32.487 -70.523  1.00 72.72  ?  204  VAL C CA    1 
ATOM   4731  C  C     . VAL C 2  200  ? 15.726  -31.244 -69.685  1.00 73.01  ?  204  VAL C C     1 
ATOM   4732  O  O     . VAL C 2  200  ? 14.731  -31.169 -68.954  1.00 79.26  ?  204  VAL C O     1 
ATOM   4733  C  CB    . VAL C 2  200  ? 14.763  -32.834 -71.391  1.00 75.09  ?  204  VAL C CB    1 
ATOM   4734  C  CG1   . VAL C 2  200  ? 14.421  -31.669 -72.306  1.00 71.43  ?  204  VAL C CG1   1 
ATOM   4735  C  CG2   . VAL C 2  200  ? 15.034  -34.091 -72.200  1.00 76.82  ?  204  VAL C CG2   1 
ATOM   4736  N  N     . ILE C 2  201  ? 16.620  -30.272 -69.784  1.00 68.31  ?  205  ILE C N     1 
ATOM   4737  C  CA    . ILE C 2  201  ? 16.594  -29.075 -68.949  1.00 67.15  ?  205  ILE C CA    1 
ATOM   4738  C  C     . ILE C 2  201  ? 16.240  -27.887 -69.835  1.00 63.96  ?  205  ILE C C     1 
ATOM   4739  O  O     . ILE C 2  201  ? 16.966  -27.603 -70.795  1.00 61.56  ?  205  ILE C O     1 
ATOM   4740  C  CB    . ILE C 2  201  ? 17.937  -28.855 -68.238  1.00 71.54  ?  205  ILE C CB    1 
ATOM   4741  C  CG1   . ILE C 2  201  ? 18.140  -29.917 -67.157  1.00 73.44  ?  205  ILE C CG1   1 
ATOM   4742  C  CG2   . ILE C 2  201  ? 18.005  -27.459 -67.642  1.00 72.85  ?  205  ILE C CG2   1 
ATOM   4743  C  CD1   . ILE C 2  201  ? 19.380  -30.752 -67.347  1.00 70.75  ?  205  ILE C CD1   1 
ATOM   4744  N  N     . PRO C 2  202  ? 15.125  -27.201 -69.586  1.00 66.39  ?  206  PRO C N     1 
ATOM   4745  C  CA    . PRO C 2  202  ? 14.822  -25.981 -70.342  1.00 67.88  ?  206  PRO C CA    1 
ATOM   4746  C  C     . PRO C 2  202  ? 15.299  -24.724 -69.635  1.00 66.90  ?  206  PRO C C     1 
ATOM   4747  O  O     . PRO C 2  202  ? 15.826  -24.791 -68.520  1.00 65.34  ?  206  PRO C O     1 
ATOM   4748  C  CB    . PRO C 2  202  ? 13.296  -26.019 -70.436  1.00 72.90  ?  206  PRO C CB    1 
ATOM   4749  C  CG    . PRO C 2  202  ? 12.895  -26.632 -69.122  1.00 74.25  ?  206  PRO C CG    1 
ATOM   4750  C  CD    . PRO C 2  202  ? 13.995  -27.608 -68.734  1.00 72.52  ?  206  PRO C CD    1 
ATOM   4751  N  N     . SER C 2  203  ? 15.096  -23.565 -70.265  1.00 66.39  ?  207  SER C N     1 
ATOM   4752  C  CA    . SER C 2  203  ? 15.341  -22.302 -69.577  1.00 65.22  ?  207  SER C CA    1 
ATOM   4753  C  C     . SER C 2  203  ? 14.262  -22.042 -68.535  1.00 65.04  ?  207  SER C C     1 
ATOM   4754  O  O     . SER C 2  203  ? 14.559  -21.750 -67.372  1.00 61.93  ?  207  SER C O     1 
ATOM   4755  C  CB    . SER C 2  203  ? 15.404  -21.157 -70.587  1.00 65.46  ?  207  SER C CB    1 
ATOM   4756  O  OG    . SER C 2  203  ? 15.598  -19.915 -69.934  1.00 58.60  ?  207  SER C OG    1 
ATOM   4757  N  N     . ARG C 2  204  ? 13.000  -22.139 -68.942  1.00 71.50  ?  208  ARG C N     1 
ATOM   4758  C  CA    . ARG C 2  204  ? 11.866  -22.074 -68.033  1.00 77.64  ?  208  ARG C CA    1 
ATOM   4759  C  C     . ARG C 2  204  ? 10.860  -23.127 -68.465  1.00 77.39  ?  208  ARG C C     1 
ATOM   4760  O  O     . ARG C 2  204  ? 10.449  -23.148 -69.628  1.00 82.36  ?  208  ARG C O     1 
ATOM   4761  C  CB    . ARG C 2  204  ? 11.220  -20.683 -68.037  1.00 74.77  ?  208  ARG C CB    1 
ATOM   4762  N  N     . GLY C 2  205  ? 10.475  -24.002 -67.546  1.00 76.69  ?  209  GLY C N     1 
ATOM   4763  C  CA    . GLY C 2  205  ? 9.487   -25.009 -67.884  1.00 84.23  ?  209  GLY C CA    1 
ATOM   4764  C  C     . GLY C 2  205  ? 9.556   -26.188 -66.931  1.00 85.83  ?  209  GLY C C     1 
ATOM   4765  O  O     . GLY C 2  205  ? 10.036  -26.071 -65.806  1.00 86.93  ?  209  GLY C O     1 
ATOM   4766  N  N     . ALA C 2  206  ? 9.060   -27.319 -67.421  1.00 90.73  ?  210  ALA C N     1 
ATOM   4767  C  CA    . ALA C 2  206  ? 8.930   -28.537 -66.636  1.00 93.93  ?  210  ALA C CA    1 
ATOM   4768  C  C     . ALA C 2  206  ? 10.051  -29.508 -66.974  1.00 93.26  ?  210  ALA C C     1 
ATOM   4769  O  O     . ALA C 2  206  ? 10.479  -29.607 -68.128  1.00 90.78  ?  210  ALA C O     1 
ATOM   4770  C  CB    . ALA C 2  206  ? 7.575   -29.199 -66.888  1.00 94.52  ?  210  ALA C CB    1 
ATOM   4771  N  N     . TRP C 2  207  ? 10.520  -30.226 -65.960  1.00 96.32  ?  211  TRP C N     1 
ATOM   4772  C  CA    . TRP C 2  207  ? 11.600  -31.180 -66.145  1.00 96.70  ?  211  TRP C CA    1 
ATOM   4773  C  C     . TRP C 2  207  ? 11.074  -32.515 -66.654  1.00 96.44  ?  211  TRP C C     1 
ATOM   4774  O  O     . TRP C 2  207  ? 9.979   -32.958 -66.295  1.00 100.83 ?  211  TRP C O     1 
ATOM   4775  C  CB    . TRP C 2  207  ? 12.362  -31.385 -64.839  1.00 101.37 ?  211  TRP C CB    1 
ATOM   4776  C  CG    . TRP C 2  207  ? 13.495  -30.435 -64.682  1.00 97.56  ?  211  TRP C CG    1 
ATOM   4777  C  CD1   . TRP C 2  207  ? 13.937  -29.532 -65.601  1.00 93.66  ?  211  TRP C CD1   1 
ATOM   4778  C  CD2   . TRP C 2  207  ? 14.339  -30.293 -63.539  1.00 100.61 ?  211  TRP C CD2   1 
ATOM   4779  N  NE1   . TRP C 2  207  ? 15.006  -28.833 -65.101  1.00 95.43  ?  211  TRP C NE1   1 
ATOM   4780  C  CE2   . TRP C 2  207  ? 15.273  -29.282 -63.835  1.00 101.85 ?  211  TRP C CE2   1 
ATOM   4781  C  CE3   . TRP C 2  207  ? 14.397  -30.921 -62.293  1.00 104.82 ?  211  TRP C CE3   1 
ATOM   4782  C  CZ2   . TRP C 2  207  ? 16.251  -28.885 -62.932  1.00 109.57 ?  211  TRP C CZ2   1 
ATOM   4783  C  CZ3   . TRP C 2  207  ? 15.366  -30.526 -61.400  1.00 110.24 ?  211  TRP C CZ3   1 
ATOM   4784  C  CH2   . TRP C 2  207  ? 16.283  -29.520 -61.724  1.00 111.20 ?  211  TRP C CH2   1 
ATOM   4785  N  N     . LEU C 2  208  ? 11.876  -33.156 -67.500  1.00 94.00  ?  212  LEU C N     1 
ATOM   4786  C  CA    . LEU C 2  208  ? 11.536  -34.440 -68.100  1.00 92.15  ?  212  LEU C CA    1 
ATOM   4787  C  C     . LEU C 2  208  ? 12.751  -35.349 -68.016  1.00 93.27  ?  212  LEU C C     1 
ATOM   4788  O  O     . LEU C 2  208  ? 13.812  -35.017 -68.554  1.00 91.08  ?  212  LEU C O     1 
ATOM   4789  C  CB    . LEU C 2  208  ? 11.091  -34.261 -69.553  1.00 86.31  ?  212  LEU C CB    1 
ATOM   4790  C  CG    . LEU C 2  208  ? 10.675  -35.528 -70.293  1.00 91.29  ?  212  LEU C CG    1 
ATOM   4791  C  CD1   . LEU C 2  208  ? 9.516   -36.195 -69.578  1.00 99.25  ?  212  LEU C CD1   1 
ATOM   4792  C  CD2   . LEU C 2  208  ? 10.307  -35.199 -71.728  1.00 91.04  ?  212  LEU C CD2   1 
ATOM   4793  N  N     . GLU C 2  209  ? 12.599  -36.488 -67.346  1.00 94.31  ?  213  GLU C N     1 
ATOM   4794  C  CA    . GLU C 2  209  ? 13.688  -37.433 -67.145  1.00 95.14  ?  213  GLU C CA    1 
ATOM   4795  C  C     . GLU C 2  209  ? 13.310  -38.802 -67.691  1.00 99.03  ?  213  GLU C C     1 
ATOM   4796  O  O     . GLU C 2  209  ? 12.192  -39.279 -67.478  1.00 103.02 ?  213  GLU C O     1 
ATOM   4797  C  CB    . GLU C 2  209  ? 14.050  -37.557 -65.662  1.00 95.71  ?  213  GLU C CB    1 
ATOM   4798  C  CG    . GLU C 2  209  ? 14.941  -36.447 -65.141  1.00 94.86  ?  213  GLU C CG    1 
ATOM   4799  C  CD    . GLU C 2  209  ? 15.645  -36.829 -63.853  1.00 98.56  ?  213  GLU C CD    1 
ATOM   4800  O  OE1   . GLU C 2  209  ? 15.070  -36.608 -62.767  1.00 96.69  ?  213  GLU C OE1   1 
ATOM   4801  O  OE2   . GLU C 2  209  ? 16.770  -37.365 -63.931  1.00 99.08  ?  213  GLU C OE2   1 
ATOM   4802  N  N     . PHE C 2  210  ? 14.252  -39.432 -68.391  1.00 94.47  ?  214  PHE C N     1 
ATOM   4803  C  CA    . PHE C 2  210  ? 14.114  -40.805 -68.856  1.00 92.58  ?  214  PHE C CA    1 
ATOM   4804  C  C     . PHE C 2  210  ? 15.220  -41.644 -68.235  1.00 92.32  ?  214  PHE C C     1 
ATOM   4805  O  O     . PHE C 2  210  ? 16.382  -41.227 -68.216  1.00 91.32  ?  214  PHE C O     1 
ATOM   4806  C  CB    . PHE C 2  210  ? 14.177  -40.897 -70.381  1.00 89.95  ?  214  PHE C CB    1 
ATOM   4807  C  CG    . PHE C 2  210  ? 13.122  -40.100 -71.083  1.00 89.66  ?  214  PHE C CG    1 
ATOM   4808  C  CD1   . PHE C 2  210  ? 11.790  -40.448 -70.975  1.00 95.07  ?  214  PHE C CD1   1 
ATOM   4809  C  CD2   . PHE C 2  210  ? 13.462  -39.011 -71.865  1.00 93.27  ?  214  PHE C CD2   1 
ATOM   4810  C  CE1   . PHE C 2  210  ? 10.813  -39.720 -71.623  1.00 99.55  ?  214  PHE C CE1   1 
ATOM   4811  C  CE2   . PHE C 2  210  ? 12.490  -38.278 -72.517  1.00 95.14  ?  214  PHE C CE2   1 
ATOM   4812  C  CZ    . PHE C 2  210  ? 11.164  -38.634 -72.396  1.00 95.18  ?  214  PHE C CZ    1 
ATOM   4813  N  N     . ASP C 2  211  ? 14.860  -42.820 -67.728  1.00 93.12  ?  215  ASP C N     1 
ATOM   4814  C  CA    . ASP C 2  211  ? 15.805  -43.678 -67.025  1.00 93.57  ?  215  ASP C CA    1 
ATOM   4815  C  C     . ASP C 2  211  ? 15.588  -45.124 -67.437  1.00 97.95  ?  215  ASP C C     1 
ATOM   4816  O  O     . ASP C 2  211  ? 14.475  -45.643 -67.310  1.00 101.16 ?  215  ASP C O     1 
ATOM   4817  C  CB    . ASP C 2  211  ? 15.652  -43.529 -65.509  1.00 98.40  ?  215  ASP C CB    1 
ATOM   4818  C  CG    . ASP C 2  211  ? 16.272  -44.680 -64.746  1.00 104.16 ?  215  ASP C CG    1 
ATOM   4819  O  OD1   . ASP C 2  211  ? 17.514  -44.709 -64.615  1.00 100.40 ?  215  ASP C OD1   1 
ATOM   4820  O  OD2   . ASP C 2  211  ? 15.516  -45.555 -64.272  1.00 105.49 ?  215  ASP C OD2   1 
ATOM   4821  N  N     . VAL C 2  212  ? 16.643  -45.772 -67.920  1.00 96.81  ?  216  VAL C N     1 
ATOM   4822  C  CA    . VAL C 2  212  ? 16.613  -47.218 -68.102  1.00 97.37  ?  216  VAL C CA    1 
ATOM   4823  C  C     . VAL C 2  212  ? 16.845  -47.869 -66.745  1.00 100.02 ?  216  VAL C C     1 
ATOM   4824  O  O     . VAL C 2  212  ? 17.764  -47.495 -66.005  1.00 97.04  ?  216  VAL C O     1 
ATOM   4825  C  CB    . VAL C 2  212  ? 17.647  -47.668 -69.151  1.00 94.67  ?  216  VAL C CB    1 
ATOM   4826  C  CG1   . VAL C 2  212  ? 17.427  -46.919 -70.457  1.00 95.62  ?  216  VAL C CG1   1 
ATOM   4827  C  CG2   . VAL C 2  212  ? 19.076  -47.476 -68.665  1.00 99.53  ?  216  VAL C CG2   1 
ATOM   4828  N  N     . ASP C 2  213  ? 15.979  -48.810 -66.387  1.00 104.46 ?  217  ASP C N     1 
ATOM   4829  C  CA    . ASP C 2  213  ? 15.962  -49.310 -65.022  1.00 105.87 ?  217  ASP C CA    1 
ATOM   4830  C  C     . ASP C 2  213  ? 17.081  -50.311 -64.781  1.00 106.30 ?  217  ASP C C     1 
ATOM   4831  O  O     . ASP C 2  213  ? 17.528  -51.019 -65.689  1.00 106.22 ?  217  ASP C O     1 
ATOM   4832  C  CB    . ASP C 2  213  ? 14.617  -49.961 -64.697  1.00 103.94 ?  217  ASP C CB    1 
ATOM   4833  N  N     . LYS C 2  214  ? 17.539  -50.353 -63.529  1.00 109.09 ?  218  LYS C N     1 
ATOM   4834  C  CA    . LYS C 2  214  ? 18.339  -51.473 -63.055  1.00 107.92 ?  218  LYS C CA    1 
ATOM   4835  C  C     . LYS C 2  214  ? 17.592  -52.790 -63.220  1.00 105.31 ?  218  LYS C C     1 
ATOM   4836  O  O     . LYS C 2  214  ? 18.223  -53.845 -63.339  1.00 102.15 ?  218  LYS C O     1 
ATOM   4837  C  CB    . LYS C 2  214  ? 18.717  -51.231 -61.593  1.00 111.44 ?  218  LYS C CB    1 
ATOM   4838  C  CG    . LYS C 2  214  ? 19.638  -52.255 -60.965  1.00 114.84 ?  218  LYS C CG    1 
ATOM   4839  C  CD    . LYS C 2  214  ? 20.049  -51.790 -59.576  1.00 117.56 ?  218  LYS C CD    1 
ATOM   4840  C  CE    . LYS C 2  214  ? 20.711  -52.897 -58.783  1.00 121.27 ?  218  LYS C CE    1 
ATOM   4841  N  NZ    . LYS C 2  214  ? 19.782  -54.037 -58.557  1.00 116.56 ?  218  LYS C NZ    1 
ATOM   4842  N  N     . ARG C 2  215  ? 16.262  -52.738 -63.251  1.00 106.27 ?  219  ARG C N     1 
ATOM   4843  C  CA    . ARG C 2  215  ? 15.405  -53.869 -63.570  1.00 105.13 ?  219  ARG C CA    1 
ATOM   4844  C  C     . ARG C 2  215  ? 15.137  -53.987 -65.065  1.00 104.48 ?  219  ARG C C     1 
ATOM   4845  O  O     . ARG C 2  215  ? 14.298  -54.800 -65.469  1.00 104.91 ?  219  ARG C O     1 
ATOM   4846  C  CB    . ARG C 2  215  ? 14.081  -53.760 -62.810  1.00 100.43 ?  219  ARG C CB    1 
ATOM   4847  N  N     . ASP C 2  216  ? 15.813  -53.178 -65.883  1.00 105.94 ?  220  ASP C N     1 
ATOM   4848  C  CA    . ASP C 2  216  ? 15.652  -53.158 -67.337  1.00 102.51 ?  220  ASP C CA    1 
ATOM   4849  C  C     . ASP C 2  216  ? 14.226  -52.756 -67.728  1.00 102.62 ?  220  ASP C C     1 
ATOM   4850  O  O     . ASP C 2  216  ? 13.421  -53.550 -68.220  1.00 104.12 ?  220  ASP C O     1 
ATOM   4851  C  CB    . ASP C 2  216  ? 16.046  -54.508 -67.951  1.00 100.81 ?  220  ASP C CB    1 
ATOM   4852  C  CG    . ASP C 2  216  ? 17.541  -54.747 -67.913  1.00 101.10 ?  220  ASP C CG    1 
ATOM   4853  O  OD1   . ASP C 2  216  ? 18.282  -53.814 -67.542  1.00 101.77 ?  220  ASP C OD1   1 
ATOM   4854  O  OD2   . ASP C 2  216  ? 17.977  -55.862 -68.265  1.00 102.03 ?  220  ASP C OD2   1 
ATOM   4855  N  N     . THR C 2  217  ? 13.943  -51.480 -67.479  1.00 103.24 ?  221  THR C N     1 
ATOM   4856  C  CA    . THR C 2  217  ? 12.726  -50.829 -67.942  1.00 106.62 ?  221  THR C CA    1 
ATOM   4857  C  C     . THR C 2  217  ? 13.039  -49.357 -68.165  1.00 106.48 ?  221  THR C C     1 
ATOM   4858  O  O     . THR C 2  217  ? 13.830  -48.769 -67.424  1.00 105.25 ?  221  THR C O     1 
ATOM   4859  C  CB    . THR C 2  217  ? 11.578  -50.987 -66.939  1.00 104.44 ?  221  THR C CB    1 
ATOM   4860  N  N     . VAL C 2  218  ? 12.424  -48.763 -69.181  1.00 104.34 ?  222  VAL C N     1 
ATOM   4861  C  CA    . VAL C 2  218  ? 12.699  -47.376 -69.538  1.00 98.80  ?  222  VAL C CA    1 
ATOM   4862  C  C     . VAL C 2  218  ? 11.664  -46.498 -68.844  1.00 100.20 ?  222  VAL C C     1 
ATOM   4863  O  O     . VAL C 2  218  ? 10.488  -46.496 -69.215  1.00 104.98 ?  222  VAL C O     1 
ATOM   4864  C  CB    . VAL C 2  218  ? 12.679  -47.175 -71.057  1.00 98.10  ?  222  VAL C CB    1 
ATOM   4865  C  CG1   . VAL C 2  218  ? 13.303  -45.840 -71.421  1.00 103.52 ?  222  VAL C CG1   1 
ATOM   4866  C  CG2   . VAL C 2  218  ? 13.410  -48.317 -71.740  1.00 98.32  ?  222  VAL C CG2   1 
ATOM   4867  N  N     . GLY C 2  219  ? 12.110  -45.730 -67.847  1.00 99.64  ?  223  GLY C N     1 
ATOM   4868  C  CA    . GLY C 2  219  ? 11.222  -44.930 -67.034  1.00 102.31 ?  223  GLY C CA    1 
ATOM   4869  C  C     . GLY C 2  219  ? 11.125  -43.487 -67.506  1.00 100.68 ?  223  GLY C C     1 
ATOM   4870  O  O     . GLY C 2  219  ? 11.918  -43.010 -68.310  1.00 101.00 ?  223  GLY C O     1 
ATOM   4871  N  N     . VAL C 2  220  ? 10.107  -42.796 -66.992  1.00 105.37 ?  224  VAL C N     1 
ATOM   4872  C  CA    . VAL C 2  220  ? 9.862   -41.391 -67.307  1.00 102.50 ?  224  VAL C CA    1 
ATOM   4873  C  C     . VAL C 2  220  ? 9.469   -40.667 -66.028  1.00 106.86 ?  224  VAL C C     1 
ATOM   4874  O  O     . VAL C 2  220  ? 8.538   -41.087 -65.335  1.00 110.07 ?  224  VAL C O     1 
ATOM   4875  C  CB    . VAL C 2  220  ? 8.757   -41.208 -68.366  1.00 103.36 ?  224  VAL C CB    1 
ATOM   4876  C  CG1   . VAL C 2  220  ? 8.603   -39.736 -68.715  1.00 104.11 ?  224  VAL C CG1   1 
ATOM   4877  C  CG2   . VAL C 2  220  ? 9.052   -42.019 -69.606  1.00 108.75 ?  224  VAL C CG2   1 
ATOM   4878  N  N     . ARG C 2  221  ? 10.154  -39.567 -65.730  1.00 106.61 ?  225  ARG C N     1 
ATOM   4879  C  CA    . ARG C 2  221  ? 9.842   -38.730 -64.579  1.00 107.91 ?  225  ARG C CA    1 
ATOM   4880  C  C     . ARG C 2  221  ? 9.570   -37.310 -65.055  1.00 108.24 ?  225  ARG C C     1 
ATOM   4881  O  O     . ARG C 2  221  ? 10.393  -36.723 -65.766  1.00 107.22 ?  225  ARG C O     1 
ATOM   4882  C  CB    . ARG C 2  221  ? 10.985  -38.743 -63.560  1.00 104.49 ?  225  ARG C CB    1 
ATOM   4883  N  N     . ILE C 2  222  ? 8.421   -36.763 -64.665  1.00 110.55 ?  226  ILE C N     1 
ATOM   4884  C  CA    . ILE C 2  222  ? 7.994   -35.430 -65.082  1.00 112.49 ?  226  ILE C CA    1 
ATOM   4885  C  C     . ILE C 2  222  ? 7.852   -34.572 -63.833  1.00 111.24 ?  226  ILE C C     1 
ATOM   4886  O  O     . ILE C 2  222  ? 6.936   -34.786 -63.030  1.00 111.42 ?  226  ILE C O     1 
ATOM   4887  C  CB    . ILE C 2  222  ? 6.677   -35.466 -65.866  1.00 108.94 ?  226  ILE C CB    1 
ATOM   4888  C  CG1   . ILE C 2  222  ? 6.818   -36.340 -67.112  1.00 106.77 ?  226  ILE C CG1   1 
ATOM   4889  C  CG2   . ILE C 2  222  ? 6.244   -34.058 -66.242  1.00 109.05 ?  226  ILE C CG2   1 
ATOM   4890  C  CD1   . ILE C 2  222  ? 5.587   -36.346 -67.989  1.00 105.70 ?  226  ILE C CD1   1 
ATOM   4891  N  N     . ASP C 2  223  ? 8.731   -33.582 -63.687  1.00 107.78 ?  227  ASP C N     1 
ATOM   4892  C  CA    . ASP C 2  223  ? 8.733   -32.696 -62.523  1.00 110.11 ?  227  ASP C CA    1 
ATOM   4893  C  C     . ASP C 2  223  ? 8.688   -33.499 -61.226  1.00 112.00 ?  227  ASP C C     1 
ATOM   4894  O  O     . ASP C 2  223  ? 7.864   -33.253 -60.342  1.00 114.99 ?  227  ASP C O     1 
ATOM   4895  C  CB    . ASP C 2  223  ? 7.575   -31.698 -62.584  1.00 110.41 ?  227  ASP C CB    1 
ATOM   4896  C  CG    . ASP C 2  223  ? 7.856   -30.532 -63.507  1.00 108.81 ?  227  ASP C CG    1 
ATOM   4897  O  OD1   . ASP C 2  223  ? 9.033   -30.322 -63.868  1.00 110.12 ?  227  ASP C OD1   1 
ATOM   4898  O  OD2   . ASP C 2  223  ? 6.897   -29.814 -63.860  1.00 106.22 ?  227  ASP C OD2   1 
ATOM   4899  N  N     . ARG C 2  224  ? 9.577   -34.487 -61.134  1.00 113.29 ?  228  ARG C N     1 
ATOM   4900  C  CA    . ARG C 2  224  ? 9.764   -35.408 -60.012  1.00 119.50 ?  228  ARG C CA    1 
ATOM   4901  C  C     . ARG C 2  224  ? 8.698   -36.500 -59.961  1.00 117.17 ?  228  ARG C C     1 
ATOM   4902  O  O     . ARG C 2  224  ? 8.760   -37.343 -59.058  1.00 118.69 ?  228  ARG C O     1 
ATOM   4903  C  CB    . ARG C 2  224  ? 9.814   -34.701 -58.646  1.00 122.12 ?  228  ARG C CB    1 
ATOM   4904  C  CG    . ARG C 2  224  ? 10.833  -33.575 -58.567  1.00 124.36 ?  228  ARG C CG    1 
ATOM   4905  C  CD    . ARG C 2  224  ? 11.158  -33.221 -57.126  1.00 127.17 ?  228  ARG C CD    1 
ATOM   4906  N  NE    . ARG C 2  224  ? 12.066  -32.081 -57.032  1.00 125.13 ?  228  ARG C NE    1 
ATOM   4907  C  CZ    . ARG C 2  224  ? 13.378  -32.151 -57.234  1.00 122.61 ?  228  ARG C CZ    1 
ATOM   4908  N  NH1   . ARG C 2  224  ? 13.942  -33.308 -57.550  1.00 124.33 ?  228  ARG C NH1   1 
ATOM   4909  N  NH2   . ARG C 2  224  ? 14.125  -31.061 -57.125  1.00 119.97 ?  228  ARG C NH2   1 
ATOM   4910  N  N     . LYS C 2  225  ? 7.726   -36.517 -60.873  1.00 115.70 ?  229  LYS C N     1 
ATOM   4911  C  CA    . LYS C 2  225  ? 6.701   -37.552 -60.841  1.00 118.40 ?  229  LYS C CA    1 
ATOM   4912  C  C     . LYS C 2  225  ? 7.321   -38.930 -61.061  1.00 118.83 ?  229  LYS C C     1 
ATOM   4913  O  O     . LYS C 2  225  ? 8.393   -39.075 -61.655  1.00 121.40 ?  229  LYS C O     1 
ATOM   4914  C  CB    . LYS C 2  225  ? 5.628   -37.291 -61.897  1.00 121.08 ?  229  LYS C CB    1 
ATOM   4915  N  N     . ARG C 2  226  ? 6.626   -39.951 -60.568  1.00 118.54 ?  230  ARG C N     1 
ATOM   4916  C  CA    . ARG C 2  226  ? 7.187   -41.292 -60.534  1.00 119.88 ?  230  ARG C CA    1 
ATOM   4917  C  C     . ARG C 2  226  ? 7.246   -41.908 -61.929  1.00 117.64 ?  230  ARG C C     1 
ATOM   4918  O  O     . ARG C 2  226  ? 6.533   -41.508 -62.853  1.00 114.54 ?  230  ARG C O     1 
ATOM   4919  C  CB    . ARG C 2  226  ? 6.385   -42.186 -59.590  1.00 121.48 ?  230  ARG C CB    1 
ATOM   4920  C  CG    . ARG C 2  226  ? 6.937   -42.186 -58.179  1.00 120.45 ?  230  ARG C CG    1 
ATOM   4921  C  CD    . ARG C 2  226  ? 8.446   -42.368 -58.218  1.00 120.39 ?  230  ARG C CD    1 
ATOM   4922  N  NE    . ARG C 2  226  ? 9.057   -42.308 -56.895  1.00 123.46 ?  230  ARG C NE    1 
ATOM   4923  C  CZ    . ARG C 2  226  ? 10.368  -42.318 -56.682  1.00 120.48 ?  230  ARG C CZ    1 
ATOM   4924  N  NH1   . ARG C 2  226  ? 11.207  -42.381 -57.708  1.00 117.98 ?  230  ARG C NH1   1 
ATOM   4925  N  NH2   . ARG C 2  226  ? 10.843  -42.261 -55.446  1.00 119.33 ?  230  ARG C NH2   1 
ATOM   4926  N  N     . ARG C 2  227  ? 8.115   -42.907 -62.063  1.00 115.63 ?  231  ARG C N     1 
ATOM   4927  C  CA    . ARG C 2  227  ? 8.435   -43.461 -63.368  1.00 115.89 ?  231  ARG C CA    1 
ATOM   4928  C  C     . ARG C 2  227  ? 7.263   -44.235 -63.958  1.00 115.46 ?  231  ARG C C     1 
ATOM   4929  O  O     . ARG C 2  227  ? 6.421   -44.786 -63.245  1.00 117.03 ?  231  ARG C O     1 
ATOM   4930  C  CB    . ARG C 2  227  ? 9.659   -44.373 -63.280  1.00 116.43 ?  231  ARG C CB    1 
ATOM   4931  C  CG    . ARG C 2  227  ? 10.984  -43.634 -63.309  1.00 117.01 ?  231  ARG C CG    1 
ATOM   4932  C  CD    . ARG C 2  227  ? 12.142  -44.591 -63.531  1.00 112.48 ?  231  ARG C CD    1 
ATOM   4933  N  NE    . ARG C 2  227  ? 12.178  -45.644 -62.523  1.00 114.08 ?  231  ARG C NE    1 
ATOM   4934  C  CZ    . ARG C 2  227  ? 12.736  -45.509 -61.325  1.00 119.97 ?  231  ARG C CZ    1 
ATOM   4935  N  NH1   . ARG C 2  227  ? 12.724  -46.519 -60.467  1.00 118.62 ?  231  ARG C NH1   1 
ATOM   4936  N  NH2   . ARG C 2  227  ? 13.305  -44.360 -60.983  1.00 120.17 ?  231  ARG C NH2   1 
ATOM   4937  N  N     . GLN C 2  228  ? 7.221   -44.256 -65.281  1.00 116.94 ?  232  GLN C N     1 
ATOM   4938  C  CA    . GLN C 2  228  ? 6.312   -45.066 -66.072  1.00 117.61 ?  232  GLN C CA    1 
ATOM   4939  C  C     . GLN C 2  228  ? 7.079   -45.540 -67.294  1.00 117.66 ?  232  GLN C C     1 
ATOM   4940  O  O     . GLN C 2  228  ? 8.090   -44.934 -67.667  1.00 119.20 ?  232  GLN C O     1 
ATOM   4941  C  CB    . GLN C 2  228  ? 5.066   -44.275 -66.495  1.00 119.74 ?  232  GLN C CB    1 
ATOM   4942  N  N     . PRO C 2  229  ? 6.649   -46.634 -67.918  1.00 120.33 ?  233  PRO C N     1 
ATOM   4943  C  CA    . PRO C 2  229  ? 7.294   -47.063 -69.163  1.00 121.14 ?  233  PRO C CA    1 
ATOM   4944  C  C     . PRO C 2  229  ? 7.303   -45.933 -70.182  1.00 119.75 ?  233  PRO C C     1 
ATOM   4945  O  O     . PRO C 2  229  ? 6.318   -45.211 -70.344  1.00 120.99 ?  233  PRO C O     1 
ATOM   4946  C  CB    . PRO C 2  229  ? 6.427   -48.238 -69.622  1.00 128.24 ?  233  PRO C CB    1 
ATOM   4947  C  CG    . PRO C 2  229  ? 5.871   -48.793 -68.358  1.00 129.59 ?  233  PRO C CG    1 
ATOM   4948  C  CD    . PRO C 2  229  ? 5.643   -47.608 -67.456  1.00 126.44 ?  233  PRO C CD    1 
ATOM   4949  N  N     . VAL C 2  230  ? 8.444   -45.770 -70.858  1.00 117.18 ?  234  VAL C N     1 
ATOM   4950  C  CA    . VAL C 2  230  ? 8.593   -44.693 -71.832  1.00 119.04 ?  234  VAL C CA    1 
ATOM   4951  C  C     . VAL C 2  230  ? 7.528   -44.764 -72.914  1.00 126.64 ?  234  VAL C C     1 
ATOM   4952  O  O     . VAL C 2  230  ? 7.192   -43.742 -73.521  1.00 127.68 ?  234  VAL C O     1 
ATOM   4953  C  CB    . VAL C 2  230  ? 10.004  -44.717 -72.453  1.00 117.35 ?  234  VAL C CB    1 
ATOM   4954  N  N     . THR C 2  231  ? 6.986   -45.955 -73.171  1.00 129.64 ?  235  THR C N     1 
ATOM   4955  C  CA    . THR C 2  231  ? 5.940   -46.098 -74.176  1.00 132.83 ?  235  THR C CA    1 
ATOM   4956  C  C     . THR C 2  231  ? 4.640   -45.431 -73.744  1.00 132.39 ?  235  THR C C     1 
ATOM   4957  O  O     . THR C 2  231  ? 3.851   -45.012 -74.599  1.00 134.27 ?  235  THR C O     1 
ATOM   4958  C  CB    . THR C 2  231  ? 5.704   -47.580 -74.469  1.00 135.19 ?  235  THR C CB    1 
ATOM   4959  O  OG1   . THR C 2  231  ? 4.518   -47.735 -75.257  1.00 143.84 ?  235  THR C OG1   1 
ATOM   4960  C  CG2   . THR C 2  231  ? 5.552   -48.357 -73.172  1.00 135.68 ?  235  THR C CG2   1 
ATOM   4961  N  N     . VAL C 2  232  ? 4.400   -45.322 -72.434  1.00 130.64 ?  236  VAL C N     1 
ATOM   4962  C  CA    . VAL C 2  232  ? 3.152   -44.735 -71.947  1.00 132.11 ?  236  VAL C CA    1 
ATOM   4963  C  C     . VAL C 2  232  ? 3.007   -43.304 -72.449  1.00 131.39 ?  236  VAL C C     1 
ATOM   4964  O  O     . VAL C 2  232  ? 1.971   -42.923 -73.007  1.00 131.06 ?  236  VAL C O     1 
ATOM   4965  C  CB    . VAL C 2  232  ? 3.089   -44.798 -70.410  1.00 128.70 ?  236  VAL C CB    1 
ATOM   4966  C  CG1   . VAL C 2  232  ? 1.760   -44.251 -69.910  1.00 129.12 ?  236  VAL C CG1   1 
ATOM   4967  C  CG2   . VAL C 2  232  ? 3.300   -46.222 -69.926  1.00 132.71 ?  236  VAL C CG2   1 
ATOM   4968  N  N     . LEU C 2  233  ? 4.048   -42.491 -72.259  1.00 132.14 ?  237  LEU C N     1 
ATOM   4969  C  CA    . LEU C 2  233  ? 4.000   -41.111 -72.728  1.00 135.82 ?  237  LEU C CA    1 
ATOM   4970  C  C     . LEU C 2  233  ? 3.959   -41.043 -74.248  1.00 136.38 ?  237  LEU C C     1 
ATOM   4971  O  O     . LEU C 2  233  ? 3.196   -40.254 -74.817  1.00 136.22 ?  237  LEU C O     1 
ATOM   4972  C  CB    . LEU C 2  233  ? 5.201   -40.333 -72.193  1.00 136.59 ?  237  LEU C CB    1 
ATOM   4973  C  CG    . LEU C 2  233  ? 5.414   -38.948 -72.808  1.00 133.28 ?  237  LEU C CG    1 
ATOM   4974  C  CD1   . LEU C 2  233  ? 4.231   -38.037 -72.514  1.00 138.88 ?  237  LEU C CD1   1 
ATOM   4975  C  CD2   . LEU C 2  233  ? 6.711   -38.334 -72.308  1.00 121.84 ?  237  LEU C CD2   1 
ATOM   4976  N  N     . LEU C 2  234  ? 4.776   -41.856 -74.921  1.00 136.16 ?  238  LEU C N     1 
ATOM   4977  C  CA    . LEU C 2  234  ? 4.806   -41.828 -76.379  1.00 138.94 ?  238  LEU C CA    1 
ATOM   4978  C  C     . LEU C 2  234  ? 3.438   -42.164 -76.956  1.00 141.02 ?  238  LEU C C     1 
ATOM   4979  O  O     . LEU C 2  234  ? 2.954   -41.485 -77.868  1.00 142.27 ?  238  LEU C O     1 
ATOM   4980  C  CB    . LEU C 2  234  ? 5.868   -42.792 -76.906  1.00 139.10 ?  238  LEU C CB    1 
ATOM   4981  C  CG    . LEU C 2  234  ? 6.129   -42.651 -78.405  1.00 140.30 ?  238  LEU C CG    1 
ATOM   4982  C  CD1   . LEU C 2  234  ? 6.503   -41.216 -78.740  1.00 141.75 ?  238  LEU C CD1   1 
ATOM   4983  C  CD2   . LEU C 2  234  ? 7.215   -43.603 -78.858  1.00 140.38 ?  238  LEU C CD2   1 
ATOM   4984  N  N     . LYS C 2  235  ? 2.794   -43.205 -76.424  1.00 138.60 ?  239  LYS C N     1 
ATOM   4985  C  CA    . LYS C 2  235  ? 1.425   -43.510 -76.824  1.00 141.73 ?  239  LYS C CA    1 
ATOM   4986  C  C     . LYS C 2  235  ? 0.514   -42.312 -76.590  1.00 141.24 ?  239  LYS C C     1 
ATOM   4987  O  O     . LYS C 2  235  ? -0.195  -41.869 -77.503  1.00 143.61 ?  239  LYS C O     1 
ATOM   4988  C  CB    . LYS C 2  235  ? 0.916   -44.734 -76.062  1.00 150.98 ?  239  LYS C CB    1 
ATOM   4989  N  N     . ALA C 2  236  ? 0.554   -41.750 -75.374  1.00 138.90 ?  240  ALA C N     1 
ATOM   4990  C  CA    . ALA C 2  236  ? -0.267  -40.596 -75.019  1.00 138.11 ?  240  ALA C CA    1 
ATOM   4991  C  C     . ALA C 2  236  ? -0.028  -39.403 -75.930  1.00 136.48 ?  240  ALA C C     1 
ATOM   4992  O  O     . ALA C 2  236  ? -0.868  -38.499 -75.983  1.00 135.77 ?  240  ALA C O     1 
ATOM   4993  C  CB    . ALA C 2  236  ? -0.007  -40.189 -73.568  1.00 138.06 ?  240  ALA C CB    1 
ATOM   4994  N  N     . LEU C 2  237  ? 1.091   -39.378 -76.647  1.00 138.21 ?  241  LEU C N     1 
ATOM   4995  C  CA    . LEU C 2  237  ? 1.348   -38.343 -77.637  1.00 139.60 ?  241  LEU C CA    1 
ATOM   4996  C  C     . LEU C 2  237  ? 0.671   -38.645 -78.967  1.00 139.71 ?  241  LEU C C     1 
ATOM   4997  O  O     . LEU C 2  237  ? 0.842   -37.885 -79.926  1.00 139.04 ?  241  LEU C O     1 
ATOM   4998  C  CB    . LEU C 2  237  ? 2.858   -38.173 -77.836  1.00 138.33 ?  241  LEU C CB    1 
ATOM   4999  C  CG    . LEU C 2  237  ? 3.350   -36.862 -78.456  1.00 131.50 ?  241  LEU C CG    1 
ATOM   5000  C  CD1   . LEU C 2  237  ? 2.952   -35.675 -77.593  1.00 126.36 ?  241  LEU C CD1   1 
ATOM   5001  C  CD2   . LEU C 2  237  ? 4.853   -36.900 -78.667  1.00 126.50 ?  241  LEU C CD2   1 
ATOM   5002  N  N     . GLY C 2  238  ? -0.099  -39.726 -79.040  1.00 141.12 ?  242  GLY C N     1 
ATOM   5003  C  CA    . GLY C 2  238  ? -0.724  -40.145 -80.272  1.00 145.09 ?  242  GLY C CA    1 
ATOM   5004  C  C     . GLY C 2  238  ? -0.068  -41.316 -80.962  1.00 144.54 ?  242  GLY C C     1 
ATOM   5005  O  O     . GLY C 2  238  ? -0.355  -41.555 -82.140  1.00 145.11 ?  242  GLY C O     1 
ATOM   5006  N  N     . TRP C 2  239  ? 0.806   -42.048 -80.277  1.00 144.22 ?  243  TRP C N     1 
ATOM   5007  C  CA    . TRP C 2  239  ? 1.527   -43.146 -80.904  1.00 145.12 ?  243  TRP C CA    1 
ATOM   5008  C  C     . TRP C 2  239  ? 0.819   -44.470 -80.665  1.00 146.97 ?  243  TRP C C     1 
ATOM   5009  O  O     . TRP C 2  239  ? 0.311   -44.733 -79.571  1.00 145.40 ?  243  TRP C O     1 
ATOM   5010  C  CB    . TRP C 2  239  ? 2.961   -43.222 -80.384  1.00 145.55 ?  243  TRP C CB    1 
ATOM   5011  C  CG    . TRP C 2  239  ? 3.849   -42.185 -80.978  1.00 142.26 ?  243  TRP C CG    1 
ATOM   5012  C  CD1   . TRP C 2  239  ? 3.731   -40.833 -80.847  1.00 141.73 ?  243  TRP C CD1   1 
ATOM   5013  C  CD2   . TRP C 2  239  ? 4.998   -42.411 -81.801  1.00 141.22 ?  243  TRP C CD2   1 
ATOM   5014  N  NE1   . TRP C 2  239  ? 4.734   -40.202 -81.540  1.00 142.42 ?  243  TRP C NE1   1 
ATOM   5015  C  CE2   . TRP C 2  239  ? 5.526   -41.149 -82.134  1.00 141.47 ?  243  TRP C CE2   1 
ATOM   5016  C  CE3   . TRP C 2  239  ? 5.632   -43.557 -82.288  1.00 141.39 ?  243  TRP C CE3   1 
ATOM   5017  C  CZ2   . TRP C 2  239  ? 6.656   -41.001 -82.932  1.00 137.22 ?  243  TRP C CZ2   1 
ATOM   5018  C  CZ3   . TRP C 2  239  ? 6.754   -43.408 -83.079  1.00 142.33 ?  243  TRP C CZ3   1 
ATOM   5019  C  CH2   . TRP C 2  239  ? 7.254   -42.139 -83.392  1.00 137.24 ?  243  TRP C CH2   1 
ATOM   5020  N  N     . THR C 2  240  ? 0.781   -45.295 -81.704  1.00 148.52 ?  244  THR C N     1 
ATOM   5021  C  CA    . THR C 2  240  ? 0.244   -46.639 -81.600  1.00 151.25 ?  244  THR C CA    1 
ATOM   5022  C  C     . THR C 2  240  ? 1.277   -47.574 -80.978  1.00 150.85 ?  244  THR C C     1 
ATOM   5023  O  O     . THR C 2  240  ? 2.487   -47.341 -81.045  1.00 152.19 ?  244  THR C O     1 
ATOM   5024  C  CB    . THR C 2  240  ? -0.165  -47.163 -82.975  1.00 153.83 ?  244  THR C CB    1 
ATOM   5025  O  OG1   . THR C 2  240  ? 0.992   -47.656 -83.660  1.00 151.71 ?  244  THR C OG1   1 
ATOM   5026  C  CG2   . THR C 2  240  ? -0.791  -46.048 -83.799  1.00 147.48 ?  244  THR C CG2   1 
ATOM   5027  N  N     . SER C 2  241  ? 0.781   -48.649 -80.361  1.00 149.48 ?  245  SER C N     1 
ATOM   5028  C  CA    . SER C 2  241  ? 1.676   -49.673 -79.836  1.00 147.27 ?  245  SER C CA    1 
ATOM   5029  C  C     . SER C 2  241  ? 2.494   -50.331 -80.939  1.00 146.97 ?  245  SER C C     1 
ATOM   5030  O  O     . SER C 2  241  ? 3.559   -50.892 -80.657  1.00 142.93 ?  245  SER C O     1 
ATOM   5031  C  CB    . SER C 2  241  ? 0.876   -50.728 -79.070  1.00 141.68 ?  245  SER C CB    1 
ATOM   5032  O  OG    . SER C 2  241  ? 1.730   -51.696 -78.487  1.00 137.23 ?  245  SER C OG    1 
ATOM   5033  N  N     . GLU C 2  242  ? 2.015   -50.285 -82.185  1.00 149.14 ?  246  GLU C N     1 
ATOM   5034  C  CA    . GLU C 2  242  ? 2.771   -50.822 -83.311  1.00 150.20 ?  246  GLU C CA    1 
ATOM   5035  C  C     . GLU C 2  242  ? 3.824   -49.839 -83.815  1.00 148.47 ?  246  GLU C C     1 
ATOM   5036  O  O     . GLU C 2  242  ? 4.953   -50.241 -84.117  1.00 146.42 ?  246  GLU C O     1 
ATOM   5037  C  CB    . GLU C 2  242  ? 1.820   -51.206 -84.444  1.00 151.69 ?  246  GLU C CB    1 
ATOM   5038  N  N     . GLN C 2  243  ? 3.473   -48.552 -83.919  1.00 148.65 ?  247  GLN C N     1 
ATOM   5039  C  CA    . GLN C 2  243  ? 4.411   -47.569 -84.457  1.00 147.85 ?  247  GLN C CA    1 
ATOM   5040  C  C     . GLN C 2  243  ? 5.667   -47.463 -83.606  1.00 146.04 ?  247  GLN C C     1 
ATOM   5041  O  O     . GLN C 2  243  ? 6.752   -47.186 -84.132  1.00 141.43 ?  247  GLN C O     1 
ATOM   5042  C  CB    . GLN C 2  243  ? 3.738   -46.201 -84.575  1.00 147.65 ?  247  GLN C CB    1 
ATOM   5043  C  CG    . GLN C 2  243  ? 2.799   -46.076 -85.761  1.00 146.98 ?  247  GLN C CG    1 
ATOM   5044  C  CD    . GLN C 2  243  ? 3.490   -46.365 -87.078  1.00 145.82 ?  247  GLN C CD    1 
ATOM   5045  O  OE1   . GLN C 2  243  ? 3.472   -47.495 -87.566  1.00 144.76 ?  247  GLN C OE1   1 
ATOM   5046  N  NE2   . GLN C 2  243  ? 4.106   -45.343 -87.661  1.00 147.04 ?  247  GLN C NE2   1 
ATOM   5047  N  N     . ILE C 2  244  ? 5.543   -47.675 -82.295  1.00 145.70 ?  248  ILE C N     1 
ATOM   5048  C  CA    . ILE C 2  244  ? 6.717   -47.691 -81.431  1.00 143.11 ?  248  ILE C CA    1 
ATOM   5049  C  C     . ILE C 2  244  ? 7.635   -48.845 -81.809  1.00 143.76 ?  248  ILE C C     1 
ATOM   5050  O  O     . ILE C 2  244  ? 8.864   -48.703 -81.828  1.00 142.87 ?  248  ILE C O     1 
ATOM   5051  C  CB    . ILE C 2  244  ? 6.286   -47.764 -79.955  1.00 142.85 ?  248  ILE C CB    1 
ATOM   5052  C  CG1   . ILE C 2  244  ? 5.373   -46.584 -79.619  1.00 145.03 ?  248  ILE C CG1   1 
ATOM   5053  C  CG2   . ILE C 2  244  ? 7.500   -47.792 -79.040  1.00 144.75 ?  248  ILE C CG2   1 
ATOM   5054  C  CD1   . ILE C 2  244  ? 4.966   -46.517 -78.170  1.00 145.67 ?  248  ILE C CD1   1 
ATOM   5055  N  N     . VAL C 2  245  ? 7.054   -50.003 -82.134  1.00 144.50 ?  249  VAL C N     1 
ATOM   5056  C  CA    . VAL C 2  245  ? 7.856   -51.153 -82.530  1.00 142.41 ?  249  VAL C CA    1 
ATOM   5057  C  C     . VAL C 2  245  ? 8.556   -50.924 -83.863  1.00 140.57 ?  249  VAL C C     1 
ATOM   5058  O  O     . VAL C 2  245  ? 9.569   -51.574 -84.144  1.00 138.55 ?  249  VAL C O     1 
ATOM   5059  C  CB    . VAL C 2  245  ? 6.985   -52.420 -82.591  1.00 144.42 ?  249  VAL C CB    1 
ATOM   5060  N  N     . GLU C 2  246  ? 8.044   -50.019 -84.698  1.00 139.17 ?  250  GLU C N     1 
ATOM   5061  C  CA    . GLU C 2  246  ? 8.693   -49.751 -85.976  1.00 137.80 ?  250  GLU C CA    1 
ATOM   5062  C  C     . GLU C 2  246  ? 9.995   -48.984 -85.779  1.00 139.29 ?  250  GLU C C     1 
ATOM   5063  O  O     . GLU C 2  246  ? 11.047  -49.382 -86.293  1.00 136.83 ?  250  GLU C O     1 
ATOM   5064  C  CB    . GLU C 2  246  ? 7.745   -48.979 -86.894  1.00 136.63 ?  250  GLU C CB    1 
ATOM   5065  N  N     . ARG C 2  247  ? 9.943   -47.876 -85.039  1.00 140.18 ?  251  ARG C N     1 
ATOM   5066  C  CA    . ARG C 2  247  ? 11.141  -47.075 -84.811  1.00 137.92 ?  251  ARG C CA    1 
ATOM   5067  C  C     . ARG C 2  247  ? 12.024  -47.675 -83.721  1.00 135.80 ?  251  ARG C C     1 
ATOM   5068  O  O     . ARG C 2  247  ? 13.246  -47.769 -83.886  1.00 130.98 ?  251  ARG C O     1 
ATOM   5069  C  CB    . ARG C 2  247  ? 10.753  -45.640 -84.454  1.00 137.32 ?  251  ARG C CB    1 
ATOM   5070  C  CG    . ARG C 2  247  ? 9.983   -44.919 -85.544  1.00 142.17 ?  251  ARG C CG    1 
ATOM   5071  C  CD    . ARG C 2  247  ? 9.818   -43.449 -85.209  1.00 143.64 ?  251  ARG C CD    1 
ATOM   5072  N  NE    . ARG C 2  247  ? 9.040   -42.737 -86.218  1.00 147.17 ?  251  ARG C NE    1 
ATOM   5073  C  CZ    . ARG C 2  247  ? 9.572   -42.074 -87.240  1.00 149.52 ?  251  ARG C CZ    1 
ATOM   5074  N  NH1   . ARG C 2  247  ? 10.889  -42.030 -87.390  1.00 147.15 ?  251  ARG C NH1   1 
ATOM   5075  N  NH2   . ARG C 2  247  ? 8.788   -41.454 -88.111  1.00 153.69 ?  251  ARG C NH2   1 
ATOM   5076  N  N     . PHE C 2  248  ? 11.427  -48.083 -82.603  1.00 136.77 ?  252  PHE C N     1 
ATOM   5077  C  CA    . PHE C 2  248  ? 12.184  -48.493 -81.425  1.00 135.82 ?  252  PHE C CA    1 
ATOM   5078  C  C     . PHE C 2  248  ? 12.428  -49.994 -81.363  1.00 130.95 ?  252  PHE C C     1 
ATOM   5079  O  O     . PHE C 2  248  ? 13.070  -50.460 -80.416  1.00 126.56 ?  252  PHE C O     1 
ATOM   5080  C  CB    . PHE C 2  248  ? 11.465  -48.070 -80.135  1.00 136.01 ?  252  PHE C CB    1 
ATOM   5081  C  CG    . PHE C 2  248  ? 11.263  -46.581 -79.982  1.00 133.00 ?  252  PHE C CG    1 
ATOM   5082  C  CD1   . PHE C 2  248  ? 11.663  -45.684 -80.960  1.00 133.17 ?  252  PHE C CD1   1 
ATOM   5083  C  CD2   . PHE C 2  248  ? 10.673  -46.083 -78.833  1.00 128.22 ?  252  PHE C CD2   1 
ATOM   5084  C  CE1   . PHE C 2  248  ? 11.464  -44.327 -80.800  1.00 129.84 ?  252  PHE C CE1   1 
ATOM   5085  C  CE2   . PHE C 2  248  ? 10.478  -44.731 -78.665  1.00 129.54 ?  252  PHE C CE2   1 
ATOM   5086  C  CZ    . PHE C 2  248  ? 10.872  -43.850 -79.649  1.00 128.76 ?  252  PHE C CZ    1 
ATOM   5087  N  N     . GLY C 2  249  ? 11.931  -50.758 -82.339  1.00 132.64 ?  253  GLY C N     1 
ATOM   5088  C  CA    . GLY C 2  249  ? 11.968  -52.207 -82.231  1.00 130.95 ?  253  GLY C CA    1 
ATOM   5089  C  C     . GLY C 2  249  ? 13.365  -52.780 -82.112  1.00 127.58 ?  253  GLY C C     1 
ATOM   5090  O  O     . GLY C 2  249  ? 13.555  -53.831 -81.494  1.00 127.71 ?  253  GLY C O     1 
ATOM   5091  N  N     . PHE C 2  250  ? 14.361  -52.100 -82.688  1.00 125.75 ?  254  PHE C N     1 
ATOM   5092  C  CA    . PHE C 2  250  ? 15.733  -52.593 -82.641  1.00 122.11 ?  254  PHE C CA    1 
ATOM   5093  C  C     . PHE C 2  250  ? 16.241  -52.765 -81.216  1.00 117.90 ?  254  PHE C C     1 
ATOM   5094  O  O     . PHE C 2  250  ? 17.212  -53.497 -81.000  1.00 113.34 ?  254  PHE C O     1 
ATOM   5095  C  CB    . PHE C 2  250  ? 16.657  -51.648 -83.411  1.00 120.93 ?  254  PHE C CB    1 
ATOM   5096  N  N     . SER C 2  251  ? 15.609  -52.114 -80.244  1.00 121.37 ?  255  SER C N     1 
ATOM   5097  C  CA    . SER C 2  251  ? 16.015  -52.215 -78.850  1.00 121.38 ?  255  SER C CA    1 
ATOM   5098  C  C     . SER C 2  251  ? 15.333  -53.418 -78.212  1.00 120.71 ?  255  SER C C     1 
ATOM   5099  O  O     . SER C 2  251  ? 14.100  -53.475 -78.143  1.00 120.23 ?  255  SER C O     1 
ATOM   5100  C  CB    . SER C 2  251  ? 15.659  -50.936 -78.096  1.00 121.32 ?  255  SER C CB    1 
ATOM   5101  O  OG    . SER C 2  251  ? 15.997  -49.788 -78.854  1.00 119.42 ?  255  SER C OG    1 
ATOM   5102  N  N     . GLU C 2  252  ? 16.135  -54.377 -77.747  1.00 119.93 ?  256  GLU C N     1 
ATOM   5103  C  CA    . GLU C 2  252  ? 15.587  -55.493 -76.990  1.00 120.47 ?  256  GLU C CA    1 
ATOM   5104  C  C     . GLU C 2  252  ? 14.995  -55.041 -75.664  1.00 117.78 ?  256  GLU C C     1 
ATOM   5105  O  O     . GLU C 2  252  ? 14.115  -55.721 -75.126  1.00 116.40 ?  256  GLU C O     1 
ATOM   5106  C  CB    . GLU C 2  252  ? 16.667  -56.546 -76.746  1.00 123.04 ?  256  GLU C CB    1 
ATOM   5107  C  CG    . GLU C 2  252  ? 17.269  -57.116 -78.017  1.00 125.30 ?  256  GLU C CG    1 
ATOM   5108  C  CD    . GLU C 2  252  ? 18.379  -58.106 -77.738  1.00 134.23 ?  256  GLU C CD    1 
ATOM   5109  O  OE1   . GLU C 2  252  ? 18.932  -58.083 -76.618  1.00 136.63 ?  256  GLU C OE1   1 
ATOM   5110  O  OE2   . GLU C 2  252  ? 18.696  -58.911 -78.638  1.00 139.52 ?  256  GLU C OE2   1 
ATOM   5111  N  N     . ILE C 2  253  ? 15.458  -53.910 -75.131  1.00 117.33 ?  257  ILE C N     1 
ATOM   5112  C  CA    . ILE C 2  253  ? 14.917  -53.401 -73.878  1.00 118.04 ?  257  ILE C CA    1 
ATOM   5113  C  C     . ILE C 2  253  ? 13.593  -52.681 -74.109  1.00 118.06 ?  257  ILE C C     1 
ATOM   5114  O  O     . ILE C 2  253  ? 12.685  -52.748 -73.273  1.00 116.87 ?  257  ILE C O     1 
ATOM   5115  C  CB    . ILE C 2  253  ? 15.954  -52.499 -73.183  1.00 115.57 ?  257  ILE C CB    1 
ATOM   5116  C  CG1   . ILE C 2  253  ? 15.417  -52.028 -71.835  1.00 110.49 ?  257  ILE C CG1   1 
ATOM   5117  C  CG2   . ILE C 2  253  ? 16.339  -51.323 -74.070  1.00 119.20 ?  257  ILE C CG2   1 
ATOM   5118  C  CD1   . ILE C 2  253  ? 14.924  -53.159 -70.983  1.00 105.17 ?  257  ILE C CD1   1 
ATOM   5119  N  N     . MET C 2  254  ? 13.454  -51.983 -75.240  1.00 117.19 ?  258  MET C N     1 
ATOM   5120  C  CA    . MET C 2  254  ? 12.165  -51.383 -75.566  1.00 121.04 ?  258  MET C CA    1 
ATOM   5121  C  C     . MET C 2  254  ? 11.129  -52.448 -75.894  1.00 127.53 ?  258  MET C C     1 
ATOM   5122  O  O     . MET C 2  254  ? 9.940   -52.263 -75.612  1.00 128.19 ?  258  MET C O     1 
ATOM   5123  C  CB    . MET C 2  254  ? 12.309  -50.404 -76.731  1.00 124.62 ?  258  MET C CB    1 
ATOM   5124  C  CG    . MET C 2  254  ? 13.053  -49.126 -76.381  1.00 126.83 ?  258  MET C CG    1 
ATOM   5125  S  SD    . MET C 2  254  ? 12.263  -48.197 -75.052  1.00 124.95 ?  258  MET C SD    1 
ATOM   5126  C  CE    . MET C 2  254  ? 10.675  -47.820 -75.786  1.00 122.98 ?  258  MET C CE    1 
ATOM   5127  N  N     . ARG C 2  255  ? 11.559  -53.564 -76.487  1.00 124.12 ?  259  ARG C N     1 
ATOM   5128  C  CA    . ARG C 2  255  ? 10.648  -54.682 -76.700  1.00 123.14 ?  259  ARG C CA    1 
ATOM   5129  C  C     . ARG C 2  255  ? 10.156  -55.241 -75.371  1.00 124.45 ?  259  ARG C C     1 
ATOM   5130  O  O     . ARG C 2  255  ? 8.966   -55.537 -75.214  1.00 128.99 ?  259  ARG C O     1 
ATOM   5131  C  CB    . ARG C 2  255  ? 11.336  -55.771 -77.522  1.00 121.82 ?  259  ARG C CB    1 
ATOM   5132  N  N     . SER C 2  256  ? 11.059  -55.384 -74.399  1.00 122.58 ?  260  SER C N     1 
ATOM   5133  C  CA    . SER C 2  256  ? 10.673  -55.871 -73.081  1.00 123.81 ?  260  SER C CA    1 
ATOM   5134  C  C     . SER C 2  256  ? 9.811   -54.873 -72.320  1.00 128.50 ?  260  SER C C     1 
ATOM   5135  O  O     . SER C 2  256  ? 9.046   -55.280 -71.440  1.00 130.85 ?  260  SER C O     1 
ATOM   5136  C  CB    . SER C 2  256  ? 11.921  -56.207 -72.261  1.00 122.22 ?  260  SER C CB    1 
ATOM   5137  O  OG    . SER C 2  256  ? 11.588  -56.489 -70.913  1.00 117.66 ?  260  SER C OG    1 
ATOM   5138  N  N     . THR C 2  257  ? 9.917   -53.580 -72.635  1.00 131.87 ?  261  THR C N     1 
ATOM   5139  C  CA    . THR C 2  257  ? 9.175   -52.565 -71.895  1.00 131.39 ?  261  THR C CA    1 
ATOM   5140  C  C     . THR C 2  257  ? 7.720   -52.460 -72.339  1.00 135.17 ?  261  THR C C     1 
ATOM   5141  O  O     . THR C 2  257  ? 6.854   -52.130 -71.521  1.00 135.71 ?  261  THR C O     1 
ATOM   5142  C  CB    . THR C 2  257  ? 9.859   -51.204 -72.039  1.00 124.78 ?  261  THR C CB    1 
ATOM   5143  N  N     . LEU C 2  258  ? 7.430   -52.729 -73.615  1.00 135.56 ?  262  LEU C N     1 
ATOM   5144  C  CA    . LEU C 2  258  ? 6.068   -52.554 -74.109  1.00 134.84 ?  262  LEU C CA    1 
ATOM   5145  C  C     . LEU C 2  258  ? 5.117   -53.598 -73.537  1.00 137.93 ?  262  LEU C C     1 
ATOM   5146  O  O     . LEU C 2  258  ? 3.931   -53.310 -73.340  1.00 139.89 ?  262  LEU C O     1 
ATOM   5147  C  CB    . LEU C 2  258  ? 6.050   -52.594 -75.637  1.00 134.04 ?  262  LEU C CB    1 
ATOM   5148  C  CG    . LEU C 2  258  ? 4.699   -52.328 -76.305  1.00 134.83 ?  262  LEU C CG    1 
ATOM   5149  C  CD1   . LEU C 2  258  ? 4.063   -51.061 -75.753  1.00 136.82 ?  262  LEU C CD1   1 
ATOM   5150  C  CD2   . LEU C 2  258  ? 4.862   -52.233 -77.812  1.00 134.37 ?  262  LEU C CD2   1 
ATOM   5151  N  N     . GLU C 2  259  ? 5.606   -54.810 -73.270  1.00 142.68 ?  263  GLU C N     1 
ATOM   5152  C  CA    . GLU C 2  259  ? 4.768   -55.796 -72.596  1.00 145.74 ?  263  GLU C CA    1 
ATOM   5153  C  C     . GLU C 2  259  ? 4.578   -55.434 -71.129  1.00 144.78 ?  263  GLU C C     1 
ATOM   5154  O  O     . GLU C 2  259  ? 3.478   -55.581 -70.583  1.00 145.80 ?  263  GLU C O     1 
ATOM   5155  C  CB    . GLU C 2  259  ? 5.372   -57.193 -72.735  1.00 146.75 ?  263  GLU C CB    1 
ATOM   5156  C  CG    . GLU C 2  259  ? 4.591   -58.290 -72.018  1.00 150.44 ?  263  GLU C CG    1 
ATOM   5157  C  CD    . GLU C 2  259  ? 3.256   -58.601 -72.676  1.00 154.46 ?  263  GLU C CD    1 
ATOM   5158  O  OE1   . GLU C 2  259  ? 3.045   -58.188 -73.836  1.00 160.97 ?  263  GLU C OE1   1 
ATOM   5159  O  OE2   . GLU C 2  259  ? 2.416   -59.264 -72.031  1.00 149.67 ?  263  GLU C OE2   1 
ATOM   5160  N  N     . LYS C 2  260  ? 5.637   -54.950 -70.475  1.00 141.40 ?  264  LYS C N     1 
ATOM   5161  C  CA    . LYS C 2  260  ? 5.506   -54.469 -69.106  1.00 137.40 ?  264  LYS C CA    1 
ATOM   5162  C  C     . LYS C 2  260  ? 4.644   -53.219 -69.022  1.00 137.91 ?  264  LYS C C     1 
ATOM   5163  O  O     . LYS C 2  260  ? 4.154   -52.892 -67.936  1.00 136.34 ?  264  LYS C O     1 
ATOM   5164  C  CB    . LYS C 2  260  ? 6.886   -54.201 -68.506  1.00 134.04 ?  264  LYS C CB    1 
ATOM   5165  C  CG    . LYS C 2  260  ? 7.792   -55.421 -68.488  1.00 125.90 ?  264  LYS C CG    1 
ATOM   5166  C  CD    . LYS C 2  260  ? 8.503   -55.558 -67.156  1.00 114.09 ?  264  LYS C CD    1 
ATOM   5167  C  CE    . LYS C 2  260  ? 7.502   -55.714 -66.024  1.00 112.59 ?  264  LYS C CE    1 
ATOM   5168  N  NZ    . LYS C 2  260  ? 8.170   -55.843 -64.701  1.00 104.32 ?  264  LYS C NZ    1 
ATOM   5169  N  N     . ASP C 2  261  ? 4.456   -52.513 -70.136  1.00 140.59 ?  265  ASP C N     1 
ATOM   5170  C  CA    . ASP C 2  261  ? 3.468   -51.445 -70.187  1.00 141.79 ?  265  ASP C CA    1 
ATOM   5171  C  C     . ASP C 2  261  ? 2.097   -52.013 -69.852  1.00 144.07 ?  265  ASP C C     1 
ATOM   5172  O  O     . ASP C 2  261  ? 1.642   -52.979 -70.470  1.00 145.18 ?  265  ASP C O     1 
ATOM   5173  C  CB    . ASP C 2  261  ? 3.463   -50.799 -71.571  1.00 140.71 ?  265  ASP C CB    1 
ATOM   5174  C  CG    . ASP C 2  261  ? 2.302   -49.846 -71.772  1.00 141.46 ?  265  ASP C CG    1 
ATOM   5175  O  OD1   . ASP C 2  261  ? 1.878   -49.198 -70.792  1.00 140.44 ?  265  ASP C OD1   1 
ATOM   5176  O  OD2   . ASP C 2  261  ? 1.815   -49.744 -72.918  1.00 141.21 ?  265  ASP C OD2   1 
ATOM   5177  N  N     . ASN C 2  262  ? 1.436   -51.407 -68.866  1.00 145.57 ?  266  ASN C N     1 
ATOM   5178  C  CA    . ASN C 2  262  ? 0.243   -52.023 -68.301  1.00 148.38 ?  266  ASN C CA    1 
ATOM   5179  C  C     . ASN C 2  262  ? -0.975  -51.843 -69.199  1.00 150.30 ?  266  ASN C C     1 
ATOM   5180  O  O     . ASN C 2  262  ? -1.778  -52.771 -69.347  1.00 154.80 ?  266  ASN C O     1 
ATOM   5181  C  CB    . ASN C 2  262  ? -0.031  -51.452 -66.911  1.00 151.78 ?  266  ASN C CB    1 
ATOM   5182  C  CG    . ASN C 2  262  ? -0.797  -52.417 -66.030  1.00 154.42 ?  266  ASN C CG    1 
ATOM   5183  O  OD1   . ASN C 2  262  ? -2.022  -52.506 -66.105  1.00 154.37 ?  266  ASN C OD1   1 
ATOM   5184  N  ND2   . ASN C 2  262  ? -0.075  -53.150 -65.191  1.00 155.19 ?  266  ASN C ND2   1 
ATOM   5185  N  N     . THR C 2  263  ? -1.133  -50.670 -69.804  1.00 146.96 ?  267  THR C N     1 
ATOM   5186  C  CA    . THR C 2  263  ? -2.301  -50.378 -70.619  1.00 146.48 ?  267  THR C CA    1 
ATOM   5187  C  C     . THR C 2  263  ? -1.864  -49.800 -71.957  1.00 148.36 ?  267  THR C C     1 
ATOM   5188  O  O     . THR C 2  263  ? -0.779  -49.228 -72.089  1.00 148.33 ?  267  THR C O     1 
ATOM   5189  C  CB    . THR C 2  263  ? -3.253  -49.403 -69.910  1.00 148.02 ?  267  THR C CB    1 
ATOM   5190  O  OG1   . THR C 2  263  ? -3.263  -49.686 -68.505  1.00 151.16 ?  267  THR C OG1   1 
ATOM   5191  C  CG2   . THR C 2  263  ? -4.668  -49.551 -70.448  1.00 143.82 ?  267  THR C CG2   1 
ATOM   5192  N  N     . VAL C 2  264  ? -2.732  -49.956 -72.954  1.00 149.68 ?  268  VAL C N     1 
ATOM   5193  C  CA    . VAL C 2  264  ? -2.491  -49.453 -74.296  1.00 150.54 ?  268  VAL C CA    1 
ATOM   5194  C  C     . VAL C 2  264  ? -3.607  -48.482 -74.657  1.00 150.60 ?  268  VAL C C     1 
ATOM   5195  O  O     . VAL C 2  264  ? -4.674  -48.459 -74.039  1.00 149.72 ?  268  VAL C O     1 
ATOM   5196  C  CB    . VAL C 2  264  ? -2.400  -50.587 -75.338  1.00 152.29 ?  268  VAL C CB    1 
ATOM   5197  C  CG1   . VAL C 2  264  ? -1.191  -51.466 -75.063  1.00 151.88 ?  268  VAL C CG1   1 
ATOM   5198  C  CG2   . VAL C 2  264  ? -3.677  -51.412 -75.335  1.00 152.01 ?  268  VAL C CG2   1 
ATOM   5199  N  N     . GLY C 2  265  ? -3.343  -47.673 -75.668  1.00 150.61 ?  269  GLY C N     1 
ATOM   5200  C  CA    . GLY C 2  265  ? -4.314  -46.725 -76.172  1.00 149.30 ?  269  GLY C CA    1 
ATOM   5201  C  C     . GLY C 2  265  ? -4.040  -45.305 -75.713  1.00 145.87 ?  269  GLY C C     1 
ATOM   5202  O  O     . GLY C 2  265  ? -3.544  -45.057 -74.606  1.00 144.11 ?  269  GLY C O     1 
ATOM   5203  N  N     . THR C 2  266  ? -4.393  -44.349 -76.576  1.00 146.70 ?  270  THR C N     1 
ATOM   5204  C  CA    . THR C 2  266  ? -4.117  -42.945 -76.297  1.00 144.69 ?  270  THR C CA    1 
ATOM   5205  C  C     . THR C 2  266  ? -5.007  -42.404 -75.187  1.00 147.22 ?  270  THR C C     1 
ATOM   5206  O  O     . THR C 2  266  ? -4.577  -41.538 -74.418  1.00 148.31 ?  270  THR C O     1 
ATOM   5207  C  CB    . THR C 2  266  ? -4.298  -42.115 -77.570  1.00 144.08 ?  270  THR C CB    1 
ATOM   5208  O  OG1   . THR C 2  266  ? -3.613  -42.750 -78.656  1.00 145.23 ?  270  THR C OG1   1 
ATOM   5209  C  CG2   . THR C 2  266  ? -3.737  -40.713 -77.380  1.00 144.16 ?  270  THR C CG2   1 
ATOM   5210  N  N     . ASP C 2  267  ? -6.243  -42.895 -75.086  1.00 149.55 ?  271  ASP C N     1 
ATOM   5211  C  CA    . ASP C 2  267  ? -7.144  -42.420 -74.041  1.00 148.83 ?  271  ASP C CA    1 
ATOM   5212  C  C     . ASP C 2  267  ? -6.690  -42.898 -72.668  1.00 146.98 ?  271  ASP C C     1 
ATOM   5213  O  O     . ASP C 2  267  ? -6.649  -42.117 -71.709  1.00 146.56 ?  271  ASP C O     1 
ATOM   5214  C  CB    . ASP C 2  267  ? -8.573  -42.882 -74.330  1.00 150.69 ?  271  ASP C CB    1 
ATOM   5215  N  N     . GLU C 2  268  ? -6.346  -44.182 -72.552  1.00 145.60 ?  272  GLU C N     1 
ATOM   5216  C  CA    . GLU C 2  268  ? -5.848  -44.700 -71.283  1.00 142.35 ?  272  GLU C CA    1 
ATOM   5217  C  C     . GLU C 2  268  ? -4.487  -44.112 -70.936  1.00 141.35 ?  272  GLU C C     1 
ATOM   5218  O  O     . GLU C 2  268  ? -4.192  -43.894 -69.755  1.00 139.86 ?  272  GLU C O     1 
ATOM   5219  C  CB    . GLU C 2  268  ? -5.770  -46.225 -71.332  1.00 144.58 ?  272  GLU C CB    1 
ATOM   5220  N  N     . ALA C 2  269  ? -3.652  -43.846 -71.942  1.00 143.07 ?  273  ALA C N     1 
ATOM   5221  C  CA    . ALA C 2  269  ? -2.342  -43.261 -71.677  1.00 141.03 ?  273  ALA C CA    1 
ATOM   5222  C  C     . ALA C 2  269  ? -2.470  -41.818 -71.199  1.00 139.74 ?  273  ALA C C     1 
ATOM   5223  O  O     . ALA C 2  269  ? -1.887  -41.439 -70.177  1.00 140.44 ?  273  ALA C O     1 
ATOM   5224  C  CB    . ALA C 2  269  ? -1.470  -43.350 -72.928  1.00 142.54 ?  273  ALA C CB    1 
ATOM   5225  N  N     . LEU C 2  270  ? -3.231  -40.998 -71.929  1.00 138.13 ?  274  LEU C N     1 
ATOM   5226  C  CA    . LEU C 2  270  ? -3.464  -39.621 -71.503  1.00 135.97 ?  274  LEU C CA    1 
ATOM   5227  C  C     . LEU C 2  270  ? -4.173  -39.561 -70.157  1.00 135.26 ?  274  LEU C C     1 
ATOM   5228  O  O     . LEU C 2  270  ? -3.917  -38.650 -69.362  1.00 133.27 ?  274  LEU C O     1 
ATOM   5229  C  CB    . LEU C 2  270  ? -4.279  -38.872 -72.558  1.00 135.03 ?  274  LEU C CB    1 
ATOM   5230  C  CG    . LEU C 2  270  ? -3.535  -38.390 -73.803  1.00 135.02 ?  274  LEU C CG    1 
ATOM   5231  C  CD1   . LEU C 2  270  ? -4.511  -37.811 -74.814  1.00 135.41 ?  274  LEU C CD1   1 
ATOM   5232  C  CD2   . LEU C 2  270  ? -2.488  -37.360 -73.421  1.00 132.89 ?  274  LEU C CD2   1 
ATOM   5233  N  N     . LEU C 2  271  ? -5.065  -40.515 -69.886  1.00 138.49 ?  275  LEU C N     1 
ATOM   5234  C  CA    . LEU C 2  271  ? -5.750  -40.539 -68.598  1.00 140.61 ?  275  LEU C CA    1 
ATOM   5235  C  C     . LEU C 2  271  ? -4.795  -40.922 -67.474  1.00 142.95 ?  275  LEU C C     1 
ATOM   5236  O  O     . LEU C 2  271  ? -4.840  -40.334 -66.387  1.00 143.43 ?  275  LEU C O     1 
ATOM   5237  C  CB    . LEU C 2  271  ? -6.935  -41.502 -68.651  1.00 140.44 ?  275  LEU C CB    1 
ATOM   5238  N  N     . ASP C 2  272  ? -3.924  -41.905 -67.716  1.00 141.54 ?  276  ASP C N     1 
ATOM   5239  C  CA    . ASP C 2  272  ? -2.944  -42.285 -66.704  1.00 139.11 ?  276  ASP C CA    1 
ATOM   5240  C  C     . ASP C 2  272  ? -1.929  -41.176 -66.464  1.00 138.75 ?  276  ASP C C     1 
ATOM   5241  O  O     . ASP C 2  272  ? -1.371  -41.076 -65.365  1.00 139.66 ?  276  ASP C O     1 
ATOM   5242  C  CB    . ASP C 2  272  ? -2.233  -43.573 -67.118  1.00 137.74 ?  276  ASP C CB    1 
ATOM   5243  N  N     . ILE C 2  273  ? -1.681  -40.335 -67.470  1.00 137.88 ?  277  ILE C N     1 
ATOM   5244  C  CA    . ILE C 2  273  ? -0.744  -39.231 -67.300  1.00 138.74 ?  277  ILE C CA    1 
ATOM   5245  C  C     . ILE C 2  273  ? -1.357  -38.135 -66.436  1.00 141.12 ?  277  ILE C C     1 
ATOM   5246  O  O     . ILE C 2  273  ? -0.705  -37.606 -65.528  1.00 139.48 ?  277  ILE C O     1 
ATOM   5247  C  CB    . ILE C 2  273  ? -0.301  -38.691 -68.672  1.00 136.54 ?  277  ILE C CB    1 
ATOM   5248  N  N     . TYR C 2  274  ? -2.616  -37.776 -66.703  1.00 143.47 ?  278  TYR C N     1 
ATOM   5249  C  CA    . TYR C 2  274  ? -3.274  -36.737 -65.917  1.00 142.35 ?  278  TYR C CA    1 
ATOM   5250  C  C     . TYR C 2  274  ? -3.461  -37.161 -64.466  1.00 139.65 ?  278  TYR C C     1 
ATOM   5251  O  O     . TYR C 2  274  ? -3.553  -36.305 -63.578  1.00 136.75 ?  278  TYR C O     1 
ATOM   5252  C  CB    . TYR C 2  274  ? -4.622  -36.376 -66.543  1.00 139.90 ?  278  TYR C CB    1 
ATOM   5253  N  N     . ARG C 2  275  ? -3.522  -38.468 -64.206  1.00 142.07 ?  279  ARG C N     1 
ATOM   5254  C  CA    . ARG C 2  275  ? -3.623  -38.942 -62.830  1.00 143.02 ?  279  ARG C CA    1 
ATOM   5255  C  C     . ARG C 2  275  ? -2.322  -38.711 -62.072  1.00 140.18 ?  279  ARG C C     1 
ATOM   5256  O  O     . ARG C 2  275  ? -2.341  -38.355 -60.888  1.00 137.40 ?  279  ARG C O     1 
ATOM   5257  C  CB    . ARG C 2  275  ? -3.993  -40.424 -62.810  1.00 144.30 ?  279  ARG C CB    1 
ATOM   5258  C  CG    . ARG C 2  275  ? -4.116  -41.005 -61.412  1.00 144.83 ?  279  ARG C CG    1 
ATOM   5259  C  CD    . ARG C 2  275  ? -3.891  -42.504 -61.415  1.00 146.97 ?  279  ARG C CD    1 
ATOM   5260  N  NE    . ARG C 2  275  ? -2.594  -42.851 -61.988  1.00 150.36 ?  279  ARG C NE    1 
ATOM   5261  C  CZ    . ARG C 2  275  ? -2.017  -44.042 -61.864  1.00 153.86 ?  279  ARG C CZ    1 
ATOM   5262  N  NH1   . ARG C 2  275  ? -2.620  -45.004 -61.179  1.00 151.83 ?  279  ARG C NH1   1 
ATOM   5263  N  NH2   . ARG C 2  275  ? -0.835  -44.269 -62.420  1.00 152.15 ?  279  ARG C NH2   1 
ATOM   5264  N  N     . LYS C 2  276  ? -1.183  -38.908 -62.738  1.00 138.98 ?  280  LYS C N     1 
ATOM   5265  C  CA    . LYS C 2  276  ? 0.103   -38.760 -62.064  1.00 137.47 ?  280  LYS C CA    1 
ATOM   5266  C  C     . LYS C 2  276  ? 0.356   -37.314 -61.657  1.00 131.64 ?  280  LYS C C     1 
ATOM   5267  O  O     . LYS C 2  276  ? 0.932   -37.055 -60.594  1.00 126.29 ?  280  LYS C O     1 
ATOM   5268  C  CB    . LYS C 2  276  ? 1.226   -39.267 -62.968  1.00 138.92 ?  280  LYS C CB    1 
ATOM   5269  N  N     . LEU C 2  277  ? -0.064  -36.360 -62.489  1.00 133.53 ?  281  LEU C N     1 
ATOM   5270  C  CA    . LEU C 2  277  ? 0.194   -34.953 -62.198  1.00 133.05 ?  281  LEU C CA    1 
ATOM   5271  C  C     . LEU C 2  277  ? -0.673  -34.452 -61.049  1.00 138.01 ?  281  LEU C C     1 
ATOM   5272  O  O     . LEU C 2  277  ? -0.161  -33.910 -60.062  1.00 139.56 ?  281  LEU C O     1 
ATOM   5273  C  CB    . LEU C 2  277  ? -0.033  -34.118 -63.457  1.00 129.92 ?  281  LEU C CB    1 
ATOM   5274  C  CG    . LEU C 2  277  ? 0.907   -34.474 -64.609  1.00 128.26 ?  281  LEU C CG    1 
ATOM   5275  C  CD1   . LEU C 2  277  ? 0.356   -33.983 -65.931  1.00 126.85 ?  281  LEU C CD1   1 
ATOM   5276  C  CD2   . LEU C 2  277  ? 2.290   -33.895 -64.359  1.00 125.96 ?  281  LEU C CD2   1 
ATOM   5277  N  N     . ARG C 2  278  ? -1.991  -34.629 -61.155  1.00 140.53 ?  282  ARG C N     1 
ATOM   5278  C  CA    . ARG C 2  278  ? -2.917  -34.159 -60.133  1.00 135.77 ?  282  ARG C CA    1 
ATOM   5279  C  C     . ARG C 2  278  ? -3.322  -35.328 -59.252  1.00 137.06 ?  282  ARG C C     1 
ATOM   5280  O  O     . ARG C 2  278  ? -3.931  -36.284 -59.757  1.00 139.08 ?  282  ARG C O     1 
