data_6A3V
# 
_entry.id   6A3V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6A3V         
WWPDB D_1300008116 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6A3V 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, Y.'    1 ? 
'Zhang, C.' 2 ? 
'Chai, Y.'  3 ? 
'Qi, J.'    4 ? 
'Tien, P.'  5 ? 
'Gao, S.'   6 ? 
'Gao, G.F.' 7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                909 
_citation.page_last                 920.e4 
_citation.title                     
'Limited Cross-Linking of 4-1BB by 4-1BB Ligand and the Agonist Monoclonal Antibody Utomilumab.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2018.09.073 
_citation.pdbx_database_id_PubMed   30355497 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, Y.'      1  ? 
primary 'Tan, S.'     2  ? 
primary 'Zhang, C.'   3  ? 
primary 'Chai, Y.'    4  ? 
primary 'He, M.'      5  ? 
primary 'Zhang, C.W.' 6  ? 
primary 'Wang, Q.'    7  ? 
primary 'Tong, Z.'    8  ? 
primary 'Liu, K.'     9  ? 
primary 'Lei, Y.'     10 ? 
primary 'Liu, W.J.'   11 ? 
primary 'Liu, Y.'     12 ? 
primary 'Tian, Z.'    13 ? 
primary 'Cao, X.'     14 ? 
primary 'Yan, J.'     15 ? 
primary 'Qi, J.'      16 ? 
primary 'Tien, P.'    17 ? 
primary 'Gao, S.'     18 ? 
primary 'Gao, G.F.'   19 ? 
# 
_cell.entry_id           6A3V 
_cell.length_a           126.091 
_cell.length_b           137.195 
_cell.length_c           140.318 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.80 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6A3V 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor necrosis factor ligand superfamily member 9'   21517.334 12 ? ? ? ? 
2 polymer     man 'Tumor necrosis factor receptor superfamily member 9' 17523.689 12 ? ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose              221.208   12 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 '4-1BB ligand,4-1BBL'                                                          
2 '4-1BB ligand receptor,CDw137,T-cell antigen 4-1BB homolog,T-cell antigen ILA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAK
AGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLH
TEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSEHHHHHH
;
;ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAK
AGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLH
TEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSEHHHHHH
;
A,C,E,G,I,K,M,O,Q,S,U,W ? 
2 'polypeptide(L)' no no 
;LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCE
QDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREHHH
HHH
;
;LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCE
QDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREHHH
HHH
;
B,D,F,H,J,L,N,P,R,T,V,X ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   ALA n 
1 4   SER n 
1 5   PRO n 
1 6   GLY n 
1 7   SER n 
1 8   ALA n 
1 9   ALA n 
1 10  SER n 
1 11  PRO n 
1 12  ARG n 
1 13  LEU n 
1 14  ARG n 
1 15  GLU n 
1 16  GLY n 
1 17  PRO n 
1 18  GLU n 
1 19  LEU n 
1 20  SER n 
1 21  PRO n 
1 22  ASP n 
1 23  ASP n 
1 24  PRO n 
1 25  ALA n 
1 26  GLY n 
1 27  LEU n 
1 28  LEU n 
1 29  ASP n 
1 30  LEU n 
1 31  ARG n 
1 32  GLN n 
1 33  GLY n 
1 34  MET n 
1 35  PHE n 
1 36  ALA n 
1 37  GLN n 
1 38  LEU n 
1 39  VAL n 
1 40  ALA n 
1 41  GLN n 
1 42  ASN n 
1 43  VAL n 
1 44  LEU n 
1 45  LEU n 
1 46  ILE n 
1 47  ASP n 
1 48  GLY n 
1 49  PRO n 
1 50  LEU n 
1 51  SER n 
1 52  TRP n 
1 53  TYR n 
1 54  SER n 
1 55  ASP n 
1 56  PRO n 
1 57  GLY n 
1 58  LEU n 
1 59  ALA n 
1 60  GLY n 
1 61  VAL n 
1 62  SER n 
1 63  LEU n 
1 64  THR n 
1 65  GLY n 
1 66  GLY n 
1 67  LEU n 
1 68  SER n 
1 69  TYR n 
1 70  LYS n 
1 71  GLU n 
1 72  ASP n 
1 73  THR n 
1 74  LYS n 
1 75  GLU n 
1 76  LEU n 
1 77  VAL n 
1 78  VAL n 
1 79  ALA n 
1 80  LYS n 
1 81  ALA n 
1 82  GLY n 
1 83  VAL n 
1 84  TYR n 
1 85  TYR n 
1 86  VAL n 
1 87  PHE n 
1 88  PHE n 
1 89  GLN n 
1 90  LEU n 
1 91  GLU n 
1 92  LEU n 
1 93  ARG n 
1 94  ARG n 
1 95  VAL n 
1 96  VAL n 
1 97  ALA n 
1 98  GLY n 
1 99  GLU n 
1 100 GLY n 
1 101 SER n 
1 102 GLY n 
1 103 SER n 
1 104 VAL n 
1 105 SER n 
1 106 LEU n 
1 107 ALA n 
1 108 LEU n 
1 109 HIS n 
1 110 LEU n 
1 111 GLN n 
1 112 PRO n 
1 113 LEU n 
1 114 ARG n 
1 115 SER n 
1 116 ALA n 
1 117 ALA n 
1 118 GLY n 
1 119 ALA n 
1 120 ALA n 
1 121 ALA n 
1 122 LEU n 
1 123 ALA n 
1 124 LEU n 
1 125 THR n 
1 126 VAL n 
1 127 ASP n 
1 128 LEU n 
1 129 PRO n 
1 130 PRO n 
1 131 ALA n 
1 132 SER n 
1 133 SER n 
1 134 GLU n 
1 135 ALA n 
1 136 ARG n 
1 137 ASN n 
1 138 SER n 
1 139 ALA n 
1 140 PHE n 
1 141 GLY n 
1 142 PHE n 
1 143 GLN n 
1 144 GLY n 
1 145 ARG n 
1 146 LEU n 
1 147 LEU n 
1 148 HIS n 
1 149 LEU n 
1 150 SER n 
1 151 ALA n 
1 152 GLY n 
1 153 GLN n 
1 154 ARG n 
1 155 LEU n 
1 156 GLY n 
1 157 VAL n 
1 158 HIS n 
1 159 LEU n 
1 160 HIS n 
1 161 THR n 
1 162 GLU n 
1 163 ALA n 
1 164 ARG n 
1 165 ALA n 
1 166 ARG n 
1 167 HIS n 
1 168 ALA n 
1 169 TRP n 
1 170 GLN n 
1 171 LEU n 
1 172 THR n 
1 173 GLN n 
1 174 GLY n 
1 175 ALA n 
1 176 THR n 
1 177 VAL n 
1 178 LEU n 
1 179 GLY n 
1 180 LEU n 
1 181 PHE n 
1 182 ARG n 
1 183 VAL n 
1 184 THR n 
1 185 PRO n 
1 186 GLU n 
1 187 ILE n 
1 188 PRO n 
1 189 ALA n 
1 190 GLY n 
1 191 LEU n 
1 192 PRO n 
1 193 SER n 
1 194 PRO n 
1 195 ARG n 
1 196 SER n 
1 197 GLU n 
1 198 HIS n 
1 199 HIS n 
1 200 HIS n 
1 201 HIS n 
1 202 HIS n 
1 203 HIS n 
2 1   LEU n 
2 2   GLN n 
2 3   ASP n 
2 4   PRO n 
2 5   CYS n 
2 6   SER n 
2 7   ASN n 
2 8   CYS n 
2 9   PRO n 
2 10  ALA n 
2 11  GLY n 
2 12  THR n 
2 13  PHE n 
2 14  CYS n 
2 15  ASP n 
2 16  ASN n 
2 17  ASN n 
2 18  ARG n 
2 19  ASN n 
2 20  GLN n 
2 21  ILE n 
2 22  CYS n 
2 23  SER n 
2 24  PRO n 
2 25  CYS n 
2 26  PRO n 
2 27  PRO n 
2 28  ASN n 
2 29  SER n 
2 30  PHE n 
2 31  SER n 
2 32  SER n 
2 33  ALA n 
2 34  GLY n 
2 35  GLY n 
2 36  GLN n 
2 37  ARG n 
2 38  THR n 
2 39  CYS n 
2 40  ASP n 
2 41  ILE n 
2 42  CYS n 
2 43  ARG n 
2 44  GLN n 
2 45  CYS n 
2 46  LYS n 
2 47  GLY n 
2 48  VAL n 
2 49  PHE n 
2 50  ARG n 
2 51  THR n 
2 52  ARG n 
2 53  LYS n 
2 54  GLU n 
2 55  CYS n 
2 56  SER n 
2 57  SER n 
2 58  THR n 
2 59  SER n 
2 60  ASN n 
2 61  ALA n 
2 62  GLU n 
2 63  CYS n 
2 64  ASP n 
2 65  CYS n 
2 66  THR n 
2 67  PRO n 
2 68  GLY n 
2 69  PHE n 
2 70  HIS n 
2 71  CYS n 
2 72  LEU n 
2 73  GLY n 
2 74  ALA n 
2 75  GLY n 
2 76  CYS n 
2 77  SER n 
2 78  MET n 
2 79  CYS n 
2 80  GLU n 
2 81  GLN n 
2 82  ASP n 
2 83  CYS n 
2 84  LYS n 
2 85  GLN n 
2 86  GLY n 
2 87  GLN n 
2 88  GLU n 
2 89  LEU n 
2 90  THR n 
2 91  LYS n 
2 92  LYS n 
2 93  GLY n 
2 94  CYS n 
2 95  LYS n 
2 96  ASP n 
2 97  CYS n 
2 98  CYS n 
2 99  PHE n 
2 100 GLY n 
2 101 THR n 
2 102 PHE n 
2 103 ASN n 
2 104 ASP n 
2 105 GLN n 
2 106 LYS n 
2 107 ARG n 
2 108 GLY n 
2 109 ILE n 
2 110 CYS n 
2 111 ARG n 
2 112 PRO n 
2 113 TRP n 
2 114 THR n 
2 115 ASN n 
2 116 CYS n 
2 117 SER n 
2 118 LEU n 
2 119 ASP n 
2 120 GLY n 
2 121 LYS n 
2 122 SER n 
2 123 VAL n 
2 124 LEU n 
2 125 VAL n 
2 126 ASN n 
2 127 GLY n 
2 128 THR n 
2 129 LYS n 
2 130 GLU n 
2 131 ARG n 
2 132 ASP n 
2 133 VAL n 
2 134 VAL n 
2 135 CYS n 
2 136 GLY n 
2 137 PRO n 
2 138 SER n 
2 139 PRO n 
2 140 ALA n 
2 141 ASP n 
2 142 LEU n 
2 143 SER n 
2 144 PRO n 
2 145 GLY n 
2 146 ALA n 
2 147 SER n 
2 148 SER n 
2 149 VAL n 
2 150 THR n 
2 151 PRO n 
2 152 PRO n 
2 153 ALA n 
2 154 PRO n 
2 155 ALA n 
2 156 ARG n 
2 157 GLU n 
2 158 HIS n 
2 159 HIS n 
2 160 HIS n 
2 161 HIS n 
2 162 HIS n 
2 163 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 203 Human ? TNFSF9                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Baculovirus transfer vector pFASTBAC1' 136645 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 163 Human ? 'TNFRSF9, CD137, ILA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Baculovirus transfer vector pFASTBAC1' 136645 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TNFL9_HUMAN P41273 ? 1 
;ARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAK
AGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLH
TEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
;
58 
2 UNP TNR9_HUMAN  Q07011 ? 2 
;LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCE
QDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
;
24 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6A3V A 1 ? 197 ? P41273 58 ? 254 ? 58 254 
2  2 6A3V B 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
3  1 6A3V C 1 ? 197 ? P41273 58 ? 254 ? 58 254 
4  2 6A3V D 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
5  1 6A3V E 1 ? 197 ? P41273 58 ? 254 ? 58 254 
6  2 6A3V F 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
7  1 6A3V G 1 ? 197 ? P41273 58 ? 254 ? 58 254 
8  2 6A3V H 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
9  1 6A3V I 1 ? 197 ? P41273 58 ? 254 ? 58 254 
10 2 6A3V J 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
11 1 6A3V K 1 ? 197 ? P41273 58 ? 254 ? 58 254 
12 2 6A3V L 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
13 1 6A3V M 1 ? 197 ? P41273 58 ? 254 ? 58 254 
14 2 6A3V N 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
15 1 6A3V O 1 ? 197 ? P41273 58 ? 254 ? 58 254 
16 2 6A3V P 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
17 1 6A3V Q 1 ? 197 ? P41273 58 ? 254 ? 58 254 
18 2 6A3V R 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
19 1 6A3V S 1 ? 197 ? P41273 58 ? 254 ? 58 254 
20 2 6A3V T 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
21 1 6A3V U 1 ? 197 ? P41273 58 ? 254 ? 58 254 
22 2 6A3V V 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
23 1 6A3V W 1 ? 197 ? P41273 58 ? 254 ? 58 254 
24 2 6A3V X 1 ? 157 ? Q07011 24 ? 180 ? 24 180 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6A3V HIS A 198 ? UNP P41273 ? ? 'expression tag' 255 1   
1  6A3V HIS A 199 ? UNP P41273 ? ? 'expression tag' 256 2   
1  6A3V HIS A 200 ? UNP P41273 ? ? 'expression tag' 257 3   
1  6A3V HIS A 201 ? UNP P41273 ? ? 'expression tag' 258 4   
1  6A3V HIS A 202 ? UNP P41273 ? ? 'expression tag' 259 5   
1  6A3V HIS A 203 ? UNP P41273 ? ? 'expression tag' 260 6   
2  6A3V HIS B 158 ? UNP Q07011 ? ? 'expression tag' 181 7   
2  6A3V HIS B 159 ? UNP Q07011 ? ? 'expression tag' 182 8   
2  6A3V HIS B 160 ? UNP Q07011 ? ? 'expression tag' 183 9   
2  6A3V HIS B 161 ? UNP Q07011 ? ? 'expression tag' 184 10  
2  6A3V HIS B 162 ? UNP Q07011 ? ? 'expression tag' 185 11  
2  6A3V HIS B 163 ? UNP Q07011 ? ? 'expression tag' 186 12  
3  6A3V HIS C 198 ? UNP P41273 ? ? 'expression tag' 255 13  
3  6A3V HIS C 199 ? UNP P41273 ? ? 'expression tag' 256 14  
3  6A3V HIS C 200 ? UNP P41273 ? ? 'expression tag' 257 15  
3  6A3V HIS C 201 ? UNP P41273 ? ? 'expression tag' 258 16  
3  6A3V HIS C 202 ? UNP P41273 ? ? 'expression tag' 259 17  
3  6A3V HIS C 203 ? UNP P41273 ? ? 'expression tag' 260 18  
4  6A3V HIS D 158 ? UNP Q07011 ? ? 'expression tag' 181 19  
4  6A3V HIS D 159 ? UNP Q07011 ? ? 'expression tag' 182 20  
4  6A3V HIS D 160 ? UNP Q07011 ? ? 'expression tag' 183 21  
4  6A3V HIS D 161 ? UNP Q07011 ? ? 'expression tag' 184 22  
4  6A3V HIS D 162 ? UNP Q07011 ? ? 'expression tag' 185 23  
4  6A3V HIS D 163 ? UNP Q07011 ? ? 'expression tag' 186 24  
5  6A3V HIS E 198 ? UNP P41273 ? ? 'expression tag' 255 25  
5  6A3V HIS E 199 ? UNP P41273 ? ? 'expression tag' 256 26  
5  6A3V HIS E 200 ? UNP P41273 ? ? 'expression tag' 257 27  
5  6A3V HIS E 201 ? UNP P41273 ? ? 'expression tag' 258 28  
5  6A3V HIS E 202 ? UNP P41273 ? ? 'expression tag' 259 29  
5  6A3V HIS E 203 ? UNP P41273 ? ? 'expression tag' 260 30  
6  6A3V HIS F 158 ? UNP Q07011 ? ? 'expression tag' 181 31  
6  6A3V HIS F 159 ? UNP Q07011 ? ? 'expression tag' 182 32  
6  6A3V HIS F 160 ? UNP Q07011 ? ? 'expression tag' 183 33  
6  6A3V HIS F 161 ? UNP Q07011 ? ? 'expression tag' 184 34  
6  6A3V HIS F 162 ? UNP Q07011 ? ? 'expression tag' 185 35  
6  6A3V HIS F 163 ? UNP Q07011 ? ? 'expression tag' 186 36  
7  6A3V HIS G 198 ? UNP P41273 ? ? 'expression tag' 255 37  
7  6A3V HIS G 199 ? UNP P41273 ? ? 'expression tag' 256 38  
7  6A3V HIS G 200 ? UNP P41273 ? ? 'expression tag' 257 39  
7  6A3V HIS G 201 ? UNP P41273 ? ? 'expression tag' 258 40  
7  6A3V HIS G 202 ? UNP P41273 ? ? 'expression tag' 259 41  
7  6A3V HIS G 203 ? UNP P41273 ? ? 'expression tag' 260 42  
8  6A3V HIS H 158 ? UNP Q07011 ? ? 'expression tag' 181 43  
8  6A3V HIS H 159 ? UNP Q07011 ? ? 'expression tag' 182 44  
8  6A3V HIS H 160 ? UNP Q07011 ? ? 'expression tag' 183 45  
8  6A3V HIS H 161 ? UNP Q07011 ? ? 'expression tag' 184 46  
8  6A3V HIS H 162 ? UNP Q07011 ? ? 'expression tag' 185 47  
8  6A3V HIS H 163 ? UNP Q07011 ? ? 'expression tag' 186 48  
9  6A3V HIS I 198 ? UNP P41273 ? ? 'expression tag' 255 49  
9  6A3V HIS I 199 ? UNP P41273 ? ? 'expression tag' 256 50  
9  6A3V HIS I 200 ? UNP P41273 ? ? 'expression tag' 257 51  
9  6A3V HIS I 201 ? UNP P41273 ? ? 'expression tag' 258 52  
9  6A3V HIS I 202 ? UNP P41273 ? ? 'expression tag' 259 53  
9  6A3V HIS I 203 ? UNP P41273 ? ? 'expression tag' 260 54  
10 6A3V HIS J 158 ? UNP Q07011 ? ? 'expression tag' 181 55  
10 6A3V HIS J 159 ? UNP Q07011 ? ? 'expression tag' 182 56  
10 6A3V HIS J 160 ? UNP Q07011 ? ? 'expression tag' 183 57  
10 6A3V HIS J 161 ? UNP Q07011 ? ? 'expression tag' 184 58  
10 6A3V HIS J 162 ? UNP Q07011 ? ? 'expression tag' 185 59  
10 6A3V HIS J 163 ? UNP Q07011 ? ? 'expression tag' 186 60  
11 6A3V HIS K 198 ? UNP P41273 ? ? 'expression tag' 255 61  
11 6A3V HIS K 199 ? UNP P41273 ? ? 'expression tag' 256 62  
11 6A3V HIS K 200 ? UNP P41273 ? ? 'expression tag' 257 63  
11 6A3V HIS K 201 ? UNP P41273 ? ? 'expression tag' 258 64  
11 6A3V HIS K 202 ? UNP P41273 ? ? 'expression tag' 259 65  
11 6A3V HIS K 203 ? UNP P41273 ? ? 'expression tag' 260 66  
12 6A3V HIS L 158 ? UNP Q07011 ? ? 'expression tag' 181 67  
12 6A3V HIS L 159 ? UNP Q07011 ? ? 'expression tag' 182 68  
12 6A3V HIS L 160 ? UNP Q07011 ? ? 'expression tag' 183 69  
12 6A3V HIS L 161 ? UNP Q07011 ? ? 'expression tag' 184 70  
12 6A3V HIS L 162 ? UNP Q07011 ? ? 'expression tag' 185 71  
12 6A3V HIS L 163 ? UNP Q07011 ? ? 'expression tag' 186 72  
13 6A3V HIS M 198 ? UNP P41273 ? ? 'expression tag' 255 73  
13 6A3V HIS M 199 ? UNP P41273 ? ? 'expression tag' 256 74  
13 6A3V HIS M 200 ? UNP P41273 ? ? 'expression tag' 257 75  
13 6A3V HIS M 201 ? UNP P41273 ? ? 'expression tag' 258 76  
13 6A3V HIS M 202 ? UNP P41273 ? ? 'expression tag' 259 77  
13 6A3V HIS M 203 ? UNP P41273 ? ? 'expression tag' 260 78  
14 6A3V HIS N 158 ? UNP Q07011 ? ? 'expression tag' 181 79  
14 6A3V HIS N 159 ? UNP Q07011 ? ? 'expression tag' 182 80  
14 6A3V HIS N 160 ? UNP Q07011 ? ? 'expression tag' 183 81  
14 6A3V HIS N 161 ? UNP Q07011 ? ? 'expression tag' 184 82  
14 6A3V HIS N 162 ? UNP Q07011 ? ? 'expression tag' 185 83  
14 6A3V HIS N 163 ? UNP Q07011 ? ? 'expression tag' 186 84  
15 6A3V HIS O 198 ? UNP P41273 ? ? 'expression tag' 255 85  
15 6A3V HIS O 199 ? UNP P41273 ? ? 'expression tag' 256 86  
15 6A3V HIS O 200 ? UNP P41273 ? ? 'expression tag' 257 87  
15 6A3V HIS O 201 ? UNP P41273 ? ? 'expression tag' 258 88  
15 6A3V HIS O 202 ? UNP P41273 ? ? 'expression tag' 259 89  
15 6A3V HIS O 203 ? UNP P41273 ? ? 'expression tag' 260 90  
16 6A3V HIS P 158 ? UNP Q07011 ? ? 'expression tag' 181 91  
16 6A3V HIS P 159 ? UNP Q07011 ? ? 'expression tag' 182 92  
16 6A3V HIS P 160 ? UNP Q07011 ? ? 'expression tag' 183 93  
16 6A3V HIS P 161 ? UNP Q07011 ? ? 'expression tag' 184 94  
16 6A3V HIS P 162 ? UNP Q07011 ? ? 'expression tag' 185 95  
16 6A3V HIS P 163 ? UNP Q07011 ? ? 'expression tag' 186 96  
17 6A3V HIS Q 198 ? UNP P41273 ? ? 'expression tag' 255 97  
17 6A3V HIS Q 199 ? UNP P41273 ? ? 'expression tag' 256 98  
17 6A3V HIS Q 200 ? UNP P41273 ? ? 'expression tag' 257 99  
17 6A3V HIS Q 201 ? UNP P41273 ? ? 'expression tag' 258 100 
17 6A3V HIS Q 202 ? UNP P41273 ? ? 'expression tag' 259 101 
17 6A3V HIS Q 203 ? UNP P41273 ? ? 'expression tag' 260 102 
18 6A3V HIS R 158 ? UNP Q07011 ? ? 'expression tag' 181 103 
18 6A3V HIS R 159 ? UNP Q07011 ? ? 'expression tag' 182 104 
18 6A3V HIS R 160 ? UNP Q07011 ? ? 'expression tag' 183 105 
18 6A3V HIS R 161 ? UNP Q07011 ? ? 'expression tag' 184 106 
18 6A3V HIS R 162 ? UNP Q07011 ? ? 'expression tag' 185 107 
18 6A3V HIS R 163 ? UNP Q07011 ? ? 'expression tag' 186 108 
19 6A3V HIS S 198 ? UNP P41273 ? ? 'expression tag' 255 109 
19 6A3V HIS S 199 ? UNP P41273 ? ? 'expression tag' 256 110 
19 6A3V HIS S 200 ? UNP P41273 ? ? 'expression tag' 257 111 
19 6A3V HIS S 201 ? UNP P41273 ? ? 'expression tag' 258 112 
19 6A3V HIS S 202 ? UNP P41273 ? ? 'expression tag' 259 113 
19 6A3V HIS S 203 ? UNP P41273 ? ? 'expression tag' 260 114 
20 6A3V HIS T 158 ? UNP Q07011 ? ? 'expression tag' 181 115 
20 6A3V HIS T 159 ? UNP Q07011 ? ? 'expression tag' 182 116 
20 6A3V HIS T 160 ? UNP Q07011 ? ? 'expression tag' 183 117 
20 6A3V HIS T 161 ? UNP Q07011 ? ? 'expression tag' 184 118 
20 6A3V HIS T 162 ? UNP Q07011 ? ? 'expression tag' 185 119 
20 6A3V HIS T 163 ? UNP Q07011 ? ? 'expression tag' 186 120 
21 6A3V HIS U 198 ? UNP P41273 ? ? 'expression tag' 255 121 
21 6A3V HIS U 199 ? UNP P41273 ? ? 'expression tag' 256 122 
21 6A3V HIS U 200 ? UNP P41273 ? ? 'expression tag' 257 123 
21 6A3V HIS U 201 ? UNP P41273 ? ? 'expression tag' 258 124 
21 6A3V HIS U 202 ? UNP P41273 ? ? 'expression tag' 259 125 
21 6A3V HIS U 203 ? UNP P41273 ? ? 'expression tag' 260 126 
22 6A3V HIS V 158 ? UNP Q07011 ? ? 'expression tag' 181 127 
22 6A3V HIS V 159 ? UNP Q07011 ? ? 'expression tag' 182 128 
22 6A3V HIS V 160 ? UNP Q07011 ? ? 'expression tag' 183 129 
22 6A3V HIS V 161 ? UNP Q07011 ? ? 'expression tag' 184 130 
22 6A3V HIS V 162 ? UNP Q07011 ? ? 'expression tag' 185 131 
22 6A3V HIS V 163 ? UNP Q07011 ? ? 'expression tag' 186 132 
23 6A3V HIS W 198 ? UNP P41273 ? ? 'expression tag' 255 133 
23 6A3V HIS W 199 ? UNP P41273 ? ? 'expression tag' 256 134 
23 6A3V HIS W 200 ? UNP P41273 ? ? 'expression tag' 257 135 
23 6A3V HIS W 201 ? UNP P41273 ? ? 'expression tag' 258 136 
23 6A3V HIS W 202 ? UNP P41273 ? ? 'expression tag' 259 137 
23 6A3V HIS W 203 ? UNP P41273 ? ? 'expression tag' 260 138 
24 6A3V HIS X 158 ? UNP Q07011 ? ? 'expression tag' 181 139 
24 6A3V HIS X 159 ? UNP Q07011 ? ? 'expression tag' 182 140 
24 6A3V HIS X 160 ? UNP Q07011 ? ? 'expression tag' 183 141 
24 6A3V HIS X 161 ? UNP Q07011 ? ? 'expression tag' 184 142 
24 6A3V HIS X 162 ? UNP Q07011 ? ? 'expression tag' 185 143 
24 6A3V HIS X 163 ? UNP Q07011 ? ? 'expression tag' 186 144 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6A3V 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.41 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.86 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M sodium iodide, 0.1M Bis Tris propane, pH 7.5, 20% w/v PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-02-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9789 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9789 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6A3V 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.391 
_reflns.d_resolution_low                 44.666 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60878 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.82 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.121 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.40 
_reflns_shell.d_res_low                   3.52 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6A3V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     60878 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.666 
_refine.ls_d_res_high                            3.391 
_refine.ls_percent_reflns_obs                    98.82 
_refine.ls_R_factor_obs                          0.2650 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2635 
_refine.ls_R_factor_R_free                       0.2930 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_number_reflns_R_free                  3099 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      5L36 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.46 
_refine.pdbx_overall_phase_error                 30.36 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        24905 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         168 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               25073 
_refine_hist.d_res_high                       3.391 
_refine_hist.d_res_low                        44.666 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 25647 'X-RAY DIFFRACTION' ? 
f_angle_d          0.691  ? ? 34726 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 21.688 ? ? 9605  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 3856  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 4541  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.3914 3.4443  2389 0.3423 90.00  0.3529 . . 125 . . . . 
'X-RAY DIFFRACTION' . 3.4443 3.5008  2624 0.3386 100.00 0.3725 . . 160 . . . . 
'X-RAY DIFFRACTION' . 3.5008 3.5611  2636 0.3244 100.00 0.3649 . . 155 . . . . 
'X-RAY DIFFRACTION' . 3.5611 3.6259  2647 0.3204 100.00 0.3673 . . 129 . . . . 
'X-RAY DIFFRACTION' . 3.6259 3.6956  2626 0.2964 100.00 0.2959 . . 135 . . . . 
'X-RAY DIFFRACTION' . 3.6956 3.7710  2644 0.2803 100.00 0.3074 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.7710 3.8529  2635 0.2805 100.00 0.3177 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.8529 3.9425  2656 0.2863 100.00 0.3023 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.9425 4.0410  2605 0.2789 99.00  0.3116 . . 152 . . . . 
'X-RAY DIFFRACTION' . 4.0410 4.1502  2640 0.2573 100.00 0.3360 . . 130 . . . . 
'X-RAY DIFFRACTION' . 4.1502 4.2722  2628 0.2463 99.00  0.2552 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.2722 4.4100  2641 0.2233 99.00  0.2384 . . 148 . . . . 
'X-RAY DIFFRACTION' . 4.4100 4.5675  2670 0.2329 99.00  0.2508 . . 114 . . . . 
'X-RAY DIFFRACTION' . 4.5675 4.7502  2606 0.2159 100.00 0.2308 . . 148 . . . . 
'X-RAY DIFFRACTION' . 4.7502 4.9661  2676 0.2272 100.00 0.2527 . . 125 . . . . 
'X-RAY DIFFRACTION' . 4.9661 5.2275  2642 0.2402 100.00 0.2831 . . 150 . . . . 
'X-RAY DIFFRACTION' . 5.2275 5.5545  2616 0.2628 99.00  0.2537 . . 144 . . . . 
'X-RAY DIFFRACTION' . 5.5545 5.9824  2694 0.2628 99.00  0.3033 . . 135 . . . . 
'X-RAY DIFFRACTION' . 5.9824 6.5828  2603 0.2873 98.00  0.3197 . . 129 . . . . 
'X-RAY DIFFRACTION' . 6.5828 7.5314  2600 0.2746 98.00  0.3257 . . 171 . . . . 
'X-RAY DIFFRACTION' . 7.5314 9.4738  2642 0.2471 99.00  0.2784 . . 145 . . . . 
'X-RAY DIFFRACTION' . 9.4738 44.6694 2659 0.2434 97.00  0.2791 . . 136 . . . . 
# 
_struct.entry_id                     6A3V 
_struct.title                        'Complex structure of human 4-1BB and 4-1BBL' 
_struct.pdbx_descriptor              
'Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor receptor superfamily member 9' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6A3V 
_struct_keywords.text            'complex structure, agonist monoclonal antibody, cross-linking, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 1 ? 
J  N N 2 ? 
K  N N 1 ? 
L  N N 2 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 1 ? 
P  N N 2 ? 
Q  N N 1 ? 
R  N N 2 ? 
S  N N 1 ? 
T  N N 2 ? 
U  N N 1 ? 
V  N N 2 ? 
W  N N 1 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO B 4   ? CYS B 8   ? PRO B 27  CYS B 31  5 ? 5 
HELX_P HELX_P2 AA2 ASN B 17  ? GLN B 20  ? ASN B 40  GLN B 43  5 ? 4 
HELX_P HELX_P3 AA3 PRO D 4   ? CYS D 8   ? PRO D 27  CYS D 31  5 ? 5 
HELX_P HELX_P4 AA4 ASN D 17  ? GLN D 20  ? ASN D 40  GLN D 43  5 ? 4 
HELX_P HELX_P5 AA5 ASN F 115 ? GLY F 120 ? ASN F 138 GLY F 143 1 ? 6 
HELX_P HELX_P6 AA6 ASN N 115 ? GLY N 120 ? ASN N 138 GLY N 143 1 ? 6 
HELX_P HELX_P7 AA7 ASN P 115 ? GLY P 120 ? ASN P 138 GLY P 143 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?   ? B CYS 5   SG  ? ? ? 1_555 B  CYS 14  SG ? ? B CYS 28  B CYS 37  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf2   disulf ?   ? B CYS 8   SG  ? ? ? 1_555 B  CYS 22  SG ? ? B CYS 31  B CYS 45  1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf3   disulf ?   ? B CYS 25  SG  ? ? ? 1_555 B  CYS 39  SG ? ? B CYS 48  B CYS 62  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf4   disulf ?   ? B CYS 42  SG  ? ? ? 1_555 B  CYS 55  SG ? ? B CYS 65  B CYS 78  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf5   disulf ?   ? B CYS 45  SG  ? ? ? 1_555 B  CYS 63  SG ? ? B CYS 68  B CYS 86  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf6   disulf ?   ? B CYS 65  SG  ? ? ? 1_555 B  CYS 79  SG ? ? B CYS 88  B CYS 102 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf7   disulf ?   ? B CYS 71  SG  ? ? ? 1_555 B  CYS 76  SG ? ? B CYS 94  B CYS 99  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf8   disulf ?   ? B CYS 83  SG  ? ? ? 1_555 B  CYS 94  SG ? ? B CYS 106 B CYS 117 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf9   disulf ?   ? B CYS 97  SG  ? ? ? 1_555 B  CYS 110 SG ? ? B CYS 120 B CYS 133 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf10  disulf ?   ? B CYS 116 SG  ? ? ? 1_555 B  CYS 135 SG ? ? B CYS 139 B CYS 158 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf11  disulf ?   ? D CYS 5   SG  ? ? ? 1_555 D  CYS 14  SG ? ? D CYS 28  D CYS 37  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf12  disulf ?   ? D CYS 8   SG  ? ? ? 1_555 D  CYS 22  SG ? ? D CYS 31  D CYS 45  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf13  disulf ?   ? D CYS 25  SG  ? ? ? 1_555 D  CYS 39  SG ? ? D CYS 48  D CYS 62  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf14  disulf ?   ? D CYS 42  SG  ? ? ? 1_555 D  CYS 55  SG ? ? D CYS 65  D CYS 78  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf15  disulf ?   ? D CYS 45  SG  ? ? ? 1_555 D  CYS 63  SG ? ? D CYS 68  D CYS 86  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf16  disulf ?   ? D CYS 65  SG  ? ? ? 1_555 D  CYS 79  SG ? ? D CYS 88  D CYS 102 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf17  disulf ?   ? D CYS 71  SG  ? ? ? 1_555 D  CYS 76  SG ? ? D CYS 94  D CYS 99  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf18  disulf ?   ? D CYS 83  SG  ? ? ? 1_555 D  CYS 94  SG ? ? D CYS 106 D CYS 117 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf19  disulf ?   ? D CYS 97  SG  ? ? ? 1_555 D  CYS 110 SG ? ? D CYS 120 D CYS 133 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf20  disulf ?   ? D CYS 116 SG  ? ? ? 1_555 D  CYS 135 SG ? ? D CYS 139 D CYS 158 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf21  disulf ?   ? F CYS 5   SG  ? ? ? 1_555 F  CYS 14  SG ? ? F CYS 28  F CYS 37  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf22  disulf ?   ? F CYS 8   SG  ? ? ? 1_555 F  CYS 22  SG ? ? F CYS 31  F CYS 45  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf23  disulf ?   ? F CYS 25  SG  ? ? ? 1_555 F  CYS 39  SG ? ? F CYS 48  F CYS 62  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf24  disulf ?   ? F CYS 42  SG  ? ? ? 1_555 F  CYS 55  SG ? ? F CYS 65  F CYS 78  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf25  disulf ?   ? F CYS 45  SG  ? ? ? 1_555 F  CYS 63  SG ? ? F CYS 68  F CYS 86  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf26  disulf ?   ? F CYS 65  SG  ? ? ? 1_555 F  CYS 79  SG ? ? F CYS 88  F CYS 102 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf27  disulf ?   ? F CYS 71  SG  ? ? ? 1_555 F  CYS 76  SG ? ? F CYS 94  F CYS 99  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf28  disulf ?   ? F CYS 83  SG  ? ? ? 1_555 F  CYS 94  SG ? ? F CYS 106 F CYS 117 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf29  disulf ?   ? F CYS 97  SG  ? ? ? 1_555 F  CYS 110 SG ? ? F CYS 120 F CYS 133 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf30  disulf ?   ? F CYS 116 SG  ? ? ? 1_555 F  CYS 135 SG ? ? F CYS 139 F CYS 158 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf31  disulf ?   ? H CYS 5   SG  ? ? ? 1_555 H  CYS 14  SG ? ? H CYS 28  H CYS 37  1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf32  disulf ?   ? H CYS 8   SG  ? ? ? 1_555 H  CYS 22  SG ? ? H CYS 31  H CYS 45  1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf33  disulf ?   ? H CYS 25  SG  ? ? ? 1_555 H  CYS 39  SG ? ? H CYS 48  H CYS 62  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf34  disulf ?   ? H CYS 42  SG  ? ? ? 1_555 H  CYS 55  SG ? ? H CYS 65  H CYS 78  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf35  disulf ?   ? H CYS 45  SG  ? ? ? 1_555 H  CYS 63  SG ? ? H CYS 68  H CYS 86  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf36  disulf ?   ? H CYS 65  SG  ? ? ? 1_555 H  CYS 79  SG ? ? H CYS 88  H CYS 102 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf37  disulf ?   ? H CYS 71  SG  ? ? ? 1_555 H  CYS 76  SG ? ? H CYS 94  H CYS 99  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf38  disulf ?   ? H CYS 83  SG  ? ? ? 1_555 H  CYS 94  SG ? ? H CYS 106 H CYS 117 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf39  disulf ?   ? H CYS 97  SG  ? ? ? 1_555 H  CYS 110 SG ? ? H CYS 120 H CYS 133 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf40  disulf ?   ? H CYS 116 SG  ? ? ? 1_555 H  CYS 135 SG ? ? H CYS 139 H CYS 158 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf41  disulf ?   ? J CYS 25  SG  ? ? ? 1_555 J  CYS 39  SG ? ? J CYS 48  J CYS 62  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf42  disulf ?   ? J CYS 42  SG  ? ? ? 1_555 J  CYS 55  SG ? ? J CYS 65  J CYS 78  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf43  disulf ?   ? J CYS 45  SG  ? ? ? 1_555 J  CYS 63  SG ? ? J CYS 68  J CYS 86  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf44  disulf ?   ? J CYS 65  SG  ? ? ? 1_555 J  CYS 79  SG ? ? J CYS 88  J CYS 102 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf45  disulf ?   ? J CYS 71  SG  ? ? ? 1_555 J  CYS 76  SG ? ? J CYS 94  J CYS 99  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf46  disulf ?   ? J CYS 83  SG  ? ? ? 1_555 J  CYS 94  SG ? ? J CYS 106 J CYS 117 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf47  disulf ?   ? J CYS 97  SG  ? ? ? 1_555 J  CYS 110 SG ? ? J CYS 120 J CYS 133 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf48  disulf ?   ? J CYS 116 SG  ? ? ? 1_555 J  CYS 135 SG ? ? J CYS 139 J CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf49  disulf ?   ? L CYS 5   SG  ? ? ? 1_555 L  CYS 14  SG ? ? L CYS 28  L CYS 37  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf50  disulf ?   ? L CYS 8   SG  ? ? ? 1_555 L  CYS 22  SG ? ? L CYS 31  L CYS 45  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf51  disulf ?   ? L CYS 25  SG  ? ? ? 1_555 L  CYS 39  SG ? ? L CYS 48  L CYS 62  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf52  disulf ?   ? L CYS 42  SG  ? ? ? 1_555 L  CYS 55  SG ? ? L CYS 65  L CYS 78  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf53  disulf ?   ? L CYS 45  SG  ? ? ? 1_555 L  CYS 63  SG ? ? L CYS 68  L CYS 86  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf54  disulf ?   ? L CYS 65  SG  ? ? ? 1_555 L  CYS 79  SG ? ? L CYS 88  L CYS 102 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf55  disulf ?   ? L CYS 71  SG  ? ? ? 1_555 L  CYS 76  SG ? ? L CYS 94  L CYS 99  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf56  disulf ?   ? L CYS 83  SG  ? ? ? 1_555 L  CYS 94  SG ? ? L CYS 106 L CYS 117 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf57  disulf ?   ? L CYS 97  SG  ? ? ? 1_555 L  CYS 110 SG ? ? L CYS 120 L CYS 133 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf58  disulf ?   ? L CYS 116 SG  ? ? ? 1_555 L  CYS 135 SG ? ? L CYS 139 L CYS 158 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf59  disulf ?   ? N CYS 5   SG  ? ? ? 1_555 N  CYS 14  SG ? ? N CYS 28  N CYS 37  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf60  disulf ?   ? N CYS 8   SG  ? ? ? 1_555 N  CYS 22  SG ? ? N CYS 31  N CYS 45  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf61  disulf ?   ? N CYS 25  SG  ? ? ? 1_555 N  CYS 39  SG ? ? N CYS 48  N CYS 62  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf62  disulf ?   ? N CYS 42  SG  ? ? ? 1_555 N  CYS 55  SG ? ? N CYS 65  N CYS 78  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf63  disulf ?   ? N CYS 45  SG  ? ? ? 1_555 N  CYS 63  SG ? ? N CYS 68  N CYS 86  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf64  disulf ?   ? N CYS 65  SG  ? ? ? 1_555 N  CYS 79  SG ? ? N CYS 88  N CYS 102 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf65  disulf ?   ? N CYS 71  SG  ? ? ? 1_555 N  CYS 76  SG ? ? N CYS 94  N CYS 99  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf66  disulf ?   ? N CYS 83  SG  ? ? ? 1_555 N  CYS 94  SG ? ? N CYS 106 N CYS 117 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf67  disulf ?   ? N CYS 97  SG  ? ? ? 1_555 N  CYS 110 SG ? ? N CYS 120 N CYS 133 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf68  disulf ?   ? N CYS 116 SG  ? ? ? 1_555 N  CYS 135 SG ? ? N CYS 139 N CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf69  disulf ?   ? P CYS 5   SG  ? ? ? 1_555 P  CYS 14  SG ? ? P CYS 28  P CYS 37  1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf70  disulf ?   ? P CYS 8   SG  ? ? ? 1_555 P  CYS 22  SG ? ? P CYS 31  P CYS 45  1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf71  disulf ?   ? P CYS 25  SG  ? ? ? 1_555 P  CYS 39  SG ? ? P CYS 48  P CYS 62  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf72  disulf ?   ? P CYS 42  SG  ? ? ? 1_555 P  CYS 55  SG ? ? P CYS 65  P CYS 78  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf73  disulf ?   ? P CYS 45  SG  ? ? ? 1_555 P  CYS 63  SG ? ? P CYS 68  P CYS 86  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf74  disulf ?   ? P CYS 65  SG  ? ? ? 1_555 P  CYS 79  SG ? ? P CYS 88  P CYS 102 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf75  disulf ?   ? P CYS 71  SG  ? ? ? 1_555 P  CYS 76  SG ? ? P CYS 94  P CYS 99  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf76  disulf ?   ? P CYS 83  SG  ? ? ? 1_555 P  CYS 94  SG ? ? P CYS 106 P CYS 117 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf77  disulf ?   ? P CYS 97  SG  ? ? ? 1_555 P  CYS 110 SG ? ? P CYS 120 P CYS 133 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf78  disulf ?   ? P CYS 116 SG  ? ? ? 1_555 P  CYS 135 SG ? ? P CYS 139 P CYS 158 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf79  disulf ?   ? R CYS 5   SG  ? ? ? 1_555 R  CYS 14  SG ? ? R CYS 28  R CYS 37  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf80  disulf ?   ? R CYS 8   SG  ? ? ? 1_555 R  CYS 22  SG ? ? R CYS 31  R CYS 45  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf81  disulf ?   ? R CYS 25  SG  ? ? ? 1_555 R  CYS 39  SG ? ? R CYS 48  R CYS 62  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf82  disulf ?   ? R CYS 42  SG  ? ? ? 1_555 R  CYS 55  SG ? ? R CYS 65  R CYS 78  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf83  disulf ?   ? R CYS 45  SG  ? ? ? 1_555 R  CYS 63  SG ? ? R CYS 68  R CYS 86  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf84  disulf ?   ? R CYS 65  SG  ? ? ? 1_555 R  CYS 79  SG ? ? R CYS 88  R CYS 102 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf85  disulf ?   ? R CYS 71  SG  ? ? ? 1_555 R  CYS 76  SG ? ? R CYS 94  R CYS 99  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf86  disulf ?   ? R CYS 83  SG  ? ? ? 1_555 R  CYS 94  SG ? ? R CYS 106 R CYS 117 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf87  disulf ?   ? R CYS 97  SG  ? ? ? 1_555 R  CYS 110 SG ? ? R CYS 120 R CYS 133 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf88  disulf ?   ? R CYS 116 SG  ? ? ? 1_555 R  CYS 135 SG ? ? R CYS 139 R CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf89  disulf ?   ? T CYS 5   SG  ? ? ? 1_555 T  CYS 14  SG ? ? T CYS 28  T CYS 37  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf90  disulf ?   ? T CYS 8   SG  ? ? ? 1_555 T  CYS 22  SG ? ? T CYS 31  T CYS 45  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf91  disulf ?   ? T CYS 25  SG  ? ? ? 1_555 T  CYS 39  SG ? ? T CYS 48  T CYS 62  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf92  disulf ?   ? T CYS 42  SG  ? ? ? 1_555 T  CYS 55  SG ? ? T CYS 65  T CYS 78  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf93  disulf ?   ? T CYS 45  SG  ? ? ? 1_555 T  CYS 63  SG ? ? T CYS 68  T CYS 86  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf94  disulf ?   ? T CYS 65  SG  ? ? ? 1_555 T  CYS 79  SG ? ? T CYS 88  T CYS 102 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf95  disulf ?   ? T CYS 71  SG  ? ? ? 1_555 T  CYS 76  SG ? ? T CYS 94  T CYS 99  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf96  disulf ?   ? T CYS 83  SG  ? ? ? 1_555 T  CYS 94  SG ? ? T CYS 106 T CYS 117 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf97  disulf ?   ? T CYS 97  SG  ? ? ? 1_555 T  CYS 110 SG ? ? T CYS 120 T CYS 133 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf98  disulf ?   ? T CYS 116 SG  ? ? ? 1_555 T  CYS 135 SG ? ? T CYS 139 T CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf99  disulf ?   ? V CYS 25  SG  ? ? ? 1_555 V  CYS 39  SG ? ? V CYS 48  V CYS 62  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf100 disulf ?   ? V CYS 42  SG  ? ? ? 1_555 V  CYS 55  SG ? ? V CYS 65  V CYS 78  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf101 disulf ?   ? V CYS 45  SG  ? ? ? 1_555 V  CYS 63  SG ? ? V CYS 68  V CYS 86  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf102 disulf ?   ? V CYS 65  SG  ? ? ? 1_555 V  CYS 79  SG ? ? V CYS 88  V CYS 102 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf103 disulf ?   ? V CYS 71  SG  ? ? ? 1_555 V  CYS 76  SG ? ? V CYS 94  V CYS 99  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf104 disulf ?   ? V CYS 83  SG  ? ? ? 1_555 V  CYS 94  SG ? ? V CYS 106 V CYS 117 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf105 disulf ?   ? V CYS 97  SG  ? ? ? 1_555 V  CYS 110 SG ? ? V CYS 120 V CYS 133 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf106 disulf ?   ? V CYS 116 SG  ? ? ? 1_555 V  CYS 135 SG ? ? V CYS 139 V CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf107 disulf ?   ? X CYS 5   SG  ? ? ? 1_555 X  CYS 14  SG ? ? X CYS 28  X CYS 37  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf108 disulf ?   ? X CYS 8   SG  ? ? ? 1_555 X  CYS 22  SG ? ? X CYS 31  X CYS 45  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf109 disulf ?   ? X CYS 25  SG  ? ? ? 1_555 X  CYS 39  SG ? ? X CYS 48  X CYS 62  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf110 disulf ?   ? X CYS 42  SG  ? ? ? 1_555 X  CYS 55  SG ? ? X CYS 65  X CYS 78  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf111 disulf ?   ? X CYS 45  SG  ? ? ? 1_555 X  CYS 63  SG ? ? X CYS 68  X CYS 86  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf112 disulf ?   ? X CYS 65  SG  ? ? ? 1_555 X  CYS 79  SG ? ? X CYS 88  X CYS 102 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf113 disulf ?   ? X CYS 71  SG  ? ? ? 1_555 X  CYS 76  SG ? ? X CYS 94  X CYS 99  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf114 disulf ?   ? X CYS 83  SG  ? ? ? 1_555 X  CYS 94  SG ? ? X CYS 106 X CYS 117 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf115 disulf ?   ? X CYS 97  SG  ? ? ? 1_555 X  CYS 110 SG ? ? X CYS 120 X CYS 133 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf116 disulf ?   ? X CYS 116 SG  ? ? ? 1_555 X  CYS 135 SG ? ? X CYS 139 X CYS 158 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1   covale one ? B ASN 126 ND2 ? ? ? 1_555 Y  NAG .   C1 ? ? B ASN 149 B NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale2   covale one ? D ASN 126 ND2 ? ? ? 1_555 Z  NAG .   C1 ? ? D ASN 149 D NAG 301 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale3   covale one ? F ASN 126 ND2 ? ? ? 1_555 AA NAG .   C1 ? ? F ASN 149 F NAG 301 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale4   covale one ? H ASN 126 ND2 ? ? ? 1_555 BA NAG .   C1 ? ? H ASN 149 H NAG 301 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale5   covale one ? J ASN 126 ND2 ? ? ? 1_555 CA NAG .   C1 ? ? J ASN 149 J NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale6   covale one ? L ASN 126 ND2 ? ? ? 1_555 DA NAG .   C1 ? ? L ASN 149 L NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale7   covale one ? N ASN 126 ND2 ? ? ? 1_555 EA NAG .   C1 ? ? N ASN 149 N NAG 301 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale8   covale one ? P ASN 126 ND2 ? ? ? 1_555 FA NAG .   C1 ? ? P ASN 149 P NAG 301 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale9   covale one ? R ASN 126 ND2 ? ? ? 1_555 GA NAG .   C1 ? ? R ASN 149 R NAG 301 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale10  covale one ? T ASN 126 ND2 ? ? ? 1_555 HA NAG .   C1 ? ? T ASN 149 T NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale11  covale one ? V ASN 126 ND2 ? ? ? 1_555 IA NAG .   C1 ? ? V ASN 149 V NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale12  covale one ? X ASN 126 ND2 ? ? ? 1_555 JA NAG .   C1 ? ? X ASN 149 X NAG 301 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
AB3 ? 5 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 5 ? 
AC4 ? 5 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 5 ? 
AD4 ? 5 ? 
AD5 ? 4 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 5 ? 
AE5 ? 5 ? 
AE6 ? 4 ? 
AE7 ? 4 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 5 ? 
AF6 ? 5 ? 
AF7 ? 4 ? 
AF8 ? 4 ? 
AF9 ? 2 ? 
AG1 ? 2 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 5 ? 
AG5 ? 5 ? 
AG6 ? 4 ? 
AG7 ? 4 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 2 ? 
AH2 ? 2 ? 
AH3 ? 2 ? 
AH4 ? 5 ? 
AH5 ? 5 ? 
AH6 ? 4 ? 
AH7 ? 4 ? 
AH8 ? 2 ? 
AH9 ? 2 ? 
AI1 ? 2 ? 
AI2 ? 2 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
AI5 ? 5 ? 
AI6 ? 5 ? 
AI7 ? 4 ? 
AI8 ? 4 ? 
AI9 ? 2 ? 
AJ1 ? 2 ? 
AJ2 ? 2 ? 
AJ3 ? 5 ? 
AJ4 ? 5 ? 
AJ5 ? 4 ? 
AJ6 ? 4 ? 
AJ7 ? 2 ? 
AJ8 ? 2 ? 
AJ9 ? 2 ? 
AK1 ? 2 ? 
AK2 ? 5 ? 
AK3 ? 5 ? 
AK4 ? 4 ? 
AK5 ? 4 ? 
AK6 ? 2 ? 
AK7 ? 2 ? 
AK8 ? 2 ? 
AK9 ? 2 ? 
AL1 ? 2 ? 
AL2 ? 5 ? 
AL3 ? 5 ? 
AL4 ? 4 ? 
AL5 ? 4 ? 
AL6 ? 2 ? 
AL7 ? 2 ? 
AL8 ? 2 ? 
AL9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE4 4 5 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF5 4 5 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF6 4 5 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG4 3 4 ? anti-parallel 
AG4 4 5 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG5 4 5 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG7 3 4 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? anti-parallel 
AH4 3 4 ? anti-parallel 
AH4 4 5 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH6 2 3 ? anti-parallel 
AH6 3 4 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH7 3 4 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI6 4 5 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI7 3 4 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI8 2 3 ? anti-parallel 
AI8 3 4 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ3 2 3 ? anti-parallel 
AJ3 3 4 ? anti-parallel 
AJ3 4 5 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ4 3 4 ? anti-parallel 
AJ4 4 5 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ5 2 3 ? anti-parallel 
AJ5 3 4 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK2 4 5 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK3 3 4 ? anti-parallel 
AK3 4 5 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK5 2 3 ? anti-parallel 
AK5 3 4 ? anti-parallel 
AK6 1 2 ? anti-parallel 
AK7 1 2 ? anti-parallel 
AK8 1 2 ? anti-parallel 
AK9 1 2 ? anti-parallel 
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL2 2 3 ? anti-parallel 
AL2 3 4 ? anti-parallel 
AL2 4 5 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL3 2 3 ? anti-parallel 
AL3 3 4 ? anti-parallel 
AL3 4 5 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL4 3 4 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL5 3 4 ? anti-parallel 
AL6 1 2 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL8 1 2 ? anti-parallel 
AL9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TRP A 52  ? TYR A 53  ? TRP A 109 TYR A 110 
AA1 2 PHE A 35  ? ALA A 40  ? PHE A 92  ALA A 97  
AA1 3 VAL A 177 ? ARG A 182 ? VAL A 234 ARG A 239 
AA1 4 GLY A 82  ? ARG A 94  ? GLY A 139 ARG A 151 
AA1 5 SER A 138 ? LEU A 149 ? SER A 195 LEU A 206 
AA2 1 SER A 62  ? LEU A 63  ? SER A 119 LEU A 120 
AA2 2 PHE A 35  ? ALA A 40  ? PHE A 92  ALA A 97  
AA2 3 VAL A 177 ? ARG A 182 ? VAL A 234 ARG A 239 
AA2 4 GLY A 82  ? ARG A 94  ? GLY A 139 ARG A 151 
AA2 5 TRP A 169 ? LEU A 171 ? TRP A 226 LEU A 228 
AA3 1 GLY A 48  ? PRO A 49  ? GLY A 105 PRO A 106 
AA3 2 GLN A 153 ? ALA A 163 ? GLN A 210 ALA A 220 
AA3 3 GLU A 75  ? VAL A 78  ? GLU A 132 VAL A 135 
AA3 4 LEU A 67  ? LYS A 70  ? LEU A 124 LYS A 127 
AA4 1 GLY A 48  ? PRO A 49  ? GLY A 105 PRO A 106 
AA4 2 GLN A 153 ? ALA A 163 ? GLN A 210 ALA A 220 
AA4 3 GLY A 102 ? LEU A 110 ? GLY A 159 LEU A 167 
AA4 4 LEU A 122 ? LEU A 128 ? LEU A 179 LEU A 185 
AA5 1 THR B 12  ? CYS B 14  ? THR B 35  CYS B 37  
AA5 2 CYS B 22  ? PRO B 24  ? CYS B 45  PRO B 47  
AA6 1 PHE B 49  ? LYS B 53  ? PHE B 72  LYS B 76  
AA6 2 GLU B 62  ? CYS B 65  ? GLU B 85  CYS B 88  
AA7 1 PHE B 69  ? LEU B 72  ? PHE B 92  LEU B 95  
AA7 2 MET B 78  ? GLN B 81  ? MET B 101 GLN B 104 
AA8 1 GLU B 88  ? LEU B 89  ? GLU B 111 LEU B 112 
AA8 2 CYS B 94  ? LYS B 95  ? CYS B 117 LYS B 118 
AA9 1 THR B 101 ? PHE B 102 ? THR B 124 PHE B 125 
AA9 2 ARG B 111 ? PRO B 112 ? ARG B 134 PRO B 135 
AB1 1 SER B 122 ? VAL B 125 ? SER B 145 VAL B 148 
AB1 2 VAL B 134 ? GLY B 136 ? VAL B 157 GLY B 159 
AB2 1 TRP C 52  ? TYR C 53  ? TRP C 109 TYR C 110 
AB2 2 PHE C 35  ? ALA C 40  ? PHE C 92  ALA C 97  
AB2 3 VAL C 177 ? ARG C 182 ? VAL C 234 ARG C 239 
AB2 4 GLY C 82  ? ARG C 94  ? GLY C 139 ARG C 151 
AB2 5 PHE C 140 ? LEU C 149 ? PHE C 197 LEU C 206 
AB3 1 TRP C 52  ? TYR C 53  ? TRP C 109 TYR C 110 
AB3 2 PHE C 35  ? ALA C 40  ? PHE C 92  ALA C 97  
AB3 3 VAL C 177 ? ARG C 182 ? VAL C 234 ARG C 239 
AB3 4 GLY C 82  ? ARG C 94  ? GLY C 139 ARG C 151 
AB3 5 TRP C 169 ? LEU C 171 ? TRP C 226 LEU C 228 
AB4 1 GLY C 48  ? PRO C 49  ? GLY C 105 PRO C 106 
AB4 2 GLN C 153 ? ALA C 163 ? GLN C 210 ALA C 220 
AB4 3 GLU C 75  ? VAL C 78  ? GLU C 132 VAL C 135 
AB4 4 LEU C 67  ? LYS C 70  ? LEU C 124 LYS C 127 
AB5 1 GLY C 48  ? PRO C 49  ? GLY C 105 PRO C 106 
AB5 2 GLN C 153 ? ALA C 163 ? GLN C 210 ALA C 220 
AB5 3 GLY C 102 ? LEU C 110 ? GLY C 159 LEU C 167 
AB5 4 LEU C 122 ? LEU C 128 ? LEU C 179 LEU C 185 
AB6 1 THR D 12  ? CYS D 14  ? THR D 35  CYS D 37  
AB6 2 CYS D 22  ? PRO D 24  ? CYS D 45  PRO D 47  
AB7 1 PHE D 49  ? LYS D 53  ? PHE D 72  LYS D 76  
AB7 2 GLU D 62  ? CYS D 65  ? GLU D 85  CYS D 88  
AB8 1 PHE D 69  ? LEU D 72  ? PHE D 92  LEU D 95  
AB8 2 MET D 78  ? GLN D 81  ? MET D 101 GLN D 104 
AB9 1 GLU D 88  ? LEU D 89  ? GLU D 111 LEU D 112 
AB9 2 CYS D 94  ? LYS D 95  ? CYS D 117 LYS D 118 
AC1 1 THR D 101 ? PHE D 102 ? THR D 124 PHE D 125 
AC1 2 ARG D 111 ? PRO D 112 ? ARG D 134 PRO D 135 
AC2 1 SER D 122 ? VAL D 125 ? SER D 145 VAL D 148 
AC2 2 VAL D 134 ? GLY D 136 ? VAL D 157 GLY D 159 
AC3 1 TRP E 52  ? TYR E 53  ? TRP E 109 TYR E 110 
AC3 2 PHE E 35  ? ALA E 40  ? PHE E 92  ALA E 97  
AC3 3 VAL E 177 ? ARG E 182 ? VAL E 234 ARG E 239 
AC3 4 GLY E 82  ? ARG E 94  ? GLY E 139 ARG E 151 
AC3 5 SER E 138 ? LEU E 149 ? SER E 195 LEU E 206 
AC4 1 TRP E 52  ? TYR E 53  ? TRP E 109 TYR E 110 
AC4 2 PHE E 35  ? ALA E 40  ? PHE E 92  ALA E 97  
AC4 3 VAL E 177 ? ARG E 182 ? VAL E 234 ARG E 239 
AC4 4 GLY E 82  ? ARG E 94  ? GLY E 139 ARG E 151 
AC4 5 TRP E 169 ? LEU E 171 ? TRP E 226 LEU E 228 
AC5 1 GLY E 48  ? PRO E 49  ? GLY E 105 PRO E 106 
AC5 2 GLN E 153 ? ARG E 164 ? GLN E 210 ARG E 221 
AC5 3 GLU E 75  ? VAL E 78  ? GLU E 132 VAL E 135 
AC5 4 LEU E 67  ? LYS E 70  ? LEU E 124 LYS E 127 
AC6 1 GLY E 48  ? PRO E 49  ? GLY E 105 PRO E 106 
AC6 2 GLN E 153 ? ARG E 164 ? GLN E 210 ARG E 221 
AC6 3 SER E 101 ? LEU E 110 ? SER E 158 LEU E 167 
AC6 4 LEU E 122 ? LEU E 128 ? LEU E 179 LEU E 185 
AC7 1 THR F 12  ? CYS F 14  ? THR F 35  CYS F 37  
AC7 2 CYS F 22  ? PRO F 24  ? CYS F 45  PRO F 47  
AC8 1 PHE F 49  ? LYS F 53  ? PHE F 72  LYS F 76  
AC8 2 GLU F 62  ? CYS F 65  ? GLU F 85  CYS F 88  
AC9 1 PHE F 69  ? CYS F 71  ? PHE F 92  CYS F 94  
AC9 2 CYS F 79  ? GLN F 81  ? CYS F 102 GLN F 104 
AD1 1 THR F 101 ? PHE F 102 ? THR F 124 PHE F 125 
AD1 2 ARG F 111 ? PRO F 112 ? ARG F 134 PRO F 135 
AD2 1 SER F 122 ? VAL F 125 ? SER F 145 VAL F 148 
AD2 2 VAL F 134 ? GLY F 136 ? VAL F 157 GLY F 159 
AD3 1 TRP G 52  ? TYR G 53  ? TRP G 109 TYR G 110 
AD3 2 PHE G 35  ? ALA G 40  ? PHE G 92  ALA G 97  
AD3 3 VAL G 177 ? ARG G 182 ? VAL G 234 ARG G 239 
AD3 4 GLY G 82  ? ARG G 94  ? GLY G 139 ARG G 151 
AD3 5 SER G 138 ? LEU G 149 ? SER G 195 LEU G 206 
AD4 1 SER G 62  ? LEU G 63  ? SER G 119 LEU G 120 
AD4 2 PHE G 35  ? ALA G 40  ? PHE G 92  ALA G 97  
AD4 3 VAL G 177 ? ARG G 182 ? VAL G 234 ARG G 239 
AD4 4 GLY G 82  ? ARG G 94  ? GLY G 139 ARG G 151 
AD4 5 TRP G 169 ? LEU G 171 ? TRP G 226 LEU G 228 
AD5 1 GLY G 48  ? PRO G 49  ? GLY G 105 PRO G 106 
AD5 2 GLN G 153 ? ALA G 163 ? GLN G 210 ALA G 220 
AD5 3 GLU G 75  ? VAL G 78  ? GLU G 132 VAL G 135 
AD5 4 LEU G 67  ? LYS G 70  ? LEU G 124 LYS G 127 
AD6 1 GLY G 48  ? PRO G 49  ? GLY G 105 PRO G 106 
AD6 2 GLN G 153 ? ALA G 163 ? GLN G 210 ALA G 220 
AD6 3 GLY G 102 ? LEU G 110 ? GLY G 159 LEU G 167 
AD6 4 LEU G 122 ? LEU G 128 ? LEU G 179 LEU G 185 
AD7 1 THR H 12  ? CYS H 14  ? THR H 35  CYS H 37  
AD7 2 CYS H 22  ? PRO H 24  ? CYS H 45  PRO H 47  
AD8 1 PHE H 49  ? LYS H 53  ? PHE H 72  LYS H 76  
AD8 2 GLU H 62  ? CYS H 65  ? GLU H 85  CYS H 88  
AD9 1 PHE H 69  ? LEU H 72  ? PHE H 92  LEU H 95  
AD9 2 MET H 78  ? GLN H 81  ? MET H 101 GLN H 104 
AE1 1 GLU H 88  ? LEU H 89  ? GLU H 111 LEU H 112 
AE1 2 CYS H 94  ? LYS H 95  ? CYS H 117 LYS H 118 
AE2 1 THR H 101 ? PHE H 102 ? THR H 124 PHE H 125 
AE2 2 ARG H 111 ? PRO H 112 ? ARG H 134 PRO H 135 
AE3 1 VAL H 123 ? VAL H 125 ? VAL H 146 VAL H 148 
AE3 2 VAL H 134 ? CYS H 135 ? VAL H 157 CYS H 158 
AE4 1 TRP I 52  ? TYR I 53  ? TRP I 109 TYR I 110 
AE4 2 PHE I 35  ? ALA I 40  ? PHE I 92  ALA I 97  
AE4 3 VAL I 177 ? ARG I 182 ? VAL I 234 ARG I 239 
AE4 4 GLY I 82  ? ARG I 94  ? GLY I 139 ARG I 151 
AE4 5 SER I 138 ? LEU I 149 ? SER I 195 LEU I 206 
AE5 1 SER I 62  ? LEU I 63  ? SER I 119 LEU I 120 
AE5 2 PHE I 35  ? ALA I 40  ? PHE I 92  ALA I 97  
AE5 3 VAL I 177 ? ARG I 182 ? VAL I 234 ARG I 239 
AE5 4 GLY I 82  ? ARG I 94  ? GLY I 139 ARG I 151 
AE5 5 TRP I 169 ? LEU I 171 ? TRP I 226 LEU I 228 
AE6 1 GLY I 48  ? PRO I 49  ? GLY I 105 PRO I 106 
AE6 2 GLN I 153 ? ALA I 163 ? GLN I 210 ALA I 220 
AE6 3 GLU I 75  ? VAL I 78  ? GLU I 132 VAL I 135 
AE6 4 LEU I 67  ? LYS I 70  ? LEU I 124 LYS I 127 
AE7 1 GLY I 48  ? PRO I 49  ? GLY I 105 PRO I 106 
AE7 2 GLN I 153 ? ALA I 163 ? GLN I 210 ALA I 220 
AE7 3 GLY I 102 ? LEU I 110 ? GLY I 159 LEU I 167 
AE7 4 LEU I 122 ? LEU I 128 ? LEU I 179 LEU I 185 
AE8 1 SER J 29  ? PHE J 30  ? SER J 52  PHE J 53  
AE8 2 ASP J 40  ? ILE J 41  ? ASP J 63  ILE J 64  
AE9 1 PHE J 49  ? LYS J 53  ? PHE J 72  LYS J 76  
AE9 2 GLU J 62  ? CYS J 65  ? GLU J 85  CYS J 88  
AF1 1 PHE J 69  ? LEU J 72  ? PHE J 92  LEU J 95  
AF1 2 MET J 78  ? GLN J 81  ? MET J 101 GLN J 104 
AF2 1 GLU J 88  ? LEU J 89  ? GLU J 111 LEU J 112 
AF2 2 CYS J 94  ? LYS J 95  ? CYS J 117 LYS J 118 
AF3 1 THR J 101 ? PHE J 102 ? THR J 124 PHE J 125 
AF3 2 ARG J 111 ? PRO J 112 ? ARG J 134 PRO J 135 
AF4 1 SER J 122 ? VAL J 125 ? SER J 145 VAL J 148 
AF4 2 VAL J 134 ? GLY J 136 ? VAL J 157 GLY J 159 
AF5 1 TRP K 52  ? TYR K 53  ? TRP K 109 TYR K 110 
AF5 2 PHE K 35  ? ALA K 40  ? PHE K 92  ALA K 97  
AF5 3 VAL K 177 ? ARG K 182 ? VAL K 234 ARG K 239 
AF5 4 GLY K 82  ? ARG K 93  ? GLY K 139 ARG K 150 
AF5 5 SER K 138 ? LEU K 149 ? SER K 195 LEU K 206 
AF6 1 SER K 62  ? LEU K 63  ? SER K 119 LEU K 120 
AF6 2 PHE K 35  ? ALA K 40  ? PHE K 92  ALA K 97  
AF6 3 VAL K 177 ? ARG K 182 ? VAL K 234 ARG K 239 
AF6 4 GLY K 82  ? ARG K 93  ? GLY K 139 ARG K 150 
AF6 5 GLN K 170 ? LEU K 171 ? GLN K 227 LEU K 228 
AF7 1 GLY K 48  ? PRO K 49  ? GLY K 105 PRO K 106 
AF7 2 GLN K 153 ? ALA K 163 ? GLN K 210 ALA K 220 
AF7 3 GLU K 75  ? VAL K 78  ? GLU K 132 VAL K 135 
AF7 4 LEU K 67  ? LYS K 70  ? LEU K 124 LYS K 127 
AF8 1 GLY K 48  ? PRO K 49  ? GLY K 105 PRO K 106 
AF8 2 GLN K 153 ? ALA K 163 ? GLN K 210 ALA K 220 
AF8 3 GLY K 102 ? LEU K 110 ? GLY K 159 LEU K 167 
AF8 4 LEU K 122 ? LEU K 128 ? LEU K 179 LEU K 185 
AF9 1 PHE L 49  ? THR L 51  ? PHE L 72  THR L 74  
AF9 2 CYS L 63  ? CYS L 65  ? CYS L 86  CYS L 88  
AG1 1 HIS L 70  ? LEU L 72  ? HIS L 93  LEU L 95  
AG1 2 MET L 78  ? GLU L 80  ? MET L 101 GLU L 103 
AG2 1 GLU L 88  ? THR L 90  ? GLU L 111 THR L 113 
AG2 2 GLY L 93  ? LYS L 95  ? GLY L 116 LYS L 118 
AG3 1 THR L 101 ? PHE L 102 ? THR L 124 PHE L 125 
AG3 2 ARG L 111 ? PRO L 112 ? ARG L 134 PRO L 135 
AG4 1 TRP M 52  ? TYR M 53  ? TRP M 109 TYR M 110 
AG4 2 PHE M 35  ? ALA M 40  ? PHE M 92  ALA M 97  
AG4 3 VAL M 177 ? ARG M 182 ? VAL M 234 ARG M 239 
AG4 4 GLY M 82  ? ARG M 94  ? GLY M 139 ARG M 151 
AG4 5 SER M 138 ? LEU M 149 ? SER M 195 LEU M 206 
AG5 1 SER M 62  ? LEU M 63  ? SER M 119 LEU M 120 
AG5 2 PHE M 35  ? ALA M 40  ? PHE M 92  ALA M 97  
AG5 3 VAL M 177 ? ARG M 182 ? VAL M 234 ARG M 239 
AG5 4 GLY M 82  ? ARG M 94  ? GLY M 139 ARG M 151 
AG5 5 TRP M 169 ? LEU M 171 ? TRP M 226 LEU M 228 
AG6 1 GLY M 48  ? PRO M 49  ? GLY M 105 PRO M 106 
AG6 2 GLN M 153 ? ALA M 163 ? GLN M 210 ALA M 220 
AG6 3 GLU M 75  ? VAL M 78  ? GLU M 132 VAL M 135 
AG6 4 LEU M 67  ? LYS M 70  ? LEU M 124 LYS M 127 
AG7 1 GLY M 48  ? PRO M 49  ? GLY M 105 PRO M 106 
AG7 2 GLN M 153 ? ALA M 163 ? GLN M 210 ALA M 220 
AG7 3 GLY M 102 ? LEU M 110 ? GLY M 159 LEU M 167 
AG7 4 LEU M 122 ? LEU M 128 ? LEU M 179 LEU M 185 
AG8 1 PHE N 49  ? LYS N 53  ? PHE N 72  LYS N 76  
AG8 2 GLU N 62  ? CYS N 65  ? GLU N 85  CYS N 88  
AG9 1 PHE N 69  ? LEU N 72  ? PHE N 92  LEU N 95  
AG9 2 MET N 78  ? GLN N 81  ? MET N 101 GLN N 104 
AH1 1 GLU N 88  ? LEU N 89  ? GLU N 111 LEU N 112 
AH1 2 CYS N 94  ? LYS N 95  ? CYS N 117 LYS N 118 
AH2 1 THR N 101 ? PHE N 102 ? THR N 124 PHE N 125 
AH2 2 ARG N 111 ? PRO N 112 ? ARG N 134 PRO N 135 
AH3 1 SER N 122 ? VAL N 125 ? SER N 145 VAL N 148 
AH3 2 VAL N 134 ? GLY N 136 ? VAL N 157 GLY N 159 
AH4 1 TRP O 52  ? TYR O 53  ? TRP O 109 TYR O 110 
AH4 2 PHE O 35  ? ALA O 40  ? PHE O 92  ALA O 97  
AH4 3 VAL O 177 ? ARG O 182 ? VAL O 234 ARG O 239 
AH4 4 GLY O 82  ? ARG O 94  ? GLY O 139 ARG O 151 
AH4 5 SER O 138 ? LEU O 149 ? SER O 195 LEU O 206 
AH5 1 TRP O 52  ? TYR O 53  ? TRP O 109 TYR O 110 
AH5 2 PHE O 35  ? ALA O 40  ? PHE O 92  ALA O 97  
AH5 3 VAL O 177 ? ARG O 182 ? VAL O 234 ARG O 239 
AH5 4 GLY O 82  ? ARG O 94  ? GLY O 139 ARG O 151 
AH5 5 TRP O 169 ? LEU O 171 ? TRP O 226 LEU O 228 
AH6 1 GLY O 48  ? PRO O 49  ? GLY O 105 PRO O 106 
AH6 2 GLN O 153 ? ALA O 163 ? GLN O 210 ALA O 220 
AH6 3 GLU O 75  ? VAL O 78  ? GLU O 132 VAL O 135 
AH6 4 LEU O 67  ? LYS O 70  ? LEU O 124 LYS O 127 
AH7 1 GLY O 48  ? PRO O 49  ? GLY O 105 PRO O 106 
AH7 2 GLN O 153 ? ALA O 163 ? GLN O 210 ALA O 220 
AH7 3 GLY O 102 ? LEU O 110 ? GLY O 159 LEU O 167 
AH7 4 LEU O 122 ? LEU O 128 ? LEU O 179 LEU O 185 
AH8 1 SER P 29  ? PHE P 30  ? SER P 52  PHE P 53  
AH8 2 ASP P 40  ? ILE P 41  ? ASP P 63  ILE P 64  
AH9 1 PHE P 49  ? THR P 51  ? PHE P 72  THR P 74  
AH9 2 CYS P 63  ? CYS P 65  ? CYS P 86  CYS P 88  
AI1 1 PHE P 69  ? LEU P 72  ? PHE P 92  LEU P 95  
AI1 2 MET P 78  ? GLN P 81  ? MET P 101 GLN P 104 
AI2 1 GLU P 88  ? LEU P 89  ? GLU P 111 LEU P 112 
AI2 2 CYS P 94  ? LYS P 95  ? CYS P 117 LYS P 118 
AI3 1 THR P 101 ? PHE P 102 ? THR P 124 PHE P 125 
AI3 2 ARG P 111 ? PRO P 112 ? ARG P 134 PRO P 135 
AI4 1 SER P 122 ? VAL P 125 ? SER P 145 VAL P 148 
AI4 2 VAL P 134 ? GLY P 136 ? VAL P 157 GLY P 159 
AI5 1 TRP Q 52  ? TYR Q 53  ? TRP Q 109 TYR Q 110 
AI5 2 PHE Q 35  ? ALA Q 40  ? PHE Q 92  ALA Q 97  
AI5 3 VAL Q 177 ? ARG Q 182 ? VAL Q 234 ARG Q 239 
AI5 4 GLY Q 82  ? ARG Q 94  ? GLY Q 139 ARG Q 151 
AI5 5 SER Q 138 ? LEU Q 149 ? SER Q 195 LEU Q 206 
AI6 1 TRP Q 52  ? TYR Q 53  ? TRP Q 109 TYR Q 110 
AI6 2 PHE Q 35  ? ALA Q 40  ? PHE Q 92  ALA Q 97  
AI6 3 VAL Q 177 ? ARG Q 182 ? VAL Q 234 ARG Q 239 
AI6 4 GLY Q 82  ? ARG Q 94  ? GLY Q 139 ARG Q 151 
AI6 5 TRP Q 169 ? LEU Q 171 ? TRP Q 226 LEU Q 228 
AI7 1 GLY Q 48  ? PRO Q 49  ? GLY Q 105 PRO Q 106 
AI7 2 GLN Q 153 ? ALA Q 163 ? GLN Q 210 ALA Q 220 
AI7 3 GLU Q 75  ? VAL Q 78  ? GLU Q 132 VAL Q 135 
AI7 4 LEU Q 67  ? LYS Q 70  ? LEU Q 124 LYS Q 127 
AI8 1 GLY Q 48  ? PRO Q 49  ? GLY Q 105 PRO Q 106 
AI8 2 GLN Q 153 ? ALA Q 163 ? GLN Q 210 ALA Q 220 
AI8 3 GLY Q 102 ? LEU Q 110 ? GLY Q 159 LEU Q 167 
AI8 4 ALA Q 120 ? LEU Q 128 ? ALA Q 177 LEU Q 185 
AI9 1 PHE R 49  ? ARG R 50  ? PHE R 72  ARG R 73  
AI9 2 ASP R 64  ? CYS R 65  ? ASP R 87  CYS R 88  
AJ1 1 PHE R 69  ? LEU R 72  ? PHE R 92  LEU R 95  
AJ1 2 MET R 78  ? GLN R 81  ? MET R 101 GLN R 104 
AJ2 1 THR R 101 ? PHE R 102 ? THR R 124 PHE R 125 
AJ2 2 ARG R 111 ? PRO R 112 ? ARG R 134 PRO R 135 
AJ3 1 TRP S 52  ? TYR S 53  ? TRP S 109 TYR S 110 
AJ3 2 PHE S 35  ? ALA S 40  ? PHE S 92  ALA S 97  
AJ3 3 VAL S 177 ? ARG S 182 ? VAL S 234 ARG S 239 
AJ3 4 GLY S 82  ? ARG S 94  ? GLY S 139 ARG S 151 
AJ3 5 SER S 138 ? LEU S 149 ? SER S 195 LEU S 206 
AJ4 1 TRP S 52  ? TYR S 53  ? TRP S 109 TYR S 110 
AJ4 2 PHE S 35  ? ALA S 40  ? PHE S 92  ALA S 97  
AJ4 3 VAL S 177 ? ARG S 182 ? VAL S 234 ARG S 239 
AJ4 4 GLY S 82  ? ARG S 94  ? GLY S 139 ARG S 151 
AJ4 5 TRP S 169 ? LEU S 171 ? TRP S 226 LEU S 228 
AJ5 1 GLY S 48  ? PRO S 49  ? GLY S 105 PRO S 106 
AJ5 2 GLN S 153 ? ARG S 164 ? GLN S 210 ARG S 221 
AJ5 3 GLU S 75  ? VAL S 78  ? GLU S 132 VAL S 135 
AJ5 4 LEU S 67  ? LYS S 70  ? LEU S 124 LYS S 127 
AJ6 1 GLY S 48  ? PRO S 49  ? GLY S 105 PRO S 106 
AJ6 2 GLN S 153 ? ARG S 164 ? GLN S 210 ARG S 221 
AJ6 3 SER S 101 ? LEU S 110 ? SER S 158 LEU S 167 
AJ6 4 LEU S 122 ? LEU S 128 ? LEU S 179 LEU S 185 
AJ7 1 PHE T 49  ? LYS T 53  ? PHE T 72  LYS T 76  
AJ7 2 GLU T 62  ? CYS T 65  ? GLU T 85  CYS T 88  
AJ8 1 PHE T 69  ? LEU T 72  ? PHE T 92  LEU T 95  
AJ8 2 MET T 78  ? GLN T 81  ? MET T 101 GLN T 104 
AJ9 1 GLU T 88  ? LEU T 89  ? GLU T 111 LEU T 112 
AJ9 2 CYS T 94  ? LYS T 95  ? CYS T 117 LYS T 118 
AK1 1 SER T 122 ? VAL T 125 ? SER T 145 VAL T 148 
AK1 2 VAL T 134 ? GLY T 136 ? VAL T 157 GLY T 159 
AK2 1 TRP U 52  ? TYR U 53  ? TRP U 109 TYR U 110 
AK2 2 PHE U 35  ? ALA U 40  ? PHE U 92  ALA U 97  
AK2 3 VAL U 177 ? ARG U 182 ? VAL U 234 ARG U 239 
AK2 4 GLY U 82  ? ARG U 94  ? GLY U 139 ARG U 151 
AK2 5 SER U 138 ? LEU U 149 ? SER U 195 LEU U 206 
AK3 1 TRP U 52  ? TYR U 53  ? TRP U 109 TYR U 110 
AK3 2 PHE U 35  ? ALA U 40  ? PHE U 92  ALA U 97  
AK3 3 VAL U 177 ? ARG U 182 ? VAL U 234 ARG U 239 
AK3 4 GLY U 82  ? ARG U 94  ? GLY U 139 ARG U 151 
AK3 5 TRP U 169 ? LEU U 171 ? TRP U 226 LEU U 228 
AK4 1 GLY U 48  ? PRO U 49  ? GLY U 105 PRO U 106 
AK4 2 GLN U 153 ? HIS U 160 ? GLN U 210 HIS U 217 
AK4 3 GLU U 75  ? VAL U 78  ? GLU U 132 VAL U 135 
AK4 4 LEU U 67  ? LYS U 70  ? LEU U 124 LYS U 127 
AK5 1 GLY U 48  ? PRO U 49  ? GLY U 105 PRO U 106 
AK5 2 GLN U 153 ? HIS U 160 ? GLN U 210 HIS U 217 
AK5 3 GLY U 102 ? LEU U 110 ? GLY U 159 LEU U 167 
AK5 4 LEU U 122 ? LEU U 128 ? LEU U 179 LEU U 185 
AK6 1 PHE V 49  ? THR V 51  ? PHE V 72  THR V 74  
AK6 2 CYS V 63  ? CYS V 65  ? CYS V 86  CYS V 88  
AK7 1 PHE V 69  ? LEU V 72  ? PHE V 92  LEU V 95  
AK7 2 MET V 78  ? GLN V 81  ? MET V 101 GLN V 104 
AK8 1 GLU V 88  ? LEU V 89  ? GLU V 111 LEU V 112 
AK8 2 CYS V 94  ? LYS V 95  ? CYS V 117 LYS V 118 
AK9 1 THR V 101 ? PHE V 102 ? THR V 124 PHE V 125 
AK9 2 ARG V 111 ? PRO V 112 ? ARG V 134 PRO V 135 
AL1 1 VAL V 123 ? VAL V 125 ? VAL V 146 VAL V 148 
AL1 2 VAL V 134 ? CYS V 135 ? VAL V 157 CYS V 158 
AL2 1 TRP W 52  ? TYR W 53  ? TRP W 109 TYR W 110 
AL2 2 PHE W 35  ? ALA W 40  ? PHE W 92  ALA W 97  
AL2 3 VAL W 177 ? ARG W 182 ? VAL W 234 ARG W 239 
AL2 4 GLY W 82  ? ARG W 94  ? GLY W 139 ARG W 151 
AL2 5 SER W 138 ? LEU W 149 ? SER W 195 LEU W 206 
AL3 1 SER W 62  ? LEU W 63  ? SER W 119 LEU W 120 
AL3 2 PHE W 35  ? ALA W 40  ? PHE W 92  ALA W 97  
AL3 3 VAL W 177 ? ARG W 182 ? VAL W 234 ARG W 239 
AL3 4 GLY W 82  ? ARG W 94  ? GLY W 139 ARG W 151 
AL3 5 TRP W 169 ? LEU W 171 ? TRP W 226 LEU W 228 
AL4 1 GLY W 48  ? PRO W 49  ? GLY W 105 PRO W 106 
AL4 2 GLN W 153 ? ALA W 163 ? GLN W 210 ALA W 220 
AL4 3 GLU W 75  ? VAL W 78  ? GLU W 132 VAL W 135 
AL4 4 LEU W 67  ? LYS W 70  ? LEU W 124 LYS W 127 
AL5 1 GLY W 48  ? PRO W 49  ? GLY W 105 PRO W 106 
AL5 2 GLN W 153 ? ALA W 163 ? GLN W 210 ALA W 220 
AL5 3 GLY W 102 ? LEU W 110 ? GLY W 159 LEU W 167 
AL5 4 LEU W 122 ? LEU W 128 ? LEU W 179 LEU W 185 
AL6 1 PHE X 49  ? THR X 51  ? PHE X 72  THR X 74  
AL6 2 CYS X 63  ? CYS X 65  ? CYS X 86  CYS X 88  
AL7 1 PHE X 69  ? LEU X 72  ? PHE X 92  LEU X 95  
AL7 2 MET X 78  ? GLN X 81  ? MET X 101 GLN X 104 
AL8 1 THR X 101 ? PHE X 102 ? THR X 124 PHE X 125 
AL8 2 ARG X 111 ? PRO X 112 ? ARG X 134 PRO X 135 
AL9 1 SER X 122 ? VAL X 125 ? SER X 145 VAL X 148 
AL9 2 VAL X 134 ? GLY X 136 ? VAL X 157 GLY X 159 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O TYR A 53  ? O TYR A 110 N VAL A 39  ? N VAL A 96  
AA1 2 3 N ALA A 36  ? N ALA A 93  O LEU A 180 ? O LEU A 237 
AA1 3 4 O PHE A 181 ? O PHE A 238 N TYR A 85  ? N TYR A 142 
AA1 4 5 N TYR A 84  ? N TYR A 141 O LEU A 147 ? O LEU A 204 
AA2 1 2 O SER A 62  ? O SER A 119 N GLN A 37  ? N GLN A 94  
AA2 2 3 N ALA A 36  ? N ALA A 93  O LEU A 180 ? O LEU A 237 
AA2 3 4 O PHE A 181 ? O PHE A 238 N TYR A 85  ? N TYR A 142 
AA2 4 5 N ARG A 93  ? N ARG A 150 O GLN A 170 ? O GLN A 227 
AA3 1 2 N GLY A 48  ? N GLY A 105 O LEU A 159 ? O LEU A 216 
AA3 2 3 O LEU A 155 ? O LEU A 212 N LEU A 76  ? N LEU A 133 
AA3 3 4 O VAL A 77  ? O VAL A 134 N SER A 68  ? N SER A 125 
AA4 1 2 N GLY A 48  ? N GLY A 105 O LEU A 159 ? O LEU A 216 
AA4 2 3 O GLY A 156 ? O GLY A 213 N HIS A 109 ? N HIS A 166 
AA4 3 4 N GLY A 102 ? N GLY A 159 O LEU A 128 ? O LEU A 185 
AA5 1 2 N PHE B 13  ? N PHE B 36  O SER B 23  ? O SER B 46  
AA6 1 2 N ARG B 52  ? N ARG B 75  O GLU B 62  ? O GLU B 85  
AA7 1 2 N LEU B 72  ? N LEU B 95  O MET B 78  ? O MET B 101 
AA8 1 2 N GLU B 88  ? N GLU B 111 O LYS B 95  ? O LYS B 118 
AA9 1 2 N PHE B 102 ? N PHE B 125 O ARG B 111 ? O ARG B 134 
AB1 1 2 N SER B 122 ? N SER B 145 O GLY B 136 ? O GLY B 159 
AB2 1 2 O TYR C 53  ? O TYR C 110 N VAL C 39  ? N VAL C 96  
AB2 2 3 N ALA C 36  ? N ALA C 93  O LEU C 180 ? O LEU C 237 
AB2 3 4 O PHE C 181 ? O PHE C 238 N TYR C 85  ? N TYR C 142 
AB2 4 5 N PHE C 88  ? N PHE C 145 O GLN C 143 ? O GLN C 200 
AB3 1 2 O TYR C 53  ? O TYR C 110 N VAL C 39  ? N VAL C 96  
AB3 2 3 N ALA C 36  ? N ALA C 93  O LEU C 180 ? O LEU C 237 
AB3 3 4 O PHE C 181 ? O PHE C 238 N TYR C 85  ? N TYR C 142 
AB3 4 5 N ARG C 93  ? N ARG C 150 O GLN C 170 ? O GLN C 227 
AB4 1 2 N GLY C 48  ? N GLY C 105 O LEU C 159 ? O LEU C 216 
AB4 2 3 O GLN C 153 ? O GLN C 210 N VAL C 78  ? N VAL C 135 
AB4 3 4 O VAL C 77  ? O VAL C 134 N SER C 68  ? N SER C 125 
AB5 1 2 N GLY C 48  ? N GLY C 105 O LEU C 159 ? O LEU C 216 
AB5 2 3 O HIS C 158 ? O HIS C 215 N ALA C 107 ? N ALA C 164 
AB5 3 4 N GLY C 102 ? N GLY C 159 O LEU C 128 ? O LEU C 185 
AB6 1 2 N PHE D 13  ? N PHE D 36  O SER D 23  ? O SER D 46  
AB7 1 2 N ARG D 50  ? N ARG D 73  O ASP D 64  ? O ASP D 87  
AB8 1 2 N LEU D 72  ? N LEU D 95  O MET D 78  ? O MET D 101 
AB9 1 2 N GLU D 88  ? N GLU D 111 O LYS D 95  ? O LYS D 118 
AC1 1 2 N PHE D 102 ? N PHE D 125 O ARG D 111 ? O ARG D 134 
AC2 1 2 N SER D 122 ? N SER D 145 O GLY D 136 ? O GLY D 159 
AC3 1 2 O TYR E 53  ? O TYR E 110 N VAL E 39  ? N VAL E 96  
AC3 2 3 N ALA E 36  ? N ALA E 93  O LEU E 180 ? O LEU E 237 
AC3 3 4 O PHE E 181 ? O PHE E 238 N TYR E 85  ? N TYR E 142 
AC3 4 5 N LEU E 92  ? N LEU E 149 O ALA E 139 ? O ALA E 196 
AC4 1 2 O TYR E 53  ? O TYR E 110 N VAL E 39  ? N VAL E 96  
AC4 2 3 N ALA E 36  ? N ALA E 93  O LEU E 180 ? O LEU E 237 
AC4 3 4 O PHE E 181 ? O PHE E 238 N TYR E 85  ? N TYR E 142 
AC4 4 5 N ARG E 93  ? N ARG E 150 O GLN E 170 ? O GLN E 227 
AC5 1 2 N GLY E 48  ? N GLY E 105 O LEU E 159 ? O LEU E 216 
AC5 2 3 O GLN E 153 ? O GLN E 210 N VAL E 78  ? N VAL E 135 
AC5 3 4 O VAL E 77  ? O VAL E 134 N SER E 68  ? N SER E 125 
AC6 1 2 N GLY E 48  ? N GLY E 105 O LEU E 159 ? O LEU E 216 
AC6 2 3 O HIS E 160 ? O HIS E 217 N SER E 105 ? N SER E 162 
AC6 3 4 N GLY E 102 ? N GLY E 159 O LEU E 128 ? O LEU E 185 
AC7 1 2 N PHE F 13  ? N PHE F 36  O SER F 23  ? O SER F 46  
AC8 1 2 N ARG F 50  ? N ARG F 73  O ASP F 64  ? O ASP F 87  
AC9 1 2 N HIS F 70  ? N HIS F 93  O GLU F 80  ? O GLU F 103 
AD1 1 2 N PHE F 102 ? N PHE F 125 O ARG F 111 ? O ARG F 134 
AD2 1 2 N SER F 122 ? N SER F 145 O GLY F 136 ? O GLY F 159 
AD3 1 2 O TYR G 53  ? O TYR G 110 N VAL G 39  ? N VAL G 96  
AD3 2 3 N ALA G 36  ? N ALA G 93  O LEU G 180 ? O LEU G 237 
AD3 3 4 O PHE G 181 ? O PHE G 238 N TYR G 85  ? N TYR G 142 
AD3 4 5 N PHE G 88  ? N PHE G 145 O GLN G 143 ? O GLN G 200 
AD4 1 2 O SER G 62  ? O SER G 119 N GLN G 37  ? N GLN G 94  
AD4 2 3 N ALA G 36  ? N ALA G 93  O LEU G 180 ? O LEU G 237 
AD4 3 4 O PHE G 181 ? O PHE G 238 N TYR G 85  ? N TYR G 142 
AD4 4 5 N ARG G 93  ? N ARG G 150 O GLN G 170 ? O GLN G 227 
AD5 1 2 N GLY G 48  ? N GLY G 105 O LEU G 159 ? O LEU G 216 
AD5 2 3 O LEU G 155 ? O LEU G 212 N LEU G 76  ? N LEU G 133 
AD5 3 4 O VAL G 77  ? O VAL G 134 N SER G 68  ? N SER G 125 
AD6 1 2 N GLY G 48  ? N GLY G 105 O LEU G 159 ? O LEU G 216 
AD6 2 3 O HIS G 160 ? O HIS G 217 N SER G 105 ? N SER G 162 
AD6 3 4 N GLY G 102 ? N GLY G 159 O LEU G 128 ? O LEU G 185 
AD7 1 2 N PHE H 13  ? N PHE H 36  O SER H 23  ? O SER H 46  
AD8 1 2 N ARG H 50  ? N ARG H 73  O ASP H 64  ? O ASP H 87  
AD9 1 2 N LEU H 72  ? N LEU H 95  O MET H 78  ? O MET H 101 
AE1 1 2 N GLU H 88  ? N GLU H 111 O LYS H 95  ? O LYS H 118 
AE2 1 2 N PHE H 102 ? N PHE H 125 O ARG H 111 ? O ARG H 134 
AE3 1 2 N LEU H 124 ? N LEU H 147 O VAL H 134 ? O VAL H 157 
AE4 1 2 O TYR I 53  ? O TYR I 110 N VAL I 39  ? N VAL I 96  
AE4 2 3 N ALA I 36  ? N ALA I 93  O LEU I 180 ? O LEU I 237 
AE4 3 4 O PHE I 181 ? O PHE I 238 N TYR I 85  ? N TYR I 142 
AE4 4 5 N PHE I 88  ? N PHE I 145 O GLN I 143 ? O GLN I 200 
AE5 1 2 O SER I 62  ? O SER I 119 N GLN I 37  ? N GLN I 94  
AE5 2 3 N ALA I 36  ? N ALA I 93  O LEU I 180 ? O LEU I 237 
AE5 3 4 O PHE I 181 ? O PHE I 238 N TYR I 85  ? N TYR I 142 
AE5 4 5 N ARG I 93  ? N ARG I 150 O GLN I 170 ? O GLN I 227 
AE6 1 2 N GLY I 48  ? N GLY I 105 O LEU I 159 ? O LEU I 216 
AE6 2 3 O GLN I 153 ? O GLN I 210 N VAL I 78  ? N VAL I 135 
AE6 3 4 O VAL I 77  ? O VAL I 134 N SER I 68  ? N SER I 125 
AE7 1 2 N GLY I 48  ? N GLY I 105 O LEU I 159 ? O LEU I 216 
AE7 2 3 O GLU I 162 ? O GLU I 219 N SER I 103 ? N SER I 160 
AE7 3 4 N LEU I 108 ? N LEU I 165 O LEU I 122 ? O LEU I 179 
AE8 1 2 N PHE J 30  ? N PHE J 53  O ASP J 40  ? O ASP J 63  
AE9 1 2 N LYS J 53  ? N LYS J 76  O GLU J 62  ? O GLU J 85  
AF1 1 2 N LEU J 72  ? N LEU J 95  O MET J 78  ? O MET J 101 
AF2 1 2 N GLU J 88  ? N GLU J 111 O LYS J 95  ? O LYS J 118 
AF3 1 2 N PHE J 102 ? N PHE J 125 O ARG J 111 ? O ARG J 134 
AF4 1 2 N LEU J 124 ? N LEU J 147 O VAL J 134 ? O VAL J 157 
AF5 1 2 O TYR K 53  ? O TYR K 110 N VAL K 39  ? N VAL K 96  
AF5 2 3 N LEU K 38  ? N LEU K 95  O LEU K 178 ? O LEU K 235 
AF5 3 4 O PHE K 181 ? O PHE K 238 N TYR K 85  ? N TYR K 142 
AF5 4 5 N PHE K 88  ? N PHE K 145 O GLN K 143 ? O GLN K 200 
AF6 1 2 O SER K 62  ? O SER K 119 N GLN K 37  ? N GLN K 94  
AF6 2 3 N LEU K 38  ? N LEU K 95  O LEU K 178 ? O LEU K 235 
AF6 3 4 O PHE K 181 ? O PHE K 238 N TYR K 85  ? N TYR K 142 
AF6 4 5 N ARG K 93  ? N ARG K 150 O GLN K 170 ? O GLN K 227 
AF7 1 2 N GLY K 48  ? N GLY K 105 O LEU K 159 ? O LEU K 216 
AF7 2 3 O GLN K 153 ? O GLN K 210 N VAL K 78  ? N VAL K 135 
AF7 3 4 O VAL K 77  ? O VAL K 134 N SER K 68  ? N SER K 125 
AF8 1 2 N GLY K 48  ? N GLY K 105 O LEU K 159 ? O LEU K 216 
AF8 2 3 O HIS K 160 ? O HIS K 217 N SER K 105 ? N SER K 162 
AF8 3 4 N VAL K 104 ? N VAL K 161 O VAL K 126 ? O VAL K 183 
AF9 1 2 N ARG L 50  ? N ARG L 73  O ASP L 64  ? O ASP L 87  
AG1 1 2 N LEU L 72  ? N LEU L 95  O MET L 78  ? O MET L 101 
AG2 1 2 N THR L 90  ? N THR L 113 O GLY L 93  ? O GLY L 116 
AG3 1 2 N PHE L 102 ? N PHE L 125 O ARG L 111 ? O ARG L 134 
AG4 1 2 O TYR M 53  ? O TYR M 110 N VAL M 39  ? N VAL M 96  
AG4 2 3 N ALA M 36  ? N ALA M 93  O LEU M 180 ? O LEU M 237 
AG4 3 4 O PHE M 181 ? O PHE M 238 N TYR M 85  ? N TYR M 142 
AG4 4 5 N LEU M 92  ? N LEU M 149 O ALA M 139 ? O ALA M 196 
AG5 1 2 O SER M 62  ? O SER M 119 N GLN M 37  ? N GLN M 94  
AG5 2 3 N ALA M 36  ? N ALA M 93  O LEU M 180 ? O LEU M 237 
AG5 3 4 O PHE M 181 ? O PHE M 238 N TYR M 85  ? N TYR M 142 
AG5 4 5 N ARG M 93  ? N ARG M 150 O GLN M 170 ? O GLN M 227 
AG6 1 2 N GLY M 48  ? N GLY M 105 O LEU M 159 ? O LEU M 216 
AG6 2 3 O GLN M 153 ? O GLN M 210 N VAL M 78  ? N VAL M 135 
AG6 3 4 O VAL M 77  ? O VAL M 134 N SER M 68  ? N SER M 125 
AG7 1 2 N GLY M 48  ? N GLY M 105 O LEU M 159 ? O LEU M 216 
AG7 2 3 O HIS M 160 ? O HIS M 217 N SER M 105 ? N SER M 162 
AG7 3 4 N GLY M 102 ? N GLY M 159 O LEU M 128 ? O LEU M 185 
AG8 1 2 N ARG N 50  ? N ARG N 73  O ASP N 64  ? O ASP N 87  
AG9 1 2 N LEU N 72  ? N LEU N 95  O MET N 78  ? O MET N 101 
AH1 1 2 N GLU N 88  ? N GLU N 111 O LYS N 95  ? O LYS N 118 
AH2 1 2 N PHE N 102 ? N PHE N 125 O ARG N 111 ? O ARG N 134 
AH3 1 2 N SER N 122 ? N SER N 145 O GLY N 136 ? O GLY N 159 
AH4 1 2 O TYR O 53  ? O TYR O 110 N VAL O 39  ? N VAL O 96  
AH4 2 3 N ALA O 36  ? N ALA O 93  O LEU O 180 ? O LEU O 237 
AH4 3 4 O PHE O 181 ? O PHE O 238 N TYR O 85  ? N TYR O 142 
AH4 4 5 N PHE O 88  ? N PHE O 145 O GLN O 143 ? O GLN O 200 
AH5 1 2 O TYR O 53  ? O TYR O 110 N VAL O 39  ? N VAL O 96  
AH5 2 3 N ALA O 36  ? N ALA O 93  O LEU O 180 ? O LEU O 237 
AH5 3 4 O PHE O 181 ? O PHE O 238 N TYR O 85  ? N TYR O 142 
AH5 4 5 N ARG O 93  ? N ARG O 150 O GLN O 170 ? O GLN O 227 
AH6 1 2 N GLY O 48  ? N GLY O 105 O LEU O 159 ? O LEU O 216 
AH6 2 3 O GLN O 153 ? O GLN O 210 N VAL O 78  ? N VAL O 135 
AH6 3 4 O VAL O 77  ? O VAL O 134 N SER O 68  ? N SER O 125 
AH7 1 2 N GLY O 48  ? N GLY O 105 O LEU O 159 ? O LEU O 216 
AH7 2 3 O HIS O 160 ? O HIS O 217 N SER O 105 ? N SER O 162 
AH7 3 4 N GLY O 102 ? N GLY O 159 O LEU O 128 ? O LEU O 185 
AH8 1 2 N PHE P 30  ? N PHE P 53  O ASP P 40  ? O ASP P 63  
AH9 1 2 N ARG P 50  ? N ARG P 73  O ASP P 64  ? O ASP P 87  
AI1 1 2 N LEU P 72  ? N LEU P 95  O MET P 78  ? O MET P 101 
AI2 1 2 N GLU P 88  ? N GLU P 111 O LYS P 95  ? O LYS P 118 
AI3 1 2 N PHE P 102 ? N PHE P 125 O ARG P 111 ? O ARG P 134 
AI4 1 2 N SER P 122 ? N SER P 145 O GLY P 136 ? O GLY P 159 
AI5 1 2 O TYR Q 53  ? O TYR Q 110 N VAL Q 39  ? N VAL Q 96  
AI5 2 3 N ALA Q 36  ? N ALA Q 93  O LEU Q 180 ? O LEU Q 237 
AI5 3 4 O PHE Q 181 ? O PHE Q 238 N TYR Q 85  ? N TYR Q 142 
AI5 4 5 N PHE Q 88  ? N PHE Q 145 O GLN Q 143 ? O GLN Q 200 
AI6 1 2 O TYR Q 53  ? O TYR Q 110 N VAL Q 39  ? N VAL Q 96  
AI6 2 3 N ALA Q 36  ? N ALA Q 93  O LEU Q 180 ? O LEU Q 237 
AI6 3 4 O PHE Q 181 ? O PHE Q 238 N TYR Q 85  ? N TYR Q 142 
AI6 4 5 N ARG Q 93  ? N ARG Q 150 O GLN Q 170 ? O GLN Q 227 
AI7 1 2 N GLY Q 48  ? N GLY Q 105 O LEU Q 159 ? O LEU Q 216 
AI7 2 3 O GLN Q 153 ? O GLN Q 210 N VAL Q 78  ? N VAL Q 135 
AI7 3 4 O VAL Q 77  ? O VAL Q 134 N SER Q 68  ? N SER Q 125 
AI8 1 2 N GLY Q 48  ? N GLY Q 105 O LEU Q 159 ? O LEU Q 216 
AI8 2 3 O GLU Q 162 ? O GLU Q 219 N SER Q 103 ? N SER Q 160 
AI8 3 4 N GLY Q 102 ? N GLY Q 159 O LEU Q 128 ? O LEU Q 185 
AI9 1 2 N ARG R 50  ? N ARG R 73  O ASP R 64  ? O ASP R 87  
AJ1 1 2 N LEU R 72  ? N LEU R 95  O MET R 78  ? O MET R 101 
AJ2 1 2 N PHE R 102 ? N PHE R 125 O ARG R 111 ? O ARG R 134 
AJ3 1 2 O TYR S 53  ? O TYR S 110 N VAL S 39  ? N VAL S 96  
AJ3 2 3 N ALA S 36  ? N ALA S 93  O LEU S 180 ? O LEU S 237 
AJ3 3 4 O PHE S 181 ? O PHE S 238 N TYR S 85  ? N TYR S 142 
AJ3 4 5 N PHE S 88  ? N PHE S 145 O GLN S 143 ? O GLN S 200 
AJ4 1 2 O TYR S 53  ? O TYR S 110 N VAL S 39  ? N VAL S 96  
AJ4 2 3 N ALA S 36  ? N ALA S 93  O LEU S 180 ? O LEU S 237 
AJ4 3 4 O PHE S 181 ? O PHE S 238 N TYR S 85  ? N TYR S 142 
AJ4 4 5 N ARG S 93  ? N ARG S 150 O GLN S 170 ? O GLN S 227 
AJ5 1 2 N GLY S 48  ? N GLY S 105 O LEU S 159 ? O LEU S 216 
AJ5 2 3 O LEU S 155 ? O LEU S 212 N LEU S 76  ? N LEU S 133 
AJ5 3 4 O VAL S 77  ? O VAL S 134 N SER S 68  ? N SER S 125 
AJ6 1 2 N GLY S 48  ? N GLY S 105 O LEU S 159 ? O LEU S 216 
AJ6 2 3 O HIS S 160 ? O HIS S 217 N SER S 105 ? N SER S 162 
AJ6 3 4 N GLY S 102 ? N GLY S 159 O LEU S 128 ? O LEU S 185 
AJ7 1 2 N ARG T 50  ? N ARG T 73  O ASP T 64  ? O ASP T 87  
AJ8 1 2 N HIS T 70  ? N HIS T 93  O GLU T 80  ? O GLU T 103 
AJ9 1 2 N GLU T 88  ? N GLU T 111 O LYS T 95  ? O LYS T 118 
AK1 1 2 N LEU T 124 ? N LEU T 147 O VAL T 134 ? O VAL T 157 
AK2 1 2 O TYR U 53  ? O TYR U 110 N VAL U 39  ? N VAL U 96  
AK2 2 3 N ALA U 36  ? N ALA U 93  O LEU U 180 ? O LEU U 237 
AK2 3 4 O PHE U 181 ? O PHE U 238 N TYR U 85  ? N TYR U 142 
AK2 4 5 N PHE U 88  ? N PHE U 145 O GLN U 143 ? O GLN U 200 
AK3 1 2 O TYR U 53  ? O TYR U 110 N VAL U 39  ? N VAL U 96  
AK3 2 3 N ALA U 36  ? N ALA U 93  O LEU U 180 ? O LEU U 237 
AK3 3 4 O PHE U 181 ? O PHE U 238 N TYR U 85  ? N TYR U 142 
AK3 4 5 N ARG U 93  ? N ARG U 150 O GLN U 170 ? O GLN U 227 
AK4 1 2 N GLY U 48  ? N GLY U 105 O LEU U 159 ? O LEU U 216 
AK4 2 3 O LEU U 155 ? O LEU U 212 N LEU U 76  ? N LEU U 133 
AK4 3 4 O VAL U 77  ? O VAL U 134 N SER U 68  ? N SER U 125 
AK5 1 2 N GLY U 48  ? N GLY U 105 O LEU U 159 ? O LEU U 216 
AK5 2 3 O HIS U 160 ? O HIS U 217 N SER U 105 ? N SER U 162 
AK5 3 4 N GLY U 102 ? N GLY U 159 O LEU U 128 ? O LEU U 185 
AK6 1 2 N ARG V 50  ? N ARG V 73  O ASP V 64  ? O ASP V 87  
AK7 1 2 N LEU V 72  ? N LEU V 95  O MET V 78  ? O MET V 101 
AK8 1 2 N GLU V 88  ? N GLU V 111 O LYS V 95  ? O LYS V 118 
AK9 1 2 N PHE V 102 ? N PHE V 125 O ARG V 111 ? O ARG V 134 
AL1 1 2 N LEU V 124 ? N LEU V 147 O VAL V 134 ? O VAL V 157 
AL2 1 2 O TYR W 53  ? O TYR W 110 N VAL W 39  ? N VAL W 96  
AL2 2 3 N ALA W 36  ? N ALA W 93  O LEU W 180 ? O LEU W 237 
AL2 3 4 O PHE W 181 ? O PHE W 238 N TYR W 85  ? N TYR W 142 
AL2 4 5 N PHE W 88  ? N PHE W 145 O GLN W 143 ? O GLN W 200 
AL3 1 2 O SER W 62  ? O SER W 119 N GLN W 37  ? N GLN W 94  
AL3 2 3 N ALA W 36  ? N ALA W 93  O LEU W 180 ? O LEU W 237 
AL3 3 4 O PHE W 181 ? O PHE W 238 N TYR W 85  ? N TYR W 142 
AL3 4 5 N ARG W 93  ? N ARG W 150 O GLN W 170 ? O GLN W 227 
AL4 1 2 N GLY W 48  ? N GLY W 105 O LEU W 159 ? O LEU W 216 
AL4 2 3 O LEU W 155 ? O LEU W 212 N LEU W 76  ? N LEU W 133 
AL4 3 4 O VAL W 77  ? O VAL W 134 N SER W 68  ? N SER W 125 
AL5 1 2 N GLY W 48  ? N GLY W 105 O LEU W 159 ? O LEU W 216 
AL5 2 3 O GLU W 162 ? O GLU W 219 N SER W 103 ? N SER W 160 
AL5 3 4 N VAL W 104 ? N VAL W 161 O VAL W 126 ? O VAL W 183 
AL6 1 2 N ARG X 50  ? N ARG X 73  O ASP X 64  ? O ASP X 87  
AL7 1 2 N LEU X 72  ? N LEU X 95  O MET X 78  ? O MET X 101 
AL8 1 2 N PHE X 102 ? N PHE X 125 O ARG X 111 ? O ARG X 134 
AL9 1 2 N SER X 122 ? N SER X 145 O GLY X 136 ? O GLY X 159 
# 
_atom_sites.entry_id                    6A3V 
_atom_sites.fract_transf_matrix[1][1]   0.007931 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003172 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007289 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007675 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLY A  1 33  ? 478.330 62.156  445.491 1.00 32.48  ?  90  GLY A N   1 
ATOM   2     C CA  . GLY A  1 33  ? 477.504 61.856  444.336 1.00 37.84  ?  90  GLY A CA  1 
ATOM   3     C C   . GLY A  1 33  ? 477.032 63.090  443.592 1.00 51.77  ?  90  GLY A C   1 
ATOM   4     O O   . GLY A  1 33  ? 477.530 64.193  443.824 1.00 58.14  ?  90  GLY A O   1 
ATOM   5     N N   . MET A  1 34  ? 476.067 62.904  442.696 1.00 73.21  ?  91  MET A N   1 
ATOM   6     C CA  . MET A  1 34  ? 475.527 63.986  441.879 1.00 73.69  ?  91  MET A CA  1 
ATOM   7     C C   . MET A  1 34  ? 474.013 63.998  442.013 1.00 74.12  ?  91  MET A C   1 
ATOM   8     O O   . MET A  1 34  ? 473.345 63.050  441.584 1.00 71.96  ?  91  MET A O   1 
ATOM   9     C CB  . MET A  1 34  ? 475.933 63.824  440.412 1.00 75.07  ?  91  MET A CB  1 
ATOM   10    C CG  . MET A  1 34  ? 477.227 64.522  440.036 1.00 80.04  ?  91  MET A CG  1 
ATOM   11    S SD  . MET A  1 34  ? 477.069 66.316  440.066 1.00 88.38  ?  91  MET A SD  1 
ATOM   12    C CE  . MET A  1 34  ? 478.548 66.800  439.183 1.00 88.86  ?  91  MET A CE  1 
ATOM   13    N N   . PHE A  1 35  ? 473.476 65.077  442.582 1.00 42.84  ?  92  PHE A N   1 
ATOM   14    C CA  . PHE A  1 35  ? 472.041 65.265  442.764 1.00 34.58  ?  92  PHE A CA  1 
ATOM   15    C C   . PHE A  1 35  ? 471.814 66.636  443.382 1.00 36.89  ?  92  PHE A C   1 
ATOM   16    O O   . PHE A  1 35  ? 472.728 67.237  443.951 1.00 42.31  ?  92  PHE A O   1 
ATOM   17    C CB  . PHE A  1 35  ? 471.419 64.181  443.655 1.00 32.19  ?  92  PHE A CB  1 
ATOM   18    C CG  . PHE A  1 35  ? 471.921 64.192  445.073 1.00 39.32  ?  92  PHE A CG  1 
ATOM   19    C CD1 . PHE A  1 35  ? 473.087 63.528  445.413 1.00 40.77  ?  92  PHE A CD1 1 
ATOM   20    C CD2 . PHE A  1 35  ? 471.218 64.853  446.068 1.00 38.85  ?  92  PHE A CD2 1 
ATOM   21    C CE1 . PHE A  1 35  ? 473.548 63.530  446.717 1.00 40.70  ?  92  PHE A CE1 1 
ATOM   22    C CE2 . PHE A  1 35  ? 471.674 64.861  447.371 1.00 35.43  ?  92  PHE A CE2 1 
ATOM   23    C CZ  . PHE A  1 35  ? 472.840 64.198  447.697 1.00 35.94  ?  92  PHE A CZ  1 
ATOM   24    N N   . ALA A  1 36  ? 470.578 67.121  443.265 1.00 18.59  ?  93  ALA A N   1 
ATOM   25    C CA  . ALA A  1 36  ? 470.210 68.392  443.871 1.00 18.57  ?  93  ALA A CA  1 
ATOM   26    C C   . ALA A  1 36  ? 468.702 68.451  444.054 1.00 18.30  ?  93  ALA A C   1 
ATOM   27    O O   . ALA A  1 36  ? 467.945 67.752  443.376 1.00 20.26  ?  93  ALA A O   1 
ATOM   28    C CB  . ALA A  1 36  ? 470.690 69.578  443.028 1.00 18.78  ?  93  ALA A CB  1 
ATOM   29    N N   . GLN A  1 37  ? 468.280 69.302  444.985 1.00 28.09  ?  94  GLN A N   1 
ATOM   30    C CA  . GLN A  1 37  ? 466.876 69.632  445.170 1.00 27.47  ?  94  GLN A CA  1 
ATOM   31    C C   . GLN A  1 37  ? 466.782 71.088  445.599 1.00 30.13  ?  94  GLN A C   1 
ATOM   32    O O   . GLN A  1 37  ? 467.543 71.534  446.462 1.00 35.50  ?  94  GLN A O   1 
ATOM   33    C CB  . GLN A  1 37  ? 466.212 68.713  446.205 1.00 26.37  ?  94  GLN A CB  1 
ATOM   34    C CG  . GLN A  1 37  ? 464.820 69.153  446.624 1.00 24.37  ?  94  GLN A CG  1 
ATOM   35    C CD  . GLN A  1 37  ? 463.989 68.018  447.187 1.00 25.94  ?  94  GLN A CD  1 
ATOM   36    O OE1 . GLN A  1 37  ? 464.012 66.900  446.671 1.00 24.36  ?  94  GLN A OE1 1 
ATOM   37    N NE2 . GLN A  1 37  ? 463.245 68.299  448.251 1.00 28.46  ?  94  GLN A NE2 1 
ATOM   38    N N   . LEU A  1 38  ? 465.850 71.823  444.997 1.00 23.78  ?  95  LEU A N   1 
ATOM   39    C CA  . LEU A  1 38  ? 465.670 73.239  445.286 1.00 24.14  ?  95  LEU A CA  1 
ATOM   40    C C   . LEU A  1 38  ? 464.212 73.516  445.614 1.00 26.86  ?  95  LEU A C   1 
ATOM   41    O O   . LEU A  1 38  ? 463.308 72.991  444.957 1.00 28.79  ?  95  LEU A O   1 
ATOM   42    C CB  . LEU A  1 38  ? 466.116 74.113  444.106 1.00 21.93  ?  95  LEU A CB  1 
ATOM   43    C CG  . LEU A  1 38  ? 467.576 73.988  443.665 1.00 20.71  ?  95  LEU A CG  1 
ATOM   44    C CD1 . LEU A  1 38  ? 467.875 74.958  442.534 1.00 19.06  ?  95  LEU A CD1 1 
ATOM   45    C CD2 . LEU A  1 38  ? 468.517 74.222  444.837 1.00 24.57  ?  95  LEU A CD2 1 
ATOM   46    N N   . VAL A  1 39  ? 463.989 74.346  446.631 1.00 32.57  ?  96  VAL A N   1 
ATOM   47    C CA  . VAL A  1 39  ? 462.651 74.742  447.057 1.00 35.41  ?  96  VAL A CA  1 
ATOM   48    C C   . VAL A  1 39  ? 462.354 76.125  446.496 1.00 36.70  ?  96  VAL A C   1 
ATOM   49    O O   . VAL A  1 39  ? 463.184 77.038  446.600 1.00 39.67  ?  96  VAL A O   1 
ATOM   50    C CB  . VAL A  1 39  ? 462.527 74.726  448.590 1.00 37.82  ?  96  VAL A CB  1 
ATOM   51    C CG1 . VAL A  1 39  ? 461.287 75.481  449.034 1.00 40.88  ?  96  VAL A CG1 1 
ATOM   52    C CG2 . VAL A  1 39  ? 462.488 73.293  449.103 1.00 34.05  ?  96  VAL A CG2 1 
ATOM   53    N N   . ALA A  1 40  ? 461.173 76.281  445.901 1.00 41.89  ?  97  ALA A N   1 
ATOM   54    C CA  . ALA A  1 40  ? 460.806 77.548  445.281 1.00 42.36  ?  97  ALA A CA  1 
ATOM   55    C C   . ALA A  1 40  ? 460.691 78.649  446.326 1.00 47.67  ?  97  ALA A C   1 
ATOM   56    O O   . ALA A  1 40  ? 460.072 78.468  447.378 1.00 56.04  ?  97  ALA A O   1 
ATOM   57    C CB  . ALA A  1 40  ? 459.490 77.402  444.521 1.00 44.97  ?  97  ALA A CB  1 
ATOM   58    N N   . GLN A  1 41  ? 461.300 79.797  446.028 1.00 19.76  ?  98  GLN A N   1 
ATOM   59    C CA  . GLN A  1 41  ? 461.244 80.944  446.926 1.00 23.06  ?  98  GLN A CA  1 
ATOM   60    C C   . GLN A  1 41  ? 459.937 81.718  446.788 1.00 23.63  ?  98  GLN A C   1 
ATOM   61    O O   . GLN A  1 41  ? 459.509 82.379  447.741 1.00 21.42  ?  98  GLN A O   1 
ATOM   62    C CB  . GLN A  1 41  ? 462.437 81.861  446.660 1.00 21.37  ?  98  GLN A CB  1 
ATOM   63    C CG  . GLN A  1 41  ? 462.621 82.987  447.658 1.00 21.85  ?  98  GLN A CG  1 
ATOM   64    C CD  . GLN A  1 41  ? 463.890 83.774  447.402 1.00 32.14  ?  98  GLN A CD  1 
ATOM   65    O OE1 . GLN A  1 41  ? 463.913 84.689  446.579 1.00 32.15  ?  98  GLN A OE1 1 
ATOM   66    N NE2 . GLN A  1 41  ? 464.959 83.416  448.106 1.00 35.54  ?  98  GLN A NE2 1 
ATOM   67    N N   . ASN A  1 42  ? 459.291 81.637  445.629 1.00 44.82  ?  99  ASN A N   1 
ATOM   68    C CA  . ASN A  1 42  ? 458.109 82.440  445.359 1.00 45.34  ?  99  ASN A CA  1 
ATOM   69    C C   . ASN A  1 42  ? 456.901 81.928  446.139 1.00 49.51  ?  99  ASN A C   1 
ATOM   70    O O   . ASN A  1 42  ? 456.845 80.776  446.579 1.00 46.55  ?  99  ASN A O   1 
ATOM   71    C CB  . ASN A  1 42  ? 457.802 82.446  443.864 1.00 39.14  ?  99  ASN A CB  1 
ATOM   72    C CG  . ASN A  1 42  ? 458.999 82.846  443.033 1.00 46.97  ?  99  ASN A CG  1 
ATOM   73    O OD1 . ASN A  1 42  ? 459.904 82.046  442.807 1.00 50.54  ?  99  ASN A OD1 1 
ATOM   74    N ND2 . ASN A  1 42  ? 459.017 84.094  442.580 1.00 56.77  ?  99  ASN A ND2 1 
ATOM   75    N N   . VAL A  1 43  ? 455.920 82.815  446.305 1.00 36.09  ?  100 VAL A N   1 
ATOM   76    C CA  . VAL A  1 43  ? 454.699 82.513  447.043 1.00 26.80  ?  100 VAL A CA  1 
ATOM   77    C C   . VAL A  1 43  ? 453.478 82.838  446.186 1.00 24.28  ?  100 VAL A C   1 
ATOM   78    O O   . VAL A  1 43  ? 452.662 81.955  445.900 1.00 27.49  ?  100 VAL A O   1 
ATOM   79    C CB  . VAL A  1 43  ? 454.669 83.241  448.403 1.00 21.65  ?  100 VAL A CB  1 
ATOM   80    C CG1 . VAL A  1 43  ? 454.998 84.724  448.257 1.00 33.76  ?  100 VAL A CG1 1 
ATOM   81    C CG2 . VAL A  1 43  ? 453.319 83.051  449.075 1.00 23.45  ?  100 VAL A CG2 1 
ATOM   82    N N   . LEU A  1 44  ? 453.337 84.097  445.774 1.00 30.32  ?  101 LEU A N   1 
ATOM   83    C CA  . LEU A  1 44  ? 452.180 84.518  444.998 1.00 31.42  ?  101 LEU A CA  1 
ATOM   84    C C   . LEU A  1 44  ? 452.245 83.934  443.587 1.00 29.19  ?  101 LEU A C   1 
ATOM   85    O O   . LEU A  1 44  ? 453.197 83.246  443.205 1.00 32.83  ?  101 LEU A O   1 
ATOM   86    C CB  . LEU A  1 44  ? 452.107 86.042  444.937 1.00 30.33  ?  101 LEU A CB  1 
ATOM   87    C CG  . LEU A  1 44  ? 451.862 86.798  446.242 1.00 29.15  ?  101 LEU A CG  1 
ATOM   88    C CD1 . LEU A  1 44  ? 451.990 88.298  446.017 1.00 20.79  ?  101 LEU A CD1 1 
ATOM   89    C CD2 . LEU A  1 44  ? 450.494 86.449  446.801 1.00 39.67  ?  101 LEU A CD2 1 
ATOM   90    N N   . LEU A  1 45  ? 451.215 84.226  442.793 1.00 48.69  ?  102 LEU A N   1 
ATOM   91    C CA  . LEU A  1 45  ? 451.131 83.774  441.409 1.00 51.37  ?  102 LEU A CA  1 
ATOM   92    C C   . LEU A  1 45  ? 451.420 84.962  440.500 1.00 56.98  ?  102 LEU A C   1 
ATOM   93    O O   . LEU A  1 45  ? 450.577 85.853  440.344 1.00 62.50  ?  102 LEU A O   1 
ATOM   94    C CB  . LEU A  1 45  ? 449.758 83.175  441.109 1.00 45.57  ?  102 LEU A CB  1 
ATOM   95    C CG  . LEU A  1 45  ? 449.587 81.662  441.255 1.00 42.90  ?  102 LEU A CG  1 
ATOM   96    C CD1 . LEU A  1 45  ? 450.042 81.181  442.624 1.00 47.37  ?  102 LEU A CD1 1 
ATOM   97    C CD2 . LEU A  1 45  ? 448.137 81.271  441.007 1.00 38.18  ?  102 LEU A CD2 1 
ATOM   98    N N   . ILE A  1 46  ? 452.601 84.961  439.890 1.00 48.34  ?  103 ILE A N   1 
ATOM   99    C CA  . ILE A  1 46  ? 453.029 86.005  438.965 1.00 48.23  ?  103 ILE A CA  1 
ATOM   100   C C   . ILE A  1 46  ? 453.798 85.335  437.837 1.00 48.73  ?  103 ILE A C   1 
ATOM   101   O O   . ILE A  1 46  ? 454.596 84.423  438.074 1.00 48.10  ?  103 ILE A O   1 
ATOM   102   C CB  . ILE A  1 46  ? 453.900 87.080  439.656 1.00 48.80  ?  103 ILE A CB  1 
ATOM   103   C CG1 . ILE A  1 46  ? 453.166 87.715  440.839 1.00 47.55  ?  103 ILE A CG1 1 
ATOM   104   C CG2 . ILE A  1 46  ? 454.311 88.159  438.664 1.00 50.30  ?  103 ILE A CG2 1 
ATOM   105   C CD1 . ILE A  1 46  ? 453.987 88.744  441.585 1.00 45.79  ?  103 ILE A CD1 1 
ATOM   106   N N   . ASP A  1 47  ? 453.556 85.785  436.610 1.00 49.92  ?  104 ASP A N   1 
ATOM   107   C CA  . ASP A  1 47  ? 454.265 85.229  435.471 1.00 48.80  ?  104 ASP A CA  1 
ATOM   108   C C   . ASP A  1 47  ? 455.756 85.555  435.556 1.00 54.61  ?  104 ASP A C   1 
ATOM   109   O O   . ASP A  1 47  ? 456.176 86.515  436.210 1.00 54.42  ?  104 ASP A O   1 
ATOM   110   C CB  . ASP A  1 47  ? 453.673 85.753  434.163 1.00 57.02  ?  104 ASP A CB  1 
ATOM   111   C CG  . ASP A  1 47  ? 452.241 85.297  433.948 1.00 61.52  ?  104 ASP A CG  1 
ATOM   112   O OD1 . ASP A  1 47  ? 451.515 85.127  434.949 1.00 61.65  ?  104 ASP A OD1 1 
ATOM   113   O OD2 . ASP A  1 47  ? 451.842 85.107  432.779 1.00 62.82  -1 104 ASP A OD2 1 
ATOM   114   N N   . GLY A  1 48  ? 456.559 84.736  434.881 1.00 69.29  ?  105 GLY A N   1 
ATOM   115   C CA  . GLY A  1 48  ? 457.993 84.897  434.886 1.00 66.98  ?  105 GLY A CA  1 
ATOM   116   C C   . GLY A  1 48  ? 458.718 83.836  435.693 1.00 65.37  ?  105 GLY A C   1 
ATOM   117   O O   . GLY A  1 48  ? 458.106 82.936  436.276 1.00 70.60  ?  105 GLY A O   1 
ATOM   118   N N   . PRO A  1 49  ? 460.046 83.928  435.732 1.00 28.86  ?  106 PRO A N   1 
ATOM   119   C CA  . PRO A  1 49  ? 460.849 82.881  436.374 1.00 31.83  ?  106 PRO A CA  1 
ATOM   120   C C   . PRO A  1 49  ? 460.622 82.812  437.877 1.00 34.02  ?  106 PRO A C   1 
ATOM   121   O O   . PRO A  1 49  ? 460.092 83.733  438.503 1.00 40.99  ?  106 PRO A O   1 
ATOM   122   C CB  . PRO A  1 49  ? 462.292 83.293  436.056 1.00 40.33  ?  106 PRO A CB  1 
ATOM   123   C CG  . PRO A  1 49  ? 462.183 84.232  434.894 1.00 45.34  ?  106 PRO A CG  1 
ATOM   124   C CD  . PRO A  1 49  ? 460.884 84.947  435.082 1.00 36.54  ?  106 PRO A CD  1 
ATOM   125   N N   . LEU A  1 50  ? 461.045 81.690  438.454 1.00 24.85  ?  107 LEU A N   1 
ATOM   126   C CA  . LEU A  1 50  ? 460.888 81.415  439.876 1.00 27.36  ?  107 LEU A CA  1 
ATOM   127   C C   . LEU A  1 50  ? 462.238 81.485  440.578 1.00 26.54  ?  107 LEU A C   1 
ATOM   128   O O   . LEU A  1 50  ? 463.230 80.940  440.080 1.00 29.69  ?  107 LEU A O   1 
ATOM   129   C CB  . LEU A  1 50  ? 460.261 80.036  440.104 1.00 26.54  ?  107 LEU A CB  1 
ATOM   130   C CG  . LEU A  1 50  ? 458.811 79.809  439.673 1.00 29.91  ?  107 LEU A CG  1 
ATOM   131   C CD1 . LEU A  1 50  ? 458.376 78.390  440.015 1.00 16.88  ?  107 LEU A CD1 1 
ATOM   132   C CD2 . LEU A  1 50  ? 457.889 80.828  440.321 1.00 28.71  ?  107 LEU A CD2 1 
ATOM   133   N N   . SER A  1 51  ? 462.272 82.161  441.724 1.00 23.93  ?  108 SER A N   1 
ATOM   134   C CA  . SER A  1 51  ? 463.432 82.142  442.602 1.00 28.30  ?  108 SER A CA  1 
ATOM   135   C C   . SER A  1 51  ? 463.460 80.848  443.415 1.00 29.18  ?  108 SER A C   1 
ATOM   136   O O   . SER A  1 51  ? 462.438 80.186  443.610 1.00 32.86  ?  108 SER A O   1 
ATOM   137   C CB  . SER A  1 51  ? 463.422 83.354  443.535 1.00 22.60  ?  108 SER A CB  1 
ATOM   138   O OG  . SER A  1 51  ? 463.421 84.565  442.801 1.00 20.59  ?  108 SER A OG  1 
ATOM   139   N N   . TRP A  1 52  ? 464.651 80.489  443.892 1.00 31.49  ?  109 TRP A N   1 
ATOM   140   C CA  . TRP A  1 52  ? 464.836 79.232  444.604 1.00 31.69  ?  109 TRP A CA  1 
ATOM   141   C C   . TRP A  1 52  ? 465.754 79.432  445.801 1.00 35.64  ?  109 TRP A C   1 
ATOM   142   O O   . TRP A  1 52  ? 466.559 80.365  445.847 1.00 42.41  ?  109 TRP A O   1 
ATOM   143   C CB  . TRP A  1 52  ? 465.414 78.149  443.683 1.00 37.14  ?  109 TRP A CB  1 
ATOM   144   C CG  . TRP A  1 52  ? 464.635 77.960  442.423 1.00 31.97  ?  109 TRP A CG  1 
ATOM   145   C CD1 . TRP A  1 52  ? 464.778 78.659  441.261 1.00 31.33  ?  109 TRP A CD1 1 
ATOM   146   C CD2 . TRP A  1 52  ? 463.588 77.011  442.195 1.00 28.40  ?  109 TRP A CD2 1 
ATOM   147   N NE1 . TRP A  1 52  ? 463.884 78.204  440.323 1.00 28.49  ?  109 TRP A NE1 1 
ATOM   148   C CE2 . TRP A  1 52  ? 463.142 77.192  440.872 1.00 28.55  ?  109 TRP A CE2 1 
ATOM   149   C CE3 . TRP A  1 52  ? 462.985 76.025  442.981 1.00 29.07  ?  109 TRP A CE3 1 
ATOM   150   C CZ2 . TRP A  1 52  ? 462.121 76.425  440.318 1.00 27.99  ?  109 TRP A CZ2 1 
ATOM   151   C CZ3 . TRP A  1 52  ? 461.972 75.265  442.429 1.00 25.96  ?  109 TRP A CZ3 1 
ATOM   152   C CH2 . TRP A  1 52  ? 461.550 75.469  441.110 1.00 24.77  ?  109 TRP A CH2 1 
ATOM   153   N N   . TYR A  1 53  ? 465.622 78.531  446.777 1.00 48.69  ?  110 TYR A N   1 
ATOM   154   C CA  . TYR A  1 53  ? 466.518 78.467  447.929 1.00 51.44  ?  110 TYR A CA  1 
ATOM   155   C C   . TYR A  1 53  ? 467.577 77.408  447.644 1.00 49.73  ?  110 TYR A C   1 
ATOM   156   O O   . TYR A  1 53  ? 467.273 76.213  447.594 1.00 50.98  ?  110 TYR A O   1 
ATOM   157   C CB  . TYR A  1 53  ? 465.757 78.130  449.210 1.00 53.56  ?  110 TYR A CB  1 
ATOM   158   C CG  . TYR A  1 53  ? 464.768 79.180  449.666 1.00 56.21  ?  110 TYR A CG  1 
ATOM   159   C CD1 . TYR A  1 53  ? 465.199 80.416  450.126 1.00 55.91  ?  110 TYR A CD1 1 
ATOM   160   C CD2 . TYR A  1 53  ? 463.403 78.921  449.662 1.00 52.41  ?  110 TYR A CD2 1 
