data_6A08
# 
_entry.id   6A08 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6A08         
WWPDB D_1300007970 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6A08 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, T.L.'  1 ? 
'Lin, K.H.' 2 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? ? ? ? primary 'Acta Crystallogr D Struct Biol' ? ? 2059-7983 ? ? 75 ? 918 929 
;The flavin mononucleotide cofactor in alpha-hydroxyacid oxidases exerts its electrophilic/nucleophilic duality in control of the substrate-oxidation level.
;
2019 ? 10.1107/S2059798319011938 31588923 ? 
? ? ? ? ? ? ? ? ? ? 1       'Acta Crystallogr D Struct Biol' ? ? 2059-7983 ? ? 75 ? 733 742 
'Biochemical and structural explorations of alpha-hydroxyacid oxidases reveal a four-electron oxidative decarboxylation reaction.' 
2019 ? 10.1107/S2059798319009574 31373572 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lyu, S.Y.'   1  ?                   
primary 'Lin, K.H.'   2  ?                   
primary 'Yeh, H.W.'   3  ?                   
primary 'Li, Y.S.'    4  ?                   
primary 'Huang, C.M.' 5  ?                   
primary 'Wang, Y.L.'  6  ?                   
primary 'Shih, H.W.'  7  ?                   
primary 'Hsu, N.S.'   8  ?                   
primary 'Wu, C.J.'    9  0000-0002-5079-5839 
primary 'Li, T.L.'    10 ?                   
1       'Yeh, H.W.'   11 ?                   
1       'Lin, K.H.'   12 ?                   
1       'Lyu, S.Y.'   13 ?                   
1       'Li, Y.S.'    14 ?                   
1       'Huang, C.M.' 15 ?                   
1       'Wang, Y.L.'  16 ?                   
1       'Shih, H.W.'  17 ?                   
1       'Hsu, N.S.'   18 ?                   
1       'Wu, C.J.'    19 ?                   
1       'Li, T.L.'    20 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6A08 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     137.911 
_cell.length_a_esd                 ? 
_cell.length_b                     137.911 
_cell.length_b_esd                 ? 
_cell.length_c                     111.773 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6A08 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '4-hydroxymandelate oxidase' 40045.562 1   1.1.3.46 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'              24.305    1   ?        ? ? ? 
3 non-polymer syn 'FLAVIN MONONUCLEOTIDE'      456.344   1   ?        ? ? ? 
4 non-polymer syn 'BENZOYL-FORMIC ACID'        150.131   2   ?        ? ? ? 
5 water       nat water                        18.015    328 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMTYVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANRTALERVFVIPRMLRDLTDVTT
EIDIFGRRAALPMAVAPVAYQRLFHPEGELAVARAARDAGVPYTICTLSSVSLEEIAAVGGRPWFQLYWLRDEKRSLDLV
RRAEDAGCEAIVFTVDVPWMGRRLRDMRNGFALPEWVTAANFDAGTAAHRRTQGVSAVADHTAREFAPATWESVEAVRAH
TDLPVVLKGILAVEDARRAVDAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAVSGGCEVLVDGGIRSGGDVLKATALGA
SAVLVGRPVMWALAAAGQDGVRQLLELLAEEVRDAMGLAGCESVGAARRLNTKLGVV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMTYVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANRTALERVFVIPRMLRDLTDVTT
EIDIFGRRAALPMAVAPVAYQRLFHPEGELAVARAARDAGVPYTICTLSSVSLEEIAAVGGRPWFQLYWLRDEKRSLDLV
RRAEDAGCEAIVFTVDVPWMGRRLRDMRNGFALPEWVTAANFDAGTAAHRRTQGVSAVADHTAREFAPATWESVEAVRAH
TDLPVVLKGILAVEDARRAVDAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAVSGGCEVLVDGGIRSGGDVLKATALGA
SAVLVGRPVMWALAAAGQDGVRQLLELLAEEVRDAMGLAGCESVGAARRLNTKLGVV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  THR n 
1 23  TYR n 
1 24  VAL n 
1 25  SER n 
1 26  LEU n 
1 27  ALA n 
1 28  ASP n 
1 29  LEU n 
1 30  GLU n 
1 31  ARG n 
1 32  ALA n 
1 33  ALA n 
1 34  ARG n 
1 35  ASP n 
1 36  VAL n 
1 37  LEU n 
1 38  PRO n 
1 39  GLY n 
1 40  GLU n 
1 41  ILE n 
1 42  PHE n 
1 43  ASP n 
1 44  PHE n 
1 45  LEU n 
1 46  ALA n 
1 47  GLY n 
1 48  GLY n 
1 49  SER n 
1 50  GLY n 
1 51  THR n 
1 52  GLU n 
1 53  ALA n 
1 54  SER n 
1 55  LEU n 
1 56  VAL n 
1 57  ALA n 
1 58  ASN n 
1 59  ARG n 
1 60  THR n 
1 61  ALA n 
1 62  LEU n 
1 63  GLU n 
1 64  ARG n 
1 65  VAL n 
1 66  PHE n 
1 67  VAL n 
1 68  ILE n 
1 69  PRO n 
1 70  ARG n 
1 71  MET n 
1 72  LEU n 
1 73  ARG n 
1 74  ASP n 
1 75  LEU n 
1 76  THR n 
1 77  ASP n 
1 78  VAL n 
1 79  THR n 
1 80  THR n 
1 81  GLU n 
1 82  ILE n 
1 83  ASP n 
1 84  ILE n 
1 85  PHE n 
1 86  GLY n 
1 87  ARG n 
1 88  ARG n 
1 89  ALA n 
1 90  ALA n 
1 91  LEU n 
1 92  PRO n 
1 93  MET n 
1 94  ALA n 
1 95  VAL n 
1 96  ALA n 
1 97  PRO n 
1 98  VAL n 
1 99  ALA n 
1 100 TYR n 
1 101 GLN n 
1 102 ARG n 
1 103 LEU n 
1 104 PHE n 
1 105 HIS n 
1 106 PRO n 
1 107 GLU n 
1 108 GLY n 
1 109 GLU n 
1 110 LEU n 
1 111 ALA n 
1 112 VAL n 
1 113 ALA n 
1 114 ARG n 
1 115 ALA n 
1 116 ALA n 
1 117 ARG n 
1 118 ASP n 
1 119 ALA n 
1 120 GLY n 
1 121 VAL n 
1 122 PRO n 
1 123 TYR n 
1 124 THR n 
1 125 ILE n 
1 126 CYS n 
1 127 THR n 
1 128 LEU n 
1 129 SER n 
1 130 SER n 
1 131 VAL n 
1 132 SER n 
1 133 LEU n 
1 134 GLU n 
1 135 GLU n 
1 136 ILE n 
1 137 ALA n 
1 138 ALA n 
1 139 VAL n 
1 140 GLY n 
1 141 GLY n 
1 142 ARG n 
1 143 PRO n 
1 144 TRP n 
1 145 PHE n 
1 146 GLN n 
1 147 LEU n 
1 148 TYR n 
1 149 TRP n 
1 150 LEU n 
1 151 ARG n 
1 152 ASP n 
1 153 GLU n 
1 154 LYS n 
1 155 ARG n 
1 156 SER n 
1 157 LEU n 
1 158 ASP n 
1 159 LEU n 
1 160 VAL n 
1 161 ARG n 
1 162 ARG n 
1 163 ALA n 
1 164 GLU n 
1 165 ASP n 
1 166 ALA n 
1 167 GLY n 
1 168 CYS n 
1 169 GLU n 
1 170 ALA n 
1 171 ILE n 
1 172 VAL n 
1 173 PHE n 
1 174 THR n 
1 175 VAL n 
1 176 ASP n 
1 177 VAL n 
1 178 PRO n 
1 179 TRP n 
1 180 MET n 
1 181 GLY n 
1 182 ARG n 
1 183 ARG n 
1 184 LEU n 
1 185 ARG n 
1 186 ASP n 
1 187 MET n 
1 188 ARG n 
1 189 ASN n 
1 190 GLY n 
1 191 PHE n 
1 192 ALA n 
1 193 LEU n 
1 194 PRO n 
1 195 GLU n 
1 196 TRP n 
1 197 VAL n 
1 198 THR n 
1 199 ALA n 
1 200 ALA n 
1 201 ASN n 
1 202 PHE n 
1 203 ASP n 
1 204 ALA n 
1 205 GLY n 
1 206 THR n 
1 207 ALA n 
1 208 ALA n 
1 209 HIS n 
1 210 ARG n 
1 211 ARG n 
1 212 THR n 
1 213 GLN n 
1 214 GLY n 
1 215 VAL n 
1 216 SER n 
1 217 ALA n 
1 218 VAL n 
1 219 ALA n 
1 220 ASP n 
1 221 HIS n 
1 222 THR n 
1 223 ALA n 
1 224 ARG n 
1 225 GLU n 
1 226 PHE n 
1 227 ALA n 
1 228 PRO n 
1 229 ALA n 
1 230 THR n 
1 231 TRP n 
1 232 GLU n 
1 233 SER n 
1 234 VAL n 
1 235 GLU n 
1 236 ALA n 
1 237 VAL n 
1 238 ARG n 
1 239 ALA n 
1 240 HIS n 
1 241 THR n 
1 242 ASP n 
1 243 LEU n 
1 244 PRO n 
1 245 VAL n 
1 246 VAL n 
1 247 LEU n 
1 248 LYS n 
1 249 GLY n 
1 250 ILE n 
1 251 LEU n 
1 252 ALA n 
1 253 VAL n 
1 254 GLU n 
1 255 ASP n 
1 256 ALA n 
1 257 ARG n 
1 258 ARG n 
1 259 ALA n 
1 260 VAL n 
1 261 ASP n 
1 262 ALA n 
1 263 GLY n 
1 264 ALA n 
1 265 GLY n 
1 266 GLY n 
1 267 ILE n 
1 268 VAL n 
1 269 VAL n 
1 270 SER n 
1 271 ASN n 
1 272 HIS n 
1 273 GLY n 
1 274 GLY n 
1 275 ARG n 
1 276 GLN n 
1 277 LEU n 
1 278 ASP n 
1 279 GLY n 
1 280 ALA n 
1 281 VAL n 
1 282 PRO n 
1 283 GLY n 
1 284 ILE n 
1 285 GLU n 
1 286 MET n 
1 287 LEU n 
1 288 GLY n 
1 289 GLU n 
1 290 ILE n 
1 291 VAL n 
1 292 ALA n 
1 293 ALA n 
1 294 VAL n 
1 295 SER n 
1 296 GLY n 
1 297 GLY n 
1 298 CYS n 
1 299 GLU n 
1 300 VAL n 
1 301 LEU n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 GLY n 
1 306 ILE n 
1 307 ARG n 
1 308 SER n 
1 309 GLY n 
1 310 GLY n 
1 311 ASP n 
1 312 VAL n 
1 313 LEU n 
1 314 LYS n 
1 315 ALA n 
1 316 THR n 
1 317 ALA n 
1 318 LEU n 
1 319 GLY n 
1 320 ALA n 
1 321 SER n 
1 322 ALA n 
1 323 VAL n 
1 324 LEU n 
1 325 VAL n 
1 326 GLY n 
1 327 ARG n 
1 328 PRO n 
1 329 VAL n 
1 330 MET n 
1 331 TRP n 
1 332 ALA n 
1 333 LEU n 
1 334 ALA n 
1 335 ALA n 
1 336 ALA n 
1 337 GLY n 
1 338 GLN n 
1 339 ASP n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 GLN n 
1 344 LEU n 
1 345 LEU n 
1 346 GLU n 
1 347 LEU n 
1 348 LEU n 
1 349 ALA n 
1 350 GLU n 
1 351 GLU n 
1 352 VAL n 
1 353 ARG n 
1 354 ASP n 
1 355 ALA n 
1 356 MET n 
1 357 GLY n 
1 358 LEU n 
1 359 ALA n 
1 360 GLY n 
1 361 CYS n 
1 362 GLU n 
1 363 SER n 
1 364 VAL n 
1 365 GLY n 
1 366 ALA n 
1 367 ALA n 
1 368 ARG n 
1 369 ARG n 
1 370 LEU n 
1 371 ASN n 
1 372 THR n 
1 373 LYS n 
1 374 LEU n 
1 375 GLY n 
1 376 VAL n 
1 377 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   377 
_entity_src_gen.gene_src_common_name               'Nocardia orientalis' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 hmo 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Amycolatopsis orientalis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     31958 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HMO_AMYOR 
_struct_ref.pdbx_db_accession          O52792 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTYVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANRTALERVFVIPRMLRDLTDVTTEIDIFGRRAALPMAVAPVAY
QRLFHPEGELAVARAARDAGVPYTICTLSSVSLEEIAAVGGRPWFQLYWLRDEKRSLDLVRRAEDAGCEAIVFTVDVPWM
GRRLRDMRNGFALPEWVTAANFDAGTAAHRRTQGVSAVADHTAREFAPATWESVEAVRAHTDLPVVLKGILAVEDARRAV
DAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAVSGGCEVLVDGGIRSGGDVLKATALGASAVLVGRPVMWALAAAGQDG
VRQLLELLAEEVRDAMGLAGCESVGAARRLNTKLGVV
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6A08 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 21 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 377 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O52792 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  357 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       357 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6A08 MET A 1  ? UNP O52792 ? ? 'expression tag' -19 1  
1 6A08 GLY A 2  ? UNP O52792 ? ? 'expression tag' -18 2  
1 6A08 SER A 3  ? UNP O52792 ? ? 'expression tag' -17 3  
1 6A08 SER A 4  ? UNP O52792 ? ? 'expression tag' -16 4  
1 6A08 HIS A 5  ? UNP O52792 ? ? 'expression tag' -15 5  
1 6A08 HIS A 6  ? UNP O52792 ? ? 'expression tag' -14 6  
1 6A08 HIS A 7  ? UNP O52792 ? ? 'expression tag' -13 7  
1 6A08 HIS A 8  ? UNP O52792 ? ? 'expression tag' -12 8  
1 6A08 HIS A 9  ? UNP O52792 ? ? 'expression tag' -11 9  
1 6A08 HIS A 10 ? UNP O52792 ? ? 'expression tag' -10 10 
1 6A08 SER A 11 ? UNP O52792 ? ? 'expression tag' -9  11 
1 6A08 SER A 12 ? UNP O52792 ? ? 'expression tag' -8  12 
1 6A08 GLY A 13 ? UNP O52792 ? ? 'expression tag' -7  13 
1 6A08 LEU A 14 ? UNP O52792 ? ? 'expression tag' -6  14 
1 6A08 VAL A 15 ? UNP O52792 ? ? 'expression tag' -5  15 
1 6A08 PRO A 16 ? UNP O52792 ? ? 'expression tag' -4  16 
1 6A08 ARG A 17 ? UNP O52792 ? ? 'expression tag' -3  17 
1 6A08 GLY A 18 ? UNP O52792 ? ? 'expression tag' -2  18 
1 6A08 SER A 19 ? UNP O52792 ? ? 'expression tag' -1  19 
1 6A08 HIS A 20 ? UNP O52792 ? ? 'expression tag' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
173 non-polymer         . 'BENZOYL-FORMIC ACID'   'OXO(PHENYL)ACETIC ACID'   'C8 H6 O3'        150.131 
ALA 'L-peptide linking' y ALANINE                 ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                          'C3 H7 N O2 S'    121.158 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE               ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                 ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE               ?                          'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                   ?                          'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                  ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE              ?                          'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'         ?                          'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE           ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                 ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                  ?                          'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE               ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                  ?                          'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6A08 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '35% Tascimate, 0.1M Bis-Tris propane pH 7.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL15A1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL15A1 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6A08 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.547 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       78018 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.8 
_reflns.pdbx_Rmerge_I_obs                0.040 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            43.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.547 
_reflns_shell.d_res_low                   1.61 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           7718 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.791 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             11.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6A08 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.547 
_refine.ls_d_res_low                             29.343 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     75720 
_refine.ls_number_reflns_R_free                  3844 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.91 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1646 
_refine.ls_R_factor_R_free                       0.1861 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1641 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3SGZ 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.30 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.14 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2502 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             329 
_refine_hist.number_atoms_total               2885 
_refine_hist.d_res_high                       1.547 
_refine_hist.d_res_low                        29.343 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 2812 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.295  ? 3854 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.592 ? 1036 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.060  ? 438  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 513  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.5470 1.5857  . . 109 4039 75.00  . . . 0.2498 . 0.2182 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5857 1.6286  . . 124 4544 85.00  . . . 0.2397 . 0.2121 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6286 1.6765  . . 142 5236 98.00  . . . 0.2290 . 0.2070 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6765 1.7306  . . 145 5351 100.00 . . . 0.2260 . 0.1980 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7306 1.7925  . . 146 5370 100.00 . . . 0.2181 . 0.1898 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7925 1.8642  . . 146 5398 100.00 . . . 0.2203 . 0.1834 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8642 1.9491  . . 146 5378 100.00 . . . 0.2071 . 0.1789 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9491 2.0518  . . 147 5403 100.00 . . . 0.2012 . 0.1685 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0518 2.1803  . . 147 5403 100.00 . . . 0.1921 . 0.1640 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1803 2.3486  . . 147 5442 100.00 . . . 0.1753 . 0.1619 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3486 2.5848  . . 147 5441 100.00 . . . 0.1928 . 0.1682 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5848 2.9585  . . 150 5487 100.00 . . . 0.1787 . 0.1605 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9585 3.7262  . . 149 5511 100.00 . . . 0.1768 . 0.1440 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7262 29.3483 . . 155 5717 100.00 . . . 0.1445 . 0.1410 . . . . . . . . . . 
# 
_struct.entry_id                     6A08 
_struct.title                        'The crystal structure of Mandelate oxidase with benzoyl-formic acid' 
_struct.pdbx_descriptor              '4-hydroxymandelate oxidase (E.C.1.1.3.46)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6A08 
_struct_keywords.text            'FMN-dependent oxidase, FLAVOPROTEIN' 
_struct_keywords.pdbx_keywords   FLAVOPROTEIN 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 25  ? LEU A 37  ? SER A 5   LEU A 17  1 ? 13 
HELX_P HELX_P2  AA2 PRO A 38  ? GLY A 47  ? PRO A 18  GLY A 27  1 ? 10 
HELX_P HELX_P3  AA3 GLU A 52  ? ARG A 64  ? GLU A 32  ARG A 44  1 ? 13 
HELX_P HELX_P4  AA4 TYR A 100 ? PHE A 104 ? TYR A 80  PHE A 84  5 ? 5  
HELX_P HELX_P5  AA5 GLU A 107 ? GLY A 120 ? GLU A 87  GLY A 100 1 ? 14 
HELX_P HELX_P6  AA6 SER A 132 ? VAL A 139 ? SER A 112 VAL A 119 1 ? 8  
HELX_P HELX_P7  AA7 ASP A 152 ? ALA A 166 ? ASP A 132 ALA A 146 1 ? 15 
HELX_P HELX_P8  AA8 ARG A 183 ? GLY A 190 ? ARG A 163 GLY A 170 1 ? 8  
HELX_P HELX_P9  AA9 THR A 230 ? THR A 241 ? THR A 210 THR A 221 1 ? 12 
HELX_P HELX_P10 AB1 ALA A 252 ? ALA A 262 ? ALA A 232 ALA A 242 1 ? 11 
HELX_P HELX_P11 AB2 ASN A 271 ? ARG A 275 ? ASN A 251 ARG A 255 5 ? 5  
HELX_P HELX_P12 AB3 PRO A 282 ? SER A 295 ? PRO A 262 SER A 275 1 ? 14 
HELX_P HELX_P13 AB4 SER A 308 ? LEU A 318 ? SER A 288 LEU A 298 1 ? 11 
HELX_P HELX_P14 AB5 GLY A 326 ? ALA A 359 ? GLY A 306 ALA A 339 1 ? 34 
HELX_P HELX_P15 AB6 SER A 363 ? ARG A 369 ? SER A 343 ARG A 349 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A LEU 324 O  ? ? ? 1_555 B MG  . MG  ? ? A LEU 304 A MG  401 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc2 metalc ? ? B MG  .   MG ? ? ? 1_555 C FMN . O3P ? ? A MG  401 A FMN 402 1_555 ? ? ? ? ? ? ? 2.698 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? parallel      
AA3 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 65  ? ILE A 68  ? VAL A 45  ILE A 48  
AA1 2 ASN A 371 ? LEU A 374 ? ASN A 351 LEU A 354 
AA2 1 ILE A 82  ? ILE A 84  ? ILE A 62  ILE A 64  
AA2 2 ARG A 87  ? ALA A 89  ? ARG A 67  ALA A 69  
AA3 1 MET A 93  ? VAL A 95  ? MET A 73  VAL A 75  
AA3 2 ALA A 322 ? VAL A 325 ? ALA A 302 VAL A 305 
AA3 3 GLU A 299 ? VAL A 302 ? GLU A 279 VAL A 282 
AA3 4 GLY A 266 ? VAL A 269 ? GLY A 246 VAL A 249 
AA3 5 VAL A 245 ? ILE A 250 ? VAL A 225 ILE A 230 
AA3 6 ILE A 171 ? THR A 174 ? ILE A 151 THR A 154 
AA3 7 TRP A 144 ? LEU A 147 ? TRP A 124 LEU A 127 
AA3 8 THR A 124 ? ILE A 125 ? THR A 104 ILE A 105 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 68  ? N ILE A 48  O ASN A 371 ? O ASN A 351 
AA2 1 2 N ILE A 82  ? N ILE A 62  O ALA A 89  ? O ALA A 69  
AA3 1 2 N ALA A 94  ? N ALA A 74  O VAL A 323 ? O VAL A 303 
AA3 2 3 O LEU A 324 ? O LEU A 304 N VAL A 302 ? N VAL A 282 
AA3 3 4 O LEU A 301 ? O LEU A 281 N VAL A 269 ? N VAL A 249 
AA3 4 5 O VAL A 268 ? O VAL A 248 N LEU A 247 ? N LEU A 227 
AA3 5 6 O VAL A 246 ? O VAL A 226 N ILE A 171 ? N ILE A 151 
AA3 6 7 O VAL A 172 ? O VAL A 152 N PHE A 145 ? N PHE A 125 
AA3 7 8 O GLN A 146 ? O GLN A 126 N ILE A 125 ? N ILE A 105 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  401 ? 5  'binding site for residue MG A 401'  
AC2 Software A FMN 402 ? 21 'binding site for residue FMN A 402' 
AC3 Software A 173 403 ? 5  'binding site for residue 173 A 403' 
AC4 Software A 173 404 ? 9  'binding site for residue 173 A 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  GLY A 304 ? GLY A 284 . ? 1_555 ? 
2  AC1 5  GLY A 305 ? GLY A 285 . ? 1_555 ? 
3  AC1 5  ILE A 306 ? ILE A 286 . ? 1_555 ? 
4  AC1 5  LEU A 324 ? LEU A 304 . ? 1_555 ? 
5  AC1 5  FMN C .   ? FMN A 402 . ? 1_555 ? 
6  AC2 21 LEU A 45  ? LEU A 25  . ? 1_555 ? 
7  AC2 21 ALA A 96  ? ALA A 76  . ? 1_555 ? 
8  AC2 21 PRO A 97  ? PRO A 77  . ? 1_555 ? 
9  AC2 21 VAL A 98  ? VAL A 78  . ? 1_555 ? 
10 AC2 21 ALA A 99  ? ALA A 79  . ? 1_555 ? 
11 AC2 21 GLN A 146 ? GLN A 126 . ? 1_555 ? 
12 AC2 21 TYR A 148 ? TYR A 128 . ? 1_555 ? 
13 AC2 21 THR A 174 ? THR A 154 . ? 1_555 ? 
14 AC2 21 LYS A 248 ? LYS A 228 . ? 1_555 ? 
15 AC2 21 HIS A 272 ? HIS A 252 . ? 1_555 ? 
16 AC2 21 GLY A 273 ? GLY A 253 . ? 1_555 ? 
17 AC2 21 ARG A 275 ? ARG A 255 . ? 1_555 ? 
18 AC2 21 ASP A 303 ? ASP A 283 . ? 1_555 ? 
19 AC2 21 GLY A 305 ? GLY A 285 . ? 1_555 ? 
20 AC2 21 ARG A 307 ? ARG A 287 . ? 1_555 ? 
21 AC2 21 GLY A 326 ? GLY A 306 . ? 1_555 ? 
22 AC2 21 ARG A 327 ? ARG A 307 . ? 1_555 ? 
23 AC2 21 MG  B .   ? MG  A 401 . ? 1_555 ? 
24 AC2 21 173 E .   ? 173 A 404 . ? 1_555 ? 
25 AC2 21 HOH F .   ? HOH A 575 . ? 1_555 ? 
26 AC2 21 HOH F .   ? HOH A 610 . ? 1_555 ? 
27 AC3 5  VAL A 177 ? VAL A 157 . ? 1_555 ? 
28 AC3 5  TRP A 179 ? TRP A 159 . ? 1_555 ? 
29 AC3 5  MET A 180 ? MET A 160 . ? 1_555 ? 
30 AC3 5  PHE A 226 ? PHE A 206 . ? 1_555 ? 
31 AC3 5  HOH F .   ? HOH A 660 . ? 1_555 ? 
32 AC4 9  ALA A 99  ? ALA A 79  . ? 1_555 ? 
33 AC4 9  TYR A 100 ? TYR A 80  . ? 1_555 ? 
34 AC4 9  LEU A 128 ? LEU A 108 . ? 1_555 ? 
35 AC4 9  TYR A 148 ? TYR A 128 . ? 1_555 ? 
36 AC4 9  MET A 180 ? MET A 160 . ? 1_555 ? 
37 AC4 9  ARG A 183 ? ARG A 163 . ? 1_555 ? 
38 AC4 9  HIS A 272 ? HIS A 252 . ? 1_555 ? 
39 AC4 9  ARG A 275 ? ARG A 255 . ? 1_555 ? 
40 AC4 9  FMN C .   ? FMN A 402 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6A08 
_atom_sites.fract_transf_matrix[1][1]   0.007251 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007251 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008947 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 22  ? 15.541 -27.793 38.816 1.00 64.03 ? 2   THR A N     1 
ATOM   2    C  CA    . THR A 1 22  ? 14.164 -27.461 38.459 1.00 89.06 ? 2   THR A CA    1 
ATOM   3    C  C     . THR A 1 22  ? 14.072 -26.121 37.734 1.00 78.97 ? 2   THR A C     1 
ATOM   4    O  O     . THR A 1 22  ? 13.876 -25.075 38.357 1.00 84.51 ? 2   THR A O     1 
ATOM   5    C  CB    . THR A 1 22  ? 13.243 -27.413 39.701 1.00 96.66 ? 2   THR A CB    1 
ATOM   6    O  OG1   . THR A 1 22  ? 13.456 -28.575 40.514 1.00 93.66 ? 2   THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 22  ? 11.775 -27.343 39.286 1.00 85.83 ? 2   THR A CG2   1 
ATOM   8    N  N     . TYR A 1 23  ? 14.227 -26.158 36.416 1.00 47.56 ? 3   TYR A N     1 
ATOM   9    C  CA    . TYR A 1 23  ? 13.992 -24.985 35.590 1.00 46.01 ? 3   TYR A CA    1 
ATOM   10   C  C     . TYR A 1 23  ? 13.113 -25.382 34.416 1.00 42.71 ? 3   TYR A C     1 
ATOM   11   O  O     . TYR A 1 23  ? 13.431 -26.323 33.691 1.00 44.74 ? 3   TYR A O     1 
ATOM   12   C  CB    . TYR A 1 23  ? 15.307 -24.379 35.093 1.00 60.38 ? 3   TYR A CB    1 
ATOM   13   C  CG    . TYR A 1 23  ? 16.349 -24.153 36.170 1.00 68.88 ? 3   TYR A CG    1 
ATOM   14   C  CD1   . TYR A 1 23  ? 16.201 -23.134 37.105 1.00 46.45 ? 3   TYR A CD1   1 
ATOM   15   C  CD2   . TYR A 1 23  ? 17.498 -24.936 36.229 1.00 55.38 ? 3   TYR A CD2   1 
ATOM   16   C  CE1   . TYR A 1 23  ? 17.156 -22.915 38.086 1.00 58.32 ? 3   TYR A CE1   1 
ATOM   17   C  CE2   . TYR A 1 23  ? 18.461 -24.722 37.204 1.00 69.77 ? 3   TYR A CE2   1 
ATOM   18   C  CZ    . TYR A 1 23  ? 18.284 -23.709 38.131 1.00 69.08 ? 3   TYR A CZ    1 
ATOM   19   O  OH    . TYR A 1 23  ? 19.235 -23.488 39.105 1.00 50.47 ? 3   TYR A OH    1 
ATOM   20   N  N     . VAL A 1 24  ? 12.001 -24.675 34.232 1.00 30.76 ? 4   VAL A N     1 
ATOM   21   C  CA    . VAL A 1 24  ? 11.074 -25.005 33.148 1.00 42.32 ? 4   VAL A CA    1 
ATOM   22   C  C     . VAL A 1 24  ? 10.999 -23.865 32.133 1.00 31.17 ? 4   VAL A C     1 
ATOM   23   O  O     . VAL A 1 24  ? 10.317 -23.978 31.117 1.00 26.22 ? 4   VAL A O     1 
ATOM   24   C  CB    . VAL A 1 24  ? 9.642  -25.322 33.672 1.00 45.60 ? 4   VAL A CB    1 
ATOM   25   C  CG1   . VAL A 1 24  ? 9.652  -26.553 34.580 1.00 35.94 ? 4   VAL A CG1   1 
ATOM   26   C  CG2   . VAL A 1 24  ? 9.036  -24.116 34.381 1.00 34.20 ? 4   VAL A CG2   1 
ATOM   27   N  N     . SER A 1 25  ? 11.696 -22.768 32.424 1.00 34.58 ? 5   SER A N     1 
ATOM   28   C  CA    . SER A 1 25  ? 11.829 -21.653 31.486 1.00 27.80 ? 5   SER A CA    1 
ATOM   29   C  C     . SER A 1 25  ? 13.142 -20.907 31.745 1.00 42.99 ? 5   SER A C     1 
ATOM   30   O  O     . SER A 1 25  ? 13.763 -21.045 32.810 1.00 27.60 ? 5   SER A O     1 
ATOM   31   C  CB    . SER A 1 25  ? 10.643 -20.687 31.598 1.00 31.58 ? 5   SER A CB    1 
ATOM   32   O  OG    . SER A 1 25  ? 10.817 -19.770 32.668 1.00 33.33 ? 5   SER A OG    1 
ATOM   33   N  N     . LEU A 1 26  ? 13.566 -20.110 30.771 1.00 29.05 ? 6   LEU A N     1 
ATOM   34   C  CA    . LEU A 1 26  ? 14.803 -19.344 30.926 1.00 24.47 ? 6   LEU A CA    1 
ATOM   35   C  C     . LEU A 1 26  ? 14.646 -18.273 31.984 1.00 30.14 ? 6   LEU A C     1 
ATOM   36   O  O     . LEU A 1 26  ? 15.636 -17.808 32.540 1.00 34.00 ? 6   LEU A O     1 
ATOM   37   C  CB    . LEU A 1 26  ? 15.233 -18.711 29.604 1.00 30.16 ? 6   LEU A CB    1 
ATOM   38   C  CG    . LEU A 1 26  ? 16.184 -19.595 28.797 1.00 34.88 ? 6   LEU A CG    1 
ATOM   39   C  CD1   . LEU A 1 26  ? 15.573 -20.966 28.466 1.00 30.51 ? 6   LEU A CD1   1 
ATOM   40   C  CD2   . LEU A 1 26  ? 16.674 -18.878 27.537 1.00 32.10 ? 6   LEU A CD2   1 
ATOM   41   N  N     . ALA A 1 27  ? 13.402 -17.891 32.269 1.00 29.36 ? 7   ALA A N     1 
ATOM   42   C  CA    . ALA A 1 27  ? 13.125 -16.865 33.273 1.00 28.41 ? 7   ALA A CA    1 
ATOM   43   C  C     . ALA A 1 27  ? 13.412 -17.367 34.685 1.00 28.03 ? 7   ALA A C     1 
ATOM   44   O  O     . ALA A 1 27  ? 13.774 -16.581 35.562 1.00 37.41 ? 7   ALA A O     1 
ATOM   45   C  CB    . ALA A 1 27  ? 11.677 -16.383 33.164 1.00 35.98 ? 7   ALA A CB    1 
ATOM   46   N  N     . ASP A 1 28  ? 13.252 -18.668 34.909 1.00 35.02 ? 8   ASP A N     1 
ATOM   47   C  CA    . ASP A 1 28  ? 13.619 -19.257 36.202 1.00 30.82 ? 8   ASP A CA    1 
ATOM   48   C  C     . ASP A 1 28  ? 15.081 -18.973 36.550 1.00 54.39 ? 8   ASP A C     1 
ATOM   49   O  O     . ASP A 1 28  ? 15.438 -18.769 37.711 1.00 37.86 ? 8   ASP A O     1 
ATOM   50   C  CB    . ASP A 1 28  ? 13.396 -20.771 36.194 1.00 48.32 ? 8   ASP A CB    1 
ATOM   51   C  CG    . ASP A 1 28  ? 11.940 -21.149 36.046 1.00 47.64 ? 8   ASP A CG    1 
ATOM   52   O  OD1   . ASP A 1 28  ? 11.069 -20.288 36.291 1.00 48.37 ? 8   ASP A OD1   1 
ATOM   53   O  OD2   . ASP A 1 28  ? 11.671 -22.318 35.697 1.00 38.92 ? 8   ASP A OD2   1 
ATOM   54   N  N     . LEU A 1 29  ? 15.935 -18.978 35.534 1.00 49.64 ? 9   LEU A N     1 
ATOM   55   C  CA    . LEU A 1 29  ? 17.364 -18.823 35.770 1.00 33.39 ? 9   LEU A CA    1 
ATOM   56   C  C     . LEU A 1 29  ? 17.732 -17.370 36.061 1.00 27.70 ? 9   LEU A C     1 
ATOM   57   O  O     . LEU A 1 29  ? 18.667 -17.110 36.818 1.00 28.04 ? 9   LEU A O     1 
ATOM   58   C  CB    . LEU A 1 29  ? 18.157 -19.353 34.575 1.00 25.82 ? 9   LEU A CB    1 
ATOM   59   C  CG    . LEU A 1 29  ? 18.081 -20.875 34.400 1.00 29.93 ? 9   LEU A CG    1 
ATOM   60   C  CD1   . LEU A 1 29  ? 18.317 -21.277 32.957 1.00 37.19 ? 9   LEU A CD1   1 
ATOM   61   C  CD2   . LEU A 1 29  ? 19.076 -21.564 35.309 1.00 29.55 ? 9   LEU A CD2   1 
ATOM   62   N  N     A GLU A 1 30  ? 17.017 -16.412 35.465 0.70 28.33 ? 10  GLU A N     1 
ATOM   63   N  N     B GLU A 1 30  ? 16.990 -16.446 35.461 0.30 28.19 ? 10  GLU A N     1 
ATOM   64   C  CA    A GLU A 1 30  ? 17.328 -15.009 35.746 0.70 23.45 ? 10  GLU A CA    1 
ATOM   65   C  CA    B GLU A 1 30  ? 17.199 -15.023 35.678 0.30 23.74 ? 10  GLU A CA    1 
ATOM   66   C  C     A GLU A 1 30  ? 17.077 -14.722 37.221 0.70 33.79 ? 10  GLU A C     1 
ATOM   67   C  C     B GLU A 1 30  ? 17.010 -14.671 37.152 0.30 33.72 ? 10  GLU A C     1 
ATOM   68   O  O     A GLU A 1 30  ? 17.880 -14.047 37.870 0.70 28.75 ? 10  GLU A O     1 
ATOM   69   O  O     B GLU A 1 30  ? 17.784 -13.904 37.727 0.30 27.90 ? 10  GLU A O     1 
ATOM   70   C  CB    A GLU A 1 30  ? 16.515 -14.036 34.872 0.70 25.16 ? 10  GLU A CB    1 
ATOM   71   C  CB    B GLU A 1 30  ? 16.241 -14.216 34.797 0.30 27.19 ? 10  GLU A CB    1 
ATOM   72   C  CG    A GLU A 1 30  ? 16.991 -12.576 35.001 0.70 27.02 ? 10  GLU A CG    1 
ATOM   73   C  CG    B GLU A 1 30  ? 16.490 -12.720 34.780 0.30 25.09 ? 10  GLU A CG    1 
ATOM   74   C  CD    A GLU A 1 30  ? 16.144 -11.565 34.229 0.70 46.54 ? 10  GLU A CD    1 
ATOM   75   C  CD    B GLU A 1 30  ? 15.842 -12.000 35.945 0.30 29.98 ? 10  GLU A CD    1 
ATOM   76   O  OE1   A GLU A 1 30  ? 15.022 -11.917 33.806 0.70 44.36 ? 10  GLU A OE1   1 
ATOM   77   O  OE1   B GLU A 1 30  ? 14.918 -12.572 36.566 0.30 27.97 ? 10  GLU A OE1   1 
ATOM   78   O  OE2   A GLU A 1 30  ? 16.601 -10.408 34.050 0.70 36.36 ? 10  GLU A OE2   1 
ATOM   79   O  OE2   B GLU A 1 30  ? 16.261 -10.862 36.238 0.30 30.91 ? 10  GLU A OE2   1 
ATOM   80   N  N     . ARG A 1 31  ? 15.971 -15.242 37.751 1.00 35.15 ? 11  ARG A N     1 
ATOM   81   C  CA    . ARG A 1 31  ? 15.649 -15.014 39.157 1.00 44.25 ? 11  ARG A CA    1 
ATOM   82   C  C     . ARG A 1 31  ? 16.763 -15.580 40.024 1.00 30.00 ? 11  ARG A C     1 
ATOM   83   O  O     . ARG A 1 31  ? 17.241 -14.924 40.946 1.00 30.95 ? 11  ARG A O     1 
ATOM   84   C  CB    . ARG A 1 31  ? 14.296 -15.643 39.520 1.00 41.68 ? 11  ARG A CB    1 
ATOM   85   C  CG    . ARG A 1 31  ? 13.117 -15.051 38.751 1.00 55.86 ? 11  ARG A CG    1 
ATOM   86   C  CD    . ARG A 1 31  ? 11.774 -15.652 39.184 1.00 64.22 ? 11  ARG A CD    1 
ATOM   87   N  NE    . ARG A 1 31  ? 10.965 -16.037 38.029 1.00 66.69 ? 11  ARG A NE    1 
ATOM   88   C  CZ    . ARG A 1 31  ? 10.645 -17.287 37.708 1.00 88.66 ? 11  ARG A CZ    1 
ATOM   89   N  NH1   . ARG A 1 31  ? 11.049 -18.299 38.470 1.00 81.34 ? 11  ARG A NH1   1 
ATOM   90   N  NH2   . ARG A 1 31  ? 9.910  -17.522 36.624 1.00 68.37 ? 11  ARG A NH2   1 
ATOM   91   N  N     . ALA A 1 32  ? 17.201 -16.788 39.688 1.00 34.76 ? 12  ALA A N     1 
ATOM   92   C  CA    . ALA A 1 32  ? 18.280 -17.441 40.415 1.00 31.52 ? 12  ALA A CA    1 
ATOM   93   C  C     . ALA A 1 32  ? 19.582 -16.636 40.349 1.00 43.19 ? 12  ALA A C     1 
ATOM   94   O  O     . ALA A 1 32  ? 20.285 -16.501 41.344 1.00 29.43 ? 12  ALA A O     1 
ATOM   95   C  CB    . ALA A 1 32  ? 18.495 -18.843 39.876 1.00 33.86 ? 12  ALA A CB    1 
ATOM   96   N  N     . ALA A 1 33  ? 19.909 -16.091 39.182 1.00 28.75 ? 13  ALA A N     1 
ATOM   97   C  CA    . ALA A 1 33  ? 21.136 -15.312 39.068 1.00 24.56 ? 13  ALA A CA    1 
ATOM   98   C  C     . ALA A 1 33  ? 21.064 -13.975 39.817 1.00 24.69 ? 13  ALA A C     1 
ATOM   99   O  O     . ALA A 1 33  ? 22.068 -13.508 40.350 1.00 23.73 ? 13  ALA A O     1 
ATOM   100  C  CB    . ALA A 1 33  ? 21.481 -15.071 37.593 1.00 22.13 ? 13  ALA A CB    1 
ATOM   101  N  N     A ARG A 1 34  ? 19.857 -13.415 39.837 0.50 28.27 ? 14  ARG A N     1 
ATOM   102  N  N     B ARG A 1 34  ? 19.915 -13.306 39.851 0.50 28.31 ? 14  ARG A N     1 
ATOM   103  C  CA    A ARG A 1 34  ? 19.520 -12.214 40.589 0.50 24.98 ? 14  ARG A CA    1 
ATOM   104  C  CA    B ARG A 1 34  ? 19.910 -11.981 40.486 0.50 26.57 ? 14  ARG A CA    1 
ATOM   105  C  C     A ARG A 1 34  ? 19.797 -12.430 42.076 0.50 31.95 ? 14  ARG A C     1 
ATOM   106  C  C     B ARG A 1 34  ? 20.149 -12.098 41.990 0.50 35.52 ? 14  ARG A C     1 
ATOM   107  O  O     A ARG A 1 34  ? 20.356 -11.562 42.745 0.50 28.55 ? 14  ARG A O     1 
ATOM   108  O  O     B ARG A 1 34  ? 20.727 -11.203 42.613 0.50 34.77 ? 14  ARG A O     1 
ATOM   109  C  CB    A ARG A 1 34  ? 18.046 -11.854 40.353 0.50 26.26 ? 14  ARG A CB    1 
ATOM   110  C  CB    B ARG A 1 34  ? 18.604 -11.219 40.232 0.50 28.36 ? 14  ARG A CB    1 
ATOM   111  C  CG    A ARG A 1 34  ? 17.617 -10.471 40.815 0.50 31.54 ? 14  ARG A CG    1 
ATOM   112  C  CG    B ARG A 1 34  ? 18.691 -9.742  40.654 0.50 27.55 ? 14  ARG A CG    1 
ATOM   113  C  CD    A ARG A 1 34  ? 16.125 -10.239 40.545 0.50 41.11 ? 14  ARG A CD    1 
ATOM   114  C  CD    B ARG A 1 34  ? 17.334 -9.039  40.678 0.50 35.02 ? 14  ARG A CD    1 
ATOM   115  N  NE    A ARG A 1 34  ? 15.828 -10.023 39.127 0.50 37.43 ? 14  ARG A NE    1 
ATOM   116  N  NE    B ARG A 1 34  ? 16.599 -9.201  39.426 0.50 33.38 ? 14  ARG A NE    1 
ATOM   117  C  CZ    A ARG A 1 34  ? 14.995 -10.768 38.406 0.50 42.48 ? 14  ARG A CZ    1 
ATOM   118  C  CZ    B ARG A 1 34  ? 16.342 -8.217  38.571 0.50 33.25 ? 14  ARG A CZ    1 
ATOM   119  N  NH1   A ARG A 1 34  ? 14.357 -11.792 38.961 0.50 34.95 ? 14  ARG A NH1   1 
ATOM   120  N  NH1   B ARG A 1 34  ? 16.756 -6.985  38.832 0.50 43.01 ? 14  ARG A NH1   1 
ATOM   121  N  NH2   A ARG A 1 34  ? 14.793 -10.485 37.125 0.50 47.65 ? 14  ARG A NH2   1 
ATOM   122  N  NH2   B ARG A 1 34  ? 15.668 -8.465  37.454 0.50 30.73 ? 14  ARG A NH2   1 
ATOM   123  N  N     A ASP A 1 35  ? 19.403 -13.597 42.577 0.50 29.76 ? 15  ASP A N     1 
ATOM   124  N  N     B ASP A 1 35  ? 19.715 -13.212 42.566 0.50 30.69 ? 15  ASP A N     1 
ATOM   125  C  CA    A ASP A 1 35  ? 19.683 -14.002 43.959 0.50 33.15 ? 15  ASP A CA    1 
ATOM   126  C  CA    B ASP A 1 35  ? 19.854 -13.422 44.002 0.50 30.89 ? 15  ASP A CA    1 
ATOM   127  C  C     A ASP A 1 35  ? 21.158 -13.883 44.335 0.50 39.03 ? 15  ASP A C     1 
ATOM   128  C  C     B ASP A 1 35  ? 21.267 -13.836 44.408 0.50 39.21 ? 15  ASP A C     1 
ATOM   129  O  O     A ASP A 1 35  ? 21.522 -13.213 45.302 0.50 39.14 ? 15  ASP A O     1 
ATOM   130  O  O     B ASP A 1 35  ? 21.705 -13.514 45.513 0.50 38.60 ? 15  ASP A O     1 
ATOM   131  C  CB    A ASP A 1 35  ? 19.238 -15.453 44.180 0.50 29.72 ? 15  ASP A CB    1 
ATOM   132  C  CB    B ASP A 1 35  ? 18.839 -14.456 44.485 0.50 33.11 ? 15  ASP A CB    1 
ATOM   133  C  CG    A ASP A 1 35  ? 17.870 -15.559 44.811 0.50 44.99 ? 15  ASP A CG    1 
ATOM   134  C  CG    B ASP A 1 35  ? 17.420 -13.923 44.458 0.50 36.48 ? 15  ASP A CG    1 
ATOM   135  O  OD1   A ASP A 1 35  ? 17.641 -14.898 45.846 0.50 50.39 ? 15  ASP A OD1   1 
ATOM   136  O  OD1   B ASP A 1 35  ? 17.248 -12.698 44.639 0.50 49.20 ? 15  ASP A OD1   1 
ATOM   137  O  OD2   A ASP A 1 35  ? 17.027 -16.312 44.275 0.50 37.39 ? 15  ASP A OD2   1 
ATOM   138  O  OD2   B ASP A 1 35  ? 16.481 -14.721 44.253 0.50 37.36 ? 15  ASP A OD2   1 
ATOM   139  N  N     . VAL A 1 36  ? 21.997 -14.534 43.539 1.00 27.08 ? 16  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 36  ? 23.389 -14.824 43.887 1.00 27.86 ? 16  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 36  ? 24.377 -13.706 43.544 1.00 34.10 ? 16  VAL A C     1 
ATOM   142  O  O     . VAL A 1 36  ? 25.288 -13.435 44.314 1.00 29.51 ? 16  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 36  ? 23.870 -16.149 43.225 1.00 35.07 ? 16  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 36  ? 23.777 -16.079 41.717 1.00 39.71 ? 16  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 36  ? 25.289 -16.483 43.659 1.00 43.49 ? 16  VAL A CG2   1 
ATOM   146  N  N     . LEU A 1 37  ? 24.206 -13.035 42.408 1.00 25.10 ? 17  LEU A N     1 
ATOM   147  C  CA    . LEU A 1 37  ? 25.213 -12.065 41.995 1.00 22.56 ? 17  LEU A CA    1 
ATOM   148  C  C     . LEU A 1 37  ? 25.171 -10.777 42.800 1.00 20.20 ? 17  LEU A C     1 
ATOM   149  O  O     . LEU A 1 37  ? 24.094 -10.299 43.163 1.00 28.62 ? 17  LEU A O     1 
ATOM   150  C  CB    . LEU A 1 37  ? 25.050 -11.723 40.504 1.00 21.96 ? 17  LEU A CB    1 
ATOM   151  C  CG    . LEU A 1 37  ? 25.348 -12.831 39.497 1.00 23.05 ? 17  LEU A CG    1 
ATOM   152  C  CD1   . LEU A 1 37  ? 24.908 -12.373 38.104 1.00 20.66 ? 17  LEU A CD1   1 
ATOM   153  C  CD2   . LEU A 1 37  ? 26.829 -13.213 39.507 1.00 20.28 ? 17  LEU A CD2   1 
ATOM   154  N  N     . PRO A 1 38  ? 26.348 -10.194 43.044 1.00 20.31 ? 18  PRO A N     1 
ATOM   155  C  CA    . PRO A 1 38  ? 26.409 -8.817  43.533 1.00 26.34 ? 18  PRO A CA    1 
ATOM   156  C  C     . PRO A 1 38  ? 25.628 -7.912  42.588 1.00 46.49 ? 18  PRO A C     1 
ATOM   157  O  O     . PRO A 1 38  ? 25.643 -8.132  41.373 1.00 26.42 ? 18  PRO A O     1 
ATOM   158  C  CB    . PRO A 1 38  ? 27.899 -8.487  43.493 1.00 24.86 ? 18  PRO A CB    1 
ATOM   159  C  CG    . PRO A 1 38  ? 28.584 -9.811  43.542 1.00 34.58 ? 18  PRO A CG    1 
ATOM   160  C  CD    . PRO A 1 38  ? 27.686 -10.772 42.832 1.00 27.59 ? 18  PRO A CD    1 
ATOM   161  N  N     . GLY A 1 39  ? 24.958 -6.910  43.135 1.00 26.95 ? 19  GLY A N     1 
ATOM   162  C  CA    . GLY A 1 39  ? 24.119 -6.041  42.337 1.00 26.53 ? 19  GLY A CA    1 
ATOM   163  C  C     . GLY A 1 39  ? 24.801 -5.397  41.148 1.00 27.54 ? 19  GLY A C     1 
ATOM   164  O  O     . GLY A 1 39  ? 24.223 -5.352  40.054 1.00 26.94 ? 19  GLY A O     1 
ATOM   165  N  N     A GLU A 1 40  ? 26.017 -4.906  41.361 0.50 24.74 ? 20  GLU A N     1 
ATOM   166  N  N     B GLU A 1 40  ? 26.028 -4.909  41.315 0.50 24.65 ? 20  GLU A N     1 
ATOM   167  C  CA    A GLU A 1 40  ? 26.716 -4.176  40.321 0.50 22.61 ? 20  GLU A CA    1 
ATOM   168  C  CA    B GLU A 1 40  ? 26.657 -4.153  40.230 0.50 23.08 ? 20  GLU A CA    1 
ATOM   169  C  C     A GLU A 1 40  ? 27.038 -5.116  39.167 0.50 25.91 ? 20  GLU A C     1 
ATOM   170  C  C     B GLU A 1 40  ? 27.268 -5.079  39.174 0.50 28.18 ? 20  GLU A C     1 
ATOM   171  O  O     A GLU A 1 40  ? 26.981 -4.715  38.007 0.50 15.49 ? 20  GLU A O     1 
ATOM   172  O  O     B GLU A 1 40  ? 27.647 -4.631  38.082 0.50 19.03 ? 20  GLU A O     1 
ATOM   173  C  CB    A GLU A 1 40  ? 27.987 -3.508  40.862 0.50 27.72 ? 20  GLU A CB    1 
ATOM   174  C  CB    B GLU A 1 40  ? 27.705 -3.172  40.774 0.50 25.77 ? 20  GLU A CB    1 
ATOM   175  C  CG    A GLU A 1 40  ? 29.078 -4.455  41.353 0.50 33.89 ? 20  GLU A CG    1 
ATOM   176  C  CG    B GLU A 1 40  ? 29.029 -3.773  41.202 0.50 32.36 ? 20  GLU A CG    1 
ATOM   177  C  CD    A GLU A 1 40  ? 28.853 -4.966  42.773 0.50 35.97 ? 20  GLU A CD    1 
ATOM   178  C  CD    B GLU A 1 40  ? 29.863 -2.802  42.029 0.50 49.03 ? 20  GLU A CD    1 
ATOM   179  O  OE1   A GLU A 1 40  ? 29.706 -5.745  43.249 0.50 33.86 ? 20  GLU A OE1   1 
ATOM   180  O  OE1   B GLU A 1 40  ? 30.113 -1.665  41.562 0.50 41.36 ? 20  GLU A OE1   1 
ATOM   181  O  OE2   A GLU A 1 40  ? 27.839 -4.598  43.409 0.50 25.81 ? 20  GLU A OE2   1 
ATOM   182  O  OE2   B GLU A 1 40  ? 30.264 -3.177  43.152 0.50 48.16 ? 20  GLU A OE2   1 
ATOM   183  N  N     . ILE A 1 41  ? 27.352 -6.368  39.488 1.00 21.09 ? 21  ILE A N     1 
ATOM   184  C  CA    . ILE A 1 41  ? 27.675 -7.366  38.461 1.00 17.56 ? 21  ILE A CA    1 
ATOM   185  C  C     . ILE A 1 41  ? 26.406 -7.788  37.726 1.00 24.09 ? 21  ILE A C     1 
ATOM   186  O  O     . ILE A 1 41  ? 26.422 -7.930  36.502 1.00 18.99 ? 21  ILE A O     1 
ATOM   187  C  CB    . ILE A 1 41  ? 28.382 -8.600  39.053 1.00 18.22 ? 21  ILE A CB    1 
ATOM   188  C  CG1   . ILE A 1 41  ? 29.780 -8.196  39.503 1.00 20.46 ? 21  ILE A CG1   1 
ATOM   189  C  CG2   . ILE A 1 41  ? 28.509 -9.703  38.010 1.00 17.73 ? 21  ILE A CG2   1 
ATOM   190  C  CD1   . ILE A 1 41  ? 30.589 -9.354  40.057 1.00 27.32 ? 21  ILE A CD1   1 
ATOM   191  N  N     . PHE A 1 42  ? 25.305 -7.975  38.449 1.00 19.32 ? 22  PHE A N     1 
ATOM   192  C  CA    . PHE A 1 42  ? 24.039 -8.219  37.765 1.00 19.62 ? 22  PHE A CA    1 
ATOM   193  C  C     . PHE A 1 42  ? 23.716 -7.060  36.817 1.00 22.47 ? 22  PHE A C     1 
ATOM   194  O  O     . PHE A 1 42  ? 23.206 -7.293  35.719 1.00 18.74 ? 22  PHE A O     1 
ATOM   195  C  CB    . PHE A 1 42  ? 22.874 -8.420  38.737 1.00 18.50 ? 22  PHE A CB    1 
ATOM   196  C  CG    . PHE A 1 42  ? 21.601 -8.836  38.051 1.00 21.97 ? 22  PHE A CG    1 
ATOM   197  C  CD1   . PHE A 1 42  ? 21.360 -10.170 37.752 1.00 26.34 ? 22  PHE A CD1   1 
ATOM   198  C  CD2   . PHE A 1 42  ? 20.659 -7.885  37.670 1.00 23.91 ? 22  PHE A CD2   1 
ATOM   199  C  CE1   . PHE A 1 42  ? 20.197 -10.560 37.097 1.00 29.12 ? 22  PHE A CE1   1 
ATOM   200  C  CE2   . PHE A 1 42  ? 19.496 -8.266  37.009 1.00 24.98 ? 22  PHE A CE2   1 
ATOM   201  C  CZ    . PHE A 1 42  ? 19.261 -9.602  36.726 1.00 28.17 ? 22  PHE A CZ    1 
ATOM   202  N  N     . ASP A 1 43  ? 24.006 -5.826  37.232 1.00 18.78 ? 23  ASP A N     1 
ATOM   203  C  CA    . ASP A 1 43  ? 23.715 -4.669  36.369 1.00 17.82 ? 23  ASP A CA    1 
ATOM   204  C  C     . ASP A 1 43  ? 24.611 -4.616  35.136 1.00 17.57 ? 23  ASP A C     1 
ATOM   205  O  O     . ASP A 1 43  ? 24.137 -4.238  34.058 1.00 15.48 ? 23  ASP A O     1 
ATOM   206  C  CB    . ASP A 1 43  ? 23.841 -3.351  37.134 1.00 17.55 ? 23  ASP A CB    1 
ATOM   207  C  CG    . ASP A 1 43  ? 22.597 -3.012  37.928 1.00 18.91 ? 23  ASP A CG    1 
ATOM   208  O  OD1   . ASP A 1 43  ? 21.503 -3.537  37.625 1.00 20.82 ? 23  ASP A OD1   1 
ATOM   209  O  OD2   . ASP A 1 43  ? 22.722 -2.177  38.859 1.00 27.17 ? 23  ASP A OD2   1 
ATOM   210  N  N     . PHE A 1 44  ? 25.890 -4.967  35.284 1.00 14.47 ? 24  PHE A N     1 
ATOM   211  C  CA    . PHE A 1 44  ? 26.809 -5.048  34.153 1.00 14.52 ? 24  PHE A CA    1 
ATOM   212  C  C     . PHE A 1 44  ? 26.265 -6.024  33.117 1.00 18.28 ? 24  PHE A C     1 
ATOM   213  O  O     . PHE A 1 44  ? 26.311 -5.762  31.912 1.00 16.71 ? 24  PHE A O     1 
ATOM   214  C  CB    . PHE A 1 44  ? 28.205 -5.495  34.606 1.00 17.21 ? 24  PHE A CB    1 
ATOM   215  C  CG    . PHE A 1 44  ? 29.150 -5.762  33.479 1.00 17.78 ? 24  PHE A CG    1 
ATOM   216  C  CD1   . PHE A 1 44  ? 29.598 -4.726  32.668 1.00 15.57 ? 24  PHE A CD1   1 
ATOM   217  C  CD2   . PHE A 1 44  ? 29.601 -7.049  33.225 1.00 14.20 ? 24  PHE A CD2   1 
ATOM   218  C  CE1   . PHE A 1 44  ? 30.474 -4.967  31.621 1.00 20.70 ? 24  PHE A CE1   1 
ATOM   219  C  CE2   . PHE A 1 44  ? 30.488 -7.300  32.181 1.00 15.83 ? 24  PHE A CE2   1 