ATOM   5281  C  CB    . ARG C 2  278  ? -4.150  -33.534 -60.775  1.00 130.73 ?  282  ARG C CB    1 
ATOM   5282  C  CG    . ARG C 2  278  ? -3.853  -32.478 -61.833  1.00 125.33 ?  282  ARG C CG    1 
ATOM   5283  C  CD    . ARG C 2  278  ? -3.567  -31.116 -61.218  1.00 117.72 ?  282  ARG C CD    1 
ATOM   5284  N  NE    . ARG C 2  278  ? -3.983  -30.030 -62.103  1.00 112.15 ?  282  ARG C NE    1 
ATOM   5285  C  CZ    . ARG C 2  278  ? -3.154  -29.284 -62.826  1.00 108.50 ?  282  ARG C CZ    1 
ATOM   5286  N  NH1   . ARG C 2  278  ? -1.846  -29.493 -62.771  1.00 108.17 ?  282  ARG C NH1   1 
ATOM   5287  N  NH2   . ARG C 2  278  ? -3.635  -28.322 -63.602  1.00 100.70 ?  282  ARG C NH2   1 
ATOM   5288  N  N     . PRO C 2  279  ? -3.008  -35.312 -57.953  1.00 137.40 ?  283  PRO C N     1 
ATOM   5289  C  CA    . PRO C 2  279  ? -3.280  -36.506 -57.131  1.00 138.27 ?  283  PRO C CA    1 
ATOM   5290  C  C     . PRO C 2  279  ? -4.755  -36.862 -57.013  1.00 138.40 ?  283  PRO C C     1 
ATOM   5291  O  O     . PRO C 2  279  ? -5.125  -38.026 -57.213  1.00 136.07 ?  283  PRO C O     1 
ATOM   5292  C  CB    . PRO C 2  279  ? -2.668  -36.131 -55.773  1.00 132.41 ?  283  PRO C CB    1 
ATOM   5293  C  CG    . PRO C 2  279  ? -2.695  -34.638 -55.746  1.00 133.12 ?  283  PRO C CG    1 
ATOM   5294  C  CD    . PRO C 2  279  ? -2.446  -34.204 -57.161  1.00 134.30 ?  283  PRO C CD    1 
ATOM   5295  N  N     . GLY C 2  280  ? -5.612  -35.892 -56.697  1.00 133.82 ?  284  GLY C N     1 
ATOM   5296  C  CA    . GLY C 2  280  ? -6.995  -36.171 -56.366  1.00 128.53 ?  284  GLY C CA    1 
ATOM   5297  C  C     . GLY C 2  280  ? -8.072  -35.716 -57.325  1.00 125.58 ?  284  GLY C C     1 
ATOM   5298  O  O     . GLY C 2  280  ? -9.256  -35.793 -56.972  1.00 122.85 ?  284  GLY C O     1 
ATOM   5299  N  N     . GLU C 2  281  ? -7.731  -35.244 -58.512  1.00 124.00 ?  285  GLU C N     1 
ATOM   5300  C  CA    . GLU C 2  281  ? -8.703  -34.560 -59.350  1.00 120.32 ?  285  GLU C CA    1 
ATOM   5301  C  C     . GLU C 2  281  ? -9.335  -35.514 -60.353  1.00 123.06 ?  285  GLU C C     1 
ATOM   5302  O  O     . GLU C 2  281  ? -8.912  -36.664 -60.498  1.00 123.27 ?  285  GLU C O     1 
ATOM   5303  C  CB    . GLU C 2  281  ? -8.021  -33.398 -60.071  1.00 119.72 ?  285  GLU C CB    1 
ATOM   5304  C  CG    . GLU C 2  281  ? -7.240  -32.503 -59.137  1.00 121.16 ?  285  GLU C CG    1 
ATOM   5305  C  CD    . GLU C 2  281  ? -6.912  -31.167 -59.755  1.00 113.70 ?  285  GLU C CD    1 
ATOM   5306  O  OE1   . GLU C 2  281  ? -7.478  -30.848 -60.822  1.00 112.11 ?  285  GLU C OE1   1 
ATOM   5307  O  OE2   . GLU C 2  281  ? -6.091  -30.436 -59.169  1.00 112.21 ?  285  GLU C OE2   1 
ATOM   5308  N  N     . PRO C 2  282  ? -10.370 -35.069 -61.066  1.00 122.96 ?  286  PRO C N     1 
ATOM   5309  C  CA    . PRO C 2  282  ? -10.898 -35.859 -62.184  1.00 119.48 ?  286  PRO C CA    1 
ATOM   5310  C  C     . PRO C 2  282  ? -10.065 -35.669 -63.438  1.00 115.81 ?  286  PRO C C     1 
ATOM   5311  O  O     . PRO C 2  282  ? -9.586  -34.560 -63.717  1.00 111.39 ?  286  PRO C O     1 
ATOM   5312  C  CB    . PRO C 2  282  ? -12.316 -35.300 -62.370  1.00 119.69 ?  286  PRO C CB    1 
ATOM   5313  C  CG    . PRO C 2  282  ? -12.225 -33.905 -61.869  1.00 120.21 ?  286  PRO C CG    1 
ATOM   5314  C  CD    . PRO C 2  282  ? -11.278 -33.963 -60.707  1.00 121.00 ?  286  PRO C CD    1 
ATOM   5315  N  N     . PRO C 2  283  ? -9.875  -36.724 -64.222  1.00 116.42 ?  287  PRO C N     1 
ATOM   5316  C  CA    . PRO C 2  283  ? -9.321  -36.562 -65.568  1.00 117.27 ?  287  PRO C CA    1 
ATOM   5317  C  C     . PRO C 2  283  ? -10.388 -36.168 -66.582  1.00 116.49 ?  287  PRO C C     1 
ATOM   5318  O  O     . PRO C 2  283  ? -11.586 -36.378 -66.389  1.00 115.20 ?  287  PRO C O     1 
ATOM   5319  C  CB    . PRO C 2  283  ? -8.739  -37.945 -65.885  1.00 117.24 ?  287  PRO C CB    1 
ATOM   5320  C  CG    . PRO C 2  283  ? -9.389  -38.900 -64.908  1.00 119.23 ?  287  PRO C CG    1 
ATOM   5321  C  CD    . PRO C 2  283  ? -10.233 -38.121 -63.936  1.00 114.38 ?  287  PRO C CD    1 
ATOM   5322  N  N     . THR C 2  284  ? -9.919  -35.577 -67.678  1.00 119.14 ?  288  THR C N     1 
ATOM   5323  C  CA    . THR C 2  284  ? -10.745 -35.307 -68.846  1.00 123.10 ?  288  THR C CA    1 
ATOM   5324  C  C     . THR C 2  284  ? -9.837  -35.355 -70.065  1.00 128.80 ?  288  THR C C     1 
ATOM   5325  O  O     . THR C 2  284  ? -8.653  -35.026 -69.977  1.00 130.27 ?  288  THR C O     1 
ATOM   5326  C  CB    . THR C 2  284  ? -11.458 -33.951 -68.745  1.00 124.89 ?  288  THR C CB    1 
ATOM   5327  O  OG1   . THR C 2  284  ? -12.122 -33.852 -67.480  1.00 122.74 ?  288  THR C OG1   1 
ATOM   5328  C  CG2   . THR C 2  284  ? -12.490 -33.799 -69.855  1.00 121.67 ?  288  THR C CG2   1 
ATOM   5329  N  N     . LYS C 2  285  ? -10.386 -35.797 -71.199  1.00 131.23 ?  289  LYS C N     1 
ATOM   5330  C  CA    . LYS C 2  285  ? -9.557  -35.974 -72.389  1.00 134.58 ?  289  LYS C CA    1 
ATOM   5331  C  C     . LYS C 2  285  ? -9.068  -34.636 -72.934  1.00 136.92 ?  289  LYS C C     1 
ATOM   5332  O  O     . LYS C 2  285  ? -7.858  -34.405 -73.054  1.00 138.25 ?  289  LYS C O     1 
ATOM   5333  C  CB    . LYS C 2  285  ? -10.324 -36.744 -73.464  1.00 131.55 ?  289  LYS C CB    1 
ATOM   5334  C  CG    . LYS C 2  285  ? -9.479  -37.046 -74.692  1.00 125.91 ?  289  LYS C CG    1 
ATOM   5335  C  CD    . LYS C 2  285  ? -10.243 -37.840 -75.734  1.00 127.50 ?  289  LYS C CD    1 
ATOM   5336  C  CE    . LYS C 2  285  ? -9.365  -38.122 -76.944  1.00 116.44 ?  289  LYS C CE    1 
ATOM   5337  N  NZ    . LYS C 2  285  ? -10.078 -38.907 -77.988  1.00 118.52 ?  289  LYS C NZ    1 
ATOM   5338  N  N     . GLU C 2  286  ? -9.996  -33.731 -73.261  1.00 136.06 ?  290  GLU C N     1 
ATOM   5339  C  CA    . GLU C 2  286  ? -9.592  -32.449 -73.831  1.00 135.85 ?  290  GLU C CA    1 
ATOM   5340  C  C     . GLU C 2  286  ? -8.856  -31.591 -72.814  1.00 137.10 ?  290  GLU C C     1 
ATOM   5341  O  O     . GLU C 2  286  ? -8.027  -30.756 -73.194  1.00 137.86 ?  290  GLU C O     1 
ATOM   5342  C  CB    . GLU C 2  286  ? -10.804 -31.694 -74.377  1.00 135.10 ?  290  GLU C CB    1 
ATOM   5343  C  CG    . GLU C 2  286  ? -11.422 -32.319 -75.613  1.00 134.18 ?  290  GLU C CG    1 
ATOM   5344  C  CD    . GLU C 2  286  ? -12.591 -33.219 -75.283  1.00 132.16 ?  290  GLU C CD    1 
ATOM   5345  O  OE1   . GLU C 2  286  ? -13.276 -32.954 -74.273  1.00 135.08 ?  290  GLU C OE1   1 
ATOM   5346  O  OE2   . GLU C 2  286  ? -12.825 -34.191 -76.031  1.00 128.99 ?  290  GLU C OE2   1 
ATOM   5347  N  N     . SER C 2  287  ? -9.145  -31.775 -71.525  1.00 137.20 ?  291  SER C N     1 
ATOM   5348  C  CA    . SER C 2  287  ? -8.388  -31.067 -70.500  1.00 134.68 ?  291  SER C CA    1 
ATOM   5349  C  C     . SER C 2  287  ? -6.960  -31.588 -70.419  1.00 131.85 ?  291  SER C C     1 
ATOM   5350  O  O     . SER C 2  287  ? -6.013  -30.802 -70.311  1.00 129.54 ?  291  SER C O     1 
ATOM   5351  C  CB    . SER C 2  287  ? -9.085  -31.200 -69.146  1.00 132.34 ?  291  SER C CB    1 
ATOM   5352  O  OG    . SER C 2  287  ? -10.428 -30.754 -69.218  1.00 130.17 ?  291  SER C OG    1 
ATOM   5353  N  N     . ALA C 2  288  ? -6.786  -32.909 -70.492  1.00 131.03 ?  292  ALA C N     1 
ATOM   5354  C  CA    . ALA C 2  288  ? -5.463  -33.500 -70.328  1.00 129.54 ?  292  ALA C CA    1 
ATOM   5355  C  C     . ALA C 2  288  ? -4.585  -33.256 -71.549  1.00 129.50 ?  292  ALA C C     1 
ATOM   5356  O  O     . ALA C 2  288  ? -3.388  -32.983 -71.410  1.00 127.91 ?  292  ALA C O     1 
ATOM   5357  C  CB    . ALA C 2  288  ? -5.587  -34.997 -70.046  1.00 128.81 ?  292  ALA C CB    1 
ATOM   5358  N  N     . GLN C 2  289  ? -5.154  -33.355 -72.755  1.00 131.60 ?  293  GLN C N     1 
ATOM   5359  C  CA    . GLN C 2  289  ? -4.349  -33.104 -73.947  1.00 130.65 ?  293  GLN C CA    1 
ATOM   5360  C  C     . GLN C 2  289  ? -3.956  -31.637 -74.044  1.00 129.83 ?  293  GLN C C     1 
ATOM   5361  O  O     . GLN C 2  289  ? -2.815  -31.318 -74.398  1.00 130.26 ?  293  GLN C O     1 
ATOM   5362  C  CB    . GLN C 2  289  ? -5.094  -33.538 -75.209  1.00 135.11 ?  293  GLN C CB    1 
ATOM   5363  C  CG    . GLN C 2  289  ? -4.177  -33.647 -76.421  1.00 133.81 ?  293  GLN C CG    1 
ATOM   5364  C  CD    . GLN C 2  289  ? -4.818  -33.151 -77.700  1.00 136.69 ?  293  GLN C CD    1 
ATOM   5365  O  OE1   . GLN C 2  289  ? -4.249  -32.321 -78.410  1.00 134.09 ?  293  GLN C OE1   1 
ATOM   5366  N  NE2   . GLN C 2  289  ? -6.003  -33.664 -78.008  1.00 141.02 ?  293  GLN C NE2   1 
ATOM   5367  N  N     . THR C 2  290  ? -4.885  -30.728 -73.739  1.00 129.92 ?  294  THR C N     1 
ATOM   5368  C  CA    . THR C 2  290  ? -4.528  -29.316 -73.664  1.00 130.44 ?  294  THR C CA    1 
ATOM   5369  C  C     . THR C 2  290  ? -3.600  -29.043 -72.488  1.00 128.15 ?  294  THR C C     1 
ATOM   5370  O  O     . THR C 2  290  ? -2.830  -28.076 -72.517  1.00 127.39 ?  294  THR C O     1 
ATOM   5371  C  CB    . THR C 2  290  ? -5.785  -28.452 -73.558  1.00 131.21 ?  294  THR C CB    1 
ATOM   5372  N  N     . LEU C 2  291  ? -3.660  -29.878 -71.448  1.00 126.44 ?  295  LEU C N     1 
ATOM   5373  C  CA    . LEU C 2  291  ? -2.727  -29.748 -70.335  1.00 121.86 ?  295  LEU C CA    1 
ATOM   5374  C  C     . LEU C 2  291  ? -1.328  -30.188 -70.748  1.00 122.79 ?  295  LEU C C     1 
ATOM   5375  O  O     . LEU C 2  291  ? -0.344  -29.486 -70.490  1.00 123.80 ?  295  LEU C O     1 
ATOM   5376  C  CB    . LEU C 2  291  ? -3.228  -30.560 -69.138  1.00 120.12 ?  295  LEU C CB    1 
ATOM   5377  C  CG    . LEU C 2  291  ? -2.527  -30.466 -67.781  1.00 113.36 ?  295  LEU C CG    1 
ATOM   5378  C  CD1   . LEU C 2  291  ? -1.393  -31.467 -67.686  1.00 116.09 ?  295  LEU C CD1   1 
ATOM   5379  C  CD2   . LEU C 2  291  ? -2.024  -29.054 -67.521  1.00 116.60 ?  295  LEU C CD2   1 
ATOM   5380  N  N     . LEU C 2  292  ? -1.222  -31.353 -71.393  1.00 123.11 ?  296  LEU C N     1 
ATOM   5381  C  CA    . LEU C 2  292  ? 0.075   -31.809 -71.885  1.00 117.87 ?  296  LEU C CA    1 
ATOM   5382  C  C     . LEU C 2  292  ? 0.618   -30.882 -72.963  1.00 117.19 ?  296  LEU C C     1 
ATOM   5383  O  O     . LEU C 2  292  ? 1.835   -30.686 -73.058  1.00 115.68 ?  296  LEU C O     1 
ATOM   5384  C  CB    . LEU C 2  292  ? -0.035  -33.238 -72.417  1.00 117.81 ?  296  LEU C CB    1 
ATOM   5385  C  CG    . LEU C 2  292  ? 0.278   -34.373 -71.437  1.00 117.35 ?  296  LEU C CG    1 
ATOM   5386  C  CD1   . LEU C 2  292  ? 1.743   -34.340 -71.038  1.00 107.86 ?  296  LEU C CD1   1 
ATOM   5387  C  CD2   . LEU C 2  292  ? -0.615  -34.310 -70.206  1.00 123.79 ?  296  LEU C CD2   1 
ATOM   5388  N  N     . GLU C 2  293  ? -0.264  -30.306 -73.782  1.00 122.77 ?  297  GLU C N     1 
ATOM   5389  C  CA    . GLU C 2  293  ? 0.169   -29.320 -74.767  1.00 121.41 ?  297  GLU C CA    1 
ATOM   5390  C  C     . GLU C 2  293  ? 0.761   -28.093 -74.084  1.00 120.61 ?  297  GLU C C     1 
ATOM   5391  O  O     . GLU C 2  293  ? 1.850   -27.630 -74.444  1.00 117.83 ?  297  GLU C O     1 
ATOM   5392  C  CB    . GLU C 2  293  ? -1.009  -28.924 -75.657  1.00 127.22 ?  297  GLU C CB    1 
ATOM   5393  C  CG    . GLU C 2  293  ? -0.713  -27.788 -76.623  1.00 125.79 ?  297  GLU C CG    1 
ATOM   5394  C  CD    . GLU C 2  293  ? -1.975  -27.105 -77.115  1.00 123.10 ?  297  GLU C CD    1 
ATOM   5395  O  OE1   . GLU C 2  293  ? -2.910  -26.931 -76.306  1.00 123.09 ?  297  GLU C OE1   1 
ATOM   5396  O  OE2   . GLU C 2  293  ? -2.033  -26.747 -78.310  1.00 123.11 ?  297  GLU C OE2   1 
ATOM   5397  N  N     . ASN C 2  294  ? 0.054   -27.556 -73.087  1.00 124.32 ?  298  ASN C N     1 
ATOM   5398  C  CA    . ASN C 2  294  ? 0.510   -26.361 -72.391  1.00 122.62 ?  298  ASN C CA    1 
ATOM   5399  C  C     . ASN C 2  294  ? 1.643   -26.643 -71.414  1.00 118.50 ?  298  ASN C C     1 
ATOM   5400  O  O     . ASN C 2  294  ? 2.308   -25.702 -70.970  1.00 115.36 ?  298  ASN C O     1 
ATOM   5401  C  CB    . ASN C 2  294  ? -0.658  -25.708 -71.649  1.00 120.13 ?  298  ASN C CB    1 
ATOM   5402  N  N     . LEU C 2  295  ? 1.875   -27.910 -71.067  1.00 117.07 ?  299  LEU C N     1 
ATOM   5403  C  CA    . LEU C 2  295  ? 2.945   -28.243 -70.134  1.00 114.76 ?  299  LEU C CA    1 
ATOM   5404  C  C     . LEU C 2  295  ? 4.312   -28.244 -70.805  1.00 111.20 ?  299  LEU C C     1 
ATOM   5405  O  O     . LEU C 2  295  ? 5.318   -27.934 -70.158  1.00 105.79 ?  299  LEU C O     1 
ATOM   5406  C  CB    . LEU C 2  295  ? 2.674   -29.607 -69.496  1.00 113.69 ?  299  LEU C CB    1 
ATOM   5407  C  CG    . LEU C 2  295  ? 3.660   -30.114 -68.444  1.00 107.96 ?  299  LEU C CG    1 
ATOM   5408  C  CD1   . LEU C 2  295  ? 3.756   -29.138 -67.283  1.00 110.45 ?  299  LEU C CD1   1 
ATOM   5409  C  CD2   . LEU C 2  295  ? 3.250   -31.493 -67.954  1.00 106.99 ?  299  LEU C CD2   1 
ATOM   5410  N  N     . PHE C 2  296  ? 4.368   -28.590 -72.089  1.00 110.09 ?  300  PHE C N     1 
ATOM   5411  C  CA    . PHE C 2  296  ? 5.634   -28.742 -72.794  1.00 103.32 ?  300  PHE C CA    1 
ATOM   5412  C  C     . PHE C 2  296  ? 5.648   -27.959 -74.102  1.00 103.88 ?  300  PHE C C     1 
ATOM   5413  O  O     . PHE C 2  296  ? 6.498   -27.088 -74.306  1.00 104.35 ?  300  PHE C O     1 
ATOM   5414  C  CB    . PHE C 2  296  ? 5.922   -30.221 -73.050  1.00 101.77 ?  300  PHE C CB    1 
ATOM   5415  C  CG    . PHE C 2  296  ? 6.327   -30.979 -71.821  1.00 98.61  ?  300  PHE C CG    1 
ATOM   5416  C  CD1   . PHE C 2  296  ? 7.564   -30.767 -71.240  1.00 95.70  ?  300  PHE C CD1   1 
ATOM   5417  C  CD2   . PHE C 2  296  ? 5.475   -31.907 -71.250  1.00 102.64 ?  300  PHE C CD2   1 
ATOM   5418  C  CE1   . PHE C 2  296  ? 7.944   -31.463 -70.110  1.00 97.94  ?  300  PHE C CE1   1 
ATOM   5419  C  CE2   . PHE C 2  296  ? 5.849   -32.607 -70.119  1.00 104.07 ?  300  PHE C CE2   1 
ATOM   5420  C  CZ    . PHE C 2  296  ? 7.085   -32.384 -69.548  1.00 101.95 ?  300  PHE C CZ    1 
ATOM   5421  N  N     . PHE C 2  297  ? 4.724   -28.283 -75.002  1.00 105.63 ?  301  PHE C N     1 
ATOM   5422  C  CA    . PHE C 2  297  ? 4.761   -27.804 -76.378  1.00 107.02 ?  301  PHE C CA    1 
ATOM   5423  C  C     . PHE C 2  297  ? 4.224   -26.388 -76.549  1.00 106.17 ?  301  PHE C C     1 
ATOM   5424  O  O     . PHE C 2  297  ? 4.213   -25.887 -77.679  1.00 105.41 ?  301  PHE C O     1 
ATOM   5425  C  CB    . PHE C 2  297  ? 3.975   -28.762 -77.277  1.00 110.90 ?  301  PHE C CB    1 
ATOM   5426  C  CG    . PHE C 2  297  ? 4.423   -30.193 -77.177  1.00 111.28 ?  301  PHE C CG    1 
ATOM   5427  C  CD1   . PHE C 2  297  ? 3.954   -31.012 -76.161  1.00 109.75 ?  301  PHE C CD1   1 
ATOM   5428  C  CD2   . PHE C 2  297  ? 5.310   -30.722 -78.100  1.00 109.49 ?  301  PHE C CD2   1 
ATOM   5429  C  CE1   . PHE C 2  297  ? 4.366   -32.325 -76.064  1.00 108.76 ?  301  PHE C CE1   1 
ATOM   5430  C  CE2   . PHE C 2  297  ? 5.724   -32.036 -78.009  1.00 106.77 ?  301  PHE C CE2   1 
ATOM   5431  C  CZ    . PHE C 2  297  ? 5.250   -32.839 -76.990  1.00 109.73 ?  301  PHE C CZ    1 
ATOM   5432  N  N     . LYS C 2  298  ? 3.783   -25.733 -75.481  1.00 106.97 ?  302  LYS C N     1 
ATOM   5433  C  CA    . LYS C 2  298  ? 3.283   -24.368 -75.564  1.00 106.53 ?  302  LYS C CA    1 
ATOM   5434  C  C     . LYS C 2  298  ? 4.313   -23.389 -75.016  1.00 103.75 ?  302  LYS C C     1 
ATOM   5435  O  O     . LYS C 2  298  ? 5.063   -23.699 -74.086  1.00 104.81 ?  302  LYS C O     1 
ATOM   5436  C  CB    . LYS C 2  298  ? 1.964   -24.217 -74.804  1.00 111.14 ?  302  LYS C CB    1 
ATOM   5437  N  N     . GLU C 2  299  ? 4.339   -22.192 -75.605  1.00 101.54 ?  303  GLU C N     1 
ATOM   5438  C  CA    . GLU C 2  299  ? 5.379   -21.225 -75.282  1.00 101.43 ?  303  GLU C CA    1 
ATOM   5439  C  C     . GLU C 2  299  ? 5.172   -20.553 -73.930  1.00 102.34 ?  303  GLU C C     1 
ATOM   5440  O  O     . GLU C 2  299  ? 6.132   -20.005 -73.378  1.00 102.97 ?  303  GLU C O     1 
ATOM   5441  C  CB    . GLU C 2  299  ? 5.461   -20.162 -76.377  1.00 99.31  ?  303  GLU C CB    1 
ATOM   5442  N  N     . LYS C 2  300  ? 3.955   -20.571 -73.384  1.00 104.70 ?  304  LYS C N     1 
ATOM   5443  C  CA    . LYS C 2  300  ? 3.703   -19.805 -72.167  1.00 105.53 ?  304  LYS C CA    1 
ATOM   5444  C  C     . LYS C 2  300  ? 4.328   -20.469 -70.943  1.00 104.89 ?  304  LYS C C     1 
ATOM   5445  O  O     . LYS C 2  300  ? 5.072   -19.827 -70.194  1.00 105.58 ?  304  LYS C O     1 
ATOM   5446  C  CB    . LYS C 2  300  ? 2.198   -19.586 -71.971  1.00 114.60 ?  304  LYS C CB    1 
ATOM   5447  C  CG    . LYS C 2  300  ? 1.329   -20.837 -71.954  1.00 117.83 ?  304  LYS C CG    1 
ATOM   5448  C  CD    . LYS C 2  300  ? -0.099  -20.489 -71.550  1.00 116.31 ?  304  LYS C CD    1 
ATOM   5449  C  CE    . LYS C 2  300  ? -0.975  -21.726 -71.446  1.00 118.17 ?  304  LYS C CE    1 
ATOM   5450  N  NZ    . LYS C 2  300  ? -2.363  -21.381 -71.029  1.00 114.89 ?  304  LYS C NZ    1 
ATOM   5451  N  N     . ARG C 2  301  ? 4.044   -21.753 -70.721  1.00 106.75 ?  305  ARG C N     1 
ATOM   5452  C  CA    . ARG C 2  301  ? 4.498   -22.433 -69.515  1.00 106.19 ?  305  ARG C CA    1 
ATOM   5453  C  C     . ARG C 2  301  ? 5.777   -23.238 -69.706  1.00 101.97 ?  305  ARG C C     1 
ATOM   5454  O  O     . ARG C 2  301  ? 6.303   -23.770 -68.723  1.00 96.93  ?  305  ARG C O     1 
ATOM   5455  C  CB    . ARG C 2  301  ? 3.396   -23.358 -68.983  1.00 107.31 ?  305  ARG C CB    1 
ATOM   5456  N  N     . TYR C 2  302  ? 6.288   -23.345 -70.930  1.00 99.77  ?  306  TYR C N     1 
ATOM   5457  C  CA    . TYR C 2  302  ? 7.522   -24.077 -71.187  1.00 94.80  ?  306  TYR C CA    1 
ATOM   5458  C  C     . TYR C 2  302  ? 8.345   -23.293 -72.192  1.00 95.75  ?  306  TYR C C     1 
ATOM   5459  O  O     . TYR C 2  302  ? 7.871   -23.016 -73.298  1.00 100.61 ?  306  TYR C O     1 
ATOM   5460  C  CB    . TYR C 2  302  ? 7.235   -25.486 -71.710  1.00 92.73  ?  306  TYR C CB    1 
ATOM   5461  C  CG    . TYR C 2  302  ? 8.460   -26.363 -71.825  1.00 91.58  ?  306  TYR C CG    1 
ATOM   5462  C  CD1   . TYR C 2  302  ? 9.236   -26.365 -72.977  1.00 91.59  ?  306  TYR C CD1   1 
ATOM   5463  C  CD2   . TYR C 2  302  ? 8.839   -27.193 -70.780  1.00 93.01  ?  306  TYR C CD2   1 
ATOM   5464  C  CE1   . TYR C 2  302  ? 10.356  -27.168 -73.082  1.00 91.96  ?  306  TYR C CE1   1 
ATOM   5465  C  CE2   . TYR C 2  302  ? 9.956   -28.000 -70.876  1.00 93.87  ?  306  TYR C CE2   1 
ATOM   5466  C  CZ    . TYR C 2  302  ? 10.711  -27.984 -72.029  1.00 89.70  ?  306  TYR C CZ    1 
ATOM   5467  O  OH    . TYR C 2  302  ? 11.823  -28.789 -72.124  1.00 77.77  ?  306  TYR C OH    1 
ATOM   5468  N  N     . ASP C 2  303  ? 9.573   -22.945 -71.820  1.00 92.85  ?  307  ASP C N     1 
ATOM   5469  C  CA    . ASP C 2  303  ? 10.460  -22.206 -72.708  1.00 89.35  ?  307  ASP C CA    1 
ATOM   5470  C  C     . ASP C 2  303  ? 11.830  -22.867 -72.716  1.00 84.31  ?  307  ASP C C     1 
ATOM   5471  O  O     . ASP C 2  303  ? 12.527  -22.884 -71.696  1.00 79.66  ?  307  ASP C O     1 
ATOM   5472  C  CB    . ASP C 2  303  ? 10.569  -20.740 -72.287  1.00 89.96  ?  307  ASP C CB    1 
ATOM   5473  C  CG    . ASP C 2  303  ? 11.299  -19.895 -73.312  1.00 90.77  ?  307  ASP C CG    1 
ATOM   5474  O  OD1   . ASP C 2  303  ? 11.438  -20.349 -74.467  1.00 85.82  ?  307  ASP C OD1   1 
ATOM   5475  O  OD2   . ASP C 2  303  ? 11.726  -18.773 -72.966  1.00 90.43  ?  307  ASP C OD2   1 
ATOM   5476  N  N     . LEU C 2  304  ? 12.202  -23.412 -73.865  1.00 86.40  ?  308  LEU C N     1 
ATOM   5477  C  CA    . LEU C 2  304  ? 13.591  -23.672 -74.191  1.00 81.92  ?  308  LEU C CA    1 
ATOM   5478  C  C     . LEU C 2  304  ? 14.145  -22.385 -74.783  1.00 86.46  ?  308  LEU C C     1 
ATOM   5479  O  O     . LEU C 2  304  ? 13.505  -21.777 -75.644  1.00 95.40  ?  308  LEU C O     1 
ATOM   5480  C  CB    . LEU C 2  304  ? 13.703  -24.820 -75.195  1.00 80.95  ?  308  LEU C CB    1 
ATOM   5481  C  CG    . LEU C 2  304  ? 14.856  -25.819 -75.110  1.00 73.83  ?  308  LEU C CG    1 
ATOM   5482  C  CD1   . LEU C 2  304  ? 14.655  -26.767 -73.943  1.00 72.52  ?  308  LEU C CD1   1 
ATOM   5483  C  CD2   . LEU C 2  304  ? 14.969  -26.590 -76.413  1.00 76.49  ?  308  LEU C CD2   1 
ATOM   5484  N  N     . ALA C 2  305  ? 15.303  -21.945 -74.305  1.00 77.95  ?  309  ALA C N     1 
ATOM   5485  C  CA    . ALA C 2  305  ? 15.891  -20.755 -74.895  1.00 77.46  ?  309  ALA C CA    1 
ATOM   5486  C  C     . ALA C 2  305  ? 16.468  -21.104 -76.265  1.00 74.83  ?  309  ALA C C     1 
ATOM   5487  O  O     . ALA C 2  305  ? 16.450  -22.258 -76.698  1.00 76.03  ?  309  ALA C O     1 
ATOM   5488  C  CB    . ALA C 2  305  ? 16.956  -20.172 -73.971  1.00 82.48  ?  309  ALA C CB    1 
ATOM   5489  N  N     . ARG C 2  306  ? 16.988  -20.095 -76.969  1.00 70.24  ?  310  ARG C N     1 
ATOM   5490  C  CA    . ARG C 2  306  ? 17.709  -20.397 -78.199  1.00 75.04  ?  310  ARG C CA    1 
ATOM   5491  C  C     . ARG C 2  306  ? 18.941  -21.237 -77.906  1.00 75.78  ?  310  ARG C C     1 
ATOM   5492  O  O     . ARG C 2  306  ? 19.313  -22.101 -78.709  1.00 74.00  ?  310  ARG C O     1 
ATOM   5493  C  CB    . ARG C 2  306  ? 18.111  -19.118 -78.932  1.00 77.59  ?  310  ARG C CB    1 
ATOM   5494  C  CG    . ARG C 2  306  ? 18.935  -19.396 -80.188  1.00 80.49  ?  310  ARG C CG    1 
ATOM   5495  C  CD    . ARG C 2  306  ? 19.579  -18.148 -80.762  1.00 78.53  ?  310  ARG C CD    1 
ATOM   5496  N  NE    . ARG C 2  306  ? 18.644  -17.364 -81.560  1.00 80.74  ?  310  ARG C NE    1 
ATOM   5497  C  CZ    . ARG C 2  306  ? 17.941  -16.340 -81.091  1.00 82.30  ?  310  ARG C CZ    1 
ATOM   5498  N  NH1   . ARG C 2  306  ? 18.068  -15.972 -79.823  1.00 75.45  ?  310  ARG C NH1   1 
ATOM   5499  N  NH2   . ARG C 2  306  ? 17.113  -15.683 -81.890  1.00 86.04  ?  310  ARG C NH2   1 
ATOM   5500  N  N     . VAL C 2  307  ? 19.577  -21.000 -76.758  1.00 74.68  ?  311  VAL C N     1 
ATOM   5501  C  CA    . VAL C 2  307  ? 20.691  -21.838 -76.328  1.00 72.33  ?  311  VAL C CA    1 
ATOM   5502  C  C     . VAL C 2  307  ? 20.251  -23.292 -76.243  1.00 76.10  ?  311  VAL C C     1 
ATOM   5503  O  O     . VAL C 2  307  ? 20.890  -24.187 -76.808  1.00 78.50  ?  311  VAL C O     1 
ATOM   5504  C  CB    . VAL C 2  307  ? 21.244  -21.336 -74.982  1.00 67.35  ?  311  VAL C CB    1 
ATOM   5505  C  CG1   . VAL C 2  307  ? 22.565  -22.016 -74.662  1.00 61.00  ?  311  VAL C CG1   1 
ATOM   5506  C  CG2   . VAL C 2  307  ? 21.394  -19.823 -75.002  1.00 66.33  ?  311  VAL C CG2   1 
ATOM   5507  N  N     . GLY C 2  308  ? 19.142  -23.546 -75.545  1.00 73.55  ?  312  GLY C N     1 
ATOM   5508  C  CA    . GLY C 2  308  ? 18.648  -24.909 -75.433  1.00 73.08  ?  312  GLY C CA    1 
ATOM   5509  C  C     . GLY C 2  308  ? 18.271  -25.507 -76.774  1.00 78.54  ?  312  GLY C C     1 
ATOM   5510  O  O     . GLY C 2  308  ? 18.549  -26.677 -77.042  1.00 76.48  ?  312  GLY C O     1 
ATOM   5511  N  N     . ARG C 2  309  ? 17.642  -24.709 -77.638  1.00 80.15  ?  313  ARG C N     1 
ATOM   5512  C  CA    . ARG C 2  309  ? 17.258  -25.192 -78.961  1.00 82.75  ?  313  ARG C CA    1 
ATOM   5513  C  C     . ARG C 2  309  ? 18.480  -25.620 -79.763  1.00 83.14  ?  313  ARG C C     1 
ATOM   5514  O  O     . ARG C 2  309  ? 18.531  -26.734 -80.297  1.00 86.06  ?  313  ARG C O     1 
ATOM   5515  C  CB    . ARG C 2  309  ? 16.477  -24.105 -79.701  1.00 86.55  ?  313  ARG C CB    1 
ATOM   5516  C  CG    . ARG C 2  309  ? 15.896  -24.533 -81.040  1.00 88.71  ?  313  ARG C CG    1 
ATOM   5517  C  CD    . ARG C 2  309  ? 14.819  -25.592 -80.870  1.00 90.80  ?  313  ARG C CD    1 
ATOM   5518  N  NE    . ARG C 2  309  ? 15.342  -26.944 -81.045  1.00 91.09  ?  313  ARG C NE    1 
ATOM   5519  C  CZ    . ARG C 2  309  ? 14.611  -28.047 -80.925  1.00 94.03  ?  313  ARG C CZ    1 
ATOM   5520  N  NH1   . ARG C 2  309  ? 13.322  -27.964 -80.625  1.00 93.42  ?  313  ARG C NH1   1 
ATOM   5521  N  NH2   . ARG C 2  309  ? 15.168  -29.237 -81.105  1.00 94.40  ?  313  ARG C NH2   1 
ATOM   5522  N  N     . TYR C 2  310  ? 19.483  -24.743 -79.849  1.00 80.75  ?  314  TYR C N     1 
ATOM   5523  C  CA    . TYR C 2  310  ? 20.693  -25.063 -80.597  1.00 81.38  ?  314  TYR C CA    1 
ATOM   5524  C  C     . TYR C 2  310  ? 21.444  -26.228 -79.967  1.00 80.88  ?  314  TYR C C     1 
ATOM   5525  O  O     . TYR C 2  310  ? 21.925  -27.120 -80.675  1.00 83.58  ?  314  TYR C O     1 
ATOM   5526  C  CB    . TYR C 2  310  ? 21.588  -23.828 -80.688  1.00 81.23  ?  314  TYR C CB    1 
ATOM   5527  C  CG    . TYR C 2  310  ? 22.997  -24.114 -81.152  1.00 82.19  ?  314  TYR C CG    1 
ATOM   5528  C  CD1   . TYR C 2  310  ? 23.259  -24.467 -82.468  1.00 84.46  ?  314  TYR C CD1   1 
ATOM   5529  C  CD2   . TYR C 2  310  ? 24.068  -24.016 -80.275  1.00 80.05  ?  314  TYR C CD2   1 
ATOM   5530  C  CE1   . TYR C 2  310  ? 24.547  -24.724 -82.896  1.00 86.08  ?  314  TYR C CE1   1 
ATOM   5531  C  CE2   . TYR C 2  310  ? 25.359  -24.269 -80.692  1.00 83.53  ?  314  TYR C CE2   1 
ATOM   5532  C  CZ    . TYR C 2  310  ? 25.593  -24.623 -82.003  1.00 87.40  ?  314  TYR C CZ    1 
ATOM   5533  O  OH    . TYR C 2  310  ? 26.880  -24.878 -82.421  1.00 90.19  ?  314  TYR C OH    1 
ATOM   5534  N  N     . LYS C 2  311  ? 21.556  -26.238 -78.636  1.00 79.85  ?  315  LYS C N     1 
ATOM   5535  C  CA    . LYS C 2  311  ? 22.212  -27.354 -77.963  1.00 80.00  ?  315  LYS C CA    1 
ATOM   5536  C  C     . LYS C 2  311  ? 21.494  -28.666 -78.252  1.00 79.01  ?  315  LYS C C     1 
ATOM   5537  O  O     . LYS C 2  311  ? 22.137  -29.681 -78.538  1.00 79.35  ?  315  LYS C O     1 
ATOM   5538  C  CB    . LYS C 2  311  ? 22.287  -27.098 -76.459  1.00 74.99  ?  315  LYS C CB    1 
ATOM   5539  C  CG    . LYS C 2  311  ? 23.333  -26.071 -76.059  1.00 73.25  ?  315  LYS C CG    1 
ATOM   5540  C  CD    . LYS C 2  311  ? 24.740  -26.637 -76.154  1.00 66.30  ?  315  LYS C CD    1 
ATOM   5541  C  CE    . LYS C 2  311  ? 25.009  -27.627 -75.034  1.00 59.19  ?  315  LYS C CE    1 
ATOM   5542  N  NZ    . LYS C 2  311  ? 26.404  -28.146 -75.079  1.00 64.35  ?  315  LYS C NZ    1 
ATOM   5543  N  N     . VAL C 2  312  ? 20.161  -28.664 -78.195  1.00 80.27  ?  316  VAL C N     1 
ATOM   5544  C  CA    . VAL C 2  312  ? 19.410  -29.855 -78.582  1.00 82.16  ?  316  VAL C CA    1 
ATOM   5545  C  C     . VAL C 2  312  ? 19.618  -30.151 -80.060  1.00 82.72  ?  316  VAL C C     1 
ATOM   5546  O  O     . VAL C 2  312  ? 19.797  -31.309 -80.457  1.00 84.69  ?  316  VAL C O     1 
ATOM   5547  C  CB    . VAL C 2  312  ? 17.917  -29.687 -78.243  1.00 79.90  ?  316  VAL C CB    1 
ATOM   5548  C  CG1   . VAL C 2  312  ? 17.106  -30.814 -78.856  1.00 79.62  ?  316  VAL C CG1   1 
ATOM   5549  C  CG2   . VAL C 2  312  ? 17.718  -29.655 -76.740  1.00 77.73  ?  316  VAL C CG2   1 
ATOM   5550  N  N     . ASN C 2  313  ? 19.604  -29.111 -80.896  1.00 82.16  ?  317  ASN C N     1 
ATOM   5551  C  CA    . ASN C 2  313  ? 19.864  -29.296 -82.319  1.00 83.91  ?  317  ASN C CA    1 
ATOM   5552  C  C     . ASN C 2  313  ? 21.220  -29.951 -82.544  1.00 85.76  ?  317  ASN C C     1 
ATOM   5553  O  O     . ASN C 2  313  ? 21.318  -31.000 -83.184  1.00 88.90  ?  317  ASN C O     1 
ATOM   5554  C  CB    . ASN C 2  313  ? 19.784  -27.954 -83.048  1.00 84.70  ?  317  ASN C CB    1 
ATOM   5555  C  CG    . ASN C 2  313  ? 18.359  -27.518 -83.307  1.00 87.28  ?  317  ASN C CG    1 
ATOM   5556  O  OD1   . ASN C 2  313  ? 17.426  -28.002 -82.668  1.00 83.60  ?  317  ASN C OD1   1 
ATOM   5557  N  ND2   . ASN C 2  313  ? 18.183  -26.602 -84.251  1.00 92.85  ?  317  ASN C ND2   1 
ATOM   5558  N  N     . LYS C 2  314  ? 22.281  -29.349 -82.005  1.00 83.38  ?  318  LYS C N     1 
ATOM   5559  C  CA    . LYS C 2  314  ? 23.617  -29.898 -82.210  1.00 83.00  ?  318  LYS C CA    1 
ATOM   5560  C  C     . LYS C 2  314  ? 23.778  -31.261 -81.548  1.00 86.36  ?  318  LYS C C     1 
ATOM   5561  O  O     . LYS C 2  314  ? 24.518  -32.111 -82.056  1.00 90.43  ?  318  LYS C O     1 
ATOM   5562  C  CB    . LYS C 2  314  ? 24.666  -28.920 -81.683  1.00 85.66  ?  318  LYS C CB    1 
ATOM   5563  C  CG    . LYS C 2  314  ? 26.098  -29.265 -82.057  1.00 87.66  ?  318  LYS C CG    1 
ATOM   5564  C  CD    . LYS C 2  314  ? 27.063  -28.246 -81.474  1.00 84.94  ?  318  LYS C CD    1 
ATOM   5565  C  CE    . LYS C 2  314  ? 28.505  -28.587 -81.800  1.00 85.44  ?  318  LYS C CE    1 
ATOM   5566  N  NZ    . LYS C 2  314  ? 29.447  -27.617 -81.177  1.00 89.76  ?  318  LYS C NZ    1 
ATOM   5567  N  N     . LYS C 2  315  ? 23.091  -31.496 -80.428  1.00 84.79  ?  319  LYS C N     1 
ATOM   5568  C  CA    . LYS C 2  315  ? 23.243  -32.765 -79.724  1.00 83.45  ?  319  LYS C CA    1 
ATOM   5569  C  C     . LYS C 2  315  ? 22.487  -33.892 -80.415  1.00 84.26  ?  319  LYS C C     1 
ATOM   5570  O  O     . LYS C 2  315  ? 22.917  -35.046 -80.359  1.00 86.05  ?  319  LYS C O     1 
ATOM   5571  C  CB    . LYS C 2  315  ? 22.775  -32.626 -78.274  1.00 81.24  ?  319  LYS C CB    1 
ATOM   5572  C  CG    . LYS C 2  315  ? 22.871  -33.896 -77.449  1.00 74.71  ?  319  LYS C CG    1 
ATOM   5573  C  CD    . LYS C 2  315  ? 24.295  -34.413 -77.388  1.00 70.94  ?  319  LYS C CD    1 
ATOM   5574  C  CE    . LYS C 2  315  ? 24.397  -35.603 -76.454  1.00 72.12  ?  319  LYS C CE    1 
ATOM   5575  N  NZ    . LYS C 2  315  ? 25.777  -36.152 -76.391  1.00 75.50  ?  319  LYS C NZ    1 
ATOM   5576  N  N     . LEU C 2  316  ? 21.327  -33.602 -80.997  1.00 88.22  ?  320  LEU C N     1 
ATOM   5577  C  CA    . LEU C 2  316  ? 20.586  -34.594 -81.765  1.00 89.86  ?  320  LEU C CA    1 
ATOM   5578  C  C     . LEU C 2  316  ? 20.734  -34.440 -83.277  1.00 94.53  ?  320  LEU C C     1 
ATOM   5579  O  O     . LEU C 2  316  ? 20.213  -35.278 -84.019  1.00 100.20 ?  320  LEU C O     1 
ATOM   5580  C  CB    . LEU C 2  316  ? 19.108  -34.551 -81.372  1.00 89.58  ?  320  LEU C CB    1 
ATOM   5581  C  CG    . LEU C 2  316  ? 18.874  -34.815 -79.882  1.00 86.70  ?  320  LEU C CG    1 
ATOM   5582  C  CD1   . LEU C 2  316  ? 17.443  -34.499 -79.489  1.00 92.86  ?  320  LEU C CD1   1 
ATOM   5583  C  CD2   . LEU C 2  316  ? 19.221  -36.249 -79.528  1.00 82.52  ?  320  LEU C CD2   1 
ATOM   5584  N  N     . GLY C 2  317  ? 21.433  -33.409 -83.750  1.00 96.19  ?  321  GLY C N     1 
ATOM   5585  C  CA    . GLY C 2  317  ? 21.577  -33.191 -85.184  1.00 102.45 ?  321  GLY C CA    1 
ATOM   5586  C  C     . GLY C 2  317  ? 20.272  -33.027 -85.931  1.00 105.31 ?  321  GLY C C     1 
ATOM   5587  O  O     . GLY C 2  317  ? 20.186  -33.403 -87.105  1.00 104.72 ?  321  GLY C O     1 
ATOM   5588  N  N     . LEU C 2  318  ? 19.249  -32.462 -85.285  1.00 102.04 ?  322  LEU C N     1 
ATOM   5589  C  CA    . LEU C 2  318  ? 17.905  -32.490 -85.854  1.00 102.87 ?  322  LEU C CA    1 
ATOM   5590  C  C     . LEU C 2  318  ? 17.737  -31.498 -87.000  1.00 106.51 ?  322  LEU C C     1 
ATOM   5591  O  O     . LEU C 2  318  ? 17.263  -31.867 -88.079  1.00 111.21 ?  322  LEU C O     1 
ATOM   5592  C  CB    . LEU C 2  318  ? 16.870  -32.232 -84.761  1.00 99.34  ?  322  LEU C CB    1 
ATOM   5593  C  CG    . LEU C 2  318  ? 16.717  -33.394 -83.778  1.00 99.06  ?  322  LEU C CG    1 
ATOM   5594  C  CD1   . LEU C 2  318  ? 15.576  -33.146 -82.807  1.00 102.30 ?  322  LEU C CD1   1 
ATOM   5595  C  CD2   . LEU C 2  318  ? 16.520  -34.706 -84.525  1.00 102.54 ?  322  LEU C CD2   1 
ATOM   5596  N  N     . HIS C 2  319  ? 18.111  -30.237 -86.796  1.00 104.03 ?  323  HIS C N     1 
ATOM   5597  C  CA    . HIS C 2  319  ? 17.950  -29.214 -87.825  1.00 103.00 ?  323  HIS C CA    1 
ATOM   5598  C  C     . HIS C 2  319  ? 19.329  -28.779 -88.303  1.00 106.89 ?  323  HIS C C     1 
ATOM   5599  O  O     . HIS C 2  319  ? 20.036  -28.048 -87.602  1.00 105.04 ?  323  HIS C O     1 
ATOM   5600  C  CB    . HIS C 2  319  ? 17.150  -28.026 -87.298  1.00 103.57 ?  323  HIS C CB    1 
ATOM   5601  C  CG    . HIS C 2  319  ? 15.697  -28.320 -87.087  1.00 109.64 ?  323  HIS C CG    1 
ATOM   5602  N  ND1   . HIS C 2  319  ? 14.731  -27.337 -87.085  1.00 108.62 ?  323  HIS C ND1   1 
ATOM   5603  C  CD2   . HIS C 2  319  ? 15.046  -29.488 -86.869  1.00 110.14 ?  323  HIS C CD2   1 
ATOM   5604  C  CE1   . HIS C 2  319  ? 13.547  -27.886 -86.877  1.00 107.15 ?  323  HIS C CE1   1 
ATOM   5605  N  NE2   . HIS C 2  319  ? 13.711  -29.190 -86.742  1.00 107.18 ?  323  HIS C NE2   1 
ATOM   5606  N  N     . VAL C 2  320  ? 19.697  -29.222 -89.505  1.00 109.69 ?  324  VAL C N     1 
ATOM   5607  C  CA    . VAL C 2  320  ? 20.958  -28.804 -90.106  1.00 111.95 ?  324  VAL C CA    1 
ATOM   5608  C  C     . VAL C 2  320  ? 20.811  -27.462 -90.810  1.00 116.51 ?  324  VAL C C     1 
ATOM   5609  O  O     . VAL C 2  320  ? 21.759  -26.668 -90.844  1.00 113.30 ?  324  VAL C O     1 
ATOM   5610  C  CB    . VAL C 2  320  ? 21.472  -29.889 -91.065  1.00 109.05 ?  324  VAL C CB    1 
ATOM   5611  C  CG1   . VAL C 2  320  ? 22.954  -29.689 -91.348  1.00 102.48 ?  324  VAL C CG1   1 
ATOM   5612  C  CG2   . VAL C 2  320  ? 21.208  -31.267 -90.486  1.00 104.37 ?  324  VAL C CG2   1 
ATOM   5613  N  N     . GLY C 2  321  ? 19.636  -27.180 -91.373  1.00 118.98 ?  325  GLY C N     1 
ATOM   5614  C  CA    . GLY C 2  321  ? 19.411  -25.957 -92.121  1.00 116.95 ?  325  GLY C CA    1 
ATOM   5615  C  C     . GLY C 2  321  ? 19.390  -24.696 -91.291  1.00 117.74 ?  325  GLY C C     1 
ATOM   5616  O  O     . GLY C 2  321  ? 19.139  -23.617 -91.836  1.00 119.65 ?  325  GLY C O     1 
ATOM   5617  N  N     . GLU C 2  322  ? 19.643  -24.809 -89.990  1.00 115.71 ?  326  GLU C N     1 
ATOM   5618  C  CA    . GLU C 2  322  ? 19.666  -23.681 -89.067  1.00 116.71 ?  326  GLU C CA    1 
ATOM   5619  C  C     . GLU C 2  322  ? 18.388  -22.834 -89.072  1.00 115.81 ?  326  GLU C C     1 
ATOM   5620  O  O     . GLU C 2  322  ? 18.457  -21.614 -89.244  1.00 118.93 ?  326  GLU C O     1 
ATOM   5621  C  CB    . GLU C 2  322  ? 20.878  -22.802 -89.350  1.00 109.63 ?  326  GLU C CB    1 
ATOM   5622  N  N     . PRO C 2  323  ? 17.214  -23.445 -88.896  1.00 112.71 ?  327  PRO C N     1 
ATOM   5623  C  CA    . PRO C 2  323  ? 16.024  -22.631 -88.619  1.00 111.45 ?  327  PRO C CA    1 
ATOM   5624  C  C     . PRO C 2  323  ? 16.109  -22.026 -87.225  1.00 111.24 ?  327  PRO C C     1 
ATOM   5625  O  O     . PRO C 2  323  ? 16.376  -22.723 -86.245  1.00 107.47 ?  327  PRO C O     1 
ATOM   5626  C  CB    . PRO C 2  323  ? 14.866  -23.633 -88.734  1.00 115.56 ?  327  PRO C CB    1 
ATOM   5627  C  CG    . PRO C 2  323  ? 15.439  -24.816 -89.449  1.00 112.73 ?  327  PRO C CG    1 
ATOM   5628  C  CD    . PRO C 2  323  ? 16.860  -24.871 -89.003  1.00 113.35 ?  327  PRO C CD    1 
ATOM   5629  N  N     . ILE C 2  324  ? 15.884  -20.715 -87.144  1.00 115.13 ?  328  ILE C N     1 
ATOM   5630  C  CA    . ILE C 2  324  ? 15.851  -20.000 -85.871  1.00 115.31 ?  328  ILE C CA    1 
ATOM   5631  C  C     . ILE C 2  324  ? 14.423  -19.791 -85.374  1.00 115.10 ?  328  ILE C C     1 
ATOM   5632  O  O     . ILE C 2  324  ? 14.216  -19.117 -84.361  1.00 115.49 ?  328  ILE C O     1 
ATOM   5633  C  CB    . ILE C 2  324  ? 16.603  -18.661 -85.973  1.00 111.59 ?  328  ILE C CB    1 
ATOM   5634  C  CG1   . ILE C 2  324  ? 17.757  -18.775 -86.970  1.00 112.95 ?  328  ILE C CG1   1 
ATOM   5635  C  CG2   . ILE C 2  324  ? 17.154  -18.246 -84.615  1.00 103.37 ?  328  ILE C CG2   1 
ATOM   5636  C  CD1   . ILE C 2  324  ? 18.628  -17.539 -87.043  1.00 107.45 ?  328  ILE C CD1   1 
ATOM   5637  N  N     . THR C 2  325  ? 13.433  -20.365 -86.065  1.00 114.93 ?  329  THR C N     1 
ATOM   5638  C  CA    . THR C 2  325  ? 12.051  -19.899 -85.957  1.00 117.25 ?  329  THR C CA    1 
ATOM   5639  C  C     . THR C 2  325  ? 11.530  -19.957 -84.524  1.00 118.21 ?  329  THR C C     1 
ATOM   5640  O  O     . THR C 2  325  ? 11.156  -18.930 -83.945  1.00 116.12 ?  329  THR C O     1 
ATOM   5641  C  CB    . THR C 2  325  ? 11.156  -20.726 -86.884  1.00 116.20 ?  329  THR C CB    1 
ATOM   5642  N  N     . SER C 2  326  ? 11.504  -21.145 -83.929  1.00 115.15 ?  330  SER C N     1 
ATOM   5643  C  CA    . SER C 2  326  ? 10.866  -21.331 -82.634  1.00 110.24 ?  330  SER C CA    1 
ATOM   5644  C  C     . SER C 2  326  ? 11.760  -22.152 -81.723  1.00 105.29 ?  330  SER C C     1 
ATOM   5645  O  O     . SER C 2  326  ? 12.432  -23.084 -82.175  1.00 104.63 ?  330  SER C O     1 
ATOM   5646  C  CB    . SER C 2  326  ? 9.505   -22.023 -82.780  1.00 113.33 ?  330  SER C CB    1 
ATOM   5647  O  OG    . SER C 2  326  ? 8.647   -21.286 -83.633  1.00 116.76 ?  330  SER C OG    1 
ATOM   5648  N  N     . SER C 2  327  ? 11.769  -21.805 -80.440  1.00 101.06 ?  331  SER C N     1 
ATOM   5649  C  CA    . SER C 2  327  ? 12.483  -22.586 -79.438  1.00 95.34  ?  331  SER C CA    1 
ATOM   5650  C  C     . SER C 2  327  ? 11.448  -23.197 -78.499  1.00 94.28  ?  331  SER C C     1 
ATOM   5651  O  O     . SER C 2  327  ? 10.923  -22.524 -77.608  1.00 93.11  ?  331  SER C O     1 
ATOM   5652  C  CB    . SER C 2  327  ? 13.478  -21.708 -78.688  1.00 94.12  ?  331  SER C CB    1 
ATOM   5653  O  OG    . SER C 2  327  ? 14.258  -20.940 -79.586  1.00 97.33  ?  331  SER C OG    1 
ATOM   5654  N  N     . THR C 2  328  ? 11.176  -24.482 -78.702  1.00 95.03  ?  332  THR C N     1 
ATOM   5655  C  CA    . THR C 2  328  ? 10.345  -25.300 -77.830  1.00 96.90  ?  332  THR C CA    1 
ATOM   5656  C  C     . THR C 2  328  ? 10.659  -26.746 -78.178  1.00 96.39  ?  332  THR C C     1 
ATOM   5657  O  O     . THR C 2  328  ? 11.174  -27.035 -79.260  1.00 95.69  ?  332  THR C O     1 
ATOM   5658  C  CB    . THR C 2  328  ? 8.847   -24.995 -78.001  1.00 101.34 ?  332  THR C CB    1 
ATOM   5659  O  OG1   . THR C 2  328  ? 8.635   -23.578 -78.000  1.00 100.30 ?  332  THR C OG1   1 
ATOM   5660  C  CG2   . THR C 2  328  ? 8.032   -25.602 -76.865  1.00 99.02  ?  332  THR C CG2   1 
ATOM   5661  N  N     . LEU C 2  329  ? 10.347  -27.656 -77.261  1.00 96.92  ?  333  LEU C N     1 
ATOM   5662  C  CA    . LEU C 2  329  ? 10.550  -29.058 -77.581  1.00 100.59 ?  333  LEU C CA    1 
ATOM   5663  C  C     . LEU C 2  329  ? 9.546   -29.510 -78.638  1.00 100.08 ?  333  LEU C C     1 
ATOM   5664  O  O     . LEU C 2  329  ? 8.488   -28.905 -78.833  1.00 98.66  ?  333  LEU C O     1 
ATOM   5665  C  CB    . LEU C 2  329  ? 10.445  -29.928 -76.327  1.00 99.56  ?  333  LEU C CB    1 
ATOM   5666  C  CG    . LEU C 2  329  ? 9.327   -29.709 -75.306  1.00 102.99 ?  333  LEU C CG    1 
ATOM   5667  C  CD1   . LEU C 2  329  ? 7.958   -30.050 -75.866  1.00 103.73 ?  333  LEU C CD1   1 
ATOM   5668  C  CD2   . LEU C 2  329  ? 9.616   -30.543 -74.071  1.00 99.97  ?  333  LEU C CD2   1 
ATOM   5669  N  N     . THR C 2  330  ? 9.895   -30.589 -79.329  1.00 100.76 ?  334  THR C N     1 
ATOM   5670  C  CA    . THR C 2  330  ? 9.046   -31.154 -80.363  1.00 101.32 ?  334  THR C CA    1 
ATOM   5671  C  C     . THR C 2  330  ? 8.873   -32.647 -80.123  1.00 107.07 ?  334  THR C C     1 
ATOM   5672  O  O     . THR C 2  330  ? 9.676   -33.291 -79.438  1.00 110.82 ?  334  THR C O     1 
ATOM   5673  C  CB    . THR C 2  330  ? 9.622   -30.911 -81.765  1.00 103.60 ?  334  THR C CB    1 
ATOM   5674  N  N     . GLU C 2  331  ? 7.792   -33.190 -80.688  1.00 106.83 ?  335  GLU C N     1 
ATOM   5675  C  CA    . GLU C 2  331  ? 7.593   -34.633 -80.653  1.00 108.46 ?  335  GLU C CA    1 
ATOM   5676  C  C     . GLU C 2  331  ? 8.807   -35.357 -81.217  1.00 109.69 ?  335  GLU C C     1 
ATOM   5677  O  O     . GLU C 2  331  ? 9.266   -36.355 -80.650  1.00 110.99 ?  335  GLU C O     1 
ATOM   5678  C  CB    . GLU C 2  331  ? 6.329   -35.009 -81.429  1.00 111.73 ?  335  GLU C CB    1 
ATOM   5679  N  N     . GLU C 2  332  ? 9.357   -34.848 -82.323  1.00 107.71 ?  336  GLU C N     1 
ATOM   5680  C  CA    . GLU C 2  332  ? 10.590  -35.405 -82.863  1.00 107.16 ?  336  GLU C CA    1 
ATOM   5681  C  C     . GLU C 2  332  ? 11.757  -35.245 -81.900  1.00 108.20 ?  336  GLU C C     1 
ATOM   5682  O  O     . GLU C 2  332  ? 12.729  -36.001 -81.994  1.00 109.99 ?  336  GLU C O     1 
ATOM   5683  C  CB    . GLU C 2  332  ? 10.927  -34.753 -84.206  1.00 104.23 ?  336  GLU C CB    1 
ATOM   5684  C  CG    . GLU C 2  332  ? 11.326  -33.291 -84.113  1.00 105.11 ?  336  GLU C CG    1 
ATOM   5685  C  CD    . GLU C 2  332  ? 11.892  -32.759 -85.416  1.00 108.41 ?  336  GLU C CD    1 
ATOM   5686  O  OE1   . GLU C 2  332  ? 11.791  -31.538 -85.659  1.00 111.87 ?  336  GLU C OE1   1 
ATOM   5687  O  OE2   . GLU C 2  332  ? 12.438  -33.564 -86.199  1.00 105.49 ?  336  GLU C OE2   1 
ATOM   5688  N  N     . ASP C 2  333  ? 11.691  -34.277 -80.983  1.00 108.30 ?  337  ASP C N     1 
ATOM   5689  C  CA    . ASP C 2  333  ? 12.714  -34.170 -79.951  1.00 104.82 ?  337  ASP C CA    1 
ATOM   5690  C  C     . ASP C 2  333  ? 12.540  -35.235 -78.879  1.00 103.47 ?  337  ASP C C     1 
ATOM   5691  O  O     . ASP C 2  333  ? 13.534  -35.722 -78.330  1.00 102.96 ?  337  ASP C O     1 
ATOM   5692  C  CB    . ASP C 2  333  ? 12.692  -32.780 -79.314  1.00 103.68 ?  337  ASP C CB    1 
ATOM   5693  C  CG    . ASP C 2  333  ? 12.879  -31.672 -80.328  1.00 106.26 ?  337  ASP C CG    1 
ATOM   5694  O  OD1   . ASP C 2  333  ? 12.787  -31.955 -81.540  1.00 110.49 ?  337  ASP C OD1   1 
ATOM   5695  O  OD2   . ASP C 2  333  ? 13.109  -30.518 -79.912  1.00 101.54 ?  337  ASP C OD2   1 
ATOM   5696  N  N     . VAL C 2  334  ? 11.297  -35.603 -78.563  1.00 103.88 ?  338  VAL C N     1 
ATOM   5697  C  CA    . VAL C 2  334  ? 11.072  -36.702 -77.627  1.00 105.96 ?  338  VAL C CA    1 
ATOM   5698  C  C     . VAL C 2  334  ? 11.533  -38.020 -78.239  1.00 107.47 ?  338  VAL C C     1 
ATOM   5699  O  O     . VAL C 2  334  ? 12.262  -38.801 -77.610  1.00 106.73 ?  338  VAL C O     1 
ATOM   5700  C  CB    . VAL C 2  334  ? 9.592   -36.761 -77.213  1.00 106.20 ?  338  VAL C CB    1 
ATOM   5701  C  CG1   . VAL C 2  334  ? 9.398   -37.755 -76.077  1.00 104.05 ?  338  VAL C CG1   1 
ATOM   5702  C  CG2   . VAL C 2  334  ? 9.094   -35.380 -76.820  1.00 104.43 ?  338  VAL C CG2   1 
ATOM   5703  N  N     . VAL C 2  335  ? 11.113  -38.284 -79.480  1.00 111.14 ?  339  VAL C N     1 
ATOM   5704  C  CA    . VAL C 2  335  ? 11.552  -39.485 -80.184  1.00 112.84 ?  339  VAL C CA    1 
ATOM   5705  C  C     . VAL C 2  335  ? 13.069  -39.505 -80.302  1.00 109.40 ?  339  VAL C C     1 
ATOM   5706  O  O     . VAL C 2  335  ? 13.710  -40.544 -80.103  1.00 108.70 ?  339  VAL C O     1 
ATOM   5707  C  CB    . VAL C 2  335  ? 10.881  -39.569 -81.567  1.00 116.32 ?  339  VAL C CB    1 
ATOM   5708  C  CG1   . VAL C 2  335  ? 11.249  -40.873 -82.261  1.00 119.47 ?  339  VAL C CG1   1 
ATOM   5709  C  CG2   . VAL C 2  335  ? 9.376   -39.432 -81.436  1.00 120.31 ?  339  VAL C CG2   1 
ATOM   5710  N  N     . ALA C 2  336  ? 13.667  -38.357 -80.624  1.00 108.74 ?  340  ALA C N     1 
ATOM   5711  C  CA    . ALA C 2  336  ? 15.117  -38.287 -80.753  1.00 106.72 ?  340  ALA C CA    1 
ATOM   5712  C  C     . ALA C 2  336  ? 15.803  -38.545 -79.419  1.00 104.03 ?  340  ALA C C     1 
ATOM   5713  O  O     . ALA C 2  336  ? 16.869  -39.169 -79.373  1.00 100.42 ?  340  ALA C O     1 
ATOM   5714  C  CB    . ALA C 2  336  ? 15.526  -36.927 -81.316  1.00 104.32 ?  340  ALA C CB    1 
ATOM   5715  N  N     . THR C 2  337  ? 15.205  -38.078 -78.322  1.00 105.27 ?  341  THR C N     1 
ATOM   5716  C  CA    . THR C 2  337  ? 15.804  -38.289 -77.009  1.00 101.29 ?  341  THR C CA    1 
ATOM   5717  C  C     . THR C 2  337  ? 15.761  -39.759 -76.618  1.00 99.22  ?  341  THR C C     1 
ATOM   5718  O  O     . THR C 2  337  ? 16.759  -40.314 -76.144  1.00 96.43  ?  341  THR C O     1 
ATOM   5719  C  CB    . THR C 2  337  ? 15.093  -37.434 -75.960  1.00 99.00  ?  341  THR C CB    1 
ATOM   5720  O  OG1   . THR C 2  337  ? 15.199  -36.051 -76.317  1.00 95.79  ?  341  THR C OG1   1 
ATOM   5721  C  CG2   . THR C 2  337  ? 15.720  -37.648 -74.590  1.00 92.54  ?  341  THR C CG2   1 
ATOM   5722  N  N     . ILE C 2  338  ? 14.613  -40.412 -76.810  1.00 101.39 ?  342  ILE C N     1 
ATOM   5723  C  CA    . ILE C 2  338  ? 14.526  -41.827 -76.460  1.00 99.87  ?  342  ILE C CA    1 
ATOM   5724  C  C     . ILE C 2  338  ? 15.428  -42.657 -77.366  1.00 98.52  ?  342  ILE C C     1 
ATOM   5725  O  O     . ILE C 2  338  ? 16.134  -43.560 -76.901  1.00 93.32  ?  342  ILE C O     1 
ATOM   5726  C  CB    . ILE C 2  338  ? 13.066  -42.307 -76.509  1.00 104.48 ?  342  ILE C CB    1 
ATOM   5727  C  CG1   . ILE C 2  338  ? 12.230  -41.545 -75.479  1.00 104.33 ?  342  ILE C CG1   1 
ATOM   5728  C  CG2   . ILE C 2  338  ? 12.990  -43.804 -76.252  1.00 111.31 ?  342  ILE C CG2   1 
ATOM   5729  C  CD1   . ILE C 2  338  ? 10.849  -42.120 -75.262  1.00 107.81 ?  342  ILE C CD1   1 
ATOM   5730  N  N     . GLU C 2  339  ? 15.432  -42.358 -78.668  1.00 102.43 ?  343  GLU C N     1 
ATOM   5731  C  CA    . GLU C 2  339  ? 16.303  -43.077 -79.592  1.00 97.12  ?  343  GLU C CA    1 
ATOM   5732  C  C     . GLU C 2  339  ? 17.767  -42.922 -79.204  1.00 95.28  ?  343  GLU C C     1 
ATOM   5733  O  O     . GLU C 2  339  ? 18.521  -43.901 -79.196  1.00 98.84  ?  343  GLU C O     1 
ATOM   5734  C  CB    . GLU C 2  339  ? 16.073  -42.589 -81.023  1.00 98.05  ?  343  GLU C CB    1 
ATOM   5735  N  N     . TYR C 2  340  ? 18.187  -41.697 -78.876  1.00 93.64  ?  344  TYR C N     1 
ATOM   5736  C  CA    . TYR C 2  340  ? 19.551  -41.475 -78.406  1.00 91.44  ?  344  TYR C CA    1 
ATOM   5737  C  C     . TYR C 2  340  ? 19.833  -42.297 -77.154  1.00 91.84  ?  344  TYR C C     1 
ATOM   5738  O  O     . TYR C 2  340  ? 20.870  -42.962 -77.054  1.00 91.26  ?  344  TYR C O     1 
ATOM   5739  C  CB    . TYR C 2  340  ? 19.769  -39.983 -78.139  1.00 89.08  ?  344  TYR C CB    1 
ATOM   5740  C  CG    . TYR C 2  340  ? 21.212  -39.513 -78.194  1.00 84.55  ?  344  TYR C CG    1 
ATOM   5741  C  CD1   . TYR C 2  340  ? 22.114  -39.840 -77.190  1.00 81.44  ?  344  TYR C CD1   1 
ATOM   5742  C  CD2   . TYR C 2  340  ? 21.661  -38.714 -79.237  1.00 84.62  ?  344  TYR C CD2   1 
ATOM   5743  C  CE1   . TYR C 2  340  ? 23.424  -39.399 -77.234  1.00 78.44  ?  344  TYR C CE1   1 
ATOM   5744  C  CE2   . TYR C 2  340  ? 22.967  -38.270 -79.290  1.00 81.45  ?  344  TYR C CE2   1 
ATOM   5745  C  CZ    . TYR C 2  340  ? 23.844  -38.615 -78.287  1.00 79.19  ?  344  TYR C CZ    1 
ATOM   5746  O  OH    . TYR C 2  340  ? 25.145  -38.173 -78.338  1.00 80.62  ?  344  TYR C OH    1 
ATOM   5747  N  N     . LEU C 2  341  ? 18.909  -42.272 -76.190  1.00 88.13  ?  345  LEU C N     1 
ATOM   5748  C  CA    . LEU C 2  341  ? 19.092  -43.058 -74.974  1.00 87.10  ?  345  LEU C CA    1 
ATOM   5749  C  C     . LEU C 2  341  ? 19.046  -44.552 -75.267  1.00 91.55  ?  345  LEU C C     1 
ATOM   5750  O  O     . LEU C 2  341  ? 19.793  -45.330 -74.662  1.00 93.99  ?  345  LEU C O     1 
ATOM   5751  C  CB    . LEU C 2  341  ? 18.032  -42.686 -73.937  1.00 86.08  ?  345  LEU C CB    1 
ATOM   5752  C  CG    . LEU C 2  341  ? 18.001  -43.548 -72.670  1.00 83.89  ?  345  LEU C CG    1 
ATOM   5753  C  CD1   . LEU C 2  341  ? 19.325  -43.478 -71.923  1.00 82.69  ?  345  LEU C CD1   1 
ATOM   5754  C  CD2   . LEU C 2  341  ? 16.849  -43.147 -71.761  1.00 83.65  ?  345  LEU C CD2   1 
ATOM   5755  N  N     . VAL C 2  342  ? 18.177  -44.971 -76.190  1.00 93.01  ?  346  VAL C N     1 
ATOM   5756  C  CA    . VAL C 2  342  ? 18.060  -46.391 -76.520  1.00 93.66  ?  346  VAL C CA    1 
ATOM   5757  C  C     . VAL C 2  342  ? 19.393  -46.926 -77.029  1.00 91.78  ?  346  VAL C C     1 
ATOM   5758  O  O     . VAL C 2  342  ? 19.946  -47.891 -76.488  1.00 92.08  ?  346  VAL C O     1 
ATOM   5759  C  CB    . VAL C 2  342  ? 16.937  -46.617 -77.546  1.00 98.41  ?  346  VAL C CB    1 
ATOM   5760  N  N     . ARG C 2  343  ? 19.933  -46.295 -78.074  1.00 90.64  ?  347  ARG C N     1 
ATOM   5761  C  CA    . ARG C 2  343  ? 21.209  -46.737 -78.623  1.00 93.05  ?  347  ARG C CA    1 
ATOM   5762  C  C     . ARG C 2  343  ? 22.336  -46.585 -77.611  1.00 92.09  ?  347  ARG C C     1 
ATOM   5763  O  O     . ARG C 2  343  ? 23.306  -47.351 -77.643  1.00 93.33  ?  347  ARG C O     1 
ATOM   5764  C  CB    . ARG C 2  343  ? 21.520  -45.956 -79.900  1.00 94.04  ?  347  ARG C CB    1 
ATOM   5765  C  CG    . ARG C 2  343  ? 20.316  -45.819 -80.813  1.00 98.07  ?  347  ARG C CG    1 
ATOM   5766  C  CD    . ARG C 2  343  ? 20.703  -45.663 -82.269  1.00 101.32 ?  347  ARG C CD    1 
ATOM   5767  N  NE    . ARG C 2  343  ? 19.547  -45.829 -83.145  1.00 100.77 ?  347  ARG C NE    1 
ATOM   5768  C  CZ    . ARG C 2  343  ? 19.021  -47.006 -83.469  1.00 99.32  ?  347  ARG C CZ    1 
ATOM   5769  N  NH1   . ARG C 2  343  ? 17.967  -47.067 -84.271  1.00 100.97 ?  347  ARG C NH1   1 
ATOM   5770  N  NH2   . ARG C 2  343  ? 19.545  -48.125 -82.988  1.00 96.95  ?  347  ARG C NH2   1 
ATOM   5771  N  N     . LEU C 2  344  ? 22.222  -45.609 -76.709  1.00 91.32  ?  348  LEU C N     1 
ATOM   5772  C  CA    . LEU C 2  344  ? 23.245  -45.385 -75.693  1.00 90.22  ?  348  LEU C CA    1 
ATOM   5773  C  C     . LEU C 2  344  ? 23.460  -46.628 -74.835  1.00 91.48  ?  348  LEU C C     1 
ATOM   5774  O  O     . LEU C 2  344  ? 24.555  -47.200 -74.811  1.00 91.59  ?  348  LEU C O     1 
ATOM   5775  C  CB    . LEU C 2  344  ? 22.861  -44.181 -74.832  1.00 93.43  ?  348  LEU C CB    1 
ATOM   5776  C  CG    . LEU C 2  344  ? 23.888  -43.674 -73.820  1.00 91.72  ?  348  LEU C CG    1 
ATOM   5777  C  CD1   . LEU C 2  344  ? 25.286  -43.625 -74.415  1.00 85.83  ?  348  LEU C CD1   1 
ATOM   5778  C  CD2   . LEU C 2  344  ? 23.479  -42.304 -73.308  1.00 83.18  ?  348  LEU C CD2   1 
ATOM   5779  N  N     . HIS C 2  345  ? 22.422  -47.050 -74.106  1.00 93.67  ?  349  HIS C N     1 
ATOM   5780  C  CA    . HIS C 2  345  ? 22.551  -48.208 -73.224  1.00 95.13  ?  349  HIS C CA    1 
ATOM   5781  C  C     . HIS C 2  345  ? 22.957  -49.461 -73.989  1.00 93.77  ?  349  HIS C C     1 
ATOM   5782  O  O     . HIS C 2  345  ? 23.624  -50.340 -73.430  1.00 88.19  ?  349  HIS C O     1 
ATOM   5783  C  CB    . HIS C 2  345  ? 21.241  -48.450 -72.475  1.00 91.56  ?  349  HIS C CB    1 
ATOM   5784  C  CG    . HIS C 2  345  ? 21.333  -49.513 -71.426  1.00 93.62  ?  349  HIS C CG    1 
ATOM   5785  N  ND1   . HIS C 2  345  ? 21.032  -50.835 -71.676  1.00 97.85  ?  349  HIS C ND1   1 
ATOM   5786  C  CD2   . HIS C 2  345  ? 21.696  -49.451 -70.123  1.00 96.18  ?  349  HIS C CD2   1 
ATOM   5787  C  CE1   . HIS C 2  345  ? 21.204  -51.540 -70.573  1.00 97.52  ?  349  HIS C CE1   1 
ATOM   5788  N  NE2   . HIS C 2  345  ? 21.606  -50.724 -69.615  1.00 100.06 ?  349  HIS C NE2   1 
ATOM   5789  N  N     . GLU C 2  346  ? 22.568  -49.564 -75.261  1.00 92.31  ?  350  GLU C N     1 
ATOM   5790  C  CA    . GLU C 2  346  ? 23.017  -50.687 -76.075  1.00 91.80  ?  350  GLU C CA    1 
ATOM   5791  C  C     . GLU C 2  346  ? 24.526  -50.660 -76.275  1.00 93.34  ?  350  GLU C C     1 
ATOM   5792  O  O     . GLU C 2  346  ? 25.161  -51.717 -76.354  1.00 97.66  ?  350  GLU C O     1 
ATOM   5793  C  CB    . GLU C 2  346  ? 22.304  -50.676 -77.427  1.00 95.94  ?  350  GLU C CB    1 
ATOM   5794  C  CG    . GLU C 2  346  ? 22.709  -51.815 -78.347  1.00 105.34 ?  350  GLU C CG    1 
ATOM   5795  C  CD    . GLU C 2  346  ? 21.997  -51.769 -79.681  1.00 115.58 ?  350  GLU C CD    1 
ATOM   5796  O  OE1   . GLU C 2  346  ? 21.324  -50.755 -79.961  1.00 114.95 ?  350  GLU C OE1   1 
ATOM   5797  O  OE2   . GLU C 2  346  ? 22.109  -52.749 -80.449  1.00 117.41 ?  350  GLU C OE2   1 
ATOM   5798  N  N     . GLY C 2  347  ? 25.118  -49.471 -76.330  1.00 94.02  ?  351  GLY C N     1 
ATOM   5799  C  CA    . GLY C 2  347  ? 26.527  -49.325 -76.619  1.00 89.40  ?  351  GLY C CA    1 
ATOM   5800  C  C     . GLY C 2  347  ? 26.863  -48.828 -78.009  1.00 87.40  ?  351  GLY C C     1 
ATOM   5801  O  O     . GLY C 2  347  ? 28.037  -48.876 -78.393  1.00 85.24  ?  351  GLY C O     1 
ATOM   5802  N  N     . GLN C 2  348  ? 25.878  -48.371 -78.780  1.00 90.37  ?  352  GLN C N     1 
ATOM   5803  C  CA    . GLN C 2  348  ? 26.161  -47.805 -80.092  1.00 94.43  ?  352  GLN C CA    1 
ATOM   5804  C  C     . GLN C 2  348  ? 26.989  -46.533 -79.957  1.00 93.22  ?  352  GLN C C     1 
ATOM   5805  O  O     . GLN C 2  348  ? 26.845  -45.767 -79.001  1.00 92.12  ?  352  GLN C O     1 
ATOM   5806  C  CB    . GLN C 2  348  ? 24.864  -47.501 -80.843  1.00 96.51  ?  352  GLN C CB    1 
ATOM   5807  C  CG    . GLN C 2  348  ? 24.017  -48.720 -81.157  1.00 101.58 ?  352  GLN C CG    1 
ATOM   5808  C  CD    . GLN C 2  348  ? 23.082  -48.486 -82.327  1.00 102.07 ?  352  GLN C CD    1 
ATOM   5809  O  OE1   . GLN C 2  348  ? 23.169  -47.466 -83.012  1.00 99.34  ?  352  GLN C OE1   1 
ATOM   5810  N  NE2   . GLN C 2  348  ? 22.187  -49.436 -82.568  1.00 103.71 ?  352  GLN C NE2   1 
ATOM   5811  N  N     . THR C 2  349  ? 27.883  -46.322 -80.919  1.00 90.49  ?  353  THR C N     1 
ATOM   5812  C  CA    . THR C 2  349  ? 28.733  -45.141 -80.941  1.00 87.75  ?  353  THR C CA    1 
ATOM   5813  C  C     . THR C 2  349  ? 28.223  -44.039 -81.863  1.00 90.52  ?  353  THR C C     1 
ATOM   5814  O  O     . THR C 2  349  ? 28.818  -42.958 -81.892  1.00 88.78  ?  353  THR C O     1 
ATOM   5815  C  CB    . THR C 2  349  ? 30.157  -45.532 -81.345  1.00 85.63  ?  353  THR C CB    1 
ATOM   5816  O  OG1   . THR C 2  349  ? 30.113  -46.383 -82.496  1.00 83.98  ?  353  THR C OG1   1 
ATOM   5817  C  CG2   . THR C 2  349  ? 30.847  -46.262 -80.204  1.00 82.06  ?  353  THR C CG2   1 
ATOM   5818  N  N     . THR C 2  350  ? 27.143  -44.272 -82.606  1.00 88.31  ?  354  THR C N     1 
ATOM   5819  C  CA    . THR C 2  350  ? 26.634  -43.251 -83.511  1.00 88.31  ?  354  THR C CA    1 
ATOM   5820  C  C     . THR C 2  350  ? 25.155  -43.492 -83.767  1.00 93.22  ?  354  THR C C     1 
ATOM   5821  O  O     . THR C 2  350  ? 24.654  -44.610 -83.625  1.00 98.11  ?  354  THR C O     1 
ATOM   5822  C  CB    . THR C 2  350  ? 27.404  -43.231 -84.836  1.00 93.62  ?  354  THR C CB    1 
ATOM   5823  O  OG1   . THR C 2  350  ? 26.824  -42.256 -85.712  1.00 91.40  ?  354  THR C OG1   1 
ATOM   5824  C  CG2   . THR C 2  350  ? 27.355  -44.598 -85.502  1.00 94.81  ?  354  THR C CG2   1 
ATOM   5825  N  N     . MET C 2  351  ? 24.467  -42.423 -84.162  1.00 95.99  ?  355  MET C N     1 
ATOM   5826  C  CA    . MET C 2  351  ? 23.048  -42.494 -84.472  1.00 100.69 ?  355  MET C CA    1 
ATOM   5827  C  C     . MET C 2  351  ? 22.725  -41.500 -85.576  1.00 104.01 ?  355  MET C C     1 
ATOM   5828  O  O     . MET C 2  351  ? 23.305  -40.413 -85.636  1.00 99.68  ?  355  MET C O     1 
ATOM   5829  C  CB    . MET C 2  351  ? 22.180  -42.206 -83.240  1.00 100.47 ?  355  MET C CB    1 
ATOM   5830  C  CG    . MET C 2  351  ? 20.682  -42.303 -83.507  1.00 105.18 ?  355  MET C CG    1 