ATOM   161   C CE1 . TYR A  1 53  ? 464.297 81.375  450.553 1.00 64.87  ?  110 TYR A CE1 1 
ATOM   162   C CE2 . TYR A  1 53  ? 462.494 79.871  450.088 1.00 54.27  ?  110 TYR A CE2 1 
ATOM   163   C CZ  . TYR A  1 53  ? 462.945 81.096  450.532 1.00 65.15  ?  110 TYR A CZ  1 
ATOM   164   O OH  . TYR A  1 53  ? 462.044 82.044  450.956 1.00 70.33  ?  110 TYR A OH  1 
ATOM   165   N N   . SER A  1 54  ? 468.819 77.846  447.449 1.00 50.01  ?  111 SER A N   1 
ATOM   166   C CA  . SER A  1 54  ? 469.925 76.943  447.164 1.00 52.86  ?  111 SER A CA  1 
ATOM   167   C C   . SER A  1 54  ? 470.784 76.622  448.381 1.00 59.06  ?  111 SER A C   1 
ATOM   168   O O   . SER A  1 54  ? 471.730 75.839  448.258 1.00 62.15  ?  111 SER A O   1 
ATOM   169   C CB  . SER A  1 54  ? 470.807 77.531  446.062 1.00 60.04  ?  111 SER A CB  1 
ATOM   170   O OG  . SER A  1 54  ? 471.228 78.843  446.396 1.00 71.27  ?  111 SER A OG  1 
ATOM   171   N N   . ASP A  1 55  ? 470.484 77.198  449.547 1.00 65.37  ?  112 ASP A N   1 
ATOM   172   C CA  . ASP A  1 55  ? 471.396 77.148  450.684 1.00 70.14  ?  112 ASP A CA  1 
ATOM   173   C C   . ASP A  1 55  ? 471.194 75.855  451.465 1.00 65.08  ?  112 ASP A C   1 
ATOM   174   O O   . ASP A  1 55  ? 470.138 75.684  452.094 1.00 66.05  ?  112 ASP A O   1 
ATOM   175   C CB  . ASP A  1 55  ? 471.172 78.353  451.592 1.00 72.57  ?  112 ASP A CB  1 
ATOM   176   C CG  . ASP A  1 55  ? 472.304 78.562  452.590 1.00 88.95  ?  112 ASP A CG  1 
ATOM   177   O OD1 . ASP A  1 55  ? 472.993 77.584  452.948 1.00 87.06  ?  112 ASP A OD1 1 
ATOM   178   O OD2 . ASP A  1 55  ? 472.499 79.716  453.025 1.00 96.07  -1 112 ASP A OD2 1 
ATOM   179   N N   . PRO A  1 56  ? 472.166 74.940  451.482 1.00 55.70  ?  113 PRO A N   1 
ATOM   180   C CA  . PRO A  1 56  ? 472.045 73.760  452.346 1.00 54.47  ?  113 PRO A CA  1 
ATOM   181   C C   . PRO A  1 56  ? 471.948 74.177  453.805 1.00 67.53  ?  113 PRO A C   1 
ATOM   182   O O   . PRO A  1 56  ? 472.605 75.121  454.248 1.00 72.95  ?  113 PRO A O   1 
ATOM   183   C CB  . PRO A  1 56  ? 473.331 72.975  452.064 1.00 56.64  ?  113 PRO A CB  1 
ATOM   184   C CG  . PRO A  1 56  ? 473.812 73.484  450.743 1.00 54.50  ?  113 PRO A CG  1 
ATOM   185   C CD  . PRO A  1 56  ? 473.421 74.929  450.714 1.00 62.12  ?  113 PRO A CD  1 
ATOM   186   N N   . GLY A  1 57  ? 471.122 73.456  454.555 1.00 60.98  ?  114 GLY A N   1 
ATOM   187   C CA  . GLY A  1 57  ? 470.686 73.884  455.860 1.00 56.75  ?  114 GLY A CA  1 
ATOM   188   C C   . GLY A  1 57  ? 469.263 74.398  455.884 1.00 60.73  ?  114 GLY A C   1 
ATOM   189   O O   . GLY A  1 57  ? 468.671 74.499  456.964 1.00 71.70  ?  114 GLY A O   1 
ATOM   190   N N   . LEU A  1 58  ? 468.713 74.744  454.723 1.00 43.24  ?  115 LEU A N   1 
ATOM   191   C CA  . LEU A  1 58  ? 467.280 74.942  454.595 1.00 44.50  ?  115 LEU A CA  1 
ATOM   192   C C   . LEU A  1 58  ? 466.569 73.593  454.673 1.00 44.73  ?  115 LEU A C   1 
ATOM   193   O O   . LEU A  1 58  ? 467.179 72.532  454.516 1.00 40.36  ?  115 LEU A O   1 
ATOM   194   C CB  . LEU A  1 58  ? 466.940 75.648  453.281 1.00 44.42  ?  115 LEU A CB  1 
ATOM   195   C CG  . LEU A  1 58  ? 466.853 77.177  453.285 1.00 39.63  ?  115 LEU A CG  1 
ATOM   196   C CD1 . LEU A  1 58  ? 465.760 77.652  454.230 1.00 49.47  ?  115 LEU A CD1 1 
ATOM   197   C CD2 . LEU A  1 58  ? 468.185 77.810  453.641 1.00 41.05  ?  115 LEU A CD2 1 
ATOM   198   N N   . ALA A  1 59  ? 465.264 73.649  454.941 1.00 84.89  ?  116 ALA A N   1 
ATOM   199   C CA  . ALA A  1 59  ? 464.460 72.464  455.222 1.00 80.15  ?  116 ALA A CA  1 
ATOM   200   C C   . ALA A  1 59  ? 464.664 71.338  454.214 1.00 70.14  ?  116 ALA A C   1 
ATOM   201   O O   . ALA A  1 59  ? 465.256 70.305  454.546 1.00 74.94  ?  116 ALA A O   1 
ATOM   202   C CB  . ALA A  1 59  ? 462.978 72.839  455.278 1.00 90.58  ?  116 ALA A CB  1 
ATOM   203   N N   . GLY A  1 60  ? 464.184 71.520  452.985 1.00 62.55  ?  117 GLY A N   1 
ATOM   204   C CA  . GLY A  1 60  ? 464.194 70.461  451.997 1.00 63.83  ?  117 GLY A CA  1 
ATOM   205   C C   . GLY A  1 60  ? 465.153 70.593  450.837 1.00 59.55  ?  117 GLY A C   1 
ATOM   206   O O   . GLY A  1 60  ? 465.018 69.842  449.861 1.00 56.23  ?  117 GLY A O   1 
ATOM   207   N N   . VAL A  1 61  ? 466.121 71.505  450.889 1.00 44.75  ?  118 VAL A N   1 
ATOM   208   C CA  . VAL A  1 61  ? 466.999 71.755  449.752 1.00 42.14  ?  118 VAL A CA  1 
ATOM   209   C C   . VAL A  1 61  ? 468.299 70.982  449.927 1.00 38.38  ?  118 VAL A C   1 
ATOM   210   O O   . VAL A  1 61  ? 468.790 70.782  451.047 1.00 44.54  ?  118 VAL A O   1 
ATOM   211   C CB  . VAL A  1 61  ? 467.271 73.262  449.559 1.00 42.46  ?  118 VAL A CB  1 
ATOM   212   C CG1 . VAL A  1 61  ? 465.976 74.052  449.620 1.00 50.66  ?  118 VAL A CG1 1 
ATOM   213   C CG2 . VAL A  1 61  ? 468.264 73.767  450.580 1.00 50.54  ?  118 VAL A CG2 1 
ATOM   214   N N   . SER A  1 62  ? 468.845 70.512  448.807 1.00 27.46  ?  119 SER A N   1 
ATOM   215   C CA  . SER A  1 62  ? 470.140 69.848  448.787 1.00 33.61  ?  119 SER A CA  1 
ATOM   216   C C   . SER A  1 62  ? 470.889 70.267  447.533 1.00 33.78  ?  119 SER A C   1 
ATOM   217   O O   . SER A  1 62  ? 470.328 70.232  446.434 1.00 35.25  ?  119 SER A O   1 
ATOM   218   C CB  . SER A  1 62  ? 469.982 68.322  448.828 1.00 30.71  ?  119 SER A CB  1 
ATOM   219   O OG  . SER A  1 62  ? 469.278 67.917  449.990 1.00 30.62  ?  119 SER A OG  1 
ATOM   220   N N   . LEU A  1 63  ? 472.148 70.670  447.695 1.00 36.08  ?  120 LEU A N   1 
ATOM   221   C CA  . LEU A  1 63  ? 472.986 71.069  446.571 1.00 32.55  ?  120 LEU A CA  1 
ATOM   222   C C   . LEU A  1 63  ? 474.368 70.463  446.756 1.00 42.52  ?  120 LEU A C   1 
ATOM   223   O O   . LEU A  1 63  ? 475.044 70.748  447.749 1.00 51.42  ?  120 LEU A O   1 
ATOM   224   C CB  . LEU A  1 63  ? 473.072 72.594  446.461 1.00 30.77  ?  120 LEU A CB  1 
ATOM   225   C CG  . LEU A  1 63  ? 473.335 73.157  445.064 1.00 37.31  ?  120 LEU A CG  1 
ATOM   226   C CD1 . LEU A  1 63  ? 472.215 72.772  444.115 1.00 34.81  ?  120 LEU A CD1 1 
ATOM   227   C CD2 . LEU A  1 63  ? 473.496 74.666  445.117 1.00 48.15  ?  120 LEU A CD2 1 
ATOM   228   N N   . THR A  1 64  ? 474.786 69.633  445.805 1.00 34.39  ?  121 THR A N   1 
ATOM   229   C CA  . THR A  1 64  ? 476.063 68.941  445.880 1.00 38.38  ?  121 THR A CA  1 
ATOM   230   C C   . THR A  1 64  ? 477.071 69.582  444.931 1.00 41.46  ?  121 THR A C   1 
ATOM   231   O O   . THR A  1 64  ? 476.791 70.573  444.253 1.00 40.76  ?  121 THR A O   1 
ATOM   232   C CB  . THR A  1 64  ? 475.890 67.454  445.566 1.00 38.65  ?  121 THR A CB  1 
ATOM   233   O OG1 . THR A  1 64  ? 475.504 67.292  444.194 1.00 36.18  ?  121 THR A OG1 1 
ATOM   234   C CG2 . THR A  1 64  ? 474.825 66.847  446.462 1.00 35.53  ?  121 THR A CG2 1 
ATOM   235   N N   . GLY A  1 65  ? 478.265 68.999  444.888 1.00 45.29  ?  122 GLY A N   1 
ATOM   236   C CA  . GLY A  1 65  ? 479.304 69.512  444.020 1.00 47.68  ?  122 GLY A CA  1 
ATOM   237   C C   . GLY A  1 65  ? 478.961 69.330  442.553 1.00 41.68  ?  122 GLY A C   1 
ATOM   238   O O   . GLY A  1 65  ? 478.307 68.369  442.151 1.00 37.03  ?  122 GLY A O   1 
ATOM   239   N N   . GLY A  1 66  ? 479.415 70.284  441.742 1.00 74.65  ?  123 GLY A N   1 
ATOM   240   C CA  . GLY A  1 66  ? 479.141 70.278  440.324 1.00 74.75  ?  123 GLY A CA  1 
ATOM   241   C C   . GLY A  1 66  ? 477.862 70.978  439.919 1.00 73.79  ?  123 GLY A C   1 
ATOM   242   O O   . GLY A  1 66  ? 477.629 71.156  438.717 1.00 80.34  ?  123 GLY A O   1 
ATOM   243   N N   . LEU A  1 67  ? 477.025 71.373  440.874 1.00 38.42  ?  124 LEU A N   1 
ATOM   244   C CA  . LEU A  1 67  ? 475.789 72.088  440.589 1.00 33.98  ?  124 LEU A CA  1 
ATOM   245   C C   . LEU A  1 67  ? 475.749 73.354  441.427 1.00 35.63  ?  124 LEU A C   1 
ATOM   246   O O   . LEU A  1 67  ? 475.875 73.293  442.655 1.00 40.31  ?  124 LEU A O   1 
ATOM   247   C CB  . LEU A  1 67  ? 474.561 71.218  440.870 1.00 36.66  ?  124 LEU A CB  1 
ATOM   248   C CG  . LEU A  1 67  ? 474.043 70.363  439.712 1.00 36.16  ?  124 LEU A CG  1 
ATOM   249   C CD1 . LEU A  1 67  ? 474.967 69.193  439.419 1.00 42.97  ?  124 LEU A CD1 1 
ATOM   250   C CD2 . LEU A  1 67  ? 472.640 69.879  440.007 1.00 36.15  ?  124 LEU A CD2 1 
ATOM   251   N N   . SER A  1 68  ? 475.573 74.493  440.767 1.00 41.67  ?  125 SER A N   1 
ATOM   252   C CA  . SER A  1 68  ? 475.463 75.779  441.437 1.00 45.58  ?  125 SER A CA  1 
ATOM   253   C C   . SER A  1 68  ? 474.205 76.487  440.962 1.00 45.98  ?  125 SER A C   1 
ATOM   254   O O   . SER A  1 68  ? 473.748 76.286  439.833 1.00 47.32  ?  125 SER A O   1 
ATOM   255   C CB  . SER A  1 68  ? 476.691 76.662  441.173 1.00 54.97  ?  125 SER A CB  1 
ATOM   256   O OG  . SER A  1 68  ? 476.962 76.760  439.786 1.00 54.67  ?  125 SER A OG  1 
ATOM   257   N N   . TYR A  1 69  ? 473.649 77.315  441.837 1.00 32.46  ?  126 TYR A N   1 
ATOM   258   C CA  . TYR A  1 69  ? 472.473 78.116  441.529 1.00 33.42  ?  126 TYR A CA  1 
ATOM   259   C C   . TYR A  1 69  ? 472.910 79.558  441.311 1.00 37.58  ?  126 TYR A C   1 
ATOM   260   O O   . TYR A  1 69  ? 473.537 80.159  442.190 1.00 41.20  ?  126 TYR A O   1 
ATOM   261   C CB  . TYR A  1 69  ? 471.445 78.019  442.655 1.00 34.50  ?  126 TYR A CB  1 
ATOM   262   C CG  . TYR A  1 69  ? 470.287 78.990  442.553 1.00 38.67  ?  126 TYR A CG  1 
ATOM   263   C CD1 . TYR A  1 69  ? 469.223 78.746  441.696 1.00 39.57  ?  126 TYR A CD1 1 
ATOM   264   C CD2 . TYR A  1 69  ? 470.251 80.141  443.331 1.00 42.85  ?  126 TYR A CD2 1 
ATOM   265   C CE1 . TYR A  1 69  ? 468.160 79.629  441.606 1.00 38.29  ?  126 TYR A CE1 1 
ATOM   266   C CE2 . TYR A  1 69  ? 469.194 81.028  443.247 1.00 40.76  ?  126 TYR A CE2 1 
ATOM   267   C CZ  . TYR A  1 69  ? 468.152 80.767  442.385 1.00 41.56  ?  126 TYR A CZ  1 
ATOM   268   O OH  . TYR A  1 69  ? 467.098 81.648  442.300 1.00 45.32  ?  126 TYR A OH  1 
ATOM   269   N N   . LYS A  1 70  ? 472.577 80.110  440.148 1.00 44.97  ?  127 LYS A N   1 
ATOM   270   C CA  . LYS A  1 70  ? 472.927 81.487  439.823 1.00 45.44  ?  127 LYS A CA  1 
ATOM   271   C C   . LYS A  1 70  ? 471.784 82.380  440.285 1.00 52.37  ?  127 LYS A C   1 
ATOM   272   O O   . LYS A  1 70  ? 470.683 82.335  439.725 1.00 51.81  ?  127 LYS A O   1 
ATOM   273   C CB  . LYS A  1 70  ? 473.187 81.649  438.326 1.00 46.53  ?  127 LYS A CB  1 
ATOM   274   C CG  . LYS A  1 70  ? 474.590 81.255  437.880 1.00 49.38  ?  127 LYS A CG  1 
ATOM   275   C CD  . LYS A  1 70  ? 474.930 81.874  436.530 1.00 60.20  ?  127 LYS A CD  1 
ATOM   276   C CE  . LYS A  1 70  ? 476.423 81.810  436.237 1.00 65.92  ?  127 LYS A CE  1 
ATOM   277   N NZ  . LYS A  1 70  ? 476.856 80.462  435.775 1.00 52.45  ?  127 LYS A NZ  1 
ATOM   278   N N   . GLU A  1 71  ? 472.046 83.192  441.309 1.00 82.01  ?  128 GLU A N   1 
ATOM   279   C CA  . GLU A  1 71  ? 471.014 84.042  441.887 1.00 82.85  ?  128 GLU A CA  1 
ATOM   280   C C   . GLU A  1 71  ? 470.677 85.234  441.003 1.00 88.60  ?  128 GLU A C   1 
ATOM   281   O O   . GLU A  1 71  ? 469.702 85.940  441.284 1.00 85.82  ?  128 GLU A O   1 
ATOM   282   C CB  . GLU A  1 71  ? 471.456 84.514  443.274 1.00 82.08  ?  128 GLU A CB  1 
ATOM   283   C CG  . GLU A  1 71  ? 470.314 84.843  444.223 1.00 92.11  ?  128 GLU A CG  1 
ATOM   284   C CD  . GLU A  1 71  ? 470.601 84.403  445.647 1.00 100.14 ?  128 GLU A CD  1 
ATOM   285   O OE1 . GLU A  1 71  ? 469.754 83.696  446.234 1.00 93.58  ?  128 GLU A OE1 1 
ATOM   286   O OE2 . GLU A  1 71  ? 471.674 84.760  446.178 1.00 99.11  -1 128 GLU A OE2 1 
ATOM   287   N N   . ASP A  1 72  ? 471.451 85.469  439.943 1.00 100.80 ?  129 ASP A N   1 
ATOM   288   C CA  . ASP A  1 72  ? 471.148 86.549  439.013 1.00 101.00 ?  129 ASP A CA  1 
ATOM   289   C C   . ASP A  1 72  ? 469.976 86.176  438.111 1.00 99.91  ?  129 ASP A C   1 
ATOM   290   O O   . ASP A  1 72  ? 468.909 86.794  438.170 1.00 101.34 ?  129 ASP A O   1 
ATOM   291   C CB  . ASP A  1 72  ? 472.385 86.881  438.173 1.00 99.75  ?  129 ASP A CB  1 
ATOM   292   C CG  . ASP A  1 72  ? 473.658 86.908  438.996 1.00 112.05 ?  129 ASP A CG  1 
ATOM   293   O OD1 . ASP A  1 72  ? 473.592 87.273  440.190 1.00 117.58 ?  129 ASP A OD1 1 
ATOM   294   O OD2 . ASP A  1 72  ? 474.727 86.561  438.450 1.00 112.18 -1 129 ASP A OD2 1 
ATOM   295   N N   . THR A  1 73  ? 470.161 85.157  437.276 1.00 65.20  ?  130 THR A N   1 
ATOM   296   C CA  . THR A  1 73  ? 469.149 84.728  436.321 1.00 60.22  ?  130 THR A CA  1 
ATOM   297   C C   . THR A  1 73  ? 468.244 83.625  436.859 1.00 58.94  ?  130 THR A C   1 
ATOM   298   O O   . THR A  1 73  ? 467.384 83.138  436.117 1.00 60.69  ?  130 THR A O   1 
ATOM   299   C CB  . THR A  1 73  ? 469.823 84.263  435.026 1.00 54.78  ?  130 THR A CB  1 
ATOM   300   O OG1 . THR A  1 73  ? 470.985 83.488  435.343 1.00 53.88  ?  130 THR A OG1 1 
ATOM   301   C CG2 . THR A  1 73  ? 470.235 85.458  434.181 1.00 60.18  ?  130 THR A CG2 1 
ATOM   302   N N   . LYS A  1 74  ? 468.417 83.225  438.122 1.00 58.15  ?  131 LYS A N   1 
ATOM   303   C CA  . LYS A  1 74  ? 467.551 82.243  438.784 1.00 56.54  ?  131 LYS A CA  1 
ATOM   304   C C   . LYS A  1 74  ? 467.507 80.921  438.018 1.00 47.55  ?  131 LYS A C   1 
ATOM   305   O O   . LYS A  1 74  ? 466.441 80.345  437.786 1.00 46.66  ?  131 LYS A O   1 
ATOM   306   C CB  . LYS A  1 74  ? 466.139 82.800  438.990 1.00 48.38  ?  131 LYS A CB  1 
ATOM   307   C CG  . LYS A  1 74  ? 466.048 83.919  440.013 1.00 47.54  ?  131 LYS A CG  1 
ATOM   308   C CD  . LYS A  1 74  ? 466.006 85.279  439.341 1.00 51.48  ?  131 LYS A CD  1 
ATOM   309   C CE  . LYS A  1 74  ? 464.748 85.437  438.504 1.00 44.79  ?  131 LYS A CE  1 
ATOM   310   N NZ  . LYS A  1 74  ? 464.661 86.783  437.876 1.00 48.76  ?  131 LYS A NZ  1 
ATOM   311   N N   . GLU A  1 75  ? 468.681 80.438  437.623 1.00 64.80  ?  132 GLU A N   1 
ATOM   312   C CA  . GLU A  1 75  ? 468.792 79.174  436.905 1.00 66.21  ?  132 GLU A CA  1 
ATOM   313   C C   . GLU A  1 75  ? 469.990 78.405  437.437 1.00 61.57  ?  132 GLU A C   1 
ATOM   314   O O   . GLU A  1 75  ? 471.108 78.929  437.450 1.00 65.19  ?  132 GLU A O   1 
ATOM   315   C CB  . GLU A  1 75  ? 468.914 79.412  435.396 1.00 69.87  ?  132 GLU A CB  1 
ATOM   316   C CG  . GLU A  1 75  ? 469.755 80.621  435.037 1.00 71.53  ?  132 GLU A CG  1 
ATOM   317   C CD  . GLU A  1 75  ? 469.432 81.177  433.664 1.00 80.11  ?  132 GLU A CD  1 
ATOM   318   O OE1 . GLU A  1 75  ? 470.165 80.873  432.706 1.00 79.19  ?  132 GLU A OE1 1 
ATOM   319   O OE2 . GLU A  1 75  ? 468.439 81.926  433.544 1.00 82.56  -1 132 GLU A OE2 1 
ATOM   320   N N   . LEU A  1 76  ? 469.759 77.172  437.882 1.00 36.43  ?  133 LEU A N   1 
ATOM   321   C CA  . LEU A  1 76  ? 470.847 76.330  438.352 1.00 42.07  ?  133 LEU A CA  1 
ATOM   322   C C   . LEU A  1 76  ? 471.600 75.733  437.170 1.00 42.48  ?  133 LEU A C   1 
ATOM   323   O O   . LEU A  1 76  ? 471.041 75.516  436.091 1.00 40.37  ?  133 LEU A O   1 
ATOM   324   C CB  . LEU A  1 76  ? 470.328 75.216  439.265 1.00 34.83  ?  133 LEU A CB  1 
ATOM   325   C CG  . LEU A  1 76  ? 469.740 73.951  438.637 1.00 31.57  ?  133 LEU A CG  1 
ATOM   326   C CD1 . LEU A  1 76  ? 469.683 72.830  439.664 1.00 23.28  ?  133 LEU A CD1 1 
ATOM   327   C CD2 . LEU A  1 76  ? 468.356 74.221  438.074 1.00 39.80  ?  133 LEU A CD2 1 
ATOM   328   N N   . VAL A  1 77  ? 472.887 75.470  437.383 1.00 37.85  ?  134 VAL A N   1 
ATOM   329   C CA  . VAL A  1 77  ? 473.791 75.029  436.329 1.00 35.20  ?  134 VAL A CA  1 
ATOM   330   C C   . VAL A  1 77  ? 474.282 73.625  436.647 1.00 41.90  ?  134 VAL A C   1 
ATOM   331   O O   . VAL A  1 77  ? 474.605 73.315  437.799 1.00 44.73  ?  134 VAL A O   1 
ATOM   332   C CB  . VAL A  1 77  ? 474.981 75.996  436.167 1.00 32.50  ?  134 VAL A CB  1 
ATOM   333   C CG1 . VAL A  1 77  ? 475.775 75.660  434.915 1.00 47.57  ?  134 VAL A CG1 1 
ATOM   334   C CG2 . VAL A  1 77  ? 474.493 77.436  436.132 1.00 39.79  ?  134 VAL A CG2 1 
ATOM   335   N N   . VAL A  1 78  ? 474.338 72.779  435.623 1.00 63.33  ?  135 VAL A N   1 
ATOM   336   C CA  . VAL A  1 78  ? 474.880 71.429  435.727 1.00 61.50  ?  135 VAL A CA  1 
ATOM   337   C C   . VAL A  1 78  ? 476.212 71.422  434.992 1.00 63.32  ?  135 VAL A C   1 
ATOM   338   O O   . VAL A  1 78  ? 476.257 71.581  433.766 1.00 63.47  ?  135 VAL A O   1 
ATOM   339   C CB  . VAL A  1 78  ? 473.919 70.379  435.155 1.00 54.17  ?  135 VAL A CB  1 
ATOM   340   C CG1 . VAL A  1 78  ? 474.438 68.977  435.433 1.00 58.97  ?  135 VAL A CG1 1 
ATOM   341   C CG2 . VAL A  1 78  ? 472.526 70.564  435.735 1.00 55.91  ?  135 VAL A CG2 1 
ATOM   342   N N   . ALA A  1 79  ? 477.305 71.246  435.739 1.00 36.82  ?  136 ALA A N   1 
ATOM   343   C CA  . ALA A  1 79  ? 478.631 71.327  435.139 1.00 36.47  ?  136 ALA A CA  1 
ATOM   344   C C   . ALA A  1 79  ? 478.929 70.107  434.276 1.00 43.58  ?  136 ALA A C   1 
ATOM   345   O O   . ALA A  1 79  ? 479.335 70.238  433.115 1.00 49.25  ?  136 ALA A O   1 
ATOM   346   C CB  . ALA A  1 79  ? 479.692 71.487  436.228 1.00 38.92  ?  136 ALA A CB  1 
ATOM   347   N N   . LYS A  1 80  ? 478.729 68.910  434.822 1.00 81.03  ?  137 LYS A N   1 
ATOM   348   C CA  . LYS A  1 80  ? 479.091 67.675  434.137 1.00 82.83  ?  137 LYS A CA  1 
ATOM   349   C C   . LYS A  1 80  ? 477.903 67.175  433.323 1.00 74.79  ?  137 LYS A C   1 
ATOM   350   O O   . LYS A  1 80  ? 476.812 66.973  433.866 1.00 78.28  ?  137 LYS A O   1 
ATOM   351   C CB  . LYS A  1 80  ? 479.544 66.618  435.143 1.00 84.79  ?  137 LYS A CB  1 
ATOM   352   C CG  . LYS A  1 80  ? 480.548 67.137  436.161 1.00 94.65  ?  137 LYS A CG  1 
ATOM   353   C CD  . LYS A  1 80  ? 481.809 67.658  435.487 1.00 92.80  ?  137 LYS A CD  1 
ATOM   354   C CE  . LYS A  1 80  ? 482.561 68.616  436.397 1.00 94.39  ?  137 LYS A CE  1 
ATOM   355   N NZ  . LYS A  1 80  ? 482.780 68.044  437.754 1.00 74.37  ?  137 LYS A NZ  1 
ATOM   356   N N   . ALA A  1 81  ? 478.120 66.975  432.026 1.00 36.21  ?  138 ALA A N   1 
ATOM   357   C CA  . ALA A  1 81  ? 477.056 66.522  431.145 1.00 34.36  ?  138 ALA A CA  1 
ATOM   358   C C   . ALA A  1 81  ? 476.693 65.068  431.436 1.00 35.70  ?  138 ALA A C   1 
ATOM   359   O O   . ALA A  1 81  ? 477.475 64.302  432.007 1.00 43.93  ?  138 ALA A O   1 
ATOM   360   C CB  . ALA A  1 81  ? 477.467 66.676  429.682 1.00 30.76  ?  138 ALA A CB  1 
ATOM   361   N N   . GLY A  1 82  ? 475.488 64.695  431.036 1.00 54.27  ?  139 GLY A N   1 
ATOM   362   C CA  . GLY A  1 82  ? 475.016 63.342  431.231 1.00 52.28  ?  139 GLY A CA  1 
ATOM   363   C C   . GLY A  1 82  ? 473.502 63.292  431.173 1.00 47.72  ?  139 GLY A C   1 
ATOM   364   O O   . GLY A  1 82  ? 472.840 64.257  430.795 1.00 48.13  ?  139 GLY A O   1 
ATOM   365   N N   . VAL A  1 83  ? 472.972 62.132  431.555 1.00 22.22  ?  140 VAL A N   1 
ATOM   366   C CA  . VAL A  1 83  ? 471.534 61.903  431.623 1.00 13.37  ?  140 VAL A CA  1 
ATOM   367   C C   . VAL A  1 83  ? 471.102 62.015  433.077 1.00 13.13  ?  140 VAL A C   1 
ATOM   368   O O   . VAL A  1 83  ? 471.667 61.351  433.955 1.00 16.65  ?  140 VAL A O   1 
ATOM   369   C CB  . VAL A  1 83  ? 471.158 60.533  431.036 1.00 12.34  ?  140 VAL A CB  1 
ATOM   370   C CG1 . VAL A  1 83  ? 469.662 60.295  431.165 1.00 20.12  ?  140 VAL A CG1 1 
ATOM   371   C CG2 . VAL A  1 83  ? 471.590 60.446  429.581 1.00 12.11  ?  140 VAL A CG2 1 
ATOM   372   N N   . TYR A  1 84  ? 470.104 62.856  433.334 1.00 16.80  ?  141 TYR A N   1 
ATOM   373   C CA  . TYR A  1 84  ? 469.641 63.126  434.684 1.00 17.67  ?  141 TYR A CA  1 
ATOM   374   C C   . TYR A  1 84  ? 468.136 62.918  434.768 1.00 16.82  ?  141 TYR A C   1 
ATOM   375   O O   . TYR A  1 84  ? 467.412 63.097  433.785 1.00 20.25  ?  141 TYR A O   1 
ATOM   376   C CB  . TYR A  1 84  ? 469.981 64.556  435.118 1.00 22.33  ?  141 TYR A CB  1 
ATOM   377   C CG  . TYR A  1 84  ? 471.460 64.840  435.263 1.00 20.71  ?  141 TYR A CG  1 
ATOM   378   C CD1 . TYR A  1 84  ? 472.249 65.123  434.157 1.00 25.29  ?  141 TYR A CD1 1 
ATOM   379   C CD2 . TYR A  1 84  ? 472.062 64.840  436.511 1.00 20.67  ?  141 TYR A CD2 1 
ATOM   380   C CE1 . TYR A  1 84  ? 473.600 65.390  434.294 1.00 29.34  ?  141 TYR A CE1 1 
ATOM   381   C CE2 . TYR A  1 84  ? 473.407 65.109  436.659 1.00 25.91  ?  141 TYR A CE2 1 
ATOM   382   C CZ  . TYR A  1 84  ? 474.171 65.381  435.548 1.00 27.77  ?  141 TYR A CZ  1 
ATOM   383   O OH  . TYR A  1 84  ? 475.512 65.644  435.698 1.00 39.57  ?  141 TYR A OH  1 
ATOM   384   N N   . TYR A  1 85  ? 467.673 62.536  435.955 1.00 15.69  ?  142 TYR A N   1 
ATOM   385   C CA  . TYR A  1 85  ? 466.249 62.453  436.256 1.00 21.13  ?  142 TYR A CA  1 
ATOM   386   C C   . TYR A  1 85  ? 465.852 63.742  436.965 1.00 22.63  ?  142 TYR A C   1 
ATOM   387   O O   . TYR A  1 85  ? 466.319 64.020  438.074 1.00 24.62  ?  142 TYR A O   1 
ATOM   388   C CB  . TYR A  1 85  ? 465.937 61.228  437.114 1.00 19.53  ?  142 TYR A CB  1 
ATOM   389   C CG  . TYR A  1 85  ? 464.461 61.017  437.390 1.00 17.62  ?  142 TYR A CG  1 
ATOM   390   C CD1 . TYR A  1 85  ? 463.829 61.671  438.441 1.00 18.15  ?  142 TYR A CD1 1 
ATOM   391   C CD2 . TYR A  1 85  ? 463.701 60.158  436.605 1.00 22.44  ?  142 TYR A CD2 1 
ATOM   392   C CE1 . TYR A  1 85  ? 462.485 61.481  438.699 1.00 20.31  ?  142 TYR A CE1 1 
ATOM   393   C CE2 . TYR A  1 85  ? 462.354 59.961  436.857 1.00 21.05  ?  142 TYR A CE2 1 
ATOM   394   C CZ  . TYR A  1 85  ? 461.752 60.626  437.905 1.00 16.94  ?  142 TYR A CZ  1 
ATOM   395   O OH  . TYR A  1 85  ? 460.415 60.436  438.163 1.00 15.42  ?  142 TYR A OH  1 
ATOM   396   N N   . VAL A  1 86  ? 464.996 64.529  436.320 1.00 17.78  ?  143 VAL A N   1 
ATOM   397   C CA  . VAL A  1 86  ? 464.524 65.800  436.855 1.00 22.81  ?  143 VAL A CA  1 
ATOM   398   C C   . VAL A  1 86  ? 463.042 65.652  437.160 1.00 26.99  ?  143 VAL A C   1 
ATOM   399   O O   . VAL A  1 86  ? 462.256 65.284  436.278 1.00 32.24  ?  143 VAL A O   1 
ATOM   400   C CB  . VAL A  1 86  ? 464.776 66.953  435.872 1.00 21.48  ?  143 VAL A CB  1 
ATOM   401   C CG1 . VAL A  1 86  ? 464.318 68.272  436.471 1.00 27.01  ?  143 VAL A CG1 1 
ATOM   402   C CG2 . VAL A  1 86  ? 466.247 67.012  435.492 1.00 24.78  ?  143 VAL A CG2 1 
ATOM   403   N N   . PHE A  1 87  ? 462.655 65.935  438.403 1.00 25.52  ?  144 PHE A N   1 
ATOM   404   C CA  . PHE A  1 87  ? 461.263 65.825  438.805 1.00 25.07  ?  144 PHE A CA  1 
ATOM   405   C C   . PHE A  1 87  ? 460.720 67.185  439.226 1.00 22.75  ?  144 PHE A C   1 
ATOM   406   O O   . PHE A  1 87  ? 461.466 68.094  439.602 1.00 20.35  ?  144 PHE A O   1 
ATOM   407   C CB  . PHE A  1 87  ? 461.070 64.794  439.928 1.00 22.37  ?  144 PHE A CB  1 
ATOM   408   C CG  . PHE A  1 87  ? 461.923 65.027  441.141 1.00 24.61  ?  144 PHE A CG  1 
ATOM   409   C CD1 . PHE A  1 87  ? 461.470 65.823  442.180 1.00 30.05  ?  144 PHE A CD1 1 
ATOM   410   C CD2 . PHE A  1 87  ? 463.160 64.419  441.260 1.00 26.39  ?  144 PHE A CD2 1 
ATOM   411   C CE1 . PHE A  1 87  ? 462.244 66.026  443.306 1.00 27.69  ?  144 PHE A CE1 1 
ATOM   412   C CE2 . PHE A  1 87  ? 463.941 64.616  442.383 1.00 29.30  ?  144 PHE A CE2 1 
ATOM   413   C CZ  . PHE A  1 87  ? 463.480 65.417  443.410 1.00 30.94  ?  144 PHE A CZ  1 
ATOM   414   N N   . PHE A  1 88  ? 459.398 67.305  439.149 1.00 34.44  ?  145 PHE A N   1 
ATOM   415   C CA  . PHE A  1 88  ? 458.698 68.573  439.265 1.00 33.00  ?  145 PHE A CA  1 
ATOM   416   C C   . PHE A  1 88  ? 457.609 68.454  440.319 1.00 37.77  ?  145 PHE A C   1 
ATOM   417   O O   . PHE A  1 88  ? 456.900 67.445  440.374 1.00 47.07  ?  145 PHE A O   1 
ATOM   418   C CB  . PHE A  1 88  ? 458.077 68.959  437.919 1.00 47.97  ?  145 PHE A CB  1 
ATOM   419   C CG  . PHE A  1 88  ? 458.378 70.358  437.487 1.00 48.36  ?  145 PHE A CG  1 
ATOM   420   C CD1 . PHE A  1 88  ? 459.660 70.721  437.119 1.00 40.54  ?  145 PHE A CD1 1 
ATOM   421   C CD2 . PHE A  1 88  ? 457.375 71.305  437.423 1.00 52.09  ?  145 PHE A CD2 1 
ATOM   422   C CE1 . PHE A  1 88  ? 459.939 72.006  436.710 1.00 38.12  ?  145 PHE A CE1 1 
ATOM   423   C CE2 . PHE A  1 88  ? 457.652 72.590  437.017 1.00 49.50  ?  145 PHE A CE2 1 
ATOM   424   C CZ  . PHE A  1 88  ? 458.932 72.941  436.659 1.00 41.06  ?  145 PHE A CZ  1 
ATOM   425   N N   . GLN A  1 89  ? 457.467 69.486  441.146 1.00 34.07  ?  146 GLN A N   1 
ATOM   426   C CA  . GLN A  1 89  ? 456.443 69.493  442.184 1.00 33.93  ?  146 GLN A CA  1 
ATOM   427   C C   . GLN A  1 89  ? 455.784 70.860  442.245 1.00 34.01  ?  146 GLN A C   1 
ATOM   428   O O   . GLN A  1 89  ? 456.472 71.881  442.324 1.00 39.03  ?  146 GLN A O   1 
ATOM   429   C CB  . GLN A  1 89  ? 457.028 69.134  443.553 1.00 39.60  ?  146 GLN A CB  1 
ATOM   430   C CG  . GLN A  1 89  ? 457.050 67.648  443.845 1.00 39.87  ?  146 GLN A CG  1 
ATOM   431   C CD  . GLN A  1 89  ? 457.600 67.342  445.219 1.00 45.07  ?  146 GLN A CD  1 
ATOM   432   O OE1 . GLN A  1 89  ? 456.868 66.924  446.118 1.00 41.60  ?  146 GLN A OE1 1 
ATOM   433   N NE2 . GLN A  1 89  ? 458.897 67.559  445.396 1.00 49.26  ?  146 GLN A NE2 1 
ATOM   434   N N   . LEU A  1 90  ? 454.455 70.870  442.205 1.00 36.22  ?  147 LEU A N   1 
ATOM   435   C CA  . LEU A  1 90  ? 453.674 72.092  442.346 1.00 35.85  ?  147 LEU A CA  1 
ATOM   436   C C   . LEU A  1 90  ? 452.502 71.812  443.271 1.00 36.99  ?  147 LEU A C   1 
ATOM   437   O O   . LEU A  1 90  ? 451.685 70.933  442.985 1.00 44.55  ?  147 LEU A O   1 
ATOM   438   C CB  . LEU A  1 90  ? 453.178 72.596  440.988 1.00 38.79  ?  147 LEU A CB  1 
ATOM   439   C CG  . LEU A  1 90  ? 452.404 73.914  441.037 1.00 38.57  ?  147 LEU A CG  1 
ATOM   440   C CD1 . LEU A  1 90  ? 453.278 75.021  441.596 1.00 46.51  ?  147 LEU A CD1 1 
ATOM   441   C CD2 . LEU A  1 90  ? 451.867 74.288  439.666 1.00 35.52  ?  147 LEU A CD2 1 
ATOM   442   N N   . GLU A  1 91  ? 452.422 72.551  444.375 1.00 40.96  ?  148 GLU A N   1 
ATOM   443   C CA  . GLU A  1 91  ? 451.300 72.457  445.298 1.00 47.64  ?  148 GLU A CA  1 
ATOM   444   C C   . GLU A  1 91  ? 450.768 73.857  445.560 1.00 46.28  ?  148 GLU A C   1 
ATOM   445   O O   . GLU A  1 91  ? 451.546 74.780  445.819 1.00 52.14  ?  148 GLU A O   1 
ATOM   446   C CB  . GLU A  1 91  ? 451.703 71.787  446.614 1.00 47.15  ?  148 GLU A CB  1 
ATOM   447   C CG  . GLU A  1 91  ? 450.520 71.359  447.471 1.00 54.60  ?  148 GLU A CG  1 
ATOM   448   C CD  . GLU A  1 91  ? 450.932 70.902  448.856 1.00 68.82  ?  148 GLU A CD  1 
ATOM   449   O OE1 . GLU A  1 91  ? 450.800 71.699  449.810 1.00 62.82  ?  148 GLU A OE1 1 
ATOM   450   O OE2 . GLU A  1 91  ? 451.388 69.746  448.994 1.00 78.30  -1 148 GLU A OE2 1 
ATOM   451   N N   . LEU A  1 92  ? 449.449 74.014  445.488 1.00 22.01  ?  149 LEU A N   1 
ATOM   452   C CA  . LEU A  1 92  ? 448.813 75.305  445.691 1.00 27.83  ?  149 LEU A CA  1 
ATOM   453   C C   . LEU A  1 92  ? 447.696 75.173  446.714 1.00 36.24  ?  149 LEU A C   1 
ATOM   454   O O   . LEU A  1 92  ? 446.999 74.155  446.761 1.00 38.60  ?  149 LEU A O   1 
ATOM   455   C CB  . LEU A  1 92  ? 448.249 75.876  444.383 1.00 28.39  ?  149 LEU A CB  1 
ATOM   456   C CG  . LEU A  1 92  ? 449.206 76.036  443.201 1.00 26.68  ?  149 LEU A CG  1 
ATOM   457   C CD1 . LEU A  1 92  ? 449.193 74.789  442.339 1.00 31.41  ?  149 LEU A CD1 1 
ATOM   458   C CD2 . LEU A  1 92  ? 448.852 77.266  442.377 1.00 23.91  ?  149 LEU A CD2 1 
ATOM   459   N N   . ARG A  1 93  ? 447.537 76.209  447.529 1.00 33.35  ?  150 ARG A N   1 
ATOM   460   C CA  . ARG A  1 93  ? 446.460 76.292  448.500 1.00 30.15  ?  150 ARG A CA  1 
ATOM   461   C C   . ARG A  1 93  ? 445.597 77.507  448.192 1.00 36.06  ?  150 ARG A C   1 
ATOM   462   O O   . ARG A  1 93  ? 446.068 78.494  447.619 1.00 34.99  ?  150 ARG A O   1 
ATOM   463   C CB  . ARG A  1 93  ? 447.005 76.377  449.931 1.00 40.12  ?  150 ARG A CB  1 
ATOM   464   C CG  . ARG A  1 93  ? 448.187 77.322  450.093 1.00 39.59  ?  150 ARG A CG  1 
ATOM   465   C CD  . ARG A  1 93  ? 448.788 77.225  451.489 1.00 44.06  ?  150 ARG A CD  1 
ATOM   466   N NE  . ARG A  1 93  ? 448.108 78.088  452.449 1.00 44.88  ?  150 ARG A NE  1 
ATOM   467   C CZ  . ARG A  1 93  ? 448.577 79.263  452.858 1.00 49.42  ?  150 ARG A CZ  1 
ATOM   468   N NH1 . ARG A  1 93  ? 449.734 79.714  452.391 1.00 50.36  ?  150 ARG A NH1 1 
ATOM   469   N NH2 . ARG A  1 93  ? 447.895 79.985  453.736 1.00 47.02  ?  150 ARG A NH2 1 
ATOM   470   N N   . ARG A  1 94  ? 444.325 77.425  448.574 1.00 26.56  ?  151 ARG A N   1 
ATOM   471   C CA  . ARG A  1 94  ? 443.392 78.531  448.400 1.00 26.33  ?  151 ARG A CA  1 
ATOM   472   C C   . ARG A  1 94  ? 443.455 79.395  449.653 1.00 30.04  ?  151 ARG A C   1 
ATOM   473   O O   . ARG A  1 94  ? 443.098 78.942  450.745 1.00 33.97  ?  151 ARG A O   1 
ATOM   474   C CB  . ARG A  1 94  ? 441.975 78.016  448.154 1.00 29.23  ?  151 ARG A CB  1 
ATOM   475   C CG  . ARG A  1 94  ? 440.993 79.090  447.709 1.00 25.61  ?  151 ARG A CG  1 
ATOM   476   C CD  . ARG A  1 94  ? 439.549 78.616  447.814 1.00 26.35  ?  151 ARG A CD  1 
ATOM   477   N NE  . ARG A  1 94  ? 439.293 77.407  447.036 1.00 24.92  ?  151 ARG A NE  1 
ATOM   478   C CZ  . ARG A  1 94  ? 438.878 77.403  445.774 1.00 23.10  ?  151 ARG A CZ  1 
ATOM   479   N NH1 . ARG A  1 94  ? 438.671 78.547  445.137 1.00 26.84  ?  151 ARG A NH1 1 
ATOM   480   N NH2 . ARG A  1 94  ? 438.669 76.254  445.145 1.00 26.67  ?  151 ARG A NH2 1 
ATOM   481   N N   . VAL A  1 95  ? 443.930 80.636  449.501 1.00 23.91  ?  152 VAL A N   1 
ATOM   482   C CA  . VAL A  1 95  ? 444.081 81.530  450.646 1.00 24.96  ?  152 VAL A CA  1 
ATOM   483   C C   . VAL A  1 95  ? 442.873 82.430  450.867 1.00 27.49  ?  152 VAL A C   1 
ATOM   484   O O   . VAL A  1 95  ? 442.810 83.121  451.895 1.00 33.99  ?  152 VAL A O   1 
ATOM   485   C CB  . VAL A  1 95  ? 445.346 82.398  450.502 1.00 21.82  ?  152 VAL A CB  1 
ATOM   486   C CG1 . VAL A  1 95  ? 446.578 81.515  450.357 1.00 22.61  ?  152 VAL A CG1 1 
ATOM   487   C CG2 . VAL A  1 95  ? 445.217 83.341  449.319 1.00 23.37  ?  152 VAL A CG2 1 
ATOM   488   N N   . VAL A  1 96  ? 441.914 82.449  449.943 1.00 31.03  ?  153 VAL A N   1 
ATOM   489   C CA  . VAL A  1 96  ? 440.692 83.233  450.091 1.00 33.15  ?  153 VAL A CA  1 
ATOM   490   C C   . VAL A  1 96  ? 439.509 82.314  449.828 1.00 36.14  ?  153 VAL A C   1 
ATOM   491   O O   . VAL A  1 96  ? 439.373 81.770  448.726 1.00 35.19  ?  153 VAL A O   1 
ATOM   492   C CB  . VAL A  1 96  ? 440.654 84.444  449.144 1.00 28.18  ?  153 VAL A CB  1 
ATOM   493   C CG1 . VAL A  1 96  ? 439.328 85.179  449.271 1.00 24.96  ?  153 VAL A CG1 1 
ATOM   494   C CG2 . VAL A  1 96  ? 441.813 85.378  449.435 1.00 30.84  ?  153 VAL A CG2 1 
ATOM   495   N N   . ALA A  1 97  ? 438.655 82.145  450.835 1.00 34.34  ?  154 ALA A N   1 
ATOM   496   C CA  . ALA A  1 97  ? 437.505 81.265  450.697 1.00 32.92  ?  154 ALA A CA  1 
ATOM   497   C C   . ALA A  1 97  ? 436.458 81.897  449.789 1.00 32.41  ?  154 ALA A C   1 
ATOM   498   O O   . ALA A  1 97  ? 436.040 83.039  450.004 1.00 29.73  ?  154 ALA A O   1 
ATOM   499   C CB  . ALA A  1 97  ? 436.903 80.962  452.068 1.00 40.03  ?  154 ALA A CB  1 
ATOM   500   N N   . GLY A  1 98  ? 436.042 81.152  448.765 1.00 53.62  ?  155 GLY A N   1 
ATOM   501   C CA  . GLY A  1 98  ? 434.973 81.566  447.883 1.00 51.04  ?  155 GLY A CA  1 
ATOM   502   C C   . GLY A  1 98  ? 435.411 82.091  446.533 1.00 53.53  ?  155 GLY A C   1 
ATOM   503   O O   . GLY A  1 98  ? 434.552 82.323  445.674 1.00 56.13  ?  155 GLY A O   1 
ATOM   504   N N   . GLU A  1 99  ? 436.709 82.284  446.314 1.00 29.52  ?  156 GLU A N   1 
ATOM   505   C CA  . GLU A  1 99  ? 437.204 82.854  445.071 1.00 28.66  ?  156 GLU A CA  1 
ATOM   506   C C   . GLU A  1 99  ? 438.338 82.004  444.516 1.00 22.74  ?  156 GLU A C   1 
ATOM   507   O O   . GLU A  1 99  ? 438.931 81.181  445.217 1.00 24.25  ?  156 GLU A O   1 
ATOM   508   C CB  . GLU A  1 99  ? 437.683 84.299  445.268 1.00 29.19  ?  156 GLU A CB  1 
ATOM   509   C CG  . GLU A  1 99  ? 436.562 85.300  445.498 1.00 31.07  ?  156 GLU A CG  1 
ATOM   510   C CD  . GLU A  1 99  ? 437.063 86.730  445.575 1.00 42.30  ?  156 GLU A CD  1 
ATOM   511   O OE1 . GLU A  1 99  ? 437.925 87.016  446.433 1.00 38.24  ?  156 GLU A OE1 1 
ATOM   512   O OE2 . GLU A  1 99  ? 436.599 87.565  444.769 1.00 41.95  -1 156 GLU A OE2 1 
ATOM   513   N N   . GLY A  1 100 ? 438.628 82.217  443.242 1.00 26.68  ?  157 GLY A N   1 
ATOM   514   C CA  . GLY A  1 100 ? 439.716 81.560  442.548 1.00 26.39  ?  157 GLY A CA  1 
ATOM   515   C C   . GLY A  1 100 ? 439.246 80.393  441.698 1.00 27.24  ?  157 GLY A C   1 
ATOM   516   O O   . GLY A  1 100 ? 438.295 79.678  442.038 1.00 34.94  ?  157 GLY A O   1 
ATOM   517   N N   . SER A  1 101 ? 439.940 80.183  440.582 1.00 64.77  ?  158 SER A N   1 
ATOM   518   C CA  . SER A  1 101 ? 439.667 79.124  439.614 1.00 71.13  ?  158 SER A CA  1 
ATOM   519   C C   . SER A  1 101 ? 440.705 79.250  438.505 1.00 64.40  ?  158 SER A C   1 
ATOM   520   O O   . SER A  1 101 ? 441.506 80.187  438.487 1.00 67.37  ?  158 SER A O   1 
ATOM   521   C CB  . SER A  1 101 ? 438.253 79.203  439.031 1.00 66.88  ?  158 SER A CB  1 
ATOM   522   O OG  . SER A  1 101 ? 438.102 80.351  438.216 1.00 70.91  ?  158 SER A OG  1 
ATOM   523   N N   . GLY A  1 102 ? 440.679 78.299  437.581 1.00 13.72  ?  159 GLY A N   1 
ATOM   524   C CA  . GLY A  1 102 ? 441.572 78.328  436.438 1.00 14.45  ?  159 GLY A CA  1 
ATOM   525   C C   . GLY A  1 102 ? 442.729 77.358  436.565 1.00 21.00  ?  159 GLY A C   1 
ATOM   526   O O   . GLY A  1 102 ? 442.773 76.483  437.435 1.00 19.54  ?  159 GLY A O   1 
ATOM   527   N N   . SER A  1 103 ? 443.687 77.525  435.656 1.00 56.62  ?  160 SER A N   1 
ATOM   528   C CA  . SER A  1 103 ? 444.849 76.656  435.559 1.00 50.48  ?  160 SER A CA  1 
ATOM   529   C C   . SER A  1 103 ? 446.124 77.425  435.884 1.00 49.40  ?  160 SER A C   1 
ATOM   530   O O   . SER A  1 103 ? 446.230 78.627  435.626 1.00 54.78  ?  160 SER A O   1 
ATOM   531   C CB  . SER A  1 103 ? 444.965 76.047  434.155 1.00 55.61  ?  160 SER A CB  1 
ATOM   532   O OG  . SER A  1 103 ? 443.812 75.297  433.820 1.00 64.87  ?  160 SER A OG  1 
ATOM   533   N N   . VAL A  1 104 ? 447.093 76.713  436.456 1.00 57.26  ?  161 VAL A N   1 
ATOM   534   C CA  . VAL A  1 104 ? 448.418 77.251  436.742 1.00 52.70  ?  161 VAL A CA  1 
ATOM   535   C C   . VAL A  1 104 ? 449.439 76.329  436.093 1.00 55.39  ?  161 VAL A C   1 
ATOM   536   O O   . VAL A  1 104 ? 449.562 75.162  436.484 1.00 64.02  ?  161 VAL A O   1 
ATOM   537   C CB  . VAL A  1 104 ? 448.684 77.372  438.252 1.00 51.82  ?  161 VAL A CB  1 
ATOM   538   C CG1 . VAL A  1 104 ? 450.070 77.946  438.498 1.00 58.73  ?  161 VAL A CG1 1 
ATOM   539   C CG2 . VAL A  1 104 ? 447.622 78.232  438.909 1.00 57.61  ?  161 VAL A CG2 1 
ATOM   540   N N   . SER A  1 105 ? 450.172 76.848  435.114 1.00 25.33  ?  162 SER A N   1 
ATOM   541   C CA  . SER A  1 105 ? 451.102 76.050  434.330 1.00 24.10  ?  162 SER A CA  1 
ATOM   542   C C   . SER A  1 105 ? 452.537 76.313  434.767 1.00 22.35  ?  162 SER A C   1 
ATOM   543   O O   . SER A  1 105 ? 452.892 77.436  435.138 1.00 28.76  ?  162 SER A O   1 
ATOM   544   C CB  . SER A  1 105 ? 450.949 76.351  432.837 1.00 26.51  ?  162 SER A CB  1 
ATOM   545   O OG  . SER A  1 105 ? 449.607 76.172  432.416 1.00 26.98  ?  162 SER A OG  1 
ATOM   546   N N   . LEU A  1 106 ? 453.357 75.265  434.723 1.00 27.24  ?  163 LEU A N   1 
ATOM   547   C CA  . LEU A  1 106 ? 454.778 75.351  435.026 1.00 26.18  ?  163 LEU A CA  1 
ATOM   548   C C   . LEU A  1 106 ? 455.574 74.732  433.888 1.00 31.34  ?  163 LEU A C   1 
ATOM   549   O O   . LEU A  1 106 ? 455.174 73.709  433.323 1.00 30.67  ?  163 LEU A O   1 
ATOM   550   C CB  . LEU A  1 106 ? 455.117 74.647  436.340 1.00 25.97  ?  163 LEU A CB  1 
ATOM   551   C CG  . LEU A  1 106 ? 454.770 75.354  437.650 1.00 39.12  ?  163 LEU A CG  1 
ATOM   552   C CD1 . LEU A  1 106 ? 455.554 74.745  438.800 1.00 29.02  ?  163 LEU A CD1 1 
ATOM   553   C CD2 . LEU A  1 106 ? 455.064 76.831  437.538 1.00 39.29  ?  163 LEU A CD2 1 
ATOM   554   N N   . ALA A  1 107 ? 456.706 75.351  433.558 1.00 34.31  ?  164 ALA A N   1 
ATOM   555   C CA  . ALA A  1 107 ? 457.540 74.896  432.455 1.00 30.98  ?  164 ALA A CA  1 
ATOM   556   C C   . ALA A  1 107 ? 459.007 75.042  432.823 1.00 34.61  ?  164 ALA A C   1 
ATOM   557   O O   . ALA A  1 107 ? 459.415 76.059  433.391 1.00 39.72  ?  164 ALA A O   1 
ATOM   558   C CB  . ALA A  1 107 ? 457.240 75.678  431.171 1.00 44.52  ?  164 ALA A CB  1 
ATOM   559   N N   . LEU A  1 108 ? 459.797 74.021  432.492 1.00 28.50  ?  165 LEU A N   1 
ATOM   560   C CA  . LEU A  1 108 ? 461.238 74.026  432.720 1.00 31.35  ?  165 LEU A CA  1 
ATOM   561   C C   . LEU A  1 108 ? 461.934 74.298  431.392 1.00 33.73  ?  165 LEU A C   1 
ATOM   562   O O   . LEU A  1 108 ? 461.916 73.455  430.489 1.00 33.16  ?  165 LEU A O   1 
ATOM   563   C CB  . LEU A  1 108 ? 461.700 72.699  433.319 1.00 28.92  ?  165 LEU A CB  1 
ATOM   564   C CG  . LEU A  1 108 ? 463.207 72.475  433.456 1.00 26.96  ?  165 LEU A CG  1 
ATOM   565   C CD1 . LEU A  1 108 ? 463.801 73.402  434.504 1.00 29.67  ?  165 LEU A CD1 1 
ATOM   566   C CD2 . LEU A  1 108 ? 463.505 71.020  433.789 1.00 24.40  ?  165 LEU A CD2 1 
ATOM   567   N N   . HIS A  1 109 ? 462.547 75.471  431.276 1.00 48.53  ?  166 HIS A N   1 
ATOM   568   C CA  . HIS A  1 109 ? 463.223 75.886  430.056 1.00 50.86  ?  166 HIS A CA  1 
ATOM   569   C C   . HIS A  1 109 ? 464.717 75.604  430.156 1.00 46.86  ?  166 HIS A C   1 
ATOM   570   O O   . HIS A  1 109 ? 465.339 75.851  431.194 1.00 46.84  ?  166 HIS A O   1 
ATOM   571   C CB  . HIS A  1 109 ? 462.993 77.376  429.783 1.00 59.57  ?  166 HIS A CB  1 
ATOM   572   C CG  . HIS A  1 109 ? 461.584 77.713  429.402 1.00 56.10  ?  166 HIS A CG  1 
ATOM   573   N ND1 . HIS A  1 109 ? 460.666 76.757  429.020 1.00 57.54  ?  166 HIS A ND1 1 
ATOM   574   C CD2 . HIS A  1 109 ? 460.939 78.901  429.339 1.00 54.93  ?  166 HIS A CD2 1 
ATOM   575   C CE1 . HIS A  1 109 ? 459.516 77.343  428.740 1.00 60.27  ?  166 HIS A CE1 1 
ATOM   576   N NE2 . HIS A  1 109 ? 459.654 78.644  428.926 1.00 58.15  ?  166 HIS A NE2 1 
ATOM   577   N N   . LEU A  1 110 ? 465.286 75.083  429.072 1.00 36.73  ?  167 LEU A N   1 
ATOM   578   C CA  . LEU A  1 110 ? 466.725 74.867  428.970 1.00 36.87  ?  167 LEU A CA  1 
ATOM   579   C C   . LEU A  1 110 ? 467.334 76.080  428.277 1.00 42.50  ?  167 LEU A C   1 
ATOM   580   O O   . LEU A  1 110 ? 467.064 76.328  427.097 1.00 54.24  ?  167 LEU A O   1 
ATOM   581   C CB  . LEU A  1 110 ? 467.027 73.579  428.208 1.00 38.37  ?  167 LEU A CB  1 
ATOM   582   C CG  . LEU A  1 110 ? 466.702 72.266  428.924 1.00 30.42  ?  167 LEU A CG  1 
ATOM   583   C CD1 . LEU A  1 110 ? 466.885 71.082  427.987 1.00 28.68  ?  167 LEU A CD1 1 
ATOM   584   C CD2 . LEU A  1 110 ? 467.560 72.104  430.167 1.00 27.04  ?  167 LEU A CD2 1 
ATOM   585   N N   . GLN A  1 111 ? 468.157 76.813  429.019 1.00 90.09  ?  168 GLN A N   1 
ATOM   586   C CA  . GLN A  1 111 ? 468.798 78.034  428.536 1.00 99.20  ?  168 GLN A CA  1 
ATOM   587   C C   . GLN A  1 111 ? 469.639 77.920  427.262 1.00 110.11 ?  168 GLN A C   1 
ATOM   588   O O   . GLN A  1 111 ? 469.318 78.547  426.253 1.00 115.13 ?  168 GLN A O   1 
ATOM   589   C CB  . GLN A  1 111 ? 469.642 78.659  429.652 1.00 107.70 ?  168 GLN A CB  1 
ATOM   590   C CG  . GLN A  1 111 ? 468.831 79.165  430.834 1.00 111.60 ?  168 GLN A CG  1 
ATOM   591   C CD  . GLN A  1 111 ? 467.490 79.738  430.419 1.00 121.18 ?  168 GLN A CD  1 
ATOM   592   O OE1 . GLN A  1 111 ? 467.405 80.531  429.481 1.00 125.94 ?  168 GLN A OE1 1 
ATOM   593   N NE2 . GLN A  1 111 ? 466.433 79.339  431.116 1.00 110.46 ?  168 GLN A NE2 1 
ATOM   594   N N   . PRO A  1 112 ? 470.720 77.125  427.302 1.00 83.00  ?  169 PRO A N   1 
ATOM   595   C CA  . PRO A  1 112 ? 471.586 77.053  426.108 1.00 82.25  ?  169 PRO A CA  1 
ATOM   596   C C   . PRO A  1 112 ? 471.147 75.980  425.112 1.00 85.69  ?  169 PRO A C   1 
ATOM   597   O O   . PRO A  1 112 ? 471.708 74.886  425.012 1.00 92.68  ?  169 PRO A O   1 
ATOM   598   C CB  . PRO A  1 112 ? 472.960 76.752  426.709 1.00 81.65  ?  169 PRO A CB  1 
ATOM   599   C CG  . PRO A  1 112 ? 472.686 76.146  428.079 1.00 74.52  ?  169 PRO A CG  1 
ATOM   600   C CD  . PRO A  1 112 ? 471.213 76.244  428.374 1.00 75.42  ?  169 PRO A CD  1 
ATOM   601   N N   . LEU A  1 113 ? 470.104 76.303  424.353 1.00 76.28  ?  170 LEU A N   1 
ATOM   602   C CA  . LEU A  1 113 ? 469.610 75.417  423.304 1.00 83.59  ?  170 LEU A CA  1 
ATOM   603   C C   . LEU A  1 113 ? 468.746 76.202  422.319 1.00 85.39  ?  170 LEU A C   1 
ATOM   604   O O   . LEU A  1 113 ? 467.701 76.744  422.686 1.00 78.47  ?  170 LEU A O   1 
ATOM   605   C CB  . LEU A  1 113 ? 468.818 74.250  423.905 1.00 82.44  ?  170 LEU A CB  1 
ATOM   606   C CG  . LEU A  1 113 ? 468.617 72.997  423.043 1.00 90.76  ?  170 LEU A CG  1 
ATOM   607   C CD1 . LEU A  1 113 ? 467.438 73.137  422.084 1.00 96.50  ?  170 LEU A CD1 1 
ATOM   608   C CD2 . LEU A  1 113 ? 469.893 72.663  422.279 1.00 81.38  ?  170 LEU A CD2 1 
ATOM   609   N N   . ALA A  1 119 ? 460.797 73.893  422.974 1.00 101.87 ?  176 ALA A N   1 
ATOM   610   C CA  . ALA A  1 119 ? 460.873 75.134  423.736 1.00 105.42 ?  176 ALA A CA  1 
ATOM   611   C C   . ALA A  1 119 ? 460.695 74.874  425.228 1.00 90.76  ?  176 ALA A C   1 
ATOM   612   O O   . ALA A  1 119 ? 461.265 75.578  426.063 1.00 84.55  ?  176 ALA A O   1 
ATOM   613   C CB  . ALA A  1 119 ? 459.828 76.124  423.240 1.00 101.78 ?  176 ALA A CB  1 
ATOM   614   N N   . ALA A  1 120 ? 459.898 73.861  425.559 1.00 73.90  ?  177 ALA A N   1 
ATOM   615   C CA  . ALA A  1 120 ? 459.626 73.479  426.941 1.00 64.66  ?  177 ALA A CA  1 
ATOM   616   C C   . ALA A  1 120 ? 460.064 72.033  427.139 1.00 54.98  ?  177 ALA A C   1 
ATOM   617   O O   . ALA A  1 120 ? 459.472 71.117  426.560 1.00 60.72  ?  177 ALA A O   1 
ATOM   618   C CB  . ALA A  1 120 ? 458.146 73.657  427.280 1.00 63.61  ?  177 ALA A CB  1 
ATOM   619   N N   . ALA A  1 121 ? 461.096 71.831  427.960 1.00 35.64  ?  178 ALA A N   1 
ATOM   620   C CA  . ALA A  1 121 ? 461.577 70.481  428.227 1.00 30.02  ?  178 ALA A CA  1 
ATOM   621   C C   . ALA A  1 121 ? 460.701 69.749  429.234 1.00 35.36  ?  178 ALA A C   1 
ATOM   622   O O   . ALA A  1 121 ? 460.647 68.514  429.217 1.00 44.40  ?  178 ALA A O   1 
ATOM   623   C CB  . ALA A  1 121 ? 463.024 70.525  428.724 1.00 32.19  ?  178 ALA A CB  1 
ATOM   624   N N   . LEU A  1 122 ? 460.016 70.482  430.110 1.00 38.02  ?  179 LEU A N   1 
ATOM   625   C CA  . LEU A  1 122 ? 459.144 69.889  431.113 1.00 35.04  ?  179 LEU A CA  1 
ATOM   626   C C   . LEU A  1 122 ? 457.878 70.726  431.218 1.00 37.22  ?  179 LEU A C   1 
ATOM   627   O O   . LEU A  1 122 ? 457.941 71.958  431.213 1.00 40.00  ?  179 LEU A O   1 
ATOM   628   C CB  . LEU A  1 122 ? 459.839 69.808  432.478 1.00 36.73  ?  179 LEU A CB  1 
ATOM   629   C CG  . LEU A  1 122 ? 459.733 68.481  433.229 1.00 37.88  ?  179 LEU A CG  1 
ATOM   630   C CD1 . LEU A  1 122 ? 460.253 67.363  432.355 1.00 35.30  ?  179 LEU A CD1 1 
ATOM   631   C CD2 . LEU A  1 122 ? 460.501 68.533  434.538 1.00 33.74  ?  179 LEU A CD2 1 
ATOM   632   N N   . ALA A  1 123 ? 456.731 70.057  431.310 1.00 21.29  ?  180 ALA A N   1 
ATOM   633   C CA  . ALA A  1 123 ? 455.441 70.739  431.339 1.00 20.20  ?  180 ALA A CA  1 
ATOM   634   C C   . ALA A  1 123 ? 454.561 70.113  432.410 1.00 24.56  ?  180 ALA A C   1 
ATOM   635   O O   . ALA A  1 123 ? 454.330 68.900  432.395 1.00 23.97  ?  180 ALA A O   1 
ATOM   636   C CB  . ALA A  1 123 ? 454.751 70.672  429.974 1.00 25.12  ?  180 ALA A CB  1 
ATOM   637   N N   . LEU A  1 124 ? 454.076 70.941  433.333 1.00 47.00  ?  181 LEU A N   1 
ATOM   638   C CA  . LEU A  1 124 ? 453.139 70.508  434.364 1.00 47.78  ?  181 LEU A CA  1 
ATOM   639   C C   . LEU A  1 124 ? 452.055 71.567  434.476 1.00 48.17  ?  181 LEU A C   1 
ATOM   640   O O   . LEU A  1 124 ? 452.354 72.731  434.760 1.00 56.90  ?  181 LEU A O   1 
ATOM   641   C CB  . LEU A  1 124 ? 453.849 70.310  435.711 1.00 50.77  ?  181 LEU A CB  1 
ATOM   642   C CG  . LEU A  1 124 ? 453.275 69.343  436.757 1.00 49.29  ?  181 LEU A CG  1 
ATOM   643   C CD1 . LEU A  1 124 ? 454.101 69.399  438.037 1.00 45.36  ?  181 LEU A CD1 1 
ATOM   644   C CD2 . LEU A  1 124 ? 451.801 69.580  437.059 1.00 50.87  ?  181 LEU A CD2 1 
ATOM   645   N N   . THR A  1 125 ? 450.804 71.172  434.254 1.00 21.83  ?  182 THR A N   1 
ATOM   646   C CA  . THR A  1 125 ? 449.665 72.082  434.333 1.00 23.55  ?  182 THR A CA  1 
ATOM   647   C C   . THR A  1 125 ? 448.748 71.613  435.456 1.00 28.89  ?  182 THR A C   1 
ATOM   648   O O   . THR A  1 125 ? 448.158 70.531  435.372 1.00 34.26  ?  182 THR A O   1 
ATOM   649   C CB  . THR A  1 125 ? 448.913 72.148  433.005 1.00 27.58  ?  182 THR A CB  1 
ATOM   650   O OG1 . THR A  1 125 ? 449.810 72.559  431.965 1.00 27.75  ?  182 THR A OG1 1 
ATOM   651   C CG2 . THR A  1 125 ? 447.764 73.142  433.094 1.00 31.07  ?  182 THR A CG2 1 
ATOM   652   N N   . VAL A  1 126 ? 448.632 72.425  436.501 1.00 24.28  ?  183 VAL A N   1 
ATOM   653   C CA  . VAL A  1 126 ? 447.764 72.142  437.638 1.00 20.48  ?  183 VAL A CA  1 
ATOM   654   C C   . VAL A  1 126 ? 446.498 72.972  437.504 1.00 28.40  ?  183 VAL A C   1 
ATOM   655   O O   . VAL A  1 126 ? 446.553 74.164  437.176 1.00 34.50  ?  183 VAL A O   1 
ATOM   656   C CB  . VAL A  1 126 ? 448.481 72.435  438.970 1.00 22.60  ?  183 VAL A CB  1 
ATOM   657   C CG1 . VAL A  1 126 ? 447.494 72.410  440.120 1.00 29.72  ?  183 VAL A CG1 1 
ATOM   658   C CG2 . VAL A  1 126 ? 449.587 71.426  439.208 1.00 25.51  ?  183 VAL A CG2 1 
ATOM   659   N N   . ASP A  1 127 ? 445.351 72.343  437.750 1.00 54.61  ?  184 ASP A N   1 
ATOM   660   C CA  . ASP A  1 127 ? 444.062 73.014  437.687 1.00 56.11  ?  184 ASP A CA  1 
ATOM   661   C C   . ASP A  1 127 ? 443.607 73.419  439.083 1.00 55.87  ?  184 ASP A C   1 
ATOM   662   O O   . ASP A  1 127 ? 443.808 72.682  440.053 1.00 61.93  ?  184 ASP A O   1 
ATOM   663   C CB  . ASP A  1 127 ? 443.008 72.115  437.042 1.00 61.41  ?  184 ASP A CB  1 
ATOM   664   C CG  . ASP A  1 127 ? 441.613 72.708  437.119 1.00 76.83  ?  184 ASP A CG  1 
ATOM   665   O OD1 . ASP A  1 127 ? 441.278 73.559  436.266 1.00 78.05  ?  184 ASP A OD1 1 
ATOM   666   O OD2 . ASP A  1 127 ? 440.855 72.329  438.035 1.00 74.06  -1 184 ASP A OD2 1 
ATOM   667   N N   . LEU A  1 128 ? 442.993 74.599  439.177 1.00 23.04  ?  185 LEU A N   1 
ATOM   668   C CA  . LEU A  1 128 ? 442.449 75.083  440.436 1.00 24.07  ?  185 LEU A CA  1 
ATOM   669   C C   . LEU A  1 128 ? 440.941 74.908  440.431 1.00 28.01  ?  185 LEU A C   1 
ATOM   670   O O   . LEU A  1 128 ? 440.272 75.432  439.526 1.00 33.18  ?  185 LEU A O   1 
ATOM   671   C CB  . LEU A  1 128 ? 442.808 76.550  440.648 1.00 28.10  ?  185 LEU A CB  1 
ATOM   672   C CG  . LEU A  1 128 ? 444.270 76.943  440.434 1.00 21.74  ?  185 LEU A CG  1 
ATOM   673   C CD1 . LEU A  1 128 ? 444.443 78.439  440.619 1.00 20.10  ?  185 LEU A CD1 1 
ATOM   674   C CD2 . LEU A  1 128 ? 445.182 76.171  441.374 1.00 24.18  ?  185 LEU A CD2 1 
ATOM   675   N N   . PRO A  1 129 ? 440.363 74.189  441.395 1.00 22.80  ?  186 PRO A N   1 
ATOM   676   C CA  . PRO A  1 129 ? 438.916 73.997  441.387 1.00 22.25  ?  186 PRO A CA  1 
ATOM   677   C C   . PRO A  1 129 ? 438.198 75.279  441.767 1.00 28.52  ?  186 PRO A C   1 
ATOM   678   O O   . PRO A  1 129 ? 438.722 76.092  442.548 1.00 33.94  ?  186 PRO A O   1 
ATOM   679   C CB  . PRO A  1 129 ? 438.697 72.898  442.445 1.00 27.47  ?  186 PRO A CB  1 
ATOM   680   C CG  . PRO A  1 129 ? 440.050 72.295  442.681 1.00 32.88  ?  186 PRO A CG  1 
ATOM   681   C CD  . PRO A  1 129 ? 441.020 73.405  442.452 1.00 28.24  ?  186 PRO A CD  1 
ATOM   682   N N   . PRO A  1 130 ? 437.000 75.508  441.237 1.00 59.10  ?  187 PRO A N   1 
ATOM   683   C CA  . PRO A  1 130 ? 436.209 76.661  441.673 1.00 56.82  ?  187 PRO A CA  1 
ATOM   684   C C   . PRO A  1 130 ? 435.608 76.424  443.049 1.00 62.78  ?  187 PRO A C   1 
ATOM   685   O O   . PRO A  1 130 ? 435.540 75.299  443.548 1.00 63.32  ?  187 PRO A O   1 
ATOM   686   C CB  . PRO A  1 130 ? 435.121 76.767  440.601 1.00 64.02  ?  187 PRO A CB  1 
ATOM   687   C CG  . PRO A  1 130 ? 434.945 75.361  440.130 1.00 66.32  ?  187 PRO A CG  1 
ATOM   688   C CD  . PRO A  1 130 ? 436.312 74.726  440.193 1.00 67.48  ?  187 PRO A CD  1 
ATOM   689   N N   . ALA A  1 131 ? 435.170 77.517  443.667 1.00 70.28  ?  188 ALA A N   1 
ATOM   690   C CA  . ALA A  1 131 ? 434.533 77.428  444.974 1.00 75.30  ?  188 ALA A CA  1 
ATOM   691   C C   . ALA A  1 131 ? 433.166 76.766  444.847 1.00 78.66  ?  188 ALA A C   1 
ATOM   692   O O   . ALA A  1 131 ? 432.320 77.209  444.065 1.00 76.56  ?  188 ALA A O   1 
ATOM   693   C CB  . ALA A  1 131 ? 434.397 78.817  445.593 1.00 70.96  ?  188 ALA A CB  1 
ATOM   694   N N   . SER A  1 132 ? 432.950 75.704  445.622 1.00 58.49  ?  189 SER A N   1 
ATOM   695   C CA  . SER A  1 132 ? 431.718 74.932  445.562 1.00 65.71  ?  189 SER A CA  1 
ATOM   696   C C   . SER A  1 132 ? 431.247 74.636  446.980 1.00 70.48  ?  189 SER A C   1 
ATOM   697   O O   . SER A  1 132 ? 431.841 75.093  447.962 1.00 65.79  ?  189 SER A O   1 
ATOM   698   C CB  . SER A  1 132 ? 431.915 73.633  444.770 1.00 65.77  ?  189 SER A CB  1 
ATOM   699   O OG  . SER A  1 132 ? 432.379 73.898  443.458 1.00 65.48  ?  189 SER A OG  1 
ATOM   700   N N   . SER A  1 133 ? 430.159 73.869  447.081 1.00 114.15 ?  190 SER A N   1 
ATOM   701   C CA  . SER A  1 133 ? 429.693 73.409  448.385 1.00 118.69 ?  190 SER A CA  1 
ATOM   702   C C   . SER A  1 133 ? 430.750 72.543  449.058 1.00 111.74 ?  190 SER A C   1 
ATOM   703   O O   . SER A  1 133 ? 431.089 72.752  450.229 1.00 109.94 ?  190 SER A O   1 
ATOM   704   C CB  . SER A  1 133 ? 428.376 72.646  448.235 1.00 108.96 ?  190 SER A CB  1 
ATOM   705   O OG  . SER A  1 133 ? 428.535 71.510  447.403 1.00 101.38 ?  190 SER A OG  1 
ATOM   706   N N   . GLU A  1 134 ? 431.280 71.564  448.331 1.00 104.35 ?  191 GLU A N   1 
ATOM   707   C CA  . GLU A  1 134 ? 432.456 70.849  448.794 1.00 103.18 ?  191 GLU A CA  1 
ATOM   708   C C   . GLU A  1 134 ? 433.646 71.800  448.849 1.00 111.39 ?  191 GLU A C   1 
ATOM   709   O O   . GLU A  1 134 ? 433.742 72.755  448.072 1.00 112.98 ?  191 GLU A O   1 
ATOM   710   C CB  . GLU A  1 134 ? 432.765 69.668  447.875 1.00 99.17  ?  191 GLU A CB  1 
ATOM   711   C CG  . GLU A  1 134 ? 433.258 70.073  446.493 1.00 102.29 ?  191 GLU A CG  1 
ATOM   712   C CD  . GLU A  1 134 ? 433.449 68.890  445.567 1.00 105.41 ?  191 GLU A CD  1 
ATOM   713   O OE1 . GLU A  1 134 ? 432.539 68.038  445.492 1.00 101.47 ?  191 GLU A OE1 1 
ATOM   714   O OE2 . GLU A  1 134 ? 434.512 68.812  444.915 1.00 102.65 -1 191 GLU A OE2 1 
ATOM   715   N N   . ALA A  1 135 ? 434.551 71.543  449.785 1.00 114.80 ?  192 ALA A N   1 
ATOM   716   C CA  . ALA A  1 135 ? 435.726 72.384  449.976 1.00 108.62 ?  192 ALA A CA  1 
ATOM   717   C C   . ALA A  1 135 ? 436.938 71.681  449.380 1.00 108.37 ?  192 ALA A C   1 
ATOM   718   O O   . ALA A  1 135 ? 437.424 70.689  449.935 1.00 112.43 ?  192 ALA A O   1 
ATOM   719   C CB  . ALA A  1 135 ? 435.942 72.690  451.457 1.00 89.74  ?  192 ALA A CB  1 
ATOM   720   N N   . ARG A  1 136 ? 437.426 72.192  448.253 1.00 108.69 ?  193 ARG A N   1 
ATOM   721   C CA  . ARG A  1 136 ? 438.717 71.793  447.704 1.00 105.02 ?  193 ARG A CA  1 
ATOM   722   C C   . ARG A  1 136 ? 439.624 73.014  447.778 1.00 100.68 ?  193 ARG A C   1 
ATOM   723   O O   . ARG A  1 136 ? 439.504 73.940  446.972 1.00 98.42  ?  193 ARG A O   1 
ATOM   724   C CB  . ARG A  1 136 ? 438.572 71.281  446.274 1.00 102.91 ?  193 ARG A CB  1 
ATOM   725   C CG  . ARG A  1 136 ? 438.012 69.875  446.171 1.00 103.43 ?  193 ARG A CG  1 
ATOM   726   C CD  . ARG A  1 136 ? 438.942 68.882  446.851 1.00 112.73 ?  193 ARG A CD  1 
ATOM   727   N NE  . ARG A  1 136 ? 440.291 68.938  446.292 1.00 112.77 ?  193 ARG A NE  1 
ATOM   728   C CZ  . ARG A  1 136 ? 441.345 68.321  446.815 1.00 102.76 ?  193 ARG A CZ  1 
ATOM   729   N NH1 . ARG A  1 136 ? 441.212 67.597  447.918 1.00 94.42  ?  193 ARG A NH1 1 
ATOM   730   N NH2 . ARG A  1 136 ? 442.534 68.429  446.238 1.00 100.03 ?  193 ARG A NH2 1 
ATOM   731   N N   . ASN A  1 137 ? 440.532 73.009  448.749 1.00 49.26  ?  194 ASN A N   1 
ATOM   732   C CA  . ASN A  1 137 ? 441.494 74.086  448.924 1.00 51.08  ?  194 ASN A CA  1 
ATOM   733   C C   . ASN A  1 137 ? 442.879 73.744  448.397 1.00 45.16  ?  194 ASN A C   1 
ATOM   734   O O   . ASN A  1 137 ? 443.774 74.592  448.455 1.00 42.77  ?  194 ASN A O   1 
ATOM   735   C CB  . ASN A  1 137 ? 441.572 74.473  450.402 1.00 59.52  ?  194 ASN A CB  1 
ATOM   736   C CG  . ASN A  1 137 ? 440.212 74.820  450.977 1.00 53.60  ?  194 ASN A CG  1 
ATOM   737   O OD1 . ASN A  1 137 ? 439.802 74.278  452.003 1.00 63.55  ?  194 ASN A OD1 1 
ATOM   738   N ND2 . ASN A  1 137 ? 439.501 75.721  450.310 1.00 37.30  ?  194 ASN A ND2 1 
ATOM   739   N N   . SER A  1 138 ? 443.082 72.532  447.886 1.00 43.21  ?  195 SER A N   1 
ATOM   740   C CA  . SER A  1 138 ? 444.410 72.057  447.533 1.00 44.88  ?  195 SER A CA  1 
ATOM   741   C C   . SER A  1 138 ? 444.435 71.569  446.093 1.00 41.82  ?  195 SER A C   1 
ATOM   742   O O   . SER A  1 138 ? 443.449 71.033  445.580 1.00 44.86  ?  195 SER A O   1 
ATOM   743   C CB  . SER A  1 138 ? 444.866 70.927  448.468 1.00 58.27  ?  195 SER A CB  1 
ATOM   744   O OG  . SER A  1 138 ? 444.835 71.342  449.823 1.00 67.46  ?  195 SER A OG  1 
ATOM   745   N N   . ALA A  1 139 ? 445.580 71.769  445.447 1.00 37.27  ?  196 ALA A N   1 
ATOM   746   C CA  . ALA A  1 139 ? 445.826 71.259  444.108 1.00 38.95  ?  196 ALA A CA  1 
ATOM   747   C C   . ALA A  1 139 ? 447.298 70.885  444.009 1.00 35.84  ?  196 ALA A C   1 
ATOM   748   O O   . ALA A  1 139 ? 448.160 71.605  444.520 1.00 33.09  ?  196 ALA A O   1 
ATOM   749   C CB  . ALA A  1 139 ? 445.451 72.287  443.037 1.00 38.40  ?  196 ALA A CB  1 
ATOM   750   N N   . PHE A  1 140 ? 447.581 69.760  443.354 1.00 35.11  ?  197 PHE A N   1 
ATOM   751   C CA  . PHE A  1 140 ? 448.934 69.226  443.307 1.00 34.66  ?  197 PHE A CA  1 
ATOM   752   C C   . PHE A  1 140 ? 449.194 68.571  441.958 1.00 35.56  ?  197 PHE A C   1 
ATOM   753   O O   . PHE A  1 140 ? 448.273 68.091  441.292 1.00 39.90  ?  197 PHE A O   1 
ATOM   754   C CB  . PHE A  1 140 ? 449.174 68.212  444.440 1.00 33.17  ?  197 PHE A CB  1 
ATOM   755   C CG  . PHE A  1 140 ? 450.559 67.627  444.449 1.00 39.66  ?  197 PHE A CG  1 
ATOM   756   C CD1 . PHE A  1 140 ? 451.621 68.335  444.986 1.00 39.55  ?  197 PHE A CD1 1 
ATOM   757   C CD2 . PHE A  1 140 ? 450.798 66.368  443.920 1.00 38.34  ?  197 PHE A CD2 1 
ATOM   758   C CE1 . PHE A  1 140 ? 452.896 67.799  444.995 1.00 38.18  ?  197 PHE A CE1 1 
ATOM   759   C CE2 . PHE A  1 140 ? 452.070 65.828  443.926 1.00 31.13  ?  197 PHE A CE2 1 
ATOM   760   C CZ  . PHE A  1 140 ? 453.120 66.545  444.462 1.00 33.31  ?  197 PHE A CZ  1 
ATOM   761   N N   . GLY A  1 141 ? 450.466 68.561  441.565 1.00 25.29  ?  198 GLY A N   1 
ATOM   762   C CA  . GLY A  1 141 ? 450.891 67.859  440.369 1.00 27.92  ?  198 GLY A CA  1 
ATOM   763   C C   . GLY A  1 141 ? 452.351 67.475  440.475 1.00 26.81  ?  198 GLY A C   1 
ATOM   764   O O   . GLY A  1 141 ? 453.130 68.098  441.204 1.00 25.74  ?  198 GLY A O   1 
ATOM   765   N N   . PHE A  1 142 ? 452.718 66.435  439.728 1.00 39.19  ?  199 PHE A N   1 
ATOM   766   C CA  . PHE A  1 142 ? 454.077 65.914  439.735 1.00 32.30  ?  199 PHE A CA  1 
ATOM   767   C C   . PHE A  1 142 ? 454.465 65.499  438.326 1.00 35.07  ?  199 PHE A C   1 
ATOM   768   O O   . PHE A  1 142 ? 453.686 64.845  437.627 1.00 39.56  ?  199 PHE A O   1 
ATOM   769   C CB  . PHE A  1 142 ? 454.217 64.717  440.687 1.00 33.47  ?  199 PHE A CB  1 
ATOM   770   C CG  . PHE A  1 142 ? 455.594 64.112  440.708 1.00 31.06  ?  199 PHE A CG  1 
ATOM   771   C CD1 . PHE A  1 142 ? 456.584 64.640  441.517 1.00 35.29  ?  199 PHE A CD1 1 
ATOM   772   C CD2 . PHE A  1 142 ? 455.897 63.013  439.921 1.00 29.38  ?  199 PHE A CD2 1 
ATOM   773   C CE1 . PHE A  1 142 ? 457.851 64.088  441.538 1.00 32.29  ?  199 PHE A CE1 1 
ATOM   774   C CE2 . PHE A  1 142 ? 457.161 62.457  439.939 1.00 25.48  ?  199 PHE A CE2 1 
ATOM   775   C CZ  . PHE A  1 142 ? 458.138 62.994  440.748 1.00 28.78  ?  199 PHE A CZ  1 
ATOM   776   N N   . GLN A  1 143 ? 455.678 65.867  437.921 1.00 27.18  ?  200 GLN A N   1 
ATOM   777   C CA  . GLN A  1 143 ? 456.179 65.576  436.587 1.00 26.18  ?  200 GLN A CA  1 
ATOM   778   C C   . GLN A  1 143 ? 457.649 65.195  436.672 1.00 30.22  ?  200 GLN A C   1 
ATOM   779   O O   . GLN A  1 143 ? 458.414 65.819  437.410 1.00 33.81  ?  200 GLN A O   1 
ATOM   780   C CB  . GLN A  1 143 ? 455.996 66.780  435.653 1.00 28.91  ?  200 GLN A CB  1 
ATOM   781   C CG  . GLN A  1 143 ? 456.612 66.622  434.269 1.00 33.00  ?  200 GLN A CG  1 
ATOM   782   C CD  . GLN A  1 143 ? 455.830 65.680  433.373 1.00 35.53  ?  200 GLN A CD  1 
ATOM   783   O OE1 . GLN A  1 143 ? 455.692 64.492  433.666 1.00 33.89  ?  200 GLN A OE1 1 
ATOM   784   N NE2 . GLN A  1 143 ? 455.311 66.210  432.272 1.00 37.96  ?  200 GLN A NE2 1 
ATOM   785   N N   . GLY A  1 144 ? 458.036 64.169  435.921 1.00 26.84  ?  201 GLY A N   1 
ATOM   786   C CA  . GLY A  1 144 ? 459.427 63.763  435.876 1.00 21.96  ?  201 GLY A CA  1 
ATOM   787   C C   . GLY A  1 144 ? 459.697 62.854  434.701 1.00 22.91  ?  201 GLY A C   1 
ATOM   788   O O   . GLY A  1 144 ? 458.799 62.169  434.201 1.00 23.38  ?  201 GLY A O   1 
ATOM   789   N N   . ARG A  1 145 ? 460.958 62.846  434.275 1.00 40.83  ?  202 ARG A N   1 
ATOM   790   C CA  . ARG A  1 145 ? 461.428 62.043  433.151 1.00 44.24  ?  202 ARG A CA  1 
ATOM   791   C C   . ARG A  1 145 ? 462.922 62.275  432.990 1.00 39.76  ?  202 ARG A C   1 
ATOM   792   O O   . ARG A  1 145 ? 463.474 63.253  433.501 1.00 42.44  ?  202 ARG A O   1 
ATOM   793   C CB  . ARG A  1 145 ? 460.697 62.384  431.848 1.00 49.24  ?  202 ARG A CB  1 
ATOM   794   C CG  . ARG A  1 145 ? 460.672 63.863  431.516 1.00 51.55  ?  202 ARG A CG  1 
ATOM   795   C CD  . ARG A  1 145 ? 459.354 64.259  430.864 1.00 54.53  ?  202 ARG A CD  1 
ATOM   796   N NE  . ARG A  1 145 ? 459.199 63.702  429.525 1.00 51.45  ?  202 ARG A NE  1 
ATOM   797   C CZ  . ARG A  1 145 ? 459.548 64.337  428.411 1.00 56.85  ?  202 ARG A CZ  1 
ATOM   798   N NH1 . ARG A  1 145 ? 460.070 65.554  428.477 1.00 65.41  ?  202 ARG A NH1 1 
ATOM   799   N NH2 . ARG A  1 145 ? 459.373 63.759  427.231 1.00 57.61  ?  202 ARG A NH2 1 
ATOM   800   N N   . LEU A  1 146 ? 463.566 61.366  432.264 1.00 20.47  ?  203 LEU A N   1 
ATOM   801   C CA  . LEU A  1 146 ? 465.000 61.455  432.037 1.00 21.03  ?  203 LEU A CA  1 
ATOM   802   C C   . LEU A  1 146 ? 465.305 62.531  431.004 1.00 25.37  ?  203 LEU A C   1 
ATOM   803   O O   . LEU A  1 146 ? 464.618 62.651  429.986 1.00 29.56  ?  203 LEU A O   1 
ATOM   804   C CB  . LEU A  1 146 ? 465.553 60.107  431.571 1.00 22.00  ?  203 LEU A CB  1 
ATOM   805   C CG  . LEU A  1 146 ? 465.232 58.896  432.450 1.00 21.57  ?  203 LEU A CG  1 
ATOM   806   C CD1 . LEU A  1 146 ? 465.782 57.621  431.830 1.00 17.99  ?  203 LEU A CD1 1 
ATOM   807   C CD2 . LEU A  1 146 ? 465.782 59.095  433.854 1.00 27.69  ?  203 LEU A CD2 1 
ATOM   808   N N   . LEU A  1 147 ? 466.344 63.316  431.275 1.00 17.65  ?  204 LEU A N   1 
ATOM   809   C CA  . LEU A  1 147 ? 466.777 64.385  430.388 1.00 17.22  ?  204 LEU A CA  1 
ATOM   810   C C   . LEU A  1 147 ? 468.284 64.305  430.199 1.00 18.97  ?  204 LEU A C   1 
ATOM   811   O O   . LEU A  1 147 ? 469.019 63.988  431.138 1.00 19.12  ?  204 LEU A O   1 
ATOM   812   C CB  . LEU A  1 147 ? 466.396 65.764  430.944 1.00 17.90  ?  204 LEU A CB  1 
ATOM   813   C CG  . LEU A  1 147 ? 464.921 66.018  431.255 1.00 15.51  ?  204 LEU A CG  1 
ATOM   814   C CD1 . LEU A  1 147 ? 464.751 67.345  431.975 1.00 14.15  ?  204 LEU A CD1 1 
ATOM   815   C CD2 . LEU A  1 147 ? 464.089 65.989  429.981 1.00 19.41  ?  204 LEU A CD2 1 
ATOM   816   N N   . HIS A  1 148 ? 468.739 64.589  428.983 1.00 44.89  ?  205 HIS A N   1 
ATOM   817   C CA  . HIS A  1 148 ? 470.161 64.679  428.680 1.00 45.39  ?  205 HIS A CA  1 
ATOM   818   C C   . HIS A  1 148 ? 470.578 66.141  428.764 1.00 43.61  ?  205 HIS A C   1 
ATOM   819   O O   . HIS A  1 148 ? 470.090 66.974  427.994 1.00 54.37  ?  205 HIS A O   1 
ATOM   820   C CB  . HIS A  1 148 ? 470.473 64.106  427.298 1.00 44.61  ?  205 HIS A CB  1 
ATOM   821   C CG  . HIS A  1 148 ? 471.931 64.115  426.959 1.00 58.81  ?  205 HIS A CG  1 
ATOM   822   N ND1 . HIS A  1 148 ? 472.786 63.094  427.319 1.00 62.05  ?  205 HIS A ND1 1 
ATOM   823   C CD2 . HIS A  1 148 ? 472.690 65.023  426.301 1.00 66.64  ?  205 HIS A CD2 1 
ATOM   824   C CE1 . HIS A  1 148 ? 474.006 63.372  426.894 1.00 59.13  ?  205 HIS A CE1 1 
ATOM   825   N NE2 . HIS A  1 148 ? 473.974 64.538  426.273 1.00 58.82  ?  205 HIS A NE2 1 
ATOM   826   N N   . LEU A  1 149 ? 471.468 66.449  429.701 1.00 29.93  ?  206 LEU A N   1 
ATOM   827   C CA  . LEU A  1 149 ? 471.916 67.812  429.939 1.00 14.78  ?  206 LEU A CA  1 
ATOM   828   C C   . LEU A  1 149 ? 473.338 67.991  429.424 1.00 19.20  ?  206 LEU A C   1 
ATOM   829   O O   . LEU A  1 149 ? 474.171 67.087  429.540 1.00 19.50  ?  206 LEU A O   1 
ATOM   830   C CB  . LEU A  1 149 ? 471.852 68.155  431.429 1.00 30.09  ?  206 LEU A CB  1 
ATOM   831   C CG  . LEU A  1 149 ? 470.505 67.885  432.102 1.00 28.87  ?  206 LEU A CG  1 
ATOM   832   C CD1 . LEU A  1 149 ? 470.535 68.324  433.557 1.00 26.92  ?  206 LEU A CD1 1 
ATOM   833   C CD2 . LEU A  1 149 ? 469.376 68.570  431.346 1.00 28.85  ?  206 LEU A CD2 1 
ATOM   834   N N   . SER A  1 150 ? 473.609 69.163  428.855 1.00 45.49  ?  207 SER A N   1 
ATOM   835   C CA  . SER A  1 150 ? 474.927 69.471  428.329 1.00 42.33  ?  207 SER A CA  1 
ATOM   836   C C   . SER A  1 150 ? 475.856 69.908  429.461 1.00 42.65  ?  207 SER A C   1 
ATOM   837   O O   . SER A  1 150 ? 475.490 69.905  430.640 1.00 40.69  ?  207 SER A O   1 
ATOM   838   C CB  . SER A  1 150 ? 474.826 70.548  427.250 1.00 45.37  ?  207 SER A CB  1 
ATOM   839   O OG  . SER A  1 150 ? 473.912 70.166  426.237 1.00 48.41  ?  207 SER A OG  1 
ATOM   840   N N   . ALA A  1 151 ? 477.077 70.289  429.098 1.00 47.56  ?  208 ALA A N   1 
ATOM   841   C CA  . ALA A  1 151 ? 478.052 70.792  430.058 1.00 43.97  ?  208 ALA A CA  1 
ATOM   842   C C   . ALA A  1 151 ? 477.819 72.284  430.255 1.00 44.92  ?  208 ALA A C   1 
ATOM   843   O O   . ALA A  1 151 ? 477.913 73.064  429.301 1.00 53.20  ?  208 ALA A O   1 
ATOM   844   C CB  . ALA A  1 151 ? 479.476 70.522  429.578 1.00 47.91  ?  208 ALA A CB  1 
ATOM   845   N N   . GLY A  1 152 ? 477.520 72.680  431.489 1.00 25.24  ?  209 GLY A N   1 
ATOM   846   C CA  . GLY A  1 152 ? 477.141 74.052  431.752 1.00 24.33  ?  209 GLY A CA  1 
ATOM   847   C C   . GLY A  1 152 ? 475.727 74.392  431.349 1.00 24.49  ?  209 GLY A C   1 
ATOM   848   O O   . GLY A  1 152 ? 475.427 75.564  431.104 1.00 23.06  ?  209 GLY A O   1 
ATOM   849   N N   . GLN A  1 153 ? 474.846 73.397  431.266 1.00 59.95  ?  210 GLN A N   1 
ATOM   850   C CA  . GLN A  1 153 ? 473.464 73.637  430.877 1.00 58.40  ?  210 GLN A CA  1 
ATOM   851   C C   . GLN A  1 153 ? 472.720 74.342  432.002 1.00 55.44  ?  210 GLN A C   1 
ATOM   852   O O   . GLN A  1 153 ? 472.719 73.879  433.147 1.00 58.60  ?  210 GLN A O   1 
ATOM   853   C CB  . GLN A  1 153 ? 472.775 72.316  430.534 1.00 49.57  ?  210 GLN A CB  1 
ATOM   854   C CG  . GLN A  1 153 ? 471.356 72.460  430.004 1.00 49.21  ?  210 GLN A CG  1 
ATOM   855   C CD  . GLN A  1 153 ? 471.263 72.225  428.506 1.00 62.85  ?  210 GLN A CD  1 
ATOM   856   O OE1 . GLN A  1 153 ? 471.130 73.164  427.724 1.00 72.75  ?  210 GLN A OE1 1 
ATOM   857   N NE2 . GLN A  1 153 ? 471.331 70.962  428.103 1.00 57.06  ?  210 GLN A NE2 1 
ATOM   858   N N   . ARG A  1 154 ? 472.090 75.467  431.678 1.00 61.57  ?  211 ARG A N   1 
ATOM   859   C CA  . ARG A  1 154 ? 471.320 76.228  432.650 1.00 67.60  ?  211 ARG A CA  1 
ATOM   860   C C   . ARG A  1 154 ? 469.857 75.799  432.599 1.00 65.19  ?  211 ARG A C   1 
ATOM   861   O O   . ARG A  1 154 ? 469.259 75.740  431.519 1.00 68.05  ?  211 ARG A O   1 
ATOM   862   C CB  . ARG A  1 154 ? 471.446 77.728  432.383 1.00 75.92  ?  211 ARG A CB  1 
ATOM   863   C CG  . ARG A  1 154 ? 472.849 78.300  432.556 1.00 75.73  ?  211 ARG A CG  1 
ATOM   864   C CD  . ARG A  1 154 ? 472.879 79.745  432.084 1.00 92.88  ?  211 ARG A CD  1 
ATOM   865   N NE  . ARG A  1 154 ? 474.155 80.416  432.317 1.00 124.54 ?  211 ARG A NE  1 
ATOM   866   C CZ  . ARG A  1 154 ? 474.356 81.712  432.098 1.00 123.52 ?  211 ARG A CZ  1 
ATOM   867   N NH1 . ARG A  1 154 ? 473.366 82.471  431.647 1.00 118.91 ?  211 ARG A NH1 1 
ATOM   868   N NH2 . ARG A  1 154 ? 475.546 82.252  432.333 1.00 107.40 ?  211 ARG A NH2 1 
ATOM   869   N N   . LEU A  1 155 ? 469.289 75.501  433.765 1.00 32.54  ?  212 LEU A N   1 
ATOM   870   C CA  . LEU A  1 155 ? 467.908 75.051  433.884 1.00 27.77  ?  212 LEU A CA  1 
ATOM   871   C C   . LEU A  1 155 ? 467.125 76.054  434.718 1.00 30.32  ?  212 LEU A C   1 
ATOM   872   O O   . LEU A  1 155 ? 467.589 76.475  435.783 1.00 29.59  ?  212 LEU A O   1 
ATOM   873   C CB  . LEU A  1 155 ? 467.826 73.663  434.529 1.00 20.45  ?  212 LEU A CB  1 
ATOM   874   C CG  . LEU A  1 155 ? 468.320 72.438  433.757 1.00 23.72  ?  212 LEU A CG  1 
ATOM   875   C CD1 . LEU A  1 155 ? 469.839 72.354  433.741 1.00 27.01  ?  212 LEU A CD1 1 
ATOM   876   C CD2 . LEU A  1 155 ? 467.718 71.171  434.343 1.00 26.94  ?  212 LEU A CD2 1 
ATOM   877   N N   . GLY A  1 156 ? 465.937 76.419  434.246 1.00 32.64  ?  213 GLY A N   1 
ATOM   878   C CA  . GLY A  1 156 ? 465.106 77.367  434.964 1.00 32.07  ?  213 GLY A CA  1 
ATOM   879   C C   . GLY A  1 156 ? 463.637 77.094  434.725 1.00 31.26  ?  213 GLY A C   1 
ATOM   880   O O   . GLY A  1 156 ? 463.247 76.487  433.722 1.00 31.24  ?  213 GLY A O   1 
ATOM   881   N N   . VAL A  1 157 ? 462.820 77.569  435.661 1.00 38.47  ?  214 VAL A N   1 
ATOM   882   C CA  . VAL A  1 157 ? 461.393 77.271  435.696 1.00 42.07  ?  214 VAL A CA  1 
ATOM   883   C C   . VAL A  1 157 ? 460.625 78.578  435.575 1.00 45.00  ?  214 VAL A C   1 
ATOM   884   O O   . VAL A  1 157 ? 460.814 79.494  436.386 1.00 50.68  ?  214 VAL A O   1 
ATOM   885   C CB  . VAL A  1 157 ? 460.999 76.524  436.979 1.00 38.01  ?  214 VAL A CB  1 
ATOM   886   C CG1 . VAL A  1 157 ? 459.488 76.366  437.059 1.00 39.60  ?  214 VAL A CG1 1 
ATOM   887   C CG2 . VAL A  1 157 ? 461.689 75.171  437.036 1.00 36.07  ?  214 VAL A CG2 1 
ATOM   888   N N   . HIS A  1 158 ? 459.755 78.659  434.573 1.00 60.03  ?  215 HIS A N   1 
ATOM   889   C CA  . HIS A  1 158 ? 458.897 79.814  434.360 1.00 58.73  ?  215 HIS A CA  1 
ATOM   890   C C   . HIS A  1 158 ? 457.472 79.451  434.752 1.00 56.57  ?  215 HIS A C   1 
ATOM   891   O O   . HIS A  1 158 ? 456.975 78.383  434.382 1.00 52.97  ?  215 HIS A O   1 
ATOM   892   C CB  . HIS A  1 158 ? 458.947 80.281  432.903 1.00 60.95  ?  215 HIS A CB  1 
ATOM   893   C CG  . HIS A  1 158 ? 460.289 80.787  432.471 1.00 70.18  ?  215 HIS A CG  1 
ATOM   894   N ND1 . HIS A  1 158 ? 460.442 81.752  431.499 1.00 83.99  ?  215 HIS A ND1 1 
ATOM   895   C CD2 . HIS A  1 158 ? 461.540 80.459  432.875 1.00 70.35  ?  215 HIS A CD2 1 
ATOM   896   C CE1 . HIS A  1 158 ? 461.728 81.998  431.324 1.00 77.51  ?  215 HIS A CE1 1 
ATOM   897   N NE2 . HIS A  1 158 ? 462.416 81.227  432.146 1.00 73.98  ?  215 HIS A NE2 1 
ATOM   898   N N   . LEU A  1 159 ? 456.826 80.336  435.503 1.00 34.02  ?  216 LEU A N   1 
ATOM   899   C CA  . LEU A  1 159 ? 455.457 80.140  435.956 1.00 29.16  ?  216 LEU A CA  1 
ATOM   900   C C   . LEU A  1 159 ? 454.526 81.003  435.117 1.00 33.17  ?  216 LEU A C   1 
ATOM   901   O O   . LEU A  1 159 ? 454.731 82.215  435.009 1.00 46.39  ?  216 LEU A O   1 
ATOM   902   C CB  . LEU A  1 159 ? 455.328 80.490  437.442 1.00 29.46  ?  216 LEU A CB  1 
ATOM   903   C CG  . LEU A  1 159 ? 454.027 80.191  438.194 1.00 34.81  ?  216 LEU A CG  1 
ATOM   904   C CD1 . LEU A  1 159 ? 454.328 79.945  439.663 1.00 27.38  ?  216 LEU A CD1 1 
ATOM   905   C CD2 . LEU A  1 159 ? 453.018 81.321  438.049 1.00 43.91  ?  216 LEU A CD2 1 
ATOM   906   N N   . HIS A  1 160 ? 453.520 80.378  434.510 1.00 30.02  ?  217 HIS A N   1 
ATOM   907   C CA  . HIS A  1 160 ? 452.494 81.091  433.759 1.00 34.83  ?  217 HIS A CA  1 
ATOM   908   C C   . HIS A  1 160 ? 451.134 80.551  434.168 1.00 33.88  ?  217 HIS A C   1 
ATOM   909   O O   . HIS A  1 160 ? 450.840 79.373  433.939 1.00 39.64  ?  217 HIS A O   1 
ATOM   910   C CB  . HIS A  1 160 ? 452.697 80.943  432.249 1.00 45.51  ?  217 HIS A CB  1 
ATOM   911   C CG  . HIS A  1 160 ? 451.671 81.665  431.432 1.00 49.51  ?  217 HIS A CG  1 
ATOM   912   N ND1 . HIS A  1 160 ? 451.794 82.994  431.087 1.00 51.33  ?  217 HIS A ND1 1 
ATOM   913   C CD2 . HIS A  1 160 ? 450.502 81.243  430.893 1.00 44.61  ?  217 HIS A CD2 1 
ATOM   914   C CE1 . HIS A  1 160 ? 450.746 83.360  430.370 1.00 46.77  ?  217 HIS A CE1 1 
ATOM   915   N NE2 . HIS A  1 160 ? 449.947 82.316  430.238 1.00 44.78  ?  217 HIS A NE2 1 
ATOM   916   N N   . THR A  1 161 ? 450.306 81.407  434.756 1.00 44.47  ?  218 THR A N   1 
ATOM   917   C CA  . THR A  1 161 ? 449.004 81.006  435.270 1.00 44.81  ?  218 THR A CA  1 
ATOM   918   C C   . THR A  1 161 ? 447.913 81.838  434.614 1.00 47.78  ?  218 THR A C   1 
ATOM   919   O O   . THR A  1 161 ? 448.018 83.067  434.539 1.00 51.03  ?  218 THR A O   1 
ATOM   920   C CB  . THR A  1 161 ? 448.944 81.150  436.795 1.00 41.96  ?  218 THR A CB  1 
ATOM   921   O OG1 . THR A  1 161 ? 447.583 81.054  437.233 1.00 47.46  ?  218 THR A OG1 1 
ATOM   922   C CG2 . THR A  1 161 ? 449.533 82.484  437.240 1.00 47.13  ?  218 THR A CG2 1 
ATOM   923   N N   . GLU A  1 162 ? 446.874 81.163  434.131 1.00 53.78  ?  219 GLU A N   1 
ATOM   924   C CA  . GLU A  1 162 ? 445.681 81.808  433.594 1.00 57.27  ?  219 GLU A CA  1 
ATOM   925   C C   . GLU A  1 162 ? 444.528 81.485  434.537 1.00 59.14  ?  219 GLU A C   1 
ATOM   926   O O   . GLU A  1 162 ? 444.080 80.335  434.606 1.00 56.85  ?  219 GLU A O   1 
ATOM   927   C CB  . GLU A  1 162 ? 445.389 81.333  432.173 1.00 65.49  ?  219 GLU A CB  1 
ATOM   928   C CG  . GLU A  1 162 ? 446.524 81.574  431.193 1.00 62.78  ?  219 GLU A CG  1 
ATOM   929   C CD  . GLU A  1 162 ? 446.148 81.213  429.770 1.00 75.90  ?  219 GLU A CD  1 
ATOM   930   O OE1 . GLU A  1 162 ? 444.937 81.082  429.489 1.00 75.44  ?  219 GLU A OE1 1 
ATOM   931   O OE2 . GLU A  1 162 ? 447.062 81.057  428.934 1.00 78.10  -1 219 GLU A OE2 1 
ATOM   932   N N   . ALA A  1 163 ? 444.051 82.496  435.257 1.00 51.37  ?  220 ALA A N   1 
ATOM   933   C CA  . ALA A  1 163 ? 443.059 82.294  436.300 1.00 51.37  ?  220 ALA A CA  1 
ATOM   934   C C   . ALA A  1 163 ? 442.019 83.403  436.240 1.00 55.11  ?  220 ALA A C   1 
ATOM   935   O O   . ALA A  1 163 ? 442.231 84.451  435.626 1.00 54.68  ?  220 ALA A O   1 
ATOM   936   C CB  . ALA A  1 163 ? 443.710 82.256  437.687 1.00 52.11  ?  220 ALA A CB  1 
ATOM   937   N N   . ARG A  1 164 ? 440.886 83.159  436.900 1.00 65.10  ?  221 ARG A N   1 
ATOM   938   C CA  . ARG A  1 164 ? 439.865 84.192  437.031 1.00 70.63  ?  221 ARG A CA  1 
ATOM   939   C C   . ARG A  1 164 ? 440.312 85.254  438.028 1.00 77.88  ?  221 ARG A C   1 
ATOM   940   O O   . ARG A  1 164 ? 440.513 86.420  437.669 1.00 86.26  ?  221 ARG A O   1 
ATOM   941   C CB  . ARG A  1 164 ? 438.534 83.569  437.455 1.00 76.79  ?  221 ARG A CB  1 
ATOM   942   C CG  . ARG A  1 164 ? 437.417 84.579  437.681 1.00 81.63  ?  221 ARG A CG  1 
ATOM   943   C CD  . ARG A  1 164 ? 436.161 83.912  438.226 1.00 76.26  ?  221 ARG A CD  1 
ATOM   944   N NE  . ARG A  1 164 ? 435.531 83.035  437.243 1.00 79.82  ?  221 ARG A NE  1 
ATOM   945   C CZ  . ARG A  1 164 ? 434.482 83.376  436.501 1.00 83.83  ?  221 ARG A CZ  1 
ATOM   946   N NH1 . ARG A  1 164 ? 433.940 84.581  436.627 1.00 79.03  ?  221 ARG A NH1 1 
ATOM   947   N NH2 . ARG A  1 164 ? 433.973 82.514  435.632 1.00 81.33  ?  221 ARG A NH2 1 
ATOM   948   N N   . ALA A  1 165 ? 440.469 84.865  439.289 1.00 55.72  ?  222 ALA A N   1 
ATOM   949   C CA  . ALA A  1 165 ? 441.091 85.707  440.302 1.00 61.59  ?  222 ALA A CA  1 
ATOM   950   C C   . ALA A  1 165 ? 442.518 85.207  440.504 1.00 67.56  ?  222 ALA A C   1 
ATOM   951   O O   . ALA A  1 165 ? 442.727 84.109  441.028 1.00 62.94  ?  222 ALA A O   1 
ATOM   952   C CB  . ALA A  1 165 ? 440.302 85.670  441.609 1.00 54.47  ?  222 ALA A CB  1 
ATOM   953   N N   . ARG A  1 166 ? 443.496 86.008  440.072 1.00 69.10  ?  223 ARG A N   1 
ATOM   954   C CA  . ARG A  1 166 ? 444.892 85.603  440.213 1.00 57.26  ?  223 ARG A CA  1 
ATOM   955   C C   . ARG A  1 166 ? 445.297 85.499  441.676 1.00 51.13  ?  223 ARG A C   1 
ATOM   956   O O   . ARG A  1 166 ? 446.174 84.700  442.022 1.00 53.97  ?  223 ARG A O   1 
ATOM   957   C CB  . ARG A  1 166 ? 445.801 86.581  439.464 1.00 57.24  ?  223 ARG A CB  1 
ATOM   958   C CG  . ARG A  1 166 ? 447.271 86.190  439.460 1.00 54.78  ?  223 ARG A CG  1 
ATOM   959   C CD  . ARG A  1 166 ? 447.993 86.757  438.250 1.00 55.30  ?  223 ARG A CD  1 
ATOM   960   N NE  . ARG A  1 166 ? 447.540 86.136  437.008 1.00 62.31  ?  223 ARG A NE  1 
ATOM   961   C CZ  . ARG A  1 166 ? 448.039 86.412  435.807 1.00 75.00  ?  223 ARG A CZ  1 
ATOM   962   N NH1 . ARG A  1 166 ? 449.014 87.302  435.680 1.00 87.30  ?  223 ARG A NH1 1 
ATOM   963   N NH2 . ARG A  1 166 ? 447.565 85.795  434.733 1.00 62.37  ?  223 ARG A NH2 1 
ATOM   964   N N   . HIS A  1 167 ? 444.659 86.277  442.546 1.00 49.31  ?  224 HIS A N   1 
ATOM   965   C CA  . HIS A  1 167 ? 444.832 86.133  443.985 1.00 47.14  ?  224 HIS A CA  1 
ATOM   966   C C   . HIS A  1 167 ? 444.019 84.928  444.453 1.00 45.39  ?  224 HIS A C   1 
ATOM   967   O O   . HIS A  1 167 ? 443.547 84.121  443.647 1.00 49.60  ?  224 HIS A O   1 
ATOM   968   C CB  . HIS A  1 167 ? 444.431 87.421  444.699 1.00 43.28  ?  224 HIS A CB  1 
ATOM   969   C CG  . HIS A  1 167 ? 442.995 87.799  444.505 1.00 47.03  ?  224 HIS A CG  1 
ATOM   970   N ND1 . HIS A  1 167 ? 441.989 87.340  445.327 1.00 53.46  ?  224 HIS A ND1 1 
ATOM   971   C CD2 . HIS A  1 167 ? 442.398 88.586  443.581 1.00 44.96  ?  224 HIS A CD2 1 
ATOM   972   C CE1 . HIS A  1 167 ? 440.833 87.832  444.919 1.00 49.00  ?  224 HIS A CE1 1 
ATOM   973   N NE2 . HIS A  1 167 ? 441.053 88.591  443.861 1.00 50.12  ?  224 HIS A NE2 1 
ATOM   974   N N   . ALA A  1 168 ? 443.892 84.768  445.772 1.00 29.66  ?  225 ALA A N   1 
ATOM   975   C CA  . ALA A  1 168 ? 443.102 83.700  446.386 1.00 37.43  ?  225 ALA A CA  1 
ATOM   976   C C   . ALA A  1 168 ? 443.736 82.328  446.182 1.00 38.37  ?  225 ALA A C   1 
ATOM   977   O O   . ALA A  1 168 ? 443.275 81.337  446.757 1.00 37.14  ?  225 ALA A O   1 
ATOM   978   C CB  . ALA A  1 168 ? 441.665 83.702  445.852 1.00 33.97  ?  225 ALA A CB  1 
ATOM   979   N N   . TRP A  1 169 ? 444.788 82.256  445.370 1.00 39.32  ?  226 TRP A N   1 
ATOM   980   C CA  . TRP A  1 169 ? 445.548 81.030  445.160 1.00 32.98  ?  226 TRP A CA  1 
ATOM   981   C C   . TRP A  1 169 ? 447.026 81.370  445.223 1.00 31.67  ?  226 TRP A C   1 
ATOM   982   O O   . TRP A  1 169 ? 447.507 82.197  444.442 1.00 30.98  ?  226 TRP A O   1 
ATOM   983   C CB  . TRP A  1 169 ? 445.205 80.377  443.818 1.00 34.00  ?  226 TRP A CB  1 
ATOM   984   C CG  . TRP A  1 169 ? 443.932 79.586  443.827 1.00 34.36  ?  226 TRP A CG  1 
ATOM   985   C CD1 . TRP A  1 169 ? 442.704 80.006  443.406 1.00 39.83  ?  226 TRP A CD1 1 
ATOM   986   C CD2 . TRP A  1 169 ? 443.765 78.233  444.267 1.00 36.45  ?  226 TRP A CD2 1 
ATOM   987   N NE1 . TRP A  1 169 ? 441.782 79.000  443.562 1.00 40.74  ?  226 TRP A NE1 1 
ATOM   988   C CE2 . TRP A  1 169 ? 442.407 77.901  444.090 1.00 36.91  ?  226 TRP A CE2 1 
ATOM   989   C CE3 . TRP A  1 169 ? 444.630 77.272  444.800 1.00 39.01  ?  226 TRP A CE3 1 
ATOM   990   C CZ2 . TRP A  1 169 ? 441.894 76.649  444.423 1.00 36.30  ?  226 TRP A CZ2 1 
ATOM   991   C CZ3 . TRP A  1 169 ? 444.118 76.029  445.130 1.00 40.58  ?  226 TRP A CZ3 1 
ATOM   992   C CH2 . TRP A  1 169 ? 442.764 75.730  444.940 1.00 38.98  ?  226 TRP A CH2 1 
ATOM   993   N N   . GLN A  1 170 ? 447.741 80.739  446.148 1.00 25.04  ?  227 GLN A N   1 
ATOM   994   C CA  . GLN A  1 170 ? 449.169 80.956  446.314 1.00 26.14  ?  227 GLN A CA  1 
ATOM   995   C C   . GLN A  1 170 ? 449.889 79.616  446.311 1.00 25.09  ?  227 GLN A C   1 
ATOM   996   O O   . GLN A  1 170 ? 449.278 78.556  446.458 1.00 27.78  ?  227 GLN A O   1 
ATOM   997   C CB  . GLN A  1 170 ? 449.484 81.713  447.612 1.00 25.88  ?  227 GLN A CB  1 
ATOM   998   C CG  . GLN A  1 170 ? 448.875 83.102  447.690 1.00 26.15  ?  227 GLN A CG  1 
ATOM   999   C CD  . GLN A  1 170 ? 449.234 83.817  448.977 1.00 30.17  ?  227 GLN A CD  1 
ATOM   1000  O OE1 . GLN A  1 170 ? 450.063 83.342  449.755 1.00 24.24  ?  227 GLN A OE1 1 
ATOM   1001  N NE2 . GLN A  1 170 ? 448.609 84.965  449.210 1.00 34.81  ?  227 GLN A NE2 1 
ATOM   1002  N N   . LEU A  1 171 ? 451.205 79.678  446.134 1.00 34.33  ?  228 LEU A N   1 
ATOM   1003  C CA  . LEU A  1 171 ? 452.035 78.486  446.209 1.00 40.08  ?  228 LEU A CA  1 
ATOM   1004  C C   . LEU A  1 171 ? 452.243 78.101  447.667 1.00 38.71  ?  228 LEU A C   1 
ATOM   1005  O O   . LEU A  1 171 ? 452.541 78.957  448.507 1.00 41.37  ?  228 LEU A O   1 
ATOM   1006  C CB  . LEU A  1 171 ? 453.383 78.723  445.529 1.00 47.02  ?  228 LEU A CB  1 
ATOM   1007  C CG  . LEU A  1 171 ? 453.385 79.206  444.076 1.00 43.02  ?  228 LEU A CG  1 
ATOM   1008  C CD1 . LEU A  1 171 ? 454.804 79.495  443.611 1.00 38.81  ?  228 LEU A CD1 1 
ATOM   1009  C CD2 . LEU A  1 171 ? 452.717 78.195  443.165 1.00 40.35  ?  228 LEU A CD2 1 
ATOM   1010  N N   . THR A  1 172 ? 452.077 76.817  447.971 1.00 22.78  ?  229 THR A N   1 
ATOM   1011  C CA  . THR A  1 172 ? 452.386 76.330  449.308 1.00 24.39  ?  229 THR A CA  1 
ATOM   1012  C C   . THR A  1 172 ? 453.886 76.440  449.552 1.00 34.52  ?  229 THR A C   1 
ATOM   1013  O O   . THR A  1 172 ? 454.693 75.957  448.753 1.00 42.63  ?  229 THR A O   1 
ATOM   1014  C CB  . THR A  1 172 ? 451.926 74.883  449.475 1.00 24.25  ?  229 THR A CB  1 
ATOM   1015  O OG1 . THR A  1 172 ? 450.525 74.788  449.190 1.00 26.53  ?  229 THR A OG1 1 
ATOM   1016  C CG2 . THR A  1 172 ? 452.180 74.409  450.898 1.00 27.95  ?  229 THR A CG2 1 
ATOM   1017  N N   . GLN A  1 173 ? 454.259 77.082  450.656 1.00 40.70  ?  230 GLN A N   1 
ATOM   1018  C CA  . GLN A  1 173 ? 455.665 77.341  450.930 1.00 41.07  ?  230 GLN A CA  1 
ATOM   1019  C C   . GLN A  1 173 ? 456.393 76.046  451.268 1.00 43.36  ?  230 GLN A C   1 
ATOM   1020  O O   . GLN A  1 173 ? 455.985 75.307  452.170 1.00 44.22  ?  230 GLN A O   1 
ATOM   1021  C CB  . GLN A  1 173 ? 455.799 78.344  452.073 1.00 43.70  ?  230 GLN A CB  1 
ATOM   1022  C CG  . GLN A  1 173 ? 455.157 79.684  451.778 1.00 44.03  ?  230 GLN A CG  1 
ATOM   1023  C CD  . GLN A  1 173 ? 455.075 80.566  453.002 1.00 62.07  ?  230 GLN A CD  1 
ATOM   1024  O OE1 . GLN A  1 173 ? 455.920 81.434  453.210 1.00 67.33  ?  230 GLN A OE1 1 
ATOM   1025  N NE2 . GLN A  1 173 ? 454.052 80.348  453.822 1.00 71.90  ?  230 GLN A NE2 1 
ATOM   1026  N N   . GLY A  1 174 ? 457.476 75.775  450.540 1.00 43.37  ?  231 GLY A N   1 
ATOM   1027  C CA  . GLY A  1 174 ? 458.260 74.578  450.741 1.00 41.31  ?  231 GLY A CA  1 
ATOM   1028  C C   . GLY A  1 174 ? 457.783 73.361  449.979 1.00 48.28  ?  231 GLY A C   1 
ATOM   1029  O O   . GLY A  1 174 ? 458.507 72.357  449.935 1.00 54.76  ?  231 GLY A O   1 
ATOM   1030  N N   . ALA A  1 175 ? 456.593 73.410  449.380 1.00 40.57  ?  232 ALA A N   1 
ATOM   1031  C CA  . ALA A  1 175 ? 456.025 72.276  448.663 1.00 37.55  ?  232 ALA A CA  1 
ATOM   1032  C C   . ALA A  1 175 ? 456.272 72.323  447.160 1.00 29.43  ?  232 ALA A C   1 
ATOM   1033  O O   . ALA A  1 175 ? 455.878 71.390  446.454 1.00 28.86  ?  232 ALA A O   1 
ATOM   1034  C CB  . ALA A  1 175 ? 454.520 72.183  448.934 1.00 39.44  ?  232 ALA A CB  1 
ATOM   1035  N N   . THR A  1 176 ? 456.902 73.378  446.653 1.00 32.57  ?  233 THR A N   1 
ATOM   1036  C CA  . THR A  1 176 ? 457.252 73.480  445.241 1.00 34.68  ?  233 THR A CA  1 
ATOM   1037  C C   . THR A  1 176 ? 458.747 73.230  445.096 1.00 36.27  ?  233 THR A C   1 
ATOM   1038  O O   . THR A  1 176 ? 459.562 73.985  445.637 1.00 41.01  ?  233 THR A O   1 
ATOM   1039  C CB  . THR A  1 176 ? 456.869 74.846  444.675 1.00 33.58  ?  233 THR A CB  1 
ATOM   1040  O OG1 . THR A  1 176 ? 455.462 75.059  444.846 1.00 39.92  ?  233 THR A OG1 1 
ATOM   1041  C CG2 . THR A  1 176 ? 457.206 74.920  443.194 1.00 29.85  ?  233 THR A CG2 1 
ATOM   1042  N N   . VAL A  1 177 ? 459.104 72.176  444.367 1.00 33.62  ?  234 VAL A N   1 
ATOM   1043  C CA  . VAL A  1 177 ? 460.467 71.659  444.357 1.00 35.34  ?  234 VAL A CA  1 
ATOM   1044  C C   . VAL A  1 177 ? 460.864 71.286  442.936 1.00 40.78  ?  234 VAL A C   1 
ATOM   1045  O O   . VAL A  1 177 ? 460.085 70.667  442.203 1.00 48.14  ?  234 VAL A O   1 
ATOM   1046  C CB  . VAL A  1 177 ? 460.601 70.445  445.303 1.00 35.83  ?  234 VAL A CB  1 
ATOM   1047  C CG1 . VAL A  1 177 ? 461.729 69.526  444.860 1.00 38.27  ?  234 VAL A CG1 1 
ATOM   1048  C CG2 . VAL A  1 177 ? 460.823 70.912  446.732 1.00 38.37  ?  234 VAL A CG2 1 
ATOM   1049  N N   . LEU A  1 178 ? 462.080 71.669  442.546 1.00 27.76  ?  235 LEU A N   1 
ATOM   1050  C CA  . LEU A  1 178 ? 462.711 71.195  441.319 1.00 26.44  ?  235 LEU A CA  1 
ATOM   1051  C C   . LEU A  1 178 ? 463.900 70.329  441.718 1.00 31.03  ?  235 LEU A C   1 
ATOM   1052  O O   . LEU A  1 178 ? 464.929 70.847  442.164 1.00 32.66  ?  235 LEU A O   1 
ATOM   1053  C CB  . LEU A  1 178 ? 463.152 72.363  440.441 1.00 26.42  ?  235 LEU A CB  1 
ATOM   1054  C CG  . LEU A  1 178 ? 464.018 72.015  439.229 1.00 26.63  ?  235 LEU A CG  1 
ATOM   1055  C CD1 . LEU A  1 178 ? 463.181 71.374  438.132 1.00 28.28  ?  235 LEU A CD1 1 
ATOM   1056  C CD2 . LEU A  1 178 ? 464.742 73.246  438.708 1.00 26.54  ?  235 LEU A CD2 1 
ATOM   1057  N N   . GLY A  1 179 ? 463.758 69.015  441.558 1.00 32.86  ?  236 GLY A N   1 
ATOM   1058  C CA  . GLY A  1 179 ? 464.801 68.083  441.915 1.00 22.97  ?  236 GLY A CA  1 
ATOM   1059  C C   . GLY A  1 179 ? 465.602 67.592  440.726 1.00 21.06  ?  236 GLY A C   1 
ATOM   1060  O O   . GLY A  1 179 ? 465.168 67.670  439.580 1.00 26.04  ?  236 GLY A O   1 
ATOM   1061  N N   . LEU A  1 180 ? 466.794 67.078  441.022 1.00 38.94  ?  237 LEU A N   1 
ATOM   1062  C CA  . LEU A  1 180 ? 467.663 66.509  440.006 1.00 37.14  ?  237 LEU A CA  1 
ATOM   1063  C C   . LEU A  1 180 ? 468.561 65.463  440.654 1.00 42.33  ?  237 LEU A C   1 
ATOM   1064  O O   . LEU A  1 180 ? 469.015 65.653  441.784 1.00 51.38  ?  237 LEU A O   1 
ATOM   1065  C CB  . LEU A  1 180 ? 468.493 67.614  439.341 1.00 39.79  ?  237 LEU A CB  1 
ATOM   1066  C CG  . LEU A  1 180 ? 469.387 67.310  438.144 1.00 42.95  ?  237 LEU A CG  1 
ATOM   1067  C CD1 . LEU A  1 180 ? 469.293 68.435  437.128 1.00 41.48  ?  237 LEU A CD1 1 
ATOM   1068  C CD2 . LEU A  1 180 ? 470.813 67.148  438.615 1.00 49.49  ?  237 LEU A CD2 1 
ATOM   1069  N N   . PHE A  1 181 ? 468.810 64.361  439.945 1.00 19.55  ?  238 PHE A N   1 
ATOM   1070  C CA  . PHE A  1 181 ? 469.841 63.419  440.363 1.00 25.01  ?  238 PHE A CA  1 
ATOM   1071  C C   . PHE A  1 181 ? 470.367 62.673  439.144 1.00 24.15  ?  238 PHE A C   1 
ATOM   1072  O O   . PHE A  1 181 ? 469.637 62.437  438.179 1.00 26.63  ?  238 PHE A O   1 
ATOM   1073  C CB  . PHE A  1 181 ? 469.347 62.442  441.447 1.00 21.22  ?  238 PHE A CB  1 
ATOM   1074  C CG  . PHE A  1 181 ? 468.353 61.421  440.970 1.00 15.10  ?  238 PHE A CG  1 
ATOM   1075  C CD1 . PHE A  1 181 ? 468.776 60.224  440.415 1.00 14.04  ?  238 PHE A CD1 1 
ATOM   1076  C CD2 . PHE A  1 181 ? 466.995 61.635  441.132 1.00 21.19  ?  238 PHE A CD2 1 
ATOM   1077  C CE1 . PHE A  1 181 ? 467.863 59.277  439.996 1.00 19.99  ?  238 PHE A CE1 1 
ATOM   1078  C CE2 . PHE A  1 181 ? 466.077 60.690  440.718 1.00 20.45  ?  238 PHE A CE2 1 
ATOM   1079  C CZ  . PHE A  1 181 ? 466.511 59.509  440.149 1.00 21.89  ?  238 PHE A CZ  1 
ATOM   1080  N N   . ARG A  1 182 ? 471.643 62.296  439.209 1.00 36.97  ?  239 ARG A N   1 
ATOM   1081  C CA  . ARG A  1 182 ? 472.343 61.768  438.048 1.00 36.09  ?  239 ARG A CA  1 
ATOM   1082  C C   . ARG A  1 182 ? 472.003 60.303  437.796 1.00 34.30  ?  239 ARG A C   1 
ATOM   1083  O O   . ARG A  1 182 ? 471.628 59.558  438.705 1.00 40.96  ?  239 ARG A O   1 
ATOM   1084  C CB  . ARG A  1 182 ? 473.855 61.926  438.215 1.00 42.63  ?  239 ARG A CB  1 
ATOM   1085  C CG  . ARG A  1 182 ? 474.625 61.832  436.906 1.00 40.85  ?  239 ARG A CG  1 
ATOM   1086  C CD  . ARG A  1 182 ? 476.087 62.198  437.071 1.00 42.99  ?  239 ARG A CD  1 
ATOM   1087  N NE  . ARG A  1 182 ? 476.742 62.330  435.773 1.00 57.30  ?  239 ARG A NE  1 
ATOM   1088  C CZ  . ARG A  1 182 ? 478.029 62.618  435.608 1.00 75.04  ?  239 ARG A CZ  1 
ATOM   1089  N NH1 . ARG A  1 182 ? 478.811 62.805  436.664 1.00 77.37  ?  239 ARG A NH1 1 
ATOM   1090  N NH2 . ARG A  1 182 ? 478.533 62.721  434.386 1.00 67.95  ?  239 ARG A NH2 1 
ATOM   1091  N N   . VAL A  1 183 ? 472.147 59.901  436.534 1.00 18.21  ?  240 VAL A N   1 
ATOM   1092  C CA  . VAL A  1 183 ? 471.937 58.531  436.085 1.00 18.95  ?  240 VAL A CA  1 
ATOM   1093  C C   . VAL A  1 183 ? 473.217 58.042  435.420 1.00 34.05  ?  240 VAL A C   1 
ATOM   1094  O O   . VAL A  1 183 ? 473.791 57.026  435.830 1.00 43.61  ?  240 VAL A O   1 
ATOM   1095  C CB  . VAL A  1 183 ? 470.733 58.425  435.132 1.00 18.64  ?  240 VAL A CB  1 
ATOM   1096  C CG1 . VAL A  1 183 ? 470.656 57.031  434.533 1.00 22.47  ?  240 VAL A CG1 1 
ATOM   1097  C CG2 . VAL A  1 183 ? 469.448 58.762  435.870 1.00 18.84  ?  240 VAL A CG2 1 
ATOM   1098  N N   . THR A  1 184 ? 473.640 58.739  434.366 1.00 39.05  ?  241 THR A N   1 
ATOM   1099  C CA  . THR A  1 184 ? 474.860 58.398  433.647 1.00 37.34  ?  241 THR A CA  1 
ATOM   1100  C C   . THR A  1 184 ? 476.027 58.235  434.623 1.00 43.74  ?  241 THR A C   1 
ATOM   1101  O O   . THR A  1 184 ? 476.280 59.136  435.436 1.00 45.11  ?  241 THR A O   1 
ATOM   1102  C CB  . THR A  1 184 ? 475.189 59.486  432.622 1.00 35.50  ?  241 THR A CB  1 
ATOM   1103  O OG1 . THR A  1 184 ? 474.237 59.442  431.551 1.00 45.51  ?  241 THR A OG1 1 
ATOM   1104  C CG2 . THR A  1 184 ? 476.590 59.296  432.061 1.00 42.44  ?  241 THR A CG2 1 
ATOM   1105  N N   . PRO A  1 185 ? 476.758 57.127  434.566 1.00 50.06  ?  242 PRO A N   1 
ATOM   1106  C CA  . PRO A  1 185 ? 477.799 56.868  435.563 1.00 48.84  ?  242 PRO A CA  1 
ATOM   1107  C C   . PRO A  1 185 ? 479.059 57.686  435.316 1.00 54.09  ?  242 PRO A C   1 
ATOM   1108  O O   . PRO A  1 185 ? 479.328 58.160  434.211 1.00 55.76  ?  242 PRO A O   1 
ATOM   1109  C CB  . PRO A  1 185 ? 478.080 55.371  435.390 1.00 50.14  ?  242 PRO A CB  1 
ATOM   1110  C CG  . PRO A  1 185 ? 477.787 55.118  433.949 1.00 48.81  ?  242 PRO A CG  1 
ATOM   1111  C CD  . PRO A  1 185 ? 476.632 56.022  433.598 1.00 51.92  ?  242 PRO A CD  1 
ATOM   1112  N N   . GLU A  1 186 ? 479.831 57.840  436.387 1.00 67.23  ?  243 GLU A N   1 
ATOM   1113  C CA  . GLU A  1 186 ? 481.128 58.507  436.333 1.00 76.14  ?  243 GLU A CA  1 
ATOM   1114  C C   . GLU A  1 186 ? 482.036 57.988  437.442 1.00 76.54  ?  243 GLU A C   1 
ATOM   1115  O O   . GLU A  1 186 ? 481.600 57.230  438.309 1.00 62.52  ?  243 GLU A O   1 
ATOM   1116  C CB  . GLU A  1 186 ? 480.968 60.025  436.448 1.00 79.06  ?  243 GLU A CB  1 
ATOM   1117  C CG  . GLU A  1 186 ? 481.029 60.762  435.119 1.00 78.50  ?  243 GLU A CG  1 
ATOM   1118  C CD  . GLU A  1 186 ? 482.442 60.876  434.576 1.00 84.23  ?  243 GLU A CD  1 
ATOM   1119  O OE1 . GLU A  1 186 ? 483.077 61.931  434.787 1.00 83.50  ?  243 GLU A OE1 1 
ATOM   1120  O OE2 . GLU A  1 186 ? 482.916 59.912  433.939 1.00 83.19  -1 243 GLU A OE2 1 
ATOM   1121  N N   . PRO B  2 4   ? 475.437 64.041  469.556 1.00 97.33  ?  27  PRO B N   1 
ATOM   1122  C CA  . PRO B  2 4   ? 476.458 65.100  469.602 1.00 104.83 ?  27  PRO B CA  1 
ATOM   1123  C C   . PRO B  2 4   ? 475.980 66.460  469.102 1.00 107.07 ?  27  PRO B C   1 
ATOM   1124  O O   . PRO B  2 4   ? 476.174 67.471  469.742 1.00 112.51 ?  27  PRO B O   1 
ATOM   1125  C CB  . PRO B  2 4   ? 477.547 64.570  468.667 1.00 97.07  ?  27  PRO B CB  1 
ATOM   1126  C CG  . PRO B  2 4   ? 476.854 63.626  467.724 1.00 95.38  ?  27  PRO B CG  1 
ATOM   1127  C CD  . PRO B  2 4   ? 475.663 63.078  468.463 1.00 92.67  ?  27  PRO B CD  1 
ATOM   1128  N N   . CYS B  2 5   ? 475.424 66.510  467.918 1.00 89.88  ?  28  CYS B N   1 
ATOM   1129  C CA  . CYS B  2 5   ? 474.951 67.744  467.420 1.00 93.47  ?  28  CYS B CA  1 
ATOM   1130  C C   . CYS B  2 5   ? 473.794 68.331  468.232 1.00 98.49  ?  28  CYS B C   1 
ATOM   1131  O O   . CYS B  2 5   ? 473.344 69.430  467.906 1.00 101.22 ?  28  CYS B O   1 
ATOM   1132  C CB  . CYS B  2 5   ? 474.376 67.367  465.970 1.00 93.70  ?  28  CYS B CB  1 
ATOM   1133  S SG  . CYS B  2 5   ? 473.227 68.469  465.121 1.00 109.85 ?  28  CYS B SG  1 
ATOM   1134  N N   . SER B  2 6   ? 473.413 67.672  469.337 1.00 106.17 ?  29  SER B N   1 
ATOM   1135  C CA  . SER B  2 6   ? 472.217 68.041  470.093 1.00 104.09 ?  29  SER B CA  1 
ATOM   1136  C C   . SER B  2 6   ? 472.400 69.277  470.969 1.00 101.25 ?  29  SER B C   1 
ATOM   1137  O O   . SER B  2 6   ? 471.428 70.003  471.207 1.00 101.75 ?  29  SER B O   1 
ATOM   1138  C CB  . SER B  2 6   ? 471.777 66.860  470.960 1.00 97.57  ?  29  SER B CB  1 
ATOM   1139  O OG  . SER B  2 6   ? 472.793 66.509  471.888 1.00 104.18 ?  29  SER B OG  1 
ATOM   1140  N N   . ASN B  2 7   ? 473.614 69.535  471.460 1.00 117.03 ?  30  ASN B N   1 