ATOM   220  C  CZ    . PHE A 1 44  ? 30.921 -6.255  31.373 1.00 18.14 ? 24  PHE A CZ    1 
ATOM   221  N  N     . LEU A 1 45  ? 25.763 -7.155  33.600 1.00 15.70 ? 25  LEU A N     1 
ATOM   222  C  CA    . LEU A 1 45  ? 25.187 -8.186  32.735 1.00 12.80 ? 25  LEU A CA    1 
ATOM   223  C  C     . LEU A 1 45  ? 23.864 -7.763  32.099 1.00 18.96 ? 25  LEU A C     1 
ATOM   224  O  O     . LEU A 1 45  ? 23.686 -7.918  30.888 1.00 13.31 ? 25  LEU A O     1 
ATOM   225  C  CB    . LEU A 1 45  ? 24.975 -9.486  33.531 1.00 13.14 ? 25  LEU A CB    1 
ATOM   226  C  CG    . LEU A 1 45  ? 24.352 -10.672 32.779 1.00 13.31 ? 25  LEU A CG    1 
ATOM   227  C  CD1   . LEU A 1 45  ? 25.187 -11.074 31.565 1.00 11.37 ? 25  LEU A CD1   1 
ATOM   228  C  CD2   . LEU A 1 45  ? 24.177 -11.871 33.744 1.00 16.38 ? 25  LEU A CD2   1 
ATOM   229  N  N     . ALA A 1 46  ? 22.947 -7.234  32.905 1.00 12.40 ? 26  ALA A N     1 
ATOM   230  C  CA    . ALA A 1 46  ? 21.580 -6.965  32.448 1.00 13.90 ? 26  ALA A CA    1 
ATOM   231  C  C     . ALA A 1 46  ? 21.450 -5.703  31.621 1.00 13.90 ? 26  ALA A C     1 
ATOM   232  O  O     . ALA A 1 46  ? 20.588 -5.631  30.749 1.00 14.27 ? 26  ALA A O     1 
ATOM   233  C  CB    . ALA A 1 46  ? 20.636 -6.867  33.630 1.00 16.23 ? 26  ALA A CB    1 
ATOM   234  N  N     . GLY A 1 47  ? 22.292 -4.718  31.905 1.00 12.53 ? 27  GLY A N     1 
ATOM   235  C  CA    . GLY A 1 47  ? 22.103 -3.382  31.369 1.00 14.17 ? 27  GLY A CA    1 
ATOM   236  C  C     . GLY A 1 47  ? 22.291 -3.180  29.874 1.00 14.65 ? 27  GLY A C     1 
ATOM   237  O  O     . GLY A 1 47  ? 22.838 -4.026  29.144 1.00 12.20 ? 27  GLY A O     1 
ATOM   238  N  N     . GLY A 1 48  ? 21.819 -2.019  29.426 1.00 13.26 ? 28  GLY A N     1 
ATOM   239  C  CA    . GLY A 1 48  ? 22.048 -1.540  28.070 1.00 12.39 ? 28  GLY A CA    1 
ATOM   240  C  C     . GLY A 1 48  ? 22.579 -0.122  28.115 1.00 13.42 ? 28  GLY A C     1 
ATOM   241  O  O     . GLY A 1 48  ? 22.844 0.437   29.200 1.00 14.24 ? 28  GLY A O     1 
ATOM   242  N  N     . SER A 1 49  ? 22.741 0.484   26.945 1.00 10.81 ? 29  SER A N     1 
ATOM   243  C  CA    . SER A 1 49  ? 23.220 1.856   26.873 1.00 10.89 ? 29  SER A CA    1 
ATOM   244  C  C     . SER A 1 49  ? 22.070 2.854   26.986 1.00 15.24 ? 29  SER A C     1 
ATOM   245  O  O     . SER A 1 49  ? 20.907 2.521   26.769 1.00 12.31 ? 29  SER A O     1 
ATOM   246  C  CB    . SER A 1 49  ? 23.981 2.070   25.565 1.00 13.88 ? 29  SER A CB    1 
ATOM   247  O  OG    . SER A 1 49  ? 23.102 1.848   24.484 1.00 14.55 ? 29  SER A OG    1 
ATOM   248  N  N     . GLY A 1 50  ? 22.411 4.086   27.350 1.00 16.22 ? 30  GLY A N     1 
ATOM   249  C  CA    . GLY A 1 50  ? 21.431 5.158   27.376 1.00 16.13 ? 30  GLY A CA    1 
ATOM   250  C  C     . GLY A 1 50  ? 20.187 4.858   28.193 1.00 13.19 ? 30  GLY A C     1 
ATOM   251  O  O     . GLY A 1 50  ? 20.267 4.434   29.344 1.00 17.85 ? 30  GLY A O     1 
ATOM   252  N  N     . THR A 1 51  ? 19.020 5.051   27.580 1.00 11.83 ? 31  THR A N     1 
ATOM   253  C  CA    . THR A 1 51  ? 17.754 4.789   28.260 1.00 10.15 ? 31  THR A CA    1 
ATOM   254  C  C     . THR A 1 51  ? 17.305 3.330   28.193 1.00 12.53 ? 31  THR A C     1 
ATOM   255  O  O     . THR A 1 51  ? 16.221 3.000   28.651 1.00 15.27 ? 31  THR A O     1 
ATOM   256  C  CB    . THR A 1 51  ? 16.602 5.626   27.659 1.00 16.26 ? 31  THR A CB    1 
ATOM   257  O  OG1   . THR A 1 51  ? 16.351 5.166   26.326 1.00 19.29 ? 31  THR A OG1   1 
ATOM   258  C  CG2   . THR A 1 51  ? 16.955 7.113   27.630 1.00 17.90 ? 31  THR A CG2   1 
ATOM   259  N  N     . GLU A 1 52  ? 18.141 2.483   27.596 1.00 12.22 ? 32  GLU A N     1 
ATOM   260  C  CA    . GLU A 1 52  ? 17.871 1.054   27.395 1.00 11.47 ? 32  GLU A CA    1 
ATOM   261  C  C     . GLU A 1 52  ? 16.678 0.817   26.470 1.00 11.66 ? 32  GLU A C     1 
ATOM   262  O  O     . GLU A 1 52  ? 16.022 -0.219  26.510 1.00 13.22 ? 32  GLU A O     1 
ATOM   263  C  CB    . GLU A 1 52  ? 17.702 0.338   28.753 1.00 12.88 ? 32  GLU A CB    1 
ATOM   264  C  CG    . GLU A 1 52  ? 19.003 0.429   29.546 1.00 15.48 ? 32  GLU A CG    1 
ATOM   265  C  CD    . GLU A 1 52  ? 19.026 -0.385  30.840 1.00 18.90 ? 32  GLU A CD    1 
ATOM   266  O  OE1   . GLU A 1 52  ? 17.949 -0.748  31.370 1.00 18.46 ? 32  GLU A OE1   1 
ATOM   267  O  OE2   . GLU A 1 52  ? 20.157 -0.631  31.326 1.00 18.03 ? 32  GLU A OE2   1 
ATOM   268  N  N     . ALA A 1 53  ? 16.432 1.775   25.579 1.00 11.67 ? 33  ALA A N     1 
ATOM   269  C  CA    . ALA A 1 53  ? 15.371 1.598   24.584 1.00 9.46  ? 33  ALA A CA    1 
ATOM   270  C  C     . ALA A 1 53  ? 15.619 0.413   23.652 1.00 9.12  ? 33  ALA A C     1 
ATOM   271  O  O     . ALA A 1 53  ? 14.667 -0.291  23.294 1.00 11.17 ? 33  ALA A O     1 
ATOM   272  C  CB    . ALA A 1 53  ? 15.215 2.862   23.757 1.00 13.03 ? 33  ALA A CB    1 
ATOM   273  N  N     . SER A 1 54  ? 16.874 0.208   23.242 1.00 8.73  ? 34  SER A N     1 
ATOM   274  C  CA    . SER A 1 54  ? 17.161 -0.869  22.296 1.00 8.48  ? 34  SER A CA    1 
ATOM   275  C  C     . SER A 1 54  ? 17.151 -2.225  22.991 1.00 12.24 ? 34  SER A C     1 
ATOM   276  O  O     . SER A 1 54  ? 16.778 -3.234  22.390 1.00 12.90 ? 34  SER A O     1 
ATOM   277  C  CB    . SER A 1 54  ? 18.497 -0.629  21.599 1.00 11.04 ? 34  SER A CB    1 
ATOM   278  O  OG    . SER A 1 54  ? 18.362 0.446   20.678 1.00 9.84  ? 34  SER A OG    1 
ATOM   279  N  N     . LEU A 1 55  ? 17.536 -2.222  24.265 1.00 9.50  ? 35  LEU A N     1 
ATOM   280  C  CA    . LEU A 1 55  ? 17.463 -3.421  25.099 1.00 10.58 ? 35  LEU A CA    1 
ATOM   281  C  C     . LEU A 1 55  ? 16.016 -3.910  25.207 1.00 11.56 ? 35  LEU A C     1 
ATOM   282  O  O     . LEU A 1 55  ? 15.706 -5.087  24.937 1.00 13.03 ? 35  LEU A O     1 
ATOM   283  C  CB    . LEU A 1 55  ? 18.039 -3.108  26.492 1.00 9.93  ? 35  LEU A CB    1 
ATOM   284  C  CG    . LEU A 1 55  ? 17.874 -4.221  27.530 1.00 12.60 ? 35  LEU A CG    1 
ATOM   285  C  CD1   . LEU A 1 55  ? 18.708 -5.424  27.109 1.00 14.83 ? 35  LEU A CD1   1 
ATOM   286  C  CD2   . LEU A 1 55  ? 18.259 -3.719  28.933 1.00 15.77 ? 35  LEU A CD2   1 
ATOM   287  N  N     . VAL A 1 56  ? 15.115 -3.000  25.571 1.00 10.45 ? 36  VAL A N     1 
ATOM   288  C  CA    . VAL A 1 56  ? 13.699 -3.352  25.690 1.00 9.98  ? 36  VAL A CA    1 
ATOM   289  C  C     . VAL A 1 56  ? 13.108 -3.722  24.332 1.00 10.18 ? 36  VAL A C     1 
ATOM   290  O  O     . VAL A 1 56  ? 12.340 -4.680  24.206 1.00 11.55 ? 36  VAL A O     1 
ATOM   291  C  CB    . VAL A 1 56  ? 12.914 -2.200  26.328 1.00 14.84 ? 36  VAL A CB    1 
ATOM   292  C  CG1   . VAL A 1 56  ? 11.411 -2.447  26.229 1.00 19.18 ? 36  VAL A CG1   1 
ATOM   293  C  CG2   . VAL A 1 56  ? 13.336 -2.071  27.778 1.00 17.54 ? 36  VAL A CG2   1 
ATOM   294  N  N     . ALA A 1 57  ? 13.506 -2.985  23.289 1.00 8.56  ? 37  ALA A N     1 
ATOM   295  C  CA    . ALA A 1 57  ? 12.957 -3.263  21.967 1.00 9.69  ? 37  ALA A CA    1 
ATOM   296  C  C     . ALA A 1 57  ? 13.309 -4.648  21.424 1.00 10.31 ? 37  ALA A C     1 
ATOM   297  O  O     . ALA A 1 57  ? 12.554 -5.211  20.633 1.00 9.51  ? 37  ALA A O     1 
ATOM   298  C  CB    . ALA A 1 57  ? 13.406 -2.177  20.980 1.00 10.74 ? 37  ALA A CB    1 
ATOM   299  N  N     . ASN A 1 58  ? 14.443 -5.214  21.838 1.00 9.26  ? 38  ASN A N     1 
ATOM   300  C  CA    . ASN A 1 58  ? 14.750 -6.575  21.393 1.00 7.44  ? 38  ASN A CA    1 
ATOM   301  C  C     . ASN A 1 58  ? 13.658 -7.544  21.828 1.00 7.66  ? 38  ASN A C     1 
ATOM   302  O  O     . ASN A 1 58  ? 13.252 -8.430  21.088 1.00 10.92 ? 38  ASN A O     1 
ATOM   303  C  CB    . ASN A 1 58  ? 16.113 -7.031  21.933 1.00 10.01 ? 38  ASN A CB    1 
ATOM   304  C  CG    . ASN A 1 58  ? 17.262 -6.316  21.255 1.00 12.24 ? 38  ASN A CG    1 
ATOM   305  O  OD1   . ASN A 1 58  ? 17.069 -5.697  20.205 1.00 11.01 ? 38  ASN A OD1   1 
ATOM   306  N  ND2   . ASN A 1 58  ? 18.457 -6.396  21.831 1.00 8.65  ? 38  ASN A ND2   1 
ATOM   307  N  N     . ARG A 1 59  ? 13.173 -7.354  23.047 1.00 9.18  ? 39  ARG A N     1 
ATOM   308  C  CA    . ARG A 1 59  ? 12.094 -8.217  23.520 1.00 8.24  ? 39  ARG A CA    1 
ATOM   309  C  C     . ARG A 1 59  ? 10.758 -7.872  22.901 1.00 9.95  ? 39  ARG A C     1 
ATOM   310  O  O     . ARG A 1 59  ? 10.017 -8.766  22.485 1.00 11.57 ? 39  ARG A O     1 
ATOM   311  C  CB    . ARG A 1 59  ? 12.009 -8.175  25.054 1.00 12.98 ? 39  ARG A CB    1 
ATOM   312  C  CG    . ARG A 1 59  ? 13.125 -8.973  25.746 1.00 16.03 ? 39  ARG A CG    1 
ATOM   313  C  CD    . ARG A 1 59  ? 13.093 -10.485 25.343 1.00 19.39 ? 39  ARG A CD    1 
ATOM   314  N  NE    . ARG A 1 59  ? 11.785 -11.079 25.603 1.00 20.78 ? 39  ARG A NE    1 
ATOM   315  C  CZ    . ARG A 1 59  ? 11.358 -12.235 25.102 1.00 27.47 ? 39  ARG A CZ    1 
ATOM   316  N  NH1   . ARG A 1 59  ? 12.141 -12.954 24.307 1.00 20.57 ? 39  ARG A NH1   1 
ATOM   317  N  NH2   . ARG A 1 59  ? 10.140 -12.677 25.402 1.00 24.97 ? 39  ARG A NH2   1 
ATOM   318  N  N     A THR A 1 60  ? 10.451 -6.579  22.826 0.50 9.35  ? 40  THR A N     1 
ATOM   319  N  N     B THR A 1 60  ? 10.434 -6.589  22.795 0.50 9.37  ? 40  THR A N     1 
ATOM   320  C  CA    A THR A 1 60  ? 9.190  -6.135  22.236 0.50 10.78 ? 40  THR A CA    1 
ATOM   321  C  CA    B THR A 1 60  ? 9.114  -6.240  22.274 0.50 11.10 ? 40  THR A CA    1 
ATOM   322  C  C     A THR A 1 60  ? 9.040  -6.686  20.828 0.50 11.12 ? 40  THR A C     1 
ATOM   323  C  C     B THR A 1 60  ? 8.995  -6.580  20.783 0.50 11.17 ? 40  THR A C     1 
ATOM   324  O  O     A THR A 1 60  ? 7.991  -7.225  20.451 0.50 11.40 ? 40  THR A O     1 
ATOM   325  O  O     B THR A 1 60  ? 7.901  -6.894  20.297 0.50 15.38 ? 40  THR A O     1 
ATOM   326  C  CB    A THR A 1 60  ? 9.083  -4.598  22.185 0.50 11.47 ? 40  THR A CB    1 
ATOM   327  C  CB    B THR A 1 60  ? 8.769  -4.751  22.526 0.50 11.28 ? 40  THR A CB    1 
ATOM   328  O  OG1   A THR A 1 60  ? 9.247  -4.052  23.497 0.50 13.14 ? 40  THR A OG1   1 
ATOM   329  O  OG1   B THR A 1 60  ? 9.736  -3.905  21.901 0.50 17.00 ? 40  THR A OG1   1 
ATOM   330  C  CG2   A THR A 1 60  ? 7.722  -4.196  21.649 0.50 12.33 ? 40  THR A CG2   1 
ATOM   331  C  CG2   B THR A 1 60  ? 8.729  -4.460  24.015 0.50 13.01 ? 40  THR A CG2   1 
ATOM   332  N  N     . ALA A 1 61  ? 10.111 -6.579  20.056 1.00 10.82 ? 41  ALA A N     1 
ATOM   333  C  CA    . ALA A 1 61  ? 10.064 -6.948  18.654 1.00 13.16 ? 41  ALA A CA    1 
ATOM   334  C  C     . ALA A 1 61  ? 9.780  -8.447  18.500 1.00 12.50 ? 41  ALA A C     1 
ATOM   335  O  O     . ALA A 1 61  ? 8.975  -8.847  17.658 1.00 14.07 ? 41  ALA A O     1 
ATOM   336  C  CB    . ALA A 1 61  ? 11.353 -6.564  17.974 1.00 17.69 ? 41  ALA A CB    1 
ATOM   337  N  N     . LEU A 1 62  ? 10.396 -9.278  19.333 1.00 10.42 ? 42  LEU A N     1 
ATOM   338  C  CA    . LEU A 1 62  ? 10.135 -10.716 19.283 1.00 12.14 ? 42  LEU A CA    1 
ATOM   339  C  C     . LEU A 1 62  ? 8.717  -11.043 19.685 1.00 12.16 ? 42  LEU A C     1 
ATOM   340  O  O     . LEU A 1 62  ? 8.073  -11.924 19.093 1.00 12.26 ? 42  LEU A O     1 
ATOM   341  C  CB    . LEU A 1 62  ? 11.095 -11.486 20.196 1.00 16.97 ? 42  LEU A CB    1 
ATOM   342  C  CG    . LEU A 1 62  ? 12.392 -11.959 19.572 1.00 17.15 ? 42  LEU A CG    1 
ATOM   343  C  CD1   . LEU A 1 62  ? 13.311 -12.450 20.694 1.00 15.87 ? 42  LEU A CD1   1 
ATOM   344  C  CD2   . LEU A 1 62  ? 12.111 -13.066 18.567 1.00 13.18 ? 42  LEU A CD2   1 
ATOM   345  N  N     . GLU A 1 63  ? 8.221  -10.333 20.691 1.00 10.20 ? 43  GLU A N     1 
ATOM   346  C  CA    . GLU A 1 63  ? 6.874  -10.606 21.176 1.00 10.81 ? 43  GLU A CA    1 
ATOM   347  C  C     . GLU A 1 63  ? 5.785  -10.229 20.178 1.00 12.54 ? 43  GLU A C     1 
ATOM   348  O  O     . GLU A 1 63  ? 4.657  -10.749 20.273 1.00 17.31 ? 43  GLU A O     1 
ATOM   349  C  CB    . GLU A 1 63  ? 6.674  -9.900  22.519 1.00 12.52 ? 43  GLU A CB    1 
ATOM   350  C  CG    . GLU A 1 63  ? 7.568  -10.551 23.551 1.00 15.06 ? 43  GLU A CG    1 
ATOM   351  C  CD    . GLU A 1 63  ? 7.567  -9.850  24.896 1.00 53.58 ? 43  GLU A CD    1 
ATOM   352  O  OE1   . GLU A 1 63  ? 6.984  -8.749  24.990 1.00 36.98 ? 43  GLU A OE1   1 
ATOM   353  O  OE2   . GLU A 1 63  ? 8.159  -10.409 25.855 1.00 31.95 ? 43  GLU A OE2   1 
ATOM   354  N  N     . ARG A 1 64  ? 6.108  -9.370  19.207 1.00 11.13 ? 44  ARG A N     1 
ATOM   355  C  CA    . ARG A 1 64  ? 5.149  -8.972  18.184 1.00 11.59 ? 44  ARG A CA    1 
ATOM   356  C  C     . ARG A 1 64  ? 5.036  -10.004 17.068 1.00 10.55 ? 44  ARG A C     1 
ATOM   357  O  O     . ARG A 1 64  ? 4.119  -9.939  16.269 1.00 13.85 ? 44  ARG A O     1 
ATOM   358  C  CB    . ARG A 1 64  ? 5.541  -7.627  17.553 1.00 18.39 ? 44  ARG A CB    1 
ATOM   359  C  CG    . ARG A 1 64  ? 5.234  -6.417  18.390 1.00 32.89 ? 44  ARG A CG    1 
ATOM   360  C  CD    . ARG A 1 64  ? 5.198  -5.176  17.500 1.00 50.35 ? 44  ARG A CD    1 
ATOM   361  N  NE    . ARG A 1 64  ? 6.398  -5.051  16.676 1.00 62.23 ? 44  ARG A NE    1 
ATOM   362  C  CZ    . ARG A 1 64  ? 6.409  -4.605  15.422 1.00 78.01 ? 44  ARG A CZ    1 
ATOM   363  N  NH1   . ARG A 1 64  ? 7.557  -4.530  14.757 1.00 73.38 ? 44  ARG A NH1   1 
ATOM   364  N  NH2   . ARG A 1 64  ? 5.279  -4.233  14.829 1.00 38.36 ? 44  ARG A NH2   1 
ATOM   365  N  N     . VAL A 1 65  ? 6.000  -10.922 16.991 1.00 9.71  ? 45  VAL A N     1 
ATOM   366  C  CA    . VAL A 1 65  ? 6.064  -11.904 15.913 1.00 10.18 ? 45  VAL A CA    1 
ATOM   367  C  C     . VAL A 1 65  ? 5.249  -13.136 16.279 1.00 9.19  ? 45  VAL A C     1 
ATOM   368  O  O     . VAL A 1 65  ? 5.443  -13.692 17.362 1.00 13.10 ? 45  VAL A O     1 
ATOM   369  C  CB    . VAL A 1 65  ? 7.520  -12.357 15.651 1.00 9.06  ? 45  VAL A CB    1 
ATOM   370  C  CG1   . VAL A 1 65  ? 7.548  -13.439 14.559 1.00 11.90 ? 45  VAL A CG1   1 
ATOM   371  C  CG2   . VAL A 1 65  ? 8.362  -11.184 15.212 1.00 13.60 ? 45  VAL A CG2   1 
ATOM   372  N  N     . PHE A 1 66  ? 4.325  -13.543 15.413 1.00 8.01  ? 46  PHE A N     1 
ATOM   373  C  CA    . PHE A 1 66  ? 3.603  -14.805 15.626 1.00 9.69  ? 46  PHE A CA    1 
ATOM   374  C  C     . PHE A 1 66  ? 3.898  -15.730 14.483 1.00 8.72  ? 46  PHE A C     1 
ATOM   375  O  O     . PHE A 1 66  ? 4.060  -15.292 13.336 1.00 10.60 ? 46  PHE A O     1 
ATOM   376  C  CB    . PHE A 1 66  ? 2.089  -14.564 15.767 1.00 8.13  ? 46  PHE A CB    1 
ATOM   377  C  CG    . PHE A 1 66  ? 1.738  -13.857 17.044 1.00 10.92 ? 46  PHE A CG    1 
ATOM   378  C  CD1   . PHE A 1 66  ? 1.913  -12.482 17.162 1.00 16.32 ? 46  PHE A CD1   1 
ATOM   379  C  CD2   . PHE A 1 66  ? 1.332  -14.584 18.146 1.00 10.72 ? 46  PHE A CD2   1 
ATOM   380  C  CE1   . PHE A 1 66  ? 1.629  -11.832 18.356 1.00 17.09 ? 46  PHE A CE1   1 
ATOM   381  C  CE2   . PHE A 1 66  ? 1.040  -13.938 19.350 1.00 13.64 ? 46  PHE A CE2   1 
ATOM   382  C  CZ    . PHE A 1 66  ? 1.201  -12.568 19.458 1.00 14.63 ? 46  PHE A CZ    1 
ATOM   383  N  N     . VAL A 1 67  ? 4.034  -17.012 14.802 1.00 7.25  ? 47  VAL A N     1 
ATOM   384  C  CA    . VAL A 1 67  ? 4.283  -18.030 13.788 1.00 7.41  ? 47  VAL A CA    1 
ATOM   385  C  C     . VAL A 1 67  ? 2.981  -18.602 13.242 1.00 7.90  ? 47  VAL A C     1 
ATOM   386  O  O     . VAL A 1 67  ? 2.011  -18.768 13.996 1.00 8.87  ? 47  VAL A O     1 
ATOM   387  C  CB    . VAL A 1 67  ? 5.145  -19.173 14.376 1.00 8.81  ? 47  VAL A CB    1 
ATOM   388  C  CG1   . VAL A 1 67  ? 5.287  -20.323 13.400 1.00 10.10 ? 47  VAL A CG1   1 
ATOM   389  C  CG2   . VAL A 1 67  ? 6.529  -18.611 14.718 1.00 13.22 ? 47  VAL A CG2   1 
ATOM   390  N  N     . ILE A 1 68  ? 2.939  -18.892 11.941 1.00 6.76  ? 48  ILE A N     1 
ATOM   391  C  CA    . ILE A 1 68  ? 1.814  -19.626 11.360 1.00 7.70  ? 48  ILE A CA    1 
ATOM   392  C  C     . ILE A 1 68  ? 2.248  -21.093 11.203 1.00 8.03  ? 48  ILE A C     1 
ATOM   393  O  O     . ILE A 1 68  ? 2.950  -21.464 10.253 1.00 8.63  ? 48  ILE A O     1 
ATOM   394  C  CB    . ILE A 1 68  ? 1.393  -19.027 9.999  1.00 7.27  ? 48  ILE A CB    1 
ATOM   395  C  CG1   . ILE A 1 68  ? 1.149  -17.509 10.140 1.00 7.64  ? 48  ILE A CG1   1 
ATOM   396  C  CG2   . ILE A 1 68  ? 0.153  -19.781 9.459  1.00 8.61  ? 48  ILE A CG2   1 
ATOM   397  C  CD1   . ILE A 1 68  ? 0.895  -16.797 8.772  1.00 9.11  ? 48  ILE A CD1   1 
ATOM   398  N  N     . PRO A 1 69  ? 1.870  -21.951 12.169 1.00 6.98  ? 49  PRO A N     1 
ATOM   399  C  CA    . PRO A 1 69  ? 2.351  -23.341 12.118 1.00 7.42  ? 49  PRO A CA    1 
ATOM   400  C  C     . PRO A 1 69  ? 1.677  -24.164 11.036 1.00 7.29  ? 49  PRO A C     1 
ATOM   401  O  O     . PRO A 1 69  ? 0.535  -23.882 10.655 1.00 8.55  ? 49  PRO A O     1 
ATOM   402  C  CB    . PRO A 1 69  ? 1.990  -23.874 13.509 1.00 7.83  ? 49  PRO A CB    1 
ATOM   403  C  CG    . PRO A 1 69  ? 0.733  -23.091 13.874 1.00 8.12  ? 49  PRO A CG    1 
ATOM   404  C  CD    . PRO A 1 69  ? 0.970  -21.702 13.317 1.00 7.99  ? 49  PRO A CD    1 
ATOM   405  N  N     . ARG A 1 70  ? 2.370  -25.191 10.562 1.00 7.62  ? 50  ARG A N     1 
ATOM   406  C  CA    . ARG A 1 70  ? 1.798  -26.140 9.627  1.00 7.47  ? 50  ARG A CA    1 
ATOM   407  C  C     . ARG A 1 70  ? 1.444  -27.431 10.356 1.00 8.24  ? 50  ARG A C     1 
ATOM   408  O  O     . ARG A 1 70  ? 2.107  -27.796 11.346 1.00 9.84  ? 50  ARG A O     1 
ATOM   409  C  CB    . ARG A 1 70  ? 2.783  -26.463 8.484  1.00 10.57 ? 50  ARG A CB    1 
ATOM   410  C  CG    . ARG A 1 70  ? 3.262  -25.242 7.699  1.00 14.32 ? 50  ARG A CG    1 
ATOM   411  C  CD    . ARG A 1 70  ? 2.153  -24.601 6.910  1.00 17.11 ? 50  ARG A CD    1 
ATOM   412  N  NE    . ARG A 1 70  ? 1.531  -25.547 5.992  1.00 19.06 ? 50  ARG A NE    1 
ATOM   413  C  CZ    . ARG A 1 70  ? 1.738  -25.578 4.681  1.00 41.94 ? 50  ARG A CZ    1 
ATOM   414  N  NH1   . ARG A 1 70  ? 2.562  -24.703 4.109  1.00 38.91 ? 50  ARG A NH1   1 
ATOM   415  N  NH2   . ARG A 1 70  ? 1.105  -26.483 3.945  1.00 26.91 ? 50  ARG A NH2   1 
ATOM   416  N  N     . MET A 1 71  ? 0.426  -28.116 9.857  1.00 7.01  ? 51  MET A N     1 
ATOM   417  C  CA    . MET A 1 71  ? -0.087 -29.328 10.494 1.00 8.98  ? 51  MET A CA    1 
ATOM   418  C  C     . MET A 1 71  ? 0.070  -30.565 9.619  1.00 8.41  ? 51  MET A C     1 
ATOM   419  O  O     . MET A 1 71  ? 0.194  -30.483 8.391  1.00 9.81  ? 51  MET A O     1 
ATOM   420  C  CB    . MET A 1 71  ? -1.582 -29.157 10.829 1.00 10.05 ? 51  MET A CB    1 
ATOM   421  C  CG    . MET A 1 71  ? -1.868 -27.887 11.630 1.00 10.11 ? 51  MET A CG    1 
ATOM   422  S  SD    . MET A 1 71  ? -1.015 -27.901 13.215 1.00 12.00 ? 51  MET A SD    1 
ATOM   423  C  CE    . MET A 1 71  ? -0.991 -26.146 13.577 1.00 12.36 ? 51  MET A CE    1 
ATOM   424  N  N     . LEU A 1 72  ? 0.040  -31.720 10.283 1.00 7.84  ? 52  LEU A N     1 
ATOM   425  C  CA    . LEU A 1 72  ? -0.165 -33.010 9.621  1.00 8.98  ? 52  LEU A CA    1 
ATOM   426  C  C     . LEU A 1 72  ? 1.029  -33.439 8.770  1.00 10.01 ? 52  LEU A C     1 
ATOM   427  O  O     . LEU A 1 72  ? 0.896  -34.248 7.854  1.00 11.70 ? 52  LEU A O     1 
ATOM   428  C  CB    . LEU A 1 72  ? -1.452 -32.983 8.781  1.00 9.99  ? 52  LEU A CB    1 
ATOM   429  C  CG    . LEU A 1 72  ? -2.711 -32.804 9.659  1.00 8.23  ? 52  LEU A CG    1 
ATOM   430  C  CD1   . LEU A 1 72  ? -3.918 -32.528 8.765  1.00 13.48 ? 52  LEU A CD1   1 
ATOM   431  C  CD2   . LEU A 1 72  ? -2.945 -34.066 10.493 1.00 12.09 ? 52  LEU A CD2   1 
ATOM   432  N  N     A ARG A 1 73  ? 2.194  -32.901 9.123  0.50 10.08 ? 53  ARG A N     1 
ATOM   433  N  N     B ARG A 1 73  ? 2.207  -32.906 9.078  0.50 10.21 ? 53  ARG A N     1 
ATOM   434  C  CA    A ARG A 1 73  ? 3.451  -33.254 8.470  0.50 10.44 ? 53  ARG A CA    1 
ATOM   435  C  CA    B ARG A 1 73  ? 3.403  -33.298 8.331  0.50 10.41 ? 53  ARG A CA    1 
ATOM   436  C  C     A ARG A 1 73  ? 4.069  -34.517 9.074  0.50 11.56 ? 53  ARG A C     1 
ATOM   437  C  C     B ARG A 1 73  ? 4.190  -34.375 9.085  0.50 12.60 ? 53  ARG A C     1 
ATOM   438  O  O     A ARG A 1 73  ? 3.741  -34.914 10.193 0.50 13.13 ? 53  ARG A O     1 
ATOM   439  O  O     B ARG A 1 73  ? 4.084  -34.510 10.307 0.50 14.86 ? 53  ARG A O     1 
ATOM   440  C  CB    A ARG A 1 73  ? 4.435  -32.088 8.575  0.50 8.27  ? 53  ARG A CB    1 
ATOM   441  C  CB    B ARG A 1 73  ? 4.268  -32.071 8.048  0.50 13.89 ? 53  ARG A CB    1 
ATOM   442  C  CG    A ARG A 1 73  ? 3.974  -30.802 7.903  0.50 13.92 ? 53  ARG A CG    1 
ATOM   443  C  CG    B ARG A 1 73  ? 3.562  -31.036 7.172  0.50 8.59  ? 53  ARG A CG    1 
ATOM   444  C  CD    A ARG A 1 73  ? 5.193  -30.196 7.213  0.50 36.20 ? 53  ARG A CD    1 
ATOM   445  C  CD    B ARG A 1 73  ? 4.299  -29.709 7.201  0.50 28.28 ? 53  ARG A CD    1 
ATOM   446  N  NE    A ARG A 1 73  ? 5.051  -28.820 6.751  0.50 39.89 ? 53  ARG A NE    1 
ATOM   447  N  NE    B ARG A 1 73  ? 5.656  -29.865 6.691  0.50 35.73 ? 53  ARG A NE    1 
ATOM   448  C  CZ    A ARG A 1 73  ? 5.145  -28.473 5.472  0.50 22.90 ? 53  ARG A CZ    1 
ATOM   449  C  CZ    B ARG A 1 73  ? 6.570  -28.903 6.670  0.50 34.79 ? 53  ARG A CZ    1 
ATOM   450  N  NH1   A ARG A 1 73  ? 5.349  -29.409 4.571  0.50 22.26 ? 53  ARG A NH1   1 
ATOM   451  N  NH1   B ARG A 1 73  ? 6.280  -27.689 7.138  0.50 19.09 ? 53  ARG A NH1   1 
ATOM   452  N  NH2   A ARG A 1 73  ? 5.021  -27.208 5.097  0.50 30.69 ? 53  ARG A NH2   1 
ATOM   453  N  NH2   B ARG A 1 73  ? 7.774  -29.164 6.179  0.50 22.06 ? 53  ARG A NH2   1 
ATOM   454  N  N     . ASP A 1 74  ? 4.983  -35.141 8.337  1.00 12.85 ? 54  ASP A N     1 
ATOM   455  C  CA    . ASP A 1 74  ? 5.719  -36.275 8.887  1.00 13.70 ? 54  ASP A CA    1 
ATOM   456  C  C     . ASP A 1 74  ? 6.752  -35.807 9.898  1.00 16.28 ? 54  ASP A C     1 
ATOM   457  O  O     . ASP A 1 74  ? 7.641  -35.029 9.561  1.00 16.79 ? 54  ASP A O     1 
ATOM   458  C  CB    . ASP A 1 74  ? 6.385  -37.051 7.751  1.00 17.25 ? 54  ASP A CB    1 
ATOM   459  C  CG    . ASP A 1 74  ? 7.144  -38.279 8.237  1.00 26.29 ? 54  ASP A CG    1 
ATOM   460  O  OD1   . ASP A 1 74  ? 6.982  -38.683 9.414  1.00 23.20 ? 54  ASP A OD1   1 
ATOM   461  O  OD2   . ASP A 1 74  ? 7.889  -38.851 7.411  1.00 41.31 ? 54  ASP A OD2   1 
ATOM   462  N  N     . LEU A 1 75  ? 6.628  -36.267 11.135 1.00 13.89 ? 55  LEU A N     1 
ATOM   463  C  CA    . LEU A 1 75  ? 7.544  -35.873 12.200 1.00 13.38 ? 55  LEU A CA    1 
ATOM   464  C  C     . LEU A 1 75  ? 8.257  -37.090 12.766 1.00 23.00 ? 55  LEU A C     1 
ATOM   465  O  O     . LEU A 1 75  ? 8.630  -37.106 13.941 1.00 25.74 ? 55  LEU A O     1 
ATOM   466  C  CB    . LEU A 1 75  ? 6.794  -35.164 13.327 1.00 14.94 ? 55  LEU A CB    1 
ATOM   467  C  CG    . LEU A 1 75  ? 6.133  -33.831 12.963 1.00 13.93 ? 55  LEU A CG    1 
ATOM   468  C  CD1   . LEU A 1 75  ? 5.295  -33.341 14.157 1.00 14.65 ? 55  LEU A CD1   1 
ATOM   469  C  CD2   . LEU A 1 75  ? 7.175  -32.776 12.584 1.00 13.90 ? 55  LEU A CD2   1 
ATOM   470  N  N     A THR A 1 76  ? 8.455  -38.116 11.947 0.50 17.08 ? 56  THR A N     1 
ATOM   471  N  N     B THR A 1 76  ? 8.411  -38.115 11.937 0.50 16.87 ? 56  THR A N     1 
ATOM   472  C  CA    A THR A 1 76  ? 9.049  -39.350 12.471 0.50 24.73 ? 56  THR A CA    1 
ATOM   473  C  CA    B THR A 1 76  ? 9.057  -39.344 12.381 0.50 24.88 ? 56  THR A CA    1 
ATOM   474  C  C     A THR A 1 76  ? 10.563 -39.252 12.670 0.50 28.34 ? 56  THR A C     1 
ATOM   475  C  C     B THR A 1 76  ? 10.480 -39.060 12.845 0.50 25.81 ? 56  THR A C     1 
ATOM   476  O  O     A THR A 1 76  ? 11.151 -40.078 13.365 0.50 32.08 ? 56  THR A O     1 
ATOM   477  O  O     B THR A 1 76  ? 10.909 -39.541 13.896 0.50 28.41 ? 56  THR A O     1 
ATOM   478  C  CB    A THR A 1 76  ? 8.742  -40.554 11.565 0.50 21.74 ? 56  THR A CB    1 
ATOM   479  C  CB    B THR A 1 76  ? 9.081  -40.402 11.264 0.50 20.42 ? 56  THR A CB    1 
ATOM   480  O  OG1   A THR A 1 76  ? 9.077  -40.240 10.206 0.50 21.93 ? 56  THR A OG1   1 
ATOM   481  O  OG1   B THR A 1 76  ? 7.740  -40.705 10.860 0.50 26.19 ? 56  THR A OG1   1 
ATOM   482  C  CG2   A THR A 1 76  ? 7.270  -40.920 11.658 0.50 29.17 ? 56  THR A CG2   1 
ATOM   483  C  CG2   B THR A 1 76  ? 9.762  -41.682 11.741 0.50 19.39 ? 56  THR A CG2   1 
ATOM   484  N  N     . ASP A 1 77  ? 11.193 -38.251 12.064 1.00 20.30 ? 57  ASP A N     1 
ATOM   485  C  CA    . ASP A 1 77  ? 12.620 -38.010 12.284 1.00 28.34 ? 57  ASP A CA    1 
ATOM   486  C  C     . ASP A 1 77  ? 12.941 -36.533 12.538 1.00 17.49 ? 57  ASP A C     1 
ATOM   487  O  O     . ASP A 1 77  ? 13.836 -35.981 11.888 1.00 22.99 ? 57  ASP A O     1 
ATOM   488  C  CB    . ASP A 1 77  ? 13.432 -38.478 11.072 1.00 35.70 ? 57  ASP A CB    1 
ATOM   489  C  CG    . ASP A 1 77  ? 13.330 -39.973 10.832 1.00 62.80 ? 57  ASP A CG    1 
ATOM   490  O  OD1   . ASP A 1 77  ? 13.373 -40.746 11.815 1.00 63.43 ? 57  ASP A OD1   1 
ATOM   491  O  OD2   . ASP A 1 77  ? 13.208 -40.372 9.653  1.00 61.59 ? 57  ASP A OD2   1 
ATOM   492  N  N     . VAL A 1 78  ? 12.219 -35.903 13.461 1.00 17.80 ? 58  VAL A N     1 
ATOM   493  C  CA    . VAL A 1 78  ? 12.470 -34.483 13.769 1.00 17.76 ? 58  VAL A CA    1 
ATOM   494  C  C     . VAL A 1 78  ? 13.918 -34.320 14.217 1.00 19.68 ? 58  VAL A C     1 
ATOM   495  O  O     . VAL A 1 78  ? 14.392 -35.054 15.087 1.00 19.74 ? 58  VAL A O     1 
ATOM   496  C  CB    . VAL A 1 78  ? 11.540 -33.949 14.871 1.00 20.26 ? 58  VAL A CB    1 
ATOM   497  C  CG1   . VAL A 1 78  ? 11.836 -32.476 15.184 1.00 23.66 ? 58  VAL A CG1   1 
ATOM   498  C  CG2   . VAL A 1 78  ? 10.081 -34.108 14.471 1.00 28.09 ? 58  VAL A CG2   1 
ATOM   499  N  N     . THR A 1 79  ? 14.632 -33.382 13.604 1.00 12.53 ? 59  THR A N     1 
ATOM   500  C  CA    . THR A 1 79  ? 15.996 -33.099 14.023 1.00 12.83 ? 59  THR A CA    1 
ATOM   501  C  C     . THR A 1 79  ? 16.193 -31.600 14.133 1.00 10.85 ? 59  THR A C     1 
ATOM   502  O  O     . THR A 1 79  ? 15.725 -30.830 13.284 1.00 12.90 ? 59  THR A O     1 
ATOM   503  C  CB    . THR A 1 79  ? 17.045 -33.695 13.065 1.00 16.05 ? 59  THR A CB    1 
ATOM   504  O  OG1   . THR A 1 79  ? 18.350 -33.227 13.453 1.00 20.01 ? 59  THR A OG1   1 
ATOM   505  C  CG2   . THR A 1 79  ? 16.792 -33.292 11.646 1.00 19.55 ? 59  THR A CG2   1 
ATOM   506  N  N     . THR A 1 80  ? 16.863 -31.183 15.204 1.00 9.96  ? 60  THR A N     1 
ATOM   507  C  CA    . THR A 1 80  ? 17.182 -29.765 15.400 1.00 8.34  ? 60  THR A CA    1 
ATOM   508  C  C     . THR A 1 80  ? 18.591 -29.410 14.938 1.00 10.12 ? 60  THR A C     1 
ATOM   509  O  O     . THR A 1 80  ? 19.039 -28.282 15.150 1.00 10.82 ? 60  THR A O     1 
ATOM   510  C  CB    . THR A 1 80  ? 17.018 -29.364 16.870 1.00 10.99 ? 60  THR A CB    1 
ATOM   511  O  OG1   . THR A 1 80  ? 17.949 -30.114 17.683 1.00 12.60 ? 60  THR A OG1   1 
ATOM   512  C  CG2   . THR A 1 80  ? 15.601 -29.668 17.353 1.00 11.94 ? 60  THR A CG2   1 
ATOM   513  N  N     . GLU A 1 81  ? 19.282 -30.353 14.298 1.00 9.90  ? 61  GLU A N     1 
ATOM   514  C  CA    . GLU A 1 81  ? 20.669 -30.147 13.879 1.00 9.76  ? 61  GLU A CA    1 
ATOM   515  C  C     . GLU A 1 81  ? 20.774 -29.242 12.678 1.00 12.21 ? 61  GLU A C     1 
ATOM   516  O  O     . GLU A 1 81  ? 19.873 -29.170 11.833 1.00 14.05 ? 61  GLU A O     1 
ATOM   517  C  CB    . GLU A 1 81  ? 21.336 -31.489 13.568 1.00 15.54 ? 61  GLU A CB    1 
ATOM   518  C  CG    . GLU A 1 81  ? 21.400 -32.380 14.787 1.00 20.14 ? 61  GLU A CG    1 
ATOM   519  C  CD    . GLU A 1 81  ? 22.252 -33.625 14.576 1.00 46.24 ? 61  GLU A CD    1 
ATOM   520  O  OE1   . GLU A 1 81  ? 22.354 -34.096 13.426 1.00 33.17 ? 61  GLU A OE1   1 
ATOM   521  O  OE2   . GLU A 1 81  ? 22.822 -34.122 15.567 1.00 52.08 ? 61  GLU A OE2   1 
ATOM   522  N  N     . ILE A 1 82  ? 21.887 -28.529 12.610 1.00 10.41 ? 62  ILE A N     1 
ATOM   523  C  CA    . ILE A 1 82  ? 22.220 -27.764 11.425 1.00 11.51 ? 62  ILE A CA    1 
ATOM   524  C  C     . ILE A 1 82  ? 23.687 -27.994 11.085 1.00 11.42 ? 62  ILE A C     1 
ATOM   525  O  O     . ILE A 1 82  ? 24.467 -28.466 11.928 1.00 12.90 ? 62  ILE A O     1 
ATOM   526  C  CB    . ILE A 1 82  ? 21.980 -26.251 11.600 1.00 11.49 ? 62  ILE A CB    1 
ATOM   527  C  CG1   . ILE A 1 82  ? 22.887 -25.649 12.676 1.00 10.61 ? 62  ILE A CG1   1 
ATOM   528  C  CG2   . ILE A 1 82  ? 20.491 -25.976 11.924 1.00 14.69 ? 62  ILE A CG2   1 
ATOM   529  C  CD1   . ILE A 1 82  ? 22.934 -24.088 12.610 1.00 15.39 ? 62  ILE A CD1   1 
ATOM   530  N  N     . ASP A 1 83  ? 24.042 -27.698 9.847  1.00 11.24 ? 63  ASP A N     1 
ATOM   531  C  CA    . ASP A 1 83  ? 25.446 -27.609 9.455  1.00 11.15 ? 63  ASP A CA    1 
ATOM   532  C  C     . ASP A 1 83  ? 25.793 -26.144 9.291  1.00 13.33 ? 63  ASP A C     1 
ATOM   533  O  O     . ASP A 1 83  ? 25.093 -25.408 8.574  1.00 16.97 ? 63  ASP A O     1 
ATOM   534  C  CB    . ASP A 1 83  ? 25.710 -28.368 8.154  1.00 15.29 ? 63  ASP A CB    1 
ATOM   535  C  CG    . ASP A 1 83  ? 25.575 -29.878 8.316  1.00 25.47 ? 63  ASP A CG    1 
ATOM   536  O  OD1   . ASP A 1 83  ? 26.212 -30.445 9.234  1.00 27.72 ? 63  ASP A OD1   1 
ATOM   537  O  OD2   . ASP A 1 83  ? 24.820 -30.490 7.533  1.00 49.75 ? 63  ASP A OD2   1 
ATOM   538  N  N     . ILE A 1 84  ? 26.848 -25.696 9.962  1.00 11.61 ? 64  ILE A N     1 
ATOM   539  C  CA    . ILE A 1 84  ? 27.229 -24.297 9.841  1.00 14.38 ? 64  ILE A CA    1 
ATOM   540  C  C     . ILE A 1 84  ? 28.740 -24.168 9.972  1.00 18.02 ? 64  ILE A C     1 
ATOM   541  O  O     . ILE A 1 84  ? 29.342 -24.759 10.864 1.00 16.57 ? 64  ILE A O     1 
ATOM   542  C  CB    . ILE A 1 84  ? 26.487 -23.423 10.886 1.00 13.86 ? 64  ILE A CB    1 
ATOM   543  C  CG1   . ILE A 1 84  ? 26.749 -21.937 10.628 1.00 17.68 ? 64  ILE A CG1   1 
ATOM   544  C  CG2   . ILE A 1 84  ? 26.846 -23.793 12.309 1.00 15.46 ? 64  ILE A CG2   1 
ATOM   545  C  CD1   . ILE A 1 84  ? 25.696 -21.041 11.266 1.00 21.95 ? 64  ILE A CD1   1 
ATOM   546  N  N     . PHE A 1 85  ? 29.335 -23.394 9.064  1.00 19.52 ? 65  PHE A N     1 
ATOM   547  C  CA    . PHE A 1 85  ? 30.791 -23.171 9.039  1.00 21.78 ? 65  PHE A CA    1 
ATOM   548  C  C     . PHE A 1 85  ? 31.538 -24.500 9.068  1.00 24.98 ? 65  PHE A C     1 
ATOM   549  O  O     . PHE A 1 85  ? 32.528 -24.660 9.777  1.00 35.54 ? 65  PHE A O     1 
ATOM   550  C  CB    . PHE A 1 85  ? 31.222 -22.253 10.197 1.00 19.60 ? 65  PHE A CB    1 
ATOM   551  C  CG    . PHE A 1 85  ? 30.418 -20.978 10.283 1.00 19.96 ? 65  PHE A CG    1 
ATOM   552  C  CD1   . PHE A 1 85  ? 30.097 -20.278 9.126  1.00 21.96 ? 65  PHE A CD1   1 
ATOM   553  C  CD2   . PHE A 1 85  ? 29.987 -20.474 11.504 1.00 19.77 ? 65  PHE A CD2   1 
ATOM   554  C  CE1   . PHE A 1 85  ? 29.353 -19.126 9.180  1.00 18.35 ? 65  PHE A CE1   1 
ATOM   555  C  CE2   . PHE A 1 85  ? 29.245 -19.324 11.566 1.00 22.25 ? 65  PHE A CE2   1 
ATOM   556  C  CZ    . PHE A 1 85  ? 28.923 -18.642 10.395 1.00 22.10 ? 65  PHE A CZ    1 
ATOM   557  N  N     . GLY A 1 86  ? 31.030 -25.450 8.289  1.00 20.14 ? 66  GLY A N     1 
ATOM   558  C  CA    . GLY A 1 86  ? 31.686 -26.723 8.074  1.00 31.89 ? 66  GLY A CA    1 
ATOM   559  C  C     . GLY A 1 86  ? 31.480 -27.757 9.161  1.00 47.36 ? 66  GLY A C     1 
ATOM   560  O  O     . GLY A 1 86  ? 32.101 -28.816 9.110  1.00 49.65 ? 66  GLY A O     1 
ATOM   561  N  N     . ARG A 1 87  ? 30.636 -27.476 10.154 1.00 24.45 ? 67  ARG A N     1 
ATOM   562  C  CA    . ARG A 1 87  ? 30.461 -28.448 11.225 1.00 25.19 ? 67  ARG A CA    1 
ATOM   563  C  C     . ARG A 1 87  ? 28.997 -28.611 11.599 1.00 15.34 ? 67  ARG A C     1 
ATOM   564  O  O     . ARG A 1 87  ? 28.201 -27.695 11.433 1.00 17.80 ? 67  ARG A O     1 
ATOM   565  C  CB    . ARG A 1 87  ? 31.281 -28.036 12.444 1.00 33.79 ? 67  ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 87  ? 32.781 -28.130 12.109 1.00 71.38 ? 67  ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 87  ? 33.530 -29.341 12.705 1.00 55.34 ? 67  ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 87  ? 34.636 -28.940 13.563 1.00 81.75 ? 67  ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 87  ? 35.284 -29.754 14.390 1.00 83.76 ? 67  ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 87  ? 34.974 -31.052 14.450 1.00 83.40 ? 67  ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 87  ? 36.271 -29.263 15.135 1.00 89.53 ? 67  ARG A NH2   1 
ATOM   572  N  N     . ARG A 1 88  ? 28.647 -29.793 12.086 1.00 17.34 ? 68  ARG A N     1 
ATOM   573  C  CA    . ARG A 1 88  ? 27.307 -30.053 12.585 1.00 18.22 ? 68  ARG A CA    1 
ATOM   574  C  C     . ARG A 1 88  ? 27.152 -29.434 13.963 1.00 20.25 ? 68  ARG A C     1 
ATOM   575  O  O     . ARG A 1 88  ? 28.056 -29.515 14.783 1.00 29.58 ? 68  ARG A O     1 
ATOM   576  C  CB    . ARG A 1 88  ? 27.040 -31.560 12.627 1.00 20.21 ? 68  ARG A CB    1 
ATOM   577  C  CG    . ARG A 1 88  ? 25.637 -31.943 13.072 1.00 28.40 ? 68  ARG A CG    1 
ATOM   578  C  CD    . ARG A 1 88  ? 24.645 -31.873 11.926 1.00 45.31 ? 68  ARG A CD    1 
ATOM   579  N  NE    . ARG A 1 88  ? 24.877 -32.902 10.916 1.00 49.00 ? 68  ARG A NE    1 
ATOM   580  C  CZ    . ARG A 1 88  ? 24.169 -33.014 9.798  1.00 77.05 ? 68  ARG A CZ    1 
ATOM   581  N  NH1   . ARG A 1 88  ? 23.182 -32.159 9.549  1.00 59.99 ? 68  ARG A NH1   1 
ATOM   582  N  NH2   . ARG A 1 88  ? 24.447 -33.982 8.930  1.00 63.00 ? 68  ARG A NH2   1 
ATOM   583  N  N     . ALA A 1 89  ? 26.022 -28.773 14.207 1.00 10.58 ? 69  ALA A N     1 
ATOM   584  C  CA    . ALA A 1 89  ? 25.672 -28.294 15.536 1.00 9.65  ? 69  ALA A CA    1 
ATOM   585  C  C     . ALA A 1 89  ? 24.362 -28.937 15.941 1.00 11.34 ? 69  ALA A C     1 
ATOM   586  O  O     . ALA A 1 89  ? 23.519 -29.206 15.078 1.00 12.51 ? 69  ALA A O     1 
ATOM   587  C  CB    . ALA A 1 89  ? 25.543 -26.763 15.563 1.00 12.43 ? 69  ALA A CB    1 
ATOM   588  N  N     . ALA A 1 90  ? 24.173 -29.166 17.238 1.00 9.94  ? 70  ALA A N     1 
ATOM   589  C  CA    . ALA A 1 90  ? 23.012 -29.925 17.711 1.00 10.30 ? 70  ALA A CA    1 
ATOM   590  C  C     . ALA A 1 90  ? 21.711 -29.143 17.675 1.00 10.90 ? 70  ALA A C     1 
ATOM   591  O  O     . ALA A 1 90  ? 20.635 -29.743 17.681 1.00 10.93 ? 70  ALA A O     1 
ATOM   592  C  CB    . ALA A 1 90  ? 23.257 -30.409 19.129 1.00 14.01 ? 70  ALA A CB    1 
ATOM   593  N  N     . LEU A 1 91  ? 21.843 -27.814 17.648 1.00 9.53  ? 71  LEU A N     1 
ATOM   594  C  CA    . LEU A 1 91  ? 20.733 -26.851 17.662 1.00 10.18 ? 71  LEU A CA    1 
ATOM   595  C  C     . LEU A 1 91  ? 21.114 -25.718 16.738 1.00 10.18 ? 71  LEU A C     1 
ATOM   596  O  O     . LEU A 1 91  ? 22.294 -25.493 16.525 1.00 9.98  ? 71  LEU A O     1 
ATOM   597  C  CB    . LEU A 1 91  ? 20.524 -26.268 19.063 1.00 13.52 ? 71  LEU A CB    1 
ATOM   598  C  CG    . LEU A 1 91  ? 20.024 -27.189 20.156 1.00 14.52 ? 71  LEU A CG    1 
ATOM   599  C  CD1   . LEU A 1 91  ? 20.154 -26.470 21.482 1.00 15.44 ? 71  LEU A CD1   1 
ATOM   600  C  CD2   . LEU A 1 91  ? 18.570 -27.492 19.865 1.00 14.96 ? 71  LEU A CD2   1 
ATOM   601  N  N     . PRO A 1 92  ? 20.133 -24.952 16.253 1.00 7.79  ? 72  PRO A N     1 
ATOM   602  C  CA    . PRO A 1 92  ? 20.484 -23.749 15.491 1.00 8.61  ? 72  PRO A CA    1 
ATOM   603  C  C     . PRO A 1 92  ? 20.795 -22.588 16.432 1.00 9.01  ? 72  PRO A C     1 
ATOM   604  O  O     . PRO A 1 92  ? 20.128 -21.538 16.447 1.00 8.16  ? 72  PRO A O     1 
ATOM   605  C  CB    . PRO A 1 92  ? 19.226 -23.505 14.657 1.00 10.77 ? 72  PRO A CB    1 
ATOM   606  C  CG    . PRO A 1 92  ? 18.107 -24.013 15.533 1.00 11.81 ? 72  PRO A CG    1 
ATOM   607  C  CD    . PRO A 1 92  ? 18.676 -25.219 16.242 1.00 9.31  ? 72  PRO A CD    1 
ATOM   608  N  N     . MET A 1 93  ? 21.827 -22.781 17.247 1.00 8.26  ? 73  MET A N     1 
ATOM   609  C  CA    A MET A 1 93  ? 22.155 -21.846 18.310 0.50 9.23  ? 73  MET A CA    1 
ATOM   610  C  CA    B MET A 1 93  ? 22.189 -21.777 18.242 0.50 9.23  ? 73  MET A CA    1 
ATOM   611  C  C     . MET A 1 93  ? 23.633 -21.940 18.665 1.00 10.69 ? 73  MET A C     1 
ATOM   612  O  O     . MET A 1 93  ? 24.210 -23.035 18.597 1.00 11.98 ? 73  MET A O     1 
ATOM   613  C  CB    A MET A 1 93  ? 21.281 -22.154 19.526 0.50 11.22 ? 73  MET A CB    1 
ATOM   614  C  CB    B MET A 1 93  ? 21.255 -21.838 19.469 0.50 14.47 ? 73  MET A CB    1 
ATOM   615  C  CG    A MET A 1 93  ? 21.592 -21.398 20.778 0.50 6.97  ? 73  MET A CG    1 
ATOM   616  C  CG    B MET A 1 93  ? 21.600 -22.862 20.535 0.50 13.43 ? 73  MET A CG    1 
ATOM   617  S  SD    A MET A 1 93  ? 20.969 -22.488 22.094 0.50 19.43 ? 73  MET A SD    1 
ATOM   618  S  SD    B MET A 1 93  ? 22.899 -22.366 21.707 0.50 16.88 ? 73  MET A SD    1 
ATOM   619  C  CE    A MET A 1 93  ? 19.218 -22.222 21.906 0.50 22.18 ? 73  MET A CE    1 
ATOM   620  C  CE    B MET A 1 93  ? 22.138 -21.240 22.841 0.50 22.21 ? 73  MET A CE    1 
ATOM   621  N  N     . ALA A 1 94  ? 24.225 -20.815 19.053 1.00 9.75  ? 74  ALA A N     1 
ATOM   622  C  CA    . ALA A 1 94  ? 25.573 -20.806 19.614 1.00 8.03  ? 74  ALA A CA    1 
ATOM   623  C  C     . ALA A 1 94  ? 25.573 -19.896 20.832 1.00 8.96  ? 74  ALA A C     1 
ATOM   624  O  O     . ALA A 1 94  ? 24.701 -19.015 20.982 1.00 8.80  ? 74  ALA A O     1 
ATOM   625  C  CB    . ALA A 1 94  ? 26.612 -20.342 18.587 1.00 8.65  ? 74  ALA A CB    1 
ATOM   626  N  N     . VAL A 1 95  ? 26.537 -20.087 21.724 1.00 8.41  ? 75  VAL A N     1 
ATOM   627  C  CA    . VAL A 1 95  ? 26.698 -19.177 22.850 1.00 7.68  ? 75  VAL A CA    1 
ATOM   628  C  C     . VAL A 1 95  ? 27.338 -17.873 22.377 1.00 7.11  ? 75  VAL A C     1 
ATOM   629  O  O     . VAL A 1 95  ? 28.411 -17.880 21.744 1.00 8.47  ? 75  VAL A O     1 
ATOM   630  C  CB    . VAL A 1 95  ? 27.585 -19.818 23.966 1.00 7.74  ? 75  VAL A CB    1 
ATOM   631  C  CG1   . VAL A 1 95  ? 27.812 -18.829 25.107 1.00 8.36  ? 75  VAL A CG1   1 
ATOM   632  C  CG2   . VAL A 1 95  ? 26.913 -21.094 24.482 1.00 9.44  ? 75  VAL A CG2   1 
ATOM   633  N  N     . ALA A 1 96  ? 26.670 -16.751 22.646 1.00 7.85  ? 76  ALA A N     1 
ATOM   634  C  CA    . ALA A 1 96  ? 27.172 -15.441 22.225 1.00 6.43  ? 76  ALA A CA    1 
ATOM   635  C  C     . ALA A 1 96  ? 28.477 -15.113 22.939 1.00 7.87  ? 76  ALA A C     1 
ATOM   636  O  O     . ALA A 1 96  ? 28.669 -15.552 24.077 1.00 10.01 ? 76  ALA A O     1 
ATOM   637  C  CB    . ALA A 1 96  ? 26.134 -14.359 22.535 1.00 7.96  ? 76  ALA A CB    1 
ATOM   638  N  N     . PRO A 1 97  ? 29.335 -14.307 22.307 1.00 8.02  ? 77  PRO A N     1 
ATOM   639  C  CA    . PRO A 1 97  ? 30.495 -13.780 23.034 1.00 8.19  ? 77  PRO A CA    1 
ATOM   640  C  C     . PRO A 1 97  ? 30.057 -12.883 24.191 1.00 8.56  ? 77  PRO A C     1 
ATOM   641  O  O     . PRO A 1 97  ? 29.336 -11.904 23.971 1.00 9.53  ? 77  PRO A O     1 
ATOM   642  C  CB    . PRO A 1 97  ? 31.268 -12.996 21.959 1.00 10.93 ? 77  PRO A CB    1 
ATOM   643  C  CG    . PRO A 1 97  ? 30.205 -12.627 20.909 1.00 8.40  ? 77  PRO A CG    1 
ATOM   644  C  CD    . PRO A 1 97  ? 29.261 -13.811 20.909 1.00 7.74  ? 77  PRO A CD    1 
ATOM   645  N  N     . VAL A 1 98  ? 30.477 -13.213 25.418 1.00 9.03  ? 78  VAL A N     1 
ATOM   646  C  CA    . VAL A 1 98  ? 30.244 -12.364 26.576 1.00 8.22  ? 78  VAL A CA    1 
ATOM   647  C  C     . VAL A 1 98  ? 31.563 -12.250 27.314 1.00 10.40 ? 78  VAL A C     1 
ATOM   648  O  O     . VAL A 1 98  ? 32.085 -13.269 27.777 1.00 12.41 ? 78  VAL A O     1 
ATOM   649  C  CB    . VAL A 1 98  ? 29.170 -12.944 27.524 1.00 10.63 ? 78  VAL A CB    1 
ATOM   650  C  CG1   . VAL A 1 98  ? 29.100 -12.131 28.831 1.00 11.36 ? 78  VAL A CG1   1 
ATOM   651  C  CG2   . VAL A 1 98  ? 27.789 -12.974 26.816 1.00 11.60 ? 78  VAL A CG2   1 
ATOM   652  N  N     . ALA A 1 99  ? 32.115 -11.046 27.407 1.00 9.46  ? 79  ALA A N     1 
ATOM   653  C  CA    . ALA A 1 99  ? 33.437 -10.857 28.036 1.00 11.51 ? 79  ALA A CA    1 
ATOM   654  C  C     . ALA A 1 99  ? 33.439 -11.215 29.523 1.00 10.95 ? 79  ALA A C     1 
ATOM   655  O  O     . ALA A 1 99  ? 32.424 -11.135 30.203 1.00 13.01 ? 79  ALA A O     1 
ATOM   656  C  CB    . ALA A 1 99  ? 33.897 -9.407  27.857 1.00 11.25 ? 79  ALA A CB    1 
ATOM   657  N  N     . TYR A 1 100 ? 34.616 -11.628 30.013 1.00 11.11 ? 80  TYR A N     1 
ATOM   658  C  CA    . TYR A 1 100 ? 34.887 -11.669 31.472 1.00 13.19 ? 80  TYR A CA    1 
ATOM   659  C  C     . TYR A 1 100 ? 33.942 -12.570 32.267 1.00 13.62 ? 80  TYR A C     1 
ATOM   660  O  O     . TYR A 1 100 ? 33.360 -12.151 33.262 1.00 12.71 ? 80  TYR A O     1 
ATOM   661  C  CB    . TYR A 1 100 ? 34.852 -10.235 32.052 1.00 14.08 ? 80  TYR A CB    1 
ATOM   662  C  CG    . TYR A 1 100 ? 35.904 -9.304  31.483 1.00 13.82 ? 80  TYR A CG    1 
ATOM   663  C  CD1   . TYR A 1 100 ? 37.261 -9.625  31.554 1.00 20.57 ? 80  TYR A CD1   1 
ATOM   664  C  CD2   . TYR A 1 100 ? 35.552 -8.080  30.906 1.00 16.29 ? 80  TYR A CD2   1 
ATOM   665  C  CE1   . TYR A 1 100 ? 38.233 -8.771  31.046 1.00 17.93 ? 80  TYR A CE1   1 
ATOM   666  C  CE2   . TYR A 1 100 ? 36.522 -7.219  30.394 1.00 15.37 ? 80  TYR A CE2   1 
ATOM   667  C  CZ    . TYR A 1 100 ? 37.859 -7.568  30.469 1.00 22.32 ? 80  TYR A CZ    1 
ATOM   668  O  OH    . TYR A 1 100 ? 38.831 -6.719  29.973 1.00 22.55 ? 80  TYR A OH    1 
ATOM   669  N  N     . GLN A 1 101 ? 33.801 -13.822 31.845 1.00 10.54 ? 81  GLN A N     1 
ATOM   670  C  CA    . GLN A 1 101 ? 32.787 -14.674 32.453 1.00 10.81 ? 81  GLN A CA    1 
ATOM   671  C  C     . GLN A 1 101 ? 33.123 -15.100 33.895 1.00 12.90 ? 81  GLN A C     1 