ATOM   5831  S  SD    . MET C 2  351  ? 19.653  -41.877 -82.091  1.00 107.90 ?  355  MET C SD    1 
ATOM   5832  C  CE    . MET C 2  351  ? 20.051  -40.145 -81.898  1.00 95.74  ?  355  MET C CE    1 
ATOM   5833  N  N     . THR C 2  352  ? 21.801  -41.889 -86.449  1.00 108.00 ?  356  THR C N     1 
ATOM   5834  C  CA    . THR C 2  352  ? 21.257  -41.013 -87.475  1.00 106.86 ?  356  THR C CA    1 
ATOM   5835  C  C     . THR C 2  352  ? 19.741  -41.042 -87.364  1.00 106.02 ?  356  THR C C     1 
ATOM   5836  O  O     . THR C 2  352  ? 19.142  -42.117 -87.258  1.00 103.49 ?  356  THR C O     1 
ATOM   5837  C  CB    . THR C 2  352  ? 21.722  -41.439 -88.872  1.00 106.15 ?  356  THR C CB    1 
ATOM   5838  O  OG1   . THR C 2  352  ? 23.111  -41.118 -89.029  1.00 104.70 ?  356  THR C OG1   1 
ATOM   5839  C  CG2   . THR C 2  352  ? 20.922  -40.733 -89.952  1.00 103.45 ?  356  THR C CG2   1 
ATOM   5840  N  N     . VAL C 2  353  ? 19.129  -39.864 -87.390  1.00 105.57 ?  357  VAL C N     1 
ATOM   5841  C  CA    . VAL C 2  353  ? 17.704  -39.697 -87.119  1.00 110.11 ?  357  VAL C CA    1 
ATOM   5842  C  C     . VAL C 2  353  ? 17.056  -39.281 -88.434  1.00 112.96 ?  357  VAL C C     1 
ATOM   5843  O  O     . VAL C 2  353  ? 17.740  -38.692 -89.283  1.00 112.95 ?  357  VAL C O     1 
ATOM   5844  C  CB    . VAL C 2  353  ? 17.487  -38.656 -86.007  1.00 111.93 ?  357  VAL C CB    1 
ATOM   5845  C  CG1   . VAL C 2  353  ? 16.045  -38.624 -85.524  1.00 113.66 ?  357  VAL C CG1   1 
ATOM   5846  C  CG2   . VAL C 2  353  ? 18.426  -38.929 -84.846  1.00 108.83 ?  357  VAL C CG2   1 
ATOM   5847  N  N     . PRO C 2  354  ? 15.780  -39.588 -88.673  1.00 112.68 ?  358  PRO C N     1 
ATOM   5848  C  CA    . PRO C 2  354  ? 15.127  -39.077 -89.883  1.00 112.14 ?  358  PRO C CA    1 
ATOM   5849  C  C     . PRO C 2  354  ? 15.285  -37.569 -89.985  1.00 111.96 ?  358  PRO C C     1 
ATOM   5850  O  O     . PRO C 2  354  ? 14.970  -36.827 -89.052  1.00 115.41 ?  358  PRO C O     1 
ATOM   5851  C  CB    . PRO C 2  354  ? 13.665  -39.485 -89.688  1.00 116.09 ?  358  PRO C CB    1 
ATOM   5852  C  CG    . PRO C 2  354  ? 13.747  -40.742 -88.897  1.00 115.96 ?  358  PRO C CG    1 
ATOM   5853  C  CD    . PRO C 2  354  ? 14.965  -40.625 -88.012  1.00 111.35 ?  358  PRO C CD    1 
ATOM   5854  N  N     . GLY C 2  355  ? 15.778  -37.115 -91.134  1.00 110.11 ?  359  GLY C N     1 
ATOM   5855  C  CA    . GLY C 2  355  ? 16.129  -35.714 -91.280  1.00 113.17 ?  359  GLY C CA    1 
ATOM   5856  C  C     . GLY C 2  355  ? 17.199  -35.247 -90.318  1.00 108.89 ?  359  GLY C C     1 
ATOM   5857  O  O     . GLY C 2  355  ? 17.208  -34.074 -89.932  1.00 110.47 ?  359  GLY C O     1 
ATOM   5858  N  N     . GLY C 2  356  ? 18.112  -36.134 -89.929  1.00 106.53 ?  360  GLY C N     1 
ATOM   5859  C  CA    . GLY C 2  356  ? 19.189  -35.774 -89.025  1.00 107.92 ?  360  GLY C CA    1 
ATOM   5860  C  C     . GLY C 2  356  ? 20.409  -36.599 -89.365  1.00 108.11 ?  360  GLY C C     1 
ATOM   5861  O  O     . GLY C 2  356  ? 20.307  -37.669 -89.971  1.00 107.00 ?  360  GLY C O     1 
ATOM   5862  N  N     . VAL C 2  357  ? 21.575  -36.092 -88.968  1.00 103.24 ?  361  VAL C N     1 
ATOM   5863  C  CA    . VAL C 2  357  ? 22.826  -36.538 -89.573  1.00 102.37 ?  361  VAL C CA    1 
ATOM   5864  C  C     . VAL C 2  357  ? 23.880  -36.792 -88.503  1.00 106.12 ?  361  VAL C C     1 
ATOM   5865  O  O     . VAL C 2  357  ? 24.191  -35.899 -87.706  1.00 107.43 ?  361  VAL C O     1 
ATOM   5866  C  CB    . VAL C 2  357  ? 23.347  -35.521 -90.604  1.00 100.59 ?  361  VAL C CB    1 
ATOM   5867  C  CG1   . VAL C 2  357  ? 22.512  -35.584 -91.872  1.00 102.48 ?  361  VAL C CG1   1 
ATOM   5868  C  CG2   . VAL C 2  357  ? 23.313  -34.115 -90.030  1.00 106.11 ?  361  VAL C CG2   1 
ATOM   5869  N  N     . GLU C 2  358  ? 24.403  -38.021 -88.473  1.00 106.13 ?  362  GLU C N     1 
ATOM   5870  C  CA    . GLU C 2  358  ? 25.709  -38.368 -87.915  1.00 105.57 ?  362  GLU C CA    1 
ATOM   5871  C  C     . GLU C 2  358  ? 26.049  -37.669 -86.605  1.00 106.73 ?  362  GLU C C     1 
ATOM   5872  O  O     . GLU C 2  358  ? 26.949  -36.825 -86.566  1.00 103.15 ?  362  GLU C O     1 
ATOM   5873  C  CB    . GLU C 2  358  ? 26.803  -38.067 -88.943  1.00 106.13 ?  362  GLU C CB    1 
ATOM   5874  N  N     . VAL C 2  359  ? 25.345  -38.002 -85.536  1.00 103.91 ?  363  VAL C N     1 
ATOM   5875  C  CA    . VAL C 2  359  ? 25.633  -37.477 -84.204  1.00 98.77  ?  363  VAL C CA    1 
ATOM   5876  C  C     . VAL C 2  359  ? 26.226  -38.596 -83.361  1.00 92.44  ?  363  VAL C C     1 
ATOM   5877  O  O     . VAL C 2  359  ? 25.632  -39.677 -83.284  1.00 92.01  ?  363  VAL C O     1 
ATOM   5878  C  CB    . VAL C 2  359  ? 24.383  -36.900 -83.524  1.00 99.07  ?  363  VAL C CB    1 
ATOM   5879  C  CG1   . VAL C 2  359  ? 24.782  -36.330 -82.193  1.00 97.75  ?  363  VAL C CG1   1 
ATOM   5880  C  CG2   . VAL C 2  359  ? 23.755  -35.837 -84.398  1.00 100.34 ?  363  VAL C CG2   1 
ATOM   5881  N  N     . PRO C 2  360  ? 27.380  -38.390 -82.732  1.00 88.46  ?  364  PRO C N     1 
ATOM   5882  C  CA    . PRO C 2  360  ? 27.908  -39.407 -81.818  1.00 89.32  ?  364  PRO C CA    1 
ATOM   5883  C  C     . PRO C 2  360  ? 26.981  -39.604 -80.629  1.00 89.14  ?  364  PRO C C     1 
ATOM   5884  O  O     . PRO C 2  360  ? 26.447  -38.645 -80.067  1.00 88.75  ?  364  PRO C O     1 
ATOM   5885  C  CB    . PRO C 2  360  ? 29.261  -38.830 -81.383  1.00 89.96  ?  364  PRO C CB    1 
ATOM   5886  C  CG    . PRO C 2  360  ? 29.580  -37.766 -82.388  1.00 91.88  ?  364  PRO C CG    1 
ATOM   5887  C  CD    . PRO C 2  360  ? 28.265  -37.219 -82.830  1.00 90.19  ?  364  PRO C CD    1 
ATOM   5888  N  N     . VAL C 2  361  ? 26.787  -40.864 -80.253  1.00 89.53  ?  365  VAL C N     1 
ATOM   5889  C  CA    . VAL C 2  361  ? 26.042  -41.209 -79.048  1.00 86.07  ?  365  VAL C CA    1 
ATOM   5890  C  C     . VAL C 2  361  ? 27.056  -41.334 -77.918  1.00 83.55  ?  365  VAL C C     1 
ATOM   5891  O  O     . VAL C 2  361  ? 27.940  -42.195 -77.950  1.00 85.38  ?  365  VAL C O     1 
ATOM   5892  C  CB    . VAL C 2  361  ? 25.224  -42.493 -79.236  1.00 85.80  ?  365  VAL C CB    1 
ATOM   5893  C  CG1   . VAL C 2  361  ? 25.079  -43.241 -77.929  1.00 87.19  ?  365  VAL C CG1   1 
ATOM   5894  C  CG2   . VAL C 2  361  ? 23.845  -42.155 -79.783  1.00 88.64  ?  365  VAL C CG2   1 
ATOM   5895  N  N     . GLU C 2  362  ? 26.954  -40.445 -76.934  1.00 84.13  ?  366  GLU C N     1 
ATOM   5896  C  CA    . GLU C 2  362  ? 27.922  -40.388 -75.851  1.00 80.10  ?  366  GLU C CA    1 
ATOM   5897  C  C     . GLU C 2  362  ? 27.292  -39.681 -74.664  1.00 72.73  ?  366  GLU C C     1 
ATOM   5898  O  O     . GLU C 2  362  ? 26.297  -38.964 -74.799  1.00 74.12  ?  366  GLU C O     1 
ATOM   5899  C  CB    . GLU C 2  362  ? 29.198  -39.663 -76.286  1.00 80.75  ?  366  GLU C CB    1 
ATOM   5900  C  CG    . GLU C 2  362  ? 28.971  -38.204 -76.642  1.00 83.13  ?  366  GLU C CG    1 
ATOM   5901  C  CD    . GLU C 2  362  ? 30.095  -37.621 -77.472  1.00 87.76  ?  366  GLU C CD    1 
ATOM   5902  O  OE1   . GLU C 2  362  ? 31.078  -38.343 -77.733  1.00 88.12  ?  366  GLU C OE1   1 
ATOM   5903  O  OE2   . GLU C 2  362  ? 29.992  -36.442 -77.868  1.00 87.28  ?  366  GLU C OE2   1 
ATOM   5904  N  N     . THR C 2  363  ? 27.886  -39.896 -73.496  1.00 69.15  ?  367  THR C N     1 
ATOM   5905  C  CA    . THR C 2  363  ? 27.497  -39.145 -72.316  1.00 71.18  ?  367  THR C CA    1 
ATOM   5906  C  C     . THR C 2  363  ? 28.030  -37.719 -72.399  1.00 72.04  ?  367  THR C C     1 
ATOM   5907  O  O     . THR C 2  363  ? 28.945  -37.409 -73.166  1.00 70.75  ?  367  THR C O     1 
ATOM   5908  C  CB    . THR C 2  363  ? 28.014  -39.820 -71.048  1.00 70.18  ?  367  THR C CB    1 
ATOM   5909  O  OG1   . THR C 2  363  ? 29.441  -39.924 -71.109  1.00 69.15  ?  367  THR C OG1   1 
ATOM   5910  C  CG2   . THR C 2  363  ? 27.419  -41.203 -70.914  1.00 77.84  ?  367  THR C CG2   1 
ATOM   5911  N  N     . ASP C 2  364  ? 27.431  -36.841 -71.604  1.00 69.34  ?  368  ASP C N     1 
ATOM   5912  C  CA    . ASP C 2  364  ? 27.842  -35.449 -71.536  1.00 66.23  ?  368  ASP C CA    1 
ATOM   5913  C  C     . ASP C 2  364  ? 28.533  -35.168 -70.210  1.00 63.00  ?  368  ASP C C     1 
ATOM   5914  O  O     . ASP C 2  364  ? 28.188  -35.743 -69.173  1.00 62.55  ?  368  ASP C O     1 
ATOM   5915  C  CB    . ASP C 2  364  ? 26.645  -34.512 -71.710  1.00 66.13  ?  368  ASP C CB    1 
ATOM   5916  C  CG    . ASP C 2  364  ? 26.085  -34.544 -73.114  1.00 69.65  ?  368  ASP C CG    1 
ATOM   5917  O  OD1   . ASP C 2  364  ? 26.664  -33.879 -73.998  1.00 73.17  ?  368  ASP C OD1   1 
ATOM   5918  O  OD2   . ASP C 2  364  ? 25.067  -35.232 -73.335  1.00 67.75  ?  368  ASP C OD2   1 
ATOM   5919  N  N     . ASP C 2  365  ? 29.517  -34.275 -70.256  1.00 57.77  ?  369  ASP C N     1 
ATOM   5920  C  CA    . ASP C 2  365  ? 30.228  -33.839 -69.064  1.00 54.17  ?  369  ASP C CA    1 
ATOM   5921  C  C     . ASP C 2  365  ? 29.475  -32.660 -68.463  1.00 55.35  ?  369  ASP C C     1 
ATOM   5922  O  O     . ASP C 2  365  ? 29.346  -31.609 -69.099  1.00 55.50  ?  369  ASP C O     1 
ATOM   5923  C  CB    . ASP C 2  365  ? 31.666  -33.451 -69.402  1.00 53.43  ?  369  ASP C CB    1 
ATOM   5924  C  CG    . ASP C 2  365  ? 32.558  -33.374 -68.178  1.00 51.16  ?  369  ASP C CG    1 
ATOM   5925  O  OD1   . ASP C 2  365  ? 32.038  -33.202 -67.058  1.00 49.76  ?  369  ASP C OD1   1 
ATOM   5926  O  OD2   . ASP C 2  365  ? 33.789  -33.487 -68.339  1.00 49.77  ?  369  ASP C OD2   1 
ATOM   5927  N  N     . ILE C 2  366  ? 28.977  -32.839 -67.239  1.00 57.00  ?  370  ILE C N     1 
ATOM   5928  C  CA    . ILE C 2  366  ? 28.187  -31.794 -66.603  1.00 57.85  ?  370  ILE C CA    1 
ATOM   5929  C  C     . ILE C 2  366  ? 29.044  -30.573 -66.306  1.00 56.97  ?  370  ILE C C     1 
ATOM   5930  O  O     . ILE C 2  366  ? 28.556  -29.438 -66.352  1.00 54.67  ?  370  ILE C O     1 
ATOM   5931  C  CB    . ILE C 2  366  ? 27.524  -32.343 -65.327  1.00 66.09  ?  370  ILE C CB    1 
ATOM   5932  C  CG1   . ILE C 2  366  ? 26.852  -33.686 -65.616  1.00 75.26  ?  370  ILE C CG1   1 
ATOM   5933  C  CG2   . ILE C 2  366  ? 26.513  -31.354 -64.780  1.00 70.28  ?  370  ILE C CG2   1 
ATOM   5934  C  CD1   . ILE C 2  366  ? 26.259  -34.348 -64.392  1.00 89.43  ?  370  ILE C CD1   1 
ATOM   5935  N  N     . ASP C 2  367  ? 30.324  -30.776 -66.005  1.00 54.74  ?  371  ASP C N     1 
ATOM   5936  C  CA    . ASP C 2  367  ? 31.213  -29.692 -65.615  1.00 53.91  ?  371  ASP C CA    1 
ATOM   5937  C  C     . ASP C 2  367  ? 31.954  -29.063 -66.788  1.00 50.27  ?  371  ASP C C     1 
ATOM   5938  O  O     . ASP C 2  367  ? 32.643  -28.057 -66.593  1.00 49.32  ?  371  ASP C O     1 
ATOM   5939  C  CB    . ASP C 2  367  ? 32.221  -30.196 -64.583  1.00 58.14  ?  371  ASP C CB    1 
ATOM   5940  C  CG    . ASP C 2  367  ? 31.555  -30.683 -63.319  1.00 62.60  ?  371  ASP C CG    1 
ATOM   5941  O  OD1   . ASP C 2  367  ? 30.588  -30.036 -62.876  1.00 63.36  ?  371  ASP C OD1   1 
ATOM   5942  O  OD2   . ASP C 2  367  ? 31.991  -31.714 -62.770  1.00 67.73  ?  371  ASP C OD2   1 
ATOM   5943  N  N     . HIS C 2  368  ? 31.838  -29.629 -67.986  1.00 50.57  ?  372  HIS C N     1 
ATOM   5944  C  CA    . HIS C 2  368  ? 32.459  -29.036 -69.161  1.00 47.64  ?  372  HIS C CA    1 
ATOM   5945  C  C     . HIS C 2  368  ? 31.861  -27.661 -69.422  1.00 47.97  ?  372  HIS C C     1 
ATOM   5946  O  O     . HIS C 2  368  ? 30.666  -27.438 -69.216  1.00 51.15  ?  372  HIS C O     1 
ATOM   5947  C  CB    . HIS C 2  368  ? 32.258  -29.950 -70.369  1.00 48.64  ?  372  HIS C CB    1 
ATOM   5948  C  CG    . HIS C 2  368  ? 33.143  -29.633 -71.534  1.00 47.68  ?  372  HIS C CG    1 
ATOM   5949  N  ND1   . HIS C 2  368  ? 32.789  -28.734 -72.515  1.00 50.69  ?  372  HIS C ND1   1 
ATOM   5950  C  CD2   . HIS C 2  368  ? 34.356  -30.118 -71.889  1.00 47.73  ?  372  HIS C CD2   1 
ATOM   5951  C  CE1   . HIS C 2  368  ? 33.751  -28.668 -73.418  1.00 51.59  ?  372  HIS C CE1   1 
ATOM   5952  N  NE2   . HIS C 2  368  ? 34.713  -29.499 -73.062  1.00 51.52  ?  372  HIS C NE2   1 
ATOM   5953  N  N     . PHE C 2  369  ? 32.695  -26.731 -69.878  1.00 44.99  ?  373  PHE C N     1 
ATOM   5954  C  CA    . PHE C 2  369  ? 32.248  -25.354 -70.042  1.00 42.61  ?  373  PHE C CA    1 
ATOM   5955  C  C     . PHE C 2  369  ? 31.481  -25.123 -71.333  1.00 44.47  ?  373  PHE C C     1 
ATOM   5956  O  O     . PHE C 2  369  ? 31.025  -24.000 -71.569  1.00 49.48  ?  373  PHE C O     1 
ATOM   5957  C  CB    . PHE C 2  369  ? 33.435  -24.395 -69.971  1.00 41.72  ?  373  PHE C CB    1 
ATOM   5958  C  CG    . PHE C 2  369  ? 33.599  -23.749 -68.631  1.00 36.64  ?  373  PHE C CG    1 
ATOM   5959  C  CD1   . PHE C 2  369  ? 33.011  -24.302 -67.511  1.00 37.01  ?  373  PHE C CD1   1 
ATOM   5960  C  CD2   . PHE C 2  369  ? 34.314  -22.578 -68.494  1.00 33.32  ?  373  PHE C CD2   1 
ATOM   5961  C  CE1   . PHE C 2  369  ? 33.150  -23.711 -66.280  1.00 36.31  ?  373  PHE C CE1   1 
ATOM   5962  C  CE2   . PHE C 2  369  ? 34.453  -21.981 -67.263  1.00 31.93  ?  373  PHE C CE2   1 
ATOM   5963  C  CZ    . PHE C 2  369  ? 33.870  -22.547 -66.156  1.00 32.60  ?  373  PHE C CZ    1 
ATOM   5964  N  N     . GLY C 2  370  ? 31.335  -26.140 -72.173  1.00 45.65  ?  374  GLY C N     1 
ATOM   5965  C  CA    . GLY C 2  370  ? 30.442  -26.040 -73.307  1.00 50.94  ?  374  GLY C CA    1 
ATOM   5966  C  C     . GLY C 2  370  ? 29.032  -26.401 -72.895  1.00 52.52  ?  374  GLY C C     1 
ATOM   5967  O  O     . GLY C 2  370  ? 28.059  -25.967 -73.515  1.00 52.33  ?  374  GLY C O     1 
ATOM   5968  N  N     . ASN C 2  371  ? 28.919  -27.229 -71.859  1.00 52.63  ?  375  ASN C N     1 
ATOM   5969  C  CA    . ASN C 2  371  ? 27.639  -27.557 -71.251  1.00 52.26  ?  375  ASN C CA    1 
ATOM   5970  C  C     . ASN C 2  371  ? 27.305  -26.678 -70.055  1.00 50.77  ?  375  ASN C C     1 
ATOM   5971  O  O     . ASN C 2  371  ? 26.163  -26.704 -69.585  1.00 54.32  ?  375  ASN C O     1 
ATOM   5972  C  CB    . ASN C 2  371  ? 27.628  -29.025 -70.816  1.00 51.09  ?  375  ASN C CB    1 
ATOM   5973  C  CG    . ASN C 2  371  ? 27.990  -29.964 -71.942  1.00 54.62  ?  375  ASN C CG    1 
ATOM   5974  O  OD1   . ASN C 2  371  ? 27.488  -29.834 -73.056  1.00 56.54  ?  375  ASN C OD1   1 
ATOM   5975  N  ND2   . ASN C 2  371  ? 28.878  -30.909 -71.660  1.00 53.59  ?  375  ASN C ND2   1 
ATOM   5976  N  N     . ARG C 2  372  ? 28.257  -25.898 -69.561  1.00 48.44  ?  376  ARG C N     1 
ATOM   5977  C  CA    . ARG C 2  372  ? 28.052  -25.049 -68.400  1.00 44.48  ?  376  ARG C CA    1 
ATOM   5978  C  C     . ARG C 2  372  ? 28.121  -23.591 -68.827  1.00 43.30  ?  376  ARG C C     1 
ATOM   5979  O  O     . ARG C 2  372  ? 29.011  -23.195 -69.585  1.00 46.10  ?  376  ARG C O     1 
ATOM   5980  C  CB    . ARG C 2  372  ? 29.087  -25.335 -67.315  1.00 42.24  ?  376  ARG C CB    1 
ATOM   5981  C  CG    . ARG C 2  372  ? 28.567  -25.122 -65.917  1.00 40.64  ?  376  ARG C CG    1 
ATOM   5982  C  CD    . ARG C 2  372  ? 29.645  -25.364 -64.894  1.00 39.13  ?  376  ARG C CD    1 
ATOM   5983  N  NE    . ARG C 2  372  ? 29.163  -25.093 -63.547  1.00 40.82  ?  376  ARG C NE    1 
ATOM   5984  C  CZ    . ARG C 2  372  ? 29.953  -24.896 -62.499  1.00 43.28  ?  376  ARG C CZ    1 
ATOM   5985  N  NH1   . ARG C 2  372  ? 31.270  -24.930 -62.640  1.00 39.11  ?  376  ARG C NH1   1 
ATOM   5986  N  NH2   . ARG C 2  372  ? 29.424  -24.656 -61.312  1.00 46.60  ?  376  ARG C NH2   1 
ATOM   5987  N  N     . ARG C 2  373  ? 27.184  -22.797 -68.332  1.00 43.73  ?  377  ARG C N     1 
ATOM   5988  C  CA    . ARG C 2  373  ? 26.922  -21.478 -68.874  1.00 41.84  ?  377  ARG C CA    1 
ATOM   5989  C  C     . ARG C 2  373  ? 27.081  -20.421 -67.793  1.00 40.74  ?  377  ARG C C     1 
ATOM   5990  O  O     . ARG C 2  373  ? 27.092  -20.714 -66.595  1.00 41.47  ?  377  ARG C O     1 
ATOM   5991  C  CB    . ARG C 2  373  ? 25.513  -21.412 -69.469  1.00 43.16  ?  377  ARG C CB    1 
ATOM   5992  C  CG    . ARG C 2  373  ? 25.408  -20.619 -70.750  1.00 45.47  ?  377  ARG C CG    1 
ATOM   5993  C  CD    . ARG C 2  373  ? 23.978  -20.609 -71.242  1.00 46.73  ?  377  ARG C CD    1 
ATOM   5994  N  NE    . ARG C 2  373  ? 23.092  -19.944 -70.298  1.00 40.96  ?  377  ARG C NE    1 
ATOM   5995  C  CZ    . ARG C 2  373  ? 22.719  -18.675 -70.401  1.00 39.69  ?  377  ARG C CZ    1 
ATOM   5996  N  NH1   . ARG C 2  373  ? 23.151  -17.940 -71.413  1.00 39.46  ?  377  ARG C NH1   1 
ATOM   5997  N  NH2   . ARG C 2  373  ? 21.913  -18.147 -69.497  1.00 40.38  ?  377  ARG C NH2   1 
ATOM   5998  N  N     . LEU C 2  374  ? 27.208  -19.177 -68.239  1.00 35.93  ?  378  LEU C N     1 
ATOM   5999  C  CA    . LEU C 2  374  ? 27.354  -18.033 -67.352  1.00 36.65  ?  378  LEU C CA    1 
ATOM   6000  C  C     . LEU C 2  374  ? 26.168  -17.106 -67.558  1.00 41.46  ?  378  LEU C C     1 
ATOM   6001  O  O     . LEU C 2  374  ? 25.962  -16.595 -68.664  1.00 44.43  ?  378  LEU C O     1 
ATOM   6002  C  CB    . LEU C 2  374  ? 28.667  -17.302 -67.625  1.00 38.56  ?  378  LEU C CB    1 
ATOM   6003  C  CG    . LEU C 2  374  ? 29.248  -16.471 -66.486  1.00 37.85  ?  378  LEU C CG    1 
ATOM   6004  C  CD1   . LEU C 2  374  ? 29.646  -17.362 -65.328  1.00 36.28  ?  378  LEU C CD1   1 
ATOM   6005  C  CD2   . LEU C 2  374  ? 30.433  -15.682 -66.988  1.00 37.82  ?  378  LEU C CD2   1 
ATOM   6006  N  N     . ARG C 2  375  ? 25.388  -16.893 -66.501  1.00 40.79  ?  379  ARG C N     1 
ATOM   6007  C  CA    . ARG C 2  375  ? 24.307  -15.915 -66.527  1.00 39.56  ?  379  ARG C CA    1 
ATOM   6008  C  C     . ARG C 2  375  ? 24.870  -14.601 -66.010  1.00 41.47  ?  379  ARG C C     1 
ATOM   6009  O  O     . ARG C 2  375  ? 25.182  -14.476 -64.822  1.00 40.66  ?  379  ARG C O     1 
ATOM   6010  C  CB    . ARG C 2  375  ? 23.119  -16.371 -65.684  1.00 37.38  ?  379  ARG C CB    1 
ATOM   6011  C  CG    . ARG C 2  375  ? 22.418  -17.610 -66.207  1.00 46.93  ?  379  ARG C CG    1 
ATOM   6012  C  CD    . ARG C 2  375  ? 20.909  -17.507 -66.036  1.00 47.55  ?  379  ARG C CD    1 
ATOM   6013  N  NE    . ARG C 2  375  ? 20.510  -17.390 -64.638  1.00 46.07  ?  379  ARG C NE    1 
ATOM   6014  C  CZ    . ARG C 2  375  ? 19.908  -18.353 -63.952  1.00 50.70  ?  379  ARG C CZ    1 
ATOM   6015  N  NH1   . ARG C 2  375  ? 19.628  -19.508 -64.534  1.00 49.99  ?  379  ARG C NH1   1 
ATOM   6016  N  NH2   . ARG C 2  375  ? 19.580  -18.157 -62.684  1.00 57.68  ?  379  ARG C NH2   1 
ATOM   6017  N  N     . THR C 2  376  ? 24.993  -13.620 -66.896  1.00 41.06  ?  380  THR C N     1 
ATOM   6018  C  CA    . THR C 2  376  ? 25.609  -12.361 -66.527  1.00 40.39  ?  380  THR C CA    1 
ATOM   6019  C  C     . THR C 2  376  ? 24.572  -11.420 -65.922  1.00 40.81  ?  380  THR C C     1 
ATOM   6020  O  O     . THR C 2  376  ? 23.376  -11.724 -65.844  1.00 41.59  ?  380  THR C O     1 
ATOM   6021  C  CB    . THR C 2  376  ? 26.300  -11.730 -67.733  1.00 40.38  ?  380  THR C CB    1 
ATOM   6022  O  OG1   . THR C 2  376  ? 25.418  -11.756 -68.860  1.00 43.56  ?  380  THR C OG1   1 
ATOM   6023  C  CG2   . THR C 2  376  ? 27.570  -12.487 -68.073  1.00 39.66  ?  380  THR C CG2   1 
ATOM   6024  N  N     . VAL C 2  377  ? 25.047  -10.249 -65.494  1.00 38.92  ?  381  VAL C N     1 
ATOM   6025  C  CA    . VAL C 2  377  ? 24.203  -9.314  -64.758  1.00 39.34  ?  381  VAL C CA    1 
ATOM   6026  C  C     . VAL C 2  377  ? 23.020  -8.873  -65.612  1.00 41.72  ?  381  VAL C C     1 
ATOM   6027  O  O     . VAL C 2  377  ? 21.877  -8.832  -65.140  1.00 43.63  ?  381  VAL C O     1 
ATOM   6028  C  CB    . VAL C 2  377  ? 25.043  -8.119  -64.266  1.00 36.22  ?  381  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C 2  377  ? 25.853  -7.516  -65.409  1.00 37.66  ?  381  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C 2  377  ? 24.160  -7.076  -63.615  1.00 37.35  ?  381  VAL C CG2   1 
ATOM   6031  N  N     . GLY C 2  378  ? 23.269  -8.563  -66.885  1.00 40.08  ?  382  GLY C N     1 
ATOM   6032  C  CA    . GLY C 2  378  ? 22.184  -8.174  -67.766  1.00 40.46  ?  382  GLY C CA    1 
ATOM   6033  C  C     . GLY C 2  378  ? 21.116  -9.238  -67.905  1.00 41.90  ?  382  GLY C C     1 
ATOM   6034  O  O     . GLY C 2  378  ? 19.931  -8.919  -68.007  1.00 42.54  ?  382  GLY C O     1 
ATOM   6035  N  N     . GLU C 2  379  ? 21.514  -10.511 -67.894  1.00 42.23  ?  383  GLU C N     1 
ATOM   6036  C  CA    . GLU C 2  379  ? 20.541  -11.587 -68.039  1.00 43.95  ?  383  GLU C CA    1 
ATOM   6037  C  C     . GLU C 2  379  ? 19.767  -11.826 -66.749  1.00 43.63  ?  383  GLU C C     1 
ATOM   6038  O  O     . GLU C 2  379  ? 18.566  -12.112 -66.789  1.00 44.69  ?  383  GLU C O     1 
ATOM   6039  C  CB    . GLU C 2  379  ? 21.235  -12.869 -68.488  1.00 41.32  ?  383  GLU C CB    1 
ATOM   6040  C  CG    . GLU C 2  379  ? 20.282  -14.021 -68.696  1.00 41.15  ?  383  GLU C CG    1 
ATOM   6041  C  CD    . GLU C 2  379  ? 20.976  -15.273 -69.161  1.00 42.54  ?  383  GLU C CD    1 
ATOM   6042  O  OE1   . GLU C 2  379  ? 22.101  -15.169 -69.689  1.00 44.76  ?  383  GLU C OE1   1 
ATOM   6043  O  OE2   . GLU C 2  379  ? 20.396  -16.366 -68.998  1.00 43.70  ?  383  GLU C OE2   1 
ATOM   6044  N  N     . LEU C 2  380  ? 20.433  -11.723 -65.598  1.00 42.45  ?  384  LEU C N     1 
ATOM   6045  C  CA    . LEU C 2  380  ? 19.718  -11.835 -64.329  1.00 44.01  ?  384  LEU C CA    1 
ATOM   6046  C  C     . LEU C 2  380  ? 18.677  -10.729 -64.194  1.00 45.26  ?  384  LEU C C     1 
ATOM   6047  O  O     . LEU C 2  380  ? 17.489  -10.990 -63.933  1.00 47.76  ?  384  LEU C O     1 
ATOM   6048  C  CB    . LEU C 2  380  ? 20.716  -11.788 -63.172  1.00 41.65  ?  384  LEU C CB    1 
ATOM   6049  C  CG    . LEU C 2  380  ? 21.771  -12.893 -63.189  1.00 40.95  ?  384  LEU C CG    1 
ATOM   6050  C  CD1   . LEU C 2  380  ? 22.967  -12.528 -62.331  1.00 36.90  ?  384  LEU C CD1   1 
ATOM   6051  C  CD2   . LEU C 2  380  ? 21.156  -14.198 -62.723  1.00 43.18  ?  384  LEU C CD2   1 
ATOM   6052  N  N     . ILE C 2  381  ? 19.109  -9.481  -64.391  1.00 41.85  ?  385  ILE C N     1 
ATOM   6053  C  CA    . ILE C 2  381  ? 18.182  -8.357  -64.328  1.00 41.66  ?  385  ILE C CA    1 
ATOM   6054  C  C     . ILE C 2  381  ? 17.068  -8.531  -65.350  1.00 43.11  ?  385  ILE C C     1 
ATOM   6055  O  O     . ILE C 2  381  ? 15.897  -8.278  -65.052  1.00 46.55  ?  385  ILE C O     1 
ATOM   6056  C  CB    . ILE C 2  381  ? 18.933  -7.028  -64.522  1.00 42.65  ?  385  ILE C CB    1 
ATOM   6057  C  CG1   . ILE C 2  381  ? 19.993  -6.855  -63.437  1.00 43.19  ?  385  ILE C CG1   1 
ATOM   6058  C  CG2   . ILE C 2  381  ? 17.966  -5.864  -64.476  1.00 42.53  ?  385  ILE C CG2   1 
ATOM   6059  C  CD1   . ILE C 2  381  ? 20.722  -5.538  -63.508  1.00 41.93  ?  385  ILE C CD1   1 
ATOM   6060  N  N     . GLN C 2  382  ? 17.405  -8.990  -66.559  1.00 42.90  ?  386  GLN C N     1 
ATOM   6061  C  CA    . GLN C 2  382  ? 16.367  -9.221  -67.560  1.00 42.86  ?  386  GLN C CA    1 
ATOM   6062  C  C     . GLN C 2  382  ? 15.340  -10.230 -67.072  1.00 44.53  ?  386  GLN C C     1 
ATOM   6063  O  O     . GLN C 2  382  ? 14.138  -10.055 -67.294  1.00 48.78  ?  386  GLN C O     1 
ATOM   6064  C  CB    . GLN C 2  382  ? 16.966  -9.700  -68.879  1.00 43.07  ?  386  GLN C CB    1 
ATOM   6065  C  CG    . GLN C 2  382  ? 15.892  -9.961  -69.922  1.00 40.08  ?  386  GLN C CG    1 
ATOM   6066  C  CD    . GLN C 2  382  ? 16.405  -10.651 -71.162  1.00 46.74  ?  386  GLN C CD    1 
ATOM   6067  O  OE1   . GLN C 2  382  ? 17.135  -11.635 -71.082  1.00 49.02  ?  386  GLN C OE1   1 
ATOM   6068  N  NE2   . GLN C 2  382  ? 16.014  -10.142 -72.323  1.00 47.19  ?  386  GLN C NE2   1 
ATOM   6069  N  N     . ASN C 2  383  ? 15.791  -11.298 -66.413  1.00 46.41  ?  387  ASN C N     1 
ATOM   6070  C  CA    . ASN C 2  383  ? 14.852  -12.291 -65.899  1.00 48.65  ?  387  ASN C CA    1 
ATOM   6071  C  C     . ASN C 2  383  ? 13.897  -11.670 -64.888  1.00 50.52  ?  387  ASN C C     1 
ATOM   6072  O  O     . ASN C 2  383  ? 12.679  -11.907 -64.939  1.00 54.60  ?  387  ASN C O     1 
ATOM   6073  C  CB    . ASN C 2  383  ? 15.616  -13.464 -65.285  1.00 47.80  ?  387  ASN C CB    1 
ATOM   6074  C  CG    . ASN C 2  383  ? 16.120  -14.442 -66.331  1.00 51.77  ?  387  ASN C CG    1 
ATOM   6075  O  OD1   . ASN C 2  383  ? 15.868  -15.642 -66.245  1.00 60.07  ?  387  ASN C OD1   1 
ATOM   6076  N  ND2   . ASN C 2  383  ? 16.821  -13.929 -67.335  1.00 49.38  ?  387  ASN C ND2   1 
ATOM   6077  N  N     . GLN C 2  384  ? 14.423  -10.846 -63.976  1.00 47.59  ?  388  GLN C N     1 
ATOM   6078  C  CA    . GLN C 2  384  ? 13.534  -10.167 -63.034  1.00 49.89  ?  388  GLN C CA    1 
ATOM   6079  C  C     . GLN C 2  384  ? 12.556  -9.241  -63.753  1.00 48.42  ?  388  GLN C C     1 
ATOM   6080  O  O     . GLN C 2  384  ? 11.363  -9.192  -63.415  1.00 50.87  ?  388  GLN C O     1 
ATOM   6081  C  CB    . GLN C 2  384  ? 14.358  -9.401  -62.005  1.00 49.73  ?  388  GLN C CB    1 
ATOM   6082  C  CG    . GLN C 2  384  ? 15.112  -10.325 -61.086  1.00 50.33  ?  388  GLN C CG    1 
ATOM   6083  C  CD    . GLN C 2  384  ? 14.225  -11.429 -60.559  1.00 54.66  ?  388  GLN C CD    1 
ATOM   6084  O  OE1   . GLN C 2  384  ? 13.282  -11.177 -59.809  1.00 55.62  ?  388  GLN C OE1   1 
ATOM   6085  N  NE2   . GLN C 2  384  ? 14.507  -12.660 -60.967  1.00 47.86  ?  388  GLN C NE2   1 
ATOM   6086  N  N     . ILE C 2  385  ? 13.044  -8.510  -64.758  1.00 44.95  ?  389  ILE C N     1 
ATOM   6087  C  CA    . ILE C 2  385  ? 12.184  -7.649  -65.563  1.00 44.34  ?  389  ILE C CA    1 
ATOM   6088  C  C     . ILE C 2  385  ? 11.069  -8.459  -66.204  1.00 50.83  ?  389  ILE C C     1 
ATOM   6089  O  O     . ILE C 2  385  ? 9.932   -7.992  -66.326  1.00 52.88  ?  389  ILE C O     1 
ATOM   6090  C  CB    . ILE C 2  385  ? 13.023  -6.908  -66.621  1.00 40.50  ?  389  ILE C CB    1 
ATOM   6091  C  CG1   . ILE C 2  385  ? 13.936  -5.883  -65.956  1.00 43.15  ?  389  ILE C CG1   1 
ATOM   6092  C  CG2   . ILE C 2  385  ? 12.132  -6.234  -67.650  1.00 42.50  ?  389  ILE C CG2   1 
ATOM   6093  C  CD1   . ILE C 2  385  ? 14.843  -5.168  -66.922  1.00 44.60  ?  389  ILE C CD1   1 
ATOM   6094  N  N     . ARG C 2  386  ? 11.373  -9.685  -66.624  1.00 48.45  ?  390  ARG C N     1 
ATOM   6095  C  CA    . ARG C 2  386  ? 10.353  -10.523 -67.239  1.00 47.50  ?  390  ARG C CA    1 
ATOM   6096  C  C     . ARG C 2  386  ? 9.306   -10.945 -66.220  1.00 51.84  ?  390  ARG C C     1 
ATOM   6097  O  O     . ARG C 2  386  ? 8.111   -10.988 -66.534  1.00 57.63  ?  390  ARG C O     1 
ATOM   6098  C  CB    . ARG C 2  386  ? 11.000  -11.744 -67.886  1.00 49.83  ?  390  ARG C CB    1 
ATOM   6099  C  CG    . ARG C 2  386  ? 10.128  -12.444 -68.908  1.00 54.29  ?  390  ARG C CG    1 
ATOM   6100  C  CD    . ARG C 2  386  ? 10.851  -13.646 -69.474  1.00 51.75  ?  390  ARG C CD    1 
ATOM   6101  N  NE    . ARG C 2  386  ? 12.256  -13.344 -69.722  1.00 49.61  ?  390  ARG C NE    1 
ATOM   6102  C  CZ    . ARG C 2  386  ? 13.138  -14.221 -70.185  1.00 51.09  ?  390  ARG C CZ    1 
ATOM   6103  N  NH1   . ARG C 2  386  ? 14.397  -13.857 -70.377  1.00 49.86  ?  390  ARG C NH1   1 
ATOM   6104  N  NH2   . ARG C 2  386  ? 12.762  -15.462 -70.456  1.00 57.75  ?  390  ARG C NH2   1 
ATOM   6105  N  N     . VAL C 2  387  ? 9.730   -11.256 -64.993  1.00 51.61  ?  391  VAL C N     1 
ATOM   6106  C  CA    . VAL C 2  387  ? 8.765   -11.621 -63.954  1.00 52.18  ?  391  VAL C CA    1 
ATOM   6107  C  C     . VAL C 2  387  ? 7.820   -10.457 -63.669  1.00 56.41  ?  391  VAL C C     1 
ATOM   6108  O  O     . VAL C 2  387  ? 6.595   -10.561 -63.842  1.00 57.46  ?  391  VAL C O     1 
ATOM   6109  C  CB    . VAL C 2  387  ? 9.493   -12.078 -62.679  1.00 49.84  ?  391  VAL C CB    1 
ATOM   6110  C  CG1   . VAL C 2  387  ? 8.531   -12.124 -61.507  1.00 58.27  ?  391  VAL C CG1   1 
ATOM   6111  C  CG2   . VAL C 2  387  ? 10.133  -13.438 -62.896  1.00 53.12  ?  391  VAL C CG2   1 
ATOM   6112  N  N     . GLY C 2  388  ? 8.380   -9.318  -63.248  1.00 55.91  ?  392  GLY C N     1 
ATOM   6113  C  CA    . GLY C 2  388  ? 7.537   -8.180  -62.914  1.00 62.21  ?  392  GLY C CA    1 
ATOM   6114  C  C     . GLY C 2  388  ? 6.716   -7.692  -64.090  1.00 62.28  ?  392  GLY C C     1 
ATOM   6115  O  O     . GLY C 2  388  ? 5.571   -7.256  -63.923  1.00 66.20  ?  392  GLY C O     1 
ATOM   6116  N  N     . MET C 2  389  ? 7.280   -7.776  -65.293  1.00 60.01  ?  393  MET C N     1 
ATOM   6117  C  CA    . MET C 2  389  ? 6.553   -7.381  -66.491  1.00 59.14  ?  393  MET C CA    1 
ATOM   6118  C  C     . MET C 2  389  ? 5.366   -8.300  -66.739  1.00 62.98  ?  393  MET C C     1 
ATOM   6119  O  O     . MET C 2  389  ? 4.288   -7.833  -67.122  1.00 65.76  ?  393  MET C O     1 
ATOM   6120  C  CB    . MET C 2  389  ? 7.491   -7.383  -67.694  1.00 58.77  ?  393  MET C CB    1 
ATOM   6121  C  CG    . MET C 2  389  ? 7.143   -6.343  -68.732  1.00 59.25  ?  393  MET C CG    1 
ATOM   6122  S  SD    . MET C 2  389  ? 7.520   -4.678  -68.165  1.00 58.56  ?  393  MET C SD    1 
ATOM   6123  C  CE    . MET C 2  389  ? 9.155   -4.458  -68.854  1.00 56.45  ?  393  MET C CE    1 
ATOM   6124  N  N     . SER C 2  390  ? 5.543   -9.608  -66.535  1.00 62.08  ?  394  SER C N     1 
ATOM   6125  C  CA    . SER C 2  390  ? 4.416   -10.528 -66.668  1.00 63.35  ?  394  SER C CA    1 
ATOM   6126  C  C     . SER C 2  390  ? 3.332   -10.208 -65.650  1.00 66.23  ?  394  SER C C     1 
ATOM   6127  O  O     . SER C 2  390  ? 2.135   -10.330 -65.943  1.00 69.23  ?  394  SER C O     1 
ATOM   6128  C  CB    . SER C 2  390  ? 4.886   -11.972 -66.507  1.00 57.59  ?  394  SER C CB    1 
ATOM   6129  O  OG    . SER C 2  390  ? 5.080   -12.288 -65.140  1.00 60.04  ?  394  SER C OG    1 
ATOM   6130  N  N     . ARG C 2  391  ? 3.731   -9.799  -64.444  1.00 67.80  ?  395  ARG C N     1 
ATOM   6131  C  CA    . ARG C 2  391  ? 2.743   -9.373  -63.455  1.00 68.57  ?  395  ARG C CA    1 
ATOM   6132  C  C     . ARG C 2  391  ? 1.962   -8.156  -63.948  1.00 66.98  ?  395  ARG C C     1 
ATOM   6133  O  O     . ARG C 2  391  ? 0.725   -8.115  -63.867  1.00 70.06  ?  395  ARG C O     1 
ATOM   6134  C  CB    . ARG C 2  391  ? 3.443   -9.086  -62.129  1.00 72.07  ?  395  ARG C CB    1 
ATOM   6135  C  CG    . ARG C 2  391  ? 4.139   -10.314 -61.572  1.00 74.17  ?  395  ARG C CG    1 
ATOM   6136  C  CD    . ARG C 2  391  ? 5.011   -10.003 -60.375  1.00 76.47  ?  395  ARG C CD    1 
ATOM   6137  N  NE    . ARG C 2  391  ? 5.531   -11.231 -59.782  1.00 78.62  ?  395  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C 2  391  ? 6.394   -11.271 -58.774  1.00 81.73  ?  395  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C 2  391  ? 6.844   -10.145 -58.239  1.00 81.42  ?  395  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C 2  391  ? 6.809   -12.439 -58.301  1.00 82.89  ?  395  ARG C NH2   1 
ATOM   6141  N  N     . MET C 2  392  ? 2.673   -7.158  -64.479  1.00 64.14  ?  396  MET C N     1 
ATOM   6142  C  CA    . MET C 2  392  ? 1.995   -6.004  -65.062  1.00 62.40  ?  396  MET C CA    1 
ATOM   6143  C  C     . MET C 2  392  ? 1.055   -6.426  -66.184  1.00 65.82  ?  396  MET C C     1 
ATOM   6144  O  O     . MET C 2  392  ? -0.031  -5.856  -66.344  1.00 69.64  ?  396  MET C O     1 
ATOM   6145  C  CB    . MET C 2  392  ? 3.023   -4.999  -65.575  1.00 63.15  ?  396  MET C CB    1 
ATOM   6146  C  CG    . MET C 2  392  ? 2.417   -3.758  -66.192  1.00 67.61  ?  396  MET C CG    1 
ATOM   6147  S  SD    . MET C 2  392  ? 3.319   -3.242  -67.657  1.00 69.67  ?  396  MET C SD    1 
ATOM   6148  C  CE    . MET C 2  392  ? 3.092   -4.675  -68.705  1.00 63.88  ?  396  MET C CE    1 
ATOM   6149  N  N     . GLU C 2  393  ? 1.455   -7.427  -66.971  1.00 65.39  ?  397  GLU C N     1 
ATOM   6150  C  CA    . GLU C 2  393  ? 0.584   -7.953  -68.017  1.00 67.09  ?  397  GLU C CA    1 
ATOM   6151  C  C     . GLU C 2  393  ? -0.699  -8.513  -67.424  1.00 69.07  ?  397  GLU C C     1 
ATOM   6152  O  O     . GLU C 2  393  ? -1.797  -8.257  -67.934  1.00 69.12  ?  397  GLU C O     1 
ATOM   6153  C  CB    . GLU C 2  393  ? 1.316   -9.031  -68.815  1.00 65.33  ?  397  GLU C CB    1 
ATOM   6154  C  CG    . GLU C 2  393  ? 0.394   -9.928  -69.620  1.00 67.25  ?  397  GLU C CG    1 
ATOM   6155  C  CD    . GLU C 2  393  ? 1.136   -11.057 -70.303  1.00 69.09  ?  397  GLU C CD    1 
ATOM   6156  O  OE1   . GLU C 2  393  ? 2.147   -11.524 -69.742  1.00 69.84  ?  397  GLU C OE1   1 
ATOM   6157  O  OE2   . GLU C 2  393  ? 0.712   -11.472 -71.401  1.00 72.09  ?  397  GLU C OE2   1 
ATOM   6158  N  N     . ARG C 2  394  ? -0.579  -9.292  -66.347  1.00 69.20  ?  398  ARG C N     1 
ATOM   6159  C  CA    . ARG C 2  394  ? -1.769  -9.802  -65.676  1.00 69.82  ?  398  ARG C CA    1 
ATOM   6160  C  C     . ARG C 2  394  ? -2.679  -8.663  -65.241  1.00 69.60  ?  398  ARG C C     1 
ATOM   6161  O  O     . ARG C 2  394  ? -3.904  -8.756  -65.374  1.00 72.63  ?  398  ARG C O     1 
ATOM   6162  C  CB    . ARG C 2  394  ? -1.370  -10.665 -64.477  1.00 75.01  ?  398  ARG C CB    1 
ATOM   6163  C  CG    . ARG C 2  394  ? -2.513  -11.455 -63.835  1.00 75.32  ?  398  ARG C CG    1 
ATOM   6164  C  CD    . ARG C 2  394  ? -3.232  -10.656 -62.756  1.00 75.67  ?  398  ARG C CD    1 
ATOM   6165  N  NE    . ARG C 2  394  ? -2.294  -9.984  -61.863  1.00 76.12  ?  398  ARG C NE    1 
ATOM   6166  C  CZ    . ARG C 2  394  ? -2.652  -9.141  -60.901  1.00 78.38  ?  398  ARG C CZ    1 
ATOM   6167  N  NH1   . ARG C 2  394  ? -3.932  -8.862  -60.703  1.00 82.26  ?  398  ARG C NH1   1 
ATOM   6168  N  NH2   . ARG C 2  394  ? -1.730  -8.575  -60.136  1.00 77.84  ?  398  ARG C NH2   1 
ATOM   6169  N  N     . VAL C 2  395  ? -2.102  -7.577  -64.722  1.00 68.28  ?  399  VAL C N     1 
ATOM   6170  C  CA    . VAL C 2  395  ? -2.939  -6.458  -64.295  1.00 66.53  ?  399  VAL C CA    1 
ATOM   6171  C  C     . VAL C 2  395  ? -3.628  -5.806  -65.490  1.00 69.70  ?  399  VAL C C     1 
ATOM   6172  O  O     . VAL C 2  395  ? -4.801  -5.424  -65.411  1.00 73.91  ?  399  VAL C O     1 
ATOM   6173  C  CB    . VAL C 2  395  ? -2.111  -5.445  -63.484  1.00 68.84  ?  399  VAL C CB    1 
ATOM   6174  C  CG1   . VAL C 2  395  ? -2.607  -4.025  -63.715  1.00 72.06  ?  399  VAL C CG1   1 
ATOM   6175  C  CG2   . VAL C 2  395  ? -2.182  -5.785  -62.007  1.00 69.10  ?  399  VAL C CG2   1 
ATOM   6176  N  N     . VAL C 2  396  ? -2.924  -5.682  -66.619  1.00 71.20  ?  400  VAL C N     1 
ATOM   6177  C  CA    . VAL C 2  396  ? -3.525  -5.053  -67.794  1.00 73.79  ?  400  VAL C CA    1 
ATOM   6178  C  C     . VAL C 2  396  ? -4.700  -5.878  -68.305  1.00 75.61  ?  400  VAL C C     1 
ATOM   6179  O  O     . VAL C 2  396  ? -5.742  -5.330  -68.687  1.00 78.11  ?  400  VAL C O     1 
ATOM   6180  C  CB    . VAL C 2  396  ? -2.464  -4.835  -68.889  1.00 70.47  ?  400  VAL C CB    1 
ATOM   6181  C  CG1   . VAL C 2  396  ? -3.125  -4.442  -70.201  1.00 65.20  ?  400  VAL C CG1   1 
ATOM   6182  C  CG2   . VAL C 2  396  ? -1.476  -3.768  -68.456  1.00 69.55  ?  400  VAL C CG2   1 
ATOM   6183  N  N     . ARG C 2  397  ? -4.558  -7.205  -68.316  1.00 69.67  ?  401  ARG C N     1 
ATOM   6184  C  CA    . ARG C 2  397  ? -5.659  -8.059  -68.751  1.00 69.82  ?  401  ARG C CA    1 
ATOM   6185  C  C     . ARG C 2  397  ? -6.877  -7.877  -67.856  1.00 75.73  ?  401  ARG C C     1 
ATOM   6186  O  O     . ARG C 2  397  ? -7.986  -7.625  -68.342  1.00 75.75  ?  401  ARG C O     1 
ATOM   6187  C  CB    . ARG C 2  397  ? -5.214  -9.521  -68.771  1.00 70.07  ?  401  ARG C CB    1 
ATOM   6188  C  CG    . ARG C 2  397  ? -4.115  -9.808  -69.776  1.00 76.31  ?  401  ARG C CG    1 
ATOM   6189  C  CD    . ARG C 2  397  ? -4.486  -10.955 -70.696  1.00 73.22  ?  401  ARG C CD    1 
ATOM   6190  N  NE    . ARG C 2  397  ? -3.693  -10.933 -71.921  1.00 80.79  ?  401  ARG C NE    1 
ATOM   6191  C  CZ    . ARG C 2  397  ? -2.547  -11.584 -72.086  1.00 78.97  ?  401  ARG C CZ    1 
ATOM   6192  N  NH1   . ARG C 2  397  ? -2.053  -12.321 -71.101  1.00 80.03  ?  401  ARG C NH1   1 
ATOM   6193  N  NH2   . ARG C 2  397  ? -1.896  -11.501 -73.238  1.00 74.56  ?  401  ARG C NH2   1 
ATOM   6194  N  N     . GLU C 2  398  ? -6.686  -7.990  -66.538  1.00 78.60  ?  402  GLU C N     1 
ATOM   6195  C  CA    . GLU C 2  398  ? -7.790  -7.780  -65.606  1.00 77.94  ?  402  GLU C CA    1 
ATOM   6196  C  C     . GLU C 2  398  ? -8.411  -6.401  -65.780  1.00 74.01  ?  402  GLU C C     1 
ATOM   6197  O  O     . GLU C 2  398  ? -9.617  -6.234  -65.572  1.00 82.74  ?  402  GLU C O     1 
ATOM   6198  C  CB    . GLU C 2  398  ? -7.310  -7.962  -64.165  1.00 78.28  ?  402  GLU C CB    1 
ATOM   6199  C  CG    . GLU C 2  398  ? -6.683  -9.319  -63.863  1.00 83.50  ?  402  GLU C CG    1 
ATOM   6200  C  CD    . GLU C 2  398  ? -7.702  -10.377 -63.478  1.00 95.80  ?  402  GLU C CD    1 
ATOM   6201  O  OE1   . GLU C 2  398  ? -8.915  -10.140 -63.660  1.00 94.84  ?  402  GLU C OE1   1 
ATOM   6202  O  OE2   . GLU C 2  398  ? -7.287  -11.446 -62.984  1.00 95.24  ?  402  GLU C OE2   1 
ATOM   6203  N  N     . ARG C 2  399  ? -7.613  -5.407  -66.168  1.00 75.88  ?  403  ARG C N     1 
ATOM   6204  C  CA    . ARG C 2  399  ? -8.143  -4.066  -66.366  1.00 77.83  ?  403  ARG C CA    1 
ATOM   6205  C  C     . ARG C 2  399  ? -8.850  -3.898  -67.704  1.00 77.70  ?  403  ARG C C     1 
ATOM   6206  O  O     . ARG C 2  399  ? -9.602  -2.934  -67.870  1.00 78.37  ?  403  ARG C O     1 
ATOM   6207  C  CB    . ARG C 2  399  ? -7.031  -3.025  -66.240  1.00 77.87  ?  403  ARG C CB    1 
ATOM   6208  C  CG    . ARG C 2  399  ? -6.561  -2.796  -64.815  1.00 75.36  ?  403  ARG C CG    1 
ATOM   6209  C  CD    . ARG C 2  399  ? -5.750  -1.519  -64.704  1.00 78.90  ?  403  ARG C CD    1 
ATOM   6210  N  NE    . ARG C 2  399  ? -5.189  -1.340  -63.368  1.00 72.08  ?  403  ARG C NE    1 
ATOM   6211  C  CZ    . ARG C 2  399  ? -4.560  -0.242  -62.967  1.00 72.64  ?  403  ARG C CZ    1 
ATOM   6212  N  NH1   . ARG C 2  399  ? -4.414  0.780   -63.797  1.00 75.59  ?  403  ARG C NH1   1 
ATOM   6213  N  NH2   . ARG C 2  399  ? -4.078  -0.164  -61.734  1.00 70.38  ?  403  ARG C NH2   1 
ATOM   6214  N  N     . MET C 2  400  ? -8.633  -4.801  -68.659  1.00 80.43  ?  404  MET C N     1 
ATOM   6215  C  CA    . MET C 2  400  ? -9.301  -4.650  -69.947  1.00 81.78  ?  404  MET C CA    1 
ATOM   6216  C  C     . MET C 2  400  ? -10.784 -4.986  -69.856  1.00 81.97  ?  404  MET C C     1 
ATOM   6217  O  O     . MET C 2  400  ? -11.602 -4.350  -70.528  1.00 81.68  ?  404  MET C O     1 
ATOM   6218  C  CB    . MET C 2  400  ? -8.610  -5.512  -71.002  1.00 83.81  ?  404  MET C CB    1 
ATOM   6219  C  CG    . MET C 2  400  ? -7.398  -4.838  -71.623  1.00 80.62  ?  404  MET C CG    1 
ATOM   6220  S  SD    . MET C 2  400  ? -6.618  -5.815  -72.918  1.00 81.95  ?  404  MET C SD    1 
ATOM   6221  C  CE    . MET C 2  400  ? -5.557  -4.585  -73.667  1.00 77.53  ?  404  MET C CE    1 
ATOM   6222  N  N     . THR C 2  401  ? -11.153 -5.955  -69.020  1.00 81.37  ?  405  THR C N     1 
ATOM   6223  C  CA    . THR C 2  401  ? -12.562 -6.310  -68.895  1.00 83.42  ?  405  THR C CA    1 
ATOM   6224  C  C     . THR C 2  401  ? -13.343 -5.276  -68.091  1.00 83.14  ?  405  THR C C     1 
ATOM   6225  O  O     . THR C 2  401  ? -14.531 -5.060  -68.356  1.00 89.79  ?  405  THR C O     1 
ATOM   6226  C  CB    . THR C 2  401  ? -12.706 -7.687  -68.249  1.00 83.52  ?  405  THR C CB    1 
ATOM   6227  O  OG1   . THR C 2  401  ? -12.261 -7.627  -66.888  1.00 82.46  ?  405  THR C OG1   1 
ATOM   6228  C  CG2   . THR C 2  401  ? -11.882 -8.718  -69.002  1.00 77.13  ?  405  THR C CG2   1 
ATOM   6229  N  N     . THR C 2  402  ? -12.706 -4.629  -67.112  1.00 80.33  ?  406  THR C N     1 
ATOM   6230  C  CA    . THR C 2  402  ? -13.444 -3.752  -66.207  1.00 81.12  ?  406  THR C CA    1 
ATOM   6231  C  C     . THR C 2  402  ? -13.722 -2.382  -66.819  1.00 87.68  ?  406  THR C C     1 
ATOM   6232  O  O     . THR C 2  402  ? -14.799 -1.813  -66.609  1.00 87.10  ?  406  THR C O     1 
ATOM   6233  C  CB    . THR C 2  402  ? -12.686 -3.590  -64.888  1.00 78.12  ?  406  THR C CB    1 
ATOM   6234  O  OG1   . THR C 2  402  ? -13.349 -2.612  -64.077  1.00 78.56  ?  406  THR C OG1   1 
ATOM   6235  C  CG2   . THR C 2  402  ? -11.253 -3.145  -65.128  1.00 86.18  ?  406  THR C CG2   1 
ATOM   6236  N  N     . GLN C 2  403  ? -12.768 -1.834  -67.558  1.00 91.94  ?  407  GLN C N     1 
ATOM   6237  C  CA    . GLN C 2  403  ? -12.830 -0.448  -67.989  1.00 90.00  ?  407  GLN C CA    1 
ATOM   6238  C  C     . GLN C 2  403  ? -13.762 -0.268  -69.187  1.00 92.19  ?  407  GLN C C     1 
ATOM   6239  O  O     . GLN C 2  403  ? -14.101 -1.216  -69.901  1.00 91.66  ?  407  GLN C O     1 
ATOM   6240  C  CB    . GLN C 2  403  ? -11.429 0.059   -68.314  1.00 90.63  ?  407  GLN C CB    1 
ATOM   6241  C  CG    . GLN C 2  403  ? -10.452 -0.074  -67.160  1.00 90.19  ?  407  GLN C CG    1 
ATOM   6242  C  CD    . GLN C 2  403  ? -9.428  1.040   -67.119  1.00 85.19  ?  407  GLN C CD    1 
ATOM   6243  O  OE1   . GLN C 2  403  ? -9.486  1.984   -67.906  1.00 87.47  ?  407  GLN C OE1   1 
ATOM   6244  N  NE2   . GLN C 2  403  ? -8.487  0.941   -66.188  1.00 79.39  ?  407  GLN C NE2   1 
ATOM   6245  N  N     . ASP C 2  404  ? -14.196 0.974   -69.379  1.00 92.90  ?  408  ASP C N     1 
ATOM   6246  C  CA    . ASP C 2  404  ? -14.995 1.358   -70.535  1.00 96.13  ?  408  ASP C CA    1 
ATOM   6247  C  C     . ASP C 2  404  ? -14.063 1.824   -71.649  1.00 96.01  ?  408  ASP C C     1 
ATOM   6248  O  O     . ASP C 2  404  ? -13.314 2.786   -71.468  1.00 94.79  ?  408  ASP C O     1 
ATOM   6249  C  CB    . ASP C 2  404  ? -15.982 2.464   -70.166  1.00 98.68  ?  408  ASP C CB    1 
ATOM   6250  N  N     . VAL C 2  405  ? -14.099 1.134   -72.792  1.00 95.40  ?  409  VAL C N     1 
ATOM   6251  C  CA    . VAL C 2  405  ? -13.321 1.569   -73.942  1.00 95.83  ?  409  VAL C CA    1 
ATOM   6252  C  C     . VAL C 2  405  ? -13.751 2.981   -74.318  1.00 99.61  ?  409  VAL C C     1 
ATOM   6253  O  O     . VAL C 2  405  ? -14.913 3.359   -74.147  1.00 105.02 ?  409  VAL C O     1 
ATOM   6254  C  CB    . VAL C 2  405  ? -13.495 0.590   -75.115  1.00 91.10  ?  409  VAL C CB    1 
ATOM   6255  C  CG1   . VAL C 2  405  ? -14.965 0.442   -75.475  1.00 99.17  ?  409  VAL C CG1   1 
ATOM   6256  C  CG2   . VAL C 2  405  ? -12.684 1.041   -76.323  1.00 91.88  ?  409  VAL C CG2   1 
ATOM   6257  N  N     . GLU C 2  406  ? -12.792 3.780   -74.794  1.00 96.53  ?  410  GLU C N     1 
ATOM   6258  C  CA    . GLU C 2  406  ? -12.881 5.217   -75.038  1.00 101.87 ?  410  GLU C CA    1 
ATOM   6259  C  C     . GLU C 2  406  ? -12.815 5.991   -73.717  1.00 105.65 ?  410  GLU C C     1 
ATOM   6260  O  O     . GLU C 2  406  ? -12.608 7.209   -73.741  1.00 105.14 ?  410  GLU C O     1 
ATOM   6261  C  CB    . GLU C 2  406  ? -14.150 5.636   -75.818  1.00 105.87 ?  410  GLU C CB    1 
ATOM   6262  C  CG    . GLU C 2  406  ? -14.168 7.076   -76.321  1.00 107.33 ?  410  GLU C CG    1 
ATOM   6263  C  CD    . GLU C 2  406  ? -13.131 7.335   -77.390  1.00 109.78 ?  410  GLU C CD    1 
ATOM   6264  O  OE1   . GLU C 2  406  ? -12.853 6.409   -78.179  1.00 116.06 ?  410  GLU C OE1   1 
ATOM   6265  O  OE2   . GLU C 2  406  ? -12.592 8.460   -77.432  1.00 102.19 ?  410  GLU C OE2   1 
ATOM   6266  N  N     . ALA C 2  407  ? -13.001 5.337   -72.566  1.00 102.94 ?  411  ALA C N     1 
ATOM   6267  C  CA    . ALA C 2  407  ? -12.570 5.856   -71.275  1.00 103.65 ?  411  ALA C CA    1 
ATOM   6268  C  C     . ALA C 2  407  ? -11.204 5.316   -70.869  1.00 98.98  ?  411  ALA C C     1 
ATOM   6269  O  O     . ALA C 2  407  ? -10.758 5.580   -69.747  1.00 94.34  ?  411  ALA C O     1 
ATOM   6270  C  CB    . ALA C 2  407  ? -13.600 5.542   -70.185  1.00 106.96 ?  411  ALA C CB    1 
ATOM   6271  N  N     . ILE C 2  408  ? -10.547 4.545   -71.734  1.00 98.78  ?  412  ILE C N     1 
ATOM   6272  C  CA    . ILE C 2  408  ? -9.245  3.968   -71.431  1.00 95.36  ?  412  ILE C CA    1 
ATOM   6273  C  C     . ILE C 2  408  ? -8.182  4.629   -72.296  1.00 95.45  ?  412  ILE C C     1 
ATOM   6274  O  O     . ILE C 2  408  ? -8.366  4.820   -73.505  1.00 92.67  ?  412  ILE C O     1 
ATOM   6275  C  CB    . ILE C 2  408  ? -9.230  2.438   -71.609  1.00 93.39  ?  412  ILE C CB    1 
ATOM   6276  C  CG1   . ILE C 2  408  ? -9.254  2.020   -73.075  1.00 90.66  ?  412  ILE C CG1   1 
ATOM   6277  C  CG2   . ILE C 2  408  ? -10.412 1.836   -70.944  1.00 93.00  ?  412  ILE C CG2   1 
ATOM   6278  C  CD1   . ILE C 2  408  ? -9.396  0.532   -73.241  1.00 89.67  ?  412  ILE C CD1   1 
ATOM   6279  N  N     . THR C 2  409  ? -7.094  5.012   -71.649  1.00 94.15  ?  413  THR C N     1 
ATOM   6280  C  CA    . THR C 2  409  ? -5.792  5.353   -72.166  1.00 89.43  ?  413  THR C CA    1 
ATOM   6281  C  C     . THR C 2  409  ? -4.813  4.335   -71.590  1.00 88.87  ?  413  THR C C     1 
ATOM   6282  O  O     . THR C 2  409  ? -5.099  3.748   -70.543  1.00 87.66  ?  413  THR C O     1 
ATOM   6283  C  CB    . THR C 2  409  ? -5.406  6.782   -71.756  1.00 86.14  ?  413  THR C CB    1 
ATOM   6284  O  OG1   . THR C 2  409  ? -4.120  7.119   -72.277  1.00 88.97  ?  413  THR C OG1   1 
ATOM   6285  C  CG2   . THR C 2  409  ? -5.387  6.921   -70.241  1.00 82.94  ?  413  THR C CG2   1 
ATOM   6286  N  N     . PRO C 2  410  ? -3.693  4.053   -72.263  1.00 86.28  ?  414  PRO C N     1 
ATOM   6287  C  CA    . PRO C 2  410  ? -2.769  3.043   -71.716  1.00 81.44  ?  414  PRO C CA    1 
ATOM   6288  C  C     . PRO C 2  410  ? -2.386  3.285   -70.265  1.00 80.78  ?  414  PRO C C     1 
ATOM   6289  O  O     . PRO C 2  410  ? -2.420  2.348   -69.458  1.00 81.66  ?  414  PRO C O     1 
ATOM   6290  C  CB    . PRO C 2  410  ? -1.555  3.150   -72.645  1.00 78.52  ?  414  PRO C CB    1 
ATOM   6291  C  CG    . PRO C 2  410  ? -2.126  3.599   -73.935  1.00 82.82  ?  414  PRO C CG    1 
ATOM   6292  C  CD    . PRO C 2  410  ? -3.265  4.524   -73.591  1.00 82.80  ?  414  PRO C CD    1 
ATOM   6293  N  N     . GLN C 2  411  ? -2.061  4.528   -69.905  1.00 79.48  ?  415  GLN C N     1 
ATOM   6294  C  CA    . GLN C 2  411  ? -1.612  4.827   -68.550  1.00 84.20  ?  415  GLN C CA    1 
ATOM   6295  C  C     . GLN C 2  411  ? -2.642  4.445   -67.493  1.00 86.39  ?  415  GLN C C     1 
ATOM   6296  O  O     . GLN C 2  411  ? -2.276  4.249   -66.330  1.00 86.28  ?  415  GLN C O     1 
ATOM   6297  C  CB    . GLN C 2  411  ? -1.258  6.309   -68.437  1.00 84.00  ?  415  GLN C CB    1 
ATOM   6298  C  CG    . GLN C 2  411  ? -0.373  6.642   -67.253  1.00 82.33  ?  415  GLN C CG    1 
ATOM   6299  C  CD    . GLN C 2  411  ? 0.349   7.959   -67.428  1.00 89.76  ?  415  GLN C CD    1 
ATOM   6300  O  OE1   . GLN C 2  411  ? 0.430   8.492   -68.535  1.00 91.96  ?  415  GLN C OE1   1 
ATOM   6301  N  NE2   . GLN C 2  411  ? 0.878   8.495   -66.334  1.00 90.88  ?  415  GLN C NE2   1 
ATOM   6302  N  N     . THR C 2  412  ? -3.919  4.336   -67.865  1.00 87.71  ?  416  THR C N     1 
ATOM   6303  C  CA    . THR C 2  412  ? -4.906  3.786   -66.944  1.00 87.40  ?  416  THR C CA    1 
ATOM   6304  C  C     . THR C 2  412  ? -4.799  2.271   -66.839  1.00 81.45  ?  416  THR C C     1 
ATOM   6305  O  O     . THR C 2  412  ? -5.120  1.701   -65.791  1.00 78.95  ?  416  THR C O     1 
ATOM   6306  C  CB    . THR C 2  412  ? -6.320  4.178   -67.377  1.00 88.60  ?  416  THR C CB    1 
ATOM   6307  O  OG1   . THR C 2  412  ? -6.478  3.938   -68.781  1.00 87.79  ?  416  THR C OG1   1 
ATOM   6308  C  CG2   . THR C 2  412  ? -6.579  5.645   -67.081  1.00 88.03  ?  416  THR C CG2   1 
ATOM   6309  N  N     . LEU C 2  413  ? -4.356  1.607   -67.908  1.00 79.85  ?  417  LEU C N     1 
ATOM   6310  C  CA    . LEU C 2  413  ? -4.185  0.160   -67.873  1.00 79.10  ?  417  LEU C CA    1 
ATOM   6311  C  C     . LEU C 2  413  ? -2.887  -0.254  -67.191  1.00 76.23  ?  417  LEU C C     1 
ATOM   6312  O  O     . LEU C 2  413  ? -2.833  -1.318  -66.566  1.00 73.27  ?  417  LEU C O     1 
ATOM   6313  C  CB    . LEU C 2  413  ? -4.221  -0.407  -69.292  1.00 77.98  ?  417  LEU C CB    1 
ATOM   6314  C  CG    . LEU C 2  413  ? -5.510  -0.181  -70.081  1.00 80.74  ?  417  LEU C CG    1 
ATOM   6315  C  CD1   . LEU C 2  413  ? -5.391  -0.775  -71.474  1.00 80.22  ?  417  LEU C CD1   1 
ATOM   6316  C  CD2   . LEU C 2  413  ? -6.693  -0.777  -69.339  1.00 87.61  ?  417  LEU C CD2   1 
ATOM   6317  N  N     . ILE C 2  414  ? -1.846  0.566   -67.290  1.00 75.69  ?  418  ILE C N     1 
ATOM   6318  C  CA    . ILE C 2  414  ? -0.502  0.174   -66.882  1.00 70.13  ?  418  ILE C CA    1 
ATOM   6319  C  C     . ILE C 2  414  ? -0.278  0.550   -65.424  1.00 67.73  ?  418  ILE C C     1 
ATOM   6320  O  O     . ILE C 2  414  ? -0.347  1.728   -65.056  1.00 67.72  ?  418  ILE C O     1 
ATOM   6321  C  CB    . ILE C 2  414  ? 0.557   0.823   -67.783  1.00 69.09  ?  418  ILE C CB    1 
ATOM   6322  C  CG1   . ILE C 2  414  ? 0.493   0.217   -69.185  1.00 67.87  ?  418  ILE C CG1   1 
ATOM   6323  C  CG2   . ILE C 2  414  ? 1.941   0.658   -67.180  1.00 66.60  ?  418  ILE C CG2   1 
ATOM   6324  C  CD1   . ILE C 2  414  ? 1.359   0.920   -70.195  1.00 64.28  ?  418  ILE C CD1   1 
ATOM   6325  N  N     . ASN C 2  415  ? -0.005  -0.453  -64.597  1.00 67.11  ?  419  ASN C N     1 
ATOM   6326  C  CA    . ASN C 2  415  ? 0.419   -0.265  -63.217  1.00 67.78  ?  419  ASN C CA    1 
ATOM   6327  C  C     . ASN C 2  415  ? 1.859   -0.746  -63.100  1.00 68.78  ?  419  ASN C C     1 
ATOM   6328  O  O     . ASN C 2  415  ? 2.133   -1.938  -63.276  1.00 70.10  ?  419  ASN C O     1 
ATOM   6329  C  CB    . ASN C 2  415  ? -0.490  -1.026  -62.254  1.00 67.48  ?  419  ASN C CB    1 
ATOM   6330  C  CG    . ASN C 2  415  ? -0.103  -0.822  -60.807  1.00 69.21  ?  419  ASN C CG    1 
ATOM   6331  O  OD1   . ASN C 2  415  ? 0.616   0.118   -60.473  1.00 71.97  ?  419  ASN C OD1   1 
ATOM   6332  N  ND2   . ASN C 2  415  ? -0.581  -1.701  -59.936  1.00 72.12  ?  419  ASN C ND2   1 
ATOM   6333  N  N     . ILE C 2  416  ? 2.777   0.179   -62.805  1.00 65.97  ?  420  ILE C N     1 
ATOM   6334  C  CA    . ILE C 2  416  ? 4.203   -0.139  -62.833  1.00 64.46  ?  420  ILE C CA    1 
ATOM   6335  C  C     . ILE C 2  416  ? 4.736   -0.689  -61.520  1.00 67.59  ?  420  ILE C C     1 
ATOM   6336  O  O     . ILE C 2  416  ? 5.886   -1.152  -61.483  1.00 73.13  ?  420  ILE C O     1 
ATOM   6337  C  CB    . ILE C 2  416  ? 5.049   1.095   -63.202  1.00 62.50  ?  420  ILE C CB    1 
ATOM   6338  C  CG1   . ILE C 2  416  ? 4.950   2.150   -62.100  1.00 61.69  ?  420  ILE C CG1   1 
ATOM   6339  C  CG2   . ILE C 2  416  ? 4.611   1.659   -64.539  1.00 62.27  ?  420  ILE C CG2   1 
ATOM   6340  C  CD1   . ILE C 2  416  ? 5.869   3.328   -62.302  1.00 59.38  ?  420  ILE C CD1   1 
ATOM   6341  N  N     . ARG C 2  417  ? 3.947   -0.657  -60.446  1.00 68.62  ?  421  ARG C N     1 
ATOM   6342  C  CA    . ARG C 2  417  ? 4.430   -1.078  -59.130  1.00 70.43  ?  421  ARG C CA    1 
ATOM   6343  C  C     . ARG C 2  417  ? 5.097   -2.451  -59.118  1.00 76.32  ?  421  ARG C C     1 
ATOM   6344  O  O     . ARG C 2  417  ? 6.187   -2.571  -58.537  1.00 76.74  ?  421  ARG C O     1 
ATOM   6345  C  CB    . ARG C 2  417  ? 3.272   -1.024  -58.125  1.00 69.74  ?  421  ARG C CB    1 
ATOM   6346  N  N     . PRO C 2  418  ? 4.533   -3.508  -59.720  1.00 76.08  ?  422  PRO C N     1 
ATOM   6347  C  CA    . PRO C 2  418  ? 5.203   -4.818  -59.647  1.00 76.50  ?  422  PRO C CA    1 
ATOM   6348  C  C     . PRO C 2  418  ? 6.523   -4.881  -60.398  1.00 71.13  ?  422  PRO C C     1 
ATOM   6349  O  O     . PRO C 2  418  ? 7.343   -5.753  -60.088  1.00 68.33  ?  422  PRO C O     1 
ATOM   6350  C  CB    . PRO C 2  418  ? 4.173   -5.775  -60.258  1.00 73.05  ?  422  PRO C CB    1 
ATOM   6351  C  CG    . PRO C 2  418  ? 3.364   -4.919  -61.155  1.00 72.49  ?  422  PRO C CG    1 
ATOM   6352  C  CD    . PRO C 2  418  ? 3.253   -3.603  -60.447  1.00 71.55  ?  422  PRO C CD    1 
ATOM   6353  N  N     . VAL C 2  419  ? 6.750   -4.009  -61.381  1.00 70.23  ?  423  VAL C N     1 
ATOM   6354  C  CA    . VAL C 2  419  ? 8.031   -4.000  -62.084  1.00 66.08  ?  423  VAL C CA    1 
ATOM   6355  C  C     . VAL C 2  419  ? 9.124   -3.439  -61.183  1.00 66.92  ?  423  VAL C C     1 
ATOM   6356  O  O     . VAL C 2  419  ? 10.152  -4.086  -60.940  1.00 67.33  ?  423  VAL C O     1 
ATOM   6357  C  CB    . VAL C 2  419  ? 7.919   -3.199  -63.393  1.00 62.37  ?  423  VAL C CB    1 
ATOM   6358  C  CG1   . VAL C 2  419  ? 9.275   -3.089  -64.067  1.00 59.54  ?  423  VAL C CG1   1 
ATOM   6359  C  CG2   . VAL C 2  419  ? 6.905   -3.843  -64.323  1.00 63.81  ?  423  VAL C CG2   1 
ATOM   6360  N  N     . VAL C 2  420  ? 8.906   -2.229  -60.664  1.00 70.53  ?  424  VAL C N     1 
ATOM   6361  C  CA    . VAL C 2  420  ? 9.861   -1.621  -59.741  1.00 72.93  ?  424  VAL C CA    1 
ATOM   6362  C  C     . VAL C 2  420  ? 10.083  -2.528  -58.541  1.00 71.16  ?  424  VAL C C     1 
ATOM   6363  O  O     . VAL C 2  420  ? 11.221  -2.739  -58.104  1.00 68.76  ?  424  VAL C O     1 
ATOM   6364  C  CB    . VAL C 2  420  ? 9.372   -0.226  -59.306  1.00 82.93  ?  424  VAL C CB    1 
ATOM   6365  C  CG1   . VAL C 2  420  ? 10.366  0.410   -58.347  1.00 85.87  ?  424  VAL C CG1   1 
ATOM   6366  C  CG2   . VAL C 2  420  ? 9.139   0.665   -60.518  1.00 71.93  ?  424  VAL C CG2   1 
ATOM   6367  N  N     . ALA C 2  421  ? 9.000   -3.084  -57.996  1.00 71.27  ?  425  ALA C N     1 
ATOM   6368  C  CA    . ALA C 2  421  ? 9.123   -3.992  -56.862  1.00 74.35  ?  425  ALA C CA    1 
ATOM   6369  C  C     . ALA C 2  421  ? 9.921   -5.234  -57.234  1.00 66.12  ?  425  ALA C C     1 
ATOM   6370  O  O     . ALA C 2  421  ? 10.722  -5.730  -56.433  1.00 64.77  ?  425  ALA C O     1 
ATOM   6371  C  CB    . ALA C 2  421  ? 7.736   -4.378  -56.351  1.00 83.26  ?  425  ALA C CB    1 
ATOM   6372  N  N     . ALA C 2  422  ? 9.719   -5.749  -58.448  1.00 66.40  ?  426  ALA C N     1 
ATOM   6373  C  CA    . ALA C 2  422  ? 10.480  -6.911  -58.890  1.00 64.34  ?  426  ALA C CA    1 
ATOM   6374  C  C     . ALA C 2  422  ? 11.968  -6.600  -58.948  1.00 56.61  ?  426  ALA C C     1 
ATOM   6375  O  O     . ALA C 2  422  ? 12.795  -7.411  -58.514  1.00 55.70  ?  426  ALA C O     1 
ATOM   6376  C  CB    . ALA C 2  422  ? 9.975   -7.386  -60.251  1.00 67.54  ?  426  ALA C CB    1 
ATOM   6377  N  N     . ILE C 2  423  ? 12.331  -5.430  -59.476  1.00 54.74  ?  427  ILE C N     1 
ATOM   6378  C  CA    . ILE C 2  423  ? 13.740  -5.048  -59.498  1.00 56.58  ?  427  ILE C CA    1 
ATOM   6379  C  C     . ILE C 2  423  ? 14.275  -4.898  -58.080  1.00 55.31  ?  427  ILE C C     1 