ATOM   1141  C CA  . ASN B  2 7   ? 473.806 70.565  472.479 1.00 119.75 ?  30  ASN B CA  1 
ATOM   1142  C C   . ASN B  2 7   ? 473.579 71.986  471.980 1.00 120.76 ?  30  ASN B C   1 
ATOM   1143  O O   . ASN B  2 7   ? 473.679 72.923  472.780 1.00 122.32 ?  30  ASN B O   1 
ATOM   1144  C CB  . ASN B  2 7   ? 475.246 70.545  473.000 1.00 125.68 ?  30  ASN B CB  1 
ATOM   1145  C CG  . ASN B  2 7   ? 475.557 69.302  473.803 1.00 137.19 ?  30  ASN B CG  1 
ATOM   1146  O OD1 . ASN B  2 7   ? 475.747 68.220  473.250 1.00 132.16 ?  30  ASN B OD1 1 
ATOM   1147  N ND2 . ASN B  2 7   ? 475.613 69.451  475.123 1.00 133.66 ?  30  ASN B ND2 1 
ATOM   1148  N N   . CYS B  2 8   ? 473.290 72.172  470.734 1.00 108.40 ?  31  CYS B N   1 
ATOM   1149  C CA  . CYS B  2 8   ? 473.167 73.586  470.408 1.00 114.32 ?  31  CYS B CA  1 
ATOM   1150  C C   . CYS B  2 8   ? 471.707 74.037  470.448 1.00 112.48 ?  31  CYS B C   1 
ATOM   1151  O O   . CYS B  2 8   ? 470.809 73.272  470.082 1.00 101.65 ?  31  CYS B O   1 
ATOM   1152  C CB  . CYS B  2 8   ? 473.774 73.863  469.045 1.00 116.21 ?  31  CYS B CB  1 
ATOM   1153  S SG  . CYS B  2 8   ? 475.563 73.713  469.119 1.00 143.08 ?  31  CYS B SG  1 
ATOM   1154  N N   . PRO B  2 9   ? 471.469 75.284  470.877 1.00 126.52 ?  32  PRO B N   1 
ATOM   1155  C CA  . PRO B  2 9   ? 470.107 75.701  471.239 1.00 126.07 ?  32  PRO B CA  1 
ATOM   1156  C C   . PRO B  2 9   ? 469.236 76.087  470.056 1.00 114.82 ?  32  PRO B C   1 
ATOM   1157  O O   . PRO B  2 9   ? 469.613 75.904  468.894 1.00 110.24 ?  32  PRO B O   1 
ATOM   1158  C CB  . PRO B  2 9   ? 470.358 76.909  472.147 1.00 136.88 ?  32  PRO B CB  1 
ATOM   1159  C CG  . PRO B  2 9   ? 471.590 77.525  471.565 1.00 135.80 ?  32  PRO B CG  1 
ATOM   1160  C CD  . PRO B  2 9   ? 472.445 76.372  471.079 1.00 125.99 ?  32  PRO B CD  1 
ATOM   1161  N N   . ALA B  2 10  ? 468.054 76.619  470.360 1.00 104.70 ?  33  ALA B N   1 
ATOM   1162  C CA  . ALA B  2 10  ? 467.170 77.139  469.329 1.00 104.47 ?  33  ALA B CA  1 
ATOM   1163  C C   . ALA B  2 10  ? 467.821 78.321  468.622 1.00 100.98 ?  33  ALA B C   1 
ATOM   1164  O O   . ALA B  2 10  ? 468.621 79.060  469.202 1.00 96.61  ?  33  ALA B O   1 
ATOM   1165  C CB  . ALA B  2 10  ? 465.830 77.559  469.934 1.00 109.34 ?  33  ALA B CB  1 
ATOM   1166  N N   . GLY B  2 11  ? 467.467 78.495  467.350 1.00 119.03 ?  34  GLY B N   1 
ATOM   1167  C CA  . GLY B  2 11  ? 468.069 79.511  466.522 1.00 113.83 ?  34  GLY B CA  1 
ATOM   1168  C C   . GLY B  2 11  ? 469.313 79.073  465.783 1.00 109.23 ?  34  GLY B C   1 
ATOM   1169  O O   . GLY B  2 11  ? 469.830 79.842  464.961 1.00 99.64  ?  34  GLY B O   1 
ATOM   1170  N N   . THR B  2 12  ? 469.817 77.870  466.051 1.00 89.22  ?  35  THR B N   1 
ATOM   1171  C CA  . THR B  2 12  ? 470.983 77.335  465.369 1.00 82.13  ?  35  THR B CA  1 
ATOM   1172  C C   . THR B  2 12  ? 470.704 75.909  464.921 1.00 77.05  ?  35  THR B C   1 
ATOM   1173  O O   . THR B  2 12  ? 469.753 75.263  465.370 1.00 82.03  ?  35  THR B O   1 
ATOM   1174  C CB  . THR B  2 12  ? 472.235 77.349  466.262 1.00 78.48  ?  35  THR B CB  1 
ATOM   1175  O OG1 . THR B  2 12  ? 472.042 76.461  467.370 1.00 87.65  ?  35  THR B OG1 1 
ATOM   1176  C CG2 . THR B  2 12  ? 472.520 78.751  466.779 1.00 82.44  ?  35  THR B CG2 1 
ATOM   1177  N N   . PHE B  2 13  ? 471.553 75.426  464.022 1.00 59.32  ?  36  PHE B N   1 
ATOM   1178  C CA  . PHE B  2 13  ? 471.524 74.046  463.576 1.00 60.19  ?  36  PHE B CA  1 
ATOM   1179  C C   . PHE B  2 13  ? 472.957 73.547  463.522 1.00 62.19  ?  36  PHE B C   1 
ATOM   1180  O O   . PHE B  2 13  ? 473.906 74.288  463.790 1.00 67.36  ?  36  PHE B O   1 
ATOM   1181  C CB  . PHE B  2 13  ? 470.855 73.908  462.202 1.00 59.27  ?  36  PHE B CB  1 
ATOM   1182  C CG  . PHE B  2 13  ? 471.726 74.355  461.057 1.00 59.30  ?  36  PHE B CG  1 
ATOM   1183  C CD1 . PHE B  2 13  ? 472.024 75.696  460.874 1.00 59.57  ?  36  PHE B CD1 1 
ATOM   1184  C CD2 . PHE B  2 13  ? 472.246 73.433  460.164 1.00 55.72  ?  36  PHE B CD2 1 
ATOM   1185  C CE1 . PHE B  2 13  ? 472.825 76.107  459.822 1.00 52.70  ?  36  PHE B CE1 1 
ATOM   1186  C CE2 . PHE B  2 13  ? 473.046 73.838  459.111 1.00 51.26  ?  36  PHE B CE2 1 
ATOM   1187  C CZ  . PHE B  2 13  ? 473.336 75.176  458.941 1.00 49.39  ?  36  PHE B CZ  1 
ATOM   1188  N N   . CYS B  2 14  ? 473.114 72.281  463.162 1.00 60.39  ?  37  CYS B N   1 
ATOM   1189  C CA  . CYS B  2 14  ? 474.411 71.727  462.813 1.00 66.14  ?  37  CYS B CA  1 
ATOM   1190  C C   . CYS B  2 14  ? 474.312 71.150  461.412 1.00 69.43  ?  37  CYS B C   1 
ATOM   1191  O O   . CYS B  2 14  ? 473.384 70.393  461.111 1.00 69.50  ?  37  CYS B O   1 
ATOM   1192  C CB  . CYS B  2 14  ? 474.867 70.666  463.824 1.00 70.89  ?  37  CYS B CB  1 
ATOM   1193  S SG  . CYS B  2 14  ? 474.296 68.994  463.478 1.00 80.53  ?  37  CYS B SG  1 
ATOM   1194  N N   . ASP B  2 15  ? 475.225 71.555  460.542 1.00 83.85  ?  38  ASP B N   1 
ATOM   1195  C CA  . ASP B  2 15  ? 475.308 70.958  459.222 1.00 90.32  ?  38  ASP B CA  1 
ATOM   1196  C C   . ASP B  2 15  ? 476.195 69.725  459.293 1.00 89.05  ?  38  ASP B C   1 
ATOM   1197  O O   . ASP B  2 15  ? 477.183 69.701  460.032 1.00 89.28  ?  38  ASP B O   1 
ATOM   1198  C CB  . ASP B  2 15  ? 475.843 71.961  458.198 1.00 77.79  ?  38  ASP B CB  1 
ATOM   1199  C CG  . ASP B  2 15  ? 476.970 72.809  458.746 1.00 75.34  ?  38  ASP B CG  1 
ATOM   1200  O OD1 . ASP B  2 15  ? 477.326 72.644  459.931 1.00 77.58  ?  38  ASP B OD1 1 
ATOM   1201  O OD2 . ASP B  2 15  ? 477.490 73.655  457.989 1.00 80.18  -1 38  ASP B OD2 1 
ATOM   1202  N N   . ASN B  2 16  ? 475.806 68.681  458.562 1.00 108.20 ?  39  ASN B N   1 
ATOM   1203  C CA  . ASN B  2 16  ? 476.643 67.492  458.490 1.00 114.62 ?  39  ASN B CA  1 
ATOM   1204  C C   . ASN B  2 16  ? 477.761 67.647  457.471 1.00 120.15 ?  39  ASN B C   1 
ATOM   1205  O O   . ASN B  2 16  ? 478.713 66.859  457.487 1.00 122.64 ?  39  ASN B O   1 
ATOM   1206  C CB  . ASN B  2 16  ? 475.787 66.260  458.198 1.00 114.66 ?  39  ASN B CB  1 
ATOM   1207  C CG  . ASN B  2 16  ? 474.934 65.856  459.390 1.00 125.45 ?  39  ASN B CG  1 
ATOM   1208  O OD1 . ASN B  2 16  ? 474.026 66.584  459.795 1.00 124.24 ?  39  ASN B OD1 1 
ATOM   1209  N ND2 . ASN B  2 16  ? 475.239 64.702  459.972 1.00 128.14 ?  39  ASN B ND2 1 
ATOM   1210  N N   . ASN B  2 17  ? 477.662 68.637  456.589 1.00 82.51  ?  40  ASN B N   1 
ATOM   1211  C CA  . ASN B  2 17  ? 478.857 69.234  456.023 1.00 71.58  ?  40  ASN B CA  1 
ATOM   1212  C C   . ASN B  2 17  ? 479.475 70.140  457.083 1.00 69.36  ?  40  ASN B C   1 
ATOM   1213  O O   . ASN B  2 17  ? 478.913 70.334  458.163 1.00 75.53  ?  40  ASN B O   1 
ATOM   1214  C CB  . ASN B  2 17  ? 478.521 70.019  454.761 1.00 64.01  ?  40  ASN B CB  1 
ATOM   1215  C CG  . ASN B  2 17  ? 477.463 69.347  453.915 1.00 67.95  ?  40  ASN B CG  1 
ATOM   1216  O OD1 . ASN B  2 17  ? 477.546 68.156  453.619 1.00 68.30  ?  40  ASN B OD1 1 
ATOM   1217  N ND2 . ASN B  2 17  ? 476.454 70.115  453.517 1.00 67.32  ?  40  ASN B ND2 1 
ATOM   1218  N N   . ARG B  2 18  ? 480.638 70.717  456.789 1.00 42.84  ?  41  ARG B N   1 
ATOM   1219  C CA  . ARG B  2 18  ? 481.270 71.682  457.691 1.00 48.90  ?  41  ARG B CA  1 
ATOM   1220  C C   . ARG B  2 18  ? 481.520 71.088  459.084 1.00 46.21  ?  41  ARG B C   1 
ATOM   1221  O O   . ARG B  2 18  ? 481.649 71.821  460.069 1.00 35.05  ?  41  ARG B O   1 
ATOM   1222  C CB  . ARG B  2 18  ? 480.424 72.963  457.764 1.00 36.76  ?  41  ARG B CB  1 
ATOM   1223  C CG  . ARG B  2 18  ? 481.111 74.209  458.295 1.00 36.83  ?  41  ARG B CG  1 
ATOM   1224  C CD  . ARG B  2 18  ? 480.646 75.439  457.524 1.00 38.05  ?  41  ARG B CD  1 
ATOM   1225  N NE  . ARG B  2 18  ? 479.200 75.462  457.319 1.00 43.70  ?  41  ARG B NE  1 
ATOM   1226  C CZ  . ARG B  2 18  ? 478.610 75.934  456.222 1.00 42.05  ?  41  ARG B CZ  1 
ATOM   1227  N NH1 . ARG B  2 18  ? 479.344 76.417  455.228 1.00 39.00  1  41  ARG B NH1 1 
ATOM   1228  N NH2 . ARG B  2 18  ? 477.289 75.914  456.114 1.00 39.71  ?  41  ARG B NH2 1 
ATOM   1229  N N   . ASN B  2 19  ? 481.580 69.755  459.162 1.00 105.02 ?  42  ASN B N   1 
ATOM   1230  C CA  . ASN B  2 19  ? 481.978 68.995  460.352 1.00 102.71 ?  42  ASN B CA  1 
ATOM   1231  C C   . ASN B  2 19  ? 481.128 69.318  461.585 1.00 97.39  ?  42  ASN B C   1 
ATOM   1232  O O   . ASN B  2 19  ? 481.637 69.728  462.628 1.00 92.64  ?  42  ASN B O   1 
ATOM   1233  C CB  . ASN B  2 19  ? 483.464 69.214  460.653 1.00 107.77 ?  42  ASN B CB  1 
ATOM   1234  C CG  . ASN B  2 19  ? 484.206 67.916  460.880 1.00 113.90 ?  42  ASN B CG  1 
ATOM   1235  O OD1 . ASN B  2 19  ? 484.013 66.941  460.155 1.00 119.05 ?  42  ASN B OD1 1 
ATOM   1236  N ND2 . ASN B  2 19  ? 485.061 67.895  461.897 1.00 110.82 ?  42  ASN B ND2 1 
ATOM   1237  N N   . GLN B  2 20  ? 479.819 69.085  461.461 1.00 66.95  ?  43  GLN B N   1 
ATOM   1238  C CA  . GLN B  2 20  ? 478.935 68.932  462.616 1.00 59.09  ?  43  GLN B CA  1 
ATOM   1239  C C   . GLN B  2 20  ? 478.826 70.176  463.498 1.00 53.64  ?  43  GLN B C   1 
ATOM   1240  O O   . GLN B  2 20  ? 478.066 70.175  464.472 1.00 49.11  ?  43  GLN B O   1 
ATOM   1241  C CB  . GLN B  2 20  ? 479.377 67.734  463.461 1.00 61.81  ?  43  GLN B CB  1 
ATOM   1242  C CG  . GLN B  2 20  ? 479.364 66.414  462.705 1.00 71.16  ?  43  GLN B CG  1 
ATOM   1243  C CD  . GLN B  2 20  ? 478.553 65.343  463.408 1.00 85.70  ?  43  GLN B CD  1 
ATOM   1244  O OE1 . GLN B  2 20  ? 478.868 64.946  464.530 1.00 92.85  ?  43  GLN B OE1 1 
ATOM   1245  N NE2 . GLN B  2 20  ? 477.498 64.872  462.751 1.00 92.36  ?  43  GLN B NE2 1 
ATOM   1246  N N   . ILE B  2 21  ? 479.587 71.230  463.189 1.00 67.83  ?  44  ILE B N   1 
ATOM   1247  C CA  . ILE B  2 21  ? 479.581 72.417  464.039 1.00 60.03  ?  44  ILE B CA  1 
ATOM   1248  C C   . ILE B  2 21  ? 478.224 73.108  463.965 1.00 67.86  ?  44  ILE B C   1 
ATOM   1249  O O   . ILE B  2 21  ? 477.429 72.900  463.042 1.00 75.26  ?  44  ILE B O   1 
ATOM   1250  C CB  . ILE B  2 21  ? 480.706 73.393  463.661 1.00 69.02  ?  44  ILE B CB  1 
ATOM   1251  C CG1 . ILE B  2 21  ? 480.297 74.234  462.451 1.00 69.99  ?  44  ILE B CG1 1 
ATOM   1252  C CG2 . ILE B  2 21  ? 481.980 72.645  463.372 1.00 76.73  ?  44  ILE B CG2 1 
ATOM   1253  C CD1 . ILE B  2 21  ? 481.010 75.565  462.368 1.00 83.78  ?  44  ILE B CD1 1 
ATOM   1254  N N   . CYS B  2 22  ? 477.960 73.942  464.963 1.00 99.24  ?  45  CYS B N   1 
ATOM   1255  C CA  . CYS B  2 22  ? 476.731 74.716  465.010 1.00 93.92  ?  45  CYS B CA  1 
ATOM   1256  C C   . CYS B  2 22  ? 476.964 76.095  464.415 1.00 98.12  ?  45  CYS B C   1 
ATOM   1257  O O   . CYS B  2 22  ? 477.958 76.758  464.727 1.00 113.01 ?  45  CYS B O   1 
ATOM   1258  C CB  . CYS B  2 22  ? 476.222 74.825  466.442 1.00 86.95  ?  45  CYS B CB  1 
ATOM   1259  S SG  . CYS B  2 22  ? 476.060 73.227  467.224 1.00 116.43 ?  45  CYS B SG  1 
ATOM   1260  N N   . SER B  2 23  ? 476.043 76.518  463.564 1.00 45.17  ?  46  SER B N   1 
ATOM   1261  C CA  . SER B  2 23  ? 476.169 77.746  462.799 1.00 47.32  ?  46  SER B CA  1 
ATOM   1262  C C   . SER B  2 23  ? 474.854 78.504  462.864 1.00 45.91  ?  46  SER B C   1 
ATOM   1263  O O   . SER B  2 23  ? 473.797 77.906  463.096 1.00 47.97  ?  46  SER B O   1 
ATOM   1264  C CB  . SER B  2 23  ? 476.540 77.449  461.340 1.00 49.95  ?  46  SER B CB  1 
ATOM   1265  O OG  . SER B  2 23  ? 475.842 76.311  460.864 1.00 50.31  ?  46  SER B OG  1 
ATOM   1266  N N   . PRO B  2 24  ? 474.887 79.820  462.673 1.00 67.84  ?  47  PRO B N   1 
ATOM   1267  C CA  . PRO B  2 24  ? 473.638 80.584  462.611 1.00 69.40  ?  47  PRO B CA  1 
ATOM   1268  C C   . PRO B  2 24  ? 472.810 80.182  461.402 1.00 70.78  ?  47  PRO B C   1 
ATOM   1269  O O   . PRO B  2 24  ? 473.300 79.585  460.442 1.00 66.59  ?  47  PRO B O   1 
ATOM   1270  C CB  . PRO B  2 24  ? 474.111 82.038  462.507 1.00 69.50  ?  47  PRO B CB  1 
ATOM   1271  C CG  . PRO B  2 24  ? 475.495 81.944  461.953 1.00 75.72  ?  47  PRO B CG  1 
ATOM   1272  C CD  . PRO B  2 24  ? 476.069 80.689  462.541 1.00 70.80  ?  47  PRO B CD  1 
ATOM   1273  N N   . CYS B  2 25  ? 471.528 80.514  461.466 1.00 62.52  ?  48  CYS B N   1 
ATOM   1274  C CA  . CYS B  2 25  ? 470.603 80.134  460.416 1.00 55.90  ?  48  CYS B CA  1 
ATOM   1275  C C   . CYS B  2 25  ? 470.785 81.015  459.182 1.00 61.76  ?  48  CYS B C   1 
ATOM   1276  O O   . CYS B  2 25  ? 471.288 82.138  459.274 1.00 62.76  ?  48  CYS B O   1 
ATOM   1277  C CB  . CYS B  2 25  ? 469.168 80.227  460.925 1.00 56.63  ?  48  CYS B CB  1 
ATOM   1278  S SG  . CYS B  2 25  ? 468.681 78.913  462.075 1.00 65.34  ?  48  CYS B SG  1 
ATOM   1279  N N   . PRO B  2 26  ? 470.400 80.514  458.012 1.00 55.89  ?  49  PRO B N   1 
ATOM   1280  C CA  . PRO B  2 26  ? 470.430 81.331  456.791 1.00 56.84  ?  49  PRO B CA  1 
ATOM   1281  C C   . PRO B  2 26  ? 469.526 82.544  456.923 1.00 56.00  ?  49  PRO B C   1 
ATOM   1282  O O   . PRO B  2 26  ? 468.659 82.579  457.810 1.00 64.31  ?  49  PRO B O   1 
ATOM   1283  C CB  . PRO B  2 26  ? 469.920 80.361  455.715 1.00 59.42  ?  49  PRO B CB  1 
ATOM   1284  C CG  . PRO B  2 26  ? 470.318 79.018  456.227 1.00 56.25  ?  49  PRO B CG  1 
ATOM   1285  C CD  . PRO B  2 26  ? 470.140 79.093  457.716 1.00 53.05  ?  49  PRO B CD  1 
ATOM   1286  N N   . PRO B  2 27  ? 469.701 83.561  456.064 1.00 71.60  ?  50  PRO B N   1 
ATOM   1287  C CA  . PRO B  2 27  ? 469.006 84.847  456.280 1.00 77.44  ?  50  PRO B CA  1 
ATOM   1288  C C   . PRO B  2 27  ? 467.512 84.737  456.545 1.00 82.76  ?  50  PRO B C   1 
ATOM   1289  O O   . PRO B  2 27  ? 467.006 85.416  457.447 1.00 81.29  ?  50  PRO B O   1 
ATOM   1290  C CB  . PRO B  2 27  ? 469.295 85.606  454.978 1.00 82.52  ?  50  PRO B CB  1 
ATOM   1291  C CG  . PRO B  2 27  ? 470.608 85.074  454.530 1.00 75.90  ?  50  PRO B CG  1 
ATOM   1292  C CD  . PRO B  2 27  ? 470.608 83.617  454.903 1.00 77.90  ?  50  PRO B CD  1 
ATOM   1293  N N   . ASN B  2 28  ? 466.788 83.912  455.795 1.00 85.72  ?  51  ASN B N   1 
ATOM   1294  C CA  . ASN B  2 28  ? 465.376 83.659  456.063 1.00 87.63  ?  51  ASN B CA  1 
ATOM   1295  C C   . ASN B  2 28  ? 465.224 82.196  456.461 1.00 91.59  ?  51  ASN B C   1 
ATOM   1296  O O   . ASN B  2 28  ? 465.280 81.308  455.603 1.00 96.41  ?  51  ASN B O   1 
ATOM   1297  C CB  . ASN B  2 28  ? 464.521 83.991  454.842 1.00 91.69  ?  51  ASN B CB  1 
ATOM   1298  C CG  . ASN B  2 28  ? 464.780 85.389  454.312 1.00 92.84  ?  51  ASN B CG  1 
ATOM   1299  O OD1 . ASN B  2 28  ? 465.084 86.308  455.072 1.00 87.59  ?  51  ASN B OD1 1 
ATOM   1300  N ND2 . ASN B  2 28  ? 464.664 85.555  452.999 1.00 87.96  ?  51  ASN B ND2 1 
ATOM   1301  N N   . SER B  2 29  ? 464.993 81.956  457.752 1.00 70.61  ?  52  SER B N   1 
ATOM   1302  C CA  . SER B  2 29  ? 464.872 80.620  458.329 1.00 69.69  ?  52  SER B CA  1 
ATOM   1303  C C   . SER B  2 29  ? 464.721 80.762  459.838 1.00 75.59  ?  52  SER B C   1 
ATOM   1304  O O   . SER B  2 29  ? 464.993 81.823  460.407 1.00 77.76  ?  52  SER B O   1 
ATOM   1305  C CB  . SER B  2 29  ? 466.078 79.736  458.004 1.00 65.19  ?  52  SER B CB  1 
ATOM   1306  O OG  . SER B  2 29  ? 467.280 80.351  458.424 1.00 65.44  ?  52  SER B OG  1 
ATOM   1307  N N   . PHE B  2 30  ? 464.290 79.675  460.479 1.00 75.24  ?  53  PHE B N   1 
ATOM   1308  C CA  . PHE B  2 30  ? 464.114 79.661  461.924 1.00 75.14  ?  53  PHE B CA  1 
ATOM   1309  C C   . PHE B  2 30  ? 464.294 78.243  462.449 1.00 72.72  ?  53  PHE B C   1 
ATOM   1310  O O   . PHE B  2 30  ? 463.988 77.267  461.759 1.00 77.02  ?  53  PHE B O   1 
ATOM   1311  C CB  . PHE B  2 30  ? 462.734 80.195  462.326 1.00 77.45  ?  53  PHE B CB  1 
ATOM   1312  C CG  . PHE B  2 30  ? 461.653 79.151  462.313 1.00 74.26  ?  53  PHE B CG  1 
ATOM   1313  C CD1 . PHE B  2 30  ? 461.148 78.674  461.116 1.00 74.66  ?  53  PHE B CD1 1 
ATOM   1314  C CD2 . PHE B  2 30  ? 461.143 78.646  463.499 1.00 79.03  ?  53  PHE B CD2 1 
ATOM   1315  C CE1 . PHE B  2 30  ? 460.155 77.711  461.100 1.00 75.94  ?  53  PHE B CE1 1 
ATOM   1316  C CE2 . PHE B  2 30  ? 460.151 77.684  463.489 1.00 80.95  ?  53  PHE B CE2 1 
ATOM   1317  C CZ  . PHE B  2 30  ? 459.656 77.217  462.288 1.00 76.81  ?  53  PHE B CZ  1 
ATOM   1318  N N   . SER B  2 31  ? 464.800 78.142  463.677 1.00 77.09  ?  54  SER B N   1 
ATOM   1319  C CA  . SER B  2 31  ? 464.847 76.885  464.415 1.00 76.34  ?  54  SER B CA  1 
ATOM   1320  C C   . SER B  2 31  ? 464.353 77.146  465.829 1.00 86.79  ?  54  SER B C   1 
ATOM   1321  O O   . SER B  2 31  ? 464.991 77.889  466.582 1.00 88.13  ?  54  SER B O   1 
ATOM   1322  C CB  . SER B  2 31  ? 466.262 76.300  464.434 1.00 81.43  ?  54  SER B CB  1 
ATOM   1323  O OG  . SER B  2 31  ? 466.303 75.093  465.174 1.00 81.30  ?  54  SER B OG  1 
ATOM   1324  N N   . SER B  2 32  ? 463.219 76.543  466.187 1.00 97.91  ?  55  SER B N   1 
ATOM   1325  C CA  . SER B  2 32  ? 462.590 76.813  467.473 1.00 95.70  ?  55  SER B CA  1 
ATOM   1326  C C   . SER B  2 32  ? 462.912 75.792  468.560 1.00 100.36 ?  55  SER B C   1 
ATOM   1327  O O   . SER B  2 32  ? 462.522 76.008  469.708 1.00 112.98 ?  55  SER B O   1 
ATOM   1328  C CB  . SER B  2 32  ? 461.066 76.902  467.304 1.00 91.61  ?  55  SER B CB  1 
ATOM   1329  O OG  . SER B  2 32  ? 460.691 78.129  466.698 1.00 81.45  ?  55  SER B OG  1 
ATOM   1330  N N   . ALA B  2 33  ? 463.606 74.699  468.250 1.00 88.23  ?  56  ALA B N   1 
ATOM   1331  C CA  . ALA B  2 33  ? 463.839 73.692  469.274 1.00 90.68  ?  56  ALA B CA  1 
ATOM   1332  C C   . ALA B  2 33  ? 465.117 72.913  469.011 1.00 97.03  ?  56  ALA B C   1 
ATOM   1333  O O   . ALA B  2 33  ? 465.423 72.581  467.865 1.00 98.39  ?  56  ALA B O   1 
ATOM   1334  C CB  . ALA B  2 33  ? 462.664 72.714  469.359 1.00 78.86  ?  56  ALA B CB  1 
ATOM   1335  N N   . GLY B  2 34  ? 465.833 72.610  470.093 1.00 86.43  ?  57  GLY B N   1 
ATOM   1336  C CA  . GLY B  2 34  ? 466.744 71.476  470.158 1.00 87.99  ?  57  GLY B CA  1 
ATOM   1337  C C   . GLY B  2 34  ? 467.813 71.431  469.086 1.00 95.18  ?  57  GLY B C   1 
ATOM   1338  O O   . GLY B  2 34  ? 468.336 72.458  468.637 1.00 93.58  ?  57  GLY B O   1 
ATOM   1339  N N   . GLY B  2 35  ? 468.139 70.205  468.678 1.00 90.11  ?  58  GLY B N   1 
ATOM   1340  C CA  . GLY B  2 35  ? 469.290 69.869  467.868 1.00 87.60  ?  58  GLY B CA  1 
ATOM   1341  C C   . GLY B  2 35  ? 469.058 69.805  466.373 1.00 77.20  ?  58  GLY B C   1 
ATOM   1342  O O   . GLY B  2 35  ? 469.730 69.029  465.684 1.00 78.43  ?  58  GLY B O   1 
ATOM   1343  N N   . GLN B  2 36  ? 468.091 70.578  465.872 1.00 86.69  ?  59  GLN B N   1 
ATOM   1344  C CA  . GLN B  2 36  ? 467.658 70.471  464.483 1.00 85.88  ?  59  GLN B CA  1 
ATOM   1345  C C   . GLN B  2 36  ? 468.841 70.475  463.525 1.00 78.55  ?  59  GLN B C   1 
ATOM   1346  O O   . GLN B  2 36  ? 469.789 71.248  463.679 1.00 79.51  ?  59  GLN B O   1 
ATOM   1347  C CB  . GLN B  2 36  ? 466.726 71.631  464.130 1.00 81.01  ?  59  GLN B CB  1 
ATOM   1348  C CG  . GLN B  2 36  ? 465.398 71.643  464.851 1.00 79.88  ?  59  GLN B CG  1 
ATOM   1349  C CD  . GLN B  2 36  ? 464.448 72.674  464.270 1.00 79.73  ?  59  GLN B CD  1 
ATOM   1350  O OE1 . GLN B  2 36  ? 463.894 73.503  464.990 1.00 86.28  ?  59  GLN B OE1 1 
ATOM   1351  N NE2 . GLN B  2 36  ? 464.267 72.633  462.955 1.00 76.69  ?  59  GLN B NE2 1 
ATOM   1352  N N   . ARG B  2 37  ? 468.773 69.589  462.532 1.00 86.44  ?  60  ARG B N   1 
ATOM   1353  C CA  . ARG B  2 37  ? 469.782 69.513  461.486 1.00 86.55  ?  60  ARG B CA  1 
ATOM   1354  C C   . ARG B  2 37  ? 469.616 70.600  460.435 1.00 85.46  ?  60  ARG B C   1 
ATOM   1355  O O   . ARG B  2 37  ? 470.493 70.753  459.579 1.00 86.40  ?  60  ARG B O   1 
ATOM   1356  C CB  . ARG B  2 37  ? 469.727 68.139  460.815 1.00 90.13  ?  60  ARG B CB  1 
ATOM   1357  C CG  . ARG B  2 37  ? 469.383 67.006  461.768 1.00 88.49  ?  60  ARG B CG  1 
ATOM   1358  C CD  . ARG B  2 37  ? 468.554 65.937  461.075 1.00 94.59  ?  60  ARG B CD  1 
ATOM   1359  N NE  . ARG B  2 37  ? 468.042 64.945  462.017 1.00 95.17  ?  60  ARG B NE  1 
ATOM   1360  C CZ  . ARG B  2 37  ? 468.677 63.824  462.340 1.00 93.96  ?  60  ARG B CZ  1 
ATOM   1361  N NH1 . ARG B  2 37  ? 469.855 63.549  461.798 1.00 96.45  ?  60  ARG B NH1 1 
ATOM   1362  N NH2 . ARG B  2 37  ? 468.135 62.978  463.206 1.00 88.52  ?  60  ARG B NH2 1 
ATOM   1363  N N   . THR B  2 38  ? 468.513 71.344  460.476 1.00 97.32  ?  61  THR B N   1 
ATOM   1364  C CA  . THR B  2 38  ? 468.239 72.380  459.493 1.00 94.50  ?  61  THR B CA  1 
ATOM   1365  C C   . THR B  2 38  ? 467.366 73.456  460.120 1.00 97.52  ?  61  THR B C   1 
ATOM   1366  O O   . THR B  2 38  ? 466.573 73.183  461.025 1.00 102.93 ?  61  THR B O   1 
ATOM   1367  C CB  . THR B  2 38  ? 467.547 71.806  458.252 1.00 93.18  ?  61  THR B CB  1 
ATOM   1368  O OG1 . THR B  2 38  ? 467.033 72.879  457.457 1.00 96.42  ?  61  THR B OG1 1 
ATOM   1369  C CG2 . THR B  2 38  ? 466.403 70.888  458.655 1.00 95.84  ?  61  THR B CG2 1 
ATOM   1370  N N   . CYS B  2 39  ? 467.518 74.683  459.627 1.00 49.05  ?  62  CYS B N   1 
ATOM   1371  C CA  . CYS B  2 39  ? 466.637 75.782  459.996 1.00 52.00  ?  62  CYS B CA  1 
ATOM   1372  C C   . CYS B  2 39  ? 465.467 75.808  459.019 1.00 55.80  ?  62  CYS B C   1 
ATOM   1373  O O   . CYS B  2 39  ? 465.666 75.984  457.812 1.00 56.30  ?  62  CYS B O   1 
ATOM   1374  C CB  . CYS B  2 39  ? 467.381 77.117  459.983 1.00 55.77  ?  62  CYS B CB  1 
ATOM   1375  S SG  . CYS B  2 39  ? 468.875 77.194  461.005 1.00 61.42  ?  62  CYS B SG  1 
ATOM   1376  N N   . ASP B  2 40  ? 464.255 75.627  459.537 1.00 73.75  ?  63  ASP B N   1 
ATOM   1377  C CA  . ASP B  2 40  ? 463.076 75.568  458.685 1.00 67.44  ?  63  ASP B CA  1 
ATOM   1378  C C   . ASP B  2 40  ? 462.796 76.925  458.048 1.00 67.07  ?  63  ASP B C   1 
ATOM   1379  O O   . ASP B  2 40  ? 463.170 77.975  458.575 1.00 69.72  ?  63  ASP B O   1 
ATOM   1380  C CB  . ASP B  2 40  ? 461.859 75.104  459.486 1.00 69.21  ?  63  ASP B CB  1 
ATOM   1381  C CG  . ASP B  2 40  ? 461.973 73.661  459.938 1.00 71.83  ?  63  ASP B CG  1 
ATOM   1382  O OD1 . ASP B  2 40  ? 462.543 72.844  459.185 1.00 71.19  ?  63  ASP B OD1 1 
ATOM   1383  O OD2 . ASP B  2 40  ? 461.492 73.346  461.046 1.00 66.65  -1 63  ASP B OD2 1 
ATOM   1384  N N   . ILE B  2 41  ? 462.120 76.892  456.898 1.00 75.37  ?  64  ILE B N   1 
ATOM   1385  C CA  . ILE B  2 41  ? 461.868 78.107  456.134 1.00 69.87  ?  64  ILE B CA  1 
ATOM   1386  C C   . ILE B  2 41  ? 460.835 78.967  456.847 1.00 73.68  ?  64  ILE B C   1 
ATOM   1387  O O   . ILE B  2 41  ? 459.823 78.468  457.357 1.00 70.59  ?  64  ILE B O   1 
ATOM   1388  C CB  . ILE B  2 41  ? 461.407 77.754  454.710 1.00 63.58  ?  64  ILE B CB  1 
ATOM   1389  C CG1 . ILE B  2 41  ? 462.266 76.625  454.137 1.00 65.29  ?  64  ILE B CG1 1 
ATOM   1390  C CG2 . ILE B  2 41  ? 461.471 78.979  453.810 1.00 57.25  ?  64  ILE B CG2 1 
ATOM   1391  C CD1 . ILE B  2 41  ? 461.784 76.106  452.801 1.00 67.98  ?  64  ILE B CD1 1 
ATOM   1392  N N   . CYS B  2 42  ? 461.088 80.274  456.886 1.00 71.14  ?  65  CYS B N   1 
ATOM   1393  C CA  . CYS B  2 42  ? 460.136 81.208  457.472 1.00 68.61  ?  65  CYS B CA  1 
ATOM   1394  C C   . CYS B  2 42  ? 458.931 81.398  456.559 1.00 61.23  ?  65  CYS B C   1 
ATOM   1395  O O   . CYS B  2 42  ? 459.067 81.511  455.338 1.00 56.26  ?  65  CYS B O   1 
ATOM   1396  C CB  . CYS B  2 42  ? 460.802 82.557  457.738 1.00 64.62  ?  65  CYS B CB  1 
ATOM   1397  S SG  . CYS B  2 42  ? 461.407 82.797  459.424 1.00 80.23  ?  65  CYS B SG  1 
ATOM   1398  N N   . ARG B  2 43  ? 457.745 81.438  457.162 1.00 71.92  ?  66  ARG B N   1 
ATOM   1399  C CA  . ARG B  2 43  ? 456.529 81.681  456.399 1.00 74.81  ?  66  ARG B CA  1 
ATOM   1400  C C   . ARG B  2 43  ? 456.500 83.118  455.894 1.00 74.97  ?  66  ARG B C   1 
ATOM   1401  O O   . ARG B  2 43  ? 456.687 84.064  456.663 1.00 83.74  ?  66  ARG B O   1 
ATOM   1402  C CB  . ARG B  2 43  ? 455.291 81.403  457.253 1.00 79.65  ?  66  ARG B CB  1 
ATOM   1403  C CG  . ARG B  2 43  ? 454.761 79.982  457.151 1.00 82.31  ?  66  ARG B CG  1 
ATOM   1404  C CD  . ARG B  2 43  ? 453.276 79.925  457.484 1.00 71.79  ?  66  ARG B CD  1 
ATOM   1405  N NE  . ARG B  2 43  ? 452.469 80.625  456.487 1.00 93.62  ?  66  ARG B NE  1 
ATOM   1406  C CZ  . ARG B  2 43  ? 451.149 80.770  456.555 1.00 89.25  ?  66  ARG B CZ  1 
ATOM   1407  N NH1 . ARG B  2 43  ? 450.476 80.262  457.578 1.00 83.87  ?  66  ARG B NH1 1 
ATOM   1408  N NH2 . ARG B  2 43  ? 450.499 81.422  455.599 1.00 68.63  ?  66  ARG B NH2 1 
ATOM   1409  N N   . GLN B  2 44  ? 456.270 83.277  454.595 1.00 71.75  ?  67  GLN B N   1 
ATOM   1410  C CA  . GLN B  2 44  ? 456.089 84.590  453.996 1.00 73.49  ?  67  GLN B CA  1 
ATOM   1411  C C   . GLN B  2 44  ? 454.611 84.955  454.036 1.00 72.16  ?  67  GLN B C   1 
ATOM   1412  O O   . GLN B  2 44  ? 453.759 84.157  453.632 1.00 76.33  ?  67  GLN B O   1 
ATOM   1413  C CB  . GLN B  2 44  ? 456.595 84.606  452.552 1.00 77.91  ?  67  GLN B CB  1 
ATOM   1414  C CG  . GLN B  2 44  ? 457.918 83.888  452.336 1.00 74.95  ?  67  GLN B CG  1 
ATOM   1415  C CD  . GLN B  2 44  ? 459.099 84.642  452.911 1.00 81.00  ?  67  GLN B CD  1 
ATOM   1416  O OE1 . GLN B  2 44  ? 459.000 85.828  453.228 1.00 84.89  ?  67  GLN B OE1 1 
ATOM   1417  N NE2 . GLN B  2 44  ? 460.227 83.957  453.050 1.00 86.35  ?  67  GLN B NE2 1 
ATOM   1418  N N   . CYS B  2 45  ? 454.308 86.154  454.525 1.00 58.68  ?  68  CYS B N   1 
ATOM   1419  C CA  . CYS B  2 45  ? 452.944 86.669  454.526 1.00 54.83  ?  68  CYS B CA  1 
ATOM   1420  C C   . CYS B  2 45  ? 452.824 87.666  453.379 1.00 53.55  ?  68  CYS B C   1 
ATOM   1421  O O   . CYS B  2 45  ? 453.371 88.772  453.450 1.00 59.49  ?  68  CYS B O   1 
ATOM   1422  C CB  . CYS B  2 45  ? 452.599 87.327  455.862 1.00 65.37  ?  68  CYS B CB  1 
ATOM   1423  S SG  . CYS B  2 45  ? 453.014 86.367  457.345 1.00 99.24  ?  68  CYS B SG  1 
ATOM   1424  N N   . LYS B  2 46  ? 452.105 87.278  452.327 1.00 39.52  ?  69  LYS B N   1 
ATOM   1425  C CA  . LYS B  2 46  ? 451.905 88.124  451.161 1.00 37.87  ?  69  LYS B CA  1 
ATOM   1426  C C   . LYS B  2 46  ? 450.473 87.956  450.672 1.00 41.14  ?  69  LYS B C   1 
ATOM   1427  O O   . LYS B  2 46  ? 449.693 87.173  451.224 1.00 39.45  ?  69  LYS B O   1 
ATOM   1428  C CB  . LYS B  2 46  ? 452.909 87.799  450.048 1.00 32.11  ?  69  LYS B CB  1 
ATOM   1429  C CG  . LYS B  2 46  ? 454.331 88.263  450.325 1.00 39.11  ?  69  LYS B CG  1 
ATOM   1430  C CD  . LYS B  2 46  ? 455.152 88.312  449.045 1.00 45.59  ?  69  LYS B CD  1 
ATOM   1431  C CE  . LYS B  2 46  ? 456.560 88.827  449.302 1.00 53.87  ?  69  LYS B CE  1 
ATOM   1432  N NZ  . LYS B  2 46  ? 457.357 87.891  450.144 1.00 59.38  ?  69  LYS B NZ  1 
ATOM   1433  N N   . GLY B  2 47  ? 450.132 88.691  449.619 1.00 34.34  ?  70  GLY B N   1 
ATOM   1434  C CA  . GLY B  2 47  ? 448.767 88.653  449.118 1.00 29.53  ?  70  GLY B CA  1 
ATOM   1435  C C   . GLY B  2 47  ? 447.816 89.242  450.138 1.00 35.71  ?  70  GLY B C   1 
ATOM   1436  O O   . GLY B  2 47  ? 447.995 90.372  450.606 1.00 38.71  ?  70  GLY B O   1 
ATOM   1437  N N   . VAL B  2 48  ? 446.790 88.467  450.497 1.00 33.53  ?  71  VAL B N   1 
ATOM   1438  C CA  . VAL B  2 48  ? 445.844 88.907  451.514 1.00 34.11  ?  71  VAL B CA  1 
ATOM   1439  C C   . VAL B  2 48  ? 446.480 88.956  452.894 1.00 41.80  ?  71  VAL B C   1 
ATOM   1440  O O   . VAL B  2 48  ? 445.953 89.625  453.792 1.00 43.82  ?  71  VAL B O   1 
ATOM   1441  C CB  . VAL B  2 48  ? 444.607 87.989  451.540 1.00 29.03  ?  71  VAL B CB  1 
ATOM   1442  C CG1 . VAL B  2 48  ? 443.722 88.254  450.343 1.00 31.52  ?  71  VAL B CG1 1 
ATOM   1443  C CG2 . VAL B  2 48  ? 445.032 86.530  451.579 1.00 34.78  ?  71  VAL B CG2 1 
ATOM   1444  N N   . PHE B  2 49  ? 447.602 88.272  453.092 1.00 30.68  ?  72  PHE B N   1 
ATOM   1445  C CA  . PHE B  2 49  ? 448.187 88.149  454.417 1.00 32.96  ?  72  PHE B CA  1 
ATOM   1446  C C   . PHE B  2 49  ? 449.068 89.345  454.751 1.00 37.55  ?  72  PHE B C   1 
ATOM   1447  O O   . PHE B  2 49  ? 449.778 89.875  453.892 1.00 36.29  ?  72  PHE B O   1 
ATOM   1448  C CB  . PHE B  2 49  ? 449.006 86.861  454.521 1.00 36.37  ?  72  PHE B CB  1 
ATOM   1449  C CG  . PHE B  2 49  ? 448.207 85.613  454.285 1.00 27.71  ?  72  PHE B CG  1 
ATOM   1450  C CD1 . PHE B  2 49  ? 447.385 85.102  455.276 1.00 32.90  ?  72  PHE B CD1 1 
ATOM   1451  C CD2 . PHE B  2 49  ? 448.284 84.946  453.076 1.00 25.41  ?  72  PHE B CD2 1 
ATOM   1452  C CE1 . PHE B  2 49  ? 446.651 83.952  455.063 1.00 28.18  ?  72  PHE B CE1 1 
ATOM   1453  C CE2 . PHE B  2 49  ? 447.553 83.794  452.857 1.00 26.82  ?  72  PHE B CE2 1 
ATOM   1454  C CZ  . PHE B  2 49  ? 446.735 83.297  453.852 1.00 28.73  ?  72  PHE B CZ  1 
ATOM   1455  N N   . ARG B  2 50  ? 449.008 89.769  456.011 1.00 79.02  ?  73  ARG B N   1 
ATOM   1456  C CA  . ARG B  2 50  ? 449.937 90.736  456.576 1.00 80.94  ?  73  ARG B CA  1 
ATOM   1457  C C   . ARG B  2 50  ? 450.784 90.044  457.635 1.00 87.02  ?  73  ARG B C   1 
ATOM   1458  O O   . ARG B  2 50  ? 450.291 89.184  458.371 1.00 92.48  ?  73  ARG B O   1 
ATOM   1459  C CB  . ARG B  2 50  ? 449.206 91.926  457.203 1.00 84.17  ?  73  ARG B CB  1 
ATOM   1460  C CG  . ARG B  2 50  ? 448.511 92.847  456.218 1.00 77.44  ?  73  ARG B CG  1 
ATOM   1461  C CD  . ARG B  2 50  ? 448.000 94.107  456.911 1.00 86.08  ?  73  ARG B CD  1 
ATOM   1462  N NE  . ARG B  2 50  ? 447.048 93.814  457.981 1.00 93.08  ?  73  ARG B NE  1 
ATOM   1463  C CZ  . ARG B  2 50  ? 447.341 93.850  459.278 1.00 92.48  ?  73  ARG B CZ  1 
ATOM   1464  N NH1 . ARG B  2 50  ? 446.409 93.566  460.178 1.00 85.46  ?  73  ARG B NH1 1 
ATOM   1465  N NH2 . ARG B  2 50  ? 448.565 94.170  459.678 1.00 90.33  ?  73  ARG B NH2 1 
ATOM   1466  N N   . THR B  2 51  ? 452.056 90.422  457.712 1.00 64.98  ?  74  THR B N   1 
ATOM   1467  C CA  . THR B  2 51  ? 452.966 89.820  458.678 1.00 64.75  ?  74  THR B CA  1 
ATOM   1468  C C   . THR B  2 51  ? 452.692 90.395  460.064 1.00 68.50  ?  74  THR B C   1 
ATOM   1469  O O   . THR B  2 51  ? 452.751 91.614  460.261 1.00 70.65  ?  74  THR B O   1 
ATOM   1470  C CB  . THR B  2 51  ? 454.417 90.066  458.272 1.00 66.58  ?  74  THR B CB  1 
ATOM   1471  O OG1 . THR B  2 51  ? 454.605 89.678  456.906 1.00 68.89  ?  74  THR B OG1 1 
ATOM   1472  C CG2 . THR B  2 51  ? 455.358 89.261  459.155 1.00 72.07  ?  74  THR B CG2 1 
ATOM   1473  N N   . ARG B  2 52  ? 452.391 89.519  461.023 1.00 65.52  ?  75  ARG B N   1 
ATOM   1474  C CA  . ARG B  2 52  ? 452.208 89.939  462.418 1.00 73.32  ?  75  ARG B CA  1 
ATOM   1475  C C   . ARG B  2 52  ? 453.555 89.936  463.137 1.00 78.82  ?  75  ARG B C   1 
ATOM   1476  O O   . ARG B  2 52  ? 454.064 90.991  463.526 1.00 79.25  ?  75  ARG B O   1 
ATOM   1477  C CB  . ARG B  2 52  ? 451.192 89.038  463.122 1.00 75.31  ?  75  ARG B CB  1 
ATOM   1478  C CG  . ARG B  2 52  ? 451.152 89.224  464.633 1.00 81.51  ?  75  ARG B CG  1 
ATOM   1479  C CD  . ARG B  2 52  ? 449.776 88.915  465.197 1.00 93.67  ?  75  ARG B CD  1 
ATOM   1480  N NE  . ARG B  2 52  ? 448.767 89.840  464.691 1.00 99.39  ?  75  ARG B NE  1 
ATOM   1481  C CZ  . ARG B  2 52  ? 448.504 91.027  465.226 1.00 90.35  ?  75  ARG B CZ  1 
ATOM   1482  N NH1 . ARG B  2 52  ? 449.177 91.439  466.292 1.00 84.62  ?  75  ARG B NH1 1 
ATOM   1483  N NH2 . ARG B  2 52  ? 447.568 91.803  464.696 1.00 81.98  ?  75  ARG B NH2 1 
ATOM   1484  N N   . LYS B  2 53  ? 454.137 88.753  463.317 1.00 89.08  ?  76  LYS B N   1 
ATOM   1485  C CA  . LYS B  2 53  ? 455.475 88.612  463.875 1.00 85.83  ?  76  LYS B CA  1 
ATOM   1486  C C   . LYS B  2 53  ? 456.458 88.395  462.731 1.00 80.94  ?  76  LYS B C   1 
ATOM   1487  O O   . LYS B  2 53  ? 456.304 87.453  461.947 1.00 80.12  ?  76  LYS B O   1 
ATOM   1488  C CB  . LYS B  2 53  ? 455.543 87.453  464.869 1.00 79.49  ?  76  LYS B CB  1 
ATOM   1489  C CG  . LYS B  2 53  ? 456.960 86.965  465.141 1.00 83.16  ?  76  LYS B CG  1 
ATOM   1490  C CD  . LYS B  2 53  ? 457.003 85.925  466.249 1.00 86.56  ?  76  LYS B CD  1 
ATOM   1491  C CE  . LYS B  2 53  ? 456.904 86.570  467.623 1.00 79.88  ?  76  LYS B CE  1 
ATOM   1492  N NZ  . LYS B  2 53  ? 457.077 85.567  468.710 1.00 70.80  ?  76  LYS B NZ  1 
ATOM   1493  N N   . GLU B  2 54  ? 457.460 89.265  462.641 1.00 93.21  ?  77  GLU B N   1 
ATOM   1494  C CA  . GLU B  2 54  ? 458.465 89.139  461.600 1.00 94.75  ?  77  GLU B CA  1 
ATOM   1495  C C   . GLU B  2 54  ? 459.315 87.893  461.824 1.00 95.80  ?  77  GLU B C   1 
ATOM   1496  O O   . GLU B  2 54  ? 459.366 87.327  462.920 1.00 92.76  ?  77  GLU B O   1 
ATOM   1497  C CB  . GLU B  2 54  ? 459.353 90.383  461.552 1.00 97.07  ?  77  GLU B CB  1 
ATOM   1498  C CG  . GLU B  2 54  ? 458.613 91.665  461.199 1.00 102.72 ?  77  GLU B CG  1 
ATOM   1499  C CD  . GLU B  2 54  ? 458.295 92.516  462.414 1.00 111.66 ?  77  GLU B CD  1 
ATOM   1500  O OE1 . GLU B  2 54  ? 458.932 92.310  463.469 1.00 106.75 ?  77  GLU B OE1 1 
ATOM   1501  O OE2 . GLU B  2 54  ? 457.409 93.391  462.312 1.00 105.72 -1 77  GLU B OE2 1 
ATOM   1502  N N   . CYS B  2 55  ? 459.984 87.460  460.758 1.00 139.44 ?  78  CYS B N   1 
ATOM   1503  C CA  . CYS B  2 55  ? 460.782 86.241  460.812 1.00 141.36 ?  78  CYS B CA  1 
ATOM   1504  C C   . CYS B  2 55  ? 461.980 86.440  461.730 1.00 139.75 ?  78  CYS B C   1 
ATOM   1505  O O   . CYS B  2 55  ? 462.782 87.359  461.535 1.00 135.24 ?  78  CYS B O   1 
ATOM   1506  C CB  . CYS B  2 55  ? 461.236 85.853  459.406 1.00 144.39 ?  78  CYS B CB  1 
ATOM   1507  S SG  . CYS B  2 55  ? 462.470 84.524  459.309 1.00 147.81 ?  78  CYS B SG  1 
ATOM   1508  N N   . SER B  2 56  ? 462.094 85.576  462.735 1.00 92.82  ?  79  SER B N   1 
ATOM   1509  C CA  . SER B  2 56  ? 463.226 85.561  463.646 1.00 93.18  ?  79  SER B CA  1 
ATOM   1510  C C   . SER B  2 56  ? 463.769 84.144  463.721 1.00 92.16  ?  79  SER B C   1 
ATOM   1511  O O   . SER B  2 56  ? 463.045 83.174  463.483 1.00 90.09  ?  79  SER B O   1 
ATOM   1512  C CB  . SER B  2 56  ? 462.836 86.054  465.046 1.00 93.22  ?  79  SER B CB  1 
ATOM   1513  O OG  . SER B  2 56  ? 461.774 85.282  465.579 1.00 89.55  ?  79  SER B OG  1 
ATOM   1514  N N   . SER B  2 57  ? 465.057 84.032  464.049 1.00 61.66  ?  80  SER B N   1 
ATOM   1515  C CA  . SER B  2 57  ? 465.691 82.719  464.070 1.00 51.98  ?  80  SER B CA  1 
ATOM   1516  C C   . SER B  2 57  ? 465.064 81.807  465.117 1.00 58.21  ?  80  SER B C   1 
ATOM   1517  O O   . SER B  2 57  ? 465.045 80.583  464.941 1.00 53.24  ?  80  SER B O   1 
ATOM   1518  C CB  . SER B  2 57  ? 467.191 82.868  464.321 1.00 45.63  ?  80  SER B CB  1 
ATOM   1519  O OG  . SER B  2 57  ? 467.849 81.620  464.197 1.00 58.66  ?  80  SER B OG  1 
ATOM   1520  N N   . THR B  2 58  ? 464.554 82.376  466.210 1.00 127.16 ?  81  THR B N   1 
ATOM   1521  C CA  . THR B  2 58  ? 463.960 81.558  467.263 1.00 129.17 ?  81  THR B CA  1 
ATOM   1522  C C   . THR B  2 58  ? 462.521 81.161  466.945 1.00 128.89 ?  81  THR B C   1 
ATOM   1523  O O   . THR B  2 58  ? 462.136 80.006  467.157 1.00 132.42 ?  81  THR B O   1 
ATOM   1524  C CB  . THR B  2 58  ? 464.016 82.300  468.600 1.00 133.39 ?  81  THR B CB  1 
ATOM   1525  O OG1 . THR B  2 58  ? 463.375 83.574  468.471 1.00 133.64 ?  81  THR B OG1 1 
ATOM   1526  C CG2 . THR B  2 58  ? 465.460 82.502  469.035 1.00 130.12 ?  81  THR B CG2 1 
ATOM   1527  N N   . SER B  2 59  ? 461.714 82.090  466.437 1.00 108.16 ?  82  SER B N   1 
ATOM   1528  C CA  . SER B  2 59  ? 460.280 81.879  466.291 1.00 100.83 ?  82  SER B CA  1 
ATOM   1529  C C   . SER B  2 59  ? 459.847 82.064  464.843 1.00 101.66 ?  82  SER B C   1 
ATOM   1530  O O   . SER B  2 59  ? 460.347 82.949  464.140 1.00 106.55 ?  82  SER B O   1 
ATOM   1531  C CB  . SER B  2 59  ? 459.491 82.836  467.191 1.00 100.61 ?  82  SER B CB  1 
ATOM   1532  O OG  . SER B  2 59  ? 459.769 84.187  466.867 1.00 104.10 ?  82  SER B OG  1 
ATOM   1533  N N   . ASN B  2 60  ? 458.905 81.229  464.410 1.00 60.00  ?  83  ASN B N   1 
ATOM   1534  C CA  . ASN B  2 60  ? 458.361 81.319  463.063 1.00 61.61  ?  83  ASN B CA  1 
ATOM   1535  C C   . ASN B  2 60  ? 457.479 82.559  462.924 1.00 57.59  ?  83  ASN B C   1 
ATOM   1536  O O   . ASN B  2 60  ? 456.981 83.118  463.905 1.00 66.01  ?  83  ASN B O   1 
ATOM   1537  C CB  . ASN B  2 60  ? 457.557 80.060  462.731 1.00 55.90  ?  83  ASN B CB  1 
ATOM   1538  C CG  . ASN B  2 60  ? 457.358 79.865  461.239 1.00 44.17  ?  83  ASN B CG  1 
ATOM   1539  O OD1 . ASN B  2 60  ? 457.465 80.809  460.455 1.00 47.57  ?  83  ASN B OD1 1 
ATOM   1540  N ND2 . ASN B  2 60  ? 457.065 78.633  460.839 1.00 30.89  ?  83  ASN B ND2 1 
ATOM   1541  N N   . ALA B  2 61  ? 457.291 82.987  461.679 1.00 61.52  ?  84  ALA B N   1 
ATOM   1542  C CA  . ALA B  2 61  ? 456.469 84.154  461.396 1.00 65.76  ?  84  ALA B CA  1 
ATOM   1543  C C   . ALA B  2 61  ? 454.986 83.802  461.457 1.00 64.61  ?  84  ALA B C   1 
ATOM   1544  O O   . ALA B  2 61  ? 454.580 82.671  461.176 1.00 70.04  ?  84  ALA B O   1 
ATOM   1545  C CB  . ALA B  2 61  ? 456.810 84.733  460.023 1.00 64.37  ?  84  ALA B CB  1 
ATOM   1546  N N   . GLU B  2 62  ? 454.176 84.791  461.829 1.00 66.21  ?  85  GLU B N   1 
ATOM   1547  C CA  . GLU B  2 62  ? 452.730 84.645  461.924 1.00 68.55  ?  85  GLU B CA  1 
ATOM   1548  C C   . GLU B  2 62  ? 452.063 85.658  461.003 1.00 72.76  ?  85  GLU B C   1 
ATOM   1549  O O   . GLU B  2 62  ? 452.530 86.794  460.874 1.00 73.23  ?  85  GLU B O   1 
ATOM   1550  C CB  . GLU B  2 62  ? 452.247 84.840  463.365 1.00 75.85  ?  85  GLU B CB  1 
ATOM   1551  C CG  . GLU B  2 62  ? 451.053 83.979  463.748 1.00 91.25  ?  85  GLU B CG  1 
ATOM   1552  C CD  . GLU B  2 62  ? 451.448 82.553  464.093 1.00 90.11  ?  85  GLU B CD  1 
ATOM   1553  O OE1 . GLU B  2 62  ? 450.678 81.878  464.809 1.00 84.25  ?  85  GLU B OE1 1 
ATOM   1554  O OE2 . GLU B  2 62  ? 452.529 82.110  463.651 1.00 80.33  -1 85  GLU B OE2 1 
ATOM   1555  N N   . CYS B  2 63  ? 450.966 85.248  460.368 1.00 75.91  ?  86  CYS B N   1 
ATOM   1556  C CA  . CYS B  2 63  ? 450.304 86.051  459.347 1.00 73.21  ?  86  CYS B CA  1 
ATOM   1557  C C   . CYS B  2 63  ? 448.905 86.434  459.810 1.00 72.17  ?  86  CYS B C   1 
ATOM   1558  O O   . CYS B  2 63  ? 448.093 85.561  460.135 1.00 66.86  ?  86  CYS B O   1 
ATOM   1559  C CB  . CYS B  2 63  ? 450.221 85.296  458.016 1.00 62.42  ?  86  CYS B CB  1 
ATOM   1560  S SG  . CYS B  2 63  ? 451.792 84.744  457.292 1.00 71.09  ?  86  CYS B SG  1 
ATOM   1561  N N   . ASP B  2 64  ? 448.628 87.737  459.839 1.00 86.75  ?  87  ASP B N   1 
ATOM   1562  C CA  . ASP B  2 64  ? 447.265 88.240  459.883 1.00 78.75  ?  87  ASP B CA  1 
ATOM   1563  C C   . ASP B  2 64  ? 446.767 88.412  458.451 1.00 81.30  ?  87  ASP B C   1 
ATOM   1564  O O   . ASP B  2 64  ? 447.496 88.169  457.487 1.00 78.16  ?  87  ASP B O   1 
ATOM   1565  C CB  . ASP B  2 64  ? 447.195 89.557  460.652 1.00 83.99  ?  87  ASP B CB  1 
ATOM   1566  C CG  . ASP B  2 64  ? 447.117 89.354  462.149 1.00 100.52 ?  87  ASP B CG  1 
ATOM   1567  O OD1 . ASP B  2 64  ? 447.572 88.295  462.632 1.00 111.11 -1 87  ASP B OD1 1 
ATOM   1568  O OD2 . ASP B  2 64  ? 446.604 90.255  462.846 1.00 107.10 ?  87  ASP B OD2 1 
ATOM   1569  N N   . CYS B  2 65  ? 445.516 88.831  458.290 1.00 76.65  ?  88  CYS B N   1 
ATOM   1570  C CA  . CYS B  2 65  ? 444.996 89.097  456.958 1.00 61.77  ?  88  CYS B CA  1 
ATOM   1571  C C   . CYS B  2 65  ? 444.868 90.603  456.728 1.00 60.32  ?  88  CYS B C   1 
ATOM   1572  O O   . CYS B  2 65  ? 445.140 91.423  457.609 1.00 65.13  ?  88  CYS B O   1 
ATOM   1573  C CB  . CYS B  2 65  ? 443.661 88.385  456.728 1.00 53.73  ?  88  CYS B CB  1 
ATOM   1574  S SG  . CYS B  2 65  ? 443.425 88.003  454.970 1.00 99.63  ?  88  CYS B SG  1 
ATOM   1575  N N   . THR B  2 66  ? 444.438 90.953  455.520 1.00 44.21  ?  89  THR B N   1 
ATOM   1576  C CA  . THR B  2 66  ? 444.337 92.350  455.122 1.00 44.12  ?  89  THR B CA  1 
ATOM   1577  C C   . THR B  2 66  ? 443.148 93.008  455.821 1.00 46.70  ?  89  THR B C   1 
ATOM   1578  O O   . THR B  2 66  ? 442.118 92.360  456.030 1.00 50.04  ?  89  THR B O   1 
ATOM   1579  C CB  . THR B  2 66  ? 444.179 92.446  453.599 1.00 45.71  ?  89  THR B CB  1 
ATOM   1580  O OG1 . THR B  2 66  ? 445.313 91.844  452.963 1.00 45.94  ?  89  THR B OG1 1 
ATOM   1581  C CG2 . THR B  2 66  ? 444.056 93.891  453.131 1.00 44.63  ?  89  THR B CG2 1 
ATOM   1582  N N   . PRO B  2 67  ? 443.267 94.276  456.219 1.00 99.51  ?  90  PRO B N   1 
ATOM   1583  C CA  . PRO B  2 67  ? 442.096 94.999  456.727 1.00 105.41 ?  90  PRO B CA  1 
ATOM   1584  C C   . PRO B  2 67  ? 440.945 94.940  455.734 1.00 94.92  ?  90  PRO B C   1 
ATOM   1585  O O   . PRO B  2 67  ? 441.108 95.214  454.543 1.00 92.81  ?  90  PRO B O   1 
ATOM   1586  C CB  . PRO B  2 67  ? 442.614 96.431  456.919 1.00 99.81  ?  90  PRO B CB  1 
ATOM   1587  C CG  . PRO B  2 67  ? 443.958 96.476  456.231 1.00 95.57  ?  90  PRO B CG  1 
ATOM   1588  C CD  . PRO B  2 67  ? 444.490 95.086  456.326 1.00 99.60  ?  90  PRO B CD  1 
ATOM   1589  N N   . GLY B  2 68  ? 439.769 94.574  456.237 1.00 38.01  ?  91  GLY B N   1 
ATOM   1590  C CA  . GLY B  2 68  ? 438.642 94.217  455.406 1.00 43.07  ?  91  GLY B CA  1 
ATOM   1591  C C   . GLY B  2 68  ? 438.430 92.725  455.264 1.00 39.71  ?  91  GLY B C   1 
ATOM   1592  O O   . GLY B  2 68  ? 437.422 92.310  454.680 1.00 38.42  ?  91  GLY B O   1 
ATOM   1593  N N   . PHE B  2 69  ? 439.352 91.914  455.779 1.00 34.14  ?  92  PHE B N   1 
ATOM   1594  C CA  . PHE B  2 69  ? 439.257 90.463  455.770 1.00 34.66  ?  92  PHE B CA  1 
ATOM   1595  C C   . PHE B  2 69  ? 439.418 89.950  457.196 1.00 35.74  ?  92  PHE B C   1 
ATOM   1596  O O   . PHE B  2 69  ? 439.568 90.724  458.147 1.00 38.45  ?  92  PHE B O   1 
ATOM   1597  C CB  . PHE B  2 69  ? 440.317 89.839  454.852 1.00 38.72  ?  92  PHE B CB  1 
ATOM   1598  C CG  . PHE B  2 69  ? 440.020 89.984  453.388 1.00 38.90  ?  92  PHE B CG  1 
ATOM   1599  C CD1 . PHE B  2 69  ? 440.239 91.187  452.735 1.00 31.83  ?  92  PHE B CD1 1 
ATOM   1600  C CD2 . PHE B  2 69  ? 439.535 88.911  452.659 1.00 34.87  ?  92  PHE B CD2 1 
ATOM   1601  C CE1 . PHE B  2 69  ? 439.969 91.316  451.388 1.00 26.83  ?  92  PHE B CE1 1 
ATOM   1602  C CE2 . PHE B  2 69  ? 439.264 89.035  451.312 1.00 24.74  ?  92  PHE B CE2 1 
ATOM   1603  C CZ  . PHE B  2 69  ? 439.483 90.238  450.676 1.00 26.03  ?  92  PHE B CZ  1 
ATOM   1604  N N   . HIS B  2 70  ? 439.387 88.627  457.343 1.00 31.59  ?  93  HIS B N   1 
ATOM   1605  C CA  . HIS B  2 70  ? 439.616 87.996  458.634 1.00 37.67  ?  93  HIS B CA  1 
ATOM   1606  C C   . HIS B  2 70  ? 440.139 86.586  458.409 1.00 39.21  ?  93  HIS B C   1 
ATOM   1607  O O   . HIS B  2 70  ? 439.928 85.986  457.352 1.00 37.88  ?  93  HIS B O   1 
ATOM   1608  C CB  . HIS B  2 70  ? 438.342 87.973  459.488 1.00 41.07  ?  93  HIS B CB  1 
ATOM   1609  C CG  . HIS B  2 70  ? 437.210 87.215  458.867 1.00 29.49  ?  93  HIS B CG  1 
ATOM   1610  N ND1 . HIS B  2 70  ? 436.265 87.816  458.064 1.00 32.27  ?  93  HIS B ND1 1 
ATOM   1611  C CD2 . HIS B  2 70  ? 436.868 85.907  458.937 1.00 28.29  ?  93  HIS B CD2 1 
ATOM   1612  C CE1 . HIS B  2 70  ? 435.391 86.910  457.663 1.00 34.28  ?  93  HIS B CE1 1 
ATOM   1613  N NE2 . HIS B  2 70  ? 435.735 85.743  458.179 1.00 25.78  ?  93  HIS B NE2 1 
ATOM   1614  N N   . CYS B  2 71  ? 440.826 86.060  459.421 1.00 81.26  ?  94  CYS B N   1 
ATOM   1615  C CA  . CYS B  2 71  ? 441.413 84.733  459.312 1.00 81.87  ?  94  CYS B CA  1 
ATOM   1616  C C   . CYS B  2 71  ? 440.345 83.650  459.394 1.00 78.59  ?  94  CYS B C   1 
ATOM   1617  O O   . CYS B  2 71  ? 439.340 83.782  460.097 1.00 73.93  ?  94  CYS B O   1 
ATOM   1618  C CB  . CYS B  2 71  ? 442.451 84.507  460.410 1.00 88.21  ?  94  CYS B CB  1 
ATOM   1619  S SG  . CYS B  2 71  ? 444.129 85.052  460.017 1.00 136.10 ?  94  CYS B SG  1 
ATOM   1620  N N   . LEU B  2 72  ? 440.578 82.565  458.658 1.00 84.35  ?  95  LEU B N   1 
ATOM   1621  C CA  . LEU B  2 72  ? 439.734 81.379  458.709 1.00 88.58  ?  95  LEU B CA  1 
ATOM   1622  C C   . LEU B  2 72  ? 440.637 80.159  458.623 1.00 95.34  ?  95  LEU B C   1 
ATOM   1623  O O   . LEU B  2 72  ? 441.506 80.090  457.748 1.00 95.10  ?  95  LEU B O   1 
ATOM   1624  C CB  . LEU B  2 72  ? 438.704 81.381  457.571 1.00 76.67  ?  95  LEU B CB  1 
ATOM   1625  C CG  . LEU B  2 72  ? 437.530 80.399  457.639 1.00 70.14  ?  95  LEU B CG  1 
ATOM   1626  C CD1 . LEU B  2 72  ? 436.334 80.974  456.905 1.00 65.93  ?  95  LEU B CD1 1 
ATOM   1627  C CD2 . LEU B  2 72  ? 437.897 79.041  457.055 1.00 81.77  ?  95  LEU B CD2 1 
ATOM   1628  N N   . GLY B  2 73  ? 440.429 79.203  459.517 1.00 106.35 ?  96  GLY B N   1 
ATOM   1629  C CA  . GLY B  2 73  ? 441.258 78.017  459.590 1.00 112.15 ?  96  GLY B CA  1 
ATOM   1630  C C   . GLY B  2 73  ? 442.188 78.049  460.792 1.00 115.32 ?  96  GLY B C   1 
ATOM   1631  O O   . GLY B  2 73  ? 442.262 79.025  461.541 1.00 114.04 ?  96  GLY B O   1 
ATOM   1632  N N   . ALA B  2 74  ? 442.901 76.934  460.963 1.00 98.07  ?  97  ALA B N   1 
ATOM   1633  C CA  . ALA B  2 74  ? 443.806 76.736  462.090 1.00 99.47  ?  97  ALA B CA  1 
ATOM   1634  C C   . ALA B  2 74  ? 444.895 77.801  462.162 1.00 101.81 ?  97  ALA B C   1 
ATOM   1635  O O   . ALA B  2 74  ? 444.907 78.628  463.080 1.00 106.41 ?  97  ALA B O   1 
ATOM   1636  C CB  . ALA B  2 74  ? 444.443 75.347  462.011 1.00 101.46 ?  97  ALA B CB  1 
ATOM   1637  N N   . GLY B  2 75  ? 445.809 77.787  461.196 1.00 77.21  ?  98  GLY B N   1 
ATOM   1638  C CA  . GLY B  2 75  ? 446.963 78.666  461.196 1.00 77.31  ?  98  GLY B CA  1 
ATOM   1639  C C   . GLY B  2 75  ? 446.780 79.894  460.329 1.00 80.91  ?  98  GLY B C   1 
ATOM   1640  O O   . GLY B  2 75  ? 447.758 80.451  459.822 1.00 90.91  ?  98  GLY B O   1 
ATOM   1641  N N   . CYS B  2 76  ? 445.525 80.309  460.146 1.00 73.32  ?  99  CYS B N   1 
ATOM   1642  C CA  . CYS B  2 76  ? 445.124 81.238  459.089 1.00 70.08  ?  99  CYS B CA  1 
ATOM   1643  C C   . CYS B  2 76  ? 445.448 80.634  457.721 1.00 62.48  ?  99  CYS B C   1 
ATOM   1644  O O   . CYS B  2 76  ? 446.260 81.150  456.950 1.00 60.85  ?  99  CYS B O   1 
ATOM   1645  C CB  . CYS B  2 76  ? 445.778 82.617  459.257 1.00 61.66  ?  99  CYS B CB  1 
ATOM   1646  S SG  . CYS B  2 76  ? 445.294 83.547  460.732 1.00 111.71 ?  99  CYS B SG  1 
ATOM   1647  N N   . SER B  2 77  ? 444.783 79.513  457.438 1.00 63.28  ?  100 SER B N   1 
ATOM   1648  C CA  . SER B  2 77  ? 444.965 78.846  456.156 1.00 57.23  ?  100 SER B CA  1 
ATOM   1649  C C   . SER B  2 77  ? 444.266 79.600  455.035 1.00 57.25  ?  100 SER B C   1 
ATOM   1650  O O   . SER B  2 77  ? 444.763 79.631  453.904 1.00 60.05  ?  100 SER B O   1 
ATOM   1651  C CB  . SER B  2 77  ? 444.444 77.411  456.235 1.00 60.80  ?  100 SER B CB  1 
ATOM   1652  O OG  . SER B  2 77  ? 444.960 76.740  457.371 1.00 69.37  ?  100 SER B OG  1 
ATOM   1653  N N   . MET B  2 78  ? 443.125 80.209  455.329 1.00 65.76  ?  101 MET B N   1 
ATOM   1654  C CA  . MET B  2 78  ? 442.345 80.961  454.361 1.00 61.39  ?  101 MET B CA  1 
ATOM   1655  C C   . MET B  2 78  ? 442.134 82.384  454.865 1.00 61.82  ?  101 MET B C   1 
ATOM   1656  O O   . MET B  2 78  ? 442.529 82.744  455.976 1.00 68.76  ?  101 MET B O   1 
ATOM   1657  C CB  . MET B  2 78  ? 441.001 80.274  454.104 1.00 57.75  ?  101 MET B CB  1 
ATOM   1658  C CG  . MET B  2 78  ? 440.852 79.689  452.717 1.00 57.11  ?  101 MET B CG  1 
ATOM   1659  S SD  . MET B  2 78  ? 439.487 78.518  452.612 1.00 68.89  ?  101 MET B SD  1 
ATOM   1660  C CE  . MET B  2 78  ? 440.164 77.140  453.534 1.00 67.07  ?  101 MET B CE  1 
ATOM   1661  N N   . CYS B  2 79  ? 441.498 83.195  454.024 1.00 61.40  ?  102 CYS B N   1 
ATOM   1662  C CA  . CYS B  2 79  ? 441.013 84.514  454.411 1.00 62.75  ?  102 CYS B CA  1 
ATOM   1663  C C   . CYS B  2 79  ? 439.618 84.678  453.836 1.00 62.73  ?  102 CYS B C   1 
ATOM   1664  O O   . CYS B  2 79  ? 439.445 84.654  452.615 1.00 69.44  ?  102 CYS B O   1 
ATOM   1665  C CB  . CYS B  2 79  ? 441.923 85.631  453.894 1.00 54.93  ?  102 CYS B CB  1 
ATOM   1666  S SG  . CYS B  2 79  ? 443.423 85.974  454.836 1.00 68.84  ?  102 CYS B SG  1 
ATOM   1667  N N   . GLU B  2 80  ? 438.629 84.851  454.701 1.00 54.67  ?  103 GLU B N   1 
ATOM   1668  C CA  . GLU B  2 80  ? 437.272 85.118  454.255 1.00 55.52  ?  103 GLU B CA  1 
ATOM   1669  C C   . GLU B  2 80  ? 437.015 86.617  454.294 1.00 57.03  ?  103 GLU B C   1 
ATOM   1670  O O   . GLU B  2 80  ? 437.385 87.295  455.257 1.00 62.71  ?  103 GLU B O   1 
ATOM   1671  C CB  . GLU B  2 80  ? 436.245 84.383  455.118 1.00 62.35  ?  103 GLU B CB  1 
ATOM   1672  C CG  . GLU B  2 80  ? 434.860 84.317  454.489 1.00 61.64  ?  103 GLU B CG  1 
ATOM   1673  C CD  . GLU B  2 80  ? 433.803 83.796  455.439 1.00 61.72  ?  103 GLU B CD  1 
ATOM   1674  O OE1 . GLU B  2 80  ? 434.156 83.400  456.569 1.00 66.77  ?  103 GLU B OE1 1 
ATOM   1675  O OE2 . GLU B  2 80  ? 432.616 83.781  455.053 1.00 66.87  -1 103 GLU B OE2 1 
ATOM   1676  N N   . GLN B  2 81  ? 436.402 87.132  453.232 1.00 41.63  ?  104 GLN B N   1 
ATOM   1677  C CA  . GLN B  2 81  ? 435.967 88.520  453.234 1.00 39.23  ?  104 GLN B CA  1 
ATOM   1678  C C   . GLN B  2 81  ? 434.966 88.737  454.361 1.00 42.61  ?  104 GLN B C   1 
ATOM   1679  O O   . GLN B  2 81  ? 434.180 87.845  454.693 1.00 44.62  ?  104 GLN B O   1 
ATOM   1680  C CB  . GLN B  2 81  ? 435.339 88.881  451.888 1.00 32.36  ?  104 GLN B CB  1 
ATOM   1681  C CG  . GLN B  2 81  ? 434.856 90.318  451.790 1.00 32.73  ?  104 GLN B CG  1 
ATOM   1682  C CD  . GLN B  2 81  ? 433.858 90.523  450.670 1.00 40.38  ?  104 GLN B CD  1 
ATOM   1683  O OE1 . GLN B  2 81  ? 433.856 89.789  449.683 1.00 47.45  ?  104 GLN B OE1 1 
ATOM   1684  N NE2 . GLN B  2 81  ? 432.999 91.525  450.818 1.00 47.94  ?  104 GLN B NE2 1 
ATOM   1685  N N   . ASP B  2 82  ? 435.016 89.921  454.969 1.00 41.90  ?  105 ASP B N   1 
ATOM   1686  C CA  . ASP B  2 82  ? 434.087 90.243  456.042 1.00 47.67  ?  105 ASP B CA  1 
ATOM   1687  C C   . ASP B  2 82  ? 432.653 90.086  455.554 1.00 46.84  ?  105 ASP B C   1 
ATOM   1688  O O   . ASP B  2 82  ? 432.263 90.662  454.534 1.00 47.29  ?  105 ASP B O   1 
ATOM   1689  C CB  . ASP B  2 82  ? 434.333 91.665  456.544 1.00 54.95  ?  105 ASP B CB  1 
ATOM   1690  C CG  . ASP B  2 82  ? 435.673 91.813  457.246 1.00 55.18  ?  105 ASP B CG  1 
ATOM   1691  O OD1 . ASP B  2 82  ? 436.153 90.818  457.830 1.00 52.66  ?  105 ASP B OD1 1 
ATOM   1692  O OD2 . ASP B  2 82  ? 436.244 92.923  457.217 1.00 51.09  -1 105 ASP B OD2 1 
ATOM   1693  N N   . CYS B  2 83  ? 431.871 89.297  456.288 1.00 69.27  ?  106 CYS B N   1 
ATOM   1694  C CA  . CYS B  2 83  ? 430.555 88.895  455.820 1.00 73.24  ?  106 CYS B CA  1 
ATOM   1695  C C   . CYS B  2 83  ? 429.619 90.100  455.743 1.00 70.74  ?  106 CYS B C   1 
ATOM   1696  O O   . CYS B  2 83  ? 429.830 91.132  456.384 1.00 67.38  ?  106 CYS B O   1 
ATOM   1697  C CB  . CYS B  2 83  ? 429.973 87.813  456.731 1.00 72.71  ?  106 CYS B CB  1 
ATOM   1698  S SG  . CYS B  2 83  ? 431.171 86.552  457.276 1.00 75.16  ?  106 CYS B SG  1 
ATOM   1699  N N   . LYS B  2 84  ? 428.578 89.958  454.929 1.00 71.55  ?  107 LYS B N   1 
ATOM   1700  C CA  . LYS B  2 84  ? 427.672 91.052  454.619 1.00 64.57  ?  107 LYS B CA  1 
ATOM   1701  C C   . LYS B  2 84  ? 426.504 91.057  455.605 1.00 58.48  ?  107 LYS B C   1 
ATOM   1702  O O   . LYS B  2 84  ? 426.525 90.371  456.631 1.00 65.27  ?  107 LYS B O   1 
ATOM   1703  C CB  . LYS B  2 84  ? 427.197 90.946  453.170 1.00 65.10  ?  107 LYS B CB  1 
ATOM   1704  C CG  . LYS B  2 84  ? 428.322 90.835  452.149 1.00 66.71  ?  107 LYS B CG  1 
ATOM   1705  C CD  . LYS B  2 84  ? 428.661 89.382  451.833 1.00 69.81  ?  107 LYS B CD  1 
ATOM   1706  C CE  . LYS B  2 84  ? 429.946 89.274  451.027 1.00 72.74  ?  107 LYS B CE  1 
ATOM   1707  N NZ  . LYS B  2 84  ? 430.281 87.862  450.697 1.00 64.78  ?  107 LYS B NZ  1 
ATOM   1708  N N   . GLN B  2 85  ? 425.478 91.853  455.309 1.00 43.20  ?  108 GLN B N   1 
ATOM   1709  C CA  . GLN B  2 85  ? 424.290 91.893  456.151 1.00 42.90  ?  108 GLN B CA  1 
ATOM   1710  C C   . GLN B  2 85  ? 423.625 90.523  456.198 1.00 43.84  ?  108 GLN B C   1 
ATOM   1711  O O   . GLN B  2 85  ? 423.683 89.743  455.243 1.00 50.16  ?  108 GLN B O   1 
ATOM   1712  C CB  . GLN B  2 85  ? 423.295 92.928  455.626 1.00 49.13  ?  108 GLN B CB  1 
ATOM   1713  C CG  . GLN B  2 85  ? 423.903 94.270  455.273 1.00 56.25  ?  108 GLN B CG  1 
ATOM   1714  C CD  . GLN B  2 85  ? 422.896 95.205  454.633 1.00 59.70  ?  108 GLN B CD  1 
ATOM   1715  O OE1 . GLN B  2 85  ? 421.686 94.997  454.736 1.00 50.65  ?  108 GLN B OE1 1 
ATOM   1716  N NE2 . GLN B  2 85  ? 423.390 96.238  453.961 1.00 67.22  ?  108 GLN B NE2 1 
ATOM   1717  N N   . GLY B  2 86  ? 422.981 90.234  457.326 1.00 22.76  ?  109 GLY B N   1 
ATOM   1718  C CA  . GLY B  2 86  ? 422.332 88.950  457.497 1.00 26.38  ?  109 GLY B CA  1 
ATOM   1719  C C   . GLY B  2 86  ? 423.286 87.780  457.553 1.00 27.88  ?  109 GLY B C   1 
ATOM   1720  O O   . GLY B  2 86  ? 422.908 86.663  457.182 1.00 23.16  ?  109 GLY B O   1 
ATOM   1721  N N   . GLN B  2 87  ? 424.520 88.006  457.998 1.00 49.37  ?  110 GLN B N   1 
ATOM   1722  C CA  . GLN B  2 87  ? 425.517 86.952  458.101 1.00 48.73  ?  110 GLN B CA  1 
ATOM   1723  C C   . GLN B  2 87  ? 426.305 87.123  459.391 1.00 47.05  ?  110 GLN B C   1 
ATOM   1724  O O   . GLN B  2 87  ? 426.580 88.247  459.819 1.00 38.06  ?  110 GLN B O   1 
ATOM   1725  C CB  . GLN B  2 87  ? 426.468 86.954  456.896 1.00 47.11  ?  110 GLN B CB  1 
ATOM   1726  C CG  . GLN B  2 87  ? 425.829 86.477  455.600 1.00 49.60  ?  110 GLN B CG  1 
ATOM   1727  C CD  . GLN B  2 87  ? 426.836 86.302  454.479 1.00 54.59  ?  110 GLN B CD  1 
ATOM   1728  O OE1 . GLN B  2 87  ? 427.827 87.029  454.397 1.00 55.09  ?  110 GLN B OE1 1 
ATOM   1729  N NE2 . GLN B  2 87  ? 426.587 85.331  453.608 1.00 53.36  ?  110 GLN B NE2 1 
ATOM   1730  N N   . GLU B  2 88  ? 426.664 85.996  460.002 1.00 84.07  ?  111 GLU B N   1 
ATOM   1731  C CA  . GLU B  2 88  ? 427.405 85.956  461.253 1.00 86.46  ?  111 GLU B CA  1 
ATOM   1732  C C   . GLU B  2 88  ? 428.553 84.968  461.111 1.00 85.71  ?  111 GLU B C   1 
ATOM   1733  O O   . GLU B  2 88  ? 428.367 83.867  460.584 1.00 87.45  ?  111 GLU B O   1 
ATOM   1734  C CB  . GLU B  2 88  ? 426.492 85.550  462.419 1.00 88.49  ?  111 GLU B CB  1 
ATOM   1735  C CG  . GLU B  2 88  ? 427.195 85.390  463.756 1.00 97.73  ?  111 GLU B CG  1 
ATOM   1736  C CD  . GLU B  2 88  ? 426.312 84.725  464.796 1.00 104.11 ?  111 GLU B CD  1 
ATOM   1737  O OE1 . GLU B  2 88  ? 425.505 83.848  464.418 1.00 101.89 ?  111 GLU B OE1 1 
ATOM   1738  O OE2 . GLU B  2 88  ? 426.426 85.073  465.990 1.00 106.41 -1 111 GLU B OE2 1 
ATOM   1739  N N   . LEU B  2 89  ? 429.738 85.359  461.575 1.00 58.97  ?  112 LEU B N   1 
ATOM   1740  C CA  . LEU B  2 89  ? 430.903 84.488  461.454 1.00 67.15  ?  112 LEU B CA  1 
ATOM   1741  C C   . LEU B  2 89  ? 430.744 83.290  462.386 1.00 67.38  ?  112 LEU B C   1 
ATOM   1742  O O   . LEU B  2 89  ? 430.520 83.449  463.591 1.00 62.49  ?  112 LEU B O   1 
ATOM   1743  C CB  . LEU B  2 89  ? 432.193 85.256  461.744 1.00 67.61  ?  112 LEU B CB  1 
ATOM   1744  C CG  . LEU B  2 89  ? 432.632 85.667  463.154 1.00 74.92  ?  112 LEU B CG  1 
ATOM   1745  C CD1 . LEU B  2 89  ? 434.053 86.210  463.111 1.00 63.28  ?  112 LEU B CD1 1 
ATOM   1746  C CD2 . LEU B  2 89  ? 431.689 86.695  463.761 1.00 69.34  ?  112 LEU B CD2 1 
ATOM   1747  N N   . THR B  2 90  ? 430.828 82.091  461.814 1.00 89.16  ?  113 THR B N   1 
ATOM   1748  C CA  . THR B  2 90  ? 430.565 80.847  462.524 1.00 95.20  ?  113 THR B CA  1 
ATOM   1749  C C   . THR B  2 90  ? 431.837 80.181  463.043 1.00 103.51 ?  113 THR B C   1 
ATOM   1750  O O   . THR B  2 90  ? 431.765 79.048  463.532 1.00 103.72 ?  113 THR B O   1 
ATOM   1751  C CB  . THR B  2 90  ? 429.780 79.885  461.623 1.00 99.09  ?  113 THR B CB  1 
ATOM   1752  O OG1 . THR B  2 90  ? 428.850 80.635  460.831 1.00 96.91  ?  113 THR B OG1 1 
ATOM   1753  C CG2 . THR B  2 90  ? 428.981 78.886  462.457 1.00 98.87  ?  113 THR B CG2 1 
ATOM   1754  N N   . LYS B  2 91  ? 432.997 80.845  462.943 1.00 108.23 ?  114 LYS B N   1 
ATOM   1755  C CA  . LYS B  2 91  ? 434.244 80.243  463.413 1.00 110.75 ?  114 LYS B CA  1 
ATOM   1756  C C   . LYS B  2 91  ? 434.571 78.979  462.625 1.00 104.19 ?  114 LYS B C   1 
ATOM   1757  O O   . LYS B  2 91  ? 434.218 77.875  463.055 1.00 102.89 ?  114 LYS B O   1 
ATOM   1758  C CB  . LYS B  2 91  ? 434.189 79.950  464.918 1.00 119.58 ?  114 LYS B CB  1 
ATOM   1759  C CG  . LYS B  2 91  ? 434.225 81.190  465.798 1.00 114.68 ?  114 LYS B CG  1 
ATOM   1760  C CD  . LYS B  2 91  ? 435.632 81.765  465.885 1.00 114.45 ?  114 LYS B CD  1 
ATOM   1761  C CE  . LYS B  2 91  ? 435.631 83.273  465.695 1.00 119.01 ?  114 LYS B CE  1 
ATOM   1762  N NZ  . LYS B  2 91  ? 436.990 83.856  465.877 1.00 121.95 ?  114 LYS B NZ  1 
ATOM   1763  N N   . LYS B  2 92  ? 435.243 79.141  461.475 1.00 80.12  ?  115 LYS B N   1 
ATOM   1764  C CA  . LYS B  2 92  ? 435.275 78.207  460.347 1.00 81.71  ?  115 LYS B CA  1 
ATOM   1765  C C   . LYS B  2 92  ? 433.958 78.197  459.581 1.00 73.61  ?  115 LYS B C   1 
ATOM   1766  O O   . LYS B  2 92  ? 433.141 77.279  459.714 1.00 64.93  ?  115 LYS B O   1 
ATOM   1767  C CB  . LYS B  2 92  ? 435.630 76.783  460.795 1.00 87.34  ?  115 LYS B CB  1 
ATOM   1768  C CG  . LYS B  2 92  ? 436.911 76.235  460.185 1.00 81.73  ?  115 LYS B CG  1 
ATOM   1769  C CD  . LYS B  2 92  ? 438.141 76.806  460.869 1.00 80.69  ?  115 LYS B CD  1 
ATOM   1770  C CE  . LYS B  2 92  ? 438.270 76.292  462.295 1.00 82.23  ?  115 LYS B CE  1 
ATOM   1771  N NZ  . LYS B  2 92  ? 439.505 76.796  462.957 1.00 68.02  ?  115 LYS B NZ  1 
ATOM   1772  N N   . GLY B  2 93  ? 433.760 79.239  458.785 1.00 32.84  ?  116 GLY B N   1 
ATOM   1773  C CA  . GLY B  2 93  ? 432.618 79.460  457.926 1.00 24.91  ?  116 GLY B CA  1 
ATOM   1774  C C   . GLY B  2 93  ? 431.771 80.629  458.405 1.00 33.26  ?  116 GLY B C   1 
ATOM   1775  O O   . GLY B  2 93  ? 431.804 81.029  459.572 1.00 36.88  ?  116 GLY B O   1 
ATOM   1776  N N   . CYS B  2 94  ? 431.034 81.215  457.464 1.00 52.83  ?  117 CYS B N   1 
ATOM   1777  C CA  . CYS B  2 94  ? 430.071 82.266  457.773 1.00 50.42  ?  117 CYS B CA  1 
ATOM   1778  C C   . CYS B  2 94  ? 428.682 81.760  457.408 1.00 51.40  ?  117 CYS B C   1 
ATOM   1779  O O   . CYS B  2 94  ? 428.359 81.615  456.223 1.00 51.02  ?  117 CYS B O   1 
ATOM   1780  C CB  . CYS B  2 94  ? 430.399 83.569  457.039 1.00 43.91  ?  117 CYS B CB  1 
ATOM   1781  S SG  . CYS B  2 94  ? 430.022 85.050  458.027 1.00 82.60  ?  117 CYS B SG  1 
ATOM   1782  N N   . LYS B  2 95  ? 427.866 81.497  458.425 1.00 58.61  ?  118 LYS B N   1 
ATOM   1783  C CA  . LYS B  2 95  ? 426.465 81.172  458.222 1.00 60.07  ?  118 LYS B CA  1 
ATOM   1784  C C   . LYS B  2 95  ? 425.719 82.391  457.692 1.00 48.79  ?  118 LYS B C   1 
ATOM   1785  O O   . LYS B  2 95  ? 426.200 83.525  457.766 1.00 44.10  ?  118 LYS B O   1 
ATOM   1786  C CB  . LYS B  2 95  ? 425.819 80.706  459.527 1.00 63.69  ?  118 LYS B CB  1 
ATOM   1787  C CG  . LYS B  2 95  ? 426.049 79.247  459.877 1.00 69.58  ?  118 LYS B CG  1 
ATOM   1788  C CD  . LYS B  2 95  ? 425.488 78.935  461.258 1.00 72.39  ?  118 LYS B CD  1 
ATOM   1789  C CE  . LYS B  2 95  ? 424.048 79.408  461.393 1.00 71.45  ?  118 LYS B CE  1 
ATOM   1790  N NZ  . LYS B  2 95  ? 423.515 79.204  462.769 1.00 68.22  ?  118 LYS B NZ  1 
ATOM   1791  N N   . ASP B  2 96  ? 424.528 82.153  457.155 1.00 61.84  ?  119 ASP B N   1 
ATOM   1792  C CA  . ASP B  2 96  ? 423.654 83.252  456.767 1.00 59.97  ?  119 ASP B CA  1 
ATOM   1793  C C   . ASP B  2 96  ? 422.689 83.431  457.931 1.00 62.83  ?  119 ASP B C   1 
ATOM   1794  O O   . ASP B  2 96  ? 421.698 82.708  458.055 1.00 61.22  ?  119 ASP B O   1 
ATOM   1795  C CB  . ASP B  2 96  ? 422.934 82.943  455.459 1.00 57.78  ?  119 ASP B CB  1 
ATOM   1796  C CG  . ASP B  2 96  ? 422.188 84.142  454.901 1.00 65.29  ?  119 ASP B CG  1 
ATOM   1797  O OD1 . ASP B  2 96  ? 422.826 84.984  454.236 1.00 66.70  ?  119 ASP B OD1 1 
ATOM   1798  O OD2 . ASP B  2 96  ? 420.962 84.236  455.121 1.00 74.28  -1 119 ASP B OD2 1 
ATOM   1799  N N   . CYS B  2 97  ? 422.994 84.422  458.769 1.00 98.59  ?  120 CYS B N   1 
ATOM   1800  C CA  . CYS B  2 97  ? 422.256 84.762  459.981 1.00 93.03  ?  120 CYS B CA  1 
ATOM   1801  C C   . CYS B  2 97  ? 421.810 83.526  460.750 1.00 94.50  ?  120 CYS B C   1 
ATOM   1802  O O   . CYS B  2 97  ? 422.588 82.589  460.961 1.00 108.58 ?  120 CYS B O   1 
ATOM   1803  C CB  . CYS B  2 97  ? 421.051 85.638  459.656 1.00 84.25  ?  120 CYS B CB  1 
ATOM   1804  S SG  . CYS B  2 97  ? 420.749 86.855  460.938 1.00 111.38 ?  120 CYS B SG  1 
ATOM   1805  N N   . CYS B  2 98  ? 420.547 83.529  461.163 1.00 73.66  ?  121 CYS B N   1 
ATOM   1806  C CA  . CYS B  2 98  ? 419.892 82.372  461.750 1.00 86.52  ?  121 CYS B CA  1 
ATOM   1807  C C   . CYS B  2 98  ? 418.394 82.586  461.602 1.00 83.89  ?  121 CYS B C   1 
ATOM   1808  O O   . CYS B  2 98  ? 417.929 83.716  461.434 1.00 84.57  ?  121 CYS B O   1 
ATOM   1809  C CB  . CYS B  2 98  ? 420.284 82.182  463.219 1.00 83.44  ?  121 CYS B CB  1 
ATOM   1810  S SG  . CYS B  2 98  ? 420.003 80.519  463.861 1.00 94.44  ?  121 CYS B SG  1 
ATOM   1811  N N   . PHE B  2 99  ? 417.641 81.493  461.663 1.00 80.05  ?  122 PHE B N   1 
ATOM   1812  C CA  . PHE B  2 99  ? 416.195 81.596  461.513 1.00 88.47  ?  122 PHE B CA  1 
ATOM   1813  C C   . PHE B  2 99  ? 415.599 82.266  462.746 1.00 87.16  ?  122 PHE B C   1 
ATOM   1814  O O   . PHE B  2 99  ? 415.768 81.781  463.870 1.00 88.98  ?  122 PHE B O   1 
ATOM   1815  C CB  . PHE B  2 99  ? 415.582 80.217  461.288 1.00 104.69 ?  122 PHE B CB  1 
ATOM   1816  C CG  . PHE B  2 99  ? 415.905 79.623  459.944 1.00 109.09 ?  122 PHE B CG  1 
ATOM   1817  C CD1 . PHE B  2 99  ? 415.338 80.139  458.790 1.00 101.43 ?  122 PHE B CD1 1 
ATOM   1818  C CD2 . PHE B  2 99  ? 416.773 78.549  459.836 1.00 105.85 ?  122 PHE B CD2 1 
ATOM   1819  C CE1 . PHE B  2 99  ? 415.633 79.598  457.552 1.00 102.88 ?  122 PHE B CE1 1 
ATOM   1820  C CE2 . PHE B  2 99  ? 417.072 78.001  458.601 1.00 108.02 ?  122 PHE B CE2 1 
ATOM   1821  C CZ  . PHE B  2 99  ? 416.501 78.527  457.458 1.00 113.31 ?  122 PHE B CZ  1 
ATOM   1822  N N   . GLY B  2 100 ? 414.896 83.378  462.532 1.00 53.04  ?  123 GLY B N   1 
ATOM   1823  C CA  . GLY B  2 100 ? 414.312 84.150  463.606 1.00 42.34  ?  123 GLY B CA  1 
ATOM   1824  C C   . GLY B  2 100 ? 415.139 85.330  464.074 1.00 40.46  ?  123 GLY B C   1 
ATOM   1825  O O   . GLY B  2 100 ? 414.661 86.099  464.918 1.00 36.61  ?  123 GLY B O   1 
ATOM   1826  N N   . THR B  2 101 ? 416.354 85.502  463.560 1.00 34.62  ?  124 THR B N   1 
ATOM   1827  C CA  . THR B  2 101 ? 417.245 86.584  463.968 1.00 29.24  ?  124 THR B CA  1 
ATOM   1828  C C   . THR B  2 101 ? 417.534 87.501  462.782 1.00 22.60  ?  124 THR B C   1 
ATOM   1829  O O   . THR B  2 101 ? 417.092 87.263  461.656 1.00 24.00  ?  124 THR B O   1 
ATOM   1830  C CB  . THR B  2 101 ? 418.547 86.026  464.552 1.00 28.27  ?  124 THR B CB  1 
ATOM   1831  O OG1 . THR B  2 101 ? 419.198 85.204  463.577 1.00 27.03  ?  124 THR B OG1 1 
ATOM   1832  C CG2 . THR B  2 101 ? 418.261 85.200  465.797 1.00 30.28  ?  124 THR B CG2 1 
ATOM   1833  N N   . PHE B  2 102 ? 418.297 88.562  463.049 1.00 22.71  ?  125 PHE B N   1 
ATOM   1834  C CA  . PHE B  2 102 ? 418.632 89.546  462.029 1.00 22.51  ?  125 PHE B CA  1 
ATOM   1835  C C   . PHE B  2 102 ? 419.969 90.190  462.365 1.00 22.96  ?  125 PHE B C   1 
ATOM   1836  O O   . PHE B  2 102 ? 420.338 90.316  463.535 1.00 23.50  ?  125 PHE B O   1 
ATOM   1837  C CB  . PHE B  2 102 ? 417.563 90.639  461.918 1.00 22.45  ?  125 PHE B CB  1 
ATOM   1838  C CG  . PHE B  2 102 ? 417.855 91.855  462.755 1.00 23.01  ?  125 PHE B CG  1 
ATOM   1839  C CD1 . PHE B  2 102 ? 417.639 91.839  464.123 1.00 23.52  ?  125 PHE B CD1 1 
ATOM   1840  C CD2 . PHE B  2 102 ? 418.354 93.010  462.174 1.00 23.04  ?  125 PHE B CD2 1 
ATOM   1841  C CE1 . PHE B  2 102 ? 417.913 92.950  464.894 1.00 24.04  ?  125 PHE B CE1 1 
ATOM   1842  C CE2 . PHE B  2 102 ? 418.632 94.124  462.942 1.00 23.56  ?  125 PHE B CE2 1 
ATOM   1843  C CZ  . PHE B  2 102 ? 418.408 94.095  464.304 1.00 24.06  ?  125 PHE B CZ  1 
ATOM   1844  N N   . ASN B  2 103 ? 420.696 90.588  461.323 1.00 43.71  ?  126 ASN B N   1 
ATOM   1845  C CA  . ASN B  2 103 ? 421.836 91.483  461.472 1.00 45.19  ?  126 ASN B CA  1 
ATOM   1846  C C   . ASN B  2 103 ? 421.873 92.445  460.297 1.00 47.00  ?  126 ASN B C   1 
ATOM   1847  O O   . ASN B  2 103 ? 421.875 92.010  459.142 1.00 51.86  ?  126 ASN B O   1 
ATOM   1848  C CB  . ASN B  2 103 ? 423.155 90.712  461.548 1.00 45.03  ?  126 ASN B CB  1 
ATOM   1849  C CG  . ASN B  2 103 ? 424.365 91.615  461.421 1.00 55.14  ?  126 ASN B CG  1 
ATOM   1850  O OD1 . ASN B  2 103 ? 424.390 92.719  461.964 1.00 61.50  ?  126 ASN B OD1 1 
ATOM   1851  N ND2 . ASN B  2 103 ? 425.375 91.152  460.692 1.00 53.59  ?  126 ASN B ND2 1 
ATOM   1852  N N   . ASP B  2 104 ? 421.906 93.743  460.585 1.00 60.95  ?  127 ASP B N   1 
ATOM   1853  C CA  . ASP B  2 104 ? 422.266 94.745  459.586 1.00 68.18  ?  127 ASP B CA  1 
ATOM   1854  C C   . ASP B  2 104 ? 423.556 95.410  460.050 1.00 77.38  ?  127 ASP B C   1 
ATOM   1855  O O   . ASP B  2 104 ? 423.530 96.264  460.943 1.00 91.16  ?  127 ASP B O   1 
ATOM   1856  C CB  . ASP B  2 104 ? 421.151 95.768  459.394 1.00 69.41  ?  127 ASP B CB  1 
ATOM   1857  C CG  . ASP B  2 104 ? 421.554 96.896  458.465 1.00 81.94  ?  127 ASP B CG  1 
ATOM   1858  O OD1 . ASP B  2 104 ? 421.362 96.757  457.238 1.00 83.03  -1 127 ASP B OD1 1 
ATOM   1859  O OD2 . ASP B  2 104 ? 422.069 97.920  458.962 1.00 79.35  ?  127 ASP B OD2 1 
ATOM   1860  N N   . GLN B  2 105 ? 424.667 95.040  459.408 1.00 32.79  ?  128 GLN B N   1 
ATOM   1861  C CA  . GLN B  2 105 ? 425.986 95.615  459.649 1.00 31.04  ?  128 GLN B CA  1 
ATOM   1862  C C   . GLN B  2 105 ? 427.026 94.850  458.846 1.00 33.07  ?  128 GLN B C   1 
ATOM   1863  O O   . GLN B  2 105 ? 426.772 93.721  458.412 1.00 39.00  ?  128 GLN B O   1 
ATOM   1864  C CB  . GLN B  2 105 ? 426.359 95.577  461.133 1.00 41.54  ?  128 GLN B CB  1 
ATOM   1865  C CG  . GLN B  2 105 ? 427.225 96.739  461.579 1.00 47.93  ?  128 GLN B CG  1 
ATOM   1866  C CD  . GLN B  2 105 ? 426.466 98.050  461.596 1.00 46.41  ?  128 GLN B CD  1 
ATOM   1867  O OE1 . GLN B  2 105 ? 425.541 98.235  462.387 1.00 46.71  ?  128 GLN B OE1 1 
ATOM   1868  N NE2 . GLN B  2 105 ? 426.846 98.964  460.712 1.00 50.70  ?  128 GLN B NE2 1 
ATOM   1869  N N   . LYS B  2 106 ? 428.196 95.449  458.637 1.00 65.99  ?  129 LYS B N   1 
ATOM   1870  C CA  . LYS B  2 106 ? 429.331 94.704  458.110 1.00 64.56  ?  129 LYS B CA  1 
ATOM   1871  C C   . LYS B  2 106 ? 429.718 93.584  459.070 1.00 66.75  ?  129 LYS B C   1 
ATOM   1872  O O   . LYS B  2 106 ? 429.561 92.402  458.755 1.00 77.33  ?  129 LYS B O   1 
ATOM   1873  C CB  . LYS B  2 106 ? 430.514 95.637  457.849 1.00 69.23  ?  129 LYS B CB  1 
ATOM   1874  C CG  . LYS B  2 106 ? 430.201 96.747  456.856 1.00 76.51  ?  129 LYS B CG  1 
ATOM   1875  C CD  . LYS B  2 106 ? 431.438 97.558  456.514 1.00 82.56  ?  129 LYS B CD  1 
ATOM   1876  C CE  . LYS B  2 106 ? 432.457 96.712  455.772 1.00 79.98  ?  129 LYS B CE  1 
ATOM   1877  N NZ  . LYS B  2 106 ? 433.680 97.489  455.424 1.00 79.20  ?  129 LYS B NZ  1 
ATOM   1878  N N   . ARG B  2 107 ? 430.212 93.952  460.250 1.00 50.51  ?  130 ARG B N   1 
ATOM   1879  C CA  . ARG B  2 107 ? 430.706 92.999  461.236 1.00 52.93  ?  130 ARG B CA  1 
ATOM   1880  C C   . ARG B  2 107 ? 429.661 92.601  462.269 1.00 50.56  ?  130 ARG B C   1 
ATOM   1881  O O   . ARG B  2 107 ? 429.992 91.870  463.208 1.00 42.67  ?  130 ARG B O   1 
ATOM   1882  C CB  . ARG B  2 107 ? 431.924 93.581  461.956 1.00 61.86  ?  130 ARG B CB  1 
ATOM   1883  C CG  . ARG B  2 107 ? 432.845 94.353  461.044 1.00 60.08  ?  130 ARG B CG  1 
ATOM   1884  C CD  . ARG B  2 107 ? 433.778 93.429  460.286 1.00 60.86  ?  130 ARG B CD  1 
ATOM   1885  N NE  . ARG B  2 107 ? 434.028 93.886  458.921 1.00 63.83  ?  130 ARG B NE  1 
ATOM   1886  C CZ  . ARG B  2 107 ? 434.703 94.986  458.606 1.00 61.41  ?  130 ARG B CZ  1 
ATOM   1887  N NH1 . ARG B  2 107 ? 434.886 95.311  457.335 1.00 59.45  ?  130 ARG B NH1 1 
ATOM   1888  N NH2 . ARG B  2 107 ? 435.181 95.771  459.558 1.00 59.97  ?  130 ARG B NH2 1 
ATOM   1889  N N   . GLY B  2 108 ? 428.424 93.070  462.129 1.00 58.30  ?  131 GLY B N   1 
ATOM   1890  C CA  . GLY B  2 108 ? 427.436 92.846  463.168 1.00 61.08  ?  131 GLY B CA  1 
ATOM   1891  C C   . GLY B  2 108 ? 427.141 91.374  463.379 1.00 54.84  ?  131 GLY B C   1 
ATOM   1892  O O   . GLY B  2 108 ? 427.269 90.549  462.473 1.00 56.39  ?  131 GLY B O   1 
ATOM   1893  N N   . ILE B  2 109 ? 426.746 91.050  464.606 1.00 41.21  ?  132 ILE B N   1 
ATOM   1894  C CA  . ILE B  2 109 ? 426.369 89.696  464.995 1.00 48.50  ?  132 ILE B CA  1 
ATOM   1895  C C   . ILE B  2 109 ? 424.858 89.570  464.884 1.00 50.22  ?  132 ILE B C   1 
ATOM   1896  O O   . ILE B  2 109 ? 424.119 90.484  465.276 1.00 51.57  ?  132 ILE B O   1 
ATOM   1897  C CB  . ILE B  2 109 ? 426.849 89.376  466.423 1.00 50.80  ?  132 ILE B CB  1 
ATOM   1898  C CG1 . ILE B  2 109 ? 428.354 89.623  466.545 1.00 56.04  ?  132 ILE B CG1 1 
ATOM   1899  C CG2 . ILE B  2 109 ? 426.507 87.943  466.798 1.00 48.57  ?  132 ILE B CG2 1 
ATOM   1900  C CD1 . ILE B  2 109 ? 428.904 89.374  467.934 1.00 66.47  ?  132 ILE B CD1 1 
ATOM   1901  N N   . CYS B  2 110 ? 424.392 88.446  464.342 1.00 54.40  ?  133 CYS B N   1 
ATOM   1902  C CA  . CYS B  2 110 ? 422.957 88.250  464.180 1.00 50.00  ?  133 CYS B CA  1 
ATOM   1903  C C   . CYS B  2 110 ? 422.278 88.174  465.542 1.00 51.32  ?  133 CYS B C   1 
ATOM   1904  O O   . CYS B  2 110 ? 422.679 87.399  466.416 1.00 53.09  ?  133 CYS B O   1 
ATOM   1905  C CB  . CYS B  2 110 ? 422.670 86.995  463.351 1.00 52.52  ?  133 CYS B CB  1 
ATOM   1906  S SG  . CYS B  2 110 ? 422.634 87.343  461.566 1.00 52.15  ?  133 CYS B SG  1 
ATOM   1907  N N   . ARG B  2 111 ? 421.254 89.004  465.717 1.00 41.14  ?  134 ARG B N   1 
ATOM   1908  C CA  . ARG B  2 111 ? 420.526 89.212  466.956 1.00 35.49  ?  134 ARG B CA  1 
ATOM   1909  C C   . ARG B  2 111 ? 419.039 88.980  466.727 1.00 36.29  ?  134 ARG B C   1 
ATOM   1910  O O   . ARG B  2 111 ? 418.543 89.168  465.610 1.00 38.44  ?  134 ARG B O   1 
ATOM   1911  C CB  . ARG B  2 111 ? 420.764 90.635  467.478 1.00 38.48  ?  134 ARG B CB  1 
ATOM   1912  C CG  . ARG B  2 111 ? 421.187 91.604  466.385 1.00 41.11  ?  134 ARG B CG  1 
ATOM   1913  C CD  . ARG B  2 111 ? 421.427 93.012  466.913 1.00 39.75  ?  134 ARG B CD  1 
ATOM   1914  N NE  . ARG B  2 111 ? 420.171 93.706  467.173 1.00 54.76  ?  134 ARG B NE  1 
ATOM   1915  C CZ  . ARG B  2 111 ? 420.035 95.028  467.142 1.00 57.72  ?  134 ARG B CZ  1 
ATOM   1916  N NH1 . ARG B  2 111 ? 421.081 95.803  466.860 1.00 51.22  ?  134 ARG B NH1 1 
ATOM   1917  N NH2 . ARG B  2 111 ? 418.857 95.588  467.392 1.00 47.61  ?  134 ARG B NH2 1 
ATOM   1918  N N   . PRO B  2 112 ? 418.304 88.573  467.761 1.00 65.54  ?  135 PRO B N   1 
ATOM   1919  C CA  . PRO B  2 112 ? 416.878 88.279  467.580 1.00 63.00  ?  135 PRO B CA  1 
ATOM   1920  C C   . PRO B  2 112 ? 416.086 89.523  467.206 1.00 62.31  ?  135 PRO B C   1 
ATOM   1921  O O   . PRO B  2 112 ? 416.499 90.660  467.445 1.00 65.94  ?  135 PRO B O   1 
ATOM   1922  C CB  . PRO B  2 112 ? 416.446 87.742  468.949 1.00 59.31  ?  135 PRO B CB  1 
ATOM   1923  C CG  . PRO B  2 112 ? 417.711 87.303  469.610 1.00 64.31  ?  135 PRO B CG  1 
ATOM   1924  C CD  . PRO B  2 112 ? 418.766 88.245  469.119 1.00 65.95  ?  135 PRO B CD  1 
ATOM   1925  N N   . TRP B  2 113 ? 414.922 89.283  466.607 1.00 33.52  ?  136 TRP B N   1 
ATOM   1926  C CA  . TRP B  2 113 ? 414.035 90.366  466.210 1.00 31.11  ?  136 TRP B CA  1 
ATOM   1927  C C   . TRP B  2 113 ? 413.458 91.067  467.435 1.00 31.50  ?  136 TRP B C   1 
ATOM   1928  O O   . TRP B  2 113 ? 413.402 90.514  468.536 1.00 35.88  ?  136 TRP B O   1 
ATOM   1929  C CB  . TRP B  2 113 ? 412.886 89.841  465.348 1.00 32.98  ?  136 TRP B CB  1 
ATOM   1930  C CG  . TRP B  2 113 ? 413.302 89.258  464.036 1.00 35.70  ?  136 TRP B CG  1 
ATOM   1931  C CD1 . TRP B  2 113 ? 414.472 89.478  463.372 1.00 37.26  ?  136 TRP B CD1 1 
ATOM   1932  C CD2 . TRP B  2 113 ? 412.545 88.351  463.228 1.00 36.49  ?  136 TRP B CD2 1 
ATOM   1933  N NE1 . TRP B  2 113 ? 414.489 88.766  462.197 1.00 37.27  ?  136 TRP B NE1 1 
ATOM   1934  C CE2 . TRP B  2 113 ? 413.318 88.065  462.086 1.00 34.81  ?  136 TRP B CE2 1 
ATOM   1935  C CE3 . TRP B  2 113 ? 411.287 87.753  463.357 1.00 39.74  ?  136 TRP B CE3 1 
ATOM   1936  C CZ2 . TRP B  2 113 ? 412.876 87.206  461.081 1.00 34.93  ?  136 TRP B CZ2 1 
ATOM   1937  C CZ3 . TRP B  2 113 ? 410.850 86.902  462.359 1.00 42.41  ?  136 TRP B CZ3 1 
ATOM   1938  C CH2 . TRP B  2 113 ? 411.641 86.637  461.236 1.00 40.16  ?  136 TRP B CH2 1 
ATOM   1939  N N   . THR B  2 114 ? 413.020 92.304  467.227 1.00 31.06  ?  137 THR B N   1 
ATOM   1940  C CA  . THR B  2 114 ? 412.265 93.003  468.253 1.00 36.02  ?  137 THR B CA  1 
ATOM   1941  C C   . THR B  2 114 ? 410.903 92.342  468.421 1.00 39.39  ?  137 THR B C   1 
ATOM   1942  O O   . THR B  2 114 ? 410.264 91.943  467.444 1.00 41.73  ?  137 THR B O   1 
ATOM   1943  C CB  . THR B  2 114 ? 412.098 94.477  467.886 1.00 36.59  ?  137 THR B CB  1 
ATOM   1944  O OG1 . THR B  2 114 ? 413.351 95.002  467.434 1.00 38.86  ?  137 THR B OG1 1 
ATOM   1945  C CG2 . THR B  2 114 ? 411.628 95.277  469.092 1.00 36.20  ?  137 THR B CG2 1 
ATOM   1946  N N   . ASN B  2 115 ? 410.459 92.219  469.668 1.00 67.42  ?  138 ASN B N   1 
ATOM   1947  C CA  . ASN B  2 115 ? 409.200 91.556  469.987 1.00 66.57  ?  138 ASN B CA  1 
ATOM   1948  C C   . ASN B  2 115 ? 408.140 92.625  470.220 1.00 69.59  ?  138 ASN B C   1 
ATOM   1949  O O   . ASN B  2 115 ? 408.193 93.359  471.214 1.00 75.85  ?  138 ASN B O   1 
ATOM   1950  C CB  . ASN B  2 115 ? 409.357 90.657  471.210 1.00 61.48  ?  138 ASN B CB  1 
ATOM   1951  C CG  . ASN B  2 115 ? 408.214 89.672  471.360 1.00 68.45  ?  138 ASN B CG  1 
ATOM   1952  O OD1 . ASN B  2 115 ? 407.139 89.855  470.787 1.00 73.13  ?  138 ASN B OD1 1 
ATOM   1953  N ND2 . ASN B  2 115 ? 408.442 88.617  472.134 1.00 69.22  ?  138 ASN B ND2 1 
ATOM   1954  N N   . CYS B  2 116 ? 407.175 92.712  469.304 1.00 40.95  ?  139 CYS B N   1 
ATOM   1955  C CA  . CYS B  2 116 ? 406.099 93.683  469.440 1.00 48.41  ?  139 CYS B CA  1 
ATOM   1956  C C   . CYS B  2 116 ? 405.043 93.246  470.445 1.00 54.69  ?  139 CYS B C   1 
ATOM   1957  O O   . CYS B  2 116 ? 404.281 94.091  470.928 1.00 54.53  ?  139 CYS B O   1 
ATOM   1958  C CB  . CYS B  2 116 ? 405.443 93.939  468.081 1.00 55.79  ?  139 CYS B CB  1 
ATOM   1959  S SG  . CYS B  2 116 ? 406.604 94.257  466.730 1.00 47.64  ?  139 CYS B SG  1 
ATOM   1960  N N   . SER B  2 117 ? 404.980 91.952  470.770 1.00 63.43  ?  140 SER B N   1 
ATOM   1961  C CA  . SER B  2 117 ? 404.013 91.485  471.758 1.00 60.96  ?  140 SER B CA  1 
ATOM   1962  C C   . SER B  2 117 ? 404.298 92.066  473.135 1.00 65.89  ?  140 SER B C   1 
ATOM   1963  O O   . SER B  2 117 ? 403.369 92.280  473.923 1.00 79.61  ?  140 SER B O   1 
ATOM   1964  C CB  . SER B  2 117 ? 404.014 89.957  471.817 1.00 62.34  ?  140 SER B CB  1 
ATOM   1965  O OG  . SER B  2 117 ? 403.676 89.398  470.560 1.00 75.86  ?  140 SER B OG  1 
ATOM   1966  N N   . LEU B  2 118 ? 405.569 92.328  473.444 1.00 31.75  ?  141 LEU B N   1 
ATOM   1967  C CA  . LEU B  2 118 ? 405.922 92.930  474.722 1.00 33.82  ?  141 LEU B CA  1 
ATOM   1968  C C   . LEU B  2 118 ? 405.676 94.432  474.745 1.00 33.28  ?  141 LEU B C   1 
ATOM   1969  O O   . LEU B  2 118 ? 405.573 95.015  475.830 1.00 33.88  ?  141 LEU B O   1 
ATOM   1970  C CB  . LEU B  2 118 ? 407.389 92.641  475.051 1.00 29.96  ?  141 LEU B CB  1 
ATOM   1971  C CG  . LEU B  2 118 ? 407.861 91.196  474.864 1.00 29.47  ?  141 LEU B CG  1 
ATOM   1972  C CD1 . LEU B  2 118 ? 409.305 91.039  475.314 1.00 27.14  ?  141 LEU B CD1 1 
ATOM   1973  C CD2 . LEU B  2 118 ? 406.954 90.221  475.602 1.00 37.51  ?  141 LEU B CD2 1 
ATOM   1974  N N   . ASP B  2 119 ? 405.587 95.068  473.579 1.00 80.61  ?  142 ASP B N   1 
ATOM   1975  C CA  . ASP B  2 119 ? 405.301 96.492  473.474 1.00 84.08  ?  142 ASP B CA  1 
ATOM   1976  C C   . ASP B  2 119 ? 403.823 96.782  473.246 1.00 85.65  ?  142 ASP B C   1 
ATOM   1977  O O   . ASP B  2 119 ? 403.449 97.950  473.101 1.00 82.46  ?  142 ASP B O   1 
ATOM   1978  C CB  . ASP B  2 119 ? 406.133 97.113  472.345 1.00 103.59 ?  142 ASP B CB  1 
ATOM   1979  C CG  . ASP B  2 119 ? 406.473 98.569  472.602 1.00 117.62 ?  142 ASP B CG  1 
ATOM   1980  O OD1 . ASP B  2 119 ? 406.709 98.927  473.776 1.00 117.72 -1 142 ASP B OD1 1 
ATOM   1981  O OD2 . ASP B  2 119 ? 406.509 99.354  471.631 1.00 118.02 ?  142 ASP B OD2 1 
ATOM   1982  N N   . GLY B  2 120 ? 402.979 95.753  473.203 1.00 69.26  ?  143 GLY B N   1 
ATOM   1983  C CA  . GLY B  2 120 ? 401.559 95.933  472.985 1.00 71.33  ?  143 GLY B CA  1 
ATOM   1984  C C   . GLY B  2 120 ? 401.148 96.157  471.547 1.00 79.61  ?  143 GLY B C   1 
ATOM   1985  O O   . GLY B  2 120 ? 399.947 96.278  471.276 1.00 80.92  ?  143 GLY B O   1 
ATOM   1986  N N   . LYS B  2 121 ? 402.097 96.219  470.618 1.00 80.01  ?  144 LYS B N   1 
ATOM   1987  C CA  . LYS B  2 121 ? 401.813 96.458  469.214 1.00 73.18  ?  144 LYS B CA  1 
ATOM   1988  C C   . LYS B  2 121 ? 401.935 95.155  468.422 1.00 66.55  ?  144 LYS B C   1 
ATOM   1989  O O   . LYS B  2 121 ? 402.143 94.074  468.976 1.00 66.13  ?  144 LYS B O   1 
ATOM   1990  C CB  . LYS B  2 121 ? 402.742 97.542  468.664 1.00 71.13  ?  144 LYS B CB  1 
ATOM   1991  C CG  . LYS B  2 121 ? 402.381 98.946  469.124 1.00 83.74  ?  144 LYS B CG  1 
ATOM   1992  C CD  . LYS B  2 121 ? 403.117 100.006 468.321 1.00 98.33  ?  144 LYS B CD  1 
ATOM   1993  C CE  . LYS B  2 121 ? 402.385 101.339 468.355 1.00 97.40  ?  144 LYS B CE  1 
ATOM   1994  N NZ  . LYS B  2 121 ? 402.968 102.323 467.397 1.00 86.45  ?  144 LYS B NZ  1 
ATOM   1995  N N   . SER B  2 122 ? 401.793 95.266  467.104 1.00 38.04  ?  145 SER B N   1 
ATOM   1996  C CA  . SER B  2 122 ? 401.852 94.127  466.200 1.00 33.75  ?  145 SER B CA  1 
ATOM   1997  C C   . SER B  2 122 ? 402.816 94.435  465.063 1.00 32.23  ?  145 SER B C   1 
ATOM   1998  O O   . SER B  2 122 ? 403.247 95.575  464.874 1.00 37.25  ?  145 SER B O   1 
ATOM   1999  C CB  . SER B  2 122 ? 400.463 93.776  465.648 1.00 36.25  ?  145 SER B CB  1 
ATOM   2000  O OG  . SER B  2 122 ? 399.910 94.864  464.931 1.00 46.94  ?  145 SER B OG  1 
ATOM   2001  N N   . VAL B  2 123 ? 403.162 93.400  464.304 1.00 21.90  ?  146 VAL B N   1 
ATOM   2002  C CA  . VAL B  2 123 ? 404.175 93.524  463.261 1.00 24.42  ?  146 VAL B CA  1 
ATOM   2003  C C   . VAL B  2 123 ? 403.573 94.225  462.047 1.00 21.21  ?  146 VAL B C   1 
ATOM   2004  O O   . VAL B  2 123 ? 402.575 93.769  461.477 1.00 20.77  ?  146 VAL B O   1 
ATOM   2005  C CB  . VAL B  2 123 ? 404.754 92.150  462.885 1.00 24.31  ?  146 VAL B CB  1 
ATOM   2006  C CG1 . VAL B  2 123 ? 405.565 91.591  464.040 1.00 24.99  ?  146 VAL B CG1 1 
ATOM   2007  C CG2 . VAL B  2 123 ? 403.648 91.173  462.522 1.00 36.68  ?  146 VAL B CG2 1 
ATOM   2008  N N   . LEU B  2 124 ? 404.161 95.360  461.665 1.00 33.49  ?  147 LEU B N   1 
ATOM   2009  C CA  . LEU B  2 124 ? 403.807 95.977  460.392 1.00 33.85  ?  147 LEU B CA  1 
ATOM   2010  C C   . LEU B  2 124 ? 404.563 95.331  459.238 1.00 33.62  ?  147 LEU B C   1 
ATOM   2011  O O   . LEU B  2 124 ? 403.982 95.072  458.178 1.00 36.48  ?  147 LEU B O   1 
ATOM   2012  C CB  . LEU B  2 124 ? 404.081 97.481  460.433 1.00 38.22  ?  147 LEU B CB  1 
ATOM   2013  C CG  . LEU B  2 124 ? 403.055 98.337  461.176 1.00 41.93  ?  147 LEU B CG  1 
ATOM   2014  C CD1 . LEU B  2 124 ? 403.329 99.816  460.944 1.00 37.38  ?  147 LEU B CD1 1 
ATOM   2015  C CD2 . LEU B  2 124 ? 401.642 97.974  460.745 1.00 37.93  ?  147 LEU B CD2 1 
ATOM   2016  N N   . VAL B  2 125 ? 405.856 95.074  459.426 1.00 20.36  ?  148 VAL B N   1 
ATOM   2017  C CA  . VAL B  2 125 ? 406.699 94.420  458.430 1.00 19.99  ?  148 VAL B CA  1 
ATOM   2018  C C   . VAL B  2 125 ? 407.485 93.326  459.134 1.00 20.21  ?  148 VAL B C   1 
ATOM   2019  O O   . VAL B  2 125 ? 408.289 93.614  460.030 1.00 20.72  ?  148 VAL B O   1 
ATOM   2020  C CB  . VAL B  2 125 ? 407.658 95.406  457.742 1.00 20.03  ?  148 VAL B CB  1 
ATOM   2021  C CG1 . VAL B  2 125 ? 408.336 94.744  456.553 1.00 19.56  ?  148 VAL B CG1 1 
ATOM   2022  C CG2 . VAL B  2 125 ? 406.926 96.667  457.319 1.00 19.96  ?  148 VAL B CG2 1 
ATOM   2023  N N   . ASN B  2 126 ? 407.264 92.079  458.730 1.00 32.65  ?  149 ASN B N   1 
ATOM   2024  C CA  . ASN B  2 126 ? 407.975 90.963  459.332 1.00 33.47  ?  149 ASN B CA  1 
ATOM   2025  C C   . ASN B  2 126 ? 409.465 91.055  459.014 1.00 28.92  ?  149 ASN B C   1 
ATOM   2026  O O   . ASN B  2 126 ? 409.885 91.681  458.036 1.00 36.39  ?  149 ASN B O   1 
ATOM   2027  C CB  . ASN B  2 126 ? 407.402 89.635  458.837 1.00 44.35  ?  149 ASN B CB  1 
ATOM   2028  C CG  . ASN B  2 126 ? 407.521 88.523  459.865 1.00 51.48  ?  149 ASN B CG  1 
ATOM   2029  O OD1 . ASN B  2 126 ? 407.813 88.766  461.036 1.00 51.63  ?  149 ASN B OD1 1 
ATOM   2030  N ND2 . ASN B  2 126 ? 407.285 87.291  459.424 1.00 56.31  ?  149 ASN B ND2 1 
ATOM   2031  N N   . GLY B  2 127 ? 410.272 90.424  459.865 1.00 21.56  ?  150 GLY B N   1 
ATOM   2032  C CA  . GLY B  2 127 ? 411.710 90.535  459.753 1.00 26.59  ?  150 GLY B CA  1 
ATOM   2033  C C   . GLY B  2 127 ? 412.323 89.527  458.800 1.00 30.22  ?  150 GLY B C   1 
ATOM   2034  O O   . GLY B  2 127 ? 411.698 88.549  458.394 1.00 33.61  ?  150 GLY B O   1 
ATOM   2035  N N   . THR B  2 128 ? 413.579 89.788  458.445 1.00 34.93  ?  151 THR B N   1 
ATOM   2036  C CA  . THR B  2 128 ? 414.371 88.901  457.603 1.00 32.44  ?  151 THR B CA  1 
ATOM   2037  C C   . THR B  2 128 ? 415.779 88.849  458.182 1.00 33.54  ?  151 THR B C   1 
ATOM   2038  O O   . THR B  2 128 ? 416.044 89.374  459.268 1.00 38.56  ?  151 THR B O   1 
ATOM   2039  C CB  . THR B  2 128 ? 414.378 89.371  456.141 1.00 35.06  ?  151 THR B CB  1 
ATOM   2040  O OG1 . THR B  2 128 ? 414.744 90.755  456.081 1.00 38.01  ?  151 THR B OG1 1 
ATOM   2041  C CG2 . THR B  2 128 ? 413.010 89.176  455.496 1.00 37.38  ?  151 THR B CG2 1 
ATOM   2042  N N   . LYS B  2 129 ? 416.693 88.201  457.456 1.00 42.37  ?  152 LYS B N   1 
ATOM   2043  C CA  . LYS B  2 129 ? 418.083 88.162  457.901 1.00 39.90  ?  152 LYS B CA  1 
ATOM   2044  C C   . LYS B  2 129 ? 418.697 89.555  457.891 1.00 40.26  ?  152 LYS B C   1 
ATOM   2045  O O   . LYS B  2 129 ? 419.454 89.918  458.799 1.00 43.78  ?  152 LYS B O   1 
ATOM   2046  C CB  . LYS B  2 129 ? 418.901 87.221  457.014 1.00 39.72  ?  152 LYS B CB  1 
ATOM   2047  C CG  . LYS B  2 129 ? 418.263 85.868  456.742 1.00 44.83  ?  152 LYS B CG  1 
ATOM   2048  C CD  . LYS B  2 129 ? 417.505 85.866  455.422 1.00 47.30  ?  152 LYS B CD  1 
ATOM   2049  C CE  . LYS B  2 129 ? 417.159 84.453  454.985 1.00 58.06  ?  152 LYS B CE  1 
ATOM   2050  N NZ  . LYS B  2 129 ? 416.417 83.713  456.042 1.00 64.62  ?  152 LYS B NZ  1 
ATOM   2051  N N   . GLU B  2 130 ? 418.378 90.352  456.871 1.00 34.59  ?  153 GLU B N   1 
ATOM   2052  C CA  . GLU B  2 130 ? 419.033 91.640  456.681 1.00 37.11  ?  153 GLU B CA  1 
ATOM   2053  C C   . GLU B  2 130 ? 418.448 92.742  457.558 1.00 36.35  ?  153 GLU B C   1 
ATOM   2054  O O   . GLU B  2 130 ? 419.179 93.652  457.961 1.00 39.97  ?  153 GLU B O   1 
ATOM   2055  C CB  . GLU B  2 130 ? 418.954 92.042  455.208 1.00 43.11  ?  153 GLU B CB  1 
ATOM   2056  C CG  . GLU B  2 130 ? 419.438 90.957  454.257 1.00 44.35  ?  153 GLU B CG  1 
ATOM   2057  C CD  . GLU B  2 130 ? 418.895 91.125  452.853 1.00 50.45  ?  153 GLU B CD  1 
ATOM   2058  O OE1 . GLU B  2 130 ? 419.548 90.653  451.899 1.00 54.81  ?  153 GLU B OE1 1 
ATOM   2059  O OE2 . GLU B  2 130 ? 417.811 91.727  452.704 1.00 54.10  -1 153 GLU B OE2 1 
ATOM   2060  N N   . ARG B  2 131 ? 417.154 92.688  457.867 1.00 26.80  ?  154 ARG B N   1 
ATOM   2061  C CA  . ARG B  2 131 ? 416.476 93.784  458.547 1.00 26.12  ?  154 ARG B CA  1 
ATOM   2062  C C   . ARG B  2 131 ? 415.687 93.260  459.739 1.00 28.93  ?  154 ARG B C   1 
ATOM   2063  O O   . ARG B  2 131 ? 415.473 92.056  459.896 1.00 33.64  ?  154 ARG B O   1 
ATOM   2064  C CB  . ARG B  2 131 ? 415.541 94.544  457.597 1.00 27.98  ?  154 ARG B CB  1 
ATOM   2065  C CG  . ARG B  2 131 ? 414.279 93.786  457.232 1.00 27.82  ?  154 ARG B CG  1 
ATOM   2066  C CD  . ARG B  2 131 ? 413.309 94.672  456.468 1.00 25.75  ?  154 ARG B CD  1 
ATOM   2067  N NE  . ARG B  2 131 ? 412.106 93.946  456.073 1.00 20.84  ?  154 ARG B NE  1 
ATOM   2068  C CZ  . ARG B  2 131 ? 411.973 93.296  454.922 1.00 22.08  ?  154 ARG B CZ  1 
ATOM   2069  N NH1 . ARG B  2 131 ? 412.971 93.282  454.049 1.00 26.30  ?  154 ARG B NH1 1 
ATOM   2070  N NH2 . ARG B  2 131 ? 410.844 92.660  454.643 1.00 22.70  ?  154 ARG B NH2 1 
ATOM   2071  N N   . ASP B  2 132 ? 415.240 94.194  460.576 1.00 43.08  ?  155 ASP B N   1 
ATOM   2072  C CA  . ASP B  2 132 ? 414.560 93.890  461.826 1.00 44.96  ?  155 ASP B CA  1 
ATOM   2073  C C   . ASP B  2 132 ? 413.085 94.257  461.732 1.00 47.35  ?  155 ASP B C   1 
ATOM   2074  O O   . ASP B  2 132 ? 412.692 95.145  460.970 1.00 52.20  ?  155 ASP B O   1 
ATOM   2075  C CB  . ASP B  2 132 ? 415.200 94.640  462.999 1.00 50.26  ?  155 ASP B CB  1 
ATOM   2076  C CG  . ASP B  2 132 ? 414.762 94.104  464.356 1.00 49.98  ?  155 ASP B CG  1 
ATOM   2077  O OD1 . ASP B  2 132 ? 413.725 93.412  464.433 1.00 53.37  ?  155 ASP B OD1 1 
ATOM   2078  O OD2 . ASP B  2 132 ? 415.459 94.380  465.356 1.00 51.73  -1 155 ASP B OD2 1 
ATOM   2079  N N   . VAL B  2 133 ? 412.274 93.546  462.518 1.00 27.95  ?  156 VAL B N   1 
ATOM   2080  C CA  . VAL B  2 133 ? 410.843 93.816  462.579 1.00 22.14  ?  156 VAL B CA  1 
ATOM   2081  C C   . VAL B  2 133 ? 410.604 95.247  463.034 1.00 24.98  ?  156 VAL B C   1 
ATOM   2082  O O   . VAL B  2 133 ? 411.171 95.701  464.036 1.00 39.47  ?  156 VAL B O   1 
ATOM   2083  C CB  . VAL B  2 133 ? 410.158 92.822  463.529 1.00 23.80  ?  156 VAL B CB  1 
ATOM   2084  C CG1 . VAL B  2 133 ? 408.711 93.222  463.755 1.00 31.19  ?  156 VAL B CG1 1 
ATOM   2085  C CG2 . VAL B  2 133 ? 410.252 91.404  462.988 1.00 31.19  ?  156 VAL B CG2 1 
ATOM   2086  N N   . VAL B  2 134 ? 409.761 95.965  462.298 1.00 22.21  ?  157 VAL B N   1 
ATOM   2087  C CA  . VAL B  2 134 ? 409.284 97.280  462.710 1.00 27.96  ?  157 VAL B CA  1 
ATOM   2088  C C   . VAL B  2 134 ? 407.845 97.129  463.190 1.00 29.60  ?  157 VAL B C   1 
ATOM   2089  O O   . VAL B  2 134 ? 406.977 96.649  462.450 1.00 25.69  ?  157 VAL B O   1 
ATOM   2090  C CB  . VAL B  2 134 ? 409.404 98.312  461.576 1.00 29.46  ?  157 VAL B CB  1 
ATOM   2091  C CG1 . VAL B  2 134 ? 408.762 97.805  460.294 1.00 28.13  ?  157 VAL B CG1 1 
ATOM   2092  C CG2 . VAL B  2 134 ? 408.785 99.636  462.000 1.00 36.61  ?  157 VAL B CG2 1 
ATOM   2093  N N   . CYS B  2 135 ? 407.597 97.513  464.438 1.00 43.18  ?  158 CYS B N   1 
ATOM   2094  C CA  . CYS B  2 135 ? 406.287 97.329  465.041 1.00 39.45  ?  158 CYS B CA  1 
ATOM   2095  C C   . CYS B  2 135 ? 405.333 98.433  464.589 1.00 48.48  ?  158 CYS B C   1 
ATOM   2096  O O   . CYS B  2 135 ? 405.670 99.297  463.774 1.00 50.73  ?  158 CYS B O   1 
ATOM   2097  C CB  . CYS B  2 135 ? 406.400 97.295  466.564 1.00 43.21  ?  158 CYS B CB  1 
ATOM   2098  S SG  . CYS B  2 135 ? 407.495 96.015  467.228 1.00 55.42  ?  158 CYS B SG  1 
ATOM   2099  N N   . GLY B  2 136 ? 404.120 98.400  465.133 1.00 63.99  ?  159 GLY B N   1 
ATOM   2100  C CA  . GLY B  2 136 ? 403.105 99.375  464.817 1.00 63.26  ?  159 GLY B CA  1 
ATOM   2101  C C   . GLY B  2 136 ? 401.729 98.884  465.214 1.00 66.25  ?  159 GLY B C   1 
ATOM   2102  O O   . GLY B  2 136 ? 401.544 97.720  465.583 1.00 61.97  ?  159 GLY B O   1 
ATOM   2103  N N   . PRO B  2 137 ? 400.733 99.763  465.152 1.00 59.63  ?  160 PRO B N   1 
ATOM   2104  C CA  . PRO B  2 137 ? 399.364 99.336  465.453 1.00 54.37  ?  160 PRO B CA  1 
ATOM   2105  C C   . PRO B  2 137 ? 398.829 98.409  464.374 1.00 55.71  ?  160 PRO B C   1 
ATOM   2106  O O   . PRO B  2 137 ? 399.239 98.464  463.212 1.00 57.91  ?  160 PRO B O   1 
ATOM   2107  C CB  . PRO B  2 137 ? 398.582 100.653 465.497 1.00 51.14  ?  160 PRO B CB  1 
ATOM   2108  C CG  . PRO B  2 137 ? 399.369 101.580 464.634 1.00 55.49  ?  160 PRO B CG  1 
ATOM   2109  C CD  . PRO B  2 137 ? 400.810 101.198 464.830 1.00 62.55  ?  160 PRO B CD  1 
ATOM   2110  N N   . SER B  2 138 ? 397.901 97.545  464.777 1.00 69.57  ?  161 SER B N   1 
ATOM   2111  C CA  . SER B  2 138 ? 397.288 96.584  463.869 1.00 68.89  ?  161 SER B CA  1 
ATOM   2112  C C   . SER B  2 138 ? 396.382 97.307  462.874 1.00 77.06  ?  161 SER B C   1 
ATOM   2113  O O   . SER B  2 138 ? 396.201 98.527  462.979 1.00 86.21  ?  161 SER B O   1 
ATOM   2114  C CB  . SER B  2 138 ? 396.506 95.540  464.673 1.00 66.67  ?  161 SER B CB  1 
ATOM   2115  O OG  . SER B  2 138 ? 395.470 96.145  465.426 1.00 73.85  ?  161 SER B OG  1 
ATOM   2116  N N   . PRO B  2 139 ? 395.789 96.601  461.898 1.00 63.41  ?  162 PRO B N   1 
ATOM   2117  C CA  . PRO B  2 139 ? 394.820 97.257  461.008 1.00 66.57  ?  162 PRO B CA  1 
ATOM   2118  C C   . PRO B  2 139 ? 393.561 97.688  461.743 1.00 72.10  ?  162 PRO B C   1 
ATOM   2119  O O   . PRO B  2 139 ? 392.514 97.043  461.638 1.00 60.59  ?  162 PRO B O   1 
ATOM   2120  C CB  . PRO B  2 139 ? 394.515 96.178  459.962 1.00 55.48  ?  162 PRO B CB  1 