ATOM   672  O  O     . GLN A 1 101 ? 32.243 -15.559 34.611 1.00 13.00 ? 81  GLN A O     1 
ATOM   673  C  CB    . GLN A 1 101 ? 32.545 -15.891 31.561 1.00 11.15 ? 81  GLN A CB    1 
ATOM   674  C  CG    . GLN A 1 101 ? 31.784 -15.438 30.272 1.00 9.64  ? 81  GLN A CG    1 
ATOM   675  C  CD    . GLN A 1 101 ? 31.709 -16.477 29.175 1.00 11.51 ? 81  GLN A CD    1 
ATOM   676  O  OE1   . GLN A 1 101 ? 31.786 -17.682 29.406 1.00 12.89 ? 81  GLN A OE1   1 
ATOM   677  N  NE2   . GLN A 1 101 ? 31.522 -15.997 27.930 1.00 10.94 ? 81  GLN A NE2   1 
ATOM   678  N  N     . ARG A 1 102 ? 34.367 -14.893 34.330 1.00 14.02 ? 82  ARG A N     1 
ATOM   679  C  CA    A ARG A 1 102 ? 34.690 -15.174 35.731 0.50 13.41 ? 82  ARG A CA    1 
ATOM   680  C  CA    B ARG A 1 102 ? 34.711 -15.154 35.732 0.50 13.44 ? 82  ARG A CA    1 
ATOM   681  C  C     . ARG A 1 102 ? 34.019 -14.152 36.649 1.00 15.58 ? 82  ARG A C     1 
ATOM   682  O  O     . ARG A 1 102 ? 33.963 -14.331 37.879 1.00 17.79 ? 82  ARG A O     1 
ATOM   683  C  CB    A ARG A 1 102 ? 36.210 -15.220 35.944 0.50 14.66 ? 82  ARG A CB    1 
ATOM   684  C  CB    B ARG A 1 102 ? 36.232 -15.129 35.936 0.50 14.64 ? 82  ARG A CB    1 
ATOM   685  C  CG    A ARG A 1 102 ? 36.742 -16.652 35.995 0.50 18.84 ? 82  ARG A CG    1 
ATOM   686  C  CG    B ARG A 1 102 ? 36.931 -16.348 35.348 0.50 19.79 ? 82  ARG A CG    1 
ATOM   687  C  CD    A ARG A 1 102 ? 38.280 -16.740 35.958 0.50 27.60 ? 82  ARG A CD    1 
ATOM   688  C  CD    B ARG A 1 102 ? 38.341 -16.549 35.922 0.50 27.39 ? 82  ARG A CD    1 
ATOM   689  N  NE    A ARG A 1 102 ? 38.934 -15.906 36.967 0.50 44.65 ? 82  ARG A NE    1 
ATOM   690  N  NE    B ARG A 1 102 ? 38.325 -16.618 37.383 0.50 41.40 ? 82  ARG A NE    1 
ATOM   691  C  CZ    A ARG A 1 102 ? 38.962 -16.176 38.271 0.50 51.83 ? 82  ARG A CZ    1 
ATOM   692  C  CZ    B ARG A 1 102 ? 38.766 -15.651 38.183 0.50 50.43 ? 82  ARG A CZ    1 
ATOM   693  N  NH1   A ARG A 1 102 ? 39.588 -15.351 39.104 0.50 39.85 ? 82  ARG A NH1   1 
ATOM   694  N  NH1   B ARG A 1 102 ? 38.707 -15.798 39.502 0.50 43.10 ? 82  ARG A NH1   1 
ATOM   695  N  NH2   A ARG A 1 102 ? 38.364 -17.261 38.750 0.50 43.01 ? 82  ARG A NH2   1 
ATOM   696  N  NH2   B ARG A 1 102 ? 39.269 -14.536 37.665 0.50 36.18 ? 82  ARG A NH2   1 
ATOM   697  N  N     . LEU A 1 103 ? 33.449 -13.090 36.066 1.00 12.48 ? 83  LEU A N     1 
ATOM   698  C  CA    . LEU A 1 103 ? 32.624 -12.195 36.848 1.00 13.75 ? 83  LEU A CA    1 
ATOM   699  C  C     . LEU A 1 103 ? 31.435 -12.939 37.460 1.00 14.63 ? 83  LEU A C     1 
ATOM   700  O  O     . LEU A 1 103 ? 30.911 -12.535 38.500 1.00 16.86 ? 83  LEU A O     1 
ATOM   701  C  CB    . LEU A 1 103 ? 32.092 -11.034 35.982 1.00 13.86 ? 83  LEU A CB    1 
ATOM   702  C  CG    . LEU A 1 103 ? 33.073 -9.905  35.681 1.00 20.41 ? 83  LEU A CG    1 
ATOM   703  C  CD1   . LEU A 1 103 ? 32.468 -8.944  34.661 1.00 19.27 ? 83  LEU A CD1   1 
ATOM   704  C  CD2   . LEU A 1 103 ? 33.392 -9.158  36.977 1.00 20.96 ? 83  LEU A CD2   1 
ATOM   705  N  N     . PHE A 1 104 ? 30.983 -14.005 36.794 1.00 13.43 ? 84  PHE A N     1 
ATOM   706  C  CA    . PHE A 1 104 ? 29.703 -14.625 37.137 1.00 14.47 ? 84  PHE A CA    1 
ATOM   707  C  C     . PHE A 1 104 ? 29.834 -15.939 37.891 1.00 17.15 ? 84  PHE A C     1 
ATOM   708  O  O     . PHE A 1 104 ? 28.887 -16.376 38.541 1.00 18.33 ? 84  PHE A O     1 
ATOM   709  C  CB    . PHE A 1 104 ? 28.862 -14.848 35.860 1.00 14.14 ? 84  PHE A CB    1 
ATOM   710  C  CG    . PHE A 1 104 ? 28.800 -13.626 34.972 1.00 12.29 ? 84  PHE A CG    1 
ATOM   711  C  CD1   . PHE A 1 104 ? 28.240 -12.448 35.436 1.00 16.05 ? 84  PHE A CD1   1 
ATOM   712  C  CD2   . PHE A 1 104 ? 29.339 -13.653 33.692 1.00 13.98 ? 84  PHE A CD2   1 
ATOM   713  C  CE1   . PHE A 1 104 ? 28.221 -11.299 34.627 1.00 15.46 ? 84  PHE A CE1   1 
ATOM   714  C  CE2   . PHE A 1 104 ? 29.314 -12.518 32.895 1.00 15.31 ? 84  PHE A CE2   1 
ATOM   715  C  CZ    . PHE A 1 104 ? 28.762 -11.349 33.357 1.00 15.24 ? 84  PHE A CZ    1 
ATOM   716  N  N     . HIS A 1 105 ? 31.005 -16.559 37.790 1.00 16.44 ? 85  HIS A N     1 
ATOM   717  C  CA    . HIS A 1 105 ? 31.274 -17.851 38.434 1.00 17.18 ? 85  HIS A CA    1 
ATOM   718  C  C     . HIS A 1 105 ? 32.770 -18.076 38.395 1.00 15.11 ? 85  HIS A C     1 
ATOM   719  O  O     . HIS A 1 105 ? 33.437 -17.681 37.442 1.00 15.44 ? 85  HIS A O     1 
ATOM   720  C  CB    . HIS A 1 105 ? 30.538 -18.981 37.722 1.00 14.71 ? 85  HIS A CB    1 
ATOM   721  C  CG    . HIS A 1 105 ? 30.620 -20.317 38.419 1.00 15.79 ? 85  HIS A CG    1 
ATOM   722  N  ND1   . HIS A 1 105 ? 31.711 -21.139 38.312 1.00 18.41 ? 85  HIS A ND1   1 
ATOM   723  C  CD2   . HIS A 1 105 ? 29.718 -20.966 39.195 1.00 17.40 ? 85  HIS A CD2   1 
ATOM   724  C  CE1   . HIS A 1 105 ? 31.485 -22.255 38.994 1.00 19.45 ? 85  HIS A CE1   1 
ATOM   725  N  NE2   . HIS A 1 105 ? 30.288 -22.171 39.540 1.00 18.97 ? 85  HIS A NE2   1 
ATOM   726  N  N     . PRO A 1 106 ? 33.330 -18.721 39.433 1.00 18.70 ? 86  PRO A N     1 
ATOM   727  C  CA    . PRO A 1 106 ? 34.787 -18.903 39.440 1.00 17.08 ? 86  PRO A CA    1 
ATOM   728  C  C     . PRO A 1 106 ? 35.369 -19.696 38.279 1.00 17.38 ? 86  PRO A C     1 
ATOM   729  O  O     . PRO A 1 106 ? 36.535 -19.474 37.942 1.00 20.45 ? 86  PRO A O     1 
ATOM   730  C  CB    . PRO A 1 106 ? 35.032 -19.661 40.758 1.00 19.31 ? 86  PRO A CB    1 
ATOM   731  C  CG    . PRO A 1 106 ? 33.931 -19.202 41.640 1.00 21.02 ? 86  PRO A CG    1 
ATOM   732  C  CD    . PRO A 1 106 ? 32.718 -19.022 40.738 1.00 19.19 ? 86  PRO A CD    1 
ATOM   733  N  N     . GLU A 1 107 ? 34.595 -20.603 37.682 1.00 13.95 ? 87  GLU A N     1 
ATOM   734  C  CA    . GLU A 1 107 ? 35.120 -21.395 36.586 1.00 14.25 ? 87  GLU A CA    1 
ATOM   735  C  C     . GLU A 1 107 ? 34.972 -20.651 35.258 1.00 16.02 ? 87  GLU A C     1 
ATOM   736  O  O     . GLU A 1 107 ? 35.569 -21.043 34.261 1.00 17.78 ? 87  GLU A O     1 
ATOM   737  C  CB    . GLU A 1 107 ? 34.429 -22.748 36.530 1.00 17.32 ? 87  GLU A CB    1 
ATOM   738  C  CG    . GLU A 1 107 ? 34.832 -23.606 37.744 1.00 21.25 ? 87  GLU A CG    1 
ATOM   739  C  CD    . GLU A 1 107 ? 34.103 -24.914 37.808 1.00 29.49 ? 87  GLU A CD    1 
ATOM   740  O  OE1   . GLU A 1 107 ? 33.265 -25.187 36.932 1.00 21.27 ? 87  GLU A OE1   1 
ATOM   741  O  OE2   . GLU A 1 107 ? 34.374 -25.688 38.742 1.00 30.89 ? 87  GLU A OE2   1 
ATOM   742  N  N     . GLY A 1 108 ? 34.185 -19.578 35.281 1.00 16.11 ? 88  GLY A N     1 
ATOM   743  C  CA    . GLY A 1 108 ? 34.031 -18.693 34.123 1.00 13.58 ? 88  GLY A CA    1 
ATOM   744  C  C     . GLY A 1 108 ? 33.860 -19.423 32.803 1.00 9.82  ? 88  GLY A C     1 
ATOM   745  O  O     . GLY A 1 108 ? 33.012 -20.326 32.658 1.00 14.26 ? 88  GLY A O     1 
ATOM   746  N  N     . GLU A 1 109 ? 34.667 -19.023 31.830 1.00 12.68 ? 89  GLU A N     1 
ATOM   747  C  CA    . GLU A 1 109 ? 34.565 -19.561 30.476 1.00 9.76  ? 89  GLU A CA    1 
ATOM   748  C  C     . GLU A 1 109 ? 34.723 -21.066 30.383 1.00 12.45 ? 89  GLU A C     1 
ATOM   749  O  O     . GLU A 1 109 ? 34.179 -21.691 29.479 1.00 12.21 ? 89  GLU A O     1 
ATOM   750  C  CB    . GLU A 1 109 ? 35.601 -18.900 29.573 1.00 11.75 ? 89  GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 109 ? 35.323 -17.418 29.249 1.00 12.19 ? 89  GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 109 ? 35.847 -16.417 30.277 1.00 16.32 ? 89  GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 109 ? 36.373 -16.831 31.342 1.00 14.16 ? 89  GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 109 ? 35.722 -15.182 30.035 1.00 12.39 ? 89  GLU A OE2   1 
ATOM   755  N  N     . LEU A 1 110 ? 35.513 -21.670 31.279 1.00 11.11 ? 90  LEU A N     1 
ATOM   756  C  CA    . LEU A 1 110 ? 35.684 -23.114 31.172 1.00 11.07 ? 90  LEU A CA    1 
ATOM   757  C  C     . LEU A 1 110 ? 34.386 -23.859 31.449 1.00 8.34  ? 90  LEU A C     1 
ATOM   758  O  O     . LEU A 1 110 ? 34.095 -24.855 30.785 1.00 11.66 ? 90  LEU A O     1 
ATOM   759  C  CB    . LEU A 1 110 ? 36.806 -23.605 32.131 1.00 10.79 ? 90  LEU A CB    1 
ATOM   760  C  CG    . LEU A 1 110 ? 38.211 -23.090 31.782 1.00 12.96 ? 90  LEU A CG    1 
ATOM   761  C  CD1   . LEU A 1 110 ? 39.254 -23.635 32.790 1.00 15.84 ? 90  LEU A CD1   1 
ATOM   762  C  CD2   . LEU A 1 110 ? 38.628 -23.441 30.364 1.00 15.02 ? 90  LEU A CD2   1 
ATOM   763  N  N     . ALA A 1 111 ? 33.607 -23.381 32.416 1.00 10.63 ? 91  ALA A N     1 
ATOM   764  C  CA    . ALA A 1 111 ? 32.328 -24.008 32.752 1.00 10.31 ? 91  ALA A CA    1 
ATOM   765  C  C     . ALA A 1 111 ? 31.372 -23.911 31.569 1.00 11.67 ? 91  ALA A C     1 
ATOM   766  O  O     . ALA A 1 111 ? 30.711 -24.891 31.184 1.00 12.90 ? 91  ALA A O     1 
ATOM   767  C  CB    . ALA A 1 111 ? 31.710 -23.358 33.969 1.00 12.08 ? 91  ALA A CB    1 
ATOM   768  N  N     . VAL A 1 112 ? 31.333 -22.732 30.972 1.00 12.28 ? 92  VAL A N     1 
ATOM   769  C  CA    . VAL A 1 112 ? 30.398 -22.555 29.872 1.00 11.07 ? 92  VAL A CA    1 
ATOM   770  C  C     . VAL A 1 112 ? 30.829 -23.372 28.649 1.00 9.13  ? 92  VAL A C     1 
ATOM   771  O  O     . VAL A 1 112 ? 29.990 -24.020 27.990 1.00 11.09 ? 92  VAL A O     1 
ATOM   772  C  CB    . VAL A 1 112 ? 30.262 -21.061 29.470 1.00 9.54  ? 92  VAL A CB    1 
ATOM   773  C  CG1   . VAL A 1 112 ? 29.173 -20.936 28.407 1.00 11.27 ? 92  VAL A CG1   1 
ATOM   774  C  CG2   . VAL A 1 112 ? 29.934 -20.181 30.672 1.00 11.51 ? 92  VAL A CG2   1 
ATOM   775  N  N     . ALA A 1 113 ? 32.120 -23.359 28.317 1.00 8.41  ? 93  ALA A N     1 
ATOM   776  C  CA    . ALA A 1 113 ? 32.597 -24.080 27.140 1.00 8.26  ? 93  ALA A CA    1 
ATOM   777  C  C     . ALA A 1 113 ? 32.417 -25.599 27.295 1.00 10.48 ? 93  ALA A C     1 
ATOM   778  O  O     . ALA A 1 113 ? 32.112 -26.296 26.335 1.00 10.35 ? 93  ALA A O     1 
ATOM   779  C  CB    . ALA A 1 113 ? 34.057 -23.741 26.859 1.00 11.35 ? 93  ALA A CB    1 
ATOM   780  N  N     . ARG A 1 114 ? 32.613 -26.111 28.511 1.00 10.37 ? 94  ARG A N     1 
ATOM   781  C  CA    . ARG A 1 114 ? 32.385 -27.534 28.760 1.00 12.08 ? 94  ARG A CA    1 
ATOM   782  C  C     . ARG A 1 114 ? 30.918 -27.939 28.536 1.00 8.75  ? 94  ARG A C     1 
ATOM   783  O  O     . ARG A 1 114 ? 30.644 -28.952 27.890 1.00 10.66 ? 94  ARG A O     1 
ATOM   784  C  CB    . ARG A 1 114 ? 32.826 -27.879 30.188 1.00 10.64 ? 94  ARG A CB    1 
ATOM   785  C  CG    . ARG A 1 114 ? 34.340 -27.956 30.316 1.00 13.53 ? 94  ARG A CG    1 
ATOM   786  C  CD    . ARG A 1 114 ? 34.771 -27.987 31.776 1.00 11.71 ? 94  ARG A CD    1 
ATOM   787  N  NE    . ARG A 1 114 ? 36.231 -28.049 31.838 1.00 12.16 ? 94  ARG A NE    1 
ATOM   788  C  CZ    . ARG A 1 114 ? 36.952 -27.534 32.827 1.00 12.46 ? 94  ARG A CZ    1 
ATOM   789  N  NH1   . ARG A 1 114 ? 36.356 -26.937 33.844 1.00 14.32 ? 94  ARG A NH1   1 
ATOM   790  N  NH2   . ARG A 1 114 ? 38.282 -27.629 32.785 1.00 14.78 ? 94  ARG A NH2   1 
ATOM   791  N  N     . ALA A 1 115 ? 29.999 -27.137 29.057 1.00 10.53 ? 95  ALA A N     1 
ATOM   792  C  CA    . ALA A 1 115 ? 28.567 -27.402 28.897 1.00 11.68 ? 95  ALA A CA    1 
ATOM   793  C  C     . ALA A 1 115 ? 28.171 -27.284 27.418 1.00 12.00 ? 95  ALA A C     1 
ATOM   794  O  O     . ALA A 1 115 ? 27.439 -28.124 26.889 1.00 11.10 ? 95  ALA A O     1 
ATOM   795  C  CB    . ALA A 1 115 ? 27.752 -26.461 29.762 1.00 12.79 ? 95  ALA A CB    1 
ATOM   796  N  N     . ALA A 1 116 ? 28.694 -26.265 26.740 1.00 11.03 ? 96  ALA A N     1 
ATOM   797  C  CA    . ALA A 1 116 ? 28.403 -26.129 25.308 1.00 9.86  ? 96  ALA A CA    1 
ATOM   798  C  C     . ALA A 1 116 ? 28.921 -27.312 24.497 1.00 9.39  ? 96  ALA A C     1 
ATOM   799  O  O     . ALA A 1 116 ? 28.219 -27.871 23.640 1.00 12.10 ? 96  ALA A O     1 
ATOM   800  C  CB    . ALA A 1 116 ? 28.992 -24.805 24.776 1.00 9.90  ? 96  ALA A CB    1 
ATOM   801  N  N     . ARG A 1 117 ? 30.159 -27.730 24.770 1.00 8.89  ? 97  ARG A N     1 
ATOM   802  C  CA    . ARG A 1 117 ? 30.717 -28.902 24.128 1.00 8.83  ? 97  ARG A CA    1 
ATOM   803  C  C     . ARG A 1 117 ? 29.811 -30.114 24.309 1.00 10.49 ? 97  ARG A C     1 
ATOM   804  O  O     . ARG A 1 117 ? 29.498 -30.824 23.346 1.00 11.34 ? 97  ARG A O     1 
ATOM   805  C  CB    . ARG A 1 117 ? 32.115 -29.192 24.712 1.00 13.31 ? 97  ARG A CB    1 
ATOM   806  C  CG    . ARG A 1 117 ? 32.695 -30.546 24.285 1.00 12.24 ? 97  ARG A CG    1 
ATOM   807  C  CD    . ARG A 1 117 ? 33.823 -30.957 25.257 1.00 12.52 ? 97  ARG A CD    1 
ATOM   808  N  NE    . ARG A 1 117 ? 33.262 -31.178 26.580 1.00 15.26 ? 97  ARG A NE    1 
ATOM   809  C  CZ    . ARG A 1 117 ? 33.957 -31.172 27.721 1.00 14.26 ? 97  ARG A CZ    1 
ATOM   810  N  NH1   . ARG A 1 117 ? 35.266 -30.936 27.714 1.00 13.09 ? 97  ARG A NH1   1 
ATOM   811  N  NH2   . ARG A 1 117 ? 33.323 -31.373 28.865 1.00 17.68 ? 97  ARG A NH2   1 
ATOM   812  N  N     . ASP A 1 118 ? 29.379 -30.327 25.547 1.00 11.94 ? 98  ASP A N     1 
ATOM   813  C  CA    . ASP A 1 118 ? 28.607 -31.525 25.855 1.00 14.01 ? 98  ASP A CA    1 
ATOM   814  C  C     . ASP A 1 118 ? 27.234 -31.493 25.186 1.00 15.65 ? 98  ASP A C     1 
ATOM   815  O  O     . ASP A 1 118 ? 26.661 -32.551 24.874 1.00 15.03 ? 98  ASP A O     1 
ATOM   816  C  CB    . ASP A 1 118 ? 28.445 -31.680 27.374 1.00 13.04 ? 98  ASP A CB    1 
ATOM   817  C  CG    . ASP A 1 118 ? 29.751 -32.069 28.074 1.00 15.98 ? 98  ASP A CG    1 
ATOM   818  O  OD1   . ASP A 1 118 ? 30.722 -32.408 27.377 1.00 17.28 ? 98  ASP A OD1   1 
ATOM   819  O  OD2   . ASP A 1 118 ? 29.769 -32.029 29.323 1.00 22.08 ? 98  ASP A OD2   1 
ATOM   820  N  N     . ALA A 1 119 ? 26.726 -30.280 24.958 1.00 11.85 ? 99  ALA A N     1 
ATOM   821  C  CA    . ALA A 1 119 ? 25.409 -30.076 24.344 1.00 11.69 ? 99  ALA A CA    1 
ATOM   822  C  C     . ALA A 1 119 ? 25.506 -30.041 22.826 1.00 13.13 ? 99  ALA A C     1 
ATOM   823  O  O     . ALA A 1 119 ? 24.477 -30.043 22.137 1.00 15.19 ? 99  ALA A O     1 
ATOM   824  C  CB    . ALA A 1 119 ? 24.781 -28.791 24.854 1.00 13.99 ? 99  ALA A CB    1 
ATOM   825  N  N     . GLY A 1 120 ? 26.717 -29.971 22.289 1.00 10.85 ? 100 GLY A N     1 
ATOM   826  C  CA    . GLY A 1 120 ? 26.888 -29.948 20.852 1.00 9.92  ? 100 GLY A CA    1 
ATOM   827  C  C     . GLY A 1 120 ? 26.621 -28.569 20.252 1.00 11.98 ? 100 GLY A C     1 
ATOM   828  O  O     . GLY A 1 120 ? 26.307 -28.472 19.063 1.00 12.64 ? 100 GLY A O     1 
ATOM   829  N  N     . VAL A 1 121 ? 26.772 -27.523 21.051 1.00 11.90 ? 101 VAL A N     1 
ATOM   830  C  CA    A VAL A 1 121 ? 26.515 -26.131 20.682 0.50 12.56 ? 101 VAL A CA    1 
ATOM   831  C  CA    B VAL A 1 121 ? 26.576 -26.204 20.465 0.50 12.73 ? 101 VAL A CA    1 
ATOM   832  C  C     . VAL A 1 121 ? 27.848 -25.389 20.513 1.00 13.29 ? 101 VAL A C     1 
ATOM   833  O  O     . VAL A 1 121 ? 28.683 -25.506 21.410 1.00 12.87 ? 101 VAL A O     1 
ATOM   834  C  CB    A VAL A 1 121 ? 25.681 -25.462 21.809 0.50 10.63 ? 101 VAL A CB    1 
ATOM   835  C  CB    B VAL A 1 121 ? 25.440 -25.418 21.129 0.50 15.84 ? 101 VAL A CB    1 
ATOM   836  C  CG1   A VAL A 1 121 ? 25.525 -23.972 21.603 0.50 11.86 ? 101 VAL A CG1   1 
ATOM   837  C  CG1   B VAL A 1 121 ? 24.099 -26.139 20.916 0.50 11.78 ? 101 VAL A CG1   1 
ATOM   838  C  CG2   A VAL A 1 121 ? 24.317 -26.162 21.984 0.50 13.86 ? 101 VAL A CG2   1 
ATOM   839  C  CG2   B VAL A 1 121 ? 25.738 -25.183 22.593 0.50 8.19  ? 101 VAL A CG2   1 
ATOM   840  N  N     . PRO A 1 122 ? 28.058 -24.594 19.444 1.00 9.79  ? 102 PRO A N     1 
ATOM   841  C  CA    . PRO A 1 122 ? 29.286 -23.802 19.412 1.00 9.26  ? 102 PRO A CA    1 
ATOM   842  C  C     . PRO A 1 122 ? 29.366 -22.775 20.537 1.00 9.69  ? 102 PRO A C     1 
ATOM   843  O  O     . PRO A 1 122 ? 28.360 -22.196 20.952 1.00 10.86 ? 102 PRO A O     1 
ATOM   844  C  CB    . PRO A 1 122 ? 29.224 -23.096 18.037 1.00 9.62  ? 102 PRO A CB    1 
ATOM   845  C  CG    . PRO A 1 122 ? 28.315 -23.957 17.222 1.00 11.15 ? 102 PRO A CG    1 
ATOM   846  C  CD    . PRO A 1 122 ? 27.302 -24.511 18.175 1.00 11.55 ? 102 PRO A CD    1 
ATOM   847  N  N     . TYR A 1 123 ? 30.586 -22.554 21.014 1.00 8.89  ? 103 TYR A N     1 
ATOM   848  C  CA    . TYR A 1 123 ? 30.895 -21.585 22.049 1.00 10.02 ? 103 TYR A CA    1 
ATOM   849  C  C     . TYR A 1 123 ? 31.788 -20.509 21.459 1.00 9.73  ? 103 TYR A C     1 
ATOM   850  O  O     . TYR A 1 123 ? 32.788 -20.848 20.826 1.00 11.40 ? 103 TYR A O     1 
ATOM   851  C  CB    . TYR A 1 123 ? 31.624 -22.283 23.216 1.00 9.99  ? 103 TYR A CB    1 
ATOM   852  C  CG    . TYR A 1 123 ? 32.054 -21.308 24.290 1.00 9.34  ? 103 TYR A CG    1 
ATOM   853  C  CD1   . TYR A 1 123 ? 31.154 -20.882 25.250 1.00 10.79 ? 103 TYR A CD1   1 
ATOM   854  C  CD2   . TYR A 1 123 ? 33.351 -20.804 24.331 1.00 10.05 ? 103 TYR A CD2   1 
ATOM   855  C  CE1   . TYR A 1 123 ? 31.533 -19.940 26.216 1.00 11.98 ? 103 TYR A CE1   1 
ATOM   856  C  CE2   . TYR A 1 123 ? 33.730 -19.883 25.301 1.00 8.78  ? 103 TYR A CE2   1 
ATOM   857  C  CZ    . TYR A 1 123 ? 32.833 -19.465 26.230 1.00 9.93  ? 103 TYR A CZ    1 
ATOM   858  O  OH    . TYR A 1 123 ? 33.222 -18.555 27.165 1.00 11.78 ? 103 TYR A OH    1 
ATOM   859  N  N     . THR A 1 124 ? 31.447 -19.241 21.650 1.00 8.85  ? 104 THR A N     1 
ATOM   860  C  CA    . THR A 1 124 ? 32.290 -18.164 21.146 1.00 7.28  ? 104 THR A CA    1 
ATOM   861  C  C     . THR A 1 124 ? 33.266 -17.665 22.208 1.00 8.04  ? 104 THR A C     1 
ATOM   862  O  O     . THR A 1 124 ? 32.863 -17.036 23.183 1.00 11.63 ? 104 THR A O     1 
ATOM   863  C  CB    . THR A 1 124 ? 31.427 -16.972 20.648 1.00 8.56  ? 104 THR A CB    1 
ATOM   864  O  OG1   . THR A 1 124 ? 30.406 -17.478 19.772 1.00 10.18 ? 104 THR A OG1   1 
ATOM   865  C  CG2   . THR A 1 124 ? 32.287 -16.001 19.865 1.00 11.44 ? 104 THR A CG2   1 
ATOM   866  N  N     . ILE A 1 125 ? 34.552 -17.929 21.988 1.00 8.43  ? 105 ILE A N     1 
ATOM   867  C  CA    . ILE A 1 125 ? 35.619 -17.429 22.863 1.00 9.79  ? 105 ILE A CA    1 
ATOM   868  C  C     . ILE A 1 125 ? 35.847 -15.942 22.602 1.00 11.68 ? 105 ILE A C     1 
ATOM   869  O  O     . ILE A 1 125 ? 36.031 -15.557 21.435 1.00 12.35 ? 105 ILE A O     1 
ATOM   870  C  CB    . ILE A 1 125 ? 36.916 -18.186 22.605 1.00 9.93  ? 105 ILE A CB    1 
ATOM   871  C  CG1   . ILE A 1 125 ? 36.711 -19.682 22.862 1.00 12.03 ? 105 ILE A CG1   1 
ATOM   872  C  CG2   . ILE A 1 125 ? 38.052 -17.597 23.463 1.00 11.14 ? 105 ILE A CG2   1 
ATOM   873  C  CD1   . ILE A 1 125 ? 37.901 -20.503 22.380 1.00 13.22 ? 105 ILE A CD1   1 
ATOM   874  N  N     . CYS A 1 126 ? 35.846 -15.135 23.656 1.00 9.85  ? 106 CYS A N     1 
ATOM   875  C  CA    . CYS A 1 126 ? 36.018 -13.673 23.539 1.00 9.39  ? 106 CYS A CA    1 
ATOM   876  C  C     . CYS A 1 126 ? 37.460 -13.208 23.509 1.00 12.18 ? 106 CYS A C     1 
ATOM   877  O  O     . CYS A 1 126 ? 38.329 -13.761 24.188 1.00 10.95 ? 106 CYS A O     1 
ATOM   878  C  CB    . CYS A 1 126 ? 35.350 -12.955 24.701 1.00 8.26  ? 106 CYS A CB    1 
ATOM   879  S  SG    . CYS A 1 126 ? 33.569 -13.064 24.632 1.00 13.75 ? 106 CYS A SG    1 
ATOM   880  N  N     . THR A 1 127 ? 37.711 -12.156 22.736 1.00 9.69  ? 107 THR A N     1 
ATOM   881  C  CA    . THR A 1 127 ? 38.977 -11.434 22.864 1.00 7.73  ? 107 THR A CA    1 
ATOM   882  C  C     . THR A 1 127 ? 39.228 -11.027 24.317 1.00 10.85 ? 107 THR A C     1 
ATOM   883  O  O     . THR A 1 127 ? 40.373 -11.150 24.813 1.00 11.72 ? 107 THR A O     1 
ATOM   884  C  CB    . THR A 1 127 ? 38.968 -10.181 21.929 1.00 8.11  ? 107 THR A CB    1 
ATOM   885  O  OG1   . THR A 1 127 ? 39.140 -10.599 20.576 1.00 10.46 ? 107 THR A OG1   1 
ATOM   886  C  CG2   . THR A 1 127 ? 40.111 -9.231  22.289 1.00 10.08 ? 107 THR A CG2   1 
ATOM   887  N  N     . LEU A 1 128 ? 38.187 -10.571 25.017 1.00 10.38 ? 108 LEU A N     1 
ATOM   888  C  CA    . LEU A 1 128 ? 38.296 -10.160 26.425 1.00 11.72 ? 108 LEU A CA    1 
ATOM   889  C  C     . LEU A 1 128 ? 37.828 -11.274 27.364 1.00 11.21 ? 108 LEU A C     1 
ATOM   890  O  O     . LEU A 1 128 ? 37.117 -11.029 28.335 1.00 13.30 ? 108 LEU A O     1 
ATOM   891  C  CB    . LEU A 1 128 ? 37.497 -8.863  26.672 1.00 11.21 ? 108 LEU A CB    1 
ATOM   892  C  CG    . LEU A 1 128 ? 38.095 -7.692  25.884 1.00 14.98 ? 108 LEU A CG    1 
ATOM   893  C  CD1   . LEU A 1 128 ? 37.221 -6.445  26.028 1.00 18.64 ? 108 LEU A CD1   1 
ATOM   894  C  CD2   . LEU A 1 128 ? 39.522 -7.411  26.314 1.00 20.66 ? 108 LEU A CD2   1 
ATOM   895  N  N     . SER A 1 129 ? 38.232 -12.505 27.064 1.00 10.55 ? 109 SER A N     1 
ATOM   896  C  CA    . SER A 1 129 ? 37.932 -13.626 27.963 1.00 11.37 ? 109 SER A CA    1 
ATOM   897  C  C     . SER A 1 129 ? 38.776 -13.535 29.239 1.00 14.48 ? 109 SER A C     1 
ATOM   898  O  O     . SER A 1 129 ? 39.888 -12.990 29.222 1.00 14.01 ? 109 SER A O     1 
ATOM   899  C  CB    . SER A 1 129 ? 38.186 -14.964 27.266 1.00 12.25 ? 109 SER A CB    1 
ATOM   900  O  OG    . SER A 1 129 ? 39.516 -15.045 26.759 1.00 13.96 ? 109 SER A OG    1 
ATOM   901  N  N     . SER A 1 130 ? 38.236 -14.055 30.334 1.00 11.18 ? 110 SER A N     1 
ATOM   902  C  CA    . SER A 1 130 ? 38.975 -14.047 31.614 1.00 12.98 ? 110 SER A CA    1 
ATOM   903  C  C     . SER A 1 130 ? 39.762 -15.339 31.832 1.00 17.35 ? 110 SER A C     1 
ATOM   904  O  O     . SER A 1 130 ? 40.418 -15.497 32.867 1.00 17.36 ? 110 SER A O     1 
ATOM   905  C  CB    . SER A 1 130 ? 38.036 -13.778 32.793 1.00 13.60 ? 110 SER A CB    1 
ATOM   906  O  OG    . SER A 1 130 ? 36.892 -14.602 32.789 1.00 16.32 ? 110 SER A OG    1 
ATOM   907  N  N     . VAL A 1 131 ? 39.718 -16.230 30.852 1.00 13.77 ? 111 VAL A N     1 
ATOM   908  C  CA    . VAL A 1 131 ? 40.569 -17.422 30.770 1.00 13.25 ? 111 VAL A CA    1 
ATOM   909  C  C     . VAL A 1 131 ? 41.155 -17.403 29.358 1.00 14.73 ? 111 VAL A C     1 
ATOM   910  O  O     . VAL A 1 131 ? 40.462 -16.989 28.413 1.00 14.20 ? 111 VAL A O     1 
ATOM   911  C  CB    . VAL A 1 131 ? 39.762 -18.730 31.037 1.00 14.03 ? 111 VAL A CB    1 
ATOM   912  C  CG1   . VAL A 1 131 ? 40.648 -19.971 30.859 1.00 16.22 ? 111 VAL A CG1   1 
ATOM   913  C  CG2   . VAL A 1 131 ? 39.122 -18.697 32.423 1.00 15.08 ? 111 VAL A CG2   1 
ATOM   914  N  N     . SER A 1 132 ? 42.417 -17.797 29.175 1.00 11.53 ? 112 SER A N     1 
ATOM   915  C  CA    . SER A 1 132 ? 43.054 -17.657 27.864 1.00 12.88 ? 112 SER A CA    1 
ATOM   916  C  C     . SER A 1 132 ? 42.353 -18.481 26.788 1.00 12.06 ? 112 SER A C     1 
ATOM   917  O  O     . SER A 1 132 ? 41.784 -19.549 27.047 1.00 12.51 ? 112 SER A O     1 
ATOM   918  C  CB    . SER A 1 132 ? 44.532 -18.049 27.925 1.00 16.85 ? 112 SER A CB    1 
ATOM   919  O  OG    . SER A 1 132 ? 44.682 -19.460 27.951 1.00 16.95 ? 112 SER A OG    1 
ATOM   920  N  N     . LEU A 1 133 ? 42.367 -17.967 25.560 1.00 12.07 ? 113 LEU A N     1 
ATOM   921  C  CA    . LEU A 1 133 ? 41.687 -18.658 24.478 1.00 12.19 ? 113 LEU A CA    1 
ATOM   922  C  C     . LEU A 1 133 ? 42.227 -20.080 24.262 1.00 13.73 ? 113 LEU A C     1 
ATOM   923  O  O     . LEU A 1 133 ? 41.477 -20.978 23.892 1.00 12.93 ? 113 LEU A O     1 
ATOM   924  C  CB    . LEU A 1 133 ? 41.774 -17.824 23.177 1.00 13.01 ? 113 LEU A CB    1 
ATOM   925  C  CG    . LEU A 1 133 ? 43.130 -17.686 22.481 1.00 12.00 ? 113 LEU A CG    1 
ATOM   926  C  CD1   . LEU A 1 133 ? 43.351 -18.769 21.448 1.00 14.24 ? 113 LEU A CD1   1 
ATOM   927  C  CD2   . LEU A 1 133 ? 43.229 -16.284 21.845 1.00 15.53 ? 113 LEU A CD2   1 
ATOM   928  N  N     . GLU A 1 134 ? 43.520 -20.298 24.524 1.00 11.77 ? 114 GLU A N     1 
ATOM   929  C  CA    . GLU A 1 134 ? 44.075 -21.626 24.320 1.00 13.90 ? 114 GLU A CA    1 
ATOM   930  C  C     . GLU A 1 134 ? 43.534 -22.613 25.347 1.00 13.13 ? 114 GLU A C     1 
ATOM   931  O  O     . GLU A 1 134 ? 43.255 -23.769 24.996 1.00 12.94 ? 114 GLU A O     1 
ATOM   932  C  CB    . GLU A 1 134 ? 45.613 -21.610 24.374 1.00 14.18 ? 114 GLU A CB    1 
ATOM   933  C  CG    . GLU A 1 134 ? 46.267 -20.981 23.151 1.00 14.99 ? 114 GLU A CG    1 
ATOM   934  C  CD    . GLU A 1 134 ? 46.412 -19.458 23.249 1.00 13.44 ? 114 GLU A CD    1 
ATOM   935  O  OE1   . GLU A 1 134 ? 46.048 -18.861 24.300 1.00 14.51 ? 114 GLU A OE1   1 
ATOM   936  O  OE2   . GLU A 1 134 ? 46.902 -18.878 22.251 1.00 19.70 ? 114 GLU A OE2   1 
ATOM   937  N  N     . GLU A 1 135 ? 43.395 -22.170 26.595 1.00 13.45 ? 115 GLU A N     1 
ATOM   938  C  CA    . GLU A 1 135 ? 42.766 -23.015 27.615 1.00 11.75 ? 115 GLU A CA    1 
ATOM   939  C  C     . GLU A 1 135 ? 41.319 -23.342 27.266 1.00 14.16 ? 115 GLU A C     1 
ATOM   940  O  O     . GLU A 1 135 ? 40.881 -24.489 27.354 1.00 14.38 ? 115 GLU A O     1 
ATOM   941  C  CB    . GLU A 1 135 ? 42.842 -22.346 28.970 1.00 13.58 ? 115 GLU A CB    1 
ATOM   942  C  CG    . GLU A 1 135 ? 44.251 -22.370 29.565 1.00 13.89 ? 115 GLU A CG    1 
ATOM   943  C  CD    . GLU A 1 135 ? 44.366 -21.432 30.740 1.00 19.47 ? 115 GLU A CD    1 
ATOM   944  O  OE1   . GLU A 1 135 ? 44.856 -20.294 30.534 1.00 25.94 ? 115 GLU A OE1   1 
ATOM   945  O  OE2   . GLU A 1 135 ? 43.948 -21.814 31.861 1.00 21.08 ? 115 GLU A OE2   1 
ATOM   946  N  N     . ILE A 1 136 ? 40.558 -22.332 26.852 1.00 12.35 ? 116 ILE A N     1 
ATOM   947  C  CA    . ILE A 1 136 ? 39.173 -22.621 26.531 1.00 10.89 ? 116 ILE A CA    1 
ATOM   948  C  C     . ILE A 1 136 ? 39.077 -23.549 25.318 1.00 10.30 ? 116 ILE A C     1 
ATOM   949  O  O     . ILE A 1 136 ? 38.231 -24.441 25.301 1.00 12.73 ? 116 ILE A O     1 
ATOM   950  C  CB    . ILE A 1 136 ? 38.373 -21.310 26.265 1.00 10.42 ? 116 ILE A CB    1 
ATOM   951  C  CG1   . ILE A 1 136 ? 38.445 -20.385 27.478 1.00 11.33 ? 116 ILE A CG1   1 
ATOM   952  C  CG2   . ILE A 1 136 ? 36.903 -21.639 25.972 1.00 13.32 ? 116 ILE A CG2   1 
ATOM   953  C  CD1   . ILE A 1 136 ? 38.073 -18.896 27.148 1.00 11.71 ? 116 ILE A CD1   1 
ATOM   954  N  N     . ALA A 1 137 ? 39.909 -23.341 24.292 1.00 13.48 ? 117 ALA A N     1 
ATOM   955  C  CA    . ALA A 1 137 ? 39.862 -24.196 23.105 1.00 10.32 ? 117 ALA A CA    1 
ATOM   956  C  C     . ALA A 1 137 ? 40.220 -25.642 23.462 1.00 13.95 ? 117 ALA A C     1 
ATOM   957  O  O     . ALA A 1 137 ? 39.711 -26.588 22.850 1.00 14.77 ? 117 ALA A O     1 
ATOM   958  C  CB    . ALA A 1 137 ? 40.799 -23.688 22.008 1.00 13.39 ? 117 ALA A CB    1 
ATOM   959  N  N     . ALA A 1 138 ? 41.079 -25.801 24.470 1.00 14.30 ? 118 ALA A N     1 
ATOM   960  C  CA    . ALA A 1 138 ? 41.507 -27.148 24.864 1.00 17.90 ? 118 ALA A CA    1 
ATOM   961  C  C     . ALA A 1 138 ? 40.356 -27.966 25.438 1.00 17.05 ? 118 ALA A C     1 
ATOM   962  O  O     . ALA A 1 138 ? 40.405 -29.195 25.463 1.00 12.63 ? 118 ALA A O     1 
ATOM   963  C  CB    . ALA A 1 138 ? 42.657 -27.071 25.865 1.00 12.35 ? 118 ALA A CB    1 
ATOM   964  N  N     . VAL A 1 139 ? 39.305 -27.295 25.893 1.00 13.20 ? 119 VAL A N     1 
ATOM   965  C  CA    . VAL A 1 139 ? 38.103 -27.981 26.344 1.00 9.88  ? 119 VAL A CA    1 
ATOM   966  C  C     . VAL A 1 139 ? 37.523 -28.870 25.242 1.00 12.06 ? 119 VAL A C     1 
ATOM   967  O  O     . VAL A 1 139 ? 36.907 -29.909 25.507 1.00 15.01 ? 119 VAL A O     1 
ATOM   968  C  CB    . VAL A 1 139 ? 37.066 -26.928 26.815 1.00 15.81 ? 119 VAL A CB    1 
ATOM   969  C  CG1   . VAL A 1 139 ? 35.661 -27.503 26.884 1.00 15.18 ? 119 VAL A CG1   1 
ATOM   970  C  CG2   . VAL A 1 139 ? 37.516 -26.349 28.162 1.00 16.43 ? 119 VAL A CG2   1 
ATOM   971  N  N     . GLY A 1 140 ? 37.728 -28.454 23.995 1.00 12.23 ? 120 GLY A N     1 
ATOM   972  C  CA    . GLY A 1 140 ? 37.212 -29.180 22.845 1.00 14.60 ? 120 GLY A CA    1 
ATOM   973  C  C     . GLY A 1 140 ? 35.930 -28.536 22.328 1.00 16.02 ? 120 GLY A C     1 
ATOM   974  O  O     . GLY A 1 140 ? 35.707 -27.346 22.519 1.00 18.07 ? 120 GLY A O     1 
ATOM   975  N  N     . GLY A 1 141 ? 35.101 -29.327 21.665 1.00 13.71 ? 121 GLY A N     1 
ATOM   976  C  CA    . GLY A 1 141 ? 33.794 -28.849 21.228 1.00 14.18 ? 121 GLY A CA    1 
ATOM   977  C  C     . GLY A 1 141 ? 33.817 -27.880 20.074 1.00 22.22 ? 121 GLY A C     1 
ATOM   978  O  O     . GLY A 1 141 ? 32.916 -27.063 19.942 1.00 18.45 ? 121 GLY A O     1 
ATOM   979  N  N     . ARG A 1 142 ? 34.817 -27.941 19.215 1.00 20.68 ? 122 ARG A N     1 
ATOM   980  C  CA    . ARG A 1 142 ? 34.775 -27.025 18.041 1.00 54.29 ? 122 ARG A CA    1 
ATOM   981  C  C     . ARG A 1 142 ? 34.258 -25.530 18.294 1.00 48.70 ? 122 ARG A C     1 
ATOM   982  O  O     . ARG A 1 142 ? 33.164 -25.162 17.867 1.00 49.22 ? 122 ARG A O     1 
ATOM   983  C  CB    . ARG A 1 142 ? 33.931 -27.737 16.953 1.00 54.37 ? 122 ARG A CB    1 
ATOM   984  C  CG    . ARG A 1 142 ? 32.425 -28.001 17.285 1.00 64.11 ? 122 ARG A CG    1 
ATOM   985  C  CD    . ARG A 1 142 ? 31.616 -28.759 16.226 1.00 71.70 ? 122 ARG A CD    1 
ATOM   986  N  NE    . ARG A 1 142 ? 32.200 -30.017 15.784 1.00 81.60 ? 122 ARG A NE    1 
ATOM   987  C  CZ    . ARG A 1 142 ? 32.437 -31.085 16.548 1.00 75.61 ? 122 ARG A CZ    1 
ATOM   988  N  NH1   . ARG A 1 142 ? 32.166 -31.064 17.851 1.00 72.44 ? 122 ARG A NH1   1 
ATOM   989  N  NH2   . ARG A 1 142 ? 32.966 -32.193 16.000 1.00 80.93 ? 122 ARG A NH2   1 
ATOM   990  N  N     . PRO A 1 143 ? 35.043 -24.683 19.016 1.00 15.94 ? 123 PRO A N     1 
ATOM   991  C  CA    . PRO A 1 143 ? 34.803 -23.276 19.406 1.00 13.57 ? 123 PRO A CA    1 
ATOM   992  C  C     . PRO A 1 143 ? 34.992 -22.245 18.282 1.00 13.84 ? 123 PRO A C     1 
ATOM   993  O  O     . PRO A 1 143 ? 35.706 -22.508 17.311 1.00 12.92 ? 123 PRO A O     1 
ATOM   994  C  CB    . PRO A 1 143 ? 35.851 -23.034 20.489 1.00 19.52 ? 123 PRO A CB    1 
ATOM   995  C  CG    . PRO A 1 143 ? 36.961 -23.906 20.105 1.00 16.86 ? 123 PRO A CG    1 
ATOM   996  C  CD    . PRO A 1 143 ? 36.353 -25.143 19.514 1.00 16.72 ? 123 PRO A CD    1 
ATOM   997  N  N     . TRP A 1 144 ? 34.339 -21.091 18.433 1.00 10.26 ? 124 TRP A N     1 
ATOM   998  C  CA    . TRP A 1 144 ? 34.564 -19.937 17.559 1.00 11.27 ? 124 TRP A CA    1 
ATOM   999  C  C     . TRP A 1 144 ? 35.372 -18.907 18.328 1.00 12.13 ? 124 TRP A C     1 
ATOM   1000 O  O     . TRP A 1 144 ? 35.443 -18.977 19.557 1.00 12.78 ? 124 TRP A O     1 
ATOM   1001 C  CB    . TRP A 1 144 ? 33.224 -19.332 17.117 1.00 9.85  ? 124 TRP A CB    1 
ATOM   1002 C  CG    . TRP A 1 144 ? 32.349 -20.251 16.347 1.00 11.50 ? 124 TRP A CG    1 
ATOM   1003 C  CD1   . TRP A 1 144 ? 32.700 -21.444 15.792 1.00 12.88 ? 124 TRP A CD1   1 
ATOM   1004 C  CD2   . TRP A 1 144 ? 30.954 -20.058 16.051 1.00 11.01 ? 124 TRP A CD2   1 
ATOM   1005 N  NE1   . TRP A 1 144 ? 31.607 -22.009 15.156 1.00 15.49 ? 124 TRP A NE1   1 
ATOM   1006 C  CE2   . TRP A 1 144 ? 30.530 -21.170 15.297 1.00 12.69 ? 124 TRP A CE2   1 
ATOM   1007 C  CE3   . TRP A 1 144 ? 30.030 -19.046 16.343 1.00 16.65 ? 124 TRP A CE3   1 
ATOM   1008 C  CZ2   . TRP A 1 144 ? 29.206 -21.308 14.838 1.00 14.17 ? 124 TRP A CZ2   1 
ATOM   1009 C  CZ3   . TRP A 1 144 ? 28.721 -19.176 15.882 1.00 16.23 ? 124 TRP A CZ3   1 
ATOM   1010 C  CH2   . TRP A 1 144 ? 28.327 -20.307 15.143 1.00 12.31 ? 124 TRP A CH2   1 
ATOM   1011 N  N     . PHE A 1 145 ? 35.985 -17.945 17.637 1.00 9.65  ? 125 PHE A N     1 
ATOM   1012 C  CA    . PHE A 1 145 ? 36.706 -16.885 18.325 1.00 7.72  ? 125 PHE A CA    1 
ATOM   1013 C  C     . PHE A 1 145 ? 36.187 -15.510 17.928 1.00 9.77  ? 125 PHE A C     1 
ATOM   1014 O  O     . PHE A 1 145 ? 36.135 -15.213 16.735 1.00 10.80 ? 125 PHE A O     1 
ATOM   1015 C  CB    . PHE A 1 145 ? 38.212 -16.950 18.026 1.00 9.64  ? 125 PHE A CB    1 
ATOM   1016 C  CG    . PHE A 1 145 ? 38.995 -15.864 18.701 1.00 9.48  ? 125 PHE A CG    1 
ATOM   1017 C  CD1   . PHE A 1 145 ? 39.188 -15.890 20.084 1.00 10.98 ? 125 PHE A CD1   1 
ATOM   1018 C  CD2   . PHE A 1 145 ? 39.478 -14.779 17.970 1.00 11.41 ? 125 PHE A CD2   1 
ATOM   1019 C  CE1   . PHE A 1 145 ? 39.883 -14.859 20.718 1.00 11.10 ? 125 PHE A CE1   1 
ATOM   1020 C  CE2   . PHE A 1 145 ? 40.175 -13.762 18.586 1.00 10.65 ? 125 PHE A CE2   1 
ATOM   1021 C  CZ    . PHE A 1 145 ? 40.378 -13.794 19.959 1.00 11.83 ? 125 PHE A CZ    1 
ATOM   1022 N  N     . GLN A 1 146 ? 35.832 -14.703 18.920 1.00 8.18  ? 126 GLN A N     1 
ATOM   1023 C  CA    . GLN A 1 146 ? 35.354 -13.343 18.680 1.00 9.04  ? 126 GLN A CA    1 
ATOM   1024 C  C     . GLN A 1 146 ? 36.515 -12.374 18.738 1.00 11.20 ? 126 GLN A C     1 
ATOM   1025 O  O     . GLN A 1 146 ? 37.301 -12.388 19.688 1.00 11.19 ? 126 GLN A O     1 
ATOM   1026 C  CB    . GLN A 1 146 ? 34.280 -12.969 19.710 1.00 9.23  ? 126 GLN A CB    1 
ATOM   1027 C  CG    . GLN A 1 146 ? 33.793 -11.507 19.613 1.00 9.01  ? 126 GLN A CG    1 
ATOM   1028 C  CD    . GLN A 1 146 ? 34.635 -10.545 20.440 1.00 13.35 ? 126 GLN A CD    1 
ATOM   1029 O  OE1   . GLN A 1 146 ? 35.337 -10.949 21.373 1.00 14.06 ? 126 GLN A OE1   1 
ATOM   1030 N  NE2   . GLN A 1 146 ? 34.601 -9.268  20.086 1.00 9.83  ? 126 GLN A NE2   1 
ATOM   1031 N  N     . LEU A 1 147 ? 36.621 -11.525 17.720 1.00 8.67  ? 127 LEU A N     1 
ATOM   1032 C  CA    . LEU A 1 147 ? 37.697 -10.550 17.614 1.00 8.79  ? 127 LEU A CA    1 
ATOM   1033 C  C     . LEU A 1 147 ? 37.200 -9.137  17.872 1.00 10.01 ? 127 LEU A C     1 
ATOM   1034 O  O     . LEU A 1 147 ? 36.221 -8.720  17.249 1.00 10.12 ? 127 LEU A O     1 
ATOM   1035 C  CB    . LEU A 1 147 ? 38.318 -10.618 16.224 1.00 8.56  ? 127 LEU A CB    1 
ATOM   1036 C  CG    . LEU A 1 147 ? 39.428 -9.606  15.909 1.00 10.87 ? 127 LEU A CG    1 
ATOM   1037 C  CD1   . LEU A 1 147 ? 40.685 -9.929  16.758 1.00 13.01 ? 127 LEU A CD1   1 
ATOM   1038 C  CD2   . LEU A 1 147 ? 39.771 -9.659  14.415 1.00 11.04 ? 127 LEU A CD2   1 
ATOM   1039 N  N     . TYR A 1 148 ? 37.851 -8.415  18.790 1.00 10.69 ? 128 TYR A N     1 
ATOM   1040 C  CA    . TYR A 1 148 ? 37.821 -6.955  18.836 1.00 11.12 ? 128 TYR A CA    1 
ATOM   1041 C  C     . TYR A 1 148 ? 39.125 -6.439  18.230 1.00 13.36 ? 128 TYR A C     1 
ATOM   1042 O  O     . TYR A 1 148 ? 40.206 -6.926  18.547 1.00 13.32 ? 128 TYR A O     1 
ATOM   1043 C  CB    . TYR A 1 148 ? 37.656 -6.428  20.257 1.00 11.39 ? 128 TYR A CB    1 
ATOM   1044 C  CG    . TYR A 1 148 ? 36.232 -6.361  20.763 1.00 11.11 ? 128 TYR A CG    1 
ATOM   1045 C  CD1   . TYR A 1 148 ? 35.210 -5.806  19.983 1.00 10.93 ? 128 TYR A CD1   1 
ATOM   1046 C  CD2   . TYR A 1 148 ? 35.906 -6.812  22.042 1.00 10.92 ? 128 TYR A CD2   1 
ATOM   1047 C  CE1   . TYR A 1 148 ? 33.933 -5.736  20.454 1.00 9.56  ? 128 TYR A CE1   1 
ATOM   1048 C  CE2   . TYR A 1 148 ? 34.611 -6.716  22.543 1.00 12.36 ? 128 TYR A CE2   1 
ATOM   1049 C  CZ    . TYR A 1 148 ? 33.614 -6.176  21.731 1.00 11.83 ? 128 TYR A CZ    1 
ATOM   1050 O  OH    . TYR A 1 148 ? 32.314 -6.084  22.178 1.00 12.19 ? 128 TYR A OH    1 
ATOM   1051 N  N     . TRP A 1 149 ? 39.009 -5.483  17.320 1.00 11.03 ? 129 TRP A N     1 
ATOM   1052 C  CA    . TRP A 1 149 ? 40.165 -4.944  16.606 1.00 11.55 ? 129 TRP A CA    1 
ATOM   1053 C  C     . TRP A 1 149 ? 41.097 -4.184  17.547 1.00 15.37 ? 129 TRP A C     1 
ATOM   1054 O  O     . TRP A 1 149 ? 40.673 -3.322  18.312 1.00 17.71 ? 129 TRP A O     1 
ATOM   1055 C  CB    . TRP A 1 149 ? 39.676 -4.024  15.469 1.00 13.47 ? 129 TRP A CB    1 
ATOM   1056 C  CG    . TRP A 1 149 ? 40.742 -3.658  14.473 1.00 12.98 ? 129 TRP A CG    1 
ATOM   1057 C  CD1   . TRP A 1 149 ? 41.292 -2.413  14.273 1.00 15.88 ? 129 TRP A CD1   1 
ATOM   1058 C  CD2   . TRP A 1 149 ? 41.371 -4.527  13.537 1.00 11.28 ? 129 TRP A CD2   1 
ATOM   1059 N  NE1   . TRP A 1 149 ? 42.225 -2.472  13.267 1.00 16.34 ? 129 TRP A NE1   1 
ATOM   1060 C  CE2   . TRP A 1 149 ? 42.294 -3.756  12.797 1.00 14.60 ? 129 TRP A CE2   1 
ATOM   1061 C  CE3   . TRP A 1 149 ? 41.259 -5.896  13.259 1.00 11.64 ? 129 TRP A CE3   1 
ATOM   1062 C  CZ2   . TRP A 1 149 ? 43.094 -4.310  11.799 1.00 14.30 ? 129 TRP A CZ2   1 
ATOM   1063 C  CZ3   . TRP A 1 149 ? 42.041 -6.439  12.255 1.00 17.46 ? 129 TRP A CZ3   1 
ATOM   1064 C  CH2   . TRP A 1 149 ? 42.951 -5.646  11.540 1.00 19.86 ? 129 TRP A CH2   1 
ATOM   1065 N  N     . LEU A 1 150 ? 42.381 -4.520  17.470 1.00 14.03 ? 130 LEU A N     1 
ATOM   1066 C  CA    . LEU A 1 150 ? 43.389 -3.853  18.280 1.00 18.88 ? 130 LEU A CA    1 
ATOM   1067 C  C     . LEU A 1 150 ? 44.055 -2.700  17.535 1.00 25.58 ? 130 LEU A C     1 
ATOM   1068 O  O     . LEU A 1 150 ? 44.117 -2.710  16.303 1.00 25.05 ? 130 LEU A O     1 
ATOM   1069 C  CB    . LEU A 1 150 ? 44.451 -4.873  18.713 1.00 18.36 ? 130 LEU A CB    1 
ATOM   1070 C  CG    . LEU A 1 150 ? 43.985 -6.014  19.602 1.00 28.76 ? 130 LEU A CG    1 
ATOM   1071 C  CD1   . LEU A 1 150 ? 45.058 -7.096  19.717 1.00 31.47 ? 130 LEU A CD1   1 
ATOM   1072 C  CD2   . LEU A 1 150 ? 43.705 -5.419  20.953 1.00 44.11 ? 130 LEU A CD2   1 
ATOM   1073 N  N     . ARG A 1 151 ? 44.532 -1.733  18.322 1.00 43.53 ? 131 ARG A N     1 
ATOM   1074 C  CA    . ARG A 1 151 ? 45.643 -0.821  18.012 1.00 52.21 ? 131 ARG A CA    1 
ATOM   1075 C  C     . ARG A 1 151 ? 46.243 -0.937  16.634 1.00 36.44 ? 131 ARG A C     1 
ATOM   1076 O  O     . ARG A 1 151 ? 46.029 -0.099  15.765 1.00 49.07 ? 131 ARG A O     1 
ATOM   1077 C  CB    . ARG A 1 151 ? 46.773 -1.047  19.038 1.00 51.27 ? 131 ARG A CB    1 
ATOM   1078 C  CG    . ARG A 1 151 ? 47.951 -0.072  18.941 1.00 82.79 ? 131 ARG A CG    1 
ATOM   1079 C  CD    . ARG A 1 151 ? 48.719 0.046   20.256 1.00 81.06 ? 131 ARG A CD    1 
ATOM   1080 N  NE    . ARG A 1 151 ? 48.998 -1.250  20.873 1.00 98.44 ? 131 ARG A NE    1 
ATOM   1081 C  CZ    . ARG A 1 151 ? 49.220 -1.420  22.173 1.00 92.34 ? 131 ARG A CZ    1 
ATOM   1082 N  NH1   . ARG A 1 151 ? 49.194 -0.377  22.993 1.00 89.94 ? 131 ARG A NH1   1 
ATOM   1083 N  NH2   . ARG A 1 151 ? 49.467 -2.631  22.658 1.00 87.99 ? 131 ARG A NH2   1 
ATOM   1084 N  N     . ASP A 1 152 ? 47.030 -1.984  16.456 1.00 37.93 ? 132 ASP A N     1 
ATOM   1085 C  CA    . ASP A 1 152 ? 47.734 -2.171  15.208 1.00 55.68 ? 132 ASP A CA    1 
ATOM   1086 C  C     . ASP A 1 152 ? 47.349 -3.492  14.582 1.00 39.06 ? 132 ASP A C     1 
ATOM   1087 O  O     . ASP A 1 152 ? 47.087 -4.481  15.275 1.00 43.21 ? 132 ASP A O     1 
ATOM   1088 C  CB    . ASP A 1 152 ? 49.241 -2.089  15.430 1.00 53.41 ? 132 ASP A CB    1 
ATOM   1089 C  CG    . ASP A 1 152 ? 49.762 -3.225  16.273 1.00 64.81 ? 132 ASP A CG    1 
ATOM   1090 O  OD1   . ASP A 1 152 ? 49.024 -3.673  17.174 1.00 80.17 ? 132 ASP A OD1   1 
ATOM   1091 O  OD2   . ASP A 1 152 ? 50.909 -3.662  16.049 1.00 54.59 ? 132 ASP A OD2   1 
ATOM   1092 N  N     . GLU A 1 153 ? 47.300 -3.478  13.258 1.00 33.36 ? 133 GLU A N     1 
ATOM   1093 C  CA    . GLU A 1 153 ? 46.923 -4.633  12.485 1.00 26.99 ? 133 GLU A CA    1 
ATOM   1094 C  C     . GLU A 1 153 ? 47.703 -5.887  12.908 1.00 38.68 ? 133 GLU A C     1 
ATOM   1095 O  O     . GLU A 1 153 ? 47.120 -6.958  13.033 1.00 23.99 ? 133 GLU A O     1 
ATOM   1096 C  CB    . GLU A 1 153 ? 47.122 -4.344  10.993 1.00 27.16 ? 133 GLU A CB    1 
ATOM   1097 C  CG    . GLU A 1 153 ? 46.726 -5.487  10.089 1.00 31.33 ? 133 GLU A CG    1 
ATOM   1098 C  CD    . GLU A 1 153 ? 46.709 -5.105  8.625  1.00 35.91 ? 133 GLU A CD    1 
ATOM   1099 O  OE1   . GLU A 1 153 ? 46.142 -4.042  8.294  1.00 48.23 ? 133 GLU A OE1   1 
ATOM   1100 O  OE2   . GLU A 1 153 ? 47.247 -5.880  7.802  1.00 43.85 ? 133 GLU A OE2   1 
ATOM   1101 N  N     . LYS A 1 154 ? 49.003 -5.760  13.167 1.00 29.36 ? 134 LYS A N     1 
ATOM   1102 C  CA    . LYS A 1 154 ? 49.817 -6.956  13.412 1.00 27.48 ? 134 LYS A CA    1 
ATOM   1103 C  C     . LYS A 1 154 ? 49.360 -7.707  14.670 1.00 23.62 ? 134 LYS A C     1 
ATOM   1104 O  O     . LYS A 1 154 ? 49.315 -8.935  14.685 1.00 27.54 ? 134 LYS A O     1 
ATOM   1105 C  CB    . LYS A 1 154 ? 51.314 -6.592  13.505 1.00 37.62 ? 134 LYS A CB    1 
ATOM   1106 C  CG    . LYS A 1 154 ? 51.861 -6.448  14.922 1.00 65.86 ? 134 LYS A CG    1 
ATOM   1107 C  CD    . LYS A 1 154 ? 53.272 -5.879  14.961 1.00 76.32 ? 134 LYS A CD    1 
ATOM   1108 C  CE    . LYS A 1 154 ? 53.873 -6.019  16.357 1.00 79.06 ? 134 LYS A CE    1 
ATOM   1109 N  NZ    . LYS A 1 154 ? 53.990 -7.444  16.779 1.00 76.91 ? 134 LYS A NZ    1 
ATOM   1110 N  N     . ARG A 1 155 ? 48.989 -6.987  15.723 1.00 21.32 ? 135 ARG A N     1 
ATOM   1111 C  CA    . ARG A 1 155 ? 48.570 -7.666  16.934 1.00 24.82 ? 135 ARG A CA    1 
ATOM   1112 C  C     . ARG A 1 155 ? 47.161 -8.254  16.772 1.00 24.90 ? 135 ARG A C     1 
ATOM   1113 O  O     . ARG A 1 155 ? 46.860 -9.317  17.315 1.00 19.70 ? 135 ARG A O     1 
ATOM   1114 C  CB    . ARG A 1 155 ? 48.640 -6.725  18.135 1.00 31.85 ? 135 ARG A CB    1 
ATOM   1115 C  CG    . ARG A 1 155 ? 50.081 -6.382  18.505 1.00 49.41 ? 135 ARG A CG    1 
ATOM   1116 C  CD    . ARG A 1 155 ? 50.188 -5.527  19.751 1.00 67.25 ? 135 ARG A CD    1 
ATOM   1117 N  NE    . ARG A 1 155 ? 48.994 -5.612  20.583 1.00 84.75 ? 135 ARG A NE    1 
ATOM   1118 C  CZ    . ARG A 1 155 ? 48.992 -6.021  21.847 1.00 94.64 ? 135 ARG A CZ    1 
ATOM   1119 N  NH1   . ARG A 1 155 ? 50.121 -6.406  22.428 1.00 98.47 ? 135 ARG A NH1   1 
ATOM   1120 N  NH2   . ARG A 1 155 ? 47.855 -6.061  22.527 1.00 88.85 ? 135 ARG A NH2   1 
ATOM   1121 N  N     . SER A 1 156 ? 46.308 -7.565  16.017 1.00 24.39 ? 136 SER A N     1 
ATOM   1122 C  CA    . SER A 1 156 ? 44.983 -8.108  15.729 1.00 15.50 ? 136 SER A CA    1 
ATOM   1123 C  C     . SER A 1 156 ? 45.110 -9.426  15.003 1.00 15.15 ? 136 SER A C     1 