ATOM   6380  O  O     . ILE C 2  423  ? 15.368  -5.377  -57.760  1.00 48.71  ?  427  ILE C O     1 
ATOM   6381  C  CB    . ILE C 2  423  ? 13.940  -3.755  -60.309  1.00 54.96  ?  427  ILE C CB    1 
ATOM   6382  C  CG1   . ILE C 2  423  ? 13.278  -3.873  -61.677  1.00 55.59  ?  427  ILE C CG1   1 
ATOM   6383  C  CG2   . ILE C 2  423  ? 15.420  -3.479  -60.484  1.00 51.64  ?  427  ILE C CG2   1 
ATOM   6384  C  CD1   . ILE C 2  423  ? 13.950  -4.866  -62.574  1.00 50.39  ?  427  ILE C CD1   1 
ATOM   6385  N  N     . LYS C 2  424  ? 13.514  -4.231  -57.209  1.00 59.82  ?  428  LYS C N     1 
ATOM   6386  C  CA    . LYS C 2  424  ? 13.982  -3.990  -55.848  1.00 55.88  ?  428  LYS C CA    1 
ATOM   6387  C  C     . LYS C 2  424  ? 14.182  -5.295  -55.091  1.00 52.77  ?  428  LYS C C     1 
ATOM   6388  O  O     . LYS C 2  424  ? 15.148  -5.438  -54.335  1.00 53.98  ?  428  LYS C O     1 
ATOM   6389  C  CB    . LYS C 2  424  ? 12.997  -3.090  -55.104  1.00 62.67  ?  428  LYS C CB    1 
ATOM   6390  C  CG    . LYS C 2  424  ? 13.415  -2.764  -53.680  1.00 62.42  ?  428  LYS C CG    1 
ATOM   6391  C  CD    . LYS C 2  424  ? 12.272  -2.155  -52.892  1.00 63.48  ?  428  LYS C CD    1 
ATOM   6392  C  CE    . LYS C 2  424  ? 11.143  -3.153  -52.711  1.00 77.12  ?  428  LYS C CE    1 
ATOM   6393  N  NZ    . LYS C 2  424  ? 10.009  -2.576  -51.940  1.00 91.39  ?  428  LYS C NZ    1 
ATOM   6394  N  N     . GLU C 2  425  ? 13.273  -6.255  -55.273  1.00 54.78  ?  429  GLU C N     1 
ATOM   6395  C  CA    . GLU C 2  425  ? 13.403  -7.530  -54.575  1.00 57.68  ?  429  GLU C CA    1 
ATOM   6396  C  C     . GLU C 2  425  ? 14.664  -8.270  -54.996  1.00 54.45  ?  429  GLU C C     1 
ATOM   6397  O  O     . GLU C 2  425  ? 15.284  -8.957  -54.176  1.00 54.30  ?  429  GLU C O     1 
ATOM   6398  C  CB    . GLU C 2  425  ? 12.169  -8.396  -54.826  1.00 54.70  ?  429  GLU C CB    1 
ATOM   6399  N  N     . PHE C 2  426  ? 15.056  -8.144  -56.263  1.00 50.68  ?  430  PHE C N     1 
ATOM   6400  C  CA    . PHE C 2  426  ? 16.272  -8.794  -56.734  1.00 48.88  ?  430  PHE C CA    1 
ATOM   6401  C  C     . PHE C 2  426  ? 17.501  -8.251  -56.014  1.00 48.19  ?  430  PHE C C     1 
ATOM   6402  O  O     . PHE C 2  426  ? 18.231  -8.995  -55.354  1.00 49.75  ?  430  PHE C O     1 
ATOM   6403  C  CB    . PHE C 2  426  ? 16.408  -8.610  -58.243  1.00 47.97  ?  430  PHE C CB    1 
ATOM   6404  C  CG    . PHE C 2  426  ? 17.726  -9.060  -58.782  1.00 45.68  ?  430  PHE C CG    1 
ATOM   6405  C  CD1   . PHE C 2  426  ? 18.016  -10.407 -58.892  1.00 45.75  ?  430  PHE C CD1   1 
ATOM   6406  C  CD2   . PHE C 2  426  ? 18.681  -8.140  -59.175  1.00 46.22  ?  430  PHE C CD2   1 
ATOM   6407  C  CE1   . PHE C 2  426  ? 19.232  -10.828 -59.383  1.00 45.31  ?  430  PHE C CE1   1 
ATOM   6408  C  CE2   . PHE C 2  426  ? 19.899  -8.556  -59.669  1.00 47.11  ?  430  PHE C CE2   1 
ATOM   6409  C  CZ    . PHE C 2  426  ? 20.175  -9.903  -59.773  1.00 46.86  ?  430  PHE C CZ    1 
ATOM   6410  N  N     . PHE C 2  427  ? 17.736  -6.942  -56.118  1.00 48.79  ?  431  PHE C N     1 
ATOM   6411  C  CA    . PHE C 2  427  ? 18.930  -6.362  -55.517  1.00 48.51  ?  431  PHE C CA    1 
ATOM   6412  C  C     . PHE C 2  427  ? 18.943  -6.527  -54.003  1.00 51.28  ?  431  PHE C C     1 
ATOM   6413  O  O     . PHE C 2  427  ? 20.017  -6.582  -53.396  1.00 53.25  ?  431  PHE C O     1 
ATOM   6414  C  CB    . PHE C 2  427  ? 19.040  -4.886  -55.894  1.00 48.28  ?  431  PHE C CB    1 
ATOM   6415  C  CG    . PHE C 2  427  ? 19.583  -4.653  -57.275  1.00 49.36  ?  431  PHE C CG    1 
ATOM   6416  C  CD1   . PHE C 2  427  ? 20.948  -4.583  -57.492  1.00 47.96  ?  431  PHE C CD1   1 
ATOM   6417  C  CD2   . PHE C 2  427  ? 18.733  -4.507  -58.354  1.00 50.00  ?  431  PHE C CD2   1 
ATOM   6418  C  CE1   . PHE C 2  427  ? 21.452  -4.370  -58.758  1.00 46.24  ?  431  PHE C CE1   1 
ATOM   6419  C  CE2   . PHE C 2  427  ? 19.233  -4.293  -59.624  1.00 48.69  ?  431  PHE C CE2   1 
ATOM   6420  C  CZ    . PHE C 2  427  ? 20.594  -4.225  -59.825  1.00 47.20  ?  431  PHE C CZ    1 
ATOM   6421  N  N     . GLY C 2  428  ? 17.773  -6.587  -53.377  1.00 51.91  ?  432  GLY C N     1 
ATOM   6422  C  CA    . GLY C 2  428  ? 17.704  -6.773  -51.943  1.00 52.76  ?  432  GLY C CA    1 
ATOM   6423  C  C     . GLY C 2  428  ? 17.915  -8.187  -51.437  1.00 57.93  ?  432  GLY C C     1 
ATOM   6424  O  O     . GLY C 2  428  ? 18.699  -8.402  -50.509  1.00 67.81  ?  432  GLY C O     1 
ATOM   6425  N  N     . THR C 2  429  ? 17.210  -9.158  -52.017  1.00 53.16  ?  433  THR C N     1 
ATOM   6426  C  CA    . THR C 2  429  ? 17.167  -10.510 -51.471  1.00 53.88  ?  433  THR C CA    1 
ATOM   6427  C  C     . THR C 2  429  ? 18.075  -11.514 -52.174  1.00 52.78  ?  433  THR C C     1 
ATOM   6428  O  O     . THR C 2  429  ? 18.161  -12.657 -51.718  1.00 54.96  ?  433  THR C O     1 
ATOM   6429  C  CB    . THR C 2  429  ? 15.730  -11.037 -51.500  1.00 61.10  ?  433  THR C CB    1 
ATOM   6430  O  OG1   . THR C 2  429  ? 15.273  -11.105 -52.856  1.00 61.67  ?  433  THR C OG1   1 
ATOM   6431  C  CG2   . THR C 2  429  ? 14.815  -10.123 -50.704  1.00 65.50  ?  433  THR C CG2   1 
ATOM   6432  N  N     . SER C 2  430  ? 18.755  -11.142 -53.253  1.00 53.21  ?  434  SER C N     1 
ATOM   6433  C  CA    . SER C 2  430  ? 19.457  -12.135 -54.058  1.00 48.31  ?  434  SER C CA    1 
ATOM   6434  C  C     . SER C 2  430  ? 20.858  -12.398 -53.529  1.00 47.66  ?  434  SER C C     1 
ATOM   6435  O  O     . SER C 2  430  ? 21.559  -11.481 -53.092  1.00 47.19  ?  434  SER C O     1 
ATOM   6436  C  CB    . SER C 2  430  ? 19.546  -11.710 -55.521  1.00 47.67  ?  434  SER C CB    1 
ATOM   6437  O  OG    . SER C 2  430  ? 20.349  -12.623 -56.249  1.00 44.79  ?  434  SER C OG    1 
ATOM   6438  N  N     . GLN C 2  431  ? 21.258  -13.669 -53.584  1.00 49.58  ?  435  GLN C N     1 
ATOM   6439  C  CA    . GLN C 2  431  ? 22.613  -14.048 -53.206  1.00 52.52  ?  435  GLN C CA    1 
ATOM   6440  C  C     . GLN C 2  431  ? 23.637  -13.511 -54.196  1.00 48.07  ?  435  GLN C C     1 
ATOM   6441  O  O     . GLN C 2  431  ? 24.790  -13.271 -53.825  1.00 43.07  ?  435  GLN C O     1 
ATOM   6442  C  CB    . GLN C 2  431  ? 22.710  -15.569 -53.100  1.00 51.01  ?  435  GLN C CB    1 
ATOM   6443  C  CG    . GLN C 2  431  ? 24.064  -16.093 -52.663  1.00 64.75  ?  435  GLN C CG    1 
ATOM   6444  C  CD    . GLN C 2  431  ? 24.115  -17.608 -52.631  1.00 74.96  ?  435  GLN C CD    1 
ATOM   6445  O  OE1   . GLN C 2  431  ? 23.114  -18.282 -52.875  1.00 71.31  ?  435  GLN C OE1   1 
ATOM   6446  N  NE2   . GLN C 2  431  ? 25.287  -18.151 -52.329  1.00 80.38  ?  435  GLN C NE2   1 
ATOM   6447  N  N     . LEU C 2  432  ? 23.233  -13.311 -55.452  1.00 47.25  ?  436  LEU C N     1 
ATOM   6448  C  CA    . LEU C 2  432  ? 24.138  -12.779 -56.463  1.00 43.10  ?  436  LEU C CA    1 
ATOM   6449  C  C     . LEU C 2  432  ? 24.324  -11.274 -56.338  1.00 44.22  ?  436  LEU C C     1 
ATOM   6450  O  O     . LEU C 2  432  ? 25.398  -10.762 -56.669  1.00 46.78  ?  436  LEU C O     1 
ATOM   6451  C  CB    . LEU C 2  432  ? 23.623  -13.121 -57.857  1.00 42.79  ?  436  LEU C CB    1 
ATOM   6452  C  CG    . LEU C 2  432  ? 23.547  -14.610 -58.173  1.00 46.89  ?  436  LEU C CG    1 
ATOM   6453  C  CD1   . LEU C 2  432  ? 22.734  -14.832 -59.430  1.00 49.32  ?  436  LEU C CD1   1 
ATOM   6454  C  CD2   . LEU C 2  432  ? 24.945  -15.182 -58.327  1.00 47.57  ?  436  LEU C CD2   1 
ATOM   6455  N  N     . SER C 2  433  ? 23.307  -10.548 -55.885  1.00 43.53  ?  437  SER C N     1 
ATOM   6456  C  CA    . SER C 2  433  ? 23.480  -9.133  -55.596  1.00 41.76  ?  437  SER C CA    1 
ATOM   6457  C  C     . SER C 2  433  ? 24.166  -9.017  -54.247  1.00 42.85  ?  437  SER C C     1 
ATOM   6458  O  O     . SER C 2  433  ? 23.597  -9.397  -53.219  1.00 44.53  ?  437  SER C O     1 
ATOM   6459  C  CB    . SER C 2  433  ? 22.138  -8.409  -55.590  1.00 45.97  ?  437  SER C CB    1 
ATOM   6460  O  OG    . SER C 2  433  ? 22.288  -7.072  -55.149  1.00 45.97  ?  437  SER C OG    1 
ATOM   6461  N  N     . GLN C 2  434  ? 25.374  -8.472  -54.243  1.00 42.19  ?  438  GLN C N     1 
ATOM   6462  C  CA    . GLN C 2  434  ? 26.262  -8.633  -53.107  1.00 42.17  ?  438  GLN C CA    1 
ATOM   6463  C  C     . GLN C 2  434  ? 26.834  -7.299  -52.671  1.00 43.99  ?  438  GLN C C     1 
ATOM   6464  O  O     . GLN C 2  434  ? 27.114  -6.425  -53.497  1.00 39.86  ?  438  GLN C O     1 
ATOM   6465  C  CB    . GLN C 2  434  ? 27.402  -9.602  -53.433  1.00 39.03  ?  438  GLN C CB    1 
ATOM   6466  C  CG    . GLN C 2  434  ? 26.933  -11.026 -53.644  1.00 42.88  ?  438  GLN C CG    1 
ATOM   6467  C  CD    . GLN C 2  434  ? 28.054  -11.977 -53.990  1.00 43.58  ?  438  GLN C CD    1 
ATOM   6468  O  OE1   . GLN C 2  434  ? 29.222  -11.702 -53.725  1.00 45.89  ?  438  GLN C OE1   1 
ATOM   6469  N  NE2   . GLN C 2  434  ? 27.704  -13.107 -54.591  1.00 41.14  ?  438  GLN C NE2   1 
ATOM   6470  N  N     . PHE C 2  435  ? 26.996  -7.164  -51.362  1.00 47.15  ?  439  PHE C N     1 
ATOM   6471  C  CA    . PHE C 2  435  ? 27.764  -6.078  -50.784  1.00 45.60  ?  439  PHE C CA    1 
ATOM   6472  C  C     . PHE C 2  435  ? 29.142  -6.073  -51.418  1.00 44.15  ?  439  PHE C C     1 
ATOM   6473  O  O     . PHE C 2  435  ? 29.862  -7.074  -51.358  1.00 43.20  ?  439  PHE C O     1 
ATOM   6474  C  CB    . PHE C 2  435  ? 27.857  -6.316  -49.275  1.00 50.73  ?  439  PHE C CB    1 
ATOM   6475  C  CG    . PHE C 2  435  ? 28.136  -5.094  -48.461  1.00 56.51  ?  439  PHE C CG    1 
ATOM   6476  C  CD1   . PHE C 2  435  ? 27.292  -4.001  -48.509  1.00 61.27  ?  439  PHE C CD1   1 
ATOM   6477  C  CD2   . PHE C 2  435  ? 29.215  -5.067  -47.594  1.00 56.54  ?  439  PHE C CD2   1 
ATOM   6478  C  CE1   . PHE C 2  435  ? 27.544  -2.885  -47.736  1.00 67.39  ?  439  PHE C CE1   1 
ATOM   6479  C  CE2   . PHE C 2  435  ? 29.469  -3.959  -46.819  1.00 59.27  ?  439  PHE C CE2   1 
ATOM   6480  C  CZ    . PHE C 2  435  ? 28.634  -2.866  -46.889  1.00 63.81  ?  439  PHE C CZ    1 
ATOM   6481  N  N     . MET C 2  436  ? 29.514  -4.958  -52.034  1.00 43.76  ?  440  MET C N     1 
ATOM   6482  C  CA    . MET C 2  436  ? 30.774  -4.934  -52.758  1.00 40.77  ?  440  MET C CA    1 
ATOM   6483  C  C     . MET C 2  436  ? 31.932  -5.021  -51.781  1.00 44.30  ?  440  MET C C     1 
ATOM   6484  O  O     . MET C 2  436  ? 31.944  -4.352  -50.744  1.00 49.64  ?  440  MET C O     1 
ATOM   6485  C  CB    . MET C 2  436  ? 30.908  -3.675  -53.605  1.00 40.40  ?  440  MET C CB    1 
ATOM   6486  C  CG    . MET C 2  436  ? 32.233  -3.615  -54.346  1.00 36.97  ?  440  MET C CG    1 
ATOM   6487  S  SD    . MET C 2  436  ? 32.519  -2.084  -55.232  1.00 35.27  ?  440  MET C SD    1 
ATOM   6488  C  CE    . MET C 2  436  ? 34.052  -2.460  -56.050  1.00 32.81  ?  440  MET C CE    1 
ATOM   6489  N  N     . ASP C 2  437  ? 32.913  -5.846  -52.116  1.00 42.26  ?  441  ASP C N     1 
ATOM   6490  C  CA    . ASP C 2  437  ? 34.098  -5.979  -51.282  1.00 43.66  ?  441  ASP C CA    1 
ATOM   6491  C  C     . ASP C 2  437  ? 35.094  -4.962  -51.812  1.00 43.31  ?  441  ASP C C     1 
ATOM   6492  O  O     . ASP C 2  437  ? 35.704  -5.162  -52.864  1.00 40.09  ?  441  ASP C O     1 
ATOM   6493  C  CB    . ASP C 2  437  ? 34.628  -7.408  -51.349  1.00 42.96  ?  441  ASP C CB    1 
ATOM   6494  C  CG    . ASP C 2  437  ? 36.022  -7.555  -50.772  1.00 48.65  ?  441  ASP C CG    1 
ATOM   6495  O  OD1   . ASP C 2  437  ? 36.351  -6.856  -49.792  1.00 49.51  ?  441  ASP C OD1   1 
ATOM   6496  O  OD2   . ASP C 2  437  ? 36.789  -8.390  -51.298  1.00 46.86  ?  441  ASP C OD2   1 
ATOM   6497  N  N     . GLN C 2  438  ? 35.247  -3.855  -51.093  1.00 40.92  ?  442  GLN C N     1 
ATOM   6498  C  CA    . GLN C 2  438  ? 36.298  -2.896  -51.388  1.00 42.66  ?  442  GLN C CA    1 
ATOM   6499  C  C     . GLN C 2  438  ? 37.184  -2.796  -50.153  1.00 42.91  ?  442  GLN C C     1 
ATOM   6500  O  O     . GLN C 2  438  ? 36.953  -1.967  -49.270  1.00 49.64  ?  442  GLN C O     1 
ATOM   6501  C  CB    . GLN C 2  438  ? 35.666  -1.552  -51.761  1.00 46.24  ?  442  GLN C CB    1 
ATOM   6502  C  CG    . GLN C 2  438  ? 34.447  -1.210  -50.897  1.00 45.14  ?  442  GLN C CG    1 
ATOM   6503  C  CD    . GLN C 2  438  ? 33.560  -0.135  -51.494  1.00 46.22  ?  442  GLN C CD    1 
ATOM   6504  O  OE1   . GLN C 2  438  ? 33.332  -0.099  -52.701  1.00 48.80  ?  442  GLN C OE1   1 
ATOM   6505  N  NE2   . GLN C 2  438  ? 33.046  0.743   -50.645  1.00 42.48  ?  442  GLN C NE2   1 
ATOM   6506  N  N     . ASN C 2  439  ? 38.235  -3.607  -50.117  1.00 40.62  ?  443  ASN C N     1 
ATOM   6507  C  CA    . ASN C 2  439  ? 39.364  -3.376  -49.234  1.00 36.95  ?  443  ASN C CA    1 
ATOM   6508  C  C     . ASN C 2  439  ? 40.390  -2.489  -49.908  1.00 37.54  ?  443  ASN C C     1 
ATOM   6509  O  O     . ASN C 2  439  ? 40.935  -1.571  -49.290  1.00 38.42  ?  443  ASN C O     1 
ATOM   6510  C  CB    . ASN C 2  439  ? 39.989  -4.705  -48.816  1.00 38.73  ?  443  ASN C CB    1 
ATOM   6511  C  CG    . ASN C 2  439  ? 39.909  -4.932  -47.327  1.00 44.75  ?  443  ASN C CG    1 
ATOM   6512  O  OD1   . ASN C 2  439  ? 38.825  -5.106  -46.773  1.00 54.82  ?  443  ASN C OD1   1 
ATOM   6513  N  ND2   . ASN C 2  439  ? 41.056  -4.932  -46.667  1.00 44.27  ?  443  ASN C ND2   1 
ATOM   6514  N  N     . ASN C 2  440  ? 40.636  -2.765  -51.174  1.00 36.20  ?  444  ASN C N     1 
ATOM   6515  C  CA    . ASN C 2  440  ? 41.502  -2.025  -52.065  1.00 34.16  ?  444  ASN C CA    1 
ATOM   6516  C  C     . ASN C 2  440  ? 40.923  -2.217  -53.461  1.00 34.51  ?  444  ASN C C     1 
ATOM   6517  O  O     . ASN C 2  440  ? 39.957  -2.975  -53.617  1.00 32.17  ?  444  ASN C O     1 
ATOM   6518  C  CB    . ASN C 2  440  ? 42.945  -2.524  -51.943  1.00 35.75  ?  444  ASN C CB    1 
ATOM   6519  C  CG    . ASN C 2  440  ? 43.058  -4.030  -52.032  1.00 34.05  ?  444  ASN C CG    1 
ATOM   6520  O  OD1   . ASN C 2  440  ? 42.837  -4.621  -53.087  1.00 34.03  ?  444  ASN C OD1   1 
ATOM   6521  N  ND2   . ASN C 2  440  ? 43.423  -4.656  -50.927  1.00 33.98  ?  444  ASN C ND2   1 
ATOM   6522  N  N     . PRO C 2  441  ? 41.457  -1.561  -54.495  1.00 35.40  ?  445  PRO C N     1 
ATOM   6523  C  CA    . PRO C 2  441  ? 40.869  -1.720  -55.834  1.00 36.23  ?  445  PRO C CA    1 
ATOM   6524  C  C     . PRO C 2  441  ? 40.914  -3.139  -56.369  1.00 33.55  ?  445  PRO C C     1 
ATOM   6525  O  O     . PRO C 2  441  ? 40.096  -3.479  -57.231  1.00 33.24  ?  445  PRO C O     1 
ATOM   6526  C  CB    . PRO C 2  441  ? 41.710  -0.773  -56.696  1.00 39.14  ?  445  PRO C CB    1 
ATOM   6527  C  CG    . PRO C 2  441  ? 42.177  0.258   -55.749  1.00 40.55  ?  445  PRO C CG    1 
ATOM   6528  C  CD    . PRO C 2  441  ? 42.420  -0.447  -54.457  1.00 36.26  ?  445  PRO C CD    1 
ATOM   6529  N  N     . LEU C 2  442  ? 41.833  -3.981  -55.896  1.00 31.36  ?  446  LEU C N     1 
ATOM   6530  C  CA    . LEU C 2  442  ? 41.932  -5.329  -56.442  1.00 31.18  ?  446  LEU C CA    1 
ATOM   6531  C  C     . LEU C 2  442  ? 40.827  -6.234  -55.914  1.00 33.50  ?  446  LEU C C     1 
ATOM   6532  O  O     . LEU C 2  442  ? 40.243  -7.012  -56.677  1.00 32.42  ?  446  LEU C O     1 
ATOM   6533  C  CB    . LEU C 2  442  ? 43.304  -5.922  -56.131  1.00 32.08  ?  446  LEU C CB    1 
ATOM   6534  C  CG    . LEU C 2  442  ? 43.524  -7.365  -56.589  1.00 31.42  ?  446  LEU C CG    1 
ATOM   6535  C  CD1   . LEU C 2  442  ? 43.329  -7.503  -58.092  1.00 29.76  ?  446  LEU C CD1   1 
ATOM   6536  C  CD2   . LEU C 2  442  ? 44.902  -7.834  -56.179  1.00 30.76  ?  446  LEU C CD2   1 
ATOM   6537  N  N     . SER C 2  443  ? 40.528  -6.151  -54.617  1.00 34.31  ?  447  SER C N     1 
ATOM   6538  C  CA    . SER C 2  443  ? 39.411  -6.910  -54.071  1.00 33.94  ?  447  SER C CA    1 
ATOM   6539  C  C     . SER C 2  443  ? 38.109  -6.542  -54.767  1.00 34.33  ?  447  SER C C     1 
ATOM   6540  O  O     . SER C 2  443  ? 37.266  -7.409  -55.023  1.00 41.63  ?  447  SER C O     1 
ATOM   6541  C  CB    . SER C 2  443  ? 39.302  -6.679  -52.566  1.00 35.47  ?  447  SER C CB    1 
ATOM   6542  O  OG    . SER C 2  443  ? 39.313  -5.302  -52.256  1.00 35.97  ?  447  SER C OG    1 
ATOM   6543  N  N     . GLY C 2  444  ? 37.937  -5.263  -55.100  1.00 30.84  ?  448  GLY C N     1 
ATOM   6544  C  CA    . GLY C 2  444  ? 36.740  -4.848  -55.804  1.00 30.17  ?  448  GLY C CA    1 
ATOM   6545  C  C     . GLY C 2  444  ? 36.732  -5.250  -57.263  1.00 29.66  ?  448  GLY C C     1 
ATOM   6546  O  O     . GLY C 2  444  ? 35.673  -5.547  -57.819  1.00 32.67  ?  448  GLY C O     1 
ATOM   6547  N  N     . LEU C 2  445  ? 37.898  -5.269  -57.903  1.00 30.55  ?  449  LEU C N     1 
ATOM   6548  C  CA    . LEU C 2  445  ? 37.945  -5.595  -59.324  1.00 30.61  ?  449  LEU C CA    1 
ATOM   6549  C  C     . LEU C 2  445  ? 37.617  -7.063  -59.571  1.00 34.45  ?  449  LEU C C     1 
ATOM   6550  O  O     . LEU C 2  445  ? 36.788  -7.385  -60.428  1.00 38.04  ?  449  LEU C O     1 
ATOM   6551  C  CB    . LEU C 2  445  ? 39.314  -5.249  -59.901  1.00 31.28  ?  449  LEU C CB    1 
ATOM   6552  C  CG    . LEU C 2  445  ? 39.459  -5.669  -61.363  1.00 33.36  ?  449  LEU C CG    1 
ATOM   6553  C  CD1   . LEU C 2  445  ? 38.471  -4.909  -62.228  1.00 35.07  ?  449  LEU C CD1   1 
ATOM   6554  C  CD2   . LEU C 2  445  ? 40.880  -5.474  -61.858  1.00 34.06  ?  449  LEU C CD2   1 
ATOM   6555  N  N     . THR C 2  446  ? 38.271  -7.973  -58.843  1.00 32.58  ?  450  THR C N     1 
ATOM   6556  C  CA    . THR C 2  446  ? 37.987  -9.391  -59.037  1.00 33.83  ?  450  THR C CA    1 
ATOM   6557  C  C     . THR C 2  446  ? 36.576  -9.745  -58.591  1.00 33.56  ?  450  THR C C     1 
ATOM   6558  O  O     . THR C 2  446  ? 35.968  -10.663 -59.150  1.00 40.20  ?  450  THR C O     1 
ATOM   6559  C  CB    . THR C 2  446  ? 38.996  -10.255 -58.285  1.00 34.40  ?  450  THR C CB    1 
ATOM   6560  O  OG1   . THR C 2  446  ? 39.126  -9.774  -56.947  1.00 31.85  ?  450  THR C OG1   1 
ATOM   6561  C  CG2   . THR C 2  446  ? 40.346  -10.231 -58.974  1.00 36.13  ?  450  THR C CG2   1 
ATOM   6562  N  N     . HIS C 2  447  ? 36.051  -9.044  -57.584  1.00 29.95  ?  451  HIS C N     1 
ATOM   6563  C  CA    . HIS C 2  447  ? 34.665  -9.253  -57.180  1.00 32.40  ?  451  HIS C CA    1 
ATOM   6564  C  C     . HIS C 2  447  ? 33.729  -9.117  -58.370  1.00 34.15  ?  451  HIS C C     1 
ATOM   6565  O  O     . HIS C 2  447  ? 32.825  -9.937  -58.558  1.00 35.12  ?  451  HIS C O     1 
ATOM   6566  C  CB    . HIS C 2  447  ? 34.286  -8.263  -56.081  1.00 34.19  ?  451  HIS C CB    1 
ATOM   6567  C  CG    . HIS C 2  447  ? 33.013  -8.603  -55.371  1.00 34.48  ?  451  HIS C CG    1 
ATOM   6568  N  ND1   . HIS C 2  447  ? 32.648  -8.018  -54.178  1.00 37.85  ?  451  HIS C ND1   1 
ATOM   6569  C  CD2   . HIS C 2  447  ? 32.020  -9.466  -55.684  1.00 33.79  ?  451  HIS C CD2   1 
ATOM   6570  C  CE1   . HIS C 2  447  ? 31.485  -8.506  -53.788  1.00 36.82  ?  451  HIS C CE1   1 
ATOM   6571  N  NE2   . HIS C 2  447  ? 31.082  -9.385  -54.685  1.00 34.49  ?  451  HIS C NE2   1 
ATOM   6572  N  N     . LYS C 2  448  ? 33.947  -8.100  -59.201  1.00 33.43  ?  452  LYS C N     1 
ATOM   6573  C  CA    . LYS C 2  448  ? 33.148  -7.943  -60.407  1.00 32.84  ?  452  LYS C CA    1 
ATOM   6574  C  C     . LYS C 2  448  ? 33.444  -9.016  -61.445  1.00 34.98  ?  452  LYS C C     1 
ATOM   6575  O  O     . LYS C 2  448  ? 32.626  -9.230  -62.345  1.00 38.17  ?  452  LYS C O     1 
ATOM   6576  C  CB    . LYS C 2  448  ? 33.382  -6.559  -61.002  1.00 30.89  ?  452  LYS C CB    1 
ATOM   6577  C  CG    . LYS C 2  448  ? 33.215  -5.448  -59.989  1.00 30.37  ?  452  LYS C CG    1 
ATOM   6578  C  CD    . LYS C 2  448  ? 33.578  -4.104  -60.565  1.00 30.43  ?  452  LYS C CD    1 
ATOM   6579  C  CE    . LYS C 2  448  ? 33.796  -3.107  -59.454  1.00 32.58  ?  452  LYS C CE    1 
ATOM   6580  N  NZ    . LYS C 2  448  ? 33.985  -1.722  -59.954  1.00 42.77  ?  452  LYS C NZ    1 
ATOM   6581  N  N     . ARG C 2  449  ? 34.593  -9.683  -61.354  1.00 31.17  ?  453  ARG C N     1 
ATOM   6582  C  CA    . ARG C 2  449  ? 34.956  -10.749 -62.277  1.00 31.11  ?  453  ARG C CA    1 
ATOM   6583  C  C     . ARG C 2  449  ? 34.653  -12.141 -61.729  1.00 30.59  ?  453  ARG C C     1 
ATOM   6584  O  O     . ARG C 2  449  ? 35.001  -13.134 -62.370  1.00 30.96  ?  453  ARG C O     1 
ATOM   6585  C  CB    . ARG C 2  449  ? 36.431  -10.630 -62.657  1.00 30.31  ?  453  ARG C CB    1 
ATOM   6586  C  CG    . ARG C 2  449  ? 36.811  -9.249  -63.154  1.00 28.29  ?  453  ARG C CG    1 
ATOM   6587  C  CD    . ARG C 2  449  ? 38.209  -9.208  -63.751  1.00 31.16  ?  453  ARG C CD    1 
ATOM   6588  N  NE    . ARG C 2  449  ? 38.197  -9.394  -65.199  1.00 29.86  ?  453  ARG C NE    1 
ATOM   6589  C  CZ    . ARG C 2  449  ? 38.799  -10.393 -65.832  1.00 32.23  ?  453  ARG C CZ    1 
ATOM   6590  N  NH1   . ARG C 2  449  ? 39.475  -11.302 -65.147  1.00 32.08  ?  453  ARG C NH1   1 
ATOM   6591  N  NH2   . ARG C 2  449  ? 38.733  -10.477 -67.152  1.00 32.44  ?  453  ARG C NH2   1 
ATOM   6592  N  N     . ARG C 2  450  ? 34.027  -12.235 -60.560  1.00 31.60  ?  454  ARG C N     1 
ATOM   6593  C  CA    . ARG C 2  450  ? 33.755  -13.530 -59.953  1.00 30.79  ?  454  ARG C CA    1 
ATOM   6594  C  C     . ARG C 2  450  ? 32.743  -14.331 -60.764  1.00 32.06  ?  454  ARG C C     1 
ATOM   6595  O  O     . ARG C 2  450  ? 31.784  -13.785 -61.312  1.00 35.62  ?  454  ARG C O     1 
ATOM   6596  C  CB    . ARG C 2  450  ? 33.240  -13.350 -58.528  1.00 28.72  ?  454  ARG C CB    1 
ATOM   6597  C  CG    . ARG C 2  450  ? 34.298  -12.944 -57.526  1.00 33.95  ?  454  ARG C CG    1 
ATOM   6598  C  CD    . ARG C 2  450  ? 35.470  -13.904 -57.563  1.00 37.33  ?  454  ARG C CD    1 
ATOM   6599  N  NE    . ARG C 2  450  ? 36.249  -13.875 -56.330  1.00 40.45  ?  454  ARG C NE    1 
ATOM   6600  C  CZ    . ARG C 2  450  ? 37.274  -14.683 -56.081  1.00 44.76  ?  454  ARG C CZ    1 
ATOM   6601  N  NH1   . ARG C 2  450  ? 37.645  -15.582 -56.981  1.00 40.50  ?  454  ARG C NH1   1 
ATOM   6602  N  NH2   . ARG C 2  450  ? 37.928  -14.594 -54.933  1.00 47.54  ?  454  ARG C NH2   1 
ATOM   6603  N  N     . LEU C 2  451  ? 32.969  -15.640 -60.838  1.00 33.87  ?  455  LEU C N     1 
ATOM   6604  C  CA    . LEU C 2  451  ? 32.030  -16.592 -61.422  1.00 32.24  ?  455  LEU C CA    1 
ATOM   6605  C  C     . LEU C 2  451  ? 31.549  -17.495 -60.296  1.00 33.48  ?  455  LEU C C     1 
ATOM   6606  O  O     . LEU C 2  451  ? 32.323  -18.296 -59.767  1.00 33.31  ?  455  LEU C O     1 
ATOM   6607  C  CB    . LEU C 2  451  ? 32.689  -17.399 -62.535  1.00 30.23  ?  455  LEU C CB    1 
ATOM   6608  C  CG    . LEU C 2  451  ? 33.490  -16.584 -63.547  1.00 31.34  ?  455  LEU C CG    1 
ATOM   6609  C  CD1   . LEU C 2  451  ? 34.034  -17.469 -64.653  1.00 28.66  ?  455  LEU C CD1   1 
ATOM   6610  C  CD2   . LEU C 2  451  ? 32.635  -15.466 -64.117  1.00 33.55  ?  455  LEU C CD2   1 
ATOM   6611  N  N     . SER C 2  452  ? 30.280  -17.363 -59.924  1.00 31.83  ?  456  SER C N     1 
ATOM   6612  C  CA    . SER C 2  452  ? 29.733  -18.044 -58.759  1.00 34.13  ?  456  SER C CA    1 
ATOM   6613  C  C     . SER C 2  452  ? 28.824  -19.181 -59.197  1.00 39.50  ?  456  SER C C     1 
ATOM   6614  O  O     . SER C 2  452  ? 27.994  -19.008 -60.094  1.00 42.35  ?  456  SER C O     1 
ATOM   6615  C  CB    . SER C 2  452  ? 28.964  -17.071 -57.868  1.00 38.21  ?  456  SER C CB    1 
ATOM   6616  O  OG    . SER C 2  452  ? 28.469  -17.725 -56.715  1.00 43.05  ?  456  SER C OG    1 
ATOM   6617  N  N     . ALA C 2  453  ? 28.992  -20.341 -58.570  1.00 41.12  ?  457  ALA C N     1 
ATOM   6618  C  CA    . ALA C 2  453  ? 28.145  -21.493 -58.830  1.00 40.65  ?  457  ALA C CA    1 
ATOM   6619  C  C     . ALA C 2  453  ? 26.959  -21.592 -57.883  1.00 45.96  ?  457  ALA C C     1 
ATOM   6620  O  O     . ALA C 2  453  ? 26.067  -22.412 -58.119  1.00 51.20  ?  457  ALA C O     1 
ATOM   6621  C  CB    . ALA C 2  453  ? 28.969  -22.778 -58.743  1.00 43.86  ?  457  ALA C CB    1 
ATOM   6622  N  N     . LEU C 2  454  ? 26.919  -20.781 -56.832  1.00 45.09  ?  458  LEU C N     1 
ATOM   6623  C  CA    . LEU C 2  454  ? 25.870  -20.847 -55.826  1.00 49.78  ?  458  LEU C CA    1 
ATOM   6624  C  C     . LEU C 2  454  ? 24.796  -19.810 -56.114  1.00 50.77  ?  458  LEU C C     1 
ATOM   6625  O  O     . LEU C 2  454  ? 25.102  -18.659 -56.438  1.00 49.88  ?  458  LEU C O     1 
ATOM   6626  C  CB    . LEU C 2  454  ? 26.445  -20.612 -54.429  1.00 53.14  ?  458  LEU C CB    1 
ATOM   6627  C  CG    . LEU C 2  454  ? 27.558  -21.552 -53.970  1.00 56.61  ?  458  LEU C CG    1 
ATOM   6628  C  CD1   . LEU C 2  454  ? 28.284  -20.967 -52.768  1.00 68.19  ?  458  LEU C CD1   1 
ATOM   6629  C  CD2   . LEU C 2  454  ? 26.996  -22.923 -53.640  1.00 58.10  ?  458  LEU C CD2   1 
ATOM   6630  N  N     . GLY C 2  455  ? 23.537  -20.223 -56.004  1.00 54.66  ?  459  GLY C N     1 
ATOM   6631  C  CA    . GLY C 2  455  ? 22.436  -19.298 -56.104  1.00 58.18  ?  459  GLY C CA    1 
ATOM   6632  C  C     . GLY C 2  455  ? 21.174  -19.905 -56.681  1.00 60.01  ?  459  GLY C C     1 
ATOM   6633  O  O     . GLY C 2  455  ? 21.094  -21.107 -56.951  1.00 59.92  ?  459  GLY C O     1 
ATOM   6634  N  N     . PRO C 2  456  ? 20.154  -19.071 -56.869  1.00 59.15  ?  460  PRO C N     1 
ATOM   6635  C  CA    . PRO C 2  456  ? 18.928  -19.535 -57.529  1.00 61.46  ?  460  PRO C CA    1 
ATOM   6636  C  C     . PRO C 2  456  ? 19.215  -19.957 -58.961  1.00 62.12  ?  460  PRO C C     1 
ATOM   6637  O  O     . PRO C 2  456  ? 19.839  -19.223 -59.729  1.00 61.20  ?  460  PRO C O     1 
ATOM   6638  C  CB    . PRO C 2  456  ? 18.008  -18.310 -57.471  1.00 64.86  ?  460  PRO C CB    1 
ATOM   6639  C  CG    . PRO C 2  456  ? 18.585  -17.438 -56.393  1.00 65.78  ?  460  PRO C CG    1 
ATOM   6640  C  CD    . PRO C 2  456  ? 20.058  -17.668 -56.438  1.00 60.44  ?  460  PRO C CD    1 
ATOM   6641  N  N     . GLY C 2  457  ? 18.740  -21.148 -59.321  1.00 65.73  ?  461  GLY C N     1 
ATOM   6642  C  CA    . GLY C 2  457  ? 19.091  -21.760 -60.582  1.00 61.63  ?  461  GLY C CA    1 
ATOM   6643  C  C     . GLY C 2  457  ? 20.402  -22.509 -60.572  1.00 63.06  ?  461  GLY C C     1 
ATOM   6644  O  O     . GLY C 2  457  ? 20.648  -23.313 -61.478  1.00 68.10  ?  461  GLY C O     1 
ATOM   6645  N  N     . GLY C 2  458  ? 21.250  -22.273 -59.581  1.00 62.24  ?  462  GLY C N     1 
ATOM   6646  C  CA    . GLY C 2  458  ? 22.483  -23.009 -59.405  1.00 58.94  ?  462  GLY C CA    1 
ATOM   6647  C  C     . GLY C 2  458  ? 22.285  -24.226 -58.533  1.00 57.52  ?  462  GLY C C     1 
ATOM   6648  O  O     . GLY C 2  458  ? 21.211  -24.834 -58.506  1.00 60.22  ?  462  GLY C O     1 
ATOM   6649  N  N     . LEU C 2  459  ? 23.335  -24.589 -57.807  1.00 56.70  ?  463  LEU C N     1 
ATOM   6650  C  CA    . LEU C 2  459  ? 23.307  -25.744 -56.926  1.00 65.06  ?  463  LEU C CA    1 
ATOM   6651  C  C     . LEU C 2  459  ? 23.379  -25.308 -55.470  1.00 64.46  ?  463  LEU C C     1 
ATOM   6652  O  O     . LEU C 2  459  ? 23.961  -24.271 -55.140  1.00 58.88  ?  463  LEU C O     1 
ATOM   6653  C  CB    . LEU C 2  459  ? 24.456  -26.705 -57.246  1.00 65.69  ?  463  LEU C CB    1 
ATOM   6654  C  CG    . LEU C 2  459  ? 25.820  -26.094 -57.573  1.00 62.06  ?  463  LEU C CG    1 
ATOM   6655  C  CD1   . LEU C 2  459  ? 26.581  -25.697 -56.318  1.00 62.01  ?  463  LEU C CD1   1 
ATOM   6656  C  CD2   . LEU C 2  459  ? 26.639  -27.054 -58.417  1.00 69.12  ?  463  LEU C CD2   1 
ATOM   6657  N  N     . SER C 2  460  ? 22.767  -26.108 -54.602  1.00 70.63  ?  464  SER C N     1 
ATOM   6658  C  CA    . SER C 2  460  ? 22.861  -25.868 -53.172  1.00 70.11  ?  464  SER C CA    1 
ATOM   6659  C  C     . SER C 2  460  ? 24.246  -26.249 -52.668  1.00 72.22  ?  464  SER C C     1 
ATOM   6660  O  O     . SER C 2  460  ? 24.901  -27.145 -53.206  1.00 74.40  ?  464  SER C O     1 
ATOM   6661  C  CB    . SER C 2  460  ? 21.797  -26.670 -52.424  1.00 77.40  ?  464  SER C CB    1 
ATOM   6662  O  OG    . SER C 2  460  ? 20.519  -26.495 -53.009  1.00 90.05  ?  464  SER C OG    1 
ATOM   6663  N  N     . ARG C 2  461  ? 24.695  -25.549 -51.625  1.00 73.79  ?  465  ARG C N     1 
ATOM   6664  C  CA    . ARG C 2  461  ? 25.962  -25.910 -50.999  1.00 74.50  ?  465  ARG C CA    1 
ATOM   6665  C  C     . ARG C 2  461  ? 25.918  -27.326 -50.444  1.00 80.00  ?  465  ARG C C     1 
ATOM   6666  O  O     . ARG C 2  461  ? 26.933  -28.030 -50.456  1.00 81.84  ?  465  ARG C O     1 
ATOM   6667  C  CB    . ARG C 2  461  ? 26.305  -24.918 -49.890  1.00 73.26  ?  465  ARG C CB    1 
ATOM   6668  C  CG    . ARG C 2  461  ? 27.651  -25.170 -49.243  1.00 70.75  ?  465  ARG C CG    1 
ATOM   6669  C  CD    . ARG C 2  461  ? 27.838  -24.304 -48.014  1.00 76.16  ?  465  ARG C CD    1 
ATOM   6670  N  NE    . ARG C 2  461  ? 27.504  -22.909 -48.279  1.00 77.49  ?  465  ARG C NE    1 
ATOM   6671  C  CZ    . ARG C 2  461  ? 28.301  -22.058 -48.917  1.00 77.58  ?  465  ARG C CZ    1 
ATOM   6672  N  NH1   . ARG C 2  461  ? 29.482  -22.460 -49.366  1.00 69.88  ?  465  ARG C NH1   1 
ATOM   6673  N  NH2   . ARG C 2  461  ? 27.917  -20.806 -49.111  1.00 82.56  ?  465  ARG C NH2   1 
ATOM   6674  N  N     . GLU C 2  462  ? 24.754  -27.761 -49.961  1.00 81.23  ?  466  GLU C N     1 
ATOM   6675  C  CA    . GLU C 2  462  ? 24.621  -29.123 -49.459  1.00 85.09  ?  466  GLU C CA    1 
ATOM   6676  C  C     . GLU C 2  462  ? 24.807  -30.155 -50.563  1.00 84.59  ?  466  GLU C C     1 
ATOM   6677  O  O     . GLU C 2  462  ? 25.358  -31.233 -50.315  1.00 89.10  ?  466  GLU C O     1 
ATOM   6678  C  CB    . GLU C 2  462  ? 23.256  -29.307 -48.798  1.00 95.43  ?  466  GLU C CB    1 
ATOM   6679  C  CG    . GLU C 2  462  ? 22.934  -28.286 -47.723  1.00 99.46  ?  466  GLU C CG    1 
ATOM   6680  C  CD    . GLU C 2  462  ? 21.511  -28.412 -47.214  1.00 105.34 ?  466  GLU C CD    1 
ATOM   6681  O  OE1   . GLU C 2  462  ? 20.715  -29.136 -47.848  1.00 108.46 ?  466  GLU C OE1   1 
ATOM   6682  O  OE2   . GLU C 2  462  ? 21.189  -27.789 -46.181  1.00 106.84 ?  466  GLU C OE2   1 
ATOM   6683  N  N     . ARG C 2  463  ? 24.357  -29.848 -51.778  1.00 83.82  ?  467  ARG C N     1 
ATOM   6684  C  CA    . ARG C 2  463  ? 24.337  -30.799 -52.881  1.00 87.79  ?  467  ARG C CA    1 
ATOM   6685  C  C     . ARG C 2  463  ? 25.560  -30.707 -53.786  1.00 88.33  ?  467  ARG C C     1 
ATOM   6686  O  O     . ARG C 2  463  ? 25.597  -31.374 -54.825  1.00 93.12  ?  467  ARG C O     1 
ATOM   6687  C  CB    . ARG C 2  463  ? 23.061  -30.619 -53.701  1.00 94.56  ?  467  ARG C CB    1 
ATOM   6688  C  CG    . ARG C 2  463  ? 21.801  -30.863 -52.892  1.00 103.02 ?  467  ARG C CG    1 
ATOM   6689  C  CD    . ARG C 2  463  ? 20.706  -31.464 -53.746  1.00 110.55 ?  467  ARG C CD    1 
ATOM   6690  N  NE    . ARG C 2  463  ? 19.691  -32.123 -52.932  1.00 112.51 ?  467  ARG C NE    1 
ATOM   6691  C  CZ    . ARG C 2  463  ? 18.767  -32.945 -53.417  1.00 120.56 ?  467  ARG C CZ    1 
ATOM   6692  N  NH1   . ARG C 2  463  ? 18.733  -33.214 -54.715  1.00 125.81 ?  467  ARG C NH1   1 
ATOM   6693  N  NH2   . ARG C 2  463  ? 17.881  -33.502 -52.603  1.00 121.22 ?  467  ARG C NH2   1 
ATOM   6694  N  N     . ALA C 2  464  ? 26.553  -29.897 -53.431  1.00 85.18  ?  468  ALA C N     1 
ATOM   6695  C  CA    . ALA C 2  464  ? 27.735  -29.718 -54.267  1.00 79.18  ?  468  ALA C CA    1 
ATOM   6696  C  C     . ALA C 2  464  ? 28.806  -30.714 -53.836  1.00 80.74  ?  468  ALA C C     1 
ATOM   6697  O  O     . ALA C 2  464  ? 29.387  -30.585 -52.753  1.00 79.02  ?  468  ALA C O     1 
ATOM   6698  C  CB    . ALA C 2  464  ? 28.250  -28.285 -54.170  1.00 73.79  ?  468  ALA C CB    1 
ATOM   6699  N  N     . GLY C 2  465  ? 29.081  -31.693 -54.695  1.00 79.74  ?  469  GLY C N     1 
ATOM   6700  C  CA    . GLY C 2  465  ? 30.082  -32.696 -54.409  1.00 77.56  ?  469  GLY C CA    1 
ATOM   6701  C  C     . GLY C 2  465  ? 31.484  -32.207 -54.708  1.00 71.62  ?  469  GLY C C     1 
ATOM   6702  O  O     . GLY C 2  465  ? 31.711  -31.075 -55.133  1.00 70.08  ?  469  GLY C O     1 
ATOM   6703  N  N     . LEU C 2  466  ? 32.452  -33.095 -54.475  1.00 67.11  ?  470  LEU C N     1 
ATOM   6704  C  CA    . LEU C 2  466  ? 33.840  -32.755 -54.749  1.00 68.73  ?  470  LEU C CA    1 
ATOM   6705  C  C     . LEU C 2  466  ? 34.157  -32.717 -56.236  1.00 67.41  ?  470  LEU C C     1 
ATOM   6706  O  O     . LEU C 2  466  ? 35.235  -32.242 -56.607  1.00 69.02  ?  470  LEU C O     1 
ATOM   6707  C  CB    . LEU C 2  466  ? 34.778  -33.740 -54.051  1.00 74.98  ?  470  LEU C CB    1 
ATOM   6708  C  CG    . LEU C 2  466  ? 34.942  -33.566 -52.542  1.00 75.05  ?  470  LEU C CG    1 
ATOM   6709  C  CD1   . LEU C 2  466  ? 36.049  -34.469 -52.022  1.00 76.04  ?  470  LEU C CD1   1 
ATOM   6710  C  CD2   . LEU C 2  466  ? 35.222  -32.112 -52.198  1.00 69.93  ?  470  LEU C CD2   1 
ATOM   6711  N  N     . GLU C 2  467  ? 33.258  -33.205 -57.091  1.00 63.96  ?  471  GLU C N     1 
ATOM   6712  C  CA    . GLU C 2  467  ? 33.501  -33.173 -58.527  1.00 63.98  ?  471  GLU C CA    1 
ATOM   6713  C  C     . GLU C 2  467  ? 33.202  -31.811 -59.137  1.00 62.67  ?  471  GLU C C     1 
ATOM   6714  O  O     . GLU C 2  467  ? 33.705  -31.508 -60.224  1.00 59.77  ?  471  GLU C O     1 
ATOM   6715  C  CB    . GLU C 2  467  ? 32.670  -34.254 -59.222  1.00 64.76  ?  471  GLU C CB    1 
ATOM   6716  C  CG    . GLU C 2  467  ? 33.164  -34.625 -60.609  1.00 70.17  ?  471  GLU C CG    1 
ATOM   6717  C  CD    . GLU C 2  467  ? 32.506  -35.881 -61.144  1.00 75.54  ?  471  GLU C CD    1 
ATOM   6718  O  OE1   . GLU C 2  467  ? 32.153  -35.908 -62.342  1.00 79.53  ?  471  GLU C OE1   1 
ATOM   6719  O  OE2   . GLU C 2  467  ? 32.339  -36.841 -60.364  1.00 78.10  ?  471  GLU C OE2   1 
ATOM   6720  N  N     . VAL C 2  468  ? 32.398  -30.986 -58.467  1.00 63.82  ?  472  VAL C N     1 
ATOM   6721  C  CA    . VAL C 2  468  ? 32.113  -29.654 -58.985  1.00 60.71  ?  472  VAL C CA    1 
ATOM   6722  C  C     . VAL C 2  468  ? 33.248  -28.690 -58.670  1.00 52.89  ?  472  VAL C C     1 
ATOM   6723  O  O     . VAL C 2  468  ? 33.461  -27.717 -59.400  1.00 51.06  ?  472  VAL C O     1 
ATOM   6724  C  CB    . VAL C 2  468  ? 30.780  -29.135 -58.421  1.00 62.36  ?  472  VAL C CB    1 
ATOM   6725  C  CG1   . VAL C 2  468  ? 30.102  -28.216 -59.423  1.00 59.23  ?  472  VAL C CG1   1 
ATOM   6726  C  CG2   . VAL C 2  468  ? 29.876  -30.296 -58.037  1.00 73.28  ?  472  VAL C CG2   1 
ATOM   6727  N  N     . ARG C 2  469  ? 33.986  -28.937 -57.593  1.00 50.23  ?  473  ARG C N     1 
ATOM   6728  C  CA    . ARG C 2  469  ? 35.017  -28.026 -57.123  1.00 48.21  ?  473  ARG C CA    1 
ATOM   6729  C  C     . ARG C 2  469  ? 36.363  -28.246 -57.794  1.00 46.04  ?  473  ARG C C     1 
ATOM   6730  O  O     . ARG C 2  469  ? 37.297  -27.486 -57.534  1.00 43.51  ?  473  ARG C O     1 
ATOM   6731  C  CB    . ARG C 2  469  ? 35.176  -28.161 -55.608  1.00 48.03  ?  473  ARG C CB    1 
ATOM   6732  C  CG    . ARG C 2  469  ? 33.871  -28.092 -54.843  1.00 48.75  ?  473  ARG C CG    1 
ATOM   6733  C  CD    . ARG C 2  469  ? 34.087  -28.428 -53.384  1.00 48.06  ?  473  ARG C CD    1 
ATOM   6734  N  NE    . ARG C 2  469  ? 32.840  -28.439 -52.628  1.00 48.53  ?  473  ARG C NE    1 
ATOM   6735  C  CZ    . ARG C 2  469  ? 32.447  -27.462 -51.821  1.00 49.61  ?  473  ARG C CZ    1 
ATOM   6736  N  NH1   . ARG C 2  469  ? 33.205  -26.387 -51.659  1.00 46.40  ?  473  ARG C NH1   1 
ATOM   6737  N  NH2   . ARG C 2  469  ? 31.297  -27.560 -51.171  1.00 58.46  ?  473  ARG C NH2   1 
ATOM   6738  N  N     . ASP C 2  470  ? 36.491  -29.259 -58.641  1.00 49.45  ?  474  ASP C N     1 
ATOM   6739  C  CA    . ASP C 2  470  ? 37.773  -29.571 -59.247  1.00 48.74  ?  474  ASP C CA    1 
ATOM   6740  C  C     . ASP C 2  470  ? 38.043  -28.678 -60.449  1.00 44.58  ?  474  ASP C C     1 
ATOM   6741  O  O     . ASP C 2  470  ? 37.124  -28.248 -61.149  1.00 43.56  ?  474  ASP C O     1 
ATOM   6742  C  CB    . ASP C 2  470  ? 37.820  -31.036 -59.673  1.00 51.34  ?  474  ASP C CB    1 
ATOM   6743  C  CG    . ASP C 2  470  ? 37.634  -31.984 -58.509  1.00 58.55  ?  474  ASP C CG    1 
ATOM   6744  O  OD1   . ASP C 2  470  ? 38.093  -31.654 -57.395  1.00 54.64  ?  474  ASP C OD1   1 
ATOM   6745  O  OD2   . ASP C 2  470  ? 37.021  -33.056 -58.704  1.00 60.13  ?  474  ASP C OD2   1 
ATOM   6746  N  N     . VAL C 2  471  ? 39.327  -28.392 -60.673  1.00 44.94  ?  475  VAL C N     1 
ATOM   6747  C  CA    . VAL C 2  471  ? 39.737  -27.780 -61.927  1.00 41.44  ?  475  VAL C CA    1 
ATOM   6748  C  C     . VAL C 2  471  ? 39.367  -28.713 -63.068  1.00 41.61  ?  475  VAL C C     1 
ATOM   6749  O  O     . VAL C 2  471  ? 39.522  -29.936 -62.974  1.00 48.71  ?  475  VAL C O     1 
ATOM   6750  C  CB    . VAL C 2  471  ? 41.246  -27.480 -61.916  1.00 37.79  ?  475  VAL C CB    1 
ATOM   6751  C  CG1   . VAL C 2  471  ? 41.675  -26.839 -63.225  1.00 33.41  ?  475  VAL C CG1   1 
ATOM   6752  C  CG2   . VAL C 2  471  ? 41.599  -26.590 -60.740  1.00 39.04  ?  475  VAL C CG2   1 
ATOM   6753  N  N     . HIS C 2  472  ? 38.864  -28.138 -64.151  1.00 38.08  ?  476  HIS C N     1 
ATOM   6754  C  CA    . HIS C 2  472  ? 38.393  -28.908 -65.279  1.00 42.08  ?  476  HIS C CA    1 
ATOM   6755  C  C     . HIS C 2  472  ? 39.126  -28.469 -66.538  1.00 43.66  ?  476  HIS C C     1 
ATOM   6756  O  O     . HIS C 2  472  ? 39.377  -27.276 -66.714  1.00 45.80  ?  476  HIS C O     1 
ATOM   6757  C  CB    . HIS C 2  472  ? 36.879  -28.712 -65.453  1.00 44.70  ?  476  HIS C CB    1 
ATOM   6758  C  CG    . HIS C 2  472  ? 36.241  -29.667 -66.410  1.00 46.41  ?  476  HIS C CG    1 
ATOM   6759  N  ND1   . HIS C 2  472  ? 36.366  -29.546 -67.776  1.00 45.50  ?  476  HIS C ND1   1 
ATOM   6760  C  CD2   . HIS C 2  472  ? 35.457  -30.750 -66.198  1.00 48.95  ?  476  HIS C CD2   1 
ATOM   6761  C  CE1   . HIS C 2  472  ? 35.697  -30.520 -68.365  1.00 48.68  ?  476  HIS C CE1   1 
ATOM   6762  N  NE2   . HIS C 2  472  ? 35.135  -31.263 -67.430  1.00 49.74  ?  476  HIS C NE2   1 
ATOM   6763  N  N     . PRO C 2  473  ? 39.484  -29.397 -67.426  1.00 45.95  ?  477  PRO C N     1 
ATOM   6764  C  CA    . PRO C 2  473  ? 40.267  -29.011 -68.612  1.00 46.45  ?  477  PRO C CA    1 
ATOM   6765  C  C     . PRO C 2  473  ? 39.601  -27.963 -69.486  1.00 42.91  ?  477  PRO C C     1 
ATOM   6766  O  O     . PRO C 2  473  ? 40.295  -27.297 -70.262  1.00 42.90  ?  477  PRO C O     1 
ATOM   6767  C  CB    . PRO C 2  473  ? 40.447  -30.337 -69.363  1.00 50.59  ?  477  PRO C CB    1 
ATOM   6768  C  CG    . PRO C 2  473  ? 39.458  -31.282 -68.755  1.00 54.26  ?  477  PRO C CG    1 
ATOM   6769  C  CD    . PRO C 2  473  ? 39.312  -30.854 -67.336  1.00 47.90  ?  477  PRO C CD    1 
ATOM   6770  N  N     . SER C 2  474  ? 38.286  -27.790 -69.394  1.00 45.07  ?  478  SER C N     1 
ATOM   6771  C  CA    . SER C 2  474  ? 37.631  -26.723 -70.139  1.00 46.82  ?  478  SER C CA    1 
ATOM   6772  C  C     . SER C 2  474  ? 37.821  -25.354 -69.498  1.00 43.18  ?  478  SER C C     1 
ATOM   6773  O  O     . SER C 2  474  ? 37.471  -24.348 -70.121  1.00 42.90  ?  478  SER C O     1 
ATOM   6774  C  CB    . SER C 2  474  ? 36.138  -27.028 -70.296  1.00 45.91  ?  478  SER C CB    1 
ATOM   6775  O  OG    . SER C 2  474  ? 35.564  -27.438 -69.069  1.00 47.53  ?  478  SER C OG    1 
ATOM   6776  N  N     . HIS C 2  475  ? 38.380  -25.295 -68.284  1.00 42.39  ?  479  HIS C N     1 
ATOM   6777  C  CA    . HIS C 2  475  ? 38.635  -24.021 -67.619  1.00 39.51  ?  479  HIS C CA    1 
ATOM   6778  C  C     . HIS C 2  475  ? 39.784  -23.244 -68.242  1.00 40.09  ?  479  HIS C C     1 
ATOM   6779  O  O     . HIS C 2  475  ? 39.926  -22.052 -67.956  1.00 41.83  ?  479  HIS C O     1 
ATOM   6780  C  CB    . HIS C 2  475  ? 38.967  -24.237 -66.142  1.00 38.87  ?  479  HIS C CB    1 
ATOM   6781  C  CG    . HIS C 2  475  ? 37.827  -24.755 -65.327  1.00 36.40  ?  479  HIS C CG    1 
ATOM   6782  N  ND1   . HIS C 2  475  ? 36.601  -25.064 -65.870  1.00 35.56  ?  479  HIS C ND1   1 
ATOM   6783  C  CD2   . HIS C 2  475  ? 37.729  -25.013 -64.002  1.00 34.57  ?  479  HIS C CD2   1 
ATOM   6784  C  CE1   . HIS C 2  475  ? 35.796  -25.492 -64.916  1.00 37.11  ?  479  HIS C CE1   1 
ATOM   6785  N  NE2   . HIS C 2  475  ? 36.457  -25.473 -63.773  1.00 34.05  ?  479  HIS C NE2   1 
ATOM   6786  N  N     . TYR C 2  476  ? 40.613  -23.887 -69.060  1.00 40.22  ?  480  TYR C N     1 
ATOM   6787  C  CA    . TYR C 2  476  ? 41.859  -23.273 -69.503  1.00 39.95  ?  480  TYR C CA    1 
ATOM   6788  C  C     . TYR C 2  476  ? 41.583  -21.999 -70.287  1.00 37.33  ?  480  TYR C C     1 
ATOM   6789  O  O     . TYR C 2  476  ? 40.883  -22.023 -71.302  1.00 40.56  ?  480  TYR C O     1 
ATOM   6790  C  CB    . TYR C 2  476  ? 42.650  -24.265 -70.353  1.00 44.04  ?  480  TYR C CB    1 
ATOM   6791  C  CG    . TYR C 2  476  ? 44.040  -23.801 -70.715  1.00 44.25  ?  480  TYR C CG    1 
ATOM   6792  C  CD1   . TYR C 2  476  ? 45.120  -24.081 -69.893  1.00 44.48  ?  480  TYR C CD1   1 
ATOM   6793  C  CD2   . TYR C 2  476  ? 44.274  -23.090 -71.883  1.00 43.92  ?  480  TYR C CD2   1 
ATOM   6794  C  CE1   . TYR C 2  476  ? 46.395  -23.660 -70.220  1.00 46.86  ?  480  TYR C CE1   1 
ATOM   6795  C  CE2   . TYR C 2  476  ? 45.544  -22.667 -72.219  1.00 46.36  ?  480  TYR C CE2   1 
ATOM   6796  C  CZ    . TYR C 2  476  ? 46.601  -22.955 -71.382  1.00 46.78  ?  480  TYR C CZ    1 
ATOM   6797  O  OH    . TYR C 2  476  ? 47.869  -22.538 -71.708  1.00 44.47  ?  480  TYR C OH    1 
ATOM   6798  N  N     . GLY C 2  477  ? 42.164  -20.893 -69.829  1.00 33.53  ?  481  GLY C N     1 
ATOM   6799  C  CA    . GLY C 2  477  ? 41.928  -19.600 -70.429  1.00 36.15  ?  481  GLY C CA    1 
ATOM   6800  C  C     . GLY C 2  477  ? 40.573  -18.998 -70.137  1.00 38.70  ?  481  GLY C C     1 
ATOM   6801  O  O     . GLY C 2  477  ? 40.268  -17.916 -70.654  1.00 36.27  ?  481  GLY C O     1 
ATOM   6802  N  N     . ARG C 2  478  ? 39.753  -19.655 -69.319  1.00 38.91  ?  482  ARG C N     1 
ATOM   6803  C  CA    . ARG C 2  478  ? 38.393  -19.211 -69.048  1.00 36.98  ?  482  ARG C CA    1 
ATOM   6804  C  C     . ARG C 2  478  ? 38.188  -18.895 -67.575  1.00 37.38  ?  482  ARG C C     1 
ATOM   6805  O  O     . ARG C 2  478  ? 37.869  -17.752 -67.237  1.00 38.09  ?  482  ARG C O     1 
ATOM   6806  C  CB    . ARG C 2  478  ? 37.401  -20.271 -69.536  1.00 36.54  ?  482  ARG C CB    1 
ATOM   6807  C  CG    . ARG C 2  478  ? 37.582  -20.571 -71.002  1.00 38.69  ?  482  ARG C CG    1 
ATOM   6808  C  CD    . ARG C 2  478  ? 36.448  -21.364 -71.595  1.00 39.56  ?  482  ARG C CD    1 
ATOM   6809  N  NE    . ARG C 2  478  ? 36.609  -21.446 -73.040  1.00 43.97  ?  482  ARG C NE    1 
ATOM   6810  C  CZ    . ARG C 2  478  ? 37.394  -22.323 -73.652  1.00 44.06  ?  482  ARG C CZ    1 
ATOM   6811  N  NH1   . ARG C 2  478  ? 37.491  -22.320 -74.971  1.00 49.28  ?  482  ARG C NH1   1 
ATOM   6812  N  NH2   . ARG C 2  478  ? 38.081  -23.204 -72.945  1.00 45.49  ?  482  ARG C NH2   1 
ATOM   6813  N  N     . MET C 2  479  ? 38.341  -19.873 -66.690  1.00 37.64  ?  483  MET C N     1 
ATOM   6814  C  CA    . MET C 2  479  ? 38.287  -19.645 -65.256  1.00 34.39  ?  483  MET C CA    1 
ATOM   6815  C  C     . MET C 2  479  ? 39.649  -19.961 -64.660  1.00 35.69  ?  483  MET C C     1 
ATOM   6816  O  O     . MET C 2  479  ? 40.225  -21.013 -64.950  1.00 40.06  ?  483  MET C O     1 
ATOM   6817  C  CB    . MET C 2  479  ? 37.199  -20.494 -64.601  1.00 30.72  ?  483  MET C CB    1 
ATOM   6818  C  CG    . MET C 2  479  ? 37.038  -20.235 -63.120  1.00 34.42  ?  483  MET C CG    1 
ATOM   6819  S  SD    . MET C 2  479  ? 35.451  -20.791 -62.488  1.00 35.47  ?  483  MET C SD    1 
ATOM   6820  C  CE    . MET C 2  479  ? 35.446  -22.485 -63.039  1.00 31.10  ?  483  MET C CE    1 
ATOM   6821  N  N     . CYS C 2  480  ? 40.159  -19.050 -63.842  1.00 36.61  ?  484  CYS C N     1 
ATOM   6822  C  CA    . CYS C 2  480  ? 41.484  -19.221 -63.268  1.00 37.47  ?  484  CYS C CA    1 
ATOM   6823  C  C     . CYS C 2  480  ? 41.507  -20.435 -62.347  1.00 38.62  ?  484  CYS C C     1 
ATOM   6824  O  O     . CYS C 2  480  ? 40.673  -20.533 -61.437  1.00 41.43  ?  484  CYS C O     1 
ATOM   6825  C  CB    . CYS C 2  480  ? 41.899  -17.973 -62.495  1.00 36.17  ?  484  CYS C CB    1 
ATOM   6826  S  SG    . CYS C 2  480  ? 43.478  -18.114 -61.622  1.00 27.83  ?  484  CYS C SG    1 
ATOM   6827  N  N     . PRO C 2  481  ? 42.422  -21.384 -62.558  1.00 36.23  ?  485  PRO C N     1 
ATOM   6828  C  CA    . PRO C 2  481  ? 42.537  -22.519 -61.632  1.00 37.96  ?  485  PRO C CA    1 
ATOM   6829  C  C     . PRO C 2  481  ? 43.116  -22.152 -60.280  1.00 38.17  ?  485  PRO C C     1 
ATOM   6830  O  O     . PRO C 2  481  ? 42.996  -22.946 -59.341  1.00 41.82  ?  485  PRO C O     1 
ATOM   6831  C  CB    . PRO C 2  481  ? 43.455  -23.488 -62.383  1.00 35.80  ?  485  PRO C CB    1 
ATOM   6832  C  CG    . PRO C 2  481  ? 44.276  -22.602 -63.250  1.00 36.59  ?  485  PRO C CG    1 
ATOM   6833  C  CD    . PRO C 2  481  ? 43.362  -21.496 -63.683  1.00 36.74  ?  485  PRO C CD    1 
ATOM   6834  N  N     . ILE C 2  482  ? 43.757  -20.995 -60.151  1.00 38.11  ?  486  ILE C N     1 
ATOM   6835  C  CA    . ILE C 2  482  ? 44.455  -20.639 -58.921  1.00 37.99  ?  486  ILE C CA    1 
ATOM   6836  C  C     . ILE C 2  482  ? 43.510  -19.931 -57.964  1.00 39.74  ?  486  ILE C C     1 
ATOM   6837  O  O     . ILE C 2  482  ? 43.302  -20.387 -56.835  1.00 41.78  ?  486  ILE C O     1 
ATOM   6838  C  CB    . ILE C 2  482  ? 45.696  -19.777 -59.204  1.00 38.69  ?  486  ILE C CB    1 
ATOM   6839  C  CG1   . ILE C 2  482  ? 46.709  -20.571 -60.019  1.00 36.02  ?  486  ILE C CG1   1 
ATOM   6840  C  CG2   . ILE C 2  482  ? 46.330  -19.324 -57.902  1.00 39.20  ?  486  ILE C CG2   1 
ATOM   6841  C  CD1   . ILE C 2  482  ? 47.180  -21.826 -59.317  1.00 37.09  ?  486  ILE C CD1   1 
ATOM   6842  N  N     . GLU C 2  483  ? 42.960  -18.796 -58.386  1.00 38.12  ?  487  GLU C N     1 
ATOM   6843  C  CA    . GLU C 2  483  ? 42.187  -17.967 -57.472  1.00 37.65  ?  487  GLU C CA    1 
ATOM   6844  C  C     . GLU C 2  483  ? 40.825  -18.596 -57.202  1.00 40.58  ?  487  GLU C C     1 
ATOM   6845  O  O     . GLU C 2  483  ? 40.021  -18.779 -58.121  1.00 41.07  ?  487  GLU C O     1 
ATOM   6846  C  CB    . GLU C 2  483  ? 42.022  -16.561 -58.036  1.00 37.92  ?  487  GLU C CB    1 
ATOM   6847  C  CG    . GLU C 2  483  ? 41.662  -15.545 -56.969  1.00 38.89  ?  487  GLU C CG    1 
ATOM   6848  C  CD    . GLU C 2  483  ? 41.409  -14.164 -57.520  1.00 36.62  ?  487  GLU C CD    1 
ATOM   6849  O  OE1   . GLU C 2  483  ? 41.388  -13.999 -58.757  1.00 35.53  ?  487  GLU C OE1   1 
ATOM   6850  O  OE2   . GLU C 2  483  ? 41.224  -13.240 -56.706  1.00 39.00  ?  487  GLU C OE2   1 
ATOM   6851  N  N     . THR C 2  484  ? 40.563  -18.884 -55.926  1.00 41.12  ?  488  THR C N     1 
ATOM   6852  C  CA    . THR C 2  484  ? 39.344  -19.479 -55.391  1.00 41.62  ?  488  THR C CA    1 
ATOM   6853  C  C     . THR C 2  484  ? 39.524  -19.553 -53.879  1.00 40.45  ?  488  THR C C     1 
ATOM   6854  O  O     . THR C 2  484  ? 40.662  -19.620 -53.405  1.00 38.29  ?  488  THR C O     1 
ATOM   6855  C  CB    . THR C 2  484  ? 39.073  -20.861 -56.002  1.00 39.38  ?  488  THR C CB    1 
ATOM   6856  O  OG1   . THR C 2  484  ? 37.831  -21.379 -55.513  1.00 40.00  ?  488  THR C OG1   1 
ATOM   6857  C  CG2   . THR C 2  484  ? 40.183  -21.835 -55.669  1.00 37.77  ?  488  THR C CG2   1 
ATOM   6858  N  N     . PRO C 2  485  ? 38.455  -19.491 -53.089  1.00 41.24  ?  489  PRO C N     1 
ATOM   6859  C  CA    . PRO C 2  485  ? 38.620  -19.518 -51.633  1.00 44.98  ?  489  PRO C CA    1 
ATOM   6860  C  C     . PRO C 2  485  ? 39.202  -20.840 -51.163  1.00 47.19  ?  489  PRO C C     1 
ATOM   6861  O  O     . PRO C 2  485  ? 39.093  -21.870 -51.826  1.00 50.64  ?  489  PRO C O     1 
ATOM   6862  C  CB    . PRO C 2  485  ? 37.193  -19.327 -51.108  1.00 48.06  ?  489  PRO C CB    1 
ATOM   6863  C  CG    . PRO C 2  485  ? 36.460  -18.684 -52.233  1.00 46.12  ?  489  PRO C CG    1 
ATOM   6864  C  CD    . PRO C 2  485  ? 37.055  -19.252 -53.476  1.00 39.45  ?  489  PRO C CD    1 
ATOM   6865  N  N     . GLU C 2  486  ? 39.866  -20.796 -50.012  1.00 47.15  ?  490  GLU C N     1 
ATOM   6866  C  CA    . GLU C 2  486  ? 40.352  -22.015 -49.384  1.00 50.09  ?  490  GLU C CA    1 
ATOM   6867  C  C     . GLU C 2  486  ? 39.437  -22.519 -48.277  1.00 54.27  ?  490  GLU C C     1 
ATOM   6868  O  O     . GLU C 2  486  ? 39.706  -23.579 -47.705  1.00 57.74  ?  490  GLU C O     1 
ATOM   6869  C  CB    . GLU C 2  486  ? 41.775  -21.820 -48.847  1.00 51.41  ?  490  GLU C CB    1 
ATOM   6870  C  CG    . GLU C 2  486  ? 41.973  -20.653 -47.908  1.00 59.47  ?  490  GLU C CG    1 
ATOM   6871  C  CD    . GLU C 2  486  ? 43.347  -20.679 -47.266  1.00 62.69  ?  490  GLU C CD    1 
ATOM   6872  O  OE1   . GLU C 2  486  ? 43.722  -21.737 -46.718  1.00 61.20  ?  490  GLU C OE1   1 
ATOM   6873  O  OE2   . GLU C 2  486  ? 44.058  -19.654 -47.323  1.00 64.74  ?  490  GLU C OE2   1 
ATOM   6874  N  N     . GLY C 2  487  ? 38.357  -21.803 -47.976  1.00 51.41  ?  491  GLY C N     1 
ATOM   6875  C  CA    . GLY C 2  487  ? 37.401  -22.250 -46.993  1.00 50.37  ?  491  GLY C CA    1 
ATOM   6876  C  C     . GLY C 2  487  ? 36.377  -23.187 -47.598  1.00 46.49  ?  491  GLY C C     1 
ATOM   6877  O  O     . GLY C 2  487  ? 36.638  -23.862 -48.597  1.00 47.99  ?  491  GLY C O     1 
ATOM   6878  N  N     . PRO C 2  488  ? 35.184  -23.246 -47.002  1.00 43.62  ?  492  PRO C N     1 
ATOM   6879  C  CA    . PRO C 2  488  ? 34.131  -24.118 -47.549  1.00 44.24  ?  492  PRO C CA    1 
ATOM   6880  C  C     . PRO C 2  488  ? 33.679  -23.749 -48.952  1.00 46.59  ?  492  PRO C C     1 
ATOM   6881  O  O     . PRO C 2  488  ? 33.041  -24.576 -49.614  1.00 49.84  ?  492  PRO C O     1 
ATOM   6882  C  CB    . PRO C 2  488  ? 32.990  -23.970 -46.533  1.00 40.54  ?  492  PRO C CB    1 
ATOM   6883  C  CG    . PRO C 2  488  ? 33.310  -22.744 -45.751  1.00 37.76  ?  492  PRO C CG    1 
ATOM   6884  C  CD    . PRO C 2  488  ? 34.794  -22.651 -45.716  1.00 42.49  ?  492  PRO C CD    1 
ATOM   6885  N  N     . ASN C 2  489  ? 33.991  -22.552 -49.436  1.00 45.19  ?  493  ASN C N     1 
ATOM   6886  C  CA    . ASN C 2  489  ? 33.586  -22.128 -50.769  1.00 46.72  ?  493  ASN C CA    1 
ATOM   6887  C  C     . ASN C 2  489  ? 34.587  -22.524 -51.844  1.00 46.25  ?  493  ASN C C     1 
ATOM   6888  O  O     . ASN C 2  489  ? 34.442  -22.096 -52.993  1.00 42.30  ?  493  ASN C O     1 
ATOM   6889  C  CB    . ASN C 2  489  ? 33.356  -20.618 -50.802  1.00 50.33  ?  493  ASN C CB    1 
ATOM   6890  C  CG    . ASN C 2  489  ? 32.022  -20.221 -50.210  1.00 55.84  ?  493  ASN C CG    1 
ATOM   6891  O  OD1   . ASN C 2  489  ? 30.971  -20.563 -50.745  1.00 58.11  ?  493  ASN C OD1   1 
ATOM   6892  N  ND2   . ASN C 2  489  ? 32.057  -19.490 -49.104  1.00 63.67  ?  493  ASN C ND2   1 
ATOM   6893  N  N     . ILE C 2  490  ? 35.609  -23.307 -51.489  1.00 50.21  ?  494  ILE C N     1 
ATOM   6894  C  CA    . ILE C 2  490  ? 36.619  -23.723 -52.455  1.00 49.85  ?  494  ILE C CA    1 
ATOM   6895  C  C     . ILE C 2  490  ? 35.962  -24.417 -53.639  1.00 47.99  ?  494  ILE C C     1 
ATOM   6896  O  O     . ILE C 2  490  ? 35.118  -25.307 -53.477  1.00 46.11  ?  494  ILE C O     1 
ATOM   6897  C  CB    . ILE C 2  490  ? 37.660  -24.629 -51.779  1.00 47.58  ?  494  ILE C CB    1 
ATOM   6898  C  CG1   . ILE C 2  490  ? 38.683  -25.118 -52.805  1.00 45.22  ?  494  ILE C CG1   1 
ATOM   6899  C  CG2   . ILE C 2  490  ? 36.995  -25.803 -51.077  1.00 48.42  ?  494  ILE C CG2   1 
ATOM   6900  C  CD1   . ILE C 2  490  ? 39.763  -25.983 -52.219  1.00 46.66  ?  494  ILE C CD1   1 
ATOM   6901  N  N     . GLY C 2  491  ? 36.338  -23.995 -54.845  1.00 43.78  ?  495  GLY C N     1 
ATOM   6902  C  CA    . GLY C 2  491  ? 35.801  -24.563 -56.059  1.00 41.95  ?  495  GLY C CA    1 
ATOM   6903  C  C     . GLY C 2  491  ? 34.425  -24.074 -56.440  1.00 41.35  ?  495  GLY C C     1 
ATOM   6904  O  O     . GLY C 2  491  ? 33.995  -24.315 -57.574  1.00 41.84  ?  495  GLY C O     1 
ATOM   6905  N  N     . LEU C 2  492  ? 33.715  -23.403 -55.537  1.00 41.11  ?  496  LEU C N     1 
ATOM   6906  C  CA    . LEU C 2  492  ? 32.401  -22.860 -55.843  1.00 42.67  ?  496  LEU C CA    1 
ATOM   6907  C  C     . LEU C 2  492  ? 32.451  -21.422 -56.336  1.00 38.72  ?  496  LEU C C     1 
ATOM   6908  O  O     . LEU C 2  492  ? 31.429  -20.908 -56.804  1.00 37.91  ?  496  LEU C O     1 
ATOM   6909  C  CB    . LEU C 2  492  ? 31.498  -22.954 -54.609  1.00 44.29  ?  496  LEU C CB    1 
ATOM   6910  C  CG    . LEU C 2  492  ? 31.278  -24.379 -54.096  1.00 47.09  ?  496  LEU C CG    1 
ATOM   6911  C  CD1   . LEU C 2  492  ? 30.381  -24.390 -52.870  1.00 51.85  ?  496  LEU C CD1   1 
ATOM   6912  C  CD2   . LEU C 2  492  ? 30.708  -25.260 -55.195  1.00 39.63  ?  496  LEU C CD2   1 
ATOM   6913  N  N     . ILE C 2  493  ? 33.606  -20.767 -56.251  1.00 38.13  ?  497  ILE C N     1 
ATOM   6914  C  CA    . ILE C 2  493  ? 33.772  -19.380 -56.672  1.00 38.06  ?  497  ILE C CA    1 
ATOM   6915  C  C     . ILE C 2  493  ? 35.088  -19.272 -57.423  1.00 36.69  ?  497  ILE C C     1 
ATOM   6916  O  O     . ILE C 2  493  ? 36.112  -19.781 -56.960  1.00 37.72  ?  497  ILE C O     1 
ATOM   6917  C  CB    . ILE C 2  493  ? 33.757  -18.405 -55.478  1.00 37.78  ?  497  ILE C CB    1 
ATOM   6918  C  CG1   . ILE C 2  493  ? 32.452  -18.528 -54.693  1.00 37.81  ?  497  ILE C CG1   1 
ATOM   6919  C  CG2   . ILE C 2  493  ? 33.952  -16.977 -55.951  1.00 37.38  ?  497  ILE C CG2   1 
ATOM   6920  C  CD1   . ILE C 2  493  ? 32.444  -17.728 -53.421  1.00 51.63  ?  497  ILE C CD1   1 
ATOM   6921  N  N     . GLY C 2  494  ? 35.071  -18.581 -58.561  1.00 33.90  ?  498  GLY C N     1 
ATOM   6922  C  CA    . GLY C 2  494  ? 36.237  -18.517 -59.416  1.00 33.04  ?  498  GLY C CA    1 
ATOM   6923  C  C     . GLY C 2  494  ? 36.329  -17.166 -60.086  1.00 32.20  ?  498  GLY C C     1 
ATOM   6924  O  O     . GLY C 2  494  ? 35.434  -16.329 -59.974  1.00 33.72  ?  498  GLY C O     1 
ATOM   6925  N  N     . SER C 2  495  ? 37.444  -16.956 -60.774  1.00 33.12  ?  499  SER C N     1 
ATOM   6926  C  CA    . SER C 2  495  ? 37.753  -15.682 -61.399  1.00 30.71  ?  499  SER C CA    1 
ATOM   6927  C  C     . SER C 2  495  ? 37.865  -15.856 -62.904  1.00 31.34  ?  499  SER C C     1 
ATOM   6928  O  O     . SER C 2  495  ? 38.434  -16.838 -63.385  1.00 30.27  ?  499  SER C O     1 
ATOM   6929  C  CB    . SER C 2  495  ? 39.052  -15.100 -60.846  1.00 32.27  ?  499  SER C CB    1 
ATOM   6930  O  OG    . SER C 2  495  ? 38.964  -14.905 -59.449  1.00 36.48  ?  499  SER C OG    1 