ATOM   2121  C CG  . PRO B  2 139 ? 395.731 95.337  459.935 1.00 51.92  ?  162 PRO B CG  1 
ATOM   2122  C CD  . PRO B  2 139 ? 396.264 95.324  461.336 1.00 55.68  ?  162 PRO B CD  1 
ATOM   2123  N N   . ALA B  2 140 ? 393.664 98.781  462.498 1.00 67.03  ?  163 ALA B N   1 
ATOM   2124  C CA  . ALA B  2 140 ? 392.550 99.296  463.281 1.00 58.46  ?  163 ALA B CA  1 
ATOM   2125  C C   . ALA B  2 140 ? 391.585 100.144 462.463 1.00 53.71  ?  163 ALA B C   1 
ATOM   2126  O O   . ALA B  2 140 ? 390.585 100.617 463.013 1.00 63.59  ?  163 ALA B O   1 
ATOM   2127  C CB  . ALA B  2 140 ? 393.076 100.115 464.465 1.00 50.54  ?  163 ALA B CB  1 
ATOM   2128  N N   . ASP B  2 141 ? 391.854 100.350 461.178 1.00 50.27  ?  164 ASP B N   1 
ATOM   2129  C CA  . ASP B  2 141 ? 390.957 101.121 460.327 1.00 50.51  ?  164 ASP B CA  1 
ATOM   2130  C C   . ASP B  2 141 ? 390.571 100.327 459.082 1.00 43.53  ?  164 ASP B C   1 
ATOM   2131  O O   . ASP B  2 141 ? 389.739 99.421  459.144 1.00 27.32  ?  164 ASP B O   1 
ATOM   2132  C CB  . ASP B  2 141 ? 391.604 102.449 459.925 1.00 59.36  ?  164 ASP B CB  1 
ATOM   2133  C CG  . ASP B  2 141 ? 391.773 103.393 461.101 1.00 61.37  ?  164 ASP B CG  1 
ATOM   2134  O OD1 . ASP B  2 141 ? 390.905 103.390 461.999 1.00 49.94  ?  164 ASP B OD1 1 
ATOM   2135  O OD2 . ASP B  2 141 ? 392.774 104.141 461.124 1.00 65.40  -1 164 ASP B OD2 1 
ATOM   2136  N N   . GLY C  1 33  ? 475.664 52.545  433.248 1.00 26.72  ?  90  GLY C N   1 
ATOM   2137  C CA  . GLY C  1 33  ? 474.952 53.050  432.089 1.00 27.01  ?  90  GLY C CA  1 
ATOM   2138  C C   . GLY C  1 33  ? 473.800 52.164  431.656 1.00 38.59  ?  90  GLY C C   1 
ATOM   2139  O O   . GLY C  1 33  ? 473.802 51.624  430.549 1.00 47.41  ?  90  GLY C O   1 
ATOM   2140  N N   . MET C  1 34  ? 472.810 52.013  432.535 1.00 46.72  ?  91  MET C N   1 
ATOM   2141  C CA  . MET C  1 34  ? 471.617 51.218  432.257 1.00 41.61  ?  91  MET C CA  1 
ATOM   2142  C C   . MET C  1 34  ? 470.392 52.084  432.507 1.00 43.45  ?  91  MET C C   1 
ATOM   2143  O O   . MET C  1 34  ? 470.103 52.436  433.657 1.00 42.69  ?  91  MET C O   1 
ATOM   2144  C CB  . MET C  1 34  ? 471.579 49.959  433.123 1.00 44.54  ?  91  MET C CB  1 
ATOM   2145  C CG  . MET C  1 34  ? 472.472 48.835  432.628 1.00 56.17  ?  91  MET C CG  1 
ATOM   2146  S SD  . MET C  1 34  ? 471.815 48.044  431.146 1.00 64.04  ?  91  MET C SD  1 
ATOM   2147  C CE  . MET C  1 34  ? 470.349 47.251  431.804 1.00 46.85  ?  91  MET C CE  1 
ATOM   2148  N N   . PHE C  1 35  ? 469.664 52.399  431.438 1.00 34.72  ?  92  PHE C N   1 
ATOM   2149  C CA  . PHE C  1 35  ? 468.460 53.221  431.479 1.00 29.86  ?  92  PHE C CA  1 
ATOM   2150  C C   . PHE C  1 35  ? 467.912 53.323  430.063 1.00 35.31  ?  92  PHE C C   1 
ATOM   2151  O O   . PHE C  1 35  ? 468.622 53.066  429.086 1.00 38.10  ?  92  PHE C O   1 
ATOM   2152  C CB  . PHE C  1 35  ? 468.728 54.625  432.042 1.00 27.89  ?  92  PHE C CB  1 
ATOM   2153  C CG  . PHE C  1 35  ? 469.742 55.415  431.262 1.00 27.38  ?  92  PHE C CG  1 
ATOM   2154  C CD1 . PHE C  1 35  ? 471.098 55.260  431.502 1.00 31.56  ?  92  PHE C CD1 1 
ATOM   2155  C CD2 . PHE C  1 35  ? 469.339 56.325  430.298 1.00 33.29  ?  92  PHE C CD2 1 
ATOM   2156  C CE1 . PHE C  1 35  ? 472.031 55.989  430.790 1.00 34.98  ?  92  PHE C CE1 1 
ATOM   2157  C CE2 . PHE C  1 35  ? 470.269 57.056  429.581 1.00 35.39  ?  92  PHE C CE2 1 
ATOM   2158  C CZ  . PHE C  1 35  ? 471.616 56.889  429.829 1.00 33.07  ?  92  PHE C CZ  1 
ATOM   2159  N N   . ALA C  1 36  ? 466.639 53.700  429.966 1.00 19.60  ?  93  ALA C N   1 
ATOM   2160  C CA  . ALA C  1 36  ? 466.006 53.904  428.671 1.00 14.27  ?  93  ALA C CA  1 
ATOM   2161  C C   . ALA C  1 36  ? 464.804 54.818  428.844 1.00 12.98  ?  93  ALA C C   1 
ATOM   2162  O O   . ALA C  1 36  ? 464.242 54.938  429.936 1.00 14.32  ?  93  ALA C O   1 
ATOM   2163  C CB  . ALA C  1 36  ? 465.584 52.576  428.034 1.00 13.23  ?  93  ALA C CB  1 
ATOM   2164  N N   . GLN C  1 37  ? 464.419 55.463  427.747 1.00 34.09  ?  94  GLN C N   1 
ATOM   2165  C CA  . GLN C  1 37  ? 463.187 56.237  427.697 1.00 32.24  ?  94  GLN C CA  1 
ATOM   2166  C C   . GLN C  1 37  ? 462.624 56.150  426.287 1.00 34.63  ?  94  GLN C C   1 
ATOM   2167  O O   . GLN C  1 37  ? 463.372 56.228  425.309 1.00 36.16  ?  94  GLN C O   1 
ATOM   2168  C CB  . GLN C  1 37  ? 463.421 57.698  428.098 1.00 33.22  ?  94  GLN C CB  1 
ATOM   2169  C CG  . GLN C  1 37  ? 462.157 58.542  428.118 1.00 32.64  ?  94  GLN C CG  1 
ATOM   2170  C CD  . GLN C  1 37  ? 462.392 59.941  428.656 1.00 37.85  ?  94  GLN C CD  1 
ATOM   2171  O OE1 . GLN C  1 37  ? 462.888 60.116  429.768 1.00 33.16  ?  94  GLN C OE1 1 
ATOM   2172  N NE2 . GLN C  1 37  ? 462.032 60.946  427.866 1.00 45.08  ?  94  GLN C NE2 1 
ATOM   2173  N N   . LEU C  1 38  ? 461.307 55.992  426.188 1.00 17.58  ?  95  LEU C N   1 
ATOM   2174  C CA  . LEU C  1 38  ? 460.633 55.869  424.905 1.00 16.80  ?  95  LEU C CA  1 
ATOM   2175  C C   . LEU C  1 38  ? 459.465 56.841  424.845 1.00 21.01  ?  95  LEU C C   1 
ATOM   2176  O O   . LEU C  1 38  ? 458.775 57.059  425.846 1.00 24.01  ?  95  LEU C O   1 
ATOM   2177  C CB  . LEU C  1 38  ? 460.136 54.436  424.669 1.00 18.14  ?  95  LEU C CB  1 
ATOM   2178  C CG  . LEU C  1 38  ? 461.194 53.330  424.637 1.00 13.55  ?  95  LEU C CG  1 
ATOM   2179  C CD1 . LEU C  1 38  ? 460.561 51.995  424.287 1.00 13.08  ?  95  LEU C CD1 1 
ATOM   2180  C CD2 . LEU C  1 38  ? 462.296 53.672  423.650 1.00 20.83  ?  95  LEU C CD2 1 
ATOM   2181  N N   . VAL C  1 39  ? 459.250 57.424  423.668 1.00 16.35  ?  96  VAL C N   1 
ATOM   2182  C CA  . VAL C  1 39  ? 458.154 58.354  423.425 1.00 14.80  ?  96  VAL C CA  1 
ATOM   2183  C C   . VAL C  1 39  ? 457.113 57.650  422.566 1.00 12.73  ?  96  VAL C C   1 
ATOM   2184  O O   . VAL C  1 39  ? 457.452 57.040  421.545 1.00 12.67  ?  96  VAL C O   1 
ATOM   2185  C CB  . VAL C  1 39  ? 458.651 59.646  422.751 1.00 16.89  ?  96  VAL C CB  1 
ATOM   2186  C CG1 . VAL C  1 39  ? 457.476 60.515  422.332 1.00 21.23  ?  96  VAL C CG1 1 
ATOM   2187  C CG2 . VAL C  1 39  ? 459.572 60.408  423.692 1.00 14.26  ?  96  VAL C CG2 1 
ATOM   2188  N N   . ALA C  1 40  ? 455.850 57.735  422.978 1.00 27.86  ?  97  ALA C N   1 
ATOM   2189  C CA  . ALA C  1 40  ? 454.789 56.989  422.314 1.00 27.37  ?  97  ALA C CA  1 
ATOM   2190  C C   . ALA C  1 40  ? 454.490 57.569  420.937 1.00 29.75  ?  97  ALA C C   1 
ATOM   2191  O O   . ALA C  1 40  ? 454.367 58.788  420.775 1.00 29.43  ?  97  ALA C O   1 
ATOM   2192  C CB  . ALA C  1 40  ? 453.525 56.994  423.171 1.00 25.73  ?  97  ALA C CB  1 
ATOM   2193  N N   . GLN C  1 41  ? 454.370 56.685  419.944 1.00 36.88  ?  98  GLN C N   1 
ATOM   2194  C CA  . GLN C  1 41  ? 453.981 57.108  418.604 1.00 33.91  ?  98  GLN C CA  1 
ATOM   2195  C C   . GLN C  1 41  ? 452.498 57.430  418.517 1.00 36.15  ?  98  GLN C C   1 
ATOM   2196  O O   . GLN C  1 41  ? 452.102 58.300  417.734 1.00 39.33  ?  98  GLN C O   1 
ATOM   2197  C CB  . GLN C  1 41  ? 454.321 56.022  417.579 1.00 31.38  ?  98  GLN C CB  1 
ATOM   2198  C CG  . GLN C  1 41  ? 455.795 55.689  417.451 1.00 36.83  ?  98  GLN C CG  1 
ATOM   2199  C CD  . GLN C  1 41  ? 456.047 54.594  416.430 1.00 37.30  ?  98  GLN C CD  1 
ATOM   2200  O OE1 . GLN C  1 41  ? 455.193 54.302  415.593 1.00 32.66  ?  98  GLN C OE1 1 
ATOM   2201  N NE2 . GLN C  1 41  ? 457.224 53.981  416.496 1.00 40.56  ?  98  GLN C NE2 1 
ATOM   2202  N N   . ASN C  1 42  ? 451.671 56.746  419.306 1.00 31.21  ?  99  ASN C N   1 
ATOM   2203  C CA  . ASN C  1 42  ? 450.227 56.849  419.157 1.00 25.94  ?  99  ASN C CA  1 
ATOM   2204  C C   . ASN C  1 42  ? 449.735 58.242  419.521 1.00 27.49  ?  99  ASN C C   1 
ATOM   2205  O O   . ASN C  1 42  ? 450.143 58.819  420.534 1.00 27.37  ?  99  ASN C O   1 
ATOM   2206  C CB  . ASN C  1 42  ? 449.528 55.803  420.023 1.00 20.94  ?  99  ASN C CB  1 
ATOM   2207  C CG  . ASN C  1 42  ? 449.749 54.392  419.521 1.00 27.31  ?  99  ASN C CG  1 
ATOM   2208  O OD1 . ASN C  1 42  ? 450.853 54.031  419.116 1.00 29.71  ?  99  ASN C OD1 1 
ATOM   2209  N ND2 . ASN C  1 42  ? 448.693 53.586  419.537 1.00 32.92  ?  99  ASN C ND2 1 
ATOM   2210  N N   . VAL C  1 43  ? 448.859 58.781  418.679 1.00 20.65  ?  100 VAL C N   1 
ATOM   2211  C CA  . VAL C  1 43  ? 448.167 60.041  418.934 1.00 20.39  ?  100 VAL C CA  1 
ATOM   2212  C C   . VAL C  1 43  ? 446.685 59.802  419.235 1.00 24.20  ?  100 VAL C C   1 
ATOM   2213  O O   . VAL C  1 43  ? 446.189 60.181  420.298 1.00 23.93  ?  100 VAL C O   1 
ATOM   2214  C CB  . VAL C  1 43  ? 448.369 61.042  417.773 1.00 14.34  ?  100 VAL C CB  1 
ATOM   2215  C CG1 . VAL C  1 43  ? 448.003 60.429  416.425 1.00 27.28  ?  100 VAL C CG1 1 
ATOM   2216  C CG2 . VAL C  1 43  ? 447.572 62.313  418.022 1.00 18.45  ?  100 VAL C CG2 1 
ATOM   2217  N N   . LEU C  1 44  ? 445.962 59.179  418.304 1.00 26.61  ?  101 LEU C N   1 
ATOM   2218  C CA  . LEU C  1 44  ? 444.548 58.891  418.483 1.00 20.94  ?  101 LEU C CA  1 
ATOM   2219  C C   . LEU C  1 44  ? 444.326 57.892  419.618 1.00 14.27  ?  101 LEU C C   1 
ATOM   2220  O O   . LEU C  1 44  ? 445.235 57.178  420.051 1.00 14.35  ?  101 LEU C O   1 
ATOM   2221  C CB  . LEU C  1 44  ? 443.942 58.349  417.187 1.00 20.56  ?  101 LEU C CB  1 
ATOM   2222  C CG  . LEU C  1 44  ? 443.657 59.384  416.097 1.00 19.12  ?  101 LEU C CG  1 
ATOM   2223  C CD1 . LEU C  1 44  ? 443.055 58.722  414.870 1.00 17.94  ?  101 LEU C CD1 1 
ATOM   2224  C CD2 . LEU C  1 44  ? 442.738 60.468  416.632 1.00 19.72  ?  101 LEU C CD2 1 
ATOM   2225  N N   . LEU C  1 45  ? 443.084 57.850  420.092 1.00 21.58  ?  102 LEU C N   1 
ATOM   2226  C CA  . LEU C  1 45  ? 442.703 57.161  421.317 1.00 24.19  ?  102 LEU C CA  1 
ATOM   2227  C C   . LEU C  1 45  ? 442.347 55.694  421.099 1.00 25.72  ?  102 LEU C C   1 
ATOM   2228  O O   . LEU C  1 45  ? 441.827 55.059  422.022 1.00 30.65  ?  102 LEU C O   1 
ATOM   2229  C CB  . LEU C  1 45  ? 441.527 57.886  421.977 1.00 22.14  ?  102 LEU C CB  1 
ATOM   2230  C CG  . LEU C  1 45  ? 441.645 58.122  423.483 1.00 22.48  ?  102 LEU C CG  1 
ATOM   2231  C CD1 . LEU C  1 45  ? 442.899 58.922  423.797 1.00 17.27  ?  102 LEU C CD1 1 
ATOM   2232  C CD2 . LEU C  1 45  ? 440.406 58.830  424.012 1.00 23.46  ?  102 LEU C CD2 1 
ATOM   2233  N N   . ILE C  1 46  ? 442.577 55.159  419.896 1.00 42.74  ?  103 ILE C N   1 
ATOM   2234  C CA  . ILE C  1 46  ? 442.214 53.777  419.595 1.00 49.50  ?  103 ILE C CA  1 
ATOM   2235  C C   . ILE C  1 46  ? 442.784 52.833  420.649 1.00 49.08  ?  103 ILE C C   1 
ATOM   2236  O O   . ILE C  1 46  ? 443.939 52.960  421.067 1.00 52.52  ?  103 ILE C O   1 
ATOM   2237  C CB  . ILE C  1 46  ? 442.709 53.396  418.187 1.00 48.71  ?  103 ILE C CB  1 
ATOM   2238  C CG1 . ILE C  1 46  ? 442.256 54.435  417.160 1.00 46.13  ?  103 ILE C CG1 1 
ATOM   2239  C CG2 . ILE C  1 46  ? 442.216 52.009  417.800 1.00 53.18  ?  103 ILE C CG2 1 
ATOM   2240  C CD1 . ILE C  1 46  ? 442.713 54.135  415.747 1.00 47.37  ?  103 ILE C CD1 1 
ATOM   2241  N N   . ASP C  1 47  ? 441.958 51.883  421.084 1.00 30.48  ?  104 ASP C N   1 
ATOM   2242  C CA  . ASP C  1 47  ? 442.381 50.915  422.087 1.00 28.07  ?  104 ASP C CA  1 
ATOM   2243  C C   . ASP C  1 47  ? 443.374 49.922  421.499 1.00 32.02  ?  104 ASP C C   1 
ATOM   2244  O O   . ASP C  1 47  ? 443.207 49.442  420.375 1.00 38.10  ?  104 ASP C O   1 
ATOM   2245  C CB  . ASP C  1 47  ? 441.173 50.165  422.647 1.00 36.88  ?  104 ASP C CB  1 
ATOM   2246  C CG  . ASP C  1 47  ? 440.371 50.998  423.623 1.00 45.08  ?  104 ASP C CG  1 
ATOM   2247  O OD1 . ASP C  1 47  ? 440.968 51.873  424.284 1.00 48.59  ?  104 ASP C OD1 1 
ATOM   2248  O OD2 . ASP C  1 47  ? 439.146 50.775  423.735 1.00 49.86  -1 104 ASP C OD2 1 
ATOM   2249  N N   . GLY C  1 48  ? 444.411 49.612  422.272 1.00 26.27  ?  105 GLY C N   1 
ATOM   2250  C CA  . GLY C  1 48  ? 445.410 48.654  421.864 1.00 29.64  ?  105 GLY C CA  1 
ATOM   2251  C C   . GLY C  1 48  ? 446.777 48.980  422.428 1.00 39.58  ?  105 GLY C C   1 
ATOM   2252  O O   . GLY C  1 48  ? 446.934 49.880  423.259 1.00 41.60  ?  105 GLY C O   1 
ATOM   2253  N N   . PRO C  1 49  ? 447.797 48.246  421.990 1.00 30.11  ?  106 PRO C N   1 
ATOM   2254  C CA  . PRO C  1 49  ? 449.162 48.551  422.426 1.00 24.56  ?  106 PRO C CA  1 
ATOM   2255  C C   . PRO C  1 49  ? 449.666 49.839  421.797 1.00 25.25  ?  106 PRO C C   1 
ATOM   2256  O O   . PRO C  1 49  ? 449.218 50.259  420.728 1.00 27.68  ?  106 PRO C O   1 
ATOM   2257  C CB  . PRO C  1 49  ? 449.974 47.342  421.943 1.00 30.91  ?  106 PRO C CB  1 
ATOM   2258  C CG  . PRO C  1 49  ? 448.957 46.281  421.620 1.00 31.23  ?  106 PRO C CG  1 
ATOM   2259  C CD  . PRO C  1 49  ? 447.740 47.022  421.174 1.00 27.28  ?  106 PRO C CD  1 
ATOM   2260  N N   . LEU C  1 50  ? 450.618 50.469  422.480 1.00 28.80  ?  107 LEU C N   1 
ATOM   2261  C CA  . LEU C  1 50  ? 451.216 51.715  422.022 1.00 30.17  ?  107 LEU C CA  1 
ATOM   2262  C C   . LEU C  1 50  ? 452.553 51.440  421.345 1.00 31.63  ?  107 LEU C C   1 
ATOM   2263  O O   . LEU C  1 50  ? 453.325 50.588  421.792 1.00 33.80  ?  107 LEU C O   1 
ATOM   2264  C CB  . LEU C  1 50  ? 451.422 52.683  423.188 1.00 26.80  ?  107 LEU C CB  1 
ATOM   2265  C CG  . LEU C  1 50  ? 450.183 53.132  423.962 1.00 21.56  ?  107 LEU C CG  1 
ATOM   2266  C CD1 . LEU C  1 50  ? 450.569 54.109  425.063 1.00 20.12  ?  107 LEU C CD1 1 
ATOM   2267  C CD2 . LEU C  1 50  ? 449.163 53.751  423.026 1.00 26.36  ?  107 LEU C CD2 1 
ATOM   2268  N N   . SER C  1 51  ? 452.823 52.171  420.265 1.00 35.63  ?  108 SER C N   1 
ATOM   2269  C CA  . SER C  1 51  ? 454.128 52.124  419.630 1.00 40.47  ?  108 SER C CA  1 
ATOM   2270  C C   . SER C  1 51  ? 455.043 53.163  420.279 1.00 37.23  ?  108 SER C C   1 
ATOM   2271  O O   . SER C  1 51  ? 454.625 53.937  421.143 1.00 36.59  ?  108 SER C O   1 
ATOM   2272  C CB  . SER C  1 51  ? 453.997 52.349  418.125 1.00 43.08  ?  108 SER C CB  1 
ATOM   2273  O OG  . SER C  1 51  ? 453.147 51.377  417.541 1.00 51.22  ?  108 SER C OG  1 
ATOM   2274  N N   . TRP C  1 52  ? 456.307 53.190  419.860 1.00 20.56  ?  109 TRP C N   1 
ATOM   2275  C CA  . TRP C  1 52  ? 457.295 54.024  420.531 1.00 18.87  ?  109 TRP C CA  1 
ATOM   2276  C C   . TRP C  1 52  ? 458.370 54.449  419.543 1.00 20.31  ?  109 TRP C C   1 
ATOM   2277  O O   . TRP C  1 52  ? 458.593 53.802  418.517 1.00 28.26  ?  109 TRP C O   1 
ATOM   2278  C CB  . TRP C  1 52  ? 457.933 53.293  421.722 1.00 28.01  ?  109 TRP C CB  1 
ATOM   2279  C CG  . TRP C  1 52  ? 456.934 52.780  422.718 1.00 27.98  ?  109 TRP C CG  1 
ATOM   2280  C CD1 . TRP C  1 52  ? 456.352 51.545  422.734 1.00 22.69  ?  109 TRP C CD1 1 
ATOM   2281  C CD2 . TRP C  1 52  ? 456.382 53.498  423.828 1.00 22.92  ?  109 TRP C CD2 1 
ATOM   2282  N NE1 . TRP C  1 52  ? 455.479 51.447  423.789 1.00 26.26  ?  109 TRP C NE1 1 
ATOM   2283  C CE2 . TRP C  1 52  ? 455.480 52.632  424.477 1.00 25.75  ?  109 TRP C CE2 1 
ATOM   2284  C CE3 . TRP C  1 52  ? 456.569 54.784  424.341 1.00 17.32  ?  109 TRP C CE3 1 
ATOM   2285  C CZ2 . TRP C  1 52  ? 454.765 53.012  425.610 1.00 22.75  ?  109 TRP C CZ2 1 
ATOM   2286  C CZ3 . TRP C  1 52  ? 455.858 55.161  425.465 1.00 20.17  ?  109 TRP C CZ3 1 
ATOM   2287  C CH2 . TRP C  1 52  ? 454.968 54.278  426.087 1.00 24.20  ?  109 TRP C CH2 1 
ATOM   2288  N N   . TYR C  1 53  ? 459.041 55.553  419.870 1.00 25.21  ?  110 TYR C N   1 
ATOM   2289  C CA  . TYR C  1 53  ? 460.184 56.035  419.100 1.00 27.51  ?  110 TYR C CA  1 
ATOM   2290  C C   . TYR C  1 53  ? 461.456 55.493  419.745 1.00 38.13  ?  110 TYR C C   1 
ATOM   2291  O O   . TYR C  1 53  ? 461.822 55.896  420.855 1.00 37.72  ?  110 TYR C O   1 
ATOM   2292  C CB  . TYR C  1 53  ? 460.194 57.561  419.037 1.00 24.91  ?  110 TYR C CB  1 
ATOM   2293  C CG  . TYR C  1 53  ? 459.066 58.158  418.220 1.00 24.84  ?  110 TYR C CG  1 
ATOM   2294  C CD1 . TYR C  1 53  ? 459.177 58.296  416.842 1.00 24.19  ?  110 TYR C CD1 1 
ATOM   2295  C CD2 . TYR C  1 53  ? 457.895 58.595  418.828 1.00 24.48  ?  110 TYR C CD2 1 
ATOM   2296  C CE1 . TYR C  1 53  ? 458.152 58.845  416.092 1.00 25.12  ?  110 TYR C CE1 1 
ATOM   2297  C CE2 . TYR C  1 53  ? 456.866 59.146  418.085 1.00 22.37  ?  110 TYR C CE2 1 
ATOM   2298  C CZ  . TYR C  1 53  ? 456.999 59.269  416.719 1.00 21.41  ?  110 TYR C CZ  1 
ATOM   2299  O OH  . TYR C  1 53  ? 455.978 59.816  415.978 1.00 18.43  ?  110 TYR C OH  1 
ATOM   2300  N N   . SER C  1 54  ? 462.126 54.581  419.045 1.00 61.54  ?  111 SER C N   1 
ATOM   2301  C CA  . SER C  1 54  ? 463.230 53.795  419.582 1.00 62.91  ?  111 SER C CA  1 
ATOM   2302  C C   . SER C  1 54  ? 464.606 54.368  419.260 1.00 63.62  ?  111 SER C C   1 
ATOM   2303  O O   . SER C  1 54  ? 465.614 53.713  419.544 1.00 64.48  ?  111 SER C O   1 
ATOM   2304  C CB  . SER C  1 54  ? 463.140 52.356  419.072 1.00 69.08  ?  111 SER C CB  1 
ATOM   2305  O OG  . SER C  1 54  ? 462.990 52.325  417.663 1.00 66.15  ?  111 SER C OG  1 
ATOM   2306  N N   . ASP C  1 55  ? 464.682 55.568  418.684 1.00 35.32  ?  112 ASP C N   1 
ATOM   2307  C CA  . ASP C  1 55  ? 465.869 56.031  417.964 1.00 34.73  ?  112 ASP C CA  1 
ATOM   2308  C C   . ASP C  1 55  ? 466.455 57.265  418.636 1.00 26.06  ?  112 ASP C C   1 
ATOM   2309  O O   . ASP C  1 55  ? 465.990 58.390  418.398 1.00 24.93  ?  112 ASP C O   1 
ATOM   2310  C CB  . ASP C  1 55  ? 465.535 56.321  416.501 1.00 36.85  ?  112 ASP C CB  1 
ATOM   2311  C CG  . ASP C  1 55  ? 466.748 56.760  415.698 1.00 36.59  ?  112 ASP C CG  1 
ATOM   2312  O OD1 . ASP C  1 55  ? 467.885 56.434  416.101 1.00 44.02  ?  112 ASP C OD1 1 
ATOM   2313  O OD2 . ASP C  1 55  ? 466.564 57.427  414.657 1.00 22.93  -1 112 ASP C OD2 1 
ATOM   2314  N N   . PRO C  1 56  ? 467.449 57.095  419.511 1.00 34.67  ?  113 PRO C N   1 
ATOM   2315  C CA  . PRO C  1 56  ? 468.143 58.255  420.082 1.00 35.82  ?  113 PRO C CA  1 
ATOM   2316  C C   . PRO C  1 56  ? 468.573 59.229  418.995 1.00 47.18  ?  113 PRO C C   1 
ATOM   2317  O O   . PRO C  1 56  ? 468.997 58.834  417.906 1.00 59.32  ?  113 PRO C O   1 
ATOM   2318  C CB  . PRO C  1 56  ? 469.348 57.630  420.792 1.00 38.40  ?  113 PRO C CB  1 
ATOM   2319  C CG  . PRO C  1 56  ? 468.909 56.246  421.116 1.00 43.03  ?  113 PRO C CG  1 
ATOM   2320  C CD  . PRO C  1 56  ? 468.017 55.821  419.984 1.00 44.86  ?  113 PRO C CD  1 
ATOM   2321  N N   . GLY C  1 57  ? 468.460 60.516  419.303 1.00 27.79  ?  114 GLY C N   1 
ATOM   2322  C CA  . GLY C  1 57  ? 468.452 61.569  418.314 1.00 22.86  ?  114 GLY C CA  1 
ATOM   2323  C C   . GLY C  1 57  ? 467.079 62.164  418.096 1.00 26.21  ?  114 GLY C C   1 
ATOM   2324  O O   . GLY C  1 57  ? 466.975 63.278  417.564 1.00 29.35  ?  114 GLY C O   1 
ATOM   2325  N N   . LEU C  1 58  ? 466.026 61.449  418.487 1.00 25.73  ?  115 LEU C N   1 
ATOM   2326  C CA  . LEU C  1 58  ? 464.711 62.049  418.643 1.00 17.95  ?  115 LEU C CA  1 
ATOM   2327  C C   . LEU C  1 58  ? 464.684 62.914  419.900 1.00 19.04  ?  115 LEU C C   1 
ATOM   2328  O O   . LEU C  1 58  ? 465.544 62.802  420.779 1.00 18.91  ?  115 LEU C O   1 
ATOM   2329  C CB  . LEU C  1 58  ? 463.620 60.980  418.720 1.00 15.86  ?  115 LEU C CB  1 
ATOM   2330  C CG  . LEU C  1 58  ? 462.941 60.540  417.420 1.00 17.01  ?  115 LEU C CG  1 
ATOM   2331  C CD1 . LEU C  1 58  ? 462.366 61.738  416.680 1.00 24.51  ?  115 LEU C CD1 1 
ATOM   2332  C CD2 . LEU C  1 58  ? 463.880 59.756  416.529 1.00 17.35  ?  115 LEU C CD2 1 
ATOM   2333  N N   . ALA C  1 59  ? 463.682 63.792  419.969 1.00 46.43  ?  116 ALA C N   1 
ATOM   2334  C CA  . ALA C  1 59  ? 463.583 64.820  421.003 1.00 49.24  ?  116 ALA C CA  1 
ATOM   2335  C C   . ALA C  1 59  ? 463.839 64.297  422.413 1.00 56.34  ?  116 ALA C C   1 
ATOM   2336  O O   . ALA C  1 59  ? 464.852 64.644  423.030 1.00 62.31  ?  116 ALA C O   1 
ATOM   2337  C CB  . ALA C  1 59  ? 462.206 65.484  420.946 1.00 52.48  ?  116 ALA C CB  1 
ATOM   2338  N N   . GLY C  1 60  ? 462.938 63.469  422.935 1.00 47.41  ?  117 GLY C N   1 
ATOM   2339  C CA  . GLY C  1 60  ? 463.036 63.055  424.323 1.00 44.42  ?  117 GLY C CA  1 
ATOM   2340  C C   . GLY C  1 60  ? 463.487 61.631  424.579 1.00 43.51  ?  117 GLY C C   1 
ATOM   2341  O O   . GLY C  1 60  ? 463.615 61.226  425.738 1.00 45.91  ?  117 GLY C O   1 
ATOM   2342  N N   . VAL C  1 61  ? 463.737 60.859  423.524 1.00 65.15  ?  118 VAL C N   1 
ATOM   2343  C CA  . VAL C  1 61  ? 464.023 59.437  423.688 1.00 62.56  ?  118 VAL C CA  1 
ATOM   2344  C C   . VAL C  1 61  ? 465.460 59.240  424.155 1.00 66.36  ?  118 VAL C C   1 
ATOM   2345  O O   . VAL C  1 61  ? 466.346 60.066  423.903 1.00 68.89  ?  118 VAL C O   1 
ATOM   2346  C CB  . VAL C  1 61  ? 463.747 58.666  422.382 1.00 61.62  ?  118 VAL C CB  1 
ATOM   2347  C CG1 . VAL C  1 61  ? 462.382 59.035  421.822 1.00 66.85  ?  118 VAL C CG1 1 
ATOM   2348  C CG2 . VAL C  1 61  ? 464.838 58.930  421.366 1.00 61.92  ?  118 VAL C CG2 1 
ATOM   2349  N N   . SER C  1 62  ? 465.688 58.131  424.858 1.00 37.58  ?  119 SER C N   1 
ATOM   2350  C CA  . SER C  1 62  ? 467.016 57.743  425.314 1.00 32.59  ?  119 SER C CA  1 
ATOM   2351  C C   . SER C  1 62  ? 467.105 56.225  425.318 1.00 31.51  ?  119 SER C C   1 
ATOM   2352  O O   . SER C  1 62  ? 466.140 55.543  425.671 1.00 26.63  ?  119 SER C O   1 
ATOM   2353  C CB  . SER C  1 62  ? 467.318 58.294  426.712 1.00 23.22  ?  119 SER C CB  1 
ATOM   2354  O OG  . SER C  1 62  ? 467.385 59.709  426.703 1.00 27.90  ?  119 SER C OG  1 
ATOM   2355  N N   . LEU C  1 63  ? 468.265 55.703  424.924 1.00 77.98  ?  120 LEU C N   1 
ATOM   2356  C CA  . LEU C  1 63  ? 468.478 54.264  424.889 1.00 72.74  ?  120 LEU C CA  1 
ATOM   2357  C C   . LEU C  1 63  ? 469.955 53.975  425.114 1.00 76.89  ?  120 LEU C C   1 
ATOM   2358  O O   . LEU C  1 63  ? 470.822 54.751  424.704 1.00 79.82  ?  120 LEU C O   1 
ATOM   2359  C CB  . LEU C  1 63  ? 468.008 53.664  423.558 1.00 69.19  ?  120 LEU C CB  1 
ATOM   2360  C CG  . LEU C  1 63  ? 467.596 52.191  423.556 1.00 67.45  ?  120 LEU C CG  1 
ATOM   2361  C CD1 . LEU C  1 63  ? 466.434 51.962  424.506 1.00 63.19  ?  120 LEU C CD1 1 
ATOM   2362  C CD2 . LEU C  1 63  ? 467.230 51.741  422.150 1.00 70.63  ?  120 LEU C CD2 1 
ATOM   2363  N N   . THR C  1 64  ? 470.229 52.850  425.774 1.00 56.73  ?  121 THR C N   1 
ATOM   2364  C CA  . THR C  1 64  ? 471.590 52.416  426.057 1.00 61.45  ?  121 THR C CA  1 
ATOM   2365  C C   . THR C  1 64  ? 471.689 50.911  425.860 1.00 63.09  ?  121 THR C C   1 
ATOM   2366  O O   . THR C  1 64  ? 470.682 50.212  425.717 1.00 61.64  ?  121 THR C O   1 
ATOM   2367  C CB  . THR C  1 64  ? 472.030 52.782  427.481 1.00 51.52  ?  121 THR C CB  1 
ATOM   2368  O OG1 . THR C  1 64  ? 471.018 52.386  428.416 1.00 50.31  ?  121 THR C OG1 1 
ATOM   2369  C CG2 . THR C  1 64  ? 472.282 54.276  427.603 1.00 62.78  ?  121 THR C CG2 1 
ATOM   2370  N N   . GLY C  1 65  ? 472.926 50.417  425.846 1.00 70.44  ?  122 GLY C N   1 
ATOM   2371  C CA  . GLY C  1 65  ? 473.180 48.993  425.745 1.00 69.79  ?  122 GLY C CA  1 
ATOM   2372  C C   . GLY C  1 65  ? 472.526 48.207  426.862 1.00 69.88  ?  122 GLY C C   1 
ATOM   2373  O O   . GLY C  1 65  ? 472.633 48.577  428.035 1.00 65.91  ?  122 GLY C O   1 
ATOM   2374  N N   . GLY C  1 66  ? 471.844 47.121  426.509 1.00 65.46  ?  123 GLY C N   1 
ATOM   2375  C CA  . GLY C  1 66  ? 471.075 46.347  427.456 1.00 60.86  ?  123 GLY C CA  1 
ATOM   2376  C C   . GLY C  1 66  ? 469.580 46.567  427.379 1.00 63.52  ?  123 GLY C C   1 
ATOM   2377  O O   . GLY C  1 66  ? 468.829 45.858  428.059 1.00 67.39  ?  123 GLY C O   1 
ATOM   2378  N N   . LEU C  1 67  ? 469.131 47.533  426.578 1.00 29.64  ?  124 LEU C N   1 
ATOM   2379  C CA  . LEU C  1 67  ? 467.712 47.796  426.371 1.00 21.43  ?  124 LEU C CA  1 
ATOM   2380  C C   . LEU C  1 67  ? 467.439 47.798  424.876 1.00 21.78  ?  124 LEU C C   1 
ATOM   2381  O O   . LEU C  1 67  ? 468.031 48.590  424.136 1.00 30.92  ?  124 LEU C O   1 
ATOM   2382  C CB  . LEU C  1 67  ? 467.291 49.130  426.995 1.00 14.14  ?  124 LEU C CB  1 
ATOM   2383  C CG  . LEU C  1 67  ? 467.121 49.188  428.516 1.00 13.11  ?  124 LEU C CG  1 
ATOM   2384  C CD1 . LEU C  1 67  ? 466.351 47.976  429.016 1.00 13.24  ?  124 LEU C CD1 1 
ATOM   2385  C CD2 . LEU C  1 67  ? 468.458 49.323  429.231 1.00 20.25  ?  124 LEU C CD2 1 
ATOM   2386  N N   . SER C  1 68  ? 466.547 46.916  424.434 1.00 50.71  ?  125 SER C N   1 
ATOM   2387  C CA  . SER C  1 68  ? 466.182 46.804  423.030 1.00 58.79  ?  125 SER C CA  1 
ATOM   2388  C C   . SER C  1 68  ? 464.678 46.979  422.878 1.00 59.11  ?  125 SER C C   1 
ATOM   2389  O O   . SER C  1 68  ? 463.901 46.486  423.701 1.00 58.38  ?  125 SER C O   1 
ATOM   2390  C CB  . SER C  1 68  ? 466.610 45.450  422.455 1.00 63.83  ?  125 SER C CB  1 
ATOM   2391  O OG  . SER C  1 68  ? 467.957 45.160  422.782 1.00 69.93  ?  125 SER C OG  1 
ATOM   2392  N N   . TYR C  1 69  ? 464.274 47.687  421.828 1.00 34.76  ?  126 TYR C N   1 
ATOM   2393  C CA  . TYR C  1 69  ? 462.867 47.872  421.496 1.00 36.01  ?  126 TYR C CA  1 
ATOM   2394  C C   . TYR C  1 69  ? 462.532 46.996  420.298 1.00 43.03  ?  126 TYR C C   1 
ATOM   2395  O O   . TYR C  1 69  ? 463.161 47.120  419.240 1.00 45.06  ?  126 TYR C O   1 
ATOM   2396  C CB  . TYR C  1 69  ? 462.555 49.337  421.194 1.00 33.76  ?  126 TYR C CB  1 
ATOM   2397  C CG  . TYR C  1 69  ? 461.120 49.575  420.775 1.00 36.11  ?  126 TYR C CG  1 
ATOM   2398  C CD1 . TYR C  1 69  ? 460.084 49.494  421.695 1.00 32.30  ?  126 TYR C CD1 1 
ATOM   2399  C CD2 . TYR C  1 69  ? 460.801 49.874  419.456 1.00 37.88  ?  126 TYR C CD2 1 
ATOM   2400  C CE1 . TYR C  1 69  ? 458.773 49.709  421.316 1.00 33.22  ?  126 TYR C CE1 1 
ATOM   2401  C CE2 . TYR C  1 69  ? 459.494 50.092  419.068 1.00 34.31  ?  126 TYR C CE2 1 
ATOM   2402  C CZ  . TYR C  1 69  ? 458.484 50.008  420.001 1.00 34.55  ?  126 TYR C CZ  1 
ATOM   2403  O OH  . TYR C  1 69  ? 457.180 50.223  419.617 1.00 36.95  ?  126 TYR C OH  1 
ATOM   2404  N N   . LYS C  1 70  ? 461.547 46.117  420.462 1.00 42.55  ?  127 LYS C N   1 
ATOM   2405  C CA  . LYS C  1 70  ? 461.088 45.263  419.373 1.00 40.85  ?  127 LYS C CA  1 
ATOM   2406  C C   . LYS C  1 70  ? 459.912 45.956  418.697 1.00 47.19  ?  127 LYS C C   1 
ATOM   2407  O O   . LYS C  1 70  ? 458.826 46.063  419.278 1.00 52.87  ?  127 LYS C O   1 
ATOM   2408  C CB  . LYS C  1 70  ? 460.698 43.881  419.892 1.00 36.88  ?  127 LYS C CB  1 
ATOM   2409  C CG  . LYS C  1 70  ? 461.786 42.820  419.746 1.00 47.31  ?  127 LYS C CG  1 
ATOM   2410  C CD  . LYS C  1 70  ? 463.166 43.373  420.076 1.00 54.29  ?  127 LYS C CD  1 
ATOM   2411  C CE  . LYS C  1 70  ? 464.175 42.260  420.308 1.00 57.35  ?  127 LYS C CE  1 
ATOM   2412  N NZ  . LYS C  1 70  ? 465.550 42.796  420.519 1.00 46.37  ?  127 LYS C NZ  1 
ATOM   2413  N N   . GLU C  1 71  ? 460.126 46.420  417.466 1.00 73.43  ?  128 GLU C N   1 
ATOM   2414  C CA  . GLU C  1 71  ? 459.094 47.167  416.758 1.00 79.29  ?  128 GLU C CA  1 
ATOM   2415  C C   . GLU C  1 71  ? 457.930 46.280  416.339 1.00 86.87  ?  128 GLU C C   1 
ATOM   2416  O O   . GLU C  1 71  ? 456.818 46.784  416.145 1.00 84.33  ?  128 GLU C O   1 
ATOM   2417  C CB  . GLU C  1 71  ? 459.705 47.860  415.536 1.00 81.51  ?  128 GLU C CB  1 
ATOM   2418  C CG  . GLU C  1 71  ? 458.795 48.865  414.840 1.00 93.50  ?  128 GLU C CG  1 
ATOM   2419  C CD  . GLU C  1 71  ? 458.553 50.114  415.668 1.00 93.84  ?  128 GLU C CD  1 
ATOM   2420  O OE1 . GLU C  1 71  ? 457.657 50.090  416.540 1.00 88.70  ?  128 GLU C OE1 1 
ATOM   2421  O OE2 . GLU C  1 71  ? 459.259 51.122  415.449 1.00 86.46  -1 128 GLU C OE2 1 
ATOM   2422  N N   . ASP C  1 72  ? 458.156 44.971  416.211 1.00 100.46 ?  129 ASP C N   1 
ATOM   2423  C CA  . ASP C  1 72  ? 457.090 44.068  415.792 1.00 94.34  ?  129 ASP C CA  1 
ATOM   2424  C C   . ASP C  1 72  ? 456.044 43.905  416.888 1.00 85.80  ?  129 ASP C C   1 
ATOM   2425  O O   . ASP C  1 72  ? 454.841 44.044  416.639 1.00 81.41  ?  129 ASP C O   1 
ATOM   2426  C CB  . ASP C  1 72  ? 457.681 42.715  415.401 1.00 94.46  ?  129 ASP C CB  1 
ATOM   2427  C CG  . ASP C  1 72  ? 458.967 42.848  414.608 1.00 106.37 ?  129 ASP C CG  1 
ATOM   2428  O OD1 . ASP C  1 72  ? 458.890 43.056  413.379 1.00 114.64 ?  129 ASP C OD1 1 
ATOM   2429  O OD2 . ASP C  1 72  ? 460.055 42.752  415.215 1.00 98.43  -1 129 ASP C OD2 1 
ATOM   2430  N N   . THR C  1 73  ? 456.484 43.608  418.109 1.00 65.06  ?  130 THR C N   1 
ATOM   2431  C CA  . THR C  1 73  ? 455.586 43.396  419.237 1.00 66.59  ?  130 THR C CA  1 
ATOM   2432  C C   . THR C  1 73  ? 455.388 44.643  420.091 1.00 67.66  ?  130 THR C C   1 
ATOM   2433  O O   . THR C  1 73  ? 454.605 44.600  421.045 1.00 72.34  ?  130 THR C O   1 
ATOM   2434  C CB  . THR C  1 73  ? 456.100 42.247  420.110 1.00 61.89  ?  130 THR C CB  1 
ATOM   2435  O OG1 . THR C  1 73  ? 457.510 42.401  420.323 1.00 70.77  ?  130 THR C OG1 1 
ATOM   2436  C CG2 . THR C  1 73  ? 455.839 40.908  419.438 1.00 60.69  ?  130 THR C CG2 1 
ATOM   2437  N N   . LYS C  1 74  ? 456.073 45.745  419.773 1.00 58.07  ?  131 LYS C N   1 
ATOM   2438  C CA  . LYS C  1 74  ? 455.906 47.022  420.475 1.00 58.08  ?  131 LYS C CA  1 
ATOM   2439  C C   . LYS C  1 74  ? 456.148 46.881  421.977 1.00 53.68  ?  131 LYS C C   1 
ATOM   2440  O O   . LYS C  1 74  ? 455.401 47.419  422.798 1.00 55.02  ?  131 LYS C O   1 
ATOM   2441  C CB  . LYS C  1 74  ? 454.526 47.628  420.204 1.00 57.18  ?  131 LYS C CB  1 
ATOM   2442  C CG  . LYS C  1 74  ? 454.323 48.109  418.776 1.00 56.55  ?  131 LYS C CG  1 
ATOM   2443  C CD  . LYS C  1 74  ? 453.426 47.167  417.993 1.00 55.10  ?  131 LYS C CD  1 
ATOM   2444  C CE  . LYS C  1 74  ? 452.026 47.125  418.580 1.00 48.83  ?  131 LYS C CE  1 
ATOM   2445  N NZ  . LYS C  1 74  ? 451.105 46.297  417.752 1.00 48.30  ?  131 LYS C NZ  1 
ATOM   2446  N N   . GLU C  1 75  ? 457.199 46.150  422.343 1.00 48.19  ?  132 GLU C N   1 
ATOM   2447  C CA  . GLU C  1 75  ? 457.572 45.970  423.741 1.00 52.07  ?  132 GLU C CA  1 
ATOM   2448  C C   . GLU C  1 75  ? 459.084 46.072  423.863 1.00 45.67  ?  132 GLU C C   1 
ATOM   2449  O O   . GLU C  1 75  ? 459.811 45.353  423.172 1.00 51.23  ?  132 GLU C O   1 
ATOM   2450  C CB  . GLU C  1 75  ? 457.069 44.623  424.276 1.00 54.72  ?  132 GLU C CB  1 
ATOM   2451  C CG  . GLU C  1 75  ? 457.255 43.467  423.306 1.00 58.57  ?  132 GLU C CG  1 
ATOM   2452  C CD  . GLU C  1 75  ? 456.536 42.207  423.743 1.00 63.57  ?  132 GLU C CD  1 
ATOM   2453  O OE1 . GLU C  1 75  ? 457.171 41.131  423.758 1.00 59.32  ?  132 GLU C OE1 1 
ATOM   2454  O OE2 . GLU C  1 75  ? 455.334 42.291  424.071 1.00 75.62  -1 132 GLU C OE2 1 
ATOM   2455  N N   . LEU C  1 76  ? 459.558 46.964  424.729 1.00 26.76  ?  133 LEU C N   1 
ATOM   2456  C CA  . LEU C  1 76  ? 460.990 47.098  424.950 1.00 38.18  ?  133 LEU C CA  1 
ATOM   2457  C C   . LEU C  1 76  ? 461.493 45.947  425.815 1.00 41.67  ?  133 LEU C C   1 
ATOM   2458  O O   . LEU C  1 76  ? 460.818 45.512  426.753 1.00 46.30  ?  133 LEU C O   1 
ATOM   2459  C CB  . LEU C  1 76  ? 461.327 48.443  425.598 1.00 26.81  ?  133 LEU C CB  1 
ATOM   2460  C CG  . LEU C  1 76  ? 461.130 48.645  427.102 1.00 22.59  ?  133 LEU C CG  1 
ATOM   2461  C CD1 . LEU C  1 76  ? 461.914 49.857  427.575 1.00 12.76  ?  133 LEU C CD1 1 
ATOM   2462  C CD2 . LEU C  1 76  ? 459.657 48.805  427.433 1.00 38.28  ?  133 LEU C CD2 1 
ATOM   2463  N N   . VAL C  1 77  ? 462.682 45.448  425.484 1.00 54.65  ?  134 VAL C N   1 
ATOM   2464  C CA  . VAL C  1 77  ? 463.237 44.247  426.095 1.00 55.52  ?  134 VAL C CA  1 
ATOM   2465  C C   . VAL C  1 77  ? 464.373 44.646  427.024 1.00 64.09  ?  134 VAL C C   1 
ATOM   2466  O O   . VAL C  1 77  ? 465.272 45.402  426.631 1.00 65.51  ?  134 VAL C O   1 
ATOM   2467  C CB  . VAL C  1 77  ? 463.727 43.251  425.029 1.00 58.68  ?  134 VAL C CB  1 
ATOM   2468  C CG1 . VAL C  1 77  ? 464.233 41.977  425.687 1.00 58.51  ?  134 VAL C CG1 1 
ATOM   2469  C CG2 . VAL C  1 77  ? 462.614 42.946  424.038 1.00 64.79  ?  134 VAL C CG2 1 
ATOM   2470  N N   . VAL C  1 78  ? 464.335 44.133  428.251 1.00 41.31  ?  135 VAL C N   1 
ATOM   2471  C CA  . VAL C  1 78  ? 465.390 44.343  429.235 1.00 36.99  ?  135 VAL C CA  1 
ATOM   2472  C C   . VAL C  1 78  ? 466.291 43.115  429.226 1.00 34.28  ?  135 VAL C C   1 
ATOM   2473  O O   . VAL C  1 78  ? 465.821 41.992  429.441 1.00 35.06  ?  135 VAL C O   1 
ATOM   2474  C CB  . VAL C  1 78  ? 464.811 44.594  430.635 1.00 29.12  ?  135 VAL C CB  1 
ATOM   2475  C CG1 . VAL C  1 78  ? 465.930 44.826  431.638 1.00 35.15  ?  135 VAL C CG1 1 
ATOM   2476  C CG2 . VAL C  1 78  ? 463.857 45.777  430.609 1.00 23.50  ?  135 VAL C CG2 1 
ATOM   2477  N N   . ALA C  1 79  ? 467.584 43.325  428.980 1.00 36.50  ?  136 ALA C N   1 
ATOM   2478  C CA  . ALA C  1 79  ? 468.517 42.203  428.886 1.00 42.75  ?  136 ALA C CA  1 
ATOM   2479  C C   . ALA C  1 79  ? 468.975 41.748  430.269 1.00 41.20  ?  136 ALA C C   1 
ATOM   2480  O O   . ALA C  1 79  ? 468.577 40.683  430.751 1.00 44.05  ?  136 ALA C O   1 
ATOM   2481  C CB  . ALA C  1 79  ? 469.714 42.588  428.010 1.00 46.17  ?  136 ALA C CB  1 
ATOM   2482  N N   . LYS C  1 80  ? 469.812 42.550  430.923 1.00 62.84  ?  137 LYS C N   1 
ATOM   2483  C CA  . LYS C  1 80  ? 470.311 42.206  432.247 1.00 60.01  ?  137 LYS C CA  1 
ATOM   2484  C C   . LYS C  1 80  ? 469.225 42.440  433.286 1.00 57.67  ?  137 LYS C C   1 
ATOM   2485  O O   . LYS C  1 80  ? 468.583 43.495  433.301 1.00 65.44  ?  137 LYS C O   1 
ATOM   2486  C CB  . LYS C  1 80  ? 471.556 43.027  432.578 1.00 64.20  ?  137 LYS C CB  1 
ATOM   2487  C CG  . LYS C  1 80  ? 472.748 42.724  431.681 1.00 68.83  ?  137 LYS C CG  1 
ATOM   2488  C CD  . LYS C  1 80  ? 473.258 41.309  431.906 1.00 67.24  ?  137 LYS C CD  1 
ATOM   2489  C CE  . LYS C  1 80  ? 473.437 40.567  430.591 1.00 76.06  ?  137 LYS C CE  1 
ATOM   2490  N NZ  . LYS C  1 80  ? 474.330 41.298  429.652 1.00 92.05  ?  137 LYS C NZ  1 
ATOM   2491  N N   . ALA C  1 81  ? 469.019 41.454  434.156 1.00 34.09  ?  138 ALA C N   1 
ATOM   2492  C CA  . ALA C  1 81  ? 467.967 41.539  435.157 1.00 30.23  ?  138 ALA C CA  1 
ATOM   2493  C C   . ALA C  1 81  ? 468.372 42.498  436.274 1.00 26.11  ?  138 ALA C C   1 
ATOM   2494  O O   . ALA C  1 81  ? 469.479 43.044  436.301 1.00 28.35  ?  138 ALA C O   1 
ATOM   2495  C CB  . ALA C  1 81  ? 467.651 40.152  435.710 1.00 23.58  ?  138 ALA C CB  1 
ATOM   2496  N N   . GLY C  1 82  ? 467.461 42.702  437.211 1.00 28.48  ?  139 GLY C N   1 
ATOM   2497  C CA  . GLY C  1 82  ? 467.695 43.590  438.329 1.00 35.23  ?  139 GLY C CA  1 
ATOM   2498  C C   . GLY C  1 82  ? 466.400 44.253  438.755 1.00 30.16  ?  139 GLY C C   1 
ATOM   2499  O O   . GLY C  1 82  ? 465.314 43.828  438.373 1.00 34.61  ?  139 GLY C O   1 
ATOM   2500  N N   . VAL C  1 83  ? 466.544 45.306  439.555 1.00 14.36  ?  140 VAL C N   1 
ATOM   2501  C CA  . VAL C  1 83  ? 465.419 46.103  440.031 1.00 14.19  ?  140 VAL C CA  1 
ATOM   2502  C C   . VAL C  1 83  ? 465.525 47.485  439.405 1.00 13.95  ?  140 VAL C C   1 
ATOM   2503  O O   . VAL C  1 83  ? 466.547 48.166  439.554 1.00 18.52  ?  140 VAL C O   1 
ATOM   2504  C CB  . VAL C  1 83  ? 465.389 46.191  441.565 1.00 22.82  ?  140 VAL C CB  1 
ATOM   2505  C CG1 . VAL C  1 83  ? 464.385 47.242  442.016 1.00 25.51  ?  140 VAL C CG1 1 
ATOM   2506  C CG2 . VAL C  1 83  ? 465.052 44.835  442.165 1.00 23.01  ?  140 VAL C CG2 1 
ATOM   2507  N N   . TYR C  1 84  ? 464.468 47.902  438.714 1.00 39.29  ?  141 TYR C N   1 
ATOM   2508  C CA  . TYR C  1 84  ? 464.443 49.165  437.998 1.00 37.91  ?  141 TYR C CA  1 
ATOM   2509  C C   . TYR C  1 84  ? 463.343 50.061  438.552 1.00 38.16  ?  141 TYR C C   1 
ATOM   2510  O O   . TYR C  1 84  ? 462.392 49.596  439.186 1.00 38.36  ?  141 TYR C O   1 
ATOM   2511  C CB  . TYR C  1 84  ? 464.213 48.947  436.495 1.00 39.31  ?  141 TYR C CB  1 
ATOM   2512  C CG  . TYR C  1 84  ? 465.258 48.093  435.812 1.00 44.83  ?  141 TYR C CG  1 
ATOM   2513  C CD1 . TYR C  1 84  ? 465.137 46.711  435.774 1.00 46.85  ?  141 TYR C CD1 1 
ATOM   2514  C CD2 . TYR C  1 84  ? 466.354 48.672  435.188 1.00 46.35  ?  141 TYR C CD2 1 
ATOM   2515  C CE1 . TYR C  1 84  ? 466.087 45.928  435.142 1.00 50.93  ?  141 TYR C CE1 1 
ATOM   2516  C CE2 . TYR C  1 84  ? 467.308 47.898  434.556 1.00 45.15  ?  141 TYR C CE2 1 
ATOM   2517  C CZ  . TYR C  1 84  ? 467.170 46.528  434.535 1.00 47.34  ?  141 TYR C CZ  1 
ATOM   2518  O OH  . TYR C  1 84  ? 468.120 45.758  433.904 1.00 50.90  ?  141 TYR C OH  1 
ATOM   2519  N N   . TYR C  1 85  ? 463.487 51.362  438.308 1.00 31.86  ?  142 TYR C N   1 
ATOM   2520  C CA  . TYR C  1 85  ? 462.440 52.334  438.598 1.00 31.37  ?  142 TYR C CA  1 
ATOM   2521  C C   . TYR C  1 85  ? 461.777 52.706  437.277 1.00 32.01  ?  142 TYR C C   1 
ATOM   2522  O O   . TYR C  1 85  ? 462.386 53.376  436.436 1.00 33.71  ?  142 TYR C O   1 
ATOM   2523  C CB  . TYR C  1 85  ? 463.004 53.565  439.302 1.00 31.86  ?  142 TYR C CB  1 
ATOM   2524  C CG  . TYR C  1 85  ? 461.964 54.621  439.616 1.00 35.36  ?  142 TYR C CG  1 
ATOM   2525  C CD1 . TYR C  1 85  ? 461.098 54.474  440.692 1.00 36.28  ?  142 TYR C CD1 1 
ATOM   2526  C CD2 . TYR C  1 85  ? 461.848 55.763  438.836 1.00 31.65  ?  142 TYR C CD2 1 
ATOM   2527  C CE1 . TYR C  1 85  ? 460.146 55.436  440.980 1.00 32.13  ?  142 TYR C CE1 1 
ATOM   2528  C CE2 . TYR C  1 85  ? 460.902 56.730  439.117 1.00 31.50  ?  142 TYR C CE2 1 
ATOM   2529  C CZ  . TYR C  1 85  ? 460.054 56.562  440.189 1.00 31.91  ?  142 TYR C CZ  1 
ATOM   2530  O OH  . TYR C  1 85  ? 459.111 57.523  440.470 1.00 35.29  ?  142 TYR C OH  1 
ATOM   2531  N N   . VAL C  1 86  ? 460.536 52.267  437.097 1.00 12.81  ?  143 VAL C N   1 
ATOM   2532  C CA  . VAL C  1 86  ? 459.767 52.511  435.884 1.00 12.65  ?  143 VAL C CA  1 
ATOM   2533  C C   . VAL C  1 86  ? 458.689 53.533  436.203 1.00 12.49  ?  143 VAL C C   1 
ATOM   2534  O O   . VAL C  1 86  ? 458.022 53.433  437.238 1.00 22.84  ?  143 VAL C O   1 
ATOM   2535  C CB  . VAL C  1 86  ? 459.145 51.207  435.347 1.00 12.72  ?  143 VAL C CB  1 
ATOM   2536  C CG1 . VAL C  1 86  ? 458.535 51.434  433.976 1.00 19.79  ?  143 VAL C CG1 1 
ATOM   2537  C CG2 . VAL C  1 86  ? 460.186 50.102  435.304 1.00 12.92  ?  143 VAL C CG2 1 
ATOM   2538  N N   . PHE C  1 87  ? 458.513 54.515  435.319 1.00 21.20  ?  144 PHE C N   1 
ATOM   2539  C CA  . PHE C  1 87  ? 457.528 55.561  435.544 1.00 25.57  ?  144 PHE C CA  1 
ATOM   2540  C C   . PHE C  1 87  ? 456.687 55.794  434.296 1.00 25.56  ?  144 PHE C C   1 
ATOM   2541  O O   . PHE C  1 87  ? 457.186 55.720  433.169 1.00 23.54  ?  144 PHE C O   1 
ATOM   2542  C CB  . PHE C  1 87  ? 458.188 56.875  435.995 1.00 24.74  ?  144 PHE C CB  1 
ATOM   2543  C CG  . PHE C  1 87  ? 459.222 57.407  435.044 1.00 25.21  ?  144 PHE C CG  1 
ATOM   2544  C CD1 . PHE C  1 87  ? 460.549 57.026  435.159 1.00 28.16  ?  144 PHE C CD1 1 
ATOM   2545  C CD2 . PHE C  1 87  ? 458.873 58.311  434.055 1.00 27.33  ?  144 PHE C CD2 1 
ATOM   2546  C CE1 . PHE C  1 87  ? 461.504 57.525  434.296 1.00 24.76  ?  144 PHE C CE1 1 
ATOM   2547  C CE2 . PHE C  1 87  ? 459.824 58.811  433.186 1.00 24.69  ?  144 PHE C CE2 1 
ATOM   2548  C CZ  . PHE C  1 87  ? 461.142 58.422  433.310 1.00 25.53  ?  144 PHE C CZ  1 
ATOM   2549  N N   . PHE C  1 88  ? 455.404 56.073  434.517 1.00 32.68  ?  145 PHE C N   1 
ATOM   2550  C CA  . PHE C  1 88  ? 454.423 56.313  433.469 1.00 30.54  ?  145 PHE C CA  1 
ATOM   2551  C C   . PHE C  1 88  ? 454.214 57.807  433.261 1.00 36.72  ?  145 PHE C C   1 
ATOM   2552  O O   . PHE C  1 88  ? 454.257 58.596  434.209 1.00 43.35  ?  145 PHE C O   1 
ATOM   2553  C CB  . PHE C  1 88  ? 453.076 55.676  433.815 1.00 34.27  ?  145 PHE C CB  1 
ATOM   2554  C CG  . PHE C  1 88  ? 452.806 54.388  433.107 1.00 29.18  ?  145 PHE C CG  1 
ATOM   2555  C CD1 . PHE C  1 88  ? 452.910 54.303  431.732 1.00 39.32  ?  145 PHE C CD1 1 
ATOM   2556  C CD2 . PHE C  1 88  ? 452.393 53.272  433.810 1.00 30.52  ?  145 PHE C CD2 1 
ATOM   2557  C CE1 . PHE C  1 88  ? 452.645 53.118  431.074 1.00 49.79  ?  145 PHE C CE1 1 
ATOM   2558  C CE2 . PHE C  1 88  ? 452.126 52.085  433.158 1.00 38.27  ?  145 PHE C CE2 1 
ATOM   2559  C CZ  . PHE C  1 88  ? 452.250 52.008  431.789 1.00 47.52  ?  145 PHE C CZ  1 
ATOM   2560  N N   . GLN C  1 89  ? 453.972 58.189  432.010 1.00 39.73  ?  146 GLN C N   1 
ATOM   2561  C CA  . GLN C  1 89  ? 453.586 59.555  431.684 1.00 41.55  ?  146 GLN C CA  1 
ATOM   2562  C C   . GLN C  1 89  ? 452.479 59.531  430.645 1.00 41.71  ?  146 GLN C C   1 
ATOM   2563  O O   . GLN C  1 89  ? 452.623 58.899  429.593 1.00 45.28  ?  146 GLN C O   1 
ATOM   2564  C CB  . GLN C  1 89  ? 454.776 60.365  431.165 1.00 44.46  ?  146 GLN C CB  1 
ATOM   2565  C CG  . GLN C  1 89  ? 455.468 61.184  432.234 1.00 44.38  ?  146 GLN C CG  1 
ATOM   2566  C CD  . GLN C  1 89  ? 456.591 62.022  431.673 1.00 53.42  ?  146 GLN C CD  1 
ATOM   2567  O OE1 . GLN C  1 89  ? 457.725 61.561  431.556 1.00 53.19  ?  146 GLN C OE1 1 
ATOM   2568  N NE2 . GLN C  1 89  ? 456.282 63.264  431.316 1.00 57.11  ?  146 GLN C NE2 1 
ATOM   2569  N N   . LEU C  1 90  ? 451.380 60.220  430.943 1.00 47.80  ?  147 LEU C N   1 
ATOM   2570  C CA  . LEU C  1 90  ? 450.257 60.328  430.024 1.00 50.81  ?  147 LEU C CA  1 
ATOM   2571  C C   . LEU C  1 90  ? 449.721 61.749  430.068 1.00 53.53  ?  147 LEU C C   1 
ATOM   2572  O O   . LEU C  1 90  ? 449.450 62.278  431.150 1.00 57.23  ?  147 LEU C O   1 
ATOM   2573  C CB  . LEU C  1 90  ? 449.151 59.328  430.378 1.00 46.64  ?  147 LEU C CB  1 
ATOM   2574  C CG  . LEU C  1 90  ? 447.966 59.270  429.412 1.00 45.88  ?  147 LEU C CG  1 
ATOM   2575  C CD1 . LEU C  1 90  ? 448.431 58.910  428.011 1.00 46.43  ?  147 LEU C CD1 1 
ATOM   2576  C CD2 . LEU C  1 90  ? 446.916 58.285  429.900 1.00 48.05  ?  147 LEU C CD2 1 
ATOM   2577  N N   . GLU C  1 91  ? 449.577 62.365  428.897 1.00 52.23  ?  148 GLU C N   1 
ATOM   2578  C CA  . GLU C  1 91  ? 449.010 63.703  428.792 1.00 48.34  ?  148 GLU C CA  1 
ATOM   2579  C C   . GLU C  1 91  ? 448.076 63.749  427.594 1.00 45.85  ?  148 GLU C C   1 
ATOM   2580  O O   . GLU C  1 91  ? 448.441 63.306  426.502 1.00 41.81  ?  148 GLU C O   1 
ATOM   2581  C CB  . GLU C  1 91  ? 450.103 64.771  428.658 1.00 50.49  ?  148 GLU C CB  1 
ATOM   2582  C CG  . GLU C  1 91  ? 449.581 66.197  428.771 1.00 57.74  ?  148 GLU C CG  1 
ATOM   2583  C CD  . GLU C  1 91  ? 450.686 67.236  428.781 1.00 66.49  ?  148 GLU C CD  1 
ATOM   2584  O OE1 . GLU C  1 91  ? 451.308 67.457  427.721 1.00 70.00  ?  148 GLU C OE1 1 
ATOM   2585  O OE2 . GLU C  1 91  ? 450.933 67.833  429.851 1.00 69.13  -1 148 GLU C OE2 1 
ATOM   2586  N N   . LEU C  1 92  ? 446.876 64.285  427.803 1.00 34.39  ?  149 LEU C N   1 
ATOM   2587  C CA  . LEU C  1 92  ? 445.863 64.372  426.760 1.00 32.95  ?  149 LEU C CA  1 
ATOM   2588  C C   . LEU C  1 92  ? 445.387 65.809  426.640 1.00 35.06  ?  149 LEU C C   1 
ATOM   2589  O O   . LEU C  1 92  ? 445.042 66.439  427.647 1.00 38.18  ?  149 LEU C O   1 
ATOM   2590  C CB  . LEU C  1 92  ? 444.671 63.454  427.051 1.00 25.68  ?  149 LEU C CB  1 
ATOM   2591  C CG  . LEU C  1 92  ? 444.925 61.951  427.170 1.00 23.08  ?  149 LEU C CG  1 
ATOM   2592  C CD1 . LEU C  1 92  ? 445.290 61.575  428.596 1.00 26.75  ?  149 LEU C CD1 1 
ATOM   2593  C CD2 . LEU C  1 92  ? 443.710 61.173  426.702 1.00 22.58  ?  149 LEU C CD2 1 
ATOM   2594  N N   . ARG C  1 93  ? 445.365 66.322  425.416 1.00 38.31  ?  150 ARG C N   1 
ATOM   2595  C CA  . ARG C  1 93  ? 444.822 67.638  425.122 1.00 39.60  ?  150 ARG C CA  1 
ATOM   2596  C C   . ARG C  1 93  ? 443.536 67.492  424.321 1.00 38.72  ?  150 ARG C C   1 
ATOM   2597  O O   . ARG C  1 93  ? 443.373 66.547  423.544 1.00 35.25  ?  150 ARG C O   1 
ATOM   2598  C CB  . ARG C  1 93  ? 445.831 68.497  424.353 1.00 41.08  ?  150 ARG C CB  1 
ATOM   2599  C CG  . ARG C  1 93  ? 446.484 67.795  423.175 1.00 41.90  ?  150 ARG C CG  1 
ATOM   2600  C CD  . ARG C  1 93  ? 447.429 68.726  422.429 1.00 49.40  ?  150 ARG C CD  1 
ATOM   2601  N NE  . ARG C  1 93  ? 446.736 69.512  421.412 1.00 47.93  ?  150 ARG C NE  1 
ATOM   2602  C CZ  . ARG C  1 93  ? 446.700 69.196  420.121 1.00 47.56  ?  150 ARG C CZ  1 
ATOM   2603  N NH1 . ARG C  1 93  ? 447.319 68.106  419.686 1.00 48.07  ?  150 ARG C NH1 1 
ATOM   2604  N NH2 . ARG C  1 93  ? 446.045 69.967  419.264 1.00 46.65  ?  150 ARG C NH2 1 
ATOM   2605  N N   . ARG C  1 94  ? 442.621 68.435  424.526 1.00 35.28  ?  151 ARG C N   1 
ATOM   2606  C CA  . ARG C  1 94  ? 441.344 68.421  423.826 1.00 31.36  ?  151 ARG C CA  1 
ATOM   2607  C C   . ARG C  1 94  ? 441.537 68.998  422.428 1.00 35.41  ?  151 ARG C C   1 
ATOM   2608  O O   . ARG C  1 94  ? 441.895 70.171  422.280 1.00 37.78  ?  151 ARG C O   1 
ATOM   2609  C CB  . ARG C  1 94  ? 440.310 69.226  424.610 1.00 33.64  ?  151 ARG C CB  1 
ATOM   2610  C CG  . ARG C  1 94  ? 438.869 68.982  424.210 1.00 29.56  ?  151 ARG C CG  1 
ATOM   2611  C CD  . ARG C  1 94  ? 437.950 70.007  424.854 1.00 33.78  ?  151 ARG C CD  1 
ATOM   2612  N NE  . ARG C  1 94  ? 438.135 70.083  426.300 1.00 32.38  ?  151 ARG C NE  1 
ATOM   2613  C CZ  . ARG C  1 94  ? 437.395 69.423  427.185 1.00 33.81  ?  151 ARG C CZ  1 
ATOM   2614  N NH1 . ARG C  1 94  ? 436.418 68.627  426.773 1.00 36.59  ?  151 ARG C NH1 1 
ATOM   2615  N NH2 . ARG C  1 94  ? 437.636 69.554  428.482 1.00 33.15  ?  151 ARG C NH2 1 
ATOM   2616  N N   . VAL C  1 95  ? 441.297 68.178  421.399 1.00 28.31  ?  152 VAL C N   1 
ATOM   2617  C CA  . VAL C  1 95  ? 441.463 68.636  420.021 1.00 26.18  ?  152 VAL C CA  1 
ATOM   2618  C C   . VAL C  1 95  ? 440.182 69.201  419.423 1.00 24.20  ?  152 VAL C C   1 
ATOM   2619  O O   . VAL C  1 95  ? 440.240 69.853  418.368 1.00 27.29  ?  152 VAL C O   1 
ATOM   2620  C CB  . VAL C  1 95  ? 441.982 67.504  419.114 1.00 27.41  ?  152 VAL C CB  1 
ATOM   2621  C CG1 . VAL C  1 95  ? 443.311 66.973  419.629 1.00 28.32  ?  152 VAL C CG1 1 
ATOM   2622  C CG2 . VAL C  1 95  ? 440.957 66.384  419.004 1.00 23.31  ?  152 VAL C CG2 1 
ATOM   2623  N N   . VAL C  1 96  ? 439.033 68.984  420.057 1.00 16.85  ?  153 VAL C N   1 
ATOM   2624  C CA  . VAL C  1 96  ? 437.756 69.512  419.593 1.00 18.90  ?  153 VAL C CA  1 
ATOM   2625  C C   . VAL C  1 96  ? 437.078 70.187  420.772 1.00 18.30  ?  153 VAL C C   1 
ATOM   2626  O O   . VAL C  1 96  ? 436.719 69.522  421.750 1.00 22.74  ?  153 VAL C O   1 
ATOM   2627  C CB  . VAL C  1 96  ? 436.852 68.420  419.002 1.00 17.53  ?  153 VAL C CB  1 
ATOM   2628  C CG1 . VAL C  1 96  ? 435.465 68.973  418.726 1.00 16.44  ?  153 VAL C CG1 1 
ATOM   2629  C CG2 . VAL C  1 96  ? 437.464 67.860  417.736 1.00 18.83  ?  153 VAL C CG2 1 
ATOM   2630  N N   . ALA C  1 97  ? 436.897 71.501  420.681 1.00 15.35  ?  154 ALA C N   1 
ATOM   2631  C CA  . ALA C  1 97  ? 436.285 72.246  421.772 1.00 21.59  ?  154 ALA C CA  1 
ATOM   2632  C C   . ALA C  1 97  ? 434.813 71.881  421.910 1.00 26.52  ?  154 ALA C C   1 
ATOM   2633  O O   . ALA C  1 97  ? 434.081 71.797  420.920 1.00 27.61  ?  154 ALA C O   1 
ATOM   2634  C CB  . ALA C  1 97  ? 436.434 73.746  421.538 1.00 23.16  ?  154 ALA C CB  1 
ATOM   2635  N N   . GLY C  1 98  ? 434.383 71.659  423.151 1.00 37.84  ?  155 GLY C N   1 
ATOM   2636  C CA  . GLY C  1 98  ? 432.986 71.477  423.476 1.00 33.82  ?  155 GLY C CA  1 
ATOM   2637  C C   . GLY C  1 98  ? 432.556 70.045  423.724 1.00 33.18  ?  155 GLY C C   1 
ATOM   2638  O O   . GLY C  1 98  ? 431.517 69.831  424.359 1.00 34.54  ?  155 GLY C O   1 
ATOM   2639  N N   . GLU C  1 99  ? 433.315 69.064  423.250 1.00 40.18  ?  156 GLU C N   1 
ATOM   2640  C CA  . GLU C  1 99  ? 432.931 67.665  423.389 1.00 43.91  ?  156 GLU C CA  1 
ATOM   2641  C C   . GLU C  1 99  ? 433.953 66.913  424.235 1.00 47.88  ?  156 GLU C C   1 
ATOM   2642  O O   . GLU C  1 99  ? 434.976 67.457  424.658 1.00 46.36  ?  156 GLU C O   1 
ATOM   2643  C CB  . GLU C  1 99  ? 432.785 67.000  422.016 1.00 42.08  ?  156 GLU C CB  1 
ATOM   2644  C CG  . GLU C  1 99  ? 431.854 67.717  421.058 1.00 46.37  ?  156 GLU C CG  1 
ATOM   2645  C CD  . GLU C  1 99  ? 431.594 66.913  419.798 1.00 56.72  ?  156 GLU C CD  1 
ATOM   2646  O OE1 . GLU C  1 99  ? 431.378 65.687  419.907 1.00 54.65  ?  156 GLU C OE1 1 
ATOM   2647  O OE2 . GLU C  1 99  ? 431.611 67.505  418.698 1.00 58.92  -1 156 GLU C OE2 1 
ATOM   2648  N N   . GLY C  1 100 ? 433.652 65.646  424.478 1.00 19.69  ?  157 GLY C N   1 
ATOM   2649  C CA  . GLY C  1 100 ? 434.550 64.687  425.101 1.00 15.42  ?  157 GLY C CA  1 
ATOM   2650  C C   . GLY C  1 100 ? 434.490 64.714  426.615 1.00 16.28  ?  157 GLY C C   1 
ATOM   2651  O O   . GLY C  1 100 ? 434.299 65.753  427.246 1.00 19.62  ?  157 GLY C O   1 
ATOM   2652  N N   . SER C  1 101 ? 434.687 63.534  427.202 1.00 19.86  ?  158 SER C N   1 
ATOM   2653  C CA  . SER C  1 101 ? 434.837 63.281  428.632 1.00 20.10  ?  158 SER C CA  1 
ATOM   2654  C C   . SER C  1 101 ? 434.987 61.777  428.803 1.00 21.39  ?  158 SER C C   1 
ATOM   2655  O O   . SER C  1 101 ? 434.562 60.998  427.944 1.00 27.59  ?  158 SER C O   1 
ATOM   2656  C CB  . SER C  1 101 ? 433.645 63.787  429.451 1.00 24.83  ?  158 SER C CB  1 
ATOM   2657  O OG  . SER C  1 101 ? 432.450 63.133  429.065 1.00 27.96  ?  158 SER C OG  1 
ATOM   2658  N N   . GLY C  1 102 ? 435.568 61.376  429.920 1.00 31.55  ?  159 GLY C N   1 
ATOM   2659  C CA  . GLY C  1 102 ? 435.782 59.970  430.187 1.00 31.76  ?  159 GLY C CA  1 
ATOM   2660  C C   . GLY C  1 102 ? 437.074 59.766  430.953 1.00 38.96  ?  159 GLY C C   1 
ATOM   2661  O O   . GLY C  1 102 ? 437.624 60.698  431.530 1.00 41.36  ?  159 GLY C O   1 
ATOM   2662  N N   . SER C  1 103 ? 437.540 58.518  430.939 1.00 36.10  ?  160 SER C N   1 
ATOM   2663  C CA  . SER C  1 103 ? 438.795 58.139  431.569 1.00 37.56  ?  160 SER C CA  1 
ATOM   2664  C C   . SER C  1 103 ? 439.631 57.331  430.587 1.00 36.73  ?  160 SER C C   1 
ATOM   2665  O O   . SER C  1 103 ? 439.102 56.491  429.853 1.00 33.12  ?  160 SER C O   1 
ATOM   2666  C CB  . SER C  1 103 ? 438.560 57.323  432.846 1.00 48.34  ?  160 SER C CB  1 
ATOM   2667  O OG  . SER C  1 103 ? 438.042 56.040  432.542 1.00 59.26  ?  160 SER C OG  1 
ATOM   2668  N N   . VAL C  1 104 ? 440.935 57.592  430.579 1.00 20.44  ?  161 VAL C N   1 
ATOM   2669  C CA  . VAL C  1 104 ? 441.888 56.891  429.728 1.00 11.07  ?  161 VAL C CA  1 
ATOM   2670  C C   . VAL C  1 104 ? 442.902 56.200  430.625 1.00 12.40  ?  161 VAL C C   1 
ATOM   2671  O O   . VAL C  1 104 ? 443.486 56.836  431.511 1.00 17.39  ?  161 VAL C O   1 
ATOM   2672  C CB  . VAL C  1 104 ? 442.584 57.848  428.744 1.00 10.99  ?  161 VAL C CB  1 
ATOM   2673  C CG1 . VAL C  1 104 ? 443.573 57.089  427.874 1.00 16.67  ?  161 VAL C CG1 1 
ATOM   2674  C CG2 . VAL C  1 104 ? 441.553 58.566  427.893 1.00 14.52  ?  161 VAL C CG2 1 
ATOM   2675  N N   . SER C  1 105 ? 443.112 54.908  430.397 1.00 33.47  ?  162 SER C N   1 
ATOM   2676  C CA  . SER C  1 105 ? 443.962 54.090  431.248 1.00 35.22  ?  162 SER C CA  1 
ATOM   2677  C C   . SER C  1 105 ? 445.151 53.557  430.462 1.00 39.18  ?  162 SER C C   1 
ATOM   2678  O O   . SER C  1 105 ? 445.007 53.114  429.318 1.00 41.55  ?  162 SER C O   1 
ATOM   2679  C CB  . SER C  1 105 ? 443.174 52.920  431.849 1.00 35.12  ?  162 SER C CB  1 
ATOM   2680  O OG  . SER C  1 105 ? 442.011 53.376  432.519 1.00 46.12  ?  162 SER C OG  1 
ATOM   2681  N N   . LEU C  1 106 ? 446.326 53.611  431.083 1.00 57.56  ?  163 LEU C N   1 
ATOM   2682  C CA  . LEU C  1 106 ? 447.529 52.968  430.576 1.00 60.97  ?  163 LEU C CA  1 
ATOM   2683  C C   . LEU C  1 106 ? 447.894 51.809  431.491 1.00 67.71  ?  163 LEU C C   1 
ATOM   2684  O O   . LEU C  1 106 ? 447.750 51.905  432.714 1.00 70.44  ?  163 LEU C O   1 
ATOM   2685  C CB  . LEU C  1 106 ? 448.699 53.952  430.494 1.00 66.63  ?  163 LEU C CB  1 
ATOM   2686  C CG  . LEU C  1 106 ? 448.641 55.059  429.439 1.00 64.43  ?  163 LEU C CG  1 
ATOM   2687  C CD1 . LEU C  1 106 ? 449.953 55.827  429.411 1.00 60.80  ?  163 LEU C CD1 1 
ATOM   2688  C CD2 . LEU C  1 106 ? 448.329 54.482  428.071 1.00 59.45  ?  163 LEU C CD2 1 
ATOM   2689  N N   . ALA C  1 107 ? 448.361 50.711  430.900 1.00 45.97  ?  164 ALA C N   1 
ATOM   2690  C CA  . ALA C  1 107 ? 448.720 49.522  431.662 1.00 45.17  ?  164 ALA C CA  1 
ATOM   2691  C C   . ALA C  1 107 ? 450.021 48.953  431.120 1.00 46.62  ?  164 ALA C C   1 
ATOM   2692  O O   . ALA C  1 107 ? 450.119 48.660  429.924 1.00 54.65  ?  164 ALA C O   1 
ATOM   2693  C CB  . ALA C  1 107 ? 447.608 48.470  431.602 1.00 50.56  ?  164 ALA C CB  1 
ATOM   2694  N N   . LEU C  1 108 ? 451.013 48.794  431.993 1.00 28.25  ?  165 LEU C N   1 
ATOM   2695  C CA  . LEU C  1 108 ? 452.268 48.147  431.630 1.00 28.78  ?  165 LEU C CA  1 
ATOM   2696  C C   . LEU C  1 108 ? 452.175 46.661  431.950 1.00 35.74  ?  165 LEU C C   1 
ATOM   2697  O O   . LEU C  1 108 ? 451.846 46.282  433.079 1.00 41.56  ?  165 LEU C O   1 
ATOM   2698  C CB  . LEU C  1 108 ? 453.446 48.782  432.371 1.00 31.72  ?  165 LEU C CB  1 
ATOM   2699  C CG  . LEU C  1 108 ? 454.849 48.242  432.069 1.00 34.18  ?  165 LEU C CG  1 
ATOM   2700  C CD1 . LEU C  1 108 ? 455.853 49.381  431.975 1.00 26.67  ?  165 LEU C CD1 1 
ATOM   2701  C CD2 . LEU C  1 108 ? 455.289 47.236  433.122 1.00 34.08  ?  165 LEU C CD2 1 
ATOM   2702  N N   . HIS C  1 109 ? 452.468 45.825  430.958 1.00 37.67  ?  166 HIS C N   1 
ATOM   2703  C CA  . HIS C  1 109 ? 452.338 44.381  431.083 1.00 45.13  ?  166 HIS C CA  1 
ATOM   2704  C C   . HIS C  1 109 ? 453.686 43.707  430.874 1.00 45.20  ?  166 HIS C C   1 
ATOM   2705  O O   . HIS C  1 109 ? 454.459 44.102  429.994 1.00 48.11  ?  166 HIS C O   1 
ATOM   2706  C CB  . HIS C  1 109 ? 451.319 43.833  430.077 1.00 46.83  ?  166 HIS C CB  1 
ATOM   2707  C CG  . HIS C  1 109 ? 449.904 44.206  430.385 1.00 36.00  ?  166 HIS C CG  1 
ATOM   2708  N ND1 . HIS C  1 109 ? 448.899 44.161  429.442 1.00 36.14  ?  166 HIS C ND1 1 
ATOM   2709  C CD2 . HIS C  1 109 ? 449.322 44.627  431.533 1.00 36.88  ?  166 HIS C CD2 1 
ATOM   2710  C CE1 . HIS C  1 109 ? 447.762 44.540  429.995 1.00 43.58  ?  166 HIS C CE1 1 
ATOM   2711  N NE2 . HIS C  1 109 ? 447.990 44.829  431.264 1.00 41.20  ?  166 HIS C NE2 1 
ATOM   2712  N N   . LEU C  1 110 ? 453.962 42.691  431.687 1.00 44.70  ?  167 LEU C N   1 
ATOM   2713  C CA  . LEU C  1 110 ? 455.163 41.878  431.560 1.00 50.41  ?  167 LEU C CA  1 
ATOM   2714  C C   . LEU C  1 110 ? 454.798 40.594  430.823 1.00 55.88  ?  167 LEU C C   1 
ATOM   2715  O O   . LEU C  1 110 ? 453.935 39.837  431.283 1.00 53.43  ?  167 LEU C O   1 
ATOM   2716  C CB  . LEU C  1 110 ? 455.756 41.564  432.933 1.00 41.60  ?  167 LEU C CB  1 
ATOM   2717  C CG  . LEU C  1 110 ? 456.130 42.763  433.809 1.00 32.98  ?  167 LEU C CG  1 
ATOM   2718  C CD1 . LEU C  1 110 ? 456.842 42.303  435.071 1.00 38.63  ?  167 LEU C CD1 1 
ATOM   2719  C CD2 . LEU C  1 110 ? 456.985 43.752  433.040 1.00 34.78  ?  167 LEU C CD2 1 
ATOM   2720  N N   . GLN C  1 111 ? 455.514 40.293  429.746 1.00 84.05  ?  168 GLN C N   1 
ATOM   2721  C CA  . GLN C  1 111 ? 455.210 39.126  428.924 1.00 92.86  ?  168 GLN C CA  1 
ATOM   2722  C C   . GLN C  1 111 ? 455.520 37.735  429.456 1.00 97.25  ?  168 GLN C C   1 
ATOM   2723  O O   . GLN C  1 111 ? 454.745 36.820  429.245 1.00 96.86  ?  168 GLN C O   1 
ATOM   2724  C CB  . GLN C  1 111 ? 455.742 39.316  427.522 1.00 90.68  ?  168 GLN C CB  1 
ATOM   2725  C CG  . GLN C  1 111 ? 455.260 40.612  426.914 1.00 94.31  ?  168 GLN C CG  1 
ATOM   2726  C CD  . GLN C  1 111 ? 453.800 40.559  426.533 1.00 97.85  ?  168 GLN C CD  1 
ATOM   2727  O OE1 . GLN C  1 111 ? 453.239 39.479  426.380 1.00 97.56  ?  168 GLN C OE1 1 
ATOM   2728  N NE2 . GLN C  1 111 ? 453.176 41.725  426.383 1.00 87.49  ?  168 GLN C NE2 1 
ATOM   2729  N N   . PRO C  1 112 ? 456.682 37.530  430.053 1.00 91.92  ?  169 PRO C N   1 
ATOM   2730  C CA  . PRO C  1 112 ? 456.897 36.204  430.673 1.00 91.29  ?  169 PRO C CA  1 
ATOM   2731  C C   . PRO C  1 112 ? 456.308 36.098  432.080 1.00 98.59  ?  169 PRO C C   1 
ATOM   2732  O O   . PRO C  1 112 ? 456.997 36.149  433.098 1.00 99.22  ?  169 PRO C O   1 
ATOM   2733  C CB  . PRO C  1 112 ? 458.425 36.079  430.686 1.00 95.08  ?  169 PRO C CB  1 
ATOM   2734  C CG  . PRO C  1 112 ? 458.931 37.153  429.759 1.00 90.42  ?  169 PRO C CG  1 
ATOM   2735  C CD  . PRO C  1 112 ? 457.949 38.259  429.893 1.00 84.31  ?  169 PRO C CD  1 
ATOM   2736  N N   . LEU C  1 113 ? 454.974 35.984  432.122 1.00 73.86  ?  170 LEU C N   1 
ATOM   2737  C CA  . LEU C  1 113 ? 454.120 35.826  433.329 1.00 69.92  ?  170 LEU C CA  1 
ATOM   2738  C C   . LEU C  1 113 ? 452.775 36.497  433.145 1.00 72.08  ?  170 LEU C C   1 
ATOM   2739  O O   . LEU C  1 113 ? 452.119 36.313  432.131 1.00 73.77  ?  170 LEU C O   1 
ATOM   2740  C CB  . LEU C  1 113 ? 454.732 36.323  434.653 1.00 76.63  ?  170 LEU C CB  1 
ATOM   2741  C CG  . LEU C  1 113 ? 453.763 36.337  435.878 1.00 71.24  ?  170 LEU C CG  1 
ATOM   2742  C CD1 . LEU C  1 113 ? 452.754 35.199  435.884 1.00 59.83  ?  170 LEU C CD1 1 
ATOM   2743  C CD2 . LEU C  1 113 ? 454.384 36.497  437.266 1.00 54.46  ?  170 LEU C CD2 1 
ATOM   2744  N N   . GLY C  1 118 ? 449.494 38.061  437.962 1.00 94.06  ?  175 GLY C N   1 
ATOM   2745  C CA  . GLY C  1 118 ? 450.174 39.339  438.073 1.00 103.88 ?  175 GLY C CA  1 
ATOM   2746  C C   . GLY C  1 118 ? 449.332 40.513  437.614 1.00 99.63  ?  175 GLY C C   1 
ATOM   2747  O O   . GLY C  1 118 ? 449.500 41.632  438.103 1.00 90.62  ?  175 GLY C O   1 
ATOM   2748  N N   . ALA C  1 119 ? 448.426 40.249  436.673 1.00 100.83 ?  176 ALA C N   1 
ATOM   2749  C CA  . ALA C  1 119 ? 447.520 41.255  436.101 1.00 91.08  ?  176 ALA C CA  1 
ATOM   2750  C C   . ALA C  1 119 ? 448.383 42.351  435.478 1.00 97.18  ?  176 ALA C C   1 
ATOM   2751  O O   . ALA C  1 119 ? 449.274 42.033  434.672 1.00 98.67  ?  176 ALA C O   1 
ATOM   2752  C CB  . ALA C  1 119 ? 446.531 41.717  437.166 1.00 86.41  ?  176 ALA C CB  1 
ATOM   2753  N N   . ALA C  1 120 ? 448.171 43.622  435.804 1.00 65.01  ?  177 ALA C N   1 
ATOM   2754  C CA  . ALA C  1 120 ? 448.954 44.719  435.252 1.00 54.44  ?  177 ALA C CA  1 
ATOM   2755  C C   . ALA C  1 120 ? 449.962 45.199  436.287 1.00 49.67  ?  177 ALA C C   1 
ATOM   2756  O O   . ALA C  1 120 ? 449.592 45.497  437.428 1.00 50.16  ?  177 ALA C O   1 
ATOM   2757  C CB  . ALA C  1 120 ? 448.050 45.873  434.817 1.00 46.58  ?  177 ALA C CB  1 
ATOM   2758  N N   . ALA C  1 121 ? 451.233 45.277  435.885 1.00 35.47  ?  178 ALA C N   1 
ATOM   2759  C CA  . ALA C  1 121 ? 452.281 45.670  436.819 1.00 34.02  ?  178 ALA C CA  1 
ATOM   2760  C C   . ALA C  1 121 ? 452.239 47.162  437.126 1.00 29.98  ?  178 ALA C C   1 
ATOM   2761  O O   . ALA C  1 121 ? 452.620 47.577  438.226 1.00 30.60  ?  178 ALA C O   1 
ATOM   2762  C CB  . ALA C  1 121 ? 453.652 45.283  436.264 1.00 34.45  ?  178 ALA C CB  1 
ATOM   2763  N N   . LEU C  1 122 ? 451.791 47.979  436.176 1.00 39.45  ?  179 LEU C N   1 
ATOM   2764  C CA  . LEU C  1 122 ? 451.735 49.423  436.352 1.00 39.59  ?  179 LEU C CA  1 
ATOM   2765  C C   . LEU C  1 122 ? 450.490 49.953  435.658 1.00 43.32  ?  179 LEU C C   1 
ATOM   2766  O O   . LEU C  1 122 ? 450.211 49.576  434.518 1.00 50.50  ?  179 LEU C O   1 
ATOM   2767  C CB  . LEU C  1 122 ? 452.997 50.085  435.786 1.00 42.96  ?  179 LEU C CB  1 
ATOM   2768  C CG  . LEU C  1 122 ? 453.546 51.318  436.497 1.00 36.19  ?  179 LEU C CG  1 
ATOM   2769  C CD1 . LEU C  1 122 ? 453.822 50.986  437.938 1.00 34.18  ?  179 LEU C CD1 1 
ATOM   2770  C CD2 . LEU C  1 122 ? 454.818 51.793  435.818 1.00 32.84  ?  179 LEU C CD2 1 
ATOM   2771  N N   . ALA C  1 123 ? 449.750 50.829  436.338 1.00 25.51  ?  180 ALA C N   1 
ATOM   2772  C CA  . ALA C  1 123 ? 448.486 51.328  435.816 1.00 27.20  ?  180 ALA C CA  1 
ATOM   2773  C C   . ALA C  1 123 ? 448.313 52.800  436.161 1.00 29.36  ?  180 ALA C C   1 
ATOM   2774  O O   . ALA C  1 123 ? 448.570 53.215  437.293 1.00 28.98  ?  180 ALA C O   1 
ATOM   2775  C CB  . ALA C  1 123 ? 447.301 50.523  436.365 1.00 31.60  ?  180 ALA C CB  1 
ATOM   2776  N N   . LEU C  1 124 ? 447.861 53.579  435.180 1.00 45.78  ?  181 LEU C N   1 
ATOM   2777  C CA  . LEU C  1 124 ? 447.624 55.005  435.356 1.00 41.36  ?  181 LEU C CA  1 
ATOM   2778  C C   . LEU C  1 124 ? 446.287 55.357  434.727 1.00 40.81  ?  181 LEU C C   1 
ATOM   2779  O O   . LEU C  1 124 ? 446.049 55.044  433.558 1.00 45.35  ?  181 LEU C O   1 
ATOM   2780  C CB  . LEU C  1 124 ? 448.747 55.835  434.719 1.00 38.21  ?  181 LEU C CB  1 
ATOM   2781  C CG  . LEU C  1 124 ? 449.156 57.164  435.364 1.00 41.75  ?  181 LEU C CG  1 
ATOM   2782  C CD1 . LEU C  1 124 ? 450.271 57.806  434.556 1.00 43.07  ?  181 LEU C CD1 1 
ATOM   2783  C CD2 . LEU C  1 124 ? 447.987 58.125  435.509 1.00 46.02  ?  181 LEU C CD2 1 
ATOM   2784  N N   . THR C  1 125 ? 445.421 56.006  435.499 1.00 44.63  ?  182 THR C N   1 
ATOM   2785  C CA  . THR C  1 125 ? 444.116 56.448  435.023 1.00 51.69  ?  182 THR C CA  1 
ATOM   2786  C C   . THR C  1 125 ? 444.093 57.970  434.993 1.00 49.80  ?  182 THR C C   1 
ATOM   2787  O O   . THR C  1 125 ? 444.341 58.619  436.015 1.00 48.16  ?  182 THR C O   1 
ATOM   2788  C CB  . THR C  1 125 ? 442.991 55.908  435.907 1.00 60.86  ?  182 THR C CB  1 
ATOM   2789  O OG1 . THR C  1 125 ? 442.907 54.485  435.759 1.00 61.09  ?  182 THR C OG1 1 
ATOM   2790  C CG2 . THR C  1 125 ? 441.658 56.530  435.513 1.00 54.75  ?  182 THR C CG2 1 
ATOM   2791  N N   . VAL C  1 126 ? 443.799 58.532  433.825 1.00 23.64  ?  183 VAL C N   1 
ATOM   2792  C CA  . VAL C  1 126 ? 443.742 59.973  433.621 1.00 17.46  ?  183 VAL C CA  1 
ATOM   2793  C C   . VAL C  1 126 ? 442.312 60.352  433.267 1.00 16.87  ?  183 VAL C C   1 
ATOM   2794  O O   . VAL C  1 126 ? 441.657 59.667  432.473 1.00 17.96  ?  183 VAL C O   1 
ATOM   2795  C CB  . VAL C  1 126 ? 444.724 60.427  432.521 1.00 17.18  ?  183 VAL C CB  1 
ATOM   2796  C CG1 . VAL C  1 126 ? 444.555 61.903  432.231 1.00 20.62  ?  183 VAL C CG1 1 
ATOM   2797  C CG2 . VAL C  1 126 ? 446.155 60.126  432.936 1.00 24.31  ?  183 VAL C CG2 1 
ATOM   2798  N N   . ASP C  1 127 ? 441.827 61.438  433.862 1.00 60.71  ?  184 ASP C N   1 
ATOM   2799  C CA  . ASP C  1 127 ? 440.451 61.880  433.693 1.00 67.34  ?  184 ASP C CA  1 
ATOM   2800  C C   . ASP C  1 127 ? 440.345 62.924  432.589 1.00 67.73  ?  184 ASP C C   1 
ATOM   2801  O O   . ASP C  1 127 ? 441.223 63.777  432.435 1.00 62.67  ?  184 ASP C O   1 
ATOM   2802  C CB  . ASP C  1 127 ? 439.901 62.458  434.996 1.00 67.97  ?  184 ASP C CB  1 
ATOM   2803  C CG  . ASP C  1 127 ? 438.459 62.898  434.870 1.00 76.31  ?  184 ASP C CG  1 
ATOM   2804  O OD1 . ASP C  1 127 ? 437.573 62.018  434.819 1.00 86.78  ?  184 ASP C OD1 1 
ATOM   2805  O OD2 . ASP C  1 127 ? 438.211 64.120  434.818 1.00 84.83  -1 184 ASP C OD2 1 
ATOM   2806  N N   . LEU C  1 128 ? 439.255 62.850  431.824 1.00 37.68  ?  185 LEU C N   1 
ATOM   2807  C CA  . LEU C  1 128 ? 438.969 63.837  430.795 1.00 35.42  ?  185 LEU C CA  1 
ATOM   2808  C C   . LEU C  1 128 ? 437.878 64.769  431.297 1.00 35.90  ?  185 LEU C C   1 
ATOM   2809  O O   . LEU C  1 128 ? 436.714 64.347  431.392 1.00 32.47  ?  185 LEU C O   1 
ATOM   2810  C CB  . LEU C  1 128 ? 438.537 63.154  429.499 1.00 29.45  ?  185 LEU C CB  1 
ATOM   2811  C CG  . LEU C  1 128 ? 439.518 62.126  428.937 1.00 25.74  ?  185 LEU C CG  1 
ATOM   2812  C CD1 . LEU C  1 128 ? 438.987 61.530  427.643 1.00 31.19  ?  185 LEU C CD1 1 
ATOM   2813  C CD2 . LEU C  1 128 ? 440.886 62.752  428.721 1.00 27.96  ?  185 LEU C CD2 1 
ATOM   2814  N N   . PRO C  1 129 ? 438.189 66.017  431.629 1.00 37.14  ?  186 PRO C N   1 
ATOM   2815  C CA  . PRO C  1 129 ? 437.168 66.927  432.154 1.00 35.13  ?  186 PRO C CA  1 
ATOM   2816  C C   . PRO C  1 129 ? 436.169 67.306  431.079 1.00 37.45  ?  186 PRO C C   1 
ATOM   2817  O O   . PRO C  1 129 ? 436.552 67.585  429.932 1.00 38.85  ?  186 PRO C O   1 
ATOM   2818  C CB  . PRO C  1 129 ? 437.982 68.149  432.612 1.00 45.28  ?  186 PRO C CB  1 
ATOM   2819  C CG  . PRO C  1 129 ? 439.405 67.677  432.683 1.00 45.64  ?  186 PRO C CG  1 
ATOM   2820  C CD  . PRO C  1 129 ? 439.527 66.629  431.625 1.00 38.21  ?  186 PRO C CD  1 
ATOM   2821  N N   . PRO C  1 130 ? 434.879 67.331  431.405 1.00 47.34  ?  187 PRO C N   1 
ATOM   2822  C CA  . PRO C  1 130 ? 433.881 67.789  430.434 1.00 43.51  ?  187 PRO C CA  1 
ATOM   2823  C C   . PRO C  1 130 ? 434.029 69.275  430.147 1.00 49.24  ?  187 PRO C C   1 
ATOM   2824  O O   . PRO C  1 130 ? 434.600 70.039  430.929 1.00 47.75  ?  187 PRO C O   1 
ATOM   2825  C CB  . PRO C  1 130 ? 432.547 67.483  431.122 1.00 40.52  ?  187 PRO C CB  1 
ATOM   2826  C CG  . PRO C  1 130 ? 432.873 67.478  432.579 1.00 51.25  ?  187 PRO C CG  1 
ATOM   2827  C CD  . PRO C  1 130 ? 434.267 66.925  432.681 1.00 51.25  ?  187 PRO C CD  1 
ATOM   2828  N N   . ALA C  1 131 ? 433.496 69.679  428.997 1.00 31.76  ?  188 ALA C N   1 
ATOM   2829  C CA  . ALA C  1 131 ? 433.616 71.061  428.555 1.00 33.28  ?  188 ALA C CA  1 
ATOM   2830  C C   . ALA C  1 131 ? 432.786 71.985  429.439 1.00 33.36  ?  188 ALA C C   1 
ATOM   2831  O O   . ALA C  1 131 ? 431.593 71.751  429.654 1.00 35.99  ?  188 ALA C O   1 
ATOM   2832  C CB  . ALA C  1 131 ? 433.179 71.191  427.098 1.00 32.25  ?  188 ALA C CB  1 
ATOM   2833  N N   . SER C  1 132 ? 433.421 73.039  429.946 1.00 44.10  ?  189 SER C N   1 
ATOM   2834  C CA  . SER C  1 132 ? 432.764 74.011  430.808 1.00 57.81  ?  189 SER C CA  1 
ATOM   2835  C C   . SER C  1 132 ? 433.238 75.407  430.432 1.00 65.60  ?  189 SER C C   1 
ATOM   2836  O O   . SER C  1 132 ? 434.198 75.579  429.677 1.00 66.23  ?  189 SER C O   1 
ATOM   2837  C CB  . SER C  1 132 ? 433.044 73.731  432.291 1.00 67.69  ?  189 SER C CB  1 
ATOM   2838  O OG  . SER C  1 132 ? 432.584 72.445  432.668 1.00 72.33  ?  189 SER C OG  1 
ATOM   2839  N N   . SER C  1 133 ? 432.535 76.415  430.962 1.00 77.84  ?  190 SER C N   1 
ATOM   2840  C CA  . SER C  1 133 ? 432.979 77.795  430.789 1.00 78.95  ?  190 SER C CA  1 
ATOM   2841  C C   . SER C  1 133 ? 434.401 77.976  431.303 1.00 82.65  ?  190 SER C C   1 
ATOM   2842  O O   . SER C  1 133 ? 435.221 78.645  430.664 1.00 75.68  ?  190 SER C O   1 
ATOM   2843  C CB  . SER C  1 133 ? 432.020 78.751  431.500 1.00 80.18  ?  190 SER C CB  1 
ATOM   2844  O OG  . SER C  1 133 ? 430.733 78.717  430.908 1.00 71.47  ?  190 SER C OG  1 
ATOM   2845  N N   . GLU C  1 134 ? 434.708 77.392  432.458 1.00 119.50 ?  191 GLU C N   1 
ATOM   2846  C CA  . GLU C  1 134 ? 436.096 77.248  432.871 1.00 119.86 ?  191 GLU C CA  1 
ATOM   2847  C C   . GLU C  1 134 ? 436.799 76.309  431.903 1.00 119.92 ?  191 GLU C C   1 
ATOM   2848  O O   . GLU C  1 134 ? 436.347 75.182  431.678 1.00 116.27 ?  191 GLU C O   1 
ATOM   2849  C CB  . GLU C  1 134 ? 436.175 76.699  434.295 1.00 121.36 ?  191 GLU C CB  1 
ATOM   2850  C CG  . GLU C  1 134 ? 435.231 77.373  435.276 1.00 129.96 ?  191 GLU C CG  1 
ATOM   2851  C CD  . GLU C  1 134 ? 434.491 76.374  436.145 1.00 125.24 ?  191 GLU C CD  1 
ATOM   2852  O OE1 . GLU C  1 134 ? 433.766 76.806  437.066 1.00 117.46 ?  191 GLU C OE1 1 
ATOM   2853  O OE2 . GLU C  1 134 ? 434.630 75.156  435.903 1.00 122.19 -1 191 GLU C OE2 1 
ATOM   2854  N N   . ALA C  1 135 ? 437.905 76.766  431.326 1.00 90.52  ?  192 ALA C N   1 
ATOM   2855  C CA  . ALA C  1 135 ? 438.567 76.027  430.258 1.00 78.60  ?  192 ALA C CA  1 
ATOM   2856  C C   . ALA C  1 135 ? 439.653 75.143  430.857 1.00 77.90  ?  192 ALA C C   1 
ATOM   2857  O O   . ALA C  1 135 ? 440.686 75.640  431.319 1.00 82.61  ?  192 ALA C O   1 
ATOM   2858  C CB  . ALA C  1 135 ? 439.150 76.986  429.222 1.00 72.23  ?  192 ALA C CB  1 
ATOM   2859  N N   . ARG C  1 136 ? 439.419 73.833  430.850 1.00 59.61  ?  193 ARG C N   1 
ATOM   2860  C CA  . ARG C  1 136 ? 440.463 72.845  431.102 1.00 60.39  ?  193 ARG C CA  1 
ATOM   2861  C C   . ARG C  1 136 ? 440.612 72.045  429.814 1.00 56.78  ?  193 ARG C C   1 
ATOM   2862  O O   . ARG C  1 136 ? 439.772 71.195  429.504 1.00 54.29  ?  193 ARG C O   1 
ATOM   2863  C CB  . ARG C  1 136 ? 440.098 71.950  432.284 1.00 56.50  ?  193 ARG C CB  1 
ATOM   2864  C CG  . ARG C  1 136 ? 441.225 71.050  432.751 1.00 65.50  ?  193 ARG C CG  1 
ATOM   2865  C CD  . ARG C  1 136 ? 442.269 71.843  433.514 1.00 70.60  ?  193 ARG C CD  1 
ATOM   2866  N NE  . ARG C  1 136 ? 443.500 71.084  433.710 1.00 64.37  ?  193 ARG C NE  1 
ATOM   2867  C CZ  . ARG C  1 136 ? 444.583 71.214  432.952 1.00 61.58  ?  193 ARG C CZ  1 
ATOM   2868  N NH1 . ARG C  1 136 ? 444.587 72.082  431.948 1.00 54.53  ?  193 ARG C NH1 1 
ATOM   2869  N NH2 . ARG C  1 136 ? 445.662 70.483  433.199 1.00 63.46  ?  193 ARG C NH2 1 
ATOM   2870  N N   . ASN C  1 137 ? 441.675 72.313  429.062 1.00 46.43  ?  194 ASN C N   1 
ATOM   2871  C CA  . ASN C  1 137 ? 441.916 71.597  427.818 1.00 42.60  ?  194 ASN C CA  1 
ATOM   2872  C C   . ASN C  1 137 ? 442.958 70.495  427.938 1.00 40.46  ?  194 ASN C C   1 
ATOM   2873  O O   . ASN C  1 137 ? 443.169 69.761  426.967 1.00 39.25  ?  194 ASN C O   1 
ATOM   2874  C CB  . ASN C  1 137 ? 442.331 72.580  426.716 1.00 54.88  ?  194 ASN C CB  1 
ATOM   2875  C CG  . ASN C  1 137 ? 441.208 73.526  426.331 1.00 59.14  ?  194 ASN C CG  1 
ATOM   2876  O OD1 . ASN C  1 137 ? 441.444 74.696  426.026 1.00 66.88  ?  194 ASN C OD1 1 
ATOM   2877  N ND2 . ASN C  1 137 ? 439.978 73.024  426.347 1.00 42.88  ?  194 ASN C ND2 1 
ATOM   2878  N N   . SER C  1 138 ? 443.613 70.357  429.084 1.00 52.27  ?  195 SER C N   1 
ATOM   2879  C CA  . SER C  1 138 ? 444.649 69.350  429.249 1.00 43.76  ?  195 SER C CA  1 
ATOM   2880  C C   . SER C  1 138 ? 444.165 68.212  430.138 1.00 44.56  ?  195 SER C C   1 
ATOM   2881  O O   . SER C  1 138 ? 443.072 68.246  430.710 1.00 53.11  ?  195 SER C O   1 
ATOM   2882  C CB  . SER C  1 138 ? 445.921 69.973  429.835 1.00 45.15  ?  195 SER C CB  1 
ATOM   2883  O OG  . SER C  1 138 ? 446.326 71.104  429.085 1.00 57.93  ?  195 SER C OG  1 
ATOM   2884  N N   . ALA C  1 139 ? 445.018 67.198  430.248 1.00 10.90  ?  196 ALA C N   1 
ATOM   2885  C CA  . ALA C  1 139 ? 444.848 66.102  431.187 1.00 10.76  ?  196 ALA C CA  1 
ATOM   2886  C C   . ALA C  1 139 ? 446.230 65.538  431.471 1.00 14.14  ?  196 ALA C C   1 
ATOM   2887  O O   . ALA C  1 139 ? 447.097 65.536  430.594 1.00 21.32  ?  196 ALA C O   1 
ATOM   2888  C CB  . ALA C  1 139 ? 443.911 65.022  430.641 1.00 15.07  ?  196 ALA C CB  1 
ATOM   2889  N N   . PHE C  1 140 ? 446.440 65.056  432.693 1.00 42.02  ?  197 PHE C N   1 
ATOM   2890  C CA  . PHE C  1 140 ? 447.784 64.644  433.070 1.00 37.78  ?  197 PHE C CA  1 
ATOM   2891  C C   . PHE C  1 140 ? 447.734 63.576  434.152 1.00 36.23  ?  197 PHE C C   1 
ATOM   2892  O O   . PHE C  1 140 ? 446.784 63.502  434.936 1.00 38.60  ?  197 PHE C O   1 
ATOM   2893  C CB  . PHE C  1 140 ? 448.608 65.846  433.543 1.00 41.98  ?  197 PHE C CB  1 
ATOM   2894  C CG  . PHE C  1 140 ? 450.051 65.529  433.791 1.00 45.18  ?  197 PHE C CG  1 
ATOM   2895  C CD1 . PHE C  1 140 ? 450.837 64.991  432.786 1.00 44.10  ?  197 PHE C CD1 1 
ATOM   2896  C CD2 . PHE C  1 140 ? 450.624 65.776  435.025 1.00 46.37  ?  197 PHE C CD2 1 
ATOM   2897  C CE1 . PHE C  1 140 ? 452.166 64.699  433.010 1.00 44.99  ?  197 PHE C CE1 1 
ATOM   2898  C CE2 . PHE C  1 140 ? 451.950 65.488  435.254 1.00 45.63  ?  197 PHE C CE2 1 
ATOM   2899  C CZ  . PHE C  1 140 ? 452.723 64.947  434.248 1.00 47.73  ?  197 PHE C CZ  1 
ATOM   2900  N N   . GLY C  1 141 ? 448.781 62.755  434.183 1.00 15.25  ?  198 GLY C N   1 
ATOM   2901  C CA  . GLY C  1 141 ? 448.942 61.751  435.217 1.00 24.91  ?  198 GLY C CA  1 
ATOM   2902  C C   . GLY C  1 141 ? 450.368 61.255  435.252 1.00 24.05  ?  198 GLY C C   1 
ATOM   2903  O O   . GLY C  1 141 ? 451.101 61.342  434.261 1.00 21.07  ?  198 GLY C O   1 
ATOM   2904  N N   . PHE C  1 142 ? 450.761 60.738  436.415 1.00 48.78  ?  199 PHE C N   1 
ATOM   2905  C CA  . PHE C  1 142 ? 452.103 60.203  436.599 1.00 39.98  ?  199 PHE C CA  1 
ATOM   2906  C C   . PHE C  1 142 ? 452.059 59.086  437.630 1.00 38.42  ?  199 PHE C C   1 
ATOM   2907  O O   . PHE C  1 142 ? 451.325 59.173  438.617 1.00 42.94  ?  199 PHE C O   1 
ATOM   2908  C CB  . PHE C  1 142 ? 453.081 61.297  437.046 1.00 30.98  ?  199 PHE C CB  1 
ATOM   2909  C CG  . PHE C  1 142 ? 454.524 60.883  436.996 1.00 30.26  ?  199 PHE C CG  1 
ATOM   2910  C CD1 . PHE C  1 142 ? 455.103 60.197  438.051 1.00 33.70  ?  199 PHE C CD1 1 
ATOM   2911  C CD2 . PHE C  1 142 ? 455.307 61.192  435.898 1.00 36.38  ?  199 PHE C CD2 1 
ATOM   2912  C CE1 . PHE C  1 142 ? 456.431 59.817  438.005 1.00 34.50  ?  199 PHE C CE1 1 
ATOM   2913  C CE2 . PHE C  1 142 ? 456.635 60.818  435.847 1.00 31.34  ?  199 PHE C CE2 1 
ATOM   2914  C CZ  . PHE C  1 142 ? 457.198 60.131  436.903 1.00 32.17  ?  199 PHE C CZ  1 
ATOM   2915  N N   . GLN C  1 143 ? 452.844 58.037  437.392 1.00 17.47  ?  200 GLN C N   1 
ATOM   2916  C CA  . GLN C  1 143 ? 453.012 56.964  438.360 1.00 21.72  ?  200 GLN C CA  1 
ATOM   2917  C C   . GLN C  1 143 ? 454.371 56.318  438.144 1.00 24.04  ?  200 GLN C C   1 
ATOM   2918  O O   . GLN C  1 143 ? 454.854 56.231  437.013 1.00 25.52  ?  200 GLN C O   1 
ATOM   2919  C CB  . GLN C  1 143 ? 451.898 55.912  438.240 1.00 22.37  ?  200 GLN C CB  1 
ATOM   2920  C CG  . GLN C  1 143 ? 452.186 54.608  438.975 1.00 22.59  ?  200 GLN C CG  1 
ATOM   2921  C CD  . GLN C  1 143 ? 450.992 53.678  439.036 1.00 29.89  ?  200 GLN C CD  1 
ATOM   2922  O OE1 . GLN C  1 143 ? 451.014 52.586  438.468 1.00 34.85  ?  200 GLN C OE1 1 
ATOM   2923  N NE2 . GLN C  1 143 ? 449.944 54.100  439.731 1.00 30.72  ?  200 GLN C NE2 1 
ATOM   2924  N N   . GLY C  1 144 ? 454.987 55.867  439.235 1.00 19.87  ?  201 GLY C N   1 
ATOM   2925  C CA  . GLY C  1 144 ? 456.163 55.026  439.126 1.00 20.52  ?  201 GLY C CA  1 
ATOM   2926  C C   . GLY C  1 144 ? 456.420 54.272  440.407 1.00 23.39  ?  201 GLY C C   1 
ATOM   2927  O O   . GLY C  1 144 ? 456.068 54.729  441.499 1.00 28.30  ?  201 GLY C O   1 
ATOM   2928  N N   . ARG C  1 145 ? 457.049 53.106  440.272 1.00 43.00  ?  202 ARG C N   1 
ATOM   2929  C CA  . ARG C  1 145 ? 457.443 52.301  441.419 1.00 49.58  ?  202 ARG C CA  1 
ATOM   2930  C C   . ARG C  1 145 ? 458.521 51.322  440.978 1.00 49.52  ?  202 ARG C C   1 
ATOM   2931  O O   . ARG C  1 145 ? 458.706 51.072  439.784 1.00 46.91  ?  202 ARG C O   1 
ATOM   2932  C CB  . ARG C  1 145 ? 456.247 51.565  442.037 1.00 55.54  ?  202 ARG C CB  1 
ATOM   2933  C CG  . ARG C  1 145 ? 455.454 50.716  441.062 1.00 56.50  ?  202 ARG C CG  1 
ATOM   2934  C CD  . ARG C  1 145 ? 453.971 50.703  441.421 1.00 58.67  ?  202 ARG C CD  1 
ATOM   2935  N NE  . ARG C  1 145 ? 453.667 49.870  442.579 1.00 57.17  ?  202 ARG C NE  1 
ATOM   2936  C CZ  . ARG C  1 145 ? 453.121 48.660  442.500 1.00 73.06  ?  202 ARG C CZ  1 
ATOM   2937  N NH1 . ARG C  1 145 ? 452.818 48.146  441.315 1.00 74.98  ?  202 ARG C NH1 1 
ATOM   2938  N NH2 . ARG C  1 145 ? 452.875 47.966  443.602 1.00 78.92  ?  202 ARG C NH2 1 
ATOM   2939  N N   . LEU C  1 146 ? 459.235 50.778  441.959 1.00 26.33  ?  203 LEU C N   1 
ATOM   2940  C CA  . LEU C  1 146 ? 460.263 49.790  441.673 1.00 22.62  ?  203 LEU C CA  1 
ATOM   2941  C C   . LEU C  1 146 ? 459.634 48.460  441.269 1.00 23.62  ?  203 LEU C C   1 
ATOM   2942  O O   . LEU C  1 146 ? 458.555 48.087  441.739 1.00 22.56  ?  203 LEU C O   1 
ATOM   2943  C CB  . LEU C  1 146 ? 461.167 49.590  442.890 1.00 17.11  ?  203 LEU C CB  1 
ATOM   2944  C CG  . LEU C  1 146 ? 461.969 50.813  443.330 1.00 21.05  ?  203 LEU C CG  1 
ATOM   2945  C CD1 . LEU C  1 146 ? 462.698 50.536  444.634 1.00 32.82  ?  203 LEU C CD1 1 
ATOM   2946  C CD2 . LEU C  1 146 ? 462.946 51.222  442.242 1.00 21.17  ?  203 LEU C CD2 1 
ATOM   2947  N N   . LEU C  1 147 ? 460.325 47.741  440.388 1.00 21.29  ?  204 LEU C N   1 
ATOM   2948  C CA  . LEU C  1 147 ? 459.848 46.462  439.888 1.00 23.58  ?  204 LEU C CA  1 
ATOM   2949  C C   . LEU C  1 147 ? 461.023 45.522  439.667 1.00 27.68  ?  204 LEU C C   1 
ATOM   2950  O O   . LEU C  1 147 ? 462.129 45.953  439.331 1.00 24.80  ?  204 LEU C O   1 
ATOM   2951  C CB  . LEU C  1 147 ? 459.067 46.618  438.573 1.00 20.05  ?  204 LEU C CB  1 
ATOM   2952  C CG  . LEU C  1 147 ? 457.662 47.218  438.646 1.00 23.44  ?  204 LEU C CG  1 
ATOM   2953  C CD1 . LEU C  1 147 ? 457.076 47.368  437.251 1.00 18.86  ?  204 LEU C CD1 1 
ATOM   2954  C CD2 . LEU C  1 147 ? 456.759 46.361  439.519 1.00 27.09  ?  204 LEU C CD2 1 
ATOM   2955  N N   . HIS C  1 148 ? 460.772 44.231  439.864 1.00 49.98  ?  205 HIS C N   1 
ATOM   2956  C CA  . HIS C  1 148 ? 461.722 43.192  439.495 1.00 46.84  ?  205 HIS C CA  1 
ATOM   2957  C C   . HIS C  1 148 ? 461.516 42.833  438.031 1.00 51.53  ?  205 HIS C C   1 
ATOM   2958  O O   . HIS C  1 148 ? 460.386 42.579  437.602 1.00 54.42  ?  205 HIS C O   1 
ATOM   2959  C CB  . HIS C  1 148 ? 461.549 41.948  440.367 1.00 56.69  ?  205 HIS C CB  1 
ATOM   2960  C CG  . HIS C  1 148 ? 461.867 42.169  441.813 1.00 67.28  ?  205 HIS C CG  1 
ATOM   2961  N ND1 . HIS C  1 148 ? 463.143 42.055  442.320 1.00 71.54  ?  205 HIS C ND1 1 
ATOM   2962  C CD2 . HIS C  1 148 ? 461.070 42.479  442.862 1.00 75.94  ?  205 HIS C CD2 1 
ATOM   2963  C CE1 . HIS C  1 148 ? 463.121 42.295  443.618 1.00 75.81  ?  205 HIS C CE1 1 
ATOM   2964  N NE2 . HIS C  1 148 ? 461.876 42.556  443.973 1.00 78.21  ?  205 HIS C NE2 1 
ATOM   2965  N N   . LEU C  1 149 ? 462.604 42.816  437.267 1.00 32.61  ?  206 LEU C N   1 
ATOM   2966  C CA  . LEU C  1 149 ? 462.558 42.475  435.851 1.00 38.61  ?  206 LEU C CA  1 
ATOM   2967  C C   . LEU C  1 149 ? 463.492 41.302  435.594 1.00 34.52  ?  206 LEU C C   1 
ATOM   2968  O O   . LEU C  1 149 ? 464.704 41.410  435.807 1.00 30.36  ?  206 LEU C O   1 
ATOM   2969  C CB  . LEU C  1 149 ? 462.937 43.676  434.981 1.00 35.63  ?  206 LEU C CB  1 
ATOM   2970  C CG  . LEU C  1 149 ? 461.942 44.839  434.999 1.00 32.14  ?  206 LEU C CG  1 
ATOM   2971  C CD1 . LEU C  1 149 ? 462.299 45.869  433.941 1.00 34.30  ?  206 LEU C CD1 1 
ATOM   2972  C CD2 . LEU C  1 149 ? 460.518 44.338  434.805 1.00 30.28  ?  206 LEU C CD2 1 
ATOM   2973  N N   . SER C  1 150 ? 462.922 40.186  435.147 1.00 66.85  ?  207 SER C N   1 
ATOM   2974  C CA  . SER C  1 150 ? 463.707 39.007  434.823 1.00 67.07  ?  207 SER C CA  1 
ATOM   2975  C C   . SER C  1 150 ? 464.549 39.250  433.574 1.00 64.67  ?  207 SER C C   1 
ATOM   2976  O O   . SER C  1 150 ? 464.286 40.156  432.779 1.00 67.02  ?  207 SER C O   1 
ATOM   2977  C CB  . SER C  1 150 ? 462.796 37.798  434.612 1.00 74.33  ?  207 SER C CB  1 
ATOM   2978  O OG  . SER C  1 150 ? 461.937 37.604  435.722 1.00 79.27  ?  207 SER C OG  1 
ATOM   2979  N N   . ALA C  1 151 ? 465.586 38.430  433.416 1.00 61.33  ?  208 ALA C N   1 
ATOM   2980  C CA  . ALA C  1 151 ? 466.424 38.513  432.228 1.00 59.26  ?  208 ALA C CA  1 
ATOM   2981  C C   . ALA C  1 151 ? 465.597 38.233  430.980 1.00 60.42  ?  208 ALA C C   1 
ATOM   2982  O O   . ALA C  1 151 ? 464.827 37.268  430.932 1.00 62.13  ?  208 ALA C O   1 
ATOM   2983  C CB  . ALA C  1 151 ? 467.586 37.525  432.328 1.00 59.24  ?  208 ALA C CB  1 
ATOM   2984  N N   . GLY C  1 152 ? 465.752 39.086  429.971 1.00 78.75  ?  209 GLY C N   1 
ATOM   2985  C CA  . GLY C  1 152 ? 464.969 38.944  428.760 1.00 81.37  ?  209 GLY C CA  1 
ATOM   2986  C C   . GLY C  1 152 ? 463.514 39.320  428.907 1.00 80.06  ?  209 GLY C C   1 
ATOM   2987  O O   . GLY C  1 152 ? 462.683 38.851  428.126 1.00 90.76  ?  209 GLY C O   1 
ATOM   2988  N N   . GLN C  1 153 ? 463.179 40.153  429.890 1.00 53.55  ?  210 GLN C N   1 
ATOM   2989  C CA  . GLN C  1 153 ? 461.797 40.553  430.100 1.00 53.88  ?  210 GLN C CA  1 
ATOM   2990  C C   . GLN C  1 153 ? 461.338 41.491  428.989 1.00 49.93  ?  210 GLN C C   1 
ATOM   2991  O O   . GLN C  1 153 ? 462.110 42.298  428.466 1.00 53.72  ?  210 GLN C O   1 
ATOM   2992  C CB  . GLN C  1 153 ? 461.639 41.243  431.455 1.00 47.34  ?  210 GLN C CB  1 
ATOM   2993  C CG  . GLN C  1 153 ? 460.227 41.223  432.019 1.00 50.20  ?  210 GLN C CG  1 
ATOM   2994  C CD  . GLN C  1 153 ? 460.027 40.123  433.047 1.00 57.53  ?  210 GLN C CD  1 
ATOM   2995  O OE1 . GLN C  1 153 ? 460.541 40.203  434.163 1.00 57.04  ?  210 GLN C OE1 1 
ATOM   2996  N NE2 . GLN C  1 153 ? 459.279 39.093  432.677 1.00 59.67  ?  210 GLN C NE2 1 
ATOM   2997  N N   . ARG C  1 154 ? 460.063 41.378  428.631 1.00 47.72  ?  211 ARG C N   1 
ATOM   2998  C CA  . ARG C  1 154 ? 459.444 42.242  427.637 1.00 53.91  ?  211 ARG C CA  1 
ATOM   2999  C C   . ARG C  1 154 ? 458.338 43.043  428.308 1.00 56.30  ?  211 ARG C C   1 
ATOM   3000  O O   . ARG C  1 154 ? 457.526 42.483  429.052 1.00 58.34  ?  211 ARG C O   1 
ATOM   3001  C CB  . ARG C  1 154 ? 458.885 41.434  426.461 1.00 65.34  ?  211 ARG C CB  1 
ATOM   3002  C CG  . ARG C  1 154 ? 459.918 40.615  425.695 1.00 60.36  ?  211 ARG C CG  1 
ATOM   3003  C CD  . ARG C  1 154 ? 460.067 39.210  426.263 1.00 66.77  ?  211 ARG C CD  1 
ATOM   3004  N NE  . ARG C  1 154 ? 458.850 38.417  426.104 1.00 77.73  ?  211 ARG C NE  1 
ATOM   3005  C CZ  . ARG C  1 154 ? 458.630 37.579  425.097 1.00 78.72  ?  211 ARG C CZ  1 
ATOM   3006  N NH1 . ARG C  1 154 ? 459.547 37.420  424.152 1.00 69.46  ?  211 ARG C NH1 1 
ATOM   3007  N NH2 . ARG C  1 154 ? 457.493 36.898  425.034 1.00 78.10  ?  211 ARG C NH2 1 
ATOM   3008  N N   . LEU C  1 155 ? 458.309 44.349  428.047 1.00 31.97  ?  212 LEU C N   1 
ATOM   3009  C CA  . LEU C  1 155 ? 457.386 45.267  428.706 1.00 29.67  ?  212 LEU C CA  1 
ATOM   3010  C C   . LEU C  1 155 ? 456.550 45.969  427.644 1.00 23.43  ?  212 LEU C C   1 
ATOM   3011  O O   . LEU C  1 155 ? 457.080 46.745  426.842 1.00 28.62  ?  212 LEU C O   1 
ATOM   3012  C CB  . LEU C  1 155 ? 458.136 46.289  429.563 1.00 27.30  ?  212 LEU C CB  1 
ATOM   3013  C CG  . LEU C  1 155 ? 458.936 45.831  430.787 1.00 26.20  ?  212 LEU C CG  1 
ATOM   3014  C CD1 . LEU C  1 155 ? 460.252 45.175  430.399 1.00 29.12  ?  212 LEU C CD1 1 
ATOM   3015  C CD2 . LEU C  1 155 ? 459.183 47.005  431.724 1.00 26.38  ?  212 LEU C CD2 1 
ATOM   3016  N N   . GLY C  1 156 ? 455.244 45.702  427.642 1.00 38.23  ?  213 GLY C N   1 
ATOM   3017  C CA  . GLY C  1 156 ? 454.319 46.395  426.776 1.00 40.40  ?  213 GLY C CA  1 
ATOM   3018  C C   . GLY C  1 156 ? 453.503 47.435  427.532 1.00 39.26  ?  213 GLY C C   1 
ATOM   3019  O O   . GLY C  1 156 ? 453.508 47.503  428.757 1.00 39.86  ?  213 GLY C O   1 
ATOM   3020  N N   . VAL C  1 157 ? 452.792 48.260  426.763 1.00 28.26  ?  214 VAL C N   1 
ATOM   3021  C CA  . VAL C  1 157 ? 451.909 49.284  427.314 1.00 25.09  ?  214 VAL C CA  1 
ATOM   3022  C C   . VAL C  1 157 ? 450.606 49.254  426.528 1.00 25.27  ?  214 VAL C C   1 
ATOM   3023  O O   . VAL C  1 157 ? 450.616 49.390  425.300 1.00 31.86  ?  214 VAL C O   1 
ATOM   3024  C CB  . VAL C  1 157 ? 452.529 50.692  427.262 1.00 22.38  ?  214 VAL C CB  1 
ATOM   3025  C CG1 . VAL C  1 157 ? 451.513 51.730  427.713 1.00 23.37  ?  214 VAL C CG1 1 
ATOM   3026  C CG2 . VAL C  1 157 ? 453.776 50.758  428.130 1.00 25.82  ?  214 VAL C CG2 1 
ATOM   3027  N N   . HIS C  1 158 ? 449.489 49.080  427.227 1.00 38.38  ?  215 HIS C N   1 
ATOM   3028  C CA  . HIS C  1 158 ? 448.171 49.020  426.608 1.00 43.54  ?  215 HIS C CA  1 
ATOM   3029  C C   . HIS C  1 158 ? 447.342 50.220  427.040 1.00 43.62  ?  215 HIS C C   1 
ATOM   3030  O O   . HIS C  1 158 ? 447.252 50.522  428.235 1.00 43.90  ?  215 HIS C O   1 
ATOM   3031  C CB  . HIS C  1 158 ? 447.453 47.719  426.971 1.00 44.20  ?  215 HIS C CB  1 
ATOM   3032  C CG  . HIS C  1 158 ? 447.915 46.536  426.181 1.00 49.47  ?  215 HIS C CG  1 
ATOM   3033  N ND1 . HIS C  1 158 ? 449.203 46.048  426.254 1.00 52.58  ?  215 HIS C ND1 1 
ATOM   3034  C CD2 . HIS C  1 158 ? 447.265 45.746  425.294 1.00 49.51  ?  215 HIS C CD2 1 
ATOM   3035  C CE1 . HIS C  1 158 ? 449.323 45.007  425.449 1.00 51.32  ?  215 HIS C CE1 1 
ATOM   3036  N NE2 . HIS C  1 158 ? 448.162 44.803  424.856 1.00 58.27  ?  215 HIS C NE2 1 
ATOM   3037  N N   . LEU C  1 159 ? 446.739 50.897  426.066 1.00 18.91  ?  216 LEU C N   1 
ATOM   3038  C CA  . LEU C  1 159 ? 445.881 52.050  426.312 1.00 16.44  ?  216 LEU C CA  1 
ATOM   3039  C C   . LEU C  1 159 ? 444.433 51.602  426.159 1.00 25.56  ?  216 LEU C C   1 
ATOM   3040  O O   . LEU C  1 159 ? 443.986 51.287  425.051 1.00 37.03  ?  216 LEU C O   1 
ATOM   3041  C CB  . LEU C  1 159 ? 446.217 53.189  425.351 1.00 13.77  ?  216 LEU C CB  1 
ATOM   3042  C CG  . LEU C  1 159 ? 445.603 54.572  425.590 1.00 17.07  ?  216 LEU C CG  1 
ATOM   3043  C CD1 . LEU C  1 159 ? 446.512 55.644  425.019 1.00 13.97  ?  216 LEU C CD1 1 
ATOM   3044  C CD2 . LEU C  1 159 ? 444.214 54.688  424.977 1.00 22.49  ?  216 LEU C CD2 1 
ATOM   3045  N N   . HIS C  1 160 ? 443.700 51.574  427.270 1.00 48.04  ?  217 HIS C N   1 
ATOM   3046  C CA  . HIS C  1 160 ? 442.285 51.221  427.278 1.00 51.75  ?  217 HIS C CA  1 
ATOM   3047  C C   . HIS C  1 160 ? 441.502 52.423  427.788 1.00 50.17  ?  217 HIS C C   1 
ATOM   3048  O O   . HIS C  1 160 ? 441.638 52.805  428.955 1.00 55.70  ?  217 HIS C O   1 
ATOM   3049  C CB  . HIS C  1 160 ? 442.025 49.988  428.142 1.00 51.39  ?  217 HIS C CB  1 
ATOM   3050  C CG  . HIS C  1 160 ? 440.578 49.620  428.244 1.00 64.02  ?  217 HIS C CG  1 
ATOM   3051  N ND1 . HIS C  1 160 ? 439.731 50.177  429.178 1.00 59.49  ?  217 HIS C ND1 1 
ATOM   3052  C CD2 . HIS C  1 160 ? 439.825 48.753  427.524 1.00 70.59  ?  217 HIS C CD2 1 
ATOM   3053  C CE1 . HIS C  1 160 ? 438.521 49.668  429.031 1.00 67.27  ?  217 HIS C CE1 1 
ATOM   3054  N NE2 . HIS C  1 160 ? 438.551 48.801  428.035 1.00 79.06  ?  217 HIS C NE2 1 
ATOM   3055  N N   . THR C  1 161 ? 440.685 53.015  426.921 1.00 20.49  ?  218 THR C N   1 
ATOM   3056  C CA  . THR C  1 161 ? 439.945 54.226  427.244 1.00 22.45  ?  218 THR C CA  1 
ATOM   3057  C C   . THR C  1 161 ? 438.449 53.965  427.154 1.00 29.47  ?  218 THR C C   1 
ATOM   3058  O O   . THR C  1 161 ? 437.971 53.367  426.182 1.00 30.81  ?  218 THR C O   1 
ATOM   3059  C CB  . THR C  1 161 ? 440.339 55.381  426.316 1.00 20.34  ?  218 THR C CB  1 
ATOM   3060  O OG1 . THR C  1 161 ? 439.438 56.480  426.505 1.00 26.01  ?  218 THR C OG1 1 
ATOM   3061  C CG2 . THR C  1 161 ? 440.306 54.947  424.859 1.00 22.64  ?  218 THR C CG2 1 
ATOM   3062  N N   . GLU C  1 162 ? 437.718 54.400  428.176 1.00 39.61  ?  219 GLU C N   1 
ATOM   3063  C CA  . GLU C  1 162 ? 436.259 54.438  428.166 1.00 39.62  ?  219 GLU C CA  1 
ATOM   3064  C C   . GLU C  1 162 ? 435.844 55.901  428.226 1.00 38.13  ?  219 GLU C C   1 
ATOM   3065  O O   . GLU C  1 162 ? 436.053 56.570  429.244 1.00 38.88  ?  219 GLU C O   1 
ATOM   3066  C CB  . GLU C  1 162 ? 435.667 53.649  429.332 1.00 54.39  ?  219 GLU C CB  1 
ATOM   3067  C CG  . GLU C  1 162 ? 435.646 52.142  429.131 1.00 64.66  ?  219 GLU C CG  1 
ATOM   3068  C CD  . GLU C  1 162 ? 434.645 51.453  430.039 1.00 77.69  ?  219 GLU C CD  1 
ATOM   3069  O OE1 . GLU C  1 162 ? 433.441 51.447  429.703 1.00 66.62  ?  219 GLU C OE1 1 
ATOM   3070  O OE2 . GLU C  1 162 ? 435.059 50.920  431.090 1.00 95.29  -1 219 GLU C OE2 1 
ATOM   3071  N N   . ALA C  1 163 ? 435.264 56.396  427.137 1.00 34.00  ?  220 ALA C N   1 
ATOM   3072  C CA  . ALA C  1 163 ? 434.896 57.799  427.035 1.00 31.66  ?  220 ALA C CA  1 
ATOM   3073  C C   . ALA C  1 163 ? 433.615 57.911  426.221 1.00 33.93  ?  220 ALA C C   1 
ATOM   3074  O O   . ALA C  1 163 ? 433.018 56.907  425.820 1.00 38.38  ?  220 ALA C O   1 
ATOM   3075  C CB  . ALA C  1 163 ? 436.030 58.619  426.412 1.00 30.72  ?  220 ALA C CB  1 
ATOM   3076  N N   . ARG C  1 164 ? 433.190 59.150  425.982 1.00 56.34  ?  221 ARG C N   1 
ATOM   3077  C CA  . ARG C  1 164 ? 431.998 59.414  425.169 1.00 61.97  ?  221 ARG C CA  1 
ATOM   3078  C C   . ARG C  1 164 ? 432.369 59.486  423.691 1.00 67.81  ?  221 ARG C C   1 
ATOM   3079  O O   . ARG C  1 164 ? 432.013 58.603  422.905 1.00 76.88  ?  221 ARG C O   1 
ATOM   3080  C CB  . ARG C  1 164 ? 431.315 60.703  425.627 1.00 60.14  ?  221 ARG C CB  1 
ATOM   3081  C CG  . ARG C  1 164 ? 430.426 60.544  426.847 1.00 71.44  ?  221 ARG C CG  1 
ATOM   3082  C CD  . ARG C  1 164 ? 429.557 61.777  427.032 1.00 75.14  ?  221 ARG C CD  1 
ATOM   3083  N NE  . ARG C  1 164 ? 428.466 61.548  427.974 1.00 71.43  ?  221 ARG C NE  1 
ATOM   3084  C CZ  . ARG C  1 164 ? 427.464 62.399  428.171 1.00 74.47  ?  221 ARG C CZ  1 
ATOM   3085  N NH1 . ARG C  1 164 ? 427.416 63.535  427.488 1.00 58.50  ?  221 ARG C NH1 1 
ATOM   3086  N NH2 . ARG C  1 164 ? 426.510 62.113  429.046 1.00 84.00  ?  221 ARG C NH2 1 
ATOM   3087  N N   . ALA C  1 165 ? 433.088 60.540  423.303 1.00 68.20  ?  222 ALA C N   1 
ATOM   3088  C CA  . ALA C  1 165 ? 433.410 60.742  421.896 1.00 75.12  ?  222 ALA C CA  1 
ATOM   3089  C C   . ALA C  1 165 ? 434.546 59.838  421.436 1.00 83.17  ?  222 ALA C C   1 
ATOM   3090  O O   . ALA C  1 165 ? 434.512 59.324  420.312 1.00 87.34  ?  222 ALA C O   1 
ATOM   3091  C CB  . ALA C  1 165 ? 433.765 62.209  421.650 1.00 65.18  ?  222 ALA C CB  1 
ATOM   3092  N N   . ARG C  1 166 ? 435.571 59.669  422.279 1.00 42.97  ?  223 ARG C N   1 
ATOM   3093  C CA  . ARG C  1 166 ? 436.814 58.961  421.969 1.00 29.63  ?  223 ARG C CA  1 
ATOM   3094  C C   . ARG C  1 166 ? 437.621 59.755  420.946 1.00 42.56  ?  223 ARG C C   1 
ATOM   3095  O O   . ARG C  1 166 ? 438.826 59.535  420.780 1.00 55.65  ?  223 ARG C O   1 
ATOM   3096  C CB  . ARG C  1 166 ? 436.531 57.533  421.481 1.00 34.32  ?  223 ARG C CB  1 
ATOM   3097  C CG  . ARG C  1 166 ? 437.768 56.706  421.159 1.00 36.13  ?  223 ARG C CG  1 
ATOM   3098  C CD  . ARG C  1 166 ? 437.426 55.237  420.996 1.00 33.42  ?  223 ARG C CD  1 
ATOM   3099  N NE  . ARG C  1 166 ? 437.169 54.596  422.282 1.00 40.58  ?  223 ARG C NE  1 
ATOM   3100  C CZ  . ARG C  1 166 ? 436.824 53.321  422.426 1.00 48.67  ?  223 ARG C CZ  1 