ATOM   1124 O  O     . SER A 1 156 ? 44.416 -10.405 15.316 1.00 17.42 ? 136 SER A O     1 
ATOM   1125 C  CB    . SER A 1 156 ? 44.148 -7.125  14.890 1.00 14.04 ? 136 SER A CB    1 
ATOM   1126 O  OG    . SER A 1 156 ? 43.914 -5.932  15.614 1.00 17.95 ? 136 SER A OG    1 
ATOM   1127 N  N     . LEU A 1 157 ? 45.999 -9.453  14.020 1.00 15.91 ? 137 LEU A N     1 
ATOM   1128 C  CA    . LEU A 1 157 ? 46.169 -10.628 13.197 1.00 17.37 ? 137 LEU A CA    1 
ATOM   1129 C  C     . LEU A 1 157 ? 46.858 -11.742 14.003 1.00 23.02 ? 137 LEU A C     1 
ATOM   1130 O  O     . LEU A 1 157 ? 46.618 -12.914 13.751 1.00 17.92 ? 137 LEU A O     1 
ATOM   1131 C  CB    . LEU A 1 157 ? 46.941 -10.279 11.923 1.00 20.19 ? 137 LEU A CB    1 
ATOM   1132 C  CG    . LEU A 1 157 ? 46.191 -9.360  10.936 1.00 20.35 ? 137 LEU A CG    1 
ATOM   1133 C  CD1   . LEU A 1 157 ? 46.964 -9.188  9.640  1.00 23.94 ? 137 LEU A CD1   1 
ATOM   1134 C  CD2   . LEU A 1 157 ? 44.782 -9.861  10.622 1.00 19.27 ? 137 LEU A CD2   1 
ATOM   1135 N  N     A ASP A 1 158 ? 47.682 -11.373 14.979 0.50 22.90 ? 138 ASP A N     1 
ATOM   1136 N  N     B ASP A 1 158 ? 47.692 -11.376 14.977 0.50 22.91 ? 138 ASP A N     1 
ATOM   1137 C  CA    A ASP A 1 158 ? 48.318 -12.377 15.831 0.50 26.92 ? 138 ASP A CA    1 
ATOM   1138 C  CA    B ASP A 1 158 ? 48.293 -12.386 15.856 0.50 26.82 ? 138 ASP A CA    1 
ATOM   1139 C  C     A ASP A 1 158 ? 47.293 -13.065 16.744 0.50 26.06 ? 138 ASP A C     1 
ATOM   1140 C  C     B ASP A 1 158 ? 47.216 -13.111 16.635 0.50 26.38 ? 138 ASP A C     1 
ATOM   1141 O  O     A ASP A 1 158 ? 47.451 -14.224 17.109 0.50 20.27 ? 138 ASP A O     1 
ATOM   1142 O  O     B ASP A 1 158 ? 47.266 -14.330 16.807 0.50 19.61 ? 138 ASP A O     1 
ATOM   1143 C  CB    A ASP A 1 158 ? 49.443 -11.749 16.671 0.50 27.16 ? 138 ASP A CB    1 
ATOM   1144 C  CB    B ASP A 1 158 ? 49.295 -11.768 16.841 0.50 25.56 ? 138 ASP A CB    1 
ATOM   1145 C  CG    A ASP A 1 158 ? 50.676 -11.381 15.837 0.50 34.91 ? 138 ASP A CG    1 
ATOM   1146 C  CG    B ASP A 1 158 ? 49.888 -12.805 17.801 0.50 23.62 ? 138 ASP A CG    1 
ATOM   1147 O  OD1   A ASP A 1 158 ? 50.722 -11.714 14.634 0.50 32.44 ? 138 ASP A OD1   1 
ATOM   1148 O  OD1   B ASP A 1 158 ? 50.620 -13.701 17.332 0.50 32.78 ? 138 ASP A OD1   1 
ATOM   1149 O  OD2   A ASP A 1 158 ? 51.609 -10.761 16.396 0.50 34.64 ? 138 ASP A OD2   1 
ATOM   1150 O  OD2   B ASP A 1 158 ? 49.626 -12.724 19.020 0.50 38.78 ? 138 ASP A OD2   1 
ATOM   1151 N  N     . LEU A 1 159 ? 46.238 -12.346 17.108 1.00 18.74 ? 139 LEU A N     1 
ATOM   1152 C  CA    . LEU A 1 159 ? 45.159 -12.903 17.892 1.00 20.18 ? 139 LEU A CA    1 
ATOM   1153 C  C     . LEU A 1 159 ? 44.382 -13.887 17.027 1.00 16.51 ? 139 LEU A C     1 
ATOM   1154 O  O     . LEU A 1 159 ? 44.010 -14.986 17.455 1.00 16.09 ? 139 LEU A O     1 
ATOM   1155 C  CB    . LEU A 1 159 ? 44.259 -11.779 18.402 1.00 23.30 ? 139 LEU A CB    1 
ATOM   1156 C  CG    . LEU A 1 159 ? 43.472 -11.945 19.680 1.00 30.58 ? 139 LEU A CG    1 
ATOM   1157 C  CD1   . LEU A 1 159 ? 44.332 -12.542 20.790 1.00 26.47 ? 139 LEU A CD1   1 
ATOM   1158 C  CD2   . LEU A 1 159 ? 42.925 -10.573 20.078 1.00 23.08 ? 139 LEU A CD2   1 
ATOM   1159 N  N     . VAL A 1 160 ? 44.143 -13.497 15.781 1.00 15.87 ? 140 VAL A N     1 
ATOM   1160 C  CA    . VAL A 1 160 ? 43.441 -14.378 14.873 1.00 13.44 ? 140 VAL A CA    1 
ATOM   1161 C  C     . VAL A 1 160 ? 44.262 -15.655 14.641 1.00 14.02 ? 140 VAL A C     1 
ATOM   1162 O  O     . VAL A 1 160 ? 43.720 -16.752 14.606 1.00 15.50 ? 140 VAL A O     1 
ATOM   1163 C  CB    . VAL A 1 160 ? 43.152 -13.661 13.538 1.00 13.26 ? 140 VAL A CB    1 
ATOM   1164 C  CG1   . VAL A 1 160 ? 42.676 -14.639 12.463 1.00 14.76 ? 140 VAL A CG1   1 
ATOM   1165 C  CG2   . VAL A 1 160 ? 42.144 -12.518 13.777 1.00 14.86 ? 140 VAL A CG2   1 
ATOM   1166 N  N     . ARG A 1 161 ? 45.578 -15.492 14.496 1.00 16.01 ? 141 ARG A N     1 
ATOM   1167 C  CA    . ARG A 1 161 ? 46.444 -16.644 14.242 1.00 16.55 ? 141 ARG A CA    1 
ATOM   1168 C  C     . ARG A 1 161 ? 46.463 -17.566 15.462 1.00 13.03 ? 141 ARG A C     1 
ATOM   1169 O  O     . ARG A 1 161 ? 46.385 -18.779 15.306 1.00 15.46 ? 141 ARG A O     1 
ATOM   1170 C  CB    . ARG A 1 161 ? 47.856 -16.174 13.873 1.00 18.29 ? 141 ARG A CB    1 
ATOM   1171 C  CG    . ARG A 1 161 ? 48.840 -17.314 13.584 1.00 26.78 ? 141 ARG A CG    1 
ATOM   1172 C  CD    . ARG A 1 161 ? 48.373 -18.232 12.441 1.00 36.17 ? 141 ARG A CD    1 
ATOM   1173 N  NE    . ARG A 1 161 ? 47.957 -17.517 11.230 1.00 44.47 ? 141 ARG A NE    1 
ATOM   1174 C  CZ    . ARG A 1 161 ? 48.779 -17.142 10.251 1.00 65.24 ? 141 ARG A CZ    1 
ATOM   1175 N  NH1   . ARG A 1 161 ? 50.077 -17.404 10.330 1.00 45.55 ? 141 ARG A NH1   1 
ATOM   1176 N  NH2   . ARG A 1 161 ? 48.302 -16.500 9.188  1.00 55.29 ? 141 ARG A NH2   1 
ATOM   1177 N  N     . ARG A 1 162 ? 46.514 -16.992 16.664 1.00 14.57 ? 142 ARG A N     1 
ATOM   1178 C  CA    . ARG A 1 162 ? 46.394 -17.792 17.885 1.00 15.55 ? 142 ARG A CA    1 
ATOM   1179 C  C     . ARG A 1 162 ? 45.126 -18.606 17.902 1.00 21.52 ? 142 ARG A C     1 
ATOM   1180 O  O     . ARG A 1 162 ? 45.131 -19.788 18.252 1.00 16.77 ? 142 ARG A O     1 
ATOM   1181 C  CB    . ARG A 1 162 ? 46.405 -16.925 19.132 1.00 17.44 ? 142 ARG A CB    1 
ATOM   1182 C  CG    . ARG A 1 162 ? 47.765 -16.454 19.551 1.00 18.41 ? 142 ARG A CG    1 
ATOM   1183 C  CD    . ARG A 1 162 ? 47.635 -15.480 20.684 1.00 18.98 ? 142 ARG A CD    1 
ATOM   1184 N  NE    . ARG A 1 162 ? 47.151 -16.102 21.904 1.00 16.01 ? 142 ARG A NE    1 
ATOM   1185 C  CZ    . ARG A 1 162 ? 46.923 -15.433 23.026 1.00 14.77 ? 142 ARG A CZ    1 
ATOM   1186 N  NH1   . ARG A 1 162 ? 47.120 -14.117 23.063 1.00 18.19 ? 142 ARG A NH1   1 
ATOM   1187 N  NH2   . ARG A 1 162 ? 46.495 -16.058 24.116 1.00 16.88 ? 142 ARG A NH2   1 
ATOM   1188 N  N     . ALA A 1 163 ? 44.016 -17.965 17.541 1.00 14.64 ? 143 ALA A N     1 
ATOM   1189 C  CA    . ALA A 1 163 ? 42.752 -18.658 17.586 1.00 14.33 ? 143 ALA A CA    1 
ATOM   1190 C  C     . ALA A 1 163 ? 42.733 -19.826 16.607 1.00 14.37 ? 143 ALA A C     1 
ATOM   1191 O  O     . ALA A 1 163 ? 42.279 -20.922 16.934 1.00 15.95 ? 143 ALA A O     1 
ATOM   1192 C  CB    . ALA A 1 163 ? 41.603 -17.666 17.279 1.00 13.05 ? 143 ALA A CB    1 
ATOM   1193 N  N     . GLU A 1 164 ? 43.215 -19.584 15.395 1.00 13.67 ? 144 GLU A N     1 
ATOM   1194 C  CA    . GLU A 1 164 ? 43.238 -20.603 14.366 1.00 13.03 ? 144 GLU A CA    1 
ATOM   1195 C  C     . GLU A 1 164 ? 44.176 -21.755 14.776 1.00 16.19 ? 144 GLU A C     1 
ATOM   1196 O  O     . GLU A 1 164 ? 43.828 -22.920 14.612 1.00 16.58 ? 144 GLU A O     1 
ATOM   1197 C  CB    . GLU A 1 164 ? 43.664 -19.993 13.022 1.00 18.09 ? 144 GLU A CB    1 
ATOM   1198 C  CG    . GLU A 1 164 ? 43.528 -20.952 11.855 1.00 18.72 ? 144 GLU A CG    1 
ATOM   1199 C  CD    . GLU A 1 164 ? 43.607 -20.254 10.497 1.00 30.99 ? 144 GLU A CD    1 
ATOM   1200 O  OE1   . GLU A 1 164 ? 43.853 -19.028 10.465 1.00 28.82 ? 144 GLU A OE1   1 
ATOM   1201 O  OE2   . GLU A 1 164 ? 43.419 -20.937 9.467  1.00 34.43 ? 144 GLU A OE2   1 
ATOM   1202 N  N     . ASP A 1 165 ? 45.340 -21.409 15.315 1.00 17.53 ? 145 ASP A N     1 
ATOM   1203 C  CA    . ASP A 1 165 ? 46.288 -22.434 15.789 1.00 20.27 ? 145 ASP A CA    1 
ATOM   1204 C  C     . ASP A 1 165 ? 45.684 -23.290 16.895 1.00 21.70 ? 145 ASP A C     1 
ATOM   1205 O  O     . ASP A 1 165 ? 45.984 -24.478 16.996 1.00 20.50 ? 145 ASP A O     1 
ATOM   1206 C  CB    . ASP A 1 165 ? 47.580 -21.800 16.305 1.00 17.75 ? 145 ASP A CB    1 
ATOM   1207 C  CG    . ASP A 1 165 ? 48.469 -21.267 15.192 1.00 24.38 ? 145 ASP A CG    1 
ATOM   1208 O  OD1   . ASP A 1 165 ? 48.238 -21.597 14.012 1.00 27.15 ? 145 ASP A OD1   1 
ATOM   1209 O  OD2   . ASP A 1 165 ? 49.415 -20.518 15.518 1.00 33.37 ? 145 ASP A OD2   1 
ATOM   1210 N  N     . ALA A 1 166 ? 44.837 -22.689 17.728 1.00 17.85 ? 146 ALA A N     1 
ATOM   1211 C  CA    . ALA A 1 166 ? 44.221 -23.407 18.855 1.00 18.46 ? 146 ALA A CA    1 
ATOM   1212 C  C     . ALA A 1 166 ? 43.016 -24.252 18.447 1.00 16.46 ? 146 ALA A C     1 
ATOM   1213 O  O     . ALA A 1 166 ? 42.442 -24.956 19.281 1.00 17.31 ? 146 ALA A O     1 
ATOM   1214 C  CB    . ALA A 1 166 ? 43.815 -22.416 19.955 1.00 18.48 ? 146 ALA A CB    1 
ATOM   1215 N  N     . GLY A 1 167 ? 42.613 -24.171 17.180 1.00 15.73 ? 147 GLY A N     1 
ATOM   1216 C  CA    . GLY A 1 167 ? 41.512 -24.970 16.679 1.00 16.31 ? 147 GLY A CA    1 
ATOM   1217 C  C     . GLY A 1 167 ? 40.152 -24.293 16.607 1.00 16.96 ? 147 GLY A C     1 
ATOM   1218 O  O     . GLY A 1 167 ? 39.124 -24.969 16.443 1.00 16.77 ? 147 GLY A O     1 
ATOM   1219 N  N     . CYS A 1 168 ? 40.127 -22.968 16.725 1.00 14.49 ? 148 CYS A N     1 
ATOM   1220 C  CA    . CYS A 1 168 ? 38.847 -22.270 16.572 1.00 14.00 ? 148 CYS A CA    1 
ATOM   1221 C  C     . CYS A 1 168 ? 38.408 -22.409 15.128 1.00 15.73 ? 148 CYS A C     1 
ATOM   1222 O  O     . CYS A 1 168 ? 39.251 -22.511 14.241 1.00 18.56 ? 148 CYS A O     1 
ATOM   1223 C  CB    . CYS A 1 168 ? 38.981 -20.807 16.962 1.00 11.63 ? 148 CYS A CB    1 
ATOM   1224 S  SG    . CYS A 1 168 ? 39.278 -20.609 18.723 1.00 16.51 ? 148 CYS A SG    1 
ATOM   1225 N  N     . GLU A 1 169 ? 37.098 -22.410 14.884 1.00 12.83 ? 149 GLU A N     1 
ATOM   1226 C  CA    . GLU A 1 169 ? 36.614 -22.758 13.558 1.00 14.91 ? 149 GLU A CA    1 
ATOM   1227 C  C     . GLU A 1 169 ? 35.934 -21.643 12.805 1.00 13.37 ? 149 GLU A C     1 
ATOM   1228 O  O     . GLU A 1 169 ? 35.570 -21.822 11.642 1.00 16.23 ? 149 GLU A O     1 
ATOM   1229 C  CB    . GLU A 1 169 ? 35.682 -23.935 13.662 1.00 25.96 ? 149 GLU A CB    1 
ATOM   1230 C  CG    . GLU A 1 169 ? 36.443 -25.032 14.312 1.00 35.12 ? 149 GLU A CG    1 
ATOM   1231 C  CD    . GLU A 1 169 ? 35.820 -26.347 14.122 1.00 58.94 ? 149 GLU A CD    1 
ATOM   1232 O  OE1   . GLU A 1 169 ? 34.625 -26.478 14.436 1.00 58.12 ? 149 GLU A OE1   1 
ATOM   1233 O  OE2   . GLU A 1 169 ? 36.531 -27.252 13.642 1.00 59.67 ? 149 GLU A OE2   1 
ATOM   1234 N  N     . ALA A 1 170 ? 35.807 -20.492 13.459 1.00 11.72 ? 150 ALA A N     1 
ATOM   1235 C  CA    . ALA A 1 170 ? 35.286 -19.299 12.795 1.00 10.94 ? 150 ALA A CA    1 
ATOM   1236 C  C     . ALA A 1 170 ? 35.803 -18.094 13.543 1.00 11.49 ? 150 ALA A C     1 
ATOM   1237 O  O     . ALA A 1 170 ? 36.062 -18.166 14.735 1.00 11.94 ? 150 ALA A O     1 
ATOM   1238 C  CB    . ALA A 1 170 ? 33.744 -19.307 12.774 1.00 10.77 ? 150 ALA A CB    1 
ATOM   1239 N  N     . ILE A 1 171 ? 35.961 -16.979 12.838 1.00 9.34  ? 151 ILE A N     1 
ATOM   1240 C  CA    . ILE A 1 171 ? 36.344 -15.733 13.465 1.00 10.01 ? 151 ILE A CA    1 
ATOM   1241 C  C     . ILE A 1 171 ? 35.112 -14.835 13.458 1.00 10.53 ? 151 ILE A C     1 
ATOM   1242 O  O     . ILE A 1 171 ? 34.629 -14.476 12.387 1.00 12.73 ? 151 ILE A O     1 
ATOM   1243 C  CB    . ILE A 1 171 ? 37.496 -15.030 12.715 1.00 10.93 ? 151 ILE A CB    1 
ATOM   1244 C  CG1   . ILE A 1 171 ? 38.750 -15.934 12.642 1.00 12.07 ? 151 ILE A CG1   1 
ATOM   1245 C  CG2   . ILE A 1 171 ? 37.791 -13.658 13.332 1.00 9.71  ? 151 ILE A CG2   1 
ATOM   1246 C  CD1   . ILE A 1 171 ? 39.329 -16.353 14.017 1.00 13.44 ? 151 ILE A CD1   1 
ATOM   1247 N  N     . VAL A 1 172 ? 34.603 -14.517 14.639 1.00 7.56  ? 152 VAL A N     1 
ATOM   1248 C  CA    . VAL A 1 172 ? 33.427 -13.659 14.782 1.00 7.27  ? 152 VAL A CA    1 
ATOM   1249 C  C     . VAL A 1 172 ? 33.951 -12.255 15.024 1.00 8.22  ? 152 VAL A C     1 
ATOM   1250 O  O     . VAL A 1 172 ? 34.300 -11.888 16.139 1.00 9.23  ? 152 VAL A O     1 
ATOM   1251 C  CB    . VAL A 1 172 ? 32.522 -14.152 15.931 1.00 8.25  ? 152 VAL A CB    1 
ATOM   1252 C  CG1   . VAL A 1 172 ? 31.300 -13.211 16.123 1.00 8.13  ? 152 VAL A CG1   1 
ATOM   1253 C  CG2   . VAL A 1 172 ? 32.049 -15.572 15.633 1.00 9.50  ? 152 VAL A CG2   1 
ATOM   1254 N  N     . PHE A 1 173 ? 34.021 -11.454 13.966 1.00 7.71  ? 153 PHE A N     1 
ATOM   1255 C  CA    . PHE A 1 173 ? 34.608 -10.123 14.059 1.00 7.94  ? 153 PHE A CA    1 
ATOM   1256 C  C     . PHE A 1 173 ? 33.495 -9.161  14.472 1.00 6.98  ? 153 PHE A C     1 
ATOM   1257 O  O     . PHE A 1 173 ? 32.530 -8.985  13.729 1.00 8.07  ? 153 PHE A O     1 
ATOM   1258 C  CB    . PHE A 1 173 ? 35.240 -9.781  12.700 1.00 7.84  ? 153 PHE A CB    1 
ATOM   1259 C  CG    . PHE A 1 173 ? 36.103 -8.547  12.677 1.00 7.46  ? 153 PHE A CG    1 
ATOM   1260 C  CD1   . PHE A 1 173 ? 36.224 -7.689  13.763 1.00 14.02 ? 153 PHE A CD1   1 
ATOM   1261 C  CD2   . PHE A 1 173 ? 36.901 -8.323  11.561 1.00 11.04 ? 153 PHE A CD2   1 
ATOM   1262 C  CE1   . PHE A 1 173 ? 37.069 -6.555  13.695 1.00 14.71 ? 153 PHE A CE1   1 
ATOM   1263 C  CE2   . PHE A 1 173 ? 37.751 -7.191  11.495 1.00 11.64 ? 153 PHE A CE2   1 
ATOM   1264 C  CZ    . PHE A 1 173 ? 37.821 -6.318  12.549 1.00 12.27 ? 153 PHE A CZ    1 
ATOM   1265 N  N     . THR A 1 174 ? 33.587 -8.589  15.666 1.00 7.37  ? 154 THR A N     1 
ATOM   1266 C  CA    . THR A 1 174 ? 32.536 -7.678  16.145 1.00 6.21  ? 154 THR A CA    1 
ATOM   1267 C  C     . THR A 1 174 ? 32.757 -6.326  15.491 1.00 9.14  ? 154 THR A C     1 
ATOM   1268 O  O     . THR A 1 174 ? 33.829 -5.733  15.616 1.00 10.36 ? 154 THR A O     1 
ATOM   1269 C  CB    . THR A 1 174 ? 32.537 -7.570  17.657 1.00 9.88  ? 154 THR A CB    1 
ATOM   1270 O  OG1   . THR A 1 174 ? 32.363 -8.886  18.173 1.00 9.70  ? 154 THR A OG1   1 
ATOM   1271 C  CG2   . THR A 1 174 ? 31.372 -6.696  18.149 1.00 9.81  ? 154 THR A CG2   1 
ATOM   1272 N  N     . VAL A 1 175 ? 31.726 -5.851  14.782 1.00 8.40  ? 155 VAL A N     1 
ATOM   1273 C  CA    . VAL A 1 175 ? 31.888 -4.671  13.924 1.00 10.02 ? 155 VAL A CA    1 
ATOM   1274 C  C     . VAL A 1 175 ? 31.020 -3.499  14.368 1.00 10.89 ? 155 VAL A C     1 
ATOM   1275 O  O     . VAL A 1 175 ? 30.992 -2.470  13.670 1.00 11.64 ? 155 VAL A O     1 
ATOM   1276 C  CB    . VAL A 1 175 ? 31.570 -5.003  12.442 1.00 9.03  ? 155 VAL A CB    1 
ATOM   1277 C  CG1   . VAL A 1 175 ? 32.482 -6.144  11.948 1.00 13.02 ? 155 VAL A CG1   1 
ATOM   1278 C  CG2   . VAL A 1 175 ? 30.084 -5.337  12.238 1.00 11.40 ? 155 VAL A CG2   1 
ATOM   1279 N  N     . ASP A 1 176 ? 30.346 -3.625  15.521 1.00 9.73  ? 156 ASP A N     1 
ATOM   1280 C  CA    . ASP A 1 176 ? 29.494 -2.531  15.998 1.00 9.26  ? 156 ASP A CA    1 
ATOM   1281 C  C     . ASP A 1 176 ? 30.050 -1.828  17.220 1.00 9.89  ? 156 ASP A C     1 
ATOM   1282 O  O     . ASP A 1 176 ? 29.334 -1.111  17.925 1.00 10.13 ? 156 ASP A O     1 
ATOM   1283 C  CB    . ASP A 1 176 ? 28.028 -3.009  16.243 1.00 8.20  ? 156 ASP A CB    1 
ATOM   1284 C  CG    . ASP A 1 176 ? 27.903 -4.148  17.245 1.00 10.07 ? 156 ASP A CG    1 
ATOM   1285 O  OD1   . ASP A 1 176 ? 28.915 -4.574  17.834 1.00 11.83 ? 156 ASP A OD1   1 
ATOM   1286 O  OD2   . ASP A 1 176 ? 26.750 -4.620  17.423 1.00 8.98  ? 156 ASP A OD2   1 
ATOM   1287 N  N     . VAL A 1 177 ? 31.362 -2.001  17.452 1.00 10.62 ? 157 VAL A N     1 
ATOM   1288 C  CA    . VAL A 1 177 ? 32.001 -1.393  18.617 1.00 10.12 ? 157 VAL A CA    1 
ATOM   1289 C  C     . VAL A 1 177 ? 33.219 -0.605  18.174 1.00 12.54 ? 157 VAL A C     1 
ATOM   1290 O  O     . VAL A 1 177 ? 34.364 -1.011  18.416 1.00 13.65 ? 157 VAL A O     1 
ATOM   1291 C  CB    . VAL A 1 177 ? 32.412 -2.465  19.675 1.00 10.77 ? 157 VAL A CB    1 
ATOM   1292 C  CG1   . VAL A 1 177 ? 32.967 -1.805  20.923 1.00 13.01 ? 157 VAL A CG1   1 
ATOM   1293 C  CG2   . VAL A 1 177 ? 31.214 -3.327  20.043 1.00 9.97  ? 157 VAL A CG2   1 
ATOM   1294 N  N     . PRO A 1 178 ? 32.993 0.530   17.499 1.00 11.31 ? 158 PRO A N     1 
ATOM   1295 C  CA    . PRO A 1 178 ? 34.163 1.393   17.273 1.00 13.43 ? 158 PRO A CA    1 
ATOM   1296 C  C     . PRO A 1 178 ? 34.732 1.854   18.614 1.00 13.43 ? 158 PRO A C     1 
ATOM   1297 O  O     . PRO A 1 178 ? 35.956 2.055   18.756 1.00 18.34 ? 158 PRO A O     1 
ATOM   1298 C  CB    . PRO A 1 178 ? 33.587 2.566   16.457 1.00 14.78 ? 158 PRO A CB    1 
ATOM   1299 C  CG    . PRO A 1 178 ? 32.117 2.595   16.823 1.00 14.25 ? 158 PRO A CG    1 
ATOM   1300 C  CD    . PRO A 1 178 ? 31.744 1.121   16.978 1.00 11.89 ? 158 PRO A CD    1 
ATOM   1301 N  N     . TRP A 1 179 ? 33.840 2.011   19.587 1.00 14.73 ? 159 TRP A N     1 
ATOM   1302 C  CA    . TRP A 1 179 ? 34.152 2.143   21.004 1.00 14.62 ? 159 TRP A CA    1 
ATOM   1303 C  C     . TRP A 1 179 ? 32.969 1.610   21.782 1.00 17.37 ? 159 TRP A C     1 
ATOM   1304 O  O     . TRP A 1 179 ? 31.898 1.398   21.197 1.00 13.13 ? 159 TRP A O     1 
ATOM   1305 C  CB    . TRP A 1 179 ? 34.440 3.601   21.387 1.00 14.88 ? 159 TRP A CB    1 
ATOM   1306 C  CG    . TRP A 1 179 ? 33.396 4.604   20.932 1.00 12.86 ? 159 TRP A CG    1 
ATOM   1307 C  CD1   . TRP A 1 179 ? 32.174 4.829   21.487 1.00 18.32 ? 159 TRP A CD1   1 
ATOM   1308 C  CD2   . TRP A 1 179 ? 33.520 5.518   19.835 1.00 12.11 ? 159 TRP A CD2   1 
ATOM   1309 N  NE1   . TRP A 1 179 ? 31.519 5.841   20.801 1.00 15.75 ? 159 TRP A NE1   1 
ATOM   1310 C  CE2   . TRP A 1 179 ? 32.330 6.275   19.785 1.00 13.96 ? 159 TRP A CE2   1 
ATOM   1311 C  CE3   . TRP A 1 179 ? 34.524 5.768   18.889 1.00 13.88 ? 159 TRP A CE3   1 
ATOM   1312 C  CZ2   . TRP A 1 179 ? 32.123 7.276   18.835 1.00 13.92 ? 159 TRP A CZ2   1 
ATOM   1313 C  CZ3   . TRP A 1 179 ? 34.316 6.753   17.943 1.00 16.61 ? 159 TRP A CZ3   1 
ATOM   1314 C  CH2   . TRP A 1 179 ? 33.128 7.501   17.928 1.00 16.57 ? 159 TRP A CH2   1 
ATOM   1315 N  N     . MET A 1 180 ? 33.143 1.367   23.081 1.00 15.86 ? 160 MET A N     1 
ATOM   1316 C  CA    . MET A 1 180 ? 32.045 0.863   23.910 1.00 17.97 ? 160 MET A CA    1 
ATOM   1317 C  C     . MET A 1 180 ? 30.946 1.884   24.141 1.00 15.77 ? 160 MET A C     1 
ATOM   1318 O  O     . MET A 1 180 ? 31.220 3.074   24.346 1.00 17.57 ? 160 MET A O     1 
ATOM   1319 C  CB    . MET A 1 180 ? 32.546 0.405   25.287 1.00 26.80 ? 160 MET A CB    1 
ATOM   1320 C  CG    . MET A 1 180 ? 33.212 -0.935  25.306 1.00 33.59 ? 160 MET A CG    1 
ATOM   1321 S  SD    . MET A 1 180 ? 32.161 -2.306  24.787 1.00 32.85 ? 160 MET A SD    1 
ATOM   1322 C  CE    . MET A 1 180 ? 33.482 -3.520  24.582 1.00 28.59 ? 160 MET A CE    1 
ATOM   1323 N  N     . GLY A 1 181 ? 29.707 1.407   24.149 1.00 17.18 ? 161 GLY A N     1 
ATOM   1324 C  CA    . GLY A 1 181 ? 28.560 2.236   24.456 1.00 15.68 ? 161 GLY A CA    1 
ATOM   1325 C  C     . GLY A 1 181 ? 28.546 2.776   25.876 1.00 20.55 ? 161 GLY A C     1 
ATOM   1326 O  O     . GLY A 1 181 ? 29.327 2.336   26.729 1.00 21.63 ? 161 GLY A O     1 
ATOM   1327 N  N     A ARG A 1 182 ? 27.653 3.730   26.127 0.50 15.92 ? 162 ARG A N     1 
ATOM   1328 N  N     B ARG A 1 182 ? 27.644 3.719   26.127 0.50 15.91 ? 162 ARG A N     1 
ATOM   1329 C  CA    A ARG A 1 182 ? 27.536 4.382   27.431 0.50 16.40 ? 162 ARG A CA    1 
ATOM   1330 C  CA    B ARG A 1 182 ? 27.526 4.375   27.427 0.50 16.39 ? 162 ARG A CA    1 
ATOM   1331 C  C     A ARG A 1 182 ? 26.514 3.673   28.313 0.50 16.20 ? 162 ARG A C     1 
ATOM   1332 C  C     B ARG A 1 182 ? 26.510 3.667   28.312 0.50 16.21 ? 162 ARG A C     1 
ATOM   1333 O  O     A ARG A 1 182 ? 25.315 3.923   28.212 0.50 17.37 ? 162 ARG A O     1 
ATOM   1334 O  O     B ARG A 1 182 ? 25.309 3.915   28.216 0.50 17.36 ? 162 ARG A O     1 
ATOM   1335 C  CB    A ARG A 1 182 ? 27.151 5.860   27.262 0.50 20.62 ? 162 ARG A CB    1 
ATOM   1336 C  CB    B ARG A 1 182 ? 27.128 5.844   27.252 0.50 20.64 ? 162 ARG A CB    1 
ATOM   1337 C  CG    A ARG A 1 182 ? 28.295 6.760   26.799 0.50 20.34 ? 162 ARG A CG    1 
ATOM   1338 C  CG    B ARG A 1 182 ? 28.139 6.678   26.479 0.50 20.47 ? 162 ARG A CG    1 
ATOM   1339 C  CD    A ARG A 1 182 ? 27.826 8.200   26.505 0.50 27.77 ? 162 ARG A CD    1 
ATOM   1340 C  CD    B ARG A 1 182 ? 27.624 8.102   26.213 0.50 26.42 ? 162 ARG A CD    1 
ATOM   1341 N  NE    A ARG A 1 182 ? 27.452 8.938   27.713 0.50 23.61 ? 162 ARG A NE    1 
ATOM   1342 N  NE    B ARG A 1 182 ? 27.433 8.872   27.443 0.50 22.33 ? 162 ARG A NE    1 
ATOM   1343 C  CZ    A ARG A 1 182 ? 28.297 9.657   28.451 0.50 19.85 ? 162 ARG A CZ    1 
ATOM   1344 C  CZ    B ARG A 1 182 ? 26.263 9.039   28.049 0.50 16.98 ? 162 ARG A CZ    1 
ATOM   1345 N  NH1   A ARG A 1 182 ? 29.580 9.744   28.115 0.50 22.60 ? 162 ARG A NH1   1 
ATOM   1346 N  NH1   B ARG A 1 182 ? 25.170 8.492   27.534 0.50 17.54 ? 162 ARG A NH1   1 
ATOM   1347 N  NH2   A ARG A 1 182 ? 27.857 10.287  29.532 0.50 31.97 ? 162 ARG A NH2   1 
ATOM   1348 N  NH2   B ARG A 1 182 ? 26.183 9.751   29.167 0.50 26.15 ? 162 ARG A NH2   1 
ATOM   1349 N  N     . ARG A 1 183 ? 26.995 2.789   29.183 1.00 16.04 ? 163 ARG A N     1 
ATOM   1350 C  CA    . ARG A 1 183 ? 26.120 1.997   30.036 1.00 16.63 ? 163 ARG A CA    1 
ATOM   1351 C  C     . ARG A 1 183 ? 25.892 2.714   31.366 1.00 20.61 ? 163 ARG A C     1 
ATOM   1352 O  O     . ARG A 1 183 ? 26.760 2.699   32.243 1.00 21.76 ? 163 ARG A O     1 
ATOM   1353 C  CB    . ARG A 1 183 ? 26.723 0.604   30.248 1.00 20.40 ? 163 ARG A CB    1 
ATOM   1354 C  CG    . ARG A 1 183 ? 26.842 -0.207  28.937 1.00 20.60 ? 163 ARG A CG    1 
ATOM   1355 C  CD    . ARG A 1 183 ? 27.378 -1.634  29.192 1.00 25.38 ? 163 ARG A CD    1 
ATOM   1356 N  NE    . ARG A 1 183 ? 28.567 -1.600  30.039 1.00 27.79 ? 163 ARG A NE    1 
ATOM   1357 C  CZ    . ARG A 1 183 ? 29.798 -1.360  29.598 1.00 39.37 ? 163 ARG A CZ    1 
ATOM   1358 N  NH1   . ARG A 1 183 ? 30.023 -1.152  28.304 1.00 29.33 ? 163 ARG A NH1   1 
ATOM   1359 N  NH2   . ARG A 1 183 ? 30.810 -1.332  30.454 1.00 36.43 ? 163 ARG A NH2   1 
ATOM   1360 N  N     . LEU A 1 184 ? 24.730 3.342   31.514 1.00 17.29 ? 164 LEU A N     1 
ATOM   1361 C  CA    . LEU A 1 184 ? 24.512 4.232   32.657 1.00 19.29 ? 164 LEU A CA    1 
ATOM   1362 C  C     . LEU A 1 184 ? 24.427 3.501   33.995 1.00 28.21 ? 164 LEU A C     1 
ATOM   1363 O  O     . LEU A 1 184 ? 24.758 4.088   35.036 1.00 24.38 ? 164 LEU A O     1 
ATOM   1364 C  CB    . LEU A 1 184 ? 23.245 5.067   32.453 1.00 22.37 ? 164 LEU A CB    1 
ATOM   1365 C  CG    . LEU A 1 184 ? 23.199 5.903   31.167 1.00 22.28 ? 164 LEU A CG    1 
ATOM   1366 C  CD1   . LEU A 1 184 ? 22.048 6.897   31.258 1.00 25.64 ? 164 LEU A CD1   1 
ATOM   1367 C  CD2   . LEU A 1 184 ? 24.511 6.619   30.912 1.00 22.86 ? 164 LEU A CD2   1 
ATOM   1368 N  N     . ARG A 1 185 ? 23.987 2.243   33.994 1.00 17.67 ? 165 ARG A N     1 
ATOM   1369 C  CA    . ARG A 1 185 ? 23.995 1.491   35.251 1.00 19.73 ? 165 ARG A CA    1 
ATOM   1370 C  C     . ARG A 1 185 ? 25.423 1.396   35.771 1.00 24.05 ? 165 ARG A C     1 
ATOM   1371 O  O     . ARG A 1 185 ? 25.671 1.569   36.971 1.00 26.47 ? 165 ARG A O     1 
ATOM   1372 C  CB    . ARG A 1 185 ? 23.419 0.077   35.094 1.00 19.41 ? 165 ARG A CB    1 
ATOM   1373 C  CG    . ARG A 1 185 ? 21.992 -0.009  34.622 1.00 18.98 ? 165 ARG A CG    1 
ATOM   1374 C  CD    . ARG A 1 185 ? 21.500 -1.439  34.779 1.00 17.37 ? 165 ARG A CD    1 
ATOM   1375 N  NE    . ARG A 1 185 ? 20.330 -1.725  33.953 1.00 18.05 ? 165 ARG A NE    1 
ATOM   1376 C  CZ    . ARG A 1 185 ? 19.489 -2.734  34.157 1.00 20.61 ? 165 ARG A CZ    1 
ATOM   1377 N  NH1   . ARG A 1 185 ? 19.661 -3.561  35.188 1.00 21.25 ? 165 ARG A NH1   1 
ATOM   1378 N  NH2   . ARG A 1 185 ? 18.469 -2.918  33.332 1.00 19.05 ? 165 ARG A NH2   1 
ATOM   1379 N  N     . ASP A 1 186 ? 26.364 1.110   34.869 1.00 20.77 ? 166 ASP A N     1 
ATOM   1380 C  CA    . ASP A 1 186 ? 27.766 0.943   35.253 1.00 18.74 ? 166 ASP A CA    1 
ATOM   1381 C  C     . ASP A 1 186 ? 28.362 2.262   35.718 1.00 34.61 ? 166 ASP A C     1 
ATOM   1382 O  O     . ASP A 1 186 ? 29.196 2.295   36.627 1.00 29.34 ? 166 ASP A O     1 
ATOM   1383 C  CB    . ASP A 1 186 ? 28.604 0.404   34.098 1.00 19.50 ? 166 ASP A CB    1 
ATOM   1384 C  CG    . ASP A 1 186 ? 28.237 -1.020  33.718 1.00 25.36 ? 166 ASP A CG    1 
ATOM   1385 O  OD1   . ASP A 1 186 ? 27.427 -1.644  34.434 1.00 24.62 ? 166 ASP A OD1   1 
ATOM   1386 O  OD2   . ASP A 1 186 ? 28.770 -1.514  32.702 1.00 32.91 ? 166 ASP A OD2   1 
ATOM   1387 N  N     . MET A 1 187 ? 27.969 3.348   35.063 1.00 24.26 ? 167 MET A N     1 
ATOM   1388 C  CA    . MET A 1 187 ? 28.442 4.671   35.470 1.00 28.95 ? 167 MET A CA    1 
ATOM   1389 C  C     . MET A 1 187 ? 27.934 5.027   36.853 1.00 29.08 ? 167 MET A C     1 
ATOM   1390 O  O     . MET A 1 187 ? 28.692 5.507   37.699 1.00 37.80 ? 167 MET A O     1 
ATOM   1391 C  CB    . MET A 1 187 ? 28.004 5.734   34.476 1.00 24.91 ? 167 MET A CB    1 
ATOM   1392 C  CG    . MET A 1 187 ? 28.675 5.619   33.150 1.00 27.06 ? 167 MET A CG    1 
ATOM   1393 S  SD    . MET A 1 187 ? 28.087 6.904   32.020 1.00 38.38 ? 167 MET A SD    1 
ATOM   1394 C  CE    . MET A 1 187 ? 28.642 6.204   30.484 1.00 29.99 ? 167 MET A CE    1 
ATOM   1395 N  N     . ARG A 1 188 ? 26.647 4.797   37.080 1.00 27.53 ? 168 ARG A N     1 
ATOM   1396 C  CA    . ARG A 1 188 ? 26.038 5.113   38.362 1.00 27.21 ? 168 ARG A CA    1 
ATOM   1397 C  C     . ARG A 1 188 ? 26.620 4.249   39.473 1.00 41.54 ? 168 ARG A C     1 
ATOM   1398 O  O     . ARG A 1 188 ? 26.873 4.742   40.569 1.00 43.04 ? 168 ARG A O     1 
ATOM   1399 C  CB    . ARG A 1 188 ? 24.526 4.959   38.282 1.00 27.06 ? 168 ARG A CB    1 
ATOM   1400 C  CG    . ARG A 1 188 ? 23.911 6.095   37.495 1.00 27.05 ? 168 ARG A CG    1 
ATOM   1401 C  CD    . ARG A 1 188 ? 22.458 5.887   37.151 1.00 33.06 ? 168 ARG A CD    1 
ATOM   1402 N  NE    . ARG A 1 188 ? 21.930 7.113   36.555 1.00 53.25 ? 168 ARG A NE    1 
ATOM   1403 C  CZ    . ARG A 1 188 ? 21.089 7.157   35.528 1.00 66.75 ? 168 ARG A CZ    1 
ATOM   1404 N  NH1   . ARG A 1 188 ? 20.674 8.335   35.067 1.00 33.96 ? 168 ARG A NH1   1 
ATOM   1405 N  NH2   . ARG A 1 188 ? 20.665 6.030   34.966 1.00 36.90 ? 168 ARG A NH2   1 
ATOM   1406 N  N     . ASN A 1 189 ? 26.854 2.974   39.179 1.00 30.09 ? 169 ASN A N     1 
ATOM   1407 C  CA    . ASN A 1 189 ? 27.444 2.053   40.153 1.00 33.25 ? 169 ASN A CA    1 
ATOM   1408 C  C     . ASN A 1 189 ? 28.938 2.268   40.358 1.00 31.37 ? 169 ASN A C     1 
ATOM   1409 O  O     . ASN A 1 189 ? 29.524 1.718   41.295 1.00 37.77 ? 169 ASN A O     1 
ATOM   1410 C  CB    . ASN A 1 189 ? 27.229 0.595   39.722 1.00 29.39 ? 169 ASN A CB    1 
ATOM   1411 C  CG    . ASN A 1 189 ? 25.790 0.167   39.812 1.00 33.89 ? 169 ASN A CG    1 
ATOM   1412 O  OD1   . ASN A 1 189 ? 25.002 0.759   40.547 1.00 35.27 ? 169 ASN A OD1   1 
ATOM   1413 N  ND2   . ASN A 1 189 ? 25.432 -0.877  39.063 1.00 26.99 ? 169 ASN A ND2   1 
ATOM   1414 N  N     . GLY A 1 190 ? 29.560 3.027   39.461 1.00 29.38 ? 170 GLY A N     1 
ATOM   1415 C  CA    . GLY A 1 190 ? 31.008 3.143   39.430 1.00 32.67 ? 170 GLY A CA    1 
ATOM   1416 C  C     . GLY A 1 190 ? 31.653 1.780   39.260 1.00 38.56 ? 170 GLY A C     1 
ATOM   1417 O  O     . GLY A 1 190 ? 32.615 1.438   39.951 1.00 37.05 ? 170 GLY A O     1 
ATOM   1418 N  N     . PHE A 1 191 ? 31.115 0.991   38.337 1.00 29.81 ? 171 PHE A N     1 
ATOM   1419 C  CA    . PHE A 1 191 ? 31.554 -0.387  38.167 1.00 25.57 ? 171 PHE A CA    1 
ATOM   1420 C  C     . PHE A 1 191 ? 32.894 -0.493  37.458 1.00 30.51 ? 171 PHE A C     1 
ATOM   1421 O  O     . PHE A 1 191 ? 33.134 0.162   36.449 1.00 37.80 ? 171 PHE A O     1 
ATOM   1422 C  CB    . PHE A 1 191 ? 30.503 -1.194  37.392 1.00 31.42 ? 171 PHE A CB    1 
ATOM   1423 C  CG    . PHE A 1 191 ? 30.883 -2.639  37.186 1.00 39.83 ? 171 PHE A CG    1 
ATOM   1424 C  CD1   . PHE A 1 191 ? 30.847 -3.537  38.244 1.00 39.06 ? 171 PHE A CD1   1 
ATOM   1425 C  CD2   . PHE A 1 191 ? 31.284 -3.094  35.936 1.00 30.95 ? 171 PHE A CD2   1 
ATOM   1426 C  CE1   . PHE A 1 191 ? 31.201 -4.867  38.059 1.00 33.27 ? 171 PHE A CE1   1 
ATOM   1427 C  CE2   . PHE A 1 191 ? 31.642 -4.424  35.744 1.00 31.09 ? 171 PHE A CE2   1 
ATOM   1428 C  CZ    . PHE A 1 191 ? 31.600 -5.308  36.809 1.00 26.66 ? 171 PHE A CZ    1 
ATOM   1429 N  N     . ALA A 1 192 ? 33.765 -1.335  37.994 1.00 34.65 ? 172 ALA A N     1 
ATOM   1430 C  CA    . ALA A 1 192 ? 35.021 -1.654  37.336 1.00 40.77 ? 172 ALA A CA    1 
ATOM   1431 C  C     . ALA A 1 192 ? 35.345 -3.116  37.586 1.00 35.66 ? 172 ALA A C     1 
ATOM   1432 O  O     . ALA A 1 192 ? 34.791 -3.727  38.505 1.00 35.97 ? 172 ALA A O     1 
ATOM   1433 C  CB    . ALA A 1 192 ? 36.140 -0.760  37.841 1.00 59.56 ? 172 ALA A CB    1 
ATOM   1434 N  N     . LEU A 1 193 ? 36.227 -3.678  36.768 1.00 41.73 ? 173 LEU A N     1 
ATOM   1435 C  CA    . LEU A 1 193 ? 36.654 -5.055  36.956 1.00 40.50 ? 173 LEU A CA    1 
ATOM   1436 C  C     . LEU A 1 193 ? 37.249 -5.259  38.333 1.00 40.95 ? 173 LEU A C     1 
ATOM   1437 O  O     . LEU A 1 193 ? 38.095 -4.483  38.764 1.00 48.79 ? 173 LEU A O     1 
ATOM   1438 C  CB    . LEU A 1 193 ? 37.686 -5.460  35.905 1.00 53.03 ? 173 LEU A CB    1 
ATOM   1439 C  CG    . LEU A 1 193 ? 37.225 -5.802  34.495 1.00 41.58 ? 173 LEU A CG    1 
ATOM   1440 C  CD1   . LEU A 1 193 ? 38.418 -6.286  33.696 1.00 38.69 ? 173 LEU A CD1   1 
ATOM   1441 C  CD2   . LEU A 1 193 ? 36.136 -6.855  34.538 1.00 31.56 ? 173 LEU A CD2   1 
ATOM   1442 N  N     . PRO A 1 194 ? 36.796 -6.302  39.031 1.00 37.95 ? 174 PRO A N     1 
ATOM   1443 C  CA    . PRO A 1 194 ? 37.485 -6.758  40.233 1.00 42.80 ? 174 PRO A CA    1 
ATOM   1444 C  C     . PRO A 1 194 ? 38.933 -7.073  39.896 1.00 45.01 ? 174 PRO A C     1 
ATOM   1445 O  O     . PRO A 1 194 ? 39.237 -7.419  38.755 1.00 34.50 ? 174 PRO A O     1 
ATOM   1446 C  CB    . PRO A 1 194 ? 36.722 -8.023  40.626 1.00 42.85 ? 174 PRO A CB    1 
ATOM   1447 C  CG    . PRO A 1 194 ? 35.392 -7.879  39.995 1.00 54.55 ? 174 PRO A CG    1 
ATOM   1448 C  CD    . PRO A 1 194 ? 35.616 -7.124  38.725 1.00 42.70 ? 174 PRO A CD    1 
ATOM   1449 N  N     . GLU A 1 195 ? 39.820 -6.956  40.872 1.00 44.94 ? 175 GLU A N     1 
ATOM   1450 C  CA    . GLU A 1 195 ? 41.225 -7.213  40.621 1.00 39.80 ? 175 GLU A CA    1 
ATOM   1451 C  C     . GLU A 1 195 ? 41.425 -8.692  40.272 1.00 32.27 ? 175 GLU A C     1 
ATOM   1452 O  O     . GLU A 1 195 ? 42.415 -9.048  39.627 1.00 36.77 ? 175 GLU A O     1 
ATOM   1453 C  CB    . GLU A 1 195 ? 42.065 -6.762  41.836 1.00 55.50 ? 175 GLU A CB    1 
ATOM   1454 C  CG    . GLU A 1 195 ? 43.436 -7.425  42.060 1.00 82.07 ? 175 GLU A CG    1 
ATOM   1455 C  CD    . GLU A 1 195 ? 43.351 -8.846  42.602 1.00 87.80 ? 175 GLU A CD    1 
ATOM   1456 O  OE1   . GLU A 1 195 ? 42.484 -9.104  43.466 1.00 72.84 ? 175 GLU A OE1   1 
ATOM   1457 O  OE2   . GLU A 1 195 ? 44.152 -9.701  42.162 1.00 82.18 ? 175 GLU A OE2   1 
ATOM   1458 N  N     . TRP A 1 196 ? 40.475 -9.546  40.662 1.00 35.22 ? 176 TRP A N     1 
ATOM   1459 C  CA    . TRP A 1 196 ? 40.609 -10.984 40.422 1.00 41.66 ? 176 TRP A CA    1 
ATOM   1460 C  C     . TRP A 1 196 ? 40.127 -11.411 39.028 1.00 28.07 ? 176 TRP A C     1 
ATOM   1461 O  O     . TRP A 1 196 ? 40.167 -12.592 38.686 1.00 34.88 ? 176 TRP A O     1 
ATOM   1462 C  CB    . TRP A 1 196 ? 39.863 -11.788 41.497 1.00 34.70 ? 176 TRP A CB    1 
ATOM   1463 C  CG    . TRP A 1 196 ? 38.368 -11.739 41.407 1.00 53.88 ? 176 TRP A CG    1 
ATOM   1464 C  CD1   . TRP A 1 196 ? 37.568 -12.451 40.553 1.00 52.02 ? 176 TRP A CD1   1 
ATOM   1465 C  CD2   . TRP A 1 196 ? 37.488 -10.959 42.221 1.00 60.89 ? 176 TRP A CD2   1 
ATOM   1466 N  NE1   . TRP A 1 196 ? 36.248 -12.144 40.773 1.00 58.40 ? 176 TRP A NE1   1 
ATOM   1467 C  CE2   . TRP A 1 196 ? 36.171 -11.233 41.795 1.00 66.12 ? 176 TRP A CE2   1 
ATOM   1468 C  CE3   . TRP A 1 196 ? 37.685 -10.050 43.264 1.00 58.13 ? 176 TRP A CE3   1 
ATOM   1469 C  CZ2   . TRP A 1 196 ? 35.058 -10.631 42.378 1.00 81.53 ? 176 TRP A CZ2   1 
ATOM   1470 C  CZ3   . TRP A 1 196 ? 36.578 -9.452  43.842 1.00 79.08 ? 176 TRP A CZ3   1 
ATOM   1471 C  CH2   . TRP A 1 196 ? 35.282 -9.745  43.397 1.00 88.60 ? 176 TRP A CH2   1 
ATOM   1472 N  N     . VAL A 1 197 ? 39.671 -10.450 38.232 1.00 27.65 ? 177 VAL A N     1 
ATOM   1473 C  CA    . VAL A 1 197 ? 39.298 -10.725 36.847 1.00 27.58 ? 177 VAL A CA    1 
ATOM   1474 C  C     . VAL A 1 197 ? 40.216 -9.953  35.917 1.00 24.24 ? 177 VAL A C     1 
ATOM   1475 O  O     . VAL A 1 197 ? 40.366 -8.737  36.059 1.00 31.64 ? 177 VAL A O     1 
ATOM   1476 C  CB    . VAL A 1 197 ? 37.838 -10.328 36.545 1.00 28.59 ? 177 VAL A CB    1 
ATOM   1477 C  CG1   . VAL A 1 197 ? 37.509 -10.599 35.075 1.00 31.51 ? 177 VAL A CG1   1 
ATOM   1478 C  CG2   . VAL A 1 197 ? 36.872 -11.071 37.461 1.00 28.95 ? 177 VAL A CG2   1 
ATOM   1479 N  N     . THR A 1 198 ? 40.844 -10.648 34.973 1.00 20.32 ? 178 THR A N     1 
ATOM   1480 C  CA    . THR A 1 198 ? 41.710 -9.985  34.002 1.00 25.21 ? 178 THR A CA    1 
ATOM   1481 C  C     . THR A 1 198 ? 41.395 -10.424 32.569 1.00 19.36 ? 178 THR A C     1 
ATOM   1482 O  O     . THR A 1 198 ? 40.719 -11.435 32.348 1.00 19.10 ? 178 THR A O     1 
ATOM   1483 C  CB    . THR A 1 198 ? 43.196 -10.272 34.273 1.00 29.83 ? 178 THR A CB    1 
ATOM   1484 O  OG1   . THR A 1 198 ? 43.455 -11.658 34.033 1.00 29.13 ? 178 THR A OG1   1 
ATOM   1485 C  CG2   . THR A 1 198 ? 43.561 -9.934  35.716 1.00 35.70 ? 178 THR A CG2   1 
ATOM   1486 N  N     . ALA A 1 199 ? 41.876 -9.639  31.611 1.00 19.65 ? 179 ALA A N     1 
ATOM   1487 C  CA    . ALA A 1 199 ? 41.829 -10.010 30.203 1.00 15.65 ? 179 ALA A CA    1 
ATOM   1488 C  C     . ALA A 1 199 ? 42.956 -11.015 29.928 1.00 16.38 ? 179 ALA A C     1 
ATOM   1489 O  O     . ALA A 1 199 ? 44.103 -10.643 29.607 1.00 18.13 ? 179 ALA A O     1 
ATOM   1490 C  CB    . ALA A 1 199 ? 41.960 -8.773  29.318 1.00 16.25 ? 179 ALA A CB    1 
ATOM   1491 N  N     . ALA A 1 200 ? 42.614 -12.298 30.027 1.00 13.92 ? 180 ALA A N     1 
ATOM   1492 C  CA    . ALA A 1 200 ? 43.621 -13.366 30.034 1.00 15.06 ? 180 ALA A CA    1 
ATOM   1493 C  C     . ALA A 1 200 ? 44.377 -13.571 28.722 1.00 24.48 ? 180 ALA A C     1 
ATOM   1494 O  O     . ALA A 1 200 ? 45.422 -14.229 28.705 1.00 20.40 ? 180 ALA A O     1 
ATOM   1495 C  CB    . ALA A 1 200 ? 42.967 -14.676 30.456 1.00 18.29 ? 180 ALA A CB    1 
ATOM   1496 N  N     . ASN A 1 201 ? 43.871 -13.024 27.618 1.00 13.32 ? 181 ASN A N     1 
ATOM   1497 C  CA    . ASN A 1 201 ? 44.575 -13.138 26.358 1.00 12.01 ? 181 ASN A CA    1 
ATOM   1498 C  C     . ASN A 1 201 ? 45.721 -12.142 26.197 1.00 14.48 ? 181 ASN A C     1 
ATOM   1499 O  O     . ASN A 1 201 ? 46.445 -12.208 25.211 1.00 16.87 ? 181 ASN A O     1 
ATOM   1500 C  CB    . ASN A 1 201 ? 43.586 -12.988 25.198 1.00 13.95 ? 181 ASN A CB    1 
ATOM   1501 C  CG    . ASN A 1 201 ? 42.626 -14.153 25.135 1.00 19.09 ? 181 ASN A CG    1 
ATOM   1502 O  OD1   . ASN A 1 201 ? 42.999 -15.277 25.494 1.00 15.54 ? 181 ASN A OD1   1 
ATOM   1503 N  ND2   . ASN A 1 201 ? 41.379 -13.900 24.730 1.00 12.74 ? 181 ASN A ND2   1 
ATOM   1504 N  N     . PHE A 1 202 ? 45.867 -11.249 27.177 1.00 17.98 ? 182 PHE A N     1 
ATOM   1505 C  CA    . PHE A 1 202 ? 46.863 -10.166 27.133 1.00 18.98 ? 182 PHE A CA    1 
ATOM   1506 C  C     . PHE A 1 202 ? 47.827 -10.186 28.317 1.00 28.87 ? 182 PHE A C     1 
ATOM   1507 O  O     . PHE A 1 202 ? 47.536 -10.778 29.353 1.00 30.00 ? 182 PHE A O     1 
ATOM   1508 C  CB    . PHE A 1 202 ? 46.156 -8.812  27.090 1.00 20.82 ? 182 PHE A CB    1 
ATOM   1509 C  CG    . PHE A 1 202 ? 45.259 -8.656  25.905 1.00 19.36 ? 182 PHE A CG    1 
ATOM   1510 C  CD1   . PHE A 1 202 ? 43.921 -9.031  25.976 1.00 21.38 ? 182 PHE A CD1   1 
ATOM   1511 C  CD2   . PHE A 1 202 ? 45.760 -8.189  24.705 1.00 26.68 ? 182 PHE A CD2   1 
ATOM   1512 C  CE1   . PHE A 1 202 ? 43.097 -8.916  24.874 1.00 22.77 ? 182 PHE A CE1   1 
ATOM   1513 C  CE2   . PHE A 1 202 ? 44.938 -8.066  23.601 1.00 46.20 ? 182 PHE A CE2   1 
ATOM   1514 C  CZ    . PHE A 1 202 ? 43.604 -8.433  23.688 1.00 22.35 ? 182 PHE A CZ    1 
ATOM   1515 N  N     . ASP A 1 203 ? 48.956 -9.504  28.157 1.00 43.23 ? 183 ASP A N     1 
ATOM   1516 C  CA    . ASP A 1 203 ? 49.919 -9.322  29.239 1.00 76.39 ? 183 ASP A CA    1 
ATOM   1517 C  C     . ASP A 1 203 ? 49.800 -7.932  29.863 1.00 72.82 ? 183 ASP A C     1 
ATOM   1518 O  O     . ASP A 1 203 ? 48.846 -7.643  30.589 1.00 71.67 ? 183 ASP A O     1 
ATOM   1519 C  CB    . ASP A 1 203 ? 51.340 -9.546  28.724 1.00 69.91 ? 183 ASP A CB    1 
ATOM   1520 C  CG    . ASP A 1 203 ? 51.568 -10.970 28.258 1.00 88.00 ? 183 ASP A CG    1 
ATOM   1521 O  OD1   . ASP A 1 203 ? 50.804 -11.867 28.683 1.00 74.25 ? 183 ASP A OD1   1 
ATOM   1522 O  OD2   . ASP A 1 203 ? 52.501 -11.190 27.457 1.00 95.52 ? 183 ASP A OD2   1 
ATOM   1523 N  N     . GLU A 1 225 ? 44.358 0.857   23.450 1.00 45.67 ? 205 GLU A N     1 
ATOM   1524 C  CA    . GLU A 1 225 ? 44.774 -0.399  22.834 1.00 44.62 ? 205 GLU A CA    1 
ATOM   1525 C  C     . GLU A 1 225 ? 43.851 -0.816  21.687 1.00 28.08 ? 205 GLU A C     1 
ATOM   1526 O  O     . GLU A 1 225 ? 44.305 -1.332  20.677 1.00 34.72 ? 205 GLU A O     1 
ATOM   1527 C  CB    . GLU A 1 225 ? 44.823 -1.526  23.869 1.00 52.56 ? 205 GLU A CB    1 
ATOM   1528 C  CG    . GLU A 1 225 ? 45.469 -1.165  25.193 1.00 67.21 ? 205 GLU A CG    1 
ATOM   1529 C  CD    . GLU A 1 225 ? 45.923 -2.399  25.962 1.00 79.74 ? 205 GLU A CD    1 
ATOM   1530 O  OE1   . GLU A 1 225 ? 45.232 -3.441  25.877 1.00 86.45 ? 205 GLU A OE1   1 
ATOM   1531 O  OE2   . GLU A 1 225 ? 46.972 -2.327  26.643 1.00 87.46 ? 205 GLU A OE2   1 
ATOM   1532 N  N     . PHE A 1 226 ? 42.551 -0.631  21.853 1.00 27.03 ? 206 PHE A N     1 
ATOM   1533 C  CA    . PHE A 1 226 ? 41.632 -0.994  20.788 1.00 23.16 ? 206 PHE A CA    1 
ATOM   1534 C  C     . PHE A 1 226 ? 41.437 0.191   19.852 1.00 28.39 ? 206 PHE A C     1 
ATOM   1535 O  O     . PHE A 1 226 ? 41.576 1.343   20.263 1.00 34.18 ? 206 PHE A O     1 
ATOM   1536 C  CB    . PHE A 1 226 ? 40.303 -1.464  21.374 1.00 23.20 ? 206 PHE A CB    1 
ATOM   1537 C  CG    . PHE A 1 226 ? 40.406 -2.764  22.127 1.00 21.83 ? 206 PHE A CG    1 
ATOM   1538 C  CD1   . PHE A 1 226 ? 40.469 -3.962  21.445 1.00 18.99 ? 206 PHE A CD1   1 
ATOM   1539 C  CD2   . PHE A 1 226 ? 40.455 -2.783  23.513 1.00 33.02 ? 206 PHE A CD2   1 
ATOM   1540 C  CE1   . PHE A 1 226 ? 40.567 -5.174  22.133 1.00 28.27 ? 206 PHE A CE1   1 
ATOM   1541 C  CE2   . PHE A 1 226 ? 40.555 -3.973  24.202 1.00 31.10 ? 206 PHE A CE2   1 
ATOM   1542 C  CZ    . PHE A 1 226 ? 40.615 -5.172  23.514 1.00 29.72 ? 206 PHE A CZ    1 
ATOM   1543 N  N     . ALA A 1 227 ? 41.143 -0.095  18.587 1.00 24.69 ? 207 ALA A N     1 
ATOM   1544 C  CA    . ALA A 1 227 ? 40.872 0.949   17.603 1.00 25.51 ? 207 ALA A CA    1 
ATOM   1545 C  C     . ALA A 1 227 ? 39.651 0.556   16.791 1.00 26.48 ? 207 ALA A C     1 
ATOM   1546 O  O     . ALA A 1 227 ? 39.347 -0.628  16.671 1.00 23.25 ? 207 ALA A O     1 
ATOM   1547 C  CB    . ALA A 1 227 ? 42.063 1.158   16.699 1.00 18.68 ? 207 ALA A CB    1 
ATOM   1548 N  N     . PRO A 1 228 ? 38.940 1.542   16.234 1.00 18.35 ? 208 PRO A N     1 
ATOM   1549 C  CA    . PRO A 1 228 ? 37.750 1.199   15.449 1.00 12.48 ? 208 PRO A CA    1 
ATOM   1550 C  C     . PRO A 1 228 ? 38.071 0.373   14.205 1.00 16.54 ? 208 PRO A C     1 
ATOM   1551 O  O     . PRO A 1 228 ? 38.938 0.722   13.403 1.00 18.00 ? 208 PRO A O     1 
ATOM   1552 C  CB    . PRO A 1 228 ? 37.185 2.565   15.057 1.00 17.04 ? 208 PRO A CB    1 
ATOM   1553 C  CG    . PRO A 1 228 ? 37.706 3.512   16.119 1.00 22.18 ? 208 PRO A CG    1 
ATOM   1554 C  CD    . PRO A 1 228 ? 39.085 3.002   16.416 1.00 20.71 ? 208 PRO A CD    1 
ATOM   1555 N  N     . ALA A 1 229 ? 37.342 -0.722  14.044 1.00 14.00 ? 209 ALA A N     1 
ATOM   1556 C  CA    . ALA A 1 229 ? 37.470 -1.556  12.861 1.00 14.00 ? 209 ALA A CA    1 
ATOM   1557 C  C     . ALA A 1 229 ? 36.824 -0.876  11.660 1.00 14.17 ? 209 ALA A C     1 
ATOM   1558 O  O     . ALA A 1 229 ? 35.820 -0.173  11.810 1.00 14.77 ? 209 ALA A O     1 
ATOM   1559 C  CB    . ALA A 1 229 ? 36.827 -2.908  13.105 1.00 14.06 ? 209 ALA A CB    1 
ATOM   1560 N  N     . THR A 1 230 ? 37.406 -1.102  10.484 1.00 12.26 ? 210 THR A N     1 
ATOM   1561 C  CA    . THR A 1 230 ? 36.832 -0.636  9.221  1.00 12.91 ? 210 THR A CA    1 
ATOM   1562 C  C     . THR A 1 230 ? 36.775 -1.788  8.215  1.00 12.21 ? 210 THR A C     1 
ATOM   1563 O  O     . THR A 1 230 ? 37.223 -2.907  8.490  1.00 11.59 ? 210 THR A O     1 
ATOM   1564 C  CB    . THR A 1 230 ? 37.653 0.506   8.601  1.00 16.54 ? 210 THR A CB    1 
ATOM   1565 O  OG1   . THR A 1 230 ? 38.940 -0.007  8.246  1.00 17.24 ? 210 THR A OG1   1 
ATOM   1566 C  CG2   . THR A 1 230 ? 37.817 1.683   9.584  1.00 18.82 ? 210 THR A CG2   1 
ATOM   1567 N  N     . TRP A 1 231 ? 36.242 -1.527  7.025  1.00 10.29 ? 211 TRP A N     1 
ATOM   1568 C  CA    . TRP A 1 231 ? 36.212 -2.553  5.997  1.00 8.75  ? 211 TRP A CA    1 
ATOM   1569 C  C     . TRP A 1 231 ? 37.621 -3.014  5.604  1.00 8.98  ? 211 TRP A C     1 
ATOM   1570 O  O     . TRP A 1 231 ? 37.822 -4.161  5.228  1.00 12.12 ? 211 TRP A O     1 
ATOM   1571 C  CB    . TRP A 1 231 ? 35.435 -2.051  4.766  1.00 12.06 ? 211 TRP A CB    1 
ATOM   1572 C  CG    . TRP A 1 231 ? 33.948 -1.949  5.003  1.00 10.70 ? 211 TRP A CG    1 
ATOM   1573 C  CD1   . TRP A 1 231 ? 33.214 -0.809  5.148  1.00 11.51 ? 211 TRP A CD1   1 
ATOM   1574 C  CD2   . TRP A 1 231 ? 33.022 -3.039  5.128  1.00 9.64  ? 211 TRP A CD2   1 
ATOM   1575 N  NE1   . TRP A 1 231 ? 31.881 -1.112  5.353  1.00 10.49 ? 211 TRP A NE1   1 
ATOM   1576 C  CE2   . TRP A 1 231 ? 31.740 -2.476  5.342  1.00 9.47  ? 211 TRP A CE2   1 