ATOM   6931  N  N     . LEU C 2  496  ? 37.314  -14.900 -63.641  1.00 34.18  ?  500  LEU C N     1 
ATOM   6932  C  CA    . LEU C 2  496  ? 37.447  -14.916 -65.087  1.00 33.34  ?  500  LEU C CA    1 
ATOM   6933  C  C     . LEU C 2  496  ? 38.903  -14.695 -65.472  1.00 34.95  ?  500  LEU C C     1 
ATOM   6934  O  O     . LEU C 2  496  ? 39.594  -13.850 -64.897  1.00 33.12  ?  500  LEU C O     1 
ATOM   6935  C  CB    . LEU C 2  496  ? 36.561  -13.841 -65.712  1.00 30.25  ?  500  LEU C CB    1 
ATOM   6936  C  CG    . LEU C 2  496  ? 36.313  -13.963 -67.214  1.00 30.61  ?  500  LEU C CG    1 
ATOM   6937  C  CD1   . LEU C 2  496  ? 35.448  -15.169 -67.518  1.00 33.84  ?  500  LEU C CD1   1 
ATOM   6938  C  CD2   . LEU C 2  496  ? 35.679  -12.697 -67.752  1.00 30.96  ?  500  LEU C CD2   1 
ATOM   6939  N  N     . SER C 2  497  ? 39.371  -15.469 -66.442  1.00 37.03  ?  501  SER C N     1 
ATOM   6940  C  CA    . SER C 2  497  ? 40.736  -15.318 -66.908  1.00 34.84  ?  501  SER C CA    1 
ATOM   6941  C  C     . SER C 2  497  ? 40.903  -13.981 -67.617  1.00 34.02  ?  501  SER C C     1 
ATOM   6942  O  O     . SER C 2  497  ? 39.937  -13.347 -68.046  1.00 35.50  ?  501  SER C O     1 
ATOM   6943  C  CB    . SER C 2  497  ? 41.123  -16.469 -67.833  1.00 36.72  ?  501  SER C CB    1 
ATOM   6944  O  OG    . SER C 2  497  ? 41.057  -17.707 -67.147  1.00 40.23  ?  501  SER C OG    1 
ATOM   6945  N  N     . VAL C 2  498  ? 42.163  -13.558 -67.732  1.00 34.94  ?  502  VAL C N     1 
ATOM   6946  C  CA    . VAL C 2  498  ? 42.482  -12.198 -68.156  1.00 30.82  ?  502  VAL C CA    1 
ATOM   6947  C  C     . VAL C 2  498  ? 41.924  -11.903 -69.544  1.00 33.64  ?  502  VAL C C     1 
ATOM   6948  O  O     . VAL C 2  498  ? 41.368  -10.826 -69.786  1.00 35.60  ?  502  VAL C O     1 
ATOM   6949  C  CB    . VAL C 2  498  ? 44.005  -11.984 -68.088  1.00 31.87  ?  502  VAL C CB    1 
ATOM   6950  C  CG1   . VAL C 2  498  ? 44.411  -10.743 -68.847  1.00 38.88  ?  502  VAL C CG1   1 
ATOM   6951  C  CG2   . VAL C 2  498  ? 44.453  -11.894 -66.638  1.00 33.57  ?  502  VAL C CG2   1 
ATOM   6952  N  N     . TYR C 2  499  ? 42.059  -12.841 -70.477  1.00 32.58  ?  503  TYR C N     1 
ATOM   6953  C  CA    . TYR C 2  499  ? 41.662  -12.605 -71.858  1.00 35.26  ?  503  TYR C CA    1 
ATOM   6954  C  C     . TYR C 2  499  ? 40.276  -13.135 -72.200  1.00 37.92  ?  503  TYR C C     1 
ATOM   6955  O  O     . TYR C 2  499  ? 39.860  -13.030 -73.358  1.00 40.18  ?  503  TYR C O     1 
ATOM   6956  C  CB    . TYR C 2  499  ? 42.696  -13.208 -72.811  1.00 36.96  ?  503  TYR C CB    1 
ATOM   6957  C  CG    . TYR C 2  499  ? 44.017  -12.479 -72.791  1.00 39.00  ?  503  TYR C CG    1 
ATOM   6958  C  CD1   . TYR C 2  499  ? 44.962  -12.745 -71.813  1.00 40.10  ?  503  TYR C CD1   1 
ATOM   6959  C  CD2   . TYR C 2  499  ? 44.315  -11.517 -73.745  1.00 38.44  ?  503  TYR C CD2   1 
ATOM   6960  C  CE1   . TYR C 2  499  ? 46.167  -12.077 -71.786  1.00 42.50  ?  503  TYR C CE1   1 
ATOM   6961  C  CE2   . TYR C 2  499  ? 45.518  -10.846 -73.727  1.00 39.54  ?  503  TYR C CE2   1 
ATOM   6962  C  CZ    . TYR C 2  499  ? 46.440  -11.129 -72.745  1.00 43.42  ?  503  TYR C CZ    1 
ATOM   6963  O  OH    . TYR C 2  499  ? 47.643  -10.464 -72.720  1.00 49.11  ?  503  TYR C OH    1 
ATOM   6964  N  N     . ALA C 2  500  ? 39.551  -13.688 -71.234  1.00 34.42  ?  504  ALA C N     1 
ATOM   6965  C  CA    . ALA C 2  500  ? 38.285  -14.341 -71.533  1.00 33.92  ?  504  ALA C CA    1 
ATOM   6966  C  C     . ALA C 2  500  ? 37.175  -13.332 -71.815  1.00 35.12  ?  504  ALA C C     1 
ATOM   6967  O  O     . ALA C 2  500  ? 37.169  -12.213 -71.296  1.00 35.37  ?  504  ALA C O     1 
ATOM   6968  C  CB    . ALA C 2  500  ? 37.872  -15.245 -70.377  1.00 36.61  ?  504  ALA C CB    1 
ATOM   6969  N  N     . ARG C 2  501  ? 36.230  -13.750 -72.658  1.00 39.16  ?  505  ARG C N     1 
ATOM   6970  C  CA    . ARG C 2  501  ? 34.991  -13.036 -72.933  1.00 31.97  ?  505  ARG C CA    1 
ATOM   6971  C  C     . ARG C 2  501  ? 33.805  -13.943 -72.648  1.00 34.54  ?  505  ARG C C     1 
ATOM   6972  O  O     . ARG C 2  501  ? 33.931  -15.167 -72.599  1.00 38.03  ?  505  ARG C O     1 
ATOM   6973  C  CB    . ARG C 2  501  ? 34.890  -12.580 -74.392  1.00 35.72  ?  505  ARG C CB    1 
ATOM   6974  C  CG    . ARG C 2  501  ? 35.892  -11.556 -74.844  1.00 47.24  ?  505  ARG C CG    1 
ATOM   6975  C  CD    . ARG C 2  501  ? 35.631  -11.229 -76.305  1.00 50.46  ?  505  ARG C CD    1 
ATOM   6976  N  NE    . ARG C 2  501  ? 35.052  -12.371 -77.010  1.00 47.46  ?  505  ARG C NE    1 
ATOM   6977  C  CZ    . ARG C 2  501  ? 34.952  -12.460 -78.331  1.00 50.94  ?  505  ARG C CZ    1 
ATOM   6978  N  NH1   . ARG C 2  501  ? 35.399  -11.478 -79.099  1.00 49.41  ?  505  ARG C NH1   1 
ATOM   6979  N  NH2   . ARG C 2  501  ? 34.410  -13.534 -78.886  1.00 50.36  ?  505  ARG C NH2   1 
ATOM   6980  N  N     . VAL C 2  502  ? 32.639  -13.329 -72.488  1.00 34.48  ?  506  VAL C N     1 
ATOM   6981  C  CA    . VAL C 2  502  ? 31.375  -14.046 -72.382  1.00 33.54  ?  506  VAL C CA    1 
ATOM   6982  C  C     . VAL C 2  502  ? 30.621  -13.820 -73.685  1.00 38.13  ?  506  VAL C C     1 
ATOM   6983  O  O     . VAL C 2  502  ? 30.235  -12.688 -73.999  1.00 40.78  ?  506  VAL C O     1 
ATOM   6984  C  CB    . VAL C 2  502  ? 30.557  -13.584 -71.171  1.00 32.25  ?  506  VAL C CB    1 
ATOM   6985  C  CG1   . VAL C 2  502  ? 29.260  -14.363 -71.080  1.00 35.26  ?  506  VAL C CG1   1 
ATOM   6986  C  CG2   . VAL C 2  502  ? 31.371  -13.743 -69.903  1.00 31.16  ?  506  VAL C CG2   1 
ATOM   6987  N  N     . ASN C 2  503  ? 30.418  -14.889 -74.453  1.00 40.58  ?  507  ASN C N     1 
ATOM   6988  C  CA    . ASN C 2  503  ? 29.788  -14.773 -75.757  1.00 45.02  ?  507  ASN C CA    1 
ATOM   6989  C  C     . ASN C 2  503  ? 28.291  -14.520 -75.577  1.00 48.03  ?  507  ASN C C     1 
ATOM   6990  O  O     . ASN C 2  503  ? 27.756  -14.678 -74.479  1.00 47.46  ?  507  ASN C O     1 
ATOM   6991  C  CB    . ASN C 2  503  ? 30.091  -16.020 -76.597  1.00 45.85  ?  507  ASN C CB    1 
ATOM   6992  C  CG    . ASN C 2  503  ? 29.224  -17.218 -76.243  1.00 50.55  ?  507  ASN C CG    1 
ATOM   6993  O  OD1   . ASN C 2  503  ? 28.608  -17.280 -75.180  1.00 54.16  ?  507  ASN C OD1   1 
ATOM   6994  N  ND2   . ASN C 2  503  ? 29.193  -18.196 -77.142  1.00 48.50  ?  507  ASN C ND2   1 
ATOM   6995  N  N     . PRO C 2  504  ? 27.591  -14.098 -76.637  1.00 53.68  ?  508  PRO C N     1 
ATOM   6996  C  CA    . PRO C 2  504  ? 26.168  -13.743 -76.485  1.00 51.79  ?  508  PRO C CA    1 
ATOM   6997  C  C     . PRO C 2  504  ? 25.286  -14.851 -75.930  1.00 53.04  ?  508  PRO C C     1 
ATOM   6998  O  O     . PRO C 2  504  ? 24.190  -14.554 -75.442  1.00 51.52  ?  508  PRO C O     1 
ATOM   6999  C  CB    . PRO C 2  504  ? 25.752  -13.371 -77.913  1.00 48.41  ?  508  PRO C CB    1 
ATOM   7000  C  CG    . PRO C 2  504  ? 26.997  -12.872 -78.533  1.00 55.50  ?  508  PRO C CG    1 
ATOM   7001  C  CD    . PRO C 2  504  ? 28.107  -13.703 -77.960  1.00 56.71  ?  508  PRO C CD    1 
ATOM   7002  N  N     . PHE C 2  505  ? 25.709  -16.109 -75.993  1.00 52.42  ?  509  PHE C N     1 
ATOM   7003  C  CA    . PHE C 2  505  ? 24.898  -17.209 -75.493  1.00 52.91  ?  509  PHE C CA    1 
ATOM   7004  C  C     . PHE C 2  505  ? 25.260  -17.616 -74.072  1.00 50.88  ?  509  PHE C C     1 
ATOM   7005  O  O     . PHE C 2  505  ? 24.662  -18.556 -73.542  1.00 49.37  ?  509  PHE C O     1 
ATOM   7006  C  CB    . PHE C 2  505  ? 25.009  -18.408 -76.437  1.00 54.90  ?  509  PHE C CB    1 
ATOM   7007  C  CG    . PHE C 2  505  ? 24.645  -18.080 -77.855  1.00 58.46  ?  509  PHE C CG    1 
ATOM   7008  C  CD1   . PHE C 2  505  ? 23.325  -18.110 -78.269  1.00 62.53  ?  509  PHE C CD1   1 
ATOM   7009  C  CD2   . PHE C 2  505  ? 25.619  -17.715 -78.768  1.00 58.55  ?  509  PHE C CD2   1 
ATOM   7010  C  CE1   . PHE C 2  505  ? 22.986  -17.797 -79.571  1.00 65.61  ?  509  PHE C CE1   1 
ATOM   7011  C  CE2   . PHE C 2  505  ? 25.286  -17.400 -80.069  1.00 58.59  ?  509  PHE C CE2   1 
ATOM   7012  C  CZ    . PHE C 2  505  ? 23.968  -17.441 -80.472  1.00 64.46  ?  509  PHE C CZ    1 
ATOM   7013  N  N     . GLY C 2  506  ? 26.211  -16.929 -73.444  1.00 45.90  ?  510  GLY C N     1 
ATOM   7014  C  CA    . GLY C 2  506  ? 26.595  -17.210 -72.078  1.00 41.23  ?  510  GLY C CA    1 
ATOM   7015  C  C     . GLY C 2  506  ? 27.806  -18.100 -71.920  1.00 39.01  ?  510  GLY C C     1 
ATOM   7016  O  O     . GLY C 2  506  ? 28.163  -18.432 -70.784  1.00 37.82  ?  510  GLY C O     1 
ATOM   7017  N  N     . PHE C 2  507  ? 28.446  -18.495 -73.015  1.00 39.45  ?  511  PHE C N     1 
ATOM   7018  C  CA    . PHE C 2  507  ? 29.605  -19.371 -72.976  1.00 39.54  ?  511  PHE C CA    1 
ATOM   7019  C  C     . PHE C 2  507  ? 30.885  -18.554 -73.057  1.00 39.80  ?  511  PHE C C     1 
ATOM   7020  O  O     . PHE C 2  507  ? 30.966  -17.577 -73.804  1.00 41.40  ?  511  PHE C O     1 
ATOM   7021  C  CB    . PHE C 2  507  ? 29.554  -20.386 -74.115  1.00 42.79  ?  511  PHE C CB    1 
ATOM   7022  C  CG    . PHE C 2  507  ? 28.384  -21.316 -74.032  1.00 46.14  ?  511  PHE C CG    1 
ATOM   7023  C  CD1   . PHE C 2  507  ? 28.306  -22.253 -73.018  1.00 43.64  ?  511  PHE C CD1   1 
ATOM   7024  C  CD2   . PHE C 2  507  ? 27.359  -21.248 -74.956  1.00 47.56  ?  511  PHE C CD2   1 
ATOM   7025  C  CE1   . PHE C 2  507  ? 27.230  -23.103 -72.927  1.00 46.83  ?  511  PHE C CE1   1 
ATOM   7026  C  CE2   . PHE C 2  507  ? 26.280  -22.100 -74.871  1.00 50.44  ?  511  PHE C CE2   1 
ATOM   7027  C  CZ    . PHE C 2  507  ? 26.216  -23.030 -73.855  1.00 51.34  ?  511  PHE C CZ    1 
ATOM   7028  N  N     . ILE C 2  508  ? 31.884  -18.965 -72.290  1.00 37.96  ?  512  ILE C N     1 
ATOM   7029  C  CA    . ILE C 2  508  ? 33.123  -18.212 -72.163  1.00 36.93  ?  512  ILE C CA    1 
ATOM   7030  C  C     . ILE C 2  508  ? 34.071  -18.611 -73.285  1.00 41.13  ?  512  ILE C C     1 
ATOM   7031  O  O     . ILE C 2  508  ? 34.275  -19.801 -73.547  1.00 43.74  ?  512  ILE C O     1 
ATOM   7032  C  CB    . ILE C 2  508  ? 33.763  -18.445 -70.786  1.00 34.34  ?  512  ILE C CB    1 
ATOM   7033  C  CG1   . ILE C 2  508  ? 32.737  -18.191 -69.683  1.00 31.20  ?  512  ILE C CG1   1 
ATOM   7034  C  CG2   . ILE C 2  508  ? 34.966  -17.547 -70.606  1.00 35.32  ?  512  ILE C CG2   1 
ATOM   7035  C  CD1   . ILE C 2  508  ? 33.304  -18.275 -68.292  1.00 29.50  ?  512  ILE C CD1   1 
ATOM   7036  N  N     . GLU C 2  509  ? 34.656  -17.613 -73.940  1.00 41.28  ?  513  GLU C N     1 
ATOM   7037  C  CA    . GLU C 2  509  ? 35.588  -17.813 -75.037  1.00 42.20  ?  513  GLU C CA    1 
ATOM   7038  C  C     . GLU C 2  509  ? 36.963  -17.284 -74.654  1.00 43.22  ?  513  GLU C C     1 
ATOM   7039  O  O     . GLU C 2  509  ? 37.103  -16.436 -73.770  1.00 42.04  ?  513  GLU C O     1 
ATOM   7040  C  CB    . GLU C 2  509  ? 35.109  -17.113 -76.312  1.00 42.88  ?  513  GLU C CB    1 
ATOM   7041  C  CG    . GLU C 2  509  ? 33.850  -17.688 -76.913  1.00 46.44  ?  513  GLU C CG    1 
ATOM   7042  C  CD    . GLU C 2  509  ? 33.336  -16.857 -78.068  1.00 50.33  ?  513  GLU C CD    1 
ATOM   7043  O  OE1   . GLU C 2  509  ? 33.596  -15.637 -78.081  1.00 44.84  ?  513  GLU C OE1   1 
ATOM   7044  O  OE2   . GLU C 2  509  ? 32.676  -17.423 -78.965  1.00 54.19  ?  513  GLU C OE2   1 
ATOM   7045  N  N     . THR C 2  510  ? 37.985  -17.803 -75.333  1.00 45.91  ?  514  THR C N     1 
ATOM   7046  C  CA    . THR C 2  510  ? 39.363  -17.377 -75.147  1.00 44.42  ?  514  THR C CA    1 
ATOM   7047  C  C     . THR C 2  510  ? 40.004  -17.262 -76.523  1.00 46.90  ?  514  THR C C     1 
ATOM   7048  O  O     . THR C 2  510  ? 39.702  -18.071 -77.413  1.00 47.53  ?  514  THR C O     1 
ATOM   7049  C  CB    . THR C 2  510  ? 40.152  -18.366 -74.277  1.00 42.27  ?  514  THR C CB    1 
ATOM   7050  O  OG1   . THR C 2  510  ? 39.292  -18.901 -73.267  1.00 47.13  ?  514  THR C OG1   1 
ATOM   7051  C  CG2   . THR C 2  510  ? 41.310  -17.676 -73.592  1.00 38.35  ?  514  THR C CG2   1 
ATOM   7052  N  N     . PRO C 2  511  ? 40.860  -16.268 -76.741  1.00 45.58  ?  515  PRO C N     1 
ATOM   7053  C  CA    . PRO C 2  511  ? 41.497  -16.119 -78.051  1.00 46.08  ?  515  PRO C CA    1 
ATOM   7054  C  C     . PRO C 2  511  ? 42.654  -17.083 -78.254  1.00 49.57  ?  515  PRO C C     1 
ATOM   7055  O  O     . PRO C 2  511  ? 43.325  -17.506 -77.310  1.00 53.40  ?  515  PRO C O     1 
ATOM   7056  C  CB    . PRO C 2  511  ? 41.992  -14.669 -78.031  1.00 46.72  ?  515  PRO C CB    1 
ATOM   7057  C  CG    . PRO C 2  511  ? 42.239  -14.398 -76.596  1.00 45.34  ?  515  PRO C CG    1 
ATOM   7058  C  CD    . PRO C 2  511  ? 41.172  -15.137 -75.850  1.00 43.42  ?  515  PRO C CD    1 
ATOM   7059  N  N     . TYR C 2  512  ? 42.885  -17.416 -79.522  1.00 51.48  ?  516  TYR C N     1 
ATOM   7060  C  CA    . TYR C 2  512  ? 43.988  -18.275 -79.925  1.00 51.70  ?  516  TYR C CA    1 
ATOM   7061  C  C     . TYR C 2  512  ? 44.528  -17.793 -81.261  1.00 56.02  ?  516  TYR C C     1 
ATOM   7062  O  O     . TYR C 2  512  ? 43.855  -17.076 -82.004  1.00 58.84  ?  516  TYR C O     1 
ATOM   7063  C  CB    . TYR C 2  512  ? 43.565  -19.744 -80.034  1.00 52.34  ?  516  TYR C CB    1 
ATOM   7064  C  CG    . TYR C 2  512  ? 43.249  -20.400 -78.713  1.00 49.14  ?  516  TYR C CG    1 
ATOM   7065  C  CD1   . TYR C 2  512  ? 44.211  -20.499 -77.720  1.00 49.47  ?  516  TYR C CD1   1 
ATOM   7066  C  CD2   . TYR C 2  512  ? 41.996  -20.935 -78.465  1.00 48.83  ?  516  TYR C CD2   1 
ATOM   7067  C  CE1   . TYR C 2  512  ? 43.930  -21.100 -76.513  1.00 50.11  ?  516  TYR C CE1   1 
ATOM   7068  C  CE2   . TYR C 2  512  ? 41.707  -21.540 -77.260  1.00 53.04  ?  516  TYR C CE2   1 
ATOM   7069  C  CZ    . TYR C 2  512  ? 42.678  -21.620 -76.288  1.00 55.40  ?  516  TYR C CZ    1 
ATOM   7070  O  OH    . TYR C 2  512  ? 42.392  -22.223 -75.086  1.00 56.94  ?  516  TYR C OH    1 
ATOM   7071  N  N     . ARG C 2  513  ? 45.754  -18.204 -81.565  1.00 57.47  ?  517  ARG C N     1 
ATOM   7072  C  CA    . ARG C 2  513  ? 46.428  -17.815 -82.795  1.00 61.88  ?  517  ARG C CA    1 
ATOM   7073  C  C     . ARG C 2  513  ? 46.327  -18.940 -83.814  1.00 65.54  ?  517  ARG C C     1 
ATOM   7074  O  O     . ARG C 2  513  ? 46.652  -20.090 -83.506  1.00 62.20  ?  517  ARG C O     1 
ATOM   7075  C  CB    . ARG C 2  513  ? 47.896  -17.482 -82.526  1.00 63.25  ?  517  ARG C CB    1 
ATOM   7076  C  CG    . ARG C 2  513  ? 48.106  -16.506 -81.388  1.00 59.58  ?  517  ARG C CG    1 
ATOM   7077  C  CD    . ARG C 2  513  ? 49.580  -16.228 -81.168  1.00 59.16  ?  517  ARG C CD    1 
ATOM   7078  N  NE    . ARG C 2  513  ? 50.194  -15.602 -82.333  1.00 64.18  ?  517  ARG C NE    1 
ATOM   7079  C  CZ    . ARG C 2  513  ? 51.420  -15.091 -82.343  1.00 64.86  ?  517  ARG C CZ    1 
ATOM   7080  N  NH1   . ARG C 2  513  ? 51.900  -14.538 -83.448  1.00 68.68  ?  517  ARG C NH1   1 
ATOM   7081  N  NH2   . ARG C 2  513  ? 52.162  -15.127 -81.246  1.00 61.05  ?  517  ARG C NH2   1 
ATOM   7082  N  N     . LYS C 2  514  ? 45.879  -18.604 -85.021  1.00 70.48  ?  518  LYS C N     1 
ATOM   7083  C  CA    . LYS C 2  514  ? 45.815  -19.583 -86.097  1.00 70.36  ?  518  LYS C CA    1 
ATOM   7084  C  C     . LYS C 2  514  ? 47.210  -20.087 -86.445  1.00 75.28  ?  518  LYS C C     1 
ATOM   7085  O  O     . LYS C 2  514  ? 48.119  -19.296 -86.712  1.00 75.18  ?  518  LYS C O     1 
ATOM   7086  C  CB    . LYS C 2  514  ? 45.158  -18.963 -87.330  1.00 71.12  ?  518  LYS C CB    1 
ATOM   7087  C  CG    . LYS C 2  514  ? 43.653  -19.155 -87.423  1.00 71.17  ?  518  LYS C CG    1 
ATOM   7088  C  CD    . LYS C 2  514  ? 43.307  -20.548 -87.929  1.00 77.34  ?  518  LYS C CD    1 
ATOM   7089  C  CE    . LYS C 2  514  ? 41.842  -20.644 -88.324  1.00 72.76  ?  518  LYS C CE    1 
ATOM   7090  N  NZ    . LYS C 2  514  ? 41.499  -19.686 -89.412  1.00 79.30  ?  518  LYS C NZ    1 
ATOM   7091  N  N     . VAL C 2  515  ? 47.377  -21.406 -86.438  1.00 77.93  ?  519  VAL C N     1 
ATOM   7092  C  CA    . VAL C 2  515  ? 48.616  -22.054 -86.854  1.00 77.24  ?  519  VAL C CA    1 
ATOM   7093  C  C     . VAL C 2  515  ? 48.348  -22.719 -88.195  1.00 79.51  ?  519  VAL C C     1 
ATOM   7094  O  O     . VAL C 2  515  ? 47.572  -23.679 -88.279  1.00 80.96  ?  519  VAL C O     1 
ATOM   7095  C  CB    . VAL C 2  515  ? 49.113  -23.073 -85.819  1.00 72.63  ?  519  VAL C CB    1 
ATOM   7096  C  CG1   . VAL C 2  515  ? 50.288  -23.859 -86.376  1.00 74.60  ?  519  VAL C CG1   1 
ATOM   7097  C  CG2   . VAL C 2  515  ? 49.498  -22.373 -84.527  1.00 71.06  ?  519  VAL C CG2   1 
ATOM   7098  N  N     . VAL C 2  516  ? 48.988  -22.216 -89.246  1.00 78.11  ?  520  VAL C N     1 
ATOM   7099  C  CA    . VAL C 2  516  ? 48.774  -22.696 -90.606  1.00 80.34  ?  520  VAL C CA    1 
ATOM   7100  C  C     . VAL C 2  516  ? 50.088  -23.258 -91.129  1.00 79.77  ?  520  VAL C C     1 
ATOM   7101  O  O     . VAL C 2  516  ? 51.103  -22.552 -91.162  1.00 78.91  ?  520  VAL C O     1 
ATOM   7102  C  CB    . VAL C 2  516  ? 48.237  -21.587 -91.524  1.00 82.62  ?  520  VAL C CB    1 
ATOM   7103  C  CG1   . VAL C 2  516  ? 46.759  -21.360 -91.259  1.00 83.76  ?  520  VAL C CG1   1 
ATOM   7104  C  CG2   . VAL C 2  516  ? 49.007  -20.291 -91.313  1.00 79.23  ?  520  VAL C CG2   1 
ATOM   7105  N  N     . ASP C 2  517  ? 50.066  -24.530 -91.528  1.00 80.97  ?  521  ASP C N     1 
ATOM   7106  C  CA    . ASP C 2  517  ? 51.227  -25.205 -92.108  1.00 82.59  ?  521  ASP C CA    1 
ATOM   7107  C  C     . ASP C 2  517  ? 52.453  -25.074 -91.208  1.00 81.51  ?  521  ASP C C     1 
ATOM   7108  O  O     . ASP C 2  517  ? 53.557  -24.757 -91.656  1.00 86.00  ?  521  ASP C O     1 
ATOM   7109  C  CB    . ASP C 2  517  ? 51.519  -24.674 -93.511  1.00 84.93  ?  521  ASP C CB    1 
ATOM   7110  C  CG    . ASP C 2  517  ? 50.367  -24.895 -94.466  1.00 91.51  ?  521  ASP C CG    1 
ATOM   7111  O  OD1   . ASP C 2  517  ? 49.204  -24.871 -94.009  1.00 91.40  ?  521  ASP C OD1   1 
ATOM   7112  O  OD2   . ASP C 2  517  ? 50.621  -25.094 -95.673  1.00 94.93  ?  521  ASP C OD2   1 
ATOM   7113  N  N     . GLY C 2  518  ? 52.247  -25.318 -89.917  1.00 78.60  ?  522  GLY C N     1 
ATOM   7114  C  CA    . GLY C 2  518  ? 53.335  -25.238 -88.966  1.00 81.04  ?  522  GLY C CA    1 
ATOM   7115  C  C     . GLY C 2  518  ? 53.896  -23.854 -88.733  1.00 83.02  ?  522  GLY C C     1 
ATOM   7116  O  O     . GLY C 2  518  ? 54.965  -23.732 -88.127  1.00 84.94  ?  522  GLY C O     1 
ATOM   7117  N  N     . VAL C 2  519  ? 53.221  -22.807 -89.199  1.00 79.81  ?  523  VAL C N     1 
ATOM   7118  C  CA    . VAL C 2  519  ? 53.636  -21.436 -88.931  1.00 79.50  ?  523  VAL C CA    1 
ATOM   7119  C  C     . VAL C 2  519  ? 52.609  -20.806 -88.001  1.00 80.52  ?  523  VAL C C     1 
ATOM   7120  O  O     . VAL C 2  519  ? 51.417  -21.132 -88.043  1.00 80.07  ?  523  VAL C O     1 
ATOM   7121  C  CB    . VAL C 2  519  ? 53.810  -20.608 -90.225  1.00 82.50  ?  523  VAL C CB    1 
ATOM   7122  C  CG1   . VAL C 2  519  ? 54.157  -21.518 -91.395  1.00 89.17  ?  523  VAL C CG1   1 
ATOM   7123  C  CG2   . VAL C 2  519  ? 52.574  -19.770 -90.528  1.00 82.92  ?  523  VAL C CG2   1 
ATOM   7124  N  N     . VAL C 2  520  ? 53.084  -19.914 -87.140  1.00 80.75  ?  524  VAL C N     1 
ATOM   7125  C  CA    . VAL C 2  520  ? 52.251  -19.275 -86.129  1.00 78.57  ?  524  VAL C CA    1 
ATOM   7126  C  C     . VAL C 2  520  ? 51.916  -17.878 -86.630  1.00 75.25  ?  524  VAL C C     1 
ATOM   7127  O  O     . VAL C 2  520  ? 52.780  -16.996 -86.670  1.00 75.17  ?  524  VAL C O     1 
ATOM   7128  C  CB    . VAL C 2  520  ? 52.954  -19.232 -84.767  1.00 74.32  ?  524  VAL C CB    1 
ATOM   7129  C  CG1   . VAL C 2  520  ? 52.042  -18.624 -83.715  1.00 66.80  ?  524  VAL C CG1   1 
ATOM   7130  C  CG2   . VAL C 2  520  ? 53.393  -20.629 -84.359  1.00 76.23  ?  524  VAL C CG2   1 
ATOM   7131  N  N     . SER C 2  521  ? 50.658  -17.669 -87.004  1.00 73.56  ?  525  SER C N     1 
ATOM   7132  C  CA    . SER C 2  521  ? 50.243  -16.405 -87.583  1.00 73.46  ?  525  SER C CA    1 
ATOM   7133  C  C     . SER C 2  521  ? 49.799  -15.438 -86.490  1.00 68.82  ?  525  SER C C     1 
ATOM   7134  O  O     . SER C 2  521  ? 49.748  -15.771 -85.304  1.00 66.83  ?  525  SER C O     1 
ATOM   7135  C  CB    . SER C 2  521  ? 49.124  -16.632 -88.599  1.00 72.14  ?  525  SER C CB    1 
ATOM   7136  O  OG    . SER C 2  521  ? 48.002  -17.245 -87.989  1.00 67.18  ?  525  SER C OG    1 
ATOM   7137  N  N     . ASP C 2  522  ? 49.479  -14.215 -86.900  1.00 66.21  ?  526  ASP C N     1 
ATOM   7138  C  CA    . ASP C 2  522  ? 48.936  -13.206 -86.006  1.00 67.42  ?  526  ASP C CA    1 
ATOM   7139  C  C     . ASP C 2  522  ? 47.419  -13.102 -86.085  1.00 66.30  ?  526  ASP C C     1 
ATOM   7140  O  O     . ASP C 2  522  ? 46.837  -12.228 -85.437  1.00 64.67  ?  526  ASP C O     1 
ATOM   7141  C  CB    . ASP C 2  522  ? 49.583  -11.847 -86.292  1.00 70.24  ?  526  ASP C CB    1 
ATOM   7142  C  CG    . ASP C 2  522  ? 51.024  -11.780 -85.812  1.00 73.36  ?  526  ASP C CG    1 
ATOM   7143  O  OD1   . ASP C 2  522  ? 51.688  -12.837 -85.773  1.00 72.46  ?  526  ASP C OD1   1 
ATOM   7144  O  OD2   . ASP C 2  522  ? 51.491  -10.674 -85.468  1.00 74.69  ?  526  ASP C OD2   1 
ATOM   7145  N  N     . GLU C 2  523  ? 46.771  -13.954 -86.876  1.00 65.68  ?  527  GLU C N     1 
ATOM   7146  C  CA    . GLU C 2  523  ? 45.315  -13.994 -86.910  1.00 63.38  ?  527  GLU C CA    1 
ATOM   7147  C  C     . GLU C 2  523  ? 44.781  -14.557 -85.598  1.00 66.09  ?  527  GLU C C     1 
ATOM   7148  O  O     . GLU C 2  523  ? 45.242  -15.600 -85.126  1.00 66.20  ?  527  GLU C O     1 
ATOM   7149  C  CB    . GLU C 2  523  ? 44.838  -14.842 -88.088  1.00 69.00  ?  527  GLU C CB    1 
ATOM   7150  C  CG    . GLU C 2  523  ? 43.328  -15.002 -88.177  1.00 76.04  ?  527  GLU C CG    1 
ATOM   7151  C  CD    . GLU C 2  523  ? 42.903  -15.960 -89.275  1.00 77.93  ?  527  GLU C CD    1 
ATOM   7152  O  OE1   . GLU C 2  523  ? 43.775  -16.410 -90.046  1.00 77.49  ?  527  GLU C OE1   1 
ATOM   7153  O  OE2   . GLU C 2  523  ? 41.695  -16.266 -89.366  1.00 76.70  ?  527  GLU C OE2   1 
ATOM   7154  N  N     . ILE C 2  524  ? 43.809  -13.865 -85.008  1.00 62.38  ?  528  ILE C N     1 
ATOM   7155  C  CA    . ILE C 2  524  ? 43.245  -14.232 -83.714  1.00 57.97  ?  528  ILE C CA    1 
ATOM   7156  C  C     . ILE C 2  524  ? 41.803  -14.678 -83.909  1.00 56.29  ?  528  ILE C C     1 
ATOM   7157  O  O     . ILE C 2  524  ? 41.043  -14.058 -84.662  1.00 56.25  ?  528  ILE C O     1 
ATOM   7158  C  CB    . ILE C 2  524  ? 43.336  -13.067 -82.706  1.00 55.93  ?  528  ILE C CB    1 
ATOM   7159  C  CG1   . ILE C 2  524  ? 44.581  -13.211 -81.828  1.00 57.10  ?  528  ILE C CG1   1 
ATOM   7160  C  CG2   . ILE C 2  524  ? 42.097  -12.993 -81.827  1.00 54.44  ?  528  ILE C CG2   1 
ATOM   7161  C  CD1   . ILE C 2  524  ? 45.884  -13.091 -82.573  1.00 62.35  ?  528  ILE C CD1   1 
ATOM   7162  N  N     . VAL C 2  525  ? 41.434  -15.765 -83.234  1.00 52.67  ?  529  VAL C N     1 
ATOM   7163  C  CA    . VAL C 2  525  ? 40.082  -16.308 -83.259  1.00 52.31  ?  529  VAL C CA    1 
ATOM   7164  C  C     . VAL C 2  525  ? 39.676  -16.631 -81.829  1.00 52.67  ?  529  VAL C C     1 
ATOM   7165  O  O     . VAL C 2  525  ? 40.440  -17.263 -81.092  1.00 55.91  ?  529  VAL C O     1 
ATOM   7166  C  CB    . VAL C 2  525  ? 39.987  -17.566 -84.146  1.00 52.54  ?  529  VAL C CB    1 
ATOM   7167  C  CG1   . VAL C 2  525  ? 38.651  -18.258 -83.949  1.00 55.26  ?  529  VAL C CG1   1 
ATOM   7168  C  CG2   . VAL C 2  525  ? 40.190  -17.205 -85.607  1.00 57.62  ?  529  VAL C CG2   1 
ATOM   7169  N  N     . TYR C 2  526  ? 38.485  -16.193 -81.434  1.00 48.83  ?  530  TYR C N     1 
ATOM   7170  C  CA    . TYR C 2  526  ? 37.941  -16.512 -80.120  1.00 49.93  ?  530  TYR C CA    1 
ATOM   7171  C  C     . TYR C 2  526  ? 37.159  -17.818 -80.209  1.00 49.60  ?  530  TYR C C     1 
ATOM   7172  O  O     . TYR C 2  526  ? 36.166  -17.903 -80.939  1.00 53.21  ?  530  TYR C O     1 
ATOM   7173  C  CB    . TYR C 2  526  ? 37.048  -15.383 -79.613  1.00 47.30  ?  530  TYR C CB    1 
ATOM   7174  C  CG    . TYR C 2  526  ? 37.793  -14.246 -78.952  1.00 46.97  ?  530  TYR C CG    1 
ATOM   7175  C  CD1   . TYR C 2  526  ? 38.341  -13.216 -79.703  1.00 48.84  ?  530  TYR C CD1   1 
ATOM   7176  C  CD2   . TYR C 2  526  ? 37.938  -14.196 -77.574  1.00 47.13  ?  530  TYR C CD2   1 
ATOM   7177  C  CE1   . TYR C 2  526  ? 39.017  -12.174 -79.100  1.00 45.89  ?  530  TYR C CE1   1 
ATOM   7178  C  CE2   . TYR C 2  526  ? 38.611  -13.158 -76.963  1.00 46.87  ?  530  TYR C CE2   1 
ATOM   7179  C  CZ    . TYR C 2  526  ? 39.149  -12.151 -77.729  1.00 46.41  ?  530  TYR C CZ    1 
ATOM   7180  O  OH    . TYR C 2  526  ? 39.821  -11.118 -77.117  1.00 46.15  ?  530  TYR C OH    1 
ATOM   7181  N  N     . LEU C 2  527  ? 37.602  -18.826 -79.467  1.00 43.82  ?  531  LEU C N     1 
ATOM   7182  C  CA    . LEU C 2  527  ? 37.002  -20.150 -79.505  1.00 52.70  ?  531  LEU C CA    1 
ATOM   7183  C  C     . LEU C 2  527  ? 36.282  -20.445 -78.199  1.00 54.62  ?  531  LEU C C     1 
ATOM   7184  O  O     . LEU C 2  527  ? 36.734  -20.039 -77.125  1.00 50.50  ?  531  LEU C O     1 
ATOM   7185  C  CB    . LEU C 2  527  ? 38.059  -21.228 -79.756  1.00 55.71  ?  531  LEU C CB    1 
ATOM   7186  C  CG    . LEU C 2  527  ? 38.764  -21.232 -81.111  1.00 57.68  ?  531  LEU C CG    1 
ATOM   7187  C  CD1   . LEU C 2  527  ? 39.793  -22.345 -81.152  1.00 60.37  ?  531  LEU C CD1   1 
ATOM   7188  C  CD2   . LEU C 2  527  ? 37.758  -21.386 -82.237  1.00 56.76  ?  531  LEU C CD2   1 
ATOM   7189  N  N     . THR C 2  528  ? 35.164  -21.160 -78.296  1.00 56.99  ?  532  THR C N     1 
ATOM   7190  C  CA    . THR C 2  528  ? 34.482  -21.657 -77.115  1.00 51.57  ?  532  THR C CA    1 
ATOM   7191  C  C     . THR C 2  528  ? 35.075  -23.006 -76.721  1.00 53.85  ?  532  THR C C     1 
ATOM   7192  O  O     . THR C 2  528  ? 35.926  -23.565 -77.417  1.00 57.96  ?  532  THR C O     1 
ATOM   7193  C  CB    . THR C 2  528  ? 32.980  -21.771 -77.365  1.00 52.94  ?  532  THR C CB    1 
ATOM   7194  O  OG1   . THR C 2  528  ? 32.302  -21.935 -76.114  1.00 57.67  ?  532  THR C OG1   1 
ATOM   7195  C  CG2   . THR C 2  528  ? 32.682  -22.970 -78.240  1.00 55.70  ?  532  THR C CG2   1 
ATOM   7196  N  N     . ALA C 2  529  ? 34.609  -23.548 -75.596  1.00 53.20  ?  533  ALA C N     1 
ATOM   7197  C  CA    . ALA C 2  529  ? 35.160  -24.808 -75.111  1.00 53.82  ?  533  ALA C CA    1 
ATOM   7198  C  C     . ALA C 2  529  ? 34.868  -25.946 -76.078  1.00 57.50  ?  533  ALA C C     1 
ATOM   7199  O  O     . ALA C 2  529  ? 35.715  -26.821 -76.287  1.00 59.16  ?  533  ALA C O     1 
ATOM   7200  C  CB    . ALA C 2  529  ? 34.610  -25.122 -73.722  1.00 54.89  ?  533  ALA C CB    1 
ATOM   7201  N  N     . ASP C 2  530  ? 33.678  -25.946 -76.684  1.00 60.41  ?  534  ASP C N     1 
ATOM   7202  C  CA    . ASP C 2  530  ? 33.345  -26.967 -77.671  1.00 62.74  ?  534  ASP C CA    1 
ATOM   7203  C  C     . ASP C 2  530  ? 34.264  -26.882 -78.883  1.00 64.77  ?  534  ASP C C     1 
ATOM   7204  O  O     . ASP C 2  530  ? 34.842  -27.888 -79.310  1.00 65.74  ?  534  ASP C O     1 
ATOM   7205  C  CB    . ASP C 2  530  ? 31.882  -26.829 -78.098  1.00 65.20  ?  534  ASP C CB    1 
ATOM   7206  C  CG    . ASP C 2  530  ? 30.920  -27.397 -77.077  1.00 70.80  ?  534  ASP C CG    1 
ATOM   7207  O  OD1   . ASP C 2  530  ? 31.344  -28.252 -76.273  1.00 70.93  ?  534  ASP C OD1   1 
ATOM   7208  O  OD2   . ASP C 2  530  ? 29.738  -26.996 -77.084  1.00 77.21  ?  534  ASP C OD2   1 
ATOM   7209  N  N     . GLU C 2  531  ? 34.405  -25.683 -79.456  1.00 61.81  ?  535  GLU C N     1 
ATOM   7210  C  CA    . GLU C 2  531  ? 35.263  -25.508 -80.623  1.00 61.45  ?  535  GLU C CA    1 
ATOM   7211  C  C     . GLU C 2  531  ? 36.707  -25.879 -80.321  1.00 62.61  ?  535  GLU C C     1 
ATOM   7212  O  O     . GLU C 2  531  ? 37.436  -26.320 -81.214  1.00 65.95  ?  535  GLU C O     1 
ATOM   7213  C  CB    . GLU C 2  531  ? 35.183  -24.063 -81.115  1.00 60.47  ?  535  GLU C CB    1 
ATOM   7214  C  CG    . GLU C 2  531  ? 33.789  -23.621 -81.522  1.00 63.41  ?  535  GLU C CG    1 
ATOM   7215  C  CD    . GLU C 2  531  ? 33.613  -22.114 -81.469  1.00 65.48  ?  535  GLU C CD    1 
ATOM   7216  O  OE1   . GLU C 2  531  ? 34.618  -21.397 -81.301  1.00 65.12  ?  535  GLU C OE1   1 
ATOM   7217  O  OE2   . GLU C 2  531  ? 32.464  -21.645 -81.586  1.00 68.33  ?  535  GLU C OE2   1 
ATOM   7218  N  N     . GLU C 2  532  ? 37.133  -25.715 -79.068  1.00 62.50  ?  536  GLU C N     1 
ATOM   7219  C  CA    . GLU C 2  532  ? 38.512  -25.989 -78.686  1.00 61.65  ?  536  GLU C CA    1 
ATOM   7220  C  C     . GLU C 2  532  ? 38.836  -27.478 -78.675  1.00 65.14  ?  536  GLU C C     1 
ATOM   7221  O  O     . GLU C 2  532  ? 40.002  -27.847 -78.848  1.00 65.07  ?  536  GLU C O     1 
ATOM   7222  C  CB    . GLU C 2  532  ? 38.786  -25.377 -77.313  1.00 57.01  ?  536  GLU C CB    1 
ATOM   7223  C  CG    . GLU C 2  532  ? 40.229  -25.405 -76.872  1.00 55.21  ?  536  GLU C CG    1 
ATOM   7224  C  CD    . GLU C 2  532  ? 40.426  -24.691 -75.556  1.00 54.75  ?  536  GLU C CD    1 
ATOM   7225  O  OE1   . GLU C 2  532  ? 39.515  -23.941 -75.152  1.00 52.28  ?  536  GLU C OE1   1 
ATOM   7226  O  OE2   . GLU C 2  532  ? 41.483  -24.879 -74.922  1.00 59.41  ?  536  GLU C OE2   1 
ATOM   7227  N  N     . ASP C 2  533  ? 37.839  -28.340 -78.475  1.00 64.21  ?  537  ASP C N     1 
ATOM   7228  C  CA    . ASP C 2  533  ? 38.079  -29.778 -78.452  1.00 67.20  ?  537  ASP C CA    1 
ATOM   7229  C  C     . ASP C 2  533  ? 38.328  -30.362 -79.837  1.00 68.56  ?  537  ASP C C     1 
ATOM   7230  O  O     . ASP C 2  533  ? 38.980  -31.407 -79.945  1.00 73.53  ?  537  ASP C O     1 
ATOM   7231  C  CB    . ASP C 2  533  ? 36.900  -30.497 -77.794  1.00 68.67  ?  537  ASP C CB    1 
ATOM   7232  C  CG    . ASP C 2  533  ? 36.690  -30.070 -76.358  1.00 69.26  ?  537  ASP C CG    1 
ATOM   7233  O  OD1   . ASP C 2  533  ? 37.679  -29.677 -75.708  1.00 70.05  ?  537  ASP C OD1   1 
ATOM   7234  O  OD2   . ASP C 2  533  ? 35.538  -30.124 -75.880  1.00 68.21  ?  537  ASP C OD2   1 
ATOM   7235  N  N     . ARG C 2  534  ? 37.830  -29.720 -80.892  1.00 67.34  ?  538  ARG C N     1 
ATOM   7236  C  CA    . ARG C 2  534  ? 38.052  -30.200 -82.249  1.00 68.18  ?  538  ARG C CA    1 
ATOM   7237  C  C     . ARG C 2  534  ? 39.450  -29.896 -82.770  1.00 73.06  ?  538  ARG C C     1 
ATOM   7238  O  O     . ARG C 2  534  ? 39.824  -30.412 -83.830  1.00 72.45  ?  538  ARG C O     1 
ATOM   7239  C  CB    . ARG C 2  534  ? 37.019  -29.591 -83.201  1.00 66.66  ?  538  ARG C CB    1 
ATOM   7240  C  CG    . ARG C 2  534  ? 35.582  -29.926 -82.852  1.00 70.67  ?  538  ARG C CG    1 
ATOM   7241  C  CD    . ARG C 2  534  ? 34.639  -29.616 -84.004  1.00 71.38  ?  538  ARG C CD    1 
ATOM   7242  N  NE    . ARG C 2  534  ? 34.414  -28.185 -84.180  1.00 70.13  ?  538  ARG C NE    1 
ATOM   7243  C  CZ    . ARG C 2  534  ? 33.408  -27.516 -83.625  1.00 71.30  ?  538  ARG C CZ    1 
ATOM   7244  N  NH1   . ARG C 2  534  ? 33.273  -26.215 -83.840  1.00 73.45  ?  538  ARG C NH1   1 
ATOM   7245  N  NH2   . ARG C 2  534  ? 32.537  -28.151 -82.853  1.00 67.20  ?  538  ARG C NH2   1 
ATOM   7246  N  N     . HIS C 2  535  ? 40.229  -29.092 -82.060  1.00 72.80  ?  539  HIS C N     1 
ATOM   7247  C  CA    . HIS C 2  535  ? 41.502  -28.598 -82.561  1.00 71.19  ?  539  HIS C CA    1 
ATOM   7248  C  C     . HIS C 2  535  ? 42.628  -28.950 -81.593  1.00 72.87  ?  539  HIS C C     1 
ATOM   7249  O  O     . HIS C 2  535  ? 42.412  -29.544 -80.534  1.00 73.75  ?  539  HIS C O     1 
ATOM   7250  C  CB    . HIS C 2  535  ? 41.424  -27.090 -82.802  1.00 68.13  ?  539  HIS C CB    1 
ATOM   7251  C  CG    . HIS C 2  535  ? 40.349  -26.692 -83.764  1.00 66.47  ?  539  HIS C CG    1 
ATOM   7252  N  ND1   . HIS C 2  535  ? 40.324  -27.127 -85.071  1.00 67.96  ?  539  HIS C ND1   1 
ATOM   7253  C  CD2   . HIS C 2  535  ? 39.262  -25.901 -83.611  1.00 69.24  ?  539  HIS C CD2   1 
ATOM   7254  C  CE1   . HIS C 2  535  ? 39.268  -26.622 -85.682  1.00 70.50  ?  539  HIS C CE1   1 
ATOM   7255  N  NE2   . HIS C 2  535  ? 38.607  -25.873 -84.818  1.00 72.80  ?  539  HIS C NE2   1 
ATOM   7256  N  N     . VAL C 2  536  ? 43.844  -28.572 -81.977  1.00 70.64  ?  540  VAL C N     1 
ATOM   7257  C  CA    . VAL C 2  536  ? 45.057  -28.875 -81.225  1.00 71.33  ?  540  VAL C CA    1 
ATOM   7258  C  C     . VAL C 2  536  ? 45.720  -27.555 -80.860  1.00 70.67  ?  540  VAL C C     1 
ATOM   7259  O  O     . VAL C 2  536  ? 46.109  -26.786 -81.747  1.00 74.16  ?  540  VAL C O     1 
ATOM   7260  C  CB    . VAL C 2  536  ? 46.014  -29.768 -82.029  1.00 73.76  ?  540  VAL C CB    1 
ATOM   7261  C  CG1   . VAL C 2  536  ? 47.338  -29.915 -81.302  1.00 70.34  ?  540  VAL C CG1   1 
ATOM   7262  C  CG2   . VAL C 2  536  ? 45.380  -31.128 -82.278  1.00 70.51  ?  540  VAL C CG2   1 
ATOM   7263  N  N     . VAL C 2  537  ? 45.860  -27.300 -79.562  1.00 66.28  ?  541  VAL C N     1 
ATOM   7264  C  CA    . VAL C 2  537  ? 46.262  -25.994 -79.050  1.00 63.86  ?  541  VAL C CA    1 
ATOM   7265  C  C     . VAL C 2  537  ? 47.600  -26.133 -78.339  1.00 58.12  ?  541  VAL C C     1 
ATOM   7266  O  O     . VAL C 2  537  ? 47.719  -26.893 -77.371  1.00 60.48  ?  541  VAL C O     1 
ATOM   7267  C  CB    . VAL C 2  537  ? 45.204  -25.407 -78.105  1.00 62.13  ?  541  VAL C CB    1 
ATOM   7268  C  CG1   . VAL C 2  537  ? 45.595  -24.005 -77.686  1.00 57.58  ?  541  VAL C CG1   1 
ATOM   7269  C  CG2   . VAL C 2  537  ? 43.836  -25.412 -78.773  1.00 60.75  ?  541  VAL C CG2   1 
ATOM   7270  N  N     . ALA C 2  538  ? 48.595  -25.384 -78.805  1.00 53.17  ?  542  ALA C N     1 
ATOM   7271  C  CA    . ALA C 2  538  ? 49.920  -25.388 -78.203  1.00 55.75  ?  542  ALA C CA    1 
ATOM   7272  C  C     . ALA C 2  538  ? 50.006  -24.352 -77.090  1.00 56.72  ?  542  ALA C C     1 
ATOM   7273  O  O     . ALA C 2  538  ? 49.457  -23.254 -77.206  1.00 57.19  ?  542  ALA C O     1 
ATOM   7274  C  CB    . ALA C 2  538  ? 50.990  -25.105 -79.257  1.00 61.01  ?  542  ALA C CB    1 
ATOM   7275  N  N     . GLN C 2  539  ? 50.703  -24.708 -76.013  1.00 57.06  ?  543  GLN C N     1 
ATOM   7276  C  CA    . GLN C 2  539  ? 50.884  -23.787 -74.902  1.00 55.25  ?  543  GLN C CA    1 
ATOM   7277  C  C     . GLN C 2  539  ? 51.794  -22.633 -75.310  1.00 60.03  ?  543  GLN C C     1 
ATOM   7278  O  O     . GLN C 2  539  ? 52.557  -22.718 -76.275  1.00 63.12  ?  543  GLN C O     1 
ATOM   7279  C  CB    . GLN C 2  539  ? 51.463  -24.508 -73.685  1.00 51.63  ?  543  GLN C CB    1 
ATOM   7280  C  CG    . GLN C 2  539  ? 52.893  -24.996 -73.860  1.00 58.06  ?  543  GLN C CG    1 
ATOM   7281  C  CD    . GLN C 2  539  ? 53.524  -25.444 -72.553  1.00 54.35  ?  543  GLN C CD    1 
ATOM   7282  O  OE1   . GLN C 2  539  ? 53.034  -25.126 -71.472  1.00 50.35  ?  543  GLN C OE1   1 
ATOM   7283  N  NE2   . GLN C 2  539  ? 54.618  -26.185 -72.648  1.00 54.62  ?  543  GLN C NE2   1 
ATOM   7284  N  N     . ALA C 2  540  ? 51.699  -21.534 -74.556  1.00 58.28  ?  544  ALA C N     1 
ATOM   7285  C  CA    . ALA C 2  540  ? 52.458  -20.334 -74.895  1.00 56.74  ?  544  ALA C CA    1 
ATOM   7286  C  C     . ALA C 2  540  ? 53.953  -20.526 -74.681  1.00 62.29  ?  544  ALA C C     1 
ATOM   7287  O  O     . ALA C 2  540  ? 54.760  -19.943 -75.414  1.00 63.14  ?  544  ALA C O     1 
ATOM   7288  C  CB    . ALA C 2  540  ? 51.956  -19.147 -74.078  1.00 55.04  ?  544  ALA C CB    1 
ATOM   7289  N  N     . ASN C 2  541  ? 54.342  -21.332 -73.692  1.00 60.76  ?  545  ASN C N     1 
ATOM   7290  C  CA    . ASN C 2  541  ? 55.755  -21.599 -73.454  1.00 60.97  ?  545  ASN C CA    1 
ATOM   7291  C  C     . ASN C 2  541  ? 56.408  -22.380 -74.584  1.00 62.98  ?  545  ASN C C     1 
ATOM   7292  O  O     . ASN C 2  541  ? 57.631  -22.551 -74.564  1.00 68.48  ?  545  ASN C O     1 
ATOM   7293  C  CB    . ASN C 2  541  ? 55.939  -22.346 -72.136  1.00 54.08  ?  545  ASN C CB    1 
ATOM   7294  C  CG    . ASN C 2  541  ? 55.933  -21.418 -70.942  1.00 54.95  ?  545  ASN C CG    1 
ATOM   7295  O  OD1   . ASN C 2  541  ? 55.370  -21.735 -69.898  1.00 50.01  ?  545  ASN C OD1   1 
ATOM   7296  N  ND2   . ASN C 2  541  ? 56.558  -20.257 -71.095  1.00 55.18  ?  545  ASN C ND2   1 
ATOM   7297  N  N     . SER C 2  542  ? 55.634  -22.863 -75.547  1.00 66.00  ?  546  SER C N     1 
ATOM   7298  C  CA    . SER C 2  542  ? 56.213  -23.495 -76.720  1.00 70.02  ?  546  SER C CA    1 
ATOM   7299  C  C     . SER C 2  542  ? 57.097  -22.498 -77.462  1.00 72.41  ?  546  SER C C     1 
ATOM   7300  O  O     . SER C 2  542  ? 56.639  -21.396 -77.794  1.00 68.31  ?  546  SER C O     1 
ATOM   7301  C  CB    . SER C 2  542  ? 55.117  -24.014 -77.646  1.00 69.09  ?  546  SER C CB    1 
ATOM   7302  O  OG    . SER C 2  542  ? 55.595  -24.127 -78.973  1.00 76.57  ?  546  SER C OG    1 
ATOM   7303  N  N     . PRO C 2  543  ? 58.356  -22.833 -77.732  1.00 77.90  ?  547  PRO C N     1 
ATOM   7304  C  CA    . PRO C 2  543  ? 59.251  -21.881 -78.395  1.00 77.57  ?  547  PRO C CA    1 
ATOM   7305  C  C     . PRO C 2  543  ? 58.947  -21.731 -79.877  1.00 78.12  ?  547  PRO C C     1 
ATOM   7306  O  O     . PRO C 2  543  ? 58.638  -22.699 -80.577  1.00 75.53  ?  547  PRO C O     1 
ATOM   7307  C  CB    . PRO C 2  543  ? 60.636  -22.500 -78.178  1.00 78.81  ?  547  PRO C CB    1 
ATOM   7308  C  CG    . PRO C 2  543  ? 60.366  -23.963 -78.097  1.00 82.73  ?  547  PRO C CG    1 
ATOM   7309  C  CD    . PRO C 2  543  ? 59.035  -24.100 -77.408  1.00 79.35  ?  547  PRO C CD    1 
ATOM   7310  N  N     . ILE C 2  544  ? 59.045  -20.492 -80.349  1.00 79.99  ?  548  ILE C N     1 
ATOM   7311  C  CA    . ILE C 2  544  ? 58.976  -20.160 -81.765  1.00 81.64  ?  548  ILE C CA    1 
ATOM   7312  C  C     . ILE C 2  544  ? 60.148  -19.242 -82.072  1.00 88.33  ?  548  ILE C C     1 
ATOM   7313  O  O     . ILE C 2  544  ? 60.591  -18.467 -81.219  1.00 90.17  ?  548  ILE C O     1 
ATOM   7314  C  CB    . ILE C 2  544  ? 57.647  -19.475 -82.151  1.00 81.60  ?  548  ILE C CB    1 
ATOM   7315  C  CG1   . ILE C 2  544  ? 56.476  -20.081 -81.381  1.00 75.93  ?  548  ILE C CG1   1 
ATOM   7316  C  CG2   . ILE C 2  544  ? 57.402  -19.584 -83.648  1.00 85.65  ?  548  ILE C CG2   1 
ATOM   7317  C  CD1   . ILE C 2  544  ? 55.214  -19.269 -81.494  1.00 86.42  ?  548  ILE C CD1   1 
ATOM   7318  N  N     . ASP C 2  545  ? 60.656  -19.332 -83.293  1.00 92.41  ?  549  ASP C N     1 
ATOM   7319  C  CA    . ASP C 2  545  ? 61.733  -18.454 -83.720  1.00 99.15  ?  549  ASP C CA    1 
ATOM   7320  C  C     . ASP C 2  545  ? 61.130  -17.216 -84.385  1.00 100.53 ?  549  ASP C C     1 
ATOM   7321  O  O     . ASP C 2  545  ? 59.923  -16.971 -84.304  1.00 98.50  ?  549  ASP C O     1 
ATOM   7322  C  CB    . ASP C 2  545  ? 62.698  -19.207 -84.632  1.00 101.18 ?  549  ASP C CB    1 
ATOM   7323  C  CG    . ASP C 2  545  ? 64.086  -18.597 -84.638  1.00 105.01 ?  549  ASP C CG    1 
ATOM   7324  O  OD1   . ASP C 2  545  ? 64.796  -18.730 -83.619  1.00 98.67  ?  549  ASP C OD1   1 
ATOM   7325  O  OD2   . ASP C 2  545  ? 64.467  -17.987 -85.659  1.00 107.08 ?  549  ASP C OD2   1 
ATOM   7326  N  N     . ALA C 2  546  ? 61.975  -16.402 -85.025  1.00 102.77 ?  550  ALA C N     1 
ATOM   7327  C  CA    . ALA C 2  546  ? 61.473  -15.246 -85.761  1.00 100.91 ?  550  ALA C CA    1 
ATOM   7328  C  C     . ALA C 2  546  ? 60.440  -15.666 -86.798  1.00 101.09 ?  550  ALA C C     1 
ATOM   7329  O  O     . ALA C 2  546  ? 59.401  -15.014 -86.951  1.00 104.52 ?  550  ALA C O     1 
ATOM   7330  C  CB    . ALA C 2  546  ? 62.630  -14.500 -86.424  1.00 101.06 ?  550  ALA C CB    1 
ATOM   7331  N  N     . ASP C 2  547  ? 60.709  -16.750 -87.518  1.00 98.54  ?  551  ASP C N     1 
ATOM   7332  C  CA    . ASP C 2  547  ? 59.705  -17.347 -88.379  1.00 99.20  ?  551  ASP C CA    1 
ATOM   7333  C  C     . ASP C 2  547  ? 58.677  -18.101 -87.543  1.00 95.27  ?  551  ASP C C     1 
ATOM   7334  O  O     . ASP C 2  547  ? 58.927  -18.485 -86.398  1.00 94.20  ?  551  ASP C O     1 
ATOM   7335  C  CB    . ASP C 2  547  ? 60.351  -18.295 -89.385  1.00 104.22 ?  551  ASP C CB    1 
ATOM   7336  C  CG    . ASP C 2  547  ? 61.087  -19.433 -88.717  1.00 105.04 ?  551  ASP C CG    1 
ATOM   7337  O  OD1   . ASP C 2  547  ? 61.587  -19.234 -87.592  1.00 102.29 ?  551  ASP C OD1   1 
ATOM   7338  O  OD2   . ASP C 2  547  ? 61.163  -20.526 -89.312  1.00 109.69 ?  551  ASP C OD2   1 
ATOM   7339  N  N     . GLY C 2  548  ? 57.508  -18.318 -88.137  1.00 94.66  ?  552  GLY C N     1 
ATOM   7340  C  CA    . GLY C 2  548  ? 56.437  -19.014 -87.452  1.00 91.02  ?  552  GLY C CA    1 
ATOM   7341  C  C     . GLY C 2  548  ? 56.691  -20.478 -87.168  1.00 89.76  ?  552  GLY C C     1 
ATOM   7342  O  O     . GLY C 2  548  ? 55.850  -21.120 -86.531  1.00 90.36  ?  552  GLY C O     1 
ATOM   7343  N  N     . ARG C 2  549  ? 57.817  -21.025 -87.616  1.00 90.04  ?  553  ARG C N     1 
ATOM   7344  C  CA    . ARG C 2  549  ? 58.090  -22.441 -87.419  1.00 87.84  ?  553  ARG C CA    1 
ATOM   7345  C  C     . ARG C 2  549  ? 58.395  -22.739 -85.957  1.00 87.94  ?  553  ARG C C     1 
ATOM   7346  O  O     . ARG C 2  549  ? 59.022  -21.939 -85.258  1.00 82.99  ?  553  ARG C O     1 
ATOM   7347  C  CB    . ARG C 2  549  ? 59.259  -22.882 -88.298  1.00 86.74  ?  553  ARG C CB    1 
ATOM   7348  N  N     . PHE C 2  550  ? 57.941  -23.903 -85.498  1.00 88.08  ?  554  PHE C N     1 
ATOM   7349  C  CA    . PHE C 2  550  ? 58.231  -24.345 -84.143  1.00 86.12  ?  554  PHE C CA    1 
ATOM   7350  C  C     . PHE C 2  550  ? 59.692  -24.758 -84.009  1.00 87.63  ?  554  PHE C C     1 
ATOM   7351  O  O     . PHE C 2  550  ? 60.307  -25.274 -84.947  1.00 83.14  ?  554  PHE C O     1 
ATOM   7352  C  CB    . PHE C 2  550  ? 57.333  -25.519 -83.754  1.00 86.55  ?  554  PHE C CB    1 
ATOM   7353  C  CG    . PHE C 2  550  ? 55.932  -25.124 -83.389  1.00 83.98  ?  554  PHE C CG    1 
ATOM   7354  C  CD1   . PHE C 2  550  ? 55.631  -24.703 -82.106  1.00 79.82  ?  554  PHE C CD1   1 
ATOM   7355  C  CD2   . PHE C 2  550  ? 54.914  -25.190 -84.324  1.00 83.51  ?  554  PHE C CD2   1 
ATOM   7356  C  CE1   . PHE C 2  550  ? 54.342  -24.345 -81.764  1.00 78.51  ?  554  PHE C CE1   1 
ATOM   7357  C  CE2   . PHE C 2  550  ? 53.623  -24.834 -83.987  1.00 83.32  ?  554  PHE C CE2   1 
ATOM   7358  C  CZ    . PHE C 2  550  ? 53.338  -24.410 -82.705  1.00 82.38  ?  554  PHE C CZ    1 
ATOM   7359  N  N     . VAL C 2  551  ? 60.242  -24.536 -82.815  1.00 88.62  ?  555  VAL C N     1 
ATOM   7360  C  CA    . VAL C 2  551  ? 61.637  -24.882 -82.565  1.00 87.18  ?  555  VAL C CA    1 
ATOM   7361  C  C     . VAL C 2  551  ? 61.810  -26.390 -82.435  1.00 85.90  ?  555  VAL C C     1 
ATOM   7362  O  O     . VAL C 2  551  ? 62.838  -26.941 -82.848  1.00 87.13  ?  555  VAL C O     1 
ATOM   7363  C  CB    . VAL C 2  551  ? 62.144  -24.140 -81.315  1.00 87.02  ?  555  VAL C CB    1 
ATOM   7364  C  CG1   . VAL C 2  551  ? 63.576  -24.536 -80.992  1.00 85.83  ?  555  VAL C CG1   1 
ATOM   7365  C  CG2   . VAL C 2  551  ? 62.038  -22.637 -81.518  1.00 87.21  ?  555  VAL C CG2   1 
ATOM   7366  N  N     . GLU C 2  552  ? 60.814  -27.087 -81.894  1.00 86.36  ?  556  GLU C N     1 
ATOM   7367  C  CA    . GLU C 2  552  ? 60.944  -28.512 -81.644  1.00 86.91  ?  556  GLU C CA    1 
ATOM   7368  C  C     . GLU C 2  552  ? 59.956  -29.302 -82.492  1.00 88.15  ?  556  GLU C C     1 
ATOM   7369  O  O     . GLU C 2  552  ? 58.843  -28.836 -82.755  1.00 86.97  ?  556  GLU C O     1 
ATOM   7370  C  CB    . GLU C 2  552  ? 60.704  -28.830 -80.163  1.00 89.43  ?  556  GLU C CB    1 
ATOM   7371  C  CG    . GLU C 2  552  ? 61.666  -28.140 -79.214  1.00 91.00  ?  556  GLU C CG    1 
ATOM   7372  C  CD    . GLU C 2  552  ? 61.315  -28.382 -77.760  1.00 94.81  ?  556  GLU C CD    1 
ATOM   7373  O  OE1   . GLU C 2  552  ? 60.109  -28.456 -77.444  1.00 99.58  ?  556  GLU C OE1   1 
ATOM   7374  O  OE2   . GLU C 2  552  ? 62.245  -28.505 -76.936  1.00 91.24  ?  556  GLU C OE2   1 
ATOM   7375  N  N     . PRO C 2  553  ? 60.334  -30.505 -82.938  1.00 91.44  ?  557  PRO C N     1 
ATOM   7376  C  CA    . PRO C 2  553  ? 59.384  -31.322 -83.706  1.00 88.09  ?  557  PRO C CA    1 
ATOM   7377  C  C     . PRO C 2  553  ? 58.247  -31.864 -82.861  1.00 85.33  ?  557  PRO C C     1 
ATOM   7378  O  O     . PRO C 2  553  ? 57.153  -32.095 -83.391  1.00 81.89  ?  557  PRO C O     1 
ATOM   7379  C  CB    . PRO C 2  553  ? 60.264  -32.448 -84.264  1.00 79.88  ?  557  PRO C CB    1 
ATOM   7380  C  CG    . PRO C 2  553  ? 61.377  -32.565 -83.278  1.00 80.27  ?  557  PRO C CG    1 
ATOM   7381  C  CD    . PRO C 2  553  ? 61.639  -31.170 -82.777  1.00 83.88  ?  557  PRO C CD    1 
ATOM   7382  N  N     . ARG C 2  554  ? 58.471  -32.072 -81.567  1.00 87.21  ?  558  ARG C N     1 
ATOM   7383  C  CA    . ARG C 2  554  ? 57.437  -32.510 -80.640  1.00 88.84  ?  558  ARG C CA    1 
ATOM   7384  C  C     . ARG C 2  554  ? 57.160  -31.400 -79.637  1.00 90.81  ?  558  ARG C C     1 
ATOM   7385  O  O     . ARG C 2  554  ? 58.093  -30.819 -79.073  1.00 90.71  ?  558  ARG C O     1 
ATOM   7386  C  CB    . ARG C 2  554  ? 57.848  -33.789 -79.909  1.00 87.37  ?  558  ARG C CB    1 
ATOM   7387  C  CG    . ARG C 2  554  ? 57.522  -35.071 -80.654  1.00 87.28  ?  558  ARG C CG    1 
ATOM   7388  C  CD    . ARG C 2  554  ? 57.560  -36.263 -79.714  1.00 84.94  ?  558  ARG C CD    1 
ATOM   7389  N  NE    . ARG C 2  554  ? 58.865  -36.412 -79.076  1.00 88.13  ?  558  ARG C NE    1 
ATOM   7390  C  CZ    . ARG C 2  554  ? 59.125  -37.274 -78.098  1.00 84.69  ?  558  ARG C CZ    1 
ATOM   7391  N  NH1   . ARG C 2  554  ? 58.167  -38.065 -77.635  1.00 79.81  ?  558  ARG C NH1   1 
ATOM   7392  N  NH2   . ARG C 2  554  ? 60.344  -37.341 -77.580  1.00 83.13  ?  558  ARG C NH2   1 
ATOM   7393  N  N     . VAL C 2  555  ? 55.880  -31.114 -79.414  1.00 89.95  ?  559  VAL C N     1 
ATOM   7394  C  CA    . VAL C 2  555  ? 55.453  -30.042 -78.524  1.00 89.50  ?  559  VAL C CA    1 
ATOM   7395  C  C     . VAL C 2  555  ? 54.325  -30.557 -77.641  1.00 86.02  ?  559  VAL C C     1 
ATOM   7396  O  O     . VAL C 2  555  ? 53.433  -31.274 -78.109  1.00 84.23  ?  559  VAL C O     1 
ATOM   7397  C  CB    . VAL C 2  555  ? 55.013  -28.792 -79.319  1.00 87.51  ?  559  VAL C CB    1 
ATOM   7398  C  CG1   . VAL C 2  555  ? 53.970  -29.157 -80.369  1.00 84.79  ?  559  VAL C CG1   1 
ATOM   7399  C  CG2   . VAL C 2  555  ? 54.490  -27.708 -78.384  1.00 80.56  ?  559  VAL C CG2   1 
ATOM   7400  N  N     . LEU C 2  556  ? 54.375  -30.206 -76.358  1.00 83.72  ?  560  LEU C N     1 
ATOM   7401  C  CA    . LEU C 2  556  ? 53.326  -30.584 -75.419  1.00 80.47  ?  560  LEU C CA    1 
ATOM   7402  C  C     . LEU C 2  556  ? 52.100  -29.714 -75.664  1.00 79.80  ?  560  LEU C C     1 
ATOM   7403  O  O     . LEU C 2  556  ? 52.192  -28.482 -75.632  1.00 75.53  ?  560  LEU C O     1 
ATOM   7404  C  CB    . LEU C 2  556  ? 53.817  -30.435 -73.981  1.00 73.83  ?  560  LEU C CB    1 
ATOM   7405  N  N     . VAL C 2  557  ? 50.956  -30.350 -75.921  1.00 74.65  ?  561  VAL C N     1 
ATOM   7406  C  CA    . VAL C 2  557  ? 49.719  -29.648 -76.243  1.00 73.37  ?  561  VAL C CA    1 
ATOM   7407  C  C     . VAL C 2  557  ? 48.556  -30.321 -75.526  1.00 70.74  ?  561  VAL C C     1 
ATOM   7408  O  O     . VAL C 2  557  ? 48.668  -31.433 -75.008  1.00 70.48  ?  561  VAL C O     1 
ATOM   7409  C  CB    . VAL C 2  557  ? 49.434  -29.611 -77.762  1.00 73.09  ?  561  VAL C CB    1 
ATOM   7410  C  CG1   . VAL C 2  557  ? 50.646  -29.118 -78.545  1.00 72.53  ?  561  VAL C CG1   1 
ATOM   7411  C  CG2   . VAL C 2  557  ? 48.981  -30.977 -78.247  1.00 71.09  ?  561  VAL C CG2   1 
ATOM   7412  N  N     . ARG C 2  558  ? 47.431  -29.613 -75.497  1.00 70.33  ?  562  ARG C N     1 
ATOM   7413  C  CA    . ARG C 2  558  ? 46.134  -30.179 -75.153  1.00 69.35  ?  562  ARG C CA    1 
ATOM   7414  C  C     . ARG C 2  558  ? 45.367  -30.403 -76.448  1.00 76.97  ?  562  ARG C C     1 
ATOM   7415  O  O     . ARG C 2  558  ? 45.262  -29.489 -77.272  1.00 75.42  ?  562  ARG C O     1 
ATOM   7416  C  CB    . ARG C 2  558  ? 45.349  -29.242 -74.233  1.00 64.49  ?  562  ARG C CB    1 
ATOM   7417  C  CG    . ARG C 2  558  ? 46.138  -28.702 -73.059  1.00 60.89  ?  562  ARG C CG    1 
ATOM   7418  C  CD    . ARG C 2  558  ? 45.443  -27.505 -72.418  1.00 56.94  ?  562  ARG C CD    1 
ATOM   7419  N  NE    . ARG C 2  558  ? 45.467  -26.319 -73.273  1.00 54.87  ?  562  ARG C NE    1 
ATOM   7420  C  CZ    . ARG C 2  558  ? 44.404  -25.823 -73.899  1.00 54.53  ?  562  ARG C CZ    1 
ATOM   7421  N  NH1   . ARG C 2  558  ? 44.522  -24.741 -74.656  1.00 52.63  ?  562  ARG C NH1   1 
ATOM   7422  N  NH2   . ARG C 2  558  ? 43.222  -26.403 -73.763  1.00 55.47  ?  562  ARG C NH2   1 
ATOM   7423  N  N     . ARG C 2  559  ? 44.839  -31.612 -76.635  1.00 78.05  ?  563  ARG C N     1 
ATOM   7424  C  CA    . ARG C 2  559  ? 44.188  -31.951 -77.896  1.00 82.25  ?  563  ARG C CA    1 
ATOM   7425  C  C     . ARG C 2  559  ? 42.730  -32.355 -77.714  1.00 89.09  ?  563  ARG C C     1 
ATOM   7426  O  O     . ARG C 2  559  ? 41.842  -31.662 -78.222  1.00 90.91  ?  563  ARG C O     1 
ATOM   7427  C  CB    . ARG C 2  559  ? 44.976  -33.050 -78.625  1.00 82.08  ?  563  ARG C CB    1 
ATOM   7428  C  CG    . ARG C 2  559  ? 45.322  -34.268 -77.791  1.00 82.34  ?  563  ARG C CG    1 
ATOM   7429  C  CD    . ARG C 2  559  ? 45.713  -35.423 -78.688  1.00 89.74  ?  563  ARG C CD    1 
ATOM   7430  N  NE    . ARG C 2  559  ? 45.235  -36.700 -78.170  1.00 99.81  ?  563  ARG C NE    1 
ATOM   7431  C  CZ    . ARG C 2  559  ? 45.441  -37.870 -78.764  1.00 107.46 ?  563  ARG C CZ    1 
ATOM   7432  N  NH1   . ARG C 2  559  ? 46.127  -37.926 -79.898  1.00 109.73 ?  563  ARG C NH1   1 
ATOM   7433  N  NH2   . ARG C 2  559  ? 44.970  -38.984 -78.221  1.00 110.89 ?  563  ARG C NH2   1 
ATOM   7434  N  N     . LYS C 2  560  ? 42.450  -33.453 -77.018  1.00 92.29  ?  564  LYS C N     1 
ATOM   7435  C  CA    . LYS C 2  560  ? 41.098  -33.987 -76.907  1.00 93.51  ?  564  LYS C CA    1 
ATOM   7436  C  C     . LYS C 2  560  ? 40.756  -34.177 -75.439  1.00 96.57  ?  564  LYS C C     1 
ATOM   7437  O  O     . LYS C 2  560  ? 41.450  -34.911 -74.730  1.00 98.84  ?  564  LYS C O     1 
ATOM   7438  C  CB    . LYS C 2  560  ? 40.968  -35.315 -77.659  1.00 91.76  ?  564  LYS C CB    1 
ATOM   7439  C  CG    . LYS C 2  560  ? 40.916  -35.187 -79.173  1.00 92.93  ?  564  LYS C CG    1 
ATOM   7440  C  CD    . LYS C 2  560  ? 39.503  -34.894 -79.656  1.00 90.60  ?  564  LYS C CD    1 
ATOM   7441  C  CE    . LYS C 2  560  ? 39.397  -35.041 -81.166  1.00 87.75  ?  564  LYS C CE    1 
ATOM   7442  N  NZ    . LYS C 2  560  ? 37.996  -34.895 -81.648  1.00 78.79  ?  564  LYS C NZ    1 
ATOM   7443  N  N     . ALA C 2  561  ? 39.691  -33.510 -74.990  1.00 93.37  ?  565  ALA C N     1 
ATOM   7444  C  CA    . ALA C 2  561  ? 39.126  -33.716 -73.655  1.00 93.20  ?  565  ALA C CA    1 
ATOM   7445  C  C     . ALA C 2  561  ? 40.170  -33.533 -72.557  1.00 92.00  ?  565  ALA C C     1 
ATOM   7446  O  O     . ALA C 2  561  ? 40.118  -34.190 -71.515  1.00 95.43  ?  565  ALA C O     1 
ATOM   7447  C  CB    . ALA C 2  561  ? 38.465  -35.092 -73.544  1.00 96.15  ?  565  ALA C CB    1 
ATOM   7448  N  N     . GLY C 2  562  ? 41.131  -32.646 -72.788  1.00 88.75  ?  566  GLY C N     1 
ATOM   7449  C  CA    . GLY C 2  562  ? 42.086  -32.291 -71.758  1.00 90.62  ?  566  GLY C CA    1 
ATOM   7450  C  C     . GLY C 2  562  ? 43.101  -33.359 -71.414  1.00 87.31  ?  566  GLY C C     1 
ATOM   7451  O  O     . GLY C 2  562  ? 43.318  -33.664 -70.237  1.00 84.84  ?  566  GLY C O     1 
ATOM   7452  N  N     . GLU C 2  563  ? 43.724  -33.942 -72.431  1.00 85.32  ?  567  GLU C N     1 
ATOM   7453  C  CA    . GLU C 2  563  ? 44.891  -34.789 -72.248  1.00 85.89  ?  567  GLU C CA    1 
ATOM   7454  C  C     . GLU C 2  563  ? 46.122  -34.037 -72.729  1.00 83.22  ?  567  GLU C C     1 
ATOM   7455  O  O     . GLU C 2  563  ? 46.064  -33.298 -73.717  1.00 82.62  ?  567  GLU C O     1 
ATOM   7456  C  CB    . GLU C 2  563  ? 44.750  -36.117 -72.997  1.00 90.69  ?  567  GLU C CB    1 
ATOM   7457  C  CG    . GLU C 2  563  ? 44.238  -37.262 -72.134  1.00 92.89  ?  567  GLU C CG    1 
ATOM   7458  C  CD    . GLU C 2  563  ? 42.757  -37.150 -71.827  1.00 96.50  ?  567  GLU C CD    1 
ATOM   7459  O  OE1   . GLU C 2  563  ? 41.944  -37.286 -72.765  1.00 100.87 ?  567  GLU C OE1   1 
ATOM   7460  O  OE2   . GLU C 2  563  ? 42.406  -36.922 -70.649  1.00 94.66  ?  567  GLU C OE2   1 
ATOM   7461  N  N     . VAL C 2  564  ? 47.230  -34.217 -72.019  1.00 77.07  ?  568  VAL C N     1 
ATOM   7462  C  CA    . VAL C 2  564  ? 48.479  -33.525 -72.310  1.00 73.18  ?  568  VAL C CA    1 
ATOM   7463  C  C     . VAL C 2  564  ? 49.428  -34.507 -72.982  1.00 73.83  ?  568  VAL C C     1 
ATOM   7464  O  O     . VAL C 2  564  ? 49.664  -35.606 -72.467  1.00 76.32  ?  568  VAL C O     1 
ATOM   7465  C  CB    . VAL C 2  564  ? 49.089  -32.929 -71.030  1.00 68.10  ?  568  VAL C CB    1 
ATOM   7466  C  CG1   . VAL C 2  564  ? 48.218  -31.789 -70.531  1.00 67.53  ?  568  VAL C CG1   1 
ATOM   7467  C  CG2   . VAL C 2  564  ? 49.213  -33.990 -69.949  1.00 69.53  ?  568  VAL C CG2   1 
ATOM   7468  N  N     . GLU C 2  565  ? 49.945  -34.133 -74.150  1.00 76.09  ?  569  GLU C N     1 
ATOM   7469  C  CA    . GLU C 2  565  ? 50.712  -35.074 -74.953  1.00 82.01  ?  569  GLU C CA    1 
ATOM   7470  C  C     . GLU C 2  565  ? 51.845  -34.370 -75.682  1.00 86.55  ?  569  GLU C C     1 
ATOM   7471  O  O     . GLU C 2  565  ? 51.675  -33.255 -76.183  1.00 83.80  ?  569  GLU C O     1 
ATOM   7472  C  CB    . GLU C 2  565  ? 49.828  -35.782 -75.988  1.00 83.27  ?  569  GLU C CB    1 
ATOM   7473  C  CG    . GLU C 2  565  ? 48.561  -36.407 -75.438  1.00 88.47  ?  569  GLU C CG    1 
ATOM   7474  C  CD    . GLU C 2  565  ? 47.971  -37.427 -76.380  1.00 92.05  ?  569  GLU C CD    1 
ATOM   7475  O  OE1   . GLU C 2  565  ? 47.413  -38.432 -75.893  1.00 88.72  ?  569  GLU C OE1   1 
ATOM   7476  O  OE2   . GLU C 2  565  ? 48.080  -37.230 -77.607  1.00 92.57  ?  569  GLU C OE2   1 
ATOM   7477  N  N     . TYR C 2  566  ? 52.997  -35.035 -75.741  1.00 88.34  ?  570  TYR C N     1 
ATOM   7478  C  CA    . TYR C 2  566  ? 53.981  -34.722 -76.768  1.00 84.70  ?  570  TYR C CA    1 
ATOM   7479  C  C     . TYR C 2  566  ? 53.382  -35.056 -78.127  1.00 84.80  ?  570  TYR C C     1 
ATOM   7480  O  O     . TYR C 2  566  ? 52.890  -36.167 -78.344  1.00 85.08  ?  570  TYR C O     1 