ATOM   3101  N NH1 . ARG C  1 166 ? 436.693 52.543  421.360 1.00 49.73  ?  223 ARG C NH1 1 
ATOM   3102  N NH2 . ARG C  1 166 ? 436.612 52.822  423.636 1.00 40.56  ?  223 ARG C NH2 1 
ATOM   3103  N N   . HIS C  1 167 ? 436.971 60.704  420.283 1.00 41.82  ?  224 HIS C N   1 
ATOM   3104  C CA  . HIS C  1 167 ? 437.635 61.801  419.609 1.00 39.14  ?  224 HIS C CA  1 
ATOM   3105  C C   . HIS C  1 167 ? 437.582 63.004  420.548 1.00 40.06  ?  224 HIS C C   1 
ATOM   3106  O O   . HIS C  1 167 ? 437.198 62.879  421.716 1.00 39.43  ?  224 HIS C O   1 
ATOM   3107  C CB  . HIS C  1 167 ? 436.995 62.072  418.244 1.00 35.76  ?  224 HIS C CB  1 
ATOM   3108  C CG  . HIS C  1 167 ? 435.578 62.553  418.315 1.00 39.64  ?  224 HIS C CG  1 
ATOM   3109  N ND1 . HIS C  1 167 ? 435.248 63.860  418.601 1.00 37.89  ?  224 HIS C ND1 1 
ATOM   3110  C CD2 . HIS C  1 167 ? 434.407 61.902  418.123 1.00 41.80  ?  224 HIS C CD2 1 
ATOM   3111  C CE1 . HIS C  1 167 ? 433.934 63.993  418.588 1.00 38.30  ?  224 HIS C CE1 1 
ATOM   3112  N NE2 . HIS C  1 167 ? 433.399 62.820  418.301 1.00 40.43  ?  224 HIS C NE2 1 
ATOM   3113  N N   . ALA C  1 168 ? 438.003 64.168  420.052 1.00 49.43  ?  225 ALA C N   1 
ATOM   3114  C CA  . ALA C  1 168 ? 438.072 65.397  420.840 1.00 44.67  ?  225 ALA C CA  1 
ATOM   3115  C C   . ALA C  1 168 ? 439.118 65.284  421.945 1.00 44.05  ?  225 ALA C C   1 
ATOM   3116  O O   . ALA C  1 168 ? 439.399 66.264  422.639 1.00 49.38  ?  225 ALA C O   1 
ATOM   3117  C CB  . ALA C  1 168 ? 436.704 65.760  421.430 1.00 40.52  ?  225 ALA C CB  1 
ATOM   3118  N N   . TRP C  1 169 ? 439.690 64.095  422.122 1.00 28.81  ?  226 TRP C N   1 
ATOM   3119  C CA  . TRP C  1 169 ? 440.789 63.880  423.055 1.00 29.77  ?  226 TRP C CA  1 
ATOM   3120  C C   . TRP C  1 169 ? 441.829 63.005  422.378 1.00 32.68  ?  226 TRP C C   1 
ATOM   3121  O O   . TRP C  1 169 ? 441.532 61.868  421.999 1.00 36.72  ?  226 TRP C O   1 
ATOM   3122  C CB  . TRP C  1 169 ? 440.303 63.232  424.354 1.00 27.81  ?  226 TRP C CB  1 
ATOM   3123  C CG  . TRP C  1 169 ? 439.610 64.182  425.274 1.00 28.11  ?  226 TRP C CG  1 
ATOM   3124  C CD1 . TRP C  1 169 ? 438.267 64.291  425.484 1.00 31.24  ?  226 TRP C CD1 1 
ATOM   3125  C CD2 . TRP C  1 169 ? 440.227 65.170  426.106 1.00 26.94  ?  226 TRP C CD2 1 
ATOM   3126  N NE1 . TRP C  1 169 ? 438.010 65.282  426.401 1.00 29.51  ?  226 TRP C NE1 1 
ATOM   3127  C CE2 . TRP C  1 169 ? 439.198 65.838  426.797 1.00 28.14  ?  226 TRP C CE2 1 
ATOM   3128  C CE3 . TRP C  1 169 ? 441.552 65.553  426.335 1.00 30.82  ?  226 TRP C CE3 1 
ATOM   3129  C CZ2 . TRP C  1 169 ? 439.451 66.865  427.702 1.00 33.67  ?  226 TRP C CZ2 1 
ATOM   3130  C CZ3 . TRP C  1 169 ? 441.802 66.573  427.233 1.00 34.33  ?  226 TRP C CZ3 1 
ATOM   3131  C CH2 . TRP C  1 169 ? 440.756 67.218  427.905 1.00 36.91  ?  226 TRP C CH2 1 
ATOM   3132  N N   . GLN C  1 170 ? 443.040 63.532  422.228 1.00 24.85  ?  227 GLN C N   1 
ATOM   3133  C CA  . GLN C  1 170 ? 444.154 62.793  421.657 1.00 23.27  ?  227 GLN C CA  1 
ATOM   3134  C C   . GLN C  1 170 ? 445.352 62.906  422.585 1.00 27.74  ?  227 GLN C C   1 
ATOM   3135  O O   . GLN C  1 170 ? 445.440 63.819  423.411 1.00 35.44  ?  227 GLN C O   1 
ATOM   3136  C CB  . GLN C  1 170 ? 444.527 63.308  420.262 1.00 24.83  ?  227 GLN C CB  1 
ATOM   3137  C CG  . GLN C  1 170 ? 443.406 63.227  419.244 1.00 28.99  ?  227 GLN C CG  1 
ATOM   3138  C CD  . GLN C  1 170 ? 443.790 63.845  417.917 1.00 29.62  ?  227 GLN C CD  1 
ATOM   3139  O OE1 . GLN C  1 170 ? 444.912 64.322  417.744 1.00 22.89  ?  227 GLN C OE1 1 
ATOM   3140  N NE2 . GLN C  1 170 ? 442.857 63.847  416.972 1.00 33.62  ?  227 GLN C NE2 1 
ATOM   3141  N N   . LEU C  1 171 ? 446.277 61.963  422.443 1.00 14.78  ?  228 LEU C N   1 
ATOM   3142  C CA  . LEU C  1 171 ? 447.502 62.013  423.225 1.00 17.71  ?  228 LEU C CA  1 
ATOM   3143  C C   . LEU C  1 171 ? 448.346 63.202  422.787 1.00 15.20  ?  228 LEU C C   1 
ATOM   3144  O O   . LEU C  1 171 ? 448.504 63.457  421.590 1.00 18.82  ?  228 LEU C O   1 
ATOM   3145  C CB  . LEU C  1 171 ? 448.296 60.717  423.064 1.00 21.79  ?  228 LEU C CB  1 
ATOM   3146  C CG  . LEU C  1 171 ? 447.576 59.411  423.406 1.00 20.67  ?  228 LEU C CG  1 
ATOM   3147  C CD1 . LEU C  1 171 ? 448.566 58.256  423.423 1.00 18.68  ?  228 LEU C CD1 1 
ATOM   3148  C CD2 . LEU C  1 171 ? 446.852 59.522  424.738 1.00 20.30  ?  228 LEU C CD2 1 
ATOM   3149  N N   . THR C  1 172 ? 448.879 63.939  423.758 1.00 11.51  ?  229 THR C N   1 
ATOM   3150  C CA  . THR C  1 172 ? 449.784 65.036  423.442 1.00 15.97  ?  229 THR C CA  1 
ATOM   3151  C C   . THR C  1 172 ? 451.088 64.460  422.905 1.00 23.90  ?  229 THR C C   1 
ATOM   3152  O O   . THR C  1 172 ? 451.731 63.639  423.567 1.00 27.10  ?  229 THR C O   1 
ATOM   3153  C CB  . THR C  1 172 ? 450.037 65.897  424.675 1.00 15.81  ?  229 THR C CB  1 
ATOM   3154  O OG1 . THR C  1 172 ? 448.793 66.400  425.174 1.00 18.86  ?  229 THR C OG1 1 
ATOM   3155  C CG2 . THR C  1 172 ? 450.948 67.067  424.328 1.00 14.48  ?  229 THR C CG2 1 
ATOM   3156  N N   . GLN C  1 173 ? 451.474 64.885  421.707 1.00 30.53  ?  230 GLN C N   1 
ATOM   3157  C CA  . GLN C  1 173 ? 452.611 64.279  421.032 1.00 28.58  ?  230 GLN C CA  1 
ATOM   3158  C C   . GLN C  1 173 ? 453.905 64.643  421.749 1.00 33.98  ?  230 GLN C C   1 
ATOM   3159  O O   . GLN C  1 173 ? 454.203 65.822  421.960 1.00 29.29  ?  230 GLN C O   1 
ATOM   3160  C CB  . GLN C  1 173 ? 452.649 64.724  419.572 1.00 32.70  ?  230 GLN C CB  1 
ATOM   3161  C CG  . GLN C  1 173 ? 451.422 64.285  418.786 1.00 31.16  ?  230 GLN C CG  1 
ATOM   3162  C CD  . GLN C  1 173 ? 451.251 65.040  417.485 1.00 41.72  ?  230 GLN C CD  1 
ATOM   3163  O OE1 . GLN C  1 173 ? 452.095 64.961  416.593 1.00 42.49  ?  230 GLN C OE1 1 
ATOM   3164  N NE2 . GLN C  1 173 ? 450.152 65.778  417.369 1.00 39.32  ?  230 GLN C NE2 1 
ATOM   3165  N N   . GLY C  1 174 ? 454.671 63.620  422.127 1.00 51.42  ?  231 GLY C N   1 
ATOM   3166  C CA  . GLY C  1 174 ? 455.877 63.804  422.901 1.00 52.04  ?  231 GLY C CA  1 
ATOM   3167  C C   . GLY C  1 174 ? 455.681 63.793  424.401 1.00 47.90  ?  231 GLY C C   1 
ATOM   3168  O O   . GLY C  1 174 ? 456.668 63.666  425.138 1.00 42.23  ?  231 GLY C O   1 
ATOM   3169  N N   . ALA C  1 175 ? 454.445 63.923  424.879 1.00 58.78  ?  232 ALA C N   1 
ATOM   3170  C CA  . ALA C  1 175 ? 454.156 63.953  426.306 1.00 58.54  ?  232 ALA C CA  1 
ATOM   3171  C C   . ALA C  1 175 ? 453.747 62.598  426.865 1.00 53.08  ?  232 ALA C C   1 
ATOM   3172  O O   . ALA C  1 175 ? 453.532 62.484  428.077 1.00 57.50  ?  232 ALA C O   1 
ATOM   3173  C CB  . ALA C  1 175 ? 453.059 64.980  426.599 1.00 67.33  ?  232 ALA C CB  1 
ATOM   3174  N N   . THR C  1 176 ? 453.631 61.572  426.027 1.00 29.73  ?  233 THR C N   1 
ATOM   3175  C CA  . THR C  1 176 ? 453.361 60.212  426.483 1.00 30.61  ?  233 THR C CA  1 
ATOM   3176  C C   . THR C  1 176 ? 454.687 59.462  426.465 1.00 27.38  ?  233 THR C C   1 
ATOM   3177  O O   . THR C  1 176 ? 455.224 59.162  425.394 1.00 30.11  ?  233 THR C O   1 
ATOM   3178  C CB  . THR C  1 176 ? 452.316 59.527  425.606 1.00 33.99  ?  233 THR C CB  1 
ATOM   3179  O OG1 . THR C  1 176 ? 451.173 60.379  425.466 1.00 30.60  ?  233 THR C OG1 1 
ATOM   3180  C CG2 . THR C  1 176 ? 451.881 58.209  426.231 1.00 27.51  ?  233 THR C CG2 1 
ATOM   3181  N N   . VAL C  1 177 ? 455.207 59.158  427.650 1.00 19.70  ?  234 VAL C N   1 
ATOM   3182  C CA  . VAL C  1 177 ? 456.588 58.722  427.812 1.00 19.93  ?  234 VAL C CA  1 
ATOM   3183  C C   . VAL C  1 177 ? 456.637 57.570  428.804 1.00 24.48  ?  234 VAL C C   1 
ATOM   3184  O O   . VAL C  1 177 ? 455.978 57.607  429.848 1.00 34.24  ?  234 VAL C O   1 
ATOM   3185  C CB  . VAL C  1 177 ? 457.483 59.891  428.279 1.00 19.22  ?  234 VAL C CB  1 
ATOM   3186  C CG1 . VAL C  1 177 ? 458.773 59.382  428.896 1.00 25.71  ?  234 VAL C CG1 1 
ATOM   3187  C CG2 . VAL C  1 177 ? 457.781 60.829  427.119 1.00 27.94  ?  234 VAL C CG2 1 
ATOM   3188  N N   . LEU C  1 178 ? 457.418 56.542  428.473 1.00 23.86  ?  235 LEU C N   1 
ATOM   3189  C CA  . LEU C  1 178 ? 457.724 55.453  429.396 1.00 21.39  ?  235 LEU C CA  1 
ATOM   3190  C C   . LEU C  1 178 ? 459.229 55.440  429.623 1.00 21.55  ?  235 LEU C C   1 
ATOM   3191  O O   . LEU C  1 178 ? 459.994 55.081  428.722 1.00 21.39  ?  235 LEU C O   1 
ATOM   3192  C CB  . LEU C  1 178 ? 457.246 54.112  428.840 1.00 24.71  ?  235 LEU C CB  1 
ATOM   3193  C CG  . LEU C  1 178 ? 457.699 52.880  429.625 1.00 26.63  ?  235 LEU C CG  1 
ATOM   3194  C CD1 . LEU C  1 178 ? 457.058 52.869  431.002 1.00 32.51  ?  235 LEU C CD1 1 
ATOM   3195  C CD2 . LEU C  1 178 ? 457.382 51.600  428.864 1.00 25.75  ?  235 LEU C CD2 1 
ATOM   3196  N N   . GLY C  1 179 ? 459.653 55.840  430.821 1.00 22.51  ?  236 GLY C N   1 
ATOM   3197  C CA  . GLY C  1 179 ? 461.049 55.806  431.190 1.00 20.09  ?  236 GLY C CA  1 
ATOM   3198  C C   . GLY C  1 179 ? 461.404 54.617  432.062 1.00 19.94  ?  236 GLY C C   1 
ATOM   3199  O O   . GLY C  1 179 ? 460.550 54.014  432.708 1.00 27.68  ?  236 GLY C O   1 
ATOM   3200  N N   . LEU C  1 180 ? 462.694 54.291  432.078 1.00 24.51  ?  237 LEU C N   1 
ATOM   3201  C CA  . LEU C  1 180 ? 463.214 53.220  432.914 1.00 20.83  ?  237 LEU C CA  1 
ATOM   3202  C C   . LEU C  1 180 ? 464.674 53.512  433.231 1.00 25.57  ?  237 LEU C C   1 
ATOM   3203  O O   . LEU C  1 180 ? 465.408 54.021  432.381 1.00 30.40  ?  237 LEU C O   1 
ATOM   3204  C CB  . LEU C  1 180 ? 463.065 51.864  432.213 1.00 20.84  ?  237 LEU C CB  1 
ATOM   3205  C CG  . LEU C  1 180 ? 463.593 50.592  432.877 1.00 27.92  ?  237 LEU C CG  1 
ATOM   3206  C CD1 . LEU C  1 180 ? 462.643 49.437  432.616 1.00 31.83  ?  237 LEU C CD1 1 
ATOM   3207  C CD2 . LEU C  1 180 ? 464.978 50.257  432.350 1.00 33.87  ?  237 LEU C CD2 1 
ATOM   3208  N N   . PHE C  1 181 ? 465.091 53.187  434.454 1.00 32.73  ?  238 PHE C N   1 
ATOM   3209  C CA  . PHE C  1 181 ? 466.507 53.223  434.792 1.00 40.05  ?  238 PHE C CA  1 
ATOM   3210  C C   . PHE C  1 181 ? 466.755 52.267  435.949 1.00 41.13  ?  238 PHE C C   1 
ATOM   3211  O O   . PHE C  1 181 ? 465.832 51.882  436.670 1.00 38.79  ?  238 PHE C O   1 
ATOM   3212  C CB  . PHE C  1 181 ? 466.995 54.644  435.121 1.00 39.40  ?  238 PHE C CB  1 
ATOM   3213  C CG  . PHE C  1 181 ? 466.428 55.223  436.385 1.00 38.82  ?  238 PHE C CG  1 
ATOM   3214  C CD1 . PHE C  1 181 ? 467.058 55.020  437.603 1.00 35.24  ?  238 PHE C CD1 1 
ATOM   3215  C CD2 . PHE C  1 181 ? 465.288 56.008  436.349 1.00 43.35  ?  238 PHE C CD2 1 
ATOM   3216  C CE1 . PHE C  1 181 ? 466.544 55.564  438.765 1.00 37.82  ?  238 PHE C CE1 1 
ATOM   3217  C CE2 . PHE C  1 181 ? 464.772 56.557  437.507 1.00 38.42  ?  238 PHE C CE2 1 
ATOM   3218  C CZ  . PHE C  1 181 ? 465.399 56.334  438.716 1.00 35.89  ?  238 PHE C CZ  1 
ATOM   3219  N N   . ARG C  1 182 ? 468.022 51.899  436.117 1.00 50.57  ?  239 ARG C N   1 
ATOM   3220  C CA  . ARG C  1 182 ? 468.401 50.808  437.002 1.00 53.46  ?  239 ARG C CA  1 
ATOM   3221  C C   . ARG C  1 182 ? 468.759 51.314  438.393 1.00 53.25  ?  239 ARG C C   1 
ATOM   3222  O O   . ARG C  1 182 ? 469.357 52.383  438.548 1.00 58.73  ?  239 ARG C O   1 
ATOM   3223  C CB  . ARG C  1 182 ? 469.580 50.032  436.412 1.00 60.62  ?  239 ARG C CB  1 
ATOM   3224  C CG  . ARG C  1 182 ? 469.906 48.745  437.150 1.00 60.30  ?  239 ARG C CG  1 
ATOM   3225  C CD  . ARG C  1 182 ? 470.753 47.820  436.296 1.00 54.91  ?  239 ARG C CD  1 
ATOM   3226  N NE  . ARG C  1 182 ? 470.918 46.511  436.918 1.00 57.39  ?  239 ARG C NE  1 
ATOM   3227  C CZ  . ARG C  1 182 ? 471.401 45.443  436.293 1.00 68.93  ?  239 ARG C CZ  1 
ATOM   3228  N NH1 . ARG C  1 182 ? 471.767 45.528  435.021 1.00 75.45  ?  239 ARG C NH1 1 
ATOM   3229  N NH2 . ARG C  1 182 ? 471.516 44.291  436.938 1.00 73.51  ?  239 ARG C NH2 1 
ATOM   3230  N N   . VAL C  1 183 ? 468.383 50.533  439.402 1.00 25.32  ?  240 VAL C N   1 
ATOM   3231  C CA  . VAL C  1 183 ? 468.700 50.817  440.799 1.00 26.20  ?  240 VAL C CA  1 
ATOM   3232  C C   . VAL C  1 183 ? 469.781 49.873  441.318 1.00 35.44  ?  240 VAL C C   1 
ATOM   3233  O O   . VAL C  1 183 ? 470.857 50.314  441.730 1.00 36.40  ?  240 VAL C O   1 
ATOM   3234  C CB  . VAL C  1 183 ? 467.433 50.758  441.680 1.00 22.66  ?  240 VAL C CB  1 
ATOM   3235  C CG1 . VAL C  1 183 ? 467.768 51.136  443.114 1.00 28.81  ?  240 VAL C CG1 1 
ATOM   3236  C CG2 . VAL C  1 183 ? 466.360 51.674  441.119 1.00 23.54  ?  240 VAL C CG2 1 
ATOM   3237  N N   . THR C  1 184 ? 469.504 48.574  441.327 1.00 68.96  ?  241 THR C N   1 
ATOM   3238  C CA  . THR C  1 184 ? 470.458 47.575  441.792 1.00 72.30  ?  241 THR C CA  1 
ATOM   3239  C C   . THR C  1 184 ? 471.756 47.663  440.998 1.00 80.96  ?  241 THR C C   1 
ATOM   3240  O O   . THR C  1 184 ? 471.737 47.480  439.770 1.00 84.16  ?  241 THR C O   1 
ATOM   3241  C CB  . THR C  1 184 ? 469.867 46.172  441.663 1.00 71.10  ?  241 THR C CB  1 
ATOM   3242  O OG1 . THR C  1 184 ? 468.757 46.033  442.558 1.00 76.43  ?  241 THR C OG1 1 
ATOM   3243  C CG2 . THR C  1 184 ? 470.913 45.118  441.993 1.00 82.29  ?  241 THR C CG2 1 
ATOM   3244  N N   . PRO C  1 185 ? 472.894 47.937  441.642 1.00 76.70  ?  242 PRO C N   1 
ATOM   3245  C CA  . PRO C  1 185 ? 474.160 48.045  440.901 1.00 72.94  ?  242 PRO C CA  1 
ATOM   3246  C C   . PRO C  1 185 ? 474.638 46.707  440.361 1.00 72.07  ?  242 PRO C C   1 
ATOM   3247  O O   . PRO C  1 185 ? 473.986 45.676  440.556 1.00 72.92  ?  242 PRO C O   1 
ATOM   3248  C CB  . PRO C  1 185 ? 475.134 48.605  441.948 1.00 77.79  ?  242 PRO C CB  1 
ATOM   3249  C CG  . PRO C  1 185 ? 474.266 49.162  443.043 1.00 76.74  ?  242 PRO C CG  1 
ATOM   3250  C CD  . PRO C  1 185 ? 473.051 48.296  443.060 1.00 71.75  ?  242 PRO C CD  1 
ATOM   3251  N N   . GLU C  1 186 ? 475.781 46.715  439.681 1.00 82.27  ?  243 GLU C N   1 
ATOM   3252  C CA  . GLU C  1 186 ? 476.352 45.495  439.125 1.00 87.21  ?  243 GLU C CA  1 
ATOM   3253  C C   . GLU C  1 186 ? 477.875 45.565  439.142 1.00 91.41  ?  243 GLU C C   1 
ATOM   3254  O O   . GLU C  1 186 ? 478.457 46.644  439.029 1.00 92.53  ?  243 GLU C O   1 
ATOM   3255  C CB  . GLU C  1 186 ? 475.841 45.262  437.699 1.00 85.28  ?  243 GLU C CB  1 
ATOM   3256  C CG  . GLU C  1 186 ? 475.937 43.818  437.218 1.00 79.59  ?  243 GLU C CG  1 
ATOM   3257  C CD  . GLU C  1 186 ? 477.257 43.500  436.537 1.00 88.00  ?  243 GLU C CD  1 
ATOM   3258  O OE1 . GLU C  1 186 ? 477.285 42.565  435.709 1.00 86.12  ?  243 GLU C OE1 1 
ATOM   3259  O OE2 . GLU C  1 186 ? 478.265 44.180  436.822 1.00 87.42  -1 243 GLU C OE2 1 
ATOM   3260  N N   . PRO D  2 4   ? 481.684 72.938  417.628 1.00 78.70  ?  27  PRO D N   1 
ATOM   3261  C CA  . PRO D  2 4   ? 481.786 71.815  416.693 1.00 74.50  ?  27  PRO D CA  1 
ATOM   3262  C C   . PRO D  2 4   ? 480.430 71.369  416.150 1.00 74.99  ?  27  PRO D C   1 
ATOM   3263  O O   . PRO D  2 4   ? 480.186 71.453  414.945 1.00 72.95  ?  27  PRO D O   1 
ATOM   3264  C CB  . PRO D  2 4   ? 482.425 70.713  417.546 1.00 71.03  ?  27  PRO D CB  1 
ATOM   3265  C CG  . PRO D  2 4   ? 482.130 71.096  418.996 1.00 74.37  ?  27  PRO D CG  1 
ATOM   3266  C CD  . PRO D  2 4   ? 481.521 72.477  419.018 1.00 72.32  ?  27  PRO D CD  1 
ATOM   3267  N N   . CYS D  2 5   ? 479.561 70.901  417.051 1.00 123.12 ?  28  CYS D N   1 
ATOM   3268  C CA  . CYS D  2 5   ? 478.227 70.452  416.667 1.00 121.87 ?  28  CYS D CA  1 
ATOM   3269  C C   . CYS D  2 5   ? 477.412 71.564  416.018 1.00 117.62 ?  28  CYS D C   1 
ATOM   3270  O O   . CYS D  2 5   ? 476.496 71.286  415.235 1.00 113.63 ?  28  CYS D O   1 
ATOM   3271  C CB  . CYS D  2 5   ? 477.500 69.917  417.901 1.00 115.74 ?  28  CYS D CB  1 
ATOM   3272  S SG  . CYS D  2 5   ? 475.796 69.380  417.646 1.00 141.93 ?  28  CYS D SG  1 
ATOM   3273  N N   . SER D  2 6   ? 477.736 72.824  416.320 1.00 111.54 ?  29  SER D N   1 
ATOM   3274  C CA  . SER D  2 6   ? 476.923 73.942  415.851 1.00 115.71 ?  29  SER D CA  1 
ATOM   3275  C C   . SER D  2 6   ? 476.958 74.086  414.334 1.00 112.33 ?  29  SER D C   1 
ATOM   3276  O O   . SER D  2 6   ? 476.019 74.633  413.743 1.00 107.86 ?  29  SER D O   1 
ATOM   3277  C CB  . SER D  2 6   ? 477.398 75.239  416.507 1.00 118.33 ?  29  SER D CB  1 
ATOM   3278  O OG  . SER D  2 6   ? 478.682 75.608  416.028 1.00 108.43 ?  29  SER D OG  1 
ATOM   3279  N N   . ASN D  2 7   ? 478.015 73.595  413.688 1.00 91.22  ?  30  ASN D N   1 
ATOM   3280  C CA  . ASN D  2 7   ? 478.299 73.923  412.294 1.00 97.47  ?  30  ASN D CA  1 
ATOM   3281  C C   . ASN D  2 7   ? 477.362 73.264  411.286 1.00 97.22  ?  30  ASN D C   1 
ATOM   3282  O O   . ASN D  2 7   ? 477.510 73.539  410.091 1.00 102.65 ?  30  ASN D O   1 
ATOM   3283  C CB  . ASN D  2 7   ? 479.747 73.563  411.955 1.00 110.82 ?  30  ASN D CB  1 
ATOM   3284  C CG  . ASN D  2 7   ? 480.724 74.656  412.342 1.00 116.70 ?  30  ASN D CG  1 
ATOM   3285  O OD1 . ASN D  2 7   ? 481.168 74.733  413.487 1.00 123.55 ?  30  ASN D OD1 1 
ATOM   3286  N ND2 . ASN D  2 7   ? 481.057 75.517  411.385 1.00 101.45 ?  30  ASN D ND2 1 
ATOM   3287  N N   . CYS D  2 8   ? 476.416 72.421  411.695 1.00 66.29  ?  31  CYS D N   1 
ATOM   3288  C CA  . CYS D  2 8   ? 475.697 71.846  410.568 1.00 60.31  ?  31  CYS D CA  1 
ATOM   3289  C C   . CYS D  2 8   ? 474.265 72.367  410.499 1.00 54.43  ?  31  CYS D C   1 
ATOM   3290  O O   . CYS D  2 8   ? 473.666 72.712  411.523 1.00 56.11  ?  31  CYS D O   1 
ATOM   3291  C CB  . CYS D  2 8   ? 475.692 70.312  410.628 1.00 66.03  ?  31  CYS D CB  1 
ATOM   3292  S SG  . CYS D  2 8   ? 475.558 69.563  412.248 1.00 58.34  ?  31  CYS D SG  1 
ATOM   3293  N N   . PRO D  2 9   ? 473.690 72.434  409.290 1.00 69.24  ?  32  PRO D N   1 
ATOM   3294  C CA  . PRO D  2 9   ? 472.484 73.245  409.087 1.00 77.01  ?  32  PRO D CA  1 
ATOM   3295  C C   . PRO D  2 9   ? 471.190 72.549  409.465 1.00 75.02  ?  32  PRO D C   1 
ATOM   3296  O O   . PRO D  2 9   ? 471.191 71.474  410.073 1.00 75.26  ?  32  PRO D O   1 
ATOM   3297  C CB  . PRO D  2 9   ? 472.529 73.536  407.583 1.00 85.72  ?  32  PRO D CB  1 
ATOM   3298  C CG  . PRO D  2 9   ? 473.129 72.292  407.016 1.00 76.94  ?  32  PRO D CG  1 
ATOM   3299  C CD  . PRO D  2 9   ? 474.159 71.838  408.025 1.00 72.84  ?  32  PRO D CD  1 
ATOM   3300  N N   . ALA D  2 10  ? 470.075 73.185  409.112 1.00 90.50  ?  33  ALA D N   1 
ATOM   3301  C CA  . ALA D  2 10  ? 468.767 72.577  409.288 1.00 86.51  ?  33  ALA D CA  1 
ATOM   3302  C C   . ALA D  2 10  ? 468.662 71.298  408.467 1.00 82.63  ?  33  ALA D C   1 
ATOM   3303  O O   . ALA D  2 10  ? 469.318 71.137  407.433 1.00 77.50  ?  33  ALA D O   1 
ATOM   3304  C CB  . ALA D  2 10  ? 467.666 73.555  408.878 1.00 89.54  ?  33  ALA D CB  1 
ATOM   3305  N N   . GLY D  2 11  ? 467.827 70.377  408.942 1.00 101.14 ?  34  GLY D N   1 
ATOM   3306  C CA  . GLY D  2 11  ? 467.702 69.072  408.339 1.00 103.32 ?  34  GLY D CA  1 
ATOM   3307  C C   . GLY D  2 11  ? 468.687 68.046  408.854 1.00 94.57  ?  34  GLY D C   1 
ATOM   3308  O O   . GLY D  2 11  ? 468.547 66.860  408.534 1.00 98.38  ?  34  GLY D O   1 
ATOM   3309  N N   . THR D  2 12  ? 469.679 68.465  409.636 1.00 71.92  ?  35  THR D N   1 
ATOM   3310  C CA  . THR D  2 12  ? 470.651 67.561  410.226 1.00 76.97  ?  35  THR D CA  1 
ATOM   3311  C C   . THR D  2 12  ? 470.782 67.857  411.712 1.00 79.18  ?  35  THR D C   1 
ATOM   3312  O O   . THR D  2 12  ? 470.520 68.970  412.175 1.00 83.35  ?  35  THR D O   1 
ATOM   3313  C CB  . THR D  2 12  ? 472.032 67.683  409.562 1.00 86.79  ?  35  THR D CB  1 
ATOM   3314  O OG1 . THR D  2 12  ? 472.585 68.977  409.836 1.00 90.23  ?  35  THR D OG1 1 
ATOM   3315  C CG2 . THR D  2 12  ? 471.932 67.485  408.057 1.00 95.28  ?  35  THR D CG2 1 
ATOM   3316  N N   . PHE D  2 13  ? 471.190 66.839  412.454 1.00 56.15  ?  36  PHE D N   1 
ATOM   3317  C CA  . PHE D  2 13  ? 471.576 66.966  413.850 1.00 51.62  ?  36  PHE D CA  1 
ATOM   3318  C C   . PHE D  2 13  ? 472.998 66.448  414.001 1.00 53.35  ?  36  PHE D C   1 
ATOM   3319  O O   . PHE D  2 13  ? 473.610 65.975  413.042 1.00 64.34  ?  36  PHE D O   1 
ATOM   3320  C CB  . PHE D  2 13  ? 470.619 66.191  414.763 1.00 51.80  ?  36  PHE D CB  1 
ATOM   3321  C CG  . PHE D  2 13  ? 470.849 64.704  414.759 1.00 44.42  ?  36  PHE D CG  1 
ATOM   3322  C CD1 . PHE D  2 13  ? 470.564 63.941  413.641 1.00 52.22  ?  36  PHE D CD1 1 
ATOM   3323  C CD2 . PHE D  2 13  ? 471.341 64.066  415.887 1.00 42.84  ?  36  PHE D CD2 1 
ATOM   3324  C CE1 . PHE D  2 13  ? 470.773 62.572  413.646 1.00 50.43  ?  36  PHE D CE1 1 
ATOM   3325  C CE2 . PHE D  2 13  ? 471.550 62.700  415.895 1.00 50.70  ?  36  PHE D CE2 1 
ATOM   3326  C CZ  . PHE D  2 13  ? 471.267 61.953  414.772 1.00 51.02  ?  36  PHE D CZ  1 
ATOM   3327  N N   . CYS D  2 14  ? 473.526 66.532  415.216 1.00 51.65  ?  37  CYS D N   1 
ATOM   3328  C CA  . CYS D  2 14  ? 474.769 65.860  415.560 1.00 55.31  ?  37  CYS D CA  1 
ATOM   3329  C C   . CYS D  2 14  ? 474.472 64.887  416.690 1.00 59.57  ?  37  CYS D C   1 
ATOM   3330  O O   . CYS D  2 14  ? 473.881 65.266  417.707 1.00 66.22  ?  37  CYS D O   1 
ATOM   3331  C CB  . CYS D  2 14  ? 475.872 66.856  415.954 1.00 58.44  ?  37  CYS D CB  1 
ATOM   3332  S SG  . CYS D  2 14  ? 475.916 67.356  417.690 1.00 76.73  ?  37  CYS D SG  1 
ATOM   3333  N N   . ASP D  2 15  ? 474.821 63.625  416.484 1.00 63.71  ?  38  ASP D N   1 
ATOM   3334  C CA  . ASP D  2 15  ? 474.669 62.638  417.536 1.00 65.15  ?  38  ASP D CA  1 
ATOM   3335  C C   . ASP D  2 15  ? 475.847 62.730  418.492 1.00 63.28  ?  38  ASP D C   1 
ATOM   3336  O O   . ASP D  2 15  ? 476.993 62.902  418.070 1.00 66.77  ?  38  ASP D O   1 
ATOM   3337  C CB  . ASP D  2 15  ? 474.557 61.230  416.946 1.00 61.66  ?  38  ASP D CB  1 
ATOM   3338  C CG  . ASP D  2 15  ? 475.472 61.018  415.754 1.00 73.15  ?  38  ASP D CG  1 
ATOM   3339  O OD1 . ASP D  2 15  ? 476.387 61.843  415.545 1.00 85.40  ?  38  ASP D OD1 1 
ATOM   3340  O OD2 . ASP D  2 15  ? 475.267 60.032  415.016 1.00 71.44  -1 38  ASP D OD2 1 
ATOM   3341  N N   . ASN D  2 16  ? 475.560 62.660  419.790 1.00 75.40  ?  39  ASN D N   1 
ATOM   3342  C CA  . ASN D  2 16  ? 476.642 62.588  420.759 1.00 81.71  ?  39  ASN D CA  1 
ATOM   3343  C C   . ASN D  2 16  ? 477.172 61.170  420.909 1.00 85.52  ?  39  ASN D C   1 
ATOM   3344  O O   . ASN D  2 16  ? 478.267 60.983  421.450 1.00 94.72  ?  39  ASN D O   1 
ATOM   3345  C CB  . ASN D  2 16  ? 476.190 63.165  422.102 1.00 81.59  ?  39  ASN D CB  1 
ATOM   3346  C CG  . ASN D  2 16  ? 476.116 64.684  422.078 1.00 93.74  ?  39  ASN D CG  1 
ATOM   3347  O OD1 . ASN D  2 16  ? 476.938 65.365  422.691 1.00 91.98  ?  39  ASN D OD1 1 
ATOM   3348  N ND2 . ASN D  2 16  ? 475.139 65.219  421.354 1.00 96.68  ?  39  ASN D ND2 1 
ATOM   3349  N N   . ASN D  2 17  ? 476.421 60.174  420.444 1.00 76.20  ?  40  ASN D N   1 
ATOM   3350  C CA  . ASN D  2 17  ? 477.037 58.946  419.977 1.00 75.99  ?  40  ASN D CA  1 
ATOM   3351  C C   . ASN D  2 17  ? 477.641 59.216  418.602 1.00 82.68  ?  40  ASN D C   1 
ATOM   3352  O O   . ASN D  2 17  ? 477.491 60.302  418.039 1.00 86.60  ?  40  ASN D O   1 
ATOM   3353  C CB  . ASN D  2 17  ? 476.013 57.814  419.908 1.00 68.90  ?  40  ASN D CB  1 
ATOM   3354  C CG  . ASN D  2 17  ? 474.927 57.941  420.953 1.00 71.03  ?  40  ASN D CG  1 
ATOM   3355  O OD1 . ASN D  2 17  ? 475.202 58.130  422.138 1.00 84.85  ?  40  ASN D OD1 1 
ATOM   3356  N ND2 . ASN D  2 17  ? 473.676 57.834  420.517 1.00 65.00  ?  40  ASN D ND2 1 
ATOM   3357  N N   . ARG D  2 18  ? 478.331 58.228  418.037 1.00 61.60  ?  41  ARG D N   1 
ATOM   3358  C CA  . ARG D  2 18  ? 478.832 58.313  416.666 1.00 61.58  ?  41  ARG D CA  1 
ATOM   3359  C C   . ARG D  2 18  ? 479.749 59.528  416.462 1.00 63.11  ?  41  ARG D C   1 
ATOM   3360  O O   . ARG D  2 18  ? 479.926 60.003  415.335 1.00 55.89  ?  41  ARG D O   1 
ATOM   3361  C CB  . ARG D  2 18  ? 477.654 58.328  415.680 1.00 58.32  ?  41  ARG D CB  1 
ATOM   3362  C CG  . ARG D  2 18  ? 477.947 57.857  414.270 1.00 71.15  ?  41  ARG D CG  1 
ATOM   3363  C CD  . ARG D  2 18  ? 476.780 57.021  413.747 1.00 68.10  ?  41  ARG D CD  1 
ATOM   3364  N NE  . ARG D  2 18  ? 475.483 57.633  414.034 1.00 58.93  ?  41  ARG D NE  1 
ATOM   3365  C CZ  . ARG D  2 18  ? 474.384 56.947  414.332 1.00 55.79  ?  41  ARG D CZ  1 
ATOM   3366  N NH1 . ARG D  2 18  ? 474.419 55.621  414.383 1.00 48.77  1  41  ARG D NH1 1 
ATOM   3367  N NH2 . ARG D  2 18  ? 473.247 57.583  414.580 1.00 65.50  ?  41  ARG D NH2 1 
ATOM   3368  N N   . ASN D  2 19  ? 480.324 60.031  417.560 1.00 93.92  ?  42  ASN D N   1 
ATOM   3369  C CA  . ASN D  2 19  ? 481.364 61.065  417.572 1.00 89.09  ?  42  ASN D CA  1 
ATOM   3370  C C   . ASN D  2 19  ? 480.940 62.360  416.871 1.00 89.59  ?  42  ASN D C   1 
ATOM   3371  O O   . ASN D  2 19  ? 481.569 62.811  415.913 1.00 86.06  ?  42  ASN D O   1 
ATOM   3372  C CB  . ASN D  2 19  ? 482.659 60.527  416.959 1.00 85.15  ?  42  ASN D CB  1 
ATOM   3373  C CG  . ASN D  2 19  ? 483.866 60.809  417.822 1.00 89.74  ?  42  ASN D CG  1 
ATOM   3374  O OD1 . ASN D  2 19  ? 483.824 60.645  419.041 1.00 93.64  ?  42  ASN D OD1 1 
ATOM   3375  N ND2 . ASN D  2 19  ? 484.952 61.246  417.194 1.00 98.59  ?  42  ASN D ND2 1 
ATOM   3376  N N   . GLN D  2 20  ? 479.873 62.973  417.386 1.00 59.62  ?  43  GLN D N   1 
ATOM   3377  C CA  . GLN D  2 20  ? 479.584 64.385  417.140 1.00 52.98  ?  43  GLN D CA  1 
ATOM   3378  C C   . GLN D  2 20  ? 479.333 64.731  415.673 1.00 52.62  ?  43  GLN D C   1 
ATOM   3379  O O   . GLN D  2 20  ? 479.007 65.880  415.361 1.00 54.10  ?  43  GLN D O   1 
ATOM   3380  C CB  . GLN D  2 20  ? 480.712 65.259  417.696 1.00 41.32  ?  43  GLN D CB  1 
ATOM   3381  C CG  . GLN D  2 20  ? 480.910 65.115  419.198 1.00 51.63  ?  43  GLN D CG  1 
ATOM   3382  C CD  . GLN D  2 20  ? 480.824 66.441  419.933 1.00 59.41  ?  43  GLN D CD  1 
ATOM   3383  O OE1 . GLN D  2 20  ? 481.617 67.352  419.691 1.00 59.39  ?  43  GLN D OE1 1 
ATOM   3384  N NE2 . GLN D  2 20  ? 479.857 66.555  420.836 1.00 57.66  ?  43  GLN D NE2 1 
ATOM   3385  N N   . ILE D  2 21  ? 479.489 63.763  414.764 1.00 43.45  ?  44  ILE D N   1 
ATOM   3386  C CA  . ILE D  2 21  ? 479.302 64.055  413.345 1.00 46.86  ?  44  ILE D CA  1 
ATOM   3387  C C   . ILE D  2 21  ? 477.847 64.414  413.074 1.00 52.36  ?  44  ILE D C   1 
ATOM   3388  O O   . ILE D  2 21  ? 476.935 64.107  413.852 1.00 54.75  ?  44  ILE D O   1 
ATOM   3389  C CB  . ILE D  2 21  ? 479.748 62.880  412.458 1.00 54.70  ?  44  ILE D CB  1 
ATOM   3390  C CG1 . ILE D  2 21  ? 478.673 61.791  412.434 1.00 50.54  ?  44  ILE D CG1 1 
ATOM   3391  C CG2 . ILE D  2 21  ? 481.084 62.327  412.915 1.00 64.42  ?  44  ILE D CG2 1 
ATOM   3392  C CD1 . ILE D  2 21  ? 478.658 60.974  411.163 1.00 45.33  ?  44  ILE D CD1 1 
ATOM   3393  N N   . CYS D  2 22  ? 477.630 65.086  411.952 1.00 55.41  ?  45  CYS D N   1 
ATOM   3394  C CA  . CYS D  2 22  ? 476.302 65.522  411.551 1.00 48.96  ?  45  CYS D CA  1 
ATOM   3395  C C   . CYS D  2 22  ? 475.722 64.526  410.555 1.00 52.00  ?  45  CYS D C   1 
ATOM   3396  O O   . CYS D  2 22  ? 476.327 64.257  409.511 1.00 61.23  ?  45  CYS D O   1 
ATOM   3397  C CB  . CYS D  2 22  ? 476.350 66.931  410.966 1.00 44.30  ?  45  CYS D CB  1 
ATOM   3398  S SG  . CYS D  2 22  ? 477.003 68.144  412.140 1.00 69.10  ?  45  CYS D SG  1 
ATOM   3399  N N   . SER D  2 23  ? 474.558 63.986  410.884 1.00 24.23  ?  46  SER D N   1 
ATOM   3400  C CA  . SER D  2 23  ? 473.892 62.929  410.139 1.00 24.62  ?  46  SER D CA  1 
ATOM   3401  C C   . SER D  2 23  ? 472.483 63.387  409.805 1.00 23.04  ?  46  SER D C   1 
ATOM   3402  O O   . SER D  2 23  ? 472.049 64.455  410.250 1.00 25.63  ?  46  SER D O   1 
ATOM   3403  C CB  . SER D  2 23  ? 473.881 61.645  410.987 1.00 22.89  ?  46  SER D CB  1 
ATOM   3404  O OG  . SER D  2 23  ? 473.578 61.933  412.341 1.00 22.59  ?  46  SER D OG  1 
ATOM   3405  N N   . PRO D  2 24  ? 471.728 62.611  409.027 1.00 50.86  ?  47  PRO D N   1 
ATOM   3406  C CA  . PRO D  2 24  ? 470.363 63.027  408.693 1.00 55.54  ?  47  PRO D CA  1 
ATOM   3407  C C   . PRO D  2 24  ? 469.412 62.797  409.861 1.00 51.57  ?  47  PRO D C   1 
ATOM   3408  O O   . PRO D  2 24  ? 469.762 62.207  410.881 1.00 53.53  ?  47  PRO D O   1 
ATOM   3409  C CB  . PRO D  2 24  ? 470.004 62.133  407.503 1.00 59.17  ?  47  PRO D CB  1 
ATOM   3410  C CG  . PRO D  2 24  ? 470.807 60.906  407.726 1.00 53.34  ?  47  PRO D CG  1 
ATOM   3411  C CD  . PRO D  2 24  ? 472.121 61.422  408.244 1.00 54.29  ?  47  PRO D CD  1 
ATOM   3412  N N   . CYS D  2 25  ? 468.176 63.261  409.677 1.00 65.79  ?  48  CYS D N   1 
ATOM   3413  C CA  . CYS D  2 25  ? 467.243 63.034  410.769 1.00 62.95  ?  48  CYS D CA  1 
ATOM   3414  C C   . CYS D  2 25  ? 466.500 61.714  410.573 1.00 63.56  ?  48  CYS D C   1 
ATOM   3415  O O   . CYS D  2 25  ? 466.364 61.232  409.443 1.00 68.14  ?  48  CYS D O   1 
ATOM   3416  C CB  . CYS D  2 25  ? 466.241 64.184  410.869 1.00 63.33  ?  48  CYS D CB  1 
ATOM   3417  S SG  . CYS D  2 25  ? 466.854 65.691  411.694 1.00 75.90  ?  48  CYS D SG  1 
ATOM   3418  N N   . PRO D  2 26  ? 466.021 61.119  411.662 1.00 31.50  ?  49  PRO D N   1 
ATOM   3419  C CA  . PRO D  2 26  ? 465.270 59.856  411.569 1.00 35.69  ?  49  PRO D CA  1 
ATOM   3420  C C   . PRO D  2 26  ? 464.018 60.011  410.722 1.00 40.96  ?  49  PRO D C   1 
ATOM   3421  O O   . PRO D  2 26  ? 463.575 61.141  410.463 1.00 46.73  ?  49  PRO D O   1 
ATOM   3422  C CB  . PRO D  2 26  ? 464.926 59.557  413.036 1.00 34.27  ?  49  PRO D CB  1 
ATOM   3423  C CG  . PRO D  2 26  ? 466.054 60.176  413.791 1.00 28.63  ?  49  PRO D CG  1 
ATOM   3424  C CD  . PRO D  2 26  ? 466.379 61.442  413.054 1.00 27.78  ?  49  PRO D CD  1 
ATOM   3425  N N   . PRO D  2 27  ? 463.426 58.895  410.261 1.00 52.09  ?  50  PRO D N   1 
ATOM   3426  C CA  . PRO D  2 27  ? 462.344 58.979  409.257 1.00 56.19  ?  50  PRO D CA  1 
ATOM   3427  C C   . PRO D  2 27  ? 461.233 59.960  409.588 1.00 54.50  ?  50  PRO D C   1 
ATOM   3428  O O   . PRO D  2 27  ? 460.798 60.704  408.700 1.00 55.95  ?  50  PRO D O   1 
ATOM   3429  C CB  . PRO D  2 27  ? 461.820 57.538  409.206 1.00 57.94  ?  50  PRO D CB  1 
ATOM   3430  C CG  . PRO D  2 27  ? 462.997 56.709  409.549 1.00 68.09  ?  50  PRO D CG  1 
ATOM   3431  C CD  . PRO D  2 27  ? 463.772 57.496  410.574 1.00 57.96  ?  50  PRO D CD  1 
ATOM   3432  N N   . ASN D  2 28  ? 460.757 59.995  410.829 1.00 52.20  ?  51  ASN D N   1 
ATOM   3433  C CA  . ASN D  2 28  ? 459.801 61.009  411.259 1.00 55.25  ?  51  ASN D CA  1 
ATOM   3434  C C   . ASN D  2 28  ? 460.504 61.908  412.267 1.00 57.69  ?  51  ASN D C   1 
ATOM   3435  O O   . ASN D  2 28  ? 460.674 61.527  413.430 1.00 66.49  ?  51  ASN D O   1 
ATOM   3436  C CB  . ASN D  2 28  ? 458.552 60.369  411.862 1.00 50.39  ?  51  ASN D CB  1 
ATOM   3437  C CG  . ASN D  2 28  ? 457.822 59.481  410.875 1.00 55.21  ?  51  ASN D CG  1 
ATOM   3438  O OD1 . ASN D  2 28  ? 457.655 59.840  409.709 1.00 57.06  ?  51  ASN D OD1 1 
ATOM   3439  N ND2 . ASN D  2 28  ? 457.380 58.317  411.337 1.00 50.93  ?  51  ASN D ND2 1 
ATOM   3440  N N   . SER D  2 29  ? 460.860 63.115  411.823 1.00 25.32  ?  52  SER D N   1 
ATOM   3441  C CA  . SER D  2 29  ? 461.613 64.077  412.618 1.00 24.21  ?  52  SER D CA  1 
ATOM   3442  C C   . SER D  2 29  ? 461.960 65.305  411.785 1.00 27.86  ?  52  SER D C   1 
ATOM   3443  O O   . SER D  2 29  ? 461.901 65.264  410.552 1.00 27.33  ?  52  SER D O   1 
ATOM   3444  C CB  . SER D  2 29  ? 462.894 63.451  413.170 1.00 20.89  ?  52  SER D CB  1 
ATOM   3445  O OG  . SER D  2 29  ? 463.656 62.881  412.123 1.00 27.42  ?  52  SER D OG  1 
ATOM   3446  N N   . PHE D  2 30  ? 462.327 66.397  412.452 1.00 38.22  ?  53  PHE D N   1 
ATOM   3447  C CA  . PHE D  2 30  ? 462.762 67.599  411.761 1.00 33.02  ?  53  PHE D CA  1 
ATOM   3448  C C   . PHE D  2 30  ? 463.692 68.382  412.674 1.00 35.67  ?  53  PHE D C   1 
ATOM   3449  O O   . PHE D  2 30  ? 463.597 68.299  413.900 1.00 39.08  ?  53  PHE D O   1 
ATOM   3450  C CB  . PHE D  2 30  ? 461.573 68.475  411.347 1.00 34.60  ?  53  PHE D CB  1 
ATOM   3451  C CG  . PHE D  2 30  ? 460.927 69.191  412.497 1.00 36.20  ?  53  PHE D CG  1 
ATOM   3452  C CD1 . PHE D  2 30  ? 460.007 68.542  413.303 1.00 36.92  ?  53  PHE D CD1 1 
ATOM   3453  C CD2 . PHE D  2 30  ? 461.246 70.509  412.779 1.00 38.54  ?  53  PHE D CD2 1 
ATOM   3454  C CE1 . PHE D  2 30  ? 459.416 69.192  414.365 1.00 39.04  ?  53  PHE D CE1 1 
ATOM   3455  C CE2 . PHE D  2 30  ? 460.659 71.166  413.843 1.00 38.94  ?  53  PHE D CE2 1 
ATOM   3456  C CZ  . PHE D  2 30  ? 459.744 70.507  414.637 1.00 41.08  ?  53  PHE D CZ  1 
ATOM   3457  N N   . SER D  2 31  ? 464.602 69.137  412.064 1.00 31.63  ?  54  SER D N   1 
ATOM   3458  C CA  . SER D  2 31  ? 465.380 70.143  412.779 1.00 33.78  ?  54  SER D CA  1 
ATOM   3459  C C   . SER D  2 31  ? 465.293 71.439  411.988 1.00 40.45  ?  54  SER D C   1 
ATOM   3460  O O   . SER D  2 31  ? 465.850 71.537  410.889 1.00 45.11  ?  54  SER D O   1 
ATOM   3461  C CB  . SER D  2 31  ? 466.831 69.699  412.958 1.00 36.72  ?  54  SER D CB  1 
ATOM   3462  O OG  . SER D  2 31  ? 467.508 69.646  411.716 1.00 47.41  ?  54  SER D OG  1 
ATOM   3463  N N   . SER D  2 32  ? 464.597 72.433  412.542 1.00 84.59  ?  55  SER D N   1 
ATOM   3464  C CA  . SER D  2 32  ? 464.504 73.724  411.872 1.00 88.74  ?  55  SER D CA  1 
ATOM   3465  C C   . SER D  2 32  ? 465.724 74.589  412.155 1.00 93.80  ?  55  SER D C   1 
ATOM   3466  O O   . SER D  2 32  ? 466.268 75.221  411.242 1.00 96.91  ?  55  SER D O   1 
ATOM   3467  C CB  . SER D  2 32  ? 463.224 74.446  412.291 1.00 90.84  ?  55  SER D CB  1 
ATOM   3468  O OG  . SER D  2 32  ? 462.079 73.817  411.740 1.00 91.90  ?  55  SER D OG  1 
ATOM   3469  N N   . ALA D  2 33  ? 466.162 74.635  413.409 1.00 66.23  ?  56  ALA D N   1 
ATOM   3470  C CA  . ALA D  2 33  ? 467.335 75.412  413.771 1.00 57.16  ?  56  ALA D CA  1 
ATOM   3471  C C   . ALA D  2 33  ? 468.608 74.643  413.446 1.00 59.98  ?  56  ALA D C   1 
ATOM   3472  O O   . ALA D  2 33  ? 468.627 73.409  413.419 1.00 62.77  ?  56  ALA D O   1 
ATOM   3473  C CB  . ALA D  2 33  ? 467.303 75.774  415.256 1.00 56.41  ?  56  ALA D CB  1 
ATOM   3474  N N   . GLY D  2 34  ? 469.678 75.389  413.189 1.00 53.30  ?  57  GLY D N   1 
ATOM   3475  C CA  . GLY D  2 34  ? 470.981 74.791  412.989 1.00 45.26  ?  57  GLY D CA  1 
ATOM   3476  C C   . GLY D  2 34  ? 471.720 74.600  414.302 1.00 49.72  ?  57  GLY D C   1 
ATOM   3477  O O   . GLY D  2 34  ? 471.552 75.363  415.248 1.00 50.46  ?  57  GLY D O   1 
ATOM   3478  N N   . GLY D  2 35  ? 472.547 73.559  414.346 1.00 50.75  ?  58  GLY D N   1 
ATOM   3479  C CA  . GLY D  2 35  ? 473.340 73.280  415.524 1.00 56.13  ?  58  GLY D CA  1 
ATOM   3480  C C   . GLY D  2 35  ? 472.625 72.551  416.637 1.00 50.28  ?  58  GLY D C   1 
ATOM   3481  O O   . GLY D  2 35  ? 473.179 72.438  417.736 1.00 47.44  ?  58  GLY D O   1 
ATOM   3482  N N   . GLN D  2 36  ? 471.412 72.058  416.399 1.00 61.26  ?  59  GLN D N   1 
ATOM   3483  C CA  . GLN D  2 36  ? 470.712 71.288  417.416 1.00 61.87  ?  59  GLN D CA  1 
ATOM   3484  C C   . GLN D  2 36  ? 471.387 69.938  417.618 1.00 56.47  ?  59  GLN D C   1 
ATOM   3485  O O   . GLN D  2 36  ? 471.980 69.366  416.699 1.00 49.40  ?  59  GLN D O   1 
ATOM   3486  C CB  . GLN D  2 36  ? 469.247 71.087  417.027 1.00 57.19  ?  59  GLN D CB  1 
ATOM   3487  C CG  . GLN D  2 36  ? 468.406 72.353  417.076 1.00 59.86  ?  59  GLN D CG  1 
ATOM   3488  C CD  . GLN D  2 36  ? 466.975 72.118  416.632 1.00 62.70  ?  59  GLN D CD  1 
ATOM   3489  O OE1 . GLN D  2 36  ? 466.690 71.178  415.889 1.00 53.29  ?  59  GLN D OE1 1 
ATOM   3490  N NE2 . GLN D  2 36  ? 466.066 72.972  417.090 1.00 65.41  ?  59  GLN D NE2 1 
ATOM   3491  N N   . ARG D  2 37  ? 471.296 69.428  418.845 1.00 48.77  ?  60  ARG D N   1 
ATOM   3492  C CA  . ARG D  2 37  ? 471.867 68.131  419.180 1.00 45.37  ?  60  ARG D CA  1 
ATOM   3493  C C   . ARG D  2 37  ? 470.889 66.980  418.983 1.00 34.33  ?  60  ARG D C   1 
ATOM   3494  O O   . ARG D  2 37  ? 471.287 65.820  419.133 1.00 29.62  ?  60  ARG D O   1 
ATOM   3495  C CB  . ARG D  2 37  ? 472.376 68.138  420.625 1.00 46.31  ?  60  ARG D CB  1 
ATOM   3496  C CG  . ARG D  2 37  ? 473.604 69.010  420.832 1.00 49.61  ?  60  ARG D CG  1 
ATOM   3497  C CD  . ARG D  2 37  ? 473.987 69.120  422.300 1.00 61.83  ?  60  ARG D CD  1 
ATOM   3498  N NE  . ARG D  2 37  ? 473.052 69.952  423.053 1.00 67.59  ?  60  ARG D NE  1 
ATOM   3499  C CZ  . ARG D  2 37  ? 472.077 69.476  423.821 1.00 69.13  ?  60  ARG D CZ  1 
ATOM   3500  N NH1 . ARG D  2 37  ? 471.907 68.166  423.945 1.00 62.76  ?  60  ARG D NH1 1 
ATOM   3501  N NH2 . ARG D  2 37  ? 471.276 70.309  424.470 1.00 74.76  ?  60  ARG D NH2 1 
ATOM   3502  N N   . THR D  2 38  ? 469.629 67.269  418.664 1.00 29.85  ?  61  THR D N   1 
ATOM   3503  C CA  . THR D  2 38  ? 468.648 66.231  418.389 1.00 22.45  ?  61  THR D CA  1 
ATOM   3504  C C   . THR D  2 38  ? 467.579 66.779  417.454 1.00 22.15  ?  61  THR D C   1 
ATOM   3505  O O   . THR D  2 38  ? 467.251 67.968  417.493 1.00 26.84  ?  61  THR D O   1 
ATOM   3506  C CB  . THR D  2 38  ? 468.002 65.710  419.677 1.00 21.00  ?  61  THR D CB  1 
ATOM   3507  O OG1 . THR D  2 38  ? 466.861 64.910  419.349 1.00 21.12  ?  61  THR D OG1 1 
ATOM   3508  C CG2 . THR D  2 38  ? 467.568 66.870  420.565 1.00 26.56  ?  61  THR D CG2 1 
ATOM   3509  N N   . CYS D  2 39  ? 467.039 65.901  416.613 1.00 40.20  ?  62  CYS D N   1 
ATOM   3510  C CA  . CYS D  2 39  ? 465.909 66.268  415.771 1.00 45.93  ?  62  CYS D CA  1 
ATOM   3511  C C   . CYS D  2 39  ? 464.621 66.233  416.588 1.00 40.46  ?  62  CYS D C   1 
ATOM   3512  O O   . CYS D  2 39  ? 464.487 65.464  417.544 1.00 45.88  ?  62  CYS D O   1 
ATOM   3513  C CB  . CYS D  2 39  ? 465.795 65.330  414.566 1.00 49.59  ?  62  CYS D CB  1 
ATOM   3514  S SG  . CYS D  2 39  ? 467.318 65.125  413.595 1.00 53.80  ?  62  CYS D SG  1 
ATOM   3515  N N   . ASP D  2 40  ? 463.670 67.079  416.204 1.00 36.03  ?  63  ASP D N   1 
ATOM   3516  C CA  . ASP D  2 40  ? 462.399 67.176  416.907 1.00 37.00  ?  63  ASP D CA  1 
ATOM   3517  C C   . ASP D  2 40  ? 461.361 66.282  416.245 1.00 37.19  ?  63  ASP D C   1 
ATOM   3518  O O   . ASP D  2 40  ? 461.340 66.132  415.022 1.00 41.46  ?  63  ASP D O   1 
ATOM   3519  C CB  . ASP D  2 40  ? 461.907 68.623  416.938 1.00 39.57  ?  63  ASP D CB  1 
ATOM   3520  C CG  . ASP D  2 40  ? 462.811 69.527  417.755 1.00 49.40  ?  63  ASP D CG  1 
ATOM   3521  O OD1 . ASP D  2 40  ? 463.289 69.083  418.820 1.00 47.33  ?  63  ASP D OD1 1 
ATOM   3522  O OD2 . ASP D  2 40  ? 463.042 70.679  417.333 1.00 56.27  -1 63  ASP D OD2 1 
ATOM   3523  N N   . ILE D  2 41  ? 460.495 65.686  417.066 1.00 30.10  ?  64  ILE D N   1 
ATOM   3524  C CA  . ILE D  2 41  ? 459.502 64.747  416.558 1.00 30.48  ?  64  ILE D CA  1 
ATOM   3525  C C   . ILE D  2 41  ? 458.484 65.496  415.710 1.00 34.33  ?  64  ILE D C   1 
ATOM   3526  O O   . ILE D  2 41  ? 457.861 66.463  416.167 1.00 35.01  ?  64  ILE D O   1 
ATOM   3527  C CB  . ILE D  2 41  ? 458.818 64.009  417.719 1.00 35.45  ?  64  ILE D CB  1 
ATOM   3528  C CG1 . ILE D  2 41  ? 459.862 63.366  418.632 1.00 30.61  ?  64  ILE D CG1 1 
ATOM   3529  C CG2 . ILE D  2 41  ? 457.851 62.960  417.188 1.00 32.41  ?  64  ILE D CG2 1 
ATOM   3530  C CD1 . ILE D  2 41  ? 459.278 62.713  419.863 1.00 38.43  ?  64  ILE D CD1 1 
ATOM   3531  N N   . CYS D  2 42  ? 458.309 65.050  414.470 1.00 64.23  ?  65  CYS D N   1 
ATOM   3532  C CA  . CYS D  2 42  ? 457.340 65.675  413.584 1.00 66.67  ?  65  CYS D CA  1 
ATOM   3533  C C   . CYS D  2 42  ? 455.915 65.448  414.080 1.00 66.46  ?  65  CYS D C   1 
ATOM   3534  O O   . CYS D  2 42  ? 455.621 64.502  414.817 1.00 59.89  ?  65  CYS D O   1 
ATOM   3535  C CB  . CYS D  2 42  ? 457.483 65.152  412.156 1.00 65.00  ?  65  CYS D CB  1 
ATOM   3536  S SG  . CYS D  2 42  ? 458.482 66.203  411.076 1.00 90.75  ?  65  CYS D SG  1 
ATOM   3537  N N   . ARG D  2 43  ? 455.026 66.344  413.662 1.00 51.82  ?  66  ARG D N   1 
ATOM   3538  C CA  . ARG D  2 43  ? 453.630 66.263  414.053 1.00 47.52  ?  66  ARG D CA  1 
ATOM   3539  C C   . ARG D  2 43  ? 452.920 65.129  413.318 1.00 47.97  ?  66  ARG D C   1 
ATOM   3540  O O   . ARG D  2 43  ? 453.349 64.666  412.258 1.00 49.94  ?  66  ARG D O   1 
ATOM   3541  C CB  . ARG D  2 43  ? 452.912 67.581  413.770 1.00 48.22  ?  66  ARG D CB  1 
ATOM   3542  C CG  . ARG D  2 43  ? 453.169 68.670  414.793 1.00 57.54  ?  66  ARG D CG  1 
ATOM   3543  C CD  . ARG D  2 43  ? 451.911 69.491  415.008 1.00 65.02  ?  66  ARG D CD  1 
ATOM   3544  N NE  . ARG D  2 43  ? 450.777 68.640  415.356 1.00 64.24  ?  66  ARG D NE  1 
ATOM   3545  C CZ  . ARG D  2 43  ? 449.534 69.078  415.526 1.00 73.19  ?  66  ARG D CZ  1 
ATOM   3546  N NH1 . ARG D  2 43  ? 449.258 70.367  415.380 1.00 65.01  ?  66  ARG D NH1 1 
ATOM   3547  N NH2 . ARG D  2 43  ? 448.566 68.227  415.840 1.00 74.40  ?  66  ARG D NH2 1 
ATOM   3548  N N   . GLN D  2 44  ? 451.815 64.684  413.909 1.00 62.08  ?  67  GLN D N   1 
ATOM   3549  C CA  . GLN D  2 44  ? 450.915 63.721  413.293 1.00 64.83  ?  67  GLN D CA  1 
ATOM   3550  C C   . GLN D  2 44  ? 449.531 64.346  413.235 1.00 69.55  ?  67  GLN D C   1 
ATOM   3551  O O   . GLN D  2 44  ? 448.950 64.671  414.277 1.00 68.20  ?  67  GLN D O   1 
ATOM   3552  C CB  . GLN D  2 44  ? 450.880 62.408  414.080 1.00 64.22  ?  67  GLN D CB  1 
ATOM   3553  C CG  . GLN D  2 44  ? 452.202 61.659  414.116 1.00 66.30  ?  67  GLN D CG  1 
ATOM   3554  C CD  . GLN D  2 44  ? 452.169 60.383  413.297 1.00 66.42  ?  67  GLN D CD  1 
ATOM   3555  O OE1 . GLN D  2 44  ? 451.109 59.790  413.093 1.00 55.67  ?  67  GLN D OE1 1 
ATOM   3556  N NE2 . GLN D  2 44  ? 453.333 59.953  412.824 1.00 78.09  ?  67  GLN D NE2 1 
ATOM   3557  N N   . CYS D  2 45  ? 449.001 64.516  412.026 1.00 68.51  ?  68  CYS D N   1 
ATOM   3558  C CA  . CYS D  2 45  ? 447.658 65.047  411.837 1.00 61.22  ?  68  CYS D CA  1 
ATOM   3559  C C   . CYS D  2 45  ? 446.734 63.861  411.593 1.00 53.06  ?  68  CYS D C   1 
ATOM   3560  O O   . CYS D  2 45  ? 446.784 63.234  410.530 1.00 59.71  ?  68  CYS D O   1 
ATOM   3561  C CB  . CYS D  2 45  ? 447.604 66.032  410.670 1.00 69.59  ?  68  CYS D CB  1 
ATOM   3562  S SG  . CYS D  2 45  ? 448.957 67.243  410.572 1.00 75.82  ?  68  CYS D SG  1 
ATOM   3563  N N   . LYS D  2 46  ? 445.891 63.557  412.577 1.00 36.57  ?  69  LYS D N   1 
ATOM   3564  C CA  . LYS D  2 46  ? 444.981 62.424  412.506 1.00 41.63  ?  69  LYS D CA  1 
ATOM   3565  C C   . LYS D  2 46  ? 443.670 62.815  413.169 1.00 40.61  ?  69  LYS D C   1 
ATOM   3566  O O   . LYS D  2 46  ? 443.524 63.923  413.698 1.00 44.06  ?  69  LYS D O   1 
ATOM   3567  C CB  . LYS D  2 46  ? 445.589 61.179  413.164 1.00 35.22  ?  69  LYS D CB  1 
ATOM   3568  C CG  . LYS D  2 46  ? 446.622 60.463  412.309 1.00 40.18  ?  69  LYS D CG  1 
ATOM   3569  C CD  . LYS D  2 46  ? 447.149 59.218  413.004 1.00 45.85  ?  69  LYS D CD  1 
ATOM   3570  C CE  . LYS D  2 46  ? 447.663 58.200  411.999 1.00 47.33  ?  69  LYS D CE  1 
ATOM   3571  N NZ  . LYS D  2 46  ? 448.702 58.778  411.102 1.00 45.47  ?  69  LYS D NZ  1 
ATOM   3572  N N   . GLY D  2 47  ? 442.716 61.894  413.153 1.00 48.28  ?  70  GLY D N   1 
ATOM   3573  C CA  . GLY D  2 47  ? 441.416 62.188  413.733 1.00 46.74  ?  70  GLY D CA  1 
ATOM   3574  C C   . GLY D  2 47  ? 440.746 63.318  412.978 1.00 45.68  ?  70  GLY D C   1 
ATOM   3575  O O   . GLY D  2 47  ? 440.528 63.245  411.763 1.00 49.36  ?  70  GLY D O   1 
ATOM   3576  N N   . VAL D  2 48  ? 440.409 64.385  413.705 1.00 33.30  ?  71  VAL D N   1 
ATOM   3577  C CA  . VAL D  2 48  ? 439.760 65.534  413.091 1.00 33.38  ?  71  VAL D CA  1 
ATOM   3578  C C   . VAL D  2 48  ? 440.721 66.347  412.234 1.00 36.97  ?  71  VAL D C   1 
ATOM   3579  O O   . VAL D  2 48  ? 440.275 67.151  411.406 1.00 40.18  ?  71  VAL D O   1 
ATOM   3580  C CB  . VAL D  2 48  ? 439.126 66.424  414.178 1.00 30.22  ?  71  VAL D CB  1 
ATOM   3581  C CG1 . VAL D  2 48  ? 438.344 65.572  415.157 1.00 30.27  ?  71  VAL D CG1 1 
ATOM   3582  C CG2 . VAL D  2 48  ? 440.196 67.220  414.906 1.00 32.68  ?  71  VAL D CG2 1 
ATOM   3583  N N   . PHE D  2 49  ? 442.027 66.158  412.398 1.00 44.04  ?  72  PHE D N   1 
ATOM   3584  C CA  . PHE D  2 49  ? 443.015 66.969  411.701 1.00 45.03  ?  72  PHE D CA  1 
ATOM   3585  C C   . PHE D  2 49  ? 443.357 66.375  410.341 1.00 47.82  ?  72  PHE D C   1 
ATOM   3586  O O   . PHE D  2 49  ? 443.422 65.153  410.179 1.00 47.57  ?  72  PHE D O   1 
ATOM   3587  C CB  . PHE D  2 49  ? 444.289 67.104  412.535 1.00 45.72  ?  72  PHE D CB  1 
ATOM   3588  C CG  . PHE D  2 49  ? 444.093 67.838  413.828 1.00 43.42  ?  72  PHE D CG  1 
ATOM   3589  C CD1 . PHE D  2 49  ? 443.911 69.211  413.841 1.00 45.92  ?  72  PHE D CD1 1 
ATOM   3590  C CD2 . PHE D  2 49  ? 444.101 67.158  415.032 1.00 42.18  ?  72  PHE D CD2 1 
ATOM   3591  C CE1 . PHE D  2 49  ? 443.734 69.890  415.030 1.00 46.84  ?  72  PHE D CE1 1 
ATOM   3592  C CE2 . PHE D  2 49  ? 443.926 67.830  416.225 1.00 46.07  ?  72  PHE D CE2 1 
ATOM   3593  C CZ  . PHE D  2 49  ? 443.741 69.199  416.224 1.00 45.58  ?  72  PHE D CZ  1 
ATOM   3594  N N   . ARG D  2 50  ? 443.572 67.253  409.364 1.00 40.42  ?  73  ARG D N   1 
ATOM   3595  C CA  . ARG D  2 50  ? 444.089 66.880  408.058 1.00 39.02  ?  73  ARG D CA  1 
ATOM   3596  C C   . ARG D  2 50  ? 445.477 67.476  407.871 1.00 43.11  ?  73  ARG D C   1 
ATOM   3597  O O   . ARG D  2 50  ? 445.795 68.536  408.416 1.00 46.30  ?  73  ARG D O   1 
ATOM   3598  C CB  . ARG D  2 50  ? 443.166 67.352  406.929 1.00 34.48  ?  73  ARG D CB  1 
ATOM   3599  C CG  . ARG D  2 50  ? 441.935 66.488  406.722 1.00 39.09  ?  73  ARG D CG  1 
ATOM   3600  C CD  . ARG D  2 50  ? 441.276 66.755  405.374 1.00 44.61  ?  73  ARG D CD  1 
ATOM   3601  N NE  . ARG D  2 50  ? 440.689 68.089  405.288 1.00 52.84  ?  73  ARG D NE  1 
ATOM   3602  C CZ  . ARG D  2 50  ? 441.246 69.114  404.650 1.00 53.27  ?  73  ARG D CZ  1 
ATOM   3603  N NH1 . ARG D  2 50  ? 440.638 70.293  404.626 1.00 50.21  ?  73  ARG D NH1 1 
ATOM   3604  N NH2 . ARG D  2 50  ? 442.411 68.962  404.033 1.00 54.11  ?  73  ARG D NH2 1 
ATOM   3605  N N   . THR D  2 51  ? 446.305 66.784  407.092 1.00 57.12  ?  74  THR D N   1 
ATOM   3606  C CA  . THR D  2 51  ? 447.670 67.230  406.844 1.00 56.76  ?  74  THR D CA  1 
ATOM   3607  C C   . THR D  2 51  ? 447.672 68.312  405.771 1.00 59.84  ?  74  THR D C   1 
ATOM   3608  O O   . THR D  2 51  ? 447.176 68.094  404.659 1.00 53.99  ?  74  THR D O   1 
ATOM   3609  C CB  . THR D  2 51  ? 448.549 66.055  406.423 1.00 62.27  ?  74  THR D CB  1 
ATOM   3610  O OG1 . THR D  2 51  ? 448.486 65.027  407.418 1.00 72.71  ?  74  THR D OG1 1 
ATOM   3611  C CG2 . THR D  2 51  ? 449.993 66.506  406.255 1.00 59.17  ?  74  THR D CG2 1 
ATOM   3612  N N   . ARG D  2 52  ? 448.225 69.478  406.103 1.00 57.72  ?  75  ARG D N   1 
ATOM   3613  C CA  . ARG D  2 52  ? 448.367 70.571  405.132 1.00 56.99  ?  75  ARG D CA  1 
ATOM   3614  C C   . ARG D  2 52  ? 449.723 70.468  404.439 1.00 54.31  ?  75  ARG D C   1 
ATOM   3615  O O   . ARG D  2 52  ? 449.801 70.160  403.247 1.00 64.02  ?  75  ARG D O   1 
ATOM   3616  C CB  . ARG D  2 52  ? 448.199 71.925  405.823 1.00 56.85  ?  75  ARG D CB  1 
ATOM   3617  C CG  . ARG D  2 52  ? 448.265 73.111  404.873 1.00 55.50  ?  75  ARG D CG  1 
ATOM   3618  C CD  . ARG D  2 52  ? 448.558 74.404  405.615 1.00 50.11  ?  75  ARG D CD  1 
ATOM   3619  N NE  . ARG D  2 52  ? 447.681 74.589  406.768 1.00 56.48  ?  75  ARG D NE  1 
ATOM   3620  C CZ  . ARG D  2 52  ? 446.487 75.172  406.712 1.00 64.01  ?  75  ARG D CZ  1 
ATOM   3621  N NH1 . ARG D  2 52  ? 446.022 75.628  405.558 1.00 69.06  ?  75  ARG D NH1 1 
ATOM   3622  N NH2 . ARG D  2 52  ? 445.758 75.297  407.813 1.00 56.85  ?  75  ARG D NH2 1 
ATOM   3623  N N   . LYS D  2 53  ? 450.794 70.729  405.182 1.00 49.04  ?  76  LYS D N   1 
ATOM   3624  C CA  . LYS D  2 53  ? 452.160 70.626  404.685 1.00 47.77  ?  76  LYS D CA  1 
ATOM   3625  C C   . LYS D  2 53  ? 452.812 69.414  405.334 1.00 46.28  ?  76  LYS D C   1 
ATOM   3626  O O   . LYS D  2 53  ? 452.917 69.348  406.564 1.00 53.82  ?  76  LYS D O   1 
ATOM   3627  C CB  . LYS D  2 53  ? 452.949 71.898  404.991 1.00 46.04  ?  76  LYS D CB  1 
ATOM   3628  C CG  . LYS D  2 53  ? 454.377 71.896  404.478 1.00 55.01  ?  76  LYS D CG  1 
ATOM   3629  C CD  . LYS D  2 53  ? 455.083 73.190  404.851 1.00 65.93  ?  76  LYS D CD  1 
ATOM   3630  C CE  . LYS D  2 53  ? 454.335 74.401  404.310 1.00 60.76  ?  76  LYS D CE  1 
ATOM   3631  N NZ  . LYS D  2 53  ? 454.771 75.664  404.970 1.00 55.89  ?  76  LYS D NZ  1 
ATOM   3632  N N   . GLU D  2 54  ? 453.241 68.459  404.512 1.00 67.69  ?  77  GLU D N   1 
ATOM   3633  C CA  . GLU D  2 54  ? 453.824 67.235  405.037 1.00 74.39  ?  77  GLU D CA  1 
ATOM   3634  C C   . GLU D  2 54  ? 455.150 67.518  405.738 1.00 73.80  ?  77  GLU D C   1 
ATOM   3635  O O   . GLU D  2 54  ? 455.831 68.513  405.471 1.00 70.13  ?  77  GLU D O   1 
ATOM   3636  C CB  . GLU D  2 54  ? 454.027 66.210  403.921 1.00 74.86  ?  77  GLU D CB  1 
ATOM   3637  C CG  . GLU D  2 54  ? 452.748 65.526  403.467 1.00 83.41  ?  77  GLU D CG  1 
ATOM   3638  C CD  . GLU D  2 54  ? 452.231 66.064  402.148 1.00 92.68  ?  77  GLU D CD  1 
ATOM   3639  O OE1 . GLU D  2 54  ? 453.060 66.438  401.292 1.00 92.64  ?  77  GLU D OE1 1 
ATOM   3640  O OE2 . GLU D  2 54  ? 450.995 66.107  401.966 1.00 94.19  -1 77  GLU D OE2 1 
ATOM   3641  N N   . CYS D  2 55  ? 455.505 66.622  406.655 1.00 82.37  ?  78  CYS D N   1 
ATOM   3642  C CA  . CYS D  2 55  ? 456.731 66.764  407.429 1.00 83.68  ?  78  CYS D CA  1 
ATOM   3643  C C   . CYS D  2 55  ? 457.948 66.508  406.549 1.00 86.14  ?  78  CYS D C   1 
ATOM   3644  O O   . CYS D  2 55  ? 458.074 65.438  405.943 1.00 90.77  ?  78  CYS D O   1 
ATOM   3645  C CB  . CYS D  2 55  ? 456.709 65.801  408.613 1.00 83.20  ?  78  CYS D CB  1 
ATOM   3646  S SG  . CYS D  2 55  ? 458.333 65.315  409.255 1.00 101.16 ?  78  CYS D SG  1 
ATOM   3647  N N   . SER D  2 56  ? 458.839 67.490  406.478 1.00 78.01  ?  79  SER D N   1 
ATOM   3648  C CA  . SER D  2 56  ? 460.133 67.355  405.830 1.00 83.86  ?  79  SER D CA  1 
ATOM   3649  C C   . SER D  2 56  ? 461.225 67.300  406.895 1.00 81.74  ?  79  SER D C   1 
ATOM   3650  O O   . SER D  2 56  ? 460.958 67.364  408.098 1.00 83.21  ?  79  SER D O   1 
ATOM   3651  C CB  . SER D  2 56  ? 460.374 68.503  404.847 1.00 80.65  ?  79  SER D CB  1 
ATOM   3652  O OG  . SER D  2 56  ? 460.474 69.745  405.521 1.00 84.55  ?  79  SER D OG  1 
ATOM   3653  N N   . SER D  2 57  ? 462.472 67.187  406.440 1.00 51.74  ?  80  SER D N   1 
ATOM   3654  C CA  . SER D  2 57  ? 463.591 67.217  407.373 1.00 55.54  ?  80  SER D CA  1 
ATOM   3655  C C   . SER D  2 57  ? 463.908 68.636  407.830 1.00 63.69  ?  80  SER D C   1 
ATOM   3656  O O   . SER D  2 57  ? 464.409 68.826  408.943 1.00 64.45  ?  80  SER D O   1 
ATOM   3657  C CB  . SER D  2 57  ? 464.826 66.580  406.736 1.00 57.93  ?  80  SER D CB  1 
ATOM   3658  O OG  . SER D  2 57  ? 465.268 67.327  405.616 1.00 73.37  ?  80  SER D OG  1 
ATOM   3659  N N   . THR D  2 58  ? 463.630 69.634  406.991 1.00 67.93  ?  81  THR D N   1 
ATOM   3660  C CA  . THR D  2 58  ? 463.930 71.016  407.347 1.00 63.09  ?  81  THR D CA  1 
ATOM   3661  C C   . THR D  2 58  ? 462.864 71.619  408.255 1.00 58.74  ?  81  THR D C   1 
ATOM   3662  O O   . THR D  2 58  ? 463.193 72.329  409.212 1.00 51.79  ?  81  THR D O   1 
ATOM   3663  C CB  . THR D  2 58  ? 464.082 71.863  406.084 1.00 65.85  ?  81  THR D CB  1 
ATOM   3664  O OG1 . THR D  2 58  ? 462.793 72.076  405.493 1.00 80.90  ?  81  THR D OG1 1 
ATOM   3665  C CG2 . THR D  2 58  ? 464.983 71.161  405.078 1.00 61.91  ?  81  THR D CG2 1 
ATOM   3666  N N   . SER D  2 59  ? 461.588 71.355  407.975 1.00 68.65  ?  82  SER D N   1 
ATOM   3667  C CA  . SER D  2 59  ? 460.493 72.020  408.664 1.00 72.54  ?  82  SER D CA  1 
ATOM   3668  C C   . SER D  2 59  ? 459.519 70.998  409.235 1.00 67.66  ?  82  SER D C   1 
ATOM   3669  O O   . SER D  2 59  ? 459.431 69.857  408.772 1.00 63.66  ?  82  SER D O   1 
ATOM   3670  C CB  . SER D  2 59  ? 459.742 72.979  407.728 1.00 78.69  ?  82  SER D CB  1 
ATOM   3671  O OG  . SER D  2 59  ? 459.075 72.271  406.697 1.00 78.55  ?  82  SER D OG  1 
ATOM   3672  N N   . ASN D  2 60  ? 458.787 71.433  410.257 1.00 48.75  ?  83  ASN D N   1 
ATOM   3673  C CA  . ASN D  2 60  ? 457.741 70.624  410.861 1.00 47.67  ?  83  ASN D CA  1 
ATOM   3674  C C   . ASN D  2 60  ? 456.519 70.571  409.949 1.00 46.40  ?  83  ASN D C   1 
ATOM   3675  O O   . ASN D  2 60  ? 456.328 71.414  409.069 1.00 57.51  ?  83  ASN D O   1 
ATOM   3676  C CB  . ASN D  2 60  ? 457.354 71.187  412.229 1.00 47.73  ?  83  ASN D CB  1 
ATOM   3677  C CG  . ASN D  2 60  ? 456.453 70.254  413.017 1.00 44.03  ?  83  ASN D CG  1 
ATOM   3678  O OD1 . ASN D  2 60  ? 456.450 69.044  412.798 1.00 43.44  ?  83  ASN D OD1 1 
ATOM   3679  N ND2 . ASN D  2 60  ? 455.679 70.817  413.939 1.00 45.44  ?  83  ASN D ND2 1 
ATOM   3680  N N   . ALA D  2 61  ? 455.681 69.561  410.171 1.00 29.27  ?  84  ALA D N   1 
ATOM   3681  C CA  . ALA D  2 61  ? 454.455 69.431  409.400 1.00 29.95  ?  84  ALA D CA  1 
ATOM   3682  C C   . ALA D  2 61  ? 453.446 70.492  409.836 1.00 34.15  ?  84  ALA D C   1 
ATOM   3683  O O   . ALA D  2 61  ? 453.684 71.283  410.755 1.00 35.55  ?  84  ALA D O   1 
ATOM   3684  C CB  . ALA D  2 61  ? 453.878 68.026  409.556 1.00 24.87  ?  84  ALA D CB  1 
ATOM   3685  N N   . GLU D  2 62  ? 452.296 70.506  409.167 1.00 51.33  ?  85  GLU D N   1 
ATOM   3686  C CA  . GLU D  2 62  ? 451.244 71.469  409.451 1.00 52.06  ?  85  GLU D CA  1 
ATOM   3687  C C   . GLU D  2 62  ? 449.894 70.783  409.317 1.00 54.88  ?  85  GLU D C   1 
ATOM   3688  O O   . GLU D  2 62  ? 449.661 70.038  408.360 1.00 56.38  ?  85  GLU D O   1 
ATOM   3689  C CB  . GLU D  2 62  ? 451.319 72.678  408.508 1.00 60.96  ?  85  GLU D CB  1 
ATOM   3690  C CG  . GLU D  2 62  ? 451.559 74.003  409.217 1.00 66.36  ?  85  GLU D CG  1 
ATOM   3691  C CD  . GLU D  2 62  ? 451.684 75.169  408.253 1.00 69.71  ?  85  GLU D CD  1 
ATOM   3692  O OE1 . GLU D  2 62  ? 450.641 75.647  407.756 1.00 67.54  ?  85  GLU D OE1 1 
ATOM   3693  O OE2 . GLU D  2 62  ? 452.823 75.605  407.990 1.00 71.73  -1 85  GLU D OE2 1 
ATOM   3694  N N   . CYS D  2 63  ? 449.009 71.037  410.275 1.00 43.98  ?  86  CYS D N   1 
ATOM   3695  C CA  . CYS D  2 63  ? 447.694 70.414  410.316 1.00 43.93  ?  86  CYS D CA  1 
ATOM   3696  C C   . CYS D  2 63  ? 446.613 71.464  410.103 1.00 43.79  ?  86  CYS D C   1 
ATOM   3697  O O   . CYS D  2 63  ? 446.670 72.551  410.689 1.00 41.81  ?  86  CYS D O   1 
ATOM   3698  C CB  . CYS D  2 63  ? 447.457 69.697  411.650 1.00 45.81  ?  86  CYS D CB  1 
ATOM   3699  S SG  . CYS D  2 63  ? 448.701 68.475  412.168 1.00 44.80  ?  86  CYS D SG  1 
ATOM   3700  N N   . ASP D  2 64  ? 445.644 71.140  409.256 1.00 45.45  ?  87  ASP D N   1 
ATOM   3701  C CA  . ASP D  2 64  ? 444.359 71.820  409.195 1.00 37.78  ?  87  ASP D CA  1 
ATOM   3702  C C   . ASP D  2 64  ? 443.288 70.837  409.656 1.00 36.12  ?  87  ASP D C   1 
ATOM   3703  O O   . ASP D  2 64  ? 443.585 69.699  410.030 1.00 37.31  ?  87  ASP D O   1 
ATOM   3704  C CB  . ASP D  2 64  ? 444.082 72.354  407.785 1.00 49.66  ?  87  ASP D CB  1 
ATOM   3705  C CG  . ASP D  2 64  ? 444.128 71.269  406.727 1.00 57.21  ?  87  ASP D CG  1 
ATOM   3706  O OD1 . ASP D  2 64  ? 443.116 70.556  406.567 1.00 56.69  ?  87  ASP D OD1 1 
ATOM   3707  O OD2 . ASP D  2 64  ? 445.169 71.136  406.049 1.00 50.32  -1 87  ASP D OD2 1 
ATOM   3708  N N   . CYS D  2 65  ? 442.030 71.269  409.635 1.00 46.02  ?  88  CYS D N   1 
ATOM   3709  C CA  . CYS D  2 65  ? 440.976 70.460  410.223 1.00 45.41  ?  88  CYS D CA  1 
ATOM   3710  C C   . CYS D  2 65  ? 439.945 70.061  409.175 1.00 48.54  ?  88  CYS D C   1 
ATOM   3711  O O   . CYS D  2 65  ? 439.821 70.684  408.118 1.00 59.34  ?  88  CYS D O   1 
ATOM   3712  C CB  . CYS D  2 65  ? 440.307 71.187  411.396 1.00 45.34  ?  88  CYS D CB  1 
ATOM   3713  S SG  . CYS D  2 65  ? 439.833 70.049  412.709 1.00 81.23  ?  88  CYS D SG  1 
ATOM   3714  N N   . THR D  2 66  ? 439.211 68.995  409.498 1.00 37.48  ?  89  THR D N   1 
ATOM   3715  C CA  . THR D  2 66  ? 438.295 68.358  408.564 1.00 42.43  ?  89  THR D CA  1 
ATOM   3716  C C   . THR D  2 66  ? 437.245 69.351  408.065 1.00 45.51  ?  89  THR D C   1 
ATOM   3717  O O   . THR D  2 66  ? 436.855 70.271  408.793 1.00 42.73  ?  89  THR D O   1 
ATOM   3718  C CB  . THR D  2 66  ? 437.605 67.172  409.245 1.00 46.36  ?  89  THR D CB  1 
ATOM   3719  O OG1 . THR D  2 66  ? 438.530 66.528  410.128 1.00 51.42  ?  89  THR D OG1 1 
ATOM   3720  C CG2 . THR D  2 66  ? 437.115 66.149  408.228 1.00 45.03  ?  89  THR D CG2 1 
ATOM   3721  N N   . PRO D  2 67  ? 436.788 69.206  406.819 1.00 45.92  ?  90  PRO D N   1 
ATOM   3722  C CA  . PRO D  2 67  ? 435.637 69.991  406.359 1.00 46.45  ?  90  PRO D CA  1 
ATOM   3723  C C   . PRO D  2 67  ? 434.446 69.816  407.291 1.00 43.66  ?  90  PRO D C   1 
ATOM   3724  O O   . PRO D  2 67  ? 434.180 68.725  407.797 1.00 48.50  ?  90  PRO D O   1 
ATOM   3725  C CB  . PRO D  2 67  ? 435.354 69.427  404.960 1.00 49.09  ?  90  PRO D CB  1 
ATOM   3726  C CG  . PRO D  2 67  ? 436.203 68.181  404.841 1.00 46.96  ?  90  PRO D CG  1 
ATOM   3727  C CD  . PRO D  2 67  ? 437.382 68.433  405.717 1.00 44.96  ?  90  PRO D CD  1 
ATOM   3728  N N   . GLY D  2 68  ? 433.728 70.914  407.514 1.00 44.12  ?  91  GLY D N   1 
ATOM   3729  C CA  . GLY D  2 68  ? 432.723 70.985  408.545 1.00 53.63  ?  91  GLY D CA  1 
ATOM   3730  C C   . GLY D  2 68  ? 433.242 71.463  409.883 1.00 43.63  ?  91  GLY D C   1 
ATOM   3731  O O   . GLY D  2 68  ? 432.457 71.962  410.697 1.00 45.43  ?  91  GLY D O   1 
ATOM   3732  N N   . PHE D  2 69  ? 434.539 71.323  410.131 1.00 27.82  ?  92  PHE D N   1 
ATOM   3733  C CA  . PHE D  2 69  ? 435.213 71.912  411.275 1.00 27.72  ?  92  PHE D CA  1 
ATOM   3734  C C   . PHE D  2 69  ? 436.055 73.097  410.813 1.00 27.21  ?  92  PHE D C   1 
ATOM   3735  O O   . PHE D  2 69  ? 436.135 73.414  409.623 1.00 27.99  ?  92  PHE D O   1 
ATOM   3736  C CB  . PHE D  2 69  ? 436.079 70.873  411.990 1.00 28.47  ?  92  PHE D CB  1 
ATOM   3737  C CG  . PHE D  2 69  ? 435.293 69.813  412.706 1.00 23.47  ?  92  PHE D CG  1 
ATOM   3738  C CD1 . PHE D  2 69  ? 434.914 69.989  414.025 1.00 21.42  ?  92  PHE D CD1 1 
ATOM   3739  C CD2 . PHE D  2 69  ? 434.941 68.639  412.065 1.00 27.15  ?  92  PHE D CD2 1 
ATOM   3740  C CE1 . PHE D  2 69  ? 434.194 69.016  414.690 1.00 17.89  ?  92  PHE D CE1 1 
ATOM   3741  C CE2 . PHE D  2 69  ? 434.220 67.662  412.725 1.00 17.59  ?  92  PHE D CE2 1 
ATOM   3742  C CZ  . PHE D  2 69  ? 433.848 67.851  414.040 1.00 21.72  ?  92  PHE D CZ  1 
ATOM   3743  N N   . HIS D  2 70  ? 436.695 73.752  411.778 1.00 19.46  ?  93  HIS D N   1 
ATOM   3744  C CA  . HIS D  2 70  ? 437.612 74.844  411.495 1.00 22.06  ?  93  HIS D CA  1 
ATOM   3745  C C   . HIS D  2 70  ? 438.636 74.914  412.617 1.00 24.32  ?  93  HIS D C   1 
ATOM   3746  O O   . HIS D  2 70  ? 438.336 74.585  413.768 1.00 21.98  ?  93  HIS D O   1 
ATOM   3747  C CB  . HIS D  2 70  ? 436.875 76.179  411.346 1.00 25.72  ?  93  HIS D CB  1 
ATOM   3748  C CG  . HIS D  2 70  ? 436.021 76.529  412.523 1.00 21.63  ?  93  HIS D CG  1 
ATOM   3749  N ND1 . HIS D  2 70  ? 436.483 77.287  413.578 1.00 22.83  ?  93  HIS D ND1 1 
ATOM   3750  C CD2 . HIS D  2 70  ? 434.736 76.222  412.815 1.00 22.86  ?  93  HIS D CD2 1 
ATOM   3751  C CE1 . HIS D  2 70  ? 435.518 77.434  414.468 1.00 27.55  ?  93  HIS D CE1 1 
ATOM   3752  N NE2 . HIS D  2 70  ? 434.448 76.796  414.030 1.00 26.98  ?  93  HIS D NE2 1 
ATOM   3753  N N   . CYS D  2 71  ? 439.847 75.342  412.273 1.00 61.87  ?  94  CYS D N   1 
ATOM   3754  C CA  . CYS D  2 71  ? 440.918 75.404  413.256 1.00 57.09  ?  94  CYS D CA  1 
ATOM   3755  C C   . CYS D  2 71  ? 440.620 76.447  414.326 1.00 52.01  ?  94  CYS D C   1 
ATOM   3756  O O   . CYS D  2 71  ? 439.937 77.446  414.086 1.00 53.34  ?  94  CYS D O   1 
ATOM   3757  C CB  . CYS D  2 71  ? 442.253 75.728  412.588 1.00 52.35  ?  94  CYS D CB  1 
ATOM   3758  S SG  . CYS D  2 71  ? 443.193 74.295  412.028 1.00 56.26  ?  94  CYS D SG  1 
ATOM   3759  N N   . LEU D  2 72  ? 441.147 76.198  415.522 1.00 45.92  ?  95  LEU D N   1 
ATOM   3760  C CA  . LEU D  2 72  ? 441.042 77.121  416.640 1.00 47.52  ?  95  LEU D CA  1 
ATOM   3761  C C   . LEU D  2 72  ? 442.389 77.152  417.340 1.00 46.02  ?  95  LEU D C   1 
ATOM   3762  O O   . LEU D  2 72  ? 442.934 76.100  417.686 1.00 46.83  ?  95  LEU D O   1 
ATOM   3763  C CB  . LEU D  2 72  ? 439.930 76.698  417.609 1.00 46.41  ?  95  LEU D CB  1 
ATOM   3764  C CG  . LEU D  2 72  ? 439.284 77.772  418.490 1.00 50.51  ?  95  LEU D CG  1 
ATOM   3765  C CD1 . LEU D  2 72  ? 437.933 77.290  418.998 1.00 44.85  ?  95  LEU D CD1 1 
ATOM   3766  C CD2 . LEU D  2 72  ? 440.183 78.156  419.657 1.00 55.89  ?  95  LEU D CD2 1 
ATOM   3767  N N   . GLY D  2 73  ? 442.921 78.347  417.544 1.00 40.84  ?  96  GLY D N   1 
ATOM   3768  C CA  . GLY D  2 73  ? 444.240 78.521  418.116 1.00 41.88  ?  96  GLY D CA  1 
ATOM   3769  C C   . GLY D  2 73  ? 445.263 78.930  417.069 1.00 50.77  ?  96  GLY D C   1 
ATOM   3770  O O   . GLY D  2 73  ? 444.997 78.975  415.868 1.00 56.67  ?  96  GLY D O   1 
ATOM   3771  N N   . ALA D  2 74  ? 446.465 79.234  417.564 1.00 65.75  ?  97  ALA D N   1 
ATOM   3772  C CA  . ALA D  2 74  ? 447.528 79.714  416.686 1.00 60.62  ?  97  ALA D CA  1 
ATOM   3773  C C   . ALA D  2 74  ? 448.095 78.583  415.835 1.00 60.03  ?  97  ALA D C   1 
ATOM   3774  O O   . ALA D  2 74  ? 448.292 78.742  414.624 1.00 67.29  ?  97  ALA D O   1 
ATOM   3775  C CB  . ALA D  2 74  ? 448.630 80.375  417.513 1.00 62.61  ?  97  ALA D CB  1 
ATOM   3776  N N   . GLY D  2 75  ? 448.365 77.436  416.451 1.00 72.29  ?  98  GLY D N   1 
ATOM   3777  C CA  . GLY D  2 75  ? 448.938 76.307  415.745 1.00 78.96  ?  98  GLY D CA  1 
ATOM   3778  C C   . GLY D  2 75  ? 447.925 75.238  415.391 1.00 85.80  ?  98  GLY D C   1 
ATOM   3779  O O   . GLY D  2 75  ? 448.287 74.069  415.221 1.00 86.22  ?  98  GLY D O   1 
ATOM   3780  N N   . CYS D  2 76  ? 446.650 75.628  415.291 1.00 61.08  ?  99  CYS D N   1 
ATOM   3781  C CA  . CYS D  2 76  ? 445.538 74.685  415.143 1.00 54.49  ?  99  CYS D CA  1 
ATOM   3782  C C   . CYS D  2 76  ? 445.492 73.724  416.327 1.00 57.12  ?  99  CYS D C   1 
ATOM   3783  O O   . CYS D  2 76  ? 445.283 72.519  416.170 1.00 59.77  ?  99  CYS D O   1 
ATOM   3784  C CB  . CYS D  2 76  ? 445.610 73.917  413.821 1.00 56.04  ?  99  CYS D CB  1 
ATOM   3785  S SG  . CYS D  2 76  ? 445.120 74.847  412.350 1.00 93.79  ?  99  CYS D SG  1 
ATOM   3786  N N   . SER D  2 77  ? 445.687 74.270  417.530 1.00 42.36  ?  100 SER D N   1 
ATOM   3787  C CA  . SER D  2 77  ? 445.692 73.464  418.744 1.00 38.83  ?  100 SER D CA  1 
ATOM   3788  C C   . SER D  2 77  ? 444.344 72.821  419.031 1.00 36.34  ?  100 SER D C   1 
ATOM   3789  O O   . SER D  2 77  ? 444.267 71.952  419.906 1.00 45.42  ?  100 SER D O   1 
ATOM   3790  C CB  . SER D  2 77  ? 446.115 74.325  419.937 1.00 48.00  ?  100 SER D CB  1 
ATOM   3791  O OG  . SER D  2 77  ? 447.309 75.036  419.658 1.00 57.84  ?  100 SER D OG  1 
ATOM   3792  N N   . MET D  2 78  ? 443.288 73.220  418.326 1.00 31.81  ?  101 MET D N   1 
ATOM   3793  C CA  . MET D  2 78  ? 441.957 72.690  418.569 1.00 33.25  ?  101 MET D CA  1 
ATOM   3794  C C   . MET D  2 78  ? 441.135 72.822  417.293 1.00 31.88  ?  101 MET D C   1 
ATOM   3795  O O   . MET D  2 78  ? 441.594 73.366  416.285 1.00 37.09  ?  101 MET D O   1 
ATOM   3796  C CB  . MET D  2 78  ? 441.293 73.420  419.740 1.00 31.93  ?  101 MET D CB  1 
ATOM   3797  C CG  . MET D  2 78  ? 440.421 72.544  420.616 1.00 32.47  ?  101 MET D CG  1 
ATOM   3798  S SD  . MET D  2 78  ? 439.959 73.388  422.137 1.00 41.86  ?  101 MET D SD  1 
ATOM   3799  C CE  . MET D  2 78  ? 441.562 73.953  422.704 1.00 40.60  ?  101 MET D CE  1 
ATOM   3800  N N   . CYS D  2 79  ? 439.904 72.319  417.349 1.00 45.28  ?  102 CYS D N   1 
ATOM   3801  C CA  . CYS D  2 79  ? 438.945 72.483  416.270 1.00 47.19  ?  102 CYS D CA  1 
ATOM   3802  C C   . CYS D  2 79  ? 437.565 72.688  416.875 1.00 42.37  ?  102 CYS D C   1 
ATOM   3803  O O   . CYS D  2 79  ? 437.327 72.393  418.048 1.00 50.13  ?  102 CYS D O   1 
ATOM   3804  C CB  . CYS D  2 79  ? 438.919 71.280  415.319 1.00 49.70  ?  102 CYS D CB  1 
ATOM   3805  S SG  . CYS D  2 79  ? 440.454 70.957  414.428 1.00 52.01  ?  102 CYS D SG  1 
ATOM   3806  N N   . GLU D  2 80  ? 436.654 73.197  416.053 1.00 39.80  ?  103 GLU D N   1 
ATOM   3807  C CA  . GLU D  2 80  ? 435.303 73.482  416.505 1.00 49.57  ?  103 GLU D CA  1 
ATOM   3808  C C   . GLU D  2 80  ? 434.342 73.261  415.349 1.00 49.72  ?  103 GLU D C   1 
ATOM   3809  O O   . GLU D  2 80  ? 434.723 73.334  414.177 1.00 55.55  ?  103 GLU D O   1 
ATOM   3810  C CB  . GLU D  2 80  ? 435.183 74.915  417.040 1.00 53.25  ?  103 GLU D CB  1 
ATOM   3811  C CG  . GLU D  2 80  ? 434.090 75.109  418.078 1.00 55.17  ?  103 GLU D CG  1 
ATOM   3812  C CD  . GLU D  2 80  ? 433.781 76.571  418.326 1.00 57.45  ?  103 GLU D CD  1 
ATOM   3813  O OE1 . GLU D  2 80  ? 433.096 77.186  417.481 1.00 61.32  ?  103 GLU D OE1 1 
ATOM   3814  O OE2 . GLU D  2 80  ? 434.226 77.107  419.362 1.00 66.27  -1 103 GLU D OE2 1 
ATOM   3815  N N   . GLN D  2 81  ? 433.088 72.988  415.692 1.00 38.29  ?  104 GLN D N   1 
ATOM   3816  C CA  . GLN D  2 81  ? 432.052 72.888  414.680 1.00 43.76  ?  104 GLN D CA  1 
ATOM   3817  C C   . GLN D  2 81  ? 431.824 74.240  414.013 1.00 46.37  ?  104 GLN D C   1 
ATOM   3818  O O   . GLN D  2 81  ? 432.182 75.294  414.544 1.00 48.45  ?  104 GLN D O   1 
ATOM   3819  C CB  . GLN D  2 81  ? 430.744 72.388  415.292 1.00 50.17  ?  104 GLN D CB  1 
ATOM   3820  C CG  . GLN D  2 81  ? 430.566 70.884  415.260 1.00 51.14  ?  104 GLN D CG  1 
ATOM   3821  C CD  . GLN D  2 81  ? 429.142 70.478  415.577 1.00 51.76  ?  104 GLN D CD  1 
ATOM   3822  O OE1 . GLN D  2 81  ? 428.455 71.140  416.353 1.00 55.72  ?  104 GLN D OE1 1 
ATOM   3823  N NE2 . GLN D  2 81  ? 428.677 69.410  414.949 1.00 45.37  ?  104 GLN D NE2 1 
ATOM   3824  N N   . ASP D  2 82  ? 431.236 74.192  412.820 1.00 71.59  ?  105 ASP D N   1 
ATOM   3825  C CA  . ASP D  2 82  ? 430.830 75.416  412.146 1.00 74.06  ?  105 ASP D CA  1 
ATOM   3826  C C   . ASP D  2 82  ? 429.885 76.212  413.037 1.00 73.98  ?  105 ASP D C   1 
ATOM   3827  O O   . ASP D  2 82  ? 428.984 75.655  413.670 1.00 78.77  ?  105 ASP D O   1 
ATOM   3828  C CB  . ASP D  2 82  ? 430.164 75.087  410.806 1.00 87.89  ?  105 ASP D CB  1 
ATOM   3829  C CG  . ASP D  2 82  ? 429.269 73.856  410.877 1.00 92.89  ?  105 ASP D CG  1 
ATOM   3830  O OD1 . ASP D  2 82  ? 428.436 73.762  411.803 1.00 88.56  ?  105 ASP D OD1 1 
ATOM   3831  O OD2 . ASP D  2 82  ? 429.400 72.976  409.998 1.00 90.94  -1 105 ASP D OD2 1 
ATOM   3832  N N   . CYS D  2 83  ? 430.098 77.524  413.095 1.00 47.55  ?  106 CYS D N   1 
ATOM   3833  C CA  . CYS D  2 83  ? 429.284 78.362  413.966 1.00 46.50  ?  106 CYS D CA  1 
ATOM   3834  C C   . CYS D  2 83  ? 427.892 78.492  413.364 1.00 44.55  ?  106 CYS D C   1 
ATOM   3835  O O   . CYS D  2 83  ? 427.733 79.017  412.258 1.00 39.72  ?  106 CYS D O   1 
ATOM   3836  C CB  . CYS D  2 83  ? 429.927 79.736  414.136 1.00 45.08  ?  106 CYS D CB  1 
ATOM   3837  S SG  . CYS D  2 83  ? 431.497 79.821  415.062 1.00 46.74  ?  106 CYS D SG  1 
ATOM   3838  N N   . LYS D  2 84  ? 426.882 78.059  414.109 1.00 46.04  ?  107 LYS D N   1 
ATOM   3839  C CA  . LYS D  2 84  ? 425.550 77.844  413.561 1.00 38.76  ?  107 LYS D CA  1 
ATOM   3840  C C   . LYS D  2 84  ? 424.810 79.175  413.444 1.00 41.61  ?  107 LYS D C   1 
ATOM   3841  O O   . LYS D  2 84  ? 425.395 80.255  413.565 1.00 48.37  ?  107 LYS D O   1 
ATOM   3842  C CB  . LYS D  2 84  ? 424.791 76.844  414.426 1.00 44.08  ?  107 LYS D CB  1 
ATOM   3843  C CG  . LYS D  2 84  ? 425.688 75.805  415.075 1.00 47.40  ?  107 LYS D CG  1 
ATOM   3844  C CD  . LYS D  2 84  ? 425.012 75.157  416.269 1.00 48.92  ?  107 LYS D CD  1 
ATOM   3845  C CE  . LYS D  2 84  ? 426.032 74.478  417.170 1.00 52.52  ?  107 LYS D CE  1 
ATOM   3846  N NZ  . LYS D  2 84  ? 425.398 73.876  418.374 1.00 61.75  ?  107 LYS D NZ  1 
ATOM   3847  N N   . GLN D  2 85  ? 423.508 79.103  413.171 1.00 36.81  ?  108 GLN D N   1 
ATOM   3848  C CA  . GLN D  2 85  ? 422.682 80.302  413.129 1.00 37.41  ?  108 GLN D CA  1 
ATOM   3849  C C   . GLN D  2 85  ? 422.785 81.061  414.446 1.00 34.96  ?  108 GLN D C   1 
ATOM   3850  O O   . GLN D  2 85  ? 422.757 80.469  415.528 1.00 36.36  ?  108 GLN D O   1 
ATOM   3851  C CB  . GLN D  2 85  ? 421.226 79.933  412.851 1.00 38.56  ?  108 GLN D CB  1 
ATOM   3852  C CG  . GLN D  2 85  ? 421.040 78.939  411.723 1.00 39.60  ?  108 GLN D CG  1 
ATOM   3853  C CD  . GLN D  2 85  ? 419.580 78.644  411.452 1.00 55.07  ?  108 GLN D CD  1 
ATOM   3854  O OE1 . GLN D  2 85  ? 418.710 79.485  411.691 1.00 41.59  ?  108 GLN D OE1 1 
ATOM   3855  N NE2 . GLN D  2 85  ? 419.300 77.446  410.949 1.00 60.35  ?  108 GLN D NE2 1 
ATOM   3856  N N   . GLY D  2 86  ? 422.911 82.381  414.347 1.00 19.96  ?  109 GLY D N   1 
ATOM   3857  C CA  . GLY D  2 86  ? 423.097 83.184  415.536 1.00 20.54  ?  109 GLY D CA  1 
ATOM   3858  C C   . GLY D  2 86  ? 424.435 82.999  416.211 1.00 20.26  ?  109 GLY D C   1 
ATOM   3859  O O   . GLY D  2 86  ? 424.555 83.265  417.409 1.00 25.14  ?  109 GLY D O   1 
ATOM   3860  N N   . GLN D  2 87  ? 425.447 82.542  415.476 1.00 26.83  ?  110 GLN D N   1 
ATOM   3861  C CA  . GLN D  2 87  ? 426.782 82.359  416.022 1.00 30.94  ?  110 GLN D CA  1 
ATOM   3862  C C   . GLN D  2 87  ? 427.810 82.876  415.027 1.00 32.03  ?  110 GLN D C   1 
ATOM   3863  O O   . GLN D  2 87  ? 427.689 82.651  413.819 1.00 31.84  ?  110 GLN D O   1 
ATOM   3864  C CB  . GLN D  2 87  ? 427.059 80.888  416.359 1.00 27.17  ?  110 GLN D CB  1 
ATOM   3865  C CG  . GLN D  2 87  ? 426.346 80.402  417.612 1.00 32.92  ?  110 GLN D CG  1 
ATOM   3866  C CD  . GLN D  2 87  ? 426.649 78.953  417.940 1.00 30.51  ?  110 GLN D CD  1 
ATOM   3867  O OE1 . GLN D  2 87  ? 427.027 78.173  417.066 1.00 30.79  ?  110 GLN D OE1 1 
ATOM   3868  N NE2 . GLN D  2 87  ? 426.487 78.587  419.206 1.00 22.95  ?  110 GLN D NE2 1 
ATOM   3869  N N   . GLU D  2 88  ? 428.820 83.569  415.548 1.00 55.32  ?  111 GLU D N   1 
ATOM   3870  C CA  . GLU D  2 88  ? 429.863 84.196  414.747 1.00 58.39  ?  111 GLU D CA  1 
ATOM   3871  C C   . GLU D  2 88  ? 431.211 83.889  415.380 1.00 64.83  ?  111 GLU D C   1 
ATOM   3872  O O   . GLU D  2 88  ? 431.406 84.138  416.574 1.00 68.90  ?  111 GLU D O   1 
ATOM   3873  C CB  . GLU D  2 88  ? 429.636 85.708  414.655 1.00 60.05  ?  111 GLU D CB  1 
ATOM   3874  C CG  . GLU D  2 88  ? 430.764 86.489  414.010 1.00 74.24  ?  111 GLU D CG  1 
ATOM   3875  C CD  . GLU D  2 88  ? 430.625 87.983  414.236 1.00 77.17  ?  111 GLU D CD  1 
ATOM   3876  O OE1 . GLU D  2 88  ? 429.974 88.375  415.227 1.00 74.53  ?  111 GLU D OE1 1 
ATOM   3877  O OE2 . GLU D  2 88  ? 431.167 88.765  413.426 1.00 83.42  -1 111 GLU D OE2 1 
ATOM   3878  N N   . LEU D  2 89  ? 432.135 83.348  414.587 1.00 49.35  ?  112 LEU D N   1 
ATOM   3879  C CA  . LEU D  2 89  ? 433.416 82.908  415.127 1.00 56.89  ?  112 LEU D CA  1 
ATOM   3880  C C   . LEU D  2 89  ? 434.212 84.099  415.650 1.00 66.11  ?  112 LEU D C   1 
ATOM   3881  O O   . LEU D  2 89  ? 434.339 85.126  414.975 1.00 68.12  ?  112 LEU D O   1 
ATOM   3882  C CB  . LEU D  2 89  ? 434.215 82.138  414.071 1.00 52.70  ?  112 LEU D CB  1 
ATOM   3883  C CG  . LEU D  2 89  ? 434.991 82.853  412.963 1.00 59.30  ?  112 LEU D CG  1 
ATOM   3884  C CD1 . LEU D  2 89  ? 435.867 81.856  412.221 1.00 62.69  ?  112 LEU D CD1 1 
ATOM   3885  C CD2 . LEU D  2 89  ? 434.061 83.566  411.995 1.00 64.13  ?  112 LEU D CD2 1 
ATOM   3886  N N   . THR D  2 90  ? 434.729 83.964  416.869 1.00 64.91  ?  113 THR D N   1 
ATOM   3887  C CA  . THR D  2 90  ? 435.394 85.050  417.572 1.00 58.55  ?  113 THR D CA  1 
ATOM   3888  C C   . THR D  2 90  ? 436.910 85.023  417.419 1.00 63.27  ?  113 THR D C   1 
ATOM   3889  O O   . THR D  2 90  ? 437.587 85.860  418.024 1.00 72.48  ?  113 THR D O   1 
ATOM   3890  C CB  . THR D  2 90  ? 435.019 85.016  419.062 1.00 59.64  ?  113 THR D CB  1 
ATOM   3891  O OG1 . THR D  2 90  ? 433.652 84.614  419.194 1.00 57.45  ?  113 THR D OG1 1 
ATOM   3892  C CG2 . THR D  2 90  ? 435.169 86.394  419.696 1.00 66.59  ?  113 THR D CG2 1 
ATOM   3893  N N   . LYS D  2 91  ? 437.459 84.099  416.621 1.00 88.88  ?  114 LYS D N   1 
ATOM   3894  C CA  . LYS D  2 91  ? 438.908 84.036  416.439 1.00 100.16 ?  114 LYS D CA  1 
ATOM   3895  C C   . LYS D  2 91  ? 439.603 83.773  417.772 1.00 96.25  ?  114 LYS D C   1 
ATOM   3896  O O   . LYS D  2 91  ? 440.047 84.721  418.428 1.00 97.07  ?  114 LYS D O   1 
ATOM   3897  C CB  . LYS D  2 91  ? 439.446 85.314  415.780 1.00 101.93 ?  114 LYS D CB  1 
ATOM   3898  C CG  . LYS D  2 91  ? 438.636 85.802  414.580 1.00 98.06  ?  114 LYS D CG  1 
ATOM   3899  C CD  . LYS D  2 91  ? 438.411 84.701  413.551 1.00 95.29  ?  114 LYS D CD  1 
ATOM   3900  C CE  . LYS D  2 91  ? 439.711 84.253  412.908 1.00 99.68  ?  114 LYS D CE  1 
ATOM   3901  N NZ  . LYS D  2 91  ? 439.482 83.159  411.923 1.00 99.41  ?  114 LYS D NZ  1 
ATOM   3902  N N   . LYS D  2 92  ? 439.713 82.493  418.162 1.00 88.20  ?  115 LYS D N   1 
ATOM   3903  C CA  . LYS D  2 92  ? 439.791 82.003  419.540 1.00 84.33  ?  115 LYS D CA  1 
ATOM   3904  C C   . LYS D  2 92  ? 438.444 82.096  420.245 1.00 81.56  ?  115 LYS D C   1 
ATOM   3905  O O   . LYS D  2 92  ? 438.217 82.972  421.085 1.00 79.27  ?  115 LYS D O   1 
ATOM   3906  C CB  . LYS D  2 92  ? 440.850 82.754  420.357 1.00 90.55  ?  115 LYS D CB  1 
ATOM   3907  C CG  . LYS D  2 92  ? 441.904 81.872  421.005 1.00 84.34  ?  115 LYS D CG  1 
ATOM   3908  C CD  . LYS D  2 92  ? 443.066 81.612  420.062 1.00 78.07  ?  115 LYS D CD  1 
ATOM   3909  C CE  . LYS D  2 92  ? 444.242 81.000  420.803 1.00 74.75  ?  115 LYS D CE  1 
ATOM   3910  N NZ  . LYS D  2 92  ? 445.461 80.938  419.950 1.00 72.80  ?  115 LYS D NZ  1 
ATOM   3911  N N   . GLY D  2 93  ? 437.551 81.183  419.885 1.00 71.18  ?  116 GLY D N   1 
ATOM   3912  C CA  . GLY D  2 93  ? 436.206 81.056  420.399 1.00 54.50  ?  116 GLY D CA  1 
ATOM   3913  C C   . GLY D  2 93  ? 435.166 81.405  419.346 1.00 62.01  ?  116 GLY D C   1 
ATOM   3914  O O   . GLY D  2 93  ? 435.459 81.998  418.306 1.00 69.24  ?  116 GLY D O   1 
ATOM   3915  N N   . CYS D  2 94  ? 433.930 80.981  419.609 1.00 59.84  ?  117 CYS D N   1 
ATOM   3916  C CA  . CYS D  2 94  ? 432.782 81.390  418.806 1.00 56.51  ?  117 CYS D CA  1 
ATOM   3917  C C   . CYS D  2 94  ? 431.779 82.078  419.722 1.00 60.96  ?  117 CYS D C   1 
ATOM   3918  O O   . CYS D  2 94  ? 431.172 81.434  420.584 1.00 53.55  ?  117 CYS D O   1 
ATOM   3919  C CB  . CYS D  2 94  ? 432.136 80.209  418.074 1.00 44.25  ?  117 CYS D CB  1 
ATOM   3920  S SG  . CYS D  2 94  ? 430.999 80.790  416.782 1.00 75.19  ?  117 CYS D SG  1 
ATOM   3921  N N   . LYS D  2 95  ? 431.605 83.382  419.527 1.00 70.57  ?  118 LYS D N   1 
ATOM   3922  C CA  . LYS D  2 95  ? 430.576 84.129  420.230 1.00 70.41  ?  118 LYS D CA  1 
ATOM   3923  C C   . LYS D  2 95  ? 429.196 83.665  419.779 1.00 63.52  ?  118 LYS D C   1 
ATOM   3924  O O   . LYS D  2 95  ? 429.035 83.038  418.728 1.00 58.37  ?  118 LYS D O   1 
ATOM   3925  C CB  . LYS D  2 95  ? 430.718 85.630  419.966 1.00 78.34  ?  118 LYS D CB  1 
ATOM   3926  C CG  . LYS D  2 95  ? 431.597 86.382  420.952 1.00 79.16  ?  118 LYS D CG  1 
ATOM   3927  C CD  . LYS D  2 95  ? 431.926 87.779  420.433 1.00 75.80  ?  118 LYS D CD  1 
ATOM   3928  C CE  . LYS D  2 95  ? 430.685 88.498  419.920 1.00 81.28  ?  118 LYS D CE  1 
ATOM   3929  N NZ  . LYS D  2 95  ? 429.669 88.704  420.988 1.00 88.49  ?  118 LYS D NZ  1 
ATOM   3930  N N   . ASP D  2 96  ? 428.188 83.979  420.585 1.00 59.67  ?  119 ASP D N   1 
ATOM   3931  C CA  . ASP D  2 96  ? 426.808 83.754  420.175 1.00 54.98  ?  119 ASP D CA  1 
ATOM   3932  C C   . ASP D  2 96  ? 426.292 85.105  419.699 1.00 56.11  ?  119 ASP D C   1 
ATOM   3933  O O   . ASP D  2 96  ? 425.876 85.946  420.501 1.00 59.53  ?  119 ASP D O   1 
ATOM   3934  C CB  . ASP D  2 96  ? 425.986 83.192  421.331 1.00 55.65  ?  119 ASP D CB  1 
ATOM   3935  C CG  . ASP D  2 96  ? 424.636 82.670  420.889 1.00 71.71  ?  119 ASP D CG  1 
ATOM   3936  O OD1 . ASP D  2 96  ? 424.579 81.538  420.362 1.00 69.01  ?  119 ASP D OD1 1 
ATOM   3937  O OD2 . ASP D  2 96  ? 423.631 83.386  421.076 1.00 78.27  -1 119 ASP D OD2 1 
ATOM   3938  N N   . CYS D  2 97  ? 426.304 85.284  418.378 1.00 108.40 ?  120 CYS D N   1 
ATOM   3939  C CA  . CYS D  2 97  ? 425.892 86.499  417.682 1.00 110.78 ?  120 CYS D CA  1 
ATOM   3940  C C   . CYS D  2 97  ? 426.346 87.769  418.390 1.00 123.69 ?  120 CYS D C   1 
ATOM   3941  O O   . CYS D  2 97  ? 427.499 87.883  418.820 1.00 129.45 ?  120 CYS D O   1 
ATOM   3942  C CB  . CYS D  2 97  ? 424.379 86.528  417.486 1.00 104.23 ?  120 CYS D CB  1 
ATOM   3943  S SG  . CYS D  2 97  ? 423.932 87.283  415.910 1.00 128.34 ?  120 CYS D SG  1 
ATOM   3944  N N   . CYS D  2 98  ? 425.426 88.723  418.512 1.00 76.26  ?  121 CYS D N   1 
ATOM   3945  C CA  . CYS D  2 98  ? 425.644 89.954  419.255 1.00 78.35  ?  121 CYS D CA  1 
ATOM   3946  C C   . CYS D  2 98  ? 424.280 90.544  419.581 1.00 76.44  ?  121 CYS D C   1 
ATOM   3947  O O   . CYS D  2 98  ? 423.267 90.168  418.984 1.00 74.07  ?  121 CYS D O   1 
ATOM   3948  C CB  . CYS D  2 98  ? 426.502 90.949  418.469 1.00 81.13  ?  121 CYS D CB  1 
ATOM   3949  S SG  . CYS D  2 98  ? 427.362 92.153  419.496 1.00 99.31  ?  121 CYS D SG  1 
ATOM   3950  N N   . PHE D  2 99  ? 424.262 91.464  420.539 1.00 85.18  ?  122 PHE D N   1 
ATOM   3951  C CA  . PHE D  2 99  ? 423.021 92.150  420.876 1.00 90.55  ?  122 PHE D CA  1 
ATOM   3952  C C   . PHE D  2 99  ? 422.634 93.095  419.743 1.00 81.34  ?  122 PHE D C   1 
ATOM   3953  O O   . PHE D  2 99  ? 423.412 93.974  419.363 1.00 82.28  ?  122 PHE D O   1 
ATOM   3954  C CB  . PHE D  2 99  ? 423.174 92.917  422.188 1.00 108.43 ?  122 PHE D CB  1 
ATOM   3955  C CG  . PHE D  2 99  ? 423.356 92.033  423.392 1.00 125.28 ?  122 PHE D CG  1 
ATOM   3956  C CD1 . PHE D  2 99  ? 422.958 90.705  423.363 1.00 119.84 ?  122 PHE D CD1 1 
ATOM   3957  C CD2 . PHE D  2 99  ? 423.917 92.533  424.555 1.00 122.98 ?  122 PHE D CD2 1 
ATOM   3958  C CE1 . PHE D  2 99  ? 423.124 89.892  424.470 1.00 117.26 ?  122 PHE D CE1 1 
ATOM   3959  C CE2 . PHE D  2 99  ? 424.085 91.726  425.665 1.00 118.71 ?  122 PHE D CE2 1 
ATOM   3960  C CZ  . PHE D  2 99  ? 423.688 90.404  425.623 1.00 120.43 ?  122 PHE D CZ  1 
ATOM   3961  N N   . GLY D  2 100 ? 421.429 92.911  419.202 1.00 42.77  ?  123 GLY D N   1 
ATOM   3962  C CA  . GLY D  2 100 ? 420.923 93.756  418.144 1.00 37.59  ?  123 GLY D CA  1 
ATOM   3963  C C   . GLY D  2 100 ? 421.218 93.289  416.732 1.00 36.35  ?  123 GLY D C   1 
ATOM   3964  O O   . GLY D  2 100 ? 420.726 93.909  415.781 1.00 35.17  ?  123 GLY D O   1 
ATOM   3965  N N   . THR D  2 101 ? 421.999 92.227  416.560 1.00 33.19  ?  124 THR D N   1 
ATOM   3966  C CA  . THR D  2 101 ? 422.355 91.718  415.241 1.00 27.89  ?  124 THR D CA  1 
ATOM   3967  C C   . THR D  2 101 ? 421.775 90.318  415.050 1.00 25.75  ?  124 THR D C   1 
ATOM   3968  O O   . THR D  2 101 ? 421.143 89.753  415.947 1.00 23.49  ?  124 THR D O   1 
ATOM   3969  C CB  . THR D  2 101 ? 423.875 91.707  415.052 1.00 28.26  ?  124 THR D CB  1 
ATOM   3970  O OG1 . THR D  2 101 ? 424.469 90.795  415.983 1.00 37.71  ?  124 THR D OG1 1 
ATOM   3971  C CG2 . THR D  2 101 ? 424.448 93.097  415.280 1.00 30.62  ?  124 THR D CG2 1 
ATOM   3972  N N   . PHE D  2 102 ? 421.996 89.758  413.861 1.00 35.76  ?  125 PHE D N   1 
ATOM   3973  C CA  . PHE D  2 102 ? 421.487 88.435  413.530 1.00 29.46  ?  125 PHE D CA  1 
ATOM   3974  C C   . PHE D  2 102 ? 422.385 87.788  412.486 1.00 32.57  ?  125 PHE D C   1 
ATOM   3975  O O   . PHE D  2 102 ? 422.998 88.472  411.663 1.00 38.42  ?  125 PHE D O   1 
ATOM   3976  C CB  . PHE D  2 102 ? 420.051 88.497  412.996 1.00 36.85  ?  125 PHE D CB  1 
ATOM   3977  C CG  . PHE D  2 102 ? 419.969 88.826  411.533 1.00 35.22  ?  125 PHE D CG  1 
ATOM   3978  C CD1 . PHE D  2 102 ? 420.146 90.126  411.091 1.00 38.26  ?  125 PHE D CD1 1 
ATOM   3979  C CD2 . PHE D  2 102 ? 419.725 87.833  410.598 1.00 31.89  ?  125 PHE D CD2 1 
ATOM   3980  C CE1 . PHE D  2 102 ? 420.078 90.432  409.746 1.00 39.63  ?  125 PHE D CE1 1 
ATOM   3981  C CE2 . PHE D  2 102 ? 419.657 88.132  409.251 1.00 36.86  ?  125 PHE D CE2 1 
ATOM   3982  C CZ  . PHE D  2 102 ? 419.833 89.434  408.824 1.00 39.02  ?  125 PHE D CZ  1 
ATOM   3983  N N   . ASN D  2 103 ? 422.455 86.459  412.530 1.00 36.69  ?  126 ASN D N   1 
ATOM   3984  C CA  . ASN D  2 103 ? 423.051 85.666  411.458 1.00 35.22  ?  126 ASN D CA  1 
ATOM   3985  C C   . ASN D  2 103 ? 422.179 84.448  411.214 1.00 31.62  ?  126 ASN D C   1 
ATOM   3986  O O   . ASN D  2 103 ? 421.976 83.643  412.127 1.00 32.61  ?  126 ASN D O   1 
ATOM   3987  C CB  . ASN D  2 103 ? 424.478 85.228  411.801 1.00 33.62  ?  126 ASN D CB  1 
ATOM   3988  C CG  . ASN D  2 103 ? 425.013 84.172  410.848 1.00 39.16  ?  126 ASN D CG  1 
ATOM   3989  O OD1 . ASN D  2 103 ? 424.704 84.179  409.655 1.00 43.95  ?  126 ASN D OD1 1 
ATOM   3990  N ND2 . ASN D  2 103 ? 425.815 83.253  411.374 1.00 34.46  ?  126 ASN D ND2 1 
ATOM   3991  N N   . ASP D  2 104 ? 421.663 84.309  409.999 1.00 67.61  ?  127 ASP D N   1 
ATOM   3992  C CA  . ASP D  2 104 ? 421.065 83.053  409.560 1.00 71.50  ?  127 ASP D CA  1 
ATOM   3993  C C   . ASP D  2 104 ? 421.935 82.504  408.437 1.00 79.72  ?  127 ASP D C   1 
ATOM   3994  O O   . ASP D  2 104 ? 421.831 82.949  407.289 1.00 91.69  ?  127 ASP D O   1 
ATOM   3995  C CB  . ASP D  2 104 ? 419.625 83.266  409.102 1.00 79.33  ?  127 ASP D CB  1 
ATOM   3996  C CG  . ASP D  2 104 ? 419.005 82.008  408.532 1.00 87.42  ?  127 ASP D CG  1 
ATOM   3997  O OD1 . ASP D  2 104 ? 419.200 80.927  409.126 1.00 83.95  ?  127 ASP D OD1 1 
ATOM   3998  O OD2 . ASP D  2 104 ? 418.330 82.100  407.485 1.00 98.59  -1 127 ASP D OD2 1 
ATOM   3999  N N   . GLN D  2 105 ? 422.754 81.504  408.773 1.00 78.27  ?  128 GLN D N   1 
ATOM   4000  C CA  . GLN D  2 105 ? 423.603 80.765  407.844 1.00 80.04  ?  128 GLN D CA  1 
ATOM   4001  C C   . GLN D  2 105 ? 424.504 79.838  408.647 1.00 77.29  ?  128 GLN D C   1 
ATOM   4002  O O   . GLN D  2 105 ? 424.687 80.041  409.852 1.00 82.19  ?  128 GLN D O   1 
ATOM   4003  C CB  . GLN D  2 105 ? 424.446 81.703  406.974 1.00 86.40  ?  128 GLN D CB  1 
ATOM   4004  C CG  . GLN D  2 105 ? 424.959 81.068  405.688 1.00 91.34  ?  128 GLN D CG  1 
ATOM   4005  C CD  . GLN D  2 105 ? 425.167 82.081  404.579 1.00 89.72  ?  128 GLN D CD  1 
ATOM   4006  O OE1 . GLN D  2 105 ? 424.671 83.208  404.650 1.00 77.60  ?  128 GLN D OE1 1 
ATOM   4007  N NE2 . GLN D  2 105 ? 425.902 81.686  403.546 1.00 90.82  ?  128 GLN D NE2 1 
ATOM   4008  N N   . LYS D  2 106 ? 425.084 78.828  407.999 1.00 42.51  ?  129 LYS D N   1 
ATOM   4009  C CA  . LYS D  2 106 ? 426.040 77.977  408.696 1.00 38.49  ?  129 LYS D CA  1 
ATOM   4010  C C   . LYS D  2 106 ? 427.427 78.607  408.744 1.00 39.35  ?  129 LYS D C   1 
ATOM   4011  O O   . LYS D  2 106 ? 428.132 78.482  409.749 1.00 45.69  ?  129 LYS D O   1 
ATOM   4012  C CB  . LYS D  2 106 ? 426.098 76.598  408.045 1.00 43.76  ?  129 LYS D CB  1 
ATOM   4013  C CG  . LYS D  2 106 ? 425.044 75.637  408.566 1.00 40.28  ?  129 LYS D CG  1 
ATOM   4014  C CD  . LYS D  2 106 ? 425.322 74.220  408.109 1.00 39.11  ?  129 LYS D CD  1 
ATOM   4015  C CE  . LYS D  2 106 ? 426.768 73.840  408.371 1.00 48.37  ?  129 LYS D CE  1 
ATOM   4016  N NZ  . LYS D  2 106 ? 427.078 72.457  407.916 1.00 58.09  ?  129 LYS D NZ  1 
ATOM   4017  N N   . ARG D  2 107 ? 427.855 79.246  407.660 1.00 54.30  ?  130 ARG D N   1 
ATOM   4018  C CA  . ARG D  2 107 ? 429.129 79.951  407.631 1.00 56.82  ?  130 ARG D CA  1 
ATOM   4019  C C   . ARG D  2 107 ? 428.986 81.456  407.830 1.00 59.74  ?  130 ARG D C   1 
ATOM   4020  O O   . ARG D  2 107 ? 429.994 82.170  407.800 1.00 55.78  ?  130 ARG D O   1 
ATOM   4021  C CB  . ARG D  2 107 ? 429.858 79.663  406.314 1.00 67.73  ?  130 ARG D CB  1 
ATOM   4022  C CG  . ARG D  2 107 ? 429.947 78.179  405.984 1.00 68.71  ?  130 ARG D CG  1 
ATOM   4023  C CD  . ARG D  2 107 ? 430.522 77.383  407.148 1.00 59.55  ?  130 ARG D CD  1 
ATOM   4024  N NE  . ARG D  2 107 ? 429.912 76.059  407.260 1.00 60.67  ?  130 ARG D NE  1 
ATOM   4025  C CZ  . ARG D  2 107 ? 430.429 74.947  406.747 1.00 63.85  ?  130 ARG D CZ  1 
ATOM   4026  N NH1 . ARG D  2 107 ? 429.800 73.790  406.900 1.00 55.11  ?  130 ARG D NH1 1 
ATOM   4027  N NH2 . ARG D  2 107 ? 431.577 74.991  406.085 1.00 78.40  ?  130 ARG D NH2 1 
ATOM   4028  N N   . GLY D  2 108 ? 427.769 81.951  408.038 1.00 68.72  ?  131 GLY D N   1 
ATOM   4029  C CA  . GLY D  2 108 ? 427.505 83.374  408.001 1.00 62.33  ?  131 GLY D CA  1 
ATOM   4030  C C   . GLY D  2 108 ? 428.070 84.144  409.184 1.00 62.03  ?  131 GLY D C   1 
ATOM   4031  O O   . GLY D  2 108 ? 428.647 83.598  410.126 1.00 67.60  ?  131 GLY D O   1 
ATOM   4032  N N   . ILE D  2 109 ? 427.887 85.463  409.116 1.00 39.33  ?  132 ILE D N   1 
ATOM   4033  C CA  . ILE D  2 109 ? 428.350 86.404  410.127 1.00 38.72  ?  132 ILE D CA  1 
ATOM   4034  C C   . ILE D  2 109 ? 427.146 87.176  410.651 1.00 40.94  ?  132 ILE D C   1 
ATOM   4035  O O   . ILE D  2 109 ? 426.161 87.381  409.936 1.00 44.40  ?  132 ILE D O   1 
ATOM   4036  C CB  . ILE D  2 109 ? 429.410 87.373  409.557 1.00 37.68  ?  132 ILE D CB  1 
ATOM   4037  C CG1 . ILE D  2 109 ? 430.314 86.651  408.556 1.00 33.07  ?  132 ILE D CG1 1 
ATOM   4038  C CG2 . ILE D  2 109 ? 430.242 87.979  410.674 1.00 46.02  ?  132 ILE D CG2 1 
ATOM   4039  C CD1 . ILE D  2 109 ? 431.244 87.573  407.802 1.00 34.58  ?  132 ILE D CD1 1 
ATOM   4040  N N   . CYS D  2 110 ? 427.228 87.609  411.909 1.00 61.93  ?  133 CYS D N   1 
ATOM   4041  C CA  . CYS D  2 110 ? 426.134 88.363  412.515 1.00 64.92  ?  133 CYS D CA  1 
ATOM   4042  C C   . CYS D  2 110 ? 426.190 89.813  412.047 1.00 59.38  ?  133 CYS D C   1 
ATOM   4043  O O   . CYS D  2 110 ? 427.194 90.504  412.250 1.00 61.21  ?  133 CYS D O   1 
ATOM   4044  C CB  . CYS D  2 110 ? 426.184 88.267  414.042 1.00 70.78  ?  133 CYS D CB  1 
ATOM   4045  S SG  . CYS D  2 110 ? 425.452 86.725  414.676 1.00 71.16  ?  133 CYS D SG  1 
ATOM   4046  N N   . ARG D  2 111 ? 425.110 90.263  411.412 1.00 51.52  ?  134 ARG D N   1 
ATOM   4047  C CA  . ARG D  2 111 ? 424.940 91.586  410.841 1.00 51.49  ?  134 ARG D CA  1 
ATOM   4048  C C   . ARG D  2 111 ? 423.741 92.282  411.477 1.00 59.80  ?  134 ARG D C   1 
ATOM   4049  O O   . ARG D  2 111 ? 422.807 91.615  411.932 1.00 63.96  ?  134 ARG D O   1 
ATOM   4050  C CB  . ARG D  2 111 ? 424.751 91.497  409.319 1.00 53.42  ?  134 ARG D CB  1 
ATOM   4051  C CG  . ARG D  2 111 ? 423.996 90.255  408.864 1.00 55.62  ?  134 ARG D CG  1 
ATOM   4052  C CD  . ARG D  2 111 ? 424.176 90.007  407.372 1.00 47.58  ?  134 ARG D CD  1 
ATOM   4053  N NE  . ARG D  2 111 ? 423.199 90.734  406.568 1.00 53.85  ?  134 ARG D NE  1 
ATOM   4054  C CZ  . ARG D  2 111 ? 422.090 90.192  406.075 1.00 57.53  ?  134 ARG D CZ  1 
ATOM   4055  N NH1 . ARG D  2 111 ? 421.818 88.913  406.299 1.00 54.48  ?  134 ARG D NH1 1 
ATOM   4056  N NH2 . ARG D  2 111 ? 421.254 90.926  405.352 1.00 61.32  ?  134 ARG D NH2 1 
ATOM   4057  N N   . PRO D  2 112 ? 423.740 93.616  411.531 1.00 66.83  ?  135 PRO D N   1 
ATOM   4058  C CA  . PRO D  2 112 ? 422.676 94.327  412.249 1.00 63.98  ?  135 PRO D CA  1 
ATOM   4059  C C   . PRO D  2 112 ? 421.297 94.055  411.666 1.00 66.11  ?  135 PRO D C   1 
ATOM   4060  O O   . PRO D  2 112 ? 421.141 93.654  410.510 1.00 67.17  ?  135 PRO D O   1 
ATOM   4061  C CB  . PRO D  2 112 ? 423.062 95.803  412.088 1.00 60.10  ?  135 PRO D CB  1 
ATOM   4062  C CG  . PRO D  2 112 ? 424.526 95.786  411.827 1.00 58.56  ?  135 PRO D CG  1 
ATOM   4063  C CD  . PRO D  2 112 ? 424.780 94.536  411.038 1.00 70.77  ?  135 PRO D CD  1 
ATOM   4064  N N   . TRP D  2 113 ? 420.283 94.280  412.499 1.00 57.83  ?  136 TRP D N   1 
ATOM   4065  C CA  . TRP D  2 113 ? 418.902 94.100  412.085 1.00 59.16  ?  136 TRP D CA  1 
ATOM   4066  C C   . TRP D  2 113 ? 418.505 95.150  411.053 1.00 59.87  ?  136 TRP D C   1 
ATOM   4067  O O   . TRP D  2 113 ? 419.125 96.209  410.927 1.00 58.46  ?  136 TRP D O   1 
ATOM   4068  C CB  . TRP D  2 113 ? 417.958 94.195  413.285 1.00 56.41  ?  136 TRP D CB  1 
ATOM   4069  C CG  . TRP D  2 113 ? 417.983 93.006  414.185 1.00 58.40  ?  136 TRP D CG  1 
ATOM   4070  C CD1 . TRP D  2 113 ? 418.459 91.762  413.893 1.00 55.78  ?  136 TRP D CD1 1 
ATOM   4071  C CD2 . TRP D  2 113 ? 417.508 92.948  415.535 1.00 60.28  ?  136 TRP D CD2 1 
ATOM   4072  N NE1 . TRP D  2 113 ? 418.309 90.932  414.977 1.00 54.27  ?  136 TRP D NE1 1 
ATOM   4073  C CE2 . TRP D  2 113 ? 417.727 91.636  415.999 1.00 57.14  ?  136 TRP D CE2 1 
ATOM   4074  C CE3 . TRP D  2 113 ? 416.917 93.878  416.396 1.00 54.87  ?  136 TRP D CE3 1 
ATOM   4075  C CZ2 . TRP D  2 113 ? 417.379 91.232  417.285 1.00 55.29  ?  136 TRP D CZ2 1 
ATOM   4076  C CZ3 . TRP D  2 113 ? 416.572 93.475  417.671 1.00 57.09  ?  136 TRP D CZ3 1 
ATOM   4077  C CH2 . TRP D  2 113 ? 416.803 92.164  418.104 1.00 58.53  ?  136 TRP D CH2 1 
ATOM   4078  N N   . THR D  2 114 ? 417.448 94.840  410.308 1.00 48.60  ?  137 THR D N   1 
ATOM   4079  C CA  . THR D  2 114 ? 416.864 95.800  409.381 1.00 50.22  ?  137 THR D CA  1 
ATOM   4080  C C   . THR D  2 114 ? 416.069 96.829  410.174 1.00 52.84  ?  137 THR D C   1 