ATOM   1577 C  CE3   . TRP A 1 231 ? 33.150 -4.437  5.073  1.00 11.70 ? 211 TRP A CE3   1 
ATOM   1578 C  CZ2   . TRP A 1 231 ? 30.602 -3.260  5.517  1.00 10.04 ? 211 TRP A CZ2   1 
ATOM   1579 C  CZ3   . TRP A 1 231 ? 32.007 -5.215  5.250  1.00 10.49 ? 211 TRP A CZ3   1 
ATOM   1580 C  CH2   . TRP A 1 231 ? 30.759 -4.618  5.470  1.00 9.30  ? 211 TRP A CH2   1 
ATOM   1581 N  N     . GLU A 1 232 ? 38.596 -2.111  5.734  1.00 13.15 ? 212 GLU A N     1 
ATOM   1582 C  CA    . GLU A 1 232 ? 39.994 -2.464  5.522  1.00 12.11 ? 212 GLU A CA    1 
ATOM   1583 C  C     . GLU A 1 232 ? 40.429 -3.524  6.530  1.00 11.64 ? 212 GLU A C     1 
ATOM   1584 O  O     . GLU A 1 232 ? 41.157 -4.443  6.186  1.00 15.06 ? 212 GLU A O     1 
ATOM   1585 C  CB    . GLU A 1 232 ? 40.884 -1.225  5.629  1.00 14.09 ? 212 GLU A CB    1 
ATOM   1586 C  CG    . GLU A 1 232 ? 40.765 -0.296  4.435  1.00 27.81 ? 212 GLU A CG    1 
ATOM   1587 C  CD    . GLU A 1 232 ? 41.741 0.874   4.503  1.00 56.41 ? 212 GLU A CD    1 
ATOM   1588 O  OE1   . GLU A 1 232 ? 42.627 0.868   5.391  1.00 45.08 ? 212 GLU A OE1   1 
ATOM   1589 O  OE2   . GLU A 1 232 ? 41.618 1.794   3.664  1.00 64.01 ? 212 GLU A OE2   1 
ATOM   1590 N  N     . SER A 1 233 ? 39.972 -3.382  7.768  1.00 11.23 ? 213 SER A N     1 
ATOM   1591 C  CA    . SER A 1 233 ? 40.290 -4.363  8.808  1.00 10.87 ? 213 SER A CA    1 
ATOM   1592 C  C     . SER A 1 233 ? 39.719 -5.728  8.474  1.00 13.27 ? 213 SER A C     1 
ATOM   1593 O  O     . SER A 1 233 ? 40.371 -6.763  8.671  1.00 12.65 ? 213 SER A O     1 
ATOM   1594 C  CB    . SER A 1 233 ? 39.737 -3.926  10.163 1.00 11.05 ? 213 SER A CB    1 
ATOM   1595 O  OG    . SER A 1 233 ? 39.973 -2.541  10.404 1.00 12.98 ? 213 SER A OG    1 
ATOM   1596 N  N     . VAL A 1 234 ? 38.466 -5.742  8.027  1.00 11.14 ? 214 VAL A N     1 
ATOM   1597 C  CA    . VAL A 1 234 ? 37.843 -6.987  7.595  1.00 9.79  ? 214 VAL A CA    1 
ATOM   1598 C  C     . VAL A 1 234 ? 38.650 -7.674  6.502  1.00 12.10 ? 214 VAL A C     1 
ATOM   1599 O  O     . VAL A 1 234 ? 38.887 -8.866  6.570  1.00 12.41 ? 214 VAL A O     1 
ATOM   1600 C  CB    . VAL A 1 234 ? 36.399 -6.746  7.099  1.00 11.06 ? 214 VAL A CB    1 
ATOM   1601 C  CG1   . VAL A 1 234 ? 35.812 -8.031  6.513  1.00 12.39 ? 214 VAL A CG1   1 
ATOM   1602 C  CG2   . VAL A 1 234 ? 35.553 -6.263  8.247  1.00 11.74 ? 214 VAL A CG2   1 
ATOM   1603 N  N     . GLU A 1 235 ? 39.118 -6.895  5.525  1.00 12.30 ? 215 GLU A N     1 
ATOM   1604 C  CA    . GLU A 1 235 ? 39.890 -7.466  4.436  1.00 13.88 ? 215 GLU A CA    1 
ATOM   1605 C  C     . GLU A 1 235 ? 41.217 -8.035  4.956  1.00 13.43 ? 215 GLU A C     1 
ATOM   1606 O  O     . GLU A 1 235 ? 41.649 -9.093  4.509  1.00 14.62 ? 215 GLU A O     1 
ATOM   1607 C  CB    . GLU A 1 235 ? 40.112 -6.409  3.351  1.00 16.32 ? 215 GLU A CB    1 
ATOM   1608 C  CG    . GLU A 1 235 ? 41.074 -6.832  2.235  1.00 18.18 ? 215 GLU A CG    1 
ATOM   1609 C  CD    . GLU A 1 235 ? 40.737 -8.162  1.574  1.00 27.49 ? 215 GLU A CD    1 
ATOM   1610 O  OE1   . GLU A 1 235 ? 39.564 -8.609  1.602  1.00 22.64 ? 215 GLU A OE1   1 
ATOM   1611 O  OE2   . GLU A 1 235 ? 41.667 -8.771  0.996  1.00 28.44 ? 215 GLU A OE2   1 
ATOM   1612 N  N     . ALA A 1 236 ? 41.834 -7.354  5.917  1.00 13.15 ? 216 ALA A N     1 
ATOM   1613 C  CA    . ALA A 1 236 ? 43.089 -7.844  6.492  1.00 12.82 ? 216 ALA A CA    1 
ATOM   1614 C  C     . ALA A 1 236 ? 42.850 -9.194  7.153  1.00 17.25 ? 216 ALA A C     1 
ATOM   1615 O  O     . ALA A 1 236 ? 43.662 -10.106 7.034  1.00 15.49 ? 216 ALA A O     1 
ATOM   1616 C  CB    . ALA A 1 236 ? 43.652 -6.868  7.494  1.00 13.31 ? 216 ALA A CB    1 
ATOM   1617 N  N     . VAL A 1 237 ? 41.738 -9.322  7.866  1.00 13.93 ? 217 VAL A N     1 
ATOM   1618 C  CA    . VAL A 1 237 ? 41.457 -10.589 8.532  1.00 12.69 ? 217 VAL A CA    1 
ATOM   1619 C  C     . VAL A 1 237 ? 41.169 -11.675 7.505  1.00 14.81 ? 217 VAL A C     1 
ATOM   1620 O  O     . VAL A 1 237 ? 41.728 -12.778 7.574  1.00 16.02 ? 217 VAL A O     1 
ATOM   1621 C  CB    . VAL A 1 237 ? 40.273 -10.452 9.525  1.00 11.07 ? 217 VAL A CB    1 
ATOM   1622 C  CG1   . VAL A 1 237 ? 39.847 -11.832 10.063 1.00 12.78 ? 217 VAL A CG1   1 
ATOM   1623 C  CG2   . VAL A 1 237 ? 40.673 -9.560  10.660 1.00 11.49 ? 217 VAL A CG2   1 
ATOM   1624 N  N     . ARG A 1 238 ? 40.324 -11.365 6.524  1.00 14.79 ? 218 ARG A N     1 
ATOM   1625 C  CA    . ARG A 1 238 ? 39.964 -12.321 5.487  1.00 14.13 ? 218 ARG A CA    1 
ATOM   1626 C  C     . ARG A 1 238 ? 41.201 -12.842 4.753  1.00 18.56 ? 218 ARG A C     1 
ATOM   1627 O  O     . ARG A 1 238 ? 41.274 -14.026 4.433  1.00 21.22 ? 218 ARG A O     1 
ATOM   1628 C  CB    . ARG A 1 238 ? 38.978 -11.698 4.487  1.00 17.62 ? 218 ARG A CB    1 
ATOM   1629 C  CG    . ARG A 1 238 ? 38.419 -12.690 3.488  1.00 21.66 ? 218 ARG A CG    1 
ATOM   1630 C  CD    . ARG A 1 238 ? 38.173 -12.067 2.105  1.00 21.35 ? 218 ARG A CD    1 
ATOM   1631 N  NE    . ARG A 1 238 ? 39.374 -11.454 1.536  1.00 26.59 ? 218 ARG A NE    1 
ATOM   1632 C  CZ    . ARG A 1 238 ? 40.361 -12.121 0.934  1.00 33.92 ? 218 ARG A CZ    1 
ATOM   1633 N  NH1   . ARG A 1 238 ? 40.308 -13.438 0.817  1.00 26.84 ? 218 ARG A NH1   1 
ATOM   1634 N  NH2   . ARG A 1 238 ? 41.415 -11.468 0.456  1.00 32.07 ? 218 ARG A NH2   1 
ATOM   1635 N  N     . ALA A 1 239 ? 42.169 -11.958 4.513  1.00 16.84 ? 219 ALA A N     1 
ATOM   1636 C  CA    . ALA A 1 239 ? 43.393 -12.317 3.787  1.00 19.92 ? 219 ALA A CA    1 
ATOM   1637 C  C     . ALA A 1 239 ? 44.346 -13.196 4.604  1.00 26.74 ? 219 ALA A C     1 
ATOM   1638 O  O     . ALA A 1 239 ? 45.219 -13.866 4.040  1.00 27.53 ? 219 ALA A O     1 
ATOM   1639 C  CB    . ALA A 1 239 ? 44.121 -11.050 3.341  1.00 21.92 ? 219 ALA A CB    1 
ATOM   1640 N  N     . HIS A 1 240 ? 44.175 -13.183 5.925  1.00 17.28 ? 220 HIS A N     1 
ATOM   1641 C  CA    . HIS A 1 240 ? 45.116 -13.783 6.878  1.00 17.13 ? 220 HIS A CA    1 
ATOM   1642 C  C     . HIS A 1 240 ? 44.639 -15.130 7.429  1.00 24.07 ? 220 HIS A C     1 
ATOM   1643 O  O     . HIS A 1 240 ? 45.366 -15.796 8.172  1.00 21.96 ? 220 HIS A O     1 
ATOM   1644 C  CB    . HIS A 1 240 ? 45.344 -12.804 8.035  1.00 27.87 ? 220 HIS A CB    1 
ATOM   1645 C  CG    . HIS A 1 240 ? 46.438 -13.191 8.985  1.00 52.25 ? 220 HIS A CG    1 
ATOM   1646 N  ND1   . HIS A 1 240 ? 47.776 -13.051 8.677  1.00 65.63 ? 220 HIS A ND1   1 
ATOM   1647 C  CD2   . HIS A 1 240 ? 46.392 -13.662 10.255 1.00 43.82 ? 220 HIS A CD2   1 
ATOM   1648 C  CE1   . HIS A 1 240 ? 48.506 -13.443 9.708  1.00 48.44 ? 220 HIS A CE1   1 
ATOM   1649 N  NE2   . HIS A 1 240 ? 47.692 -13.818 10.679 1.00 57.41 ? 220 HIS A NE2   1 
ATOM   1650 N  N     . THR A 1 241 ? 43.418 -15.531 7.097  1.00 18.41 ? 221 THR A N     1 
ATOM   1651 C  CA    . THR A 1 241 ? 42.897 -16.785 7.637  1.00 15.87 ? 221 THR A CA    1 
ATOM   1652 C  C     . THR A 1 241 ? 42.095 -17.529 6.594  1.00 15.90 ? 221 THR A C     1 
ATOM   1653 O  O     . THR A 1 241 ? 41.488 -16.929 5.716  1.00 23.37 ? 221 THR A O     1 
ATOM   1654 C  CB    . THR A 1 241 ? 42.003 -16.568 8.901  1.00 20.26 ? 221 THR A CB    1 
ATOM   1655 O  OG1   . THR A 1 241 ? 41.625 -17.839 9.445  1.00 19.73 ? 221 THR A OG1   1 
ATOM   1656 C  CG2   . THR A 1 241 ? 40.732 -15.806 8.559  1.00 18.50 ? 221 THR A CG2   1 
ATOM   1657 N  N     . ASP A 1 242 ? 42.072 -18.854 6.723  1.00 19.28 ? 222 ASP A N     1 
ATOM   1658 C  CA    . ASP A 1 242 ? 41.184 -19.675 5.913  1.00 20.10 ? 222 ASP A CA    1 
ATOM   1659 C  C     . ASP A 1 242 ? 39.848 -19.931 6.618  1.00 18.29 ? 222 ASP A C     1 
ATOM   1660 O  O     . ASP A 1 242 ? 38.918 -20.475 6.019  1.00 24.72 ? 222 ASP A O     1 
ATOM   1661 C  CB    . ASP A 1 242 ? 41.859 -21.008 5.578  1.00 27.73 ? 222 ASP A CB    1 
ATOM   1662 C  CG    . ASP A 1 242 ? 43.061 -20.832 4.673  1.00 43.43 ? 222 ASP A CG    1 
ATOM   1663 O  OD1   . ASP A 1 242 ? 42.947 -20.083 3.672  1.00 40.38 ? 222 ASP A OD1   1 
ATOM   1664 O  OD2   . ASP A 1 242 ? 44.117 -21.430 4.975  1.00 62.44 ? 222 ASP A OD2   1 
ATOM   1665 N  N     . LEU A 1 243 ? 39.749 -19.535 7.885  1.00 16.08 ? 223 LEU A N     1 
ATOM   1666 C  CA    . LEU A 1 243 ? 38.495 -19.709 8.610  1.00 15.25 ? 223 LEU A CA    1 
ATOM   1667 C  C     . LEU A 1 243 ? 37.416 -18.776 8.082  1.00 13.95 ? 223 LEU A C     1 
ATOM   1668 O  O     . LEU A 1 243 ? 37.719 -17.683 7.605  1.00 14.83 ? 223 LEU A O     1 
ATOM   1669 C  CB    . LEU A 1 243 ? 38.697 -19.435 10.085 1.00 14.82 ? 223 LEU A CB    1 
ATOM   1670 C  CG    . LEU A 1 243 ? 39.726 -20.322 10.787 1.00 14.89 ? 223 LEU A CG    1 
ATOM   1671 C  CD1   . LEU A 1 243 ? 39.801 -19.844 12.207 1.00 15.14 ? 223 LEU A CD1   1 
ATOM   1672 C  CD2   . LEU A 1 243 ? 39.278 -21.774 10.702 1.00 16.88 ? 223 LEU A CD2   1 
ATOM   1673 N  N     . PRO A 1 244 ? 36.150 -19.196 8.180  1.00 12.29 ? 224 PRO A N     1 
ATOM   1674 C  CA    . PRO A 1 244 ? 35.079 -18.256 7.832  1.00 12.31 ? 224 PRO A CA    1 
ATOM   1675 C  C     . PRO A 1 244 ? 35.077 -17.052 8.765  1.00 12.85 ? 224 PRO A C     1 
ATOM   1676 O  O     . PRO A 1 244 ? 35.233 -17.213 9.980  1.00 13.65 ? 224 PRO A O     1 
ATOM   1677 C  CB    . PRO A 1 244 ? 33.789 -19.078 8.005  1.00 17.05 ? 224 PRO A CB    1 
ATOM   1678 C  CG    . PRO A 1 244 ? 34.185 -20.286 8.773  1.00 21.72 ? 224 PRO A CG    1 
ATOM   1679 C  CD    . PRO A 1 244 ? 35.655 -20.528 8.557  1.00 13.68 ? 224 PRO A CD    1 
ATOM   1680 N  N     . VAL A 1 245 ? 34.912 -15.858 8.193  1.00 10.11 ? 225 VAL A N     1 
ATOM   1681 C  CA    . VAL A 1 245 ? 34.842 -14.625 8.948  1.00 8.27  ? 225 VAL A CA    1 
ATOM   1682 C  C     . VAL A 1 245 ? 33.369 -14.237 9.028  1.00 11.02 ? 225 VAL A C     1 
ATOM   1683 O  O     . VAL A 1 245 ? 32.668 -14.201 8.018  1.00 13.99 ? 225 VAL A O     1 
ATOM   1684 C  CB    . VAL A 1 245 ? 35.670 -13.501 8.284  1.00 11.68 ? 225 VAL A CB    1 
ATOM   1685 C  CG1   . VAL A 1 245 ? 35.549 -12.207 9.074  1.00 14.48 ? 225 VAL A CG1   1 
ATOM   1686 C  CG2   . VAL A 1 245 ? 37.160 -13.923 8.192  1.00 12.93 ? 225 VAL A CG2   1 
ATOM   1687 N  N     . VAL A 1 246 ? 32.918 -13.998 10.244 1.00 8.08  ? 226 VAL A N     1 
ATOM   1688 C  CA    . VAL A 1 246 ? 31.515 -13.700 10.525 1.00 8.56  ? 226 VAL A CA    1 
ATOM   1689 C  C     . VAL A 1 246 ? 31.440 -12.294 11.114 1.00 9.90  ? 226 VAL A C     1 
ATOM   1690 O  O     . VAL A 1 246 ? 32.052 -12.030 12.148 1.00 11.65 ? 226 VAL A O     1 
ATOM   1691 C  CB    . VAL A 1 246 ? 30.943 -14.721 11.526 1.00 8.22  ? 226 VAL A CB    1 
ATOM   1692 C  CG1   . VAL A 1 246 ? 29.481 -14.383 11.879 1.00 9.08  ? 226 VAL A CG1   1 
ATOM   1693 C  CG2   . VAL A 1 246 ? 31.060 -16.130 10.962 1.00 10.56 ? 226 VAL A CG2   1 
ATOM   1694 N  N     . LEU A 1 247 ? 30.702 -11.377 10.471 1.00 7.00  ? 227 LEU A N     1 
ATOM   1695 C  CA    . LEU A 1 247 ? 30.657 -10.012 10.964 1.00 6.92  ? 227 LEU A CA    1 
ATOM   1696 C  C     . LEU A 1 247 ? 29.467 -9.850  11.906 1.00 7.17  ? 227 LEU A C     1 
ATOM   1697 O  O     . LEU A 1 247 ? 28.301 -9.967  11.470 1.00 8.15  ? 227 LEU A O     1 
ATOM   1698 C  CB    . LEU A 1 247 ? 30.565 -9.003  9.787  1.00 7.12  ? 227 LEU A CB    1 
ATOM   1699 C  CG    . LEU A 1 247 ? 31.677 -9.176  8.749  1.00 6.94  ? 227 LEU A CG    1 
ATOM   1700 C  CD1   . LEU A 1 247 ? 31.583 -7.989  7.737  1.00 9.84  ? 227 LEU A CD1   1 
ATOM   1701 C  CD2   . LEU A 1 247 ? 33.068 -9.203  9.375  1.00 7.83  ? 227 LEU A CD2   1 
ATOM   1702 N  N     . LYS A 1 248 ? 29.758 -9.587  13.185 1.00 6.31  ? 228 LYS A N     1 
ATOM   1703 C  CA    . LYS A 1 248 ? 28.720 -9.511  14.203 1.00 6.95  ? 228 LYS A CA    1 
ATOM   1704 C  C     . LYS A 1 248 ? 28.379 -8.048  14.483 1.00 6.92  ? 228 LYS A C     1 
ATOM   1705 O  O     . LYS A 1 248 ? 29.263 -7.259  14.848 1.00 7.42  ? 228 LYS A O     1 
ATOM   1706 C  CB    . LYS A 1 248 ? 29.186 -10.225 15.500 1.00 6.87  ? 228 LYS A CB    1 
ATOM   1707 C  CG    . LYS A 1 248 ? 28.272 -9.978  16.685 1.00 7.74  ? 228 LYS A CG    1 
ATOM   1708 C  CD    . LYS A 1 248 ? 28.660 -10.880 17.884 1.00 6.05  ? 228 LYS A CD    1 
ATOM   1709 C  CE    . LYS A 1 248 ? 27.658 -10.696 19.019 1.00 7.26  ? 228 LYS A CE    1 
ATOM   1710 N  NZ    . LYS A 1 248 ? 27.736 -9.369  19.740 1.00 10.00 ? 228 LYS A NZ    1 
ATOM   1711 N  N     . GLY A 1 249 ? 27.101 -7.684  14.323 1.00 6.98  ? 229 GLY A N     1 
ATOM   1712 C  CA    . GLY A 1 249 ? 26.665 -6.318  14.595 1.00 6.60  ? 229 GLY A CA    1 
ATOM   1713 C  C     . GLY A 1 249 ? 26.206 -5.583  13.343 1.00 8.68  ? 229 GLY A C     1 
ATOM   1714 O  O     . GLY A 1 249 ? 26.258 -4.355  13.306 1.00 11.99 ? 229 GLY A O     1 
ATOM   1715 N  N     . ILE A 1 250 ? 25.753 -6.324  12.333 1.00 6.29  ? 230 ILE A N     1 
ATOM   1716 C  CA    . ILE A 1 250 ? 25.228 -5.743  11.091 1.00 7.64  ? 230 ILE A CA    1 
ATOM   1717 C  C     . ILE A 1 250 ? 23.732 -5.450  11.236 1.00 8.92  ? 230 ILE A C     1 
ATOM   1718 O  O     . ILE A 1 250 ? 22.960 -6.319  11.670 1.00 7.72  ? 230 ILE A O     1 
ATOM   1719 C  CB    . ILE A 1 250 ? 25.442 -6.714  9.903  1.00 8.94  ? 230 ILE A CB    1 
ATOM   1720 C  CG1   . ILE A 1 250 ? 26.939 -6.997  9.650  1.00 13.09 ? 230 ILE A CG1   1 
ATOM   1721 C  CG2   . ILE A 1 250 ? 24.706 -6.232  8.643  1.00 10.31 ? 230 ILE A CG2   1 
ATOM   1722 C  CD1   . ILE A 1 250 ? 27.705 -5.839  9.074  1.00 12.64 ? 230 ILE A CD1   1 
ATOM   1723 N  N     . LEU A 1 251 ? 23.291 -4.239  10.874 1.00 7.10  ? 231 LEU A N     1 
ATOM   1724 C  CA    . LEU A 1 251 ? 21.856 -3.937  10.911 1.00 7.05  ? 231 LEU A CA    1 
ATOM   1725 C  C     . LEU A 1 251 ? 21.339 -3.349  9.589  1.00 6.23  ? 231 LEU A C     1 
ATOM   1726 O  O     . LEU A 1 251 ? 20.163 -3.525  9.269  1.00 7.65  ? 231 LEU A O     1 
ATOM   1727 C  CB    . LEU A 1 251 ? 21.532 -2.957  12.049 1.00 7.35  ? 231 LEU A CB    1 
ATOM   1728 C  CG    . LEU A 1 251 ? 21.655 -3.601  13.441 1.00 5.70  ? 231 LEU A CG    1 
ATOM   1729 C  CD1   . LEU A 1 251 ? 21.591 -2.558  14.546 1.00 6.90  ? 231 LEU A CD1   1 
ATOM   1730 C  CD2   . LEU A 1 251 ? 20.536 -4.656  13.624 1.00 6.79  ? 231 LEU A CD2   1 
ATOM   1731 N  N     . ALA A 1 252 ? 22.208 -2.661  8.849  1.00 6.27  ? 232 ALA A N     1 
ATOM   1732 C  CA    . ALA A 1 252 ? 21.765 -2.068  7.581  1.00 8.31  ? 232 ALA A CA    1 
ATOM   1733 C  C     . ALA A 1 252 ? 21.836 -3.080  6.456  1.00 8.38  ? 232 ALA A C     1 
ATOM   1734 O  O     . ALA A 1 252 ? 22.803 -3.834  6.336  1.00 8.96  ? 232 ALA A O     1 
ATOM   1735 C  CB    . ALA A 1 252 ? 22.623 -0.822  7.264  1.00 9.12  ? 232 ALA A CB    1 
ATOM   1736 N  N     . VAL A 1 253 ? 20.820 -3.079  5.599  1.00 7.38  ? 233 VAL A N     1 
ATOM   1737 C  CA    . VAL A 1 253 ? 20.788 -4.004  4.486  1.00 8.14  ? 233 VAL A CA    1 
ATOM   1738 C  C     . VAL A 1 253 ? 22.013 -3.855  3.596  1.00 8.01  ? 233 VAL A C     1 
ATOM   1739 O  O     . VAL A 1 253 ? 22.609 -4.856  3.160  1.00 9.06  ? 233 VAL A O     1 
ATOM   1740 C  CB    . VAL A 1 253 ? 19.494 -3.807  3.663  1.00 7.96  ? 233 VAL A CB    1 
ATOM   1741 C  CG1   . VAL A 1 253 ? 19.504 -4.711  2.442  1.00 11.95 ? 233 VAL A CG1   1 
ATOM   1742 C  CG2   . VAL A 1 253 ? 18.278 -4.098  4.509  1.00 10.93 ? 233 VAL A CG2   1 
ATOM   1743 N  N     . GLU A 1 254 ? 22.438 -2.620  3.322  1.00 8.52  ? 234 GLU A N     1 
ATOM   1744 C  CA    . GLU A 1 254 ? 23.600 -2.517  2.459  1.00 11.66 ? 234 GLU A CA    1 
ATOM   1745 C  C     . GLU A 1 254 ? 24.905 -2.948  3.128  1.00 10.86 ? 234 GLU A C     1 
ATOM   1746 O  O     . GLU A 1 254 ? 25.837 -3.361  2.448  1.00 11.70 ? 234 GLU A O     1 
ATOM   1747 C  CB    . GLU A 1 254 ? 23.773 -1.123  1.922  1.00 17.38 ? 234 GLU A CB    1 
ATOM   1748 C  CG    . GLU A 1 254 ? 25.027 -1.073  1.074  1.00 29.01 ? 234 GLU A CG    1 
ATOM   1749 C  CD    . GLU A 1 254 ? 25.010 -1.977  -0.194 1.00 40.50 ? 234 GLU A CD    1 
ATOM   1750 O  OE1   . GLU A 1 254 ? 23.929 -2.248  -0.789 1.00 28.78 ? 234 GLU A OE1   1 
ATOM   1751 O  OE2   . GLU A 1 254 ? 26.115 -2.372  -0.624 1.00 31.79 ? 234 GLU A OE2   1 
ATOM   1752 N  N     . ASP A 1 255 ? 24.969 -2.898  4.463  1.00 8.29  ? 235 ASP A N     1 
ATOM   1753 C  CA    . ASP A 1 255 ? 26.142 -3.455  5.128  1.00 8.03  ? 235 ASP A CA    1 
ATOM   1754 C  C     . ASP A 1 255 ? 26.128 -4.989  5.034  1.00 7.11  ? 235 ASP A C     1 
ATOM   1755 O  O     . ASP A 1 255 ? 27.179 -5.596  4.926  1.00 7.81  ? 235 ASP A O     1 
ATOM   1756 C  CB    . ASP A 1 255 ? 26.227 -3.021  6.598  1.00 6.80  ? 235 ASP A CB    1 
ATOM   1757 C  CG    . ASP A 1 255 ? 26.663 -1.591  6.759  1.00 10.06 ? 235 ASP A CG    1 
ATOM   1758 O  OD1   . ASP A 1 255 ? 27.146 -0.994  5.762  1.00 11.38 ? 235 ASP A OD1   1 
ATOM   1759 O  OD2   . ASP A 1 255 ? 26.547 -1.075  7.884  1.00 10.03 ? 235 ASP A OD2   1 
ATOM   1760 N  N     . ALA A 1 256 ? 24.947 -5.600  5.051  1.00 7.23  ? 236 ALA A N     1 
ATOM   1761 C  CA    . ALA A 1 256 ? 24.866 -7.050  4.863  1.00 7.07  ? 236 ALA A CA    1 
ATOM   1762 C  C     . ALA A 1 256 ? 25.333 -7.425  3.461  1.00 7.30  ? 236 ALA A C     1 
ATOM   1763 O  O     . ALA A 1 256 ? 26.100 -8.371  3.278  1.00 8.51  ? 236 ALA A O     1 
ATOM   1764 C  CB    . ALA A 1 256 ? 23.461 -7.530  5.115  1.00 8.27  ? 236 ALA A CB    1 
ATOM   1765 N  N     A ARG A 1 257 ? 24.870 -6.691  2.448  0.50 8.60  ? 237 ARG A N     1 
ATOM   1766 N  N     B ARG A 1 257 ? 24.867 -6.670  2.471  0.50 8.52  ? 237 ARG A N     1 
ATOM   1767 C  CA    A ARG A 1 257 ? 25.359 -6.965  1.094  0.50 8.40  ? 237 ARG A CA    1 
ATOM   1768 C  CA    B ARG A 1 257 ? 25.286 -6.923  1.101  0.50 8.76  ? 237 ARG A CA    1 
ATOM   1769 C  C     A ARG A 1 257 ? 26.850 -6.777  0.998  0.50 9.06  ? 237 ARG A C     1 
ATOM   1770 C  C     B ARG A 1 257 ? 26.794 -6.724  0.941  0.50 8.87  ? 237 ARG A C     1 
ATOM   1771 O  O     A ARG A 1 257 ? 27.552 -7.603  0.413  0.50 11.16 ? 237 ARG A O     1 
ATOM   1772 O  O     B ARG A 1 257 ? 27.462 -7.527  0.287  0.50 12.23 ? 237 ARG A O     1 
ATOM   1773 C  CB    A ARG A 1 257 ? 24.705 -6.056  0.058  0.50 11.43 ? 237 ARG A CB    1 
ATOM   1774 C  CB    B ARG A 1 257 ? 24.504 -6.016  0.138  0.50 10.57 ? 237 ARG A CB    1 
ATOM   1775 C  CG    A ARG A 1 257 ? 23.234 -6.201  -0.092 0.50 7.63  ? 237 ARG A CG    1 
ATOM   1776 C  CG    B ARG A 1 257 ? 24.570 -6.443  -1.313 0.50 14.87 ? 237 ARG A CG    1 
ATOM   1777 C  CD    A ARG A 1 257 ? 22.808 -5.343  -1.302 0.50 10.66 ? 237 ARG A CD    1 
ATOM   1778 C  CD    B ARG A 1 257 ? 23.605 -5.627  -2.184 0.50 13.65 ? 237 ARG A CD    1 
ATOM   1779 N  NE    A ARG A 1 257 ? 21.371 -5.309  -1.473 0.50 13.03 ? 237 ARG A NE    1 
ATOM   1780 N  NE    B ARG A 1 257 ? 23.792 -5.835  -3.630 0.50 24.41 ? 237 ARG A NE    1 
ATOM   1781 C  CZ    A ARG A 1 257 ? 20.602 -4.309  -1.075 0.50 12.50 ? 237 ARG A CZ    1 
ATOM   1782 C  CZ    B ARG A 1 257 ? 23.110 -5.180  -4.575 0.50 20.93 ? 237 ARG A CZ    1 
ATOM   1783 N  NH1   A ARG A 1 257 ? 21.144 -3.256  -0.480 0.50 14.63 ? 237 ARG A NH1   1 
ATOM   1784 N  NH1   B ARG A 1 257 ? 22.204 -4.276  -4.232 0.50 26.37 ? 237 ARG A NH1   1 
ATOM   1785 N  NH2   A ARG A 1 257 ? 19.294 -4.368  -1.272 0.50 28.08 ? 237 ARG A NH2   1 
ATOM   1786 N  NH2   B ARG A 1 257 ? 23.330 -5.420  -5.863 0.50 8.14  ? 237 ARG A NH2   1 
ATOM   1787 N  N     . ARG A 1 258 ? 27.344 -5.680  1.563  1.00 8.55  ? 238 ARG A N     1 
ATOM   1788 C  CA    . ARG A 1 258 ? 28.776 -5.417  1.477  1.00 8.64  ? 238 ARG A CA    1 
ATOM   1789 C  C     . ARG A 1 258 ? 29.560 -6.513  2.206  1.00 10.83 ? 238 ARG A C     1 
ATOM   1790 O  O     . ARG A 1 258 ? 30.642 -6.894  1.769  1.00 11.19 ? 238 ARG A O     1 
ATOM   1791 C  CB    . ARG A 1 258 ? 29.123 -4.043  2.038  1.00 11.89 ? 238 ARG A CB    1 
ATOM   1792 C  CG    . ARG A 1 258 ? 30.575 -3.722  1.875  1.00 12.78 ? 238 ARG A CG    1 
ATOM   1793 C  CD    . ARG A 1 258 ? 30.821 -2.223  1.868  1.00 17.18 ? 238 ARG A CD    1 
ATOM   1794 N  NE    . ARG A 1 258 ? 32.251 -2.015  1.710  1.00 17.16 ? 238 ARG A NE    1 
ATOM   1795 C  CZ    . ARG A 1 258 ? 32.855 -0.836  1.722  1.00 15.40 ? 238 ARG A CZ    1 
ATOM   1796 N  NH1   . ARG A 1 258 ? 32.156 0.272   1.889  1.00 17.21 ? 238 ARG A NH1   1 
ATOM   1797 N  NH2   . ARG A 1 258 ? 34.171 -0.789  1.582  1.00 21.93 ? 238 ARG A NH2   1 
ATOM   1798 N  N     . ALA A 1 259 ? 29.007 -7.040  3.298  1.00 10.22 ? 239 ALA A N     1 
ATOM   1799 C  CA    . ALA A 1 259 ? 29.673 -8.138  3.992  1.00 9.50  ? 239 ALA A CA    1 
ATOM   1800 C  C     . ALA A 1 259 ? 29.867 -9.342  3.077  1.00 9.07  ? 239 ALA A C     1 
ATOM   1801 O  O     . ALA A 1 259 ? 30.920 -9.999  3.104  1.00 9.59  ? 239 ALA A O     1 
ATOM   1802 C  CB    . ALA A 1 259 ? 28.869 -8.557  5.255  1.00 8.80  ? 239 ALA A CB    1 
ATOM   1803 N  N     . VAL A 1 260 ? 28.844 -9.675  2.293  1.00 8.62  ? 240 VAL A N     1 
ATOM   1804 C  CA    . VAL A 1 260 ? 28.971 -10.795 1.371  1.00 7.90  ? 240 VAL A CA    1 
ATOM   1805 C  C     . VAL A 1 260 ? 30.026 -10.482 0.312  1.00 10.73 ? 240 VAL A C     1 
ATOM   1806 O  O     . VAL A 1 260 ? 30.881 -11.323 -0.006 1.00 11.12 ? 240 VAL A O     1 
ATOM   1807 C  CB    . VAL A 1 260 ? 27.636 -11.116 0.689  1.00 10.69 ? 240 VAL A CB    1 
ATOM   1808 C  CG1   . VAL A 1 260 ? 27.799 -12.256 -0.302 1.00 13.25 ? 240 VAL A CG1   1 
ATOM   1809 C  CG2   . VAL A 1 260 ? 26.574 -11.465 1.718  1.00 11.61 ? 240 VAL A CG2   1 
ATOM   1810 N  N     . ASP A 1 261 ? 29.970 -9.263  -0.220 1.00 12.22 ? 241 ASP A N     1 
ATOM   1811 C  CA    . ASP A 1 261 ? 30.952 -8.828  -1.230 1.00 11.09 ? 241 ASP A CA    1 
ATOM   1812 C  C     . ASP A 1 261 ? 32.374 -8.857  -0.679 1.00 13.16 ? 241 ASP A C     1 
ATOM   1813 O  O     . ASP A 1 261 ? 33.323 -9.113  -1.414 1.00 15.53 ? 241 ASP A O     1 
ATOM   1814 C  CB    . ASP A 1 261 ? 30.630 -7.417  -1.731 1.00 13.76 ? 241 ASP A CB    1 
ATOM   1815 C  CG    . ASP A 1 261 ? 29.321 -7.347  -2.487 1.00 23.36 ? 241 ASP A CG    1 
ATOM   1816 O  OD1   . ASP A 1 261 ? 28.945 -8.355  -3.116 1.00 23.82 ? 241 ASP A OD1   1 
ATOM   1817 O  OD2   . ASP A 1 261 ? 28.682 -6.271  -2.469 1.00 28.79 ? 241 ASP A OD2   1 
ATOM   1818 N  N     . ALA A 1 262 ? 32.516 -8.593  0.617  1.00 11.62 ? 242 ALA A N     1 
ATOM   1819 C  CA    . ALA A 1 262 ? 33.806 -8.577  1.295  1.00 11.83 ? 242 ALA A CA    1 
ATOM   1820 C  C     . ALA A 1 262 ? 34.340 -9.967  1.618  1.00 14.73 ? 242 ALA A C     1 
ATOM   1821 O  O     . ALA A 1 262 ? 35.441 -10.085 2.150  1.00 16.03 ? 242 ALA A O     1 
ATOM   1822 C  CB    . ALA A 1 262 ? 33.697 -7.759  2.592  1.00 13.97 ? 242 ALA A CB    1 
ATOM   1823 N  N     . GLY A 1 263 ? 33.553 -11.005 1.347  1.00 11.38 ? 243 GLY A N     1 
ATOM   1824 C  CA    . GLY A 1 263 ? 33.998 -12.369 1.547  1.00 10.21 ? 243 GLY A CA    1 
ATOM   1825 C  C     . GLY A 1 263 ? 33.643 -12.965 2.905  1.00 13.91 ? 243 GLY A C     1 
ATOM   1826 O  O     . GLY A 1 263 ? 34.159 -14.025 3.284  1.00 14.40 ? 243 GLY A O     1 
ATOM   1827 N  N     . ALA A 1 264 ? 32.752 -12.302 3.637  1.00 10.55 ? 244 ALA A N     1 
ATOM   1828 C  CA    . ALA A 1 264 ? 32.269 -12.890 4.892  1.00 10.61 ? 244 ALA A CA    1 
ATOM   1829 C  C     . ALA A 1 264 ? 31.542 -14.191 4.652  1.00 10.77 ? 244 ALA A C     1 
ATOM   1830 O  O     . ALA A 1 264 ? 30.757 -14.327 3.694  1.00 12.74 ? 244 ALA A O     1 
ATOM   1831 C  CB    . ALA A 1 264 ? 31.341 -11.918 5.638  1.00 11.10 ? 244 ALA A CB    1 
ATOM   1832 N  N     . GLY A 1 265 ? 31.770 -15.142 5.552  1.00 9.52  ? 245 GLY A N     1 
ATOM   1833 C  CA    . GLY A 1 265 ? 31.047 -16.402 5.542  1.00 11.71 ? 245 GLY A CA    1 
ATOM   1834 C  C     . GLY A 1 265 ? 29.732 -16.321 6.302  1.00 9.40  ? 245 GLY A C     1 
ATOM   1835 O  O     . GLY A 1 265 ? 28.862 -17.181 6.147  1.00 11.73 ? 245 GLY A O     1 
ATOM   1836 N  N     . GLY A 1 266 ? 29.589 -15.280 7.118  1.00 8.58  ? 246 GLY A N     1 
ATOM   1837 C  CA    . GLY A 1 266 ? 28.343 -15.093 7.833  1.00 9.41  ? 246 GLY A CA    1 
ATOM   1838 C  C     . GLY A 1 266 ? 28.248 -13.700 8.396  1.00 7.19  ? 246 GLY A C     1 
ATOM   1839 O  O     . GLY A 1 266 ? 29.230 -12.961 8.397  1.00 7.86  ? 246 GLY A O     1 
ATOM   1840 N  N     . ILE A 1 267 ? 27.050 -13.332 8.851  1.00 6.97  ? 247 ILE A N     1 
ATOM   1841 C  CA    . ILE A 1 267 ? 26.863 -12.088 9.606  1.00 6.26  ? 247 ILE A CA    1 
ATOM   1842 C  C     . ILE A 1 267 ? 25.972 -12.411 10.803 1.00 6.24  ? 247 ILE A C     1 
ATOM   1843 O  O     . ILE A 1 267 ? 25.208 -13.399 10.766 1.00 7.38  ? 247 ILE A O     1 
ATOM   1844 C  CB    . ILE A 1 267 ? 26.224 -10.963 8.755  1.00 7.12  ? 247 ILE A CB    1 
ATOM   1845 C  CG1   . ILE A 1 267 ? 24.878 -11.414 8.227  1.00 9.24  ? 247 ILE A CG1   1 
ATOM   1846 C  CG2   . ILE A 1 267 ? 27.139 -10.557 7.609  1.00 8.73  ? 247 ILE A CG2   1 
ATOM   1847 C  CD1   . ILE A 1 267 ? 24.172 -10.312 7.411  1.00 10.38 ? 247 ILE A CD1   1 
ATOM   1848 N  N     . VAL A 1 268 ? 26.072 -11.610 11.860 1.00 6.63  ? 248 VAL A N     1 
ATOM   1849 C  CA    . VAL A 1 268 ? 25.112 -11.674 12.960 1.00 5.39  ? 248 VAL A CA    1 
ATOM   1850 C  C     . VAL A 1 268 ? 24.363 -10.356 12.961 1.00 6.44  ? 248 VAL A C     1 
ATOM   1851 O  O     . VAL A 1 268 ? 24.962 -9.301  13.126 1.00 7.15  ? 248 VAL A O     1 
ATOM   1852 C  CB    . VAL A 1 268 ? 25.770 -11.888 14.339 1.00 6.73  ? 248 VAL A CB    1 
ATOM   1853 C  CG1   . VAL A 1 268 ? 24.664 -12.163 15.386 1.00 6.52  ? 248 VAL A CG1   1 
ATOM   1854 C  CG2   . VAL A 1 268 ? 26.778 -13.050 14.311 1.00 8.84  ? 248 VAL A CG2   1 
ATOM   1855 N  N     . VAL A 1 269 ? 23.071 -10.433 12.681 1.00 6.03  ? 249 VAL A N     1 
ATOM   1856 C  CA    . VAL A 1 269 ? 22.191 -9.266  12.686 1.00 4.99  ? 249 VAL A CA    1 
ATOM   1857 C  C     . VAL A 1 269 ? 21.857 -8.962  14.144 1.00 8.56  ? 249 VAL A C     1 
ATOM   1858 O  O     . VAL A 1 269 ? 21.276 -9.805  14.849 1.00 7.98  ? 249 VAL A O     1 
ATOM   1859 C  CB    . VAL A 1 269 ? 20.942 -9.557  11.848 1.00 5.23  ? 249 VAL A CB    1 
ATOM   1860 C  CG1   . VAL A 1 269 ? 20.016 -8.340  11.818 1.00 7.18  ? 249 VAL A CG1   1 
ATOM   1861 C  CG2   . VAL A 1 269 ? 21.338 -9.929  10.414 1.00 7.51  ? 249 VAL A CG2   1 
ATOM   1862 N  N     . SER A 1 270 ? 22.285 -7.802  14.624 1.00 5.70  ? 250 SER A N     1 
ATOM   1863 C  CA    . SER A 1 270 ? 22.411 -7.602  16.061 1.00 6.09  ? 250 SER A CA    1 
ATOM   1864 C  C     . SER A 1 270 ? 22.567 -6.140  16.417 1.00 7.36  ? 250 SER A C     1 
ATOM   1865 O  O     . SER A 1 270 ? 23.294 -5.437  15.715 1.00 8.08  ? 250 SER A O     1 
ATOM   1866 C  CB    . SER A 1 270 ? 23.644 -8.384  16.546 1.00 8.70  ? 250 SER A CB    1 
ATOM   1867 O  OG    . SER A 1 270 ? 23.931 -8.110  17.913 1.00 8.60  ? 250 SER A OG    1 
ATOM   1868 N  N     . ASN A 1 271 ? 21.923 -5.690  17.497 1.00 6.74  ? 251 ASN A N     1 
ATOM   1869 C  CA    . ASN A 1 271 ? 22.246 -4.368  18.039 1.00 6.02  ? 251 ASN A CA    1 
ATOM   1870 C  C     . ASN A 1 271 ? 23.050 -4.495  19.344 1.00 7.25  ? 251 ASN A C     1 
ATOM   1871 O  O     . ASN A 1 271 ? 23.077 -3.579  20.170 1.00 8.71  ? 251 ASN A O     1 
ATOM   1872 C  CB    . ASN A 1 271 ? 20.972 -3.495  18.223 1.00 6.51  ? 251 ASN A CB    1 
ATOM   1873 C  CG    . ASN A 1 271 ? 20.019 -4.005  19.294 1.00 9.28  ? 251 ASN A CG    1 
ATOM   1874 O  OD1   . ASN A 1 271 ? 20.353 -4.887  20.085 1.00 8.46  ? 251 ASN A OD1   1 
ATOM   1875 N  ND2   . ASN A 1 271 ? 18.817 -3.413  19.348 1.00 8.44  ? 251 ASN A ND2   1 
ATOM   1876 N  N     . HIS A 1 272 ? 23.755 -5.620  19.475 1.00 7.17  ? 252 HIS A N     1 
ATOM   1877 C  CA    . HIS A 1 272 ? 24.686 -5.836  20.589 1.00 8.46  ? 252 HIS A CA    1 
ATOM   1878 C  C     . HIS A 1 272 ? 23.928 -5.841  21.923 1.00 8.50  ? 252 HIS A C     1 
ATOM   1879 O  O     . HIS A 1 272 ? 24.400 -5.282  22.927 1.00 8.55  ? 252 HIS A O     1 
ATOM   1880 C  CB    . HIS A 1 272 ? 25.793 -4.768  20.580 1.00 8.85  ? 252 HIS A CB    1 
ATOM   1881 C  CG    . HIS A 1 272 ? 27.091 -5.205  21.206 1.00 8.29  ? 252 HIS A CG    1 
ATOM   1882 N  ND1   . HIS A 1 272 ? 28.236 -5.416  20.474 1.00 10.03 ? 252 HIS A ND1   1 
ATOM   1883 C  CD2   . HIS A 1 272 ? 27.436 -5.443  22.506 1.00 10.49 ? 252 HIS A CD2   1 
ATOM   1884 C  CE1   . HIS A 1 272 ? 29.231 -5.768  21.277 1.00 12.11 ? 252 HIS A CE1   1 
ATOM   1885 N  NE2   . HIS A 1 272 ? 28.763 -5.779  22.519 1.00 10.96 ? 252 HIS A NE2   1 
ATOM   1886 N  N     . GLY A 1 273 ? 22.758 -6.477  21.940 1.00 7.74  ? 253 GLY A N     1 
ATOM   1887 C  CA    . GLY A 1 273 ? 21.976 -6.586  23.166 1.00 8.05  ? 253 GLY A CA    1 
ATOM   1888 C  C     . GLY A 1 273 ? 21.566 -5.249  23.739 1.00 10.62 ? 253 GLY A C     1 
ATOM   1889 O  O     . GLY A 1 273 ? 21.334 -5.116  24.942 1.00 11.69 ? 253 GLY A O     1 
ATOM   1890 N  N     . GLY A 1 274 ? 21.452 -4.247  22.871 1.00 7.82  ? 254 GLY A N     1 
ATOM   1891 C  CA    . GLY A 1 274 ? 21.102 -2.893  23.307 1.00 8.35  ? 254 GLY A CA    1 
ATOM   1892 C  C     . GLY A 1 274 ? 22.163 -2.174  24.131 1.00 7.43  ? 254 GLY A C     1 
ATOM   1893 O  O     . GLY A 1 274 ? 21.853 -1.230  24.857 1.00 11.14 ? 254 GLY A O     1 
ATOM   1894 N  N     . ARG A 1 275 ? 23.410 -2.622  24.008 1.00 8.17  ? 255 ARG A N     1 
ATOM   1895 C  CA    . ARG A 1 275 ? 24.528 -2.070  24.782 1.00 8.19  ? 255 ARG A CA    1 
ATOM   1896 C  C     . ARG A 1 275 ? 25.370 -1.055  24.014 1.00 11.75 ? 255 ARG A C     1 
ATOM   1897 O  O     . ARG A 1 275 ? 26.294 -0.443  24.580 1.00 11.80 ? 255 ARG A O     1 
ATOM   1898 C  CB    . ARG A 1 275 ? 25.429 -3.225  25.243 1.00 11.24 ? 255 ARG A CB    1 
ATOM   1899 C  CG    . ARG A 1 275 ? 24.698 -4.179  26.146 1.00 10.26 ? 255 ARG A CG    1 
ATOM   1900 C  CD    . ARG A 1 275 ? 25.512 -5.436  26.432 1.00 10.82 ? 255 ARG A CD    1 
ATOM   1901 N  NE    . ARG A 1 275 ? 26.676 -5.211  27.313 1.00 12.60 ? 255 ARG A NE    1 
ATOM   1902 C  CZ    . ARG A 1 275 ? 26.613 -5.225  28.644 1.00 14.43 ? 255 ARG A CZ    1 
ATOM   1903 N  NH1   . ARG A 1 275 ? 25.455 -5.347  29.267 1.00 13.74 ? 255 ARG A NH1   1 
ATOM   1904 N  NH2   . ARG A 1 275 ? 27.731 -5.090  29.354 1.00 15.23 ? 255 ARG A NH2   1 
ATOM   1905 N  N     . GLN A 1 276 ? 25.089 -0.880  22.721 1.00 8.13  ? 256 GLN A N     1 
ATOM   1906 C  CA    . GLN A 1 276 ? 25.905 0.003   21.902 1.00 8.60  ? 256 GLN A CA    1 
ATOM   1907 C  C     . GLN A 1 276 ? 25.098 1.272   21.582 1.00 9.82  ? 256 GLN A C     1 
ATOM   1908 O  O     . GLN A 1 276 ? 24.909 2.094   22.464 1.00 10.36 ? 256 GLN A O     1 
ATOM   1909 C  CB    . GLN A 1 276 ? 26.398 -0.733  20.666 1.00 9.95  ? 256 GLN A CB    1 
ATOM   1910 C  CG    . GLN A 1 276 ? 27.584 -1.686  21.010 1.00 9.42  ? 256 GLN A CG    1 
ATOM   1911 C  CD    . GLN A 1 276 ? 28.776 -0.936  21.603 1.00 10.49 ? 256 GLN A CD    1 
ATOM   1912 O  OE1   . GLN A 1 276 ? 29.036 -1.003  22.818 1.00 14.45 ? 256 GLN A OE1   1 
ATOM   1913 N  NE2   . GLN A 1 276 ? 29.496 -0.215  20.754 1.00 10.52 ? 256 GLN A NE2   1 
ATOM   1914 N  N     . LEU A 1 277 ? 24.594 1.431   20.360 1.00 9.84  ? 257 LEU A N     1 
ATOM   1915 C  CA    . LEU A 1 277 ? 23.782 2.631   20.100 1.00 8.29  ? 257 LEU A CA    1 
ATOM   1916 C  C     . LEU A 1 277 ? 22.395 2.484   20.716 1.00 9.70  ? 257 LEU A C     1 
ATOM   1917 O  O     . LEU A 1 277 ? 21.660 1.564   20.360 1.00 10.22 ? 257 LEU A O     1 
ATOM   1918 C  CB    . LEU A 1 277 ? 23.682 2.873   18.587 1.00 7.74  ? 257 LEU A CB    1 
ATOM   1919 C  CG    . LEU A 1 277 ? 22.726 4.012   18.191 1.00 10.47 ? 257 LEU A CG    1 
ATOM   1920 C  CD1   . LEU A 1 277 ? 23.267 5.364   18.667 1.00 10.32 ? 257 LEU A CD1   1 
ATOM   1921 C  CD2   . LEU A 1 277 ? 22.489 4.043   16.683 1.00 12.43 ? 257 LEU A CD2   1 
ATOM   1922 N  N     . ASP A 1 278 ? 22.039 3.375   21.645 1.00 10.28 ? 258 ASP A N     1 
ATOM   1923 C  CA    . ASP A 1 278 ? 20.707 3.375   22.226 1.00 9.06  ? 258 ASP A CA    1 
ATOM   1924 C  C     . ASP A 1 278 ? 19.783 4.007   21.191 1.00 12.82 ? 258 ASP A C     1 
ATOM   1925 O  O     . ASP A 1 278 ? 19.974 5.164   20.808 1.00 14.20 ? 258 ASP A O     1 
ATOM   1926 C  CB    . ASP A 1 278 ? 20.673 4.155   23.550 1.00 13.07 ? 258 ASP A CB    1 
ATOM   1927 C  CG    . ASP A 1 278 ? 19.313 4.101   24.230 1.00 21.00 ? 258 ASP A CG    1 
ATOM   1928 O  OD1   . ASP A 1 278 ? 18.677 3.032   24.192 1.00 19.79 ? 258 ASP A OD1   1 
ATOM   1929 O  OD2   . ASP A 1 278 ? 18.900 5.136   24.804 1.00 25.98 ? 258 ASP A OD2   1 
ATOM   1930 N  N     . GLY A 1 279 ? 18.796 3.245   20.741 1.00 9.85  ? 259 GLY A N     1 
ATOM   1931 C  CA    . GLY A 1 279 ? 17.976 3.677   19.615 1.00 10.71 ? 259 GLY A CA    1 
ATOM   1932 C  C     . GLY A 1 279 ? 18.253 2.895   18.347 1.00 9.59  ? 259 GLY A C     1 
ATOM   1933 O  O     . GLY A 1 279 ? 17.528 3.052   17.353 1.00 10.74 ? 259 GLY A O     1 
ATOM   1934 N  N     . ALA A 1 280 ? 19.274 2.041   18.361 1.00 8.21  ? 260 ALA A N     1 
ATOM   1935 C  CA    . ALA A 1 280 ? 19.493 1.134   17.238 1.00 7.36  ? 260 ALA A CA    1 
ATOM   1936 C  C     . ALA A 1 280 ? 18.336 0.142   17.130 1.00 8.31  ? 260 ALA A C     1 
ATOM   1937 O  O     . ALA A 1 280 ? 17.873 -0.434  18.126 1.00 8.90  ? 260 ALA A O     1 
ATOM   1938 C  CB    . ALA A 1 280 ? 20.810 0.380   17.396 1.00 7.68  ? 260 ALA A CB    1 
ATOM   1939 N  N     . VAL A 1 281 ? 17.850 -0.041  15.910 1.00 6.06  ? 261 VAL A N     1 
ATOM   1940 C  CA    . VAL A 1 281 ? 16.803 -1.013  15.620 1.00 6.69  ? 261 VAL A CA    1 
ATOM   1941 C  C     . VAL A 1 281 ? 17.194 -2.428  16.115 1.00 6.20  ? 261 VAL A C     1 
ATOM   1942 O  O     . VAL A 1 281 ? 18.343 -2.807  16.025 1.00 7.69  ? 261 VAL A O     1 
ATOM   1943 C  CB    . VAL A 1 281 ? 16.524 -1.022  14.089 1.00 7.70  ? 261 VAL A CB    1 
ATOM   1944 C  CG1   . VAL A 1 281 ? 17.747 -1.493  13.264 1.00 7.41  ? 261 VAL A CG1   1 
ATOM   1945 C  CG2   . VAL A 1 281 ? 15.271 -1.822  13.750 1.00 9.32  ? 261 VAL A CG2   1 
ATOM   1946 N  N     . PRO A 1 282 ? 16.220 -3.204  16.616 1.00 6.40  ? 262 PRO A N     1 
ATOM   1947 C  CA    . PRO A 1 282 ? 16.518 -4.612  16.920 1.00 7.33  ? 262 PRO A CA    1 
ATOM   1948 C  C     . PRO A 1 282 ? 16.876 -5.408  15.682 1.00 7.54  ? 262 PRO A C     1 
ATOM   1949 O  O     . PRO A 1 282 ? 16.272 -5.224  14.625 1.00 8.78  ? 262 PRO A O     1 
ATOM   1950 C  CB    . PRO A 1 282 ? 15.192 -5.140  17.507 1.00 10.22 ? 262 PRO A CB    1 
ATOM   1951 C  CG    . PRO A 1 282 ? 14.553 -3.937  18.091 1.00 11.20 ? 262 PRO A CG    1 
ATOM   1952 C  CD    . PRO A 1 282 ? 14.908 -2.788  17.129 1.00 8.15  ? 262 PRO A CD    1 
ATOM   1953 N  N     . GLY A 1 283 ? 17.827 -6.324  15.816 1.00 6.55  ? 263 GLY A N     1 
ATOM   1954 C  CA    . GLY A 1 283 ? 18.186 -7.174  14.699 1.00 8.07  ? 263 GLY A CA    1 
ATOM   1955 C  C     . GLY A 1 283 ? 16.994 -7.948  14.141 1.00 6.81  ? 263 GLY A C     1 
ATOM   1956 O  O     . GLY A 1 283 ? 16.886 -8.122  12.925 1.00 8.09  ? 263 GLY A O     1 
ATOM   1957 N  N     . ILE A 1 284 ? 16.121 -8.454  15.020 1.00 5.95  ? 264 ILE A N     1 
ATOM   1958 C  CA    A ILE A 1 284 ? 14.990 -9.242  14.559 0.50 7.78  ? 264 ILE A CA    1 
ATOM   1959 C  CA    B ILE A 1 284 ? 14.966 -9.228  14.579 0.50 7.81  ? 264 ILE A CA    1 
ATOM   1960 C  C     . ILE A 1 284 ? 14.085 -8.437  13.602 1.00 8.86  ? 264 ILE A C     1 
ATOM   1961 O  O     . ILE A 1 284 ? 13.428 -9.014  12.723 1.00 10.26 ? 264 ILE A O     1 
ATOM   1962 C  CB    A ILE A 1 284 ? 14.175 -9.777  15.765 0.50 8.37  ? 264 ILE A CB    1 
ATOM   1963 C  CB    B ILE A 1 284 ? 14.143 -9.711  15.808 0.50 8.31  ? 264 ILE A CB    1 
ATOM   1964 C  CG1   A ILE A 1 284 ? 13.286 -10.955 15.360 0.50 7.97  ? 264 ILE A CG1   1 
ATOM   1965 C  CG1   B ILE A 1 284 ? 14.787 -10.967 16.389 0.50 10.96 ? 264 ILE A CG1   1 
ATOM   1966 C  CG2   A ILE A 1 284 ? 13.390 -8.680  16.393 0.50 6.43  ? 264 ILE A CG2   1 
ATOM   1967 C  CG2   B ILE A 1 284 ? 12.707 -10.035 15.446 0.50 11.23 ? 264 ILE A CG2   1 
ATOM   1968 C  CD1   A ILE A 1 284 ? 14.065 -12.241 15.145 0.50 9.44  ? 264 ILE A CD1   1 
ATOM   1969 C  CD1   B ILE A 1 284 ? 14.608 -12.216 15.537 0.50 7.82  ? 264 ILE A CD1   1 
ATOM   1970 N  N     . GLU A 1 285 ? 14.091 -7.106  13.718 1.00 7.53  ? 265 GLU A N     1 
ATOM   1971 C  CA    . GLU A 1 285 ? 13.275 -6.264  12.816 1.00 8.68  ? 265 GLU A CA    1 
ATOM   1972 C  C     . GLU A 1 285 ? 13.916 -6.069  11.437 1.00 9.18  ? 265 GLU A C     1 
ATOM   1973 O  O     . GLU A 1 285 ? 13.212 -5.739  10.459 1.00 10.07 ? 265 GLU A O     1 
ATOM   1974 C  CB    . GLU A 1 285 ? 13.016 -4.896  13.456 1.00 10.13 ? 265 GLU A CB    1 
ATOM   1975 C  CG    . GLU A 1 285 ? 12.097 -4.995  14.652 1.00 15.56 ? 265 GLU A CG    1 
ATOM   1976 C  CD    . GLU A 1 285 ? 11.413 -3.684  14.982 1.00 56.86 ? 265 GLU A CD    1 
ATOM   1977 O  OE1   . GLU A 1 285 ? 11.361 -2.800  14.100 1.00 52.52 ? 265 GLU A OE1   1 
ATOM   1978 O  OE2   . GLU A 1 285 ? 10.918 -3.545  16.121 1.00 59.18 ? 265 GLU A OE2   1 
ATOM   1979 N  N     . MET A 1 286 ? 15.232 -6.253  11.352 1.00 6.51  ? 266 MET A N     1 
ATOM   1980 C  CA    . MET A 1 286 ? 15.945 -6.156  10.066 1.00 7.51  ? 266 MET A CA    1 
ATOM   1981 C  C     . MET A 1 286 ? 16.195 -7.496  9.398  1.00 7.46  ? 266 MET A C     1 
ATOM   1982 O  O     . MET A 1 286 ? 16.601 -7.560  8.233  1.00 8.14  ? 266 MET A O     1 
ATOM   1983 C  CB    . MET A 1 286 ? 17.299 -5.452  10.246 1.00 6.34  ? 266 MET A CB    1 
ATOM   1984 C  CG    . MET A 1 286 ? 17.202 -4.046  10.849 1.00 7.43  ? 266 MET A CG    1 
ATOM   1985 S  SD    . MET A 1 286 ? 16.153 -2.939  9.847  1.00 10.10 ? 266 MET A SD    1 
ATOM   1986 C  CE    . MET A 1 286 ? 16.960 -3.010  8.261  1.00 8.75  ? 266 MET A CE    1 
ATOM   1987 N  N     . LEU A 1 287 ? 15.989 -8.582  10.150 1.00 7.01  ? 267 LEU A N     1 
ATOM   1988 C  CA    . LEU A 1 287 ? 16.413 -9.905  9.696  1.00 6.18  ? 267 LEU A CA    1 
ATOM   1989 C  C     . LEU A 1 287 ? 15.799 -10.320 8.367  1.00 8.00  ? 267 LEU A C     1 
ATOM   1990 O  O     . LEU A 1 287 ? 16.517 -10.783 7.480  1.00 7.47  ? 267 LEU A O     1 
ATOM   1991 C  CB    . LEU A 1 287 ? 16.068 -10.918 10.804 1.00 6.59  ? 267 LEU A CB    1 
ATOM   1992 C  CG    . LEU A 1 287 ? 16.353 -12.380 10.519 1.00 9.21  ? 267 LEU A CG    1 
ATOM   1993 C  CD1   . LEU A 1 287 ? 17.834 -12.594 10.230 1.00 7.92  ? 267 LEU A CD1   1 
ATOM   1994 C  CD2   . LEU A 1 287 ? 15.896 -13.172 11.745 1.00 9.10  ? 267 LEU A CD2   1 
ATOM   1995 N  N     . GLY A 1 288 ? 14.486 -10.168 8.211  1.00 8.48  ? 268 GLY A N     1 
ATOM   1996 C  CA    . GLY A 1 288 ? 13.843 -10.632 6.989  1.00 9.28  ? 268 GLY A CA    1 
ATOM   1997 C  C     . GLY A 1 288 ? 14.376 -9.912  5.761  1.00 9.48  ? 268 GLY A C     1 
ATOM   1998 O  O     . GLY A 1 288 ? 14.675 -10.542 4.740  1.00 8.63  ? 268 GLY A O     1 
ATOM   1999 N  N     A GLU A 1 289 ? 14.491 -8.589  5.865  0.70 9.48  ? 269 GLU A N     1 
ATOM   2000 N  N     B GLU A 1 289 ? 14.515 -8.595  5.867  0.30 9.54  ? 269 GLU A N     1 
ATOM   2001 C  CA    A GLU A 1 289 ? 15.023 -7.775  4.772  0.70 8.46  ? 269 GLU A CA    1 
ATOM   2002 C  CA    B GLU A 1 289 ? 14.999 -7.798  4.748  0.30 8.60  ? 269 GLU A CA    1 
ATOM   2003 C  C     A GLU A 1 289 ? 16.441 -8.203  4.400  0.70 7.66  ? 269 GLU A C     1 
ATOM   2004 C  C     B GLU A 1 289 ? 16.451 -8.135  4.404  0.30 7.74  ? 269 GLU A C     1 
ATOM   2005 O  O     A GLU A 1 289 ? 16.807 -8.307  3.214  0.70 8.75  ? 269 GLU A O     1 
ATOM   2006 O  O     B GLU A 1 289 ? 16.843 -8.128  3.230  0.30 9.27  ? 269 GLU A O     1 
ATOM   2007 C  CB    A GLU A 1 289 ? 15.033 -6.289  5.158  0.70 11.25 ? 269 GLU A CB    1 
ATOM   2008 C  CB    B GLU A 1 289 ? 14.862 -6.305  5.057  0.30 11.60 ? 269 GLU A CB    1 
ATOM   2009 C  CG    A GLU A 1 289 ? 13.673 -5.641  5.348  0.70 26.42 ? 269 GLU A CG    1 
ATOM   2010 C  CG    B GLU A 1 289 ? 15.105 -5.422  3.850  0.30 9.96  ? 269 GLU A CG    1 
ATOM   2011 C  CD    A GLU A 1 289 ? 13.776 -4.357  6.166  0.70 37.84 ? 269 GLU A CD    1 
ATOM   2012 C  CD    B GLU A 1 289 ? 14.891 -3.950  4.127  0.30 10.32 ? 269 GLU A CD    1 
ATOM   2013 O  OE1   A GLU A 1 289 ? 13.513 -4.381  7.404  0.70 20.25 ? 269 GLU A OE1   1 
ATOM   2014 O  OE1   B GLU A 1 289 ? 15.006 -3.147  3.179  0.30 12.88 ? 269 GLU A OE1   1 
ATOM   2015 O  OE2   A GLU A 1 289 ? 14.146 -3.329  5.563  0.70 34.07 ? 269 GLU A OE2   1 
ATOM   2016 O  OE2   B GLU A 1 289 ? 14.605 -3.603  5.283  0.30 11.70 ? 269 GLU A OE2   1 
ATOM   2017 N  N     . ILE A 1 290 ? 17.242 -8.432  5.428  1.00 8.38  ? 270 ILE A N     1 
ATOM   2018 C  CA    . ILE A 1 290 ? 18.635 -8.802  5.228  1.00 7.36  ? 270 ILE A CA    1 
ATOM   2019 C  C     . ILE A 1 290 ? 18.765 -10.188 4.598  1.00 8.45  ? 270 ILE A C     1 
ATOM   2020 O  O     . ILE A 1 290 ? 19.559 -10.400 3.687  1.00 8.13  ? 270 ILE A O     1 
ATOM   2021 C  CB    . ILE A 1 290 ? 19.390 -8.722  6.570  1.00 6.25  ? 270 ILE A CB    1 
ATOM   2022 C  CG1   . ILE A 1 290 ? 19.643 -7.239  6.877  1.00 6.45  ? 270 ILE A CG1   1 
ATOM   2023 C  CG2   . ILE A 1 290 ? 20.738 -9.452  6.466  1.00 7.55  ? 270 ILE A CG2   1 
ATOM   2024 C  CD1   . ILE A 1 290 ? 20.257 -6.968  8.263  1.00 8.43  ? 270 ILE A CD1   1 
ATOM   2025 N  N     . VAL A 1 291 ? 17.960 -11.145 5.067  1.00 7.00  ? 271 VAL A N     1 
ATOM   2026 C  CA    . VAL A 1 291 ? 18.004 -12.484 4.486  1.00 7.23  ? 271 VAL A CA    1 
ATOM   2027 C  C     . VAL A 1 291 ? 17.641 -12.435 3.006  1.00 7.59  ? 271 VAL A C     1 
ATOM   2028 O  O     . VAL A 1 291 ? 18.304 -13.058 2.178  1.00 9.61  ? 271 VAL A O     1 