ATOM   7481  C  CB    . TYR C 2  566  ? 55.267  -35.515 -76.532  1.00 81.90  ?  570  TYR C CB    1 
ATOM   7482  C  CG    . TYR C 2  566  ? 56.426  -34.693 -76.007  1.00 86.42  ?  570  TYR C CG    1 
ATOM   7483  C  CD1   . TYR C 2  566  ? 56.772  -33.486 -76.597  1.00 90.45  ?  570  TYR C CD1   1 
ATOM   7484  C  CD2   . TYR C 2  566  ? 57.176  -35.128 -74.921  1.00 80.60  ?  570  TYR C CD2   1 
ATOM   7485  C  CE1   . TYR C 2  566  ? 57.833  -32.736 -76.125  1.00 91.31  ?  570  TYR C CE1   1 
ATOM   7486  C  CE2   . TYR C 2  566  ? 58.237  -34.384 -74.440  1.00 80.10  ?  570  TYR C CE2   1 
ATOM   7487  C  CZ    . TYR C 2  566  ? 58.561  -33.189 -75.045  1.00 89.35  ?  570  TYR C CZ    1 
ATOM   7488  O  OH    . TYR C 2  566  ? 59.617  -32.445 -74.569  1.00 92.28  ?  570  TYR C OH    1 
ATOM   7489  N  N     . VAL C 2  567  ? 53.410  -34.092 -79.040  1.00 87.50  ?  571  VAL C N     1 
ATOM   7490  C  CA    . VAL C 2  567  ? 52.598  -34.165 -80.254  1.00 88.87  ?  571  VAL C CA    1 
ATOM   7491  C  C     . VAL C 2  567  ? 53.414  -33.648 -81.432  1.00 93.46  ?  571  VAL C C     1 
ATOM   7492  O  O     . VAL C 2  567  ? 54.361  -32.867 -81.256  1.00 89.00  ?  571  VAL C O     1 
ATOM   7493  C  CB    . VAL C 2  567  ? 51.291  -33.356 -80.103  1.00 85.29  ?  571  VAL C CB    1 
ATOM   7494  C  CG1   . VAL C 2  567  ? 51.393  -32.001 -80.791  1.00 86.83  ?  571  VAL C CG1   1 
ATOM   7495  C  CG2   . VAL C 2  567  ? 50.083  -34.149 -80.591  1.00 86.81  ?  571  VAL C CG2   1 
ATOM   7496  N  N     . PRO C 2  568  ? 53.089  -34.093 -82.647  1.00 99.14  ?  572  PRO C N     1 
ATOM   7497  C  CA    . PRO C 2  568  ? 53.763  -33.538 -83.828  1.00 94.73  ?  572  PRO C CA    1 
ATOM   7498  C  C     . PRO C 2  568  ? 53.411  -32.071 -84.018  1.00 86.42  ?  572  PRO C C     1 
ATOM   7499  O  O     . PRO C 2  568  ? 52.241  -31.689 -83.986  1.00 85.73  ?  572  PRO C O     1 
ATOM   7500  C  CB    . PRO C 2  568  ? 53.225  -34.395 -84.982  1.00 94.03  ?  572  PRO C CB    1 
ATOM   7501  C  CG    . PRO C 2  568  ? 51.937  -34.953 -84.470  1.00 90.60  ?  572  PRO C CG    1 
ATOM   7502  C  CD    . PRO C 2  568  ? 52.198  -35.208 -83.016  1.00 95.93  ?  572  PRO C CD    1 
ATOM   7503  N  N     . SER C 2  569  ? 54.441  -31.252 -84.227  1.00 85.61  ?  573  SER C N     1 
ATOM   7504  C  CA    . SER C 2  569  ? 54.218  -29.863 -84.602  1.00 85.57  ?  573  SER C CA    1 
ATOM   7505  C  C     . SER C 2  569  ? 53.550  -29.746 -85.962  1.00 86.63  ?  573  SER C C     1 
ATOM   7506  O  O     . SER C 2  569  ? 52.887  -28.738 -86.229  1.00 84.63  ?  573  SER C O     1 
ATOM   7507  C  CB    . SER C 2  569  ? 55.542  -29.103 -84.610  1.00 82.79  ?  573  SER C CB    1 
ATOM   7508  O  OG    . SER C 2  569  ? 56.375  -29.537 -83.552  1.00 84.01  ?  573  SER C OG    1 
ATOM   7509  N  N     . SER C 2  570  ? 53.715  -30.759 -86.819  1.00 88.02  ?  574  SER C N     1 
ATOM   7510  C  CA    . SER C 2  570  ? 53.132  -30.731 -88.156  1.00 85.21  ?  574  SER C CA    1 
ATOM   7511  C  C     . SER C 2  570  ? 51.632  -30.478 -88.101  1.00 86.04  ?  574  SER C C     1 
ATOM   7512  O  O     . SER C 2  570  ? 51.102  -29.647 -88.848  1.00 87.40  ?  574  SER C O     1 
ATOM   7513  C  CB    . SER C 2  570  ? 53.430  -32.044 -88.877  1.00 87.89  ?  574  SER C CB    1 
ATOM   7514  O  OG    . SER C 2  570  ? 53.157  -33.152 -88.037  1.00 86.12  ?  574  SER C OG    1 
ATOM   7515  N  N     . GLU C 2  571  ? 50.929  -31.177 -87.215  1.00 90.61  ?  575  GLU C N     1 
ATOM   7516  C  CA    . GLU C 2  571  ? 49.508  -30.928 -87.003  1.00 90.16  ?  575  GLU C CA    1 
ATOM   7517  C  C     . GLU C 2  571  ? 49.382  -30.108 -85.726  1.00 85.07  ?  575  GLU C C     1 
ATOM   7518  O  O     . GLU C 2  571  ? 49.494  -30.636 -84.617  1.00 83.86  ?  575  GLU C O     1 
ATOM   7519  C  CB    . GLU C 2  571  ? 48.730  -32.237 -86.913  1.00 92.00  ?  575  GLU C CB    1 
ATOM   7520  N  N     . VAL C 2  572  ? 49.134  -28.814 -85.898  1.00 85.38  ?  576  VAL C N     1 
ATOM   7521  C  CA    . VAL C 2  572  ? 48.783  -27.903 -84.815  1.00 75.67  ?  576  VAL C CA    1 
ATOM   7522  C  C     . VAL C 2  572  ? 47.791  -26.904 -85.385  1.00 77.32  ?  576  VAL C C     1 
ATOM   7523  O  O     . VAL C 2  572  ? 48.021  -26.331 -86.454  1.00 77.85  ?  576  VAL C O     1 
ATOM   7524  C  CB    . VAL C 2  572  ? 50.012  -27.186 -84.219  1.00 74.59  ?  576  VAL C CB    1 
ATOM   7525  C  CG1   . VAL C 2  572  ? 49.587  -25.942 -83.460  1.00 75.79  ?  576  VAL C CG1   1 
ATOM   7526  C  CG2   . VAL C 2  572  ? 50.778  -28.116 -83.292  1.00 77.25  ?  576  VAL C CG2   1 
ATOM   7527  N  N     . ASP C 2  573  ? 46.684  -26.699 -84.681  1.00 75.50  ?  577  ASP C N     1 
ATOM   7528  C  CA    . ASP C 2  573  ? 45.651  -25.789 -85.160  1.00 72.45  ?  577  ASP C CA    1 
ATOM   7529  C  C     . ASP C 2  573  ? 45.851  -24.381 -84.608  1.00 70.47  ?  577  ASP C C     1 
ATOM   7530  O  O     . ASP C 2  573  ? 46.005  -23.425 -85.374  1.00 70.54  ?  577  ASP C O     1 
ATOM   7531  C  CB    . ASP C 2  573  ? 44.266  -26.339 -84.815  1.00 74.35  ?  577  ASP C CB    1 
ATOM   7532  C  CG    . ASP C 2  573  ? 43.812  -27.409 -85.785  1.00 79.50  ?  577  ASP C CG    1 
ATOM   7533  O  OD1   . ASP C 2  573  ? 44.462  -27.561 -86.840  1.00 90.89  ?  577  ASP C OD1   1 
ATOM   7534  O  OD2   . ASP C 2  573  ? 42.804  -28.088 -85.506  1.00 79.67  ?  577  ASP C OD2   1 
ATOM   7535  N  N     . TYR C 2  574  ? 45.830  -24.237 -83.287  1.00 69.72  ?  578  TYR C N     1 
ATOM   7536  C  CA    . TYR C 2  574  ? 45.893  -22.936 -82.642  1.00 67.14  ?  578  TYR C CA    1 
ATOM   7537  C  C     . TYR C 2  574  ? 46.967  -22.940 -81.562  1.00 61.74  ?  578  TYR C C     1 
ATOM   7538  O  O     . TYR C 2  574  ? 47.517  -23.983 -81.199  1.00 60.19  ?  578  TYR C O     1 
ATOM   7539  C  CB    . TYR C 2  574  ? 44.533  -22.548 -82.046  1.00 63.29  ?  578  TYR C CB    1 
ATOM   7540  C  CG    . TYR C 2  574  ? 43.414  -22.518 -83.062  1.00 62.19  ?  578  TYR C CG    1 
ATOM   7541  C  CD1   . TYR C 2  574  ? 42.718  -23.671 -83.386  1.00 63.02  ?  578  TYR C CD1   1 
ATOM   7542  C  CD2   . TYR C 2  574  ? 43.055  -21.337 -83.696  1.00 63.71  ?  578  TYR C CD2   1 
ATOM   7543  C  CE1   . TYR C 2  574  ? 41.700  -23.655 -84.315  1.00 67.02  ?  578  TYR C CE1   1 
ATOM   7544  C  CE2   . TYR C 2  574  ? 42.032  -21.310 -84.626  1.00 68.08  ?  578  TYR C CE2   1 
ATOM   7545  C  CZ    . TYR C 2  574  ? 41.358  -22.473 -84.932  1.00 70.86  ?  578  TYR C CZ    1 
ATOM   7546  O  OH    . TYR C 2  574  ? 40.338  -22.459 -85.856  1.00 68.77  ?  578  TYR C OH    1 
ATOM   7547  N  N     . MET C 2  575  ? 47.282  -21.744 -81.067  1.00 56.67  ?  579  MET C N     1 
ATOM   7548  C  CA    . MET C 2  575  ? 48.246  -21.574 -79.991  1.00 56.82  ?  579  MET C CA    1 
ATOM   7549  C  C     . MET C 2  575  ? 47.783  -20.452 -79.074  1.00 53.44  ?  579  MET C C     1 
ATOM   7550  O  O     . MET C 2  575  ? 47.141  -19.496 -79.515  1.00 53.44  ?  579  MET C O     1 
ATOM   7551  C  CB    . MET C 2  575  ? 49.652  -21.266 -80.529  1.00 59.35  ?  579  MET C CB    1 
ATOM   7552  C  CG    . MET C 2  575  ? 50.719  -21.155 -79.448  1.00 60.39  ?  579  MET C CG    1 
ATOM   7553  S  SD    . MET C 2  575  ? 52.345  -20.697 -80.066  1.00 67.00  ?  579  MET C SD    1 
ATOM   7554  C  CE    . MET C 2  575  ? 53.246  -20.505 -78.531  1.00 60.15  ?  579  MET C CE    1 
ATOM   7555  N  N     . ASP C 2  576  ? 48.115  -20.585 -77.790  1.00 52.00  ?  580  ASP C N     1 
ATOM   7556  C  CA    . ASP C 2  576  ? 47.792  -19.560 -76.806  1.00 49.80  ?  580  ASP C CA    1 
ATOM   7557  C  C     . ASP C 2  576  ? 48.338  -18.208 -77.239  1.00 49.87  ?  580  ASP C C     1 
ATOM   7558  O  O     . ASP C 2  576  ? 49.419  -18.115 -77.825  1.00 50.92  ?  580  ASP C O     1 
ATOM   7559  C  CB    . ASP C 2  576  ? 48.371  -19.938 -75.443  1.00 50.39  ?  580  ASP C CB    1 
ATOM   7560  C  CG    . ASP C 2  576  ? 47.844  -21.255 -74.933  1.00 54.26  ?  580  ASP C CG    1 
ATOM   7561  O  OD1   . ASP C 2  576  ? 47.235  -21.993 -75.729  1.00 58.99  ?  580  ASP C OD1   1 
ATOM   7562  O  OD2   . ASP C 2  576  ? 48.047  -21.558 -73.740  1.00 54.58  ?  580  ASP C OD2   1 
ATOM   7563  N  N     . VAL C 2  577  ? 47.575  -17.154 -76.948  1.00 50.65  ?  581  VAL C N     1 
ATOM   7564  C  CA    . VAL C 2  577  ? 47.992  -15.814 -77.339  1.00 48.35  ?  581  VAL C CA    1 
ATOM   7565  C  C     . VAL C 2  577  ? 49.053  -15.249 -76.406  1.00 48.32  ?  581  VAL C C     1 
ATOM   7566  O  O     . VAL C 2  577  ? 49.733  -14.284 -76.775  1.00 54.44  ?  581  VAL C O     1 
ATOM   7567  C  CB    . VAL C 2  577  ? 46.781  -14.870 -77.408  1.00 46.48  ?  581  VAL C CB    1 
ATOM   7568  C  CG1   . VAL C 2  577  ? 45.787  -15.371 -78.438  1.00 49.39  ?  581  VAL C CG1   1 
ATOM   7569  C  CG2   . VAL C 2  577  ? 46.122  -14.740 -76.046  1.00 44.25  ?  581  VAL C CG2   1 
ATOM   7570  N  N     . SER C 2  578  ? 49.230  -15.834 -75.224  1.00 44.48  ?  582  SER C N     1 
ATOM   7571  C  CA    . SER C 2  578  ? 50.239  -15.403 -74.265  1.00 47.12  ?  582  SER C CA    1 
ATOM   7572  C  C     . SER C 2  578  ? 50.223  -16.326 -73.058  1.00 47.93  ?  582  SER C C     1 
ATOM   7573  O  O     . SER C 2  578  ? 49.244  -17.051 -72.849  1.00 46.65  ?  582  SER C O     1 
ATOM   7574  C  CB    . SER C 2  578  ? 49.988  -13.968 -73.801  1.00 49.75  ?  582  SER C CB    1 
ATOM   7575  O  OG    . SER C 2  578  ? 49.324  -13.954 -72.550  1.00 46.45  ?  582  SER C OG    1 
ATOM   7576  N  N     . PRO C 2  579  ? 51.274  -16.334 -72.237  1.00 46.93  ?  583  PRO C N     1 
ATOM   7577  C  CA    . PRO C 2  579  ? 51.128  -16.901 -70.893  1.00 42.12  ?  583  PRO C CA    1 
ATOM   7578  C  C     . PRO C 2  579  ? 50.184  -16.025 -70.091  1.00 45.91  ?  583  PRO C C     1 
ATOM   7579  O  O     . PRO C 2  579  ? 49.719  -15.005 -70.608  1.00 48.45  ?  583  PRO C O     1 
ATOM   7580  C  CB    . PRO C 2  579  ? 52.556  -16.878 -70.340  1.00 41.32  ?  583  PRO C CB    1 
ATOM   7581  C  CG    . PRO C 2  579  ? 53.234  -15.803 -71.108  1.00 43.83  ?  583  PRO C CG    1 
ATOM   7582  C  CD    . PRO C 2  579  ? 52.641  -15.847 -72.483  1.00 45.36  ?  583  PRO C CD    1 
ATOM   7583  N  N     . ARG C 2  580  ? 49.869  -16.412 -68.855  1.00 42.99  ?  584  ARG C N     1 
ATOM   7584  C  CA    . ARG C 2  580  ? 48.916  -15.691 -68.010  1.00 42.94  ?  584  ARG C CA    1 
ATOM   7585  C  C     . ARG C 2  580  ? 47.513  -15.737 -68.610  1.00 39.04  ?  584  ARG C C     1 
ATOM   7586  O  O     . ARG C 2  580  ? 46.548  -15.299 -67.980  1.00 40.03  ?  584  ARG C O     1 
ATOM   7587  C  CB    . ARG C 2  580  ? 49.383  -14.247 -67.752  1.00 42.22  ?  584  ARG C CB    1 
ATOM   7588  C  CG    . ARG C 2  580  ? 48.710  -13.130 -68.544  1.00 48.02  ?  584  ARG C CG    1 
ATOM   7589  C  CD    . ARG C 2  580  ? 49.349  -11.778 -68.216  1.00 44.42  ?  584  ARG C CD    1 
ATOM   7590  N  NE    . ARG C 2  580  ? 49.001  -10.737 -69.182  1.00 50.07  ?  584  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C 2  580  ? 49.529  -9.517  -69.192  1.00 52.61  ?  584  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C 2  580  ? 49.156  -8.636  -70.107  1.00 47.70  ?  584  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C 2  580  ? 50.432  -9.172  -68.284  1.00 57.69  ?  584  ARG C NH2   1 
ATOM   7594  N  N     . GLN C 2  581  ? 47.394  -16.300 -69.817  1.00 39.16  ?  585  GLN C N     1 
ATOM   7595  C  CA    . GLN C 2  581  ? 46.095  -16.476 -70.457  1.00 38.55  ?  585  GLN C CA    1 
ATOM   7596  C  C     . GLN C 2  581  ? 45.177  -17.372 -69.640  1.00 37.08  ?  585  GLN C C     1 
ATOM   7597  O  O     . GLN C 2  581  ? 43.955  -17.194 -69.663  1.00 47.74  ?  585  GLN C O     1 
ATOM   7598  C  CB    . GLN C 2  581  ? 46.291  -17.050 -71.859  1.00 39.27  ?  585  GLN C CB    1 
ATOM   7599  C  CG    . GLN C 2  581  ? 45.047  -17.604 -72.522  1.00 36.21  ?  585  GLN C CG    1 
ATOM   7600  C  CD    . GLN C 2  581  ? 45.260  -17.860 -73.996  1.00 42.97  ?  585  GLN C CD    1 
ATOM   7601  O  OE1   . GLN C 2  581  ? 46.330  -17.584 -74.530  1.00 48.85  ?  585  GLN C OE1   1 
ATOM   7602  N  NE2   . GLN C 2  581  ? 44.243  -18.384 -74.665  1.00 42.89  ?  585  GLN C NE2   1 
ATOM   7603  N  N     . MET C 2  582  ? 45.737  -18.327 -68.909  1.00 34.40  ?  586  MET C N     1 
ATOM   7604  C  CA    . MET C 2  582  ? 44.949  -19.224 -68.081  1.00 37.71  ?  586  MET C CA    1 
ATOM   7605  C  C     . MET C 2  582  ? 44.729  -18.688 -66.678  1.00 38.74  ?  586  MET C C     1 
ATOM   7606  O  O     . MET C 2  582  ? 44.143  -19.386 -65.848  1.00 40.56  ?  586  MET C O     1 
ATOM   7607  C  CB    . MET C 2  582  ? 45.625  -20.592 -67.992  1.00 37.69  ?  586  MET C CB    1 
ATOM   7608  C  CG    . MET C 2  582  ? 46.832  -20.610 -67.081  1.00 35.59  ?  586  MET C CG    1 
ATOM   7609  S  SD    . MET C 2  582  ? 47.295  -22.269 -66.569  1.00 34.22  ?  586  MET C SD    1 
ATOM   7610  C  CE    . MET C 2  582  ? 48.623  -21.907 -65.430  1.00 34.90  ?  586  MET C CE    1 
ATOM   7611  N  N     . VAL C 2  583  ? 45.177  -17.472 -66.393  1.00 35.92  ?  587  VAL C N     1 
ATOM   7612  C  CA    . VAL C 2  583  ? 45.286  -16.990 -65.028  1.00 34.76  ?  587  VAL C CA    1 
ATOM   7613  C  C     . VAL C 2  583  ? 44.434  -15.733 -64.861  1.00 35.67  ?  587  VAL C C     1 
ATOM   7614  O  O     . VAL C 2  583  ? 44.101  -15.043 -65.827  1.00 35.82  ?  587  VAL C O     1 
ATOM   7615  C  CB    . VAL C 2  583  ? 46.770  -16.753 -64.669  1.00 35.36  ?  587  VAL C CB    1 
ATOM   7616  C  CG1   . VAL C 2  583  ? 47.062  -15.313 -64.332  1.00 34.98  ?  587  VAL C CG1   1 
ATOM   7617  C  CG2   . VAL C 2  583  ? 47.201  -17.686 -63.559  1.00 35.99  ?  587  VAL C CG2   1 
ATOM   7618  N  N     . SER C 2  584  ? 44.041  -15.466 -63.616  1.00 33.91  ?  588  SER C N     1 
ATOM   7619  C  CA    . SER C 2  584  ? 43.198  -14.323 -63.308  1.00 31.49  ?  588  SER C CA    1 
ATOM   7620  C  C     . SER C 2  584  ? 44.033  -13.050 -63.206  1.00 32.83  ?  588  SER C C     1 
ATOM   7621  O  O     . SER C 2  584  ? 45.242  -13.040 -63.437  1.00 35.46  ?  588  SER C O     1 
ATOM   7622  C  CB    . SER C 2  584  ? 42.439  -14.553 -62.007  1.00 34.49  ?  588  SER C CB    1 
ATOM   7623  O  OG    . SER C 2  584  ? 43.291  -14.362 -60.892  1.00 34.36  ?  588  SER C OG    1 
ATOM   7624  N  N     . VAL C 2  585  ? 43.378  -11.952 -62.837  1.00 31.18  ?  589  VAL C N     1 
ATOM   7625  C  CA    . VAL C 2  585  ? 44.094  -10.692 -62.681  1.00 28.99  ?  589  VAL C CA    1 
ATOM   7626  C  C     . VAL C 2  585  ? 44.984  -10.734 -61.444  1.00 31.15  ?  589  VAL C C     1 
ATOM   7627  O  O     . VAL C 2  585  ? 46.166  -10.382 -61.501  1.00 33.94  ?  589  VAL C O     1 
ATOM   7628  C  CB    . VAL C 2  585  ? 43.104  -9.516  -62.634  1.00 31.22  ?  589  VAL C CB    1 
ATOM   7629  C  CG1   . VAL C 2  585  ? 43.826  -8.234  -62.273  1.00 33.95  ?  589  VAL C CG1   1 
ATOM   7630  C  CG2   . VAL C 2  585  ? 42.405  -9.371  -63.971  1.00 35.01  ?  589  VAL C CG2   1 
ATOM   7631  N  N     . ALA C 2  586  ? 44.435  -11.171 -60.310  1.00 32.29  ?  590  ALA C N     1 
ATOM   7632  C  CA    . ALA C 2  586  ? 45.224  -11.213 -59.083  1.00 30.09  ?  590  ALA C CA    1 
ATOM   7633  C  C     . ALA C 2  586  ? 46.362  -12.218 -59.185  1.00 32.57  ?  590  ALA C C     1 
ATOM   7634  O  O     . ALA C 2  586  ? 47.452  -11.985 -58.652  1.00 33.81  ?  590  ALA C O     1 
ATOM   7635  C  CB    . ALA C 2  586  ? 44.329  -11.540 -57.890  1.00 32.46  ?  590  ALA C CB    1 
ATOM   7636  N  N     . THR C 2  587  ? 46.130  -13.346 -59.861  1.00 33.19  ?  591  THR C N     1 
ATOM   7637  C  CA    . THR C 2  587  ? 47.193  -14.332 -60.011  1.00 30.99  ?  591  THR C CA    1 
ATOM   7638  C  C     . THR C 2  587  ? 48.274  -13.848 -60.966  1.00 31.08  ?  591  THR C C     1 
ATOM   7639  O  O     . THR C 2  587  ? 49.455  -14.144 -60.760  1.00 33.43  ?  591  THR C O     1 
ATOM   7640  C  CB    . THR C 2  587  ? 46.622  -15.664 -60.495  1.00 31.49  ?  591  THR C CB    1 
ATOM   7641  O  OG1   . THR C 2  587  ? 45.419  -15.955 -59.780  1.00 41.06  ?  591  THR C OG1   1 
ATOM   7642  C  CG2   . THR C 2  587  ? 47.615  -16.775 -60.241  1.00 29.56  ?  591  THR C CG2   1 
ATOM   7643  N  N     . ALA C 2  588  ? 47.898  -13.099 -62.003  1.00 29.81  ?  592  ALA C N     1 
ATOM   7644  C  CA    . ALA C 2  588  ? 48.885  -12.562 -62.931  1.00 30.36  ?  592  ALA C CA    1 
ATOM   7645  C  C     . ALA C 2  588  ? 49.817  -11.551 -62.283  1.00 30.54  ?  592  ALA C C     1 
ATOM   7646  O  O     . ALA C 2  588  ? 50.808  -11.166 -62.906  1.00 28.80  ?  592  ALA C O     1 
ATOM   7647  C  CB    . ALA C 2  588  ? 48.192  -11.918 -64.128  1.00 33.26  ?  592  ALA C CB    1 
ATOM   7648  N  N     . MET C 2  589  ? 49.528  -11.118 -61.062  1.00 31.71  ?  593  MET C N     1 
ATOM   7649  C  CA    . MET C 2  589  ? 50.345  -10.153 -60.347  1.00 31.39  ?  593  MET C CA    1 
ATOM   7650  C  C     . MET C 2  589  ? 51.367  -10.797 -59.422  1.00 30.96  ?  593  MET C C     1 
ATOM   7651  O  O     . MET C 2  589  ? 52.057  -10.080 -58.695  1.00 34.76  ?  593  MET C O     1 
ATOM   7652  C  CB    . MET C 2  589  ? 49.449  -9.205  -59.549  1.00 32.20  ?  593  MET C CB    1 
ATOM   7653  C  CG    . MET C 2  589  ? 48.646  -8.256  -60.417  1.00 31.81  ?  593  MET C CG    1 
ATOM   7654  S  SD    . MET C 2  589  ? 47.529  -7.228  -59.462  1.00 34.63  ?  593  MET C SD    1 
ATOM   7655  C  CE    . MET C 2  589  ? 48.642  -6.551  -58.246  1.00 37.59  ?  593  MET C CE    1 
ATOM   7656  N  N     . ILE C 2  590  ? 51.482  -12.120 -59.422  1.00 30.76  ?  594  ILE C N     1 
ATOM   7657  C  CA    . ILE C 2  590  ? 52.447  -12.822 -58.581  1.00 30.25  ?  594  ILE C CA    1 
ATOM   7658  C  C     . ILE C 2  590  ? 53.737  -12.975 -59.383  1.00 31.00  ?  594  ILE C C     1 
ATOM   7659  O  O     . ILE C 2  590  ? 53.749  -13.728 -60.369  1.00 29.69  ?  594  ILE C O     1 
ATOM   7660  C  CB    . ILE C 2  590  ? 51.913  -14.185 -58.128  1.00 30.29  ?  594  ILE C CB    1 
ATOM   7661  C  CG1   . ILE C 2  590  ? 50.549  -14.024 -57.459  1.00 32.80  ?  594  ILE C CG1   1 
ATOM   7662  C  CG2   . ILE C 2  590  ? 52.889  -14.841 -57.170  1.00 30.40  ?  594  ILE C CG2   1 
ATOM   7663  C  CD1   . ILE C 2  590  ? 49.913  -15.327 -57.051  1.00 30.93  ?  594  ILE C CD1   1 
ATOM   7664  N  N     . PRO C 2  591  ? 54.818  -12.296 -59.013  1.00 28.22  ?  595  PRO C N     1 
ATOM   7665  C  CA    . PRO C 2  591  ? 56.084  -12.496 -59.725  1.00 28.80  ?  595  PRO C CA    1 
ATOM   7666  C  C     . PRO C 2  591  ? 56.635  -13.887 -59.457  1.00 28.53  ?  595  PRO C C     1 
ATOM   7667  O  O     . PRO C 2  591  ? 56.483  -14.432 -58.364  1.00 25.85  ?  595  PRO C O     1 
ATOM   7668  C  CB    . PRO C 2  591  ? 56.989  -11.407 -59.142  1.00 28.05  ?  595  PRO C CB    1 
ATOM   7669  C  CG    . PRO C 2  591  ? 56.441  -11.177 -57.777  1.00 30.11  ?  595  PRO C CG    1 
ATOM   7670  C  CD    . PRO C 2  591  ? 54.955  -11.347 -57.898  1.00 30.63  ?  595  PRO C CD    1 
ATOM   7671  N  N     . PHE C 2  592  ? 57.273  -14.463 -60.474  1.00 31.12  ?  596  PHE C N     1 
ATOM   7672  C  CA    . PHE C 2  592  ? 57.829  -15.815 -60.378  1.00 33.33  ?  596  PHE C CA    1 
ATOM   7673  C  C     . PHE C 2  592  ? 56.764  -16.816 -59.935  1.00 31.53  ?  596  PHE C C     1 
ATOM   7674  O  O     . PHE C 2  592  ? 57.023  -17.720 -59.139  1.00 31.48  ?  596  PHE C O     1 
ATOM   7675  C  CB    . PHE C 2  592  ? 59.032  -15.855 -59.433  1.00 32.58  ?  596  PHE C CB    1 
ATOM   7676  C  CG    . PHE C 2  592  ? 60.145  -14.931 -59.823  1.00 33.58  ?  596  PHE C CG    1 
ATOM   7677  C  CD1   . PHE C 2  592  ? 60.859  -15.140 -60.988  1.00 32.62  ?  596  PHE C CD1   1 
ATOM   7678  C  CD2   . PHE C 2  592  ? 60.488  -13.860 -59.016  1.00 33.23  ?  596  PHE C CD2   1 
ATOM   7679  C  CE1   . PHE C 2  592  ? 61.887  -14.293 -61.346  1.00 32.89  ?  596  PHE C CE1   1 
ATOM   7680  C  CE2   . PHE C 2  592  ? 61.516  -13.010 -59.370  1.00 32.06  ?  596  PHE C CE2   1 
ATOM   7681  C  CZ    . PHE C 2  592  ? 62.216  -13.229 -60.536  1.00 33.56  ?  596  PHE C CZ    1 
ATOM   7682  N  N     . LEU C 2  593  ? 55.544  -16.630 -60.443  1.00 30.95  ?  597  LEU C N     1 
ATOM   7683  C  CA    . LEU C 2  593  ? 54.444  -17.523 -60.095  1.00 28.31  ?  597  LEU C CA    1 
ATOM   7684  C  C     . LEU C 2  593  ? 54.784  -18.966 -60.428  1.00 29.95  ?  597  LEU C C     1 
ATOM   7685  O  O     . LEU C 2  593  ? 54.458  -19.882 -59.666  1.00 34.43  ?  597  LEU C O     1 
ATOM   7686  C  CB    . LEU C 2  593  ? 53.177  -17.095 -60.830  1.00 30.53  ?  597  LEU C CB    1 
ATOM   7687  C  CG    . LEU C 2  593  ? 51.980  -18.042 -60.759  1.00 28.03  ?  597  LEU C CG    1 
ATOM   7688  C  CD1   . LEU C 2  593  ? 51.224  -17.845 -59.464  1.00 27.20  ?  597  LEU C CD1   1 
ATOM   7689  C  CD2   . LEU C 2  593  ? 51.075  -17.854 -61.961  1.00 26.99  ?  597  LEU C CD2   1 
ATOM   7690  N  N     . GLU C 2  594  ? 55.465  -19.179 -61.554  1.00 34.39  ?  598  GLU C N     1 
ATOM   7691  C  CA    . GLU C 2  594  ? 55.810  -20.516 -62.016  1.00 32.64  ?  598  GLU C CA    1 
ATOM   7692  C  C     . GLU C 2  594  ? 56.710  -21.267 -61.042  1.00 32.61  ?  598  GLU C C     1 
ATOM   7693  O  O     . GLU C 2  594  ? 56.859  -22.484 -61.171  1.00 35.01  ?  598  GLU C O     1 
ATOM   7694  C  CB    . GLU C 2  594  ? 56.485  -20.417 -63.384  1.00 33.86  ?  598  GLU C CB    1 
ATOM   7695  C  CG    . GLU C 2  594  ? 57.732  -19.533 -63.407  1.00 33.68  ?  598  GLU C CG    1 
ATOM   7696  C  CD    . GLU C 2  594  ? 57.443  -18.067 -63.708  1.00 34.04  ?  598  GLU C CD    1 
ATOM   7697  O  OE1   . GLU C 2  594  ? 56.287  -17.624 -63.545  1.00 30.21  ?  598  GLU C OE1   1 
ATOM   7698  O  OE2   . GLU C 2  594  ? 58.383  -17.356 -64.119  1.00 39.76  ?  598  GLU C OE2   1 
ATOM   7699  N  N     . HIS C 2  595  ? 57.325  -20.571 -60.090  1.00 34.56  ?  599  HIS C N     1 
ATOM   7700  C  CA    . HIS C 2  595  ? 58.182  -21.174 -59.080  1.00 32.69  ?  599  HIS C CA    1 
ATOM   7701  C  C     . HIS C 2  595  ? 57.453  -21.450 -57.773  1.00 32.73  ?  599  HIS C C     1 
ATOM   7702  O  O     . HIS C 2  595  ? 58.090  -21.840 -56.792  1.00 35.49  ?  599  HIS C O     1 
ATOM   7703  C  CB    . HIS C 2  595  ? 59.390  -20.277 -58.821  1.00 33.97  ?  599  HIS C CB    1 
ATOM   7704  C  CG    . HIS C 2  595  ? 60.179  -19.956 -60.049  1.00 34.22  ?  599  HIS C CG    1 
ATOM   7705  N  ND1   . HIS C 2  595  ? 61.216  -20.745 -60.496  1.00 37.41  ?  599  HIS C ND1   1 
ATOM   7706  C  CD2   . HIS C 2  595  ? 60.081  -18.933 -60.928  1.00 32.39  ?  599  HIS C CD2   1 
ATOM   7707  C  CE1   . HIS C 2  595  ? 61.722  -20.222 -61.597  1.00 36.74  ?  599  HIS C CE1   1 
ATOM   7708  N  NE2   . HIS C 2  595  ? 61.051  -19.121 -61.881  1.00 34.71  ?  599  HIS C NE2   1 
ATOM   7709  N  N     . ASP C 2  596  ? 56.147  -21.223 -57.723  1.00 31.07  ?  600  ASP C N     1 
ATOM   7710  C  CA    . ASP C 2  596  ? 55.369  -21.390 -56.506  1.00 31.89  ?  600  ASP C CA    1 
ATOM   7711  C  C     . ASP C 2  596  ? 54.376  -22.528 -56.669  1.00 33.76  ?  600  ASP C C     1 
ATOM   7712  O  O     . ASP C 2  596  ? 53.763  -22.680 -57.728  1.00 34.77  ?  600  ASP C O     1 
ATOM   7713  C  CB    . ASP C 2  596  ? 54.620  -20.106 -56.154  1.00 30.60  ?  600  ASP C CB    1 
ATOM   7714  C  CG    . ASP C 2  596  ? 55.548  -18.957 -55.868  1.00 31.31  ?  600  ASP C CG    1 
ATOM   7715  O  OD1   . ASP C 2  596  ? 56.609  -19.184 -55.262  1.00 37.60  ?  600  ASP C OD1   1 
ATOM   7716  O  OD2   . ASP C 2  596  ? 55.221  -17.822 -56.253  1.00 33.28  ?  600  ASP C OD2   1 
ATOM   7717  N  N     . ASP C 2  597  ? 54.217  -23.324 -55.618  1.00 35.20  ?  601  ASP C N     1 
ATOM   7718  C  CA    . ASP C 2  597  ? 53.232  -24.390 -55.657  1.00 33.79  ?  601  ASP C CA    1 
ATOM   7719  C  C     . ASP C 2  597  ? 51.825  -23.803 -55.662  1.00 33.96  ?  601  ASP C C     1 
ATOM   7720  O  O     . ASP C 2  597  ? 51.565  -22.745 -55.083  1.00 39.18  ?  601  ASP C O     1 
ATOM   7721  C  CB    . ASP C 2  597  ? 53.409  -25.335 -54.471  1.00 37.45  ?  601  ASP C CB    1 
ATOM   7722  C  CG    . ASP C 2  597  ? 53.097  -26.774 -54.827  1.00 39.33  ?  601  ASP C CG    1 
ATOM   7723  O  OD1   . ASP C 2  597  ? 52.495  -27.004 -55.896  1.00 36.14  ?  601  ASP C OD1   1 
ATOM   7724  O  OD2   . ASP C 2  597  ? 53.451  -27.674 -54.041  1.00 41.11  ?  601  ASP C OD2   1 
ATOM   7725  N  N     . ALA C 2  598  ? 50.912  -24.518 -56.323  1.00 32.19  ?  602  ALA C N     1 
ATOM   7726  C  CA    . ALA C 2  598  ? 49.575  -23.994 -56.574  1.00 32.76  ?  602  ALA C CA    1 
ATOM   7727  C  C     . ALA C 2  598  ? 48.860  -23.585 -55.292  1.00 33.39  ?  602  ALA C C     1 
ATOM   7728  O  O     . ALA C 2  598  ? 48.045  -22.658 -55.311  1.00 38.91  ?  602  ALA C O     1 
ATOM   7729  C  CB    . ALA C 2  598  ? 48.751  -25.027 -57.337  1.00 32.35  ?  602  ALA C CB    1 
ATOM   7730  N  N     . ASN C 2  599  ? 49.147  -24.251 -54.174  1.00 35.63  ?  603  ASN C N     1 
ATOM   7731  C  CA    . ASN C 2  599  ? 48.475  -23.909 -52.924  1.00 33.68  ?  603  ASN C CA    1 
ATOM   7732  C  C     . ASN C 2  599  ? 48.914  -22.544 -52.414  1.00 34.19  ?  603  ASN C C     1 
ATOM   7733  O  O     . ASN C 2  599  ? 48.078  -21.699 -52.067  1.00 45.64  ?  603  ASN C O     1 
ATOM   7734  C  CB    . ASN C 2  599  ? 48.739  -24.986 -51.873  1.00 42.69  ?  603  ASN C CB    1 
ATOM   7735  C  CG    . ASN C 2  599  ? 47.911  -26.229 -52.099  1.00 42.68  ?  603  ASN C CG    1 
ATOM   7736  O  OD1   . ASN C 2  599  ? 46.839  -26.169 -52.694  1.00 42.82  ?  603  ASN C OD1   1 
ATOM   7737  N  ND2   . ASN C 2  599  ? 48.402  -27.364 -51.621  1.00 49.06  ?  603  ASN C ND2   1 
ATOM   7738  N  N     . ARG C 2  600  ? 50.226  -22.309 -52.349  1.00 32.39  ?  604  ARG C N     1 
ATOM   7739  C  CA    . ARG C 2  600  ? 50.698  -21.004 -51.907  1.00 34.45  ?  604  ARG C CA    1 
ATOM   7740  C  C     . ARG C 2  600  ? 50.352  -19.920 -52.919  1.00 33.35  ?  604  ARG C C     1 
ATOM   7741  O  O     . ARG C 2  600  ? 50.134  -18.768 -52.538  1.00 34.45  ?  604  ARG C O     1 
ATOM   7742  C  CB    . ARG C 2  600  ? 52.204  -21.036 -51.647  1.00 32.90  ?  604  ARG C CB    1 
ATOM   7743  C  CG    . ARG C 2  600  ? 52.660  -22.065 -50.631  1.00 33.58  ?  604  ARG C CG    1 
ATOM   7744  C  CD    . ARG C 2  600  ? 51.757  -22.150 -49.413  1.00 37.93  ?  604  ARG C CD    1 
ATOM   7745  N  NE    . ARG C 2  600  ? 52.124  -21.228 -48.342  1.00 39.05  ?  604  ARG C NE    1 
ATOM   7746  C  CZ    . ARG C 2  600  ? 51.921  -21.473 -47.050  1.00 39.34  ?  604  ARG C CZ    1 
ATOM   7747  N  NH1   . ARG C 2  600  ? 51.373  -22.616 -46.670  1.00 33.19  ?  604  ARG C NH1   1 
ATOM   7748  N  NH2   . ARG C 2  600  ? 52.274  -20.582 -46.136  1.00 40.17  ?  604  ARG C NH2   1 
ATOM   7749  N  N     . ALA C 2  601  ? 50.292  -20.270 -54.205  1.00 33.06  ?  605  ALA C N     1 
ATOM   7750  C  CA    . ALA C 2  601  ? 49.855  -19.309 -55.211  1.00 30.35  ?  605  ALA C CA    1 
ATOM   7751  C  C     . ALA C 2  601  ? 48.394  -18.931 -55.009  1.00 33.54  ?  605  ALA C C     1 
ATOM   7752  O  O     . ALA C 2  601  ? 48.005  -17.780 -55.235  1.00 36.55  ?  605  ALA C O     1 
ATOM   7753  C  CB    . ALA C 2  601  ? 50.075  -19.877 -56.610  1.00 29.45  ?  605  ALA C CB    1 
ATOM   7754  N  N     . LEU C 2  602  ? 47.568  -19.891 -54.596  1.00 35.53  ?  606  LEU C N     1 
ATOM   7755  C  CA    . LEU C 2  602  ? 46.200  -19.572 -54.212  1.00 31.39  ?  606  LEU C CA    1 
ATOM   7756  C  C     . LEU C 2  602  ? 46.186  -18.632 -53.015  1.00 34.82  ?  606  LEU C C     1 
ATOM   7757  O  O     . LEU C 2  602  ? 45.487  -17.613 -53.021  1.00 36.98  ?  606  LEU C O     1 
ATOM   7758  C  CB    . LEU C 2  602  ? 45.433  -20.860 -53.909  1.00 31.05  ?  606  LEU C CB    1 
ATOM   7759  C  CG    . LEU C 2  602  ? 43.970  -20.797 -53.472  1.00 35.20  ?  606  LEU C CG    1 
ATOM   7760  C  CD1   . LEU C 2  602  ? 43.268  -22.037 -53.956  1.00 33.60  ?  606  LEU C CD1   1 
ATOM   7761  C  CD2   . LEU C 2  602  ? 43.836  -20.688 -51.960  1.00 39.29  ?  606  LEU C CD2   1 
ATOM   7762  N  N     . MET C 2  603  ? 46.958  -18.960 -51.976  1.00 36.39  ?  607  MET C N     1 
ATOM   7763  C  CA    . MET C 2  603  ? 47.008  -18.092 -50.804  1.00 35.80  ?  607  MET C CA    1 
ATOM   7764  C  C     . MET C 2  603  ? 47.449  -16.681 -51.165  1.00 31.65  ?  607  MET C C     1 
ATOM   7765  O  O     . MET C 2  603  ? 47.004  -15.715 -50.541  1.00 32.47  ?  607  MET C O     1 
ATOM   7766  C  CB    . MET C 2  603  ? 47.944  -18.680 -49.751  1.00 38.25  ?  607  MET C CB    1 
ATOM   7767  C  CG    . MET C 2  603  ? 47.488  -20.009 -49.189  1.00 40.35  ?  607  MET C CG    1 
ATOM   7768  S  SD    . MET C 2  603  ? 48.484  -20.522 -47.783  1.00 48.83  ?  607  MET C SD    1 
ATOM   7769  C  CE    . MET C 2  603  ? 47.698  -22.071 -47.369  1.00 53.14  ?  607  MET C CE    1 
ATOM   7770  N  N     . GLY C 2  604  ? 48.313  -16.544 -52.164  1.00 33.56  ?  608  GLY C N     1 
ATOM   7771  C  CA    . GLY C 2  604  ? 48.818  -15.251 -52.573  1.00 31.58  ?  608  GLY C CA    1 
ATOM   7772  C  C     . GLY C 2  604  ? 47.783  -14.422 -53.299  1.00 32.65  ?  608  GLY C C     1 
ATOM   7773  O  O     . GLY C 2  604  ? 47.691  -13.210 -53.088  1.00 32.26  ?  608  GLY C O     1 
ATOM   7774  N  N     . ALA C 2  605  ? 46.996  -15.070 -54.158  1.00 31.27  ?  609  ALA C N     1 
ATOM   7775  C  CA    . ALA C 2  605  ? 45.944  -14.359 -54.875  1.00 31.75  ?  609  ALA C CA    1 
ATOM   7776  C  C     . ALA C 2  605  ? 44.874  -13.843 -53.920  1.00 33.47  ?  609  ALA C C     1 
ATOM   7777  O  O     . ALA C 2  605  ? 44.414  -12.703 -54.052  1.00 37.90  ?  609  ALA C O     1 
ATOM   7778  C  CB    . ALA C 2  605  ? 45.328  -15.268 -55.935  1.00 33.44  ?  609  ALA C CB    1 
ATOM   7779  N  N     . ASN C 2  606  ? 44.476  -14.658 -52.943  1.00 31.55  ?  610  ASN C N     1 
ATOM   7780  C  CA    . ASN C 2  606  ? 43.472  -14.216 -51.984  1.00 33.11  ?  610  ASN C CA    1 
ATOM   7781  C  C     . ASN C 2  606  ? 44.024  -13.178 -51.020  1.00 33.03  ?  610  ASN C C     1 
ATOM   7782  O  O     . ASN C 2  606  ? 43.275  -12.322 -50.540  1.00 38.12  ?  610  ASN C O     1 
ATOM   7783  C  CB    . ASN C 2  606  ? 42.923  -15.403 -51.196  1.00 35.94  ?  610  ASN C CB    1 
ATOM   7784  C  CG    . ASN C 2  606  ? 42.311  -16.455 -52.080  1.00 37.06  ?  610  ASN C CG    1 
ATOM   7785  O  OD1   . ASN C 2  606  ? 41.878  -16.171 -53.193  1.00 38.75  ?  610  ASN C OD1   1 
ATOM   7786  N  ND2   . ASN C 2  606  ? 42.267  -17.685 -51.586  1.00 40.90  ?  610  ASN C ND2   1 
ATOM   7787  N  N     . MET C 2  607  ? 45.317  -13.238 -50.711  1.00 31.39  ?  611  MET C N     1 
ATOM   7788  C  CA    . MET C 2  607  ? 45.856  -12.334 -49.702  1.00 32.74  ?  611  MET C CA    1 
ATOM   7789  C  C     . MET C 2  607  ? 46.084  -10.931 -50.240  1.00 31.95  ?  611  MET C C     1 
ATOM   7790  O  O     . MET C 2  607  ? 46.056  -9.970  -49.467  1.00 31.30  ?  611  MET C O     1 
ATOM   7791  C  CB    . MET C 2  607  ? 47.145  -12.903 -49.122  1.00 31.89  ?  611  MET C CB    1 
ATOM   7792  C  CG    . MET C 2  607  ? 46.875  -13.726 -47.897  1.00 34.06  ?  611  MET C CG    1 
ATOM   7793  S  SD    . MET C 2  607  ? 48.246  -14.695 -47.287  1.00 32.57  ?  611  MET C SD    1 
ATOM   7794  C  CE    . MET C 2  607  ? 47.453  -15.339 -45.823  1.00 42.55  ?  611  MET C CE    1 
ATOM   7795  N  N     . GLN C 2  608  ? 46.298  -10.789 -51.547  1.00 31.44  ?  612  GLN C N     1 
ATOM   7796  C  CA    . GLN C 2  608  ? 46.436  -9.459  -52.121  1.00 32.29  ?  612  GLN C CA    1 
ATOM   7797  C  C     . GLN C 2  608  ? 45.163  -8.644  -51.946  1.00 35.01  ?  612  GLN C C     1 
ATOM   7798  O  O     . GLN C 2  608  ? 45.224  -7.422  -51.772  1.00 35.54  ?  612  GLN C O     1 
ATOM   7799  C  CB    . GLN C 2  608  ? 46.806  -9.561  -53.597  1.00 33.11  ?  612  GLN C CB    1 
ATOM   7800  C  CG    . GLN C 2  608  ? 48.186  -10.130 -53.848  1.00 33.13  ?  612  GLN C CG    1 
ATOM   7801  C  CD    . GLN C 2  608  ? 48.585  -10.064 -55.302  1.00 35.63  ?  612  GLN C CD    1 
ATOM   7802  O  OE1   . GLN C 2  608  ? 49.368  -9.207  -55.699  1.00 37.22  ?  612  GLN C OE1   1 
ATOM   7803  N  NE2   . GLN C 2  608  ? 48.048  -10.969 -56.108  1.00 34.80  ?  612  GLN C NE2   1 
ATOM   7804  N  N     . ARG C 2  609  ? 44.008  -9.299  -51.962  1.00 31.70  ?  613  ARG C N     1 
ATOM   7805  C  CA    . ARG C 2  609  ? 42.741  -8.606  -51.809  1.00 33.80  ?  613  ARG C CA    1 
ATOM   7806  C  C     . ARG C 2  609  ? 42.403  -8.312  -50.357  1.00 35.41  ?  613  ARG C C     1 
ATOM   7807  O  O     . ARG C 2  609  ? 41.365  -7.700  -50.092  1.00 36.25  ?  613  ARG C O     1 
ATOM   7808  C  CB    . ARG C 2  609  ? 41.626  -9.428  -52.446  1.00 32.28  ?  613  ARG C CB    1 
ATOM   7809  C  CG    . ARG C 2  609  ? 41.963  -9.921  -53.832  1.00 31.98  ?  613  ARG C CG    1 
ATOM   7810  C  CD    . ARG C 2  609  ? 40.730  -10.466 -54.497  1.00 34.51  ?  613  ARG C CD    1 
ATOM   7811  N  NE    . ARG C 2  609  ? 39.928  -11.249 -53.568  1.00 35.46  ?  613  ARG C NE    1 
ATOM   7812  C  CZ    . ARG C 2  609  ? 39.952  -12.572 -53.498  1.00 36.83  ?  613  ARG C CZ    1 
ATOM   7813  N  NH1   . ARG C 2  609  ? 39.192  -13.201 -52.616  1.00 40.57  ?  613  ARG C NH1   1 
ATOM   7814  N  NH2   . ARG C 2  609  ? 40.729  -13.262 -54.318  1.00 37.09  ?  613  ARG C NH2   1 
ATOM   7815  N  N     . GLN C 2  610  ? 43.232  -8.756  -49.419  1.00 32.67  ?  614  GLN C N     1 
ATOM   7816  C  CA    . GLN C 2  610  ? 43.083  -8.425  -48.012  1.00 32.61  ?  614  GLN C CA    1 
ATOM   7817  C  C     . GLN C 2  610  ? 44.009  -7.306  -47.558  1.00 31.69  ?  614  GLN C C     1 
ATOM   7818  O  O     . GLN C 2  610  ? 44.019  -6.977  -46.370  1.00 32.89  ?  614  GLN C O     1 
ATOM   7819  C  CB    . GLN C 2  610  ? 43.314  -9.671  -47.161  1.00 36.11  ?  614  GLN C CB    1 
ATOM   7820  C  CG    . GLN C 2  610  ? 42.419  -10.825 -47.545  1.00 35.02  ?  614  GLN C CG    1 
ATOM   7821  C  CD    . GLN C 2  610  ? 42.808  -12.102 -46.855  1.00 40.36  ?  614  GLN C CD    1 
ATOM   7822  O  OE1   . GLN C 2  610  ? 43.152  -12.101 -45.677  1.00 43.87  ?  614  GLN C OE1   1 
ATOM   7823  N  NE2   . GLN C 2  610  ? 42.769  -13.204 -47.589  1.00 47.22  ?  614  GLN C NE2   1 
ATOM   7824  N  N     . ALA C 2  611  ? 44.796  -6.733  -48.465  1.00 30.38  ?  615  ALA C N     1 
ATOM   7825  C  CA    . ALA C 2  611  ? 45.745  -5.687  -48.105  1.00 29.64  ?  615  ALA C CA    1 
ATOM   7826  C  C     . ALA C 2  611  ? 45.033  -4.360  -47.877  1.00 31.20  ?  615  ALA C C     1 
ATOM   7827  O  O     . ALA C 2  611  ? 44.154  -3.970  -48.650  1.00 35.93  ?  615  ALA C O     1 
ATOM   7828  C  CB    . ALA C 2  611  ? 46.797  -5.530  -49.199  1.00 28.46  ?  615  ALA C CB    1 
ATOM   7829  N  N     . VAL C 2  612  ? 45.423  -3.662  -46.814  1.00 29.12  ?  616  VAL C N     1 
ATOM   7830  C  CA    . VAL C 2  612  ? 44.805  -2.383  -46.468  1.00 31.57  ?  616  VAL C CA    1 
ATOM   7831  C  C     . VAL C 2  612  ? 45.534  -1.250  -47.182  1.00 29.85  ?  616  VAL C C     1 
ATOM   7832  O  O     . VAL C 2  612  ? 46.760  -1.307  -47.345  1.00 30.04  ?  616  VAL C O     1 
ATOM   7833  C  CB    . VAL C 2  612  ? 44.787  -2.157  -44.948  1.00 29.83  ?  616  VAL C CB    1 
ATOM   7834  C  CG1   . VAL C 2  612  ? 43.902  -3.185  -44.271  1.00 34.74  ?  616  VAL C CG1   1 
ATOM   7835  C  CG2   . VAL C 2  612  ? 46.183  -2.212  -44.388  1.00 32.08  ?  616  VAL C CG2   1 
ATOM   7836  N  N     . PRO C 2  613  ? 44.824  -0.226  -47.654  1.00 29.65  ?  617  PRO C N     1 
ATOM   7837  C  CA    . PRO C 2  613  ? 45.503  0.919   -48.273  1.00 31.19  ?  617  PRO C CA    1 
ATOM   7838  C  C     . PRO C 2  613  ? 46.307  1.707   -47.249  1.00 32.33  ?  617  PRO C C     1 
ATOM   7839  O  O     . PRO C 2  613  ? 45.800  2.090   -46.194  1.00 33.20  ?  617  PRO C O     1 
ATOM   7840  C  CB    . PRO C 2  613  ? 44.348  1.745   -48.845  1.00 31.12  ?  617  PRO C CB    1 
ATOM   7841  C  CG    . PRO C 2  613  ? 43.241  0.761   -49.017  1.00 32.64  ?  617  PRO C CG    1 
ATOM   7842  C  CD    . PRO C 2  613  ? 43.370  -0.172  -47.859  1.00 30.07  ?  617  PRO C CD    1 
ATOM   7843  N  N     . LEU C 2  614  ? 47.570  1.945   -47.576  1.00 33.05  ?  618  LEU C N     1 
ATOM   7844  C  CA    . LEU C 2  614  ? 48.491  2.662   -46.712  1.00 33.23  ?  618  LEU C CA    1 
ATOM   7845  C  C     . LEU C 2  614  ? 48.327  4.173   -46.874  1.00 34.18  ?  618  LEU C C     1 
ATOM   7846  O  O     . LEU C 2  614  ? 47.802  4.664   -47.877  1.00 39.88  ?  618  LEU C O     1 
ATOM   7847  C  CB    . LEU C 2  614  ? 49.922  2.219   -47.001  1.00 32.08  ?  618  LEU C CB    1 
ATOM   7848  C  CG    . LEU C 2  614  ? 50.094  0.704   -46.838  1.00 27.06  ?  618  LEU C CG    1 
ATOM   7849  C  CD1   . LEU C 2  614  ? 51.406  0.229   -47.416  1.00 30.21  ?  618  LEU C CD1   1 
ATOM   7850  C  CD2   . LEU C 2  614  ? 49.967  0.292   -45.377  1.00 27.36  ?  618  LEU C CD2   1 
ATOM   7851  N  N     . VAL C 2  615  ? 48.756  4.907   -45.844  1.00 32.60  ?  619  VAL C N     1 
ATOM   7852  C  CA    . VAL C 2  615  ? 48.700  6.367   -45.882  1.00 31.08  ?  619  VAL C CA    1 
ATOM   7853  C  C     . VAL C 2  615  ? 49.424  6.902   -47.112  1.00 32.81  ?  619  VAL C C     1 
ATOM   7854  O  O     . VAL C 2  615  ? 48.990  7.880   -47.731  1.00 34.04  ?  619  VAL C O     1 
ATOM   7855  C  CB    . VAL C 2  615  ? 49.272  6.955   -44.579  1.00 33.15  ?  619  VAL C CB    1 
ATOM   7856  C  CG1   . VAL C 2  615  ? 48.393  6.579   -43.404  1.00 31.80  ?  619  VAL C CG1   1 
ATOM   7857  C  CG2   . VAL C 2  615  ? 50.691  6.466   -44.344  1.00 38.84  ?  619  VAL C CG2   1 
ATOM   7858  N  N     . ARG C 2  616  ? 50.530  6.269   -47.487  1.00 34.39  ?  620  ARG C N     1 
ATOM   7859  C  CA    . ARG C 2  616  ? 51.236  6.557   -48.726  1.00 38.41  ?  620  ARG C CA    1 
ATOM   7860  C  C     . ARG C 2  616  ? 51.474  5.240   -49.442  1.00 37.54  ?  620  ARG C C     1 
ATOM   7861  O  O     . ARG C 2  616  ? 51.761  4.228   -48.800  1.00 38.08  ?  620  ARG C O     1 
ATOM   7862  C  CB    . ARG C 2  616  ? 52.572  7.264   -48.466  1.00 39.64  ?  620  ARG C CB    1 
ATOM   7863  C  CG    . ARG C 2  616  ? 53.303  7.682   -49.729  1.00 45.74  ?  620  ARG C CG    1 
ATOM   7864  C  CD    . ARG C 2  616  ? 54.734  8.106   -49.441  1.00 54.66  ?  620  ARG C CD    1 
ATOM   7865  N  NE    . ARG C 2  616  ? 54.808  9.250   -48.537  1.00 69.81  ?  620  ARG C NE    1 
ATOM   7866  C  CZ    . ARG C 2  616  ? 54.836  10.518  -48.934  1.00 67.42  ?  620  ARG C CZ    1 
ATOM   7867  N  NH1   . ARG C 2  616  ? 54.792  10.812  -50.227  1.00 71.90  ?  620  ARG C NH1   1 
ATOM   7868  N  NH2   . ARG C 2  616  ? 54.906  11.494  -48.039  1.00 55.61  ?  620  ARG C NH2   1 
ATOM   7869  N  N     . SER C 2  617  ? 51.349  5.236   -50.761  1.00 33.42  ?  621  SER C N     1 
ATOM   7870  C  CA    . SER C 2  617  ? 51.598  4.001   -51.479  1.00 34.18  ?  621  SER C CA    1 
ATOM   7871  C  C     . SER C 2  617  ? 53.021  3.978   -52.018  1.00 37.13  ?  621  SER C C     1 
ATOM   7872  O  O     . SER C 2  617  ? 53.723  4.989   -52.057  1.00 40.27  ?  621  SER C O     1 
ATOM   7873  C  CB    . SER C 2  617  ? 50.590  3.839   -52.619  1.00 35.31  ?  621  SER C CB    1 
ATOM   7874  O  OG    . SER C 2  617  ? 49.270  3.725   -52.119  1.00 38.16  ?  621  SER C OG    1 
ATOM   7875  N  N     . GLU C 2  618  ? 53.439  2.793   -52.450  1.00 33.00  ?  622  GLU C N     1 
ATOM   7876  C  CA    . GLU C 2  618  ? 54.722  2.614   -53.107  1.00 30.05  ?  622  GLU C CA    1 
ATOM   7877  C  C     . GLU C 2  618  ? 54.586  1.456   -54.077  1.00 32.48  ?  622  GLU C C     1 
ATOM   7878  O  O     . GLU C 2  618  ? 54.213  0.358   -53.662  1.00 33.44  ?  622  GLU C O     1 
ATOM   7879  C  CB    . GLU C 2  618  ? 55.811  2.336   -52.072  1.00 29.78  ?  622  GLU C CB    1 
ATOM   7880  C  CG    . GLU C 2  618  ? 57.231  2.456   -52.562  1.00 32.63  ?  622  GLU C CG    1 
ATOM   7881  C  CD    . GLU C 2  618  ? 58.218  2.269   -51.432  1.00 39.70  ?  622  GLU C CD    1 
ATOM   7882  O  OE1   . GLU C 2  618  ? 58.278  1.156   -50.875  1.00 36.29  ?  622  GLU C OE1   1 
ATOM   7883  O  OE2   . GLU C 2  618  ? 58.914  3.242   -51.080  1.00 49.52  ?  622  GLU C OE2   1 
ATOM   7884  N  N     . ALA C 2  619  ? 54.939  1.671   -55.334  1.00 34.80  ?  623  ALA C N     1 
ATOM   7885  C  CA    . ALA C 2  619  ? 54.860  0.583   -56.288  1.00 29.76  ?  623  ALA C CA    1 
ATOM   7886  C  C     . ALA C 2  619  ? 55.960  -0.434  -55.997  1.00 28.54  ?  623  ALA C C     1 
ATOM   7887  O  O     . ALA C 2  619  ? 56.983  -0.098  -55.399  1.00 33.78  ?  623  ALA C O     1 
ATOM   7888  C  CB    . ALA C 2  619  ? 54.984  1.101   -57.715  1.00 30.01  ?  623  ALA C CB    1 
ATOM   7889  N  N     . PRO C 2  620  ? 55.757  -1.693  -56.370  1.00 29.65  ?  624  PRO C N     1 
ATOM   7890  C  CA    . PRO C 2  620  ? 56.820  -2.684  -56.189  1.00 29.77  ?  624  PRO C CA    1 
ATOM   7891  C  C     . PRO C 2  620  ? 57.938  -2.492  -57.198  1.00 29.81  ?  624  PRO C C     1 
ATOM   7892  O  O     . PRO C 2  620  ? 57.698  -2.180  -58.367  1.00 26.70  ?  624  PRO C O     1 
ATOM   7893  C  CB    . PRO C 2  620  ? 56.098  -4.017  -56.403  1.00 31.96  ?  624  PRO C CB    1 
ATOM   7894  C  CG    . PRO C 2  620  ? 54.947  -3.677  -57.282  1.00 30.44  ?  624  PRO C CG    1 
ATOM   7895  C  CD    . PRO C 2  620  ? 54.506  -2.312  -56.843  1.00 32.21  ?  624  PRO C CD    1 
ATOM   7896  N  N     . LEU C 2  621  ? 59.173  -2.685  -56.726  1.00 28.46  ?  625  LEU C N     1 
ATOM   7897  C  CA    . LEU C 2  621  ? 60.306  -2.779  -57.638  1.00 28.02  ?  625  LEU C CA    1 
ATOM   7898  C  C     . LEU C 2  621  ? 60.135  -3.951  -58.591  1.00 31.41  ?  625  LEU C C     1 
ATOM   7899  O  O     . LEU C 2  621  ? 60.449  -3.847  -59.781  1.00 32.06  ?  625  LEU C O     1 
ATOM   7900  C  CB    . LEU C 2  621  ? 61.605  -2.922  -56.848  1.00 25.35  ?  625  LEU C CB    1 
ATOM   7901  C  CG    . LEU C 2  621  ? 62.016  -1.758  -55.948  1.00 27.12  ?  625  LEU C CG    1 
ATOM   7902  C  CD1   . LEU C 2  621  ? 63.026  -2.214  -54.914  1.00 28.73  ?  625  LEU C CD1   1 
ATOM   7903  C  CD2   . LEU C 2  621  ? 62.580  -0.629  -56.783  1.00 31.44  ?  625  LEU C CD2   1 
ATOM   7904  N  N     . VAL C 2  622  ? 59.620  -5.070  -58.088  1.00 29.52  ?  626  VAL C N     1 
ATOM   7905  C  CA    . VAL C 2  622  ? 59.429  -6.279  -58.877  1.00 29.24  ?  626  VAL C CA    1 
ATOM   7906  C  C     . VAL C 2  622  ? 57.936  -6.453  -59.105  1.00 32.92  ?  626  VAL C C     1 
ATOM   7907  O  O     . VAL C 2  622  ? 57.195  -6.832  -58.190  1.00 31.78  ?  626  VAL C O     1 
ATOM   7908  C  CB    . VAL C 2  622  ? 60.029  -7.508  -58.180  1.00 27.03  ?  626  VAL C CB    1 
ATOM   7909  C  CG1   . VAL C 2  622  ? 59.854  -8.743  -59.039  1.00 30.13  ?  626  VAL C CG1   1 
ATOM   7910  C  CG2   . VAL C 2  622  ? 61.497  -7.273  -57.862  1.00 29.90  ?  626  VAL C CG2   1 
ATOM   7911  N  N     . GLY C 2  623  ? 57.492  -6.170  -60.329  1.00 34.76  ?  627  GLY C N     1 
ATOM   7912  C  CA    . GLY C 2  623  ? 56.142  -6.440  -60.761  1.00 33.66  ?  627  GLY C CA    1 
ATOM   7913  C  C     . GLY C 2  623  ? 56.079  -7.557  -61.790  1.00 35.62  ?  627  GLY C C     1 
ATOM   7914  O  O     . GLY C 2  623  ? 57.082  -8.134  -62.195  1.00 36.39  ?  627  GLY C O     1 
ATOM   7915  N  N     . THR C 2  624  ? 54.851  -7.881  -62.182  1.00 35.13  ?  628  THR C N     1 
ATOM   7916  C  CA    . THR C 2  624  ? 54.613  -8.692  -63.366  1.00 36.31  ?  628  THR C CA    1 
ATOM   7917  C  C     . THR C 2  624  ? 54.201  -7.872  -64.578  1.00 36.24  ?  628  THR C C     1 
ATOM   7918  O  O     . THR C 2  624  ? 54.030  -8.440  -65.660  1.00 37.45  ?  628  THR C O     1 
ATOM   7919  C  CB    . THR C 2  624  ? 53.548  -9.746  -63.082  1.00 33.50  ?  628  THR C CB    1 
ATOM   7920  O  OG1   . THR C 2  624  ? 52.261  -9.125  -63.053  1.00 33.12  ?  628  THR C OG1   1 
ATOM   7921  C  CG2   . THR C 2  624  ? 53.808  -10.402 -61.746  1.00 32.19  ?  628  THR C CG2   1 
ATOM   7922  N  N     . GLY C 2  625  ? 54.037  -6.559  -64.428  1.00 34.05  ?  629  GLY C N     1 
ATOM   7923  C  CA    . GLY C 2  625  ? 53.526  -5.724  -65.492  1.00 36.57  ?  629  GLY C CA    1 
ATOM   7924  C  C     . GLY C 2  625  ? 52.018  -5.629  -65.566  1.00 37.98  ?  629  GLY C C     1 
ATOM   7925  O  O     . GLY C 2  625  ? 51.501  -4.924  -66.440  1.00 45.07  ?  629  GLY C O     1 
ATOM   7926  N  N     . MET C 2  626  ? 51.297  -6.323  -64.690  1.00 37.49  ?  630  MET C N     1 
ATOM   7927  C  CA    . MET C 2  626  ? 49.842  -6.280  -64.637  1.00 40.14  ?  630  MET C CA    1 
ATOM   7928  C  C     . MET C 2  626  ? 49.317  -5.182  -63.717  1.00 38.51  ?  630  MET C C     1 
ATOM   7929  O  O     . MET C 2  626  ? 48.135  -4.836  -63.797  1.00 35.02  ?  630  MET C O     1 
ATOM   7930  C  CB    . MET C 2  626  ? 49.320  -7.658  -64.186  1.00 37.81  ?  630  MET C CB    1 
ATOM   7931  C  CG    . MET C 2  626  ? 47.819  -7.793  -63.953  1.00 37.70  ?  630  MET C CG    1 
ATOM   7932  S  SD    . MET C 2  626  ? 46.835  -7.879  -65.456  1.00 42.18  ?  630  MET C SD    1 
ATOM   7933  C  CE    . MET C 2  626  ? 47.705  -9.144  -66.358  1.00 37.22  ?  630  MET C CE    1 
ATOM   7934  N  N     . GLU C 2  627  ? 50.182  -4.589  -62.893  1.00 35.27  ?  631  GLU C N     1 
ATOM   7935  C  CA    . GLU C 2  627  ? 49.733  -3.682  -61.841  1.00 35.61  ?  631  GLU C CA    1 
ATOM   7936  C  C     . GLU C 2  627  ? 49.131  -2.397  -62.396  1.00 37.14  ?  631  GLU C C     1 
ATOM   7937  O  O     . GLU C 2  627  ? 48.208  -1.838  -61.792  1.00 36.93  ?  631  GLU C O     1 
ATOM   7938  C  CB    . GLU C 2  627  ? 50.896  -3.350  -60.908  1.00 35.71  ?  631  GLU C CB    1 
ATOM   7939  C  CG    . GLU C 2  627  ? 51.509  -4.545  -60.203  1.00 40.11  ?  631  GLU C CG    1 
ATOM   7940  C  CD    . GLU C 2  627  ? 52.452  -5.345  -61.085  1.00 40.91  ?  631  GLU C CD    1 
ATOM   7941  O  OE1   . GLU C 2  627  ? 52.665  -4.960  -62.252  1.00 40.03  ?  631  GLU C OE1   1 
ATOM   7942  O  OE2   . GLU C 2  627  ? 52.980  -6.368  -60.608  1.00 40.96  ?  631  GLU C OE2   1 
ATOM   7943  N  N     . LEU C 2  628  ? 49.653  -1.894  -63.514  1.00 41.06  ?  632  LEU C N     1 
ATOM   7944  C  CA    . LEU C 2  628  ? 49.119  -0.664  -64.087  1.00 40.84  ?  632  LEU C CA    1 
ATOM   7945  C  C     . LEU C 2  628  ? 47.734  -0.890  -64.675  1.00 40.61  ?  632  LEU C C     1 
ATOM   7946  O  O     . LEU C 2  628  ? 46.775  -0.191  -64.329  1.00 40.03  ?  632  LEU C O     1 
ATOM   7947  C  CB    . LEU C 2  628  ? 50.071  -0.132  -65.157  1.00 43.30  ?  632  LEU C CB    1 
ATOM   7948  C  CG    . LEU C 2  628  ? 49.511  0.968   -66.060  1.00 39.93  ?  632  LEU C CG    1 
ATOM   7949  C  CD1   . LEU C 2  628  ? 49.602  2.322   -65.380  1.00 41.32  ?  632  LEU C CD1   1 
ATOM   7950  C  CD2   . LEU C 2  628  ? 50.222  0.974   -67.396  1.00 44.30  ?  632  LEU C CD2   1 
ATOM   7951  N  N     . ARG C 2  629  ? 47.612  -1.872  -65.566  1.00 40.08  ?  633  ARG C N     1 
ATOM   7952  C  CA    . ARG C 2  629  ? 46.344  -2.140  -66.227  1.00 34.97  ?  633  ARG C CA    1 
ATOM   7953  C  C     . ARG C 2  629  ? 45.282  -2.638  -65.258  1.00 35.53  ?  633  ARG C C     1 
ATOM   7954  O  O     . ARG C 2  629  ? 44.090  -2.540  -65.559  1.00 39.98  ?  633  ARG C O     1 
ATOM   7955  C  CB    . ARG C 2  629  ? 46.566  -3.149  -67.347  1.00 36.91  ?  633  ARG C CB    1 
ATOM   7956  C  CG    . ARG C 2  629  ? 45.403  -3.311  -68.281  1.00 41.18  ?  633  ARG C CG    1 
ATOM   7957  C  CD    . ARG C 2  629  ? 45.074  -2.025  -69.005  1.00 34.36  ?  633  ARG C CD    1 
ATOM   7958  N  NE    . ARG C 2  629  ? 44.638  -2.308  -70.366  1.00 42.59  ?  633  ARG C NE    1 
ATOM   7959  C  CZ    . ARG C 2  629  ? 43.466  -2.848  -70.680  1.00 44.74  ?  633  ARG C CZ    1 
ATOM   7960  N  NH1   . ARG C 2  629  ? 42.600  -3.165  -69.728  1.00 39.59  ?  633  ARG C NH1   1 
ATOM   7961  N  NH2   . ARG C 2  629  ? 43.159  -3.074  -71.948  1.00 49.62  ?  633  ARG C NH2   1 
ATOM   7962  N  N     . ALA C 2  630  ? 45.682  -3.160  -64.100  1.00 35.76  ?  634  ALA C N     1 
ATOM   7963  C  CA    . ALA C 2  630  ? 44.703  -3.550  -63.094  1.00 33.75  ?  634  ALA C CA    1 
ATOM   7964  C  C     . ALA C 2  630  ? 44.147  -2.338  -62.360  1.00 33.71  ?  634  ALA C C     1 
ATOM   7965  O  O     . ALA C 2  630  ? 42.946  -2.277  -62.080  1.00 38.11  ?  634  ALA C O     1 
ATOM   7966  C  CB    . ALA C 2  630  ? 45.328  -4.532  -62.104  1.00 32.29  ?  634  ALA C CB    1 
ATOM   7967  N  N     . ALA C 2  631  ? 45.002  -1.363  -62.047  1.00 33.08  ?  635  ALA C N     1 
ATOM   7968  C  CA    . ALA C 2  631  ? 44.554  -0.189  -61.306  1.00 34.23  ?  635  ALA C CA    1 
ATOM   7969  C  C     . ALA C 2  631  ? 43.638  0.689   -62.148  1.00 36.73  ?  635  ALA C C     1 
ATOM   7970  O  O     . ALA C 2  631  ? 42.641  1.218   -61.644  1.00 38.03  ?  635  ALA C O     1 
ATOM   7971  C  CB    . ALA C 2  631  ? 45.759  0.611   -60.820  1.00 34.64  ?  635  ALA C CB    1 
ATOM   7972  N  N     . ILE C 2  632  ? 43.963  0.863   -63.429  1.00 36.56  ?  636  ILE C N     1 
ATOM   7973  C  CA    . ILE C 2  632  ? 43.135  1.692   -64.300  1.00 33.32  ?  636  ILE C CA    1 
ATOM   7974  C  C     . ILE C 2  632  ? 41.760  1.064   -64.482  1.00 34.93  ?  636  ILE C C     1 
ATOM   7975  O  O     . ILE C 2  632  ? 40.729  1.720   -64.299  1.00 39.99  ?  636  ILE C O     1 
ATOM   7976  C  CB    . ILE C 2  632  ? 43.836  1.918   -65.651  1.00 34.21  ?  636  ILE C CB    1 
ATOM   7977  C  CG1   . ILE C 2  632  ? 45.123  2.720   -65.456  1.00 33.45  ?  636  ILE C CG1   1 
ATOM   7978  C  CG2   . ILE C 2  632  ? 42.908  2.626   -66.620  1.00 36.02  ?  636  ILE C CG2   1 
ATOM   7979  C  CD1   . ILE C 2  632  ? 45.932  2.889   -66.723  1.00 34.38  ?  636  ILE C CD1   1 
ATOM   7980  N  N     . ASP C 2  633  ? 41.723  -0.222  -64.840  1.00 39.16  ?  637  ASP C N     1 
ATOM   7981  C  CA    . ASP C 2  633  ? 40.443  -0.880  -65.084  1.00 36.34  ?  637  ASP C CA    1 
ATOM   7982  C  C     . ASP C 2  633  ? 39.605  -0.990  -63.818  1.00 37.57  ?  637  ASP C C     1 
ATOM   7983  O  O     . ASP C 2  633  ? 38.373  -0.932  -63.891  1.00 39.51  ?  637  ASP C O     1 
ATOM   7984  C  CB    . ASP C 2  633  ? 40.665  -2.263  -65.691  1.00 35.82  ?  637  ASP C CB    1 
ATOM   7985  C  CG    . ASP C 2  633  ? 41.165  -2.195  -67.114  1.00 40.23  ?  637  ASP C CG    1 
ATOM   7986  O  OD1   . ASP C 2  633  ? 41.859  -1.215  -67.452  1.00 40.39  ?  637  ASP C OD1   1 
ATOM   7987  O  OD2   . ASP C 2  633  ? 40.865  -3.117  -67.899  1.00 38.28  ?  637  ASP C OD2   1 
ATOM   7988  N  N     . ALA C 2  634  ? 40.241  -1.152  -62.657  1.00 36.20  ?  638  ALA C N     1 
ATOM   7989  C  CA    . ALA C 2  634  ? 39.482  -1.210  -61.414  1.00 35.19  ?  638  ALA C CA    1 
ATOM   7990  C  C     . ALA C 2  634  ? 38.688  0.067   -61.189  1.00 38.15  ?  638  ALA C C     1 
ATOM   7991  O  O     . ALA C 2  634  ? 37.589  0.023   -60.628  1.00 43.77  ?  638  ALA C O     1 
ATOM   7992  C  CB    . ALA C 2  634  ? 40.414  -1.474  -60.234  1.00 36.90  ?  638  ALA C CB    1 
ATOM   7993  N  N     . GLY C 2  635  ? 39.220  1.207   -61.620  1.00 39.73  ?  639  GLY C N     1 
ATOM   7994  C  CA    . GLY C 2  635  ? 38.473  2.444   -61.623  1.00 43.32  ?  639  GLY C CA    1 
ATOM   7995  C  C     . GLY C 2  635  ? 38.599  3.300   -60.383  1.00 45.21  ?  639  GLY C C     1 
ATOM   7996  O  O     . GLY C 2  635  ? 37.972  4.363   -60.327  1.00 51.96  ?  639  GLY C O     1 
ATOM   7997  N  N     . ASP C 2  636  ? 39.388  2.889   -59.396  1.00 44.96  ?  640  ASP C N     1 
ATOM   7998  C  CA    . ASP C 2  636  ? 39.616  3.727   -58.226  1.00 47.06  ?  640  ASP C CA    1 
ATOM   7999  C  C     . ASP C 2  636  ? 40.690  4.771   -58.479  1.00 44.72  ?  640  ASP C C     1 
ATOM   8000  O  O     . ASP C 2  636  ? 41.072  5.495   -57.555  1.00 41.67  ?  640  ASP C O     1 
ATOM   8001  C  CB    . ASP C 2  636  ? 39.986  2.870   -57.015  1.00 49.01  ?  640  ASP C CB    1 
ATOM   8002  C  CG    . ASP C 2  636  ? 38.839  1.996   -56.552  1.00 55.87  ?  640  ASP C CG    1 
ATOM   8003  O  OD1   . ASP C 2  636  ? 38.231  1.318   -57.405  1.00 54.61  ?  640  ASP C OD1   1 
ATOM   8004  O  OD2   . ASP C 2  636  ? 38.536  1.999   -55.341  1.00 60.77  ?  640  ASP C OD2   1 
ATOM   8005  N  N     . VAL C 2  637  ? 41.191  4.833   -59.704  1.00 44.11  ?  641  VAL C N     1 
ATOM   8006  C  CA    . VAL C 2  637  ? 42.139  5.837   -60.154  1.00 40.94  ?  641  VAL C CA    1 
ATOM   8007  C  C     . VAL C 2  637  ? 41.411  6.769   -61.113  1.00 41.93  ?  641  VAL C C     1 
ATOM   8008  O  O     . VAL C 2  637  ? 40.462  6.366   -61.795  1.00 46.35  ?  641  VAL C O     1 
ATOM   8009  C  CB    . VAL C 2  637  ? 43.358  5.150   -60.812  1.00 38.77  ?  641  VAL C CB    1 
ATOM   8010  C  CG1   . VAL C 2  637  ? 43.462  5.492   -62.292  1.00 39.22  ?  641  VAL C CG1   1 
ATOM   8011  C  CG2   . VAL C 2  637  ? 44.633  5.490   -60.066  1.00 39.94  ?  641  VAL C CG2   1 
ATOM   8012  N  N     . VAL C 2  638  ? 41.831  8.030   -61.146  1.00 43.26  ?  642  VAL C N     1 
ATOM   8013  C  CA    . VAL C 2  638  ? 41.194  9.026   -62.001  1.00 41.87  ?  642  VAL C CA    1 
ATOM   8014  C  C     . VAL C 2  638  ? 41.950  9.110   -63.318  1.00 38.39  ?  642  VAL C C     1 
ATOM   8015  O  O     . VAL C 2  638  ? 43.178  9.239   -63.336  1.00 37.86  ?  642  VAL C O     1 
ATOM   8016  C  CB    . VAL C 2  638  ? 41.131  10.395  -61.309  1.00 37.89  ?  642  VAL C CB    1 
ATOM   8017  C  CG1   . VAL C 2  638  ? 40.352  11.376  -62.166  1.00 32.36  ?  642  VAL C CG1   1 
ATOM   8018  C  CG2   . VAL C 2  638  ? 40.493  10.260  -59.941  1.00 39.88  ?  642  VAL C CG2   1 
ATOM   8019  N  N     . VAL C 2  639  ? 41.212  9.045   -64.421  1.00 36.87  ?  643  VAL C N     1 
ATOM   8020  C  CA    . VAL C 2  639  ? 41.776  8.996   -65.761  1.00 36.43  ?  643  VAL C CA    1 
ATOM   8021  C  C     . VAL C 2  639  ? 41.149  10.106  -66.594  1.00 40.18  ?  643  VAL C C     1 
ATOM   8022  O  O     . VAL C 2  639  ? 39.959  10.403  -66.452  1.00 42.90  ?  643  VAL C O     1 
ATOM   8023  C  CB    . VAL C 2  639  ? 41.538  7.614   -66.406  1.00 33.32  ?  643  VAL C CB    1 
ATOM   8024  C  CG1   . VAL C 2  639  ? 41.995  7.595   -67.846  1.00 35.93  ?  643  VAL C CG1   1 
ATOM   8025  C  CG2   . VAL C 2  639  ? 42.246  6.535   -65.611  1.00 35.30  ?  643  VAL C CG2   1 
ATOM   8026  N  N     . ALA C 2  640  ? 41.952  10.724  -67.457  1.00 37.97  ?  644  ALA C N     1 
ATOM   8027  C  CA    . ALA C 2  640  ? 41.468  11.770  -68.348  1.00 37.32  ?  644  ALA C CA    1 
ATOM   8028  C  C     . ALA C 2  640  ? 40.752  11.140  -69.533  1.00 44.30  ?  644  ALA C C     1 
ATOM   8029  O  O     . ALA C 2  640  ? 41.349  10.359  -70.279  1.00 47.25  ?  644  ALA C O     1 
ATOM   8030  C  CB    . ALA C 2  640  ? 42.625  12.640  -68.830  1.00 36.11  ?  644  ALA C CB    1 