ATOM   4081  O O   . THR D  2 114 ? 415.162 96.468  410.934 1.00 50.53  ?  137 THR D O   1 
ATOM   4082  C CB  . THR D  2 114 ? 415.970 95.094  408.366 1.00 41.55  ?  137 THR D CB  1 
ATOM   4083  O OG1 . THR D  2 114 ? 416.714 94.062  407.705 1.00 46.86  ?  137 THR D OG1 1 
ATOM   4084  C CG2 . THR D  2 114 ? 415.460 96.083  407.329 1.00 45.47  ?  137 THR D CG2 1 
ATOM   4085  N N   . ASN D  2 115 ? 416.410 98.103  410.009 1.00 58.31  ?  138 ASN D N   1 
ATOM   4086  C CA  . ASN D  2 115 ? 415.716 99.185  410.695 1.00 59.65  ?  138 ASN D CA  1 
ATOM   4087  C C   . ASN D  2 115 ? 414.564 99.663  409.820 1.00 68.55  ?  138 ASN D C   1 
ATOM   4088  O O   . ASN D  2 115 ? 414.785 100.170 408.714 1.00 65.37  ?  138 ASN D O   1 
ATOM   4089  C CB  . ASN D  2 115 ? 416.676 100.330 411.010 1.00 59.79  ?  138 ASN D CB  1 
ATOM   4090  C CG  . ASN D  2 115 ? 416.012 101.453 411.782 1.00 62.70  ?  138 ASN D CG  1 
ATOM   4091  O OD1 . ASN D  2 115 ? 415.913 102.581 411.298 1.00 69.64  ?  138 ASN D OD1 1 
ATOM   4092  N ND2 . ASN D  2 115 ? 415.547 101.148 412.988 1.00 56.66  ?  138 ASN D ND2 1 
ATOM   4093  N N   . CYS D  2 116 ? 413.336 99.503  410.317 1.00 109.63 ?  139 CYS D N   1 
ATOM   4094  C CA  . CYS D  2 116 ? 412.151 99.842  409.541 1.00 108.80 ?  139 CYS D CA  1 
ATOM   4095  C C   . CYS D  2 116 ? 411.859 101.336 409.516 1.00 111.14 ?  139 CYS D C   1 
ATOM   4096  O O   . CYS D  2 116 ? 410.997 101.767 408.741 1.00 111.88 ?  139 CYS D O   1 
ATOM   4097  C CB  . CYS D  2 116 ? 410.932 99.090  410.087 1.00 101.09 ?  139 CYS D CB  1 
ATOM   4098  S SG  . CYS D  2 116 ? 411.192 97.322  410.419 1.00 97.41  ?  139 CYS D SG  1 
ATOM   4099  N N   . SER D  2 117 ? 412.545 102.135 410.338 1.00 59.42  ?  140 SER D N   1 
ATOM   4100  C CA  . SER D  2 117 ? 412.323 103.577 410.325 1.00 61.64  ?  140 SER D CA  1 
ATOM   4101  C C   . SER D  2 117 ? 412.752 104.200 409.004 1.00 61.58  ?  140 SER D C   1 
ATOM   4102  O O   . SER D  2 117 ? 412.126 105.161 408.539 1.00 60.18  ?  140 SER D O   1 
ATOM   4103  C CB  . SER D  2 117 ? 413.063 104.236 411.490 1.00 55.32  ?  140 SER D CB  1 
ATOM   4104  O OG  . SER D  2 117 ? 412.620 103.723 412.735 1.00 43.26  ?  140 SER D OG  1 
ATOM   4105  N N   . LEU D  2 118 ? 413.810 103.673 408.386 1.00 97.90  ?  141 LEU D N   1 
ATOM   4106  C CA  . LEU D  2 118 ? 414.242 104.181 407.089 1.00 102.73 ?  141 LEU D CA  1 
ATOM   4107  C C   . LEU D  2 118 ? 413.314 103.731 405.967 1.00 103.38 ?  141 LEU D C   1 
ATOM   4108  O O   . LEU D  2 118 ? 413.228 104.402 404.932 1.00 107.13 ?  141 LEU D O   1 
ATOM   4109  C CB  . LEU D  2 118 ? 415.676 103.737 406.802 1.00 110.69 ?  141 LEU D CB  1 
ATOM   4110  C CG  . LEU D  2 118 ? 416.684 103.934 407.936 1.00 107.59 ?  141 LEU D CG  1 
ATOM   4111  C CD1 . LEU D  2 118 ? 418.082 103.526 407.493 1.00 110.54 ?  141 LEU D CD1 1 
ATOM   4112  C CD2 . LEU D  2 118 ? 416.671 105.375 408.425 1.00 106.25 ?  141 LEU D CD2 1 
ATOM   4113  N N   . ASP D  2 119 ? 412.621 102.609 406.150 1.00 124.98 ?  142 ASP D N   1 
ATOM   4114  C CA  . ASP D  2 119 ? 411.631 102.143 405.189 1.00 127.51 ?  142 ASP D CA  1 
ATOM   4115  C C   . ASP D  2 119 ? 410.234 102.678 405.476 1.00 125.49 ?  142 ASP D C   1 
ATOM   4116  O O   . ASP D  2 119 ? 409.331 102.479 404.656 1.00 128.48 ?  142 ASP D O   1 
ATOM   4117  C CB  . ASP D  2 119 ? 411.600 100.609 405.162 1.00 136.70 ?  142 ASP D CB  1 
ATOM   4118  C CG  . ASP D  2 119 ? 411.284 100.055 403.784 1.00 145.23 ?  142 ASP D CG  1 
ATOM   4119  O OD1 . ASP D  2 119 ? 411.709 100.668 402.782 1.00 147.37 -1 142 ASP D OD1 1 
ATOM   4120  O OD2 . ASP D  2 119 ? 410.615 99.002  403.705 1.00 146.03 -1 142 ASP D OD2 1 
ATOM   4121  N N   . GLY D  2 120 ? 410.038 103.345 406.614 1.00 108.57 ?  143 GLY D N   1 
ATOM   4122  C CA  . GLY D  2 120 ? 408.773 103.951 406.956 1.00 110.88 ?  143 GLY D CA  1 
ATOM   4123  C C   . GLY D  2 120 ? 407.784 103.039 407.653 1.00 105.39 ?  143 GLY D C   1 
ATOM   4124  O O   . GLY D  2 120 ? 406.808 103.534 408.228 1.00 95.39  ?  143 GLY D O   1 
ATOM   4125  N N   . LYS D  2 121 ? 408.007 101.727 407.623 1.00 99.63  ?  144 LYS D N   1 
ATOM   4126  C CA  . LYS D  2 121 ? 407.062 100.774 408.180 1.00 93.86  ?  144 LYS D CA  1 
ATOM   4127  C C   . LYS D  2 121 ? 407.366 100.516 409.656 1.00 89.88  ?  144 LYS D C   1 
ATOM   4128  O O   . LYS D  2 121 ? 408.257 101.123 410.254 1.00 84.95  ?  144 LYS D O   1 
ATOM   4129  C CB  . LYS D  2 121 ? 407.089 99.480  407.369 1.00 89.93  ?  144 LYS D CB  1 
ATOM   4130  C CG  . LYS D  2 121 ? 406.799 99.679  405.890 1.00 96.93  ?  144 LYS D CG  1 
ATOM   4131  C CD  . LYS D  2 121 ? 407.048 98.411  405.093 1.00 99.51  ?  144 LYS D CD  1 
ATOM   4132  C CE  . LYS D  2 121 ? 406.682 98.599  403.630 1.00 108.10 ?  144 LYS D CE  1 
ATOM   4133  N NZ  . LYS D  2 121 ? 406.906 97.360  402.835 1.00 100.07 ?  144 LYS D NZ  1 
ATOM   4134  N N   . SER D  2 122 ? 406.610 99.596  410.249 1.00 77.14  ?  145 SER D N   1 
ATOM   4135  C CA  . SER D  2 122 ? 406.759 99.223  411.647 1.00 69.51  ?  145 SER D CA  1 
ATOM   4136  C C   . SER D  2 122 ? 407.029 97.728  411.754 1.00 64.00  ?  145 SER D C   1 
ATOM   4137  O O   . SER D  2 122 ? 406.792 96.964  410.814 1.00 62.14  ?  145 SER D O   1 
ATOM   4138  C CB  . SER D  2 122 ? 405.514 99.598  412.463 1.00 68.75  ?  145 SER D CB  1 
ATOM   4139  O OG  . SER D  2 122 ? 404.338 99.072  411.872 1.00 83.68  ?  145 SER D OG  1 
ATOM   4140  N N   . VAL D  2 123 ? 407.527 97.315  412.915 1.00 60.26  ?  146 VAL D N   1 
ATOM   4141  C CA  . VAL D  2 123 ? 407.987 95.943  413.104 1.00 57.56  ?  146 VAL D CA  1 
ATOM   4142  C C   . VAL D  2 123 ? 406.789 95.030  413.349 1.00 59.03  ?  146 VAL D C   1 
ATOM   4143  O O   . VAL D  2 123 ? 406.031 95.218  414.308 1.00 55.37  ?  146 VAL D O   1 
ATOM   4144  C CB  . VAL D  2 123 ? 409.003 95.856  414.254 1.00 53.23  ?  146 VAL D CB  1 
ATOM   4145  C CG1 . VAL D  2 123 ? 410.313 96.504  413.844 1.00 52.63  ?  146 VAL D CG1 1 
ATOM   4146  C CG2 . VAL D  2 123 ? 408.470 96.536  415.509 1.00 60.01  ?  146 VAL D CG2 1 
ATOM   4147  N N   . LEU D  2 124 ? 406.603 94.048  412.465 1.00 38.66  ?  147 LEU D N   1 
ATOM   4148  C CA  . LEU D  2 124 ? 405.600 93.016  412.702 1.00 30.44  ?  147 LEU D CA  1 
ATOM   4149  C C   . LEU D  2 124 ? 406.130 91.930  413.630 1.00 34.73  ?  147 LEU D C   1 
ATOM   4150  O O   . LEU D  2 124 ? 405.408 91.459  414.516 1.00 37.85  ?  147 LEU D O   1 
ATOM   4151  C CB  . LEU D  2 124 ? 405.143 92.404  411.377 1.00 28.76  ?  147 LEU D CB  1 
ATOM   4152  C CG  . LEU D  2 124 ? 404.292 93.293  410.469 1.00 36.92  ?  147 LEU D CG  1 
ATOM   4153  C CD1 . LEU D  2 124 ? 403.795 92.506  409.265 1.00 38.52  ?  147 LEU D CD1 1 
ATOM   4154  C CD2 . LEU D  2 124 ? 403.127 93.887  411.244 1.00 42.83  ?  147 LEU D CD2 1 
ATOM   4155  N N   . VAL D  2 125 ? 407.382 91.520  413.435 1.00 38.58  ?  148 VAL D N   1 
ATOM   4156  C CA  . VAL D  2 125 ? 408.018 90.478  414.234 1.00 38.54  ?  148 VAL D CA  1 
ATOM   4157  C C   . VAL D  2 125 ? 409.383 90.991  414.669 1.00 39.50  ?  148 VAL D C   1 
ATOM   4158  O O   . VAL D  2 125 ? 410.228 91.308  413.823 1.00 45.32  ?  148 VAL D O   1 
ATOM   4159  C CB  . VAL D  2 125 ? 408.165 89.158  413.458 1.00 33.87  ?  148 VAL D CB  1 
ATOM   4160  C CG1 . VAL D  2 125 ? 408.765 88.081  414.349 1.00 39.65  ?  148 VAL D CG1 1 
ATOM   4161  C CG2 . VAL D  2 125 ? 406.826 88.710  412.897 1.00 25.57  ?  148 VAL D CG2 1 
ATOM   4162  N N   . ASN D  2 126 ? 409.602 91.068  415.979 1.00 43.00  ?  149 ASN D N   1 
ATOM   4163  C CA  . ASN D  2 126 ? 410.903 91.467  416.493 1.00 41.99  ?  149 ASN D CA  1 
ATOM   4164  C C   . ASN D  2 126 ? 411.935 90.380  416.210 1.00 41.78  ?  149 ASN D C   1 
ATOM   4165  O O   . ASN D  2 126 ? 411.609 89.194  416.104 1.00 44.21  ?  149 ASN D O   1 
ATOM   4166  C CB  . ASN D  2 126 ? 410.817 91.751  417.994 1.00 50.18  ?  149 ASN D CB  1 
ATOM   4167  C CG  . ASN D  2 126 ? 412.021 92.513  418.516 1.00 53.88  ?  149 ASN D CG  1 
ATOM   4168  O OD1 . ASN D  2 126 ? 412.813 93.052  417.743 1.00 55.53  ?  149 ASN D OD1 1 
ATOM   4169  N ND2 . ASN D  2 126 ? 412.159 92.565  419.837 1.00 60.22  ?  149 ASN D ND2 1 
ATOM   4170  N N   . GLY D  2 127 ? 413.196 90.796  416.085 1.00 75.53  ?  150 GLY D N   1 
ATOM   4171  C CA  . GLY D  2 127 ? 414.243 89.883  415.678 1.00 78.29  ?  150 GLY D CA  1 
ATOM   4172  C C   . GLY D  2 127 ? 414.836 89.082  416.822 1.00 84.42  ?  150 GLY D C   1 
ATOM   4173  O O   . GLY D  2 127 ? 414.572 89.319  418.000 1.00 94.70  ?  150 GLY D O   1 
ATOM   4174  N N   . THR D  2 128 ? 415.662 88.106  416.447 1.00 31.10  ?  151 THR D N   1 
ATOM   4175  C CA  . THR D  2 128 ? 416.365 87.245  417.390 1.00 21.33  ?  151 THR D CA  1 
ATOM   4176  C C   . THR D  2 128 ? 417.797 87.077  416.891 1.00 23.79  ?  151 THR D C   1 
ATOM   4177  O O   . THR D  2 128 ? 418.224 87.735  415.937 1.00 26.23  ?  151 THR D O   1 
ATOM   4178  C CB  . THR D  2 128 ? 415.667 85.885  417.550 1.00 18.83  ?  151 THR D CB  1 
ATOM   4179  O OG1 . THR D  2 128 ? 415.680 85.183  416.301 1.00 19.38  ?  151 THR D OG1 1 
ATOM   4180  C CG2 . THR D  2 128 ? 414.226 86.054  418.018 1.00 30.73  ?  151 THR D CG2 1 
ATOM   4181  N N   . LYS D  2 129 ? 418.548 86.193  417.550 1.00 46.00  ?  152 LYS D N   1 
ATOM   4182  C CA  . LYS D  2 129 ? 419.913 85.912  417.117 1.00 40.23  ?  152 LYS D CA  1 
ATOM   4183  C C   . LYS D  2 129 ? 419.933 85.292  415.725 1.00 41.63  ?  152 LYS D C   1 
ATOM   4184  O O   . LYS D  2 129 ? 420.802 85.611  414.906 1.00 45.14  ?  152 LYS D O   1 
ATOM   4185  C CB  . LYS D  2 129 ? 420.598 84.979  418.116 1.00 40.78  ?  152 LYS D CB  1 
ATOM   4186  C CG  . LYS D  2 129 ? 420.450 85.392  419.569 1.00 57.98  ?  152 LYS D CG  1 
ATOM   4187  C CD  . LYS D  2 129 ? 420.851 84.253  420.496 1.00 67.85  ?  152 LYS D CD  1 
ATOM   4188  C CE  . LYS D  2 129 ? 420.750 84.660  421.959 1.00 88.21  ?  152 LYS D CE  1 
ATOM   4189  N NZ  . LYS D  2 129 ? 421.719 85.737  422.310 1.00 85.62  ?  152 LYS D NZ  1 
ATOM   4190  N N   . GLU D  2 130 ? 418.987 84.399  415.446 1.00 39.10  ?  153 GLU D N   1 
ATOM   4191  C CA  . GLU D  2 130 ? 418.962 83.625  414.214 1.00 35.19  ?  153 GLU D CA  1 
ATOM   4192  C C   . GLU D  2 130 ? 418.043 84.206  413.149 1.00 38.54  ?  153 GLU D C   1 
ATOM   4193  O O   . GLU D  2 130 ? 417.918 83.613  412.072 1.00 41.79  ?  153 GLU D O   1 
ATOM   4194  C CB  . GLU D  2 130 ? 418.542 82.186  414.521 1.00 37.65  ?  153 GLU D CB  1 
ATOM   4195  C CG  . GLU D  2 130 ? 419.089 81.664  415.840 1.00 41.87  ?  153 GLU D CG  1 
ATOM   4196  C CD  . GLU D  2 130 ? 418.140 80.703  416.528 1.00 50.91  ?  153 GLU D CD  1 
ATOM   4197  O OE1 . GLU D  2 130 ? 418.589 79.609  416.928 1.00 48.57  ?  153 GLU D OE1 1 
ATOM   4198  O OE2 . GLU D  2 130 ? 416.947 81.045  416.672 1.00 59.95  -1 153 GLU D OE2 1 
ATOM   4199  N N   . ARG D  2 131 ? 417.397 85.341  413.411 1.00 27.50  ?  154 ARG D N   1 
ATOM   4200  C CA  . ARG D  2 131 ? 416.328 85.820  412.547 1.00 30.87  ?  154 ARG D CA  1 
ATOM   4201  C C   . ARG D  2 131 ? 416.397 87.332  412.394 1.00 36.07  ?  154 ARG D C   1 
ATOM   4202  O O   . ARG D  2 131 ? 416.636 88.054  413.366 1.00 37.35  ?  154 ARG D O   1 
ATOM   4203  C CB  . ARG D  2 131 ? 414.961 85.413  413.107 1.00 28.19  ?  154 ARG D CB  1 
ATOM   4204  C CG  . ARG D  2 131 ? 413.790 85.623  412.169 1.00 30.30  ?  154 ARG D CG  1 
ATOM   4205  C CD  . ARG D  2 131 ? 412.502 85.222  412.860 1.00 30.38  ?  154 ARG D CD  1 
ATOM   4206  N NE  . ARG D  2 131 ? 412.229 86.076  414.012 1.00 33.71  ?  154 ARG D NE  1 
ATOM   4207  C CZ  . ARG D  2 131 ? 411.632 85.664  415.126 1.00 35.63  ?  154 ARG D CZ  1 
ATOM   4208  N NH1 . ARG D  2 131 ? 411.252 84.401  415.250 1.00 30.93  ?  154 ARG D NH1 1 
ATOM   4209  N NH2 . ARG D  2 131 ? 411.426 86.515  416.122 1.00 37.93  ?  154 ARG D NH2 1 
ATOM   4210  N N   . ASP D  2 132 ? 416.196 87.799  411.166 1.00 33.81  ?  155 ASP D N   1 
ATOM   4211  C CA  . ASP D  2 132 ? 416.076 89.223  410.890 1.00 34.08  ?  155 ASP D CA  1 
ATOM   4212  C C   . ASP D  2 132 ? 414.665 89.714  411.197 1.00 33.19  ?  155 ASP D C   1 
ATOM   4213  O O   . ASP D  2 132 ? 413.697 88.950  411.173 1.00 32.60  ?  155 ASP D O   1 
ATOM   4214  C CB  . ASP D  2 132 ? 416.419 89.517  409.429 1.00 38.50  ?  155 ASP D CB  1 
ATOM   4215  C CG  . ASP D  2 132 ? 416.474 91.005  409.126 1.00 37.46  ?  155 ASP D CG  1 
ATOM   4216  O OD1 . ASP D  2 132 ? 416.846 91.785  410.029 1.00 38.05  ?  155 ASP D OD1 1 
ATOM   4217  O OD2 . ASP D  2 132 ? 416.141 91.394  407.987 1.00 29.44  -1 155 ASP D OD2 1 
ATOM   4218  N N   . VAL D  2 133 ? 414.559 91.010  411.495 1.00 36.94  ?  156 VAL D N   1 
ATOM   4219  C CA  . VAL D  2 133 ? 413.256 91.639  411.657 1.00 31.74  ?  156 VAL D CA  1 
ATOM   4220  C C   . VAL D  2 133 ? 412.581 91.761  410.299 1.00 33.10  ?  156 VAL D C   1 
ATOM   4221  O O   . VAL D  2 133 ? 413.211 92.136  409.302 1.00 44.89  ?  156 VAL D O   1 
ATOM   4222  C CB  . VAL D  2 133 ? 413.404 93.018  412.321 1.00 38.89  ?  156 VAL D CB  1 
ATOM   4223  C CG1 . VAL D  2 133 ? 412.045 93.676  412.487 1.00 39.22  ?  156 VAL D CG1 1 
ATOM   4224  C CG2 . VAL D  2 133 ? 414.115 92.898  413.658 1.00 49.55  ?  156 VAL D CG2 1 
ATOM   4225  N N   . VAL D  2 134 ? 411.290 91.442  410.250 1.00 29.74  ?  157 VAL D N   1 
ATOM   4226  C CA  . VAL D  2 134 ? 410.484 91.600  409.044 1.00 46.52  ?  157 VAL D CA  1 
ATOM   4227  C C   . VAL D  2 134 ? 409.559 92.796  409.241 1.00 44.37  ?  157 VAL D C   1 
ATOM   4228  O O   . VAL D  2 134 ? 408.708 92.799  410.140 1.00 36.86  ?  157 VAL D O   1 
ATOM   4229  C CB  . VAL D  2 134 ? 409.706 90.317  408.703 1.00 43.55  ?  157 VAL D CB  1 
ATOM   4230  C CG1 . VAL D  2 134 ? 408.891 89.821  409.894 1.00 29.78  ?  157 VAL D CG1 1 
ATOM   4231  C CG2 . VAL D  2 134 ? 408.806 90.549  407.499 1.00 48.58  ?  157 VAL D CG2 1 
ATOM   4232  N N   . CYS D  2 135 ? 409.741 93.826  408.417 1.00 68.63  ?  158 CYS D N   1 
ATOM   4233  C CA  . CYS D  2 135 ? 408.930 95.027  408.525 1.00 73.52  ?  158 CYS D CA  1 
ATOM   4234  C C   . CYS D  2 135 ? 407.609 94.839  407.781 1.00 72.85  ?  158 CYS D C   1 
ATOM   4235  O O   . CYS D  2 135 ? 407.354 93.807  407.153 1.00 63.73  ?  158 CYS D O   1 
ATOM   4236  C CB  . CYS D  2 135 ? 409.689 96.240  407.984 1.00 77.68  ?  158 CYS D CB  1 
ATOM   4237  S SG  . CYS D  2 135 ? 411.387 96.459  408.589 1.00 71.90  ?  158 CYS D SG  1 
ATOM   4238  N N   . GLY D  2 136 ? 406.754 95.855  407.855 1.00 71.37  ?  159 GLY D N   1 
ATOM   4239  C CA  . GLY D  2 136 ? 405.502 95.856  407.140 1.00 67.51  ?  159 GLY D CA  1 
ATOM   4240  C C   . GLY D  2 136 ? 404.529 96.874  407.698 1.00 74.12  ?  159 GLY D C   1 
ATOM   4241  O O   . GLY D  2 136 ? 404.726 97.425  408.786 1.00 75.65  ?  159 GLY D O   1 
ATOM   4242  N N   . PRO D  2 137 ? 403.448 97.147  406.956 1.00 66.57  ?  160 PRO D N   1 
ATOM   4243  C CA  . PRO D  2 137 ? 402.388 98.045  407.417 1.00 71.92  ?  160 PRO D CA  1 
ATOM   4244  C C   . PRO D  2 137 ? 401.209 97.290  408.026 1.00 70.90  ?  160 PRO D C   1 
ATOM   4245  C CB  . PRO D  2 137 ? 401.966 98.779  406.135 1.00 79.62  ?  160 PRO D CB  1 
ATOM   4246  C CG  . PRO D  2 137 ? 402.695 98.071  404.981 1.00 77.43  ?  160 PRO D CG  1 
ATOM   4247  C CD  . PRO D  2 137 ? 403.273 96.808  405.537 1.00 69.96  ?  160 PRO D CD  1 
ATOM   4248  N N   . GLY E  1 33  ? 471.481 47.387  446.104 1.00 90.45  ?  90  GLY E N   1 
ATOM   4249  C CA  . GLY E  1 33  ? 472.155 47.624  447.368 1.00 89.40  ?  90  GLY E CA  1 
ATOM   4250  C C   . GLY E  1 33  ? 471.264 48.262  448.415 1.00 99.76  ?  90  GLY E C   1 
ATOM   4251  O O   . GLY E  1 33  ? 471.012 47.677  449.469 1.00 101.74 ?  90  GLY E O   1 
ATOM   4252  N N   . MET E  1 34  ? 470.783 49.469  448.124 1.00 61.87  ?  91  MET E N   1 
ATOM   4253  C CA  . MET E  1 34  ? 469.915 50.213  449.033 1.00 55.80  ?  91  MET E CA  1 
ATOM   4254  C C   . MET E  1 34  ? 468.664 50.642  448.281 1.00 56.93  ?  91  MET E C   1 
ATOM   4255  O O   . MET E  1 34  ? 468.736 51.493  447.389 1.00 59.47  ?  91  MET E O   1 
ATOM   4256  C CB  . MET E  1 34  ? 470.640 51.430  449.610 1.00 48.23  ?  91  MET E CB  1 
ATOM   4257  C CG  . MET E  1 34  ? 471.632 51.117  450.712 1.00 54.47  ?  91  MET E CG  1 
ATOM   4258  S SD  . MET E  1 34  ? 470.826 50.840  452.298 1.00 57.30  ?  91  MET E SD  1 
ATOM   4259  C CE  . MET E  1 34  ? 472.240 50.833  453.398 1.00 76.52  ?  91  MET E CE  1 
ATOM   4260  N N   . PHE E  1 35  ? 467.521 50.072  448.662 1.00 37.77  ?  92  PHE E N   1 
ATOM   4261  C CA  . PHE E  1 35  ? 466.202 50.463  448.173 1.00 34.61  ?  92  PHE E CA  1 
ATOM   4262  C C   . PHE E  1 35  ? 465.165 49.591  448.864 1.00 40.42  ?  92  PHE E C   1 
ATOM   4263  O O   . PHE E  1 35  ? 465.480 48.517  449.385 1.00 45.26  ?  92  PHE E O   1 
ATOM   4264  C CB  . PHE E  1 35  ? 466.070 50.334  446.646 1.00 31.44  ?  92  PHE E CB  1 
ATOM   4265  C CG  . PHE E  1 35  ? 466.323 48.950  446.118 1.00 30.57  ?  92  PHE E CG  1 
ATOM   4266  C CD1 . PHE E  1 35  ? 467.607 48.542  445.799 1.00 33.56  ?  92  PHE E CD1 1 
ATOM   4267  C CD2 . PHE E  1 35  ? 465.274 48.070  445.909 1.00 29.12  ?  92  PHE E CD2 1 
ATOM   4268  C CE1 . PHE E  1 35  ? 467.843 47.275  445.302 1.00 33.33  ?  92  PHE E CE1 1 
ATOM   4269  C CE2 . PHE E  1 35  ? 465.503 46.802  445.411 1.00 27.67  ?  92  PHE E CE2 1 
ATOM   4270  C CZ  . PHE E  1 35  ? 466.789 46.404  445.105 1.00 28.98  ?  92  PHE E CZ  1 
ATOM   4271  N N   . ALA E  1 36  ? 463.922 50.067  448.860 1.00 46.22  ?  93  ALA E N   1 
ATOM   4272  C CA  . ALA E  1 36  ? 462.819 49.322  449.448 1.00 42.21  ?  93  ALA E CA  1 
ATOM   4273  C C   . ALA E  1 36  ? 461.510 49.830  448.869 1.00 41.55  ?  93  ALA E C   1 
ATOM   4274  O O   . ALA E  1 36  ? 461.432 50.941  448.338 1.00 42.96  ?  93  ALA E O   1 
ATOM   4275  C CB  . ALA E  1 36  ? 462.809 49.436  450.976 1.00 47.12  ?  93  ALA E CB  1 
ATOM   4276  N N   . GLN E  1 37  ? 460.481 48.995  448.979 1.00 30.64  ?  94  GLN E N   1 
ATOM   4277  C CA  . GLN E  1 37  ? 459.127 49.384  448.618 1.00 26.71  ?  94  GLN E CA  1 
ATOM   4278  C C   . GLN E  1 37  ? 458.165 48.633  449.527 1.00 27.10  ?  94  GLN E C   1 
ATOM   4279  O O   . GLN E  1 37  ? 458.393 47.464  449.850 1.00 27.58  ?  94  GLN E O   1 
ATOM   4280  C CB  . GLN E  1 37  ? 458.835 49.097  447.140 1.00 24.48  ?  94  GLN E CB  1 
ATOM   4281  C CG  . GLN E  1 37  ? 457.490 49.608  446.660 1.00 25.13  ?  94  GLN E CG  1 
ATOM   4282  C CD  . GLN E  1 37  ? 457.408 49.717  445.149 1.00 23.42  ?  94  GLN E CD  1 
ATOM   4283  O OE1 . GLN E  1 37  ? 458.072 50.556  444.539 1.00 16.57  ?  94  GLN E OE1 1 
ATOM   4284  N NE2 . GLN E  1 37  ? 456.593 48.864  444.536 1.00 22.44  ?  94  GLN E NE2 1 
ATOM   4285  N N   . LEU E  1 38  ? 457.101 49.307  449.947 1.00 17.60  ?  95  LEU E N   1 
ATOM   4286  C CA  . LEU E  1 38  ? 456.157 48.738  450.899 1.00 17.57  ?  95  LEU E CA  1 
ATOM   4287  C C   . LEU E  1 38  ? 454.750 48.830  450.334 1.00 17.29  ?  95  LEU E C   1 
ATOM   4288  O O   . LEU E  1 38  ? 454.318 49.904  449.904 1.00 16.96  ?  95  LEU E O   1 
ATOM   4289  C CB  . LEU E  1 38  ? 456.239 49.453  452.252 1.00 30.16  ?  95  LEU E CB  1 
ATOM   4290  C CG  . LEU E  1 38  ? 457.580 49.377  452.987 1.00 28.25  ?  95  LEU E CG  1 
ATOM   4291  C CD1 . LEU E  1 38  ? 457.513 50.116  454.318 1.00 28.38  ?  95  LEU E CD1 1 
ATOM   4292  C CD2 . LEU E  1 38  ? 457.997 47.931  453.194 1.00 18.45  ?  95  LEU E CD2 1 
ATOM   4293  N N   . VAL E  1 39  ? 454.045 47.705  450.329 1.00 17.94  ?  96  VAL E N   1 
ATOM   4294  C CA  . VAL E  1 39  ? 452.647 47.660  449.918 1.00 19.66  ?  96  VAL E CA  1 
ATOM   4295  C C   . VAL E  1 39  ? 451.784 47.820  451.163 1.00 25.21  ?  96  VAL E C   1 
ATOM   4296  O O   . VAL E  1 39  ? 451.927 47.062  452.128 1.00 31.55  ?  96  VAL E O   1 
ATOM   4297  C CB  . VAL E  1 39  ? 452.324 46.351  449.183 1.00 22.71  ?  96  VAL E CB  1 
ATOM   4298  C CG1 . VAL E  1 39  ? 450.867 46.328  448.757 1.00 24.83  ?  96  VAL E CG1 1 
ATOM   4299  C CG2 . VAL E  1 39  ? 453.237 46.183  447.980 1.00 23.29  ?  96  VAL E CG2 1 
ATOM   4300  N N   . ALA E  1 40  ? 450.894 48.809  451.147 1.00 27.79  ?  97  ALA E N   1 
ATOM   4301  C CA  . ALA E  1 40  ? 450.077 49.094  452.318 1.00 27.13  ?  97  ALA E CA  1 
ATOM   4302  C C   . ALA E  1 40  ? 449.078 47.971  452.558 1.00 32.47  ?  97  ALA E C   1 
ATOM   4303  O O   . ALA E  1 40  ? 448.388 47.526  451.637 1.00 35.85  ?  97  ALA E O   1 
ATOM   4304  C CB  . ALA E  1 40  ? 449.349 50.425  452.152 1.00 25.08  ?  97  ALA E CB  1 
ATOM   4305  N N   . GLN E  1 41  ? 449.006 47.515  453.808 1.00 43.64  ?  98  GLN E N   1 
ATOM   4306  C CA  . GLN E  1 41  ? 448.094 46.445  454.185 1.00 45.97  ?  98  GLN E CA  1 
ATOM   4307  C C   . GLN E  1 41  ? 446.671 46.942  454.402 1.00 39.70  ?  98  GLN E C   1 
ATOM   4308  O O   . GLN E  1 41  ? 445.732 46.141  454.336 1.00 41.41  ?  98  GLN E O   1 
ATOM   4309  C CB  . GLN E  1 41  ? 448.610 45.757  455.452 1.00 52.46  ?  98  GLN E CB  1 
ATOM   4310  C CG  . GLN E  1 41  ? 447.920 44.454  455.810 1.00 57.01  ?  98  GLN E CG  1 
ATOM   4311  C CD  . GLN E  1 41  ? 448.497 43.825  457.062 1.00 58.04  ?  98  GLN E CD  1 
ATOM   4312  O OE1 . GLN E  1 41  ? 449.496 44.301  457.602 1.00 55.04  ?  98  GLN E OE1 1 
ATOM   4313  N NE2 . GLN E  1 41  ? 447.872 42.749  457.528 1.00 54.53  ?  98  GLN E NE2 1 
ATOM   4314  N N   . ASN E  1 42  ? 446.490 48.238  454.639 1.00 41.73  ?  99  ASN E N   1 
ATOM   4315  C CA  . ASN E  1 42  ? 445.171 48.766  454.956 1.00 39.76  ?  99  ASN E CA  1 
ATOM   4316  C C   . ASN E  1 42  ? 444.260 48.739  453.736 1.00 40.62  ?  99  ASN E C   1 
ATOM   4317  O O   . ASN E  1 42  ? 444.685 49.021  452.611 1.00 38.10  ?  99  ASN E O   1 
ATOM   4318  C CB  . ASN E  1 42  ? 445.283 50.195  455.488 1.00 32.67  ?  99  ASN E CB  1 
ATOM   4319  C CG  . ASN E  1 42  ? 446.235 50.306  456.658 1.00 44.15  ?  99  ASN E CG  1 
ATOM   4320  O OD1 . ASN E  1 42  ? 447.263 49.631  456.704 1.00 53.61  ?  99  ASN E OD1 1 
ATOM   4321  N ND2 . ASN E  1 42  ? 445.894 51.159  457.618 1.00 42.96  ?  99  ASN E ND2 1 
ATOM   4322  N N   . VAL E  1 43  ? 442.996 48.396  453.969 1.00 28.02  ?  100 VAL E N   1 
ATOM   4323  C CA  . VAL E  1 43  ? 441.959 48.419  452.941 1.00 26.53  ?  100 VAL E CA  1 
ATOM   4324  C C   . VAL E  1 43  ? 440.914 49.497  453.234 1.00 25.19  ?  100 VAL E C   1 
ATOM   4325  O O   . VAL E  1 43  ? 440.731 50.426  452.444 1.00 33.33  ?  100 VAL E O   1 
ATOM   4326  C CB  . VAL E  1 43  ? 441.313 47.026  452.761 1.00 33.32  ?  100 VAL E CB  1 
ATOM   4327  C CG1 . VAL E  1 43  ? 440.909 46.416  454.101 1.00 37.50  ?  100 VAL E CG1 1 
ATOM   4328  C CG2 . VAL E  1 43  ? 440.114 47.117  451.829 1.00 35.57  ?  100 VAL E CG2 1 
ATOM   4329  N N   . LEU E  1 44  ? 440.219 49.389  454.364 1.00 20.98  ?  101 LEU E N   1 
ATOM   4330  C CA  . LEU E  1 44  ? 439.208 50.366  454.734 1.00 25.66  ?  101 LEU E CA  1 
ATOM   4331  C C   . LEU E  1 44  ? 439.849 51.717  455.035 1.00 19.16  ?  101 LEU E C   1 
ATOM   4332  O O   . LEU E  1 44  ? 441.043 51.820  455.331 1.00 17.17  ?  101 LEU E O   1 
ATOM   4333  C CB  . LEU E  1 44  ? 438.415 49.882  455.948 1.00 21.27  ?  101 LEU E CB  1 
ATOM   4334  C CG  . LEU E  1 44  ? 437.736 48.521  455.792 1.00 19.20  ?  101 LEU E CG  1 
ATOM   4335  C CD1 . LEU E  1 44  ? 436.914 48.182  457.024 1.00 20.50  ?  101 LEU E CD1 1 
ATOM   4336  C CD2 . LEU E  1 44  ? 436.875 48.500  454.541 1.00 25.37  ?  101 LEU E CD2 1 
ATOM   4337  N N   . LEU E  1 45  ? 439.032 52.765  454.966 1.00 43.53  ?  102 LEU E N   1 
ATOM   4338  C CA  . LEU E  1 45  ? 439.504 54.128  455.176 1.00 40.12  ?  102 LEU E CA  1 
ATOM   4339  C C   . LEU E  1 45  ? 439.324 54.476  456.649 1.00 44.11  ?  102 LEU E C   1 
ATOM   4340  O O   . LEU E  1 45  ? 438.197 54.681  457.114 1.00 50.68  ?  102 LEU E O   1 
ATOM   4341  C CB  . LEU E  1 45  ? 438.739 55.099  454.279 1.00 41.60  ?  102 LEU E CB  1 
ATOM   4342  C CG  . LEU E  1 45  ? 439.467 56.353  453.801 1.00 46.96  ?  102 LEU E CG  1 
ATOM   4343  C CD1 . LEU E  1 45  ? 440.575 55.986  452.827 1.00 45.24  ?  102 LEU E CD1 1 
ATOM   4344  C CD2 . LEU E  1 45  ? 438.485 57.318  453.159 1.00 51.46  ?  102 LEU E CD2 1 
ATOM   4345  N N   . ILE E  1 46  ? 440.436 54.563  457.373 1.00 26.57  ?  103 ILE E N   1 
ATOM   4346  C CA  . ILE E  1 46  ? 440.433 54.806  458.813 1.00 29.82  ?  103 ILE E CA  1 
ATOM   4347  C C   . ILE E  1 46  ? 441.644 55.666  459.145 1.00 28.87  ?  103 ILE E C   1 
ATOM   4348  O O   . ILE E  1 46  ? 442.730 55.464  458.595 1.00 34.99  ?  103 ILE E O   1 
ATOM   4349  C CB  . ILE E  1 46  ? 440.451 53.483  459.616 1.00 29.80  ?  103 ILE E CB  1 
ATOM   4350  C CG1 . ILE E  1 46  ? 439.133 52.720  459.452 1.00 25.89  ?  103 ILE E CG1 1 
ATOM   4351  C CG2 . ILE E  1 46  ? 440.729 53.737  461.090 1.00 23.18  ?  103 ILE E CG2 1 
ATOM   4352  C CD1 . ILE E  1 46  ? 439.093 51.400  460.193 1.00 23.66  ?  103 ILE E CD1 1 
ATOM   4353  N N   . ASP E  1 47  ? 441.453 56.627  460.044 1.00 41.37  ?  104 ASP E N   1 
ATOM   4354  C CA  . ASP E  1 47  ? 442.549 57.486  460.458 1.00 52.53  ?  104 ASP E CA  1 
ATOM   4355  C C   . ASP E  1 47  ? 443.605 56.682  461.216 1.00 57.93  ?  104 ASP E C   1 
ATOM   4356  O O   . ASP E  1 47  ? 443.342 55.599  461.745 1.00 56.71  ?  104 ASP E O   1 
ATOM   4357  C CB  . ASP E  1 47  ? 442.034 58.634  461.326 1.00 54.96  ?  104 ASP E CB  1 
ATOM   4358  C CG  . ASP E  1 47  ? 441.015 59.495  460.608 1.00 64.65  ?  104 ASP E CG  1 
ATOM   4359  O OD1 . ASP E  1 47  ? 440.329 58.974  459.702 1.00 62.93  ?  104 ASP E OD1 1 
ATOM   4360  O OD2 . ASP E  1 47  ? 440.899 60.691  460.947 1.00 70.39  -1 104 ASP E OD2 1 
ATOM   4361  N N   . GLY E  1 48  ? 444.816 57.233  461.262 1.00 77.47  ?  105 GLY E N   1 
ATOM   4362  C CA  . GLY E  1 48  ? 445.928 56.573  461.905 1.00 74.19  ?  105 GLY E CA  1 
ATOM   4363  C C   . GLY E  1 48  ? 446.947 56.034  460.920 1.00 71.24  ?  105 GLY E C   1 
ATOM   4364  O O   . GLY E  1 48  ? 446.844 56.237  459.706 1.00 70.64  ?  105 GLY E O   1 
ATOM   4365  N N   . PRO E  1 49  ? 447.959 55.336  461.433 1.00 46.51  ?  106 PRO E N   1 
ATOM   4366  C CA  . PRO E  1 49  ? 449.052 54.875  460.571 1.00 45.32  ?  106 PRO E CA  1 
ATOM   4367  C C   . PRO E  1 49  ? 448.613 53.756  459.639 1.00 47.76  ?  106 PRO E C   1 
ATOM   4368  O O   . PRO E  1 49  ? 447.608 53.076  459.859 1.00 49.93  ?  106 PRO E O   1 
ATOM   4369  C CB  . PRO E  1 49  ? 450.110 54.376  461.565 1.00 44.65  ?  106 PRO E CB  1 
ATOM   4370  C CG  . PRO E  1 49  ? 449.666 54.873  462.916 1.00 50.44  ?  106 PRO E CG  1 
ATOM   4371  C CD  . PRO E  1 49  ? 448.180 54.978  462.841 1.00 52.05  ?  106 PRO E CD  1 
ATOM   4372  N N   . LEU E  1 50  ? 449.400 53.570  458.583 1.00 48.25  ?  107 LEU E N   1 
ATOM   4373  C CA  . LEU E  1 50  ? 449.158 52.535  457.587 1.00 47.63  ?  107 LEU E CA  1 
ATOM   4374  C C   . LEU E  1 50  ? 450.095 51.359  457.827 1.00 48.44  ?  107 LEU E C   1 
ATOM   4375  O O   . LEU E  1 50  ? 451.312 51.543  457.950 1.00 49.21  ?  107 LEU E O   1 
ATOM   4376  C CB  . LEU E  1 50  ? 449.363 53.075  456.171 1.00 45.55  ?  107 LEU E CB  1 
ATOM   4377  C CG  . LEU E  1 50  ? 448.390 54.128  455.636 1.00 42.79  ?  107 LEU E CG  1 
ATOM   4378  C CD1 . LEU E  1 50  ? 448.807 54.557  454.240 1.00 38.22  ?  107 LEU E CD1 1 
ATOM   4379  C CD2 . LEU E  1 50  ? 446.970 53.592  455.629 1.00 41.18  ?  107 LEU E CD2 1 
ATOM   4380  N N   . SER E  1 51  ? 449.529 50.157  457.894 1.00 56.51  ?  108 SER E N   1 
ATOM   4381  C CA  . SER E  1 51  ? 450.337 48.952  457.960 1.00 63.22  ?  108 SER E CA  1 
ATOM   4382  C C   . SER E  1 51  ? 450.935 48.644  456.589 1.00 63.59  ?  108 SER E C   1 
ATOM   4383  O O   . SER E  1 51  ? 450.437 49.091  455.553 1.00 67.68  ?  108 SER E O   1 
ATOM   4384  C CB  . SER E  1 51  ? 449.504 47.770  458.455 1.00 67.43  ?  108 SER E CB  1 
ATOM   4385  O OG  . SER E  1 51  ? 448.949 48.042  459.731 1.00 73.16  ?  108 SER E OG  1 
ATOM   4386  N N   . TRP E  1 52  ? 452.017 47.870  456.593 1.00 35.65  ?  109 TRP E N   1 
ATOM   4387  C CA  . TRP E  1 52  ? 452.737 47.558  455.366 1.00 31.73  ?  109 TRP E CA  1 
ATOM   4388  C C   . TRP E  1 52  ? 453.109 46.083  455.342 1.00 32.10  ?  109 TRP E C   1 
ATOM   4389  O O   . TRP E  1 52  ? 453.326 45.465  456.387 1.00 45.36  ?  109 TRP E O   1 
ATOM   4390  C CB  . TRP E  1 52  ? 454.005 48.411  455.226 1.00 28.85  ?  109 TRP E CB  1 
ATOM   4391  C CG  . TRP E  1 52  ? 453.764 49.880  455.394 1.00 31.83  ?  109 TRP E CG  1 
ATOM   4392  C CD1 . TRP E  1 52  ? 453.892 50.605  456.543 1.00 28.27  ?  109 TRP E CD1 1 
ATOM   4393  C CD2 . TRP E  1 52  ? 453.348 50.803  454.382 1.00 27.77  ?  109 TRP E CD2 1 
ATOM   4394  N NE1 . TRP E  1 52  ? 453.585 51.923  456.308 1.00 26.39  ?  109 TRP E NE1 1 
ATOM   4395  C CE2 . TRP E  1 52  ? 453.248 52.070  454.988 1.00 25.40  ?  109 TRP E CE2 1 
ATOM   4396  C CE3 . TRP E  1 52  ? 453.055 50.682  453.020 1.00 19.66  ?  109 TRP E CE3 1 
ATOM   4397  C CZ2 . TRP E  1 52  ? 452.865 53.206  454.280 1.00 18.62  ?  109 TRP E CZ2 1 
ATOM   4398  C CZ3 . TRP E  1 52  ? 452.674 51.811  452.321 1.00 21.26  ?  109 TRP E CZ3 1 
ATOM   4399  C CH2 . TRP E  1 52  ? 452.583 53.057  452.952 1.00 21.83  ?  109 TRP E CH2 1 
ATOM   4400  N N   . TYR E  1 53  ? 453.177 45.526  454.135 1.00 30.27  ?  110 TYR E N   1 
ATOM   4401  C CA  . TYR E  1 53  ? 453.674 44.170  453.932 1.00 30.44  ?  110 TYR E CA  1 
ATOM   4402  C C   . TYR E  1 53  ? 455.190 44.226  453.780 1.00 36.86  ?  110 TYR E C   1 
ATOM   4403  O O   . TYR E  1 53  ? 455.701 44.823  452.828 1.00 36.43  ?  110 TYR E O   1 
ATOM   4404  C CB  . TYR E  1 53  ? 453.036 43.530  452.700 1.00 34.70  ?  110 TYR E CB  1 
ATOM   4405  C CG  . TYR E  1 53  ? 451.582 43.149  452.863 1.00 37.22  ?  110 TYR E CG  1 
ATOM   4406  C CD1 . TYR E  1 53  ? 451.204 42.125  453.722 1.00 43.03  ?  110 TYR E CD1 1 
ATOM   4407  C CD2 . TYR E  1 53  ? 450.589 43.799  452.143 1.00 44.10  ?  110 TYR E CD2 1 
ATOM   4408  C CE1 . TYR E  1 53  ? 449.876 41.768  453.868 1.00 50.86  ?  110 TYR E CE1 1 
ATOM   4409  C CE2 . TYR E  1 53  ? 449.259 43.449  452.282 1.00 50.17  ?  110 TYR E CE2 1 
ATOM   4410  C CZ  . TYR E  1 53  ? 448.908 42.433  453.146 1.00 54.40  ?  110 TYR E CZ  1 
ATOM   4411  O OH  . TYR E  1 53  ? 447.585 42.083  453.287 1.00 61.30  ?  110 TYR E OH  1 
ATOM   4412  N N   . SER E  1 54  ? 455.902 43.603  454.717 1.00 50.45  ?  111 SER E N   1 
ATOM   4413  C CA  . SER E  1 54  ? 457.357 43.658  454.760 1.00 50.46  ?  111 SER E CA  1 
ATOM   4414  C C   . SER E  1 54  ? 458.035 42.441  454.147 1.00 54.91  ?  111 SER E C   1 
ATOM   4415  O O   . SER E  1 54  ? 459.267 42.404  454.090 1.00 47.37  ?  111 SER E O   1 
ATOM   4416  C CB  . SER E  1 54  ? 457.826 43.820  456.208 1.00 56.01  ?  111 SER E CB  1 
ATOM   4417  O OG  . SER E  1 54  ? 459.237 43.749  456.300 1.00 77.82  ?  111 SER E OG  1 
ATOM   4418  N N   . ASP E  1 55  ? 457.274 41.453  453.686 1.00 69.01  ?  112 ASP E N   1 
ATOM   4419  C CA  . ASP E  1 55  ? 457.848 40.162  453.328 1.00 65.05  ?  112 ASP E CA  1 
ATOM   4420  C C   . ASP E  1 55  ? 458.282 40.160  451.868 1.00 60.68  ?  112 ASP E C   1 
ATOM   4421  O O   . ASP E  1 55  ? 457.430 40.301  450.983 1.00 64.64  ?  112 ASP E O   1 
ATOM   4422  C CB  . ASP E  1 55  ? 456.843 39.048  453.569 1.00 69.93  ?  112 ASP E CB  1 
ATOM   4423  C CG  . ASP E  1 55  ? 457.500 37.691  453.728 1.00 72.78  ?  112 ASP E CG  1 
ATOM   4424  O OD1 . ASP E  1 55  ? 458.560 37.459  453.110 1.00 61.60  ?  112 ASP E OD1 1 
ATOM   4425  O OD2 . ASP E  1 55  ? 456.953 36.852  454.475 1.00 83.59  -1 112 ASP E OD2 1 
ATOM   4426  N N   . PRO E  1 56  ? 459.574 40.011  451.572 1.00 86.74  ?  113 PRO E N   1 
ATOM   4427  C CA  . PRO E  1 56  ? 459.981 39.771  450.183 1.00 88.00  ?  113 PRO E CA  1 
ATOM   4428  C C   . PRO E  1 56  ? 459.415 38.451  449.683 1.00 95.48  ?  113 PRO E C   1 
ATOM   4429  O O   . PRO E  1 56  ? 459.362 37.459  450.413 1.00 106.17 ?  113 PRO E O   1 
ATOM   4430  C CB  . PRO E  1 56  ? 461.512 39.741  450.259 1.00 82.65  ?  113 PRO E CB  1 
ATOM   4431  C CG  . PRO E  1 56  ? 461.846 40.484  451.514 1.00 87.55  ?  113 PRO E CG  1 
ATOM   4432  C CD  . PRO E  1 56  ? 460.734 40.163  452.466 1.00 96.57  ?  113 PRO E CD  1 
ATOM   4433  N N   . GLY E  1 57  ? 458.995 38.445  448.424 1.00 64.84  ?  114 GLY E N   1 
ATOM   4434  C CA  . GLY E  1 57  ? 458.249 37.339  447.859 1.00 62.35  ?  114 GLY E CA  1 
ATOM   4435  C C   . GLY E  1 57  ? 456.789 37.647  447.623 1.00 53.50  ?  114 GLY E C   1 
ATOM   4436  O O   . GLY E  1 57  ? 456.099 36.849  446.976 1.00 54.63  ?  114 GLY E O   1 
ATOM   4437  N N   . LEU E  1 58  ? 456.295 38.770  448.137 1.00 49.57  ?  115 LEU E N   1 
ATOM   4438  C CA  . LEU E  1 58  ? 454.965 39.257  447.803 1.00 53.20  ?  115 LEU E CA  1 
ATOM   4439  C C   . LEU E  1 58  ? 455.045 40.031  446.486 1.00 52.34  ?  115 LEU E C   1 
ATOM   4440  O O   . LEU E  1 58  ? 456.076 40.041  445.809 1.00 52.32  ?  115 LEU E O   1 
ATOM   4441  C CB  . LEU E  1 58  ? 454.408 40.102  448.945 1.00 54.81  ?  115 LEU E CB  1 
ATOM   4442  C CG  . LEU E  1 58  ? 454.022 39.352  450.220 1.00 53.46  ?  115 LEU E CG  1 
ATOM   4443  C CD1 . LEU E  1 58  ? 454.024 40.287  451.415 1.00 59.62  ?  115 LEU E CD1 1 
ATOM   4444  C CD2 . LEU E  1 58  ? 452.661 38.703  450.056 1.00 44.71  ?  115 LEU E CD2 1 
ATOM   4445  N N   . ALA E  1 59  ? 453.958 40.695  446.107 1.00 49.57  ?  116 ALA E N   1 
ATOM   4446  C CA  . ALA E  1 59  ? 453.888 41.392  444.828 1.00 45.15  ?  116 ALA E CA  1 
ATOM   4447  C C   . ALA E  1 59  ? 454.377 42.824  445.014 1.00 51.35  ?  116 ALA E C   1 
ATOM   4448  O O   . ALA E  1 59  ? 453.746 43.616  445.720 1.00 58.88  ?  116 ALA E O   1 
ATOM   4449  C CB  . ALA E  1 59  ? 452.466 41.362  444.277 1.00 43.91  ?  116 ALA E CB  1 
ATOM   4450  N N   . GLY E  1 60  ? 455.498 43.154  444.376 1.00 29.89  ?  117 GLY E N   1 
ATOM   4451  C CA  . GLY E  1 60  ? 456.043 44.497  444.430 1.00 25.67  ?  117 GLY E CA  1 
ATOM   4452  C C   . GLY E  1 60  ? 456.516 44.922  445.805 1.00 30.60  ?  117 GLY E C   1 
ATOM   4453  O O   . GLY E  1 60  ? 456.083 45.957  446.320 1.00 31.24  ?  117 GLY E O   1 
ATOM   4454  N N   . VAL E  1 61  ? 457.408 44.137  446.408 1.00 82.53  ?  118 VAL E N   1 
ATOM   4455  C CA  . VAL E  1 61  ? 457.931 44.437  447.738 1.00 79.15  ?  118 VAL E CA  1 
ATOM   4456  C C   . VAL E  1 61  ? 459.365 44.955  447.652 1.00 76.04  ?  118 VAL E C   1 
ATOM   4457  O O   . VAL E  1 61  ? 459.609 46.147  447.868 1.00 82.64  ?  118 VAL E O   1 
ATOM   4458  C CB  . VAL E  1 61  ? 457.813 43.208  448.659 1.00 81.71  ?  118 VAL E CB  1 
ATOM   4459  C CG1 . VAL E  1 61  ? 456.391 43.075  449.147 1.00 70.12  ?  118 VAL E CG1 1 
ATOM   4460  C CG2 . VAL E  1 61  ? 458.190 41.944  447.916 1.00 84.69  ?  118 VAL E CG2 1 
ATOM   4461  N N   . SER E  1 62  ? 460.322 44.077  447.346 1.00 90.92  ?  119 SER E N   1 
ATOM   4462  C CA  . SER E  1 62  ? 461.726 44.450  447.160 1.00 100.71 ?  119 SER E CA  1 
ATOM   4463  C C   . SER E  1 62  ? 462.294 45.125  448.414 1.00 100.18 ?  119 SER E C   1 
ATOM   4464  O O   . SER E  1 62  ? 462.559 46.327  448.451 1.00 94.72  ?  119 SER E O   1 
ATOM   4465  C CB  . SER E  1 62  ? 461.894 45.356  445.933 1.00 96.20  ?  119 SER E CB  1 
ATOM   4466  O OG  . SER E  1 62  ? 461.555 44.675  444.741 1.00 101.10 ?  119 SER E OG  1 
ATOM   4467  N N   . LEU E  1 63  ? 462.464 44.310  449.452 1.00 89.65  ?  120 LEU E N   1 
ATOM   4468  C CA  . LEU E  1 63  ? 463.146 44.732  450.669 1.00 79.55  ?  120 LEU E CA  1 
ATOM   4469  C C   . LEU E  1 63  ? 464.587 44.237  450.634 1.00 77.96  ?  120 LEU E C   1 
ATOM   4470  O O   . LEU E  1 63  ? 464.839 43.066  450.330 1.00 83.32  ?  120 LEU E O   1 
ATOM   4471  C CB  . LEU E  1 63  ? 462.435 44.210  451.917 1.00 78.59  ?  120 LEU E CB  1 
ATOM   4472  C CG  . LEU E  1 63  ? 461.896 45.296  452.852 1.00 77.28  ?  120 LEU E CG  1 
ATOM   4473  C CD1 . LEU E  1 63  ? 461.447 44.698  454.176 1.00 76.77  ?  120 LEU E CD1 1 
ATOM   4474  C CD2 . LEU E  1 63  ? 462.939 46.382  453.077 1.00 79.82  ?  120 LEU E CD2 1 
ATOM   4475  N N   . THR E  1 64  ? 465.525 45.129  450.938 1.00 53.14  ?  121 THR E N   1 
ATOM   4476  C CA  . THR E  1 64  ? 466.948 44.831  450.854 1.00 56.67  ?  121 THR E CA  1 
ATOM   4477  C C   . THR E  1 64  ? 467.616 45.139  452.189 1.00 66.05  ?  121 THR E C   1 
ATOM   4478  O O   . THR E  1 64  ? 466.962 45.518  453.167 1.00 71.27  ?  121 THR E O   1 
ATOM   4479  C CB  . THR E  1 64  ? 467.620 45.626  449.729 1.00 57.95  ?  121 THR E CB  1 
ATOM   4480  O OG1 . THR E  1 64  ? 467.560 47.027  450.027 1.00 55.76  ?  121 THR E OG1 1 
ATOM   4481  C CG2 . THR E  1 64  ? 466.925 45.365  448.405 1.00 60.55  ?  121 THR E CG2 1 
ATOM   4482  N N   . GLY E  1 65  ? 468.936 44.973  452.219 1.00 64.41  ?  122 GLY E N   1 
ATOM   4483  C CA  . GLY E  1 65  ? 469.683 45.250  453.429 1.00 64.79  ?  122 GLY E CA  1 
ATOM   4484  C C   . GLY E  1 65  ? 469.769 46.737  453.717 1.00 59.98  ?  122 GLY E C   1 
ATOM   4485  O O   . GLY E  1 65  ? 469.696 47.579  452.823 1.00 64.44  ?  122 GLY E O   1 
ATOM   4486  N N   . GLY E  1 66  ? 469.930 47.059  455.000 1.00 58.29  ?  123 GLY E N   1 
ATOM   4487  C CA  . GLY E  1 66  ? 469.951 48.435  455.444 1.00 63.78  ?  123 GLY E CA  1 
ATOM   4488  C C   . GLY E  1 66  ? 468.591 49.051  455.675 1.00 66.22  ?  123 GLY E C   1 
ATOM   4489  O O   . GLY E  1 66  ? 468.515 50.148  456.243 1.00 65.70  ?  123 GLY E O   1 
ATOM   4490  N N   . LEU E  1 67  ? 467.514 48.395  455.251 1.00 68.19  ?  124 LEU E N   1 
ATOM   4491  C CA  . LEU E  1 67  ? 466.158 48.877  455.475 1.00 72.86  ?  124 LEU E CA  1 
ATOM   4492  C C   . LEU E  1 67  ? 465.340 47.755  456.094 1.00 73.08  ?  124 LEU E C   1 
ATOM   4493  O O   . LEU E  1 67  ? 465.127 46.716  455.460 1.00 65.04  ?  124 LEU E O   1 
ATOM   4494  C CB  . LEU E  1 67  ? 465.514 49.363  454.172 1.00 68.89  ?  124 LEU E CB  1 
ATOM   4495  C CG  . LEU E  1 67  ? 466.167 50.580  453.509 1.00 55.96  ?  124 LEU E CG  1 
ATOM   4496  C CD1 . LEU E  1 67  ? 467.213 50.156  452.488 1.00 55.20  ?  124 LEU E CD1 1 
ATOM   4497  C CD2 . LEU E  1 67  ? 465.118 51.474  452.872 1.00 54.26  ?  124 LEU E CD2 1 
ATOM   4498  N N   . SER E  1 68  ? 464.889 47.964  457.327 1.00 73.49  ?  125 SER E N   1 
ATOM   4499  C CA  . SER E  1 68  ? 464.089 46.991  458.052 1.00 67.87  ?  125 SER E CA  1 
ATOM   4500  C C   . SER E  1 68  ? 462.770 47.622  458.469 1.00 70.94  ?  125 SER E C   1 
ATOM   4501  O O   . SER E  1 68  ? 462.703 48.818  458.768 1.00 65.11  ?  125 SER E O   1 
ATOM   4502  C CB  . SER E  1 68  ? 464.835 46.472  459.286 1.00 64.52  ?  125 SER E CB  1 
ATOM   4503  O OG  . SER E  1 68  ? 466.156 46.082  458.953 1.00 58.44  ?  125 SER E OG  1 
ATOM   4504  N N   . TYR E  1 69  ? 461.718 46.809  458.487 1.00 51.23  ?  126 TYR E N   1 
ATOM   4505  C CA  . TYR E  1 69  ? 460.377 47.259  458.840 1.00 43.97  ?  126 TYR E CA  1 
ATOM   4506  C C   . TYR E  1 69  ? 460.004 46.676  460.195 1.00 48.73  ?  126 TYR E C   1 
ATOM   4507  O O   . TYR E  1 69  ? 459.995 45.453  460.367 1.00 52.33  ?  126 TYR E O   1 
ATOM   4508  C CB  . TYR E  1 69  ? 459.362 46.843  457.775 1.00 37.57  ?  126 TYR E CB  1 
ATOM   4509  C CG  . TYR E  1 69  ? 457.926 47.176  458.120 1.00 44.44  ?  126 TYR E CG  1 
ATOM   4510  C CD1 . TYR E  1 69  ? 457.457 48.481  458.045 1.00 44.08  ?  126 TYR E CD1 1 
ATOM   4511  C CD2 . TYR E  1 69  ? 457.038 46.184  458.514 1.00 47.56  ?  126 TYR E CD2 1 
ATOM   4512  C CE1 . TYR E  1 69  ? 456.146 48.789  458.356 1.00 39.51  ?  126 TYR E CE1 1 
ATOM   4513  C CE2 . TYR E  1 69  ? 455.724 46.480  458.824 1.00 44.71  ?  126 TYR E CE2 1 
ATOM   4514  C CZ  . TYR E  1 69  ? 455.284 47.783  458.744 1.00 41.92  ?  126 TYR E CZ  1 
ATOM   4515  O OH  . TYR E  1 69  ? 453.977 48.082  459.054 1.00 44.13  ?  126 TYR E OH  1 
ATOM   4516  N N   . LYS E  1 70  ? 459.689 47.549  461.149 1.00 62.56  ?  127 LYS E N   1 
ATOM   4517  C CA  . LYS E  1 70  ? 459.269 47.127  462.481 1.00 61.31  ?  127 LYS E CA  1 
ATOM   4518  C C   . LYS E  1 70  ? 457.751 47.015  462.480 1.00 62.00  ?  127 LYS E C   1 
ATOM   4519  O O   . LYS E  1 70  ? 457.047 48.025  462.392 1.00 64.21  ?  127 LYS E O   1 
ATOM   4520  C CB  . LYS E  1 70  ? 459.742 48.117  463.543 1.00 62.37  ?  127 LYS E CB  1 
ATOM   4521  C CG  . LYS E  1 70  ? 461.248 48.303  463.617 1.00 72.65  ?  127 LYS E CG  1 
ATOM   4522  C CD  . LYS E  1 70  ? 461.938 47.080  464.196 1.00 82.95  ?  127 LYS E CD  1 
ATOM   4523  C CE  . LYS E  1 70  ? 463.430 47.321  464.361 1.00 90.06  ?  127 LYS E CE  1 
ATOM   4524  N NZ  . LYS E  1 70  ? 464.126 46.139  464.938 1.00 97.69  ?  127 LYS E NZ  1 
ATOM   4525  N N   . GLU E  1 71  ? 457.245 45.785  462.587 1.00 53.96  ?  128 GLU E N   1 
ATOM   4526  C CA  . GLU E  1 71  ? 455.802 45.580  462.588 1.00 50.00  ?  128 GLU E CA  1 
ATOM   4527  C C   . GLU E  1 71  ? 455.159 46.079  463.874 1.00 53.27  ?  128 GLU E C   1 
ATOM   4528  O O   . GLU E  1 71  ? 453.940 46.275  463.910 1.00 53.92  ?  128 GLU E O   1 
ATOM   4529  C CB  . GLU E  1 71  ? 455.487 44.099  462.363 1.00 45.17  ?  128 GLU E CB  1 
ATOM   4530  C CG  . GLU E  1 71  ? 454.080 43.827  461.857 1.00 53.21  ?  128 GLU E CG  1 
ATOM   4531  C CD  . GLU E  1 71  ? 453.959 42.476  461.176 1.00 63.71  ?  128 GLU E CD  1 
ATOM   4532  O OE1 . GLU E  1 71  ? 454.162 42.408  459.944 1.00 60.67  ?  128 GLU E OE1 1 
ATOM   4533  O OE2 . GLU E  1 71  ? 453.660 41.481  461.871 1.00 64.98  -1 128 GLU E OE2 1 
ATOM   4534  N N   . ASP E  1 72  ? 455.952 46.283  464.925 1.00 70.85  ?  129 ASP E N   1 
ATOM   4535  C CA  . ASP E  1 72  ? 455.478 46.873  466.171 1.00 66.06  ?  129 ASP E CA  1 
ATOM   4536  C C   . ASP E  1 72  ? 454.892 48.260  465.928 1.00 60.95  ?  129 ASP E C   1 
ATOM   4537  O O   . ASP E  1 72  ? 453.686 48.470  466.090 1.00 54.30  ?  129 ASP E O   1 
ATOM   4538  C CB  . ASP E  1 72  ? 456.619 46.952  467.189 1.00 64.10  ?  129 ASP E CB  1 
ATOM   4539  C CG  . ASP E  1 72  ? 457.423 45.667  467.264 1.00 81.50  ?  129 ASP E CG  1 
ATOM   4540  O OD1 . ASP E  1 72  ? 458.360 45.502  466.453 1.00 68.90  ?  129 ASP E OD1 1 
ATOM   4541  O OD2 . ASP E  1 72  ? 457.121 44.823  468.134 1.00 96.81  -1 129 ASP E OD2 1 
ATOM   4542  N N   . THR E  1 73  ? 455.741 49.208  465.536 1.00 71.29  ?  130 THR E N   1 
ATOM   4543  C CA  . THR E  1 73  ? 455.336 50.591  465.321 1.00 70.80  ?  130 THR E CA  1 
ATOM   4544  C C   . THR E  1 73  ? 454.984 50.899  463.870 1.00 71.58  ?  130 THR E C   1 
ATOM   4545  O O   . THR E  1 73  ? 454.592 52.034  463.574 1.00 65.89  ?  130 THR E O   1 
ATOM   4546  C CB  . THR E  1 73  ? 456.441 51.540  465.795 1.00 71.94  ?  130 THR E CB  1 
ATOM   4547  O OG1 . THR E  1 73  ? 457.718 51.034  465.385 1.00 69.30  ?  130 THR E OG1 1 
ATOM   4548  C CG2 . THR E  1 73  ? 456.416 51.675  467.310 1.00 67.52  ?  130 THR E CG2 1 
ATOM   4549  N N   . LYS E  1 74  ? 455.121 49.927  462.964 1.00 64.36  ?  131 LYS E N   1 
ATOM   4550  C CA  . LYS E  1 74  ? 454.719 50.076  461.562 1.00 57.97  ?  131 LYS E CA  1 
ATOM   4551  C C   . LYS E  1 74  ? 455.480 51.206  460.870 1.00 55.63  ?  131 LYS E C   1 
ATOM   4552  O O   . LYS E  1 74  ? 454.903 52.013  460.139 1.00 56.50  ?  131 LYS E O   1 
ATOM   4553  C CB  . LYS E  1 74  ? 453.209 50.288  461.441 1.00 51.43  ?  131 LYS E CB  1 
ATOM   4554  C CG  . LYS E  1 74  ? 452.379 49.129  461.965 1.00 62.97  ?  131 LYS E CG  1 
ATOM   4555  C CD  . LYS E  1 74  ? 451.242 49.622  462.844 1.00 68.98  ?  131 LYS E CD  1 
ATOM   4556  C CE  . LYS E  1 74  ? 450.380 50.637  462.113 1.00 67.05  ?  131 LYS E CE  1 
ATOM   4557  N NZ  . LYS E  1 74  ? 449.341 51.222  463.004 1.00 67.56  ?  131 LYS E NZ  1 
ATOM   4558  N N   . GLU E  1 75  ? 456.790 51.265  461.102 1.00 36.14  ?  132 GLU E N   1 
ATOM   4559  C CA  . GLU E  1 75  ? 457.650 52.265  460.478 1.00 39.34  ?  132 GLU E CA  1 
ATOM   4560  C C   . GLU E  1 75  ? 458.937 51.587  460.039 1.00 35.71  ?  132 GLU E C   1 
ATOM   4561  O O   . GLU E  1 75  ? 459.619 50.966  460.857 1.00 48.10  ?  132 GLU E O   1 
ATOM   4562  C CB  . GLU E  1 75  ? 457.946 53.419  461.444 1.00 45.52  ?  132 GLU E CB  1 
ATOM   4563  C CG  . GLU E  1 75  ? 458.144 52.974  462.886 1.00 50.82  ?  132 GLU E CG  1 
ATOM   4564  C CD  . GLU E  1 75  ? 458.490 54.120  463.817 1.00 57.86  ?  132 GLU E CD  1 
ATOM   4565  O OE1 . GLU E  1 75  ? 459.431 53.966  464.627 1.00 59.02  ?  132 GLU E OE1 1 
ATOM   4566  O OE2 . GLU E  1 75  ? 457.821 55.171  463.746 1.00 55.04  -1 132 GLU E OE2 1 
ATOM   4567  N N   . LEU E  1 76  ? 459.269 51.702  458.755 1.00 28.32  ?  133 LEU E N   1 
ATOM   4568  C CA  . LEU E  1 76  ? 460.486 51.076  458.256 1.00 38.02  ?  133 LEU E CA  1 
ATOM   4569  C C   . LEU E  1 76  ? 461.711 51.841  458.741 1.00 43.99  ?  133 LEU E C   1 
ATOM   4570  O O   . LEU E  1 76  ? 461.701 53.072  458.840 1.00 40.61  ?  133 LEU E O   1 
ATOM   4571  C CB  . LEU E  1 76  ? 460.472 50.993  456.729 1.00 31.77  ?  133 LEU E CB  1 
ATOM   4572  C CG  . LEU E  1 76  ? 460.846 52.212  455.884 1.00 24.11  ?  133 LEU E CG  1 
ATOM   4573  C CD1 . LEU E  1 76  ? 461.199 51.776  454.474 1.00 18.90  ?  133 LEU E CD1 1 
ATOM   4574  C CD2 . LEU E  1 76  ? 459.710 53.215  455.855 1.00 35.94  ?  133 LEU E CD2 1 
ATOM   4575  N N   . VAL E  1 77  ? 462.770 51.099  459.056 1.00 63.57  ?  134 VAL E N   1 
ATOM   4576  C CA  . VAL E  1 77  ? 463.971 51.649  459.674 1.00 64.46  ?  134 VAL E CA  1 
ATOM   4577  C C   . VAL E  1 77  ? 465.054 51.784  458.617 1.00 70.94  ?  134 VAL E C   1 
ATOM   4578  O O   . VAL E  1 77  ? 465.354 50.824  457.896 1.00 69.20  ?  134 VAL E O   1 
ATOM   4579  C CB  . VAL E  1 77  ? 464.448 50.765  460.839 1.00 66.55  ?  134 VAL E CB  1 
ATOM   4580  C CG1 . VAL E  1 77  ? 465.762 51.288  461.401 1.00 76.54  ?  134 VAL E CG1 1 
ATOM   4581  C CG2 . VAL E  1 77  ? 463.384 50.696  461.921 1.00 66.84  ?  134 VAL E CG2 1 
ATOM   4582  N N   . VAL E  1 78  ? 465.643 52.972  458.525 1.00 47.54  ?  135 VAL E N   1 
ATOM   4583  C CA  . VAL E  1 78  ? 466.762 53.237  457.631 1.00 41.40  ?  135 VAL E CA  1 
ATOM   4584  C C   . VAL E  1 78  ? 468.038 53.108  458.454 1.00 43.99  ?  135 VAL E C   1 
ATOM   4585  O O   . VAL E  1 78  ? 468.275 53.896  459.376 1.00 46.94  ?  135 VAL E O   1 
ATOM   4586  C CB  . VAL E  1 78  ? 466.650 54.621  456.980 1.00 39.80  ?  135 VAL E CB  1 
ATOM   4587  C CG1 . VAL E  1 78  ? 467.850 54.883  456.088 1.00 44.90  ?  135 VAL E CG1 1 
ATOM   4588  C CG2 . VAL E  1 78  ? 465.356 54.729  456.188 1.00 32.77  ?  135 VAL E CG2 1 
ATOM   4589  N N   . ALA E  1 79  ? 468.864 52.113  458.124 1.00 71.08  ?  136 ALA E N   1 
ATOM   4590  C CA  . ALA E  1 79  ? 470.033 51.821  458.948 1.00 77.02  ?  136 ALA E CA  1 
ATOM   4591  C C   . ALA E  1 79  ? 471.108 52.890  458.790 1.00 84.08  ?  136 ALA E C   1 
ATOM   4592  O O   . ALA E  1 79  ? 471.626 53.413  459.783 1.00 84.68  ?  136 ALA E O   1 
ATOM   4593  C CB  . ALA E  1 79  ? 470.592 50.441  458.599 1.00 81.86  ?  136 ALA E CB  1 
ATOM   4594  N N   . LYS E  1 80  ? 471.462 53.224  457.553 1.00 84.07  ?  137 LYS E N   1 
ATOM   4595  C CA  . LYS E  1 80  ? 472.535 54.169  457.282 1.00 79.70  ?  137 LYS E CA  1 
ATOM   4596  C C   . LYS E  1 80  ? 471.987 55.441  456.649 1.00 74.80  ?  137 LYS E C   1 
ATOM   4597  O O   . LYS E  1 80  ? 470.995 55.415  455.917 1.00 73.35  ?  137 LYS E O   1 
ATOM   4598  C CB  . LYS E  1 80  ? 473.599 53.547  456.373 1.00 83.94  ?  137 LYS E CB  1 
ATOM   4599  C CG  . LYS E  1 80  ? 474.528 52.595  457.102 1.00 95.28  ?  137 LYS E CG  1 
ATOM   4600  C CD  . LYS E  1 80  ? 475.217 53.302  458.260 1.00 98.72  ?  137 LYS E CD  1 
ATOM   4601  C CE  . LYS E  1 80  ? 475.821 52.311  459.239 1.00 100.12 ?  137 LYS E CE  1 
ATOM   4602  N NZ  . LYS E  1 80  ? 476.826 51.428  458.588 1.00 115.71 ?  137 LYS E NZ  1 
ATOM   4603  N N   . ALA E  1 81  ? 472.657 56.554  456.936 1.00 52.58  ?  138 ALA E N   1 
ATOM   4604  C CA  . ALA E  1 81  ? 472.209 57.853  456.466 1.00 47.81  ?  138 ALA E CA  1 
ATOM   4605  C C   . ALA E  1 81  ? 472.486 58.005  454.971 1.00 46.25  ?  138 ALA E C   1 
ATOM   4606  O O   . ALA E  1 81  ? 473.049 57.124  454.315 1.00 41.91  ?  138 ALA E O   1 
ATOM   4607  C CB  . ALA E  1 81  ? 472.888 58.966  457.262 1.00 43.34  ?  138 ALA E CB  1 
ATOM   4608  N N   . GLY E  1 82  ? 472.079 59.142  454.430 1.00 70.47  ?  139 GLY E N   1 
ATOM   4609  C CA  . GLY E  1 82  ? 472.277 59.443  453.030 1.00 68.19  ?  139 GLY E CA  1 
ATOM   4610  C C   . GLY E  1 82  ? 471.131 60.286  452.511 1.00 60.82  ?  139 GLY E C   1 
ATOM   4611  O O   . GLY E  1 82  ? 470.359 60.849  453.281 1.00 61.19  ?  139 GLY E O   1 
ATOM   4612  N N   . VAL E  1 83  ? 471.040 60.356  451.186 1.00 55.37  ?  140 VAL E N   1 
ATOM   4613  C CA  . VAL E  1 83  ? 469.945 61.030  450.500 1.00 52.15  ?  140 VAL E CA  1 
ATOM   4614  C C   . VAL E  1 83  ? 469.226 59.997  449.646 1.00 51.90  ?  140 VAL E C   1 
ATOM   4615  O O   . VAL E  1 83  ? 469.824 59.416  448.730 1.00 46.61  ?  140 VAL E O   1 
ATOM   4616  C CB  . VAL E  1 83  ? 470.433 62.208  449.645 1.00 48.76  ?  140 VAL E CB  1 
ATOM   4617  C CG1 . VAL E  1 83  ? 469.308 62.710  448.756 1.00 52.99  ?  140 VAL E CG1 1 
ATOM   4618  C CG2 . VAL E  1 83  ? 470.950 63.325  450.536 1.00 49.18  ?  140 VAL E CG2 1 
ATOM   4619  N N   . TYR E  1 84  ? 467.953 59.765  449.947 1.00 32.82  ?  141 TYR E N   1 
ATOM   4620  C CA  . TYR E  1 84  ? 467.152 58.764  449.263 1.00 30.34  ?  141 TYR E CA  1 
ATOM   4621  C C   . TYR E  1 84  ? 466.013 59.440  448.512 1.00 29.08  ?  141 TYR E C   1 
ATOM   4622  O O   . TYR E  1 84  ? 465.536 60.510  448.906 1.00 27.25  ?  141 TYR E O   1 
ATOM   4623  C CB  . TYR E  1 84  ? 466.579 57.737  450.251 1.00 34.96  ?  141 TYR E CB  1 
ATOM   4624  C CG  . TYR E  1 84  ? 467.612 57.036  451.108 1.00 31.47  ?  141 TYR E CG  1 
ATOM   4625  C CD1 . TYR E  1 84  ? 467.997 57.559  452.336 1.00 33.81  ?  141 TYR E CD1 1 
ATOM   4626  C CD2 . TYR E  1 84  ? 468.195 55.847  450.695 1.00 29.71  ?  141 TYR E CD2 1 
ATOM   4627  C CE1 . TYR E  1 84  ? 468.936 56.919  453.124 1.00 37.26  ?  141 TYR E CE1 1 
ATOM   4628  C CE2 . TYR E  1 84  ? 469.132 55.198  451.475 1.00 36.51  ?  141 TYR E CE2 1 
ATOM   4629  C CZ  . TYR E  1 84  ? 469.500 55.738  452.687 1.00 42.15  ?  141 TYR E CZ  1 
ATOM   4630  O OH  . TYR E  1 84  ? 470.435 55.093  453.465 1.00 53.49  ?  141 TYR E OH  1 
ATOM   4631  N N   . TYR E  1 85  ? 465.581 58.807  447.424 1.00 33.61  ?  142 TYR E N   1 
ATOM   4632  C CA  . TYR E  1 85  ? 464.414 59.259  446.674 1.00 29.51  ?  142 TYR E CA  1 
ATOM   4633  C C   . TYR E  1 85  ? 463.202 58.485  447.181 1.00 33.84  ?  142 TYR E C   1 
ATOM   4634  O O   . TYR E  1 85  ? 463.112 57.267  446.995 1.00 39.07  ?  142 TYR E O   1 
ATOM   4635  C CB  . TYR E  1 85  ? 464.620 59.057  445.175 1.00 21.96  ?  142 TYR E CB  1 
ATOM   4636  C CG  . TYR E  1 85  ? 463.479 59.566  444.319 1.00 26.63  ?  142 TYR E CG  1 
ATOM   4637  C CD1 . TYR E  1 85  ? 463.423 60.897  443.923 1.00 28.96  ?  142 TYR E CD1 1 
ATOM   4638  C CD2 . TYR E  1 85  ? 462.461 58.718  443.906 1.00 27.07  ?  142 TYR E CD2 1 
ATOM   4639  C CE1 . TYR E  1 85  ? 462.384 61.366  443.140 1.00 23.75  ?  142 TYR E CE1 1 
ATOM   4640  C CE2 . TYR E  1 85  ? 461.418 59.177  443.123 1.00 26.52  ?  142 TYR E CE2 1 
ATOM   4641  C CZ  . TYR E  1 85  ? 461.385 60.502  442.744 1.00 24.91  ?  142 TYR E CZ  1 
ATOM   4642  O OH  . TYR E  1 85  ? 460.348 60.962  441.966 1.00 31.83  ?  142 TYR E OH  1 
ATOM   4643  N N   . VAL E  1 86  ? 462.277 59.189  447.828 1.00 18.39  ?  143 VAL E N   1 
ATOM   4644  C CA  . VAL E  1 86  ? 461.099 58.590  448.442 1.00 19.07  ?  143 VAL E CA  1 
ATOM   4645  C C   . VAL E  1 86  ? 459.871 59.044  447.668 1.00 19.89  ?  143 VAL E C   1 
ATOM   4646  O O   . VAL E  1 86  ? 459.656 60.249  447.489 1.00 28.66  ?  143 VAL E O   1 
ATOM   4647  C CB  . VAL E  1 86  ? 460.985 58.976  449.927 1.00 19.39  ?  143 VAL E CB  1 
ATOM   4648  C CG1 . VAL E  1 86  ? 459.734 58.373  450.538 1.00 26.40  ?  143 VAL E CG1 1 
ATOM   4649  C CG2 . VAL E  1 86  ? 462.225 58.532  450.686 1.00 26.93  ?  143 VAL E CG2 1 
ATOM   4650  N N   . PHE E  1 87  ? 459.065 58.088  447.215 1.00 15.37  ?  144 PHE E N   1 
ATOM   4651  C CA  . PHE E  1 87  ? 457.864 58.399  446.458 1.00 19.18  ?  144 PHE E CA  1 
ATOM   4652  C C   . PHE E  1 87  ? 456.637 57.774  447.109 1.00 22.34  ?  144 PHE E C   1 
ATOM   4653  O O   . PHE E  1 87  ? 456.734 56.852  447.925 1.00 28.77  ?  144 PHE E O   1 
ATOM   4654  C CB  . PHE E  1 87  ? 457.984 57.943  444.993 1.00 22.79  ?  144 PHE E CB  1 
ATOM   4655  C CG  . PHE E  1 87  ? 458.322 56.489  444.823 1.00 18.01  ?  144 PHE E CG  1 
ATOM   4656  C CD1 . PHE E  1 87  ? 459.641 56.073  444.758 1.00 20.55  ?  144 PHE E CD1 1 
ATOM   4657  C CD2 . PHE E  1 87  ? 457.320 55.540  444.695 1.00 18.38  ?  144 PHE E CD2 1 
ATOM   4658  C CE1 . PHE E  1 87  ? 459.956 54.738  444.590 1.00 23.13  ?  144 PHE E CE1 1 
ATOM   4659  C CE2 . PHE E  1 87  ? 457.629 54.203  444.525 1.00 19.96  ?  144 PHE E CE2 1 
ATOM   4660  C CZ  . PHE E  1 87  ? 458.948 53.803  444.468 1.00 22.92  ?  144 PHE E CZ  1 
ATOM   4661  N N   . PHE E  1 88  ? 455.472 58.301  446.733 1.00 42.51  ?  145 PHE E N   1 
ATOM   4662  C CA  . PHE E  1 88  ? 454.191 57.921  447.310 1.00 38.46  ?  145 PHE E CA  1 
ATOM   4663  C C   . PHE E  1 88  ? 453.234 57.489  446.211 1.00 45.78  ?  145 PHE E C   1 
ATOM   4664  O O   . PHE E  1 88  ? 453.189 58.100  445.140 1.00 55.52  ?  145 PHE E O   1 
ATOM   4665  C CB  . PHE E  1 88  ? 453.564 59.083  448.083 1.00 39.76  ?  145 PHE E CB  1 
ATOM   4666  C CG  . PHE E  1 88  ? 453.692 58.965  449.566 1.00 37.06  ?  145 PHE E CG  1 
ATOM   4667  C CD1 . PHE E  1 88  ? 453.376 57.781  450.208 1.00 41.66  ?  145 PHE E CD1 1 
ATOM   4668  C CD2 . PHE E  1 88  ? 454.112 60.043  450.323 1.00 38.72  ?  145 PHE E CD2 1 
ATOM   4669  C CE1 . PHE E  1 88  ? 453.488 57.672  451.577 1.00 52.29  ?  145 PHE E CE1 1 
ATOM   4670  C CE2 . PHE E  1 88  ? 454.225 59.942  451.690 1.00 51.66  ?  145 PHE E CE2 1 
ATOM   4671  C CZ  . PHE E  1 88  ? 453.914 58.755  452.320 1.00 59.27  ?  145 PHE E CZ  1 
ATOM   4672  N N   . GLN E  1 89  ? 452.458 56.445  446.488 1.00 29.69  ?  146 GLN E N   1 
ATOM   4673  C CA  . GLN E  1 89  ? 451.397 55.999  445.593 1.00 25.15  ?  146 GLN E CA  1 
ATOM   4674  C C   . GLN E  1 89  ? 450.145 55.753  446.418 1.00 32.74  ?  146 GLN E C   1 
ATOM   4675  O O   . GLN E  1 89  ? 450.163 54.942  447.349 1.00 39.46  ?  146 GLN E O   1 
ATOM   4676  C CB  . GLN E  1 89  ? 451.797 54.736  444.828 1.00 26.91  ?  146 GLN E CB  1 
ATOM   4677  C CG  . GLN E  1 89  ? 452.218 55.006  443.397 1.00 34.67  ?  146 GLN E CG  1 
ATOM   4678  C CD  . GLN E  1 89  ? 452.522 53.738  442.625 1.00 41.93  ?  146 GLN E CD  1 
ATOM   4679  O OE1 . GLN E  1 89  ? 453.434 53.707  441.801 1.00 45.43  ?  146 GLN E OE1 1 
ATOM   4680  N NE2 . GLN E  1 89  ? 451.751 52.687  442.881 1.00 39.93  ?  146 GLN E NE2 1 
ATOM   4681  N N   . LEU E  1 90  ? 449.069 56.457  446.082 1.00 28.46  ?  147 LEU E N   1 
ATOM   4682  C CA  . LEU E  1 90  ? 447.789 56.319  446.765 1.00 19.22  ?  147 LEU E CA  1 
ATOM   4683  C C   . LEU E  1 90  ? 446.698 56.183  445.718 1.00 23.63  ?  147 LEU E C   1 
ATOM   4684  O O   . LEU E  1 90  ? 446.479 57.105  444.924 1.00 28.89  ?  147 LEU E O   1 
ATOM   4685  C CB  . LEU E  1 90  ? 447.518 57.518  447.676 1.00 14.60  ?  147 LEU E CB  1 
ATOM   4686  C CG  . LEU E  1 90  ? 446.198 57.477  448.443 1.00 14.71  ?  147 LEU E CG  1 
ATOM   4687  C CD1 . LEU E  1 90  ? 446.184 56.314  449.422 1.00 26.37  ?  147 LEU E CD1 1 
ATOM   4688  C CD2 . LEU E  1 90  ? 445.949 58.795  449.156 1.00 20.01  ?  147 LEU E CD2 1 
ATOM   4689  N N   . GLU E  1 91  ? 446.018 55.040  445.713 1.00 28.55  ?  148 GLU E N   1 
ATOM   4690  C CA  . GLU E  1 91  ? 444.929 54.781  444.783 1.00 27.16  ?  148 GLU E CA  1 
ATOM   4691  C C   . GLU E  1 91  ? 443.712 54.307  445.559 1.00 24.42  ?  148 GLU E C   1 
ATOM   4692  O O   . GLU E  1 91  ? 443.826 53.468  446.457 1.00 27.18  ?  148 GLU E O   1 
ATOM   4693  C CB  . GLU E  1 91  ? 445.327 53.742  443.730 1.00 30.00  ?  148 GLU E CB  1 
ATOM   4694  C CG  . GLU E  1 91  ? 444.363 53.639  442.558 1.00 36.24  ?  148 GLU E CG  1 
ATOM   4695  C CD  . GLU E  1 91  ? 444.775 52.579  441.551 1.00 44.56  ?  148 GLU E CD  1 
ATOM   4696  O OE1 . GLU E  1 91  ? 443.887 52.026  440.869 1.00 35.81  ?  148 GLU E OE1 1 
ATOM   4697  O OE2 . GLU E  1 91  ? 445.990 52.302  441.442 1.00 43.60  -1 148 GLU E OE2 1 
ATOM   4698  N N   . LEU E  1 92  ? 442.547 54.854  445.216 1.00 36.39  ?  149 LEU E N   1 
ATOM   4699  C CA  . LEU E  1 92  ? 441.300 54.517  445.882 1.00 40.86  ?  149 LEU E CA  1 
ATOM   4700  C C   . LEU E  1 92  ? 440.245 54.140  444.853 1.00 41.42  ?  149 LEU E C   1 
ATOM   4701  O O   . LEU E  1 92  ? 440.272 54.603  443.710 1.00 46.95  ?  149 LEU E O   1 
ATOM   4702  C CB  . LEU E  1 92  ? 440.776 55.674  446.746 1.00 35.28  ?  149 LEU E CB  1 
ATOM   4703  C CG  . LEU E  1 92  ? 441.527 56.002  448.038 1.00 38.20  ?  149 LEU E CG  1 
ATOM   4704  C CD1 . LEU E  1 92  ? 442.749 56.856  447.759 1.00 36.48  ?  149 LEU E CD1 1 
ATOM   4705  C CD2 . LEU E  1 92  ? 440.606 56.691  449.032 1.00 50.16  ?  149 LEU E CD2 1 
ATOM   4706  N N   . ARG E  1 93  ? 439.313 53.292  445.277 1.00 30.27  ?  150 ARG E N   1 
ATOM   4707  C CA  . ARG E  1 93  ? 438.197 52.870  444.448 1.00 36.46  ?  150 ARG E CA  1 
ATOM   4708  C C   . ARG E  1 93  ? 436.908 52.985  445.247 1.00 39.17  ?  150 ARG E C   1 
ATOM   4709  O O   . ARG E  1 93  ? 436.898 52.805  446.467 1.00 40.25  ?  150 ARG E O   1 
ATOM   4710  C CB  . ARG E  1 93  ? 438.377 51.430  443.946 1.00 42.00  ?  150 ARG E CB  1 
ATOM   4711  C CG  . ARG E  1 93  ? 438.783 50.441  445.027 1.00 46.65  ?  150 ARG E CG  1 
ATOM   4712  C CD  . ARG E  1 93  ? 439.036 49.057  444.446 1.00 55.78  ?  150 ARG E CD  1 
ATOM   4713  N NE  . ARG E  1 93  ? 437.813 48.264  444.355 1.00 59.40  ?  150 ARG E NE  1 
ATOM   4714  C CZ  . ARG E  1 93  ? 437.437 47.368  445.262 1.00 61.55  ?  150 ARG E CZ  1 
ATOM   4715  N NH1 . ARG E  1 93  ? 438.189 47.146  446.332 1.00 51.81  ?  150 ARG E NH1 1 
ATOM   4716  N NH2 . ARG E  1 93  ? 436.308 46.692  445.099 1.00 64.08  ?  150 ARG E NH2 1 
ATOM   4717  N N   . ARG E  1 94  ? 435.820 53.288  444.546 1.00 44.70  ?  151 ARG E N   1 
ATOM   4718  C CA  . ARG E  1 94  ? 434.513 53.389  445.182 1.00 46.29  ?  151 ARG E CA  1 
ATOM   4719  C C   . ARG E  1 94  ? 433.898 51.997  445.258 1.00 48.26  ?  151 ARG E C   1 
ATOM   4720  O O   . ARG E  1 94  ? 433.630 51.378  444.225 1.00 52.37  ?  151 ARG E O   1 
ATOM   4721  C CB  . ARG E  1 94  ? 433.612 54.337  444.394 1.00 45.00  ?  151 ARG E CB  1 
ATOM   4722  C CG  . ARG E  1 94  ? 432.350 54.762  445.121 1.00 37.55  ?  151 ARG E CG  1 
ATOM   4723  C CD  . ARG E  1 94  ? 431.348 55.383  444.158 1.00 46.00  ?  151 ARG E CD  1 
ATOM   4724  N NE  . ARG E  1 94  ? 431.956 56.385  443.286 1.00 43.79  ?  151 ARG E NE  1 
ATOM   4725  C CZ  . ARG E  1 94  ? 432.006 57.685  443.558 1.00 43.25  ?  151 ARG E CZ  1 
ATOM   4726  N NH1 . ARG E  1 94  ? 431.481 58.149  444.684 1.00 42.97  ?  151 ARG E NH1 1 
ATOM   4727  N NH2 . ARG E  1 94  ? 432.579 58.521  442.704 1.00 45.86  ?  151 ARG E NH2 1 
ATOM   4728  N N   . VAL E  1 95  ? 433.687 51.497  446.480 1.00 35.31  ?  152 VAL E N   1 
ATOM   4729  C CA  . VAL E  1 95  ? 433.175 50.139  446.653 1.00 38.35  ?  152 VAL E CA  1 
ATOM   4730  C C   . VAL E  1 95  ? 431.662 50.079  446.809 1.00 43.04  ?  152 VAL E C   1 
ATOM   4731  O O   . VAL E  1 95  ? 431.094 48.976  446.805 1.00 47.58  ?  152 VAL E O   1 
ATOM   4732  C CB  . VAL E  1 95  ? 433.854 49.448  447.853 1.00 39.52  ?  152 VAL E CB  1 
ATOM   4733  C CG1 . VAL E  1 95  ? 435.359 49.379  447.639 1.00 39.59  ?  152 VAL E CG1 1 
ATOM   4734  C CG2 . VAL E  1 95  ? 433.525 50.165  449.145 1.00 39.98  ?  152 VAL E CG2 1 
ATOM   4735  N N   . VAL E  1 96  ? 430.988 51.219  446.944 1.00 33.95  ?  153 VAL E N   1 
ATOM   4736  C CA  . VAL E  1 96  ? 429.530 51.275  446.985 1.00 28.89  ?  153 VAL E CA  1 
ATOM   4737  C C   . VAL E  1 96  ? 429.081 52.291  445.949 1.00 31.61  ?  153 VAL E C   1 
ATOM   4738  O O   . VAL E  1 96  ? 429.412 53.478  446.053 1.00 32.22  ?  153 VAL E O   1 
ATOM   4739  C CB  . VAL E  1 96  ? 428.995 51.646  448.378 1.00 29.12  ?  153 VAL E CB  1 
ATOM   4740  C CG1 . VAL E  1 96  ? 427.542 52.088  448.288 1.00 32.81  ?  153 VAL E CG1 1 
ATOM   4741  C CG2 . VAL E  1 96  ? 429.133 50.470  449.322 1.00 38.11  ?  153 VAL E CG2 1 
ATOM   4742  N N   . ALA E  1 97  ? 428.327 51.828  444.955 1.00 30.48  ?  154 ALA E N   1 
ATOM   4743  C CA  . ALA E  1 97  ? 427.952 52.683  443.839 1.00 31.00  ?  154 ALA E CA  1 
ATOM   4744  C C   . ALA E  1 97  ? 426.973 53.759  444.290 1.00 28.54  ?  154 ALA E C   1 
ATOM   4745  O O   . ALA E  1 97  ? 425.924 53.459  444.871 1.00 27.84  ?  154 ALA E O   1 
ATOM   4746  C CB  . ALA E  1 97  ? 427.343 51.847  442.715 1.00 29.99  ?  154 ALA E CB  1 
ATOM   4747  N N   . GLY E  1 98  ? 427.321 55.014  444.024 1.00 35.75  ?  155 GLY E N   1 
ATOM   4748  C CA  . GLY E  1 98  ? 426.415 56.119  444.255 1.00 33.76  ?  155 GLY E CA  1 
ATOM   4749  C C   . GLY E  1 98  ? 426.497 56.783  445.610 1.00 29.20  ?  155 GLY E C   1 
ATOM   4750  O O   . GLY E  1 98  ? 425.530 57.441  446.011 1.00 36.75  ?  155 GLY E O   1 
ATOM   4751  N N   . GLU E  1 99  ? 427.610 56.650  446.328 1.00 38.11  ?  156 GLU E N   1 
ATOM   4752  C CA  . GLU E  1 99  ? 427.713 57.259  447.647 1.00 46.51  ?  156 GLU E CA  1 
ATOM   4753  C C   . GLU E  1 99  ? 429.135 57.742  447.899 1.00 48.23  ?  156 GLU E C   1 
ATOM   4754  O O   . GLU E  1 99  ? 430.107 57.163  447.407 1.00 46.86  ?  156 GLU E O   1 
ATOM   4755  C CB  . GLU E  1 99  ? 427.296 56.288  448.761 1.00 50.14  ?  156 GLU E CB  1 
ATOM   4756  C CG  . GLU E  1 99  ? 425.812 55.937  448.780 1.00 53.99  ?  156 GLU E CG  1 
ATOM   4757  C CD  . GLU E  1 99  ? 425.395 55.222  450.051 1.00 59.69  ?  156 GLU E CD  1 
ATOM   4758  O OE1 . GLU E  1 99  ? 426.152 55.281  451.041 1.00 58.15  ?  156 GLU E OE1 1 
ATOM   4759  O OE2 . GLU E  1 99  ? 424.310 54.601  450.062 1.00 56.70  -1 156 GLU E OE2 1 
ATOM   4760  N N   . GLY E  1 100 ? 429.235 58.818  448.667 1.00 40.80  ?  157 GLY E N   1 
ATOM   4761  C CA  . GLY E  1 100 ? 430.453 59.329  449.280 1.00 39.68  ?  157 GLY E CA  1 
ATOM   4762  C C   . GLY E  1 100 ? 431.210 60.309  448.406 1.00 35.52  ?  157 GLY E C   1 
ATOM   4763  O O   . GLY E  1 100 ? 431.242 60.208  447.179 1.00 42.72  ?  157 GLY E O   1 
ATOM   4764  N N   . SER E  1 101 ? 431.840 61.276  449.069 1.00 28.55  ?  158 SER E N   1 
ATOM   4765  C CA  . SER E  1 101 ? 432.762 62.216  448.445 1.00 40.54  ?  158 SER E CA  1 
ATOM   4766  C C   . SER E  1 101 ? 433.623 62.821  449.542 1.00 39.01  ?  158 SER E C   1 
ATOM   4767  O O   . SER E  1 101 ? 433.237 62.839  450.713 1.00 38.30  ?  158 SER E O   1 
ATOM   4768  C CB  . SER E  1 101 ? 432.021 63.309  447.668 1.00 46.23  ?  158 SER E CB  1 
ATOM   4769  O OG  . SER E  1 101 ? 431.173 64.057  448.523 1.00 45.58  ?  158 SER E OG  1 
ATOM   4770  N N   . GLY E  1 102 ? 434.781 63.340  449.152 1.00 37.40  ?  159 GLY E N   1 
ATOM   4771  C CA  . GLY E  1 102 ? 435.679 63.937  450.124 1.00 41.01  ?  159 GLY E CA  1 
ATOM   4772  C C   . GLY E  1 102 ? 437.110 63.947  449.610 1.00 41.60  ?  159 GLY E C   1 
ATOM   4773  O O   . GLY E  1 102 ? 437.351 63.926  448.406 1.00 38.82  ?  159 GLY E O   1 
ATOM   4774  N N   . SER E  1 103 ? 438.042 63.994  450.561 1.00 54.96  ?  160 SER E N   1 
ATOM   4775  C CA  . SER E  1 103 ? 439.466 64.025  450.259 1.00 51.43  ?  160 SER E CA  1 
ATOM   4776  C C   . SER E  1 103 ? 440.215 63.139  451.242 1.00 57.79  ?  160 SER E C   1 
ATOM   4777  O O   . SER E  1 103 ? 439.808 62.980  452.395 1.00 65.23  ?  160 SER E O   1 
ATOM   4778  C CB  . SER E  1 103 ? 440.023 65.455  450.312 1.00 47.51  ?  160 SER E CB  1 
ATOM   4779  O OG  . SER E  1 103 ? 439.347 66.300  449.397 1.00 52.35  ?  160 SER E OG  1 
ATOM   4780  N N   . VAL E  1 104 ? 441.319 62.561  450.771 1.00 41.36  ?  161 VAL E N   1 
ATOM   4781  C CA  . VAL E  1 104 ? 442.161 61.676  451.569 1.00 38.12  ?  161 VAL E CA  1 
ATOM   4782  C C   . VAL E  1 104 ? 443.594 62.183  451.500 1.00 43.97  ?  161 VAL E C   1 
ATOM   4783  O O   . VAL E  1 104 ? 444.068 62.586  450.433 1.00 50.40  ?  161 VAL E O   1 
ATOM   4784  C CB  . VAL E  1 104 ? 442.073 60.214  451.081 1.00 39.08  ?  161 VAL E CB  1 
ATOM   4785  C CG1 . VAL E  1 104 ? 442.949 59.309  451.936 1.00 41.73  ?  161 VAL E CG1 1 
ATOM   4786  C CG2 . VAL E  1 104 ? 440.631 59.734  451.096 1.00 44.27  ?  161 VAL E CG2 1 
ATOM   4787  N N   . SER E  1 105 ? 444.283 62.161  452.638 1.00 51.63  ?  162 SER E N   1 
ATOM   4788  C CA  . SER E  1 105 ? 445.642 62.669  452.737 1.00 53.00  ?  162 SER E CA  1 
ATOM   4789  C C   . SER E  1 105 ? 446.591 61.574  453.205 1.00 53.10  ?  162 SER E C   1 
ATOM   4790  O O   . SER E  1 105 ? 446.219 60.697  453.990 1.00 53.67  ?  162 SER E O   1 
ATOM   4791  C CB  . SER E  1 105 ? 445.720 63.862  453.701 1.00 57.66  ?  162 SER E CB  1 
ATOM   4792  O OG  . SER E  1 105 ? 444.911 64.935  453.255 1.00 66.93  ?  162 SER E OG  1 
ATOM   4793  N N   . LEU E  1 106 ? 447.824 61.635  452.706 1.00 41.13  ?  163 LEU E N   1 
ATOM   4794  C CA  . LEU E  1 106 ? 448.912 60.780  453.162 1.00 36.89  ?  163 LEU E CA  1 
ATOM   4795  C C   . LEU E  1 106 ? 450.080 61.663  453.573 1.00 16.57  ?  163 LEU E C   1 
ATOM   4796  O O   . LEU E  1 106 ? 450.452 62.584  452.839 1.00 16.26  ?  163 LEU E O   1 
ATOM   4797  C CB  . LEU E  1 106 ? 449.357 59.795  452.077 1.00 32.46  ?  163 LEU E CB  1 
ATOM   4798  C CG  . LEU E  1 106 ? 448.470 58.574  451.837 1.00 29.62  ?  163 LEU E CG  1 
ATOM   4799  C CD1 . LEU E  1 106 ? 449.214 57.547  451.000 1.00 32.53  ?  163 LEU E CD1 1 
ATOM   4800  C CD2 . LEU E  1 106 ? 448.013 57.972  453.155 1.00 30.53  ?  163 LEU E CD2 1 
ATOM   4801  N N   . ALA E  1 107 ? 450.652 61.383  454.740 1.00 34.35  ?  164 ALA E N   1 
ATOM   4802  C CA  . ALA E  1 107 ? 451.757 62.167  455.273 1.00 31.49  ?  164 ALA E CA  1 
ATOM   4803  C C   . ALA E  1 107 ? 452.885 61.237  455.690 1.00 36.35  ?  164 ALA E C   1 
ATOM   4804  O O   . ALA E  1 107 ? 452.659 60.276  456.431 1.00 39.97  ?  164 ALA E O   1 
ATOM   4805  C CB  . ALA E  1 107 ? 451.305 63.020  456.463 1.00 36.14  ?  164 ALA E CB  1 
ATOM   4806  N N   . LEU E  1 108 ? 454.093 61.523  455.209 1.00 58.53  ?  165 LEU E N   1 
ATOM   4807  C CA  . LEU E  1 108 ? 455.289 60.793  455.616 1.00 58.85  ?  165 LEU E CA  1 
ATOM   4808  C C   . LEU E  1 108 ? 455.946 61.557  456.758 1.00 63.55  ?  165 LEU E C   1 
ATOM   4809  O O   . LEU E  1 108 ? 456.458 62.664  456.562 1.00 64.18  ?  165 LEU E O   1 
ATOM   4810  C CB  . LEU E  1 108 ? 456.251 60.626  454.443 1.00 56.66  ?  165 LEU E CB  1 
ATOM   4811  C CG  . LEU E  1 108 ? 457.573 59.914  454.742 1.00 54.05  ?  165 LEU E CG  1 
ATOM   4812  C CD1 . LEU E  1 108 ? 457.351 58.428  454.964 1.00 54.85  ?  165 LEU E CD1 1 
ATOM   4813  C CD2 . LEU E  1 108 ? 458.576 60.147  453.623 1.00 50.77  ?  165 LEU E CD2 1 
ATOM   4814  N N   . HIS E  1 109 ? 455.931 60.969  457.949 1.00 60.31  ?  166 HIS E N   1 
ATOM   4815  C CA  . HIS E  1 109 ? 456.476 61.603  459.139 1.00 62.37  ?  166 HIS E CA  1 
ATOM   4816  C C   . HIS E  1 109 ? 457.832 61.004  459.483 1.00 59.74  ?  166 HIS E C   1 
ATOM   4817  O O   . HIS E  1 109 ? 458.021 59.786  459.419 1.00 56.76  ?  166 HIS E O   1 
ATOM   4818  C CB  . HIS E  1 109 ? 455.529 61.441  460.330 1.00 60.87  ?  166 HIS E CB  1 
ATOM   4819  C CG  . HIS E  1 109 ? 454.262 62.229  460.209 1.00 59.94  ?  166 HIS E CG  1 
ATOM   4820  N ND1 . HIS E  1 109 ? 453.070 61.809  460.761 1.00 62.35  ?  166 HIS E ND1 1 
ATOM   4821  C CD2 . HIS E  1 109 ? 454.001 63.414  459.608 1.00 55.66  ?  166 HIS E CD2 1 
ATOM   4822  C CE1 . HIS E  1 109 ? 452.129 62.699  460.501 1.00 62.55  ?  166 HIS E CE1 1 
ATOM   4823  N NE2 . HIS E  1 109 ? 452.668 63.682  459.803 1.00 63.34  ?  166 HIS E NE2 1 
ATOM   4824  N N   . LEU E  1 110 ? 458.775 61.870  459.845 1.00 41.96  ?  167 LEU E N   1 
ATOM   4825  C CA  . LEU E  1 110 ? 460.033 61.434  460.439 1.00 49.53  ?  167 LEU E CA  1 
ATOM   4826  C C   . LEU E  1 110 ? 459.861 61.494  461.952 1.00 55.78  ?  167 LEU E C   1 
ATOM   4827  O O   . LEU E  1 110 ? 459.790 62.580  462.534 1.00 53.82  ?  167 LEU E O   1 
ATOM   4828  C CB  . LEU E  1 110 ? 461.193 62.311  459.974 1.00 46.33  ?  167 LEU E CB  1 
ATOM   4829  C CG  . LEU E  1 110 ? 461.416 62.414  458.464 1.00 42.12  ?  167 LEU E CG  1 
ATOM   4830  C CD1 . LEU E  1 110 ? 462.702 63.169  458.163 1.00 46.42  ?  167 LEU E CD1 1 
ATOM   4831  C CD2 . LEU E  1 110 ? 461.440 61.035  457.828 1.00 35.94  ?  167 LEU E CD2 1 
ATOM   4832  N N   . GLN E  1 111 ? 459.791 60.327  462.584 1.00 110.34 ?  168 GLN E N   1 
ATOM   4833  C CA  . GLN E  1 111 ? 459.482 60.235  464.006 1.00 116.33 ?  168 GLN E CA  1 
ATOM   4834  C C   . GLN E  1 111 ? 460.612 60.788  464.872 1.00 118.53 ?  168 GLN E C   1 
ATOM   4835  O O   . GLN E  1 111 ? 460.336 61.513  465.837 1.00 109.68 ?  168 GLN E O   1 
ATOM   4836  C CB  . GLN E  1 111 ? 459.153 58.788  464.385 1.00 118.23 ?  168 GLN E CB  1 
ATOM   4837  C CG  . GLN E  1 111 ? 458.178 58.098  463.429 1.00 111.44 ?  168 GLN E CG  1 
ATOM   4838  C CD  . GLN E  1 111 ? 456.763 58.659  463.488 1.00 107.11 ?  168 GLN E CD  1 
ATOM   4839  O OE1 . GLN E  1 111 ? 456.465 59.561  464.272 1.00 118.22 ?  168 GLN E OE1 1 
ATOM   4840  N NE2 . GLN E  1 111 ? 455.885 58.124  462.647 1.00 93.14  ?  168 GLN E NE2 1 
ATOM   4841  N N   . PRO E  1 112 ? 461.893 60.471  464.587 1.00 84.25  ?  169 PRO E N   1 
ATOM   4842  C CA  . PRO E  1 112 ? 462.941 61.133  465.376 1.00 84.02  ?  169 PRO E CA  1 
ATOM   4843  C C   . PRO E  1 112 ? 462.963 62.650  465.186 1.00 70.60  ?  169 PRO E C   1 
ATOM   4844  O O   . PRO E  1 112 ? 463.505 63.122  464.187 1.00 64.46  ?  169 PRO E O   1 
ATOM   4845  C CB  . PRO E  1 112 ? 464.232 60.506  464.841 1.00 75.39  ?  169 PRO E CB  1 
ATOM   4846  C CG  . PRO E  1 112 ? 463.815 59.185  464.312 1.00 69.91  ?  169 PRO E CG  1 
ATOM   4847  C CD  . PRO E  1 112 ? 462.454 59.409  463.729 1.00 67.69  ?  169 PRO E CD  1 
ATOM   4848  N N   . ALA E  1 119 ? 457.061 69.116  460.484 1.00 115.28 ?  176 ALA E N   1 
ATOM   4849  C CA  . ALA E  1 119 ? 455.814 68.572  459.961 1.00 101.32 ?  176 ALA E CA  1 
ATOM   4850  C C   . ALA E  1 119 ? 456.078 67.390  459.032 1.00 96.11  ?  176 ALA E C   1 
ATOM   4851  O O   . ALA E  1 119 ? 457.104 66.720  459.143 1.00 99.52  ?  176 ALA E O   1 
ATOM   4852  C CB  . ALA E  1 119 ? 455.030 69.653  459.232 1.00 97.18  ?  176 ALA E CB  1 
ATOM   4853  N N   . ALA E  1 120 ? 455.145 67.141  458.117 1.00 57.51  ?  177 ALA E N   1 
ATOM   4854  C CA  . ALA E  1 120 ? 455.258 66.017  457.200 1.00 55.87  ?  177 ALA E CA  1 
ATOM   4855  C C   . ALA E  1 120 ? 456.205 66.358  456.056 1.00 60.61  ?  177 ALA E C   1 
ATOM   4856  O O   . ALA E  1 120 ? 456.098 67.429  455.449 1.00 63.86  ?  177 ALA E O   1 
ATOM   4857  C CB  . ALA E  1 120 ? 453.884 65.635  456.655 1.00 58.96  ?  177 ALA E CB  1 
ATOM   4858  N N   . ALA E  1 121 ? 457.128 65.441  455.762 1.00 76.21  ?  178 ALA E N   1 
ATOM   4859  C CA  . ALA E  1 121 ? 458.082 65.662  454.680 1.00 70.78  ?  178 ALA E CA  1 
ATOM   4860  C C   . ALA E  1 121 ? 457.441 65.446  453.314 1.00 76.61  ?  178 ALA E C   1 
ATOM   4861  O O   . ALA E  1 121 ? 457.778 66.143  452.352 1.00 76.63  ?  178 ALA E O   1 
ATOM   4862  C CB  . ALA E  1 121 ? 459.295 64.748  454.852 1.00 59.85  ?  178 ALA E CB  1 
ATOM   4863  N N   . LEU E  1 122 ? 456.527 64.483  453.209 1.00 65.66  ?  179 LEU E N   1 
ATOM   4864  C CA  . LEU E  1 122 ? 455.793 64.216  451.977 1.00 57.33  ?  179 LEU E CA  1 
ATOM   4865  C C   . LEU E  1 122 ? 454.305 64.260  452.285 1.00 54.52  ?  179 LEU E C   1 
ATOM   4866  O O   . LEU E  1 122 ? 453.821 63.485  453.115 1.00 57.51  ?  179 LEU E O   1 
ATOM   4867  C CB  . LEU E  1 122 ? 456.176 62.858  451.379 1.00 48.40  ?  179 LEU E CB  1 
ATOM   4868  C CG  . LEU E  1 122 ? 457.283 62.828  450.323 1.00 45.68  ?  179 LEU E CG  1 
ATOM   4869  C CD1 . LEU E  1 122 ? 458.596 63.310  450.905 1.00 54.90  ?  179 LEU E CD1 1 
ATOM   4870  C CD2 . LEU E  1 122 ? 457.433 61.430  449.741 1.00 40.07  ?  179 LEU E CD2 1 
ATOM   4871  N N   . ALA E  1 123 ? 453.584 65.157  451.617 1.00 76.84  ?  180 ALA E N   1 
ATOM   4872  C CA  . ALA E  1 123 ? 452.153 65.333  451.834 1.00 79.71  ?  180 ALA E CA  1 
ATOM   4873  C C   . ALA E  1 123 ? 451.428 65.187  450.507 1.00 77.86  ?  180 ALA E C   1 
ATOM   4874  O O   . ALA E  1 123 ? 451.606 66.013  449.606 1.00 82.74  ?  180 ALA E O   1 
ATOM   4875  C CB  . ALA E  1 123 ? 451.850 66.694  452.466 1.00 86.17  ?  180 ALA E CB  1 
ATOM   4876  N N   . LEU E  1 124 ? 450.604 64.150  450.393 1.00 47.33  ?  181 LEU E N   1 
ATOM   4877  C CA  . LEU E  1 124 ? 449.851 63.858  449.183 1.00 41.87  ?  181 LEU E CA  1 
ATOM   4878  C C   . LEU E  1 124 ? 448.362 63.892  449.495 1.00 47.98  ?  181 LEU E C   1 
ATOM   4879  O O   . LEU E  1 124 ? 447.925 63.395  450.537 1.00 53.66  ?  181 LEU E O   1 
ATOM   4880  C CB  . LEU E  1 124 ? 450.254 62.491  448.612 1.00 34.99  ?  181 LEU E CB  1 
ATOM   4881  C CG  . LEU E  1 124 ? 449.692 62.037  447.265 1.00 35.28  ?  181 LEU E CG  1 
ATOM   4882  C CD1 . LEU E  1 124 ? 450.719 61.185  446.549 1.00 40.42  ?  181 LEU E CD1 1 
ATOM   4883  C CD2 . LEU E  1 124 ? 448.408 61.252  447.454 1.00 37.66  ?  181 LEU E CD2 1 
ATOM   4884  N N   . THR E  1 125 ? 447.585 64.482  448.588 1.00 43.42  ?  182 THR E N   1 
ATOM   4885  C CA  . THR E  1 125 ? 446.148 64.641  448.774 1.00 46.24  ?  182 THR E CA  1 
ATOM   4886  C C   . THR E  1 125 ? 445.417 64.126  447.544 1.00 49.73  ?  182 THR E C   1 
ATOM   4887  O O   . THR E  1 125 ? 445.743 64.512  446.417 1.00 54.40  ?  182 THR E O   1 
ATOM   4888  C CB  . THR E  1 125 ? 445.782 66.108  449.032 1.00 56.22  ?  182 THR E CB  1 
ATOM   4889  O OG1 . THR E  1 125 ? 446.388 66.546  450.254 1.00 61.48  ?  182 THR E OG1 1 
ATOM   4890  C CG2 . THR E  1 125 ? 444.272 66.274  449.128 1.00 48.33  ?  182 THR E CG2 1 
ATOM   4891  N N   . VAL E  1 126 ? 444.432 63.259  447.764 1.00 31.96  ?  183 VAL E N   1 
ATOM   4892  C CA  . VAL E  1 126 ? 443.628 62.676  446.697 1.00 28.51  ?  183 VAL E CA  1 
ATOM   4893  C C   . VAL E  1 126 ? 442.175 63.068  446.922 1.00 32.97  ?  183 VAL E C   1 
ATOM   4894  O O   . VAL E  1 126 ? 441.638 62.878  448.020 1.00 35.64  ?  183 VAL E O   1 
ATOM   4895  C CB  . VAL E  1 126 ? 443.782 61.145  446.642 1.00 21.64  ?  183 VAL E CB  1 
ATOM   4896  C CG1 . VAL E  1 126 ? 442.664 60.530  445.828 1.00 22.11  ?  183 VAL E CG1 1 
ATOM   4897  C CG2 . VAL E  1 126 ? 445.128 60.773  446.050 1.00 24.08  ?  183 VAL E CG2 1 
ATOM   4898  N N   . ASP E  1 127 ? 441.542 63.612  445.884 1.00 57.82  ?  184 ASP E N   1 
ATOM   4899  C CA  . ASP E  1 127 ? 440.160 64.065  445.962 1.00 58.54  ?  184 ASP E CA  1 
ATOM   4900  C C   . ASP E  1 127 ? 439.217 62.945  445.539 1.00 58.32  ?  184 ASP E C   1 
ATOM   4901  O O   . ASP E  1 127 ? 439.453 62.274  444.529 1.00 61.68  ?  184 ASP E O   1 
ATOM   4902  C CB  . ASP E  1 127 ? 439.954 65.297  445.080 1.00 60.82  ?  184 ASP E CB  1 
ATOM   4903  C CG  . ASP E  1 127 ? 438.529 65.814  445.121 1.00 81.90  ?  184 ASP E CG  1 
ATOM   4904  O OD1 . ASP E  1 127 ? 437.854 65.627  446.156 1.00 85.60  ?  184 ASP E OD1 1 
ATOM   4905  O OD2 . ASP E  1 127 ? 438.086 66.415  444.120 1.00 95.08  -1 184 ASP E OD2 1 
ATOM   4906  N N   . LEU E  1 128 ? 438.150 62.747  446.315 1.00 56.63  ?  185 LEU E N   1 
ATOM   4907  C CA  . LEU E  1 128 ? 437.143 61.747  445.995 1.00 56.26  ?  185 LEU E CA  1 
ATOM   4908  C C   . LEU E  1 128 ? 435.984 62.424  445.283 1.00 56.13  ?  185 LEU E C   1 
ATOM   4909  O O   . LEU E  1 128 ? 435.257 63.209  445.913 1.00 53.71  ?  185 LEU E O   1 
ATOM   4910  C CB  . LEU E  1 128 ? 436.655 61.042  447.259 1.00 55.30  ?  185 LEU E CB  1 
ATOM   4911  C CG  . LEU E  1 128 ? 437.722 60.372  448.126 1.00 55.24  ?  185 LEU E CG  1 
ATOM   4912  C CD1 . LEU E  1 128 ? 437.093 59.723  449.350 1.00 54.05  ?  185 LEU E CD1 1 
ATOM   4913  C CD2 . LEU E  1 128 ? 438.511 59.351  447.321 1.00 49.68  ?  185 LEU E CD2 1 
ATOM   4914  N N   . PRO E  1 129 ? 435.769 62.168  443.991 1.00 57.31  ?  186 PRO E N   1 
ATOM   4915  C CA  . PRO E  1 129 ? 434.689 62.851  443.285 1.00 57.12  ?  186 PRO E CA  1 
ATOM   4916  C C   . PRO E  1 129 ? 433.335 62.344  443.744 1.00 56.41  ?  186 PRO E C   1 
ATOM   4917  O O   . PRO E  1 129 ? 433.183 61.159  444.090 1.00 56.50  ?  186 PRO E O   1 
ATOM   4918  C CB  . PRO E  1 129 ? 434.949 62.494  441.809 1.00 65.48  ?  186 PRO E CB  1 
ATOM   4919  C CG  . PRO E  1 129 ? 436.365 61.997  441.765 1.00 67.03  ?  186 PRO E CG  1 
ATOM   4920  C CD  . PRO E  1 129 ? 436.590 61.346  443.088 1.00 60.65  ?  186 PRO E CD  1 
ATOM   4921  N N   . PRO E  1 130 ? 432.319 63.203  443.764 1.00 44.77  ?  187 PRO E N   1 
ATOM   4922  C CA  . PRO E  1 130 ? 430.977 62.752  444.147 1.00 41.67  ?  187 PRO E CA  1 
ATOM   4923  C C   . PRO E  1 130 ? 430.359 61.868  443.076 1.00 41.15  ?  187 PRO E C   1 
ATOM   4924  O O   . PRO E  1 130 ? 430.798 61.827  441.925 1.00 40.92  ?  187 PRO E O   1 
ATOM   4925  C CB  . PRO E  1 130 ? 430.196 64.060  444.309 1.00 41.60  ?  187 PRO E CB  1 
ATOM   4926  C CG  . PRO E  1 130 ? 430.905 65.025  443.421 1.00 51.22  ?  187 PRO E CG  1 
ATOM   4927  C CD  . PRO E  1 130 ? 432.359 64.645  443.471 1.00 46.04  ?  187 PRO E CD  1 
ATOM   4928  N N   . ALA E  1 131 ? 429.314 61.151  443.479 1.00 39.76  ?  188 ALA E N   1 
ATOM   4929  C CA  . ALA E  1 131 ? 428.662 60.191  442.601 1.00 37.29  ?  188 ALA E CA  1 
ATOM   4930  C C   . ALA E  1 131 ? 427.799 60.889  441.559 1.00 44.25  ?  188 ALA E C   1 
ATOM   4931  O O   . ALA E  1 131 ? 427.081 61.847  441.862 1.00 44.10  ?  188 ALA E O   1 
ATOM   4932  C CB  . ALA E  1 131 ? 427.807 59.225  443.418 1.00 41.00  ?  188 ALA E CB  1 
ATOM   4933  N N   . SER E  1 132 ? 427.872 60.397  440.325 1.00 61.41  ?  189 SER E N   1 
ATOM   4934  C CA  . SER E  1 132 ? 427.086 60.930  439.219 1.00 66.15  ?  189 SER E CA  1 
ATOM   4935  C C   . SER E  1 132 ? 426.939 59.840  438.168 1.00 64.71  ?  189 SER E C   1 
ATOM   4936  O O   . SER E  1 132 ? 427.634 58.821  438.203 1.00 54.34  ?  189 SER E O   1 
ATOM   4937  C CB  . SER E  1 132 ? 427.728 62.188  438.625 1.00 64.55  ?  189 SER E CB  1 
ATOM   4938  O OG  . SER E  1 132 ? 427.750 63.248  439.566 1.00 56.46  ?  189 SER E OG  1 
ATOM   4939  N N   . SER E  1 133 ? 425.998 60.057  437.242 1.00 111.95 ?  190 SER E N   1 
ATOM   4940  C CA  . SER E  1 133 ? 425.793 59.116  436.143 1.00 117.39 ?  190 SER E CA  1 
ATOM   4941  C C   . SER E  1 133 ? 427.108 58.816  435.433 1.00 117.53 ?  190 SER E C   1 
ATOM   4942  O O   . SER E  1 133 ? 427.492 57.652  435.272 1.00 109.38 ?  190 SER E O   1 
ATOM   4943  C CB  . SER E  1 133 ? 424.759 59.672  435.162 1.00 113.40 ?  190 SER E CB  1 
ATOM   4944  O OG  . SER E  1 133 ? 425.163 60.928  434.646 1.00 114.19 ?  190 SER E OG  1 
ATOM   4945  N N   . GLU E  1 134 ? 427.815 59.857  435.006 1.00 117.65 ?  191 GLU E N   1 
ATOM   4946  C CA  . GLU E  1 134 ? 429.218 59.742  434.635 1.00 111.86 ?  191 GLU E CA  1 
ATOM   4947  C C   . GLU E  1 134 ? 430.047 60.227  435.819 1.00 112.64 ?  191 GLU E C   1 
ATOM   4948  O O   . GLU E  1 134 ? 429.806 61.315  436.353 1.00 116.57 ?  191 GLU E O   1 
ATOM   4949  C CB  . GLU E  1 134 ? 429.527 60.522  433.348 1.00 115.28 ?  191 GLU E CB  1 
ATOM   4950  C CG  . GLU E  1 134 ? 430.100 61.930  433.501 1.00 107.33 ?  191 GLU E CG  1 
ATOM   4951  C CD  . GLU E  1 134 ? 429.066 62.942  433.960 1.00 110.51 ?  191 GLU E CD  1 
ATOM   4952  O OE1 . GLU E  1 134 ? 427.856 62.682  433.791 1.00 112.98 ?  191 GLU E OE1 1 
ATOM   4953  O OE2 . GLU E  1 134 ? 429.467 63.999  434.492 1.00 104.63 -1 191 GLU E OE2 1 
ATOM   4954  N N   . ALA E  1 135 ? 430.969 59.387  436.275 1.00 80.09  ?  192 ALA E N   1 
ATOM   4955  C CA  . ALA E  1 135 ? 431.692 59.684  437.502 1.00 77.28  ?  192 ALA E CA  1 
ATOM   4956  C C   . ALA E  1 135 ? 433.000 58.914  437.512 1.00 74.05  ?  192 ALA E C   1 
ATOM   4957  O O   . ALA E  1 135 ? 433.188 57.956  436.758 1.00 75.50  ?  192 ALA E O   1 
ATOM   4958  C CB  . ALA E  1 135 ? 430.859 59.343  438.742 1.00 79.03  ?  192 ALA E CB  1 
ATOM   4959  N N   . ARG E  1 136 ? 433.902 59.348  438.385 1.00 85.14  ?  193 ARG E N   1 
ATOM   4960  C CA  . ARG E  1 136 ? 435.197 58.703  438.554 1.00 89.83  ?  193 ARG E CA  1 
ATOM   4961  C C   . ARG E  1 136 ? 435.086 57.675  439.674 1.00 91.09  ?  193 ARG E C   1 
ATOM   4962  O O   . ARG E  1 136 ? 434.879 58.033  440.839 1.00 90.02  ?  193 ARG E O   1 
ATOM   4963  C CB  . ARG E  1 136 ? 436.278 59.735  438.861 1.00 97.87  ?  193 ARG E CB  1 
ATOM   4964  C CG  . ARG E  1 136 ? 436.494 60.748  437.755 1.00 91.95  ?  193 ARG E CG  1 
ATOM   4965  C CD  . ARG E  1 136 ? 437.761 61.555  437.995 1.00 89.53  ?  193 ARG E CD  1 
ATOM   4966  N NE  . ARG E  1 136 ? 438.862 60.729  438.489 1.00 90.42  ?  193 ARG E NE  1 
ATOM   4967  C CZ  . ARG E  1 136 ? 439.530 59.842  437.756 1.00 92.77  ?  193 ARG E CZ  1 
ATOM   4968  N NH1 . ARG E  1 136 ? 439.211 59.641  436.485 1.00 83.96  ?  193 ARG E NH1 1 
ATOM   4969  N NH2 . ARG E  1 136 ? 440.518 59.145  438.301 1.00 93.11  ?  193 ARG E NH2 1 
ATOM   4970  N N   . ASN E  1 137 ? 435.216 56.401  439.322 1.00 33.62  ?  194 ASN E N   1 
ATOM   4971  C CA  . ASN E  1 137 ? 435.249 55.327  440.303 1.00 29.90  ?  194 ASN E CA  1 
ATOM   4972  C C   . ASN E  1 137 ? 436.662 54.991  440.755 1.00 28.65  ?  194 ASN E C   1 
ATOM   4973  O O   . ASN E  1 137 ? 436.841 54.063  441.548 1.00 32.63  ?  194 ASN E O   1 
ATOM   4974  C CB  . ASN E  1 137 ? 434.570 54.075  439.738 1.00 39.34  ?  194 ASN E CB  1 
ATOM   4975  C CG  . ASN E  1 137 ? 433.074 54.250  439.572 1.00 35.15  ?  194 ASN E CG  1 
ATOM   4976  O OD1 . ASN E  1 137 ? 432.448 55.045  440.276 1.00 24.31  ?  194 ASN E OD1 1 
ATOM   4977  N ND2 . ASN E  1 137 ? 432.490 53.507  438.638 1.00 28.52  ?  194 ASN E ND2 1 
ATOM   4978  N N   . SER E  1 138 ? 437.663 55.722  440.269 1.00 40.26  ?  195 SER E N   1 
ATOM   4979  C CA  . SER E  1 138 ? 439.053 55.521  440.652 1.00 32.41  ?  195 SER E CA  1 
ATOM   4980  C C   . SER E  1 138 ? 439.672 56.868  440.983 1.00 33.54  ?  195 SER E C   1 
ATOM   4981  O O   . SER E  1 138 ? 439.536 57.825  440.213 1.00 44.00  ?  195 SER E O   1 
ATOM   4982  C CB  . SER E  1 138 ? 439.844 54.831  439.536 1.00 35.02  ?  195 SER E CB  1 
ATOM   4983  O OG  . SER E  1 138 ? 439.285 53.568  439.221 1.00 43.56  ?  195 SER E OG  1 
ATOM   4984  N N   . ALA E  1 139 ? 440.346 56.943  442.127 1.00 39.44  ?  196 ALA E N   1 
ATOM   4985  C CA  . ALA E  1 139 ? 441.031 58.148  442.571 1.00 39.55  ?  196 ALA E CA  1 
ATOM   4986  C C   . ALA E  1 139 ? 442.488 57.806  442.838 1.00 40.81  ?  196 ALA E C   1 
ATOM   4987  O O   . ALA E  1 139 ? 442.782 56.806  443.502 1.00 45.22  ?  196 ALA E O   1 
ATOM   4988  C CB  . ALA E  1 139 ? 440.369 58.727  443.824 1.00 34.94  ?  196 ALA E CB  1 
ATOM   4989  N N   . PHE E  1 140 ? 443.398 58.632  442.325 1.00 27.96  ?  197 PHE E N   1 
ATOM   4990  C CA  . PHE E  1 140 ? 444.812 58.288  442.333 1.00 23.12  ?  197 PHE E CA  1 
ATOM   4991  C C   . PHE E  1 140 ? 445.655 59.550  442.448 1.00 20.75  ?  197 PHE E C   1 
ATOM   4992  O O   . PHE E  1 140 ? 445.264 60.623  441.976 1.00 21.43  ?  197 PHE E O   1 
ATOM   4993  C CB  . PHE E  1 140 ? 445.178 57.495  441.071 1.00 28.52  ?  197 PHE E CB  1 
ATOM   4994  C CG  . PHE E  1 140 ? 446.654 57.384  440.824 1.00 31.23  ?  197 PHE E CG  1 
ATOM   4995  C CD1 . PHE E  1 140 ? 447.449 56.594  441.638 1.00 30.65  ?  197 PHE E CD1 1 
ATOM   4996  C CD2 . PHE E  1 140 ? 447.243 58.063  439.771 1.00 30.59  ?  197 PHE E CD2 1 
ATOM   4997  C CE1 . PHE E  1 140 ? 448.807 56.490  441.410 1.00 25.69  ?  197 PHE E CE1 1 
ATOM   4998  C CE2 . PHE E  1 140 ? 448.599 57.961  439.537 1.00 29.60  ?  197 PHE E CE2 1 
ATOM   4999  C CZ  . PHE E  1 140 ? 449.383 57.175  440.359 1.00 29.83  ?  197 PHE E CZ  1 
ATOM   5000  N N   . GLY E  1 141 ? 446.814 59.410  443.089 1.00 13.04  ?  198 GLY E N   1 
ATOM   5001  C CA  . GLY E  1 141 ? 447.766 60.501  443.189 1.00 14.63  ?  198 GLY E CA  1 
ATOM   5002  C C   . GLY E  1 141 ? 449.169 59.964  443.385 1.00 18.41  ?  198 GLY E C   1 
ATOM   5003  O O   . GLY E  1 141 ? 449.368 58.847  443.875 1.00 20.44  ?  198 GLY E O   1 
ATOM   5004  N N   . PHE E  1 142 ? 450.147 60.781  443.000 1.00 32.27  ?  199 PHE E N   1 
ATOM   5005  C CA  . PHE E  1 142 ? 451.551 60.394  443.076 1.00 29.14  ?  199 PHE E CA  1 
ATOM   5006  C C   . PHE E  1 142 ? 452.393 61.590  443.490 1.00 33.96  ?  199 PHE E C   1 
ATOM   5007  O O   . PHE E  1 142 ? 452.101 62.728  443.112 1.00 41.35  ?  199 PHE E O   1 
ATOM   5008  C CB  . PHE E  1 142 ? 452.057 59.844  441.737 1.00 26.32  ?  199 PHE E CB  1 
ATOM   5009  C CG  . PHE E  1 142 ? 453.457 59.297  441.796 1.00 29.86  ?  199 PHE E CG  1 
ATOM   5010  C CD1 . PHE E  1 142 ? 454.550 60.115  441.556 1.00 28.81  ?  199 PHE E CD1 1 
ATOM   5011  C CD2 . PHE E  1 142 ? 453.681 57.963  442.088 1.00 34.30  ?  199 PHE E CD2 1 
ATOM   5012  C CE1 . PHE E  1 142 ? 455.836 59.613  441.613 1.00 27.68  ?  199 PHE E CE1 1 
ATOM   5013  C CE2 . PHE E  1 142 ? 454.964 57.456  442.145 1.00 25.54  ?  199 PHE E CE2 1 
ATOM   5014  C CZ  . PHE E  1 142 ? 456.042 58.281  441.906 1.00 24.09  ?  199 PHE E CZ  1 
ATOM   5015  N N   . GLN E  1 143 ? 453.435 61.322  444.273 1.00 25.11  ?  200 GLN E N   1 
ATOM   5016  C CA  . GLN E  1 143 ? 454.388 62.346  444.673 1.00 24.36  ?  200 GLN E CA  1 
ATOM   5017  C C   . GLN E  1 143 ? 455.719 61.682  444.991 1.00 28.40  ?  200 GLN E C   1 
ATOM   5018  O O   . GLN E  1 143 ? 455.764 60.514  445.383 1.00 33.61  ?  200 GLN E O   1 
ATOM   5019  C CB  . GLN E  1 143 ? 453.870 63.140  445.880 1.00 23.01  ?  200 GLN E CB  1 
ATOM   5020  C CG  . GLN E  1 143 ? 454.847 64.159  446.443 1.00 26.88  ?  200 GLN E CG  1 
ATOM   5021  C CD  . GLN E  1 143 ? 454.175 65.168  447.341 1.00 41.31  ?  200 GLN E CD  1 
ATOM   5022  O OE1 . GLN E  1 143 ? 452.952 65.306  447.329 1.00 51.68  ?  200 GLN E OE1 1 
ATOM   5023  N NE2 . GLN E  1 143 ? 454.970 65.881  448.131 1.00 41.33  ?  200 GLN E NE2 1 
ATOM   5024  N N   . GLY E  1 144 ? 456.804 62.435  444.814 1.00 19.44  ?  201 GLY E N   1 
ATOM   5025  C CA  . GLY E  1 144 ? 458.106 62.002  445.280 1.00 15.42  ?  201 GLY E CA  1 
ATOM   5026  C C   . GLY E  1 144 ? 459.143 63.104  445.233 1.00 19.24  ?  201 GLY E C   1 
ATOM   5027  O O   . GLY E  1 144 ? 459.042 64.027  444.418 1.00 19.08  ?  201 GLY E O   1 
ATOM   5028  N N   . ARG E  1 145 ? 460.147 63.020  446.102 1.00 42.06  ?  202 ARG E N   1 
ATOM   5029  C CA  . ARG E  1 145 ? 461.218 64.007  446.146 1.00 40.47  ?  202 ARG E CA  1 
ATOM   5030  C C   . ARG E  1 145 ? 462.412 63.409  446.872 1.00 37.71  ?  202 ARG E C   1 
ATOM   5031  O O   . ARG E  1 145 ? 462.287 62.419  447.599 1.00 38.02  ?  202 ARG E O   1 
ATOM   5032  C CB  . ARG E  1 145 ? 460.759 65.302  446.825 1.00 35.29  ?  202 ARG E CB  1 
ATOM   5033  C CG  . ARG E  1 145 ? 460.177 65.099  448.210 1.00 36.66  ?  202 ARG E CG  1 
ATOM   5034  C CD  . ARG E  1 145 ? 459.020 66.052  448.469 1.00 44.56  ?  202 ARG E CD  1 
ATOM   5035  N NE  . ARG E  1 145 ? 459.445 67.448  448.511 1.00 43.43  ?  202 ARG E NE  1 
ATOM   5036  C CZ  . ARG E  1 145 ? 459.752 68.098  449.628 1.00 44.60  ?  202 ARG E CZ  1 
ATOM   5037  N NH1 . ARG E  1 145 ? 459.682 67.477  450.798 1.00 48.45  ?  202 ARG E NH1 1 
ATOM   5038  N NH2 . ARG E  1 145 ? 460.129 69.369  449.579 1.00 42.36  ?  202 ARG E NH2 1 
ATOM   5039  N N   . LEU E  1 146 ? 463.573 64.024  446.668 1.00 28.77  ?  203 LEU E N   1 
ATOM   5040  C CA  . LEU E  1 146 ? 464.763 63.627  447.406 1.00 30.68  ?  203 LEU E CA  1 
ATOM   5041  C C   . LEU E  1 146 ? 464.601 63.965  448.882 1.00 36.48  ?  203 LEU E C   1 
ATOM   5042  O O   . LEU E  1 146 ? 463.994 64.978  449.241 1.00 42.07  ?  203 LEU E O   1 
ATOM   5043  C CB  . LEU E  1 146 ? 466.003 64.321  446.842 1.00 28.36  ?  203 LEU E CB  1 
ATOM   5044  C CG  . LEU E  1 146 ? 466.371 64.021  445.387 1.00 31.44  ?  203 LEU E CG  1 
ATOM   5045  C CD1 . LEU E  1 146 ? 467.596 64.820  444.967 1.00 28.03  ?  203 LEU E CD1 1 
ATOM   5046  C CD2 . LEU E  1 146 ? 466.606 62.534  445.191 1.00 31.63  ?  203 LEU E CD2 1 
ATOM   5047  N N   . LEU E  1 147 ? 465.146 63.106  449.741 1.00 25.46  ?  204 LEU E N   1 
ATOM   5048  C CA  . LEU E  1 147 ? 465.078 63.304  451.182 1.00 29.12  ?  204 LEU E CA  1 
ATOM   5049  C C   . LEU E  1 147 ? 466.416 62.954  451.810 1.00 31.25  ?  204 LEU E C   1 
ATOM   5050  O O   . LEU E  1 147 ? 467.055 61.973  451.419 1.00 30.90  ?  204 LEU E O   1 
ATOM   5051  C CB  . LEU E  1 147 ? 463.978 62.450  451.824 1.00 18.35  ?  204 LEU E CB  1 
ATOM   5052  C CG  . LEU E  1 147 ? 462.538 62.948  451.719 1.00 18.51  ?  204 LEU E CG  1 
ATOM   5053  C CD1 . LEU E  1 147 ? 461.613 62.007  452.470 1.00 19.71  ?  204 LEU E CD1 1 
ATOM   5054  C CD2 . LEU E  1 147 ? 462.421 64.364  452.257 1.00 20.76  ?  204 LEU E CD2 1 
ATOM   5055  N N   . HIS E  1 148 ? 466.830 63.756  452.785 1.00 62.56  ?  205 HIS E N   1 
ATOM   5056  C CA  . HIS E  1 148 ? 468.021 63.465  453.572 1.00 70.57  ?  205 HIS E CA  1 
ATOM   5057  C C   . HIS E  1 148 ? 467.605 62.685  454.812 1.00 73.61  ?  205 HIS E C   1 
ATOM   5058  O O   . HIS E  1 148 ? 466.871 63.203  455.661 1.00 78.60  ?  205 HIS E O   1 
ATOM   5059  C CB  . HIS E  1 148 ? 468.753 64.748  453.960 1.00 77.62  ?  205 HIS E CB  1 
ATOM   5060  C CG  . HIS E  1 148 ? 469.993 64.513  454.766 1.00 89.91  ?  205 HIS E CG  1 