ATOM   2029 C  CB    . VAL A 1 291 ? 17.058 -13.424 5.244  1.00 7.14  ? 271 VAL A CB    1 
ATOM   2030 C  CG1   . VAL A 1 291 ? 16.814 -14.730 4.450  1.00 11.95 ? 271 VAL A CG1   1 
ATOM   2031 C  CG2   . VAL A 1 291 ? 17.636 -13.730 6.638  1.00 9.02  ? 271 VAL A CG2   1 
ATOM   2032 N  N     . ALA A 1 292 ? 16.641 -11.633 2.667  1.00 8.29  ? 272 ALA A N     1 
ATOM   2033 C  CA    . ALA A 1 292 ? 16.286 -11.488 1.256  1.00 8.39  ? 272 ALA A CA    1 
ATOM   2034 C  C     . ALA A 1 292 ? 17.412 -10.850 0.441  1.00 9.69  ? 272 ALA A C     1 
ATOM   2035 O  O     . ALA A 1 292 ? 17.706 -11.290 -0.681 1.00 11.93 ? 272 ALA A O     1 
ATOM   2036 C  CB    . ALA A 1 292 ? 15.003 -10.661 1.115  1.00 10.45 ? 272 ALA A CB    1 
ATOM   2037 N  N     . ALA A 1 293 ? 18.058 -9.841  1.005  1.00 8.50  ? 273 ALA A N     1 
ATOM   2038 C  CA    . ALA A 1 293 ? 19.120 -9.140  0.287  1.00 8.33  ? 273 ALA A CA    1 
ATOM   2039 C  C     . ALA A 1 293 ? 20.374 -9.979  0.050  1.00 10.16 ? 273 ALA A C     1 
ATOM   2040 O  O     . ALA A 1 293 ? 21.059 -9.829  -0.982 1.00 11.79 ? 273 ALA A O     1 
ATOM   2041 C  CB    . ALA A 1 293 ? 19.491 -7.869  1.035  1.00 9.32  ? 273 ALA A CB    1 
ATOM   2042 N  N     A VAL A 1 294 ? 20.728 -10.870 0.969  0.70 7.57  ? 274 VAL A N     1 
ATOM   2043 N  N     B VAL A 1 294 ? 20.644 -10.843 1.023  0.30 7.56  ? 274 VAL A N     1 
ATOM   2044 C  CA    A VAL A 1 294 ? 21.970 -11.615 0.730  0.70 7.29  ? 274 VAL A CA    1 
ATOM   2045 C  CA    B VAL A 1 294 ? 21.838 -11.669 1.065  0.30 8.07  ? 274 VAL A CA    1 
ATOM   2046 C  C     A VAL A 1 294 ? 21.707 -12.842 -0.130 0.70 9.76  ? 274 VAL A C     1 
ATOM   2047 C  C     B VAL A 1 294 ? 21.741 -12.798 0.031  0.30 9.95  ? 274 VAL A C     1 
ATOM   2048 O  O     A VAL A 1 294 ? 22.638 -13.396 -0.705 0.70 10.24 ? 274 VAL A O     1 
ATOM   2049 O  O     B VAL A 1 294 ? 22.761 -13.236 -0.507 0.30 10.27 ? 274 VAL A O     1 
ATOM   2050 C  CB    A VAL A 1 294 ? 22.687 -12.036 2.038  0.70 14.08 ? 274 VAL A CB    1 
ATOM   2051 C  CB    B VAL A 1 294 ? 22.060 -12.211 2.520  0.30 2.85  ? 274 VAL A CB    1 
ATOM   2052 C  CG1   A VAL A 1 294 ? 23.016 -10.807 2.896  0.70 9.00  ? 274 VAL A CG1   1 
ATOM   2053 C  CG1   B VAL A 1 294 ? 23.046 -13.372 2.556  0.30 4.64  ? 274 VAL A CG1   1 
ATOM   2054 C  CG2   A VAL A 1 294 ? 21.877 -13.058 2.818  0.70 13.71 ? 274 VAL A CG2   1 
ATOM   2055 C  CG2   B VAL A 1 294 ? 22.542 -11.084 3.438  0.30 6.85  ? 274 VAL A CG2   1 
ATOM   2056 N  N     A SER A 1 295 ? 20.433 -13.242 -0.208 0.50 12.20 ? 275 SER A N     1 
ATOM   2057 N  N     B SER A 1 295 ? 20.509 -13.226 -0.270 0.50 12.38 ? 275 SER A N     1 
ATOM   2058 C  CA    A SER A 1 295 ? 19.975 -14.317 -1.090 0.50 12.45 ? 275 SER A CA    1 
ATOM   2059 C  CA    B SER A 1 295 ? 20.245 -14.248 -1.291 0.50 13.59 ? 275 SER A CA    1 
ATOM   2060 C  C     A SER A 1 295 ? 20.922 -15.525 -1.104 0.50 12.54 ? 275 SER A C     1 
ATOM   2061 C  C     B SER A 1 295 ? 21.115 -15.497 -1.132 0.50 12.14 ? 275 SER A C     1 
ATOM   2062 O  O     A SER A 1 295 ? 21.396 -15.963 -2.151 0.50 14.32 ? 275 SER A O     1 
ATOM   2063 O  O     B SER A 1 295 ? 21.704 -15.971 -2.109 0.50 15.37 ? 275 SER A O     1 
ATOM   2064 C  CB    A SER A 1 295 ? 19.787 -13.774 -2.504 0.50 14.79 ? 275 SER A CB    1 
ATOM   2065 C  CB    B SER A 1 295 ? 20.448 -13.669 -2.697 0.50 15.67 ? 275 SER A CB    1 
ATOM   2066 O  OG    A SER A 1 295 ? 19.036 -14.670 -3.300 0.50 12.85 ? 275 SER A OG    1 
ATOM   2067 O  OG    B SER A 1 295 ? 19.472 -12.686 -2.993 0.50 22.28 ? 275 SER A OG    1 
ATOM   2068 N  N     . GLY A 1 296 ? 21.212 -16.013 0.092  1.00 10.36 ? 276 GLY A N     1 
ATOM   2069 C  CA    . GLY A 1 296 ? 22.021 -17.203 0.306  1.00 14.41 ? 276 GLY A CA    1 
ATOM   2070 C  C     . GLY A 1 296 ? 23.527 -17.028 0.223  1.00 11.39 ? 276 GLY A C     1 
ATOM   2071 O  O     . GLY A 1 296 ? 24.269 -18.019 0.317  1.00 14.49 ? 276 GLY A O     1 
ATOM   2072 N  N     . GLY A 1 297 ? 23.991 -15.787 0.065  1.00 10.88 ? 277 GLY A N     1 
ATOM   2073 C  CA    . GLY A 1 297 ? 25.408 -15.514 -0.104 1.00 10.70 ? 277 GLY A CA    1 
ATOM   2074 C  C     . GLY A 1 297 ? 26.273 -15.724 1.135  1.00 11.63 ? 277 GLY A C     1 
ATOM   2075 O  O     . GLY A 1 297 ? 27.487 -15.847 1.007  1.00 12.87 ? 277 GLY A O     1 
ATOM   2076 N  N     . CYS A 1 298 ? 25.659 -15.760 2.317  1.00 10.34 ? 278 CYS A N     1 
ATOM   2077 C  CA    . CYS A 1 298 ? 26.364 -16.087 3.568  1.00 10.48 ? 278 CYS A CA    1 
ATOM   2078 C  C     . CYS A 1 298 ? 25.334 -16.563 4.587  1.00 11.15 ? 278 CYS A C     1 
ATOM   2079 O  O     . CYS A 1 298 ? 24.133 -16.416 4.365  1.00 11.83 ? 278 CYS A O     1 
ATOM   2080 C  CB    . CYS A 1 298 ? 27.140 -14.880 4.125  1.00 11.75 ? 278 CYS A CB    1 
ATOM   2081 S  SG    . CYS A 1 298 ? 26.126 -13.485 4.692  1.00 13.74 ? 278 CYS A SG    1 
ATOM   2082 N  N     . GLU A 1 299 ? 25.802 -17.141 5.690  1.00 9.56  ? 279 GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 299 ? 24.924 -17.485 6.805  1.00 11.44 ? 279 GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 299 ? 24.449 -16.210 7.471  1.00 10.20 ? 279 GLU A C     1 
ATOM   2085 O  O     . GLU A 1 299 ? 25.243 -15.299 7.665  1.00 9.71  ? 279 GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 299 ? 25.665 -18.340 7.843  1.00 12.71 ? 279 GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 299 ? 26.289 -19.605 7.289  1.00 15.52 ? 279 GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 299 ? 25.280 -20.715 7.064  1.00 23.93 ? 279 GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 299 ? 24.084 -20.522 7.358  1.00 24.03 ? 279 GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 299 ? 25.682 -21.797 6.580  1.00 23.01 ? 279 GLU A OE2   1 
ATOM   2091 N  N     . VAL A 1 300 ? 23.172 -16.152 7.859  1.00 9.40  ? 280 VAL A N     1 
ATOM   2092 C  CA    . VAL A 1 300 ? 22.643 -14.983 8.553  1.00 6.22  ? 280 VAL A CA    1 
ATOM   2093 C  C     . VAL A 1 300 ? 22.134 -15.401 9.914  1.00 6.73  ? 280 VAL A C     1 
ATOM   2094 O  O     . VAL A 1 300 ? 21.123 -16.098 10.026 1.00 10.36 ? 280 VAL A O     1 
ATOM   2095 C  CB    . VAL A 1 300 ? 21.515 -14.304 7.757  1.00 7.96  ? 280 VAL A CB    1 
ATOM   2096 C  CG1   . VAL A 1 300 ? 21.029 -13.068 8.476  1.00 7.77  ? 280 VAL A CG1   1 
ATOM   2097 C  CG2   . VAL A 1 300 ? 22.033 -13.932 6.356  1.00 9.73  ? 280 VAL A CG2   1 
ATOM   2098 N  N     . LEU A 1 301 ? 22.874 -15.011 10.944 1.00 7.30  ? 281 LEU A N     1 
ATOM   2099 C  CA    . LEU A 1 301 ? 22.488 -15.270 12.327 1.00 6.34  ? 281 LEU A CA    1 
ATOM   2100 C  C     . LEU A 1 301 ? 21.837 -14.026 12.918 1.00 6.87  ? 281 LEU A C     1 
ATOM   2101 O  O     . LEU A 1 301 ? 21.932 -12.927 12.346 1.00 7.96  ? 281 LEU A O     1 
ATOM   2102 C  CB    . LEU A 1 301 ? 23.715 -15.682 13.155 1.00 8.30  ? 281 LEU A CB    1 
ATOM   2103 C  CG    . LEU A 1 301 ? 24.376 -17.017 12.792 1.00 8.85  ? 281 LEU A CG    1 
ATOM   2104 C  CD1   . LEU A 1 301 ? 25.360 -16.868 11.623 1.00 12.48 ? 281 LEU A CD1   1 
ATOM   2105 C  CD2   . LEU A 1 301 ? 25.110 -17.583 14.027 1.00 11.46 ? 281 LEU A CD2   1 
ATOM   2106 N  N     . VAL A 1 302 ? 21.161 -14.192 14.048 1.00 6.45  ? 282 VAL A N     1 
ATOM   2107 C  CA    . VAL A 1 302 ? 20.541 -13.060 14.721 1.00 6.52  ? 282 VAL A CA    1 
ATOM   2108 C  C     . VAL A 1 302 ? 20.732 -13.243 16.216 1.00 8.80  ? 282 VAL A C     1 
ATOM   2109 O  O     . VAL A 1 302 ? 20.826 -14.379 16.706 1.00 8.42  ? 282 VAL A O     1 
ATOM   2110 C  CB    . VAL A 1 302 ? 19.036 -12.918 14.352 1.00 6.45  ? 282 VAL A CB    1 
ATOM   2111 C  CG1   . VAL A 1 302 ? 18.197 -14.102 14.886 1.00 7.97  ? 282 VAL A CG1   1 
ATOM   2112 C  CG2   . VAL A 1 302 ? 18.484 -11.575 14.850 1.00 7.02  ? 282 VAL A CG2   1 
ATOM   2113 N  N     . ASP A 1 303 ? 20.828 -12.140 16.949 1.00 6.75  ? 283 ASP A N     1 
ATOM   2114 C  CA    . ASP A 1 303 ? 20.736 -12.253 18.394 1.00 7.68  ? 283 ASP A CA    1 
ATOM   2115 C  C     . ASP A 1 303 ? 19.984 -11.083 18.986 1.00 10.45 ? 283 ASP A C     1 
ATOM   2116 O  O     . ASP A 1 303 ? 19.511 -10.200 18.255 1.00 10.20 ? 283 ASP A O     1 
ATOM   2117 C  CB    . ASP A 1 303 ? 22.122 -12.431 19.038 1.00 7.83  ? 283 ASP A CB    1 
ATOM   2118 C  CG    . ASP A 1 303 ? 22.985 -11.188 19.036 1.00 12.37 ? 283 ASP A CG    1 
ATOM   2119 O  OD1   . ASP A 1 303 ? 22.519 -10.064 18.767 1.00 11.14 ? 283 ASP A OD1   1 
ATOM   2120 O  OD2   . ASP A 1 303 ? 24.183 -11.344 19.354 1.00 12.12 ? 283 ASP A OD2   1 
ATOM   2121 N  N     . GLY A 1 304 ? 19.822 -11.125 20.299 1.00 7.55  ? 284 GLY A N     1 
ATOM   2122 C  CA    . GLY A 1 304 ? 19.118 -10.081 21.021 1.00 8.03  ? 284 GLY A CA    1 
ATOM   2123 C  C     . GLY A 1 304 ? 17.795 -10.580 21.552 1.00 9.78  ? 284 GLY A C     1 
ATOM   2124 O  O     . GLY A 1 304 ? 16.830 -10.686 20.816 1.00 11.10 ? 284 GLY A O     1 
ATOM   2125 N  N     . GLY A 1 305 ? 17.748 -10.931 22.833 1.00 8.27  ? 285 GLY A N     1 
ATOM   2126 C  CA    . GLY A 1 305 ? 16.480 -11.279 23.444 1.00 10.35 ? 285 GLY A CA    1 
ATOM   2127 C  C     . GLY A 1 305 ? 15.933 -12.671 23.206 1.00 9.22  ? 285 GLY A C     1 
ATOM   2128 O  O     . GLY A 1 305 ? 14.772 -12.929 23.522 1.00 11.39 ? 285 GLY A O     1 
ATOM   2129 N  N     . ILE A 1 306 ? 16.716 -13.569 22.614 1.00 7.94  ? 286 ILE A N     1 
ATOM   2130 C  CA    . ILE A 1 306 ? 16.250 -14.943 22.447 1.00 8.24  ? 286 ILE A CA    1 
ATOM   2131 C  C     . ILE A 1 306 ? 16.151 -15.584 23.838 1.00 11.09 ? 286 ILE A C     1 
ATOM   2132 O  O     . ILE A 1 306 ? 17.158 -15.680 24.529 1.00 12.42 ? 286 ILE A O     1 
ATOM   2133 C  CB    . ILE A 1 306 ? 17.203 -15.757 21.585 1.00 10.48 ? 286 ILE A CB    1 
ATOM   2134 C  CG1   . ILE A 1 306 ? 17.357 -15.140 20.181 1.00 10.07 ? 286 ILE A CG1   1 
ATOM   2135 C  CG2   . ILE A 1 306 ? 16.721 -17.213 21.499 1.00 13.53 ? 286 ILE A CG2   1 
ATOM   2136 C  CD1   . ILE A 1 306 ? 16.072 -15.036 19.344 1.00 13.78 ? 286 ILE A CD1   1 
ATOM   2137 N  N     . ARG A 1 307 ? 14.947 -15.984 24.257 1.00 10.02 ? 287 ARG A N     1 
ATOM   2138 C  CA    . ARG A 1 307 ? 14.747 -16.480 25.629 1.00 13.11 ? 287 ARG A CA    1 
ATOM   2139 C  C     . ARG A 1 307 ? 13.946 -17.768 25.698 1.00 17.11 ? 287 ARG A C     1 
ATOM   2140 O  O     . ARG A 1 307 ? 13.476 -18.143 26.777 1.00 18.82 ? 287 ARG A O     1 
ATOM   2141 C  CB    . ARG A 1 307 ? 14.028 -15.427 26.485 1.00 13.41 ? 287 ARG A CB    1 
ATOM   2142 C  CG    . ARG A 1 307 ? 14.698 -14.038 26.553 1.00 16.29 ? 287 ARG A CG    1 
ATOM   2143 C  CD    . ARG A 1 307 ? 16.003 -14.097 27.361 1.00 14.84 ? 287 ARG A CD    1 
ATOM   2144 N  NE    . ARG A 1 307 ? 16.731 -12.811 27.422 1.00 12.97 ? 287 ARG A NE    1 
ATOM   2145 C  CZ    . ARG A 1 307 ? 17.762 -12.482 26.648 1.00 11.60 ? 287 ARG A CZ    1 
ATOM   2146 N  NH1   . ARG A 1 307 ? 18.231 -13.329 25.706 1.00 12.22 ? 287 ARG A NH1   1 
ATOM   2147 N  NH2   . ARG A 1 307 ? 18.342 -11.293 26.827 1.00 18.19 ? 287 ARG A NH2   1 
ATOM   2148 N  N     . SER A 1 308 ? 13.756 -18.434 24.569 1.00 10.72 ? 288 SER A N     1 
ATOM   2149 C  CA    . SER A 1 308 ? 13.025 -19.692 24.558 1.00 11.03 ? 288 SER A CA    1 
ATOM   2150 C  C     . SER A 1 308 ? 13.202 -20.389 23.238 1.00 12.04 ? 288 SER A C     1 
ATOM   2151 O  O     . SER A 1 308 ? 13.615 -19.778 22.246 1.00 10.69 ? 288 SER A O     1 
ATOM   2152 C  CB    . SER A 1 308 ? 11.530 -19.465 24.789 1.00 12.04 ? 288 SER A CB    1 
ATOM   2153 O  OG    . SER A 1 308 ? 10.943 -18.847 23.645 1.00 12.80 ? 288 SER A OG    1 
ATOM   2154 N  N     . GLY A 1 309 ? 12.817 -21.656 23.193 1.00 11.79 ? 289 GLY A N     1 
ATOM   2155 C  CA    . GLY A 1 309 ? 12.791 -22.370 21.935 1.00 11.06 ? 289 GLY A CA    1 
ATOM   2156 C  C     . GLY A 1 309 ? 11.790 -21.764 20.951 1.00 11.21 ? 289 GLY A C     1 
ATOM   2157 O  O     . GLY A 1 309 ? 12.005 -21.794 19.744 1.00 10.95 ? 289 GLY A O     1 
ATOM   2158 N  N     . GLY A 1 310 ? 10.679 -21.238 21.455 1.00 9.96  ? 290 GLY A N     1 
ATOM   2159 C  CA    . GLY A 1 310 ? 9.742  -20.553 20.585 1.00 11.45 ? 290 GLY A CA    1 
ATOM   2160 C  C     . GLY A 1 310 ? 10.375 -19.328 19.936 1.00 10.92 ? 290 GLY A C     1 
ATOM   2161 O  O     . GLY A 1 310 ? 10.056 -19.022 18.772 1.00 9.99  ? 290 GLY A O     1 
ATOM   2162 N  N     . ASP A 1 311 ? 11.240 -18.616 20.664 1.00 9.90  ? 291 ASP A N     1 
ATOM   2163 C  CA    . ASP A 1 311 ? 11.938 -17.464 20.081 1.00 9.49  ? 291 ASP A CA    1 
ATOM   2164 C  C     . ASP A 1 311 ? 12.896 -17.926 18.987 1.00 9.65  ? 291 ASP A C     1 
ATOM   2165 O  O     . ASP A 1 311 ? 13.059 -17.251 17.967 1.00 9.23  ? 291 ASP A O     1 
ATOM   2166 C  CB    . ASP A 1 311 ? 12.716 -16.695 21.143 1.00 10.28 ? 291 ASP A CB    1 
ATOM   2167 C  CG    . ASP A 1 311 ? 11.809 -15.949 22.113 1.00 14.60 ? 291 ASP A CG    1 
ATOM   2168 O  OD1   . ASP A 1 311 ? 10.601 -15.731 21.803 1.00 15.92 ? 291 ASP A OD1   1 
ATOM   2169 O  OD2   . ASP A 1 311 ? 12.300 -15.548 23.189 1.00 15.50 ? 291 ASP A OD2   1 
ATOM   2170 N  N     . VAL A 1 312 ? 13.572 -19.056 19.220 1.00 8.28  ? 292 VAL A N     1 
ATOM   2171 C  CA    . VAL A 1 312 ? 14.443 -19.624 18.190 1.00 6.54  ? 292 VAL A CA    1 
ATOM   2172 C  C     . VAL A 1 312 ? 13.620 -19.927 16.945 1.00 8.27  ? 292 VAL A C     1 
ATOM   2173 O  O     . VAL A 1 312 ? 14.053 -19.657 15.815 1.00 7.93  ? 292 VAL A O     1 
ATOM   2174 C  CB    . VAL A 1 312 ? 15.144 -20.898 18.702 1.00 6.67  ? 292 VAL A CB    1 
ATOM   2175 C  CG1   . VAL A 1 312 ? 15.951 -21.589 17.576 1.00 8.06  ? 292 VAL A CG1   1 
ATOM   2176 C  CG2   . VAL A 1 312 ? 16.031 -20.545 19.905 1.00 10.08 ? 292 VAL A CG2   1 
ATOM   2177 N  N     . LEU A 1 313 ? 12.430 -20.500 17.131 1.00 7.68  ? 293 LEU A N     1 
ATOM   2178 C  CA    . LEU A 1 313 ? 11.577 -20.787 15.992 1.00 7.24  ? 293 LEU A CA    1 
ATOM   2179 C  C     . LEU A 1 313 ? 11.202 -19.512 15.241 1.00 8.15  ? 293 LEU A C     1 
ATOM   2180 O  O     . LEU A 1 313 ? 11.214 -19.507 14.014 1.00 8.59  ? 293 LEU A O     1 
ATOM   2181 C  CB    . LEU A 1 313 ? 10.301 -21.524 16.443 1.00 7.94  ? 293 LEU A CB    1 
ATOM   2182 C  CG    . LEU A 1 313 ? 9.433  -22.011 15.275 1.00 8.40  ? 293 LEU A CG    1 
ATOM   2183 C  CD1   . LEU A 1 313 ? 10.078 -23.180 14.553 1.00 11.76 ? 293 LEU A CD1   1 
ATOM   2184 C  CD2   . LEU A 1 313 ? 8.022  -22.402 15.748 1.00 9.83  ? 293 LEU A CD2   1 
ATOM   2185 N  N     . LYS A 1 314 ? 10.865 -18.454 15.973 1.00 7.64  ? 294 LYS A N     1 
ATOM   2186 C  CA    . LYS A 1 314 ? 10.526 -17.182 15.305 1.00 7.18  ? 294 LYS A CA    1 
ATOM   2187 C  C     . LYS A 1 314 ? 11.689 -16.684 14.466 1.00 6.62  ? 294 LYS A C     1 
ATOM   2188 O  O     . LYS A 1 314 ? 11.524 -16.243 13.314 1.00 8.44  ? 294 LYS A O     1 
ATOM   2189 C  CB    . LYS A 1 314 ? 10.150 -16.116 16.330 1.00 6.71  ? 294 LYS A CB    1 
ATOM   2190 C  CG    . LYS A 1 314 ? 8.807  -16.350 17.010 1.00 10.09 ? 294 LYS A CG    1 
ATOM   2191 C  CD    . LYS A 1 314 ? 8.599  -15.357 18.132 1.00 9.37  ? 294 LYS A CD    1 
ATOM   2192 C  CE    . LYS A 1 314 ? 7.285  -15.676 18.855 1.00 11.27 ? 294 LYS A CE    1 
ATOM   2193 N  NZ    . LYS A 1 314 ? 6.908  -14.577 19.781 1.00 12.62 ? 294 LYS A NZ    1 
ATOM   2194 N  N     . ALA A 1 315 ? 12.880 -16.703 15.053 1.00 6.90  ? 295 ALA A N     1 
ATOM   2195 C  CA    . ALA A 1 315 ? 14.072 -16.255 14.309 1.00 6.26  ? 295 ALA A CA    1 
ATOM   2196 C  C     . ALA A 1 315 ? 14.285 -17.077 13.057 1.00 7.30  ? 295 ALA A C     1 
ATOM   2197 O  O     . ALA A 1 315 ? 14.614 -16.553 11.986 1.00 7.46  ? 295 ALA A O     1 
ATOM   2198 C  CB    . ALA A 1 315 ? 15.320 -16.342 15.210 1.00 7.70  ? 295 ALA A CB    1 
ATOM   2199 N  N     . THR A 1 316 ? 14.145 -18.399 13.166 1.00 6.26  ? 296 THR A N     1 
ATOM   2200 C  CA    A THR A 1 316 ? 14.291 -19.272 12.025 0.50 6.02  ? 296 THR A CA    1 
ATOM   2201 C  CA    B THR A 1 316 ? 14.352 -19.198 11.967 0.50 6.00  ? 296 THR A CA    1 
ATOM   2202 C  C     . THR A 1 316 ? 13.234 -18.947 10.953 1.00 7.04  ? 296 THR A C     1 
ATOM   2203 O  O     . THR A 1 316 ? 13.522 -18.894 9.745  1.00 7.87  ? 296 THR A O     1 
ATOM   2204 C  CB    A THR A 1 316 ? 14.196 -20.736 12.509 0.50 8.13  ? 296 THR A CB    1 
ATOM   2205 C  CB    B THR A 1 316 ? 14.473 -20.708 12.274 0.50 8.17  ? 296 THR A CB    1 
ATOM   2206 O  OG1   A THR A 1 316 ? 15.103 -20.925 13.608 0.50 15.27 ? 296 THR A OG1   1 
ATOM   2207 O  OG1   B THR A 1 316 ? 13.330 -21.149 13.006 0.50 5.87  ? 296 THR A OG1   1 
ATOM   2208 C  CG2   A THR A 1 316 ? 14.565 -21.685 11.418 0.50 10.31 ? 296 THR A CG2   1 
ATOM   2209 C  CG2   B THR A 1 316 ? 15.739 -20.981 13.092 0.50 7.29  ? 296 THR A CG2   1 
ATOM   2210 N  N     . ALA A 1 317 ? 11.983 -18.752 11.404 1.00 7.34  ? 297 ALA A N     1 
ATOM   2211 C  CA    . ALA A 1 317 ? 10.886 -18.483 10.458 1.00 7.88  ? 297 ALA A CA    1 
ATOM   2212 C  C     . ALA A 1 317 ? 11.114 -17.167 9.717  1.00 8.73  ? 297 ALA A C     1 
ATOM   2213 O  O     . ALA A 1 317 ? 10.647 -16.994 8.591  1.00 11.29 ? 297 ALA A O     1 
ATOM   2214 C  CB    . ALA A 1 317 ? 9.558  -18.447 11.170 1.00 7.98  ? 297 ALA A CB    1 
ATOM   2215 N  N     . LEU A 1 318 ? 11.798 -16.230 10.370 1.00 6.48  ? 298 LEU A N     1 
ATOM   2216 C  CA    . LEU A 1 318 ? 12.148 -14.966 9.692  1.00 6.86  ? 298 LEU A CA    1 
ATOM   2217 C  C     . LEU A 1 318 ? 13.386 -15.093 8.811  1.00 9.95  ? 298 LEU A C     1 
ATOM   2218 O  O     . LEU A 1 318 ? 13.746 -14.151 8.087  1.00 10.64 ? 298 LEU A O     1 
ATOM   2219 C  CB    . LEU A 1 318 ? 12.366 -13.876 10.733 1.00 7.17  ? 298 LEU A CB    1 
ATOM   2220 C  CG    . LEU A 1 318 ? 11.114 -13.439 11.510 1.00 9.25  ? 298 LEU A CG    1 
ATOM   2221 C  CD1   . LEU A 1 318 ? 11.534 -12.571 12.700 1.00 11.21 ? 298 LEU A CD1   1 
ATOM   2222 C  CD2   . LEU A 1 318 ? 10.184 -12.661 10.604 1.00 13.77 ? 298 LEU A CD2   1 
ATOM   2223 N  N     . GLY A 1 319 ? 14.039 -16.244 8.853  1.00 7.57  ? 299 GLY A N     1 
ATOM   2224 C  CA    . GLY A 1 319 ? 15.092 -16.548 7.898  1.00 9.09  ? 299 GLY A CA    1 
ATOM   2225 C  C     . GLY A 1 319 ? 16.475 -16.800 8.479  1.00 7.32  ? 299 GLY A C     1 
ATOM   2226 O  O     . GLY A 1 319 ? 17.386 -17.109 7.729  1.00 9.10  ? 299 GLY A O     1 
ATOM   2227 N  N     . ALA A 1 320 ? 16.634 -16.688 9.803  1.00 7.99  ? 300 ALA A N     1 
ATOM   2228 C  CA    . ALA A 1 320 ? 17.954 -16.908 10.394 1.00 7.66  ? 300 ALA A CA    1 
ATOM   2229 C  C     . ALA A 1 320 ? 18.446 -18.329 10.202 1.00 8.98  ? 300 ALA A C     1 
ATOM   2230 O  O     . ALA A 1 320 ? 17.657 -19.267 10.246 1.00 9.99  ? 300 ALA A O     1 
ATOM   2231 C  CB    . ALA A 1 320 ? 17.930 -16.583 11.874 1.00 7.40  ? 300 ALA A CB    1 
ATOM   2232 N  N     . SER A 1 321 ? 19.751 -18.453 9.984  1.00 7.14  ? 301 SER A N     1 
ATOM   2233 C  CA    . SER A 1 321 ? 20.445 -19.737 9.970  1.00 9.23  ? 301 SER A CA    1 
ATOM   2234 C  C     . SER A 1 321 ? 20.538 -20.327 11.372 1.00 11.03 ? 301 SER A C     1 
ATOM   2235 O  O     . SER A 1 321 ? 20.508 -21.554 11.554 1.00 11.65 ? 301 SER A O     1 
ATOM   2236 C  CB    . SER A 1 321 ? 21.869 -19.556 9.431  1.00 13.85 ? 301 SER A CB    1 
ATOM   2237 O  OG    . SER A 1 321 ? 21.870 -19.002 8.114  1.00 22.29 ? 301 SER A OG    1 
ATOM   2238 N  N     . ALA A 1 322 ? 20.717 -19.432 12.336 1.00 9.87  ? 302 ALA A N     1 
ATOM   2239 C  CA    . ALA A 1 322 ? 20.928 -19.784 13.721 1.00 7.90  ? 302 ALA A CA    1 
ATOM   2240 C  C     . ALA A 1 322 ? 20.856 -18.535 14.563 1.00 8.37  ? 302 ALA A C     1 
ATOM   2241 O  O     . ALA A 1 322 ? 20.891 -17.409 14.017 1.00 9.20  ? 302 ALA A O     1 
ATOM   2242 C  CB    . ALA A 1 322 ? 22.286 -20.473 13.894 1.00 8.94  ? 302 ALA A CB    1 
ATOM   2243 N  N     . VAL A 1 323 ? 20.781 -18.707 15.879 1.00 7.21  ? 303 VAL A N     1 
ATOM   2244 C  CA    . VAL A 1 323 ? 20.759 -17.573 16.791 1.00 6.17  ? 303 VAL A CA    1 
ATOM   2245 C  C     . VAL A 1 323 ? 21.977 -17.605 17.704 1.00 7.47  ? 303 VAL A C     1 
ATOM   2246 O  O     . VAL A 1 323 ? 22.585 -18.673 17.889 1.00 7.39  ? 303 VAL A O     1 
ATOM   2247 C  CB    . VAL A 1 323 ? 19.498 -17.552 17.682 1.00 6.99  ? 303 VAL A CB    1 
ATOM   2248 C  CG1   . VAL A 1 323 ? 18.213 -17.546 16.824 1.00 8.39  ? 303 VAL A CG1   1 
ATOM   2249 C  CG2   . VAL A 1 323 ? 19.471 -18.753 18.640 1.00 9.78  ? 303 VAL A CG2   1 
ATOM   2250 N  N     . LEU A 1 324 ? 22.304 -16.462 18.291 1.00 6.87  ? 304 LEU A N     1 
ATOM   2251 C  CA    . LEU A 1 324 ? 23.182 -16.450 19.477 1.00 6.62  ? 304 LEU A CA    1 
ATOM   2252 C  C     . LEU A 1 324 ? 22.339 -16.166 20.711 1.00 7.57  ? 304 LEU A C     1 
ATOM   2253 O  O     . LEU A 1 324 ? 21.348 -15.417 20.660 1.00 8.67  ? 304 LEU A O     1 
ATOM   2254 C  CB    . LEU A 1 324 ? 24.293 -15.398 19.389 1.00 7.10  ? 304 LEU A CB    1 
ATOM   2255 C  CG    . LEU A 1 324 ? 25.072 -15.351 18.076 1.00 6.98  ? 304 LEU A CG    1 
ATOM   2256 C  CD1   . LEU A 1 324 ? 26.176 -14.278 18.197 1.00 8.89  ? 304 LEU A CD1   1 
ATOM   2257 C  CD2   . LEU A 1 324 ? 25.663 -16.718 17.727 1.00 9.03  ? 304 LEU A CD2   1 
ATOM   2258 N  N     . VAL A 1 325 ? 22.772 -16.722 21.842 1.00 7.26  ? 305 VAL A N     1 
ATOM   2259 C  CA    . VAL A 1 325 ? 22.139 -16.480 23.147 1.00 7.72  ? 305 VAL A CA    1 
ATOM   2260 C  C     . VAL A 1 325 ? 23.221 -16.005 24.114 1.00 8.13  ? 305 VAL A C     1 
ATOM   2261 O  O     . VAL A 1 325 ? 24.245 -16.681 24.254 1.00 10.12 ? 305 VAL A O     1 
ATOM   2262 C  CB    . VAL A 1 325 ? 21.455 -17.763 23.688 1.00 6.45  ? 305 VAL A CB    1 
ATOM   2263 C  CG1   . VAL A 1 325 ? 20.789 -17.504 25.036 1.00 9.33  ? 305 VAL A CG1   1 
ATOM   2264 C  CG2   . VAL A 1 325 ? 20.402 -18.244 22.688 1.00 9.69  ? 305 VAL A CG2   1 
ATOM   2265 N  N     . GLY A 1 326 ? 23.008 -14.845 24.741 1.00 8.70  ? 306 GLY A N     1 
ATOM   2266 C  CA    . GLY A 1 326 ? 24.004 -14.237 25.602 1.00 7.53  ? 306 GLY A CA    1 
ATOM   2267 C  C     . GLY A 1 326 ? 23.614 -14.280 27.060 1.00 11.56 ? 306 GLY A C     1 
ATOM   2268 O  O     . GLY A 1 326 ? 24.006 -15.205 27.793 1.00 10.72 ? 306 GLY A O     1 
ATOM   2269 N  N     . ARG A 1 327 ? 22.856 -13.285 27.504 1.00 8.06  ? 307 ARG A N     1 
ATOM   2270 C  CA    . ARG A 1 327 ? 22.569 -13.168 28.942 1.00 9.82  ? 307 ARG A CA    1 
ATOM   2271 C  C     . ARG A 1 327 ? 22.038 -14.451 29.620 1.00 11.22 ? 307 ARG A C     1 
ATOM   2272 O  O     . ARG A 1 327 ? 22.524 -14.764 30.709 1.00 12.22 ? 307 ARG A O     1 
ATOM   2273 C  CB    . ARG A 1 327 ? 21.631 -12.000 29.196 1.00 9.71  ? 307 ARG A CB    1 
ATOM   2274 C  CG    . ARG A 1 327 ? 22.311 -10.667 28.942 1.00 10.31 ? 307 ARG A CG    1 
ATOM   2275 C  CD    . ARG A 1 327 ? 21.299 -9.525  29.098 1.00 8.98  ? 307 ARG A CD    1 
ATOM   2276 N  NE    . ARG A 1 327 ? 21.810 -8.189  28.806 1.00 9.96  ? 307 ARG A NE    1 
ATOM   2277 C  CZ    . ARG A 1 327 ? 21.660 -7.572  27.630 1.00 12.12 ? 307 ARG A CZ    1 
ATOM   2278 N  NH1   . ARG A 1 327 ? 21.102 -8.223  26.609 1.00 10.61 ? 307 ARG A NH1   1 
ATOM   2279 N  NH2   . ARG A 1 327 ? 22.087 -6.314  27.477 1.00 10.63 ? 307 ARG A NH2   1 
ATOM   2280 N  N     . PRO A 1 328 ? 21.119 -15.215 28.991 1.00 10.13 ? 308 PRO A N     1 
ATOM   2281 C  CA    . PRO A 1 328 ? 20.600 -16.409 29.686 1.00 8.03  ? 308 PRO A CA    1 
ATOM   2282 C  C     . PRO A 1 328 ? 21.700 -17.408 30.024 1.00 12.71 ? 308 PRO A C     1 
ATOM   2283 O  O     . PRO A 1 328 ? 21.608 -18.085 31.065 1.00 12.13 ? 308 PRO A O     1 
ATOM   2284 C  CB    . PRO A 1 328 ? 19.596 -16.998 28.694 1.00 9.60  ? 308 PRO A CB    1 
ATOM   2285 C  CG    . PRO A 1 328 ? 19.108 -15.759 27.946 1.00 10.69 ? 308 PRO A CG    1 
ATOM   2286 C  CD    . PRO A 1 328 ? 20.352 -14.948 27.750 1.00 10.71 ? 308 PRO A CD    1 
ATOM   2287 N  N     . VAL A 1 329 ? 22.725 -17.501 29.181 1.00 10.55 ? 309 VAL A N     1 
ATOM   2288 C  CA    . VAL A 1 329 ? 23.805 -18.456 29.439 1.00 9.99  ? 309 VAL A CA    1 
ATOM   2289 C  C     . VAL A 1 329 ? 24.555 -18.011 30.695 1.00 12.67 ? 309 VAL A C     1 
ATOM   2290 O  O     . VAL A 1 329 ? 24.963 -18.846 31.511 1.00 12.72 ? 309 VAL A O     1 
ATOM   2291 C  CB    . VAL A 1 329 ? 24.738 -18.575 28.234 1.00 10.43 ? 309 VAL A CB    1 
ATOM   2292 C  CG1   . VAL A 1 329 ? 25.896 -19.559 28.531 1.00 11.93 ? 309 VAL A CG1   1 
ATOM   2293 C  CG2   . VAL A 1 329 ? 23.955 -19.040 26.996 1.00 11.57 ? 309 VAL A CG2   1 
ATOM   2294 N  N     . MET A 1 330 ? 24.718 -16.704 30.867 1.00 10.17 ? 310 MET A N     1 
ATOM   2295 C  CA    . MET A 1 330 ? 25.402 -16.170 32.038 1.00 9.95  ? 310 MET A CA    1 
ATOM   2296 C  C     . MET A 1 330 ? 24.536 -16.322 33.281 1.00 12.88 ? 310 MET A C     1 
ATOM   2297 O  O     . MET A 1 330 ? 25.074 -16.523 34.379 1.00 14.54 ? 310 MET A O     1 
ATOM   2298 C  CB    . MET A 1 330 ? 25.784 -14.714 31.830 1.00 14.18 ? 310 MET A CB    1 
ATOM   2299 C  CG    . MET A 1 330 ? 26.660 -14.495 30.607 1.00 13.30 ? 310 MET A CG    1 
ATOM   2300 S  SD    . MET A 1 330 ? 28.232 -15.392 30.720 1.00 18.05 ? 310 MET A SD    1 
ATOM   2301 C  CE    . MET A 1 330 ? 28.043 -16.642 29.503 1.00 15.40 ? 310 MET A CE    1 
ATOM   2302 N  N     . TRP A 1 331 ? 23.211 -16.214 33.133 1.00 13.77 ? 311 TRP A N     1 
ATOM   2303 C  CA    . TRP A 1 331 ? 22.316 -16.475 34.280 1.00 11.45 ? 311 TRP A CA    1 
ATOM   2304 C  C     . TRP A 1 331 ? 22.533 -17.884 34.782 1.00 15.47 ? 311 TRP A C     1 
ATOM   2305 O  O     . TRP A 1 331 ? 22.634 -18.100 35.982 1.00 17.29 ? 311 TRP A O     1 
ATOM   2306 C  CB    . TRP A 1 331 ? 20.833 -16.335 33.925 1.00 12.93 ? 311 TRP A CB    1 
ATOM   2307 C  CG    . TRP A 1 331 ? 20.407 -15.008 33.428 1.00 13.28 ? 311 TRP A CG    1 
ATOM   2308 C  CD1   . TRP A 1 331 ? 21.013 -13.797 33.649 1.00 13.92 ? 311 TRP A CD1   1 
ATOM   2309 C  CD2   . TRP A 1 331 ? 19.250 -14.745 32.611 1.00 14.57 ? 311 TRP A CD2   1 
ATOM   2310 N  NE1   . TRP A 1 331 ? 20.304 -12.793 32.993 1.00 15.30 ? 311 TRP A NE1   1 
ATOM   2311 C  CE2   . TRP A 1 331 ? 19.230 -13.357 32.351 1.00 17.31 ? 311 TRP A CE2   1 
ATOM   2312 C  CE3   . TRP A 1 331 ? 18.247 -15.556 32.067 1.00 15.99 ? 311 TRP A CE3   1 
ATOM   2313 C  CZ2   . TRP A 1 331 ? 18.221 -12.757 31.568 1.00 14.86 ? 311 TRP A CZ2   1 
ATOM   2314 C  CZ3   . TRP A 1 331 ? 17.253 -14.965 31.289 1.00 17.12 ? 311 TRP A CZ3   1 
ATOM   2315 C  CH2   . TRP A 1 331 ? 17.253 -13.578 31.053 1.00 15.04 ? 311 TRP A CH2   1 
ATOM   2316 N  N     . ALA A 1 332 ? 22.575 -18.836 33.853 1.00 12.83 ? 312 ALA A N     1 
ATOM   2317 C  CA    . ALA A 1 332 ? 22.726 -20.255 34.193 1.00 11.16 ? 312 ALA A CA    1 
ATOM   2318 C  C     . ALA A 1 332 ? 24.089 -20.487 34.850 1.00 16.54 ? 312 ALA A C     1 
ATOM   2319 O  O     . ALA A 1 332 ? 24.196 -21.213 35.847 1.00 15.73 ? 312 ALA A O     1 
ATOM   2320 C  CB    . ALA A 1 332 ? 22.575 -21.121 32.957 1.00 12.66 ? 312 ALA A CB    1 
ATOM   2321 N  N     . LEU A 1 333 ? 25.124 -19.883 34.273 1.00 12.52 ? 313 LEU A N     1 
ATOM   2322 C  CA    . LEU A 1 333 ? 26.475 -19.927 34.843 1.00 12.48 ? 313 LEU A CA    1 
ATOM   2323 C  C     . LEU A 1 333 ? 26.507 -19.372 36.269 1.00 15.49 ? 313 LEU A C     1 
ATOM   2324 O  O     . LEU A 1 333 ? 27.082 -20.002 37.183 1.00 15.81 ? 313 LEU A O     1 
ATOM   2325 C  CB    . LEU A 1 333 ? 27.442 -19.136 33.949 1.00 11.30 ? 313 LEU A CB    1 
ATOM   2326 C  CG    . LEU A 1 333 ? 28.875 -18.976 34.465 1.00 11.82 ? 313 LEU A CG    1 
ATOM   2327 C  CD1   . LEU A 1 333 ? 29.561 -20.348 34.546 1.00 14.32 ? 313 LEU A CD1   1 
ATOM   2328 C  CD2   . LEU A 1 333 ? 29.681 -18.029 33.560 1.00 13.25 ? 313 LEU A CD2   1 
ATOM   2329 N  N     . ALA A 1 334 ? 25.911 -18.206 36.481 1.00 15.20 ? 314 ALA A N     1 
ATOM   2330 C  CA    . ALA A 1 334 ? 25.895 -17.604 37.816 1.00 16.03 ? 314 ALA A CA    1 
ATOM   2331 C  C     . ALA A 1 334 ? 25.117 -18.486 38.800 1.00 19.89 ? 314 ALA A C     1 
ATOM   2332 O  O     . ALA A 1 334 ? 25.516 -18.648 39.965 1.00 20.00 ? 314 ALA A O     1 
ATOM   2333 C  CB    . ALA A 1 334 ? 25.303 -16.203 37.771 1.00 19.43 ? 314 ALA A CB    1 
ATOM   2334 N  N     . ALA A 1 335 ? 24.013 -19.057 38.328 1.00 16.13 ? 315 ALA A N     1 
ATOM   2335 C  CA    . ALA A 1 335 ? 23.119 -19.814 39.201 1.00 20.51 ? 315 ALA A CA    1 
ATOM   2336 C  C     . ALA A 1 335 ? 23.729 -21.137 39.651 1.00 22.08 ? 315 ALA A C     1 
ATOM   2337 O  O     . ALA A 1 335 ? 23.539 -21.547 40.807 1.00 23.67 ? 315 ALA A O     1 
ATOM   2338 C  CB    . ALA A 1 335 ? 21.792 -20.074 38.501 1.00 19.26 ? 315 ALA A CB    1 
ATOM   2339 N  N     . ALA A 1 336 ? 24.433 -21.820 38.750 1.00 16.65 ? 316 ALA A N     1 
ATOM   2340 C  CA    . ALA A 1 336 ? 24.848 -23.197 39.043 1.00 15.79 ? 316 ALA A CA    1 
ATOM   2341 C  C     . ALA A 1 336 ? 26.054 -23.699 38.243 1.00 13.85 ? 316 ALA A C     1 
ATOM   2342 O  O     . ALA A 1 336 ? 26.235 -24.906 38.079 1.00 17.66 ? 316 ALA A O     1 
ATOM   2343 C  CB    . ALA A 1 336 ? 23.668 -24.135 38.833 1.00 19.49 ? 316 ALA A CB    1 
ATOM   2344 N  N     . GLY A 1 337 ? 26.890 -22.783 37.766 1.00 13.63 ? 317 GLY A N     1 
ATOM   2345 C  CA    . GLY A 1 337 ? 28.118 -23.157 37.097 1.00 13.98 ? 317 GLY A CA    1 
ATOM   2346 C  C     . GLY A 1 337 ? 27.908 -24.022 35.871 1.00 16.62 ? 317 GLY A C     1 
ATOM   2347 O  O     . GLY A 1 337 ? 26.921 -23.848 35.135 1.00 15.45 ? 317 GLY A O     1 
ATOM   2348 N  N     . GLN A 1 338 ? 28.811 -24.964 35.650 1.00 14.22 ? 318 GLN A N     1 
ATOM   2349 C  CA    . GLN A 1 338 ? 28.708 -25.815 34.477 1.00 14.87 ? 318 GLN A CA    1 
ATOM   2350 C  C     . GLN A 1 338 ? 27.375 -26.559 34.414 1.00 17.77 ? 318 GLN A C     1 
ATOM   2351 O  O     . GLN A 1 338 ? 26.776 -26.676 33.348 1.00 13.78 ? 318 GLN A O     1 
ATOM   2352 C  CB    . GLN A 1 338 ? 29.864 -26.827 34.417 1.00 15.01 ? 318 GLN A CB    1 
ATOM   2353 C  CG    . GLN A 1 338 ? 29.873 -27.674 33.126 1.00 14.48 ? 318 GLN A CG    1 
ATOM   2354 C  CD    . GLN A 1 338 ? 30.922 -28.766 33.129 1.00 15.69 ? 318 GLN A CD    1 
ATOM   2355 O  OE1   . GLN A 1 338 ? 31.957 -28.645 33.780 1.00 18.36 ? 318 GLN A OE1   1 
ATOM   2356 N  NE2   . GLN A 1 338 ? 30.673 -29.820 32.371 1.00 22.30 ? 318 GLN A NE2   1 
ATOM   2357 N  N     . ASP A 1 339 ? 26.918 -27.107 35.537 1.00 15.00 ? 319 ASP A N     1 
ATOM   2358 C  CA    A ASP A 1 339 ? 25.666 -27.860 35.541 0.50 17.48 ? 319 ASP A CA    1 
ATOM   2359 C  CA    B ASP A 1 339 ? 25.674 -27.869 35.529 0.50 17.42 ? 319 ASP A CA    1 
ATOM   2360 C  C     . ASP A 1 339 ? 24.483 -26.961 35.203 1.00 14.51 ? 319 ASP A C     1 
ATOM   2361 O  O     . ASP A 1 339 ? 23.522 -27.401 34.567 1.00 17.03 ? 319 ASP A O     1 
ATOM   2362 C  CB    A ASP A 1 339 ? 25.428 -28.532 36.895 0.50 21.31 ? 319 ASP A CB    1 
ATOM   2363 C  CB    B ASP A 1 339 ? 25.465 -28.581 36.873 0.50 21.40 ? 319 ASP A CB    1 
ATOM   2364 C  CG    A ASP A 1 339 ? 24.307 -29.549 36.842 0.50 15.16 ? 319 ASP A CG    1 
ATOM   2365 C  CG    B ASP A 1 339 ? 26.419 -29.758 37.071 0.50 20.99 ? 319 ASP A CG    1 
ATOM   2366 O  OD1   A ASP A 1 339 ? 24.454 -30.545 36.107 0.50 22.93 ? 319 ASP A OD1   1 
ATOM   2367 O  OD1   B ASP A 1 339 ? 26.767 -30.433 36.073 0.50 32.85 ? 319 ASP A OD1   1 
ATOM   2368 O  OD2   A ASP A 1 339 ? 23.281 -29.348 37.524 0.50 25.96 ? 319 ASP A OD2   1 
ATOM   2369 O  OD2   B ASP A 1 339 ? 26.815 -30.009 38.228 0.50 42.12 ? 319 ASP A OD2   1 
ATOM   2370 N  N     . GLY A 1 340 ? 24.558 -25.703 35.622 1.00 14.57 ? 320 GLY A N     1 
ATOM   2371 C  CA    . GLY A 1 340 ? 23.525 -24.731 35.305 1.00 16.16 ? 320 GLY A CA    1 
ATOM   2372 C  C     . GLY A 1 340 ? 23.446 -24.495 33.805 1.00 16.44 ? 320 GLY A C     1 
ATOM   2373 O  O     . GLY A 1 340 ? 22.355 -24.518 33.217 1.00 13.08 ? 320 GLY A O     1 
ATOM   2374 N  N     . VAL A 1 341 ? 24.597 -24.300 33.176 1.00 15.36 ? 321 VAL A N     1 
ATOM   2375 C  CA    . VAL A 1 341 ? 24.599 -24.079 31.728 1.00 11.27 ? 321 VAL A CA    1 
ATOM   2376 C  C     . VAL A 1 341 ? 24.125 -25.342 31.021 1.00 14.35 ? 321 VAL A C     1 
ATOM   2377 O  O     . VAL A 1 341 ? 23.347 -25.273 30.063 1.00 13.75 ? 321 VAL A O     1 
ATOM   2378 C  CB    . VAL A 1 341 ? 25.977 -23.642 31.210 1.00 12.33 ? 321 VAL A CB    1 
ATOM   2379 C  CG1   . VAL A 1 341 ? 25.934 -23.476 29.678 1.00 11.38 ? 321 VAL A CG1   1 
ATOM   2380 C  CG2   . VAL A 1 341 ? 26.395 -22.328 31.873 1.00 13.28 ? 321 VAL A CG2   1 
ATOM   2381 N  N     . ARG A 1 342 ? 24.542 -26.518 31.508 1.00 13.53 ? 322 ARG A N     1 
ATOM   2382 C  CA    . ARG A 1 342 ? 24.013 -27.769 30.964 1.00 13.80 ? 322 ARG A CA    1 
ATOM   2383 C  C     . ARG A 1 342 ? 22.477 -27.812 31.021 1.00 12.37 ? 322 ARG A C     1 
ATOM   2384 O  O     . ARG A 1 342 ? 21.827 -28.173 30.032 1.00 15.08 ? 322 ARG A O     1 
ATOM   2385 C  CB    . ARG A 1 342 ? 24.592 -28.985 31.715 1.00 15.74 ? 322 ARG A CB    1 
ATOM   2386 C  CG    . ARG A 1 342 ? 23.993 -30.312 31.248 1.00 19.30 ? 322 ARG A CG    1 
ATOM   2387 C  CD    . ARG A 1 342 ? 24.348 -31.481 32.191 1.00 34.61 ? 322 ARG A CD    1 
ATOM   2388 N  NE    . ARG A 1 342 ? 23.817 -31.277 33.540 1.00 44.88 ? 322 ARG A NE    1 
ATOM   2389 C  CZ    . ARG A 1 342 ? 22.578 -31.587 33.916 1.00 41.98 ? 322 ARG A CZ    1 
ATOM   2390 N  NH1   . ARG A 1 342 ? 21.733 -32.124 33.047 1.00 51.95 ? 322 ARG A NH1   1 
ATOM   2391 N  NH2   . ARG A 1 342 ? 22.183 -31.358 35.164 1.00 42.46 ? 322 ARG A NH2   1 
ATOM   2392 N  N     . GLN A 1 343 ? 21.899 -27.438 32.154 1.00 12.24 ? 323 GLN A N     1 
ATOM   2393 C  CA    . GLN A 1 343 ? 20.443 -27.510 32.302 1.00 12.76 ? 323 GLN A CA    1 
ATOM   2394 C  C     . GLN A 1 343 ? 19.759 -26.524 31.354 1.00 10.54 ? 323 GLN A C     1 
ATOM   2395 O  O     . GLN A 1 343 ? 18.721 -26.845 30.748 1.00 13.22 ? 323 GLN A O     1 
ATOM   2396 C  CB    . GLN A 1 343 ? 20.024 -27.228 33.739 1.00 17.34 ? 323 GLN A CB    1 
ATOM   2397 C  CG    . GLN A 1 343 ? 20.380 -28.355 34.689 1.00 25.62 ? 323 GLN A CG    1 
ATOM   2398 C  CD    . GLN A 1 343 ? 19.930 -28.063 36.106 1.00 44.98 ? 323 GLN A CD    1 
ATOM   2399 O  OE1   . GLN A 1 343 ? 18.735 -28.100 36.405 1.00 47.62 ? 323 GLN A OE1   1 
ATOM   2400 N  NE2   . GLN A 1 343 ? 20.884 -27.749 36.983 1.00 41.29 ? 323 GLN A NE2   1 
ATOM   2401 N  N     . LEU A 1 344 ? 20.359 -25.346 31.224 1.00 12.33 ? 324 LEU A N     1 
ATOM   2402 C  CA    . LEU A 1 344 ? 19.819 -24.345 30.302 1.00 12.08 ? 324 LEU A CA    1 
ATOM   2403 C  C     . LEU A 1 344 ? 19.804 -24.889 28.880 1.00 12.46 ? 324 LEU A C     1 
ATOM   2404 O  O     . LEU A 1 344 ? 18.778 -24.790 28.175 1.00 12.38 ? 324 LEU A O     1 
ATOM   2405 C  CB    . LEU A 1 344 ? 20.639 -23.063 30.358 1.00 14.08 ? 324 LEU A CB    1 
ATOM   2406 C  CG    . LEU A 1 344 ? 20.377 -22.113 29.183 1.00 18.77 ? 324 LEU A CG    1 
ATOM   2407 C  CD1   . LEU A 1 344 ? 18.993 -21.585 29.348 1.00 21.81 ? 324 LEU A CD1   1 
ATOM   2408 C  CD2   . LEU A 1 344 ? 21.376 -20.990 29.185 1.00 20.36 ? 324 LEU A CD2   1 
ATOM   2409 N  N     . LEU A 1 345 ? 20.916 -25.469 28.437 1.00 12.02 ? 325 LEU A N     1 
ATOM   2410 C  CA    . LEU A 1 345 ? 20.982 -25.941 27.060 1.00 10.08 ? 325 LEU A CA    1 
ATOM   2411 C  C     . LEU A 1 345 ? 20.072 -27.148 26.838 1.00 15.02 ? 325 LEU A C     1 
ATOM   2412 O  O     . LEU A 1 345 ? 19.533 -27.333 25.745 1.00 15.31 ? 325 LEU A O     1 
ATOM   2413 C  CB    . LEU A 1 345 ? 22.429 -26.256 26.663 1.00 11.86 ? 325 LEU A CB    1 
ATOM   2414 C  CG    . LEU A 1 345 ? 23.335 -25.018 26.711 1.00 11.38 ? 325 LEU A CG    1 
ATOM   2415 C  CD1   . LEU A 1 345 ? 24.758 -25.407 26.377 1.00 14.68 ? 325 LEU A CD1   1 
ATOM   2416 C  CD2   . LEU A 1 345 ? 22.843 -23.933 25.715 1.00 12.16 ? 325 LEU A CD2   1 
ATOM   2417 N  N     . GLU A 1 346 ? 19.878 -27.975 27.873 1.00 12.01 ? 326 GLU A N     1 
ATOM   2418 C  CA    . GLU A 1 346 ? 18.936 -29.081 27.746 1.00 13.38 ? 326 GLU A CA    1 
ATOM   2419 C  C     . GLU A 1 346 ? 17.504 -28.551 27.626 1.00 12.15 ? 326 GLU A C     1 
ATOM   2420 O  O     . GLU A 1 346 ? 16.710 -29.082 26.847 1.00 13.30 ? 326 GLU A O     1 
ATOM   2421 C  CB    . GLU A 1 346 ? 19.072 -30.043 28.941 1.00 16.62 ? 326 GLU A CB    1 
ATOM   2422 C  CG    . GLU A 1 346 ? 20.285 -30.962 28.804 1.00 34.91 ? 326 GLU A CG    1 
ATOM   2423 C  CD    . GLU A 1 346 ? 20.571 -31.793 30.049 1.00 63.01 ? 326 GLU A CD    1 
ATOM   2424 O  OE1   . GLU A 1 346 ? 19.814 -31.681 31.036 1.00 40.14 ? 326 GLU A OE1   1 
ATOM   2425 O  OE2   . GLU A 1 346 ? 21.562 -32.559 30.035 1.00 44.51 ? 326 GLU A OE2   1 
ATOM   2426 N  N     . LEU A 1 347 ? 17.192 -27.518 28.397 1.00 11.39 ? 327 LEU A N     1 
ATOM   2427 C  CA    . LEU A 1 347 ? 15.869 -26.901 28.354 1.00 11.21 ? 327 LEU A CA    1 
ATOM   2428 C  C     . LEU A 1 347 ? 15.640 -26.286 26.978 1.00 12.73 ? 327 LEU A C     1 
ATOM   2429 O  O     . LEU A 1 347 ? 14.593 -26.505 26.352 1.00 12.46 ? 327 LEU A O     1 
ATOM   2430 C  CB    . LEU A 1 347 ? 15.734 -25.851 29.451 1.00 12.08 ? 327 LEU A CB    1 
ATOM   2431 C  CG    . LEU A 1 347 ? 14.477 -24.982 29.489 1.00 15.95 ? 327 LEU A CG    1 
ATOM   2432 C  CD1   . LEU A 1 347 ? 13.220 -25.847 29.554 1.00 19.32 ? 327 LEU A CD1   1 
ATOM   2433 C  CD2   . LEU A 1 347 ? 14.562 -24.042 30.676 1.00 23.07 ? 327 LEU A CD2   1 
ATOM   2434 N  N     . LEU A 1 348 ? 16.622 -25.539 26.493 1.00 11.58 ? 328 LEU A N     1 
ATOM   2435 C  CA    A LEU A 1 348 ? 16.454 -24.922 25.173 0.50 10.02 ? 328 LEU A CA    1 
ATOM   2436 C  CA    B LEU A 1 348 ? 16.510 -24.924 25.170 0.50 10.09 ? 328 LEU A CA    1 
ATOM   2437 C  C     . LEU A 1 348 ? 16.334 -25.981 24.088 1.00 10.10 ? 328 LEU A C     1 
ATOM   2438 O  O     . LEU A 1 348 ? 15.522 -25.844 23.169 1.00 11.79 ? 328 LEU A O     1 
ATOM   2439 C  CB    A LEU A 1 348 ? 17.601 -23.959 24.861 0.50 10.07 ? 328 LEU A CB    1 
ATOM   2440 C  CB    B LEU A 1 348 ? 17.745 -24.071 24.897 0.50 11.34 ? 328 LEU A CB    1 
ATOM   2441 C  CG    A LEU A 1 348 ? 17.534 -22.615 25.585 0.50 8.33  ? 328 LEU A CG    1 
ATOM   2442 C  CG    B LEU A 1 348 ? 17.736 -23.021 23.799 0.50 18.10 ? 328 LEU A CG    1 
ATOM   2443 C  CD1   A LEU A 1 348 ? 18.826 -21.830 25.388 0.50 11.45 ? 328 LEU A CD1   1 
ATOM   2444 C  CD1   B LEU A 1 348 ? 16.538 -22.110 23.936 0.50 12.47 ? 328 LEU A CD1   1 
ATOM   2445 C  CD2   A LEU A 1 348 ? 16.339 -21.785 25.119 0.50 12.69 ? 328 LEU A CD2   1 
ATOM   2446 C  CD2   B LEU A 1 348 ? 19.014 -22.230 23.952 0.50 15.73 ? 328 LEU A CD2   1 
ATOM   2447 N  N     . ALA A 1 349 ? 17.102 -27.062 24.187 1.00 10.37 ? 329 ALA A N     1 
ATOM   2448 C  CA    . ALA A 1 349 ? 16.972 -28.131 23.223 1.00 10.20 ? 329 ALA A CA    1 
ATOM   2449 C  C     . ALA A 1 349 ? 15.566 -28.716 23.226 1.00 10.92 ? 329 ALA A C     1 
ATOM   2450 O  O     . ALA A 1 349 ? 15.004 -28.980 22.162 1.00 13.72 ? 329 ALA A O     1 
ATOM   2451 C  CB    . ALA A 1 349 ? 18.010 -29.232 23.500 1.00 12.80 ? 329 ALA A CB    1 
ATOM   2452 N  N     A GLU A 1 350 ? 14.981 -28.945 24.400 0.70 11.01 ? 330 GLU A N     1 
ATOM   2453 N  N     B GLU A 1 350 ? 15.027 -28.939 24.420 0.30 11.03 ? 330 GLU A N     1 
ATOM   2454 C  CA    A GLU A 1 350 ? 13.634 -29.508 24.421 0.70 11.97 ? 330 GLU A CA    1 
ATOM   2455 C  CA    B GLU A 1 350 ? 13.671 -29.441 24.561 0.30 12.12 ? 330 GLU A CA    1 
ATOM   2456 C  C     A GLU A 1 350 ? 12.616 -28.486 23.897 0.70 9.58  ? 330 GLU A C     1 
ATOM   2457 C  C     B GLU A 1 350 ? 12.703 -28.491 23.871 0.30 9.60  ? 330 GLU A C     1 
ATOM   2458 O  O     A GLU A 1 350 ? 11.661 -28.861 23.199 0.70 11.71 ? 330 GLU A O     1 
ATOM   2459 O  O     B GLU A 1 350 ? 11.904 -28.913 23.022 0.30 9.42  ? 330 GLU A O     1 
ATOM   2460 C  CB    A GLU A 1 350 ? 13.231 -29.977 25.823 0.70 13.89 ? 330 GLU A CB    1 
ATOM   2461 C  CB    B GLU A 1 350 ? 13.305 -29.612 26.041 0.30 9.85  ? 330 GLU A CB    1 
ATOM   2462 C  CG    A GLU A 1 350 ? 11.858 -30.662 25.853 0.70 22.60 ? 330 GLU A CG    1 
ATOM   2463 C  CG    B GLU A 1 350 ? 13.967 -30.824 26.686 0.30 12.01 ? 330 GLU A CG    1 
ATOM   2464 C  CD    A GLU A 1 350 ? 11.665 -31.679 24.711 0.70 50.54 ? 330 GLU A CD    1 
ATOM   2465 C  CD    B GLU A 1 350 ? 13.530 -31.038 28.120 0.30 25.42 ? 330 GLU A CD    1 
ATOM   2466 O  OE1   A GLU A 1 350 ? 10.720 -31.515 23.895 0.70 35.39 ? 330 GLU A OE1   1 
ATOM   2467 O  OE1   B GLU A 1 350 ? 12.364 -30.721 28.443 0.30 20.19 ? 330 GLU A OE1   1 
ATOM   2468 O  OE2   A GLU A 1 350 ? 12.459 -32.644 24.624 0.70 34.86 ? 330 GLU A OE2   1 
ATOM   2469 O  OE2   B GLU A 1 350 ? 14.354 -31.520 28.924 0.30 23.40 ? 330 GLU A OE2   1 
ATOM   2470 N  N     . GLU A 1 351 ? 12.815 -27.211 24.211 1.00 9.65  ? 331 GLU A N     1 
ATOM   2471 C  CA    . GLU A 1 351 ? 11.873 -26.189 23.731 1.00 9.60  ? 331 GLU A CA    1 
ATOM   2472 C  C     . GLU A 1 351 ? 11.960 -26.042 22.207 1.00 9.81  ? 331 GLU A C     1 
ATOM   2473 O  O     . GLU A 1 351 ? 10.936 -25.833 21.557 1.00 9.19  ? 331 GLU A O     1 
ATOM   2474 C  CB    . GLU A 1 351 ? 12.128 -24.848 24.396 1.00 10.95 ? 331 GLU A CB    1 
ATOM   2475 C  CG    . GLU A 1 351 ? 11.727 -24.769 25.876 1.00 11.37 ? 331 GLU A CG    1 
ATOM   2476 C  CD    . GLU A 1 351 ? 12.088 -23.438 26.479 1.00 18.09 ? 331 GLU A CD    1 
ATOM   2477 O  OE1   . GLU A 1 351 ? 12.818 -22.668 25.822 1.00 19.34 ? 331 GLU A OE1   1 
ATOM   2478 O  OE2   . GLU A 1 351 ? 11.650 -23.135 27.610 1.00 22.87 ? 331 GLU A OE2   1 
ATOM   2479 N  N     . VAL A 1 352 ? 13.168 -26.124 21.645 1.00 8.46  ? 332 VAL A N     1 
ATOM   2480 C  CA    . VAL A 1 352 ? 13.307 -25.995 20.188 1.00 9.01  ? 332 VAL A CA    1 