ATOM   8031  N  N     . GLU C 2  641  ? 39.479  11.487  -69.714  1.00 45.99  ?  645  GLU C N     1 
ATOM   8032  C  CA    . GLU C 2  641  ? 38.713  10.977  -70.842  1.00 47.49  ?  645  GLU C CA    1 
ATOM   8033  C  C     . GLU C 2  641  ? 39.107  11.628  -72.155  1.00 50.26  ?  645  GLU C C     1 
ATOM   8034  O  O     . GLU C 2  641  ? 38.878  11.042  -73.217  1.00 54.62  ?  645  GLU C O     1 
ATOM   8035  C  CB    . GLU C 2  641  ? 37.219  11.193  -70.607  1.00 50.65  ?  645  GLU C CB    1 
ATOM   8036  C  CG    . GLU C 2  641  ? 36.728  10.703  -69.266  1.00 60.43  ?  645  GLU C CG    1 
ATOM   8037  C  CD    . GLU C 2  641  ? 35.332  11.196  -68.955  1.00 71.13  ?  645  GLU C CD    1 
ATOM   8038  O  OE1   . GLU C 2  641  ? 34.711  11.817  -69.844  1.00 69.06  ?  645  GLU C OE1   1 
ATOM   8039  O  OE2   . GLU C 2  641  ? 34.858  10.968  -67.821  1.00 76.74  ?  645  GLU C OE2   1 
ATOM   8040  N  N     . GLU C 2  642  ? 39.689  12.821  -72.103  1.00 48.22  ?  646  GLU C N     1 
ATOM   8041  C  CA    . GLU C 2  642  ? 40.019  13.592  -73.289  1.00 50.05  ?  646  GLU C CA    1 
ATOM   8042  C  C     . GLU C 2  642  ? 41.341  14.299  -73.047  1.00 48.17  ?  646  GLU C C     1 
ATOM   8043  O  O     . GLU C 2  642  ? 41.604  14.769  -71.938  1.00 47.78  ?  646  GLU C O     1 
ATOM   8044  C  CB    . GLU C 2  642  ? 38.915  14.607  -73.605  1.00 54.66  ?  646  GLU C CB    1 
ATOM   8045  C  CG    . GLU C 2  642  ? 38.480  14.656  -75.056  1.00 56.42  ?  646  GLU C CG    1 
ATOM   8046  C  CD    . GLU C 2  642  ? 37.199  15.450  -75.239  1.00 65.02  ?  646  GLU C CD    1 
ATOM   8047  O  OE1   . GLU C 2  642  ? 36.301  15.331  -74.378  1.00 65.61  ?  646  GLU C OE1   1 
ATOM   8048  O  OE2   . GLU C 2  642  ? 37.094  16.199  -76.234  1.00 66.31  ?  646  GLU C OE2   1 
ATOM   8049  N  N     . SER C 2  643  ? 42.172  14.364  -74.082  1.00 48.14  ?  647  SER C N     1 
ATOM   8050  C  CA    . SER C 2  643  ? 43.483  14.980  -73.945  1.00 49.26  ?  647  SER C CA    1 
ATOM   8051  C  C     . SER C 2  643  ? 43.363  16.495  -73.822  1.00 56.10  ?  647  SER C C     1 
ATOM   8052  O  O     . SER C 2  643  ? 42.495  17.128  -74.432  1.00 59.21  ?  647  SER C O     1 
ATOM   8053  C  CB    . SER C 2  643  ? 44.369  14.615  -75.133  1.00 52.83  ?  647  SER C CB    1 
ATOM   8054  O  OG    . SER C 2  643  ? 43.642  14.666  -76.347  1.00 61.16  ?  647  SER C OG    1 
ATOM   8055  N  N     . GLY C 2  644  ? 44.245  17.076  -73.022  1.00 50.20  ?  648  GLY C N     1 
ATOM   8056  C  CA    . GLY C 2  644  ? 44.207  18.506  -72.805  1.00 48.12  ?  648  GLY C CA    1 
ATOM   8057  C  C     . GLY C 2  644  ? 45.330  18.955  -71.902  1.00 45.81  ?  648  GLY C C     1 
ATOM   8058  O  O     . GLY C 2  644  ? 46.310  18.238  -71.697  1.00 50.38  ?  648  GLY C O     1 
ATOM   8059  N  N     . VAL C 2  645  ? 45.177  20.160  -71.365  1.00 44.38  ?  649  VAL C N     1 
ATOM   8060  C  CA    . VAL C 2  645  ? 46.165  20.778  -70.491  1.00 45.08  ?  649  VAL C CA    1 
ATOM   8061  C  C     . VAL C 2  645  ? 45.509  21.031  -69.145  1.00 45.38  ?  649  VAL C C     1 
ATOM   8062  O  O     . VAL C 2  645  ? 44.317  21.345  -69.081  1.00 45.97  ?  649  VAL C O     1 
ATOM   8063  C  CB    . VAL C 2  645  ? 46.710  22.087  -71.104  1.00 45.26  ?  649  VAL C CB    1 
ATOM   8064  C  CG1   . VAL C 2  645  ? 47.684  22.770  -70.160  1.00 45.41  ?  649  VAL C CG1   1 
ATOM   8065  C  CG2   . VAL C 2  645  ? 47.376  21.803  -72.440  1.00 52.33  ?  649  VAL C CG2   1 
ATOM   8066  N  N     . ILE C 2  646  ? 46.277  20.892  -68.069  1.00 45.54  ?  650  ILE C N     1 
ATOM   8067  C  CA    . ILE C 2  646  ? 45.717  21.098  -66.739  1.00 45.78  ?  650  ILE C CA    1 
ATOM   8068  C  C     . ILE C 2  646  ? 45.620  22.597  -66.501  1.00 45.35  ?  650  ILE C C     1 
ATOM   8069  O  O     . ILE C 2  646  ? 46.633  23.303  -66.467  1.00 43.19  ?  650  ILE C O     1 
ATOM   8070  C  CB    . ILE C 2  646  ? 46.561  20.413  -65.653  1.00 44.26  ?  650  ILE C CB    1 
ATOM   8071  C  CG1   . ILE C 2  646  ? 46.132  18.960  -65.465  1.00 41.40  ?  650  ILE C CG1   1 
ATOM   8072  C  CG2   . ILE C 2  646  ? 46.378  21.110  -64.328  1.00 45.71  ?  650  ILE C CG2   1 
ATOM   8073  C  CD1   . ILE C 2  646  ? 46.329  18.089  -66.664  1.00 46.58  ?  650  ILE C CD1   1 
ATOM   8074  N  N     . GLU C 2  647  ? 44.389  23.082  -66.360  1.00 45.62  ?  651  GLU C N     1 
ATOM   8075  C  CA    . GLU C 2  647  ? 44.134  24.493  -66.110  1.00 44.06  ?  651  GLU C CA    1 
ATOM   8076  C  C     . GLU C 2  647  ? 44.246  24.829  -64.629  1.00 44.43  ?  651  GLU C C     1 
ATOM   8077  O  O     . GLU C 2  647  ? 44.795  25.874  -64.264  1.00 46.74  ?  651  GLU C O     1 
ATOM   8078  C  CB    . GLU C 2  647  ? 42.759  24.858  -66.659  1.00 39.40  ?  651  GLU C CB    1 
ATOM   8079  C  CG    . GLU C 2  647  ? 42.096  26.038  -66.006  1.00 42.23  ?  651  GLU C CG    1 
ATOM   8080  C  CD    . GLU C 2  647  ? 40.722  26.285  -66.578  1.00 45.92  ?  651  GLU C CD    1 
ATOM   8081  O  OE1   . GLU C 2  647  ? 40.620  26.453  -67.810  1.00 46.79  ?  651  GLU C OE1   1 
ATOM   8082  O  OE2   . GLU C 2  647  ? 39.744  26.287  -65.803  1.00 46.31  ?  651  GLU C OE2   1 
ATOM   8083  N  N     . GLU C 2  648  ? 43.732  23.958  -63.767  1.00 44.09  ?  652  GLU C N     1 
ATOM   8084  C  CA    . GLU C 2  648  ? 43.755  24.198  -62.334  1.00 43.56  ?  652  GLU C CA    1 
ATOM   8085  C  C     . GLU C 2  648  ? 43.845  22.863  -61.610  1.00 44.01  ?  652  GLU C C     1 
ATOM   8086  O  O     . GLU C 2  648  ? 43.254  21.873  -62.047  1.00 38.10  ?  652  GLU C O     1 
ATOM   8087  C  CB    . GLU C 2  648  ? 42.510  24.968  -61.889  1.00 41.96  ?  652  GLU C CB    1 
ATOM   8088  C  CG    . GLU C 2  648  ? 42.573  25.465  -60.465  1.00 47.97  ?  652  GLU C CG    1 
ATOM   8089  C  CD    . GLU C 2  648  ? 41.282  26.108  -60.023  1.00 54.65  ?  652  GLU C CD    1 
ATOM   8090  O  OE1   . GLU C 2  648  ? 41.278  26.764  -58.961  1.00 53.64  ?  652  GLU C OE1   1 
ATOM   8091  O  OE2   . GLU C 2  648  ? 40.270  25.955  -60.737  1.00 59.69  ?  652  GLU C OE2   1 
ATOM   8092  N  N     . VAL C 2  649  ? 44.584  22.846  -60.503  1.00 43.83  ?  653  VAL C N     1 
ATOM   8093  C  CA    . VAL C 2  649  ? 44.751  21.645  -59.694  1.00 40.48  ?  653  VAL C CA    1 
ATOM   8094  C  C     . VAL C 2  649  ? 44.768  22.034  -58.225  1.00 38.77  ?  653  VAL C C     1 
ATOM   8095  O  O     . VAL C 2  649  ? 45.434  22.998  -57.836  1.00 42.45  ?  653  VAL C O     1 
ATOM   8096  C  CB    . VAL C 2  649  ? 46.033  20.872  -60.063  1.00 38.99  ?  653  VAL C CB    1 
ATOM   8097  C  CG1   . VAL C 2  649  ? 46.630  20.194  -58.842  1.00 39.00  ?  653  VAL C CG1   1 
ATOM   8098  C  CG2   . VAL C 2  649  ? 45.727  19.835  -61.116  1.00 45.58  ?  653  VAL C CG2   1 
ATOM   8099  N  N     . SER C 2  650  ? 44.029  21.285  -57.417  1.00 39.63  ?  654  SER C N     1 
ATOM   8100  C  CA    . SER C 2  650  ? 44.129  21.342  -55.969  1.00 38.50  ?  654  SER C CA    1 
ATOM   8101  C  C     . SER C 2  650  ? 43.796  19.955  -55.441  1.00 37.94  ?  654  SER C C     1 
ATOM   8102  O  O     . SER C 2  650  ? 43.497  19.036  -56.207  1.00 35.73  ?  654  SER C O     1 
ATOM   8103  C  CB    . SER C 2  650  ? 43.203  22.412  -55.389  1.00 40.21  ?  654  SER C CB    1 
ATOM   8104  O  OG    . SER C 2  650  ? 41.848  22.103  -55.662  1.00 45.28  ?  654  SER C OG    1 
ATOM   8105  N  N     . ALA C 2  651  ? 43.844  19.804  -54.120  1.00 36.92  ?  655  ALA C N     1 
ATOM   8106  C  CA    . ALA C 2  651  ? 43.459  18.530  -53.532  1.00 32.67  ?  655  ALA C CA    1 
ATOM   8107  C  C     . ALA C 2  651  ? 41.993  18.210  -53.774  1.00 33.72  ?  655  ALA C C     1 
ATOM   8108  O  O     . ALA C 2  651  ? 41.609  17.038  -53.728  1.00 40.48  ?  655  ALA C O     1 
ATOM   8109  C  CB    . ALA C 2  651  ? 43.755  18.533  -52.035  1.00 35.50  ?  655  ALA C CB    1 
ATOM   8110  N  N     . ASP C 2  652  ? 41.165  19.225  -54.027  1.00 39.35  ?  656  ASP C N     1 
ATOM   8111  C  CA    . ASP C 2  652  ? 39.732  19.008  -54.172  1.00 36.36  ?  656  ASP C CA    1 
ATOM   8112  C  C     . ASP C 2  652  ? 39.350  18.540  -55.572  1.00 39.30  ?  656  ASP C C     1 
ATOM   8113  O  O     . ASP C 2  652  ? 38.489  17.666  -55.716  1.00 39.72  ?  656  ASP C O     1 
ATOM   8114  C  CB    . ASP C 2  652  ? 38.978  20.280  -53.802  1.00 39.33  ?  656  ASP C CB    1 
ATOM   8115  C  CG    . ASP C 2  652  ? 39.124  20.625  -52.340  1.00 43.93  ?  656  ASP C CG    1 
ATOM   8116  O  OD1   . ASP C 2  652  ? 39.190  19.689  -51.522  1.00 40.83  ?  656  ASP C OD1   1 
ATOM   8117  O  OD2   . ASP C 2  652  ? 39.180  21.825  -52.005  1.00 46.70  ?  656  ASP C OD2   1 
ATOM   8118  N  N     . TYR C 2  653  ? 39.947  19.111  -56.615  1.00 38.98  ?  657  TYR C N     1 
ATOM   8119  C  CA    . TYR C 2  653  ? 39.558  18.726  -57.965  1.00 38.30  ?  657  TYR C CA    1 
ATOM   8120  C  C     . TYR C 2  653  ? 40.676  19.043  -58.947  1.00 37.31  ?  657  TYR C C     1 
ATOM   8121  O  O     . TYR C 2  653  ? 41.624  19.765  -58.637  1.00 38.54  ?  657  TYR C O     1 
ATOM   8122  C  CB    . TYR C 2  653  ? 38.247  19.402  -58.390  1.00 43.02  ?  657  TYR C CB    1 
ATOM   8123  C  CG    . TYR C 2  653  ? 38.256  20.919  -58.408  1.00 46.90  ?  657  TYR C CG    1 
ATOM   8124  C  CD1   . TYR C 2  653  ? 38.804  21.620  -59.472  1.00 45.09  ?  657  TYR C CD1   1 
ATOM   8125  C  CD2   . TYR C 2  653  ? 37.680  21.647  -57.377  1.00 47.13  ?  657  TYR C CD2   1 
ATOM   8126  C  CE1   . TYR C 2  653  ? 38.802  23.000  -59.497  1.00 48.87  ?  657  TYR C CE1   1 
ATOM   8127  C  CE2   . TYR C 2  653  ? 37.670  23.029  -57.398  1.00 51.15  ?  657  TYR C CE2   1 
ATOM   8128  C  CZ    . TYR C 2  653  ? 38.231  23.701  -58.461  1.00 54.52  ?  657  TYR C CZ    1 
ATOM   8129  O  OH    . TYR C 2  653  ? 38.223  25.079  -58.485  1.00 52.99  ?  657  TYR C OH    1 
ATOM   8130  N  N     . ILE C 2  654  ? 40.548  18.466  -60.139  1.00 36.44  ?  658  ILE C N     1 
ATOM   8131  C  CA    . ILE C 2  654  ? 41.430  18.723  -61.270  1.00 39.46  ?  658  ILE C CA    1 
ATOM   8132  C  C     . ILE C 2  654  ? 40.559  19.111  -62.453  1.00 39.80  ?  658  ILE C C     1 
ATOM   8133  O  O     . ILE C 2  654  ? 39.571  18.431  -62.743  1.00 35.45  ?  658  ILE C O     1 
ATOM   8134  C  CB    . ILE C 2  654  ? 42.282  17.488  -61.621  1.00 39.96  ?  658  ILE C CB    1 
ATOM   8135  C  CG1   . ILE C 2  654  ? 43.099  17.042  -60.413  1.00 41.68  ?  658  ILE C CG1   1 
ATOM   8136  C  CG2   . ILE C 2  654  ? 43.177  17.772  -62.815  1.00 36.86  ?  658  ILE C CG2   1 
ATOM   8137  C  CD1   . ILE C 2  654  ? 43.116  15.556  -60.222  1.00 36.88  ?  658  ILE C CD1   1 
ATOM   8138  N  N     . THR C 2  655  ? 40.916  20.198  -63.133  1.00 42.58  ?  659  THR C N     1 
ATOM   8139  C  CA    . THR C 2  655  ? 40.225  20.616  -64.346  1.00 42.22  ?  659  THR C CA    1 
ATOM   8140  C  C     . THR C 2  655  ? 41.196  20.561  -65.512  1.00 40.31  ?  659  THR C C     1 
ATOM   8141  O  O     . THR C 2  655  ? 42.317  21.069  -65.417  1.00 38.90  ?  659  THR C O     1 
ATOM   8142  C  CB    . THR C 2  655  ? 39.643  22.029  -64.226  1.00 39.93  ?  659  THR C CB    1 
ATOM   8143  O  OG1   . THR C 2  655  ? 40.639  22.988  -64.588  1.00 49.41  ?  659  THR C OG1   1 
ATOM   8144  C  CG2   . THR C 2  655  ? 39.196  22.300  -62.816  1.00 41.29  ?  659  THR C CG2   1 
ATOM   8145  N  N     . VAL C 2  656  ? 40.757  19.953  -66.607  1.00 41.24  ?  660  VAL C N     1 
ATOM   8146  C  CA    . VAL C 2  656  ? 41.554  19.808  -67.817  1.00 43.27  ?  660  VAL C CA    1 
ATOM   8147  C  C     . VAL C 2  656  ? 40.895  20.618  -68.920  1.00 46.90  ?  660  VAL C C     1 
ATOM   8148  O  O     . VAL C 2  656  ? 39.710  20.425  -69.213  1.00 48.22  ?  660  VAL C O     1 
ATOM   8149  C  CB    . VAL C 2  656  ? 41.679  18.331  -68.229  1.00 45.33  ?  660  VAL C CB    1 
ATOM   8150  C  CG1   . VAL C 2  656  ? 42.459  18.205  -69.524  1.00 47.35  ?  660  VAL C CG1   1 
ATOM   8151  C  CG2   . VAL C 2  656  ? 42.329  17.524  -67.120  1.00 45.78  ?  660  VAL C CG2   1 
ATOM   8152  N  N     . MET C 2  657  ? 41.657  21.513  -69.539  1.00 44.75  ?  661  MET C N     1 
ATOM   8153  C  CA    . MET C 2  657  ? 41.167  22.292  -70.669  1.00 45.22  ?  661  MET C CA    1 
ATOM   8154  C  C     . MET C 2  657  ? 41.520  21.547  -71.949  1.00 47.61  ?  661  MET C C     1 
ATOM   8155  O  O     . MET C 2  657  ? 42.696  21.423  -72.299  1.00 50.24  ?  661  MET C O     1 
ATOM   8156  C  CB    . MET C 2  657  ? 41.767  23.696  -70.665  1.00 44.44  ?  661  MET C CB    1 
ATOM   8157  C  CG    . MET C 2  657  ? 41.534  24.479  -71.951  1.00 46.34  ?  661  MET C CG    1 
ATOM   8158  S  SD    . MET C 2  657  ? 39.821  24.975  -72.210  1.00 53.24  ?  661  MET C SD    1 
ATOM   8159  C  CE    . MET C 2  657  ? 39.576  26.075  -70.822  1.00 52.51  ?  661  MET C CE    1 
ATOM   8160  N  N     . HIS C 2  658  ? 40.502  21.050  -72.643  1.00 49.90  ?  662  HIS C N     1 
ATOM   8161  C  CA    . HIS C 2  658  ? 40.723  20.362  -73.902  1.00 52.09  ?  662  HIS C CA    1 
ATOM   8162  C  C     . HIS C 2  658  ? 41.097  21.361  -74.990  1.00 55.30  ?  662  HIS C C     1 
ATOM   8163  O  O     . HIS C 2  658  ? 40.849  22.565  -74.880  1.00 55.35  ?  662  HIS C O     1 
ATOM   8164  C  CB    . HIS C 2  658  ? 39.475  19.586  -74.324  1.00 54.34  ?  662  HIS C CB    1 
ATOM   8165  C  CG    . HIS C 2  658  ? 38.820  18.832  -73.209  1.00 55.05  ?  662  HIS C CG    1 
ATOM   8166  N  ND1   . HIS C 2  658  ? 39.528  18.290  -72.158  1.00 55.66  ?  662  HIS C ND1   1 
ATOM   8167  C  CD2   . HIS C 2  658  ? 37.520  18.533  -72.980  1.00 53.38  ?  662  HIS C CD2   1 
ATOM   8168  C  CE1   . HIS C 2  658  ? 38.692  17.689  -71.331  1.00 54.12  ?  662  HIS C CE1   1 
ATOM   8169  N  NE2   . HIS C 2  658  ? 37.468  17.822  -71.806  1.00 50.85  ?  662  HIS C NE2   1 
ATOM   8170  N  N     . ASP C 2  659  ? 41.709  20.845  -76.056  1.00 56.45  ?  663  ASP C N     1 
ATOM   8171  C  CA    . ASP C 2  659  ? 42.002  21.678  -77.215  1.00 57.26  ?  663  ASP C CA    1 
ATOM   8172  C  C     . ASP C 2  659  ? 40.734  22.235  -77.849  1.00 59.60  ?  663  ASP C C     1 
ATOM   8173  O  O     . ASP C 2  659  ? 40.808  23.204  -78.612  1.00 58.47  ?  663  ASP C O     1 
ATOM   8174  C  CB    . ASP C 2  659  ? 42.797  20.876  -78.242  1.00 62.43  ?  663  ASP C CB    1 
ATOM   8175  C  CG    . ASP C 2  659  ? 43.980  20.159  -77.626  1.00 67.31  ?  663  ASP C CG    1 
ATOM   8176  O  OD1   . ASP C 2  659  ? 44.585  20.713  -76.685  1.00 62.76  ?  663  ASP C OD1   1 
ATOM   8177  O  OD2   . ASP C 2  659  ? 44.298  19.039  -78.077  1.00 66.24  ?  663  ASP C OD2   1 
ATOM   8178  N  N     . ASN C 2  660  ? 39.578  21.636  -77.554  1.00 58.28  ?  664  ASN C N     1 
ATOM   8179  C  CA    . ASN C 2  660  ? 38.301  22.188  -77.993  1.00 53.42  ?  664  ASN C CA    1 
ATOM   8180  C  C     . ASN C 2  660  ? 38.094  23.611  -77.499  1.00 56.22  ?  664  ASN C C     1 
ATOM   8181  O  O     . ASN C 2  660  ? 37.456  24.420  -78.182  1.00 56.37  ?  664  ASN C O     1 
ATOM   8182  C  CB    . ASN C 2  660  ? 37.154  21.317  -77.483  1.00 46.33  ?  664  ASN C CB    1 
ATOM   8183  C  CG    . ASN C 2  660  ? 36.721  20.280  -78.479  1.00 52.71  ?  664  ASN C CG    1 
ATOM   8184  O  OD1   . ASN C 2  660  ? 36.803  20.491  -79.686  1.00 64.53  ?  664  ASN C OD1   1 
ATOM   8185  N  ND2   . ASN C 2  660  ? 36.240  19.148  -77.981  1.00 57.41  ?  664  ASN C ND2   1 
ATOM   8186  N  N     . GLY C 2  661  ? 38.622  23.934  -76.324  1.00 55.54  ?  665  GLY C N     1 
ATOM   8187  C  CA    . GLY C 2  661  ? 38.144  25.047  -75.540  1.00 50.65  ?  665  GLY C CA    1 
ATOM   8188  C  C     . GLY C 2  661  ? 37.149  24.634  -74.481  1.00 51.38  ?  665  GLY C C     1 
ATOM   8189  O  O     . GLY C 2  661  ? 36.834  25.438  -73.595  1.00 51.76  ?  665  GLY C O     1 
ATOM   8190  N  N     . THR C 2  662  ? 36.643  23.408  -74.562  1.00 52.92  ?  666  THR C N     1 
ATOM   8191  C  CA    . THR C 2  662  ? 35.831  22.816  -73.512  1.00 55.43  ?  666  THR C CA    1 
ATOM   8192  C  C     . THR C 2  662  ? 36.725  22.229  -72.431  1.00 53.53  ?  666  THR C C     1 
ATOM   8193  O  O     . THR C 2  662  ? 37.819  21.731  -72.704  1.00 54.16  ?  666  THR C O     1 
ATOM   8194  C  CB    . THR C 2  662  ? 34.936  21.717  -74.083  1.00 52.74  ?  666  THR C CB    1 
ATOM   8195  O  OG1   . THR C 2  662  ? 35.754  20.713  -74.696  1.00 49.80  ?  666  THR C OG1   1 
ATOM   8196  C  CG2   . THR C 2  662  ? 33.992  22.291  -75.120  1.00 53.09  ?  666  THR C CG2   1 
ATOM   8197  N  N     . ARG C 2  663  ? 36.258  22.290  -71.192  1.00 50.91  ?  667  ARG C N     1 
ATOM   8198  C  CA    . ARG C 2  663  ? 37.031  21.744  -70.094  1.00 49.99  ?  667  ARG C CA    1 
ATOM   8199  C  C     . ARG C 2  663  ? 36.187  20.768  -69.291  1.00 48.37  ?  667  ARG C C     1 
ATOM   8200  O  O     . ARG C 2  663  ? 34.955  20.791  -69.325  1.00 49.38  ?  667  ARG C O     1 
ATOM   8201  C  CB    . ARG C 2  663  ? 37.601  22.844  -69.190  1.00 51.02  ?  667  ARG C CB    1 
ATOM   8202  C  CG    . ARG C 2  663  ? 36.594  23.717  -68.490  1.00 50.72  ?  667  ARG C CG    1 
ATOM   8203  C  CD    . ARG C 2  663  ? 37.323  24.830  -67.762  1.00 47.83  ?  667  ARG C CD    1 
ATOM   8204  N  NE    . ARG C 2  663  ? 36.442  25.590  -66.888  1.00 46.67  ?  667  ARG C NE    1 
ATOM   8205  C  CZ    . ARG C 2  663  ? 35.659  26.575  -67.302  1.00 51.30  ?  667  ARG C CZ    1 
ATOM   8206  N  NH1   . ARG C 2  663  ? 34.885  27.214  -66.438  1.00 54.38  ?  667  ARG C NH1   1 
ATOM   8207  N  NH2   . ARG C 2  663  ? 35.643  26.911  -68.585  1.00 60.22  ?  667  ARG C NH2   1 
ATOM   8208  N  N     . ARG C 2  664  ? 36.888  19.894  -68.578  1.00 49.01  ?  668  ARG C N     1 
ATOM   8209  C  CA    . ARG C 2  664  ? 36.286  18.822  -67.804  1.00 44.06  ?  668  ARG C CA    1 
ATOM   8210  C  C     . ARG C 2  664  ? 36.986  18.767  -66.459  1.00 41.39  ?  668  ARG C C     1 
ATOM   8211  O  O     . ARG C 2  664  ? 38.217  18.795  -66.399  1.00 41.10  ?  668  ARG C O     1 
ATOM   8212  C  CB    . ARG C 2  664  ? 36.409  17.485  -68.541  1.00 44.67  ?  668  ARG C CB    1 
ATOM   8213  C  CG    . ARG C 2  664  ? 36.170  16.261  -67.685  1.00 45.29  ?  668  ARG C CG    1 
ATOM   8214  C  CD    . ARG C 2  664  ? 34.772  16.229  -67.118  1.00 46.86  ?  668  ARG C CD    1 
ATOM   8215  N  NE    . ARG C 2  664  ? 34.520  14.998  -66.377  1.00 51.41  ?  668  ARG C NE    1 
ATOM   8216  C  CZ    . ARG C 2  664  ? 34.009  13.898  -66.916  1.00 61.11  ?  668  ARG C CZ    1 
ATOM   8217  N  NH1   . ARG C 2  664  ? 33.812  12.821  -66.170  1.00 63.89  ?  668  ARG C NH1   1 
ATOM   8218  N  NH2   . ARG C 2  664  ? 33.695  13.877  -68.205  1.00 61.68  ?  668  ARG C NH2   1 
ATOM   8219  N  N     . THR C 2  665  ? 36.206  18.707  -65.388  1.00 39.48  ?  669  THR C N     1 
ATOM   8220  C  CA    . THR C 2  665  ? 36.738  18.723  -64.036  1.00 39.71  ?  669  THR C CA    1 
ATOM   8221  C  C     . THR C 2  665  ? 36.475  17.387  -63.358  1.00 40.31  ?  669  THR C C     1 
ATOM   8222  O  O     . THR C 2  665  ? 35.411  16.788  -63.534  1.00 41.46  ?  669  THR C O     1 
ATOM   8223  C  CB    . THR C 2  665  ? 36.127  19.867  -63.223  1.00 40.23  ?  669  THR C CB    1 
ATOM   8224  O  OG1   . THR C 2  665  ? 36.453  21.112  -63.846  1.00 42.28  ?  669  THR C OG1   1 
ATOM   8225  C  CG2   . THR C 2  665  ? 36.664  19.879  -61.802  1.00 38.35  ?  669  THR C CG2   1 
ATOM   8226  N  N     . TYR C 2  666  ? 37.458  16.922  -62.592  1.00 41.06  ?  670  TYR C N     1 
ATOM   8227  C  CA    . TYR C 2  666  ? 37.390  15.659  -61.873  1.00 34.64  ?  670  TYR C CA    1 
ATOM   8228  C  C     . TYR C 2  666  ? 37.499  15.944  -60.384  1.00 34.21  ?  670  TYR C C     1 
ATOM   8229  O  O     . TYR C 2  666  ? 38.533  16.432  -59.920  1.00 35.83  ?  670  TYR C O     1 
ATOM   8230  C  CB    . TYR C 2  666  ? 38.506  14.719  -62.329  1.00 33.88  ?  670  TYR C CB    1 
ATOM   8231  C  CG    . TYR C 2  666  ? 38.509  14.458  -63.818  1.00 34.19  ?  670  TYR C CG    1 
ATOM   8232  C  CD1   . TYR C 2  666  ? 37.790  13.403  -64.356  1.00 37.14  ?  670  TYR C CD1   1 
ATOM   8233  C  CD2   . TYR C 2  666  ? 39.230  15.263  -64.683  1.00 32.18  ?  670  TYR C CD2   1 
ATOM   8234  C  CE1   . TYR C 2  666  ? 37.786  13.161  -65.712  1.00 38.56  ?  670  TYR C CE1   1 
ATOM   8235  C  CE2   . TYR C 2  666  ? 39.232  15.027  -66.043  1.00 36.70  ?  670  TYR C CE2   1 
ATOM   8236  C  CZ    . TYR C 2  666  ? 38.509  13.972  -66.551  1.00 39.39  ?  670  TYR C CZ    1 
ATOM   8237  O  OH    . TYR C 2  666  ? 38.503  13.726  -67.903  1.00 40.30  ?  670  TYR C OH    1 
ATOM   8238  N  N     . ARG C 2  667  ? 36.438  15.649  -59.640  1.00 33.38  ?  671  ARG C N     1 
ATOM   8239  C  CA    . ARG C 2  667  ? 36.454  15.840  -58.198  1.00 33.70  ?  671  ARG C CA    1 
ATOM   8240  C  C     . ARG C 2  667  ? 37.110  14.648  -57.511  1.00 34.69  ?  671  ARG C C     1 
ATOM   8241  O  O     . ARG C 2  667  ? 36.931  13.500  -57.921  1.00 35.60  ?  671  ARG C O     1 
ATOM   8242  C  CB    . ARG C 2  667  ? 35.036  16.037  -57.667  1.00 34.70  ?  671  ARG C CB    1 
ATOM   8243  C  CG    . ARG C 2  667  ? 34.362  17.320  -58.117  1.00 36.58  ?  671  ARG C CG    1 
ATOM   8244  C  CD    . ARG C 2  667  ? 32.939  17.394  -57.593  1.00 38.17  ?  671  ARG C CD    1 
ATOM   8245  N  NE    . ARG C 2  667  ? 32.886  17.325  -56.135  1.00 41.79  ?  671  ARG C NE    1 
ATOM   8246  C  CZ    . ARG C 2  667  ? 31.803  16.982  -55.445  1.00 44.42  ?  671  ARG C CZ    1 
ATOM   8247  N  NH1   . ARG C 2  667  ? 30.687  16.669  -56.083  1.00 44.94  ?  671  ARG C NH1   1 
ATOM   8248  N  NH2   . ARG C 2  667  ? 31.838  16.943  -54.121  1.00 39.99  ?  671  ARG C NH2   1 
ATOM   8249  N  N     . MET C 2  668  ? 37.864  14.928  -56.454  1.00 32.44  ?  672  MET C N     1 
ATOM   8250  C  CA    . MET C 2  668  ? 38.642  13.911  -55.765  1.00 32.90  ?  672  MET C CA    1 
ATOM   8251  C  C     . MET C 2  668  ? 37.864  13.344  -54.587  1.00 33.78  ?  672  MET C C     1 
ATOM   8252  O  O     . MET C 2  668  ? 37.303  14.095  -53.786  1.00 35.67  ?  672  MET C O     1 
ATOM   8253  C  CB    . MET C 2  668  ? 39.966  14.497  -55.274  1.00 33.83  ?  672  MET C CB    1 
ATOM   8254  C  CG    . MET C 2  668  ? 40.820  15.149  -56.351  1.00 35.01  ?  672  MET C CG    1 
ATOM   8255  S  SD    . MET C 2  668  ? 41.726  13.974  -57.368  1.00 36.13  ?  672  MET C SD    1 
ATOM   8256  C  CE    . MET C 2  668  ? 40.546  13.614  -58.660  1.00 34.80  ?  672  MET C CE    1 
ATOM   8257  N  N     . ARG C 2  669  ? 37.841  12.019  -54.481  1.00 34.62  ?  673  ARG C N     1 
ATOM   8258  C  CA    . ARG C 2  669  ? 37.364  11.380  -53.263  1.00 35.30  ?  673  ARG C CA    1 
ATOM   8259  C  C     . ARG C 2  669  ? 38.391  11.596  -52.162  1.00 35.44  ?  673  ARG C C     1 
ATOM   8260  O  O     . ARG C 2  669  ? 39.547  11.185  -52.297  1.00 37.28  ?  673  ARG C O     1 
ATOM   8261  C  CB    . ARG C 2  669  ? 37.137  9.892   -53.502  1.00 39.63  ?  673  ARG C CB    1 
ATOM   8262  C  CG    . ARG C 2  669  ? 36.219  9.588   -54.665  1.00 49.33  ?  673  ARG C CG    1 
ATOM   8263  C  CD    . ARG C 2  669  ? 35.141  8.610   -54.251  1.00 57.17  ?  673  ARG C CD    1 
ATOM   8264  N  NE    . ARG C 2  669  ? 35.678  7.282   -53.983  1.00 59.32  ?  673  ARG C NE    1 
ATOM   8265  C  CZ    . ARG C 2  669  ? 35.034  6.350   -53.292  1.00 69.21  ?  673  ARG C CZ    1 
ATOM   8266  N  NH1   . ARG C 2  669  ? 35.590  5.163   -53.096  1.00 67.82  ?  673  ARG C NH1   1 
ATOM   8267  N  NH2   . ARG C 2  669  ? 33.837  6.611   -52.787  1.00 74.79  ?  673  ARG C NH2   1 
ATOM   8268  N  N     . LYS C 2  670  ? 37.977  12.222  -51.067  1.00 33.87  ?  674  LYS C N     1 
ATOM   8269  C  CA    . LYS C 2  670  ? 38.901  12.622  -50.013  1.00 36.66  ?  674  LYS C CA    1 
ATOM   8270  C  C     . LYS C 2  670  ? 38.490  11.962  -48.706  1.00 35.64  ?  674  LYS C C     1 
ATOM   8271  O  O     . LYS C 2  670  ? 37.457  12.314  -48.127  1.00 34.99  ?  674  LYS C O     1 
ATOM   8272  C  CB    . LYS C 2  670  ? 38.945  14.143  -49.875  1.00 34.59  ?  674  LYS C CB    1 
ATOM   8273  C  CG    . LYS C 2  670  ? 39.440  14.861  -51.120  1.00 34.39  ?  674  LYS C CG    1 
ATOM   8274  C  CD    . LYS C 2  670  ? 40.760  14.290  -51.621  1.00 35.32  ?  674  LYS C CD    1 
ATOM   8275  C  CE    . LYS C 2  670  ? 41.874  14.439  -50.599  1.00 39.91  ?  674  LYS C CE    1 
ATOM   8276  N  NZ    . LYS C 2  670  ? 43.194  14.022  -51.151  1.00 37.50  ?  674  LYS C NZ    1 
ATOM   8277  N  N     . PHE C 2  671  ? 39.316  11.027  -48.240  1.00 36.58  ?  675  PHE C N     1 
ATOM   8278  C  CA    . PHE C 2  671  ? 39.114  10.335  -46.970  1.00 35.92  ?  675  PHE C CA    1 
ATOM   8279  C  C     . PHE C 2  671  ? 37.714  9.737   -46.883  1.00 35.14  ?  675  PHE C C     1 
ATOM   8280  O  O     . PHE C 2  671  ? 36.963  9.968   -45.933  1.00 39.86  ?  675  PHE C O     1 
ATOM   8281  C  CB    . PHE C 2  671  ? 39.403  11.268  -45.798  1.00 32.84  ?  675  PHE C CB    1 
ATOM   8282  C  CG    . PHE C 2  671  ? 40.779  11.850  -45.836  1.00 34.21  ?  675  PHE C CG    1 
ATOM   8283  C  CD1   . PHE C 2  671  ? 41.877  11.076  -45.503  1.00 34.66  ?  675  PHE C CD1   1 
ATOM   8284  C  CD2   . PHE C 2  671  ? 40.982  13.159  -46.230  1.00 33.21  ?  675  PHE C CD2   1 
ATOM   8285  C  CE1   . PHE C 2  671  ? 43.149  11.600  -45.550  1.00 34.26  ?  675  PHE C CE1   1 
ATOM   8286  C  CE2   . PHE C 2  671  ? 42.253  13.688  -46.281  1.00 36.94  ?  675  PHE C CE2   1 
ATOM   8287  C  CZ    . PHE C 2  671  ? 43.337  12.907  -45.938  1.00 37.52  ?  675  PHE C CZ    1 
ATOM   8288  N  N     . ALA C 2  672  ? 37.369  8.956   -47.901  1.00 36.08  ?  676  ALA C N     1 
ATOM   8289  C  CA    . ALA C 2  672  ? 36.076  8.299   -47.976  1.00 34.87  ?  676  ALA C CA    1 
ATOM   8290  C  C     . ALA C 2  672  ? 36.160  6.903   -47.379  1.00 36.38  ?  676  ALA C C     1 
ATOM   8291  O  O     . ALA C 2  672  ? 37.140  6.182   -47.578  1.00 38.77  ?  676  ALA C O     1 
ATOM   8292  C  CB    . ALA C 2  672  ? 35.593  8.219   -49.423  1.00 37.07  ?  676  ALA C CB    1 
ATOM   8293  N  N     . ARG C 2  673  ? 35.120  6.527   -46.646  1.00 37.42  ?  677  ARG C N     1 
ATOM   8294  C  CA    . ARG C 2  673  ? 35.061  5.217   -46.020  1.00 37.59  ?  677  ARG C CA    1 
ATOM   8295  C  C     . ARG C 2  673  ? 34.600  4.174   -47.029  1.00 39.99  ?  677  ARG C C     1 
ATOM   8296  O  O     . ARG C 2  673  ? 33.564  4.343   -47.677  1.00 39.74  ?  677  ARG C O     1 
ATOM   8297  C  CB    . ARG C 2  673  ? 34.112  5.257   -44.827  1.00 36.23  ?  677  ARG C CB    1 
ATOM   8298  C  CG    . ARG C 2  673  ? 34.079  3.995   -44.011  1.00 38.75  ?  677  ARG C CG    1 
ATOM   8299  C  CD    . ARG C 2  673  ? 33.037  4.103   -42.923  1.00 39.57  ?  677  ARG C CD    1 
ATOM   8300  N  NE    . ARG C 2  673  ? 33.068  2.952   -42.033  1.00 42.35  ?  677  ARG C NE    1 
ATOM   8301  C  CZ    . ARG C 2  673  ? 32.451  1.803   -42.280  1.00 44.53  ?  677  ARG C CZ    1 
ATOM   8302  N  NH1   . ARG C 2  673  ? 31.756  1.651   -43.396  1.00 40.68  ?  677  ARG C NH1   1 
ATOM   8303  N  NH2   . ARG C 2  673  ? 32.534  0.808   -41.412  1.00 51.61  ?  677  ARG C NH2   1 
ATOM   8304  N  N     . SER C 2  674  ? 35.372  3.101   -47.169  1.00 36.97  ?  678  SER C N     1 
ATOM   8305  C  CA    . SER C 2  674  ? 34.920  1.983   -47.977  1.00 38.87  ?  678  SER C CA    1 
ATOM   8306  C  C     . SER C 2  674  ? 34.008  1.085   -47.149  1.00 42.09  ?  678  SER C C     1 
ATOM   8307  O  O     . SER C 2  674  ? 33.831  1.277   -45.943  1.00 42.25  ?  678  SER C O     1 
ATOM   8308  C  CB    . SER C 2  674  ? 36.105  1.187   -48.512  1.00 40.60  ?  678  SER C CB    1 
ATOM   8309  O  OG    . SER C 2  674  ? 36.749  0.473   -47.470  1.00 43.44  ?  678  SER C OG    1 
ATOM   8310  N  N     . ASN C 2  675  ? 33.447  0.067   -47.806  1.00 42.72  ?  679  ASN C N     1 
ATOM   8311  C  CA    . ASN C 2  675  ? 32.471  -0.784  -47.135  1.00 43.52  ?  679  ASN C CA    1 
ATOM   8312  C  C     . ASN C 2  675  ? 33.079  -1.509  -45.944  1.00 46.19  ?  679  ASN C C     1 
ATOM   8313  O  O     . ASN C 2  675  ? 32.384  -1.773  -44.958  1.00 47.12  ?  679  ASN C O     1 
ATOM   8314  C  CB    . ASN C 2  675  ? 31.882  -1.791  -48.119  1.00 47.74  ?  679  ASN C CB    1 
ATOM   8315  C  CG    . ASN C 2  675  ? 30.832  -1.180  -49.023  1.00 50.81  ?  679  ASN C CG    1 
ATOM   8316  O  OD1   . ASN C 2  675  ? 30.164  -0.217  -48.653  1.00 54.43  ?  679  ASN C OD1   1 
ATOM   8317  N  ND2   . ASN C 2  675  ? 30.675  -1.745  -50.213  1.00 49.00  ?  679  ASN C ND2   1 
ATOM   8318  N  N     . HIS C 2  676  ? 34.365  -1.839  -46.015  1.00 48.51  ?  680  HIS C N     1 
ATOM   8319  C  CA    . HIS C 2  676  ? 35.049  -2.571  -44.960  1.00 50.75  ?  680  HIS C CA    1 
ATOM   8320  C  C     . HIS C 2  676  ? 35.825  -1.670  -44.006  1.00 48.93  ?  680  HIS C C     1 
ATOM   8321  O  O     . HIS C 2  676  ? 36.542  -2.177  -43.138  1.00 50.04  ?  680  HIS C O     1 
ATOM   8322  C  CB    . HIS C 2  676  ? 35.964  -3.624  -45.577  1.00 48.85  ?  680  HIS C CB    1 
ATOM   8323  C  CG    . HIS C 2  676  ? 35.226  -4.632  -46.398  1.00 55.00  ?  680  HIS C CG    1 
ATOM   8324  N  ND1   . HIS C 2  676  ? 34.227  -5.423  -45.875  1.00 58.27  ?  680  HIS C ND1   1 
ATOM   8325  C  CD2   . HIS C 2  676  ? 35.320  -4.961  -47.707  1.00 56.66  ?  680  HIS C CD2   1 
ATOM   8326  C  CE1   . HIS C 2  676  ? 33.746  -6.206  -46.823  1.00 60.82  ?  680  HIS C CE1   1 
ATOM   8327  N  NE2   . HIS C 2  676  ? 34.393  -5.945  -47.945  1.00 60.60  ?  680  HIS C NE2   1 
ATOM   8328  N  N     . GLY C 2  677  ? 35.721  -0.354  -44.157  1.00 42.75  ?  681  GLY C N     1 
ATOM   8329  C  CA    . GLY C 2  677  ? 36.335  0.559   -43.222  1.00 39.13  ?  681  GLY C CA    1 
ATOM   8330  C  C     . GLY C 2  677  ? 37.725  1.017   -43.588  1.00 38.29  ?  681  GLY C C     1 
ATOM   8331  O  O     . GLY C 2  677  ? 38.364  1.705   -42.782  1.00 35.55  ?  681  GLY C O     1 
ATOM   8332  N  N     . THR C 2  678  ? 38.222  0.653   -44.764  1.00 39.52  ?  682  THR C N     1 
ATOM   8333  C  CA    . THR C 2  678  ? 39.495  1.173   -45.220  1.00 38.01  ?  682  THR C CA    1 
ATOM   8334  C  C     . THR C 2  678  ? 39.297  2.592   -45.747  1.00 37.26  ?  682  THR C C     1 
ATOM   8335  O  O     . THR C 2  678  ? 38.180  3.108   -45.808  1.00 39.00  ?  682  THR C O     1 
ATOM   8336  C  CB    . THR C 2  678  ? 40.098  0.248   -46.272  1.00 37.71  ?  682  THR C CB    1 
ATOM   8337  O  OG1   . THR C 2  678  ? 39.170  0.077   -47.349  1.00 40.70  ?  682  THR C OG1   1 
ATOM   8338  C  CG2   . THR C 2  678  ? 40.405  -1.107  -45.664  1.00 35.89  ?  682  THR C CG2   1 
ATOM   8339  N  N     . CYS C 2  679  ? 40.386  3.237   -46.141  1.00 37.97  ?  683  CYS C N     1 
ATOM   8340  C  CA    . CYS C 2  679  ? 40.363  4.649   -46.498  1.00 34.96  ?  683  CYS C CA    1 
ATOM   8341  C  C     . CYS C 2  679  ? 40.560  4.785   -48.000  1.00 36.66  ?  683  CYS C C     1 
ATOM   8342  O  O     . CYS C 2  679  ? 41.636  4.479   -48.522  1.00 37.26  ?  683  CYS C O     1 
ATOM   8343  C  CB    . CYS C 2  679  ? 41.431  5.421   -45.731  1.00 35.79  ?  683  CYS C CB    1 
ATOM   8344  S  SG    . CYS C 2  679  ? 41.457  7.185   -46.099  1.00 41.24  ?  683  CYS C SG    1 
ATOM   8345  N  N     . ALA C 2  680  ? 39.522  5.249   -48.690  1.00 37.96  ?  684  ALA C N     1 
ATOM   8346  C  CA    . ALA C 2  680  ? 39.609  5.560   -50.110  1.00 37.76  ?  684  ALA C CA    1 
ATOM   8347  C  C     . ALA C 2  680  ? 39.970  7.034   -50.238  1.00 38.95  ?  684  ALA C C     1 
ATOM   8348  O  O     . ALA C 2  680  ? 39.161  7.911   -49.922  1.00 40.60  ?  684  ALA C O     1 
ATOM   8349  C  CB    . ALA C 2  680  ? 38.294  5.247   -50.818  1.00 33.92  ?  684  ALA C CB    1 
ATOM   8350  N  N     . ASN C 2  681  ? 41.185  7.306   -50.699  1.00 35.83  ?  685  ASN C N     1 
ATOM   8351  C  CA    . ASN C 2  681  ? 41.701  8.664   -50.772  1.00 37.63  ?  685  ASN C CA    1 
ATOM   8352  C  C     . ASN C 2  681  ? 42.418  8.823   -52.099  1.00 40.94  ?  685  ASN C C     1 
ATOM   8353  O  O     . ASN C 2  681  ? 43.347  8.068   -52.396  1.00 45.10  ?  685  ASN C O     1 
ATOM   8354  C  CB    . ASN C 2  681  ? 42.647  8.954   -49.604  1.00 40.76  ?  685  ASN C CB    1 
ATOM   8355  C  CG    . ASN C 2  681  ? 42.907  10.431  -49.415  1.00 38.65  ?  685  ASN C CG    1 
ATOM   8356  O  OD1   . ASN C 2  681  ? 42.117  11.268  -49.839  1.00 43.86  ?  685  ASN C OD1   1 
ATOM   8357  N  ND2   . ASN C 2  681  ? 44.013  10.758  -48.768  1.00 38.76  ?  685  ASN C ND2   1 
ATOM   8358  N  N     . GLN C 2  682  ? 41.991  9.794   -52.892  1.00 36.85  ?  686  GLN C N     1 
ATOM   8359  C  CA    . GLN C 2  682  ? 42.611  10.066  -54.177  1.00 38.32  ?  686  GLN C CA    1 
ATOM   8360  C  C     . GLN C 2  682  ? 43.476  11.314  -54.083  1.00 40.39  ?  686  GLN C C     1 
ATOM   8361  O  O     . GLN C 2  682  ? 43.118  12.281  -53.406  1.00 40.57  ?  686  GLN C O     1 
ATOM   8362  C  CB    . GLN C 2  682  ? 41.552  10.234  -55.265  1.00 35.50  ?  686  GLN C CB    1 
ATOM   8363  C  CG    . GLN C 2  682  ? 40.773  8.972   -55.560  1.00 34.98  ?  686  GLN C CG    1 
ATOM   8364  C  CD    . GLN C 2  682  ? 39.585  9.223   -56.460  1.00 39.62  ?  686  GLN C CD    1 
ATOM   8365  O  OE1   . GLN C 2  682  ? 39.016  10.313  -56.463  1.00 40.24  ?  686  GLN C OE1   1 
ATOM   8366  N  NE2   . GLN C 2  682  ? 39.202  8.214   -57.232  1.00 45.45  ?  686  GLN C NE2   1 
ATOM   8367  N  N     . CYS C 2  683  ? 44.628  11.278  -54.750  1.00 39.02  ?  687  CYS C N     1 
ATOM   8368  C  CA    . CYS C 2  683  ? 45.514  12.424  -54.807  1.00 35.82  ?  687  CYS C CA    1 
ATOM   8369  C  C     . CYS C 2  683  ? 45.937  12.682  -56.246  1.00 37.65  ?  687  CYS C C     1 
ATOM   8370  O  O     . CYS C 2  683  ? 46.252  11.739  -56.978  1.00 41.25  ?  687  CYS C O     1 
ATOM   8371  C  CB    . CYS C 2  683  ? 46.754  12.196  -53.937  1.00 36.32  ?  687  CYS C CB    1 
ATOM   8372  S  SG    . CYS C 2  683  ? 46.392  11.897  -52.198  1.00 50.14  ?  687  CYS C SG    1 
ATOM   8373  N  N     . PRO C 2  684  ? 45.974  13.943  -56.670  1.00 38.63  ?  688  PRO C N     1 
ATOM   8374  C  CA    . PRO C 2  684  ? 46.397  14.247  -58.041  1.00 37.66  ?  688  PRO C CA    1 
ATOM   8375  C  C     . PRO C 2  684  ? 47.888  14.027  -58.230  1.00 36.59  ?  688  PRO C C     1 
ATOM   8376  O  O     . PRO C 2  684  ? 48.705  14.415  -57.392  1.00 38.75  ?  688  PRO C O     1 
ATOM   8377  C  CB    . PRO C 2  684  ? 46.029  15.727  -58.206  1.00 38.24  ?  688  PRO C CB    1 
ATOM   8378  C  CG    . PRO C 2  684  ? 45.075  16.025  -57.091  1.00 34.91  ?  688  PRO C CG    1 
ATOM   8379  C  CD    . PRO C 2  684  ? 45.488  15.138  -55.966  1.00 37.15  ?  688  PRO C CD    1 
ATOM   8380  N  N     . ILE C 2  685  ? 48.236  13.369  -59.335  1.00 33.83  ?  689  ILE C N     1 
ATOM   8381  C  CA    . ILE C 2  685  ? 49.628  13.162  -59.716  1.00 32.98  ?  689  ILE C CA    1 
ATOM   8382  C  C     . ILE C 2  685  ? 50.092  14.153  -60.782  1.00 37.54  ?  689  ILE C C     1 
ATOM   8383  O  O     . ILE C 2  685  ? 51.193  14.003  -61.318  1.00 38.04  ?  689  ILE C O     1 
ATOM   8384  C  CB    . ILE C 2  685  ? 49.881  11.711  -60.154  1.00 29.42  ?  689  ILE C CB    1 
ATOM   8385  C  CG1   . ILE C 2  685  ? 49.176  11.402  -61.471  1.00 32.06  ?  689  ILE C CG1   1 
ATOM   8386  C  CG2   . ILE C 2  685  ? 49.424  10.757  -59.074  1.00 33.12  ?  689  ILE C CG2   1 
ATOM   8387  C  CD1   . ILE C 2  685  ? 49.318  9.970   -61.897  1.00 33.88  ?  689  ILE C CD1   1 
ATOM   8388  N  N     . VAL C 2  686  ? 49.270  15.141  -61.130  1.00 37.12  ?  690  VAL C N     1 
ATOM   8389  C  CA    . VAL C 2  686  ? 49.594  16.081  -62.196  1.00 35.91  ?  690  VAL C CA    1 
ATOM   8390  C  C     . VAL C 2  686  ? 49.714  17.490  -61.623  1.00 38.46  ?  690  VAL C C     1 
ATOM   8391  O  O     . VAL C 2  686  ? 49.226  17.793  -60.533  1.00 40.44  ?  690  VAL C O     1 
ATOM   8392  C  CB    . VAL C 2  686  ? 48.556  16.050  -63.333  1.00 35.33  ?  690  VAL C CB    1 
ATOM   8393  C  CG1   . VAL C 2  686  ? 48.647  14.744  -64.097  1.00 34.21  ?  690  VAL C CG1   1 
ATOM   8394  C  CG2   . VAL C 2  686  ? 47.163  16.251  -62.774  1.00 36.53  ?  690  VAL C CG2   1 
ATOM   8395  N  N     . ASP C 2  687  ? 50.392  18.352  -62.378  1.00 43.30  ?  691  ASP C N     1 
ATOM   8396  C  CA    . ASP C 2  687  ? 50.665  19.725  -61.980  1.00 43.78  ?  691  ASP C CA    1 
ATOM   8397  C  C     . ASP C 2  687  ? 50.049  20.702  -62.971  1.00 42.04  ?  691  ASP C C     1 
ATOM   8398  O  O     . ASP C 2  687  ? 49.801  20.372  -64.133  1.00 40.20  ?  691  ASP C O     1 
ATOM   8399  C  CB    . ASP C 2  687  ? 52.173  19.983  -61.879  1.00 48.87  ?  691  ASP C CB    1 
ATOM   8400  C  CG    . ASP C 2  687  ? 52.768  19.457  -60.595  1.00 55.07  ?  691  ASP C CG    1 
ATOM   8401  O  OD1   . ASP C 2  687  ? 52.274  19.840  -59.514  1.00 50.73  ?  691  ASP C OD1   1 
ATOM   8402  O  OD2   . ASP C 2  687  ? 53.724  18.655  -60.664  1.00 56.38  ?  691  ASP C OD2   1 
ATOM   8403  N  N     . ALA C 2  688  ? 49.816  21.923  -62.492  1.00 43.48  ?  692  ALA C N     1 
ATOM   8404  C  CA    . ALA C 2  688  ? 49.233  22.964  -63.328  1.00 40.86  ?  692  ALA C CA    1 
ATOM   8405  C  C     . ALA C 2  688  ? 50.134  23.264  -64.517  1.00 43.42  ?  692  ALA C C     1 
ATOM   8406  O  O     . ALA C 2  688  ? 51.323  23.554  -64.357  1.00 39.59  ?  692  ALA C O     1 
ATOM   8407  C  CB    . ALA C 2  688  ? 48.997  24.229  -62.507  1.00 32.57  ?  692  ALA C CB    1 
ATOM   8408  N  N     . GLY C 2  689  ? 49.560  23.195  -65.714  1.00 41.39  ?  693  GLY C N     1 
ATOM   8409  C  CA    . GLY C 2  689  ? 50.289  23.388  -66.941  1.00 42.30  ?  693  GLY C CA    1 
ATOM   8410  C  C     . GLY C 2  689  ? 50.687  22.108  -67.644  1.00 44.85  ?  693  GLY C C     1 
ATOM   8411  O  O     . GLY C 2  689  ? 51.024  22.152  -68.832  1.00 49.03  ?  693  GLY C O     1 
ATOM   8412  N  N     . ASP C 2  690  ? 50.656  20.976  -66.944  1.00 43.84  ?  694  ASP C N     1 
ATOM   8413  C  CA    . ASP C 2  690  ? 51.026  19.707  -67.554  1.00 43.94  ?  694  ASP C CA    1 
ATOM   8414  C  C     . ASP C 2  690  ? 50.102  19.372  -68.716  1.00 43.12  ?  694  ASP C C     1 
ATOM   8415  O  O     . ASP C 2  690  ? 48.908  19.678  -68.702  1.00 42.10  ?  694  ASP C O     1 
ATOM   8416  C  CB    . ASP C 2  690  ? 50.981  18.578  -66.525  1.00 45.96  ?  694  ASP C CB    1 
ATOM   8417  C  CG    . ASP C 2  690  ? 52.100  18.665  -65.512  1.00 50.30  ?  694  ASP C CG    1 
ATOM   8418  O  OD1   . ASP C 2  690  ? 53.039  19.456  -65.730  1.00 53.79  ?  694  ASP C OD1   1 
ATOM   8419  O  OD2   . ASP C 2  690  ? 52.048  17.930  -64.504  1.00 48.15  ?  694  ASP C OD2   1 
ATOM   8420  N  N     . ARG C 2  691  ? 50.675  18.737  -69.731  1.00 43.76  ?  695  ARG C N     1 
ATOM   8421  C  CA    . ARG C 2  691  ? 49.932  18.253  -70.885  1.00 46.25  ?  695  ARG C CA    1 
ATOM   8422  C  C     . ARG C 2  691  ? 49.651  16.769  -70.692  1.00 45.73  ?  695  ARG C C     1 
ATOM   8423  O  O     . ARG C 2  691  ? 50.579  15.980  -70.483  1.00 46.78  ?  695  ARG C O     1 
ATOM   8424  C  CB    . ARG C 2  691  ? 50.715  18.490  -72.175  1.00 46.78  ?  695  ARG C CB    1 
ATOM   8425  C  CG    . ARG C 2  691  ? 50.132  17.797  -73.394  1.00 49.17  ?  695  ARG C CG    1 
ATOM   8426  C  CD    . ARG C 2  691  ? 48.906  18.521  -73.912  1.00 55.92  ?  695  ARG C CD    1 
ATOM   8427  N  NE    . ARG C 2  691  ? 48.343  17.860  -75.085  1.00 63.25  ?  695  ARG C NE    1 
ATOM   8428  C  CZ    . ARG C 2  691  ? 47.349  18.354  -75.816  1.00 66.64  ?  695  ARG C CZ    1 
ATOM   8429  N  NH1   . ARG C 2  691  ? 46.808  19.522  -75.500  1.00 63.69  ?  695  ARG C NH1   1 
ATOM   8430  N  NH2   . ARG C 2  691  ? 46.899  17.682  -76.867  1.00 69.46  ?  695  ARG C NH2   1 
ATOM   8431  N  N     . VAL C 2  692  ? 48.378  16.394  -70.762  1.00 42.26  ?  696  VAL C N     1 
ATOM   8432  C  CA    . VAL C 2  692  ? 47.956  15.020  -70.545  1.00 42.98  ?  696  VAL C CA    1 
ATOM   8433  C  C     . VAL C 2  692  ? 47.228  14.526  -71.785  1.00 48.72  ?  696  VAL C C     1 
ATOM   8434  O  O     . VAL C 2  692  ? 46.774  15.305  -72.625  1.00 52.71  ?  696  VAL C O     1 
ATOM   8435  C  CB    . VAL C 2  692  ? 47.066  14.874  -69.299  1.00 38.93  ?  696  VAL C CB    1 
ATOM   8436  C  CG1   . VAL C 2  692  ? 47.840  15.269  -68.059  1.00 39.14  ?  696  VAL C CG1   1 
ATOM   8437  C  CG2   . VAL C 2  692  ? 45.813  15.713  -69.449  1.00 41.78  ?  696  VAL C CG2   1 
ATOM   8438  N  N     . GLU C 2  693  ? 47.117  13.208  -71.887  1.00 44.81  ?  697  GLU C N     1 
ATOM   8439  C  CA    . GLU C 2  693  ? 46.521  12.555  -73.038  1.00 45.74  ?  697  GLU C CA    1 
ATOM   8440  C  C     . GLU C 2  693  ? 45.339  11.707  -72.596  1.00 45.14  ?  697  GLU C C     1 
ATOM   8441  O  O     . GLU C 2  693  ? 45.161  11.422  -71.410  1.00 44.27  ?  697  GLU C O     1 
ATOM   8442  C  CB    . GLU C 2  693  ? 47.548  11.689  -73.773  1.00 48.30  ?  697  GLU C CB    1 
ATOM   8443  C  CG    . GLU C 2  693  ? 48.639  12.489  -74.452  1.00 52.53  ?  697  GLU C CG    1 
ATOM   8444  C  CD    . GLU C 2  693  ? 48.111  13.302  -75.615  1.00 61.96  ?  697  GLU C CD    1 
ATOM   8445  O  OE1   . GLU C 2  693  ? 47.101  12.884  -76.218  1.00 65.69  ?  697  GLU C OE1   1 
ATOM   8446  O  OE2   . GLU C 2  693  ? 48.700  14.357  -75.927  1.00 62.68  ?  697  GLU C OE2   1 
ATOM   8447  N  N     . ALA C 2  694  ? 44.511  11.330  -73.566  1.00 48.85  ?  698  ALA C N     1 
ATOM   8448  C  CA    . ALA C 2  694  ? 43.363  10.485  -73.274  1.00 47.04  ?  698  ALA C CA    1 
ATOM   8449  C  C     . ALA C 2  694  ? 43.828  9.124   -72.776  1.00 46.67  ?  698  ALA C C     1 
ATOM   8450  O  O     . ALA C 2  694  ? 44.630  8.450   -73.428  1.00 47.19  ?  698  ALA C O     1 
ATOM   8451  C  CB    . ALA C 2  694  ? 42.492  10.328  -74.519  1.00 47.88  ?  698  ALA C CB    1 
ATOM   8452  N  N     . GLY C 2  695  ? 43.323  8.723   -71.613  1.00 41.95  ?  699  GLY C N     1 
ATOM   8453  C  CA    . GLY C 2  695  ? 43.708  7.485   -70.985  1.00 45.95  ?  699  GLY C CA    1 
ATOM   8454  C  C     . GLY C 2  695  ? 44.777  7.624   -69.922  1.00 42.54  ?  699  GLY C C     1 
ATOM   8455  O  O     . GLY C 2  695  ? 44.960  6.699   -69.123  1.00 44.49  ?  699  GLY C O     1 
ATOM   8456  N  N     . GLN C 2  696  ? 45.486  8.748   -69.893  1.00 39.79  ?  700  GLN C N     1 
ATOM   8457  C  CA    . GLN C 2  696  ? 46.511  8.969   -68.886  1.00 39.29  ?  700  GLN C CA    1 
ATOM   8458  C  C     . GLN C 2  696  ? 45.883  9.091   -67.502  1.00 39.49  ?  700  GLN C C     1 
ATOM   8459  O  O     . GLN C 2  696  ? 44.755  9.563   -67.347  1.00 39.37  ?  700  GLN C O     1 
ATOM   8460  C  CB    . GLN C 2  696  ? 47.314  10.225  -69.224  1.00 38.35  ?  700  GLN C CB    1 
ATOM   8461  C  CG    . GLN C 2  696  ? 48.327  10.640  -68.175  1.00 37.19  ?  700  GLN C CG    1 
ATOM   8462  C  CD    . GLN C 2  696  ? 49.346  11.616  -68.712  1.00 38.46  ?  700  GLN C CD    1 
ATOM   8463  O  OE1   . GLN C 2  696  ? 49.358  11.924  -69.901  1.00 40.43  ?  700  GLN C OE1   1 
ATOM   8464  N  NE2   . GLN C 2  696  ? 50.214  12.102  -67.839  1.00 38.17  ?  700  GLN C NE2   1 
ATOM   8465  N  N     . VAL C 2  697  ? 46.621  8.649   -66.489  1.00 37.63  ?  701  VAL C N     1 
ATOM   8466  C  CA    . VAL C 2  697  ? 46.139  8.694   -65.114  1.00 34.52  ?  701  VAL C CA    1 
ATOM   8467  C  C     . VAL C 2  697  ? 46.380  10.087  -64.547  1.00 34.46  ?  701  VAL C C     1 
ATOM   8468  O  O     . VAL C 2  697  ? 47.520  10.557  -64.491  1.00 35.25  ?  701  VAL C O     1 
ATOM   8469  C  CB    . VAL C 2  697  ? 46.820  7.623   -64.254  1.00 33.53  ?  701  VAL C CB    1 
ATOM   8470  C  CG1   . VAL C 2  697  ? 46.368  7.743   -62.812  1.00 35.92  ?  701  VAL C CG1   1 
ATOM   8471  C  CG2   . VAL C 2  697  ? 46.514  6.242   -64.800  1.00 32.31  ?  701  VAL C CG2   1 
ATOM   8472  N  N     . ILE C 2  698  ? 45.297  10.755  -64.145  1.00 37.88  ?  702  ILE C N     1 
ATOM   8473  C  CA    . ILE C 2  698  ? 45.390  12.082  -63.547  1.00 35.34  ?  702  ILE C CA    1 
ATOM   8474  C  C     . ILE C 2  698  ? 45.702  12.000  -62.060  1.00 36.26  ?  702  ILE C C     1 
ATOM   8475  O  O     . ILE C 2  698  ? 46.438  12.833  -61.524  1.00 41.84  ?  702  ILE C O     1 
ATOM   8476  C  CB    . ILE C 2  698  ? 44.087  12.863  -63.789  1.00 37.10  ?  702  ILE C CB    1 
ATOM   8477  C  CG1   . ILE C 2  698  ? 43.741  12.925  -65.267  1.00 36.14  ?  702  ILE C CG1   1 
ATOM   8478  C  CG2   . ILE C 2  698  ? 44.208  14.267  -63.264  1.00 50.83  ?  702  ILE C CG2   1 
ATOM   8479  C  CD1   . ILE C 2  698  ? 42.465  13.681  -65.502  1.00 38.56  ?  702  ILE C CD1   1 
ATOM   8480  N  N     . ALA C 2  699  ? 45.118  11.034  -61.357  1.00 39.37  ?  703  ALA C N     1 
ATOM   8481  C  CA    . ALA C 2  699  ? 45.197  11.021  -59.905  1.00 40.14  ?  703  ALA C CA    1 
ATOM   8482  C  C     . ALA C 2  699  ? 45.267  9.590   -59.397  1.00 39.95  ?  703  ALA C C     1 
ATOM   8483  O  O     . ALA C 2  699  ? 44.619  8.697   -59.947  1.00 39.56  ?  703  ALA C O     1 
ATOM   8484  C  CB    . ALA C 2  699  ? 43.999  11.744  -59.284  1.00 39.30  ?  703  ALA C CB    1 
ATOM   8485  N  N     . ASP C 2  700  ? 46.051  9.384   -58.343  1.00 38.35  ?  704  ASP C N     1 
ATOM   8486  C  CA    . ASP C 2  700  ? 46.194  8.069   -57.740  1.00 36.34  ?  704  ASP C CA    1 
ATOM   8487  C  C     . ASP C 2  700  ? 45.011  7.748   -56.839  1.00 37.91  ?  704  ASP C C     1 
ATOM   8488  O  O     . ASP C 2  700  ? 44.380  8.638   -56.266  1.00 37.17  ?  704  ASP C O     1 
ATOM   8489  C  CB    . ASP C 2  700  ? 47.486  7.980   -56.927  1.00 36.24  ?  704  ASP C CB    1 
ATOM   8490  C  CG    . ASP C 2  700  ? 48.673  7.569   -57.761  1.00 37.29  ?  704  ASP C CG    1 
ATOM   8491  O  OD1   . ASP C 2  700  ? 48.468  6.911   -58.798  1.00 37.22  ?  704  ASP C OD1   1 
ATOM   8492  O  OD2   . ASP C 2  700  ? 49.814  7.898   -57.377  1.00 37.93  ?  704  ASP C OD2   1 
ATOM   8493  N  N     . GLY C 2  701  ? 44.730  6.456   -56.705  1.00 40.09  ?  705  GLY C N     1 
ATOM   8494  C  CA    . GLY C 2  701  ? 43.718  5.978   -55.797  1.00 39.14  ?  705  GLY C CA    1 
ATOM   8495  C  C     . GLY C 2  701  ? 44.331  5.402   -54.538  1.00 40.73  ?  705  GLY C C     1 
ATOM   8496  O  O     . GLY C 2  701  ? 45.519  5.588   -54.261  1.00 40.90  ?  705  GLY C O     1 
ATOM   8497  N  N     . PRO C 2  702  ? 43.531  4.669   -53.759  1.00 44.19  ?  706  PRO C N     1 
ATOM   8498  C  CA    . PRO C 2  702  ? 44.006  4.242   -52.428  1.00 43.96  ?  706  PRO C CA    1 
ATOM   8499  C  C     . PRO C 2  702  ? 45.260  3.383   -52.461  1.00 45.34  ?  706  PRO C C     1 
ATOM   8500  O  O     . PRO C 2  702  ? 46.210  3.641   -51.711  1.00 51.70  ?  706  PRO C O     1 
ATOM   8501  C  CB    . PRO C 2  702  ? 42.805  3.462   -51.869  1.00 39.64  ?  706  PRO C CB    1 
ATOM   8502  C  CG    . PRO C 2  702  ? 41.634  3.874   -52.698  1.00 41.18  ?  706  PRO C CG    1 
ATOM   8503  C  CD    . PRO C 2  702  ? 42.165  4.204   -54.047  1.00 44.57  ?  706  PRO C CD    1 
ATOM   8504  N  N     . CYS C 2  703  ? 45.272  2.341   -53.287  1.00 37.27  ?  707  CYS C N     1 
ATOM   8505  C  CA    . CYS C 2  703  ? 46.397  1.424   -53.410  1.00 32.67  ?  707  CYS C CA    1 
ATOM   8506  C  C     . CYS C 2  703  ? 47.250  1.658   -54.652  1.00 34.56  ?  707  CYS C C     1 
ATOM   8507  O  O     . CYS C 2  703  ? 47.982  0.756   -55.051  1.00 38.63  ?  707  CYS C O     1 
ATOM   8508  C  CB    . CYS C 2  703  ? 45.918  -0.024  -53.338  1.00 38.62  ?  707  CYS C CB    1 
ATOM   8509  S  SG    . CYS C 2  703  ? 45.874  -0.618  -51.630  1.00 39.28  ?  707  CYS C SG    1 
ATOM   8510  N  N     . THR C 2  704  ? 47.093  2.778   -55.342  1.00 38.08  ?  708  THR C N     1 
ATOM   8511  C  CA    . THR C 2  704  ? 47.876  3.026   -56.544  1.00 35.79  ?  708  THR C CA    1 
ATOM   8512  C  C     . THR C 2  704  ? 49.006  4.012   -56.271  1.00 37.65  ?  708  THR C C     1 
ATOM   8513  O  O     . THR C 2  704  ? 48.912  4.866   -55.386  1.00 40.83  ?  708  THR C O     1 
ATOM   8514  C  CB    . THR C 2  704  ? 46.995  3.559   -57.672  1.00 36.54  ?  708  THR C CB    1 
ATOM   8515  O  OG1   . THR C 2  704  ? 46.498  4.849   -57.315  1.00 40.39  ?  708  THR C OG1   1 
ATOM   8516  C  CG2   . THR C 2  704  ? 45.824  2.629   -57.903  1.00 37.04  ?  708  THR C CG2   1 
ATOM   8517  N  N     . ASP C 2  705  ? 50.105  3.846   -57.007  1.00 36.07  ?  709  ASP C N     1 
ATOM   8518  C  CA    . ASP C 2  705  ? 51.201  4.809   -57.033  1.00 32.09  ?  709  ASP C CA    1 
ATOM   8519  C  C     . ASP C 2  705  ? 51.596  5.035   -58.486  1.00 33.68  ?  709  ASP C C     1 
ATOM   8520  O  O     . ASP C 2  705  ? 52.102  4.122   -59.141  1.00 33.36  ?  709  ASP C O     1 
ATOM   8521  C  CB    . ASP C 2  705  ? 52.390  4.319   -56.213  1.00 34.29  ?  709  ASP C CB    1 
ATOM   8522  C  CG    . ASP C 2  705  ? 53.642  5.129   -56.462  1.00 39.48  ?  709  ASP C CG    1 
ATOM   8523  O  OD1   . ASP C 2  705  ? 54.421  4.757   -57.361  1.00 41.95  ?  709  ASP C OD1   1 
ATOM   8524  O  OD2   . ASP C 2  705  ? 53.851  6.139   -55.759  1.00 45.55  ?  709  ASP C OD2   1 
ATOM   8525  N  N     . ASP C 2  706  ? 51.379  6.256   -58.977  1.00 35.81  ?  710  ASP C N     1 
ATOM   8526  C  CA    . ASP C 2  706  ? 51.615  6.635   -60.370  1.00 36.08  ?  710  ASP C CA    1 
ATOM   8527  C  C     . ASP C 2  706  ? 50.795  5.795   -61.346  1.00 36.42  ?  710  ASP C C     1 
ATOM   8528  O  O     . ASP C 2  706  ? 51.171  5.641   -62.510  1.00 34.81  ?  710  ASP C O     1 
ATOM   8529  C  CB    . ASP C 2  706  ? 53.108  6.566   -60.716  1.00 42.18  ?  710  ASP C CB    1 
ATOM   8530  C  CG    . ASP C 2  706  ? 53.449  7.286   -62.010  1.00 45.84  ?  710  ASP C CG    1 
ATOM   8531  O  OD1   . ASP C 2  706  ? 52.589  8.024   -62.533  1.00 43.96  ?  710  ASP C OD1   1 
ATOM   8532  O  OD2   . ASP C 2  706  ? 54.581  7.115   -62.503  1.00 49.38  ?  710  ASP C OD2   1 
ATOM   8533  N  N     . GLY C 2  707  ? 49.666  5.250   -60.902  1.00 37.35  ?  711  GLY C N     1 
ATOM   8534  C  CA    . GLY C 2  707  ? 48.790  4.491   -61.767  1.00 35.20  ?  711  GLY C CA    1 
ATOM   8535  C  C     . GLY C 2  707  ? 48.971  2.990   -61.732  1.00 39.59  ?  711  GLY C C     1 
ATOM   8536  O  O     . GLY C 2  707  ? 48.191  2.277   -62.373  1.00 40.88  ?  711  GLY C O     1 
ATOM   8537  N  N     . GLU C 2  708  ? 49.973  2.487   -61.020  1.00 38.17  ?  712  GLU C N     1 
ATOM   8538  C  CA    . GLU C 2  708  ? 50.179  1.056   -60.862  1.00 37.34  ?  712  GLU C CA    1 
ATOM   8539  C  C     . GLU C 2  708  ? 49.666  0.625   -59.498  1.00 39.61  ?  712  GLU C C     1 
ATOM   8540  O  O     . GLU C 2  708  ? 49.816  1.354   -58.514  1.00 39.47  ?  712  GLU C O     1 
ATOM   8541  C  CB    . GLU C 2  708  ? 51.659  0.693   -61.003  1.00 36.00  ?  712  GLU C CB    1 
ATOM   8542  C  CG    . GLU C 2  708  ? 52.264  1.046   -62.349  1.00 39.89  ?  712  GLU C CG    1 
ATOM   8543  C  CD    . GLU C 2  708  ? 53.651  0.461   -62.542  1.00 41.08  ?  712  GLU C CD    1 
ATOM   8544  O  OE1   . GLU C 2  708  ? 53.861  -0.262  -63.537  1.00 40.39  ?  712  GLU C OE1   1 
ATOM   8545  O  OE2   . GLU C 2  708  ? 54.531  0.720   -61.698  1.00 35.48  ?  712  GLU C OE2   1 
ATOM   8546  N  N     . MET C 2  709  ? 49.050  -0.555  -59.442  1.00 38.49  ?  713  MET C N     1 
ATOM   8547  C  CA    . MET C 2  709  ? 48.584  -1.074  -58.164  1.00 35.58  ?  713  MET C CA    1 
ATOM   8548  C  C     . MET C 2  709  ? 49.763  -1.207  -57.213  1.00 34.34  ?  713  MET C C     1 
ATOM   8549  O  O     . MET C 2  709  ? 50.728  -1.916  -57.505  1.00 35.53  ?  713  MET C O     1 
ATOM   8550  C  CB    . MET C 2  709  ? 47.910  -2.432  -58.359  1.00 36.72  ?  713  MET C CB    1 
ATOM   8551  C  CG    . MET C 2  709  ? 46.567  -2.412  -59.070  1.00 42.01  ?  713  MET C CG    1 
ATOM   8552  S  SD    . MET C 2  709  ? 45.160  -2.283  -57.945  1.00 47.04  ?  713  MET C SD    1 
ATOM   8553  C  CE    . MET C 2  709  ? 45.858  -3.005  -56.471  1.00 40.05  ?  713  MET C CE    1 
ATOM   8554  N  N     . ALA C 2  710  ? 49.691  -0.516  -56.085  1.00 34.36  ?  714  ALA C N     1 
ATOM   8555  C  CA    . ALA C 2  710  ? 50.683  -0.637  -55.023  1.00 30.41  ?  714  ALA C CA    1 
ATOM   8556  C  C     . ALA C 2  710  ? 49.956  -1.152  -53.789  1.00 32.54  ?  714  ALA C C     1 
ATOM   8557  O  O     . ALA C 2  710  ? 49.318  -0.378  -53.074  1.00 37.61  ?  714  ALA C O     1 
ATOM   8558  C  CB    . ALA C 2  710  ? 51.346  0.708   -54.761  1.00 29.22  ?  714  ALA C CB    1 
ATOM   8559  N  N     . LEU C 2  711  ? 50.113  -2.431  -53.486  1.00 31.19  ?  715  LEU C N     1 
ATOM   8560  C  CA    . LEU C 2  711  ? 49.409  -3.020  -52.360  1.00 39.43  ?  715  LEU C CA    1 
ATOM   8561  C  C     . LEU C 2  711  ? 50.260  -3.069  -51.105  1.00 31.17  ?  715  LEU C C     1 
ATOM   8562  O  O     . LEU C 2  711  ? 49.747  -3.427  -50.040  1.00 31.78  ?  715  LEU C O     1 
ATOM   8563  C  CB    . LEU C 2  711  ? 48.916  -4.418  -52.729  1.00 29.24  ?  715  LEU C CB    1 
ATOM   8564  C  CG    . LEU C 2  711  ? 47.772  -4.380  -53.741  1.00 29.59  ?  715  LEU C CG    1 
ATOM   8565  C  CD1   . LEU C 2  711  ? 47.509  -5.742  -54.351  1.00 29.98  ?  715  LEU C CD1   1 
ATOM   8566  C  CD2   . LEU C 2  711  ? 46.518  -3.835  -53.083  1.00 31.11  ?  715  LEU C CD2   1 
ATOM   8567  N  N     . GLY C 2  712  ? 51.519  -2.672  -51.193  1.00 31.44  ?  716  GLY C N     1 
ATOM   8568  C  CA    . GLY C 2  712  ? 52.408  -2.767  -50.062  1.00 29.43  ?  716  GLY C CA    1 
ATOM   8569  C  C     . GLY C 2  712  ? 53.649  -1.935  -50.271  1.00 34.17  ?  716  GLY C C     1 
ATOM   8570  O  O     . GLY C 2  712  ? 53.711  -1.080  -51.159  1.00 31.61  ?  716  GLY C O     1 
ATOM   8571  N  N     . LYS C 2  713  ? 54.645  -2.202  -49.438  1.00 30.87  ?  717  LYS C N     1 
ATOM   8572  C  CA    . LYS C 2  713  ? 55.904  -1.483  -49.437  1.00 28.26  ?  717  LYS C CA    1 
ATOM   8573  C  C     . LYS C 2  713  ? 57.038  -2.426  -49.814  1.00 27.83  ?  717  LYS C C     1 
ATOM   8574  O  O     . LYS C 2  713  ? 56.908  -3.647  -49.726  1.00 27.48  ?  717  LYS C O     1 
ATOM   8575  C  CB    . LYS C 2  713  ? 56.174  -0.859  -48.066  1.00 27.49  ?  717  LYS C CB    1 
ATOM   8576  C  CG    . LYS C 2  713  ? 55.196  0.237   -47.695  1.00 31.56  ?  717  LYS C CG    1 
ATOM   8577  C  CD    . LYS C 2  713  ? 55.215  1.342   -48.733  1.00 29.23  ?  717  LYS C CD    1 
ATOM   8578  C  CE    . LYS C 2  713  ? 54.375  2.517   -48.305  1.00 30.07  ?  717  LYS C CE    1 
ATOM   8579  N  NZ    . LYS C 2  713  ? 54.910  3.144   -47.078  1.00 30.73  ?  717  LYS C NZ    1 
ATOM   8580  N  N     . ASN C 2  714  ? 58.148  -1.844  -50.263  1.00 29.33  ?  718  ASN C N     1 