ATOM   5061  N ND1 . HIS E  1 148 ? 471.050 63.761  454.301 1.00 87.39  ?  205 HIS E ND1 1 
ATOM   5062  C CD2 . HIS E  1 148 ? 470.341 64.923  456.008 1.00 96.10  ?  205 HIS E CD2 1 
ATOM   5063  C CE1 . HIS E  1 148 ? 471.998 63.721  455.220 1.00 89.91  ?  205 HIS E CE1 1 
ATOM   5064  N NE2 . HIS E  1 148 ? 471.592 64.419  456.266 1.00 106.92 ?  205 HIS E NE2 1 
ATOM   5065  N N   . LEU E  1 149 ? 468.073 61.447  454.916 1.00 41.71  ?  206 LEU E N   1 
ATOM   5066  C CA  . LEU E  1 149 ? 467.720 60.566  456.015 1.00 38.68  ?  206 LEU E CA  1 
ATOM   5067  C C   . LEU E  1 149 ? 468.946 60.282  456.873 1.00 44.83  ?  206 LEU E C   1 
ATOM   5068  O O   . LEU E  1 149 ? 470.089 60.382  456.420 1.00 41.43  ?  206 LEU E O   1 
ATOM   5069  C CB  . LEU E  1 149 ? 467.117 59.255  455.499 1.00 33.18  ?  206 LEU E CB  1 
ATOM   5070  C CG  . LEU E  1 149 ? 465.750 59.395  454.823 1.00 32.37  ?  206 LEU E CG  1 
ATOM   5071  C CD1 . LEU E  1 149 ? 465.174 58.033  454.466 1.00 33.53  ?  206 LEU E CD1 1 
ATOM   5072  C CD2 . LEU E  1 149 ? 464.793 60.171  455.714 1.00 41.20  ?  206 LEU E CD2 1 
ATOM   5073  N N   . SER E  1 150 ? 468.686 59.934  458.128 1.00 37.37  ?  207 SER E N   1 
ATOM   5074  C CA  . SER E  1 150 ? 469.718 59.759  459.136 1.00 39.78  ?  207 SER E CA  1 
ATOM   5075  C C   . SER E  1 150 ? 469.842 58.290  459.515 1.00 41.22  ?  207 SER E C   1 
ATOM   5076  O O   . SER E  1 150 ? 468.895 57.513  459.373 1.00 45.50  ?  207 SER E O   1 
ATOM   5077  C CB  . SER E  1 150 ? 469.408 60.589  460.384 1.00 37.72  ?  207 SER E CB  1 
ATOM   5078  O OG  . SER E  1 150 ? 469.075 61.920  460.032 1.00 38.31  ?  207 SER E OG  1 
ATOM   5079  N N   . ALA E  1 151 ? 471.033 57.909  459.972 1.00 48.88  ?  208 ALA E N   1 
ATOM   5080  C CA  . ALA E  1 151 ? 471.237 56.555  460.462 1.00 51.56  ?  208 ALA E CA  1 
ATOM   5081  C C   . ALA E  1 151 ? 470.289 56.271  461.619 1.00 52.55  ?  208 ALA E C   1 
ATOM   5082  O O   . ALA E  1 151 ? 470.245 57.019  462.601 1.00 52.06  ?  208 ALA E O   1 
ATOM   5083  C CB  . ALA E  1 151 ? 472.689 56.363  460.900 1.00 55.66  ?  208 ALA E CB  1 
ATOM   5084  N N   . GLY E  1 152 ? 469.523 55.190  461.497 1.00 57.28  ?  209 GLY E N   1 
ATOM   5085  C CA  . GLY E  1 152 ? 468.525 54.869  462.497 1.00 62.13  ?  209 GLY E CA  1 
ATOM   5086  C C   . GLY E  1 152 ? 467.246 55.667  462.403 1.00 63.67  ?  209 GLY E C   1 
ATOM   5087  O O   . GLY E  1 152 ? 466.511 55.753  463.390 1.00 68.25  ?  209 GLY E O   1 
ATOM   5088  N N   . GLN E  1 153 ? 466.957 56.258  461.246 1.00 51.00  ?  210 GLN E N   1 
ATOM   5089  C CA  . GLN E  1 153 ? 465.735 57.029  461.070 1.00 49.63  ?  210 GLN E CA  1 
ATOM   5090  C C   . GLN E  1 153 ? 464.569 56.105  460.749 1.00 48.42  ?  210 GLN E C   1 
ATOM   5091  O O   . GLN E  1 153 ? 464.709 55.145  459.985 1.00 42.94  ?  210 GLN E O   1 
ATOM   5092  C CB  . GLN E  1 153 ? 465.903 58.060  459.953 1.00 46.17  ?  210 GLN E CB  1 
ATOM   5093  C CG  . GLN E  1 153 ? 464.725 59.007  459.782 1.00 40.96  ?  210 GLN E CG  1 
ATOM   5094  C CD  . GLN E  1 153 ? 464.960 60.354  460.438 1.00 47.34  ?  210 GLN E CD  1 
ATOM   5095  O OE1 . GLN E  1 153 ? 464.289 60.712  461.406 1.00 52.50  ?  210 GLN E OE1 1 
ATOM   5096  N NE2 . GLN E  1 153 ? 465.914 61.111  459.908 1.00 44.03  ?  210 GLN E NE2 1 
ATOM   5097  N N   . ARG E  1 154 ? 463.414 56.400  461.337 1.00 77.71  ?  211 ARG E N   1 
ATOM   5098  C CA  . ARG E  1 154 ? 462.192 55.648  461.099 1.00 76.72  ?  211 ARG E CA  1 
ATOM   5099  C C   . ARG E  1 154 ? 461.203 56.517  460.334 1.00 71.87  ?  211 ARG E C   1 
ATOM   5100  O O   . ARG E  1 154 ? 461.017 57.694  460.658 1.00 66.09  ?  211 ARG E O   1 
ATOM   5101  C CB  . ARG E  1 154 ? 461.563 55.170  462.412 1.00 79.86  ?  211 ARG E CB  1 
ATOM   5102  C CG  . ARG E  1 154 ? 462.284 54.002  463.083 1.00 80.37  ?  211 ARG E CG  1 
ATOM   5103  C CD  . ARG E  1 154 ? 463.522 54.457  463.842 1.00 84.12  ?  211 ARG E CD  1 
ATOM   5104  N NE  . ARG E  1 154 ? 463.269 55.682  464.594 1.00 96.30  ?  211 ARG E NE  1 
ATOM   5105  C CZ  . ARG E  1 154 ? 462.750 55.717  465.816 1.00 96.92  ?  211 ARG E CZ  1 
ATOM   5106  N NH1 . ARG E  1 154 ? 462.428 54.590  466.436 1.00 94.24  ?  211 ARG E NH1 1 
ATOM   5107  N NH2 . ARG E  1 154 ? 462.553 56.881  466.419 1.00 94.09  ?  211 ARG E NH2 1 
ATOM   5108  N N   . LEU E  1 155 ? 460.575 55.932  459.316 1.00 56.46  ?  212 LEU E N   1 
ATOM   5109  C CA  . LEU E  1 155 ? 459.649 56.643  458.441 1.00 50.67  ?  212 LEU E CA  1 
ATOM   5110  C C   . LEU E  1 155 ? 458.274 55.999  458.557 1.00 45.01  ?  212 LEU E C   1 
ATOM   5111  O O   . LEU E  1 155 ? 458.081 54.855  458.130 1.00 35.73  ?  212 LEU E O   1 
ATOM   5112  C CB  . LEU E  1 155 ? 460.137 56.622  456.991 1.00 41.12  ?  212 LEU E CB  1 
ATOM   5113  C CG  . LEU E  1 155 ? 461.209 57.619  456.540 1.00 40.08  ?  212 LEU E CG  1 
ATOM   5114  C CD1 . LEU E  1 155 ? 462.540 57.393  457.245 1.00 50.98  ?  212 LEU E CD1 1 
ATOM   5115  C CD2 . LEU E  1 155 ? 461.387 57.553  455.031 1.00 45.20  ?  212 LEU E CD2 1 
ATOM   5116  N N   . GLY E  1 156 ? 457.322 56.729  459.137 1.00 42.84  ?  213 GLY E N   1 
ATOM   5117  C CA  . GLY E  1 156 ? 455.947 56.288  459.195 1.00 42.00  ?  213 GLY E CA  1 
ATOM   5118  C C   . GLY E  1 156 ? 455.070 57.017  458.187 1.00 36.66  ?  213 GLY E C   1 
ATOM   5119  O O   . GLY E  1 156 ? 455.450 58.028  457.603 1.00 38.66  ?  213 GLY E O   1 
ATOM   5120  N N   . VAL E  1 157 ? 453.867 56.480  457.998 1.00 41.33  ?  214 VAL E N   1 
ATOM   5121  C CA  . VAL E  1 157 ? 452.882 57.049  457.083 1.00 40.61  ?  214 VAL E CA  1 
ATOM   5122  C C   . VAL E  1 157 ? 451.515 56.977  457.746 1.00 47.48  ?  214 VAL E C   1 
ATOM   5123  O O   . VAL E  1 157 ? 451.100 55.909  458.208 1.00 49.39  ?  214 VAL E O   1 
ATOM   5124  C CB  . VAL E  1 157 ? 452.858 56.318  455.725 1.00 38.82  ?  214 VAL E CB  1 
ATOM   5125  C CG1 . VAL E  1 157 ? 451.730 56.852  454.856 1.00 37.97  ?  214 VAL E CG1 1 
ATOM   5126  C CG2 . VAL E  1 157 ? 454.194 56.457  455.011 1.00 40.86  ?  214 VAL E CG2 1 
ATOM   5127  N N   . HIS E  1 158 ? 450.814 58.106  457.786 1.00 50.67  ?  215 HIS E N   1 
ATOM   5128  C CA  . HIS E  1 158 ? 449.491 58.187  458.386 1.00 47.32  ?  215 HIS E CA  1 
ATOM   5129  C C   . HIS E  1 158 ? 448.467 58.600  457.339 1.00 45.46  ?  215 HIS E C   1 
ATOM   5130  O O   . HIS E  1 158 ? 448.764 59.375  456.423 1.00 41.76  ?  215 HIS E O   1 
ATOM   5131  C CB  . HIS E  1 158 ? 449.467 59.182  459.553 1.00 54.21  ?  215 HIS E CB  1 
ATOM   5132  C CG  . HIS E  1 158 ? 450.368 58.806  460.687 1.00 56.47  ?  215 HIS E CG  1 
ATOM   5133  N ND1 . HIS E  1 158 ? 451.721 59.066  460.682 1.00 58.50  ?  215 HIS E ND1 1 
ATOM   5134  C CD2 . HIS E  1 158 ? 450.108 58.186  461.863 1.00 54.71  ?  215 HIS E CD2 1 
ATOM   5135  C CE1 . HIS E  1 158 ? 452.256 58.626  461.806 1.00 62.10  ?  215 HIS E CE1 1 
ATOM   5136  N NE2 . HIS E  1 158 ? 451.300 58.086  462.540 1.00 64.99  ?  215 HIS E NE2 1 
ATOM   5137  N N   . LEU E  1 159 ? 447.255 58.075  457.485 1.00 42.76  ?  216 LEU E N   1 
ATOM   5138  C CA  . LEU E  1 159 ? 446.138 58.392  456.608 1.00 38.80  ?  216 LEU E CA  1 
ATOM   5139  C C   . LEU E  1 159 ? 445.121 59.233  457.370 1.00 43.24  ?  216 LEU E C   1 
ATOM   5140  O O   . LEU E  1 159 ? 444.790 58.933  458.521 1.00 45.22  ?  216 LEU E O   1 
ATOM   5141  C CB  . LEU E  1 159 ? 445.482 57.115  456.072 1.00 30.07  ?  216 LEU E CB  1 
ATOM   5142  C CG  . LEU E  1 159 ? 444.526 57.208  454.878 1.00 30.18  ?  216 LEU E CG  1 
ATOM   5143  C CD1 . LEU E  1 159 ? 444.505 55.887  454.129 1.00 28.77  ?  216 LEU E CD1 1 
ATOM   5144  C CD2 . LEU E  1 159 ? 443.115 57.580  455.312 1.00 39.43  ?  216 LEU E CD2 1 
ATOM   5145  N N   . HIS E  1 160 ? 444.631 60.288  456.723 1.00 57.32  ?  217 HIS E N   1 
ATOM   5146  C CA  . HIS E  1 160 ? 443.631 61.169  457.310 1.00 60.47  ?  217 HIS E CA  1 
ATOM   5147  C C   . HIS E  1 160 ? 442.623 61.545  456.237 1.00 61.71  ?  217 HIS E C   1 
ATOM   5148  O O   . HIS E  1 160 ? 443.010 61.888  455.115 1.00 68.79  ?  217 HIS E O   1 
ATOM   5149  C CB  . HIS E  1 160 ? 444.275 62.426  457.904 1.00 58.10  ?  217 HIS E CB  1 
ATOM   5150  C CG  . HIS E  1 160 ? 443.295 63.371  458.523 1.00 71.18  ?  217 HIS E CG  1 
ATOM   5151  N ND1 . HIS E  1 160 ? 442.587 63.067  459.666 1.00 82.56  ?  217 HIS E ND1 1 
ATOM   5152  C CD2 . HIS E  1 160 ? 442.900 64.613  458.156 1.00 77.66  ?  217 HIS E CD2 1 
ATOM   5153  C CE1 . HIS E  1 160 ? 441.800 64.080  459.977 1.00 86.31  ?  217 HIS E CE1 1 
ATOM   5154  N NE2 . HIS E  1 160 ? 441.971 65.032  459.077 1.00 88.31  ?  217 HIS E NE2 1 
ATOM   5155  N N   . THR E  1 161 ? 441.337 61.481  456.577 1.00 55.97  ?  218 THR E N   1 
ATOM   5156  C CA  . THR E  1 161 ? 440.282 61.713  455.603 1.00 60.59  ?  218 THR E CA  1 
ATOM   5157  C C   . THR E  1 161 ? 439.120 62.465  456.237 1.00 64.90  ?  218 THR E C   1 
ATOM   5158  O O   . THR E  1 161 ? 438.690 62.145  457.348 1.00 62.65  ?  218 THR E O   1 
ATOM   5159  C CB  . THR E  1 161 ? 439.778 60.388  455.008 1.00 60.66  ?  218 THR E CB  1 
ATOM   5160  O OG1 . THR E  1 161 ? 438.546 60.610  454.310 1.00 63.96  ?  218 THR E OG1 1 
ATOM   5161  C CG2 . THR E  1 161 ? 439.568 59.350  456.104 1.00 59.79  ?  218 THR E CG2 1 
ATOM   5162  N N   . GLU E  1 162 ? 438.623 63.471  455.517 1.00 50.18  ?  219 GLU E N   1 
ATOM   5163  C CA  . GLU E  1 162 ? 437.390 64.175  455.859 1.00 50.84  ?  219 GLU E CA  1 
ATOM   5164  C C   . GLU E  1 162 ? 436.429 63.999  454.693 1.00 43.94  ?  219 GLU E C   1 
ATOM   5165  O O   . GLU E  1 162 ? 436.657 64.546  453.608 1.00 32.85  ?  219 GLU E O   1 
ATOM   5166  C CB  . GLU E  1 162 ? 437.648 65.655  456.134 1.00 54.80  ?  219 GLU E CB  1 
ATOM   5167  C CG  . GLU E  1 162 ? 438.576 65.927  457.302 1.00 71.22  ?  219 GLU E CG  1 
ATOM   5168  C CD  . GLU E  1 162 ? 438.408 67.327  457.858 1.00 81.50  ?  219 GLU E CD  1 
ATOM   5169  O OE1 . GLU E  1 162 ? 437.286 67.871  457.768 1.00 76.76  ?  219 GLU E OE1 1 
ATOM   5170  O OE2 . GLU E  1 162 ? 439.393 67.883  458.384 1.00 90.30  -1 219 GLU E OE2 1 
ATOM   5171  N N   . ALA E  1 163 ? 435.360 63.236  454.909 1.00 46.96  ?  220 ALA E N   1 
ATOM   5172  C CA  . ALA E  1 163 ? 434.453 62.908  453.822 1.00 42.85  ?  220 ALA E CA  1 
ATOM   5173  C C   . ALA E  1 163 ? 433.061 62.614  454.361 1.00 48.61  ?  220 ALA E C   1 
ATOM   5174  O O   . ALA E  1 163 ? 432.903 62.118  455.481 1.00 52.04  ?  220 ALA E O   1 
ATOM   5175  C CB  . ALA E  1 163 ? 434.968 61.704  453.022 1.00 37.15  ?  220 ALA E CB  1 
ATOM   5176  N N   . ARG E  1 164 ? 432.054 62.920  453.546 1.00 72.43  ?  221 ARG E N   1 
ATOM   5177  C CA  . ARG E  1 164 ? 430.750 62.304  453.716 1.00 73.71  ?  221 ARG E CA  1 
ATOM   5178  C C   . ARG E  1 164 ? 430.878 60.813  453.418 1.00 80.86  ?  221 ARG E C   1 
ATOM   5179  O O   . ARG E  1 164 ? 431.838 60.376  452.777 1.00 80.85  ?  221 ARG E O   1 
ATOM   5180  C CB  . ARG E  1 164 ? 429.718 62.951  452.792 1.00 70.16  ?  221 ARG E CB  1 
ATOM   5181  C CG  . ARG E  1 164 ? 429.826 64.465  452.711 1.00 74.72  ?  221 ARG E CG  1 
ATOM   5182  C CD  . ARG E  1 164 ? 428.820 65.043  451.728 1.00 87.27  ?  221 ARG E CD  1 
ATOM   5183  N NE  . ARG E  1 164 ? 427.447 64.917  452.210 1.00 101.32 ?  221 ARG E NE  1 
ATOM   5184  C CZ  . ARG E  1 164 ? 426.378 65.318  451.530 1.00 99.65  ?  221 ARG E CZ  1 
ATOM   5185  N NH1 . ARG E  1 164 ? 426.520 65.874  450.335 1.00 88.93  ?  221 ARG E NH1 1 
ATOM   5186  N NH2 . ARG E  1 164 ? 425.165 65.165  452.046 1.00 95.94  ?  221 ARG E NH2 1 
ATOM   5187  N N   . ALA E  1 165 ? 429.901 60.028  453.887 1.00 79.08  ?  222 ALA E N   1 
ATOM   5188  C CA  . ALA E  1 165 ? 430.097 58.581  453.922 1.00 67.85  ?  222 ALA E CA  1 
ATOM   5189  C C   . ALA E  1 165 ? 431.322 58.296  454.781 1.00 75.71  ?  222 ALA E C   1 
ATOM   5190  O O   . ALA E  1 165 ? 431.234 58.352  456.013 1.00 80.79  ?  222 ALA E O   1 
ATOM   5191  C CB  . ALA E  1 165 ? 430.229 57.973  452.522 1.00 51.74  ?  222 ALA E CB  1 
ATOM   5192  N N   . ARG E  1 166 ? 432.448 57.969  454.135 1.00 83.69  ?  223 ARG E N   1 
ATOM   5193  C CA  . ARG E  1 166 ? 433.720 57.462  454.658 1.00 82.08  ?  223 ARG E CA  1 
ATOM   5194  C C   . ARG E  1 166 ? 433.737 55.941  454.656 1.00 85.88  ?  223 ARG E C   1 
ATOM   5195  O O   . ARG E  1 166 ? 434.791 55.347  454.882 1.00 85.41  ?  223 ARG E O   1 
ATOM   5196  C CB  . ARG E  1 166 ? 434.054 57.977  456.072 1.00 82.84  ?  223 ARG E CB  1 
ATOM   5197  C CG  . ARG E  1 166 ? 435.493 57.831  456.532 1.00 81.21  ?  223 ARG E CG  1 
ATOM   5198  C CD  . ARG E  1 166 ? 435.618 58.353  457.953 1.00 83.65  ?  223 ARG E CD  1 
ATOM   5199  N NE  . ARG E  1 166 ? 435.087 59.710  458.065 1.00 97.07  ?  223 ARG E NE  1 
ATOM   5200  C CZ  . ARG E  1 166 ? 434.556 60.220  459.172 1.00 106.95 ?  223 ARG E CZ  1 
ATOM   5201  N NH1 . ARG E  1 166 ? 434.477 59.484  460.272 1.00 117.04 ?  223 ARG E NH1 1 
ATOM   5202  N NH2 . ARG E  1 166 ? 434.096 61.464  459.177 1.00 102.05 ?  223 ARG E NH2 1 
ATOM   5203  N N   . HIS E  1 167 ? 432.612 55.298  454.382 1.00 73.70  ?  224 HIS E N   1 
ATOM   5204  C CA  . HIS E  1 167 ? 432.607 53.982  453.771 1.00 64.10  ?  224 HIS E CA  1 
ATOM   5205  C C   . HIS E  1 167 ? 432.548 54.203  452.261 1.00 63.01  ?  224 HIS E C   1 
ATOM   5206  O O   . HIS E  1 167 ? 432.789 55.312  451.775 1.00 70.10  ?  224 HIS E O   1 
ATOM   5207  C CB  . HIS E  1 167 ? 431.451 53.138  454.299 1.00 70.49  ?  224 HIS E CB  1 
ATOM   5208  C CG  . HIS E  1 167 ? 430.099 53.694  453.976 1.00 69.57  ?  224 HIS E CG  1 
ATOM   5209  N ND1 . HIS E  1 167 ? 429.556 53.645  452.710 1.00 66.90  ?  224 HIS E ND1 1 
ATOM   5210  C CD2 . HIS E  1 167 ? 429.187 54.322  454.752 1.00 69.79  ?  224 HIS E CD2 1 
ATOM   5211  C CE1 . HIS E  1 167 ? 428.363 54.210  452.723 1.00 65.68  ?  224 HIS E CE1 1 
ATOM   5212  N NE2 . HIS E  1 167 ? 428.114 54.631  453.950 1.00 64.89  ?  224 HIS E NE2 1 
ATOM   5213  N N   . ALA E  1 168 ? 432.271 53.144  451.500 1.00 51.03  ?  225 ALA E N   1 
ATOM   5214  C CA  . ALA E  1 168 ? 432.064 53.244  450.057 1.00 53.59  ?  225 ALA E CA  1 
ATOM   5215  C C   . ALA E  1 168 ? 433.344 53.613  449.314 1.00 46.69  ?  225 ALA E C   1 
ATOM   5216  O O   . ALA E  1 168 ? 433.361 53.630  448.081 1.00 48.37  ?  225 ALA E O   1 
ATOM   5217  C CB  . ALA E  1 168 ? 430.957 54.254  449.730 1.00 45.17  ?  225 ALA E CB  1 
ATOM   5218  N N   . TRP E  1 169 ? 434.415 53.913  450.047 1.00 40.18  ?  226 TRP E N   1 
ATOM   5219  C CA  . TRP E  1 169 ? 435.719 54.195  449.460 1.00 32.91  ?  226 TRP E CA  1 
ATOM   5220  C C   . TRP E  1 169 ? 436.777 53.414  450.221 1.00 28.68  ?  226 TRP E C   1 
ATOM   5221  O O   . TRP E  1 169 ? 436.996 53.659  451.412 1.00 29.23  ?  226 TRP E O   1 
ATOM   5222  C CB  . TRP E  1 169 ? 436.033 55.694  449.491 1.00 34.40  ?  226 TRP E CB  1 
ATOM   5223  C CG  . TRP E  1 169 ? 435.363 56.470  448.401 1.00 33.57  ?  226 TRP E CG  1 
ATOM   5224  C CD1 . TRP E  1 169 ? 434.184 57.150  448.484 1.00 35.94  ?  226 TRP E CD1 1 
ATOM   5225  C CD2 . TRP E  1 169 ? 435.837 56.648  447.061 1.00 30.30  ?  226 TRP E CD2 1 
ATOM   5226  N NE1 . TRP E  1 169 ? 433.893 57.740  447.278 1.00 34.93  ?  226 TRP E NE1 1 
ATOM   5227  C CE2 . TRP E  1 169 ? 434.892 57.446  446.388 1.00 31.30  ?  226 TRP E CE2 1 
ATOM   5228  C CE3 . TRP E  1 169 ? 436.967 56.208  446.365 1.00 31.72  ?  226 TRP E CE3 1 
ATOM   5229  C CZ2 . TRP E  1 169 ? 435.043 57.815  445.053 1.00 36.77  ?  226 TRP E CZ2 1 
ATOM   5230  C CZ3 . TRP E  1 169 ? 437.115 56.574  445.041 1.00 33.75  ?  226 TRP E CZ3 1 
ATOM   5231  C CH2 . TRP E  1 169 ? 436.159 57.370  444.398 1.00 37.33  ?  226 TRP E CH2 1 
ATOM   5232  N N   . GLN E  1 170 ? 437.435 52.486  449.536 1.00 33.22  ?  227 GLN E N   1 
ATOM   5233  C CA  . GLN E  1 170 ? 438.509 51.694  450.110 1.00 39.49  ?  227 GLN E CA  1 
ATOM   5234  C C   . GLN E  1 170 ? 439.785 51.909  449.310 1.00 38.64  ?  227 GLN E C   1 
ATOM   5235  O O   . GLN E  1 170 ? 439.743 52.191  448.109 1.00 48.53  ?  227 GLN E O   1 
ATOM   5236  C CB  . GLN E  1 170 ? 438.158 50.200  450.131 1.00 42.53  ?  227 GLN E CB  1 
ATOM   5237  C CG  . GLN E  1 170 ? 436.920 49.855  450.943 1.00 41.12  ?  227 GLN E CG  1 
ATOM   5238  C CD  . GLN E  1 170 ? 436.548 48.388  450.838 1.00 46.43  ?  227 GLN E CD  1 
ATOM   5239  O OE1 . GLN E  1 170 ? 437.231 47.608  450.174 1.00 44.64  ?  227 GLN E OE1 1 
ATOM   5240  N NE2 . GLN E  1 170 ? 435.460 48.005  451.495 1.00 47.12  ?  227 GLN E NE2 1 
ATOM   5241  N N   . LEU E  1 171 ? 440.922 51.784  449.989 1.00 26.24  ?  228 LEU E N   1 
ATOM   5242  C CA  . LEU E  1 171 ? 442.204 51.857  449.303 1.00 33.23  ?  228 LEU E CA  1 
ATOM   5243  C C   . LEU E  1 171 ? 442.328 50.706  448.316 1.00 36.61  ?  228 LEU E C   1 
ATOM   5244  O O   . LEU E  1 171 ? 442.030 49.554  448.648 1.00 42.50  ?  228 LEU E O   1 
ATOM   5245  C CB  . LEU E  1 171 ? 443.349 51.814  450.313 1.00 36.53  ?  228 LEU E CB  1 
ATOM   5246  C CG  . LEU E  1 171 ? 443.335 52.873  451.416 1.00 37.77  ?  228 LEU E CG  1 
ATOM   5247  C CD1 . LEU E  1 171 ? 444.480 52.639  452.389 1.00 37.46  ?  228 LEU E CD1 1 
ATOM   5248  C CD2 . LEU E  1 171 ? 443.407 54.269  450.821 1.00 35.52  ?  228 LEU E CD2 1 
ATOM   5249  N N   . THR E  1 172 ? 442.754 51.020  447.094 1.00 33.72  ?  229 THR E N   1 
ATOM   5250  C CA  . THR E  1 172 ? 442.949 49.985  446.089 1.00 36.12  ?  229 THR E CA  1 
ATOM   5251  C C   . THR E  1 172 ? 443.997 48.989  446.569 1.00 39.16  ?  229 THR E C   1 
ATOM   5252  O O   . THR E  1 172 ? 445.096 49.373  446.978 1.00 42.79  ?  229 THR E O   1 
ATOM   5253  C CB  . THR E  1 172 ? 443.372 50.603  444.755 1.00 43.91  ?  229 THR E CB  1 
ATOM   5254  O OG1 . THR E  1 172 ? 442.396 51.568  444.342 1.00 45.04  ?  229 THR E OG1 1 
ATOM   5255  C CG2 . THR E  1 172 ? 443.495 49.529  443.683 1.00 40.11  ?  229 THR E CG2 1 
ATOM   5256  N N   . GLN E  1 173 ? 443.649 47.705  446.520 1.00 63.40  ?  230 GLN E N   1 
ATOM   5257  C CA  . GLN E  1 173 ? 444.496 46.670  447.097 1.00 67.64  ?  230 GLN E CA  1 
ATOM   5258  C C   . GLN E  1 173 ? 445.781 46.535  446.291 1.00 67.30  ?  230 GLN E C   1 
ATOM   5259  O O   . GLN E  1 173 ? 445.743 46.300  445.078 1.00 67.14  ?  230 GLN E O   1 
ATOM   5260  C CB  . GLN E  1 173 ? 443.741 45.346  447.141 1.00 72.39  ?  230 GLN E CB  1 
ATOM   5261  C CG  . GLN E  1 173 ? 442.506 45.377  448.027 1.00 71.71  ?  230 GLN E CG  1 
ATOM   5262  C CD  . GLN E  1 173 ? 441.387 44.502  447.500 1.00 82.71  ?  230 GLN E CD  1 
ATOM   5263  O OE1 . GLN E  1 173 ? 440.704 43.821  448.265 1.00 91.83  ?  230 GLN E OE1 1 
ATOM   5264  N NE2 . GLN E  1 173 ? 441.189 44.520  446.186 1.00 70.08  ?  230 GLN E NE2 1 
ATOM   5265  N N   . GLY E  1 174 ? 446.921 46.681  446.967 1.00 73.41  ?  231 GLY E N   1 
ATOM   5266  C CA  . GLY E  1 174 ? 448.214 46.607  446.329 1.00 75.73  ?  231 GLY E CA  1 
ATOM   5267  C C   . GLY E  1 174 ? 448.697 47.887  445.684 1.00 75.06  ?  231 GLY E C   1 
ATOM   5268  O O   . GLY E  1 174 ? 449.890 47.995  445.375 1.00 80.53  ?  231 GLY E O   1 
ATOM   5269  N N   . ALA E  1 175 ? 447.820 48.865  445.473 1.00 30.21  ?  232 ALA E N   1 
ATOM   5270  C CA  . ALA E  1 175 ? 448.182 50.089  444.771 1.00 31.56  ?  232 ALA E CA  1 
ATOM   5271  C C   . ALA E  1 175 ? 448.591 51.223  445.702 1.00 31.01  ?  232 ALA E C   1 
ATOM   5272  O O   . ALA E  1 175 ? 448.947 52.301  445.216 1.00 38.47  ?  232 ALA E O   1 
ATOM   5273  C CB  . ALA E  1 175 ? 447.022 50.548  443.882 1.00 38.51  ?  232 ALA E CB  1 
ATOM   5274  N N   . THR E  1 176 ? 448.547 51.019  447.017 1.00 29.30  ?  233 THR E N   1 
ATOM   5275  C CA  . THR E  1 176 ? 449.047 51.997  447.978 1.00 31.94  ?  233 THR E CA  1 
ATOM   5276  C C   . THR E  1 176 ? 450.478 51.604  448.324 1.00 31.00  ?  233 THR E C   1 
ATOM   5277  O O   . THR E  1 176 ? 450.709 50.560  448.943 1.00 36.69  ?  233 THR E O   1 
ATOM   5278  C CB  . THR E  1 176 ? 448.163 52.051  449.222 1.00 35.18  ?  233 THR E CB  1 
ATOM   5279  O OG1 . THR E  1 176 ? 446.786 52.101  448.830 1.00 39.58  ?  233 THR E OG1 1 
ATOM   5280  C CG2 . THR E  1 176 ? 448.490 53.288  450.050 1.00 25.77  ?  233 THR E CG2 1 
ATOM   5281  N N   . VAL E  1 177 ? 451.437 52.438  447.929 1.00 22.74  ?  234 VAL E N   1 
ATOM   5282  C CA  . VAL E  1 177 ? 452.843 52.049  447.895 1.00 21.61  ?  234 VAL E CA  1 
ATOM   5283  C C   . VAL E  1 177 ? 453.705 53.177  448.444 1.00 25.15  ?  234 VAL E C   1 
ATOM   5284  O O   . VAL E  1 177 ? 453.538 54.339  448.060 1.00 29.75  ?  234 VAL E O   1 
ATOM   5285  C CB  . VAL E  1 177 ? 453.281 51.686  446.462 1.00 21.62  ?  234 VAL E CB  1 
ATOM   5286  C CG1 . VAL E  1 177 ? 454.783 51.822  446.305 1.00 25.48  ?  234 VAL E CG1 1 
ATOM   5287  C CG2 . VAL E  1 177 ? 452.828 50.276  446.108 1.00 26.25  ?  234 VAL E CG2 1 
ATOM   5288  N N   . LEU E  1 178 ? 454.626 52.832  449.346 1.00 16.36  ?  235 LEU E N   1 
ATOM   5289  C CA  . LEU E  1 178 ? 455.707 53.716  449.770 1.00 16.42  ?  235 LEU E CA  1 
ATOM   5290  C C   . LEU E  1 178 ? 457.019 53.096  449.302 1.00 16.51  ?  235 LEU E C   1 
ATOM   5291  O O   . LEU E  1 178 ? 457.455 52.076  449.846 1.00 16.85  ?  235 LEU E O   1 
ATOM   5292  C CB  . LEU E  1 178 ? 455.707 53.910  451.284 1.00 16.79  ?  235 LEU E CB  1 
ATOM   5293  C CG  . LEU E  1 178 ? 456.968 54.561  451.862 1.00 23.28  ?  235 LEU E CG  1 
ATOM   5294  C CD1 . LEU E  1 178 ? 457.111 55.988  451.360 1.00 16.61  ?  235 LEU E CD1 1 
ATOM   5295  C CD2 . LEU E  1 178 ? 456.970 54.516  453.381 1.00 22.37  ?  235 LEU E CD2 1 
ATOM   5296  N N   . GLY E  1 179 ? 457.641 53.704  448.294 1.00 25.59  ?  236 GLY E N   1 
ATOM   5297  C CA  . GLY E  1 179 ? 458.905 53.229  447.779 1.00 17.89  ?  236 GLY E CA  1 
ATOM   5298  C C   . GLY E  1 179 ? 460.087 54.064  448.233 1.00 16.35  ?  236 GLY E C   1 
ATOM   5299  O O   . GLY E  1 179 ? 459.936 55.181  448.724 1.00 16.29  ?  236 GLY E O   1 
ATOM   5300  N N   . LEU E  1 180 ? 461.279 53.499  448.060 1.00 40.84  ?  237 LEU E N   1 
ATOM   5301  C CA  . LEU E  1 180 ? 462.510 54.186  448.415 1.00 43.99  ?  237 LEU E CA  1 
ATOM   5302  C C   . LEU E  1 180 ? 463.656 53.611  447.592 1.00 46.82  ?  237 LEU E C   1 
ATOM   5303  O O   . LEU E  1 180 ? 463.659 52.420  447.268 1.00 54.63  ?  237 LEU E O   1 
ATOM   5304  C CB  . LEU E  1 180 ? 462.784 54.052  449.919 1.00 44.51  ?  237 LEU E CB  1 
ATOM   5305  C CG  . LEU E  1 180 ? 463.861 54.908  450.585 1.00 50.89  ?  237 LEU E CG  1 
ATOM   5306  C CD1 . LEU E  1 180 ? 463.488 55.176  452.034 1.00 50.50  ?  237 LEU E CD1 1 
ATOM   5307  C CD2 . LEU E  1 180 ? 465.203 54.213  450.514 1.00 53.76  ?  237 LEU E CD2 1 
ATOM   5308  N N   . PHE E  1 181 ? 464.623 54.464  447.257 1.00 25.31  ?  238 PHE E N   1 
ATOM   5309  C CA  . PHE E  1 181 ? 465.912 53.994  446.763 1.00 27.03  ?  238 PHE E CA  1 
ATOM   5310  C C   . PHE E  1 181 ? 466.951 55.081  447.000 1.00 30.98  ?  238 PHE E C   1 
ATOM   5311  O O   . PHE E  1 181 ? 466.622 56.259  447.157 1.00 28.28  ?  238 PHE E O   1 
ATOM   5312  C CB  . PHE E  1 181 ? 465.860 53.571  445.285 1.00 27.38  ?  238 PHE E CB  1 
ATOM   5313  C CG  . PHE E  1 181 ? 465.636 54.697  444.314 1.00 26.54  ?  238 PHE E CG  1 
ATOM   5314  C CD1 . PHE E  1 181 ? 466.703 55.433  443.823 1.00 21.89  ?  238 PHE E CD1 1 
ATOM   5315  C CD2 . PHE E  1 181 ? 464.363 54.988  443.856 1.00 31.08  ?  238 PHE E CD2 1 
ATOM   5316  C CE1 . PHE E  1 181 ? 466.499 56.458  442.919 1.00 28.46  ?  238 PHE E CE1 1 
ATOM   5317  C CE2 . PHE E  1 181 ? 464.153 56.007  442.949 1.00 29.57  ?  238 PHE E CE2 1 
ATOM   5318  C CZ  . PHE E  1 181 ? 465.223 56.745  442.480 1.00 28.97  ?  238 PHE E CZ  1 
ATOM   5319  N N   . ARG E  1 182 ? 468.215 54.663  447.020 1.00 52.27  ?  239 ARG E N   1 
ATOM   5320  C CA  . ARG E  1 182 ? 469.311 55.516  447.461 1.00 47.08  ?  239 ARG E CA  1 
ATOM   5321  C C   . ARG E  1 182 ? 469.902 56.323  446.312 1.00 48.90  ?  239 ARG E C   1 
ATOM   5322  O O   . ARG E  1 182 ? 469.999 55.845  445.179 1.00 50.34  ?  239 ARG E O   1 
ATOM   5323  C CB  . ARG E  1 182 ? 470.408 54.680  448.122 1.00 51.64  ?  239 ARG E CB  1 
ATOM   5324  C CG  . ARG E  1 182 ? 471.549 55.510  448.687 1.00 62.86  ?  239 ARG E CG  1 
ATOM   5325  C CD  . ARG E  1 182 ? 472.311 54.780  449.777 1.00 61.74  ?  239 ARG E CD  1 
ATOM   5326  N NE  . ARG E  1 182 ? 473.118 55.706  450.568 1.00 58.84  ?  239 ARG E NE  1 
ATOM   5327  C CZ  . ARG E  1 182 ? 473.799 55.365  451.656 1.00 76.72  ?  239 ARG E CZ  1 
ATOM   5328  N NH1 . ARG E  1 182 ? 473.775 54.113  452.090 1.00 81.78  ?  239 ARG E NH1 1 
ATOM   5329  N NH2 . ARG E  1 182 ? 474.504 56.278  452.311 1.00 79.67  ?  239 ARG E NH2 1 
ATOM   5330  N N   . VAL E  1 183 ? 470.293 57.558  446.623 1.00 36.82  ?  240 VAL E N   1 
ATOM   5331  C CA  . VAL E  1 183 ? 471.021 58.427  445.701 1.00 38.88  ?  240 VAL E CA  1 
ATOM   5332  C C   . VAL E  1 183 ? 472.488 58.555  446.109 1.00 41.87  ?  240 VAL E C   1 
ATOM   5333  O O   . VAL E  1 183 ? 473.387 58.216  445.336 1.00 36.48  ?  240 VAL E O   1 
ATOM   5334  C CB  . VAL E  1 183 ? 470.347 59.813  445.589 1.00 34.53  ?  240 VAL E CB  1 
ATOM   5335  C CG1 . VAL E  1 183 ? 471.112 60.693  444.620 1.00 34.94  ?  240 VAL E CG1 1 
ATOM   5336  C CG2 . VAL E  1 183 ? 468.902 59.661  445.147 1.00 32.28  ?  240 VAL E CG2 1 
ATOM   5337  N N   . THR E  1 184 ? 472.747 59.069  447.311 1.00 71.78  ?  241 THR E N   1 
ATOM   5338  C CA  . THR E  1 184 ? 474.096 59.249  447.829 1.00 73.17  ?  241 THR E CA  1 
ATOM   5339  C C   . THR E  1 184 ? 474.884 57.940  447.749 1.00 83.88  ?  241 THR E C   1 
ATOM   5340  O O   . THR E  1 184 ? 474.460 56.932  448.334 1.00 83.37  ?  241 THR E O   1 
ATOM   5341  C CB  . THR E  1 184 ? 474.047 59.736  449.275 1.00 69.94  ?  241 THR E CB  1 
ATOM   5342  O OG1 . THR E  1 184 ? 473.538 61.075  449.314 1.00 73.29  ?  241 THR E OG1 1 
ATOM   5343  C CG2 . THR E  1 184 ? 475.435 59.707  449.896 1.00 79.33  ?  241 THR E CG2 1 
ATOM   5344  N N   . PRO E  1 185 ? 476.020 57.917  447.059 1.00 108.19 ?  242 PRO E N   1 
ATOM   5345  C CA  . PRO E  1 185 ? 476.742 56.661  446.850 1.00 104.61 ?  242 PRO E CA  1 
ATOM   5346  C C   . PRO E  1 185 ? 477.541 56.236  448.074 1.00 104.73 ?  242 PRO E C   1 
ATOM   5347  O O   . PRO E  1 185 ? 477.901 57.040  448.935 1.00 99.86  ?  242 PRO E O   1 
ATOM   5348  C CB  . PRO E  1 185 ? 477.674 56.991  445.679 1.00 101.10 ?  242 PRO E CB  1 
ATOM   5349  C CG  . PRO E  1 185 ? 477.957 58.446  445.853 1.00 105.58 ?  242 PRO E CG  1 
ATOM   5350  C CD  . PRO E  1 185 ? 476.692 59.057  446.411 1.00 105.95 ?  242 PRO E CD  1 
ATOM   5351  N N   . GLU E  1 186 ? 477.819 54.936  448.125 1.00 74.88  ?  243 GLU E N   1 
ATOM   5352  C CA  . GLU E  1 186 ? 478.673 54.353  449.155 1.00 77.84  ?  243 GLU E CA  1 
ATOM   5353  C C   . GLU E  1 186 ? 479.168 52.977  448.722 1.00 68.95  ?  243 GLU E C   1 
ATOM   5354  O O   . GLU E  1 186 ? 479.082 52.617  447.548 1.00 54.59  ?  243 GLU E O   1 
ATOM   5355  C CB  . GLU E  1 186 ? 477.930 54.250  450.490 1.00 79.07  ?  243 GLU E CB  1 
ATOM   5356  C CG  . GLU E  1 186 ? 478.431 55.213  451.562 1.00 86.43  ?  243 GLU E CG  1 
ATOM   5357  C CD  . GLU E  1 186 ? 479.815 54.856  452.083 1.00 92.80  ?  243 GLU E CD  1 
ATOM   5358  O OE1 . GLU E  1 186 ? 480.145 55.263  453.217 1.00 92.96  ?  243 GLU E OE1 1 
ATOM   5359  O OE2 . GLU E  1 186 ? 480.575 54.173  451.363 1.00 81.12  -1 243 GLU E OE2 1 
ATOM   5360  N N   . PRO F  2 4   ? 464.983 25.916  436.178 1.00 95.27  ?  27  PRO F N   1 
ATOM   5361  C CA  . PRO F  2 4   ? 464.847 25.341  437.519 1.00 102.71 ?  27  PRO F CA  1 
ATOM   5362  C C   . PRO F  2 4   ? 463.701 25.974  438.302 1.00 105.78 ?  27  PRO F C   1 
ATOM   5363  O O   . PRO F  2 4   ? 463.198 25.390  439.262 1.00 107.29 ?  27  PRO F O   1 
ATOM   5364  C CB  . PRO F  2 4   ? 466.193 25.664  438.169 1.00 93.76  ?  27  PRO F CB  1 
ATOM   5365  C CG  . PRO F  2 4   ? 466.598 26.947  437.524 1.00 88.74  ?  27  PRO F CG  1 
ATOM   5366  C CD  . PRO F  2 4   ? 466.115 26.857  436.096 1.00 94.39  ?  27  PRO F CD  1 
ATOM   5367  N N   . CYS F  2 5   ? 463.293 27.166  437.871 1.00 90.02  ?  28  CYS F N   1 
ATOM   5368  C CA  . CYS F  2 5   ? 462.283 27.951  438.569 1.00 82.79  ?  28  CYS F CA  1 
ATOM   5369  C C   . CYS F  2 5   ? 460.863 27.467  438.298 1.00 78.91  ?  28  CYS F C   1 
ATOM   5370  O O   . CYS F  2 5   ? 459.974 27.713  439.118 1.00 85.05  ?  28  CYS F O   1 
ATOM   5371  C CB  . CYS F  2 5   ? 462.426 29.419  438.154 1.00 85.10  ?  28  CYS F CB  1 
ATOM   5372  S SG  . CYS F  2 5   ? 461.990 30.693  439.371 1.00 76.45  ?  28  CYS F SG  1 
ATOM   5373  N N   . SER F  2 6   ? 460.639 26.768  437.183 1.00 83.65  ?  29  SER F N   1 
ATOM   5374  C CA  . SER F  2 6   ? 459.282 26.462  436.740 1.00 85.26  ?  29  SER F CA  1 
ATOM   5375  C C   . SER F  2 6   ? 458.651 25.295  437.490 1.00 86.66  ?  29  SER F C   1 
ATOM   5376  O O   . SER F  2 6   ? 457.420 25.216  437.573 1.00 95.92  ?  29  SER F O   1 
ATOM   5377  C CB  . SER F  2 6   ? 459.278 26.159  435.240 1.00 79.57  ?  29  SER F CB  1 
ATOM   5378  O OG  . SER F  2 6   ? 460.005 24.974  434.962 1.00 82.80  ?  29  SER F OG  1 
ATOM   5379  N N   . ASN F  2 7   ? 459.460 24.385  438.039 1.00 95.55  ?  30  ASN F N   1 
ATOM   5380  C CA  . ASN F  2 7   ? 458.921 23.123  438.538 1.00 97.69  ?  30  ASN F CA  1 
ATOM   5381  C C   . ASN F  2 7   ? 458.118 23.271  439.825 1.00 101.89 ?  30  ASN F C   1 
ATOM   5382  O O   . ASN F  2 7   ? 457.378 22.345  440.177 1.00 107.92 ?  30  ASN F O   1 
ATOM   5383  C CB  . ASN F  2 7   ? 460.052 22.115  438.745 1.00 101.44 ?  30  ASN F CB  1 
ATOM   5384  C CG  . ASN F  2 7   ? 460.581 21.559  437.439 1.00 120.74 ?  30  ASN F CG  1 
ATOM   5385  O OD1 . ASN F  2 7   ? 461.322 22.229  436.719 1.00 127.86 ?  30  ASN F OD1 1 
ATOM   5386  N ND2 . ASN F  2 7   ? 460.200 20.326  437.123 1.00 122.73 ?  30  ASN F ND2 1 
ATOM   5387  N N   . CYS F  2 8   ? 458.241 24.391  440.535 1.00 93.25  ?  31  CYS F N   1 
ATOM   5388  C CA  . CYS F  2 8   ? 457.476 24.558  441.763 1.00 88.36  ?  31  CYS F CA  1 
ATOM   5389  C C   . CYS F  2 8   ? 455.982 24.570  441.440 1.00 87.21  ?  31  CYS F C   1 
ATOM   5390  O O   . CYS F  2 8   ? 455.574 25.123  440.412 1.00 86.42  ?  31  CYS F O   1 
ATOM   5391  C CB  . CYS F  2 8   ? 457.857 25.855  442.486 1.00 79.08  ?  31  CYS F CB  1 
ATOM   5392  S SG  . CYS F  2 8   ? 459.618 26.317  442.538 1.00 103.41 ?  31  CYS F SG  1 
ATOM   5393  N N   . PRO F  2 9   ? 455.139 23.969  442.284 1.00 60.64  ?  32  PRO F N   1 
ATOM   5394  C CA  . PRO F  2 9   ? 453.698 23.960  441.999 1.00 60.86  ?  32  PRO F CA  1 
ATOM   5395  C C   . PRO F  2 9   ? 452.996 25.211  442.504 1.00 56.12  ?  32  PRO F C   1 
ATOM   5396  O O   . PRO F  2 9   ? 453.641 26.132  443.013 1.00 52.67  ?  32  PRO F O   1 
ATOM   5397  C CB  . PRO F  2 9   ? 453.212 22.710  442.738 1.00 63.94  ?  32  PRO F CB  1 
ATOM   5398  C CG  . PRO F  2 9   ? 454.121 22.629  443.922 1.00 64.92  ?  32  PRO F CG  1 
ATOM   5399  C CD  . PRO F  2 9   ? 455.470 23.152  443.466 1.00 60.36  ?  32  PRO F CD  1 
ATOM   5400  N N   . ALA F  2 10  ? 451.673 25.253  442.361 1.00 81.00  ?  33  ALA F N   1 
ATOM   5401  C CA  . ALA F  2 10  ? 450.896 26.347  442.922 1.00 80.28  ?  33  ALA F CA  1 
ATOM   5402  C C   . ALA F  2 10  ? 450.926 26.285  444.445 1.00 78.80  ?  33  ALA F C   1 
ATOM   5403  O O   . ALA F  2 10  ? 451.035 25.214  445.046 1.00 80.90  ?  33  ALA F O   1 
ATOM   5404  C CB  . ALA F  2 10  ? 449.453 26.296  442.419 1.00 76.38  ?  33  ALA F CB  1 
ATOM   5405  N N   . GLY F  2 11  ? 450.825 27.456  445.071 1.00 62.86  ?  34  GLY F N   1 
ATOM   5406  C CA  . GLY F  2 11  ? 450.990 27.581  446.498 1.00 59.54  ?  34  GLY F CA  1 
ATOM   5407  C C   . GLY F  2 11  ? 452.401 27.899  446.941 1.00 59.94  ?  34  GLY F C   1 
ATOM   5408  O O   . GLY F  2 11  ? 452.598 28.319  448.087 1.00 58.66  ?  34  GLY F O   1 
ATOM   5409  N N   . THR F  2 12  ? 453.384 27.709  446.069 1.00 60.78  ?  35  THR F N   1 
ATOM   5410  C CA  . THR F  2 12  ? 454.772 28.050  446.332 1.00 56.20  ?  35  THR F CA  1 
ATOM   5411  C C   . THR F  2 12  ? 455.212 29.154  445.376 1.00 52.77  ?  35  THR F C   1 
ATOM   5412  O O   . THR F  2 12  ? 454.467 29.577  444.490 1.00 58.37  ?  35  THR F O   1 
ATOM   5413  C CB  . THR F  2 12  ? 455.676 26.823  446.182 1.00 60.01  ?  35  THR F CB  1 
ATOM   5414  O OG1 . THR F  2 12  ? 455.625 26.353  444.830 1.00 62.48  ?  35  THR F OG1 1 
ATOM   5415  C CG2 . THR F  2 12  ? 455.226 25.713  447.118 1.00 72.31  ?  35  THR F CG2 1 
ATOM   5416  N N   . PHE F  2 13  ? 456.446 29.614  445.561 1.00 42.34  ?  36  PHE F N   1 
ATOM   5417  C CA  . PHE F  2 13  ? 457.051 30.560  444.634 1.00 45.00  ?  36  PHE F CA  1 
ATOM   5418  C C   . PHE F  2 13  ? 458.548 30.309  444.596 1.00 45.41  ?  36  PHE F C   1 
ATOM   5419  O O   . PHE F  2 13  ? 459.165 30.030  445.627 1.00 50.69  ?  36  PHE F O   1 
ATOM   5420  C CB  . PHE F  2 13  ? 456.761 32.015  445.030 1.00 42.16  ?  36  PHE F CB  1 
ATOM   5421  C CG  . PHE F  2 13  ? 457.573 32.509  446.195 1.00 34.64  ?  36  PHE F CG  1 
ATOM   5422  C CD1 . PHE F  2 13  ? 457.356 32.021  447.472 1.00 39.44  ?  36  PHE F CD1 1 
ATOM   5423  C CD2 . PHE F  2 13  ? 458.546 33.479  446.015 1.00 37.45  ?  36  PHE F CD2 1 
ATOM   5424  C CE1 . PHE F  2 13  ? 458.102 32.482  448.541 1.00 39.77  ?  36  PHE F CE1 1 
ATOM   5425  C CE2 . PHE F  2 13  ? 459.290 33.944  447.082 1.00 35.04  ?  36  PHE F CE2 1 
ATOM   5426  C CZ  . PHE F  2 13  ? 459.069 33.444  448.345 1.00 31.71  ?  36  PHE F CZ  1 
ATOM   5427  N N   . CYS F  2 14  ? 459.124 30.402  443.403 1.00 82.82  ?  37  CYS F N   1 
ATOM   5428  C CA  . CYS F  2 14  ? 460.565 30.280  443.228 1.00 94.50  ?  37  CYS F CA  1 
ATOM   5429  C C   . CYS F  2 14  ? 461.159 31.683  443.274 1.00 93.50  ?  37  CYS F C   1 
ATOM   5430  O O   . CYS F  2 14  ? 460.994 32.468  442.335 1.00 97.66  ?  37  CYS F O   1 
ATOM   5431  C CB  . CYS F  2 14  ? 460.875 29.568  441.913 1.00 103.46 ?  37  CYS F CB  1 
ATOM   5432  S SG  . CYS F  2 14  ? 462.487 29.921  441.181 1.00 103.50 ?  37  CYS F SG  1 
ATOM   5433  N N   . ASP F  2 15  ? 461.845 31.995  444.368 1.00 88.95  ?  38  ASP F N   1 
ATOM   5434  C CA  . ASP F  2 15  ? 462.365 33.337  444.577 1.00 100.34 ?  38  ASP F CA  1 
ATOM   5435  C C   . ASP F  2 15  ? 463.679 33.532  443.833 1.00 102.80 ?  38  ASP F C   1 
ATOM   5436  O O   . ASP F  2 15  ? 464.418 32.581  443.566 1.00 106.21 ?  38  ASP F O   1 
ATOM   5437  C CB  . ASP F  2 15  ? 462.551 33.621  446.067 1.00 103.63 ?  38  ASP F CB  1 
ATOM   5438  C CG  . ASP F  2 15  ? 463.464 32.624  446.746 1.00 103.86 ?  38  ASP F CG  1 
ATOM   5439  O OD1 . ASP F  2 15  ? 463.697 31.539  446.175 1.00 104.61 ?  38  ASP F OD1 1 
ATOM   5440  O OD2 . ASP F  2 15  ? 463.938 32.923  447.862 1.00 104.75 -1 38  ASP F OD2 1 
ATOM   5441  N N   . ASN F  2 16  ? 463.959 34.789  443.487 1.00 62.60  ?  39  ASN F N   1 
ATOM   5442  C CA  . ASN F  2 16  ? 465.211 35.101  442.808 1.00 63.05  ?  39  ASN F CA  1 
ATOM   5443  C C   . ASN F  2 16  ? 466.376 35.173  443.788 1.00 70.88  ?  39  ASN F C   1 
ATOM   5444  O O   . ASN F  2 16  ? 467.493 34.763  443.453 1.00 80.67  ?  39  ASN F O   1 
ATOM   5445  C CB  . ASN F  2 16  ? 465.077 36.407  442.026 1.00 57.94  ?  39  ASN F CB  1 
ATOM   5446  C CG  . ASN F  2 16  ? 464.985 36.176  440.531 1.00 56.17  ?  39  ASN F CG  1 
ATOM   5447  O OD1 . ASN F  2 16  ? 464.798 35.048  440.076 1.00 56.70  ?  39  ASN F OD1 1 
ATOM   5448  N ND2 . ASN F  2 16  ? 465.117 37.248  439.758 1.00 55.54  ?  39  ASN F ND2 1 
ATOM   5449  N N   . ASN F  2 17  ? 466.145 35.685  444.995 1.00 75.97  ?  40  ASN F N   1 
ATOM   5450  C CA  . ASN F  2 17  ? 467.206 35.655  445.985 1.00 74.54  ?  40  ASN F CA  1 
ATOM   5451  C C   . ASN F  2 17  ? 467.301 34.263  446.608 1.00 76.48  ?  40  ASN F C   1 
ATOM   5452  O O   . ASN F  2 17  ? 466.451 33.397  446.381 1.00 79.13  ?  40  ASN F O   1 
ATOM   5453  C CB  . ASN F  2 17  ? 466.969 36.711  447.064 1.00 76.16  ?  40  ASN F CB  1 
ATOM   5454  C CG  . ASN F  2 17  ? 466.533 38.043  446.488 1.00 77.26  ?  40  ASN F CG  1 
ATOM   5455  O OD1 . ASN F  2 17  ? 467.360 38.854  446.073 1.00 87.63  ?  40  ASN F OD1 1 
ATOM   5456  N ND2 . ASN F  2 17  ? 465.226 38.276  446.461 1.00 79.34  ?  40  ASN F ND2 1 
ATOM   5457  N N   . ARG F  2 18  ? 468.334 34.074  447.424 1.00 96.12  ?  41  ARG F N   1 
ATOM   5458  C CA  . ARG F  2 18  ? 468.716 32.774  447.988 1.00 99.25  ?  41  ARG F CA  1 
ATOM   5459  C C   . ARG F  2 18  ? 468.529 31.658  446.953 1.00 100.49 ?  41  ARG F C   1 
ATOM   5460  O O   . ARG F  2 18  ? 467.769 30.705  447.130 1.00 97.87  ?  41  ARG F O   1 
ATOM   5461  C CB  . ARG F  2 18  ? 467.981 32.491  449.304 1.00 99.82  ?  41  ARG F CB  1 
ATOM   5462  C CG  . ARG F  2 18  ? 466.465 32.380  449.260 1.00 94.16  ?  41  ARG F CG  1 
ATOM   5463  C CD  . ARG F  2 18  ? 465.898 32.313  450.668 1.00 102.51 ?  41  ARG F CD  1 
ATOM   5464  N NE  . ARG F  2 18  ? 465.533 33.634  451.169 1.00 107.08 ?  41  ARG F NE  1 
ATOM   5465  C CZ  . ARG F  2 18  ? 465.654 34.011  452.438 1.00 95.50  ?  41  ARG F CZ  1 
ATOM   5466  N NH1 . ARG F  2 18  ? 466.133 33.166  453.341 1.00 89.21  1  41  ARG F NH1 1 
ATOM   5467  N NH2 . ARG F  2 18  ? 465.298 35.235  452.805 1.00 81.81  ?  41  ARG F NH2 1 
ATOM   5468  N N   . ASN F  2 19  ? 469.284 31.797  445.863 1.00 79.87  ?  42  ASN F N   1 
ATOM   5469  C CA  . ASN F  2 19  ? 469.207 30.949  444.678 1.00 74.45  ?  42  ASN F CA  1 
ATOM   5470  C C   . ASN F  2 19  ? 467.785 30.815  444.134 1.00 77.78  ?  42  ASN F C   1 
ATOM   5471  O O   . ASN F  2 19  ? 467.006 31.771  444.169 1.00 79.23  ?  42  ASN F O   1 
ATOM   5472  C CB  . ASN F  2 19  ? 469.785 29.564  444.981 1.00 74.82  ?  42  ASN F CB  1 
ATOM   5473  C CG  . ASN F  2 19  ? 470.464 28.939  443.776 1.00 83.77  ?  42  ASN F CG  1 
ATOM   5474  O OD1 . ASN F  2 19  ? 470.169 29.288  442.632 1.00 79.49  ?  42  ASN F OD1 1 
ATOM   5475  N ND2 . ASN F  2 19  ? 471.380 28.010  444.028 1.00 83.78  ?  42  ASN F ND2 1 
ATOM   5476  N N   . GLN F  2 20  ? 467.450 29.630  443.621 1.00 85.54  ?  43  GLN F N   1 
ATOM   5477  C CA  . GLN F  2 20  ? 466.197 29.375  442.916 1.00 84.49  ?  43  GLN F CA  1 
ATOM   5478  C C   . GLN F  2 20  ? 465.157 28.605  443.731 1.00 81.92  ?  43  GLN F C   1 
ATOM   5479  O O   . GLN F  2 20  ? 464.127 28.216  443.173 1.00 83.20  ?  43  GLN F O   1 
ATOM   5480  C CB  . GLN F  2 20  ? 466.477 28.653  441.598 1.00 96.81  ?  43  GLN F CB  1 
ATOM   5481  C CG  . GLN F  2 20  ? 467.418 29.414  440.665 1.00 100.82 ?  43  GLN F CG  1 
ATOM   5482  C CD  . GLN F  2 20  ? 466.820 30.713  440.141 1.00 102.51 ?  43  GLN F CD  1 
ATOM   5483  O OE1 . GLN F  2 20  ? 466.274 30.755  439.039 1.00 110.97 ?  43  GLN F OE1 1 
ATOM   5484  N NE2 . GLN F  2 20  ? 466.940 31.783  440.922 1.00 94.77  ?  43  GLN F NE2 1 
ATOM   5485  N N   . ILE F  2 21  ? 465.409 28.346  445.018 1.00 51.72  ?  44  ILE F N   1 
ATOM   5486  C CA  . ILE F  2 21  ? 464.630 27.339  445.747 1.00 45.77  ?  44  ILE F CA  1 
ATOM   5487  C C   . ILE F  2 21  ? 463.139 27.697  445.795 1.00 48.64  ?  44  ILE F C   1 
ATOM   5488  O O   . ILE F  2 21  ? 462.739 28.863  445.683 1.00 51.06  ?  44  ILE F O   1 
ATOM   5489  C CB  . ILE F  2 21  ? 465.187 27.163  447.167 1.00 34.20  ?  44  ILE F CB  1 
ATOM   5490  C CG1 . ILE F  2 21  ? 464.879 28.401  448.012 1.00 38.63  ?  44  ILE F CG1 1 
ATOM   5491  C CG2 . ILE F  2 21  ? 466.684 26.912  447.122 1.00 40.48  ?  44  ILE F CG2 1 
ATOM   5492  C CD1 . ILE F  2 21  ? 465.449 28.352  449.412 1.00 44.46  ?  44  ILE F CD1 1 
ATOM   5493  N N   . CYS F  2 22  ? 462.308 26.662  445.955 1.00 63.85  ?  45  CYS F N   1 
ATOM   5494  C CA  . CYS F  2 22  ? 460.858 26.823  446.057 1.00 58.57  ?  45  CYS F CA  1 
ATOM   5495  C C   . CYS F  2 22  ? 460.508 27.014  447.529 1.00 59.12  ?  45  CYS F C   1 
ATOM   5496  O O   . CYS F  2 22  ? 460.682 26.097  448.338 1.00 64.23  ?  45  CYS F O   1 
ATOM   5497  C CB  . CYS F  2 22  ? 460.120 25.605  445.500 1.00 62.41  ?  45  CYS F CB  1 
ATOM   5498  S SG  . CYS F  2 22  ? 460.524 25.027  443.823 1.00 86.80  ?  45  CYS F SG  1 
ATOM   5499  N N   . SER F  2 23  ? 460.014 28.191  447.879 1.00 60.87  ?  46  SER F N   1 
ATOM   5500  C CA  . SER F  2 23  ? 459.606 28.487  449.243 1.00 63.45  ?  46  SER F CA  1 
ATOM   5501  C C   . SER F  2 23  ? 458.087 28.449  449.365 1.00 69.26  ?  46  SER F C   1 
ATOM   5502  O O   . SER F  2 23  ? 457.373 28.336  448.367 1.00 67.46  ?  46  SER F O   1 
ATOM   5503  C CB  . SER F  2 23  ? 460.149 29.859  449.651 1.00 59.49  ?  46  SER F CB  1 
ATOM   5504  O OG  . SER F  2 23  ? 461.565 29.884  449.598 1.00 60.65  ?  46  SER F OG  1 
ATOM   5505  N N   . PRO F  2 24  ? 457.551 28.547  450.581 1.00 85.37  ?  47  PRO F N   1 
ATOM   5506  C CA  . PRO F  2 24  ? 456.108 28.741  450.737 1.00 80.33  ?  47  PRO F CA  1 
ATOM   5507  C C   . PRO F  2 24  ? 455.719 30.201  450.559 1.00 78.36  ?  47  PRO F C   1 
ATOM   5508  O O   . PRO F  2 24  ? 456.527 31.116  450.722 1.00 71.04  ?  47  PRO F O   1 
ATOM   5509  C CB  . PRO F  2 24  ? 455.840 28.272  452.170 1.00 82.24  ?  47  PRO F CB  1 
ATOM   5510  C CG  . PRO F  2 24  ? 457.102 28.568  452.878 1.00 78.15  ?  47  PRO F CG  1 
ATOM   5511  C CD  . PRO F  2 24  ? 458.195 28.284  451.882 1.00 78.52  ?  47  PRO F CD  1 
ATOM   5512  N N   . CYS F  2 25  ? 454.446 30.404  450.234 1.00 57.39  ?  48  CYS F N   1 
ATOM   5513  C CA  . CYS F  2 25  ? 453.933 31.754  450.085 1.00 52.81  ?  48  CYS F CA  1 
ATOM   5514  C C   . CYS F  2 25  ? 453.969 32.491  451.426 1.00 49.21  ?  48  CYS F C   1 
ATOM   5515  O O   . CYS F  2 25  ? 453.872 31.870  452.488 1.00 54.89  ?  48  CYS F O   1 
ATOM   5516  C CB  . CYS F  2 25  ? 452.507 31.728  449.542 1.00 45.75  ?  48  CYS F CB  1 
ATOM   5517  S SG  . CYS F  2 25  ? 452.385 31.508  447.748 1.00 53.03  ?  48  CYS F SG  1 
ATOM   5518  N N   . PRO F  2 26  ? 454.117 33.812  451.399 1.00 57.18  ?  49  PRO F N   1 
ATOM   5519  C CA  . PRO F  2 26  ? 454.095 34.604  452.639 1.00 55.93  ?  49  PRO F CA  1 
ATOM   5520  C C   . PRO F  2 26  ? 452.782 34.431  453.381 1.00 61.81  ?  49  PRO F C   1 
ATOM   5521  O O   . PRO F  2 26  ? 451.799 33.946  452.800 1.00 73.89  ?  49  PRO F O   1 
ATOM   5522  C CB  . PRO F  2 26  ? 454.271 36.043  452.131 1.00 62.25  ?  49  PRO F CB  1 
ATOM   5523  C CG  . PRO F  2 26  ? 455.060 35.885  450.876 1.00 67.52  ?  49  PRO F CG  1 
ATOM   5524  C CD  . PRO F  2 26  ? 454.568 34.610  450.243 1.00 63.06  ?  49  PRO F CD  1 
ATOM   5525  N N   . PRO F  2 27  ? 452.729 34.806  454.670 1.00 99.06  ?  50  PRO F N   1 
ATOM   5526  C CA  . PRO F  2 27  ? 451.558 34.448  455.496 1.00 99.32  ?  50  PRO F CA  1 
ATOM   5527  C C   . PRO F  2 27  ? 450.204 34.773  454.879 1.00 111.32 ?  50  PRO F C   1 
ATOM   5528  O O   . PRO F  2 27  ? 449.301 33.927  454.916 1.00 117.82 ?  50  PRO F O   1 
ATOM   5529  C CB  . PRO F  2 27  ? 451.805 35.245  456.783 1.00 99.16  ?  50  PRO F CB  1 
ATOM   5530  C CG  . PRO F  2 27  ? 453.286 35.326  456.880 1.00 107.50 ?  50  PRO F CG  1 
ATOM   5531  C CD  . PRO F  2 27  ? 453.781 35.466  455.466 1.00 104.76 ?  50  PRO F CD  1 
ATOM   5532  N N   . ASN F  2 28  ? 450.029 35.963  454.311 1.00 57.17  ?  51  ASN F N   1 
ATOM   5533  C CA  . ASN F  2 28  ? 448.829 36.278  453.540 1.00 51.85  ?  51  ASN F CA  1 
ATOM   5534  C C   . ASN F  2 28  ? 449.257 36.493  452.093 1.00 53.30  ?  51  ASN F C   1 
ATOM   5535  O O   . ASN F  2 28  ? 449.813 37.541  451.753 1.00 65.23  ?  51  ASN F O   1 
ATOM   5536  C CB  . ASN F  2 28  ? 448.119 37.509  454.100 1.00 52.21  ?  51  ASN F CB  1 
ATOM   5537  C CG  . ASN F  2 28  ? 448.018 37.488  455.612 1.00 60.08  ?  51  ASN F CG  1 
ATOM   5538  O OD1 . ASN F  2 28  ? 447.108 36.879  456.176 1.00 60.01  ?  51  ASN F OD1 1 
ATOM   5539  N ND2 . ASN F  2 28  ? 448.952 38.158  456.276 1.00 66.37  ?  51  ASN F ND2 1 
ATOM   5540  N N   . SER F  2 29  ? 448.974 35.509  451.245 1.00 29.81  ?  52  SER F N   1 
ATOM   5541  C CA  . SER F  2 29  ? 449.296 35.574  449.822 1.00 29.83  ?  52  SER F CA  1 
ATOM   5542  C C   . SER F  2 29  ? 448.693 34.351  449.141 1.00 30.18  ?  52  SER F C   1 
ATOM   5543  O O   . SER F  2 29  ? 448.065 33.504  449.782 1.00 30.90  ?  52  SER F O   1 
ATOM   5544  C CB  . SER F  2 29  ? 450.806 35.643  449.592 1.00 29.57  ?  52  SER F CB  1 
ATOM   5545  O OG  . SER F  2 29  ? 451.456 34.589  450.272 1.00 31.06  ?  52  SER F OG  1 
ATOM   5546  N N   . PHE F  2 30  ? 448.899 34.267  447.828 1.00 43.09  ?  53  PHE F N   1 
ATOM   5547  C CA  . PHE F  2 30  ? 448.534 33.082  447.064 1.00 43.68  ?  53  PHE F CA  1 
ATOM   5548  C C   . PHE F  2 30  ? 449.336 33.069  445.771 1.00 43.52  ?  53  PHE F C   1 
ATOM   5549  O O   . PHE F  2 30  ? 449.816 34.105  445.306 1.00 47.01  ?  53  PHE F O   1 
ATOM   5550  C CB  . PHE F  2 30  ? 447.031 33.044  446.762 1.00 49.12  ?  53  PHE F CB  1 
ATOM   5551  C CG  . PHE F  2 30  ? 446.590 34.061  445.748 1.00 44.56  ?  53  PHE F CG  1 
ATOM   5552  C CD1 . PHE F  2 30  ? 446.350 35.373  446.122 1.00 41.68  ?  53  PHE F CD1 1 
ATOM   5553  C CD2 . PHE F  2 30  ? 446.412 33.704  444.421 1.00 45.34  ?  53  PHE F CD2 1 
ATOM   5554  C CE1 . PHE F  2 30  ? 445.945 36.311  445.191 1.00 47.13  ?  53  PHE F CE1 1 
ATOM   5555  C CE2 . PHE F  2 30  ? 446.009 34.637  443.484 1.00 49.14  ?  53  PHE F CE2 1 
ATOM   5556  C CZ  . PHE F  2 30  ? 445.775 35.942  443.869 1.00 52.27  ?  53  PHE F CZ  1 
ATOM   5557  N N   . SER F  2 31  ? 449.468 31.877  445.193 1.00 37.47  ?  54  SER F N   1 
ATOM   5558  C CA  . SER F  2 31  ? 450.013 31.719  443.849 1.00 41.87  ?  54  SER F CA  1 
ATOM   5559  C C   . SER F  2 31  ? 449.140 30.720  443.108 1.00 40.54  ?  54  SER F C   1 
ATOM   5560  O O   . SER F  2 31  ? 449.045 29.558  443.516 1.00 40.78  ?  54  SER F O   1 
ATOM   5561  C CB  . SER F  2 31  ? 451.471 31.250  443.881 1.00 43.30  ?  54  SER F CB  1 
ATOM   5562  O OG  . SER F  2 31  ? 451.580 29.951  444.433 1.00 45.80  ?  54  SER F OG  1 
ATOM   5563  N N   . SER F  2 32  ? 448.507 31.167  442.025 1.00 63.88  ?  55  SER F N   1 
ATOM   5564  C CA  . SER F  2 32  ? 447.547 30.350  441.296 1.00 60.89  ?  55  SER F CA  1 
ATOM   5565  C C   . SER F  2 32  ? 448.147 29.634  440.094 1.00 66.37  ?  55  SER F C   1 
ATOM   5566  O O   . SER F  2 32  ? 447.433 28.879  439.427 1.00 70.51  ?  55  SER F O   1 
ATOM   5567  C CB  . SER F  2 32  ? 446.363 31.209  440.840 1.00 62.33  ?  55  SER F CB  1 
ATOM   5568  O OG  . SER F  2 32  ? 445.526 31.542  441.935 1.00 71.05  ?  55  SER F OG  1 
ATOM   5569  N N   . ALA F  2 33  ? 449.427 29.845  439.795 1.00 67.85  ?  56  ALA F N   1 
ATOM   5570  C CA  . ALA F  2 33  ? 450.068 29.191  438.664 1.00 62.92  ?  56  ALA F CA  1 
ATOM   5571  C C   . ALA F  2 33  ? 451.340 28.494  439.130 1.00 60.31  ?  56  ALA F C   1 
ATOM   5572  O O   . ALA F  2 33  ? 451.750 28.600  440.290 1.00 58.39  ?  56  ALA F O   1 
ATOM   5573  C CB  . ALA F  2 33  ? 450.372 30.195  437.544 1.00 60.82  ?  56  ALA F CB  1 
ATOM   5574  N N   . GLY F  2 34  ? 451.969 27.772  438.205 1.00 87.64  ?  57  GLY F N   1 
ATOM   5575  C CA  . GLY F  2 34  ? 453.184 27.037  438.497 1.00 92.54  ?  57  GLY F CA  1 
ATOM   5576  C C   . GLY F  2 34  ? 454.448 27.872  438.531 1.00 90.48  ?  57  GLY F C   1 
ATOM   5577  O O   . GLY F  2 34  ? 455.253 27.754  439.457 1.00 92.53  ?  57  GLY F O   1 
ATOM   5578  N N   . GLY F  2 35  ? 454.630 28.722  437.523 1.00 91.69  ?  58  GLY F N   1 
ATOM   5579  C CA  . GLY F  2 35  ? 455.884 29.428  437.356 1.00 94.91  ?  58  GLY F CA  1 
ATOM   5580  C C   . GLY F  2 35  ? 455.905 30.838  437.909 1.00 97.09  ?  58  GLY F C   1 
ATOM   5581  O O   . GLY F  2 35  ? 456.732 31.655  437.495 1.00 106.57 ?  58  GLY F O   1 
ATOM   5582  N N   . GLN F  2 36  ? 455.004 31.139  438.841 1.00 75.69  ?  59  GLN F N   1 
ATOM   5583  C CA  . GLN F  2 36  ? 454.949 32.476  439.417 1.00 72.23  ?  59  GLN F CA  1 
ATOM   5584  C C   . GLN F  2 36  ? 456.201 32.752  440.240 1.00 62.07  ?  59  GLN F C   1 
ATOM   5585  O O   . GLN F  2 36  ? 456.552 31.980  441.138 1.00 67.87  ?  59  GLN F O   1 
ATOM   5586  C CB  . GLN F  2 36  ? 453.699 32.633  440.281 1.00 69.04  ?  59  GLN F CB  1 
ATOM   5587  C CG  . GLN F  2 36  ? 452.394 32.546  439.505 1.00 71.54  ?  59  GLN F CG  1 
ATOM   5588  C CD  . GLN F  2 36  ? 451.207 33.062  440.297 1.00 66.56  ?  59  GLN F CD  1 
ATOM   5589  O OE1 . GLN F  2 36  ? 451.357 33.548  441.417 1.00 64.94  ?  59  GLN F OE1 1 
ATOM   5590  N NE2 . GLN F  2 36  ? 450.018 32.962  439.714 1.00 66.46  ?  59  GLN F NE2 1 
ATOM   5591  N N   . ARG F  2 37  ? 456.876 33.860  439.932 1.00 67.42  ?  60  ARG F N   1 
ATOM   5592  C CA  . ARG F  2 37  ? 458.061 34.269  440.673 1.00 73.92  ?  60  ARG F CA  1 
ATOM   5593  C C   . ARG F  2 37  ? 457.726 34.906  442.013 1.00 63.97  ?  60  ARG F C   1 
ATOM   5594  O O   . ARG F  2 37  ? 458.638 35.152  442.811 1.00 58.27  ?  60  ARG F O   1 
ATOM   5595  C CB  . ARG F  2 37  ? 458.894 35.245  439.837 1.00 78.29  ?  60  ARG F CB  1 
ATOM   5596  C CG  . ARG F  2 37  ? 459.492 34.635  438.581 1.00 76.50  ?  60  ARG F CG  1 
ATOM   5597  C CD  . ARG F  2 37  ? 459.975 35.707  437.615 1.00 86.33  ?  60  ARG F CD  1 
ATOM   5598  N NE  . ARG F  2 37  ? 458.870 36.463  437.029 1.00 93.41  ?  60  ARG F NE  1 
ATOM   5599  C CZ  . ARG F  2 37  ? 458.493 37.674  437.429 1.00 92.27  ?  60  ARG F CZ  1 
ATOM   5600  N NH1 . ARG F  2 37  ? 459.135 38.280  438.418 1.00 89.77  ?  60  ARG F NH1 1 
ATOM   5601  N NH2 . ARG F  2 37  ? 457.473 38.282  436.835 1.00 76.64  ?  60  ARG F NH2 1 
ATOM   5602  N N   . THR F  2 38  ? 456.451 35.183  442.274 1.00 53.79  ?  61  THR F N   1 
ATOM   5603  C CA  . THR F  2 38  ? 456.031 35.775  443.533 1.00 50.95  ?  61  THR F CA  1 
ATOM   5604  C C   . THR F  2 38  ? 454.590 35.375  443.809 1.00 50.17  ?  61  THR F C   1 
ATOM   5605  O O   . THR F  2 38  ? 453.826 35.079  442.886 1.00 50.77  ?  61  THR F O   1 
ATOM   5606  C CB  . THR F  2 38  ? 456.162 37.301  443.512 1.00 50.22  ?  61  THR F CB  1 
ATOM   5607  O OG1 . THR F  2 38  ? 455.488 37.853  444.647 1.00 57.92  ?  61  THR F OG1 1 
ATOM   5608  C CG2 . THR F  2 38  ? 455.554 37.872  442.239 1.00 52.72  ?  61  THR F CG2 1 
ATOM   5609  N N   . CYS F  2 39  ? 454.226 35.370  445.088 1.00 49.62  ?  62  CYS F N   1 
ATOM   5610  C CA  . CYS F  2 39  ? 452.865 35.059  445.504 1.00 52.32  ?  62  CYS F CA  1 
ATOM   5611  C C   . CYS F  2 39  ? 452.045 36.344  445.508 1.00 53.15  ?  62  CYS F C   1 
ATOM   5612  O O   . CYS F  2 39  ? 452.421 37.324  446.161 1.00 52.81  ?  62  CYS F O   1 
ATOM   5613  C CB  . CYS F  2 39  ? 452.851 34.403  446.884 1.00 59.00  ?  62  CYS F CB  1 
ATOM   5614  S SG  . CYS F  2 39  ? 453.733 32.824  446.982 1.00 69.51  ?  62  CYS F SG  1 
ATOM   5615  N N   . ASP F  2 40  ? 450.936 36.341  444.774 1.00 59.42  ?  63  ASP F N   1 
ATOM   5616  C CA  . ASP F  2 40  ? 450.069 37.509  444.718 1.00 56.27  ?  63  ASP F CA  1 
ATOM   5617  C C   . ASP F  2 40  ? 449.379 37.731  446.059 1.00 57.50  ?  63  ASP F C   1 
ATOM   5618  O O   . ASP F  2 40  ? 449.076 36.787  446.792 1.00 66.59  ?  63  ASP F O   1 
ATOM   5619  C CB  . ASP F  2 40  ? 449.024 37.348  443.614 1.00 63.97  ?  63  ASP F CB  1 
ATOM   5620  C CG  . ASP F  2 40  ? 449.624 37.439  442.224 1.00 72.56  ?  63  ASP F CG  1 
ATOM   5621  O OD1 . ASP F  2 40  ? 450.859 37.304  442.097 1.00 69.17  ?  63  ASP F OD1 1 
ATOM   5622  O OD2 . ASP F  2 40  ? 448.859 37.644  441.257 1.00 75.39  -1 63  ASP F OD2 1 
ATOM   5623  N N   . ILE F  2 41  ? 449.128 39.001  446.375 1.00 33.05  ?  64  ILE F N   1 
ATOM   5624  C CA  . ILE F  2 41  ? 448.499 39.345  447.644 1.00 33.89  ?  64  ILE F CA  1 
ATOM   5625  C C   . ILE F  2 41  ? 447.016 38.999  447.593 1.00 38.34  ?  64  ILE F C   1 
ATOM   5626  O O   . ILE F  2 41  ? 446.325 39.271  446.602 1.00 39.73  ?  64  ILE F O   1 
ATOM   5627  C CB  . ILE F  2 41  ? 448.716 40.834  447.961 1.00 29.89  ?  64  ILE F CB  1 
ATOM   5628  C CG1 . ILE F  2 41  ? 450.206 41.174  447.908 1.00 33.42  ?  64  ILE F CG1 1 
ATOM   5629  C CG2 . ILE F  2 41  ? 448.144 41.181  449.327 1.00 32.60  ?  64  ILE F CG2 1 
ATOM   5630  C CD1 . ILE F  2 41  ? 450.521 42.612  448.256 1.00 36.64  ?  64  ILE F CD1 1 
ATOM   5631  N N   . CYS F  2 42  ? 446.521 38.387  448.667 1.00 51.69  ?  65  CYS F N   1 
ATOM   5632  C CA  . CYS F  2 42  ? 445.117 38.011  448.743 1.00 55.82  ?  65  CYS F CA  1 
ATOM   5633  C C   . CYS F  2 42  ? 444.225 39.233  448.926 1.00 55.73  ?  65  CYS F C   1 
ATOM   5634  O O   . CYS F  2 42  ? 444.588 40.204  449.596 1.00 50.13  ?  65  CYS F O   1 
ATOM   5635  C CB  . CYS F  2 42  ? 444.882 37.032  449.891 1.00 56.24  ?  65  CYS F CB  1 
ATOM   5636  S SG  . CYS F  2 42  ? 444.871 35.289  449.424 1.00 72.53  ?  65  CYS F SG  1 
ATOM   5637  N N   . ARG F  2 43  ? 443.038 39.170  448.325 1.00 71.84  ?  66  ARG F N   1 
ATOM   5638  C CA  . ARG F  2 43  ? 442.052 40.224  448.504 1.00 73.17  ?  66  ARG F CA  1 
ATOM   5639  C C   . ARG F  2 43  ? 441.572 40.266  449.950 1.00 72.43  ?  66  ARG F C   1 
ATOM   5640  O O   . ARG F  2 43  ? 441.564 39.255  450.657 1.00 69.50  ?  66  ARG F O   1 
ATOM   5641  C CB  . ARG F  2 43  ? 440.859 40.018  447.569 1.00 80.18  ?  66  ARG F CB  1 
ATOM   5642  C CG  . ARG F  2 43  ? 441.047 40.582  446.167 1.00 83.26  ?  66  ARG F CG  1 
ATOM   5643  C CD  . ARG F  2 43  ? 439.702 40.919  445.533 1.00 81.23  ?  66  ARG F CD  1 
ATOM   5644  N NE  . ARG F  2 43  ? 439.043 42.033  446.212 1.00 100.13 ?  66  ARG F NE  1 
ATOM   5645  C CZ  . ARG F  2 43  ? 437.809 42.450  445.948 1.00 99.84  ?  66  ARG F CZ  1 
ATOM   5646  N NH1 . ARG F  2 43  ? 437.085 41.844  445.017 1.00 94.92  ?  66  ARG F NH1 1 
ATOM   5647  N NH2 . ARG F  2 43  ? 437.294 43.473  446.619 1.00 82.49  ?  66  ARG F NH2 1 
ATOM   5648  N N   . GLN F  2 44  ? 441.170 41.456  450.385 1.00 53.45  ?  67  GLN F N   1 
ATOM   5649  C CA  . GLN F  2 44  ? 440.678 41.682  451.739 1.00 50.97  ?  67  GLN F CA  1 
ATOM   5650  C C   . GLN F  2 44  ? 439.225 42.125  451.646 1.00 51.56  ?  67  GLN F C   1 
ATOM   5651  O O   . GLN F  2 44  ? 438.935 43.212  451.133 1.00 49.78  ?  67  GLN F O   1 
ATOM   5652  C CB  . GLN F  2 44  ? 441.527 42.728  452.463 1.00 49.43  ?  67  GLN F CB  1 
ATOM   5653  C CG  . GLN F  2 44  ? 443.026 42.470  452.403 1.00 57.65  ?  67  GLN F CG  1 
ATOM   5654  C CD  . GLN F  2 44  ? 443.471 41.357  453.332 1.00 51.23  ?  67  GLN F CD  1 
ATOM   5655  O OE1 . GLN F  2 44  ? 443.070 41.305  454.494 1.00 52.65  ?  67  GLN F OE1 1 
ATOM   5656  N NE2 . GLN F  2 44  ? 444.306 40.459  452.821 1.00 45.67  ?  67  GLN F NE2 1 
ATOM   5657  N N   . CYS F  2 45  ? 438.313 41.290  452.138 1.00 49.70  ?  68  CYS F N   1 
ATOM   5658  C CA  . CYS F  2 45  ? 436.893 41.624  452.155 1.00 47.54  ?  68  CYS F CA  1 
ATOM   5659  C C   . CYS F  2 45  ? 436.573 42.239  453.512 1.00 50.22  ?  68  CYS F C   1 
ATOM   5660  O O   . CYS F  2 45  ? 436.578 41.544  454.534 1.00 53.39  ?  68  CYS F O   1 
ATOM   5661  C CB  . CYS F  2 45  ? 436.039 40.385  451.894 1.00 53.05  ?  68  CYS F CB  1 
ATOM   5662  S SG  . CYS F  2 45  ? 436.608 39.349  450.521 1.00 67.62  ?  68  CYS F SG  1 
ATOM   5663  N N   . LYS F  2 46  ? 436.289 43.539  453.521 1.00 41.53  ?  69  LYS F N   1 
ATOM   5664  C CA  . LYS F  2 46  ? 435.987 44.259  454.749 1.00 36.34  ?  69  LYS F CA  1 
ATOM   5665  C C   . LYS F  2 46  ? 434.977 45.352  454.434 1.00 39.86  ?  69  LYS F C   1 
ATOM   5666  O O   . LYS F  2 46  ? 434.594 45.558  453.279 1.00 43.33  ?  69  LYS F O   1 
ATOM   5667  C CB  . LYS F  2 46  ? 437.257 44.843  455.378 1.00 33.44  ?  69  LYS F CB  1 
ATOM   5668  C CG  . LYS F  2 46  ? 438.090 43.840  456.156 1.00 40.75  ?  69  LYS F CG  1 
ATOM   5669  C CD  . LYS F  2 46  ? 439.148 44.533  456.995 1.00 42.97  ?  69  LYS F CD  1 
ATOM   5670  C CE  . LYS F  2 46  ? 439.803 43.559  457.959 1.00 45.27  ?  69  LYS F CE  1 
ATOM   5671  N NZ  . LYS F  2 46  ? 438.797 42.897  458.836 1.00 28.99  ?  69  LYS F NZ  1 
ATOM   5672  N N   . GLY F  2 47  ? 434.560 46.067  455.473 1.00 61.00  ?  70  GLY F N   1 
ATOM   5673  C CA  . GLY F  2 47  ? 433.599 47.138  455.280 1.00 58.57  ?  70  GLY F CA  1 
ATOM   5674  C C   . GLY F  2 47  ? 432.284 46.592  454.762 1.00 62.35  ?  70  GLY F C   1 
ATOM   5675  O O   . GLY F  2 47  ? 431.641 45.740  455.388 1.00 62.34  ?  70  GLY F O   1 
ATOM   5676  N N   . VAL F  2 48  ? 431.874 47.089  453.597 1.00 48.13  ?  71  VAL F N   1 
ATOM   5677  C CA  . VAL F  2 48  ? 430.625 46.685  452.965 1.00 45.67  ?  71  VAL F CA  1 
ATOM   5678  C C   . VAL F  2 48  ? 430.760 45.291  452.362 1.00 53.71  ?  71  VAL F C   1 
ATOM   5679  O O   . VAL F  2 48  ? 429.785 44.732  451.848 1.00 58.36  ?  71  VAL F O   1 
ATOM   5680  C CB  . VAL F  2 48  ? 430.199 47.708  451.899 1.00 51.28  ?  71  VAL F CB  1 
ATOM   5681  C CG1 . VAL F  2 48  ? 430.280 49.116  452.466 1.00 52.65  ?  71  VAL F CG1 1 
ATOM   5682  C CG2 . VAL F  2 48  ? 431.070 47.574  450.659 1.00 53.59  ?  71  VAL F CG2 1 
ATOM   5683  N N   . PHE F  2 49  ? 431.961 44.722  452.414 1.00 39.85  ?  72  PHE F N   1 
ATOM   5684  C CA  . PHE F  2 49  ? 432.227 43.415  451.830 1.00 38.29  ?  72  PHE F CA  1 
ATOM   5685  C C   . PHE F  2 49  ? 432.253 42.323  452.893 1.00 39.90  ?  72  PHE F C   1 
ATOM   5686  O O   . PHE F  2 49  ? 432.696 42.546  454.023 1.00 33.39  ?  72  PHE F O   1 
ATOM   5687  C CB  . PHE F  2 49  ? 433.553 43.411  451.066 1.00 38.56  ?  72  PHE F CB  1 
ATOM   5688  C CG  . PHE F  2 49  ? 433.523 44.203  449.793 1.00 41.98  ?  72  PHE F CG  1 
ATOM   5689  C CD1 . PHE F  2 49  ? 432.753 43.785  448.721 1.00 41.96  ?  72  PHE F CD1 1 
ATOM   5690  C CD2 . PHE F  2 49  ? 434.275 45.357  449.661 1.00 42.78  ?  72  PHE F CD2 1 
ATOM   5691  C CE1 . PHE F  2 49  ? 432.725 44.509  447.545 1.00 33.52  ?  72  PHE F CE1 1 
ATOM   5692  C CE2 . PHE F  2 49  ? 434.252 46.083  448.488 1.00 35.51  ?  72  PHE F CE2 1 
ATOM   5693  C CZ  . PHE F  2 49  ? 433.476 45.659  447.428 1.00 30.22  ?  72  PHE F CZ  1 
ATOM   5694  N N   . ARG F  2 50  ? 431.773 41.140  452.513 1.00 97.81  ?  73  ARG F N   1 
ATOM   5695  C CA  . ARG F  2 50  ? 431.870 39.925  453.309 1.00 101.44 ?  73  ARG F CA  1 
ATOM   5696  C C   . ARG F  2 50  ? 432.706 38.902  452.550 1.00 103.53 ?  73  ARG F C   1 
ATOM   5697  O O   . ARG F  2 50  ? 432.857 38.976  451.329 1.00 108.00 ?  73  ARG F O   1 
ATOM   5698  C CB  . ARG F  2 50  ? 430.485 39.339  453.625 1.00 100.09 ?  73  ARG F CB  1 
ATOM   5699  C CG  . ARG F  2 50  ? 429.673 40.136  454.636 1.00 98.85  ?  73  ARG F CG  1 
ATOM   5700  C CD  . ARG F  2 50  ? 428.440 39.368  455.104 1.00 95.38  ?  73  ARG F CD  1 
ATOM   5701  N NE  . ARG F  2 50  ? 427.439 39.207  454.051 1.00 107.79 ?  73  ARG F NE  1 
ATOM   5702  C CZ  . ARG F  2 50  ? 427.267 38.095  453.342 1.00 110.74 ?  73  ARG F CZ  1 
ATOM   5703  N NH1 . ARG F  2 50  ? 426.330 38.042  452.403 1.00 108.86 ?  73  ARG F NH1 1 
ATOM   5704  N NH2 . ARG F  2 50  ? 428.027 37.033  453.572 1.00 118.45 ?  73  ARG F NH2 1 
ATOM   5705  N N   . THR F  2 51  ? 433.261 37.943  453.285 1.00 56.59  ?  74  THR F N   1 
ATOM   5706  C CA  . THR F  2 51  ? 434.112 36.921  452.687 1.00 55.51  ?  74  THR F CA  1 
ATOM   5707  C C   . THR F  2 51  ? 433.292 35.680  452.357 1.00 62.21  ?  74  THR F C   1 
ATOM   5708  O O   . THR F  2 51  ? 432.577 35.153  453.216 1.00 63.99  ?  74  THR F O   1 
ATOM   5709  C CB  . THR F  2 51  ? 435.263 36.557  453.624 1.00 55.92  ?  74  THR F CB  1 
ATOM   5710  O OG1 . THR F  2 51  ? 435.995 37.740  453.967 1.00 56.99  ?  74  THR F OG1 1 
ATOM   5711  C CG2 . THR F  2 51  ? 436.202 35.566  452.952 1.00 53.85  ?  74  THR F CG2 1 
ATOM   5712  N N   . ARG F  2 52  ? 433.396 35.220  451.110 1.00 86.52  ?  75  ARG F N   1 
ATOM   5713  C CA  . ARG F  2 52  ? 432.746 33.982  450.696 1.00 88.17  ?  75  ARG F CA  1 
ATOM   5714  C C   . ARG F  2 52  ? 433.725 32.818  450.783 1.00 93.01  ?  75  ARG F C   1 
ATOM   5715  O O   . ARG F  2 52  ? 433.541 31.903  451.591 1.00 100.35 ?  75  ARG F O   1 
ATOM   5716  C CB  . ARG F  2 52  ? 432.189 34.107  449.276 1.00 88.83  ?  75  ARG F CB  1 
ATOM   5717  C CG  . ARG F  2 52  ? 431.691 32.794  448.693 1.00 94.09  ?  75  ARG F CG  1 
ATOM   5718  C CD  . ARG F  2 52  ? 430.439 32.994  447.857 1.00 104.31 ?  75  ARG F CD  1 
ATOM   5719  N NE  . ARG F  2 52  ? 429.366 33.615  448.629 1.00 112.94 ?  75  ARG F NE  1 
ATOM   5720  C CZ  . ARG F  2 52  ? 428.568 32.957  449.464 1.00 112.45 ?  75  ARG F CZ  1 
ATOM   5721  N NH1 . ARG F  2 52  ? 428.718 31.652  449.642 1.00 109.48 ?  75  ARG F NH1 1 
ATOM   5722  N NH2 . ARG F  2 52  ? 427.619 33.607  450.124 1.00 111.12 ?  75  ARG F NH2 1 
ATOM   5723  N N   . LYS F  2 53  ? 434.764 32.844  449.952 1.00 69.44  ?  76  LYS F N   1 
ATOM   5724  C CA  . LYS F  2 53  ? 435.826 31.848  449.987 1.00 64.26  ?  76  LYS F CA  1 
ATOM   5725  C C   . LYS F  2 53  ? 437.060 32.471  450.626 1.00 66.22  ?  76  LYS F C   1 
ATOM   5726  O O   . LYS F  2 53  ? 437.571 33.485  450.139 1.00 68.47  ?  76  LYS F O   1 
ATOM   5727  C CB  . LYS F  2 53  ? 436.146 31.333  448.583 1.00 59.49  ?  76  LYS F CB  1 
ATOM   5728  C CG  . LYS F  2 53  ? 437.366 30.428  448.519 1.00 59.52  ?  76  LYS F CG  1 
ATOM   5729  C CD  . LYS F  2 53  ? 437.458 29.708  447.182 1.00 58.48  ?  76  LYS F CD  1 
ATOM   5730  C CE  . LYS F  2 53  ? 436.290 28.751  446.989 1.00 57.37  ?  76  LYS F CE  1 
ATOM   5731  N NZ  . LYS F  2 53  ? 436.400 27.985  445.716 1.00 50.19  ?  76  LYS F NZ  1 
ATOM   5732  N N   . GLU F  2 54  ? 437.533 31.866  451.713 1.00 78.82  ?  77  GLU F N   1 
ATOM   5733  C CA  . GLU F  2 54  ? 438.672 32.408  452.434 1.00 77.33  ?  77  GLU F CA  1 
ATOM   5734  C C   . GLU F  2 54  ? 439.944 32.306  451.598 1.00 78.71  ?  77  GLU F C   1 
ATOM   5735  O O   . GLU F  2 54  ? 440.049 31.511  450.659 1.00 71.73  ?  77  GLU F O   1 
ATOM   5736  C CB  . GLU F  2 54  ? 438.866 31.682  453.766 1.00 71.72  ?  77  GLU F CB  1 
ATOM   5737  C CG  . GLU F  2 54  ? 437.824 32.019  454.818 1.00 75.01  ?  77  GLU F CG  1 
ATOM   5738  C CD  . GLU F  2 54  ? 436.900 30.855  455.114 1.00 102.62 ?  77  GLU F CD  1 
ATOM   5739  O OE1 . GLU F  2 54  ? 436.910 29.875  454.342 1.00 104.23 ?  77  GLU F OE1 1 
ATOM   5740  O OE2 . GLU F  2 54  ? 436.163 30.923  456.122 1.00 115.01 -1 77  GLU F OE2 1 
ATOM   5741  N N   . CYS F  2 55  ? 440.921 33.137  451.954 1.00 86.44  ?  78  CYS F N   1 
ATOM   5742  C CA  . CYS F  2 55  ? 442.196 33.147  451.252 1.00 82.76  ?  78  CYS F CA  1 
ATOM   5743  C C   . CYS F  2 55  ? 442.978 31.874  451.545 1.00 79.99  ?  78  CYS F C   1 
ATOM   5744  O O   . CYS F  2 55  ? 443.187 31.510  452.706 1.00 86.84  ?  78  CYS F O   1 
ATOM   5745  C CB  . CYS F  2 55  ? 443.008 34.375  451.661 1.00 91.17  ?  78  CYS F CB  1 
ATOM   5746  S SG  . CYS F  2 55  ? 444.763 34.327  451.209 1.00 102.02 ?  78  CYS F SG  1 
ATOM   5747  N N   . SER F  2 56  ? 443.406 31.197  450.485 1.00 70.80  ?  79  SER F N   1 
ATOM   5748  C CA  . SER F  2 56  ? 444.256 30.022  450.583 1.00 70.52  ?  79  SER F CA  1 
ATOM   5749  C C   . SER F  2 56  ? 445.522 30.259  449.770 1.00 73.46  ?  79  SER F C   1 
ATOM   5750  O O   . SER F  2 56  ? 445.592 31.175  448.947 1.00 81.66  ?  79  SER F O   1 
ATOM   5751  C CB  . SER F  2 56  ? 443.539 28.761  450.085 1.00 69.35  ?  79  SER F CB  1 
ATOM   5752  O OG  . SER F  2 56  ? 443.327 28.810  448.685 1.00 66.92  ?  79  SER F OG  1 
ATOM   5753  N N   . SER F  2 57  ? 446.534 29.430  450.020 1.00 64.23  ?  80  SER F N   1 
ATOM   5754  C CA  . SER F  2 57  ? 447.791 29.582  449.296 1.00 66.22  ?  80  SER F CA  1 
ATOM   5755  C C   . SER F  2 57  ? 447.638 29.307  447.805 1.00 64.75  ?  80  SER F C   1 
ATOM   5756  O O   . SER F  2 57  ? 448.444 29.802  447.011 1.00 68.39  ?  80  SER F O   1 
ATOM   5757  C CB  . SER F  2 57  ? 448.854 28.658  449.893 1.00 69.92  ?  80  SER F CB  1 
ATOM   5758  O OG  . SER F  2 57  ? 448.427 27.307  449.872 1.00 74.38  ?  80  SER F OG  1 
ATOM   5759  N N   . THR F  2 58  ? 446.631 28.530  447.406 1.00 60.83  ?  81  THR F N   1 
ATOM   5760  C CA  . THR F  2 58  ? 446.462 28.145  446.011 1.00 57.05  ?  81  THR F CA  1 
ATOM   5761  C C   . THR F  2 58  ? 445.568 29.085  445.209 1.00 59.54  ?  81  THR F C   1 
ATOM   5762  O O   . THR F  2 58  ? 445.559 28.992  443.976 1.00 56.99  ?  81  THR F O   1 
ATOM   5763  C CB  . THR F  2 58  ? 445.891 26.725  445.928 1.00 66.31  ?  81  THR F CB  1 
ATOM   5764  O OG1 . THR F  2 58  ? 444.475 26.764  446.153 1.00 66.60  ?  81  THR F OG1 1 
ATOM   5765  C CG2 . THR F  2 58  ? 446.534 25.837  446.982 1.00 71.67  ?  81  THR F CG2 1 
ATOM   5766  N N   . SER F  2 59  ? 444.825 29.983  445.854 1.00 73.46  ?  82  SER F N   1 
ATOM   5767  C CA  . SER F  2 59  ? 443.873 30.814  445.127 1.00 73.45  ?  82  SER F CA  1 
ATOM   5768  C C   . SER F  2 59  ? 443.561 32.067  445.931 1.00 69.16  ?  82  SER F C   1 
ATOM   5769  O O   . SER F  2 59  ? 443.820 32.138  447.135 1.00 67.15  ?  82  SER F O   1 
ATOM   5770  C CB  . SER F  2 59  ? 442.584 30.045  444.813 1.00 71.50  ?  82  SER F CB  1 
ATOM   5771  O OG  . SER F  2 59  ? 441.938 29.625  446.002 1.00 72.13  ?  82  SER F OG  1 
ATOM   5772  N N   . ASN F  2 60  ? 442.987 33.054  445.245 1.00 44.65  ?  83  ASN F N   1 
ATOM   5773  C CA  . ASN F  2 60  ? 442.642 34.324  445.866 1.00 44.09  ?  83  ASN F CA  1 
ATOM   5774  C C   . ASN F  2 60  ? 441.371 34.174  446.704 1.00 45.34  ?  83  ASN F C   1 
ATOM   5775  O O   . ASN F  2 60  ? 440.735 33.118  446.741 1.00 50.46  ?  83  ASN F O   1 
ATOM   5776  C CB  . ASN F  2 60  ? 442.478 35.400  444.791 1.00 39.65  ?  83  ASN F CB  1 
ATOM   5777  C CG  . ASN F  2 60  ? 442.482 36.807  445.361 1.00 40.63  ?  83  ASN F CG  1 
ATOM   5778  O OD1 . ASN F  2 60  ? 442.824 37.017  446.525 1.00 36.76  ?  83  ASN F OD1 1 
ATOM   5779  N ND2 . ASN F  2 60  ? 442.100 37.778  444.539 1.00 40.92  ?  83  ASN F ND2 1 
ATOM   5780  N N   . ALA F  2 61  ? 440.995 35.253  447.388 1.00 66.16  ?  84  ALA F N   1 
ATOM   5781  C CA  . ALA F  2 61  ? 439.789 35.286  448.204 1.00 69.73  ?  84  ALA F CA  1 
ATOM   5782  C C   . ALA F  2 61  ? 438.599 35.763  447.383 1.00 70.18  ?  84  ALA F C   1 
ATOM   5783  O O   . ALA F  2 61  ? 438.733 36.638  446.522 1.00 71.85  ?  84  ALA F O   1 
ATOM   5784  C CB  . ALA F  2 61  ? 439.984 36.194  449.420 1.00 66.55  ?  84  ALA F CB  1 
ATOM   5785  N N   . GLU F  2 62  ? 437.431 35.184  447.655 1.00 62.76  ?  85  GLU F N   1 
ATOM   5786  C CA  . GLU F  2 62  ? 436.192 35.540  446.971 1.00 62.68  ?  85  GLU F CA  1 
ATOM   5787  C C   . GLU F  2 62  ? 435.357 36.419  447.898 1.00 70.89  ?  85  GLU F C   1 
ATOM   5788  O O   . GLU F  2 62  ? 434.853 35.947  448.922 1.00 74.02  ?  85  GLU F O   1 
ATOM   5789  C CB  . GLU F  2 62  ? 435.422 34.286  446.563 1.00 65.60  ?  85  GLU F CB  1 
ATOM   5790  C CG  . GLU F  2 62  ? 434.991 34.268  445.107 1.00 74.06  ?  85  GLU F CG  1 
ATOM   5791  C CD  . GLU F  2 62  ? 436.161 34.398  444.154 1.00 75.69  ?  85  GLU F CD  1 
ATOM   5792  O OE1 . GLU F  2 62  ? 435.986 35.000  443.074 1.00 74.31  ?  85  GLU F OE1 1 
ATOM   5793  O OE2 . GLU F  2 62  ? 437.258 33.903  444.487 1.00 77.02  -1 85  GLU F OE2 1 
ATOM   5794  N N   . CYS F  2 63  ? 435.219 37.693  447.542 1.00 70.16  ?  86  CYS F N   1 
ATOM   5795  C CA  . CYS F  2 63  ? 434.440 38.622  448.348 1.00 64.36  ?  86  CYS F CA  1 
ATOM   5796  C C   . CYS F  2 63  ? 432.946 38.497  448.061 1.00 64.69  ?  86  CYS F C   1 
ATOM   5797  O O   . CYS F  2 63  ? 432.525 38.105  446.969 1.00 61.98  ?  86  CYS F O   1 
ATOM   5798  C CB  . CYS F  2 63  ? 434.886 40.064  448.101 1.00 55.13  ?  86  CYS F CB  1 
ATOM   5799  S SG  . CYS F  2 63  ? 436.452 40.531  448.876 1.00 74.72  ?  86  CYS F SG  1 
ATOM   5800  N N   . ASP F  2 64  ? 432.150 38.839  449.068 1.00 99.77  ?  87  ASP F N   1 
ATOM   5801  C CA  . ASP F  2 64  ? 430.706 38.993  448.973 1.00 99.25  ?  87  ASP F CA  1 
ATOM   5802  C C   . ASP F  2 64  ? 430.333 40.282  449.692 1.00 101.44 ?  87  ASP F C   1 
ATOM   5803  O O   . ASP F  2 64  ? 431.169 40.910  450.341 1.00 98.10  ?  87  ASP F O   1 
ATOM   5804  C CB  . ASP F  2 64  ? 429.960 37.796  449.573 1.00 102.71 ?  87  ASP F CB  1 
ATOM   5805  C CG  . ASP F  2 64  ? 429.392 36.875  448.513 1.00 113.03 ?  87  ASP F CG  1 
ATOM   5806  O OD1 . ASP F  2 64  ? 429.473 37.223  447.316 1.00 116.71 ?  87  ASP F OD1 1 
ATOM   5807  O OD2 . ASP F  2 64  ? 428.860 35.805  448.876 1.00 115.14 -1 87  ASP F OD2 1 
ATOM   5808  N N   . CYS F  2 65  ? 429.080 40.703  449.561 1.00 76.88  ?  88  CYS F N   1 
ATOM   5809  C CA  . CYS F  2 65  ? 428.652 41.958  450.160 1.00 70.30  ?  88  CYS F CA  1 
ATOM   5810  C C   . CYS F  2 65  ? 427.670 41.735  451.301 1.00 66.44  ?  88  CYS F C   1 
ATOM   5811  O O   . CYS F  2 65  ? 426.916 40.758  451.323 1.00 73.16  ?  88  CYS F O   1 
ATOM   5812  C CB  . CYS F  2 65  ? 428.035 42.886  449.114 1.00 73.97  ?  88  CYS F CB  1 
ATOM   5813  S SG  . CYS F  2 65  ? 429.213 44.115  448.522 1.00 89.35  ?  88  CYS F SG  1 
ATOM   5814  N N   . THR F  2 66  ? 427.698 42.673  452.251 1.00 48.78  ?  89  THR F N   1 
ATOM   5815  C CA  . THR F  2 66  ? 426.891 42.723  453.464 1.00 50.53  ?  89  THR F CA  1 
ATOM   5816  C C   . THR F  2 66  ? 425.413 42.612  453.106 1.00 58.96  ?  89  THR F C   1 
ATOM   5817  O O   . THR F  2 66  ? 425.013 43.045  452.017 1.00 63.66  ?  89  THR F O   1 
ATOM   5818  C CB  . THR F  2 66  ? 427.178 44.034  454.209 1.00 50.33  ?  89  THR F CB  1 
ATOM   5819  O OG1 . THR F  2 66  ? 428.565 44.359  454.072 1.00 62.20  ?  89  THR F OG1 1 
ATOM   5820  C CG2 . THR F  2 66  ? 426.864 43.927  455.692 1.00 45.78  ?  89  THR F CG2 1 
ATOM   5821  N N   . PRO F  2 67  ? 424.577 42.023  453.967 1.00 60.37  ?  90  PRO F N   1 
ATOM   5822  C CA  . PRO F  2 67  ? 423.138 42.000  453.690 1.00 64.25  ?  90  PRO F CA  1 
ATOM   5823  C C   . PRO F  2 67  ? 422.582 43.398  453.463 1.00 68.75  ?  90  PRO F C   1 
ATOM   5824  O O   . PRO F  2 67  ? 423.090 44.389  453.993 1.00 65.92  ?  90  PRO F O   1 
ATOM   5825  C CB  . PRO F  2 67  ? 422.542 41.356  454.950 1.00 67.33  ?  90  PRO F CB  1 
ATOM   5826  C CG  . PRO F  2 67  ? 423.636 41.428  455.984 1.00 58.91  ?  90  PRO F CG  1 
ATOM   5827  C CD  . PRO F  2 67  ? 424.892 41.271  455.191 1.00 64.58  ?  90  PRO F CD  1 
ATOM   5828  N N   . GLY F  2 68  ? 421.526 43.462  452.659 1.00 77.15  ?  91  GLY F N   1 
ATOM   5829  C CA  . GLY F  2 68  ? 421.008 44.724  452.183 1.00 79.63  ?  91  GLY F CA  1 
ATOM   5830  C C   . GLY F  2 68  ? 421.704 45.263  450.953 1.00 81.34  ?  91  GLY F C   1 
ATOM   5831  O O   . GLY F  2 68  ? 421.301 46.316  450.445 1.00 77.95  ?  91  GLY F O   1 
ATOM   5832  N N   . PHE F  2 69  ? 422.737 44.581  450.464 1.00 58.18  ?  92  PHE F N   1 
ATOM   5833  C CA  . PHE F  2 69  ? 423.469 44.988  449.276 1.00 48.51  ?  92  PHE F CA  1 
ATOM   5834  C C   . PHE F  2 69  ? 423.528 43.813  448.305 1.00 48.84  ?  92  PHE F C   1 
ATOM   5835  O O   . PHE F  2 69  ? 423.056 42.711  448.599 1.00 60.96  ?  92  PHE F O   1 
ATOM   5836  C CB  . PHE F  2 69  ? 424.876 45.487  449.635 1.00 44.90  ?  92  PHE F CB  1 
ATOM   5837  C CG  . PHE F  2 69  ? 424.882 46.739  450.472 1.00 41.25  ?  92  PHE F CG  1 
ATOM   5838  C CD1 . PHE F  2 69  ? 424.588 46.689  451.825 1.00 40.59  ?  92  PHE F CD1 1 
ATOM   5839  C CD2 . PHE F  2 69  ? 425.184 47.965  449.904 1.00 42.76  ?  92  PHE F CD2 1 
ATOM   5840  C CE1 . PHE F  2 69  ? 424.591 47.837  452.595 1.00 40.32  ?  92  PHE F CE1 1 
ATOM   5841  C CE2 . PHE F  2 69  ? 425.191 49.117  450.669 1.00 38.18  ?  92  PHE F CE2 1 
ATOM   5842  C CZ  . PHE F  2 69  ? 424.894 49.052  452.015 1.00 34.03  ?  92  PHE F CZ  1 
ATOM   5843  N N   . HIS F  2 70  ? 424.118 44.051  447.135 1.00 32.18  ?  93  HIS F N   1 
ATOM   5844  C CA  . HIS F  2 70  ? 424.206 43.028  446.104 1.00 42.05  ?  93  HIS F CA  1 
ATOM   5845  C C   . HIS F  2 70  ? 425.425 43.291  445.231 1.00 40.15  ?  93  HIS F C   1 
ATOM   5846  O O   . HIS F  2 70  ? 425.858 44.435  445.076 1.00 38.36  ?  93  HIS F O   1 
ATOM   5847  C CB  . HIS F  2 70  ? 422.929 42.974  445.252 1.00 37.74  ?  93  HIS F CB  1 
ATOM   5848  C CG  . HIS F  2 70  ? 422.538 44.290  444.649 1.00 39.85  ?  93  HIS F CG  1 
ATOM   5849  N ND1 . HIS F  2 70  ? 421.390 44.450  443.902 1.00 48.21  ?  93  HIS F ND1 1 
ATOM   5850  C CD2 . HIS F  2 70  ? 423.134 45.505  444.684 1.00 41.35  ?  93  HIS F CD2 1 
ATOM   5851  C CE1 . HIS F  2 70  ? 421.298 45.705  443.502 1.00 48.34  ?  93  HIS F CE1 1 
ATOM   5852  N NE2 . HIS F  2 70  ? 422.344 46.367  443.963 1.00 44.47  ?  93  HIS F NE2 1 
ATOM   5853  N N   . CYS F  2 71  ? 425.964 42.222  444.652 1.00 45.66  ?  94  CYS F N   1 
ATOM   5854  C CA  . CYS F  2 71  ? 427.207 42.327  443.906 1.00 54.58  ?  94  CYS F CA  1 
ATOM   5855  C C   . CYS F  2 71  ? 427.014 43.108  442.609 1.00 51.26  ?  94  CYS F C   1 
ATOM   5856  O O   . CYS F  2 71  ? 425.914 43.203  442.057 1.00 43.16  ?  94  CYS F O   1 
ATOM   5857  C CB  . CYS F  2 71  ? 427.774 40.939  443.598 1.00 68.42  ?  94  CYS F CB  1 
ATOM   5858  S SG  . CYS F  2 71  ? 428.761 40.239  444.941 1.00 104.30 ?  94  CYS F SG  1 
ATOM   5859  N N   . LEU F  2 72  ? 428.116 43.678  442.130 1.00 51.65  ?  95  LEU F N   1 
ATOM   5860  C CA  . LEU F  2 72  ? 428.151 44.405  440.871 1.00 51.20  ?  95  LEU F CA  1 
ATOM   5861  C C   . LEU F  2 72  ? 429.542 44.236  440.274 1.00 53.85  ?  95  LEU F C   1 
ATOM   5862  O O   . LEU F  2 72  ? 430.423 43.614  440.874 1.00 60.07  ?  95  LEU F O   1 
ATOM   5863  C CB  . LEU F  2 72  ? 427.797 45.882  441.079 1.00 52.63  ?  95  LEU F CB  1 
ATOM   5864  C CG  . LEU F  2 72  ? 426.897 46.558  440.044 1.00 47.32  ?  95  LEU F CG  1 
ATOM   5865  C CD1 . LEU F  2 72  ? 425.528 45.901  440.022 1.00 55.77  ?  95  LEU F CD1 1 
ATOM   5866  C CD2 . LEU F  2 72  ? 426.777 48.047  440.333 1.00 37.63  ?  95  LEU F CD2 1 
ATOM   5867  N N   . GLY F  2 73  ? 429.744 44.804  439.089 1.00 92.66  ?  96  GLY F N   1 
ATOM   5868  C CA  . GLY F  2 73  ? 431.051 44.710  438.460 1.00 98.94  ?  96  GLY F CA  1 
ATOM   5869  C C   . GLY F  2 73  ? 431.405 43.281  438.101 1.00 106.94 ?  96  GLY F C   1 
ATOM   5870  O O   . GLY F  2 73  ? 430.550 42.480  437.706 1.00 110.75 ?  96  GLY F O   1 
ATOM   5871  N N   . ALA F  2 74  ? 432.687 42.946  438.254 1.00 66.57  ?  97  ALA F N   1 
ATOM   5872  C CA  . ALA F  2 74  ? 433.186 41.632  437.865 1.00 66.34  ?  97  ALA F CA  1 
ATOM   5873  C C   . ALA F  2 74  ? 433.386 40.727  439.074 1.00 63.55  ?  97  ALA F C   1 
ATOM   5874  O O   . ALA F  2 74  ? 432.660 39.744  439.253 1.00 66.25  ?  97  ALA F O   1 
ATOM   5875  C CB  . ALA F  2 74  ? 434.497 41.772  437.089 1.00 54.17  ?  97  ALA F CB  1 
ATOM   5876  N N   . GLY F  2 75  ? 434.368 41.058  439.908 1.00 84.15  ?  98  GLY F N   1 
ATOM   5877  C CA  . GLY F  2 75  ? 434.718 40.259  441.068 1.00 88.42  ?  98  GLY F CA  1 
ATOM   5878  C C   . GLY F  2 75  ? 433.938 40.657  442.302 1.00 94.66  ?  98  GLY F C   1 
ATOM   5879  O O   . GLY F  2 75  ? 434.420 40.488  443.427 1.00 89.47  ?  98  GLY F O   1 
ATOM   5880  N N   . CYS F  2 76  ? 432.738 41.200  442.092 1.00 117.87 ?  99  CYS F N   1 
ATOM   5881  C CA  . CYS F  2 76  ? 432.004 41.961  443.103 1.00 117.22 ?  99  CYS F CA  1 
ATOM   5882  C C   . CYS F  2 76  ? 432.827 43.182  443.517 1.00 106.61 ?  99  CYS F C   1 
ATOM   5883  O O   . CYS F  2 76  ? 433.238 43.343  444.667 1.00 108.11 ?  99  CYS F O   1 
ATOM   5884  C CB  . CYS F  2 76  ? 431.633 41.084  444.307 1.00 114.19 ?  99  CYS F CB  1 
ATOM   5885  S SG  . CYS F  2 76  ? 430.198 41.637  445.270 1.00 124.97 ?  99  CYS F SG  1 
ATOM   5886  N N   . SER F  2 77  ? 433.059 44.050  442.527 1.00 58.70  ?  100 SER F N   1 
ATOM   5887  C CA  . SER F  2 77  ? 433.885 45.236  442.717 1.00 53.91  ?  100 SER F CA  1 
ATOM   5888  C C   . SER F  2 77  ? 433.120 46.370  443.384 1.00 53.71  ?  100 SER F C   1 
ATOM   5889  O O   . SER F  2 77  ? 433.731 47.226  444.033 1.00 46.86  ?  100 SER F O   1 
ATOM   5890  C CB  . SER F  2 77  ? 434.444 45.699  441.369 1.00 61.15  ?  100 SER F CB  1 
ATOM   5891  O OG  . SER F  2 77  ? 434.715 47.089  441.375 1.00 57.58  ?  100 SER F OG  1 
ATOM   5892  N N   . MET F  2 78  ? 431.798 46.398  443.231 1.00 50.54  ?  101 MET F N   1 
ATOM   5893  C CA  . MET F  2 78  ? 430.961 47.409  443.854 1.00 45.85  ?  101 MET F CA  1 
ATOM   5894  C C   . MET F  2 78  ? 429.665 46.763  444.314 1.00 43.67  ?  101 MET F C   1 
ATOM   5895  O O   . MET F  2 78  ? 429.319 45.656  443.897 1.00 44.72  ?  101 MET F O   1 
ATOM   5896  C CB  . MET F  2 78  ? 430.639 48.565  442.897 1.00 48.85  ?  101 MET F CB  1 
ATOM   5897  C CG  . MET F  2 78  ? 431.746 49.582  442.743 1.00 46.06  ?  101 MET F CG  1 
ATOM   5898  S SD  . MET F  2 78  ? 431.170 51.089  441.940 1.00 57.28  ?  101 MET F SD  1 
ATOM   5899  C CE  . MET F  2 78  ? 430.346 50.411  440.501 1.00 53.00  ?  101 MET F CE  1 
ATOM   5900  N N   . CYS F  2 79  ? 428.947 47.472  445.182 1.00 50.63  ?  102 CYS F N   1 
ATOM   5901  C CA  . CYS F  2 79  ? 427.634 47.036  445.628 1.00 52.23  ?  102 CYS F CA  1 
ATOM   5902  C C   . CYS F  2 79  ? 426.726 48.252  445.749 1.00 56.92  ?  102 CYS F C   1 
ATOM   5903  O O   . CYS F  2 79  ? 427.146 49.394  445.543 1.00 60.83  ?  102 CYS F O   1 
ATOM   5904  C CB  . CYS F  2 79  ? 427.731 46.251  446.940 1.00 55.30  ?  102 CYS F CB  1 
ATOM   5905  S SG  . CYS F  2 79  ? 428.495 44.633  446.702 1.00 67.55  ?  102 CYS F SG  1 
ATOM   5906  N N   . GLU F  2 80  ? 425.468 47.997  446.098 1.00 60.91  ?  103 GLU F N   1 
ATOM   5907  C CA  . GLU F  2 80  ? 424.432 49.017  446.048 1.00 62.80  ?  103 GLU F CA  1 
ATOM   5908  C C   . GLU F  2 80  ? 423.266 48.539  446.903 1.00 69.98  ?  103 GLU F C   1 
ATOM   5909  O O   . GLU F  2 80  ? 423.262 47.414  447.403 1.00 73.72  ?  103 GLU F O   1 
ATOM   5910  C CB  . GLU F  2 80  ? 424.002 49.265  444.596 1.00 62.38  ?  103 GLU F CB  1 
ATOM   5911  C CG  . GLU F  2 80  ? 423.238 50.550  444.322 1.00 73.71  ?  103 GLU F CG  1 
ATOM   5912  C CD  . GLU F  2 80  ? 422.867 50.688  442.857 1.00 80.62  ?  103 GLU F CD  1 
ATOM   5913  O OE1 . GLU F  2 80  ? 423.072 49.716  442.098 1.00 76.62  ?  103 GLU F OE1 1 
ATOM   5914  O OE2 . GLU F  2 80  ? 422.367 51.763  442.463 1.00 82.39  -1 103 GLU F OE2 1 
ATOM   5915  N N   . GLN F  2 81  ? 422.270 49.403  447.056 1.00 62.32  ?  104 GLN F N   1 
ATOM   5916  C CA  . GLN F  2 81  ? 421.038 49.003  447.712 1.00 61.55  ?  104 GLN F CA  1 
ATOM   5917  C C   . GLN F  2 81  ? 420.192 48.151  446.769 1.00 69.35  ?  104 GLN F C   1 
ATOM   5918  O O   . GLN F  2 81  ? 420.388 48.143  445.551 1.00 74.49  ?  104 GLN F O   1 
ATOM   5919  C CB  . GLN F  2 81  ? 420.255 50.226  448.190 1.00 57.59  ?  104 GLN F CB  1 
ATOM   5920  C CG  . GLN F  2 81  ? 420.971 51.013  449.278 1.00 42.17  ?  104 GLN F CG  1 
ATOM   5921  C CD  . GLN F  2 81  ? 420.062 52.002  449.978 1.00 38.95  ?  104 GLN F CD  1 
ATOM   5922  O OE1 . GLN F  2 81  ? 418.880 52.113  449.654 1.00 37.46  ?  104 GLN F OE1 1 
ATOM   5923  N NE2 . GLN F  2 81  ? 420.609 52.723  450.950 1.00 40.54  ?  104 GLN F NE2 1 
ATOM   5924  N N   . ASP F  2 82  ? 419.249 47.412  447.352 1.00 111.54 ?  105 ASP F N   1 
ATOM   5925  C CA  . ASP F  2 82  ? 418.417 46.496  446.578 1.00 119.75 ?  105 ASP F CA  1 
ATOM   5926  C C   . ASP F  2 82  ? 417.396 47.204  445.688 1.00 128.28 ?  105 ASP F C   1 
ATOM   5927  O O   . ASP F  2 82  ? 416.690 46.518  444.939 1.00 129.18 ?  105 ASP F O   1 
ATOM   5928  C CB  . ASP F  2 82  ? 417.713 45.514  447.518 1.00 128.59 ?  105 ASP F CB  1 
ATOM   5929  C CG  . ASP F  2 82  ? 418.676 44.520  448.145 1.00 126.16 ?  105 ASP F CG  1 
ATOM   5930  O OD1 . ASP F  2 82  ? 419.803 44.928  448.495 1.00 117.58 ?  105 ASP F OD1 1 
ATOM   5931  O OD2 . ASP F  2 82  ? 418.313 43.332  448.275 1.00 132.56 -1 105 ASP F OD2 1 
ATOM   5932  N N   . CYS F  2 83  ? 417.297 48.536  445.752 1.00 92.66  ?  106 CYS F N   1 
ATOM   5933  C CA  . CYS F  2 83  ? 416.469 49.343  444.846 1.00 94.07  ?  106 CYS F CA  1 
ATOM   5934  C C   . CYS F  2 83  ? 414.987 48.967  444.955 1.00 90.62  ?  106 CYS F C   1 
ATOM   5935  O O   . CYS F  2 83  ? 414.405 48.311  444.089 1.00 94.68  ?  106 CYS F O   1 
ATOM   5936  C CB  . CYS F  2 83  ? 416.934 49.215  443.390 1.00 92.17  ?  106 CYS F CB  1 
ATOM   5937  S SG  . CYS F  2 83  ? 418.699 49.149  443.072 1.00 92.59  ?  106 CYS F SG  1 
ATOM   5938  N N   . LYS F  2 84  ? 414.397 49.393  446.064 1.00 105.07 ?  107 LYS F N   1 
ATOM   5939  C CA  . LYS F  2 84  ? 412.979 49.167  446.301 1.00 106.92 ?  107 LYS F CA  1 
ATOM   5940  C C   . LYS F  2 84  ? 412.109 50.090  445.445 1.00 101.56 ?  107 LYS F C   1 
ATOM   5941  O O   . LYS F  2 84  ? 412.526 51.171  445.017 1.00 101.59 ?  107 LYS F O   1 
ATOM   5942  C CB  . LYS F  2 84  ? 412.633 49.396  447.771 1.00 108.38 ?  107 LYS F CB  1 
ATOM   5943  C CG  . LYS F  2 84  ? 412.437 50.870  448.128 1.00 109.35 ?  107 LYS F CG  1 
ATOM   5944  C CD  . LYS F  2 84  ? 413.731 51.669  448.015 1.00 106.25 ?  107 LYS F CD  1 
ATOM   5945  C CE  . LYS F  2 84  ? 413.482 53.164  448.070 1.00 109.42 ?  107 LYS F CE  1 
ATOM   5946  N NZ  . LYS F  2 84  ? 414.734 53.935  447.830 1.00 105.70 ?  107 LYS F NZ  1 
ATOM   5947  N N   . GLN F  2 85  ? 410.884 49.624  445.196 1.00 78.50  ?  108 GLN F N   1 
ATOM   5948  C CA  . GLN F  2 85  ? 409.734 50.461  444.854 1.00 76.47  ?  108 GLN F CA  1 
ATOM   5949  C C   . GLN F  2 85  ? 409.991 51.365  443.645 1.00 68.11  ?  108 GLN F C   1 
ATOM   5950  O O   . GLN F  2 85  ? 410.212 52.569  443.762 1.00 60.60  ?  108 GLN F O   1 
ATOM   5951  C CB  . GLN F  2 85  ? 409.298 51.284  446.072 1.00 73.51  ?  108 GLN F CB  1 
ATOM   5952  C CG  . GLN F  2 85  ? 407.884 50.979  446.510 1.00 75.76  ?  108 GLN F CG  1 
ATOM   5953  C CD  . GLN F  2 85  ? 407.331 52.044  447.426 1.00 76.79  ?  108 GLN F CD  1 
ATOM   5954  O OE1 . GLN F  2 85  ? 407.894 52.314  448.483 1.00 79.09  ?  108 GLN F OE1 1 
ATOM   5955  N NE2 . GLN F  2 85  ? 406.211 52.646  447.034 1.00 74.55  ?  108 GLN F NE2 1 
ATOM   5956  N N   . GLY F  2 86  ? 409.980 50.737  442.476 1.00 88.39  ?  109 GLY F N   1 
ATOM   5957  C CA  . GLY F  2 86  ? 410.098 51.452  441.220 1.00 86.48  ?  109 GLY F CA  1 
ATOM   5958  C C   . GLY F  2 86  ? 411.445 51.354  440.557 1.00 92.54  ?  109 GLY F C   1 
ATOM   5959  O O   . GLY F  2 86  ? 411.690 52.070  439.579 1.00 98.26  ?  109 GLY F O   1 
ATOM   5960  N N   . GLN F  2 87  ? 412.330 50.504  441.065 1.00 64.01  ?  110 GLN F N   1 
ATOM   5961  C CA  . GLN F  2 87  ? 413.644 50.295  440.478 1.00 63.55  ?  110 GLN F CA  1 
ATOM   5962  C C   . GLN F  2 87  ? 413.893 48.800  440.372 1.00 60.54  ?  110 GLN F C   1 
ATOM   5963  O O   . GLN F  2 87  ? 413.948 48.106  441.391 1.00 64.26  ?  110 GLN F O   1 
ATOM   5964  C CB  . GLN F  2 87  ? 414.733 50.971  441.316 1.00 64.57  ?  110 GLN F CB  1 
ATOM   5965  C CG  . GLN F  2 87  ? 414.807 52.477  441.149 1.00 61.54  ?  110 GLN F CG  1 
ATOM   5966  C CD  . GLN F  2 87  ? 415.282 53.180  442.405 1.00 62.32  ?  110 GLN F CD  1 
ATOM   5967  O OE1 . GLN F  2 87  ? 415.747 52.541  443.350 1.00 62.17  ?  110 GLN F OE1 1 
ATOM   5968  N NE2 . GLN F  2 87  ? 415.169 54.504  442.421 1.00 54.43  ?  110 GLN F NE2 1 
ATOM   5969  N N   . GLU F  2 88  ? 414.026 48.306  439.146 1.00 65.78  ?  111 GLU F N   1 
ATOM   5970  C CA  . GLU F  2 88  ? 414.469 46.941  438.915 1.00 64.18  ?  111 GLU F CA  1 
ATOM   5971  C C   . GLU F  2 88  ? 415.982 46.933  438.774 1.00 69.92  ?  111 GLU F C   1 
ATOM   5972  O O   . GLU F  2 88  ? 416.564 47.851  438.190 1.00 75.40  ?  111 GLU F O   1 
ATOM   5973  C CB  . GLU F  2 88  ? 413.824 46.353  437.660 1.00 67.06  ?  111 GLU F CB  1 
ATOM   5974  C CG  . GLU F  2 88  ? 414.117 44.874  437.455 1.00 67.09  ?  111 GLU F CG  1 
ATOM   5975  C CD  . GLU F  2 88  ? 414.097 44.470  435.995 1.00 74.81  ?  111 GLU F CD  1 
ATOM   5976  O OE1 . GLU F  2 88  ? 415.094 43.881  435.527 1.00 78.53  ?  111 GLU F OE1 1 
ATOM   5977  O OE2 . GLU F  2 88  ? 413.084 44.740  435.314 1.00 70.92  -1 111 GLU F OE2 1 
ATOM   5978  N N   . LEU F  2 89  ? 416.623 45.905  439.323 1.00 73.43  ?  112 LEU F N   1 
ATOM   5979  C CA  . LEU F  2 89  ? 418.071 45.818  439.209 1.00 71.07  ?  112 LEU F CA  1 
ATOM   5980  C C   . LEU F  2 89  ? 418.457 45.500  437.768 1.00 76.64  ?  112 LEU F C   1 
ATOM   5981  O O   . LEU F  2 89  ? 417.957 44.543  437.168 1.00 73.14  ?  112 LEU F O   1 
ATOM   5982  C CB  . LEU F  2 89  ? 418.635 44.772  440.177 1.00 66.06  ?  112 LEU F CB  1 
ATOM   5983  C CG  . LEU F  2 89  ? 418.738 43.289  439.813 1.00 65.79  ?  112 LEU F CG  1 
ATOM   5984  C CD1 . LEU F  2 89  ? 419.610 42.553  440.819 1.00 59.81  ?  112 LEU F CD1 1 
ATOM   5985  C CD2 . LEU F  2 89  ? 417.361 42.649  439.730 1.00 66.07  ?  112 LEU F CD2 1 
ATOM   5986  N N   . THR F  2 90  ? 419.310 46.344  437.200 1.00 79.55  ?  113 THR F N   1 
ATOM   5987  C CA  . THR F  2 90  ? 419.923 46.097  435.904 1.00 74.83  ?  113 THR F CA  1 
ATOM   5988  C C   . THR F  2 90  ? 421.356 45.657  436.146 1.00 74.86  ?  113 THR F C   1 
ATOM   5989  O O   . THR F  2 90  ? 422.079 46.300  436.913 1.00 70.18  ?  113 THR F O   1 
ATOM   5990  C CB  . THR F  2 90  ? 419.888 47.352  435.027 1.00 79.70  ?  113 THR F CB  1 
ATOM   5991  O OG1 . THR F  2 90  ? 418.600 47.475  434.413 1.00 84.43  ?  113 THR F OG1 1 
ATOM   5992  C CG2 . THR F  2 90  ? 420.959 47.288  433.943 1.00 87.11  ?  113 THR F CG2 1 
ATOM   5993  N N   . LYS F  2 91  ? 421.760 44.556  435.518 1.00 83.75  ?  114 LYS F N   1 
ATOM   5994  C CA  . LYS F  2 91  ? 423.103 44.047  435.746 1.00 82.93  ?  114 LYS F CA  1 
ATOM   5995  C C   . LYS F  2 91  ? 424.126 45.126  435.424 1.00 79.95  ?  114 LYS F C   1 
ATOM   5996  O O   . LYS F  2 91  ? 424.122 45.698  434.328 1.00 84.47  ?  114 LYS F O   1 
ATOM   5997  C CB  . LYS F  2 91  ? 423.351 42.790  434.909 1.00 80.23  ?  114 LYS F CB  1 
ATOM   5998  C CG  . LYS F  2 91  ? 422.681 41.530  435.464 1.00 83.33  ?  114 LYS F CG  1 
ATOM   5999  C CD  . LYS F  2 91  ? 422.562 41.548  436.990 1.00 85.16  ?  114 LYS F CD  1 
ATOM   6000  C CE  . LYS F  2 91  ? 423.899 41.303  437.686 1.00 85.93  ?  114 LYS F CE  1 
ATOM   6001  N NZ  . LYS F  2 91  ? 423.823 41.607  439.143 1.00 73.69  1  114 LYS F NZ  1 
ATOM   6002  N N   . LYS F  2 92  ? 424.992 45.411  436.399 1.00 82.50  ?  115 LYS F N   1 
ATOM   6003  C CA  . LYS F  2 92  ? 425.907 46.553  436.376 1.00 89.91  ?  115 LYS F CA  1 
ATOM   6004  C C   . LYS F  2 92  ? 425.123 47.868  436.281 1.00 94.99  ?  115 LYS F C   1 
ATOM   6005  O O   . LYS F  2 92  ? 425.156 48.594  435.286 1.00 97.39  ?  115 LYS F O   1 
ATOM   6006  C CB  . LYS F  2 92  ? 426.928 46.409  435.241 1.00 97.67  ?  115 LYS F CB  1 
ATOM   6007  C CG  . LYS F  2 92  ? 427.825 45.189  435.398 1.00 92.57  ?  115 LYS F CG  1 
ATOM   6008  C CD  . LYS F  2 92  ? 428.481 44.796  434.084 1.00 85.05  ?  115 LYS F CD  1 
ATOM   6009  C CE  . LYS F  2 92  ? 429.818 44.109  434.322 1.00 83.41  ?  115 LYS F CE  1 
ATOM   6010  N NZ  . LYS F  2 92  ? 429.653 42.717  434.831 1.00 80.61  1  115 LYS F NZ  1 
ATOM   6011  N N   . GLY F  2 93  ? 424.404 48.136  437.357 1.00 101.73 ?  116 GLY F N   1 
ATOM   6012  C CA  . GLY F  2 93  ? 423.602 49.339  437.479 1.00 91.61  ?  116 GLY F CA  1 
ATOM   6013  C C   . GLY F  2 93  ? 422.386 49.057  438.337 1.00 97.66  ?  116 GLY F C   1 
ATOM   6014  O O   . GLY F  2 93  ? 422.244 47.984  438.915 1.00 95.71  ?  116 GLY F O   1 
ATOM   6015  N N   . CYS F  2 94  ? 421.523 50.065  438.449 1.00 79.67  ?  117 CYS F N   1 
ATOM   6016  C CA  . CYS F  2 94  ? 420.160 49.810  438.898 1.00 73.67  ?  117 CYS F CA  1 
ATOM   6017  C C   . CYS F  2 94  ? 419.221 50.718  438.120 1.00 74.07  ?  117 CYS F C   1 
ATOM   6018  O O   . CYS F  2 94  ? 419.375 51.945  438.147 1.00 78.01  ?  117 CYS F O   1 
ATOM   6019  C CB  . CYS F  2 94  ? 420.001 50.019  440.409 1.00 66.66  ?  117 CYS F CB  1 
ATOM   6020  S SG  . CYS F  2 94  ? 418.696 48.947  441.035 1.00 77.01  ?  117 CYS F SG  1 
ATOM   6021  N N   . LYS F  2 95  ? 418.251 50.119  437.438 1.00 104.48 ?  118 LYS F N   1 
ATOM   6022  C CA  . LYS F  2 95  ? 417.388 50.850  436.524 1.00 105.97 ?  118 LYS F CA  1 
ATOM   6023  C C   . LYS F  2 95  ? 416.257 51.562  437.266 1.00 103.11 ?  118 LYS F C   1 
ATOM   6024  O O   . LYS F  2 95  ? 415.869 51.194  438.378 1.00 94.75  ?  118 LYS F O   1 
ATOM   6025  C CB  . LYS F  2 95  ? 416.838 49.909  435.448 1.00 111.71 ?  118 LYS F CB  1 
ATOM   6026  C CG  . LYS F  2 95  ? 415.424 49.394  435.654 1.00 103.66 ?  118 LYS F CG  1 
ATOM   6027  C CD  . LYS F  2 95  ? 415.113 48.309  434.628 1.00 102.43 ?  118 LYS F CD  1 
ATOM   6028  C CE  . LYS F  2 95  ? 413.630 48.213  434.313 1.00 97.52  ?  118 LYS F CE  1 
ATOM   6029  N NZ  . LYS F  2 95  ? 413.350 47.168  433.288 1.00 96.66  1  118 LYS F NZ  1 
ATOM   6030  N N   . ASP F  2 96  ? 415.730 52.601  436.616 1.00 92.62  ?  119 ASP F N   1 
ATOM   6031  C CA  . ASP F  2 96  ? 414.674 53.464  437.129 1.00 85.98  ?  119 ASP F CA  1 
ATOM   6032  C C   . ASP F  2 96  ? 413.279 52.933  436.798 1.00 85.63  ?  119 ASP F C   1 
ATOM   6033  O O   . ASP F  2 96  ? 412.299 53.683  436.889 1.00 90.27  ?  119 ASP F O   1 
ATOM   6034  C CB  . ASP F  2 96  ? 414.847 54.892  436.601 1.00 90.46  ?  119 ASP F CB  1 
ATOM   6035  C CG  . ASP F  2 96  ? 414.034 55.911  437.387 1.00 94.63  ?  119 ASP F CG  1 
ATOM   6036  O OD1 . ASP F  2 96  ? 414.371 56.159  438.565 1.00 86.19  ?  119 ASP F OD1 1 
ATOM   6037  O OD2 . ASP F  2 96  ? 413.059 56.457  436.829 1.00 102.11 -1 119 ASP F OD2 1 
ATOM   6038  N N   . CYS F  2 97  ? 413.185 51.660  436.401 1.00 101.04 ?  120 CYS F N   1 
ATOM   6039  C CA  . CYS F  2 97  ? 412.051 51.041  435.720 1.00 102.32 ?  120 CYS F CA  1 
ATOM   6040  C C   . CYS F  2 97  ? 411.921 51.597  434.307 1.00 102.58 ?  120 CYS F C   1 