ATOM   2481 C  C     . VAL A 1 352 ? 12.652 -27.180 19.471 1.00 10.59 ? 332 VAL A C     1 
ATOM   2482 O  O     . VAL A 1 352 ? 11.925 -27.000 18.476 1.00 9.11  ? 332 VAL A O     1 
ATOM   2483 C  CB    . VAL A 1 352 ? 14.796 -25.863 19.770 1.00 8.96  ? 332 VAL A CB    1 
ATOM   2484 C  CG1   . VAL A 1 352 ? 14.954 -25.964 18.244 1.00 10.90 ? 332 VAL A CG1   1 
ATOM   2485 C  CG2   . VAL A 1 352 ? 15.384 -24.555 20.285 1.00 8.88  ? 332 VAL A CG2   1 
ATOM   2486 N  N     A ARG A 1 353 ? 12.898 -28.393 19.966 0.50 10.65 ? 333 ARG A N     1 
ATOM   2487 N  N     B ARG A 1 353 ? 12.886 -28.389 19.975 0.50 10.68 ? 333 ARG A N     1 
ATOM   2488 C  CA    A ARG A 1 353 ? 12.266 -29.573 19.393 0.50 9.09  ? 333 ARG A CA    1 
ATOM   2489 C  CA    B ARG A 1 353 ? 12.281 -29.567 19.378 0.50 9.06  ? 333 ARG A CA    1 
ATOM   2490 C  C     A ARG A 1 353 ? 10.747 -29.470 19.471 0.50 7.25  ? 333 ARG A C     1 
ATOM   2491 C  C     B ARG A 1 353 ? 10.754 -29.501 19.481 0.50 7.28  ? 333 ARG A C     1 
ATOM   2492 O  O     A ARG A 1 353 ? 10.041 -29.763 18.500 0.50 9.55  ? 333 ARG A O     1 
ATOM   2493 O  O     B ARG A 1 353 ? 10.049 -29.833 18.521 0.50 9.56  ? 333 ARG A O     1 
ATOM   2494 C  CB    A ARG A 1 353 ? 12.723 -30.847 20.110 0.50 11.80 ? 333 ARG A CB    1 
ATOM   2495 C  CB    B ARG A 1 353 ? 12.815 -30.834 20.052 0.50 11.80 ? 333 ARG A CB    1 
ATOM   2496 C  CG    A ARG A 1 353 ? 11.931 -32.059 19.669 0.50 12.89 ? 333 ARG A CG    1 
ATOM   2497 C  CG    B ARG A 1 353 ? 12.568 -32.097 19.264 0.50 14.08 ? 333 ARG A CG    1 
ATOM   2498 C  CD    A ARG A 1 353 ? 12.330 -33.323 20.419 0.50 18.18 ? 333 ARG A CD    1 
ATOM   2499 C  CD    B ARG A 1 353 ? 13.161 -33.296 19.997 0.50 22.58 ? 333 ARG A CD    1 
ATOM   2500 N  NE    A ARG A 1 353 ? 12.013 -34.502 19.617 0.50 26.73 ? 333 ARG A NE    1 
ATOM   2501 N  NE    B ARG A 1 353 ? 13.153 -34.496 19.165 0.50 38.48 ? 333 ARG A NE    1 
ATOM   2502 C  CZ    A ARG A 1 353 ? 10.814 -35.067 19.558 0.50 38.17 ? 333 ARG A CZ    1 
ATOM   2503 C  CZ    B ARG A 1 353 ? 14.141 -34.831 18.345 0.50 26.22 ? 333 ARG A CZ    1 
ATOM   2504 N  NH1   A ARG A 1 353 ? 9.807  -34.570 20.267 0.50 33.79 ? 333 ARG A NH1   1 
ATOM   2505 N  NH1   B ARG A 1 353 ? 15.218 -34.059 18.249 0.50 33.45 ? 333 ARG A NH1   1 
ATOM   2506 N  NH2   A ARG A 1 353 ? 10.623 -36.131 18.788 0.50 30.82 ? 333 ARG A NH2   1 
ATOM   2507 N  NH2   B ARG A 1 353 ? 14.057 -35.941 17.628 0.50 25.13 ? 333 ARG A NH2   1 
ATOM   2508 N  N     . ASP A 1 354 ? 10.261 -29.079 20.645 1.00 10.20 ? 334 ASP A N     1 
ATOM   2509 C  CA    . ASP A 1 354 ? 8.821  -28.925 20.884 1.00 9.83  ? 334 ASP A CA    1 
ATOM   2510 C  C     . ASP A 1 354 ? 8.214  -27.937 19.899 1.00 11.27 ? 334 ASP A C     1 
ATOM   2511 O  O     . ASP A 1 354 ? 7.237  -28.256 19.208 1.00 11.02 ? 334 ASP A O     1 
ATOM   2512 C  CB    . ASP A 1 354 ? 8.567  -28.455 22.320 1.00 11.69 ? 334 ASP A CB    1 
ATOM   2513 C  CG    . ASP A 1 354 ? 7.084  -28.292 22.638 1.00 19.04 ? 334 ASP A CG    1 
ATOM   2514 O  OD1   . ASP A 1 354 ? 6.330  -29.280 22.464 1.00 17.81 ? 334 ASP A OD1   1 
ATOM   2515 O  OD2   . ASP A 1 354 ? 6.671  -27.178 23.044 1.00 17.59 ? 334 ASP A OD2   1 
ATOM   2516 N  N     . ALA A 1 355 ? 8.810  -26.751 19.825 1.00 9.41  ? 335 ALA A N     1 
ATOM   2517 C  CA    . ALA A 1 355 ? 8.285  -25.704 18.934 1.00 7.36  ? 335 ALA A CA    1 
ATOM   2518 C  C     . ALA A 1 355 ? 8.313  -26.138 17.480 1.00 10.31 ? 335 ALA A C     1 
ATOM   2519 O  O     . ALA A 1 355 ? 7.343  -25.931 16.727 1.00 8.39  ? 335 ALA A O     1 
ATOM   2520 C  CB    . ALA A 1 355 ? 9.102  -24.397 19.125 1.00 8.08  ? 335 ALA A CB    1 
ATOM   2521 N  N     . MET A 1 356 ? 9.412  -26.758 17.058 1.00 8.62  ? 336 MET A N     1 
ATOM   2522 C  CA    . MET A 1 356 ? 9.506  -27.191 15.668 1.00 7.96  ? 336 MET A CA    1 
ATOM   2523 C  C     . MET A 1 356 ? 8.440  -28.209 15.328 1.00 10.59 ? 336 MET A C     1 
ATOM   2524 O  O     . MET A 1 356 ? 7.797  -28.112 14.292 1.00 10.25 ? 336 MET A O     1 
ATOM   2525 C  CB    . MET A 1 356 ? 10.892 -27.781 15.362 1.00 10.54 ? 336 MET A CB    1 
ATOM   2526 C  CG    . MET A 1 356 ? 11.930 -26.715 15.210 1.00 8.85  ? 336 MET A CG    1 
ATOM   2527 S  SD    . MET A 1 356 ? 13.585 -27.431 14.968 1.00 12.87 ? 336 MET A SD    1 
ATOM   2528 C  CE    . MET A 1 356 ? 13.289 -28.377 13.486 1.00 13.73 ? 336 MET A CE    1 
ATOM   2529 N  N     . GLY A 1 357 ? 8.250  -29.195 16.205 1.00 9.97  ? 337 GLY A N     1 
ATOM   2530 C  CA    . GLY A 1 357 ? 7.271  -30.226 15.919 1.00 10.30 ? 337 GLY A CA    1 
ATOM   2531 C  C     . GLY A 1 357 ? 5.854  -29.688 15.915 1.00 7.94  ? 337 GLY A C     1 
ATOM   2532 O  O     . GLY A 1 357 ? 5.052  -30.028 15.028 1.00 9.52  ? 337 GLY A O     1 
ATOM   2533 N  N     . LEU A 1 358 ? 5.536  -28.859 16.909 1.00 8.52  ? 338 LEU A N     1 
ATOM   2534 C  CA    . LEU A 1 358 ? 4.209  -28.266 16.966 1.00 8.01  ? 338 LEU A CA    1 
ATOM   2535 C  C     . LEU A 1 358 ? 3.948  -27.417 15.733 1.00 11.36 ? 338 LEU A C     1 
ATOM   2536 O  O     . LEU A 1 358 ? 2.810  -27.308 15.304 1.00 11.51 ? 338 LEU A O     1 
ATOM   2537 C  CB    . LEU A 1 358 ? 4.041  -27.449 18.238 1.00 9.22  ? 338 LEU A CB    1 
ATOM   2538 C  CG    . LEU A 1 358 ? 4.077  -28.330 19.491 1.00 10.97 ? 338 LEU A CG    1 
ATOM   2539 C  CD1   . LEU A 1 358 ? 3.924  -27.473 20.703 1.00 11.25 ? 338 LEU A CD1   1 
ATOM   2540 C  CD2   . LEU A 1 358 ? 2.977  -29.383 19.447 1.00 16.01 ? 338 LEU A CD2   1 
ATOM   2541 N  N     . ALA A 1 359 ? 5.007  -26.858 15.130 1.00 7.83  ? 339 ALA A N     1 
ATOM   2542 C  CA    . ALA A 1 359 ? 4.835  -26.065 13.903 1.00 7.53  ? 339 ALA A CA    1 
ATOM   2543 C  C     . ALA A 1 359 ? 4.978  -26.880 12.603 1.00 8.06  ? 339 ALA A C     1 
ATOM   2544 O  O     . ALA A 1 359 ? 4.965  -26.319 11.474 1.00 9.44  ? 339 ALA A O     1 
ATOM   2545 C  CB    . ALA A 1 359 ? 5.833  -24.883 13.915 1.00 8.08  ? 339 ALA A CB    1 
ATOM   2546 N  N     . GLY A 1 360 ? 5.097  -28.205 12.738 1.00 9.21  ? 340 GLY A N     1 
ATOM   2547 C  CA    . GLY A 1 360 ? 5.110  -29.090 11.592 1.00 9.56  ? 340 GLY A CA    1 
ATOM   2548 C  C     . GLY A 1 360 ? 6.450  -29.149 10.887 1.00 10.78 ? 340 GLY A C     1 
ATOM   2549 O  O     . GLY A 1 360 ? 6.499  -29.476 9.700  1.00 12.66 ? 340 GLY A O     1 
ATOM   2550 N  N     . CYS A 1 361 ? 7.529  -28.883 11.608 1.00 9.07  ? 341 CYS A N     1 
ATOM   2551 C  CA    . CYS A 1 361 ? 8.846  -28.828 10.962 1.00 10.19 ? 341 CYS A CA    1 
ATOM   2552 C  C     . CYS A 1 361 ? 9.742  -29.961 11.408 1.00 10.59 ? 341 CYS A C     1 
ATOM   2553 O  O     . CYS A 1 361 ? 10.098 -30.029 12.582 1.00 12.30 ? 341 CYS A O     1 
ATOM   2554 C  CB    . CYS A 1 361 ? 9.533  -27.502 11.274 1.00 8.72  ? 341 CYS A CB    1 
ATOM   2555 S  SG    . CYS A 1 361 ? 8.592  -26.125 10.619 1.00 13.96 ? 341 CYS A SG    1 
ATOM   2556 N  N     . GLU A 1 362 ? 10.135 -30.819 10.475 1.00 10.38 ? 342 GLU A N     1 
ATOM   2557 C  CA    A GLU A 1 362 ? 10.977 -31.963 10.817 0.50 11.62 ? 342 GLU A CA    1 
ATOM   2558 C  CA    B GLU A 1 362 ? 10.987 -31.963 10.795 0.50 11.66 ? 342 GLU A CA    1 
ATOM   2559 C  C     . GLU A 1 362 ? 12.461 -31.567 10.770 1.00 11.24 ? 342 GLU A C     1 
ATOM   2560 O  O     . GLU A 1 362 ? 13.331 -32.326 11.194 1.00 13.35 ? 342 GLU A O     1 
ATOM   2561 C  CB    A GLU A 1 362 ? 10.688 -33.141 9.865  0.50 14.17 ? 342 GLU A CB    1 
ATOM   2562 C  CB    B GLU A 1 362 ? 10.743 -33.109 9.806  0.50 14.19 ? 342 GLU A CB    1 
ATOM   2563 C  CG    A GLU A 1 362 ? 11.005 -34.531 10.434 0.50 14.36 ? 342 GLU A CG    1 
ATOM   2564 C  CG    B GLU A 1 362 ? 11.214 -32.783 8.400  0.50 14.77 ? 342 GLU A CG    1 
ATOM   2565 C  CD    A GLU A 1 362 ? 10.760 -35.654 9.427  0.50 16.79 ? 342 GLU A CD    1 
ATOM   2566 C  CD    B GLU A 1 362 ? 11.907 -33.944 7.712  0.50 34.46 ? 342 GLU A CD    1 
ATOM   2567 O  OE1   A GLU A 1 362 ? 10.845 -35.402 8.209  0.50 22.92 ? 342 GLU A OE1   1 
ATOM   2568 O  OE1   B GLU A 1 362 ? 11.540 -35.114 7.965  0.50 30.13 ? 342 GLU A OE1   1 
ATOM   2569 O  OE2   A GLU A 1 362 ? 10.478 -36.789 9.852  0.50 15.32 ? 342 GLU A OE2   1 
ATOM   2570 O  OE2   B GLU A 1 362 ? 12.835 -33.678 6.921  0.50 23.28 ? 342 GLU A OE2   1 
ATOM   2571 N  N     . SER A 1 363 ? 12.749 -30.375 10.254 1.00 9.47  ? 343 SER A N     1 
ATOM   2572 C  CA    . SER A 1 363 ? 14.107 -29.871 10.157 1.00 10.31 ? 343 SER A CA    1 
ATOM   2573 C  C     . SER A 1 363 ? 14.127 -28.361 10.295 1.00 9.45  ? 343 SER A C     1 
ATOM   2574 O  O     . SER A 1 363 ? 13.104 -27.687 10.108 1.00 9.34  ? 343 SER A O     1 
ATOM   2575 C  CB    . SER A 1 363 ? 14.729 -30.259 8.813  1.00 12.86 ? 343 SER A CB    1 
ATOM   2576 O  OG    . SER A 1 363 ? 14.074 -29.546 7.760  1.00 13.77 ? 343 SER A OG    1 
ATOM   2577 N  N     . VAL A 1 364 ? 15.296 -27.813 10.593 1.00 8.57  ? 344 VAL A N     1 
ATOM   2578 C  CA    . VAL A 1 364 ? 15.442 -26.357 10.661 1.00 8.91  ? 344 VAL A CA    1 
ATOM   2579 C  C     . VAL A 1 364 ? 15.172 -25.717 9.277  1.00 9.06  ? 344 VAL A C     1 
ATOM   2580 O  O     . VAL A 1 364 ? 14.583 -24.639 9.199  1.00 9.67  ? 344 VAL A O     1 
ATOM   2581 C  CB    . VAL A 1 364 ? 16.829 -25.985 11.204 1.00 8.64  ? 344 VAL A CB    1 
ATOM   2582 C  CG1   . VAL A 1 364 ? 17.066 -24.495 11.115 1.00 13.68 ? 344 VAL A CG1   1 
ATOM   2583 C  CG2   . VAL A 1 364 ? 16.924 -26.428 12.679 1.00 11.65 ? 344 VAL A CG2   1 
ATOM   2584 N  N     . GLY A 1 365 ? 15.562 -26.376 8.192  1.00 10.08 ? 345 GLY A N     1 
ATOM   2585 C  CA    . GLY A 1 365 ? 15.214 -25.852 6.876  1.00 12.19 ? 345 GLY A CA    1 
ATOM   2586 C  C     . GLY A 1 365 ? 13.722 -25.652 6.693  1.00 15.20 ? 345 GLY A C     1 
ATOM   2587 O  O     . GLY A 1 365 ? 13.281 -24.640 6.119  1.00 12.80 ? 345 GLY A O     1 
ATOM   2588 N  N     . ALA A 1 366 ? 12.922 -26.618 7.160  1.00 9.78  ? 346 ALA A N     1 
ATOM   2589 C  CA    . ALA A 1 366 ? 11.479 -26.465 7.104  1.00 8.92  ? 346 ALA A CA    1 
ATOM   2590 C  C     . ALA A 1 366 ? 11.002 -25.276 7.931  1.00 9.46  ? 346 ALA A C     1 
ATOM   2591 O  O     . ALA A 1 366 ? 10.061 -24.546 7.537  1.00 9.50  ? 346 ALA A O     1 
ATOM   2592 C  CB    . ALA A 1 366 ? 10.793 -27.761 7.590  1.00 11.11 ? 346 ALA A CB    1 
ATOM   2593 N  N     . ALA A 1 367 ? 11.620 -25.082 9.098  1.00 8.26  ? 347 ALA A N     1 
ATOM   2594 C  CA    . ALA A 1 367 ? 11.241 -23.954 9.938  1.00 7.38  ? 347 ALA A CA    1 
ATOM   2595 C  C     . ALA A 1 367 ? 11.519 -22.621 9.241  1.00 6.92  ? 347 ALA A C     1 
ATOM   2596 O  O     . ALA A 1 367 ? 10.747 -21.678 9.394  1.00 9.37  ? 347 ALA A O     1 
ATOM   2597 C  CB    . ALA A 1 367 ? 11.948 -24.032 11.304 1.00 11.27 ? 347 ALA A CB    1 
ATOM   2598 N  N     . ARG A 1 368 ? 12.582 -22.563 8.436  1.00 8.40  ? 348 ARG A N     1 
ATOM   2599 C  CA    . ARG A 1 368 ? 12.875 -21.314 7.742  1.00 8.19  ? 348 ARG A CA    1 
ATOM   2600 C  C     . ARG A 1 368 ? 11.804 -21.001 6.695  1.00 9.70  ? 348 ARG A C     1 
ATOM   2601 O  O     . ARG A 1 368 ? 11.658 -19.831 6.320  1.00 12.13 ? 348 ARG A O     1 
ATOM   2602 C  CB    . ARG A 1 368 ? 14.286 -21.352 7.111  1.00 9.90  ? 348 ARG A CB    1 
ATOM   2603 C  CG    . ARG A 1 368 ? 15.410 -21.379 8.163  1.00 11.87 ? 348 ARG A CG    1 
ATOM   2604 C  CD    . ARG A 1 368 ? 16.844 -21.322 7.571  1.00 10.51 ? 348 ARG A CD    1 
ATOM   2605 N  NE    . ARG A 1 368 ? 17.093 -20.039 6.932  1.00 12.56 ? 348 ARG A NE    1 
ATOM   2606 C  CZ    . ARG A 1 368 ? 17.005 -19.804 5.624  1.00 15.91 ? 348 ARG A CZ    1 
ATOM   2607 N  NH1   . ARG A 1 368 ? 16.759 -20.798 4.779  1.00 18.52 ? 348 ARG A NH1   1 
ATOM   2608 N  NH2   . ARG A 1 368 ? 17.190 -18.571 5.160  1.00 15.44 ? 348 ARG A NH2   1 
ATOM   2609 N  N     . ARG A 1 369 ? 11.029 -22.002 6.265  1.00 6.38  ? 349 ARG A N     1 
ATOM   2610 C  CA    . ARG A 1 369 ? 9.971  -21.783 5.277  1.00 7.09  ? 349 ARG A CA    1 
ATOM   2611 C  C     . ARG A 1 369 ? 8.603  -21.454 5.905  1.00 6.92  ? 349 ARG A C     1 
ATOM   2612 O  O     . ARG A 1 369 ? 7.632  -21.208 5.173  1.00 9.69  ? 349 ARG A O     1 
ATOM   2613 C  CB    . ARG A 1 369 ? 9.828  -23.004 4.363  1.00 8.15  ? 349 ARG A CB    1 
ATOM   2614 C  CG    . ARG A 1 369 ? 11.075 -23.224 3.506  1.00 8.07  ? 349 ARG A CG    1 
ATOM   2615 C  CD    . ARG A 1 369 ? 10.886 -24.283 2.425  1.00 10.66 ? 349 ARG A CD    1 
ATOM   2616 N  NE    . ARG A 1 369 ? 10.560 -25.606 2.950  1.00 12.41 ? 349 ARG A NE    1 
ATOM   2617 C  CZ    . ARG A 1 369 ? 11.452 -26.519 3.317  1.00 17.44 ? 349 ARG A CZ    1 
ATOM   2618 N  NH1   . ARG A 1 369 ? 12.749 -26.251 3.275  1.00 16.30 ? 349 ARG A NH1   1 
ATOM   2619 N  NH2   . ARG A 1 369 ? 11.027 -27.711 3.756  1.00 17.51 ? 349 ARG A NH2   1 
ATOM   2620 N  N     . LEU A 1 370 ? 8.533  -21.475 7.238  1.00 7.97  ? 350 LEU A N     1 
ATOM   2621 C  CA    . LEU A 1 370 ? 7.325  -21.000 7.927  1.00 6.46  ? 350 LEU A CA    1 
ATOM   2622 C  C     . LEU A 1 370 ? 7.059  -19.533 7.670  1.00 7.39  ? 350 LEU A C     1 
ATOM   2623 O  O     . LEU A 1 370 ? 7.990  -18.713 7.564  1.00 8.69  ? 350 LEU A O     1 
ATOM   2624 C  CB    . LEU A 1 370 ? 7.432  -21.197 9.440  1.00 7.34  ? 350 LEU A CB    1 
ATOM   2625 C  CG    . LEU A 1 370 ? 7.495  -22.635 9.916  1.00 8.05  ? 350 LEU A CG    1 
ATOM   2626 C  CD1   . LEU A 1 370 ? 7.868  -22.582 11.382 1.00 9.94  ? 350 LEU A CD1   1 
ATOM   2627 C  CD2   . LEU A 1 370 ? 6.131  -23.298 9.710  1.00 10.82 ? 350 LEU A CD2   1 
ATOM   2628 N  N     . ASN A 1 371 ? 5.780  -19.177 7.599  1.00 7.23  ? 351 ASN A N     1 
ATOM   2629 C  CA    . ASN A 1 371 ? 5.406  -17.771 7.524  1.00 6.96  ? 351 ASN A CA    1 
ATOM   2630 C  C     . ASN A 1 371 ? 5.092  -17.223 8.901  1.00 8.13  ? 351 ASN A C     1 
ATOM   2631 O  O     . ASN A 1 371 ? 4.856  -17.993 9.851  1.00 8.81  ? 351 ASN A O     1 
ATOM   2632 C  CB    . ASN A 1 371 ? 4.213  -17.603 6.598  1.00 10.04 ? 351 ASN A CB    1 
ATOM   2633 C  CG    . ASN A 1 371 ? 4.589  -17.849 5.174  1.00 14.73 ? 351 ASN A CG    1 
ATOM   2634 O  OD1   . ASN A 1 371 ? 5.618  -17.343 4.706  1.00 15.94 ? 351 ASN A OD1   1 
ATOM   2635 N  ND2   . ASN A 1 371 ? 3.816  -18.685 4.490  1.00 16.84 ? 351 ASN A ND2   1 
ATOM   2636 N  N     . THR A 1 372 ? 5.138  -15.896 9.013  1.00 8.27  ? 352 THR A N     1 
ATOM   2637 C  CA    . THR A 1 372 ? 4.869  -15.205 10.267 1.00 8.15  ? 352 THR A CA    1 
ATOM   2638 C  C     . THR A 1 372 ? 3.855  -14.103 10.055 1.00 10.44 ? 352 THR A C     1 
ATOM   2639 O  O     . THR A 1 372 ? 3.573  -13.718 8.924  1.00 11.86 ? 352 THR A O     1 
ATOM   2640 C  CB    . THR A 1 372 ? 6.141  -14.575 10.859 1.00 9.59  ? 352 THR A CB    1 
ATOM   2641 O  OG1   . THR A 1 372 ? 6.749  -13.714 9.868  1.00 12.17 ? 352 THR A OG1   1 
ATOM   2642 C  CG2   . THR A 1 372 ? 7.144  -15.656 11.293 1.00 10.58 ? 352 THR A CG2   1 
ATOM   2643 N  N     . LYS A 1 373 ? 3.299  -13.611 11.160 1.00 9.66  ? 353 LYS A N     1 
ATOM   2644 C  CA    A LYS A 1 373 ? 2.370  -12.489 11.111 0.50 11.13 ? 353 LYS A CA    1 
ATOM   2645 C  CA    B LYS A 1 373 ? 2.366  -12.494 11.108 0.50 11.14 ? 353 LYS A CA    1 
ATOM   2646 C  C     . LYS A 1 373 ? 2.672  -11.588 12.289 1.00 16.37 ? 353 LYS A C     1 
ATOM   2647 O  O     . LYS A 1 373 ? 2.865  -12.070 13.397 1.00 17.22 ? 353 LYS A O     1 
ATOM   2648 C  CB    A LYS A 1 373 ? 0.918  -12.978 11.155 0.50 14.28 ? 353 LYS A CB    1 
ATOM   2649 C  CB    B LYS A 1 373 ? 0.919  -13.004 11.147 0.50 14.24 ? 353 LYS A CB    1 
ATOM   2650 C  CG    A LYS A 1 373 ? -0.116 -11.866 11.021 0.50 17.90 ? 353 LYS A CG    1 
ATOM   2651 C  CG    B LYS A 1 373 ? -0.078 -12.134 10.391 0.50 24.33 ? 353 LYS A CG    1 
ATOM   2652 C  CD    A LYS A 1 373 ? -1.507 -12.441 10.830 0.50 16.62 ? 353 LYS A CD    1 
ATOM   2653 C  CD    B LYS A 1 373 ? -1.119 -12.988 9.679  0.50 23.70 ? 353 LYS A CD    1 
ATOM   2654 C  CE    A LYS A 1 373 ? -2.492 -11.360 10.409 0.50 35.61 ? 353 LYS A CE    1 
ATOM   2655 C  CE    B LYS A 1 373 ? -2.229 -12.136 9.082  0.50 29.06 ? 353 LYS A CE    1 
ATOM   2656 N  NZ    A LYS A 1 373 ? -2.299 -10.968 8.981  0.50 42.53 ? 353 LYS A NZ    1 
ATOM   2657 N  NZ    B LYS A 1 373 ? -2.849 -11.239 10.104 0.50 42.95 ? 353 LYS A NZ    1 
ATOM   2658 N  N     . LEU A 1 374 ? 2.740  -10.278 12.055 1.00 14.26 ? 354 LEU A N     1 
ATOM   2659 C  CA    . LEU A 1 374 ? 2.974  -9.352  13.162 1.00 19.14 ? 354 LEU A CA    1 
ATOM   2660 C  C     . LEU A 1 374 ? 1.664  -9.082  13.886 1.00 31.38 ? 354 LEU A C     1 
ATOM   2661 O  O     . LEU A 1 374 ? 0.625  -8.885  13.250 1.00 29.20 ? 354 LEU A O     1 
ATOM   2662 C  CB    . LEU A 1 374 ? 3.580  -8.039  12.661 1.00 23.99 ? 354 LEU A CB    1 
ATOM   2663 C  CG    . LEU A 1 374 ? 5.000  -8.057  12.091 1.00 27.62 ? 354 LEU A CG    1 
ATOM   2664 C  CD1   . LEU A 1 374 ? 5.957  -8.765  13.038 1.00 24.57 ? 354 LEU A CD1   1 
ATOM   2665 C  CD2   . LEU A 1 374 ? 5.073  -8.670  10.699 1.00 58.41 ? 354 LEU A CD2   1 
ATOM   2666 N  N     . GLY A 1 375 ? 1.707  -9.098  15.213 1.00 21.02 ? 355 GLY A N     1 
ATOM   2667 C  CA    . GLY A 1 375 ? 0.518  -8.849  16.017 1.00 28.97 ? 355 GLY A CA    1 
ATOM   2668 C  C     . GLY A 1 375 ? 0.723  -7.610  16.865 1.00 50.02 ? 355 GLY A C     1 
ATOM   2669 O  O     . GLY A 1 375 ? 1.596  -6.795  16.565 1.00 45.88 ? 355 GLY A O     1 
ATOM   2670 N  N     . VAL A 1 376 ? -0.074 -7.458  17.920 1.00 66.17 ? 356 VAL A N     1 
ATOM   2671 C  CA    . VAL A 1 376 ? 0.104  -6.334  18.839 1.00 65.86 ? 356 VAL A CA    1 
ATOM   2672 C  C     . VAL A 1 376 ? 0.369  -6.808  20.269 1.00 65.08 ? 356 VAL A C     1 
ATOM   2673 O  O     . VAL A 1 376 ? -0.120 -7.864  20.686 1.00 61.89 ? 356 VAL A O     1 
ATOM   2674 C  CB    . VAL A 1 376 ? -1.113 -5.394  18.841 1.00 66.21 ? 356 VAL A CB    1 
ATOM   2675 C  CG1   . VAL A 1 376 ? -1.288 -4.737  17.475 1.00 50.90 ? 356 VAL A CG1   1 
ATOM   2676 C  CG2   . VAL A 1 376 ? -2.348 -6.153  19.230 1.00 62.92 ? 356 VAL A CG2   1 
ATOM   2677 N  N     . VAL A 1 377 ? 1.123  -5.985  21.005 1.00 82.55 ? 357 VAL A N     1 
ATOM   2678 C  CA    . VAL A 1 377 ? 1.721  -6.281  22.322 1.00 87.25 ? 357 VAL A CA    1 
ATOM   2679 C  C     . VAL A 1 377 ? 2.161  -7.740  22.538 1.00 65.09 ? 357 VAL A C     1 
ATOM   2680 O  O     . VAL A 1 377 ? 2.385  -8.165  23.674 1.00 55.50 ? 357 VAL A O     1 
ATOM   2681 C  CB    . VAL A 1 377 ? 0.779  -5.860  23.506 1.00 73.27 ? 357 VAL A CB    1 
ATOM   2682 C  CG1   . VAL A 1 377 ? 0.864  -4.358  23.743 1.00 71.06 ? 357 VAL A CG1   1 
ATOM   2683 C  CG2   . VAL A 1 377 ? -0.671 -6.303  23.301 1.00 55.32 ? 357 VAL A CG2   1 
ATOM   2684 O  OXT   . VAL A 1 377 ? 2.346  -8.525  21.604 1.00 58.66 ? 357 VAL A OXT   1 
HETATM 2685 MG MG    . MG  B 2 .   ? 19.797 -13.532 21.944 1.00 16.63 ? 401 MG  A MG    1 
HETATM 2686 N  N1    . FMN C 3 .   ? 29.596 -9.050  22.195 1.00 8.65  ? 402 FMN A N1    1 
HETATM 2687 C  C2    . FMN C 3 .   ? 30.804 -9.152  21.568 1.00 10.88 ? 402 FMN A C2    1 
HETATM 2688 O  O2    . FMN C 3 .   ? 30.848 -9.203  20.331 1.00 10.66 ? 402 FMN A O2    1 
HETATM 2689 N  N3    . FMN C 3 .   ? 31.963 -9.184  22.322 1.00 10.45 ? 402 FMN A N3    1 
HETATM 2690 C  C4    . FMN C 3 .   ? 31.911 -9.106  23.695 1.00 13.46 ? 402 FMN A C4    1 
HETATM 2691 O  O4    . FMN C 3 .   ? 32.977 -9.144  24.349 1.00 12.70 ? 402 FMN A O4    1 
HETATM 2692 C  C4A   . FMN C 3 .   ? 30.678 -8.996  24.326 1.00 10.45 ? 402 FMN A C4A   1 
HETATM 2693 N  N5    . FMN C 3 .   ? 30.578 -8.931  25.693 1.00 13.29 ? 402 FMN A N5    1 
HETATM 2694 C  C5A   . FMN C 3 .   ? 29.349 -8.853  26.295 1.00 9.72  ? 402 FMN A C5A   1 
HETATM 2695 C  C6    . FMN C 3 .   ? 29.262 -8.785  27.678 1.00 10.31 ? 402 FMN A C6    1 
HETATM 2696 C  C7    . FMN C 3 .   ? 28.022 -8.731  28.289 1.00 9.22  ? 402 FMN A C7    1 
HETATM 2697 C  C7M   . FMN C 3 .   ? 27.927 -8.670  29.796 1.00 15.55 ? 402 FMN A C7M   1 
HETATM 2698 C  C8    . FMN C 3 .   ? 26.858 -8.744  27.534 1.00 11.76 ? 402 FMN A C8    1 
HETATM 2699 C  C8M   . FMN C 3 .   ? 25.521 -8.674  28.203 1.00 15.92 ? 402 FMN A C8M   1 
HETATM 2700 C  C9    . FMN C 3 .   ? 26.940 -8.812  26.142 1.00 8.54  ? 402 FMN A C9    1 
HETATM 2701 C  C9A   . FMN C 3 .   ? 28.175 -8.859  25.523 1.00 10.40 ? 402 FMN A C9A   1 
HETATM 2702 N  N10   . FMN C 3 .   ? 28.283 -8.914  24.143 1.00 8.07  ? 402 FMN A N10   1 
HETATM 2703 C  C10   . FMN C 3 .   ? 29.514 -8.982  23.556 1.00 8.81  ? 402 FMN A C10   1 
HETATM 2704 C  "C1'" . FMN C 3 .   ? 27.051 -8.921  23.254 1.00 7.37  ? 402 FMN A "C1'" 1 
HETATM 2705 C  "C2'" . FMN C 3 .   ? 26.501 -10.352 23.071 1.00 6.77  ? 402 FMN A "C2'" 1 
HETATM 2706 O  "O2'" . FMN C 3 .   ? 27.400 -11.107 22.273 1.00 8.17  ? 402 FMN A "O2'" 1 
HETATM 2707 C  "C3'" . FMN C 3 .   ? 25.103 -10.338 22.431 1.00 8.48  ? 402 FMN A "C3'" 1 
HETATM 2708 O  "O3'" . FMN C 3 .   ? 25.184 -9.643  21.194 1.00 8.68  ? 402 FMN A "O3'" 1 
HETATM 2709 C  "C4'" . FMN C 3 .   ? 24.071 -9.635  23.307 1.00 11.79 ? 402 FMN A "C4'" 1 
HETATM 2710 O  "O4'" . FMN C 3 .   ? 24.204 -10.007 24.672 1.00 17.15 ? 402 FMN A "O4'" 1 
HETATM 2711 C  "C5'" . FMN C 3 .   ? 22.616 -9.862  22.871 1.00 15.90 ? 402 FMN A "C5'" 1 
HETATM 2712 O  "O5'" . FMN C 3 .   ? 22.158 -11.123 23.223 1.00 14.85 ? 402 FMN A "O5'" 1 
HETATM 2713 P  P     . FMN C 3 .   ? 21.220 -11.466 24.526 1.00 10.35 ? 402 FMN A P     1 
HETATM 2714 O  O1P   . FMN C 3 .   ? 22.098 -11.155 25.705 1.00 10.64 ? 402 FMN A O1P   1 
HETATM 2715 O  O2P   . FMN C 3 .   ? 19.966 -10.651 24.580 1.00 11.41 ? 402 FMN A O2P   1 
HETATM 2716 O  O3P   . FMN C 3 .   ? 20.940 -12.920 24.310 1.00 9.94  ? 402 FMN A O3P   1 
HETATM 2717 O  O1B   . 173 D 4 .   ? 35.715 1.836   24.351 1.00 26.92 ? 403 173 A O1B   1 
HETATM 2718 C  C1    . 173 D 4 .   ? 36.920 1.444   24.373 1.00 59.52 ? 403 173 A C1    1 
HETATM 2719 O  O1A   . 173 D 4 .   ? 37.845 2.282   24.190 1.00 69.91 ? 403 173 A O1A   1 
HETATM 2720 C  C2    . 173 D 4 .   ? 37.287 -0.016  24.617 1.00 60.14 ? 403 173 A C2    1 
HETATM 2721 O  O2    . 173 D 4 .   ? 36.605 -0.544  25.730 1.00 69.45 ? 403 173 A O2    1 
HETATM 2722 C  C1G   . 173 D 4 .   ? 37.001 -0.877  23.401 1.00 31.30 ? 403 173 A C1G   1 
HETATM 2723 C  C2D   . 173 D 4 .   ? 36.790 -2.241  23.567 1.00 40.29 ? 403 173 A C2D   1 
HETATM 2724 C  C2E   . 173 D 4 .   ? 36.534 -3.030  22.457 1.00 24.14 ? 403 173 A C2E   1 
HETATM 2725 C  C3    . 173 D 4 .   ? 36.505 -2.461  21.192 1.00 26.74 ? 403 173 A C3    1 
HETATM 2726 C  C1E   . 173 D 4 .   ? 36.720 -1.099  21.022 1.00 37.75 ? 403 173 A C1E   1 
HETATM 2727 C  C1D   . 173 D 4 .   ? 36.971 -0.309  22.133 1.00 34.36 ? 403 173 A C1D   1 
HETATM 2728 O  O1B   A 173 E 4 .   ? 28.964 -5.969  25.059 0.50 23.31 ? 404 173 A O1B   1 
HETATM 2729 O  O1B   B 173 E 4 .   ? 29.077 -5.083  25.460 0.50 16.75 ? 404 173 A O1B   1 
HETATM 2730 C  C1    A 173 E 4 .   ? 30.151 -5.706  25.368 0.50 10.48 ? 404 173 A C1    1 
HETATM 2731 C  C1    B 173 E 4 .   ? 29.869 -5.099  26.448 0.50 37.07 ? 404 173 A C1    1 
HETATM 2732 O  O1A   A 173 E 4 .   ? 31.045 -5.964  24.529 0.50 21.91 ? 404 173 A O1A   1 
HETATM 2733 O  O1A   B 173 E 4 .   ? 29.510 -4.482  27.486 0.50 24.96 ? 404 173 A O1A   1 
HETATM 2734 C  C2    A 173 E 4 .   ? 30.423 -5.047  26.730 0.50 13.94 ? 404 173 A C2    1 
HETATM 2735 C  C2    B 173 E 4 .   ? 31.185 -5.880  26.392 0.50 28.33 ? 404 173 A C2    1 
HETATM 2736 O  O2    A 173 E 4 .   ? 29.583 -5.583  27.726 0.50 35.31 ? 404 173 A O2    1 
HETATM 2737 O  O2    B 173 E 4 .   ? 31.695 -5.991  25.070 0.50 21.69 ? 404 173 A O2    1 
HETATM 2738 C  C1G   A 173 E 4 .   ? 31.842 -5.079  27.265 0.50 22.09 ? 404 173 A C1G   1 
HETATM 2739 C  C1G   B 173 E 4 .   ? 32.298 -5.383  27.310 0.50 24.23 ? 404 173 A C1G   1 
HETATM 2740 C  C2D   A 173 E 4 .   ? 32.182 -4.124  28.212 0.50 27.35 ? 404 173 A C2D   1 
HETATM 2741 C  C2D   B 173 E 4 .   ? 32.138 -4.377  28.256 0.50 28.12 ? 404 173 A C2D   1 
HETATM 2742 C  C2E   A 173 E 4 .   ? 33.457 -4.089  28.752 0.50 39.78 ? 404 173 A C2E   1 
HETATM 2743 C  C2E   B 173 E 4 .   ? 33.187 -3.976  29.066 0.50 40.35 ? 404 173 A C2E   1 
HETATM 2744 C  C3    A 173 E 4 .   ? 34.396 -5.022  28.348 0.50 37.47 ? 404 173 A C3    1 
HETATM 2745 C  C3    B 173 E 4 .   ? 34.422 -4.584  28.937 0.50 34.09 ? 404 173 A C3    1 
HETATM 2746 C  C1E   A 173 E 4 .   ? 34.055 -5.981  27.406 0.50 37.60 ? 404 173 A C1E   1 
HETATM 2747 C  C1E   B 173 E 4 .   ? 34.591 -5.589  28.001 0.50 41.89 ? 404 173 A C1E   1 
HETATM 2748 C  C1D   A 173 E 4 .   ? 32.779 -6.020  26.868 0.50 32.29 ? 404 173 A C1D   1 
HETATM 2749 C  C1D   B 173 E 4 .   ? 33.539 -5.985  27.192 0.50 39.39 ? 404 173 A C1D   1 
HETATM 2750 O  O     . HOH F 5 .   ? 18.228 -30.967 32.446 1.00 43.19 ? 501 HOH A O     1 
HETATM 2751 O  O     . HOH F 5 .   ? 10.009 -18.010 6.611  1.00 8.00  ? 502 HOH A O     1 
HETATM 2752 O  O     . HOH F 5 .   ? 12.109 -19.922 39.757 1.00 55.01 ? 503 HOH A O     1 
HETATM 2753 O  O     . HOH F 5 .   ? 21.876 -9.276  41.896 1.00 35.94 ? 504 HOH A O     1 
HETATM 2754 O  O     . HOH F 5 .   ? 5.740  -6.936  24.084 1.00 33.46 ? 505 HOH A O     1 
HETATM 2755 O  O     . HOH F 5 .   ? 13.582 -13.410 32.464 1.00 40.14 ? 506 HOH A O     1 
HETATM 2756 O  O     . HOH F 5 .   ? 23.172 9.377   28.689 1.00 50.09 ? 507 HOH A O     1 
HETATM 2757 O  O     . HOH F 5 .   ? 2.556  -35.207 12.366 1.00 27.76 ? 508 HOH A O     1 
HETATM 2758 O  O     . HOH F 5 .   ? 22.437 -33.786 18.018 1.00 45.87 ? 509 HOH A O     1 
HETATM 2759 O  O     . HOH F 5 .   ? 15.231 -36.219 9.813  1.00 48.07 ? 510 HOH A O     1 
HETATM 2760 O  O     . HOH F 5 .   ? 27.209 -4.177  -1.988 1.00 29.56 ? 511 HOH A O     1 
HETATM 2761 O  O     . HOH F 5 .   ? 13.778 -0.937  6.258  1.00 41.50 ? 512 HOH A O     1 
HETATM 2762 O  O     . HOH F 5 .   ? 27.236 -34.883 25.653 1.00 43.96 ? 513 HOH A O     1 
HETATM 2763 O  O     . HOH F 5 .   ? 50.576 -16.208 17.028 1.00 53.97 ? 514 HOH A O     1 
HETATM 2764 O  O     . HOH F 5 .   ? 5.773  -30.625 24.529 1.00 30.81 ? 515 HOH A O     1 
HETATM 2765 O  O     . HOH F 5 .   ? 31.238 -33.090 31.084 1.00 34.63 ? 516 HOH A O     1 
HETATM 2766 O  O     . HOH F 5 .   ? 31.416 -34.008 25.545 1.00 41.33 ? 517 HOH A O     1 
HETATM 2767 O  O     . HOH F 5 .   ? 17.961 -13.562 -5.309 1.00 20.37 ? 518 HOH A O     1 
HETATM 2768 O  O     . HOH F 5 .   ? 22.703 -20.324 42.874 1.00 41.96 ? 519 HOH A O     1 
HETATM 2769 O  O     . HOH F 5 .   ? 38.380 -2.225  18.414 1.00 26.70 ? 520 HOH A O     1 
HETATM 2770 O  O     . HOH F 5 .   ? 3.668  -12.405 21.960 1.00 20.73 ? 521 HOH A O     1 
HETATM 2771 O  O     . HOH F 5 .   ? 12.054 -0.601  15.222 1.00 41.86 ? 522 HOH A O     1 
HETATM 2772 O  O     . HOH F 5 .   ? 11.685 -1.436  17.366 1.00 34.66 ? 523 HOH A O     1 
HETATM 2773 O  O     . HOH F 5 .   ? 43.843 -2.885  8.260  1.00 35.98 ? 524 HOH A O     1 
HETATM 2774 O  O     . HOH F 5 .   ? 39.807 -16.084 3.931  1.00 23.59 ? 525 HOH A O     1 
HETATM 2775 O  O     . HOH F 5 .   ? 20.796 3.494   35.423 1.00 37.03 ? 526 HOH A O     1 
HETATM 2776 O  O     . HOH F 5 .   ? 34.392 -15.585 40.093 1.00 29.05 ? 527 HOH A O     1 
HETATM 2777 O  O     . HOH F 5 .   ? 44.091 -18.048 31.555 1.00 20.06 ? 528 HOH A O     1 
HETATM 2778 O  O     . HOH F 5 .   ? 50.054 -18.442 16.919 1.00 44.09 ? 529 HOH A O     1 
HETATM 2779 O  O     . HOH F 5 .   ? 15.422 -29.648 5.531  1.00 41.70 ? 530 HOH A O     1 
HETATM 2780 O  O     . HOH F 5 .   ? 48.114 -12.103 21.051 1.00 26.93 ? 531 HOH A O     1 
HETATM 2781 O  O     . HOH F 5 .   ? 17.373 -29.714 11.306 1.00 15.19 ? 532 HOH A O     1 
HETATM 2782 O  O     . HOH F 5 .   ? 41.244 1.063   8.859  1.00 34.60 ? 533 HOH A O     1 
HETATM 2783 O  O     . HOH F 5 .   ? 35.569 -23.816 9.948  1.00 28.61 ? 534 HOH A O     1 
HETATM 2784 O  O     . HOH F 5 .   ? 41.420 -23.753 13.462 1.00 22.97 ? 535 HOH A O     1 
HETATM 2785 O  O     . HOH F 5 .   ? 48.992 -12.651 30.462 1.00 47.97 ? 536 HOH A O     1 
HETATM 2786 O  O     . HOH F 5 .   ? 38.382 -27.433 15.948 1.00 35.08 ? 537 HOH A O     1 
HETATM 2787 O  O     . HOH F 5 .   ? 37.181 -7.964  2.484  1.00 20.23 ? 538 HOH A O     1 
HETATM 2788 O  O     . HOH F 5 .   ? 28.259 -22.300 6.634  1.00 23.90 ? 539 HOH A O     1 
HETATM 2789 O  O     . HOH F 5 .   ? 12.106 -13.680 6.085  1.00 20.43 ? 540 HOH A O     1 
HETATM 2790 O  O     . HOH F 5 .   ? 8.717  -13.909 22.112 1.00 24.73 ? 541 HOH A O     1 
HETATM 2791 O  O     . HOH F 5 .   ? 30.766 -25.626 37.672 1.00 19.56 ? 542 HOH A O     1 
HETATM 2792 O  O     . HOH F 5 .   ? 31.552 0.075   13.224 1.00 10.46 ? 543 HOH A O     1 
HETATM 2793 O  O     . HOH F 5 .   ? 44.205 -8.051  1.190  1.00 29.58 ? 544 HOH A O     1 
HETATM 2794 O  O     . HOH F 5 .   ? 50.110 -13.455 12.738 1.00 42.82 ? 545 HOH A O     1 
HETATM 2795 O  O     . HOH F 5 .   ? 45.342 -16.876 10.860 1.00 28.33 ? 546 HOH A O     1 
HETATM 2796 O  O     . HOH F 5 .   ? 34.701 -14.245 27.779 1.00 12.28 ? 547 HOH A O     1 
HETATM 2797 O  O     . HOH F 5 .   ? 35.836 -24.933 23.602 1.00 15.36 ? 548 HOH A O     1 
HETATM 2798 O  O     . HOH F 5 .   ? 0.502  -29.418 5.978  1.00 13.09 ? 549 HOH A O     1 
HETATM 2799 O  O     . HOH F 5 .   ? 14.403 -29.476 30.621 1.00 43.19 ? 550 HOH A O     1 
HETATM 2800 O  O     . HOH F 5 .   ? 44.758 -20.230 33.837 1.00 37.48 ? 551 HOH A O     1 
HETATM 2801 O  O     . HOH F 5 .   ? 8.957  -30.815 7.898  1.00 20.33 ? 552 HOH A O     1 
HETATM 2802 O  O     . HOH F 5 .   ? 8.969  -3.470  17.932 1.00 48.77 ? 553 HOH A O     1 
HETATM 2803 O  O     . HOH F 5 .   ? 28.535 -1.402  26.107 1.00 22.27 ? 554 HOH A O     1 
HETATM 2804 O  O     . HOH F 5 .   ? 35.768 -15.382 1.649  1.00 26.69 ? 555 HOH A O     1 
HETATM 2805 O  O     . HOH F 5 .   ? 51.696 -3.042  18.529 1.00 55.32 ? 556 HOH A O     1 
HETATM 2806 O  O     . HOH F 5 .   ? 37.883 -16.312 5.314  1.00 26.78 ? 557 HOH A O     1 
HETATM 2807 O  O     . HOH F 5 .   ? 14.971 -9.552  19.261 1.00 10.70 ? 558 HOH A O     1 
HETATM 2808 O  O     . HOH F 5 .   ? 10.674 -38.841 8.142  1.00 45.69 ? 559 HOH A O     1 
HETATM 2809 O  O     . HOH F 5 .   ? 43.605 -24.359 32.651 1.00 24.53 ? 560 HOH A O     1 
HETATM 2810 O  O     . HOH F 5 .   ? 15.210 3.508   31.092 1.00 48.94 ? 561 HOH A O     1 
HETATM 2811 O  O     . HOH F 5 .   ? 20.479 -7.732  -2.571 1.00 18.58 ? 562 HOH A O     1 
HETATM 2812 O  O     . HOH F 5 .   ? 4.354  -26.046 23.838 1.00 15.38 ? 563 HOH A O     1 
HETATM 2813 O  O     . HOH F 5 .   ? 28.047 -17.586 40.807 1.00 27.80 ? 564 HOH A O     1 
HETATM 2814 O  O     . HOH F 5 .   ? 18.026 -6.552  -2.238 1.00 29.99 ? 565 HOH A O     1 
HETATM 2815 O  O     . HOH F 5 .   ? 21.908 -21.007 5.828  1.00 45.66 ? 566 HOH A O     1 
HETATM 2816 O  O     . HOH F 5 .   ? 33.605 -26.613 34.657 1.00 18.21 ? 567 HOH A O     1 
HETATM 2817 O  O     . HOH F 5 .   ? 15.584 -6.880  1.183  1.00 17.49 ? 568 HOH A O     1 
HETATM 2818 O  O     . HOH F 5 .   ? 3.666  -21.199 7.653  1.00 11.58 ? 569 HOH A O     1 
HETATM 2819 O  O     . HOH F 5 .   ? 29.364 -19.684 5.228  1.00 31.15 ? 570 HOH A O     1 
HETATM 2820 O  O     . HOH F 5 .   ? 51.227 -19.907 13.590 1.00 49.47 ? 571 HOH A O     1 
HETATM 2821 O  O     . HOH F 5 .   ? 16.443 -13.345 -1.931 1.00 33.31 ? 572 HOH A O     1 
HETATM 2822 O  O     . HOH F 5 .   ? 31.067 8.432   26.247 1.00 42.81 ? 573 HOH A O     1 
HETATM 2823 O  O     . HOH F 5 .   ? 21.826 -30.171 22.779 1.00 28.70 ? 574 HOH A O     1 
HETATM 2824 O  O     . HOH F 5 .   ? 35.679 -9.756  23.806 1.00 10.07 ? 575 HOH A O     1 
HETATM 2825 O  O     . HOH F 5 .   ? 18.546 8.319   33.353 1.00 43.58 ? 576 HOH A O     1 
HETATM 2826 O  O     . HOH F 5 .   ? 41.669 0.606   24.126 1.00 50.26 ? 577 HOH A O     1 
HETATM 2827 O  O     . HOH F 5 .   ? 24.846 -1.934  9.846  1.00 7.83  ? 578 HOH A O     1 
HETATM 2828 O  O     . HOH F 5 .   ? 22.593 -1.069  21.144 1.00 9.96  ? 579 HOH A O     1 
HETATM 2829 O  O     . HOH F 5 .   ? 43.567 -26.656 21.108 1.00 18.74 ? 580 HOH A O     1 
HETATM 2830 O  O     . HOH F 5 .   ? 24.771 -2.923  16.587 1.00 11.41 ? 581 HOH A O     1 
HETATM 2831 O  O     . HOH F 5 .   ? 32.796 -2.025  41.125 1.00 45.33 ? 582 HOH A O     1 
HETATM 2832 O  O     . HOH F 5 .   ? 36.305 -5.404  3.310  1.00 21.56 ? 583 HOH A O     1 
HETATM 2833 O  O     . HOH F 5 .   ? 4.182  -14.482 20.074 1.00 16.88 ? 584 HOH A O     1 
HETATM 2834 O  O     . HOH F 5 .   ? 20.289 -32.429 18.120 1.00 21.18 ? 585 HOH A O     1 
HETATM 2835 O  O     . HOH F 5 .   ? 43.250 -4.411  4.411  1.00 24.97 ? 586 HOH A O     1 
HETATM 2836 O  O     . HOH F 5 .   ? 31.059 -16.350 25.247 1.00 10.84 ? 587 HOH A O     1 
HETATM 2837 O  O     . HOH F 5 .   ? 31.918 -12.440 -2.292 1.00 40.20 ? 588 HOH A O     1 
HETATM 2838 O  O     . HOH F 5 .   ? 8.537  -17.606 24.114 1.00 44.72 ? 589 HOH A O     1 
HETATM 2839 O  O     . HOH F 5 .   ? 46.134 -9.620  31.414 1.00 53.84 ? 590 HOH A O     1 
HETATM 2840 O  O     . HOH F 5 .   ? 42.439 -1.412  9.926  1.00 22.19 ? 591 HOH A O     1 
HETATM 2841 O  O     . HOH F 5 .   ? 12.094 0.697   23.280 1.00 19.20 ? 592 HOH A O     1 
HETATM 2842 O  O     . HOH F 5 .   ? -0.279 -8.552  10.667 1.00 38.17 ? 593 HOH A O     1 
HETATM 2843 O  O     . HOH F 5 .   ? 19.672 -15.438 2.440  1.00 15.90 ? 594 HOH A O     1 
HETATM 2844 O  O     . HOH F 5 .   ? 13.280 -12.776 3.922  1.00 17.21 ? 595 HOH A O     1 
HETATM 2845 O  O     . HOH F 5 .   ? 27.157 -2.002  37.158 1.00 19.98 ? 596 HOH A O     1 
HETATM 2846 O  O     . HOH F 5 .   ? 34.952 -15.804 5.241  1.00 15.63 ? 597 HOH A O     1 
HETATM 2847 O  O     . HOH F 5 .   ? 12.563 -9.106  10.101 1.00 12.11 ? 598 HOH A O     1 
HETATM 2848 O  O     . HOH F 5 .   ? 29.146 -15.720 -1.199 1.00 27.33 ? 599 HOH A O     1 
HETATM 2849 O  O     . HOH F 5 .   ? 21.954 2.668   30.638 1.00 21.44 ? 600 HOH A O     1 
HETATM 2850 O  O     . HOH F 5 .   ? 20.065 -17.408 6.754  1.00 16.31 ? 601 HOH A O     1 
HETATM 2851 O  O     . HOH F 5 .   ? 40.906 -5.692  31.491 1.00 41.65 ? 602 HOH A O     1 
HETATM 2852 O  O     . HOH F 5 .   ? 39.370 -27.508 20.260 1.00 37.93 ? 603 HOH A O     1 
HETATM 2853 O  O     . HOH F 5 .   ? 47.341 -15.117 26.915 1.00 21.67 ? 604 HOH A O     1 
HETATM 2854 O  O     . HOH F 5 .   ? 4.528  -37.804 12.087 1.00 19.87 ? 605 HOH A O     1 
HETATM 2855 O  O     . HOH F 5 .   ? 14.717 -34.124 8.906  1.00 35.72 ? 606 HOH A O     1 
HETATM 2856 O  O     . HOH F 5 .   ? 22.979 -2.372  41.614 1.00 39.21 ? 607 HOH A O     1 
HETATM 2857 O  O     . HOH F 5 .   ? 20.600 -23.314 9.412  1.00 18.29 ? 608 HOH A O     1 
HETATM 2858 O  O     . HOH F 5 .   ? 7.746  -24.869 24.148 1.00 24.49 ? 609 HOH A O     1 
HETATM 2859 O  O     . HOH F 5 .   ? 19.125 -8.024  24.262 1.00 10.20 ? 610 HOH A O     1 
HETATM 2860 O  O     . HOH F 5 .   ? 7.540  -25.278 6.568  1.00 17.20 ? 611 HOH A O     1 
HETATM 2861 O  O     . HOH F 5 .   ? 15.316 -1.519  30.921 1.00 27.12 ? 612 HOH A O     1 
HETATM 2862 O  O     . HOH F 5 .   ? 31.027 -13.930 0.950  1.00 18.45 ? 613 HOH A O     1 
HETATM 2863 O  O     . HOH F 5 .   ? 21.253 -7.845  19.870 1.00 11.29 ? 614 HOH A O     1 
HETATM 2864 O  O     . HOH F 5 .   ? 47.259 -20.472 19.911 1.00 19.35 ? 615 HOH A O     1 
HETATM 2865 O  O     . HOH F 5 .   ? 19.492 0.249   24.776 1.00 14.18 ? 616 HOH A O     1 
HETATM 2866 O  O     . HOH F 5 .   ? 20.859 -10.083 33.340 1.00 30.26 ? 617 HOH A O     1 
HETATM 2867 O  O     . HOH F 5 .   ? 26.595 -7.335  18.201 1.00 8.87  ? 618 HOH A O     1 
HETATM 2868 O  O     . HOH F 5 .   ? 7.923  -33.331 7.366  1.00 21.18 ? 619 HOH A O     1 
HETATM 2869 O  O     . HOH F 5 .   ? 37.994 3.663   19.780 1.00 33.97 ? 620 HOH A O     1 
HETATM 2870 O  O     . HOH F 5 .   ? 46.423 -15.859 30.737 1.00 33.04 ? 621 HOH A O     1 
HETATM 2871 O  O     . HOH F 5 .   ? 17.305 -31.075 20.224 1.00 33.14 ? 622 HOH A O     1 
HETATM 2872 O  O     . HOH F 5 .   ? 41.413 -11.550 27.375 1.00 12.33 ? 623 HOH A O     1 
HETATM 2873 O  O     . HOH F 5 .   ? 27.347 -30.765 33.351 1.00 35.98 ? 624 HOH A O     1 
HETATM 2874 O  O     . HOH F 5 .   ? 37.790 -4.220  29.239 1.00 33.52 ? 625 HOH A O     1 
HETATM 2875 O  O     . HOH F 5 .   ? 36.399 -1.913  16.705 1.00 14.76 ? 626 HOH A O     1 
HETATM 2876 O  O     . HOH F 5 .   ? 18.447 -7.441  30.559 1.00 19.74 ? 627 HOH A O     1 
HETATM 2877 O  O     . HOH F 5 .   ? 10.215 -15.841 25.050 1.00 24.99 ? 628 HOH A O     1 
HETATM 2878 O  O     . HOH F 5 .   ? 31.821 2.696   27.973 1.00 47.36 ? 629 HOH A O     1 
HETATM 2879 O  O     . HOH F 5 .   ? 27.957 -30.461 30.794 1.00 27.24 ? 630 HOH A O     1 
HETATM 2880 O  O     . HOH F 5 .   ? 38.861 -31.900 25.874 1.00 21.89 ? 631 HOH A O     1 
HETATM 2881 O  O     . HOH F 5 .   ? 46.364 -10.466 6.317  1.00 35.52 ? 632 HOH A O     1 
HETATM 2882 O  O     . HOH F 5 .   ? 30.111 -31.533 14.645 1.00 44.03 ? 633 HOH A O     1 
HETATM 2883 O  O     . HOH F 5 .   ? 10.101 -1.210  22.661 1.00 23.88 ? 634 HOH A O     1 
HETATM 2884 O  O     . HOH F 5 .   ? 5.416  -6.620  21.613 1.00 28.38 ? 635 HOH A O     1 
HETATM 2885 O  O     . HOH F 5 .   ? 23.076 -27.788 39.873 1.00 47.64 ? 636 HOH A O     1 
HETATM 2886 O  O     . HOH F 5 .   ? 33.555 -2.788  15.850 1.00 14.79 ? 637 HOH A O     1 
HETATM 2887 O  O     . HOH F 5 .   ? 30.862 -30.821 20.866 1.00 31.93 ? 638 HOH A O     1 
HETATM 2888 O  O     . HOH F 5 .   ? 17.842 0.679   33.815 1.00 36.96 ? 639 HOH A O     1 
HETATM 2889 O  O     . HOH F 5 .   ? 10.559 -37.350 16.003 1.00 44.62 ? 640 HOH A O     1 
HETATM 2890 O  O     . HOH F 5 .   ? 38.671 -15.569 1.725  1.00 31.02 ? 641 HOH A O     1 
HETATM 2891 O  O     . HOH F 5 .   ? 8.493  -14.867 7.950  1.00 17.20 ? 642 HOH A O     1 
HETATM 2892 O  O     . HOH F 5 .   ? 22.934 -18.472 -2.647 1.00 43.66 ? 643 HOH A O     1 
HETATM 2893 O  O     . HOH F 5 .   ? 1.523  -13.180 7.034  1.00 45.40 ? 644 HOH A O     1 
HETATM 2894 O  O     . HOH F 5 .   ? 16.941 -28.725 31.916 1.00 31.04 ? 645 HOH A O     1 
HETATM 2895 O  O     . HOH F 5 .   ? 33.915 2.499   2.019  1.00 46.96 ? 646 HOH A O     1 
HETATM 2896 O  O     . HOH F 5 .   ? 16.993 -31.822 26.135 1.00 23.53 ? 647 HOH A O     1 
HETATM 2897 O  O     . HOH F 5 .   ? 0.569  -27.179 17.053 1.00 10.96 ? 648 HOH A O     1 
HETATM 2898 O  O     . HOH F 5 .   ? 47.556 -19.503 26.627 1.00 31.21 ? 649 HOH A O     1 
HETATM 2899 O  O     . HOH F 5 .   ? 17.045 -8.865  17.766 1.00 10.75 ? 650 HOH A O     1 
HETATM 2900 O  O     . HOH F 5 .   ? 25.769 -29.608 28.653 1.00 21.49 ? 651 HOH A O     1 
HETATM 2901 O  O     . HOH F 5 .   ? 19.826 7.821   25.024 1.00 37.15 ? 652 HOH A O     1 
HETATM 2902 O  O     . HOH F 5 .   ? 13.050 -7.140  7.951  1.00 11.76 ? 653 HOH A O     1 
HETATM 2903 O  O     . HOH F 5 .   ? 23.347 -23.157 8.696  1.00 21.28 ? 654 HOH A O     1 
HETATM 2904 O  O     . HOH F 5 .   ? 19.685 -1.092  0.670  1.00 43.96 ? 655 HOH A O     1 
HETATM 2905 O  O     . HOH F 5 .   ? 21.278 -0.038  3.689  1.00 16.38 ? 656 HOH A O     1 
HETATM 2906 O  O     . HOH F 5 .   ? 36.303 -4.717  16.616 1.00 12.84 ? 657 HOH A O     1 
HETATM 2907 O  O     . HOH F 5 .   ? 33.049 -25.422 23.783 1.00 14.45 ? 658 HOH A O     1 
HETATM 2908 O  O     . HOH F 5 .   ? 38.287 -21.020 35.140 1.00 31.87 ? 659 HOH A O     1 
HETATM 2909 O  O     . HOH F 5 .   ? 34.077 3.924   25.412 1.00 48.76 ? 660 HOH A O     1 
HETATM 2910 O  O     . HOH F 5 .   ? 29.772 2.650   29.856 1.00 33.12 ? 661 HOH A O     1 
HETATM 2911 O  O     . HOH F 5 .   ? 47.620 -19.549 30.481 1.00 41.22 ? 662 HOH A O     1 
HETATM 2912 O  O     . HOH F 5 .   ? 23.832 0.105   31.867 1.00 17.44 ? 663 HOH A O     1 
HETATM 2913 O  O     . HOH F 5 .   ? 4.930  -34.747 5.501  1.00 28.14 ? 664 HOH A O     1 
HETATM 2914 O  O     . HOH F 5 .   ? 43.852 -12.365 -0.753 1.00 43.79 ? 665 HOH A O     1 
HETATM 2915 O  O     . HOH F 5 .   ? 25.575 -26.692 40.221 1.00 39.08 ? 666 HOH A O     1 
HETATM 2916 O  O     . HOH F 5 .   ? 34.955 -16.369 26.088 1.00 12.31 ? 667 HOH A O     1 
HETATM 2917 O  O     . HOH F 5 .   ? 23.923 -14.558 -3.254 1.00 21.16 ? 668 HOH A O     1 
HETATM 2918 O  O     . HOH F 5 .   ? -1.803 -9.817  19.427 1.00 43.41 ? 669 HOH A O     1 
HETATM 2919 O  O     . HOH F 5 .   ? 25.292 -2.187  32.407 1.00 21.50 ? 670 HOH A O     1 
HETATM 2920 O  O     . HOH F 5 .   ? 12.536 -30.093 4.318  1.00 36.56 ? 671 HOH A O     1 
HETATM 2921 O  O     . HOH F 5 .   ? 45.530 -3.380  5.561  1.00 39.03 ? 672 HOH A O     1 
HETATM 2922 O  O     . HOH F 5 .   ? 42.333 3.897   19.173 1.00 40.65 ? 673 HOH A O     1 
HETATM 2923 O  O     . HOH F 5 .   ? 40.083 -26.911 34.918 1.00 19.52 ? 674 HOH A O     1 
HETATM 2924 O  O     . HOH F 5 .   ? 15.189 -11.042 29.103 1.00 29.75 ? 675 HOH A O     1 
HETATM 2925 O  O     . HOH F 5 .   ? 12.222 -20.368 28.206 1.00 21.86 ? 676 HOH A O     1 
HETATM 2926 O  O     . HOH F 5 .   ? 2.224  -29.725 13.496 1.00 12.05 ? 677 HOH A O     1 
HETATM 2927 O  O     . HOH F 5 .   ? 29.050 -30.490 8.682  1.00 48.40 ? 678 HOH A O     1 
HETATM 2928 O  O     . HOH F 5 .   ? 13.627 1.871   28.034 1.00 35.38 ? 679 HOH A O     1 
HETATM 2929 O  O     . HOH F 5 .   ? 18.554 -9.278  32.224 1.00 34.18 ? 680 HOH A O     1 
HETATM 2930 O  O     . HOH F 5 .   ? 30.391 -13.254 41.265 1.00 38.70 ? 681 HOH A O     1 
HETATM 2931 O  O     . HOH F 5 .   ? 2.062  -35.326 5.422  1.00 29.91 ? 682 HOH A O     1 
HETATM 2932 O  O     . HOH F 5 .   ? 29.747 -17.208 2.224  1.00 29.18 ? 683 HOH A O     1 