ATOM   8581  C  CA    . ASN C 2  714  ? 59.375  -2.594  -50.501  1.00 27.06  ?  718  ASN C CA    1 
ATOM   8582  C  C     . ASN C 2  714  ? 60.203  -2.547  -49.226  1.00 28.57  ?  718  ASN C C     1 
ATOM   8583  O  O     . ASN C 2  714  ? 60.728  -1.493  -48.858  1.00 29.56  ?  718  ASN C O     1 
ATOM   8584  C  CB    . ASN C 2  714  ? 60.160  -2.014  -51.672  1.00 27.70  ?  718  ASN C CB    1 
ATOM   8585  C  CG    . ASN C 2  714  ? 59.395  -2.062  -52.967  1.00 28.28  ?  718  ASN C CG    1 
ATOM   8586  O  OD1   . ASN C 2  714  ? 59.537  -2.999  -53.749  1.00 26.19  ?  718  ASN C OD1   1 
ATOM   8587  N  ND2   . ASN C 2  714  ? 58.584  -1.042  -53.211  1.00 31.05  ?  718  ASN C ND2   1 
ATOM   8588  N  N     . LEU C 2  715  ? 60.331  -3.687  -48.561  1.00 28.96  ?  719  LEU C N     1 
ATOM   8589  C  CA    . LEU C 2  715  ? 61.044  -3.783  -47.300  1.00 29.18  ?  719  LEU C CA    1 
ATOM   8590  C  C     . LEU C 2  715  ? 62.359  -4.523  -47.491  1.00 31.53  ?  719  LEU C C     1 
ATOM   8591  O  O     . LEU C 2  715  ? 62.458  -5.452  -48.296  1.00 33.58  ?  719  LEU C O     1 
ATOM   8592  C  CB    . LEU C 2  715  ? 60.197  -4.499  -46.247  1.00 31.20  ?  719  LEU C CB    1 
ATOM   8593  C  CG    . LEU C 2  715  ? 58.870  -3.829  -45.897  1.00 31.31  ?  719  LEU C CG    1 
ATOM   8594  C  CD1   . LEU C 2  715  ? 58.172  -4.587  -44.783  1.00 29.55  ?  719  LEU C CD1   1 
ATOM   8595  C  CD2   . LEU C 2  715  ? 59.101  -2.385  -45.503  1.00 31.18  ?  719  LEU C CD2   1 
ATOM   8596  N  N     . LEU C 2  716  ? 63.373  -4.097  -46.743  1.00 31.51  ?  720  LEU C N     1 
ATOM   8597  C  CA    . LEU C 2  716  ? 64.664  -4.772  -46.749  1.00 30.14  ?  720  LEU C CA    1 
ATOM   8598  C  C     . LEU C 2  716  ? 64.572  -5.997  -45.852  1.00 32.29  ?  720  LEU C C     1 
ATOM   8599  O  O     . LEU C 2  716  ? 64.317  -5.873  -44.650  1.00 33.29  ?  720  LEU C O     1 
ATOM   8600  C  CB    . LEU C 2  716  ? 65.765  -3.826  -46.276  1.00 31.60  ?  720  LEU C CB    1 
ATOM   8601  C  CG    . LEU C 2  716  ? 67.187  -4.387  -46.232  1.00 32.37  ?  720  LEU C CG    1 
ATOM   8602  C  CD1   . LEU C 2  716  ? 67.650  -4.807  -47.615  1.00 30.44  ?  720  LEU C CD1   1 
ATOM   8603  C  CD2   . LEU C 2  716  ? 68.146  -3.378  -45.629  1.00 27.48  ?  720  LEU C CD2   1 
ATOM   8604  N  N     . VAL C 2  717  ? 64.788  -7.175  -46.428  1.00 32.47  ?  721  VAL C N     1 
ATOM   8605  C  CA    . VAL C 2  717  ? 64.489  -8.438  -45.767  1.00 31.30  ?  721  VAL C CA    1 
ATOM   8606  C  C     . VAL C 2  717  ? 65.766  -9.251  -45.608  1.00 30.98  ?  721  VAL C C     1 
ATOM   8607  O  O     . VAL C 2  717  ? 66.608  -9.294  -46.510  1.00 31.06  ?  721  VAL C O     1 
ATOM   8608  C  CB    . VAL C 2  717  ? 63.415  -9.230  -46.545  1.00 31.39  ?  721  VAL C CB    1 
ATOM   8609  C  CG1   . VAL C 2  717  ? 63.874  -9.530  -47.960  1.00 30.58  ?  721  VAL C CG1   1 
ATOM   8610  C  CG2   . VAL C 2  717  ? 63.048  -10.501 -45.809  1.00 33.38  ?  721  VAL C CG2   1 
ATOM   8611  N  N     . ALA C 2  718  ? 65.908  -9.885  -44.447  1.00 30.74  ?  722  ALA C N     1 
ATOM   8612  C  CA    . ALA C 2  718  ? 66.990  -10.816 -44.160  1.00 31.01  ?  722  ALA C CA    1 
ATOM   8613  C  C     . ALA C 2  718  ? 66.385  -12.153 -43.758  1.00 33.07  ?  722  ALA C C     1 
ATOM   8614  O  O     . ALA C 2  718  ? 65.473  -12.196 -42.929  1.00 36.79  ?  722  ALA C O     1 
ATOM   8615  C  CB    . ALA C 2  718  ? 67.894  -10.283 -43.047  1.00 32.30  ?  722  ALA C CB    1 
ATOM   8616  N  N     . ILE C 2  719  ? 66.887  -13.237 -44.340  1.00 31.83  ?  723  ILE C N     1 
ATOM   8617  C  CA    . ILE C 2  719  ? 66.332  -14.569 -44.125  1.00 31.49  ?  723  ILE C CA    1 
ATOM   8618  C  C     . ILE C 2  719  ? 67.239  -15.313 -43.158  1.00 31.36  ?  723  ILE C C     1 
ATOM   8619  O  O     . ILE C 2  719  ? 68.320  -15.776 -43.534  1.00 32.92  ?  723  ILE C O     1 
ATOM   8620  C  CB    . ILE C 2  719  ? 66.185  -15.337 -45.440  1.00 29.94  ?  723  ILE C CB    1 
ATOM   8621  C  CG1   . ILE C 2  719  ? 65.354  -14.528 -46.426  1.00 32.75  ?  723  ILE C CG1   1 
ATOM   8622  C  CG2   . ILE C 2  719  ? 65.541  -16.683 -45.195  1.00 31.79  ?  723  ILE C CG2   1 
ATOM   8623  C  CD1   . ILE C 2  719  ? 65.241  -15.179 -47.760  1.00 37.84  ?  723  ILE C CD1   1 
ATOM   8624  N  N     . MET C 2  720  ? 66.766  -15.491 -41.938  1.00 30.26  ?  724  MET C N     1 
ATOM   8625  C  CA    . MET C 2  720  ? 67.573  -16.046 -40.865  1.00 31.38  ?  724  MET C CA    1 
ATOM   8626  C  C     . MET C 2  720  ? 66.723  -16.188 -39.613  1.00 35.09  ?  724  MET C C     1 
ATOM   8627  O  O     . MET C 2  720  ? 65.867  -15.337 -39.345  1.00 37.01  ?  724  MET C O     1 
ATOM   8628  C  CB    . MET C 2  720  ? 68.773  -15.148 -40.572  1.00 28.80  ?  724  MET C CB    1 
ATOM   8629  C  CG    . MET C 2  720  ? 68.381  -13.727 -40.208  1.00 26.49  ?  724  MET C CG    1 
ATOM   8630  S  SD    . MET C 2  720  ? 69.735  -12.708 -39.615  1.00 33.59  ?  724  MET C SD    1 
ATOM   8631  C  CE    . MET C 2  720  ? 70.332  -13.685 -38.245  1.00 33.14  ?  724  MET C CE    1 
ATOM   8632  N  N     . PRO C 2  721  ? 66.904  -17.247 -38.835  1.00 31.65  ?  725  PRO C N     1 
ATOM   8633  C  CA    . PRO C 2  721  ? 66.333  -17.257 -37.489  1.00 32.61  ?  725  PRO C CA    1 
ATOM   8634  C  C     . PRO C 2  721  ? 66.978  -16.171 -36.645  1.00 30.01  ?  725  PRO C C     1 
ATOM   8635  O  O     . PRO C 2  721  ? 68.193  -15.974 -36.682  1.00 34.52  ?  725  PRO C O     1 
ATOM   8636  C  CB    . PRO C 2  721  ? 66.663  -18.660 -36.966  1.00 34.04  ?  725  PRO C CB    1 
ATOM   8637  C  CG    . PRO C 2  721  ? 67.706  -19.192 -37.881  1.00 31.04  ?  725  PRO C CG    1 
ATOM   8638  C  CD    . PRO C 2  721  ? 67.492  -18.543 -39.202  1.00 29.48  ?  725  PRO C CD    1 
ATOM   8639  N  N     . TRP C 2  722  ? 66.151  -15.437 -35.907  1.00 27.69  ?  726  TRP C N     1 
ATOM   8640  C  CA    . TRP C 2  722  ? 66.646  -14.407 -35.000  1.00 28.26  ?  726  TRP C CA    1 
ATOM   8641  C  C     . TRP C 2  722  ? 66.036  -14.643 -33.624  1.00 28.88  ?  726  TRP C C     1 
ATOM   8642  O  O     . TRP C 2  722  ? 64.869  -14.324 -33.394  1.00 30.02  ?  726  TRP C O     1 
ATOM   8643  C  CB    . TRP C 2  722  ? 66.297  -13.021 -35.533  1.00 29.48  ?  726  TRP C CB    1 
ATOM   8644  C  CG    . TRP C 2  722  ? 67.147  -11.924 -34.992  1.00 30.95  ?  726  TRP C CG    1 
ATOM   8645  C  CD1   . TRP C 2  722  ? 68.288  -11.433 -35.541  1.00 31.33  ?  726  TRP C CD1   1 
ATOM   8646  C  CD2   . TRP C 2  722  ? 66.922  -11.175 -33.795  1.00 29.12  ?  726  TRP C CD2   1 
ATOM   8647  N  NE1   . TRP C 2  722  ? 68.791  -10.424 -34.762  1.00 33.08  ?  726  TRP C NE1   1 
ATOM   8648  C  CE2   . TRP C 2  722  ? 67.969  -10.247 -33.681  1.00 31.25  ?  726  TRP C CE2   1 
ATOM   8649  C  CE3   . TRP C 2  722  ? 65.936  -11.201 -32.807  1.00 31.21  ?  726  TRP C CE3   1 
ATOM   8650  C  CZ2   . TRP C 2  722  ? 68.062  -9.355  -32.621  1.00 33.96  ?  726  TRP C CZ2   1 
ATOM   8651  C  CZ3   . TRP C 2  722  ? 66.030  -10.314 -31.755  1.00 32.21  ?  726  TRP C CZ3   1 
ATOM   8652  C  CH2   . TRP C 2  722  ? 67.084  -9.405  -31.669  1.00 34.76  ?  726  TRP C CH2   1 
ATOM   8653  N  N     . GLU C 2  723  ? 66.850  -15.169 -32.712  1.00 32.18  ?  727  GLU C N     1 
ATOM   8654  C  CA    . GLU C 2  723  ? 66.566  -15.265 -31.283  1.00 32.77  ?  727  GLU C CA    1 
ATOM   8655  C  C     . GLU C 2  723  ? 65.153  -15.735 -30.957  1.00 32.61  ?  727  GLU C C     1 
ATOM   8656  O  O     . GLU C 2  723  ? 64.600  -15.366 -29.918  1.00 35.38  ?  727  GLU C O     1 
ATOM   8657  C  CB    . GLU C 2  723  ? 66.848  -13.920 -30.612  1.00 31.49  ?  727  GLU C CB    1 
ATOM   8658  C  CG    . GLU C 2  723  ? 68.243  -13.373 -30.892  1.00 33.30  ?  727  GLU C CG    1 
ATOM   8659  C  CD    . GLU C 2  723  ? 69.365  -14.246 -30.336  1.00 38.00  ?  727  GLU C CD    1 
ATOM   8660  O  OE1   . GLU C 2  723  ? 69.083  -15.213 -29.596  1.00 38.08  ?  727  GLU C OE1   1 
ATOM   8661  O  OE2   . GLU C 2  723  ? 70.543  -13.953 -30.633  1.00 42.84  ?  727  GLU C OE2   1 
ATOM   8662  N  N     . GLY C 2  724  ? 64.577  -16.576 -31.810  1.00 33.21  ?  728  GLY C N     1 
ATOM   8663  C  CA    . GLY C 2  724  ? 63.282  -17.169 -31.547  1.00 32.46  ?  728  GLY C CA    1 
ATOM   8664  C  C     . GLY C 2  724  ? 62.069  -16.281 -31.739  1.00 33.18  ?  728  GLY C C     1 
ATOM   8665  O  O     . GLY C 2  724  ? 60.945  -16.769 -31.581  1.00 33.62  ?  728  GLY C O     1 
ATOM   8666  N  N     . HIS C 2  725  ? 62.240  -14.999 -32.067  1.00 31.44  ?  729  HIS C N     1 
ATOM   8667  C  CA    . HIS C 2  725  ? 61.074  -14.142 -32.241  1.00 28.10  ?  729  HIS C CA    1 
ATOM   8668  C  C     . HIS C 2  725  ? 60.402  -14.317 -33.596  1.00 30.17  ?  729  HIS C C     1 
ATOM   8669  O  O     . HIS C 2  725  ? 59.229  -13.964 -33.733  1.00 35.59  ?  729  HIS C O     1 
ATOM   8670  C  CB    . HIS C 2  725  ? 61.453  -12.676 -32.041  1.00 30.03  ?  729  HIS C CB    1 
ATOM   8671  C  CG    . HIS C 2  725  ? 61.894  -12.356 -30.649  1.00 31.73  ?  729  HIS C CG    1 
ATOM   8672  N  ND1   . HIS C 2  725  ? 61.024  -11.918 -29.675  1.00 30.58  ?  729  HIS C ND1   1 
ATOM   8673  C  CD2   . HIS C 2  725  ? 63.111  -12.426 -30.064  1.00 29.45  ?  729  HIS C CD2   1 
ATOM   8674  C  CE1   . HIS C 2  725  ? 61.688  -11.725 -28.551  1.00 30.75  ?  729  HIS C CE1   1 
ATOM   8675  N  NE2   . HIS C 2  725  ? 62.956  -12.027 -28.759  1.00 32.29  ?  729  HIS C NE2   1 
ATOM   8676  N  N     . ASN C 2  726  ? 61.118  -14.802 -34.604  1.00 29.74  ?  730  ASN C N     1 
ATOM   8677  C  CA    . ASN C 2  726  ? 60.523  -15.173 -35.880  1.00 30.10  ?  730  ASN C CA    1 
ATOM   8678  C  C     . ASN C 2  726  ? 60.208  -16.663 -35.958  1.00 33.28  ?  730  ASN C C     1 
ATOM   8679  O  O     . ASN C 2  726  ? 59.994  -17.188 -37.054  1.00 38.67  ?  730  ASN C O     1 
ATOM   8680  C  CB    . ASN C 2  726  ? 61.399  -14.720 -37.050  1.00 29.89  ?  730  ASN C CB    1 
ATOM   8681  C  CG    . ASN C 2  726  ? 62.751  -15.368 -37.063  1.00 33.78  ?  730  ASN C CG    1 
ATOM   8682  O  OD1   . ASN C 2  726  ? 63.229  -15.867 -36.047  1.00 36.63  ?  730  ASN C OD1   1 
ATOM   8683  N  ND2   . ASN C 2  726  ? 63.389  -15.353 -38.222  1.00 33.47  ?  730  ASN C ND2   1 
ATOM   8684  N  N     . TYR C 2  727  ? 60.261  -17.361 -34.829  1.00 34.64  ?  731  TYR C N     1 
ATOM   8685  C  CA    . TYR C 2  727  ? 59.918  -18.776 -34.751  1.00 34.76  ?  731  TYR C CA    1 
ATOM   8686  C  C     . TYR C 2  727  ? 58.545  -19.057 -35.346  1.00 36.01  ?  731  TYR C C     1 
ATOM   8687  O  O     . TYR C 2  727  ? 57.545  -18.457 -34.941  1.00 37.32  ?  731  TYR C O     1 
ATOM   8688  C  CB    . TYR C 2  727  ? 59.954  -19.193 -33.280  1.00 34.61  ?  731  TYR C CB    1 
ATOM   8689  C  CG    . TYR C 2  727  ? 59.542  -20.611 -32.961  1.00 34.03  ?  731  TYR C CG    1 
ATOM   8690  C  CD1   . TYR C 2  727  ? 60.290  -21.690 -33.405  1.00 38.88  ?  731  TYR C CD1   1 
ATOM   8691  C  CD2   . TYR C 2  727  ? 58.434  -20.868 -32.164  1.00 35.29  ?  731  TYR C CD2   1 
ATOM   8692  C  CE1   . TYR C 2  727  ? 59.927  -22.985 -33.093  1.00 36.12  ?  731  TYR C CE1   1 
ATOM   8693  C  CE2   . TYR C 2  727  ? 58.066  -22.159 -31.846  1.00 34.12  ?  731  TYR C CE2   1 
ATOM   8694  C  CZ    . TYR C 2  727  ? 58.816  -23.213 -32.313  1.00 36.66  ?  731  TYR C CZ    1 
ATOM   8695  O  OH    . TYR C 2  727  ? 58.453  -24.502 -32.001  1.00 38.46  ?  731  TYR C OH    1 
ATOM   8696  N  N     . GLU C 2  728  ? 58.509  -19.979 -36.310  1.00 42.90  ?  732  GLU C N     1 
ATOM   8697  C  CA    . GLU C 2  728  ? 57.274  -20.540 -36.857  1.00 36.38  ?  732  GLU C CA    1 
ATOM   8698  C  C     . GLU C 2  728  ? 56.354  -19.443 -37.399  1.00 37.82  ?  732  GLU C C     1 
ATOM   8699  O  O     . GLU C 2  728  ? 55.326  -19.100 -36.815  1.00 47.41  ?  732  GLU C O     1 
ATOM   8700  C  CB    . GLU C 2  728  ? 56.563  -21.394 -35.803  1.00 38.17  ?  732  GLU C CB    1 
ATOM   8701  C  CG    . GLU C 2  728  ? 55.423  -22.226 -36.346  1.00 44.93  ?  732  GLU C CG    1 
ATOM   8702  C  CD    . GLU C 2  728  ? 55.286  -23.543 -35.623  1.00 51.08  ?  732  GLU C CD    1 
ATOM   8703  O  OE1   . GLU C 2  728  ? 55.472  -24.595 -36.267  1.00 52.83  ?  732  GLU C OE1   1 
ATOM   8704  O  OE2   . GLU C 2  728  ? 55.008  -23.526 -34.407  1.00 51.54  ?  732  GLU C OE2   1 
ATOM   8705  N  N     . ASP C 2  729  ? 56.780  -18.881 -38.531  1.00 41.16  ?  733  ASP C N     1 
ATOM   8706  C  CA    . ASP C 2  729  ? 55.982  -17.942 -39.317  1.00 39.14  ?  733  ASP C CA    1 
ATOM   8707  C  C     . ASP C 2  729  ? 55.823  -16.574 -38.664  1.00 35.90  ?  733  ASP C C     1 
ATOM   8708  O  O     . ASP C 2  729  ? 55.367  -15.633 -39.318  1.00 33.63  ?  733  ASP C O     1 
ATOM   8709  C  CB    . ASP C 2  729  ? 54.600  -18.523 -39.617  1.00 35.00  ?  733  ASP C CB    1 
ATOM   8710  C  CG    . ASP C 2  729  ? 54.651  -19.620 -40.641  1.00 44.45  ?  733  ASP C CG    1 
ATOM   8711  O  OD1   . ASP C 2  729  ? 55.674  -19.714 -41.350  1.00 47.54  ?  733  ASP C OD1   1 
ATOM   8712  O  OD2   . ASP C 2  729  ? 53.672  -20.387 -40.746  1.00 47.84  ?  733  ASP C OD2   1 
ATOM   8713  N  N     . ALA C 2  730  ? 56.192  -16.443 -37.394  1.00 33.37  ?  734  ALA C N     1 
ATOM   8714  C  CA    . ALA C 2  730  ? 56.225  -15.126 -36.783  1.00 29.35  ?  734  ALA C CA    1 
ATOM   8715  C  C     . ALA C 2  730  ? 57.221  -14.242 -37.523  1.00 31.42  ?  734  ALA C C     1 
ATOM   8716  O  O     . ALA C 2  730  ? 58.227  -14.713 -38.059  1.00 34.81  ?  734  ALA C O     1 
ATOM   8717  C  CB    . ALA C 2  730  ? 56.594  -15.224 -35.305  1.00 29.92  ?  734  ALA C CB    1 
ATOM   8718  N  N     . ILE C 2  731  ? 56.925  -12.950 -37.569  1.00 31.68  ?  735  ILE C N     1 
ATOM   8719  C  CA    . ILE C 2  731  ? 57.712  -11.992 -38.332  1.00 31.09  ?  735  ILE C CA    1 
ATOM   8720  C  C     . ILE C 2  731  ? 58.273  -10.947 -37.379  1.00 31.66  ?  735  ILE C C     1 
ATOM   8721  O  O     . ILE C 2  731  ? 57.604  -10.545 -36.422  1.00 36.95  ?  735  ILE C O     1 
ATOM   8722  C  CB    . ILE C 2  731  ? 56.864  -11.342 -39.444  1.00 31.07  ?  735  ILE C CB    1 
ATOM   8723  C  CG1   . ILE C 2  731  ? 56.452  -12.402 -40.467  1.00 29.28  ?  735  ILE C CG1   1 
ATOM   8724  C  CG2   . ILE C 2  731  ? 57.615  -10.205 -40.112  1.00 27.84  ?  735  ILE C CG2   1 
ATOM   8725  C  CD1   . ILE C 2  731  ? 55.594  -11.882 -41.586  1.00 28.76  ?  735  ILE C CD1   1 
ATOM   8726  N  N     . ILE C 2  732  ? 59.512  -10.533 -37.629  1.00 31.95  ?  736  ILE C N     1 
ATOM   8727  C  CA    . ILE C 2  732  ? 60.173  -9.476  -36.873  1.00 31.67  ?  736  ILE C CA    1 
ATOM   8728  C  C     . ILE C 2  732  ? 60.254  -8.237  -37.751  1.00 32.01  ?  736  ILE C C     1 
ATOM   8729  O  O     . ILE C 2  732  ? 60.680  -8.317  -38.909  1.00 29.97  ?  736  ILE C O     1 
ATOM   8730  C  CB    . ILE C 2  732  ? 61.574  -9.903  -36.406  1.00 31.25  ?  736  ILE C CB    1 
ATOM   8731  C  CG1   . ILE C 2  732  ? 61.490  -11.151 -35.530  1.00 29.75  ?  736  ILE C CG1   1 
ATOM   8732  C  CG2   . ILE C 2  732  ? 62.250  -8.765  -35.663  1.00 30.60  ?  736  ILE C CG2   1 
ATOM   8733  C  CD1   . ILE C 2  732  ? 62.826  -11.770 -35.242  1.00 28.58  ?  736  ILE C CD1   1 
ATOM   8734  N  N     . LEU C 2  733  ? 59.854  -7.096  -37.197  1.00 32.60  ?  737  LEU C N     1 
ATOM   8735  C  CA    . LEU C 2  733  ? 59.839  -5.832  -37.915  1.00 30.09  ?  737  LEU C CA    1 
ATOM   8736  C  C     . LEU C 2  733  ? 60.779  -4.824  -37.270  1.00 29.06  ?  737  LEU C C     1 
ATOM   8737  O  O     . LEU C 2  733  ? 61.015  -4.849  -36.059  1.00 34.96  ?  737  LEU C O     1 
ATOM   8738  C  CB    . LEU C 2  733  ? 58.434  -5.230  -37.962  1.00 30.87  ?  737  LEU C CB    1 
ATOM   8739  C  CG    . LEU C 2  733  ? 57.441  -5.784  -38.975  1.00 28.75  ?  737  LEU C CG    1 
ATOM   8740  C  CD1   . LEU C 2  733  ? 56.237  -4.866  -39.034  1.00 29.39  ?  737  LEU C CD1   1 
ATOM   8741  C  CD2   . LEU C 2  733  ? 58.083  -5.922  -40.334  1.00 28.33  ?  737  LEU C CD2   1 
ATOM   8742  N  N     . SER C 2  734  ? 61.298  -3.928  -38.103  1.00 29.45  ?  738  SER C N     1 
ATOM   8743  C  CA    . SER C 2  734  ? 62.051  -2.776  -37.631  1.00 31.56  ?  738  SER C CA    1 
ATOM   8744  C  C     . SER C 2  734  ? 61.100  -1.680  -37.170  1.00 31.48  ?  738  SER C C     1 
ATOM   8745  O  O     . SER C 2  734  ? 60.078  -1.417  -37.809  1.00 29.57  ?  738  SER C O     1 
ATOM   8746  C  CB    . SER C 2  734  ? 62.961  -2.251  -38.743  1.00 31.04  ?  738  SER C CB    1 
ATOM   8747  O  OG    . SER C 2  734  ? 63.697  -1.117  -38.325  1.00 31.90  ?  738  SER C OG    1 
ATOM   8748  N  N     . ASN C 2  735  ? 61.439  -1.036  -36.052  1.00 31.63  ?  739  ASN C N     1 
ATOM   8749  C  CA    . ASN C 2  735  ? 60.610  0.064   -35.578  1.00 27.04  ?  739  ASN C CA    1 
ATOM   8750  C  C     . ASN C 2  735  ? 60.632  1.252   -36.524  1.00 32.32  ?  739  ASN C C     1 
ATOM   8751  O  O     . ASN C 2  735  ? 59.817  2.165   -36.360  1.00 37.65  ?  739  ASN C O     1 
ATOM   8752  C  CB    . ASN C 2  735  ? 61.045  0.504   -34.181  1.00 28.76  ?  739  ASN C CB    1 
ATOM   8753  C  CG    . ASN C 2  735  ? 59.953  1.248   -33.440  1.00 31.82  ?  739  ASN C CG    1 
ATOM   8754  O  OD1   . ASN C 2  735  ? 58.941  0.665   -33.062  1.00 37.24  ?  739  ASN C OD1   1 
ATOM   8755  N  ND2   . ASN C 2  735  ? 60.155  2.539   -33.222  1.00 32.03  ?  739  ASN C ND2   1 
ATOM   8756  N  N     . ARG C 2  736  ? 61.543  1.262   -37.500  1.00 31.58  ?  740  ARG C N     1 
ATOM   8757  C  CA    . ARG C 2  736  ? 61.501  2.272   -38.551  1.00 31.83  ?  740  ARG C CA    1 
ATOM   8758  C  C     . ARG C 2  736  ? 60.148  2.283   -39.243  1.00 32.19  ?  740  ARG C C     1 
ATOM   8759  O  O     . ARG C 2  736  ? 59.623  3.347   -39.589  1.00 33.56  ?  740  ARG C O     1 
ATOM   8760  C  CB    . ARG C 2  736  ? 62.608  2.016   -39.574  1.00 26.55  ?  740  ARG C CB    1 
ATOM   8761  C  CG    . ARG C 2  736  ? 62.571  2.964   -40.748  1.00 27.02  ?  740  ARG C CG    1 
ATOM   8762  C  CD    . ARG C 2  736  ? 63.513  2.552   -41.839  1.00 28.99  ?  740  ARG C CD    1 
ATOM   8763  N  NE    . ARG C 2  736  ? 62.888  1.666   -42.811  1.00 31.14  ?  740  ARG C NE    1 
ATOM   8764  C  CZ    . ARG C 2  736  ? 62.209  2.085   -43.871  1.00 32.98  ?  740  ARG C CZ    1 
ATOM   8765  N  NH1   . ARG C 2  736  ? 62.058  3.380   -44.088  1.00 34.83  ?  740  ARG C NH1   1 
ATOM   8766  N  NH2   . ARG C 2  736  ? 61.676  1.213   -44.712  1.00 34.45  ?  740  ARG C NH2   1 
ATOM   8767  N  N     . LEU C 2  737  ? 59.568  1.103   -39.455  1.00 29.87  ?  741  LEU C N     1 
ATOM   8768  C  CA    . LEU C 2  737  ? 58.278  1.020   -40.122  1.00 27.40  ?  741  LEU C CA    1 
ATOM   8769  C  C     . LEU C 2  737  ? 57.160  1.595   -39.271  1.00 28.96  ?  741  LEU C C     1 
ATOM   8770  O  O     . LEU C 2  737  ? 56.104  1.938   -39.807  1.00 31.71  ?  741  LEU C O     1 
ATOM   8771  C  CB    . LEU C 2  737  ? 57.987  -0.430  -40.493  1.00 29.21  ?  741  LEU C CB    1 
ATOM   8772  C  CG    . LEU C 2  737  ? 59.199  -1.163  -41.077  1.00 27.43  ?  741  LEU C CG    1 
ATOM   8773  C  CD1   . LEU C 2  737  ? 58.839  -2.588  -41.434  1.00 32.76  ?  741  LEU C CD1   1 
ATOM   8774  C  CD2   . LEU C 2  737  ? 59.764  -0.437  -42.287  1.00 28.06  ?  741  LEU C CD2   1 
ATOM   8775  N  N     . VAL C 2  738  ? 57.364  1.695   -37.959  1.00 29.92  ?  742  VAL C N     1 
ATOM   8776  C  CA    . VAL C 2  738  ? 56.438  2.430   -37.106  1.00 30.11  ?  742  VAL C CA    1 
ATOM   8777  C  C     . VAL C 2  738  ? 56.722  3.924   -37.165  1.00 35.25  ?  742  VAL C C     1 
ATOM   8778  O  O     . VAL C 2  738  ? 55.805  4.741   -37.305  1.00 40.71  ?  742  VAL C O     1 
ATOM   8779  C  CB    . VAL C 2  738  ? 56.514  1.903   -35.662  1.00 31.59  ?  742  VAL C CB    1 
ATOM   8780  C  CG1   . VAL C 2  738  ? 55.925  2.915   -34.695  1.00 35.33  ?  742  VAL C CG1   1 
ATOM   8781  C  CG2   . VAL C 2  738  ? 55.798  0.573   -35.546  1.00 31.84  ?  742  VAL C CG2   1 
ATOM   8782  N  N     . GLU C 2  739  ? 58.002  4.302   -37.084  1.00 39.17  ?  743  GLU C N     1 
ATOM   8783  C  CA    . GLU C 2  739  ? 58.360  5.712   -36.948  1.00 39.07  ?  743  GLU C CA    1 
ATOM   8784  C  C     . GLU C 2  739  ? 58.100  6.484   -38.234  1.00 37.11  ?  743  GLU C C     1 
ATOM   8785  O  O     . GLU C 2  739  ? 57.609  7.617   -38.193  1.00 41.49  ?  743  GLU C O     1 
ATOM   8786  C  CB    . GLU C 2  739  ? 59.825  5.844   -36.534  1.00 41.22  ?  743  GLU C CB    1 
ATOM   8787  C  CG    . GLU C 2  739  ? 60.159  5.195   -35.197  1.00 43.89  ?  743  GLU C CG    1 
ATOM   8788  C  CD    . GLU C 2  739  ? 61.646  5.224   -34.879  1.00 49.60  ?  743  GLU C CD    1 
ATOM   8789  O  OE1   . GLU C 2  739  ? 62.418  5.827   -35.657  1.00 49.97  ?  743  GLU C OE1   1 
ATOM   8790  O  OE2   . GLU C 2  739  ? 62.044  4.641   -33.848  1.00 49.68  ?  743  GLU C OE2   1 
ATOM   8791  N  N     . GLU C 2  740  ? 58.415  5.891   -39.381  1.00 35.65  ?  744  GLU C N     1 
ATOM   8792  C  CA    . GLU C 2  740  ? 58.250  6.540   -40.673  1.00 35.90  ?  744  GLU C CA    1 
ATOM   8793  C  C     . GLU C 2  740  ? 56.908  6.236   -41.330  1.00 38.13  ?  744  GLU C C     1 
ATOM   8794  O  O     . GLU C 2  740  ? 56.708  6.616   -42.488  1.00 40.16  ?  744  GLU C O     1 
ATOM   8795  C  CB    . GLU C 2  740  ? 59.387  6.145   -41.614  1.00 35.72  ?  744  GLU C CB    1 
ATOM   8796  C  CG    . GLU C 2  740  ? 60.758  6.595   -41.150  1.00 35.65  ?  744  GLU C CG    1 
ATOM   8797  C  CD    . GLU C 2  740  ? 61.831  6.336   -42.186  1.00 40.77  ?  744  GLU C CD    1 
ATOM   8798  O  OE1   . GLU C 2  740  ? 61.480  5.966   -43.326  1.00 39.61  ?  744  GLU C OE1   1 
ATOM   8799  O  OE2   . GLU C 2  740  ? 63.024  6.502   -41.862  1.00 39.67  ?  744  GLU C OE2   1 
ATOM   8800  N  N     . ASP C 2  741  ? 56.009  5.537   -40.637  1.00 35.72  ?  745  ASP C N     1 
ATOM   8801  C  CA    . ASP C 2  741  ? 54.637  5.332   -41.111  1.00 37.76  ?  745  ASP C CA    1 
ATOM   8802  C  C     . ASP C 2  741  ? 54.600  4.564   -42.426  1.00 38.29  ?  745  ASP C C     1 
ATOM   8803  O  O     . ASP C 2  741  ? 53.764  4.830   -43.292  1.00 41.68  ?  745  ASP C O     1 
ATOM   8804  C  CB    . ASP C 2  741  ? 53.898  6.664   -41.264  1.00 40.50  ?  745  ASP C CB    1 
ATOM   8805  C  CG    . ASP C 2  741  ? 53.311  7.165   -39.969  1.00 43.27  ?  745  ASP C CG    1 
ATOM   8806  O  OD1   . ASP C 2  741  ? 52.741  6.351   -39.219  1.00 39.48  ?  745  ASP C OD1   1 
ATOM   8807  O  OD2   . ASP C 2  741  ? 53.413  8.379   -39.705  1.00 49.68  ?  745  ASP C OD2   1 
ATOM   8808  N  N     . VAL C 2  742  ? 55.509  3.606   -42.595  1.00 33.08  ?  746  VAL C N     1 
ATOM   8809  C  CA    . VAL C 2  742  ? 55.522  2.910   -43.874  1.00 30.84  ?  746  VAL C CA    1 
ATOM   8810  C  C     . VAL C 2  742  ? 54.426  1.850   -43.930  1.00 33.16  ?  746  VAL C C     1 
ATOM   8811  O  O     . VAL C 2  742  ? 53.884  1.575   -45.004  1.00 35.70  ?  746  VAL C O     1 
ATOM   8812  C  CB    . VAL C 2  742  ? 56.919  2.330   -44.172  1.00 29.08  ?  746  VAL C CB    1 
ATOM   8813  C  CG1   . VAL C 2  742  ? 57.943  2.869   -43.191  1.00 31.76  ?  746  VAL C CG1   1 
ATOM   8814  C  CG2   . VAL C 2  742  ? 56.908  0.811   -44.189  1.00 33.44  ?  746  VAL C CG2   1 
ATOM   8815  N  N     . LEU C 2  743  ? 54.097  1.223   -42.802  1.00 34.24  ?  747  LEU C N     1 
ATOM   8816  C  CA    . LEU C 2  743  ? 52.985  0.285   -42.718  1.00 31.63  ?  747  LEU C CA    1 
ATOM   8817  C  C     . LEU C 2  743  ? 51.726  0.885   -42.096  1.00 35.60  ?  747  LEU C C     1 
ATOM   8818  O  O     . LEU C 2  743  ? 50.776  0.148   -41.826  1.00 35.03  ?  747  LEU C O     1 
ATOM   8819  C  CB    . LEU C 2  743  ? 53.412  -0.977  -41.972  1.00 28.90  ?  747  LEU C CB    1 
ATOM   8820  C  CG    . LEU C 2  743  ? 54.319  -1.845  -42.849  1.00 30.81  ?  747  LEU C CG    1 
ATOM   8821  C  CD1   . LEU C 2  743  ? 54.646  -3.166  -42.186  1.00 29.97  ?  747  LEU C CD1   1 
ATOM   8822  C  CD2   . LEU C 2  743  ? 53.692  -2.065  -44.221  1.00 26.71  ?  747  LEU C CD2   1 
ATOM   8823  N  N     . THR C 2  744  ? 51.710  2.185   -41.815  1.00 36.88  ?  748  THR C N     1 
ATOM   8824  C  CA    . THR C 2  744  ? 50.523  2.804   -41.239  1.00 32.83  ?  748  THR C CA    1 
ATOM   8825  C  C     . THR C 2  744  ? 49.399  2.888   -42.267  1.00 32.41  ?  748  THR C C     1 
ATOM   8826  O  O     . THR C 2  744  ? 49.636  3.104   -43.457  1.00 32.60  ?  748  THR C O     1 
ATOM   8827  C  CB    . THR C 2  744  ? 50.856  4.198   -40.707  1.00 33.10  ?  748  THR C CB    1 
ATOM   8828  O  OG1   . THR C 2  744  ? 51.932  4.106   -39.768  1.00 34.37  ?  748  THR C OG1   1 
ATOM   8829  C  CG2   . THR C 2  744  ? 49.656  4.818   -40.010  1.00 33.24  ?  748  THR C CG2   1 
ATOM   8830  N  N     . SER C 2  745  ? 48.167  2.700   -41.798  1.00 34.86  ?  749  SER C N     1 
ATOM   8831  C  CA    . SER C 2  745  ? 46.981  2.824   -42.630  1.00 33.03  ?  749  SER C CA    1 
ATOM   8832  C  C     . SER C 2  745  ? 45.895  3.542   -41.841  1.00 34.92  ?  749  SER C C     1 
ATOM   8833  O  O     . SER C 2  745  ? 45.917  3.581   -40.609  1.00 36.04  ?  749  SER C O     1 
ATOM   8834  C  CB    . SER C 2  745  ? 46.475  1.457   -43.107  1.00 33.90  ?  749  SER C CB    1 
ATOM   8835  O  OG    . SER C 2  745  ? 46.012  0.680   -42.018  1.00 30.28  ?  749  SER C OG    1 
ATOM   8836  N  N     . ILE C 2  746  ? 44.937  4.108   -42.567  1.00 34.49  ?  750  ILE C N     1 
ATOM   8837  C  CA    . ILE C 2  746  ? 43.830  4.849   -41.972  1.00 38.11  ?  750  ILE C CA    1 
ATOM   8838  C  C     . ILE C 2  746  ? 42.575  3.992   -42.044  1.00 36.73  ?  750  ILE C C     1 
ATOM   8839  O  O     . ILE C 2  746  ? 42.274  3.402   -43.088  1.00 35.51  ?  750  ILE C O     1 
ATOM   8840  C  CB    . ILE C 2  746  ? 43.625  6.204   -42.672  1.00 38.78  ?  750  ILE C CB    1 
ATOM   8841  C  CG1   . ILE C 2  746  ? 44.838  7.107   -42.442  1.00 37.50  ?  750  ILE C CG1   1 
ATOM   8842  C  CG2   . ILE C 2  746  ? 42.368  6.887   -42.168  1.00 32.09  ?  750  ILE C CG2   1 
ATOM   8843  C  CD1   . ILE C 2  746  ? 44.856  8.344   -43.304  1.00 35.12  ?  750  ILE C CD1   1 
ATOM   8844  N  N     . HIS C 2  747  ? 41.846  3.920   -40.932  1.00 37.21  ?  751  HIS C N     1 
ATOM   8845  C  CA    . HIS C 2  747  ? 40.644  3.107   -40.815  1.00 37.49  ?  751  HIS C CA    1 
ATOM   8846  C  C     . HIS C 2  747  ? 39.509  3.967   -40.282  1.00 38.81  ?  751  HIS C C     1 
ATOM   8847  O  O     . HIS C 2  747  ? 39.652  4.613   -39.240  1.00 39.94  ?  751  HIS C O     1 
ATOM   8848  C  CB    . HIS C 2  747  ? 40.889  1.905   -39.899  1.00 37.11  ?  751  HIS C CB    1 
ATOM   8849  C  CG    . HIS C 2  747  ? 41.927  0.961   -40.418  1.00 35.47  ?  751  HIS C CG    1 
ATOM   8850  N  ND1   . HIS C 2  747  ? 41.608  -0.218  -41.054  1.00 35.57  ?  751  HIS C ND1   1 
ATOM   8851  C  CD2   . HIS C 2  747  ? 43.278  1.033   -40.418  1.00 37.46  ?  751  HIS C CD2   1 
ATOM   8852  C  CE1   . HIS C 2  747  ? 42.717  -0.836  -41.415  1.00 35.88  ?  751  HIS C CE1   1 
ATOM   8853  N  NE2   . HIS C 2  747  ? 43.745  -0.096  -41.042  1.00 34.13  ?  751  HIS C NE2   1 
ATOM   8854  N  N     . ILE C 2  748  ? 38.384  3.968   -40.992  1.00 36.88  ?  752  ILE C N     1 
ATOM   8855  C  CA    . ILE C 2  748  ? 37.271  4.864   -40.701  1.00 38.89  ?  752  ILE C CA    1 
ATOM   8856  C  C     . ILE C 2  748  ? 36.058  4.033   -40.304  1.00 41.64  ?  752  ILE C C     1 
ATOM   8857  O  O     . ILE C 2  748  ? 35.586  3.195   -41.083  1.00 40.42  ?  752  ILE C O     1 
ATOM   8858  C  CB    . ILE C 2  748  ? 36.950  5.771   -41.898  1.00 37.92  ?  752  ILE C CB    1 
ATOM   8859  C  CG1   . ILE C 2  748  ? 38.240  6.371   -42.460  1.00 35.73  ?  752  ILE C CG1   1 
ATOM   8860  C  CG2   . ILE C 2  748  ? 35.989  6.870   -41.480  1.00 35.33  ?  752  ILE C CG2   1 
ATOM   8861  C  CD1   . ILE C 2  748  ? 38.058  7.144   -43.736  1.00 32.09  ?  752  ILE C CD1   1 
ATOM   8862  N  N     . GLU C 2  749  ? 35.549  4.280   -39.102  1.00 42.03  ?  753  GLU C N     1 
ATOM   8863  C  CA    . GLU C 2  749  ? 34.377  3.612   -38.560  1.00 41.90  ?  753  GLU C CA    1 
ATOM   8864  C  C     . GLU C 2  749  ? 33.154  4.518   -38.640  1.00 42.70  ?  753  GLU C C     1 
ATOM   8865  O  O     . GLU C 2  749  ? 33.253  5.738   -38.503  1.00 43.39  ?  753  GLU C O     1 
ATOM   8866  C  CB    . GLU C 2  749  ? 34.619  3.202   -37.107  1.00 41.26  ?  753  GLU C CB    1 
ATOM   8867  C  CG    . GLU C 2  749  ? 35.339  1.883   -36.953  1.00 44.48  ?  753  GLU C CG    1 
ATOM   8868  C  CD    . GLU C 2  749  ? 34.387  0.708   -36.943  1.00 54.20  ?  753  GLU C CD    1 
ATOM   8869  O  OE1   . GLU C 2  749  ? 34.526  -0.156  -36.054  1.00 65.31  ?  753  GLU C OE1   1 
ATOM   8870  O  OE2   . GLU C 2  749  ? 33.492  0.654   -37.813  1.00 55.75  ?  753  GLU C OE2   1 
ATOM   8871  N  N     . GLU C 2  750  ? 31.994  3.904   -38.861  1.00 43.57  ?  754  GLU C N     1 
ATOM   8872  C  CA    . GLU C 2  750  ? 30.715  4.606   -38.913  1.00 41.22  ?  754  GLU C CA    1 
ATOM   8873  C  C     . GLU C 2  750  ? 29.852  4.145   -37.747  1.00 41.32  ?  754  GLU C C     1 
ATOM   8874  O  O     . GLU C 2  750  ? 29.447  2.981   -37.690  1.00 46.15  ?  754  GLU C O     1 
ATOM   8875  C  CB    . GLU C 2  750  ? 30.007  4.353   -40.240  1.00 45.28  ?  754  GLU C CB    1 
ATOM   8876  C  CG    . GLU C 2  750  ? 28.583  4.876   -40.280  1.00 44.06  ?  754  GLU C CG    1 
ATOM   8877  C  CD    . GLU C 2  750  ? 27.909  4.616   -41.610  1.00 49.72  ?  754  GLU C CD    1 
ATOM   8878  O  OE1   . GLU C 2  750  ? 27.702  3.435   -41.956  1.00 50.35  ?  754  GLU C OE1   1 
ATOM   8879  O  OE2   . GLU C 2  750  ? 27.597  5.594   -42.317  1.00 50.69  ?  754  GLU C OE2   1 
ATOM   8880  N  N     . HIS C 2  751  ? 29.567  5.057   -36.825  1.00 38.25  ?  755  HIS C N     1 
ATOM   8881  C  CA    . HIS C 2  751  ? 28.705  4.785   -35.685  1.00 39.92  ?  755  HIS C CA    1 
ATOM   8882  C  C     . HIS C 2  751  ? 27.358  5.457   -35.903  1.00 39.87  ?  755  HIS C C     1 
ATOM   8883  O  O     . HIS C 2  751  ? 27.294  6.666   -36.143  1.00 42.22  ?  755  HIS C O     1 
ATOM   8884  C  CB    . HIS C 2  751  ? 29.346  5.270   -34.387  1.00 38.78  ?  755  HIS C CB    1 
ATOM   8885  C  CG    . HIS C 2  751  ? 30.679  4.650   -34.109  1.00 42.70  ?  755  HIS C CG    1 
ATOM   8886  N  ND1   . HIS C 2  751  ? 30.815  3.422   -33.500  1.00 50.17  ?  755  HIS C ND1   1 
ATOM   8887  C  CD2   . HIS C 2  751  ? 31.935  5.085   -34.365  1.00 41.67  ?  755  HIS C CD2   1 
ATOM   8888  C  CE1   . HIS C 2  751  ? 32.098  3.129   -33.388  1.00 49.83  ?  755  HIS C CE1   1 
ATOM   8889  N  NE2   . HIS C 2  751  ? 32.799  4.121   -33.906  1.00 47.28  ?  755  HIS C NE2   1 
ATOM   8890  N  N     . GLU C 2  752  ? 26.290  4.673   -35.818  1.00 42.75  ?  756  GLU C N     1 
ATOM   8891  C  CA    . GLU C 2  752  ? 24.944  5.125   -36.129  1.00 41.98  ?  756  GLU C CA    1 
ATOM   8892  C  C     . GLU C 2  752  ? 24.073  5.031   -34.885  1.00 41.21  ?  756  GLU C C     1 
ATOM   8893  O  O     . GLU C 2  752  ? 24.189  4.081   -34.108  1.00 44.00  ?  756  GLU C O     1 
ATOM   8894  C  CB    . GLU C 2  752  ? 24.355  4.287   -37.261  1.00 43.73  ?  756  GLU C CB    1 
ATOM   8895  C  CG    . GLU C 2  752  ? 23.069  4.805   -37.852  1.00 45.62  ?  756  GLU C CG    1 
ATOM   8896  C  CD    . GLU C 2  752  ? 22.641  3.991   -39.055  1.00 57.10  ?  756  GLU C CD    1 
ATOM   8897  O  OE1   . GLU C 2  752  ? 23.517  3.362   -39.681  1.00 65.48  ?  756  GLU C OE1   1 
ATOM   8898  O  OE2   . GLU C 2  752  ? 21.435  3.968   -39.374  1.00 58.45  ?  756  GLU C OE2   1 
ATOM   8899  N  N     . ILE C 2  753  ? 23.214  6.026   -34.691  1.00 42.64  ?  757  ILE C N     1 
ATOM   8900  C  CA    . ILE C 2  753  ? 22.308  6.046   -33.549  1.00 41.78  ?  757  ILE C CA    1 
ATOM   8901  C  C     . ILE C 2  753  ? 21.040  6.785   -33.952  1.00 41.56  ?  757  ILE C C     1 
ATOM   8902  O  O     . ILE C 2  753  ? 21.084  7.738   -34.734  1.00 40.33  ?  757  ILE C O     1 
ATOM   8903  C  CB    . ILE C 2  753  ? 22.977  6.683   -32.312  1.00 38.07  ?  757  ILE C CB    1 
ATOM   8904  C  CG1   . ILE C 2  753  ? 22.127  6.453   -31.066  1.00 37.31  ?  757  ILE C CG1   1 
ATOM   8905  C  CG2   . ILE C 2  753  ? 23.231  8.165   -32.534  1.00 45.12  ?  757  ILE C CG2   1 
ATOM   8906  C  CD1   . ILE C 2  753  ? 21.947  4.993   -30.730  1.00 44.82  ?  757  ILE C CD1   1 
ATOM   8907  N  N     . ASP C 2  754  ? 19.905  6.328   -33.428  1.00 42.82  ?  758  ASP C N     1 
ATOM   8908  C  CA    . ASP C 2  754  ? 18.621  6.944   -33.721  1.00 43.35  ?  758  ASP C CA    1 
ATOM   8909  C  C     . ASP C 2  754  ? 17.778  7.008   -32.459  1.00 44.42  ?  758  ASP C C     1 
ATOM   8910  O  O     . ASP C 2  754  ? 17.870  6.145   -31.585  1.00 45.66  ?  758  ASP C O     1 
ATOM   8911  C  CB    . ASP C 2  754  ? 17.855  6.184   -34.811  1.00 44.59  ?  758  ASP C CB    1 
ATOM   8912  C  CG    . ASP C 2  754  ? 17.477  4.780   -34.389  1.00 51.52  ?  758  ASP C CG    1 
ATOM   8913  O  OD1   . ASP C 2  754  ? 16.397  4.609   -33.790  1.00 52.16  ?  758  ASP C OD1   1 
ATOM   8914  O  OD2   . ASP C 2  754  ? 18.256  3.843   -34.665  1.00 53.49  ?  758  ASP C OD2   1 
ATOM   8915  N  N     . ALA C 2  755  ? 16.961  8.051   -32.369  1.00 45.77  ?  759  ALA C N     1 
ATOM   8916  C  CA    . ALA C 2  755  ? 15.962  8.179   -31.319  1.00 45.70  ?  759  ALA C CA    1 
ATOM   8917  C  C     . ALA C 2  755  ? 14.619  7.733   -31.877  1.00 49.50  ?  759  ALA C C     1 
ATOM   8918  O  O     . ALA C 2  755  ? 14.192  8.213   -32.931  1.00 53.39  ?  759  ALA C O     1 
ATOM   8919  C  CB    . ALA C 2  755  ? 15.880  9.616   -30.808  1.00 46.58  ?  759  ALA C CB    1 
ATOM   8920  N  N     . ARG C 2  756  ? 13.966  6.809   -31.184  1.00 49.01  ?  760  ARG C N     1 
ATOM   8921  C  CA    . ARG C 2  756  ? 12.731  6.224   -31.681  1.00 51.33  ?  760  ARG C CA    1 
ATOM   8922  C  C     . ARG C 2  756  ? 11.673  6.254   -30.586  1.00 55.73  ?  760  ARG C C     1 
ATOM   8923  O  O     . ARG C 2  756  ? 11.932  6.654   -29.448  1.00 55.40  ?  760  ARG C O     1 
ATOM   8924  C  CB    . ARG C 2  756  ? 12.966  4.794   -32.184  1.00 50.89  ?  760  ARG C CB    1 
ATOM   8925  C  CG    . ARG C 2  756  ? 13.531  3.854   -31.133  1.00 52.68  ?  760  ARG C CG    1 
ATOM   8926  C  CD    . ARG C 2  756  ? 13.731  2.445   -31.677  1.00 53.85  ?  760  ARG C CD    1 
ATOM   8927  N  NE    . ARG C 2  756  ? 14.737  2.390   -32.733  1.00 50.24  ?  760  ARG C NE    1 
ATOM   8928  C  CZ    . ARG C 2  756  ? 15.263  1.265   -33.203  1.00 50.46  ?  760  ARG C CZ    1 
ATOM   8929  N  NH1   . ARG C 2  756  ? 14.883  0.097   -32.705  1.00 50.59  ?  760  ARG C NH1   1 
ATOM   8930  N  NH2   . ARG C 2  756  ? 16.175  1.307   -34.164  1.00 49.84  ?  760  ARG C NH2   1 
ATOM   8931  N  N     . ASP C 2  757  ? 10.469  5.812   -30.941  1.00 54.66  ?  761  ASP C N     1 
ATOM   8932  C  CA    . ASP C 2  757  ? 9.351   5.766   -30.011  1.00 47.44  ?  761  ASP C CA    1 
ATOM   8933  C  C     . ASP C 2  757  ? 9.318   4.413   -29.319  1.00 43.50  ?  761  ASP C C     1 
ATOM   8934  O  O     . ASP C 2  757  ? 9.423   3.372   -29.972  1.00 42.66  ?  761  ASP C O     1 
ATOM   8935  C  CB    . ASP C 2  757  ? 8.030   6.024   -30.734  1.00 52.44  ?  761  ASP C CB    1 
ATOM   8936  C  CG    . ASP C 2  757  ? 7.852   7.475   -31.121  1.00 61.33  ?  761  ASP C CG    1 
ATOM   8937  O  OD1   . ASP C 2  757  ? 7.744   8.321   -30.209  1.00 60.65  ?  761  ASP C OD1   1 
ATOM   8938  O  OD2   . ASP C 2  757  ? 7.811   7.772   -32.332  1.00 65.99  ?  761  ASP C OD2   1 
ATOM   8939  N  N     . THR C 2  758  ? 9.172   4.434   -28.002  1.00 44.49  ?  762  THR C N     1 
ATOM   8940  C  CA    . THR C 2  758  ? 9.182   3.232   -27.186  1.00 44.22  ?  762  THR C CA    1 
ATOM   8941  C  C     . THR C 2  758  ? 7.859   3.099   -26.439  1.00 44.61  ?  762  THR C C     1 
ATOM   8942  O  O     . THR C 2  758  ? 6.932   3.894   -26.612  1.00 43.41  ?  762  THR C O     1 
ATOM   8943  C  CB    . THR C 2  758  ? 10.349  3.245   -26.197  1.00 46.80  ?  762  THR C CB    1 
ATOM   8944  O  OG1   . THR C 2  758  ? 10.041  4.121   -25.107  1.00 47.70  ?  762  THR C OG1   1 
ATOM   8945  C  CG2   . THR C 2  758  ? 11.622  3.717   -26.878  1.00 46.25  ?  762  THR C CG2   1 
ATOM   8946  N  N     . LYS C 2  759  ? 7.794   2.067   -25.597  1.00 46.12  ?  763  LYS C N     1 
ATOM   8947  C  CA    . LYS C 2  759  ? 6.590   1.803   -24.817  1.00 47.60  ?  763  LYS C CA    1 
ATOM   8948  C  C     . LYS C 2  759  ? 6.228   2.986   -23.929  1.00 48.41  ?  763  LYS C C     1 
ATOM   8949  O  O     . LYS C 2  759  ? 5.056   3.366   -23.837  1.00 51.52  ?  763  LYS C O     1 
ATOM   8950  C  CB    . LYS C 2  759  ? 6.794   0.546   -23.973  1.00 49.01  ?  763  LYS C CB    1 
ATOM   8951  C  CG    . LYS C 2  759  ? 5.803   -0.569  -24.246  1.00 53.80  ?  763  LYS C CG    1 
ATOM   8952  C  CD    . LYS C 2  759  ? 6.203   -1.835  -23.508  1.00 57.27  ?  763  LYS C CD    1 
ATOM   8953  C  CE    . LYS C 2  759  ? 5.141   -2.910  -23.635  1.00 57.23  ?  763  LYS C CE    1 
ATOM   8954  N  NZ    . LYS C 2  759  ? 5.622   -4.221  -23.130  1.00 56.07  ?  763  LYS C NZ    1 
ATOM   8955  N  N     . LEU C 2  760  ? 7.220   3.582   -23.270  1.00 49.73  ?  764  LEU C N     1 
ATOM   8956  C  CA    . LEU C 2  760  ? 6.993   4.625   -22.280  1.00 47.29  ?  764  LEU C CA    1 
ATOM   8957  C  C     . LEU C 2  760  ? 7.109   6.035   -22.843  1.00 45.99  ?  764  LEU C C     1 
ATOM   8958  O  O     . LEU C 2  760  ? 6.989   6.998   -22.082  1.00 47.01  ?  764  LEU C O     1 
ATOM   8959  C  CB    . LEU C 2  760  ? 7.967   4.461   -21.107  1.00 49.61  ?  764  LEU C CB    1 
ATOM   8960  C  CG    . LEU C 2  760  ? 7.614   3.475   -19.987  1.00 53.65  ?  764  LEU C CG    1 
ATOM   8961  C  CD1   . LEU C 2  760  ? 6.302   3.862   -19.318  1.00 63.67  ?  764  LEU C CD1   1 
ATOM   8962  C  CD2   . LEU C 2  760  ? 7.560   2.037   -20.484  1.00 54.13  ?  764  LEU C CD2   1 
ATOM   8963  N  N     . GLY C 2  761  ? 7.354   6.187   -24.134  1.00 45.84  ?  765  GLY C N     1 
ATOM   8964  C  CA    . GLY C 2  761  ? 7.422   7.503   -24.729  1.00 45.44  ?  765  GLY C CA    1 
ATOM   8965  C  C     . GLY C 2  761  ? 8.421   7.528   -25.868  1.00 44.89  ?  765  GLY C C     1 
ATOM   8966  O  O     . GLY C 2  761  ? 8.823   6.492   -26.382  1.00 46.04  ?  765  GLY C O     1 
ATOM   8967  N  N     . ALA C 2  762  ? 8.807   8.742   -26.244  1.00 47.11  ?  766  ALA C N     1 
ATOM   8968  C  CA    . ALA C 2  762  ? 9.764   8.969   -27.314  1.00 49.24  ?  766  ALA C CA    1 
ATOM   8969  C  C     . ALA C 2  762  ? 11.156  9.191   -26.741  1.00 49.22  ?  766  ALA C C     1 
ATOM   8970  O  O     . ALA C 2  762  ? 11.311  9.787   -25.672  1.00 49.74  ?  766  ALA C O     1 
ATOM   8971  C  CB    . ALA C 2  762  ? 9.359   10.174  -28.163  1.00 48.57  ?  766  ALA C CB    1 
ATOM   8972  N  N     . GLU C 2  763  ? 12.162  8.693   -27.451  1.00 48.18  ?  767  GLU C N     1 
ATOM   8973  C  CA    . GLU C 2  763  ? 13.544  8.985   -27.108  1.00 49.16  ?  767  GLU C CA    1 
ATOM   8974  C  C     . GLU C 2  763  ? 13.930  10.368  -27.612  1.00 50.67  ?  767  GLU C C     1 
ATOM   8975  O  O     . GLU C 2  763  ? 13.402  10.858  -28.614  1.00 51.40  ?  767  GLU C O     1 
ATOM   8976  C  CB    . GLU C 2  763  ? 14.484  7.937   -27.702  1.00 46.39  ?  767  GLU C CB    1 
ATOM   8977  C  CG    . GLU C 2  763  ? 14.409  6.587   -27.022  1.00 49.03  ?  767  GLU C CG    1 
ATOM   8978  C  CD    . GLU C 2  763  ? 15.366  5.584   -27.624  1.00 51.03  ?  767  GLU C CD    1 
ATOM   8979  O  OE1   . GLU C 2  763  ? 15.411  5.472   -28.865  1.00 50.56  ?  767  GLU C OE1   1 
ATOM   8980  O  OE2   . GLU C 2  763  ? 16.087  4.919   -26.856  1.00 52.22  ?  767  GLU C OE2   1 
ATOM   8981  N  N     . GLU C 2  764  ? 14.864  10.996  -26.906  1.00 46.44  ?  768  GLU C N     1 
ATOM   8982  C  CA    . GLU C 2  764  ? 15.350  12.316  -27.275  1.00 49.52  ?  768  GLU C CA    1 
ATOM   8983  C  C     . GLU C 2  764  ? 16.869  12.312  -27.318  1.00 52.35  ?  768  GLU C C     1 
ATOM   8984  O  O     . GLU C 2  764  ? 17.521  11.853  -26.375  1.00 50.71  ?  768  GLU C O     1 
ATOM   8985  C  CB    . GLU C 2  764  ? 14.864  13.386  -26.294  1.00 54.23  ?  768  GLU C CB    1 
ATOM   8986  C  CG    . GLU C 2  764  ? 15.394  14.774  -26.610  1.00 57.70  ?  768  GLU C CG    1 
ATOM   8987  C  CD    . GLU C 2  764  ? 15.064  15.784  -25.534  1.00 65.07  ?  768  GLU C CD    1 
ATOM   8988  O  OE1   . GLU C 2  764  ? 14.541  15.375  -24.477  1.00 65.96  ?  768  GLU C OE1   1 
ATOM   8989  O  OE2   . GLU C 2  764  ? 15.328  16.986  -25.747  1.00 67.44  ?  768  GLU C OE2   1 
ATOM   8990  N  N     . ILE C 2  765  ? 17.423  12.817  -28.415  1.00 52.12  ?  769  ILE C N     1 
ATOM   8991  C  CA    . ILE C 2  765  ? 18.848  13.113  -28.492  1.00 44.90  ?  769  ILE C CA    1 
ATOM   8992  C  C     . ILE C 2  765  ? 19.079  14.464  -27.833  1.00 49.28  ?  769  ILE C C     1 
ATOM   8993  O  O     . ILE C 2  765  ? 18.515  15.477  -28.259  1.00 53.47  ?  769  ILE C O     1 
ATOM   8994  C  CB    . ILE C 2  765  ? 19.333  13.117  -29.947  1.00 41.98  ?  769  ILE C CB    1 
ATOM   8995  C  CG1   . ILE C 2  765  ? 19.242  11.711  -30.531  1.00 46.55  ?  769  ILE C CG1   1 
ATOM   8996  C  CG2   . ILE C 2  765  ? 20.745  13.661  -30.035  1.00 42.12  ?  769  ILE C CG2   1 
ATOM   8997  C  CD1   . ILE C 2  765  ? 19.543  11.652  -31.996  1.00 50.88  ?  769  ILE C CD1   1 
ATOM   8998  N  N     . THR C 2  766  ? 19.905  14.485  -26.793  1.00 48.09  ?  770  THR C N     1 
ATOM   8999  C  CA    . THR C 2  766  ? 20.068  15.694  -26.005  1.00 49.72  ?  770  THR C CA    1 
ATOM   9000  C  C     . THR C 2  766  ? 21.485  15.777  -25.468  1.00 50.56  ?  770  THR C C     1 
ATOM   9001  O  O     . THR C 2  766  ? 22.212  14.782  -25.406  1.00 49.31  ?  770  THR C O     1 
ATOM   9002  C  CB    . THR C 2  766  ? 19.074  15.746  -24.842  1.00 53.01  ?  770  THR C CB    1 
ATOM   9003  O  OG1   . THR C 2  766  ? 19.498  16.737  -23.898  1.00 57.79  ?  770  THR C OG1   1 
ATOM   9004  C  CG2   . THR C 2  766  ? 19.002  14.399  -24.149  1.00 50.90  ?  770  THR C CG2   1 
ATOM   9005  N  N     . ARG C 2  767  ? 21.867  16.989  -25.081  1.00 51.13  ?  771  ARG C N     1 
ATOM   9006  C  CA    . ARG C 2  767  ? 23.085  17.217  -24.324  1.00 48.82  ?  771  ARG C CA    1 
ATOM   9007  C  C     . ARG C 2  767  ? 22.858  17.090  -22.827  1.00 50.46  ?  771  ARG C C     1 
ATOM   9008  O  O     . ARG C 2  767  ? 23.818  17.164  -22.055  1.00 49.59  ?  771  ARG C O     1 
ATOM   9009  C  CB    . ARG C 2  767  ? 23.657  18.600  -24.647  1.00 49.34  ?  771  ARG C CB    1 
ATOM   9010  C  CG    . ARG C 2  767  ? 25.101  18.785  -24.228  1.00 49.33  ?  771  ARG C CG    1 
ATOM   9011  C  CD    . ARG C 2  767  ? 25.443  20.243  -24.022  1.00 51.62  ?  771  ARG C CD    1 
ATOM   9012  N  NE    . ARG C 2  767  ? 26.566  20.397  -23.105  1.00 50.52  ?  771  ARG C NE    1 
ATOM   9013  C  CZ    . ARG C 2  767  ? 27.840  20.334  -23.470  1.00 51.00  ?  771  ARG C CZ    1 
ATOM   9014  N  NH1   . ARG C 2  767  ? 28.156  20.120  -24.738  1.00 51.06  ?  771  ARG C NH1   1 
ATOM   9015  N  NH2   . ARG C 2  767  ? 28.798  20.484  -22.567  1.00 55.87  ?  771  ARG C NH2   1 
ATOM   9016  N  N     . ASP C 2  768  ? 21.621  16.868  -22.397  1.00 52.11  ?  772  ASP C N     1 
ATOM   9017  C  CA    . ASP C 2  768  ? 21.296  16.805  -20.978  1.00 54.78  ?  772  ASP C CA    1 
ATOM   9018  C  C     . ASP C 2  768  ? 21.222  15.329  -20.607  1.00 56.77  ?  772  ASP C C     1 
ATOM   9019  O  O     . ASP C 2  768  ? 20.233  14.650  -20.889  1.00 55.73  ?  772  ASP C O     1 
ATOM   9020  C  CB    . ASP C 2  768  ? 19.987  17.539  -20.708  1.00 54.79  ?  772  ASP C CB    1 
ATOM   9021  C  CG    . ASP C 2  768  ? 19.532  17.426  -19.269  1.00 64.77  ?  772  ASP C CG    1 
ATOM   9022  O  OD1   . ASP C 2  768  ? 20.390  17.249  -18.381  1.00 68.21  ?  772  ASP C OD1   1 
ATOM   9023  O  OD2   . ASP C 2  768  ? 18.310  17.523  -19.028  1.00 64.02  ?  772  ASP C OD2   1 
ATOM   9024  N  N     . ILE C 2  769  ? 22.265  14.850  -19.940  1.00 60.06  ?  773  ILE C N     1 
ATOM   9025  C  CA    . ILE C 2  769  ? 22.422  13.448  -19.579  1.00 59.95  ?  773  ILE C CA    1 
ATOM   9026  C  C     . ILE C 2  769  ? 22.466  13.370  -18.059  1.00 60.76  ?  773  ILE C C     1 
ATOM   9027  O  O     . ILE C 2  769  ? 23.355  13.958  -17.437  1.00 64.18  ?  773  ILE C O     1 
ATOM   9028  C  CB    . ILE C 2  769  ? 23.684  12.822  -20.196  1.00 59.68  ?  773  ILE C CB    1 
ATOM   9029  C  CG1   . ILE C 2  769  ? 23.761  13.140  -21.690  1.00 52.87  ?  773  ILE C CG1   1 
ATOM   9030  C  CG2   . ILE C 2  769  ? 23.674  11.321  -20.000  1.00 56.21  ?  773  ILE C CG2   1 
ATOM   9031  C  CD1   . ILE C 2  769  ? 22.586  12.618  -22.482  1.00 51.81  ?  773  ILE C CD1   1 
ATOM   9032  N  N     . PRO C 2  770  ? 21.532  12.672  -17.420  1.00 59.68  ?  774  PRO C N     1 
ATOM   9033  C  CA    . PRO C 2  770  ? 21.430  12.737  -15.958  1.00 63.68  ?  774  PRO C CA    1 
ATOM   9034  C  C     . PRO C 2  770  ? 22.667  12.178  -15.271  1.00 63.25  ?  774  PRO C C     1 
ATOM   9035  O  O     . PRO C 2  770  ? 23.233  11.168  -15.692  1.00 61.87  ?  774  PRO C O     1 
ATOM   9036  C  CB    . PRO C 2  770  ? 20.191  11.886  -15.651  1.00 69.19  ?  774  PRO C CB    1 
ATOM   9037  C  CG    . PRO C 2  770  ? 19.475  11.737  -16.962  1.00 64.76  ?  774  PRO C CG    1 
ATOM   9038  C  CD    . PRO C 2  770  ? 20.533  11.769  -18.008  1.00 59.60  ?  774  PRO C CD    1 
ATOM   9039  N  N     . ASN C 2  771  ? 23.083  12.863  -14.204  1.00 63.41  ?  775  ASN C N     1 
ATOM   9040  C  CA    . ASN C 2  771  ? 24.169  12.411  -13.334  1.00 64.55  ?  775  ASN C CA    1 
ATOM   9041  C  C     . ASN C 2  771  ? 25.480  12.228  -14.094  1.00 66.10  ?  775  ASN C C     1 
ATOM   9042  O  O     . ASN C 2  771  ? 26.319  11.408  -13.715  1.00 72.72  ?  775  ASN C O     1 
ATOM   9043  C  CB    . ASN C 2  771  ? 23.791  11.118  -12.605  1.00 62.31  ?  775  ASN C CB    1 
ATOM   9044  N  N     . ILE C 2  772  ? 25.674  12.988  -15.167  1.00 64.12  ?  776  ILE C N     1 
ATOM   9045  C  CA    . ILE C 2  772  ? 26.888  12.929  -15.972  1.00 65.63  ?  776  ILE C CA    1 
ATOM   9046  C  C     . ILE C 2  772  ? 27.633  14.245  -15.816  1.00 64.83  ?  776  ILE C C     1 
ATOM   9047  O  O     . ILE C 2  772  ? 27.045  15.323  -15.966  1.00 63.72  ?  776  ILE C O     1 
ATOM   9048  C  CB    . ILE C 2  772  ? 26.573  12.632  -17.448  1.00 63.25  ?  776  ILE C CB    1 
ATOM   9049  C  CG1   . ILE C 2  772  ? 26.401  11.128  -17.659  1.00 60.82  ?  776  ILE C CG1   1 
ATOM   9050  C  CG2   . ILE C 2  772  ? 27.675  13.149  -18.344  1.00 58.51  ?  776  ILE C CG2   1 
ATOM   9051  C  CD1   . ILE C 2  772  ? 27.691  10.347  -17.543  1.00 55.68  ?  776  ILE C CD1   1 
ATOM   9052  N  N     . SER C 2  773  ? 28.925  14.153  -15.510  1.00 64.78  ?  777  SER C N     1 
ATOM   9053  C  CA    . SER C 2  773  ? 29.735  15.333  -15.248  1.00 63.01  ?  777  SER C CA    1 
ATOM   9054  C  C     . SER C 2  773  ? 29.828  16.224  -16.481  1.00 59.47  ?  777  SER C C     1 
ATOM   9055  O  O     . SER C 2  773  ? 29.771  15.758  -17.622  1.00 58.04  ?  777  SER C O     1 
ATOM   9056  C  CB    . SER C 2  773  ? 31.135  14.916  -14.797  1.00 62.71  ?  777  SER C CB    1 
ATOM   9057  O  OG    . SER C 2  773  ? 32.049  15.993  -14.894  1.00 69.14  ?  777  SER C OG    1 
ATOM   9058  N  N     . ASP C 2  774  ? 29.969  17.529  -16.239  1.00 60.95  ?  778  ASP C N     1 
ATOM   9059  C  CA    . ASP C 2  774  ? 30.161  18.466  -17.339  1.00 63.90  ?  778  ASP C CA    1 
ATOM   9060  C  C     . ASP C 2  774  ? 31.500  18.249  -18.028  1.00 62.92  ?  778  ASP C C     1 
ATOM   9061  O  O     . ASP C 2  774  ? 31.642  18.561  -19.215  1.00 63.11  ?  778  ASP C O     1 
ATOM   9062  C  CB    . ASP C 2  774  ? 30.058  19.903  -16.833  1.00 64.54  ?  778  ASP C CB    1 
ATOM   9063  C  CG    . ASP C 2  774  ? 28.679  20.237  -16.315  1.00 69.36  ?  778  ASP C CG    1 
ATOM   9064  O  OD1   . ASP C 2  774  ? 28.421  19.996  -15.117  1.00 69.85  ?  778  ASP C OD1   1 
ATOM   9065  O  OD2   . ASP C 2  774  ? 27.852  20.740  -17.106  1.00 68.97  ?  778  ASP C OD2   1 
ATOM   9066  N  N     . GLU C 2  775  ? 32.487  17.725  -17.299  1.00 63.65  ?  779  GLU C N     1 
ATOM   9067  C  CA    . GLU C 2  775  ? 33.793  17.461  -17.889  1.00 64.82  ?  779  GLU C CA    1 
ATOM   9068  C  C     . GLU C 2  775  ? 33.691  16.472  -19.041  1.00 62.45  ?  779  GLU C C     1 
ATOM   9069  O  O     . GLU C 2  775  ? 34.284  16.682  -20.105  1.00 63.70  ?  779  GLU C O     1 
ATOM   9070  C  CB    . GLU C 2  775  ? 34.748  16.939  -16.816  1.00 72.46  ?  779  GLU C CB    1 
ATOM   9071  C  CG    . GLU C 2  775  ? 36.074  16.429  -17.347  1.00 81.75  ?  779  GLU C CG    1 
ATOM   9072  C  CD    . GLU C 2  775  ? 36.923  15.799  -16.262  1.00 95.42  ?  779  GLU C CD    1 
ATOM   9073  O  OE1   . GLU C 2  775  ? 36.579  15.959  -15.071  1.00 95.76  ?  779  GLU C OE1   1 
ATOM   9074  O  OE2   . GLU C 2  775  ? 37.930  15.139  -16.598  1.00 105.83 ?  779  GLU C OE2   1 
ATOM   9075  N  N     . VAL C 2  776  ? 32.933  15.390  -18.853  1.00 60.04  ?  780  VAL C N     1 
ATOM   9076  C  CA    . VAL C 2  776  ? 32.822  14.371  -19.891  1.00 54.82  ?  780  VAL C CA    1 
ATOM   9077  C  C     . VAL C 2  776  ? 31.955  14.832  -21.058  1.00 57.29  ?  780  VAL C C     1 
ATOM   9078  O  O     . VAL C 2  776  ? 32.094  14.305  -22.169  1.00 58.34  ?  780  VAL C O     1 
ATOM   9079  C  CB    . VAL C 2  776  ? 32.297  13.061  -19.279  1.00 51.14  ?  780  VAL C CB    1 
ATOM   9080  C  CG1   . VAL C 2  776  ? 32.305  13.151  -17.762  1.00 53.88  ?  780  VAL C CG1   1 
ATOM   9081  C  CG2   . VAL C 2  776  ? 30.909  12.726  -19.791  1.00 51.54  ?  780  VAL C CG2   1 
ATOM   9082  N  N     . LEU C 2  777  ? 31.084  15.816  -20.848  1.00 57.16  ?  781  LEU C N     1 
ATOM   9083  C  CA    . LEU C 2  777  ? 30.257  16.363  -21.915  1.00 51.75  ?  781  LEU C CA    1 
ATOM   9084  C  C     . LEU C 2  777  ? 30.970  17.434  -22.727  1.00 55.00  ?  781  LEU C C     1 
ATOM   9085  O  O     . LEU C 2  777  ? 30.381  17.960  -23.677  1.00 53.67  ?  781  LEU C O     1 
ATOM   9086  C  CB    . LEU C 2  777  ? 28.971  16.950  -21.331  1.00 49.83  ?  781  LEU C CB    1 
ATOM   9087  C  CG    . LEU C 2  777  ? 28.060  16.002  -20.557  1.00 49.73  ?  781  LEU C CG    1 
ATOM   9088  C  CD1   . LEU C 2  777  ? 26.985  16.782  -19.826  1.00 55.57  ?  781  LEU C CD1   1 
ATOM   9089  C  CD2   . LEU C 2  777  ? 27.436  14.989  -21.496  1.00 51.32  ?  781  LEU C CD2   1 
ATOM   9090  N  N     . ALA C 2  778  ? 32.225  17.743  -22.390  1.00 53.64  ?  782  ALA C N     1 
ATOM   9091  C  CA    . ALA C 2  778  ? 32.876  18.944  -22.904  1.00 57.04  ?  782  ALA C CA    1 
ATOM   9092  C  C     . ALA C 2  778  ? 32.999  18.944  -24.421  1.00 52.09  ?  782  ALA C C     1 
ATOM   9093  O  O     . ALA C 2  778  ? 33.024  20.014  -25.036  1.00 53.91  ?  782  ALA C O     1 
ATOM   9094  C  CB    . ALA C 2  778  ? 34.257  19.099  -22.269  1.00 66.85  ?  782  ALA C CB    1 
ATOM   9095  N  N     . ASP C 2  779  ? 33.087  17.775  -25.045  1.00 51.90  ?  783  ASP C N     1 
ATOM   9096  C  CA    . ASP C 2  779  ? 33.271  17.711  -26.488  1.00 53.43  ?  783  ASP C CA    1 
ATOM   9097  C  C     . ASP C 2  779  ? 31.961  17.592  -27.253  1.00 49.62  ?  783  ASP C C     1 
ATOM   9098  O  O     . ASP C 2  779  ? 31.985  17.485  -28.482  1.00 47.23  ?  783  ASP C O     1 
ATOM   9099  C  CB    . ASP C 2  779  ? 34.200  16.549  -26.847  1.00 55.16  ?  783  ASP C CB    1 
ATOM   9100  C  CG    . ASP C 2  779  ? 35.620  16.770  -26.360  1.00 59.41  ?  783  ASP C CG    1 
ATOM   9101  O  OD1   . ASP C 2  779  ? 35.985  17.936  -26.103  1.00 57.70  ?  783  ASP C OD1   1 
ATOM   9102  O  OD2   . ASP C 2  779  ? 36.373  15.782  -26.236  1.00 58.74  ?  783  ASP C OD2   1 
ATOM   9103  N  N     . LEU C 2  780  ? 30.827  17.609  -26.560  1.00 47.76  ?  784  LEU C N     1 
ATOM   9104  C  CA    . LEU C 2  780  ? 29.525  17.592  -27.209  1.00 45.45  ?  784  LEU C CA    1 
ATOM   9105  C  C     . LEU C 2  780  ? 29.103  19.002  -27.606  1.00 46.98  ?  784  LEU C C     1 
ATOM   9106  O  O     . LEU C 2  780  ? 29.400  19.978  -26.913  1.00 55.00  ?  784  LEU C O     1 
ATOM   9107  C  CB    . LEU C 2  780  ? 28.477  16.981  -26.279  1.00 47.08  ?  784  LEU C CB    1 
ATOM   9108  C  CG    . LEU C 2  780  ? 28.238  15.469  -26.309  1.00 45.19  ?  784  LEU C CG    1 
ATOM   9109  C  CD1   . LEU C 2  780  ? 29.533  14.681  -26.243  1.00 44.76  ?  784  LEU C CD1   1 
ATOM   9110  C  CD2   . LEU C 2  780  ? 27.321  15.079  -25.163  1.00 41.65  ?  784  LEU C CD2   1 
ATOM   9111  N  N     . ASP C 2  781  ? 28.396  19.105  -28.730  1.00 42.14  ?  785  ASP C N     1 
ATOM   9112  C  CA    . ASP C 2  781  ? 27.861  20.389  -29.164  1.00 41.91  ?  785  ASP C CA    1 
ATOM   9113  C  C     . ASP C 2  781  ? 26.549  20.651  -28.425  1.00 45.98  ?  785  ASP C C     1 
ATOM   9114  O  O     . ASP C 2  781  ? 26.236  20.005  -27.422  1.00 53.19  ?  785  ASP C O     1 
ATOM   9115  C  CB    . ASP C 2  781  ? 27.738  20.446  -30.690  1.00 43.54  ?  785  ASP C CB    1 
ATOM   9116  C  CG    . ASP C 2  781  ? 26.644  19.546  -31.256  1.00 44.75  ?  785  ASP C CG    1 
ATOM   9117  O  OD1   . ASP C 2  781  ? 25.680  19.192  -30.553  1.00 45.79  ?  785  ASP C OD1   1 
ATOM   9118  O  OD2   . ASP C 2  781  ? 26.743  19.205  -32.451  1.00 44.55  ?  785  ASP C OD2   1 
ATOM   9119  N  N     . GLU C 2  782  ? 25.773  21.630  -28.895  1.00 48.35  ?  786  GLU C N     1 
ATOM   9120  C  CA    . GLU C 2  782  ? 24.538  21.979  -28.203  1.00 48.25  ?  786  GLU C CA    1 
ATOM   9121  C  C     . GLU C 2  782  ? 23.429  20.951  -28.411  1.00 47.64  ?  786  GLU C C     1 
ATOM   9122  O  O     . GLU C 2  782  ? 22.514  20.881  -27.584  1.00 50.80  ?  786  GLU C O     1 
ATOM   9123  C  CB    . GLU C 2  782  ? 24.055  23.364  -28.640  1.00 51.35  ?  786  GLU C CB    1 
ATOM   9124  C  CG    . GLU C 2  782  ? 23.185  23.382  -29.886  1.00 51.82  ?  786  GLU C CG    1 
ATOM   9125  C  CD    . GLU C 2  782  ? 23.988  23.336  -31.164  1.00 49.29  ?  786  GLU C CD    1 
ATOM   9126  O  OE1   . GLU C 2  782  ? 25.232  23.326  -31.087  1.00 47.26  ?  786  GLU C OE1   1 
ATOM   9127  O  OE2   . GLU C 2  782  ? 23.376  23.314  -32.250  1.00 47.52  ?  786  GLU C OE2   1 
ATOM   9128  N  N     . ARG C 2  783  ? 23.477  20.157  -29.483  1.00 42.71  ?  787  ARG C N     1 
ATOM   9129  C  CA    . ARG C 2  783  ? 22.468  19.120  -29.670  1.00 44.72  ?  787  ARG C CA    1 
ATOM   9130  C  C     . ARG C 2  783  ? 22.733  17.877  -28.833  1.00 47.00  ?  787  ARG C C