HETATM 2933 O  O     . HOH F 5 .   ? 18.724 4.101   31.784 1.00 38.56 ? 684 HOH A O     1 
HETATM 2934 O  O     . HOH F 5 .   ? 40.679 -13.713 35.148 1.00 23.45 ? 685 HOH A O     1 
HETATM 2935 O  O     . HOH F 5 .   ? 17.587 -28.406 7.703  1.00 23.32 ? 686 HOH A O     1 
HETATM 2936 O  O     . HOH F 5 .   ? 2.505  -30.011 4.456  1.00 36.32 ? 687 HOH A O     1 
HETATM 2937 O  O     . HOH F 5 .   ? 25.985 -7.746  -3.687 1.00 28.63 ? 688 HOH A O     1 
HETATM 2938 O  O     . HOH F 5 .   ? 48.041 -9.883  19.915 1.00 40.44 ? 689 HOH A O     1 
HETATM 2939 O  O     . HOH F 5 .   ? 49.591 -8.940  25.370 1.00 45.77 ? 690 HOH A O     1 
HETATM 2940 O  O     . HOH F 5 .   ? 22.836 9.621   37.730 1.00 41.29 ? 691 HOH A O     1 
HETATM 2941 O  O     . HOH F 5 .   ? 30.507 -32.035 11.954 1.00 39.00 ? 692 HOH A O     1 
HETATM 2942 O  O     . HOH F 5 .   ? 15.310 -32.658 24.003 1.00 32.22 ? 693 HOH A O     1 
HETATM 2943 O  O     . HOH F 5 .   ? 23.681 5.551   22.700 1.00 19.75 ? 694 HOH A O     1 
HETATM 2944 O  O     . HOH F 5 .   ? 19.008 -6.991  18.431 1.00 9.77  ? 695 HOH A O     1 
HETATM 2945 O  O     . HOH F 5 .   ? 1.716  -20.285 5.761  1.00 11.25 ? 696 HOH A O     1 
HETATM 2946 O  O     . HOH F 5 .   ? 21.933 -27.161 7.885  1.00 22.25 ? 697 HOH A O     1 
HETATM 2947 O  O     . HOH F 5 .   ? 8.195  -17.407 21.740 1.00 29.97 ? 698 HOH A O     1 
HETATM 2948 O  O     . HOH F 5 .   ? 51.003 -9.809  19.105 1.00 41.26 ? 699 HOH A O     1 
HETATM 2949 O  O     . HOH F 5 .   ? 3.102  -31.859 11.712 1.00 13.26 ? 700 HOH A O     1 
HETATM 2950 O  O     . HOH F 5 .   ? 18.834 -0.929  5.843  1.00 12.92 ? 701 HOH A O     1 
HETATM 2951 O  O     . HOH F 5 .   ? 28.692 -27.650 37.814 1.00 24.11 ? 702 HOH A O     1 
HETATM 2952 O  O     . HOH F 5 .   ? 23.910 -26.009 5.953  1.00 47.38 ? 703 HOH A O     1 
HETATM 2953 O  O     . HOH F 5 .   ? 45.949 2.405   17.309 1.00 45.20 ? 704 HOH A O     1 
HETATM 2954 O  O     . HOH F 5 .   ? 28.529 -25.765 6.759  1.00 32.17 ? 705 HOH A O     1 
HETATM 2955 O  O     . HOH F 5 .   ? 17.949 -33.280 16.982 1.00 18.33 ? 706 HOH A O     1 
HETATM 2956 O  O     . HOH F 5 .   ? 16.638 -7.849  25.467 1.00 19.12 ? 707 HOH A O     1 
HETATM 2957 O  O     . HOH F 5 .   ? 2.251  -9.376  9.271  1.00 30.81 ? 708 HOH A O     1 
HETATM 2958 O  O     . HOH F 5 .   ? 20.710 -26.345 39.595 1.00 40.80 ? 709 HOH A O     1 
HETATM 2959 O  O     . HOH F 5 .   ? 37.715 -28.623 19.210 1.00 26.25 ? 710 HOH A O     1 
HETATM 2960 O  O     . HOH F 5 .   ? 43.293 -7.128  32.355 1.00 40.70 ? 711 HOH A O     1 
HETATM 2961 O  O     . HOH F 5 .   ? 28.158 -23.366 41.246 1.00 40.28 ? 712 HOH A O     1 
HETATM 2962 O  O     . HOH F 5 .   ? 42.633 -17.162 33.962 1.00 39.92 ? 713 HOH A O     1 
HETATM 2963 O  O     . HOH F 5 .   ? 42.438 -16.247 2.822  1.00 42.01 ? 714 HOH A O     1 
HETATM 2964 O  O     . HOH F 5 .   ? 19.573 6.910   18.425 1.00 25.74 ? 715 HOH A O     1 
HETATM 2965 O  O     . HOH F 5 .   ? 17.350 -5.432  35.448 1.00 37.12 ? 716 HOH A O     1 
HETATM 2966 O  O     . HOH F 5 .   ? 15.021 -28.164 3.580  1.00 30.08 ? 717 HOH A O     1 
HETATM 2967 O  O     . HOH F 5 .   ? 5.953  -14.693 6.404  1.00 21.34 ? 718 HOH A O     1 
HETATM 2968 O  O     . HOH F 5 .   ? 21.149 -16.664 4.307  1.00 21.11 ? 719 HOH A O     1 
HETATM 2969 O  O     . HOH F 5 .   ? 49.413 -13.361 26.487 1.00 37.77 ? 720 HOH A O     1 
HETATM 2970 O  O     . HOH F 5 .   ? 34.165 -0.532  14.289 1.00 15.68 ? 721 HOH A O     1 
HETATM 2971 O  O     . HOH F 5 .   ? 34.501 -4.000  1.594  1.00 22.25 ? 722 HOH A O     1 
HETATM 2972 O  O     . HOH F 5 .   ? 26.553 -20.512 42.083 1.00 43.49 ? 723 HOH A O     1 
HETATM 2973 O  O     . HOH F 5 .   ? 15.708 -11.111 -2.925 1.00 37.84 ? 724 HOH A O     1 
HETATM 2974 O  O     . HOH F 5 .   ? 16.792 6.093   22.877 1.00 36.79 ? 725 HOH A O     1 
HETATM 2975 O  O     . HOH F 5 .   ? 37.917 -25.658 36.081 1.00 24.25 ? 726 HOH A O     1 
HETATM 2976 O  O     . HOH F 5 .   ? 37.164 -26.724 38.248 1.00 51.09 ? 727 HOH A O     1 
HETATM 2977 O  O     . HOH F 5 .   ? 9.174  -22.234 23.873 1.00 22.24 ? 728 HOH A O     1 
HETATM 2978 O  O     . HOH F 5 .   ? 22.243 -10.168 45.547 1.00 46.63 ? 729 HOH A O     1 
HETATM 2979 O  O     . HOH F 5 .   ? 35.272 -32.343 21.867 1.00 29.80 ? 730 HOH A O     1 
HETATM 2980 O  O     . HOH F 5 .   ? 24.578 -0.259  17.843 1.00 12.53 ? 731 HOH A O     1 
HETATM 2981 O  O     . HOH F 5 .   ? 19.370 -28.019 9.057  1.00 38.66 ? 732 HOH A O     1 
HETATM 2982 O  O     . HOH F 5 .   ? 17.242 -9.079  28.610 1.00 35.77 ? 733 HOH A O     1 
HETATM 2983 O  O     . HOH F 5 .   ? 9.137  -41.541 15.375 1.00 48.96 ? 734 HOH A O     1 
HETATM 2984 O  O     . HOH F 5 .   ? 17.768 -17.663 2.297  1.00 25.45 ? 735 HOH A O     1 
HETATM 2985 O  O     . HOH F 5 .   ? 29.225 1.129   1.629  1.00 40.10 ? 736 HOH A O     1 
HETATM 2986 O  O     . HOH F 5 .   ? 25.845 -19.265 2.644  1.00 36.47 ? 738 HOH A O     1 
HETATM 2987 O  O     . HOH F 5 .   ? 16.431 -7.299  34.708 1.00 46.96 ? 739 HOH A O     1 
HETATM 2988 O  O     . HOH F 5 .   ? 49.743 -6.719  9.404  1.00 45.13 ? 740 HOH A O     1 
HETATM 2989 O  O     . HOH F 5 .   ? 7.370  -13.031 27.304 1.00 42.25 ? 741 HOH A O     1 
HETATM 2990 O  O     . HOH F 5 .   ? 16.149 -0.919  5.097  1.00 31.04 ? 742 HOH A O     1 
HETATM 2991 O  O     . HOH F 5 .   ? 9.292  -7.538  14.808 1.00 27.69 ? 743 HOH A O     1 
HETATM 2992 O  O     . HOH F 5 .   ? 43.078 -14.956 0.842  1.00 50.24 ? 744 HOH A O     1 
HETATM 2993 O  O     . HOH F 5 .   ? 35.369 -32.107 31.157 1.00 23.65 ? 745 HOH A O     1 
HETATM 2994 O  O     . HOH F 5 .   ? 37.780 0.864   5.039  1.00 25.98 ? 746 HOH A O     1 
HETATM 2995 O  O     . HOH F 5 .   ? 30.286 -3.603  -1.902 1.00 44.24 ? 747 HOH A O     1 
HETATM 2996 O  O     . HOH F 5 .   ? 7.232  -38.215 16.579 1.00 47.47 ? 748 HOH A O     1 
HETATM 2997 O  O     . HOH F 5 .   ? 10.039 -5.903  10.154 1.00 49.93 ? 749 HOH A O     1 
HETATM 2998 O  O     . HOH F 5 .   ? 27.266 -19.119 0.338  1.00 51.62 ? 750 HOH A O     1 
HETATM 2999 O  O     . HOH F 5 .   ? 32.960 0.104   28.545 1.00 50.48 ? 751 HOH A O     1 
HETATM 3000 O  O     . HOH F 5 .   ? 17.868 -23.737 5.447  1.00 49.84 ? 752 HOH A O     1 
HETATM 3001 O  O     . HOH F 5 .   ? 10.184 -8.618  13.012 1.00 26.95 ? 753 HOH A O     1 
HETATM 3002 O  O     . HOH F 5 .   ? 11.184 -16.334 5.390  1.00 22.87 ? 754 HOH A O     1 
HETATM 3003 O  O     . HOH F 5 .   ? 29.618 -25.322 40.377 1.00 45.71 ? 755 HOH A O     1 
HETATM 3004 O  O     . HOH F 5 .   ? 38.031 -22.120 39.308 1.00 42.63 ? 756 HOH A O     1 
HETATM 3005 O  O     . HOH F 5 .   ? 32.934 -5.126  0.073  1.00 48.35 ? 757 HOH A O     1 
HETATM 3006 O  O     . HOH F 5 .   ? 35.927 -19.982 4.554  1.00 45.89 ? 758 HOH A O     1 
HETATM 3007 O  O     . HOH F 5 .   ? 21.280 -30.202 25.430 1.00 27.59 ? 759 HOH A O     1 
HETATM 3008 O  O     . HOH F 5 .   ? 18.584 -35.623 15.817 1.00 40.29 ? 760 HOH A O     1 
HETATM 3009 O  O     . HOH F 5 .   ? 45.072 -17.498 4.188  1.00 49.99 ? 761 HOH A O     1 
HETATM 3010 O  O     . HOH F 5 .   ? 10.683 -16.364 27.516 1.00 43.46 ? 762 HOH A O     1 
HETATM 3011 O  O     . HOH F 5 .   ? 39.314 2.881   5.991  1.00 50.39 ? 763 HOH A O     1 
HETATM 3012 O  O     . HOH F 5 .   ? 49.835 -19.802 18.874 1.00 35.50 ? 764 HOH A O     1 
HETATM 3013 O  O     . HOH F 5 .   ? 18.550 -0.184  36.510 1.00 35.80 ? 765 HOH A O     1 
HETATM 3014 O  O     . HOH F 5 .   ? 34.399 -34.634 29.623 1.00 28.88 ? 766 HOH A O     1 
HETATM 3015 O  O     . HOH F 5 .   ? 20.322 2.580   32.759 1.00 29.41 ? 767 HOH A O     1 
HETATM 3016 O  O     . HOH F 5 .   ? 6.416  -14.011 23.247 1.00 33.50 ? 768 HOH A O     1 
HETATM 3017 O  O     . HOH F 5 .   ? 23.453 -33.456 22.086 1.00 38.86 ? 769 HOH A O     1 
HETATM 3018 O  O     . HOH F 5 .   ? 11.622 -8.739  3.686  1.00 31.34 ? 770 HOH A O     1 
HETATM 3019 O  O     . HOH F 5 .   ? 16.595 -16.060 -1.035 1.00 29.26 ? 771 HOH A O     1 
HETATM 3020 O  O     . HOH F 5 .   ? 38.385 -3.471  1.708  1.00 44.87 ? 772 HOH A O     1 
HETATM 3021 O  O     . HOH F 5 .   ? 24.398 -31.531 28.014 1.00 36.29 ? 773 HOH A O     1 
HETATM 3022 O  O     . HOH F 5 .   ? 34.738 -23.920 6.986  1.00 47.46 ? 774 HOH A O     1 
HETATM 3023 O  O     . HOH F 5 .   ? 12.310 -12.715 28.812 1.00 41.51 ? 775 HOH A O     1 
HETATM 3024 O  O     . HOH F 5 .   ? 20.590 8.343   27.595 1.00 35.53 ? 776 HOH A O     1 
HETATM 3025 O  O     . HOH F 5 .   ? 30.391 -21.416 43.121 1.00 50.71 ? 777 HOH A O     1 
HETATM 3026 O  O     . HOH F 5 .   ? 16.020 -7.905  -1.349 1.00 28.96 ? 778 HOH A O     1 
HETATM 3027 O  O     . HOH F 5 .   ? 47.632 -23.340 20.088 1.00 38.83 ? 779 HOH A O     1 
HETATM 3028 O  O     . HOH F 5 .   ? 10.888 -8.041  6.477  1.00 30.04 ? 780 HOH A O     1 
HETATM 3029 O  O     . HOH F 5 .   ? 14.228 -6.163  28.161 1.00 38.92 ? 781 HOH A O     1 
HETATM 3030 O  O     . HOH F 5 .   ? 40.336 -19.409 35.932 1.00 45.51 ? 782 HOH A O     1 
HETATM 3031 O  O     . HOH F 5 .   ? 20.038 -22.384 6.621  1.00 39.14 ? 783 HOH A O     1 
HETATM 3032 O  O     . HOH F 5 .   ? 8.333  -15.444 33.870 1.00 46.05 ? 784 HOH A O     1 
HETATM 3033 O  O     . HOH F 5 .   ? 31.740 -15.675 41.419 1.00 42.97 ? 785 HOH A O     1 
HETATM 3034 O  O     . HOH F 5 .   ? 43.767 -27.808 17.004 1.00 39.29 ? 786 HOH A O     1 
HETATM 3035 O  O     . HOH F 5 .   ? 44.785 -6.688  3.522  1.00 39.52 ? 787 HOH A O     1 
HETATM 3036 O  O     . HOH F 5 .   ? 33.770 -18.291 4.378  1.00 27.55 ? 788 HOH A O     1 
HETATM 3037 O  O     . HOH F 5 .   ? 5.429  -39.708 13.936 1.00 42.31 ? 789 HOH A O     1 
HETATM 3038 O  O     . HOH F 5 .   ? 32.634 -22.551 6.125  1.00 38.48 ? 790 HOH A O     1 
HETATM 3039 O  O     . HOH F 5 .   ? 9.974  -18.980 28.436 1.00 32.85 ? 791 HOH A O     1 
HETATM 3040 O  O     . HOH F 5 .   ? 28.495 -14.785 42.379 1.00 47.55 ? 792 HOH A O     1 
HETATM 3041 O  O     . HOH F 5 .   ? 1.633  -11.472 25.778 1.00 35.07 ? 793 HOH A O     1 
HETATM 3042 O  O     . HOH F 5 .   ? 13.589 -14.557 30.068 1.00 30.54 ? 794 HOH A O     1 
HETATM 3043 O  O     . HOH F 5 .   ? 45.485 -27.568 19.589 1.00 33.53 ? 795 HOH A O     1 
HETATM 3044 O  O     . HOH F 5 .   ? 18.220 -31.456 8.961  1.00 33.17 ? 796 HOH A O     1 
HETATM 3045 O  O     . HOH F 5 .   ? 32.305 -17.745 2.213  1.00 46.98 ? 797 HOH A O     1 
HETATM 3046 O  O     . HOH F 5 .   ? 3.626  -40.643 10.609 1.00 44.36 ? 798 HOH A O     1 
HETATM 3047 O  O     . HOH F 5 .   ? 20.067 -31.709 21.235 1.00 26.90 ? 799 HOH A O     1 
HETATM 3048 O  O     . HOH F 5 .   ? 48.209 -17.349 28.066 1.00 38.25 ? 800 HOH A O     1 
HETATM 3049 O  O     . HOH F 5 .   ? 25.760 -16.933 -3.488 1.00 34.89 ? 801 HOH A O     1 
HETATM 3050 O  O     . HOH F 5 .   ? 19.624 -25.649 8.390  1.00 26.02 ? 802 HOH A O     1 
HETATM 3051 O  O     . HOH F 5 .   ? 13.643 0.288   30.416 1.00 39.95 ? 803 HOH A O     1 
HETATM 3052 O  O     . HOH F 5 .   ? 16.841 -33.450 8.067  1.00 44.72 ? 804 HOH A O     1 
HETATM 3053 O  O     . HOH F 5 .   ? 31.373 2.397   32.243 1.00 54.24 ? 805 HOH A O     1 
HETATM 3054 O  O     . HOH F 5 .   ? 0.059  -18.157 2.719  1.00 47.52 ? 806 HOH A O     1 
HETATM 3055 O  O     . HOH F 5 .   ? 4.663  -12.318 24.495 1.00 40.05 ? 807 HOH A O     1 
HETATM 3056 O  O     . HOH F 5 .   ? 25.869 -33.990 28.797 1.00 42.28 ? 808 HOH A O     1 
HETATM 3057 O  O     . HOH F 5 .   ? 20.312 -6.988  41.887 1.00 44.62 ? 809 HOH A O     1 
HETATM 3058 O  O     . HOH F 5 .   ? 0.714  -9.720  27.349 1.00 38.47 ? 810 HOH A O     1 
HETATM 3059 O  O     . HOH F 5 .   ? 8.555  -16.306 31.384 1.00 48.08 ? 811 HOH A O     1 
HETATM 3060 O  O     . HOH F 5 .   ? 19.416 -32.269 25.521 1.00 35.07 ? 812 HOH A O     1 
HETATM 3061 O  O     . HOH F 5 .   ? 9.857  -12.530 6.847  1.00 31.22 ? 813 HOH A O     1 
HETATM 3062 O  O     . HOH F 5 .   ? 12.973 -7.342  1.233  1.00 32.89 ? 814 HOH A O     1 
HETATM 3063 O  O     . HOH F 5 .   ? 32.014 -20.149 5.244  1.00 38.95 ? 815 HOH A O     1 
HETATM 3064 O  O     . HOH F 5 .   ? 35.251 -26.799 6.711  1.00 50.51 ? 816 HOH A O     1 
HETATM 3065 O  O     . HOH F 5 .   ? 38.642 -23.187 36.691 1.00 27.81 ? 817 HOH A O     1 
HETATM 3066 O  O     . HOH F 5 .   ? 11.873 -6.294  28.352 1.00 39.27 ? 818 HOH A O     1 
HETATM 3067 O  O     . HOH F 5 .   ? 9.895  -8.975  9.923  1.00 42.95 ? 819 HOH A O     1 
HETATM 3068 O  O     . HOH F 5 .   ? 31.311 -11.795 43.005 1.00 46.84 ? 820 HOH A O     1 
HETATM 3069 O  O     . HOH F 5 .   ? 42.307 -3.357  1.884  1.00 41.03 ? 821 HOH A O     1 
HETATM 3070 O  O     . HOH F 5 .   ? 14.817 -4.145  30.795 1.00 32.58 ? 822 HOH A O     1 
HETATM 3071 O  O     . HOH F 5 .   ? 23.968 -34.246 20.093 1.00 47.34 ? 823 HOH A O     1 
HETATM 3072 O  O     . HOH F 5 .   ? 38.485 5.982   18.863 1.00 42.38 ? 824 HOH A O     1 
HETATM 3073 O  O     . HOH F 5 .   ? 29.468 -18.811 42.721 1.00 46.06 ? 825 HOH A O     1 
HETATM 3074 O  O     . HOH F 5 .   ? 3.828  -7.103  8.132  1.00 48.47 ? 826 HOH A O     1 
HETATM 3075 O  O     . HOH F 5 .   ? 18.812 -33.133 23.097 1.00 41.50 ? 827 HOH A O     1 
HETATM 3076 O  O     . HOH F 5 .   ? 12.270 -4.234  30.685 1.00 52.20 ? 828 HOH A O     1 
HETATM 3077 O  O     . HOH F 5 .   ? 11.179 -0.678  30.355 1.00 47.42 ? 829 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  THR 22  2   2   THR THR A . n 
A 1 23  TYR 23  3   3   TYR TYR A . n 
A 1 24  VAL 24  4   4   VAL VAL A . n 
A 1 25  SER 25  5   5   SER SER A . n 
A 1 26  LEU 26  6   6   LEU LEU A . n 
A 1 27  ALA 27  7   7   ALA ALA A . n 
A 1 28  ASP 28  8   8   ASP ASP A . n 
A 1 29  LEU 29  9   9   LEU LEU A . n 
A 1 30  GLU 30  10  10  GLU GLU A . n 
A 1 31  ARG 31  11  11  ARG ARG A . n 
A 1 32  ALA 32  12  12  ALA ALA A . n 
A 1 33  ALA 33  13  13  ALA ALA A . n 
A 1 34  ARG 34  14  14  ARG ARG A . n 
A 1 35  ASP 35  15  15  ASP ASP A . n 
A 1 36  VAL 36  16  16  VAL VAL A . n 
A 1 37  LEU 37  17  17  LEU LEU A . n 
A 1 38  PRO 38  18  18  PRO PRO A . n 
A 1 39  GLY 39  19  19  GLY GLY A . n 
A 1 40  GLU 40  20  20  GLU GLU A . n 
A 1 41  ILE 41  21  21  ILE ILE A . n 
A 1 42  PHE 42  22  22  PHE PHE A . n 
A 1 43  ASP 43  23  23  ASP ASP A . n 
A 1 44  PHE 44  24  24  PHE PHE A . n 
A 1 45  LEU 45  25  25  LEU LEU A . n 
A 1 46  ALA 46  26  26  ALA ALA A . n 
A 1 47  GLY 47  27  27  GLY GLY A . n 
A 1 48  GLY 48  28  28  GLY GLY A . n 
A 1 49  SER 49  29  29  SER SER A . n 
A 1 50  GLY 50  30  30  GLY GLY A . n 
A 1 51  THR 51  31  31  THR THR A . n 
A 1 52  GLU 52  32  32  GLU GLU A . n 
A 1 53  ALA 53  33  33  ALA ALA A . n 
A 1 54  SER 54  34  34  SER SER A . n 
A 1 55  LEU 55  35  35  LEU LEU A . n 
A 1 56  VAL 56  36  36  VAL VAL A . n 
A 1 57  ALA 57  37  37  ALA ALA A . n 
A 1 58  ASN 58  38  38  ASN ASN A . n 
A 1 59  ARG 59  39  39  ARG ARG A . n 
A 1 60  THR 60  40  40  THR THR A . n 
A 1 61  ALA 61  41  41  ALA ALA A . n 
A 1 62  LEU 62  42  42  LEU LEU A . n 
A 1 63  GLU 63  43  43  GLU GLU A . n 
A 1 64  ARG 64  44  44  ARG ARG A . n 
A 1 65  VAL 65  45  45  VAL VAL A . n 
A 1 66  PHE 66  46  46  PHE PHE A . n 
A 1 67  VAL 67  47  47  VAL VAL A . n 
A 1 68  ILE 68  48  48  ILE ILE A . n 
A 1 69  PRO 69  49  49  PRO PRO A . n 
A 1 70  ARG 70  50  50  ARG ARG A . n 
A 1 71  MET 71  51  51  MET MET A . n 
A 1 72  LEU 72  52  52  LEU LEU A . n 
A 1 73  ARG 73  53  53  ARG ARG A . n 
A 1 74  ASP 74  54  54  ASP ASP A . n 
A 1 75  LEU 75  55  55  LEU LEU A . n 
A 1 76  THR 76  56  56  THR THR A . n 
A 1 77  ASP 77  57  57  ASP ASP A . n 
A 1 78  VAL 78  58  58  VAL VAL A . n 
A 1 79  THR 79  59  59  THR THR A . n 
A 1 80  THR 80  60  60  THR THR A . n 
A 1 81  GLU 81  61  61  GLU GLU A . n 
A 1 82  ILE 82  62  62  ILE ILE A . n 
A 1 83  ASP 83  63  63  ASP ASP A . n 
A 1 84  ILE 84  64  64  ILE ILE A . n 
A 1 85  PHE 85  65  65  PHE PHE A . n 
A 1 86  GLY 86  66  66  GLY GLY A . n 
A 1 87  ARG 87  67  67  ARG ARG A . n 
A 1 88  ARG 88  68  68  ARG ARG A . n 
A 1 89  ALA 89  69  69  ALA ALA A . n 
A 1 90  ALA 90  70  70  ALA ALA A . n 
A 1 91  LEU 91  71  71  LEU LEU A . n 
A 1 92  PRO 92  72  72  PRO PRO A . n 
A 1 93  MET 93  73  73  MET MET A . n 
A 1 94  ALA 94  74  74  ALA ALA A . n 
A 1 95  VAL 95  75  75  VAL VAL A . n 
A 1 96  ALA 96  76  76  ALA ALA A . n 
A 1 97  PRO 97  77  77  PRO PRO A . n 
A 1 98  VAL 98  78  78  VAL VAL A . n 
A 1 99  ALA 99  79  79  ALA ALA A . n 
A 1 100 TYR 100 80  80  TYR TYR A . n 
A 1 101 GLN 101 81  81  GLN GLN A . n 
A 1 102 ARG 102 82  82  ARG ARG A . n 
A 1 103 LEU 103 83  83  LEU LEU A . n 
A 1 104 PHE 104 84  84  PHE PHE A . n 
A 1 105 HIS 105 85  85  HIS HIS A . n 
A 1 106 PRO 106 86  86  PRO PRO A . n 
A 1 107 GLU 107 87  87  GLU GLU A . n 
A 1 108 GLY 108 88  88  GLY GLY A . n 
A 1 109 GLU 109 89  89  GLU GLU A . n 
A 1 110 LEU 110 90  90  LEU LEU A . n 
A 1 111 ALA 111 91  91  ALA ALA A . n 
A 1 112 VAL 112 92  92  VAL VAL A . n 
A 1 113 ALA 113 93  93  ALA ALA A . n 
A 1 114 ARG 114 94  94  ARG ARG A . n 
A 1 115 ALA 115 95  95  ALA ALA A . n 
A 1 116 ALA 116 96  96  ALA ALA A . n 
A 1 117 ARG 117 97  97  ARG ARG A . n 
A 1 118 ASP 118 98  98  ASP ASP A . n 
A 1 119 ALA 119 99  99  ALA ALA A . n 
A 1 120 GLY 120 100 100 GLY GLY A . n 
A 1 121 VAL 121 101 101 VAL VAL A . n 
A 1 122 PRO 122 102 102 PRO PRO A . n 
A 1 123 TYR 123 103 103 TYR TYR A . n 
A 1 124 THR 124 104 104 THR THR A . n 
A 1 125 ILE 125 105 105 ILE ILE A . n 
A 1 126 CYS 126 106 106 CYS CYS A . n 
A 1 127 THR 127 107 107 THR THR A . n 
A 1 128 LEU 128 108 108 LEU LEU A . n 
A 1 129 SER 129 109 109 SER SER A . n 
A 1 130 SER 130 110 110 SER SER A . n 
A 1 131 VAL 131 111 111 VAL VAL A . n 
A 1 132 SER 132 112 112 SER SER A . n 
A 1 133 LEU 133 113 113 LEU LEU A . n 
A 1 134 GLU 134 114 114 GLU GLU A . n 
A 1 135 GLU 135 115 115 GLU GLU A . n 
A 1 136 ILE 136 116 116 ILE ILE A . n 
A 1 137 ALA 137 117 117 ALA ALA A . n 
A 1 138 ALA 138 118 118 ALA ALA A . n 
A 1 139 VAL 139 119 119 VAL VAL A . n 
A 1 140 GLY 140 120 120 GLY GLY A . n 
A 1 141 GLY 141 121 121 GLY GLY A . n 
A 1 142 ARG 142 122 122 ARG ARG A . n 
A 1 143 PRO 143 123 123 PRO PRO A . n 
A 1 144 TRP 144 124 124 TRP TRP A . n 
A 1 145 PHE 145 125 125 PHE PHE A . n 
A 1 146 GLN 146 126 126 GLN GLN A . n 
A 1 147 LEU 147 127 127 LEU LEU A . n 
A 1 148 TYR 148 128 128 TYR TYR A . n 
A 1 149 TRP 149 129 129 TRP TRP A . n 
A 1 150 LEU 150 130 130 LEU LEU A . n 
A 1 151 ARG 151 131 131 ARG ARG A . n 
A 1 152 ASP 152 132 132 ASP ASP A . n 
A 1 153 GLU 153 133 133 GLU GLU A . n 
A 1 154 LYS 154 134 134 LYS LYS A . n 
A 1 155 ARG 155 135 135 ARG ARG A . n 
A 1 156 SER 156 136 136 SER SER A . n 
A 1 157 LEU 157 137 137 LEU LEU A . n 
A 1 158 ASP 158 138 138 ASP ASP A . n 
A 1 159 LEU 159 139 139 LEU LEU A . n 
A 1 160 VAL 160 140 140 VAL VAL A . n 
A 1 161 ARG 161 141 141 ARG ARG A . n 
A 1 162 ARG 162 142 142 ARG ARG A . n 
A 1 163 ALA 163 143 143 ALA ALA A . n 
A 1 164 GLU 164 144 144 GLU GLU A . n 
A 1 165 ASP 165 145 145 ASP ASP A . n 
A 1 166 ALA 166 146 146 ALA ALA A . n 
A 1 167 GLY 167 147 147 GLY GLY A . n 
A 1 168 CYS 168 148 148 CYS CYS A . n 
A 1 169 GLU 169 149 149 GLU GLU A . n 
A 1 170 ALA 170 150 150 ALA ALA A . n 
A 1 171 ILE 171 151 151 ILE ILE A . n 
A 1 172 VAL 172 152 152 VAL VAL A . n 
A 1 173 PHE 173 153 153 PHE PHE A . n 
A 1 174 THR 174 154 154 THR THR A . n 
A 1 175 VAL 175 155 155 VAL VAL A . n 
A 1 176 ASP 176 156 156 ASP ASP A . n 
A 1 177 VAL 177 157 157 VAL VAL A . n 
A 1 178 PRO 178 158 158 PRO PRO A . n 
A 1 179 TRP 179 159 159 TRP TRP A . n 
A 1 180 MET 180 160 160 MET MET A . n 
A 1 181 GLY 181 161 161 GLY GLY A . n 
A 1 182 ARG 182 162 162 ARG ARG A . n 
A 1 183 ARG 183 163 163 ARG ARG A . n 
A 1 184 LEU 184 164 164 LEU LEU A . n 
A 1 185 ARG 185 165 165 ARG ARG A . n 
A 1 186 ASP 186 166 166 ASP ASP A . n 
A 1 187 MET 187 167 167 MET MET A . n 
A 1 188 ARG 188 168 168 ARG ARG A . n 
A 1 189 ASN 189 169 169 ASN ASN A . n 
A 1 190 GLY 190 170 170 GLY GLY A . n 
A 1 191 PHE 191 171 171 PHE PHE A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 LEU 193 173 173 LEU LEU A . n 
A 1 194 PRO 194 174 174 PRO PRO A . n 
A 1 195 GLU 195 175 175 GLU GLU A . n 
A 1 196 TRP 196 176 176 TRP TRP A . n 
A 1 197 VAL 197 177 177 VAL VAL A . n 
A 1 198 THR 198 178 178 THR THR A . n 
A 1 199 ALA 199 179 179 ALA ALA A . n 
A 1 200 ALA 200 180 180 ALA ALA A . n 
A 1 201 ASN 201 181 181 ASN ASN A . n 
A 1 202 PHE 202 182 182 PHE PHE A . n 
A 1 203 ASP 203 183 183 ASP ASP A . n 
A 1 204 ALA 204 184 ?   ?   ?   A . n 
A 1 205 GLY 205 185 ?   ?   ?   A . n 
A 1 206 THR 206 186 ?   ?   ?   A . n 
A 1 207 ALA 207 187 ?   ?   ?   A . n 
A 1 208 ALA 208 188 ?   ?   ?   A . n 
A 1 209 HIS 209 189 ?   ?   ?   A . n 
A 1 210 ARG 210 190 ?   ?   ?   A . n 
A 1 211 ARG 211 191 ?   ?   ?   A . n 
A 1 212 THR 212 192 ?   ?   ?   A . n 
A 1 213 GLN 213 193 ?   ?   ?   A . n 
A 1 214 GLY 214 194 ?   ?   ?   A . n 
A 1 215 VAL 215 195 ?   ?   ?   A . n 
A 1 216 SER 216 196 ?   ?   ?   A . n 
A 1 217 ALA 217 197 ?   ?   ?   A . n 
A 1 218 VAL 218 198 ?   ?   ?   A . n 
A 1 219 ALA 219 199 ?   ?   ?   A . n 
A 1 220 ASP 220 200 ?   ?   ?   A . n 
A 1 221 HIS 221 201 ?   ?   ?   A . n 
A 1 222 THR 222 202 ?   ?   ?   A . n 
A 1 223 ALA 223 203 ?   ?   ?   A . n 
A 1 224 ARG 224 204 ?   ?   ?   A . n 
A 1 225 GLU 225 205 205 GLU GLU A . n 
A 1 226 PHE 226 206 206 PHE PHE A . n 
A 1 227 ALA 227 207 207 ALA ALA A . n 
A 1 228 PRO 228 208 208 PRO PRO A . n 
A 1 229 ALA 229 209 209 ALA ALA A . n 
A 1 230 THR 230 210 210 THR THR A . n 
A 1 231 TRP 231 211 211 TRP TRP A . n 
A 1 232 GLU 232 212 212 GLU GLU A . n 
A 1 233 SER 233 213 213 SER SER A . n 
A 1 234 VAL 234 214 214 VAL VAL A . n 
A 1 235 GLU 235 215 215 GLU GLU A . n 
A 1 236 ALA 236 216 216 ALA ALA A . n 
A 1 237 VAL 237 217 217 VAL VAL A . n 
A 1 238 ARG 238 218 218 ARG ARG A . n 
A 1 239 ALA 239 219 219 ALA ALA A . n 
A 1 240 HIS 240 220 220 HIS HIS A . n 
A 1 241 THR 241 221 221 THR THR A . n 
A 1 242 ASP 242 222 222 ASP ASP A . n 
A 1 243 LEU 243 223 223 LEU LEU A . n 
A 1 244 PRO 244 224 224 PRO PRO A . n 
A 1 245 VAL 245 225 225 VAL VAL A . n 
A 1 246 VAL 246 226 226 VAL VAL A . n 
A 1 247 LEU 247 227 227 LEU LEU A . n 
A 1 248 LYS 248 228 228 LYS LYS A . n 
A 1 249 GLY 249 229 229 GLY GLY A . n 
A 1 250 ILE 250 230 230 ILE ILE A . n 
A 1 251 LEU 251 231 231 LEU LEU A . n 
A 1 252 ALA 252 232 232 ALA ALA A . n 
A 1 253 VAL 253 233 233 VAL VAL A . n 
A 1 254 GLU 254 234 234 GLU GLU A . n 
A 1 255 ASP 255 235 235 ASP ASP A . n 
A 1 256 ALA 256 236 236 ALA ALA A . n 
A 1 257 ARG 257 237 237 ARG ARG A . n 
A 1 258 ARG 258 238 238 ARG ARG A . n 
A 1 259 ALA 259 239 239 ALA ALA A . n 
A 1 260 VAL 260 240 240 VAL VAL A . n 
A 1 261 ASP 261 241 241 ASP ASP A . n 
A 1 262 ALA 262 242 242 ALA ALA A . n 
A 1 263 GLY 263 243 243 GLY GLY A . n 
A 1 264 ALA 264 244 244 ALA ALA A . n 
A 1 265 GLY 265 245 245 GLY GLY A . n 
A 1 266 GLY 266 246 246 GLY GLY A . n 
A 1 267 ILE 267 247 247 ILE ILE A . n 
A 1 268 VAL 268 248 248 VAL VAL A . n 
A 1 269 VAL 269 249 249 VAL VAL A . n 
A 1 270 SER 270 250 250 SER SER A . n 
A 1 271 ASN 271 251 251 ASN ASN A . n 
A 1 272 HIS 272 252 252 HIS HIS A . n 
A 1 273 GLY 273 253 253 GLY GLY A . n 
A 1 274 GLY 274 254 254 GLY GLY A . n 
A 1 275 ARG 275 255 255 ARG ARG A . n 
A 1 276 GLN 276 256 256 GLN GLN A . n 
A 1 277 LEU 277 257 257 LEU LEU A . n 
A 1 278 ASP 278 258 258 ASP ASP A . n 
A 1 279 GLY 279 259 259 GLY GLY A . n 
A 1 280 ALA 280 260 260 ALA ALA A . n 
A 1 281 VAL 281 261 261 VAL VAL A . n 
A 1 282 PRO 282 262 262 PRO PRO A . n 
A 1 283 GLY 283 263 263 GLY GLY A . n 
A 1 284 ILE 284 264 264 ILE ILE A . n 
A 1 285 GLU 285 265 265 GLU GLU A . n 
A 1 286 MET 286 266 266 MET MET A . n 
A 1 287 LEU 287 267 267 LEU LEU A . n 
A 1 288 GLY 288 268 268 GLY GLY A . n 
A 1 289 GLU 289 269 269 GLU GLU A . n 
A 1 290 ILE 290 270 270 ILE ILE A . n 
A 1 291 VAL 291 271 271 VAL VAL A . n 
A 1 292 ALA 292 272 272 ALA ALA A . n 
A 1 293 ALA 293 273 273 ALA ALA A . n 
A 1 294 VAL 294 274 274 VAL VAL A . n 
A 1 295 SER 295 275 275 SER SER A . n 
A 1 296 GLY 296 276 276 GLY GLY A . n 
A 1 297 GLY 297 277 277 GLY GLY A . n 
A 1 298 CYS 298 278 278 CYS CYS A . n 
A 1 299 GLU 299 279 279 GLU GLU A . n 
A 1 300 VAL 300 280 280 VAL VAL A . n 
A 1 301 LEU 301 281 281 LEU LEU A . n 
A 1 302 VAL 302 282 282 VAL VAL A . n 
A 1 303 ASP 303 283 283 ASP ASP A . n 
A 1 304 GLY 304 284 284 GLY GLY A . n 
A 1 305 GLY 305 285 285 GLY GLY A . n 
A 1 306 ILE 306 286 286 ILE ILE A . n 
A 1 307 ARG 307 287 287 ARG ARG A . n 
A 1 308 SER 308 288 288 SER SER A . n 
A 1 309 GLY 309 289 289 GLY GLY A . n 
A 1 310 GLY 310 290 290 GLY GLY A . n 
A 1 311 ASP 311 291 291 ASP ASP A . n 
A 1 312 VAL 312 292 292 VAL VAL A . n 
A 1 313 LEU 313 293 293 LEU LEU A . n 
A 1 314 LYS 314 294 294 LYS LYS A . n 
A 1 315 ALA 315 295 295 ALA ALA A . n 
A 1 316 THR 316 296 296 THR THR A . n 
A 1 317 ALA 317 297 297 ALA ALA A . n 
A 1 318 LEU 318 298 298 LEU LEU A . n 
A 1 319 GLY 319 299 299 GLY GLY A . n 
A 1 320 ALA 320 300 300 ALA ALA A . n 
A 1 321 SER 321 301 301 SER SER A . n 
A 1 322 ALA 322 302 302 ALA ALA A . n 
A 1 323 VAL 323 303 303 VAL VAL A . n 
A 1 324 LEU 324 304 304 LEU LEU A . n 
A 1 325 VAL 325 305 305 VAL VAL A . n 
A 1 326 GLY 326 306 306 GLY GLY A . n 
A 1 327 ARG 327 307 307 ARG ARG A . n 
A 1 328 PRO 328 308 308 PRO PRO A . n 
A 1 329 VAL 329 309 309 VAL VAL A . n 
A 1 330 MET 330 310 310 MET MET A . n 
A 1 331 TRP 331 311 311 TRP TRP A . n 
A 1 332 ALA 332 312 312 ALA ALA A . n 
A 1 333 LEU 333 313 313 LEU LEU A . n 
A 1 334 ALA 334 314 314 ALA ALA A . n 
A 1 335 ALA 335 315 315 ALA ALA A . n 
A 1 336 ALA 336 316 316 ALA ALA A . n 
A 1 337 GLY 337 317 317 GLY GLY A . n 
A 1 338 GLN 338 318 318 GLN GLN A . n 
A 1 339 ASP 339 319 319 ASP ASP A . n 
A 1 340 GLY 340 320 320 GLY GLY A . n 
A 1 341 VAL 341 321 321 VAL VAL A . n 
A 1 342 ARG 342 322 322 ARG ARG A . n 
A 1 343 GLN 343 323 323 GLN GLN A . n 
A 1 344 LEU 344 324 324 LEU LEU A . n 
A 1 345 LEU 345 325 325 LEU LEU A . n 
A 1 346 GLU 346 326 326 GLU GLU A . n 
A 1 347 LEU 347 327 327 LEU LEU A . n 
A 1 348 LEU 348 328 328 LEU LEU A . n 
A 1 349 ALA 349 329 329 ALA ALA A . n 
A 1 350 GLU 350 330 330 GLU GLU A . n 
A 1 351 GLU 351 331 331 GLU GLU A . n 
A 1 352 VAL 352 332 332 VAL VAL A . n 
A 1 353 ARG 353 333 333 ARG ARG A . n 
A 1 354 ASP 354 334 334 ASP ASP A . n 
A 1 355 ALA 355 335 335 ALA ALA A . n 
A 1 356 MET 356 336 336 MET MET A . n 
A 1 357 GLY 357 337 337 GLY GLY A . n 
A 1 358 LEU 358 338 338 LEU LEU A . n 
A 1 359 ALA 359 339 339 ALA ALA A . n 
A 1 360 GLY 360 340 340 GLY GLY A . n 
A 1 361 CYS 361 341 341 CYS CYS A . n 
A 1 362 GLU 362 342 342 GLU GLU A . n 
A 1 363 SER 363 343 343 SER SER A . n 
A 1 364 VAL 364 344 344 VAL VAL A . n 
A 1 365 GLY 365 345 345 GLY GLY A . n 
A 1 366 ALA 366 346 346 ALA ALA A . n 
A 1 367 ALA 367 347 347 ALA ALA A . n 
A 1 368 ARG 368 348 348 ARG ARG A . n 
A 1 369 ARG 369 349 349 ARG ARG A . n 
A 1 370 LEU 370 350 350 LEU LEU A . n 
A 1 371 ASN 371 351 351 ASN ASN A . n 
A 1 372 THR 372 352 352 THR THR A . n 
A 1 373 LYS 373 353 353 LYS LYS A . n 
A 1 374 LEU 374 354 354 LEU LEU A . n 
A 1 375 GLY 375 355 355 GLY GLY A . n 
A 1 376 VAL 376 356 356 VAL VAL A . n 
A 1 377 VAL 377 357 357 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   401 1   MG  MG  A . 
C 3 FMN 1   402 1   FMN FMN A . 
D 4 173 1   403 1   173 173 A . 
E 4 173 1   404 2   173 173 A . 
F 5 HOH 1   501 245 HOH HOH A . 
F 5 HOH 2   502 218 HOH HOH A . 
F 5 HOH 3   503 148 HOH HOH A . 
F 5 HOH 4   504 106 HOH HOH A . 
F 5 HOH 5   505 220 HOH HOH A . 
F 5 HOH 6   506 211 HOH HOH A . 
F 5 HOH 7   507 307 HOH HOH A . 
F 5 HOH 8   508 97  HOH HOH A . 
F 5 HOH 9   509 240 HOH HOH A . 
F 5 HOH 10  510 260 HOH HOH A . 
F 5 HOH 11  511 135 HOH HOH A . 
F 5 HOH 12  512 310 HOH HOH A . 
F 5 HOH 13  513 246 HOH HOH A . 
F 5 HOH 14  514 323 HOH HOH A . 
F 5 HOH 15  515 170 HOH HOH A . 
F 5 HOH 16  516 159 HOH HOH A . 
F 5 HOH 17  517 167 HOH HOH A . 
F 5 HOH 18  518 51  HOH HOH A . 
F 5 HOH 19  519 155 HOH HOH A . 
F 5 HOH 20  520 112 HOH HOH A . 
F 5 HOH 21  521 40  HOH HOH A . 
F 5 HOH 22  522 321 HOH HOH A . 
F 5 HOH 23  523 234 HOH HOH A . 
F 5 HOH 24  524 178 HOH HOH A . 
F 5 HOH 25  525 190 HOH HOH A . 
F 5 HOH 26  526 54  HOH HOH A . 
F 5 HOH 27  527 107 HOH HOH A . 
F 5 HOH 28  528 53  HOH HOH A . 
F 5 HOH 29  529 247 HOH HOH A . 
F 5 HOH 30  530 253 HOH HOH A . 
F 5 HOH 31  531 265 HOH HOH A . 
F 5 HOH 32  532 34  HOH HOH A . 
F 5 HOH 33  533 262 HOH HOH A . 
F 5 HOH 34  534 67  HOH HOH A . 
F 5 HOH 35  535 109 HOH HOH A . 
F 5 HOH 36  536 267 HOH HOH A . 
F 5 HOH 37  537 222 HOH HOH A . 
F 5 HOH 38  538 69  HOH HOH A . 
F 5 HOH 39  539 48  HOH HOH A . 
F 5 HOH 40  540 71  HOH HOH A . 
F 5 HOH 41  541 136 HOH HOH A . 
F 5 HOH 42  542 58  HOH HOH A . 
F 5 HOH 43  543 50  HOH HOH A . 
F 5 HOH 44  544 156 HOH HOH A . 
F 5 HOH 45  545 248 HOH HOH A . 
F 5 HOH 46  546 151 HOH HOH A . 
F 5 HOH 47  547 16  HOH HOH A . 
F 5 HOH 48  548 47  HOH HOH A . 
F 5 HOH 49  549 96  HOH HOH A . 
F 5 HOH 50  550 127 HOH HOH A . 
F 5 HOH 51  551 126 HOH HOH A . 
F 5 HOH 52  552 8   HOH HOH A . 
F 5 HOH 53  553 129 HOH HOH A . 
F 5 HOH 54  554 270 HOH HOH A . 
F 5 HOH 55  555 85  HOH HOH A . 
F 5 HOH 56  556 289 HOH HOH A . 
F 5 HOH 57  557 134 HOH HOH A . 
F 5 HOH 58  558 18  HOH HOH A . 
F 5 HOH 59  559 316 HOH HOH A . 
F 5 HOH 60  560 78  HOH HOH A . 
F 5 HOH 61  561 73  HOH HOH A . 
F 5 HOH 62  562 88  HOH HOH A . 
F 5 HOH 63  563 43  HOH HOH A . 
F 5 HOH 64  564 128 HOH HOH A . 
F 5 HOH 65  565 250 HOH HOH A . 
F 5 HOH 66  566 299 HOH HOH A . 
F 5 HOH 67  567 74  HOH HOH A . 
F 5 HOH 68  568 27  HOH HOH A . 
F 5 HOH 69  569 42  HOH HOH A . 
F 5 HOH 70  570 152 HOH HOH A . 
F 5 HOH 71  571 197 HOH HOH A . 
F 5 HOH 72  572 280 HOH HOH A . 
F 5 HOH 73  573 119 HOH HOH A . 
F 5 HOH 74  574 138 HOH HOH A . 
F 5 HOH 75  575 98  HOH HOH A . 
F 5 HOH 76  576 242 HOH HOH A . 
F 5 HOH 77  577 291 HOH HOH A . 
F 5 HOH 78  578 4   HOH HOH A . 
F 5 HOH 79  579 19  HOH HOH A . 
F 5 HOH 80  580 75  HOH HOH A . 
F 5 HOH 81  581 30  HOH HOH A . 
F 5 HOH 82  582 196 HOH HOH A . 
F 5 HOH 83  583 108 HOH HOH A . 
F 5 HOH 84  584 57  HOH HOH A . 
F 5 HOH 85  585 38  HOH HOH A . 
F 5 HOH 86  586 125 HOH HOH A . 
F 5 HOH 87  587 28  HOH HOH A . 
F 5 HOH 88  588 137 HOH HOH A . 
F 5 HOH 89  589 202 HOH HOH A . 
F 5 HOH 90  590 292 HOH HOH A . 
F 5 HOH 91  591 68  HOH HOH A . 
F 5 HOH 92  592 66  HOH HOH A . 
F 5 HOH 93  593 172 HOH HOH A . 
F 5 HOH 94  594 12  HOH HOH A . 
F 5 HOH 95  595 29  HOH HOH A . 
F 5 HOH 96  596 5   HOH HOH A . 
F 5 HOH 97  597 64  HOH HOH A . 
F 5 HOH 98  598 9   HOH HOH A . 
F 5 HOH 99  599 149 HOH HOH A . 
F 5 HOH 100 600 216 HOH HOH A . 
F 5 HOH 101 601 79  HOH HOH A . 
F 5 HOH 102 602 212 HOH HOH A . 
F 5 HOH 103 603 186 HOH HOH A . 
F 5 HOH 104 604 84  HOH HOH A . 
F 5 HOH 105 605 147 HOH HOH A . 
F 5 HOH 106 606 140 HOH HOH A . 
F 5 HOH 107 607 150 HOH HOH A . 
F 5 HOH 108 608 52  HOH HOH A . 
F 5 HOH 109 609 276 HOH HOH A . 
F 5 HOH 110 610 17  HOH HOH A . 
F 5 HOH 111 611 111 HOH HOH A . 
F 5 HOH 112 612 10  HOH HOH A . 
F 5 HOH 113 613 100 HOH HOH A . 
F 5 HOH 114 614 21  HOH HOH A . 
F 5 HOH 115 615 83  HOH HOH A . 
F 5 HOH 116 616 2   HOH HOH A . 
F 5 HOH 117 617 192 HOH HOH A . 
F 5 HOH 118 618 3   HOH HOH A . 
F 5 HOH 119 619 113 HOH HOH A . 
F 5 HOH 120 620 162 HOH HOH A . 
F 5 HOH 121 621 195 HOH HOH A . 
F 5 HOH 122 622 122 HOH HOH A . 
F 5 HOH 123 623 6   HOH HOH A . 
F 5 HOH 124 624 130 HOH HOH A . 
F 5 HOH 125 625 56  HOH HOH A . 
F 5 HOH 126 626 76  HOH HOH A . 
F 5 HOH 127 627 41  HOH HOH A . 
F 5 HOH 128 628 104 HOH HOH A . 
F 5 HOH 129 629 285 HOH HOH A . 
F 5 HOH 130 630 94  HOH HOH A . 
F 5 HOH 131 631 273 HOH HOH A . 
F 5 HOH 132 632 101 HOH HOH A . 
F 5 HOH 133 633 313 HOH HOH A . 
F 5 HOH 134 634 139 HOH HOH A . 
F 5 HOH 135 635 169 HOH HOH A . 
F 5 HOH 136 636 286 HOH HOH A . 
F 5 HOH 137 637 24  HOH HOH A . 
F 5 HOH 138 638 116 HOH HOH A . 
F 5 HOH 139 639 117 HOH HOH A . 
F 5 HOH 140 640 168 HOH HOH A . 
F 5 HOH 141 641 165 HOH HOH A . 
F 5 HOH 142 642 60  HOH HOH A . 
F 5 HOH 143 643 214 HOH HOH A . 
F 5 HOH 144 644 314 HOH HOH A . 
F 5 HOH 145 645 110 HOH HOH A . 
F 5 HOH 146 646 282 HOH HOH A . 
F 5 HOH 147 647 7   HOH HOH A . 
F 5 HOH 148 648 36  HOH HOH A . 
F 5 HOH 149 649 123 HOH HOH A . 
F 5 HOH 150 650 15  HOH HOH A . 
F 5 HOH 151 651 80  HOH HOH A . 
F 5 HOH 152 652 236 HOH HOH A . 
F 5 HOH 153 653 11  HOH HOH A . 
F 5 HOH 154 654 61  HOH HOH A . 
F 5 HOH 155 655 259 HOH HOH A . 
F 5 HOH 156 656 249 HOH HOH A . 
F 5 HOH 157 657 55  HOH HOH A . 
F 5 HOH 158 658 39  HOH HOH A . 
F 5 HOH 159 659 141 HOH HOH A . 
F 5 HOH 160 660 215 HOH HOH A . 
F 5 HOH 161 661 45  HOH HOH A . 
F 5 HOH 162 662 194 HOH HOH A . 
F 5 HOH 163 663 14  HOH HOH A . 
F 5 HOH 164 664 62  HOH HOH A . 
F 5 HOH 165 665 293 HOH HOH A . 
F 5 HOH 166 666 180 HOH HOH A . 
F 5 HOH 167 667 32  HOH HOH A . 
F 5 HOH 168 668 256 HOH HOH A . 
F 5 HOH 169 669 160 HOH HOH A . 
F 5 HOH 170 670 59  HOH HOH A . 
F 5 HOH 171 671 252 HOH HOH A . 
F 5 HOH 172 672 268 HOH HOH A . 
F 5 HOH 173 673 297 HOH HOH A . 
F 5 HOH 174 674 25  HOH HOH A . 
F 5 HOH 175 675 209 HOH HOH A . 
F 5 HOH 176 676 65  HOH HOH A . 
F 5 HOH 177 677 35  HOH HOH A . 
F 5 HOH 178 678 263 HOH HOH A . 
F 5 HOH 179 679 124 HOH HOH A . 
F 5 HOH 180 680 31  HOH HOH A . 
F 5 HOH 181 681 205 HOH HOH A . 
F 5 HOH 182 682 144 HOH HOH A . 
F 5 HOH 183 683 118 HOH HOH A . 
F 5 HOH 184 684 99  HOH HOH A . 
F 5 HOH 185 685 223 HOH HOH A . 
F 5 HOH 186 686 33  HOH HOH A . 
F 5 HOH 187 687 132 HOH HOH A . 
F 5 HOH 188 688 226 HOH HOH A . 
F 5 HOH 189 689 266 HOH HOH A . 
F 5 HOH 190 690 177 HOH HOH A . 
F 5 HOH 191 691 163 HOH HOH A . 
F 5 HOH 192 692 102 HOH HOH A . 
F 5 HOH 193 693 133 HOH HOH A . 
F 5 HOH 194 694 269 HOH HOH A . 
F 5 HOH 195 695 13  HOH HOH A . 
F 5 HOH 196 696 1   HOH HOH A . 
F 5 HOH 197 697 89  HOH HOH A . 
F 5 HOH 198 698 91  HOH HOH A . 
F 5 HOH 199 699 264 HOH HOH A . 
F 5 HOH 200 700 26  HOH HOH A . 
F 5 HOH 201 701 203 HOH HOH A . 
F 5 HOH 202 702 44  HOH HOH A . 
F 5 HOH 203 703 330 HOH HOH A . 
F 5 HOH 204 704 324 HOH HOH A . 
F 5 HOH 205 705 87  HOH HOH A . 
F 5 HOH 206 706 23  HOH HOH A . 
F 5 HOH 207 707 95  HOH HOH A . 
F 5 HOH 208 708 81  HOH HOH A . 
F 5 HOH 209 709 143 HOH HOH A . 
F 5 HOH 210 710 22  HOH HOH A . 
F 5 HOH 211 711 77  HOH HOH A . 
F 5 HOH 212 712 20  HOH HOH A . 
F 5 HOH 213 713 188 HOH HOH A . 
F 5 HOH 214 714 199 HOH HOH A . 
F 5 HOH 215 715 271 HOH HOH A . 
F 5 HOH 216 716 37  HOH HOH A . 
F 5 HOH 217 717 254 HOH HOH A . 
F 5 HOH 218 718 46  HOH HOH A . 
F 5 HOH 219 719 121 HOH HOH A . 
F 5 HOH 220 720 198 HOH HOH A . 
F 5 HOH 221 721 82  HOH HOH A . 
F 5 HOH 222 722 92  HOH HOH A . 
F 5 HOH 223 723 164 HOH HOH A . 
F 5 HOH 224 724 208 HOH HOH A . 
F 5 HOH 225 725 221 HOH HOH A . 
F 5 HOH 226 726 70  HOH HOH A . 
F 5 HOH 227 727 283 HOH HOH A . 
F 5 HOH 228 728 272 HOH HOH A . 
F 5 HOH 229 729 191 HOH HOH A . 
F 5 HOH 230 730 93  HOH HOH A . 
F 5 HOH 231 731 49  HOH HOH A . 
F 5 HOH 232 732 183 HOH HOH A . 
F 5 HOH 233 733 213 HOH HOH A . 
F 5 HOH 234 734 298 HOH HOH A . 
F 5 HOH 235 735 275 HOH HOH A . 
F 5 HOH 236 736 311 HOH HOH A . 
F 5 HOH 237 738 115 HOH HOH A . 
F 5 HOH 238 739 243 HOH HOH A . 
F 5 HOH 239 740 329 HOH HOH A . 
F 5 HOH 240 741 173 HOH HOH A . 
F 5 HOH 241 742 258 HOH HOH A . 
F 5 HOH 242 743 63  HOH HOH A . 
F 5 HOH 243 744 327 HOH HOH A . 
F 5 HOH 244 745 274 HOH HOH A . 
F 5 HOH 245 746 238 HOH HOH A . 
F 5 HOH 246 747 317 HOH HOH A . 
F 5 HOH 247 748 304 HOH HOH A . 
F 5 HOH 248 749 308 HOH HOH A . 
F 5 HOH 249 750 301 HOH HOH A . 
F 5 HOH 250 751 294 HOH HOH A . 
F 5 HOH 251 752 325 HOH HOH A . 
F 5 HOH 252 753 120 HOH HOH A . 
F 5 HOH 253 754 72  HOH HOH A . 
F 5 HOH 254 755 257 HOH HOH A . 
F 5 HOH 255 756 158 HOH HOH A . 
F 5 HOH 256 757 315 HOH HOH A . 
F 5 HOH 257 758 210 HOH HOH A . 
F 5 HOH 258 759 231 HOH HOH A . 
F 5 HOH 259 760 189 HOH HOH A . 
F 5 HOH 260 761 305 HOH HOH A . 
F 5 HOH 261 762 322 HOH HOH A . 
F 5 HOH 262 763 295 HOH HOH A . 
F 5 HOH 263 764 103 HOH HOH A . 
F 5 HOH 264 765 228 HOH HOH A . 
F 5 HOH 265 766 233 HOH HOH A . 
F 5 HOH 266 767 227 HOH HOH A . 
F 5 HOH 267 768 200 HOH HOH A . 
F 5 HOH 268 769 278 HOH HOH A . 
F 5 HOH 269 770 184 HOH HOH A . 
F 5 HOH 270 771 281 HOH HOH A . 
F 5 HOH 271 772 303 HOH HOH A . 
F 5 HOH 272 773 306 HOH HOH A . 
F 5 HOH 273 774 171 HOH HOH A . 
F 5 HOH 274 775 232 HOH HOH A . 
F 5 HOH 275 776 277 HOH HOH A . 
F 5 HOH 276 777 206 HOH HOH A . 
F 5 HOH 277 778 90  HOH HOH A . 
F 5 HOH 278 779 193 HOH HOH A . 
F 5 HOH 279 780 131 HOH HOH A . 
F 5 HOH 280 781 239 HOH HOH A . 
F 5 HOH 281 782 185 HOH HOH A . 
F 5 HOH 282 783 204 HOH HOH A . 
F 5 HOH 283 784 217 HOH HOH A . 
F 5 HOH 284 785 146 HOH HOH A . 
F 5 HOH 285 786 319 HOH HOH A . 
F 5 HOH 286 787 142 HOH HOH A . 
F 5 HOH 287 788 145 HOH HOH A . 
F 5 HOH 288 789 166 HOH HOH A . 
F 5 HOH 289 790 161 HOH HOH A . 
F 5 HOH 290 791 207 HOH HOH A . 
F 5 HOH 291 792 225 HOH HOH A . 
F 5 HOH 292 793 174 HOH HOH A . 
F 5 HOH 293 794 230 HOH HOH A . 
F 5 HOH 294 795 157 HOH HOH A . 
F 5 HOH 295 796 179 HOH HOH A . 
F 5 HOH 296 797 219 HOH HOH A . 
F 5 HOH 297 798 279 HOH HOH A . 
F 5 HOH 298 799 229 HOH HOH A . 
F 5 HOH 299 800 309 HOH HOH A . 
F 5 HOH 300 801 255 HOH HOH A . 
F 5 HOH 301 802 114 HOH HOH A . 
F 5 HOH 302 803 176 HOH HOH A . 
F 5 HOH 303 804 261 HOH HOH A . 
F 5 HOH 304 805 326 HOH HOH A . 
F 5 HOH 305 806 296 HOH HOH A . 
F 5 HOH 306 807 181 HOH HOH A . 
F 5 HOH 307 808 302 HOH HOH A . 
F 5 HOH 308 809 318 HOH HOH A . 
F 5 HOH 309 810 182 HOH HOH A . 
F 5 HOH 310 811 224 HOH HOH A . 
F 5 HOH 311 812 244 HOH HOH A . 
F 5 HOH 312 813 86  HOH HOH A . 
F 5 HOH 313 814 154 HOH HOH A . 
F 5 HOH 314 815 153 HOH HOH A . 
F 5 HOH 315 816 300 HOH HOH A . 
F 5 HOH 316 817 105 HOH HOH A . 
F 5 HOH 317 818 235 HOH HOH A . 
F 5 HOH 318 819 312 HOH HOH A . 
F 5 HOH 319 820 237 HOH HOH A . 
F 5 HOH 320 821 175 HOH HOH A . 
F 5 HOH 321 822 241 HOH HOH A . 
F 5 HOH 322 823 284 HOH HOH A . 
F 5 HOH 323 824 287 HOH HOH A . 
F 5 HOH 324 825 187 HOH HOH A . 
F 5 HOH 325 826 320 HOH HOH A . 
F 5 HOH 326 827 251 HOH HOH A . 
F 5 HOH 327 828 290 HOH HOH A . 
F 5 HOH 328 829 288 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 17520 ? 
1 MORE         -172  ? 
1 'SSA (A^2)'  44060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z  0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z  0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   LEU 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    324 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    LEU 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     304 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    MG 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     401 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O3P 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   FMN 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    FMN 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     402 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 109.0 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-06-19 
2 'Structure model' 1 1 2019-08-14 
3 'Structure model' 1 2 2019-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_abbrev'          
2  2 'Structure model' '_citation.journal_id_CSD'          
3  2 'Structure model' '_citation.journal_id_ISSN'         
4  2 'Structure model' '_citation.journal_volume'          
5  2 'Structure model' '_citation.page_first'              
6  2 'Structure model' '_citation.page_last'               
7  2 'Structure model' '_citation.pdbx_database_id_DOI'    
8  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
9  2 'Structure model' '_citation.title'                   
10 2 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .        4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              122 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.61 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.31 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 108 ? ? -98.54  42.95   
2 1 ARG A 131 ? ? 4.09    -75.69  
3 1 GLN A 256 ? ? -108.31 -105.37 
4 1 ALA A 316 ? ? -157.58 24.03   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 828 ? 5.98 . 
2 1 O ? A HOH 829 ? 6.20 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A HIS 0   ? A HIS 20  
21 1 Y 1 A MET 1   ? A MET 21  
22 1 Y 1 A ALA 184 ? A ALA 204 
23 1 Y 1 A GLY 185 ? A GLY 205 
24 1 Y 1 A THR 186 ? A THR 206 
25 1 Y 1 A ALA 187 ? A ALA 207 
26 1 Y 1 A ALA 188 ? A ALA 208 
27 1 Y 1 A HIS 189 ? A HIS 209 
28 1 Y 1 A ARG 190 ? A ARG 210 
29 1 Y 1 A ARG 191 ? A ARG 211 
30 1 Y 1 A THR 192 ? A THR 212 
31 1 Y 1 A GLN 193 ? A GLN 213 
32 1 Y 1 A GLY 194 ? A GLY 214 
33 1 Y 1 A VAL 195 ? A VAL 215 
34 1 Y 1 A SER 196 ? A SER 216 
35 1 Y 1 A ALA 197 ? A ALA 217 
36 1 Y 1 A VAL 198 ? A VAL 218 
37 1 Y 1 A ALA 199 ? A ALA 219 
38 1 Y 1 A ASP 200 ? A ASP 220 
39 1 Y 1 A HIS 201 ? A HIS 221 
40 1 Y 1 A THR 202 ? A THR 222 
41 1 Y 1 A ALA 203 ? A ALA 223 
42 1 Y 1 A ARG 204 ? A ARG 224 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'         MG  
3 'FLAVIN MONONUCLEOTIDE' FMN 
4 'BENZOYL-FORMIC ACID'   173 
5 water                   HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#