ATOM   6041  O O   . CYS F  2 97  ? 412.930 51.737  433.607 1.00 104.08 ?  120 CYS F O   1 
ATOM   6042  C CB  . CYS F  2 97  ? 410.760 51.261  436.514 1.00 91.05  ?  120 CYS F CB  1 
ATOM   6043  S SG  . CYS F  2 97  ? 409.539 49.931  436.518 1.00 104.79 ?  120 CYS F SG  1 
ATOM   6044  N N   . CYS F  2 98  ? 410.714 51.927  433.872 1.00 118.98 ?  121 CYS F N   1 
ATOM   6045  C CA  . CYS F  2 98  ? 410.495 52.234  432.459 1.00 126.15 ?  121 CYS F CA  1 
ATOM   6046  C C   . CYS F  2 98  ? 409.124 52.882  432.307 1.00 125.74 ?  121 CYS F C   1 
ATOM   6047  O O   . CYS F  2 98  ? 408.439 53.171  433.295 1.00 123.00 ?  121 CYS F O   1 
ATOM   6048  C CB  . CYS F  2 98  ? 410.628 50.977  431.596 1.00 128.38 ?  121 CYS F CB  1 
ATOM   6049  S SG  . CYS F  2 98  ? 410.623 51.280  429.815 1.00 151.94 ?  121 CYS F SG  1 
ATOM   6050  N N   . PHE F  2 99  ? 408.727 53.109  431.057 1.00 115.41 ?  122 PHE F N   1 
ATOM   6051  C CA  . PHE F  2 99  ? 407.435 53.699  430.730 1.00 109.64 ?  122 PHE F CA  1 
ATOM   6052  C C   . PHE F  2 99  ? 406.441 52.570  430.491 1.00 100.64 ?  122 PHE F C   1 
ATOM   6053  O O   . PHE F  2 99  ? 406.584 51.798  429.537 1.00 107.88 ?  122 PHE F O   1 
ATOM   6054  C CB  . PHE F  2 99  ? 407.552 54.599  429.503 1.00 113.11 ?  122 PHE F CB  1 
ATOM   6055  C CG  . PHE F  2 99  ? 408.617 55.653  429.621 1.00 120.66 ?  122 PHE F CG  1 
ATOM   6056  C CD1 . PHE F  2 99  ? 408.327 56.893  430.165 1.00 122.81 ?  122 PHE F CD1 1 
ATOM   6057  C CD2 . PHE F  2 99  ? 409.909 55.404  429.186 1.00 123.84 ?  122 PHE F CD2 1 
ATOM   6058  C CE1 . PHE F  2 99  ? 409.304 57.865  430.274 1.00 127.40 ?  122 PHE F CE1 1 
ATOM   6059  C CE2 . PHE F  2 99  ? 410.891 56.370  429.294 1.00 121.60 ?  122 PHE F CE2 1 
ATOM   6060  C CZ  . PHE F  2 99  ? 410.589 57.602  429.838 1.00 126.75 ?  122 PHE F CZ  1 
ATOM   6061  N N   . GLY F  2 100 ? 405.436 52.471  431.354 1.00 38.54  ?  123 GLY F N   1 
ATOM   6062  C CA  . GLY F  2 100 ? 404.444 51.424  431.257 1.00 42.08  ?  123 GLY F CA  1 
ATOM   6063  C C   . GLY F  2 100 ? 404.661 50.237  432.168 1.00 41.06  ?  123 GLY F C   1 
ATOM   6064  O O   . GLY F  2 100 ? 403.975 49.221  432.002 1.00 42.94  ?  123 GLY F O   1 
ATOM   6065  N N   . THR F  2 101 ? 405.588 50.327  433.117 1.00 54.75  ?  124 THR F N   1 
ATOM   6066  C CA  . THR F  2 101 ? 405.857 49.252  434.058 1.00 54.48  ?  124 THR F CA  1 
ATOM   6067  C C   . THR F  2 101 ? 405.825 49.801  435.477 1.00 55.08  ?  124 THR F C   1 
ATOM   6068  O O   . THR F  2 101 ? 405.956 51.007  435.703 1.00 59.55  ?  124 THR F O   1 
ATOM   6069  C CB  . THR F  2 101 ? 407.212 48.583  433.783 1.00 60.09  ?  124 THR F CB  1 
ATOM   6070  O OG1 . THR F  2 101 ? 408.231 49.586  433.677 1.00 72.21  ?  124 THR F OG1 1 
ATOM   6071  C CG2 . THR F  2 101 ? 407.160 47.779  432.492 1.00 56.39  ?  124 THR F CG2 1 
ATOM   6072  N N   . PHE F  2 102 ? 405.645 48.897  436.438 1.00 53.37  ?  125 PHE F N   1 
ATOM   6073  C CA  . PHE F  2 102 ? 405.587 49.277  437.842 1.00 52.77  ?  125 PHE F CA  1 
ATOM   6074  C C   . PHE F  2 102 ? 406.200 48.169  438.684 1.00 52.16  ?  125 PHE F C   1 
ATOM   6075  O O   . PHE F  2 102 ? 406.045 46.985  438.372 1.00 61.62  ?  125 PHE F O   1 
ATOM   6076  C CB  . PHE F  2 102 ? 404.147 49.550  438.295 1.00 54.54  ?  125 PHE F CB  1 
ATOM   6077  C CG  . PHE F  2 102 ? 403.436 48.336  438.823 1.00 57.69  ?  125 PHE F CG  1 
ATOM   6078  C CD1 . PHE F  2 102 ? 402.908 47.393  437.955 1.00 60.30  ?  125 PHE F CD1 1 
ATOM   6079  C CD2 . PHE F  2 102 ? 403.297 48.136  440.188 1.00 55.70  ?  125 PHE F CD2 1 
ATOM   6080  C CE1 . PHE F  2 102 ? 402.257 46.273  438.439 1.00 60.79  ?  125 PHE F CE1 1 
ATOM   6081  C CE2 . PHE F  2 102 ? 402.649 47.017  440.677 1.00 58.38  ?  125 PHE F CE2 1 
ATOM   6082  C CZ  . PHE F  2 102 ? 402.127 46.085  439.802 1.00 60.28  ?  125 PHE F CZ  1 
ATOM   6083  N N   . ASN F  2 103 ? 406.910 48.560  439.741 1.00 38.84  ?  126 ASN F N   1 
ATOM   6084  C CA  . ASN F  2 103 ? 407.434 47.614  440.719 1.00 41.54  ?  126 ASN F CA  1 
ATOM   6085  C C   . ASN F  2 103 ? 407.217 48.180  442.111 1.00 39.23  ?  126 ASN F C   1 
ATOM   6086  O O   . ASN F  2 103 ? 407.754 49.244  442.437 1.00 44.36  ?  126 ASN F O   1 
ATOM   6087  C CB  . ASN F  2 103 ? 408.923 47.336  440.480 1.00 45.18  ?  126 ASN F CB  1 
ATOM   6088  C CG  . ASN F  2 103 ? 409.570 46.573  441.625 1.00 40.70  ?  126 ASN F CG  1 
ATOM   6089  O OD1 . ASN F  2 103 ? 408.919 45.782  442.308 1.00 43.57  ?  126 ASN F OD1 1 
ATOM   6090  N ND2 . ASN F  2 103 ? 410.858 46.812  441.840 1.00 41.77  ?  126 ASN F ND2 1 
ATOM   6091  N N   . ASP F  2 104 ? 406.433 47.483  442.928 1.00 89.91  ?  127 ASP F N   1 
ATOM   6092  C CA  . ASP F  2 104 ? 406.343 47.774  444.357 1.00 93.53  ?  127 ASP F CA  1 
ATOM   6093  C C   . ASP F  2 104 ? 406.875 46.561  445.114 1.00 101.97 ?  127 ASP F C   1 
ATOM   6094  O O   . ASP F  2 104 ? 406.173 45.554  445.246 1.00 109.19 ?  127 ASP F O   1 
ATOM   6095  C CB  . ASP F  2 104 ? 404.908 48.102  444.757 1.00 94.25  ?  127 ASP F CB  1 
ATOM   6096  C CG  . ASP F  2 104 ? 404.748 48.284  446.251 1.00 108.81 ?  127 ASP F CG  1 
ATOM   6097  O OD1 . ASP F  2 104 ? 405.581 48.988  446.860 1.00 106.89 -1 127 ASP F OD1 1 
ATOM   6098  O OD2 . ASP F  2 104 ? 403.788 47.718  446.814 1.00 114.58 ?  127 ASP F OD2 1 
ATOM   6099  N N   . GLN F  2 105 ? 408.098 46.690  445.636 1.00 85.98  ?  128 GLN F N   1 
ATOM   6100  C CA  . GLN F  2 105 ? 408.779 45.668  446.428 1.00 90.08  ?  128 GLN F CA  1 
ATOM   6101  C C   . GLN F  2 105 ? 410.209 46.127  446.681 1.00 94.45  ?  128 GLN F C   1 
ATOM   6102  O O   . GLN F  2 105 ? 410.701 47.023  445.987 1.00 95.49  ?  128 GLN F O   1 
ATOM   6103  C CB  . GLN F  2 105 ? 408.770 44.310  445.715 1.00 97.78  ?  128 GLN F CB  1 
ATOM   6104  C CG  . GLN F  2 105 ? 409.278 43.131  446.537 1.00 94.92  ?  128 GLN F CG  1 
ATOM   6105  C CD  . GLN F  2 105 ? 408.276 42.660  447.570 1.00 89.92  ?  128 GLN F CD  1 
ATOM   6106  O OE1 . GLN F  2 105 ? 407.169 42.242  447.232 1.00 93.73  ?  128 GLN F OE1 1 
ATOM   6107  N NE2 . GLN F  2 105 ? 408.662 42.718  448.840 1.00 75.86  ?  128 GLN F NE2 1 
ATOM   6108  N N   . LYS F  2 106 ? 410.891 45.528  447.658 1.00 73.71  ?  129 LYS F N   1 
ATOM   6109  C CA  . LYS F  2 106 ? 412.321 45.774  447.813 1.00 62.93  ?  129 LYS F CA  1 
ATOM   6110  C C   . LYS F  2 106 ? 413.126 44.977  446.790 1.00 63.97  ?  129 LYS F C   1 
ATOM   6111  O O   . LYS F  2 106 ? 414.027 45.518  446.140 1.00 57.84  ?  129 LYS F O   1 
ATOM   6112  C CB  . LYS F  2 106 ? 412.764 45.435  449.237 1.00 65.77  ?  129 LYS F CB  1 
ATOM   6113  C CG  . LYS F  2 106 ? 412.221 46.387  450.293 1.00 66.74  ?  129 LYS F CG  1 
ATOM   6114  C CD  . LYS F  2 106 ? 412.447 45.853  451.700 1.00 59.98  ?  129 LYS F CD  1 
ATOM   6115  C CE  . LYS F  2 106 ? 413.925 45.657  451.988 1.00 55.78  ?  129 LYS F CE  1 
ATOM   6116  N NZ  . LYS F  2 106 ? 414.156 45.087  453.344 1.00 45.73  ?  129 LYS F NZ  1 
ATOM   6117  N N   . ARG F  2 107 ? 412.807 43.694  446.633 1.00 67.33  ?  130 ARG F N   1 
ATOM   6118  C CA  . ARG F  2 107 ? 413.465 42.820  445.671 1.00 64.33  ?  130 ARG F CA  1 
ATOM   6119  C C   . ARG F  2 107 ? 412.725 42.730  444.344 1.00 58.62  ?  130 ARG F C   1 
ATOM   6120  O O   . ARG F  2 107 ? 413.138 41.958  443.473 1.00 65.64  ?  130 ARG F O   1 
ATOM   6121  C CB  . ARG F  2 107 ? 413.616 41.410  446.253 1.00 67.14  ?  130 ARG F CB  1 
ATOM   6122  C CG  . ARG F  2 107 ? 414.225 41.355  447.641 1.00 73.39  ?  130 ARG F CG  1 
ATOM   6123  C CD  . ARG F  2 107 ? 415.658 41.847  447.639 1.00 66.27  ?  130 ARG F CD  1 
ATOM   6124  N NE  . ARG F  2 107 ? 415.861 42.925  448.602 1.00 69.61  ?  130 ARG F NE  1 
ATOM   6125  C CZ  . ARG F  2 107 ? 416.120 42.733  449.891 1.00 78.15  ?  130 ARG F CZ  1 
ATOM   6126  N NH1 . ARG F  2 107 ? 416.292 43.772  450.696 1.00 76.09  ?  130 ARG F NH1 1 
ATOM   6127  N NH2 . ARG F  2 107 ? 416.211 41.502  450.376 1.00 84.42  ?  130 ARG F NH2 1 
ATOM   6128  N N   . GLY F  2 108 ? 411.647 43.488  444.173 1.00 67.66  ?  131 GLY F N   1 
ATOM   6129  C CA  . GLY F  2 108 ? 410.751 43.283  443.056 1.00 67.68  ?  131 GLY F CA  1 
ATOM   6130  C C   . GLY F  2 108 ? 411.374 43.570  441.704 1.00 55.98  ?  131 GLY F C   1 
ATOM   6131  O O   . GLY F  2 108 ? 412.443 44.165  441.569 1.00 52.05  ?  131 GLY F O   1 
ATOM   6132  N N   . ILE F  2 109 ? 410.661 43.120  440.675 1.00 43.93  ?  132 ILE F N   1 
ATOM   6133  C CA  . ILE F  2 109 ? 411.054 43.282  439.282 1.00 47.93  ?  132 ILE F CA  1 
ATOM   6134  C C   . ILE F  2 109 ? 409.957 44.059  438.571 1.00 47.98  ?  132 ILE F C   1 
ATOM   6135  O O   . ILE F  2 109 ? 408.767 43.820  438.804 1.00 53.16  ?  132 ILE F O   1 
ATOM   6136  C CB  . ILE F  2 109 ? 411.291 41.916  438.605 1.00 49.40  ?  132 ILE F CB  1 
ATOM   6137  C CG1 . ILE F  2 109 ? 412.301 41.095  439.408 1.00 52.16  ?  132 ILE F CG1 1 
ATOM   6138  C CG2 . ILE F  2 109 ? 411.761 42.098  437.171 1.00 49.33  ?  132 ILE F CG2 1 
ATOM   6139  C CD1 . ILE F  2 109 ? 412.360 39.640  439.009 1.00 53.63  ?  132 ILE F CD1 1 
ATOM   6140  N N   . CYS F  2 110 ? 410.357 44.991  437.710 1.00 60.51  ?  133 CYS F N   1 
ATOM   6141  C CA  . CYS F  2 110 ? 409.387 45.836  437.025 1.00 62.84  ?  133 CYS F CA  1 
ATOM   6142  C C   . CYS F  2 110 ? 408.516 45.010  436.085 1.00 57.69  ?  133 CYS F C   1 
ATOM   6143  O O   . CYS F  2 110 ? 409.020 44.269  435.236 1.00 62.37  ?  133 CYS F O   1 
ATOM   6144  C CB  . CYS F  2 110 ? 410.097 46.958  436.270 1.00 72.22  ?  133 CYS F CB  1 
ATOM   6145  S SG  . CYS F  2 110 ? 410.505 48.349  437.353 1.00 74.94  ?  133 CYS F SG  1 
ATOM   6146  N N   . ARG F  2 111 ? 407.203 45.142  436.249 1.00 72.98  ?  134 ARG F N   1 
ATOM   6147  C CA  . ARG F  2 111 ? 406.178 44.416  435.519 1.00 75.38  ?  134 ARG F CA  1 
ATOM   6148  C C   . ARG F  2 111 ? 405.180 45.400  434.925 1.00 80.05  ?  134 ARG F C   1 
ATOM   6149  O O   . ARG F  2 111 ? 404.919 46.454  435.514 1.00 86.05  ?  134 ARG F O   1 
ATOM   6150  C CB  . ARG F  2 111 ? 405.452 43.425  436.440 1.00 73.41  ?  134 ARG F CB  1 
ATOM   6151  C CG  . ARG F  2 111 ? 405.595 43.759  437.919 1.00 75.24  ?  134 ARG F CG  1 
ATOM   6152  C CD  . ARG F  2 111 ? 404.879 42.758  438.810 1.00 77.77  ?  134 ARG F CD  1 
ATOM   6153  N NE  . ARG F  2 111 ? 403.447 43.027  438.906 1.00 82.48  ?  134 ARG F NE  1 
ATOM   6154  C CZ  . ARG F  2 111 ? 402.635 42.434  439.775 1.00 87.29  ?  134 ARG F CZ  1 
ATOM   6155  N NH1 . ARG F  2 111 ? 403.114 41.537  440.627 1.00 71.69  ?  134 ARG F NH1 1 
ATOM   6156  N NH2 . ARG F  2 111 ? 401.344 42.738  439.795 1.00 97.62  ?  134 ARG F NH2 1 
ATOM   6157  N N   . PRO F  2 112 ? 404.614 45.086  433.761 1.00 42.69  ?  135 PRO F N   1 
ATOM   6158  C CA  . PRO F  2 112 ? 403.709 46.034  433.102 1.00 45.92  ?  135 PRO F CA  1 
ATOM   6159  C C   . PRO F  2 112 ? 402.456 46.302  433.925 1.00 52.86  ?  135 PRO F C   1 
ATOM   6160  O O   . PRO F  2 112 ? 402.059 45.515  434.788 1.00 55.57  ?  135 PRO F O   1 
ATOM   6161  C CB  . PRO F  2 112 ? 403.364 45.338  431.779 1.00 46.55  ?  135 PRO F CB  1 
ATOM   6162  C CG  . PRO F  2 112 ? 404.471 44.356  431.562 1.00 36.99  ?  135 PRO F CG  1 
ATOM   6163  C CD  . PRO F  2 112 ? 404.864 43.895  432.932 1.00 37.01  ?  135 PRO F CD  1 
ATOM   6164  N N   . TRP F  2 113 ? 401.833 47.444  433.643 1.00 60.48  ?  136 TRP F N   1 
ATOM   6165  C CA  . TRP F  2 113 ? 400.612 47.835  434.328 1.00 58.99  ?  136 TRP F CA  1 
ATOM   6166  C C   . TRP F  2 113 ? 399.456 46.918  433.940 1.00 64.80  ?  136 TRP F C   1 
ATOM   6167  O O   . TRP F  2 113 ? 399.476 46.244  432.907 1.00 66.12  ?  136 TRP F O   1 
ATOM   6168  C CB  . TRP F  2 113 ? 400.240 49.280  433.991 1.00 64.27  ?  136 TRP F CB  1 
ATOM   6169  C CG  . TRP F  2 113 ? 401.235 50.304  434.432 1.00 59.19  ?  136 TRP F CG  1 
ATOM   6170  C CD1 . TRP F  2 113 ? 402.135 50.191  435.452 1.00 57.83  ?  136 TRP F CD1 1 
ATOM   6171  C CD2 . TRP F  2 113 ? 401.435 51.602  433.861 1.00 53.76  ?  136 TRP F CD2 1 
ATOM   6172  N NE1 . TRP F  2 113 ? 402.880 51.342  435.553 1.00 57.17  ?  136 TRP F NE1 1 
ATOM   6173  C CE2 . TRP F  2 113 ? 402.470 52.223  434.587 1.00 57.03  ?  136 TRP F CE2 1 
ATOM   6174  C CE3 . TRP F  2 113 ? 400.838 52.300  432.807 1.00 51.04  ?  136 TRP F CE3 1 
ATOM   6175  C CZ2 . TRP F  2 113 ? 402.922 53.507  434.292 1.00 62.73  ?  136 TRP F CZ2 1 
ATOM   6176  C CZ3 . TRP F  2 113 ? 401.287 53.575  432.516 1.00 52.39  ?  136 TRP F CZ3 1 
ATOM   6177  C CH2 . TRP F  2 113 ? 402.318 54.166  433.256 1.00 62.77  ?  136 TRP F CH2 1 
ATOM   6178  N N   . THR F  2 114 ? 398.435 46.902  434.792 1.00 91.60  ?  137 THR F N   1 
ATOM   6179  C CA  . THR F  2 114 ? 397.200 46.194  434.482 1.00 95.32  ?  137 THR F CA  1 
ATOM   6180  C C   . THR F  2 114 ? 396.391 47.023  433.491 1.00 97.85  ?  137 THR F C   1 
ATOM   6181  O O   . THR F  2 114 ? 396.045 48.175  433.776 1.00 100.66 ?  137 THR F O   1 
ATOM   6182  C CB  . THR F  2 114 ? 396.396 45.935  435.754 1.00 92.78  ?  137 THR F CB  1 
ATOM   6183  O OG1 . THR F  2 114 ? 397.173 45.140  436.660 1.00 78.85  ?  137 THR F OG1 1 
ATOM   6184  C CG2 . THR F  2 114 ? 395.101 45.205  435.427 1.00 103.95 ?  137 THR F CG2 1 
ATOM   6185  N N   . ASN F  2 115 ? 396.089 46.441  432.333 1.00 92.28  ?  138 ASN F N   1 
ATOM   6186  C CA  . ASN F  2 115 ? 395.350 47.135  431.288 1.00 94.98  ?  138 ASN F CA  1 
ATOM   6187  C C   . ASN F  2 115 ? 393.859 46.912  431.508 1.00 100.61 ?  138 ASN F C   1 
ATOM   6188  O O   . ASN F  2 115 ? 393.386 45.771  431.478 1.00 103.93 ?  138 ASN F O   1 
ATOM   6189  C CB  . ASN F  2 115 ? 395.776 46.644  429.905 1.00 90.64  ?  138 ASN F CB  1 
ATOM   6190  C CG  . ASN F  2 115 ? 395.397 47.609  428.798 1.00 91.78  ?  138 ASN F CG  1 
ATOM   6191  O OD1 . ASN F  2 115 ? 394.519 48.457  428.968 1.00 94.81  ?  138 ASN F OD1 1 
ATOM   6192  N ND2 . ASN F  2 115 ? 396.060 47.486  427.654 1.00 86.22  ?  138 ASN F ND2 1 
ATOM   6193  N N   . CYS F  2 116 ? 393.121 48.002  431.730 1.00 100.52 ?  139 CYS F N   1 
ATOM   6194  C CA  . CYS F  2 116 ? 391.698 47.897  432.029 1.00 104.65 ?  139 CYS F CA  1 
ATOM   6195  C C   . CYS F  2 116 ? 390.863 47.511  430.815 1.00 100.58 ?  139 CYS F C   1 
ATOM   6196  O O   . CYS F  2 116 ? 389.681 47.190  430.978 1.00 98.16  ?  139 CYS F O   1 
ATOM   6197  C CB  . CYS F  2 116 ? 391.190 49.216  432.616 1.00 96.85  ?  139 CYS F CB  1 
ATOM   6198  S SG  . CYS F  2 116 ? 392.169 49.845  434.006 1.00 94.36  ?  139 CYS F SG  1 
ATOM   6199  N N   . SER F  2 117 ? 391.439 47.534  429.610 1.00 93.92  ?  140 SER F N   1 
ATOM   6200  C CA  . SER F  2 117 ? 390.701 47.089  428.433 1.00 93.20  ?  140 SER F CA  1 
ATOM   6201  C C   . SER F  2 117 ? 390.448 45.587  428.468 1.00 94.45  ?  140 SER F C   1 
ATOM   6202  O O   . SER F  2 117 ? 389.416 45.122  427.970 1.00 93.55  ?  140 SER F O   1 
ATOM   6203  C CB  . SER F  2 117 ? 391.454 47.473  427.160 1.00 92.27  ?  140 SER F CB  1 
ATOM   6204  O OG  . SER F  2 117 ? 391.542 48.881  427.027 1.00 83.46  ?  140 SER F OG  1 
ATOM   6205  N N   . LEU F  2 118 ? 391.374 44.816  429.045 1.00 104.44 ?  141 LEU F N   1 
ATOM   6206  C CA  . LEU F  2 118 ? 391.147 43.383  429.208 1.00 102.78 ?  141 LEU F CA  1 
ATOM   6207  C C   . LEU F  2 118 ? 389.962 43.120  430.128 1.00 106.49 ?  141 LEU F C   1 
ATOM   6208  O O   . LEU F  2 118 ? 389.197 42.172  429.913 1.00 115.01 ?  141 LEU F O   1 
ATOM   6209  C CB  . LEU F  2 118 ? 392.408 42.708  429.749 1.00 106.34 ?  141 LEU F CB  1 
ATOM   6210  C CG  . LEU F  2 118 ? 393.509 42.366  428.742 1.00 105.71 ?  141 LEU F CG  1 
ATOM   6211  C CD1 . LEU F  2 118 ? 394.815 42.059  429.460 1.00 92.34  ?  141 LEU F CD1 1 
ATOM   6212  C CD2 . LEU F  2 118 ? 393.091 41.195  427.865 1.00 100.47 ?  141 LEU F CD2 1 
ATOM   6213  N N   . ASP F  2 119 ? 389.795 43.947  431.158 1.00 92.67  ?  142 ASP F N   1 
ATOM   6214  C CA  . ASP F  2 119 ? 388.672 43.824  432.076 1.00 91.10  ?  142 ASP F CA  1 
ATOM   6215  C C   . ASP F  2 119 ? 387.462 44.643  431.646 1.00 92.71  ?  142 ASP F C   1 
ATOM   6216  O O   . ASP F  2 119 ? 386.389 44.495  432.240 1.00 93.22  ?  142 ASP F O   1 
ATOM   6217  C CB  . ASP F  2 119 ? 389.098 44.243  433.488 1.00 101.47 ?  142 ASP F CB  1 
ATOM   6218  C CG  . ASP F  2 119 ? 388.195 43.673  434.565 1.00 95.65  ?  142 ASP F CG  1 
ATOM   6219  O OD1 . ASP F  2 119 ? 387.690 42.546  434.382 1.00 87.31  ?  142 ASP F OD1 1 
ATOM   6220  O OD2 . ASP F  2 119 ? 387.994 44.351  435.595 1.00 92.92  -1 142 ASP F OD2 1 
ATOM   6221  N N   . GLY F  2 120 ? 387.605 45.494  430.630 1.00 93.39  ?  143 GLY F N   1 
ATOM   6222  C CA  . GLY F  2 120 ? 386.507 46.300  430.139 1.00 92.32  ?  143 GLY F CA  1 
ATOM   6223  C C   . GLY F  2 120 ? 386.183 47.531  430.957 1.00 91.09  ?  143 GLY F C   1 
ATOM   6224  O O   . GLY F  2 120 ? 385.243 48.255  430.606 1.00 87.34  ?  143 GLY F O   1 
ATOM   6225  N N   . LYS F  2 121 ? 386.924 47.797  432.030 1.00 98.34  ?  144 LYS F N   1 
ATOM   6226  C CA  . LYS F  2 121 ? 386.665 48.941  432.890 1.00 91.69  ?  144 LYS F CA  1 
ATOM   6227  C C   . LYS F  2 121 ? 387.403 50.171  432.363 1.00 86.89  ?  144 LYS F C   1 
ATOM   6228  O O   . LYS F  2 121 ? 387.975 50.164  431.270 1.00 88.59  ?  144 LYS F O   1 
ATOM   6229  C CB  . LYS F  2 121 ? 387.070 48.623  434.328 1.00 94.34  ?  144 LYS F CB  1 
ATOM   6230  C CG  . LYS F  2 121 ? 386.208 47.579  435.018 1.00 95.68  ?  144 LYS F CG  1 
ATOM   6231  C CD  . LYS F  2 121 ? 386.642 47.392  436.464 1.00 94.40  ?  144 LYS F CD  1 
ATOM   6232  C CE  . LYS F  2 121 ? 385.690 46.483  437.222 1.00 101.02 ?  144 LYS F CE  1 
ATOM   6233  N NZ  . LYS F  2 121 ? 386.060 46.378  438.661 1.00 93.24  ?  144 LYS F NZ  1 
ATOM   6234  N N   . SER F  2 122 ? 387.393 51.245  433.145 1.00 76.08  ?  145 SER F N   1 
ATOM   6235  C CA  . SER F  2 122 ? 388.132 52.464  432.853 1.00 77.07  ?  145 SER F CA  1 
ATOM   6236  C C   . SER F  2 122 ? 389.230 52.654  433.895 1.00 81.76  ?  145 SER F C   1 
ATOM   6237  O O   . SER F  2 122 ? 389.396 51.845  434.813 1.00 85.65  ?  145 SER F O   1 
ATOM   6238  C CB  . SER F  2 122 ? 387.189 53.669  432.808 1.00 73.06  ?  145 SER F CB  1 
ATOM   6239  O OG  . SER F  2 122 ? 386.460 53.791  434.016 1.00 81.36  ?  145 SER F OG  1 
ATOM   6240  N N   . VAL F  2 123 ? 389.980 53.741  433.753 1.00 58.41  ?  146 VAL F N   1 
ATOM   6241  C CA  . VAL F  2 123 ? 391.136 54.014  434.599 1.00 55.95  ?  146 VAL F CA  1 
ATOM   6242  C C   . VAL F  2 123 ? 390.725 55.005  435.683 1.00 55.19  ?  146 VAL F C   1 
ATOM   6243  O O   . VAL F  2 123 ? 390.406 56.165  435.398 1.00 52.74  ?  146 VAL F O   1 
ATOM   6244  C CB  . VAL F  2 123 ? 392.324 54.533  433.776 1.00 56.28  ?  146 VAL F CB  1 
ATOM   6245  C CG1 . VAL F  2 123 ? 393.012 53.378  433.068 1.00 59.09  ?  146 VAL F CG1 1 
ATOM   6246  C CG2 . VAL F  2 123 ? 391.857 55.563  432.755 1.00 63.67  ?  146 VAL F CG2 1 
ATOM   6247  N N   . LEU F  2 124 ? 390.723 54.545  436.936 1.00 63.42  ?  147 LEU F N   1 
ATOM   6248  C CA  . LEU F  2 124 ? 390.492 55.447  438.060 1.00 56.32  ?  147 LEU F CA  1 
ATOM   6249  C C   . LEU F  2 124 ? 391.727 56.289  438.354 1.00 56.22  ?  147 LEU F C   1 
ATOM   6250  O O   . LEU F  2 124 ? 391.633 57.513  438.502 1.00 59.13  ?  147 LEU F O   1 
ATOM   6251  C CB  . LEU F  2 124 ? 390.080 54.653  439.301 1.00 56.30  ?  147 LEU F CB  1 
ATOM   6252  C CG  . LEU F  2 124 ? 388.605 54.268  439.430 1.00 59.36  ?  147 LEU F CG  1 
ATOM   6253  C CD1 . LEU F  2 124 ? 388.375 53.456  440.694 1.00 56.43  ?  147 LEU F CD1 1 
ATOM   6254  C CD2 . LEU F  2 124 ? 387.731 55.511  439.423 1.00 57.11  ?  147 LEU F CD2 1 
ATOM   6255  N N   . VAL F  2 125 ? 392.892 55.650  438.449 1.00 62.00  ?  148 VAL F N   1 
ATOM   6256  C CA  . VAL F  2 125 ? 394.152 56.328  438.739 1.00 62.03  ?  148 VAL F CA  1 
ATOM   6257  C C   . VAL F  2 125 ? 395.201 55.814  437.766 1.00 64.18  ?  148 VAL F C   1 
ATOM   6258  O O   . VAL F  2 125 ? 395.483 54.610  437.728 1.00 70.23  ?  148 VAL F O   1 
ATOM   6259  C CB  . VAL F  2 125 ? 394.612 56.105  440.190 1.00 56.48  ?  148 VAL F CB  1 
ATOM   6260  C CG1 . VAL F  2 125 ? 395.899 56.865  440.459 1.00 59.78  ?  148 VAL F CG1 1 
ATOM   6261  C CG2 . VAL F  2 125 ? 393.531 56.520  441.171 1.00 48.49  ?  148 VAL F CG2 1 
ATOM   6262  N N   . ASN F  2 126 ? 395.780 56.722  436.984 1.00 45.74  ?  149 ASN F N   1 
ATOM   6263  C CA  . ASN F  2 126 ? 396.843 56.354  436.059 1.00 48.34  ?  149 ASN F CA  1 
ATOM   6264  C C   . ASN F  2 126 ? 398.094 55.958  436.835 1.00 48.18  ?  149 ASN F C   1 
ATOM   6265  O O   . ASN F  2 126 ? 398.475 56.614  437.808 1.00 44.67  ?  149 ASN F O   1 
ATOM   6266  C CB  . ASN F  2 126 ? 397.138 57.524  435.119 1.00 60.74  ?  149 ASN F CB  1 
ATOM   6267  C CG  . ASN F  2 126 ? 397.918 57.115  433.883 1.00 59.93  ?  149 ASN F CG  1 
ATOM   6268  O OD1 . ASN F  2 126 ? 398.190 55.936  433.654 1.00 49.94  ?  149 ASN F OD1 1 
ATOM   6269  N ND2 . ASN F  2 126 ? 398.276 58.106  433.071 1.00 68.31  ?  149 ASN F ND2 1 
ATOM   6270  N N   . GLY F  2 127 ? 398.734 54.872  436.402 1.00 75.77  ?  150 GLY F N   1 
ATOM   6271  C CA  . GLY F  2 127 ? 399.847 54.324  437.148 1.00 75.17  ?  150 GLY F CA  1 
ATOM   6272  C C   . GLY F  2 127 ? 401.157 55.054  436.907 1.00 74.17  ?  150 GLY F C   1 
ATOM   6273  O O   . GLY F  2 127 ? 401.354 55.734  435.901 1.00 78.42  ?  150 GLY F O   1 
ATOM   6274  N N   . THR F  2 128 ? 402.065 54.897  437.865 1.00 58.98  ?  151 THR F N   1 
ATOM   6275  C CA  . THR F  2 128 ? 403.402 55.477  437.828 1.00 50.47  ?  151 THR F CA  1 
ATOM   6276  C C   . THR F  2 128 ? 404.441 54.359  437.909 1.00 56.22  ?  151 THR F C   1 
ATOM   6277  O O   . THR F  2 128 ? 404.112 53.169  437.867 1.00 55.89  ?  151 THR F O   1 
ATOM   6278  C CB  . THR F  2 128 ? 403.597 56.490  438.959 1.00 48.72  ?  151 THR F CB  1 
ATOM   6279  O OG1 . THR F  2 128 ? 403.644 55.803  440.217 1.00 52.18  ?  151 THR F OG1 1 
ATOM   6280  C CG2 . THR F  2 128 ? 402.466 57.503  438.977 1.00 58.21  ?  151 THR F CG2 1 
ATOM   6281  N N   . LYS F  2 129 ? 405.711 54.758  438.010 1.00 72.46  ?  152 LYS F N   1 
ATOM   6282  C CA  . LYS F  2 129 ? 406.789 53.784  438.149 1.00 64.40  ?  152 LYS F CA  1 
ATOM   6283  C C   . LYS F  2 129 ? 406.608 52.930  439.399 1.00 62.27  ?  152 LYS F C   1 
ATOM   6284  O O   . LYS F  2 129 ? 406.879 51.725  439.382 1.00 62.99  ?  152 LYS F O   1 
ATOM   6285  C CB  . LYS F  2 129 ? 408.139 54.500  438.190 1.00 60.92  ?  152 LYS F CB  1 
ATOM   6286  C CG  . LYS F  2 129 ? 408.362 55.493  437.063 1.00 68.43  ?  152 LYS F CG  1 
ATOM   6287  C CD  . LYS F  2 129 ? 409.538 56.407  437.373 1.00 76.26  ?  152 LYS F CD  1 
ATOM   6288  C CE  . LYS F  2 129 ? 409.809 57.372  436.229 1.00 90.32  ?  152 LYS F CE  1 
ATOM   6289  N NZ  . LYS F  2 129 ? 410.303 56.671  435.013 1.00 78.40  ?  152 LYS F NZ  1 
ATOM   6290  N N   . GLU F  2 130 ? 406.166 53.540  440.497 1.00 77.80  ?  153 GLU F N   1 
ATOM   6291  C CA  . GLU F  2 130 ? 406.032 52.854  441.774 1.00 76.04  ?  153 GLU F CA  1 
ATOM   6292  C C   . GLU F  2 130 ? 404.616 52.369  442.061 1.00 79.52  ?  153 GLU F C   1 
ATOM   6293  O O   . GLU F  2 130 ? 404.393 51.747  443.104 1.00 85.84  ?  153 GLU F O   1 
ATOM   6294  C CB  . GLU F  2 130 ? 406.493 53.773  442.912 1.00 76.94  ?  153 GLU F CB  1 
ATOM   6295  C CG  . GLU F  2 130 ? 407.732 54.590  442.589 1.00 84.51  ?  153 GLU F CG  1 
ATOM   6296  C CD  . GLU F  2 130 ? 407.406 56.034  442.253 1.00 94.86  ?  153 GLU F CD  1 
ATOM   6297  O OE1 . GLU F  2 130 ? 407.589 56.906  443.130 1.00 96.52  ?  153 GLU F OE1 1 
ATOM   6298  O OE2 . GLU F  2 130 ? 406.964 56.298  441.115 1.00 93.78  -1 153 GLU F OE2 1 
ATOM   6299  N N   . ARG F  2 131 ? 403.659 52.627  441.173 1.00 65.46  ?  154 ARG F N   1 
ATOM   6300  C CA  . ARG F  2 131 ? 402.251 52.410  441.486 1.00 67.03  ?  154 ARG F CA  1 
ATOM   6301  C C   . ARG F  2 131 ? 401.543 51.735  440.321 1.00 73.81  ?  154 ARG F C   1 
ATOM   6302  O O   . ARG F  2 131 ? 401.706 52.144  439.169 1.00 79.32  ?  154 ARG F O   1 
ATOM   6303  C CB  . ARG F  2 131 ? 401.566 53.740  441.819 1.00 68.22  ?  154 ARG F CB  1 
ATOM   6304  C CG  . ARG F  2 131 ? 400.104 53.626  442.198 1.00 63.61  ?  154 ARG F CG  1 
ATOM   6305  C CD  . ARG F  2 131 ? 399.489 55.007  442.333 1.00 63.16  ?  154 ARG F CD  1 
ATOM   6306  N NE  . ARG F  2 131 ? 399.445 55.708  441.052 1.00 65.17  ?  154 ARG F NE  1 
ATOM   6307  C CZ  . ARG F  2 131 ? 399.310 57.025  440.923 1.00 67.73  ?  154 ARG F CZ  1 
ATOM   6308  N NH1 . ARG F  2 131 ? 399.211 57.792  441.998 1.00 68.17  ?  154 ARG F NH1 1 
ATOM   6309  N NH2 . ARG F  2 131 ? 399.275 57.576  439.718 1.00 67.75  ?  154 ARG F NH2 1 
ATOM   6310  N N   . ASP F  2 132 ? 400.763 50.702  440.629 1.00 70.27  ?  155 ASP F N   1 
ATOM   6311  C CA  . ASP F  2 132 ? 399.945 50.032  439.630 1.00 71.40  ?  155 ASP F CA  1 
ATOM   6312  C C   . ASP F  2 132 ? 398.654 50.804  439.378 1.00 75.41  ?  155 ASP F C   1 
ATOM   6313  O O   . ASP F  2 132 ? 398.161 51.536  440.241 1.00 80.99  ?  155 ASP F O   1 
ATOM   6314  C CB  . ASP F  2 132 ? 399.616 48.605  440.072 1.00 75.11  ?  155 ASP F CB  1 
ATOM   6315  C CG  . ASP F  2 132 ? 399.003 47.774  438.959 1.00 76.50  ?  155 ASP F CG  1 
ATOM   6316  O OD1 . ASP F  2 132 ? 399.401 47.958  437.789 1.00 76.29  ?  155 ASP F OD1 1 
ATOM   6317  O OD2 . ASP F  2 132 ? 398.125 46.937  439.255 1.00 72.14  -1 155 ASP F OD2 1 
ATOM   6318  N N   . VAL F  2 133 ? 398.105 50.630  438.175 1.00 93.47  ?  156 VAL F N   1 
ATOM   6319  C CA  . VAL F  2 133 ? 396.820 51.229  437.835 1.00 94.57  ?  156 VAL F CA  1 
ATOM   6320  C C   . VAL F  2 133 ? 395.710 50.501  438.582 1.00 93.97  ?  156 VAL F C   1 
ATOM   6321  O O   . VAL F  2 133 ? 395.753 49.276  438.758 1.00 105.16 ?  156 VAL F O   1 
ATOM   6322  C CB  . VAL F  2 133 ? 396.595 51.177  436.314 1.00 90.84  ?  156 VAL F CB  1 
ATOM   6323  C CG1 . VAL F  2 133 ? 395.317 51.911  435.928 1.00 90.75  ?  156 VAL F CG1 1 
ATOM   6324  C CG2 . VAL F  2 133 ? 397.792 51.753  435.575 1.00 91.98  ?  156 VAL F CG2 1 
ATOM   6325  N N   . VAL F  2 134 ? 394.709 51.253  439.031 1.00 47.70  ?  157 VAL F N   1 
ATOM   6326  C CA  . VAL F  2 134 ? 393.519 50.689  439.660 1.00 56.08  ?  157 VAL F CA  1 
ATOM   6327  C C   . VAL F  2 134 ? 392.345 50.904  438.711 1.00 52.76  ?  157 VAL F C   1 
ATOM   6328  O O   . VAL F  2 134 ? 391.931 52.042  438.453 1.00 50.37  ?  157 VAL F O   1 
ATOM   6329  C CB  . VAL F  2 134 ? 393.257 51.292  441.049 1.00 52.16  ?  157 VAL F CB  1 
ATOM   6330  C CG1 . VAL F  2 134 ? 393.288 52.814  441.013 1.00 40.93  ?  157 VAL F CG1 1 
ATOM   6331  C CG2 . VAL F  2 134 ? 391.923 50.800  441.595 1.00 47.67  ?  157 VAL F CG2 1 
ATOM   6332  N N   . CYS F  2 135 ? 391.821 49.809  438.169 1.00 71.38  ?  158 CYS F N   1 
ATOM   6333  C CA  . CYS F  2 135 ? 390.710 49.881  437.234 1.00 78.65  ?  158 CYS F CA  1 
ATOM   6334  C C   . CYS F  2 135 ? 389.387 50.053  437.973 1.00 79.13  ?  158 CYS F C   1 
ATOM   6335  O O   . CYS F  2 135 ? 389.246 49.677  439.139 1.00 73.07  ?  158 CYS F O   1 
ATOM   6336  C CB  . CYS F  2 135 ? 390.659 48.628  436.360 1.00 83.57  ?  158 CYS F CB  1 
ATOM   6337  S SG  . CYS F  2 135 ? 392.148 48.336  435.370 1.00 95.52  ?  158 CYS F SG  1 
ATOM   6338  N N   . GLY F  2 136 ? 388.415 50.636  437.275 1.00 116.04 ?  159 GLY F N   1 
ATOM   6339  C CA  . GLY F  2 136 ? 387.087 50.812  437.809 1.00 113.53 ?  159 GLY F CA  1 
ATOM   6340  C C   . GLY F  2 136 ? 386.073 51.092  436.719 1.00 117.50 ?  159 GLY F C   1 
ATOM   6341  O O   . GLY F  2 136 ? 386.411 51.574  435.634 1.00 122.50 ?  159 GLY F O   1 
ATOM   6342  N N   . PRO F  2 137 ? 384.792 50.793  436.990 1.00 108.53 ?  160 PRO F N   1 
ATOM   6343  C CA  . PRO F  2 137 ? 383.717 50.996  436.014 1.00 109.22 ?  160 PRO F CA  1 
ATOM   6344  C C   . PRO F  2 137 ? 383.172 52.422  436.025 1.00 108.63 ?  160 PRO F C   1 
ATOM   6345  O O   . PRO F  2 137 ? 383.006 52.990  437.104 1.00 115.79 ?  160 PRO F O   1 
ATOM   6346  C CB  . PRO F  2 137 ? 382.637 49.998  436.462 1.00 114.39 ?  160 PRO F CB  1 
ATOM   6347  C CG  . PRO F  2 137 ? 383.156 49.353  437.746 1.00 116.05 ?  160 PRO F CG  1 
ATOM   6348  C CD  . PRO F  2 137 ? 384.285 50.200  438.235 1.00 110.61 ?  160 PRO F CD  1 
ATOM   6349  N N   . ARG G  1 31  ? 467.773 29.408  410.898 1.00 107.52 ?  88  ARG G N   1 
ATOM   6350  C CA  . ARG G  1 31  ? 467.099 30.635  411.303 1.00 102.46 ?  88  ARG G CA  1 
ATOM   6351  C C   . ARG G  1 31  ? 468.039 31.556  412.080 1.00 106.48 ?  88  ARG G C   1 
ATOM   6352  O O   . ARG G  1 31  ? 469.228 31.268  412.221 1.00 108.81 ?  88  ARG G O   1 
ATOM   6353  C CB  . ARG G  1 31  ? 465.856 30.310  412.134 1.00 100.90 ?  88  ARG G CB  1 
ATOM   6354  C CG  . ARG G  1 31  ? 466.152 29.690  413.487 1.00 101.92 ?  88  ARG G CG  1 
ATOM   6355  C CD  . ARG G  1 31  ? 464.866 29.301  414.195 1.00 101.06 ?  88  ARG G CD  1 
ATOM   6356  N NE  . ARG G  1 31  ? 465.080 29.022  415.613 1.00 103.56 ?  88  ARG G NE  1 
ATOM   6357  C CZ  . ARG G  1 31  ? 464.937 29.921  416.581 1.00 101.13 ?  88  ARG G CZ  1 
ATOM   6358  N NH1 . ARG G  1 31  ? 465.151 29.578  417.843 1.00 93.11  ?  88  ARG G NH1 1 
ATOM   6359  N NH2 . ARG G  1 31  ? 464.579 31.163  416.287 1.00 103.58 ?  88  ARG G NH2 1 
ATOM   6360  N N   . GLN G  1 32  ? 467.494 32.666  412.580 1.00 103.76 ?  89  GLN G N   1 
ATOM   6361  C CA  . GLN G  1 32  ? 468.318 33.711  413.184 1.00 101.71 ?  89  GLN G CA  1 
ATOM   6362  C C   . GLN G  1 32  ? 468.726 33.367  414.614 1.00 91.81  ?  89  GLN G C   1 
ATOM   6363  O O   . GLN G  1 32  ? 469.917 33.249  414.918 1.00 73.57  ?  89  GLN G O   1 
ATOM   6364  C CB  . GLN G  1 32  ? 467.582 35.056  413.141 1.00 108.26 ?  89  GLN G CB  1 
ATOM   6365  C CG  . GLN G  1 32  ? 466.104 34.998  413.509 1.00 114.01 ?  89  GLN G CG  1 
ATOM   6366  C CD  . GLN G  1 32  ? 465.558 36.346  413.941 1.00 106.56 ?  89  GLN G CD  1 
ATOM   6367  O OE1 . GLN G  1 32  ? 466.241 37.119  414.613 1.00 106.23 ?  89  GLN G OE1 1 
ATOM   6368  N NE2 . GLN G  1 32  ? 464.320 36.634  413.556 1.00 93.68  ?  89  GLN G NE2 1 
ATOM   6369  N N   . GLY G  1 33  ? 467.740 33.208  415.503 1.00 139.67 ?  90  GLY G N   1 
ATOM   6370  C CA  . GLY G  1 33  ? 467.999 33.252  416.935 1.00 135.15 ?  90  GLY G CA  1 
ATOM   6371  C C   . GLY G  1 33  ? 469.094 32.324  417.421 1.00 125.63 ?  90  GLY G C   1 
ATOM   6372  O O   . GLY G  1 33  ? 469.755 32.614  418.421 1.00 119.04 ?  90  GLY G O   1 
ATOM   6373  N N   . MET G  1 34  ? 469.318 31.210  416.731 1.00 104.45 ?  91  MET G N   1 
ATOM   6374  C CA  . MET G  1 34  ? 470.256 30.198  417.200 1.00 95.44  ?  91  MET G CA  1 
ATOM   6375  C C   . MET G  1 34  ? 471.486 30.168  416.299 1.00 100.11 ?  91  MET G C   1 
ATOM   6376  O O   . MET G  1 34  ? 471.416 29.696  415.159 1.00 95.20  ?  91  MET G O   1 
ATOM   6377  C CB  . MET G  1 34  ? 469.585 28.827  417.251 1.00 99.39  ?  91  MET G CB  1 
ATOM   6378  C CG  . MET G  1 34  ? 468.399 28.754  418.198 1.00 108.72 ?  91  MET G CG  1 
ATOM   6379  S SD  . MET G  1 34  ? 468.810 29.299  419.866 1.00 116.94 ?  91  MET G SD  1 
ATOM   6380  C CE  . MET G  1 34  ? 467.317 28.861  420.750 1.00 111.39 ?  91  MET G CE  1 
ATOM   6381  N N   . PHE G  1 35  ? 472.603 30.669  416.826 1.00 48.96  ?  92  PHE G N   1 
ATOM   6382  C CA  . PHE G  1 35  ? 473.971 30.419  416.379 1.00 35.43  ?  92  PHE G CA  1 
ATOM   6383  C C   . PHE G  1 35  ? 474.896 31.235  417.271 1.00 29.75  ?  92  PHE G C   1 
ATOM   6384  O O   . PHE G  1 35  ? 474.481 32.229  417.872 1.00 35.01  ?  92  PHE G O   1 
ATOM   6385  C CB  . PHE G  1 35  ? 474.205 30.768  414.897 1.00 33.28  ?  92  PHE G CB  1 
ATOM   6386  C CG  . PHE G  1 35  ? 474.124 32.237  414.577 1.00 34.49  ?  92  PHE G CG  1 
ATOM   6387  C CD1 . PHE G  1 35  ? 475.260 33.032  414.600 1.00 30.50  ?  92  PHE G CD1 1 
ATOM   6388  C CD2 . PHE G  1 35  ? 472.920 32.814  414.209 1.00 40.91  ?  92  PHE G CD2 1 
ATOM   6389  C CE1 . PHE G  1 35  ? 475.190 34.379  414.290 1.00 28.44  ?  92  PHE G CE1 1 
ATOM   6390  C CE2 . PHE G  1 35  ? 472.844 34.159  413.895 1.00 35.94  ?  92  PHE G CE2 1 
ATOM   6391  C CZ  . PHE G  1 35  ? 473.981 34.942  413.936 1.00 24.90  ?  92  PHE G CZ  1 
ATOM   6392  N N   . ALA G  1 36  ? 476.155 30.810  417.341 1.00 29.62  ?  93  ALA G N   1 
ATOM   6393  C CA  . ALA G  1 36  ? 477.125 31.493  418.185 1.00 29.16  ?  93  ALA G CA  1 
ATOM   6394  C C   . ALA G  1 36  ? 478.532 31.138  417.735 1.00 28.40  ?  93  ALA G C   1 
ATOM   6395  O O   . ALA G  1 36  ? 478.756 30.123  417.070 1.00 32.52  ?  93  ALA G O   1 
ATOM   6396  C CB  . ALA G  1 36  ? 476.936 31.137  419.663 1.00 29.05  ?  93  ALA G CB  1 
ATOM   6397  N N   . GLN G  1 37  ? 479.480 31.993  418.113 1.00 17.90  ?  94  GLN G N   1 
ATOM   6398  C CA  . GLN G  1 37  ? 480.900 31.711  417.957 1.00 14.51  ?  94  GLN G CA  1 
ATOM   6399  C C   . GLN G  1 37  ? 481.644 32.286  419.153 1.00 17.10  ?  94  GLN G C   1 
ATOM   6400  O O   . GLN G  1 37  ? 481.441 33.450  419.509 1.00 19.83  ?  94  GLN G O   1 
ATOM   6401  C CB  . GLN G  1 37  ? 481.441 32.293  416.646 1.00 15.86  ?  94  GLN G CB  1 
ATOM   6402  C CG  . GLN G  1 37  ? 482.917 32.029  416.418 1.00 17.18  ?  94  GLN G CG  1 
ATOM   6403  C CD  . GLN G  1 37  ? 483.279 31.948  414.946 1.00 15.43  ?  94  GLN G CD  1 
ATOM   6404  O OE1 . GLN G  1 37  ? 482.952 30.975  414.267 1.00 14.06  ?  94  GLN G OE1 1 
ATOM   6405  N NE2 . GLN G  1 37  ? 483.958 32.974  414.447 1.00 17.99  ?  94  GLN G NE2 1 
ATOM   6406  N N   . LEU G  1 38  ? 482.505 31.475  419.766 1.00 27.94  ?  95  LEU G N   1 
ATOM   6407  C CA  . LEU G  1 38  ? 483.267 31.880  420.938 1.00 23.34  ?  95  LEU G CA  1 
ATOM   6408  C C   . LEU G  1 38  ? 484.752 31.662  420.684 1.00 27.06  ?  95  LEU G C   1 
ATOM   6409  O O   . LEU G  1 38  ? 485.152 30.626  420.145 1.00 32.26  ?  95  LEU G O   1 
ATOM   6410  C CB  . LEU G  1 38  ? 482.834 31.100  422.187 1.00 29.20  ?  95  LEU G CB  1 
ATOM   6411  C CG  . LEU G  1 38  ? 481.352 31.131  422.571 1.00 32.88  ?  95  LEU G CG  1 
ATOM   6412  C CD1 . LEU G  1 38  ? 481.133 30.441  423.910 1.00 25.39  ?  95  LEU G CD1 1 
ATOM   6413  C CD2 . LEU G  1 38  ? 480.828 32.557  422.610 1.00 31.88  ?  95  LEU G CD2 1 
ATOM   6414  N N   . VAL G  1 39  ? 485.564 32.639  421.080 1.00 16.69  ?  96  VAL G N   1 
ATOM   6415  C CA  . VAL G  1 39  ? 487.012 32.588  420.908 1.00 13.77  ?  96  VAL G CA  1 
ATOM   6416  C C   . VAL G  1 39  ? 487.651 32.237  422.244 1.00 18.43  ?  96  VAL G C   1 
ATOM   6417  O O   . VAL G  1 39  ? 487.316 32.830  423.277 1.00 23.20  ?  96  VAL G O   1 
ATOM   6418  C CB  . VAL G  1 39  ? 487.555 33.921  420.364 1.00 13.79  ?  96  VAL G CB  1 
ATOM   6419  C CG1 . VAL G  1 39  ? 489.071 33.957  420.452 1.00 22.84  ?  96  VAL G CG1 1 
ATOM   6420  C CG2 . VAL G  1 39  ? 487.104 34.125  418.926 1.00 15.73  ?  96  VAL G CG2 1 
ATOM   6421  N N   . ALA G  1 40  ? 488.574 31.277  422.224 1.00 48.46  ?  97  ALA G N   1 
ATOM   6422  C CA  . ALA G  1 40  ? 489.176 30.780  423.454 1.00 48.11  ?  97  ALA G CA  1 
ATOM   6423  C C   . ALA G  1 40  ? 490.035 31.846  424.122 1.00 48.90  ?  97  ALA G C   1 
ATOM   6424  O O   . ALA G  1 40  ? 490.773 32.581  423.461 1.00 48.26  ?  97  ALA G O   1 
ATOM   6425  C CB  . ALA G  1 40  ? 490.018 29.537  423.167 1.00 53.90  ?  97  ALA G CB  1 
ATOM   6426  N N   . GLN G  1 41  ? 489.925 31.927  425.449 1.00 31.82  ?  98  GLN G N   1 
ATOM   6427  C CA  . GLN G  1 41  ? 490.690 32.902  426.217 1.00 29.97  ?  98  GLN G CA  1 
ATOM   6428  C C   . GLN G  1 41  ? 492.114 32.427  426.493 1.00 26.45  ?  98  GLN G C   1 
ATOM   6429  O O   . GLN G  1 41  ? 493.061 33.215  426.392 1.00 28.07  ?  98  GLN G O   1 
ATOM   6430  C CB  . GLN G  1 41  ? 489.971 33.202  427.533 1.00 37.39  ?  98  GLN G CB  1 
ATOM   6431  C CG  . GLN G  1 41  ? 489.727 34.678  427.799 1.00 38.78  ?  98  GLN G CG  1 
ATOM   6432  C CD  . GLN G  1 41  ? 488.820 34.908  428.994 1.00 40.60  ?  98  GLN G CD  1 
ATOM   6433  O OE1 . GLN G  1 41  ? 487.674 35.334  428.845 1.00 30.22  ?  98  GLN G OE1 1 
ATOM   6434  N NE2 . GLN G  1 41  ? 489.328 34.622  430.187 1.00 53.49  ?  98  GLN G NE2 1 
ATOM   6435  N N   . ASN G  1 42  ? 492.285 31.151  426.836 1.00 23.73  ?  99  ASN G N   1 
ATOM   6436  C CA  . ASN G  1 42  ? 493.566 30.664  427.337 1.00 25.97  ?  99  ASN G CA  1 
ATOM   6437  C C   . ASN G  1 42  ? 494.602 30.623  426.220 1.00 26.71  ?  99  ASN G C   1 
ATOM   6438  O O   . ASN G  1 42  ? 494.399 29.961  425.197 1.00 27.39  ?  99  ASN G O   1 
ATOM   6439  C CB  . ASN G  1 42  ? 493.398 29.275  427.946 1.00 22.62  ?  99  ASN G CB  1 
ATOM   6440  C CG  . ASN G  1 42  ? 492.259 29.210  428.940 1.00 32.65  ?  99  ASN G CG  1 
ATOM   6441  O OD1 . ASN G  1 42  ? 491.088 29.243  428.560 1.00 35.19  ?  99  ASN G OD1 1 
ATOM   6442  N ND2 . ASN G  1 42  ? 492.594 29.111  430.220 1.00 38.64  ?  99  ASN G ND2 1 
ATOM   6443  N N   . VAL G  1 43  ? 495.713 31.337  426.414 1.00 14.29  ?  100 VAL G N   1 
ATOM   6444  C CA  . VAL G  1 43  ? 496.824 31.239  425.474 1.00 19.68  ?  100 VAL G CA  1 
ATOM   6445  C C   . VAL G  1 43  ? 497.726 30.045  425.794 1.00 13.68  ?  100 VAL G C   1 
ATOM   6446  O O   . VAL G  1 43  ? 498.291 29.434  424.880 1.00 18.69  ?  100 VAL G O   1 
ATOM   6447  C CB  . VAL G  1 43  ? 497.615 32.559  425.435 1.00 14.90  ?  100 VAL G CB  1 
ATOM   6448  C CG1 . VAL G  1 43  ? 498.421 32.755  426.709 1.00 16.84  ?  100 VAL G CG1 1 
ATOM   6449  C CG2 . VAL G  1 43  ? 498.518 32.602  424.211 1.00 25.82  ?  100 VAL G CG2 1 
ATOM   6450  N N   . LEU G  1 44  ? 497.871 29.683  427.071 1.00 17.42  ?  101 LEU G N   1 
ATOM   6451  C CA  . LEU G  1 44  ? 498.842 28.677  427.470 1.00 18.33  ?  101 LEU G CA  1 
ATOM   6452  C C   . LEU G  1 44  ? 498.233 27.278  427.400 1.00 19.92  ?  101 LEU G C   1 
ATOM   6453  O O   . LEU G  1 44  ? 497.040 27.100  427.149 1.00 16.62  ?  101 LEU G O   1 
ATOM   6454  C CB  . LEU G  1 44  ? 499.363 28.966  428.877 1.00 14.46  ?  101 LEU G CB  1 
ATOM   6455  C CG  . LEU G  1 44  ? 500.250 30.198  429.057 1.00 16.45  ?  101 LEU G CG  1 
ATOM   6456  C CD1 . LEU G  1 44  ? 500.688 30.329  430.506 1.00 16.54  ?  101 LEU G CD1 1 
ATOM   6457  C CD2 . LEU G  1 44  ? 501.454 30.131  428.132 1.00 21.10  ?  101 LEU G CD2 1 
ATOM   6458  N N   . LEU G  1 45  ? 499.064 26.267  427.657 1.00 33.20  ?  102 LEU G N   1 
ATOM   6459  C CA  . LEU G  1 45  ? 498.656 24.868  427.563 1.00 34.82  ?  102 LEU G CA  1 
ATOM   6460  C C   . LEU G  1 45  ? 498.685 24.243  428.952 1.00 35.43  ?  102 LEU G C   1 
ATOM   6461  O O   . LEU G  1 45  ? 499.760 23.923  429.470 1.00 42.39  ?  102 LEU G O   1 
ATOM   6462  C CB  . LEU G  1 45  ? 499.569 24.099  426.608 1.00 33.14  ?  102 LEU G CB  1 
ATOM   6463  C CG  . LEU G  1 45  ? 499.184 23.997  425.134 1.00 28.90  ?  102 LEU G CG  1 
ATOM   6464  C CD1 . LEU G  1 45  ? 499.056 25.371  424.498 1.00 26.59  ?  102 LEU G CD1 1 
ATOM   6465  C CD2 . LEU G  1 45  ? 500.208 23.154  424.388 1.00 25.31  ?  102 LEU G CD2 1 
ATOM   6466  N N   . ILE G  1 46  ? 497.499 24.030  429.522 1.00 40.08  ?  103 ILE G N   1 
ATOM   6467  C CA  . ILE G  1 46  ? 497.305 23.272  430.754 1.00 49.68  ?  103 ILE G CA  1 
ATOM   6468  C C   . ILE G  1 46  ? 495.912 22.662  430.688 1.00 49.17  ?  103 ILE G C   1 
ATOM   6469  O O   . ILE G  1 46  ? 494.997 23.227  430.082 1.00 48.34  ?  103 ILE G O   1 
ATOM   6470  C CB  . ILE G  1 46  ? 497.512 24.137  432.029 1.00 61.14  ?  103 ILE G CB  1 
ATOM   6471  C CG1 . ILE G  1 46  ? 499.001 24.300  432.341 1.00 69.66  ?  103 ILE G CG1 1 
ATOM   6472  C CG2 . ILE G  1 46  ? 496.756 23.584  433.242 1.00 59.27  ?  103 ILE G CG2 1 
ATOM   6473  C CD1 . ILE G  1 46  ? 499.291 24.899  433.695 1.00 71.41  ?  103 ILE G CD1 1 
ATOM   6474  N N   . ASP G  1 47  ? 495.754 21.498  431.315 1.00 53.71  ?  104 ASP G N   1 
ATOM   6475  C CA  . ASP G  1 47  ? 494.505 20.764  431.221 1.00 54.02  ?  104 ASP G CA  1 
ATOM   6476  C C   . ASP G  1 47  ? 493.404 21.502  431.980 1.00 56.57  ?  104 ASP G C   1 
ATOM   6477  O O   . ASP G  1 47  ? 493.625 22.539  432.612 1.00 69.01  ?  104 ASP G O   1 
ATOM   6478  C CB  . ASP G  1 47  ? 494.692 19.346  431.755 1.00 52.33  ?  104 ASP G CB  1 
ATOM   6479  C CG  . ASP G  1 47  ? 495.833 18.615  431.072 1.00 56.47  ?  104 ASP G CG  1 
ATOM   6480  O OD1 . ASP G  1 47  ? 496.852 19.266  430.757 1.00 52.21  ?  104 ASP G OD1 1 
ATOM   6481  O OD2 . ASP G  1 47  ? 495.715 17.391  430.854 1.00 61.98  -1 104 ASP G OD2 1 
ATOM   6482  N N   . GLY G  1 48  ? 492.196 20.949  431.923 1.00 48.93  ?  105 GLY G N   1 
ATOM   6483  C CA  . GLY G  1 48  ? 491.034 21.616  432.459 1.00 52.00  ?  105 GLY G CA  1 
ATOM   6484  C C   . GLY G  1 48  ? 490.290 22.387  431.387 1.00 47.32  ?  105 GLY G C   1 
ATOM   6485  O O   . GLY G  1 48  ? 490.754 22.519  430.250 1.00 48.38  ?  105 GLY G O   1 
ATOM   6486  N N   . PRO G  1 49  ? 489.119 22.916  431.733 1.00 36.43  ?  106 PRO G N   1 
ATOM   6487  C CA  . PRO G  1 49  ? 488.290 23.599  430.733 1.00 35.33  ?  106 PRO G CA  1 
ATOM   6488  C C   . PRO G  1 49  ? 488.916 24.901  430.255 1.00 29.42  ?  106 PRO G C   1 
ATOM   6489  O O   . PRO G  1 49  ? 489.821 25.462  430.877 1.00 33.93  ?  106 PRO G O   1 
ATOM   6490  C CB  . PRO G  1 49  ? 486.975 23.862  431.478 1.00 40.91  ?  106 PRO G CB  1 
ATOM   6491  C CG  . PRO G  1 49  ? 486.993 22.921  432.647 1.00 42.76  ?  106 PRO G CG  1 
ATOM   6492  C CD  . PRO G  1 49  ? 488.433 22.793  433.028 1.00 37.70  ?  106 PRO G CD  1 
ATOM   6493  N N   . LEU G  1 50  ? 488.409 25.381  429.122 1.00 16.58  ?  107 LEU G N   1 
ATOM   6494  C CA  . LEU G  1 50  ? 488.885 26.601  428.486 1.00 20.35  ?  107 LEU G CA  1 
ATOM   6495  C C   . LEU G  1 50  ? 487.884 27.731  428.691 1.00 24.86  ?  107 LEU G C   1 
ATOM   6496  O O   . LEU G  1 50  ? 486.673 27.533  428.551 1.00 30.69  ?  107 LEU G O   1 
ATOM   6497  C CB  . LEU G  1 50  ? 489.112 26.387  426.984 1.00 24.38  ?  107 LEU G CB  1 
ATOM   6498  C CG  . LEU G  1 50  ? 490.332 25.585  426.529 1.00 26.14  ?  107 LEU G CG  1 
ATOM   6499  C CD1 . LEU G  1 50  ? 490.190 25.186  425.068 1.00 19.23  ?  107 LEU G CD1 1 
ATOM   6500  C CD2 . LEU G  1 50  ? 491.607 26.381  426.740 1.00 21.58  ?  107 LEU G CD2 1 
ATOM   6501  N N   . SER G  1 51  ? 488.396 28.914  429.026 1.00 23.01  ?  108 SER G N   1 
ATOM   6502  C CA  . SER G  1 51  ? 487.576 30.113  429.100 1.00 25.27  ?  108 SER G CA  1 
ATOM   6503  C C   . SER G  1 51  ? 487.341 30.683  427.701 1.00 25.98  ?  108 SER G C   1 
ATOM   6504  O O   . SER G  1 51  ? 488.126 30.463  426.774 1.00 28.36  ?  108 SER G O   1 
ATOM   6505  C CB  . SER G  1 51  ? 488.233 31.162  429.997 1.00 31.05  ?  108 SER G CB  1 
ATOM   6506  O OG  . SER G  1 51  ? 488.381 30.680  431.322 1.00 31.38  ?  108 SER G OG  1 
ATOM   6507  N N   . TRP G  1 52  ? 486.245 31.426  427.556 1.00 28.03  ?  109 TRP G N   1 
ATOM   6508  C CA  . TRP G  1 52  ? 485.819 31.920  426.254 1.00 34.11  ?  109 TRP G CA  1 
ATOM   6509  C C   . TRP G  1 52  ? 485.476 33.403  426.325 1.00 35.16  ?  109 TRP G C   1 
ATOM   6510  O O   . TRP G  1 52  ? 485.190 33.949  427.394 1.00 40.58  ?  109 TRP G O   1 
ATOM   6511  C CB  . TRP G  1 52  ? 484.613 31.127  425.732 1.00 34.14  ?  109 TRP G CB  1 
ATOM   6512  C CG  . TRP G  1 52  ? 484.891 29.665  425.595 1.00 28.31  ?  109 TRP G CG  1 
ATOM   6513  C CD1 . TRP G  1 52  ? 484.646 28.694  426.522 1.00 25.68  ?  109 TRP G CD1 1 
ATOM   6514  C CD2 . TRP G  1 52  ? 485.481 29.005  424.469 1.00 25.53  ?  109 TRP G CD2 1 
ATOM   6515  N NE1 . TRP G  1 52  ? 485.041 27.470  426.039 1.00 24.29  ?  109 TRP G NE1 1 
ATOM   6516  C CE2 . TRP G  1 52  ? 485.557 27.635  424.781 1.00 24.31  ?  109 TRP G CE2 1 
ATOM   6517  C CE3 . TRP G  1 52  ? 485.947 29.442  423.225 1.00 25.89  ?  109 TRP G CE3 1 
ATOM   6518  C CZ2 . TRP G  1 52  ? 486.082 26.697  423.896 1.00 26.15  ?  109 TRP G CZ2 1 
ATOM   6519  C CZ3 . TRP G  1 52  ? 486.469 28.510  422.349 1.00 26.74  ?  109 TRP G CZ3 1 
ATOM   6520  C CH2 . TRP G  1 52  ? 486.533 27.153  422.688 1.00 26.97  ?  109 TRP G CH2 1 
ATOM   6521  N N   . TYR G  1 53  ? 485.508 34.050  425.156 1.00 30.64  ?  110 TYR G N   1 
ATOM   6522  C CA  . TYR G  1 53  ? 485.145 35.457  425.008 1.00 31.53  ?  110 TYR G CA  1 
ATOM   6523  C C   . TYR G  1 53  ? 483.681 35.537  424.582 1.00 36.12  ?  110 TYR G C   1 
ATOM   6524  O O   . TYR G  1 53  ? 483.322 35.110  423.480 1.00 39.43  ?  110 TYR G O   1 
ATOM   6525  C CB  . TYR G  1 53  ? 486.054 36.150  423.995 1.00 33.59  ?  110 TYR G CB  1 
ATOM   6526  C CG  . TYR G  1 53  ? 487.401 36.565  424.549 1.00 36.81  ?  110 TYR G CG  1 
ATOM   6527  C CD1 . TYR G  1 53  ? 487.503 37.582  425.491 1.00 36.80  ?  110 TYR G CD1 1 
ATOM   6528  C CD2 . TYR G  1 53  ? 488.571 35.948  424.124 1.00 39.57  ?  110 TYR G CD2 1 
ATOM   6529  C CE1 . TYR G  1 53  ? 488.731 37.968  425.997 1.00 45.54  ?  110 TYR G CE1 1 
ATOM   6530  C CE2 . TYR G  1 53  ? 489.804 36.327  424.625 1.00 40.29  ?  110 TYR G CE2 1 
ATOM   6531  C CZ  . TYR G  1 53  ? 489.877 37.338  425.561 1.00 44.63  ?  110 TYR G CZ  1 
ATOM   6532  O OH  . TYR G  1 53  ? 491.100 37.720  426.064 1.00 44.24  ?  110 TYR G OH  1 
ATOM   6533  N N   . SER G  1 54  ? 482.841 36.084  425.460 1.00 61.27  ?  111 SER G N   1 
ATOM   6534  C CA  . SER G  1 54  ? 481.393 36.057  425.313 1.00 60.98  ?  111 SER G CA  1 
ATOM   6535  C C   . SER G  1 54  ? 480.807 37.325  424.701 1.00 64.30  ?  111 SER G C   1 
ATOM   6536  O O   . SER G  1 54  ? 479.580 37.453  424.644 1.00 72.88  ?  111 SER G O   1 
ATOM   6537  C CB  . SER G  1 54  ? 480.737 35.802  426.670 1.00 67.25  ?  111 SER G CB  1 
ATOM   6538  O OG  . SER G  1 54  ? 479.326 35.800  426.560 1.00 79.38  ?  111 SER G OG  1 
ATOM   6539  N N   . ASP G  1 55  ? 481.636 38.260  424.239 1.00 24.10  ?  112 ASP G N   1 
ATOM   6540  C CA  . ASP G  1 55  ? 481.228 39.655  424.058 1.00 30.60  ?  112 ASP G CA  1 
ATOM   6541  C C   . ASP G  1 55  ? 481.287 40.051  422.588 1.00 26.49  ?  112 ASP G C   1 
ATOM   6542  O O   . ASP G  1 55  ? 482.345 40.467  422.090 1.00 31.27  ?  112 ASP G O   1 
ATOM   6543  C CB  . ASP G  1 55  ? 482.103 40.586  424.897 1.00 36.85  ?  112 ASP G CB  1 
ATOM   6544  C CG  . ASP G  1 55  ? 481.543 41.995  424.984 1.00 37.82  ?  112 ASP G CG  1 
ATOM   6545  O OD1 . ASP G  1 55  ? 481.615 42.733  423.978 1.00 30.90  ?  112 ASP G OD1 1 
ATOM   6546  O OD2 . ASP G  1 55  ? 481.036 42.368  426.063 1.00 39.65  -1 112 ASP G OD2 1 
ATOM   6547  N N   . PRO G  1 56  ? 480.177 39.922  421.854 1.00 32.13  ?  113 PRO G N   1 
ATOM   6548  C CA  . PRO G  1 56  ? 480.149 40.377  420.458 1.00 35.59  ?  113 PRO G CA  1 
ATOM   6549  C C   . PRO G  1 56  ? 480.646 41.810  420.331 1.00 40.09  ?  113 PRO G C   1 
ATOM   6550  O O   . PRO G  1 56  ? 480.428 42.650  421.205 1.00 49.58  ?  113 PRO G O   1 
ATOM   6551  C CB  . PRO G  1 56  ? 478.670 40.255  420.071 1.00 41.54  ?  113 PRO G CB  1 
ATOM   6552  C CG  . PRO G  1 56  ? 477.929 40.209  421.371 1.00 42.84  ?  113 PRO G CG  1 
ATOM   6553  C CD  . PRO G  1 56  ? 478.846 39.507  422.322 1.00 38.20  ?  113 PRO G CD  1 
ATOM   6554  N N   . GLY G  1 57  ? 481.321 42.079  419.219 1.00 62.11  ?  114 GLY G N   1 
ATOM   6555  C CA  . GLY G  1 57  ? 482.162 43.241  419.073 1.00 69.16  ?  114 GLY G CA  1 
ATOM   6556  C C   . GLY G  1 57  ? 483.639 42.932  419.188 1.00 67.26  ?  114 GLY G C   1 
ATOM   6557  O O   . GLY G  1 57  ? 484.466 43.717  418.707 1.00 69.21  ?  114 GLY G O   1 
ATOM   6558  N N   . LEU G  1 58  ? 483.985 41.812  419.814 1.00 26.95  ?  115 LEU G N   1 
ATOM   6559  C CA  . LEU G  1 58  ? 485.324 41.263  419.715 1.00 23.73  ?  115 LEU G CA  1 
ATOM   6560  C C   . LEU G  1 58  ? 485.525 40.651  418.332 1.00 23.07  ?  115 LEU G C   1 
ATOM   6561  O O   . LEU G  1 58  ? 484.567 40.377  417.604 1.00 22.74  ?  115 LEU G O   1 
ATOM   6562  C CB  . LEU G  1 58  ? 485.563 40.221  420.805 1.00 22.75  ?  115 LEU G CB  1 
ATOM   6563  C CG  . LEU G  1 58  ? 485.564 40.770  422.232 1.00 19.43  ?  115 LEU G CG  1 
ATOM   6564  C CD1 . LEU G  1 58  ? 485.684 39.645  423.238 1.00 21.67  ?  115 LEU G CD1 1 
ATOM   6565  C CD2 . LEU G  1 58  ? 486.692 41.764  422.406 1.00 19.67  ?  115 LEU G CD2 1 
ATOM   6566  N N   . ALA G  1 59  ? 486.794 40.452  417.974 1.00 31.79  ?  116 ALA G N   1 
ATOM   6567  C CA  . ALA G  1 59  ? 487.202 40.100  416.617 1.00 33.00  ?  116 ALA G CA  1 
ATOM   6568  C C   . ALA G  1 59  ? 486.347 39.005  415.987 1.00 28.89  ?  116 ALA G C   1 
ATOM   6569  O O   . ALA G  1 59  ? 485.612 39.265  415.029 1.00 32.33  ?  116 ALA G O   1 
ATOM   6570  C CB  . ALA G  1 59  ? 488.672 39.671  416.609 1.00 43.56  ?  116 ALA G CB  1 
ATOM   6571  N N   . GLY G  1 60  ? 486.429 37.783  416.511 1.00 17.07  ?  117 GLY G N   1 
ATOM   6572  C CA  . GLY G  1 60  ? 485.768 36.646  415.902 1.00 14.16  ?  117 GLY G CA  1 
ATOM   6573  C C   . GLY G  1 60  ? 484.561 36.078  416.611 1.00 14.05  ?  117 GLY G C   1 
ATOM   6574  O O   . GLY G  1 60  ? 484.138 34.964  416.273 1.00 19.50  ?  117 GLY G O   1 
ATOM   6575  N N   . VAL G  1 61  ? 483.974 36.787  417.571 1.00 69.34  ?  118 VAL G N   1 
ATOM   6576  C CA  . VAL G  1 61  ? 482.907 36.224  418.392 1.00 74.17  ?  118 VAL G CA  1 
ATOM   6577  C C   . VAL G  1 61  ? 481.556 36.720  417.899 1.00 74.31  ?  118 VAL G C   1 
ATOM   6578  O O   . VAL G  1 61  ? 481.414 37.847  417.407 1.00 76.72  ?  118 VAL G O   1 
ATOM   6579  C CB  . VAL G  1 61  ? 483.107 36.553  419.888 1.00 75.21  ?  118 VAL G CB  1 
ATOM   6580  C CG1 . VAL G  1 61  ? 484.502 36.156  420.338 1.00 74.97  ?  118 VAL G CG1 1 
ATOM   6581  C CG2 . VAL G  1 61  ? 482.862 38.020  420.149 1.00 78.69  ?  118 VAL G CG2 1 
ATOM   6582  N N   . SER G  1 62  ? 480.555 35.847  418.006 1.00 41.57  ?  119 SER G N   1 
ATOM   6583  C CA  . SER G  1 62  ? 479.171 36.179  417.692 1.00 42.50  ?  119 SER G CA  1 
ATOM   6584  C C   . SER G  1 62  ? 478.266 35.465  418.684 1.00 40.62  ?  119 SER G C   1 
ATOM   6585  O O   . SER G  1 62  ? 478.447 34.270  418.937 1.00 37.71  ?  119 SER G O   1 
ATOM   6586  C CB  . SER G  1 62  ? 478.815 35.777  416.256 1.00 41.75  ?  119 SER G CB  1 
ATOM   6587  O OG  . SER G  1 62  ? 477.432 35.958  416.005 1.00 61.22  ?  119 SER G OG  1 
ATOM   6588  N N   . LEU G  1 63  ? 477.309 36.193  419.256 1.00 44.37  ?  120 LEU G N   1 
ATOM   6589  C CA  . LEU G  1 63  ? 476.387 35.616  420.226 1.00 47.11  ?  120 LEU G CA  1 
ATOM   6590  C C   . LEU G  1 63  ? 474.994 36.192  420.014 1.00 53.96  ?  120 LEU G C   1 
ATOM   6591  O O   . LEU G  1 63  ? 474.826 37.415  419.986 1.00 61.42  ?  120 LEU G O   1 
ATOM   6592  C CB  . LEU G  1 63  ? 476.865 35.885  421.658 1.00 38.38  ?  120 LEU G CB  1 
ATOM   6593  C CG  . LEU G  1 63  ? 476.283 34.994  422.754 1.00 36.73  ?  120 LEU G CG  1 
ATOM   6594  C CD1 . LEU G  1 63  ? 476.577 33.535  422.458 1.00 40.47  ?  120 LEU G CD1 1 
ATOM   6595  C CD2 . LEU G  1 63  ? 476.844 35.390  424.109 1.00 44.30  ?  120 LEU G CD2 1 
ATOM   6596  N N   . THR G  1 64  ? 474.004 35.315  419.866 1.00 60.93  ?  121 THR G N   1 
ATOM   6597  C CA  . THR G  1 64  ? 472.615 35.704  419.661 1.00 64.58  ?  121 THR G CA  1 
ATOM   6598  C C   . THR G  1 64  ? 471.794 35.425  420.918 1.00 69.65  ?  121 THR G C   1 
ATOM   6599  O O   . THR G  1 64  ? 472.312 34.983  421.947 1.00 70.84  ?  121 THR G O   1 
ATOM   6600  C CB  . THR G  1 64  ? 472.019 34.973  418.456 1.00 59.68  ?  121 THR G CB  1 
ATOM   6601  O OG1 . THR G  1 64  ? 471.846 33.586  418.773 1.00 61.36  ?  121 THR G OG1 1 
ATOM   6602  C CG2 . THR G  1 64  ? 472.939 35.101  417.260 1.00 61.97  ?  121 THR G CG2 1 
ATOM   6603  N N   . GLY G  1 65  ? 470.492 35.693  420.820 1.00 54.90  ?  122 GLY G N   1 
ATOM   6604  C CA  . GLY G  1 65  ? 469.590 35.395  421.916 1.00 54.05  ?  122 GLY G CA  1 
ATOM   6605  C C   . GLY G  1 65  ? 469.295 33.909  422.025 1.00 53.68  ?  122 GLY G C   1 
ATOM   6606  O O   . GLY G  1 65  ? 469.294 33.173  421.041 1.00 48.14  ?  122 GLY G O   1 
ATOM   6607  N N   . GLY G  1 66  ? 469.034 33.467  423.255 1.00 66.65  ?  123 GLY G N   1 
ATOM   6608  C CA  . GLY G  1 66  ? 468.886 32.059  423.547 1.00 65.95  ?  123 GLY G CA  1 
ATOM   6609  C C   . GLY G  1 66  ? 470.188 31.322  423.762 1.00 65.16  ?  123 GLY G C   1 
ATOM   6610  O O   . GLY G  1 66  ? 470.175 30.205  424.293 1.00 61.26  ?  123 GLY G O   1 
ATOM   6611  N N   . LEU G  1 67  ? 471.312 31.907  423.359 1.00 50.71  ?  124 LEU G N   1 
ATOM   6612  C CA  . LEU G  1 67  ? 472.642 31.360  423.592 1.00 47.30  ?  124 LEU G CA  1 
ATOM   6613  C C   . LEU G  1 67  ? 473.430 32.373  424.409 1.00 49.71  ?  124 LEU G C   1 
ATOM   6614  O O   . LEU G  1 67  ? 473.670 33.493  423.946 1.00 54.30  ?  124 LEU G O   1 
ATOM   6615  C CB  . LEU G  1 67  ? 473.354 31.061  422.270 1.00 46.54  ?  124 LEU G CB  1 
ATOM   6616  C CG  . LEU G  1 67  ? 473.200 29.694  421.600 1.00 40.96  ?  124 LEU G CG  1 
ATOM   6617  C CD1 . LEU G  1 67  ? 471.785 29.169  421.678 1.00 48.15  ?  124 LEU G CD1 1 
ATOM   6618  C CD2 . LEU G  1 67  ? 473.610 29.833  420.153 1.00 42.06  ?  124 LEU G CD2 1 
ATOM   6619  N N   . SER G  1 68  ? 473.814 31.990  425.624 1.00 68.56  ?  125 SER G N   1 
ATOM   6620  C CA  . SER G  1 68  ? 474.557 32.882  426.506 1.00 69.50  ?  125 SER G CA  1 
ATOM   6621  C C   . SER G  1 68  ? 475.675 32.103  427.175 1.00 63.26  ?  125 SER G C   1 
ATOM   6622  O O   . SER G  1 68  ? 475.424 31.079  427.819 1.00 62.56  ?  125 SER G O   1 
ATOM   6623  C CB  . SER G  1 68  ? 473.639 33.517  427.554 1.00 74.54  ?  125 SER G CB  1 
ATOM   6624  O OG  . SER G  1 68  ? 472.884 34.574  426.988 1.00 75.05  ?  125 SER G OG  1 
ATOM   6625  N N   . TYR G  1 69  ? 476.905 32.584  427.015 1.00 30.50  ?  126 TYR G N   1 
ATOM   6626  C CA  . TYR G  1 69  ? 478.037 32.009  427.727 1.00 28.95  ?  126 TYR G CA  1 
ATOM   6627  C C   . TYR G  1 69  ? 477.925 32.328  429.211 1.00 33.31  ?  126 TYR G C   1 
ATOM   6628  O O   . TYR G  1 69  ? 477.674 33.475  429.593 1.00 34.56  ?  126 TYR G O   1 
ATOM   6629  C CB  . TYR G  1 69  ? 479.345 32.554  427.157 1.00 24.71  ?  126 TYR G CB  1 
ATOM   6630  C CG  . TYR G  1 69  ? 480.589 32.183  427.937 1.00 30.19  ?  126 TYR G CG  1 
ATOM   6631  C CD1 . TYR G  1 69  ? 481.111 30.898  427.886 1.00 29.68  ?  126 TYR G CD1 1 
ATOM   6632  C CD2 . TYR G  1 69  ? 481.246 33.125  428.719 1.00 36.55  ?  126 TYR G CD2 1 
ATOM   6633  C CE1 . TYR G  1 69  ? 482.252 30.562  428.594 1.00 34.10  ?  126 TYR G CE1 1 
ATOM   6634  C CE2 . TYR G  1 69  ? 482.384 32.800  429.428 1.00 37.78  ?  126 TYR G CE2 1 
ATOM   6635  C CZ  . TYR G  1 69  ? 482.883 31.519  429.364 1.00 36.97  ?  126 TYR G CZ  1 
ATOM   6636  O OH  . TYR G  1 69  ? 484.018 31.196  430.073 1.00 35.73  ?  126 TYR G OH  1 
ATOM   6637  N N   . LYS G  1 70  ? 478.105 31.313  430.049 1.00 38.69  ?  127 LYS G N   1 
ATOM   6638  C CA  . LYS G  1 70  ? 478.026 31.471  431.495 1.00 38.78  ?  127 LYS G CA  1 
ATOM   6639  C C   . LYS G  1 70  ? 479.451 31.560  432.027 1.00 44.94  ?  127 LYS G C   1 
ATOM   6640  O O   . LYS G  1 70  ? 480.189 30.570  432.016 1.00 48.09  ?  127 LYS G O   1 
ATOM   6641  C CB  . LYS G  1 70  ? 477.254 30.314  432.126 1.00 38.40  ?  127 LYS G CB  1 
ATOM   6642  C CG  . LYS G  1 70  ? 476.625 30.645  433.469 1.00 42.05  ?  127 LYS G CG  1 
ATOM   6643  C CD  . LYS G  1 70  ? 475.308 29.907  433.658 1.00 36.61  ?  127 LYS G CD  1 
ATOM   6644  C CE  . LYS G  1 70  ? 474.125 30.778  433.249 1.00 40.15  ?  127 LYS G CE  1 
ATOM   6645  N NZ  . LYS G  1 70  ? 472.813 30.110  433.486 1.00 41.56  ?  127 LYS G NZ  1 
ATOM   6646  N N   . GLU G  1 71  ? 479.831 32.753  432.494 1.00 62.95  ?  128 GLU G N   1 
ATOM   6647  C CA  . GLU G  1 71  ? 481.221 33.015  432.851 1.00 64.22  ?  128 GLU G CA  1 
ATOM   6648  C C   . GLU G  1 71  ? 481.671 32.191  434.050 1.00 67.40  ?  128 GLU G C   1 
ATOM   6649  O O   . GLU G  1 71  ? 482.869 31.920  434.198 1.00 67.76  ?  128 GLU G O   1 
ATOM   6650  C CB  . GLU G  1 71  ? 481.409 34.508  433.130 1.00 65.23  ?  128 GLU G CB  1 
ATOM   6651  C CG  . GLU G  1 71  ? 482.855 34.951  433.293 1.00 75.89  ?  128 GLU G CG  1 
ATOM   6652  C CD  . GLU G  1 71  ? 483.546 35.189  431.964 1.00 85.04  ?  128 GLU G CD  1 
ATOM   6653  O OE1 . GLU G  1 71  ? 484.555 34.507  431.687 1.00 80.83  ?  128 GLU G OE1 1 
ATOM   6654  O OE2 . GLU G  1 71  ? 483.079 36.058  431.198 1.00 88.14  -1 128 GLU G OE2 1 
ATOM   6655  N N   . ASP G  1 72  ? 480.737 31.782  434.909 1.00 69.48  ?  129 ASP G N   1 
ATOM   6656  C CA  . ASP G  1 72  ? 481.104 31.077  436.133 1.00 71.10  ?  129 ASP G CA  1 
ATOM   6657  C C   . ASP G  1 72  ? 481.694 29.704  435.828 1.00 70.65  ?  129 ASP G C   1 
ATOM   6658  O O   . ASP G  1 72  ? 482.813 29.386  436.250 1.00 67.20  ?  129 ASP G O   1 
ATOM   6659  C CB  . ASP G  1 72  ? 479.881 30.954  437.045 1.00 69.35  ?  129 ASP G CB  1 
ATOM   6660  C CG  . ASP G  1 72  ? 479.241 32.297  437.349 1.00 76.25  ?  129 ASP G CG  1 
ATOM   6661  O OD1 . ASP G  1 72  ? 478.422 32.767  436.531 1.00 70.47  -1 129 ASP G OD1 1 
ATOM   6662  O OD2 . ASP G  1 72  ? 479.554 32.882  438.407 1.00 85.40  ?  129 ASP G OD2 1 
ATOM   6663  N N   . THR G  1 73  ? 480.955 28.874  435.095 1.00 41.47  ?  130 THR G N   1 
ATOM   6664  C CA  . THR G  1 73  ? 481.351 27.497  434.828 1.00 37.59  ?  130 THR G CA  1 
ATOM   6665  C C   . THR G  1 73  ? 482.050 27.314  433.485 1.00 32.44  ?  130 THR G C   1 
ATOM   6666  O O   . THR G  1 73  ? 482.411 26.182  433.144 1.00 30.49  ?  130 THR G O   1 
ATOM   6667  C CB  . THR G  1 73  ? 480.127 26.577  434.905 1.00 39.98  ?  130 THR G CB  1 
ATOM   6668  O OG1 . THR G  1 73  ? 479.011 27.208  434.266 1.00 36.15  ?  130 THR G OG1 1 
ATOM   6669  C CG2 . THR G  1 73  ? 479.772 26.283  436.355 1.00 37.47  ?  130 THR G CG2 1 
ATOM   6670  N N   . LYS G  1 74  ? 482.247 28.391  432.721 1.00 57.05  ?  131 LYS G N   1 
ATOM   6671  C CA  . LYS G  1 74  ? 482.950 28.343  431.434 1.00 54.28  ?  131 LYS G CA  1 
ATOM   6672  C C   . LYS G  1 74  ? 482.272 27.390  430.452 1.00 47.79  ?  131 LYS G C   1 
ATOM   6673  O O   . LYS G  1 74  ? 482.933 26.661  429.711 1.00 47.58  ?  131 LYS G O   1 
ATOM   6674  C CB  . LYS G  1 74  ? 484.424 27.968  431.615 1.00 54.52  ?  131 LYS G CB  1 
ATOM   6675  C CG  . LYS G  1 74  ? 485.211 28.900  432.520 1.00 60.14  ?  131 LYS G CG  1 
ATOM   6676  C CD  . LYS G  1 74  ? 485.522 28.236  433.850 1.00 67.32  ?  131 LYS G CD  1 
ATOM   6677  C CE  . LYS G  1 74  ? 486.328 26.961  433.652 1.00 57.25  ?  131 LYS G CE  1 
ATOM   6678  N NZ  . LYS G  1 74  ? 486.588 26.261  434.942 1.00 58.67  ?  131 LYS G NZ  1 
ATOM   6679  N N   . GLU G  1 75  ? 480.941 27.393  430.445 1.00 38.03  ?  132 GLU G N   1 
ATOM   6680  C CA  . GLU G  1 75  ? 480.173 26.568  429.521 1.00 41.54  ?  132 GLU G CA  1 
ATOM   6681  C C   . GLU G  1 75  ? 478.991 27.372  429.003 1.00 42.98  ?  132 GLU G C   1 
ATOM   6682  O O   . GLU G  1 75  ? 478.222 27.929  429.794 1.00 44.86  ?  132 GLU G O   1 
ATOM   6683  C CB  . GLU G  1 75  ? 479.695 25.278  430.201 1.00 47.43  ?  132 GLU G CB  1 
ATOM   6684  C CG  . GLU G  1 75  ? 479.157 25.484  431.607 1.00 52.30  ?  132 GLU G CG  1 
ATOM   6685  C CD  . GLU G  1 75  ? 479.171 24.215  432.441 1.00 58.50  ?  132 GLU G CD  1 
ATOM   6686  O OE1 . GLU G  1 75  ? 478.083 23.725  432.807 1.00 57.44  ?  132 GLU G OE1 1 
ATOM   6687  O OE2 . GLU G  1 75  ? 480.275 23.708  432.732 1.00 66.43  -1 132 GLU G OE2 1 
ATOM   6688  N N   . LEU G  1 76  ? 478.851 27.438  427.681 1.00 24.35  ?  133 LEU G N   1 
ATOM   6689  C CA  . LEU G  1 76  ? 477.748 28.171  427.079 1.00 21.93  ?  133 LEU G CA  1 
ATOM   6690  C C   . LEU G  1 76  ? 476.474 27.340  427.138 1.00 29.59  ?  133 LEU G C   1 
ATOM   6691  O O   . LEU G  1 76  ? 476.507 26.112  427.015 1.00 32.68  ?  133 LEU G O   1 
ATOM   6692  C CB  . LEU G  1 76  ? 478.067 28.553  425.632 1.00 14.42  ?  133 LEU G CB  1 
ATOM   6693  C CG  . LEU G  1 76  ? 477.946 27.501  424.528 1.00 20.88  ?  133 LEU G CG  1 
ATOM   6694  C CD1 . LEU G  1 76  ? 477.865 28.179  423.171 1.00 18.47  ?  133 LEU G CD1 1 
ATOM   6695  C CD2 . LEU G  1 76  ? 479.113 26.531  424.568 1.00 18.69  ?  133 LEU G CD2 1 
ATOM   6696  N N   . VAL G  1 77  ? 475.346 28.019  427.335 1.00 30.85  ?  134 VAL G N   1 
ATOM   6697  C CA  . VAL G  1 77  ? 474.059 27.373  427.560 1.00 23.71  ?  134 VAL G CA  1 
ATOM   6698  C C   . VAL G  1 77  ? 473.184 27.579  426.334 1.00 25.90  ?  134 VAL G C   1 
ATOM   6699  O O   . VAL G  1 77  ? 472.981 28.715  425.889 1.00 26.46  ?  134 VAL G O   1 
ATOM   6700  C CB  . VAL G  1 77  ? 473.370 27.922  428.821 1.00 25.59  ?  134 VAL G CB  1 
ATOM   6701  C CG1 . VAL G  1 77  ? 472.046 27.211  429.053 1.00 37.12  ?  134 VAL G CG1 1 
ATOM   6702  C CG2 . VAL G  1 77  ? 474.281 27.779  430.029 1.00 25.55  ?  134 VAL G CG2 1 
ATOM   6703  N N   . VAL G  1 78  ? 472.670 26.482  425.790 1.00 49.43  ?  135 VAL G N   1 
ATOM   6704  C CA  . VAL G  1 78  ? 471.677 26.526  424.723 1.00 51.84  ?  135 VAL G CA  1 
ATOM   6705  C C   . VAL G  1 78  ? 470.299 26.462  425.370 1.00 58.65  ?  135 VAL G C   1 
ATOM   6706  O O   . VAL G  1 78  ? 469.980 25.497  426.073 1.00 57.79  ?  135 VAL G O   1 
ATOM   6707  C CB  . VAL G  1 78  ? 471.876 25.376  423.726 1.00 43.58  ?  135 VAL G CB  1 
ATOM   6708  C CG1 . VAL G  1 78  ? 470.792 25.406  422.660 1.00 48.90  ?  135 VAL G CG1 1 
ATOM   6709  C CG2 . VAL G  1 78  ? 473.257 25.457  423.094 1.00 40.80  ?  135 VAL G CG2 1 
ATOM   6710  N N   . ALA G  1 79  ? 469.481 27.488  425.133 1.00 49.52  ?  136 ALA G N   1 
ATOM   6711  C CA  . ALA G  1 79  ? 468.196 27.592  425.814 1.00 46.35  ?  136 ALA G CA  1 
ATOM   6712  C C   . ALA G  1 79  ? 467.192 26.593  425.258 1.00 47.84  ?  136 ALA G C   1 
ATOM   6713  O O   . ALA G  1 79  ? 466.808 25.644  425.947 1.00 47.30  ?  136 ALA G O   1 
ATOM   6714  C CB  . ALA G  1 79  ? 467.641 29.014  425.704 1.00 47.26  ?  136 ALA G CB  1 
ATOM   6715  N N   . LYS G  1 80  ? 466.762 26.792  424.016 1.00 63.77  ?  137 LYS G N   1 
ATOM   6716  C CA  . LYS G  1 80  ? 465.779 25.915  423.400 1.00 72.90  ?  137 LYS G CA  1 
ATOM   6717  C C   . LYS G  1 80  ? 466.470 24.765  422.680 1.00 71.28  ?  137 LYS G C   1 
ATOM   6718  O O   . LYS G  1 80  ? 467.462 24.961  421.971 1.00 71.67  ?  137 LYS G O   1 
ATOM   6719  C CB  . LYS G  1 80  ? 464.890 26.697  422.430 1.00 74.96  ?  137 LYS G CB  1 
ATOM   6720  C CG  . LYS G  1 80  ? 463.958 27.679  423.124 1.00 72.26  ?  137 LYS G CG  1 
ATOM   6721  C CD  . LYS G  1 80  ? 463.065 26.962  424.129 1.00 68.80  ?  137 LYS G CD  1 
ATOM   6722  C CE  . LYS G  1 80  ? 462.331 27.943  425.031 1.00 72.51  ?  137 LYS G CE  1 
ATOM   6723  N NZ  . LYS G  1 80  ? 461.434 28.850  424.265 1.00 74.40  ?  137 LYS G NZ  1 
ATOM   6724  N N   . ALA G  1 81  ? 465.938 23.560  422.873 1.00 63.58  ?  138 ALA G N   1 
ATOM   6725  C CA  . ALA G  1 81  ? 466.547 22.359  422.327 1.00 59.93  ?  138 ALA G CA  1 
ATOM   6726  C C   . ALA G  1 81  ? 466.437 22.330  420.805 1.00 60.70  ?  138 ALA G C   1 
ATOM   6727  O O   . ALA G  1 81  ? 465.602 23.003  420.197 1.00 60.75  ?  138 ALA G O   1 
ATOM   6728  C CB  . ALA G  1 81  ? 465.891 21.111  422.920 1.00 62.48  ?  138 ALA G CB  1 
ATOM   6729  N N   . GLY G  1 82  ? 467.303 21.532  420.193 1.00 71.68  ?  139 GLY G N   1 
ATOM   6730  C CA  . GLY G  1 82  ? 467.302 21.387  418.753 1.00 70.39  ?  139 GLY G CA  1 
ATOM   6731  C C   . GLY G  1 82  ? 468.512 20.602  418.298 1.00 64.87  ?  139 GLY G C   1 
ATOM   6732  O O   . GLY G  1 82  ? 469.304 20.103  419.106 1.00 67.32  ?  139 GLY G O   1 
ATOM   6733  N N   . VAL G  1 83  ? 468.637 20.498  416.980 1.00 31.27  ?  140 VAL G N   1 
ATOM   6734  C CA  . VAL G  1 83  ? 469.762 19.822  416.342 1.00 25.78  ?  140 VAL G CA  1 
ATOM   6735  C C   . VAL G  1 83  ? 470.696 20.896  415.805 1.00 26.56  ?  140 VAL G C   1 
ATOM   6736  O O   . VAL G  1 83  ? 470.343 21.637  414.881 1.00 31.12  ?  140 VAL G O   1 
ATOM   6737  C CB  . VAL G  1 83  ? 469.298 18.873  415.232 1.00 27.25  ?  140 VAL G CB  1 
ATOM   6738  C CG1 . VAL G  1 83  ? 470.496 18.328  414.469 1.00 26.89  ?  140 VAL G CG1 1 
ATOM   6739  C CG2 . VAL G  1 83  ? 468.474 17.739  415.822 1.00 34.97  ?  140 VAL G CG2 1 
ATOM   6740  N N   . TYR G  1 84  ? 471.892 20.980  416.380 1.00 32.59  ?  141 TYR G N   1 
ATOM   6741  C CA  . TYR G  1 84  ? 472.852 22.024  416.059 1.00 30.27  ?  141 TYR G CA  1 
ATOM   6742  C C   . TYR G  1 84  ? 474.090 21.419  415.413 1.00 30.86  ?  141 TYR G C   1 
ATOM   6743  O O   . TYR G  1 84  ? 474.455 20.272  415.686 1.00 35.26  ?  141 TYR G O   1 
ATOM   6744  C CB  . TYR G  1 84  ? 473.261 22.805  417.316 1.00 31.05  ?  141 TYR G CB  1 
ATOM   6745  C CG  . TYR G  1 84  ? 472.132 23.562  417.981 1.00 37.26  ?  141 TYR G CG  1 
ATOM   6746  C CD1 . TYR G  1 84  ? 471.163 22.898  418.723 1.00 40.90  ?  141 TYR G CD1 1 
ATOM   6747  C CD2 . TYR G  1 84  ? 472.044 24.941  417.879 1.00 34.57  ?  141 TYR G CD2 1 
ATOM   6748  C CE1 . TYR G  1 84  ? 470.135 23.590  419.335 1.00 45.58  ?  141 TYR G CE1 1 
ATOM   6749  C CE2 . TYR G  1 84  ? 471.026 25.642  418.490 1.00 41.39  ?  141 TYR G CE2 1 
ATOM   6750  C CZ  . TYR G  1 84  ? 470.071 24.962  419.214 1.00 51.08  ?  141 TYR G CZ  1 
ATOM   6751  O OH  . TYR G  1 84  ? 469.053 25.660  419.820 1.00 60.58  ?  141 TYR G OH  1 
ATOM   6752  N N   . TYR G  1 85  ? 474.732 22.203  414.551 1.00 24.85  ?  142 TYR G N   1 
ATOM   6753  C CA  . TYR G  1 85  ? 476.023 21.847  413.972 1.00 23.31  ?  142 TYR G CA  1 
ATOM   6754  C C   . TYR G  1 85  ? 477.105 22.535  414.796 1.00 24.65  ?  142 TYR G C   1 
ATOM   6755  O O   . TYR G  1 85  ? 477.195 23.767  414.811 1.00 24.65  ?  142 TYR G O   1 
ATOM   6756  C CB  . TYR G  1 85  ? 476.101 22.255  412.502 1.00 17.64  ?  142 TYR G CB  1 
ATOM   6757  C CG  . TYR G  1 85  ? 477.397 21.868  411.819 1.00 16.37  ?  142 TYR G CG  1 
ATOM   6758  C CD1 . TYR G  1 85  ? 477.595 20.582  411.336 1.00 20.66  ?  142 TYR G CD1 1 
ATOM   6759  C CD2 . TYR G  1 85  ? 478.419 22.793  411.655 1.00 21.57  ?  142 TYR G CD2 1 
ATOM   6760  C CE1 . TYR G  1 85  ? 478.778 20.228  410.710 1.00 20.12  ?  142 TYR G CE1 1 
ATOM   6761  C CE2 . TYR G  1 85  ? 479.603 22.449  411.029 1.00 21.81  ?  142 TYR G CE2 1 
ATOM   6762  C CZ  . TYR G  1 85  ? 479.778 21.166  410.560 1.00 18.54  ?  142 TYR G CZ  1 
ATOM   6763  O OH  . TYR G  1 85  ? 480.956 20.823  409.938 1.00 20.71  ?  142 TYR G OH  1 
ATOM   6764  N N   . VAL G  1 86  ? 477.916 21.740  415.489 1.00 19.59  ?  143 VAL G N   1 
ATOM   6765  C CA  . VAL G  1 86  ? 478.965 22.239  416.369 1.00 19.99  ?  143 VAL G CA  1 
ATOM   6766  C C   . VAL G  1 86  ? 480.308 21.855  415.770 1.00 24.29  ?  143 VAL G C   1 
ATOM   6767  O O   . VAL G  1 86  ? 480.529 20.688  415.426 1.00 30.49  ?  143 VAL G O   1 
ATOM   6768  C CB  . VAL G  1 86  ? 478.816 21.676  417.793 1.00 21.56  ?  143 VAL G CB  1 
ATOM   6769  C CG1 . VAL G  1 86  ? 479.833 22.310  418.725 1.00 24.57  ?  143 VAL G CG1 1 
ATOM   6770  C CG2 . VAL G  1 86  ? 477.400 21.894  418.302 1.00 31.79  ?  143 VAL G CG2 1 
ATOM   6771  N N   . PHE G  1 87  ? 481.206 22.831  415.642 1.00 24.19  ?  144 PHE G N   1 
ATOM   6772  C CA  . PHE G  1 87  ? 482.507 22.597  415.035 1.00 24.62  ?  144 PHE G CA  1 
ATOM   6773  C C   . PHE G  1 87  ? 483.624 23.108  415.935 1.00 25.15  ?  144 PHE G C   1 
ATOM   6774  O O   . PHE G  1 87  ? 483.438 24.037  416.726 1.00 26.07  ?  144 PHE G O   1 
ATOM   6775  C CB  . PHE G  1 87  ? 482.609 23.240  413.640 1.00 29.70  ?  144 PHE G CB  1 
ATOM   6776  C CG  . PHE G  1 87  ? 482.241 24.698  413.601 1.00 29.56  ?  144 PHE G CG  1 
ATOM   6777  C CD1 . PHE G  1 87  ? 480.935 25.090  413.360 1.00 38.92  ?  144 PHE G CD1 1 
ATOM   6778  C CD2 . PHE G  1 87  ? 483.207 25.676  413.775 1.00 32.52  ?  144 PHE G CD2 1 
ATOM   6779  C CE1 . PHE G  1 87  ? 480.596 26.428  413.310 1.00 25.57  ?  144 PHE G CE1 1 
ATOM   6780  C CE2 . PHE G  1 87  ? 482.873 27.018  413.727 1.00 26.83  ?  144 PHE G CE2 1 
ATOM   6781  C CZ  . PHE G  1 87  ? 481.566 27.393  413.490 1.00 24.36  ?  144 PHE G CZ  1 
ATOM   6782  N N   . PHE G  1 88  ? 484.791 22.482  415.795 1.00 38.55  ?  145 PHE G N   1 
ATOM   6783  C CA  . PHE G  1 88  ? 485.970 22.759  416.603 1.00 32.74  ?  145 PHE G CA  1 
ATOM   6784  C C   . PHE G  1 88  ? 487.032 23.466  415.774 1.00 35.42  ?  145 PHE G C   1 
ATOM   6785  O O   . PHE G  1 88  ? 487.147 23.250  414.564 1.00 40.81  ?  145 PHE G O   1 
ATOM   6786  C CB  . PHE G  1 88  ? 486.574 21.468  417.164 1.00 38.10  ?  145 PHE G CB  1 
ATOM   6787  C CG  . PHE G  1 88  ? 486.239 21.203  418.599 1.00 34.85  ?  145 PHE G CG  1 
ATOM   6788  C CD1 . PHE G  1 88  ? 486.462 22.166  419.566 1.00 32.32  ?  145 PHE G CD1 1 
ATOM   6789  C CD2 . PHE G  1 88  ? 485.750 19.972  418.990 1.00 36.02  ?  145 PHE G CD2 1 
ATOM   6790  C CE1 . PHE G  1 88  ? 486.168 21.917  420.892 1.00 35.95  ?  145 PHE G CE1 1 
ATOM   6791  C CE2 . PHE G  1 88  ? 485.456 19.715  420.314 1.00 40.71  ?  145 PHE G CE2 1 
ATOM   6792  C CZ  . PHE G  1 88  ? 485.666 20.689  421.266 1.00 41.92  ?  145 PHE G CZ  1 
ATOM   6793  N N   . GLN G  1 89  ? 487.818 24.308  416.441 1.00 32.95  ?  146 GLN G N   1 
ATOM   6794  C CA  . GLN G  1 89  ? 488.999 24.907  415.837 1.00 30.42  ?  146 GLN G CA  1 
ATOM   6795  C C   . GLN G  1 89  ? 490.119 24.946  416.863 1.00 26.01  ?  146 GLN G C   1 
ATOM   6796  O O   . GLN G  1 89  ? 489.933 25.463  417.968 1.00 28.85  ?  146 GLN G O   1 
ATOM   6797  C CB  . GLN G  1 89  ? 488.711 26.319  415.319 1.00 36.99  ?  146 GLN G CB  1 
ATOM   6798  C CG  . GLN G  1 89  ? 488.421 26.388  413.834 1.00 35.09  ?  146 GLN G CG  1 
ATOM   6799  C CD  . GLN G  1 89  ? 488.184 27.807  413.369 1.00 50.13  ?  146 GLN G CD  1 
ATOM   6800  O OE1 . GLN G  1 89  ? 489.052 28.427  412.755 1.00 54.38  ?  146 GLN G OE1 1 
ATOM   6801  N NE2 . GLN G  1 89  ? 487.004 28.334  413.668 1.00 45.90  ?  146 GLN G NE2 1 
ATOM   6802  N N   . LEU G  1 90  ? 491.275 24.401  416.495 1.00 23.45  ?  147 LEU G N   1 
ATOM   6803  C CA  . LEU G  1 90  ? 492.455 24.431  417.350 1.00 25.07  ?  147 LEU G CA  1 
ATOM   6804  C C   . LEU G  1 90  ? 493.661 24.784  416.495 1.00 25.26  ?  147 LEU G C   1 
ATOM   6805  O O   . LEU G  1 90  ? 493.996 24.046  415.565 1.00 33.02  ?  147 LEU G O   1 
ATOM   6806  C CB  . LEU G  1 90  ? 492.669 23.086  418.050 1.00 25.09  ?  147 LEU G CB  1 
ATOM   6807  C CG  . LEU G  1 90  ? 493.763 23.063  419.118 1.00 24.74  ?  147 LEU G CG  1 
ATOM   6808  C CD1 . LEU G  1 90  ? 493.362 23.922  420.303 1.00 25.57  ?  147 LEU G CD1 1 
ATOM   6809  C CD2 . LEU G  1 90  ? 494.066 21.643  419.564 1.00 25.41  ?  147 LEU G CD2 1 
ATOM   6810  N N   . GLU G  1 91  ? 494.308 25.903  416.808 1.00 27.11  ?  148 GLU G N   1 
ATOM   6811  C CA  . GLU G  1 91  ? 495.534 26.309  416.134 1.00 29.90  ?  148 GLU G CA  1 
ATOM   6812  C C   . GLU G  1 91  ? 496.561 26.701  417.181 1.00 28.96  ?  148 GLU G C   1 
ATOM   6813  O O   . GLU G  1 91  ? 496.267 27.502  418.074 1.00 32.24  ?  148 GLU G O   1 
ATOM   6814  C CB  . GLU G  1 91  ? 495.294 27.472  415.167 1.00 31.40  ?  148 GLU G CB  1 
ATOM   6815  C CG  . GLU G  1 91  ? 496.484 27.760  414.263 1.00 39.55  ?  148 GLU G CG  1 
ATOM   6816  C CD  . GLU G  1 91  ? 496.309 29.017  413.433 1.00 46.00  ?  148 GLU G CD  1 
ATOM   6817  O OE1 . GLU G  1 91  ? 497.328 29.671  413.123 1.00 43.75  ?  148 GLU G OE1 1 
ATOM   6818  O OE2 . GLU G  1 91  ? 495.155 29.349  413.089 1.00 50.69  -1 148 GLU G OE2 1 
ATOM   6819  N N   . LEU G  1 92  ? 497.759 26.135  417.072 1.00 22.40  ?  149 LEU G N   1 
ATOM   6820  C CA  . LEU G  1 92  ? 498.838 26.390  418.013 1.00 22.44  ?  149 LEU G CA  1 
ATOM   6821  C C   . LEU G  1 92  ? 500.067 26.884  417.264 1.00 24.35  ?  149 LEU G C   1 
ATOM   6822  O O   . LEU G  1 92  ? 500.423 26.345  416.211 1.00 29.85  ?  149 LEU G O   1 
ATOM   6823  C CB  . LEU G  1 92  ? 499.189 25.133  418.816 1.00 18.41  ?  149 LEU G CB  1 
ATOM   6824  C CG  . LEU G  1 92  ? 498.046 24.444  419.567 1.00 20.27  ?  149 LEU G CG  1 
ATOM   6825  C CD1 . LEU G  1 92  ? 497.424 23.340  418.726 1.00 22.49  ?  149 LEU G CD1 1 
ATOM   6826  C CD2 . LEU G  1 92  ? 498.531 23.898  420.899 1.00 23.60  ?  149 LEU G CD2 1 
ATOM   6827  N N   . ARG G  1 93  ? 500.707 27.910  417.810 1.00 29.93  ?  150 ARG G N   1 
ATOM   6828  C CA  . ARG G  1 93  ? 501.935 28.462  417.257 1.00 32.09  ?  150 ARG G CA  1 
ATOM   6829  C C   . ARG G  1 93  ? 503.080 28.196  418.222 1.00 36.11  ?  150 ARG G C   1 
ATOM   6830  O O   . ARG G  1 93  ? 502.959 28.456  419.423 1.00 37.13  ?  150 ARG G O   1 
ATOM   6831  C CB  . ARG G  1 93  ? 501.793 29.964  416.996 1.00 36.36  ?  150 ARG G CB  1 
ATOM   6832  C CG  . ARG G  1 93  ? 501.122 30.730  418.126 1.00 37.58  ?  150 ARG G CG  1 
ATOM   6833  C CD  . ARG G  1 93  ? 501.065 32.220  417.829 1.00 42.27  ?  150 ARG G CD  1 
ATOM   6834  N NE  . ARG G  1 93  ? 502.374 32.852  417.966 1.00 41.12  ?  150 ARG G NE  1 
ATOM   6835  C CZ  . ARG G  1 93  ? 502.816 33.410  419.088 1.00 41.67  ?  150 ARG G CZ  1 
ATOM   6836  N NH1 . ARG G  1 93  ? 502.053 33.415  420.172 1.00 38.77  ?  150 ARG G NH1 1 
ATOM   6837  N NH2 . ARG G  1 93  ? 504.020 33.963  419.127 1.00 45.44  ?  150 ARG G NH2 1 
ATOM   6838  N N   . ARG G  1 94  ? 504.184 27.673  417.697 1.00 17.30  ?  151 ARG G N   1 
ATOM   6839  C CA  . ARG G  1 94  ? 505.361 27.434  418.520 1.00 16.91  ?  151 ARG G CA  1 
ATOM   6840  C C   . ARG G  1 94  ? 505.976 28.771  418.913 1.00 22.30  ?  151 ARG G C   1 
ATOM   6841  O O   . ARG G  1 94  ? 506.337 29.571  418.045 1.00 26.98  ?  151 ARG G O   1 
ATOM   6842  C CB  . ARG G  1 94  ? 506.366 26.579  417.754 1.00 19.69  ?  151 ARG G CB  1 
ATOM   6843  C CG  . ARG G  1 94  ? 507.634 26.258  418.519 1.00 17.83  ?  151 ARG G CG  1 
ATOM   6844  C CD  . ARG G  1 94  ? 508.726 25.775  417.580 1.00 19.42  ?  151 ARG G CD  1 
ATOM   6845  N NE  . ARG G  1 94  ? 508.273 24.691  416.714 1.00 15.18  ?  151 ARG G NE  1 
ATOM   6846  C CZ  . ARG G  1 94  ? 508.344 23.403  417.033 1.00 15.89  ?  151 ARG G CZ  1 
ATOM   6847  N NH1 . ARG G  1 94  ? 508.847 23.036  418.204 1.00 15.64  ?  151 ARG G NH1 1 
ATOM   6848  N NH2 . ARG G  1 94  ? 507.910 22.483  416.183 1.00 18.08  ?  151 ARG G NH2 1 
ATOM   6849  N N   . VAL G  1 95  ? 506.082 29.023  420.221 1.00 29.09  ?  152 VAL G N   1 
ATOM   6850  C CA  . VAL G  1 95  ? 506.595 30.297  420.715 1.00 28.12  ?  152 VAL G CA  1 
ATOM   6851  C C   . VAL G  1 95  ? 508.061 30.231  421.110 1.00 32.34  ?  152 VAL G C   1 
ATOM   6852  O O   . VAL G  1 95  ? 508.638 31.262  421.483 1.00 35.59  ?  152 VAL G O   1 
ATOM   6853  C CB  . VAL G  1 95  ? 505.753 30.812  421.899 1.00 26.78  ?  152 VAL G CB  1 
ATOM   6854  C CG1 . VAL G  1 95  ? 504.283 30.880  421.514 1.00 30.69  ?  152 VAL G CG1 1 
ATOM   6855  C CG2 . VAL G  1 95  ? 505.955 29.933  423.120 1.00 31.66  ?  152 VAL G CG2 1 
ATOM   6856  N N   . VAL G  1 96  ? 508.684 29.056  421.054 1.00 44.85  ?  153 VAL G N   1 
ATOM   6857  C CA  . VAL G  1 96  ? 510.101 28.906  421.365 1.00 44.88  ?  153 VAL G CA  1 
ATOM   6858  C C   . VAL G  1 96  ? 510.721 28.000  420.314 1.00 43.63  ?  153 VAL G C   1 
ATOM   6859  O O   . VAL G  1 96  ? 510.336 26.832  420.194 1.00 46.82  ?  153 VAL G O   1 
ATOM   6860  C CB  . VAL G  1 96  ? 510.340 28.327  422.771 1.00 43.29  ?  153 VAL G CB  1 
ATOM   6861  C CG1 . VAL G  1 96  ? 511.812 27.996  422.968 1.00 50.71  ?  153 VAL G CG1 1 
ATOM   6862  C CG2 . VAL G  1 96  ? 509.868 29.299  423.835 1.00 42.04  ?  153 VAL G CG2 1 
ATOM   6863  N N   . ALA G  1 97  ? 511.685 28.525  419.565 1.00 31.16  ?  154 ALA G N   1 
ATOM   6864  C CA  . ALA G  1 97  ? 512.323 27.733  418.527 1.00 38.86  ?  154 ALA G CA  1 
ATOM   6865  C C   . ALA G  1 97  ? 513.234 26.679  419.144 1.00 40.50  ?  154 ALA G C   1 
ATOM   6866  O O   . ALA G  1 97  ? 513.804 26.869  420.222 1.00 38.39  ?  154 ALA G O   1 
ATOM   6867  C CB  . ALA G  1 97  ? 513.118 28.629  417.579 1.00 42.95  ?  154 ALA G CB  1 
ATOM   6868  N N   . GLY G  1 98  ? 513.358 25.549  418.448 1.00 38.77  ?  155 GLY G N   1 
ATOM   6869  C CA  . GLY G  1 98  ? 514.225 24.475  418.875 1.00 33.42  ?  155 GLY G CA  1 
ATOM   6870  C C   . GLY G  1 98  ? 513.649 23.543  419.917 1.00 31.67  ?  155 GLY G C   1 
ATOM   6871  O O   . GLY G  1 98  ? 514.226 22.474  420.149 1.00 38.85  ?  155 GLY G O   1 
ATOM   6872  N N   . GLU G  1 99  ? 512.532 23.898  420.551 1.00 38.50  ?  156 GLU G N   1 
ATOM   6873  C CA  . GLU G  1 99  ? 511.975 23.107  421.636 1.00 43.31  ?  156 GLU G CA  1 
ATOM   6874  C C   . GLU G  1 99  ? 510.492 22.853  421.404 1.00 40.51  ?  156 GLU G C   1 
ATOM   6875  O O   . GLU G  1 99  ? 509.821 23.567  420.654 1.00 38.83  ?  156 GLU G O   1 
ATOM   6876  C CB  . GLU G  1 99  ? 512.171 23.797  422.994 1.00 43.61  ?  156 GLU G CB  1 
ATOM   6877  C CG  . GLU G  1 99  ? 513.622 23.989  423.400 1.00 45.88  ?  156 GLU G CG  1 
ATOM   6878  C CD  . GLU G  1 99  ? 513.762 24.680  424.741 1.00 49.35  ?  156 GLU G CD  1 
ATOM   6879  O OE1 . GLU G  1 99  ? 512.757 25.237  425.232 1.00 51.76  ?  156 GLU G OE1 1 
ATOM   6880  O OE2 . GLU G  1 99  ? 514.875 24.665  425.308 1.00 49.45  -1 156 GLU G OE2 1 
ATOM   6881  N N   . GLY G  1 100 ? 509.994 21.820  422.061 1.00 19.64  ?  157 GLY G N   1 
ATOM   6882  C CA  . GLY G  1 100 ? 508.582 21.501  422.113 1.00 18.18  ?  157 GLY G CA  1 
ATOM   6883  C C   . GLY G  1 100 ? 508.176 20.455  421.093 1.00 22.99  ?  157 GLY G C   1 
ATOM   6884  O O   . GLY G  1 100 ? 508.695 20.400  419.972 1.00 29.54  ?  157 GLY G O   1 
ATOM   6885  N N   . SER G  1 101 ? 507.213 19.624  421.485 1.00 29.29  ?  158 SER G N   1 
ATOM   6886  C CA  . SER G  1 101 ? 506.572 18.589  420.680 1.00 30.98  ?  158 SER G CA  1 
ATOM   6887  C C   . SER G  1 101 ? 505.574 17.878  421.580 1.00 25.50  ?  158 SER G C   1 
ATOM   6888  O O   . SER G  1 101 ? 505.680 17.934  422.809 1.00 28.75  ?  158 SER G O   1 
ATOM   6889  C CB  . SER G  1 101 ? 507.576 17.582  420.106 1.00 35.39  ?  158 SER G CB  1 
ATOM   6890  O OG  . SER G  1 101 ? 508.234 16.873  421.142 1.00 30.67  ?  158 SER G OG  1 
ATOM   6891  N N   . GLY G  1 102 ? 504.617 17.203  420.965 1.00 23.66  ?  159 GLY G N   1 
ATOM   6892  C CA  . GLY G  1 102 ? 503.627 16.466  421.720 1.00 28.20  ?  159 GLY G CA  1 
ATOM   6893  C C   . GLY G  1 102 ? 502.303 16.423  420.981 1.00 33.64  ?  159 GLY G C   1 
ATOM   6894  O O   . GLY G  1 102 ? 502.248 16.605  419.768 1.00 30.14  ?  159 GLY G O   1 
ATOM   6895  N N   . SER G  1 103 ? 501.244 16.176  421.750 1.00 38.32  ?  160 SER G N   1 
ATOM   6896  C CA  . SER G  1 103 ? 499.888 16.068  421.228 1.00 32.53  ?  160 SER G CA  1 
ATOM   6897  C C   . SER G  1 103 ? 498.941 16.852  422.124 1.00 31.99  ?  160 SER G C   1 
ATOM   6898  O O   . SER G  1 103 ? 498.892 16.617  423.335 1.00 38.21  ?  160 SER G O   1 
ATOM   6899  C CB  . SER G  1 103 ? 499.443 14.604  421.148 1.00 38.82  ?  160 SER G CB  1 
ATOM   6900  O OG  . SER G  1 103 ? 500.480 13.786  420.638 1.00 50.15  ?  160 SER G OG  1 
ATOM   6901  N N   . VAL G  1 104 ? 498.193 17.775  421.528 1.00 30.50  ?  161 VAL G N   1 
ATOM   6902  C CA  . VAL G  1 104 ? 497.194 18.569  422.234 1.00 31.43  ?  161 VAL G CA  1 
ATOM   6903  C C   . VAL G  1 104 ? 495.814 18.076  421.828 1.00 34.46  ?  161 VAL G C   1 
ATOM   6904  O O   . VAL G  1 104 ? 495.551 17.844  420.642 1.00 35.43  ?  161 VAL G O   1 
ATOM   6905  C CB  . VAL G  1 104 ? 497.352 20.073  421.934 1.00 32.66  ?  161 VAL G CB  1 
ATOM   6906  C CG1 . VAL G  1 104 ? 496.359 20.888  422.750 1.00 33.65  ?  161 VAL G CG1 1 
ATOM   6907  C CG2 . VAL G  1 104 ? 498.775 20.516  422.216 1.00 33.81  ?  161 VAL G CG2 1 
ATOM   6908  N N   . SER G  1 105 ? 494.934 17.914  422.812 1.00 45.46  ?  162 SER G N   1 
ATOM   6909  C CA  . SER G  1 105 ? 493.599 17.383  422.584 1.00 44.35  ?  162 SER G CA  1 
ATOM   6910  C C   . SER G  1 105 ? 492.545 18.353  423.093 1.00 49.03  ?  162 SER G C   1 
ATOM   6911  O O   . SER G  1 105 ? 492.744 19.028  424.109 1.00 55.05  ?  162 SER G O   1 
ATOM   6912  C CB  . SER G  1 105 ? 493.420 16.022  423.268 1.00 45.35  ?  162 SER G CB  1 
ATOM   6913  O OG  . SER G  1 105 ? 494.246 15.037  422.674 1.00 66.34  ?  162 SER G OG  1 
ATOM   6914  N N   . LEU G  1 106 ? 491.428 18.419  422.376 1.00 28.78  ?  163 LEU G N   1 
ATOM   6915  C CA  . LEU G  1 106 ? 490.233 19.119  422.813 1.00 23.37  ?  163 LEU G CA  1 
ATOM   6916  C C   . LEU G  1 106 ? 489.109 18.108  422.998 1.00 27.48  ?  163 LEU G C   1 
ATOM   6917  O O   . LEU G  1 106 ? 489.114 17.030  422.402 1.00 36.42  ?  163 LEU G O   1 
ATOM   6918  C CB  . LEU G  1 106 ? 489.801 20.198  421.811 1.00 25.94  ?  163 LEU G CB  1 
ATOM   6919  C CG  . LEU G  1 106 ? 490.656 21.459  421.689 1.00 27.86  ?  163 LEU G CG  1 
ATOM   6920  C CD1 . LEU G  1 106 ? 489.975 22.470  420.776 1.00 18.50  ?  163 LEU G CD1 1 
ATOM   6921  C CD2 . LEU G  1 106 ? 490.921 22.062  423.060 1.00 26.30  ?  163 LEU G CD2 1 
ATOM   6922  N N   . ALA G  1 107 ? 488.151 18.462  423.849 1.00 37.25  ?  164 ALA G N   1 
ATOM   6923  C CA  . ALA G  1 107 ? 486.983 17.624  424.069 1.00 32.83  ?  164 ALA G CA  1 
ATOM   6924  C C   . ALA G  1 107 ? 485.802 18.515  424.415 1.00 32.92  ?  164 ALA G C   1 
ATOM   6925  O O   . ALA G  1 107 ? 485.964 19.524  425.103 1.00 42.06  ?  164 ALA G O   1 
ATOM   6926  C CB  . ALA G  1 107 ? 487.223 16.602  425.185 1.00 41.30  ?  164 ALA G CB  1 
ATOM   6927  N N   . LEU G  1 108 ? 484.621 18.136  423.936 1.00 22.95  ?  165 LEU G N   1 
ATOM   6928  C CA  . LEU G  1 108 ? 483.388 18.871  424.205 1.00 24.61  ?  165 LEU G CA  1 
ATOM   6929  C C   . LEU G  1 108 ? 482.460 17.961  424.995 1.00 29.07  ?  165 LEU G C   1 
ATOM   6930  O O   . LEU G  1 108 ? 481.987 16.945  424.475 1.00 34.07  ?  165 LEU G O   1 
ATOM   6931  C CB  . LEU G  1 108 ? 482.735 19.341  422.906 1.00 25.51  ?  165 LEU G CB  1 
ATOM   6932  C CG  . LEU G  1 108 ? 481.405 20.090  423.018 1.00 29.51  ?  165 LEU G CG  1 
ATOM   6933  C CD1 . LEU G  1 108 ? 481.428 21.337  422.150 1.00 23.74  ?  165 LEU G CD1 1 
ATOM   6934  C CD2 . LEU G  1 108 ? 480.247 19.187  422.625 1.00 32.40  ?  165 LEU G CD2 1 
ATOM   6935  N N   . HIS G  1 109 ? 482.199 18.325  426.247 1.00 43.08  ?  166 HIS G N   1 
ATOM   6936  C CA  . HIS G  1 109 ? 481.377 17.529  427.142 1.00 52.22  ?  166 HIS G CA  1 
ATOM   6937  C C   . HIS G  1 109 ? 480.043 18.221  427.394 1.00 54.64  ?  166 HIS G C   1 
ATOM   6938  O O   . HIS G  1 109 ? 479.955 19.452  427.417 1.00 51.95  ?  166 HIS G O   1 
ATOM   6939  C CB  . HIS G  1 109 ? 482.087 17.291  428.479 1.00 52.76  ?  166 HIS G CB  1 
ATOM   6940  C CG  . HIS G  1 109 ? 483.421 16.627  428.347 1.00 45.51  ?  166 HIS G CG  1 
ATOM   6941  N ND1 . HIS G  1 109 ? 484.518 17.010  429.087 1.00 50.40  ?  166 HIS G ND1 1 
ATOM   6942  C CD2 . HIS G  1 109 ? 483.835 15.603  427.564 1.00 45.24  ?  166 HIS G CD2 1 
ATOM   6943  C CE1 . HIS G  1 109 ? 485.552 16.253  428.764 1.00 52.11  ?  166 HIS G CE1 1 
ATOM   6944  N NE2 . HIS G  1 109 ? 485.164 15.390  427.843 1.00 55.10  ?  166 HIS G NE2 1 
ATOM   6945  N N   . LEU G  1 110 ? 479.005 17.410  427.582 1.00 53.27  ?  167 LEU G N   1 
ATOM   6946  C CA  . LEU G  1 110 ? 477.685 17.895  427.971 1.00 53.81  ?  167 LEU G CA  1 
ATOM   6947  C C   . LEU G  1 110 ? 477.518 17.619  429.460 1.00 60.43  ?  167 LEU G C   1 
ATOM   6948  O O   . LEU G  1 110 ? 477.389 16.462  429.874 1.00 66.49  ?  167 LEU G O   1 
ATOM   6949  C CB  . LEU G  1 110 ? 476.592 17.217  427.149 1.00 53.86  ?  167 LEU G CB  1 
ATOM   6950  C CG  . LEU G  1 110 ? 476.803 17.227  425.632 1.00 47.20  ?  167 LEU G CG  1 
ATOM   6951  C CD1 . LEU G  1 110 ? 475.615 16.607  424.910 1.00 52.40  ?  167 LEU G CD1 1 
ATOM   6952  C CD2 . LEU G  1 110 ? 477.060 18.639  425.131 1.00 39.20  ?  167 LEU G CD2 1 
ATOM   6953  N N   . GLN G  1 111 ? 477.521 18.688  430.266 1.00 72.06  ?  168 GLN G N   1 
ATOM   6954  C CA  . GLN G  1 111 ? 477.567 18.511  431.717 1.00 69.86  ?  168 GLN G CA  1 
ATOM   6955  C C   . GLN G  1 111 ? 476.303 17.860  432.269 1.00 86.83  ?  168 GLN G C   1 
ATOM   6956  O O   . GLN G  1 111 ? 476.423 16.935  433.090 1.00 93.25  ?  168 GLN G O   1 
ATOM   6957  C CB  . GLN G  1 111 ? 477.865 19.852  432.394 1.00 71.86  ?  168 GLN G CB  1 
ATOM   6958  C CG  . GLN G  1 111 ? 479.039 20.614  431.784 1.00 79.78  ?  168 GLN G CG  1 
ATOM   6959  C CD  . GLN G  1 111 ? 480.387 19.956  432.041 1.00 76.07  ?  168 GLN G CD  1 
ATOM   6960  O OE1 . GLN G  1 111 ? 480.487 18.978  432.783 1.00 80.56  ?  168 GLN G OE1 1 
ATOM   6961  N NE2 . GLN G  1 111 ? 481.431 20.493  431.421 1.00 66.24  ?  168 GLN G NE2 1 
ATOM   6962  N N   . PRO G  1 112 ? 475.078 18.281  431.892 1.00 91.89  ?  169 PRO G N   1 
ATOM   6963  C CA  . PRO G  1 112 ? 473.913 17.551  432.409 1.00 82.16  ?  169 PRO G CA  1 
ATOM   6964  C C   . PRO G  1 112 ? 473.843 16.110  431.907 1.00 80.10  ?  169 PRO G C   1 
ATOM   6965  O O   . PRO G  1 112 ? 473.436 15.892  430.766 1.00 78.50  ?  169 PRO G O   1 
ATOM   6966  C CB  . PRO G  1 112 ? 472.724 18.361  431.879 1.00 77.66  ?  169 PRO G CB  1 
ATOM   6967  C CG  . PRO G  1 112 ? 473.273 19.716  431.617 1.00 81.08  ?  169 PRO G CG  1 
ATOM   6968  C CD  . PRO G  1 112 ? 474.675 19.488  431.148 1.00 80.42  ?  169 PRO G CD  1 
ATOM   6969  N N   . ALA G  1 119 ? 480.953 9.916   427.695 1.00 96.22  ?  176 ALA G N   1 
ATOM   6970  C CA  . ALA G  1 119 ? 482.058 10.712  428.216 1.00 101.39 ?  176 ALA G CA  1 
ATOM   6971  C C   . ALA G  1 119 ? 482.225 12.008  427.427 1.00 106.13 ?  176 ALA G C   1 
ATOM   6972  O O   . ALA G  1 119 ? 481.921 13.093  427.925 1.00 102.38 ?  176 ALA G O   1 
ATOM   6973  C CB  . ALA G  1 119 ? 483.349 9.907   428.192 1.00 104.78 ?  176 ALA G CB  1 
ATOM   6974  N N   . ALA G  1 120 ? 482.709 11.890  426.192 1.00 56.02  ?  177 ALA G N   1 
ATOM   6975  C CA  . ALA G  1 120 ? 482.964 13.037  425.328 1.00 51.20  ?  177 ALA G CA  1 
ATOM   6976  C C   . ALA G  1 120 ? 482.161 12.885  424.045 1.00 55.76  ?  177 ALA G C   1 
ATOM   6977  O O   . ALA G  1 120 ? 482.337 11.905  423.312 1.00 59.87  ?  177 ALA G O   1 
ATOM   6978  C CB  . ALA G  1 120 ? 484.456 13.168  425.016 1.00 53.35  ?  177 ALA G CB  1 
ATOM   6979  N N   . ALA G  1 121 ? 481.284 13.852  423.776 1.00 69.97  ?  178 ALA G N   1 
ATOM   6980  C CA  . ALA G  1 121 ? 480.505 13.857  422.545 1.00 63.00  ?  178 ALA G CA  1 
ATOM   6981  C C   . ALA G  1 121 ? 481.265 14.456  421.371 1.00 55.20  ?  178 ALA G C   1 
ATOM   6982  O O   . ALA G  1 121 ? 480.771 14.406  420.240 1.00 54.04  ?  178 ALA G O   1 
ATOM   6983  C CB  . ALA G  1 121 ? 479.196 14.622  422.750 1.00 62.49  ?  178 ALA G CB  1 
ATOM   6984  N N   . LEU G  1 122 ? 482.446 15.017  421.612 1.00 59.60  ?  179 LEU G N   1 
ATOM   6985  C CA  . LEU G  1 122 ? 483.265 15.600  420.561 1.00 59.30  ?  179 LEU G CA  1 
ATOM   6986  C C   . LEU G  1 122 ? 484.705 15.601  421.048 1.00 57.43  ?  179 LEU G C   1 
ATOM   6987  O O   . LEU G  1 122 ? 484.964 15.528  422.252 1.00 59.15  ?  179 LEU G O   1 
ATOM   6988  C CB  . LEU G  1 122 ? 482.798 17.018  420.210 1.00 56.31  ?  179 LEU G CB  1 
ATOM   6989  C CG  . LEU G  1 122 ? 482.729 17.415  418.743 1.00 52.34  ?  179 LEU G CG  1 
ATOM   6990  C CD1 . LEU G  1 122 ? 481.605 16.683  418.091 1.00 60.26  ?  179 LEU G CD1 1 
ATOM   6991  C CD2 . LEU G  1 122 ? 482.520 18.904  418.590 1.00 46.17  ?  179 LEU G CD2 1 
ATOM   6992  N N   . ALA G  1 123 ? 485.639 15.710  420.105 1.00 61.02  ?  180 ALA G N   1 
ATOM   6993  C CA  . ALA G  1 123 ? 487.058 15.671  420.446 1.00 58.89  ?  180 ALA G CA  1 
ATOM   6994  C C   . ALA G  1 123 ? 487.886 15.923  419.195 1.00 61.63  ?  180 ALA G C   1 
ATOM   6995  O O   . ALA G  1 123 ? 487.411 15.768  418.067 1.00 68.88  ?  180 ALA G O   1 
ATOM   6996  C CB  . ALA G  1 123 ? 487.468 14.328  421.067 1.00 57.75  ?  180 ALA G CB  1 
ATOM   6997  N N   . LEU G  1 124 ? 489.141 16.307  419.421 1.00 30.16  ?  181 LEU G N   1 
ATOM   6998  C CA  . LEU G  1 124 ? 490.097 16.581  418.362 1.00 29.33  ?  181 LEU G CA  1 
ATOM   6999  C C   . LEU G  1 124 ? 491.490 16.328  418.918 1.00 35.23  ?  181 LEU G C   1 
ATOM   7000  O O   . LEU G  1 124 ? 491.744 16.552  420.105 1.00 43.60  ?  181 LEU G O   1 
ATOM   7001  C CB  . LEU G  1 124 ? 489.967 18.024  417.856 1.00 25.56  ?  181 LEU G CB  1 
ATOM   7002  C CG  . LEU G  1 124 ? 490.174 18.340  416.370 1.00 28.33  ?  181 LEU G CG  1 
ATOM   7003  C CD1 . LEU G  1 124 ? 489.774 19.780  416.086 1.00 27.45  ?  181 LEU G CD1 1 
ATOM   7004  C CD2 . LEU G  1 124 ? 491.604 18.094  415.928 1.00 34.47  ?  181 LEU G CD2 1 
ATOM   7005  N N   . THR G  1 125 ? 492.390 15.857  418.060 1.00 49.43  ?  182 THR G N   1 
ATOM   7006  C CA  . THR G  1 125 ? 493.780 15.632  418.440 1.00 49.58  ?  182 THR G CA  1 
ATOM   7007  C C   . THR G  1 125 ? 494.683 16.293  417.411 1.00 49.59  ?  182 THR G C   1 
ATOM   7008  O O   . THR G  1 125 ? 494.698 15.889  416.243 1.00 51.25  ?  182 THR G O   1 
ATOM   7009  C CB  . THR G  1 125 ? 494.093 14.138  418.551 1.00 55.90  ?  182 THR G CB  1 
ATOM   7010  O OG1 . THR G  1 125 ? 493.154 13.518  419.438 1.00 53.27  ?  182 THR G OG1 1 
ATOM   7011  C CG2 . THR G  1 125 ? 495.497 13.935  419.096 1.00 62.41  ?  182 THR G CG2 1 
ATOM   7012  N N   . VAL G  1 126 ? 495.438 17.301  417.845 1.00 26.53  ?  183 VAL G N   1 
ATOM   7013  C CA  . VAL G  1 126 ? 496.359 18.036  416.986 1.00 26.94  ?  183 VAL G CA  1 
ATOM   7014  C C   . VAL G  1 126 ? 497.781 17.711  417.415 1.00 26.29  ?  183 VAL G C   1 
ATOM   7015  O O   . VAL G  1 126 ? 498.134 17.871  418.590 1.00 32.35  ?  183 VAL G O   1 
ATOM   7016  C CB  . VAL G  1 126 ? 496.096 19.551  417.045 1.00 24.08  ?  183 VAL G CB  1 
ATOM   7017  C CG1 . VAL G  1 126 ? 497.200 20.304  416.328 1.00 21.22  ?  183 VAL G CG1 1 
ATOM   7018  C CG2 . VAL G  1 126 ? 494.747 19.877  416.430 1.00 27.91  ?  183 VAL G CG2 1 
ATOM   7019  N N   . ASP G  1 127 ? 498.594 17.258  416.465 1.00 32.92  ?  184 ASP G N   1 
ATOM   7020  C CA  . ASP G  1 127 ? 499.959 16.833  416.746 1.00 34.60  ?  184 ASP G CA  1 
ATOM   7021  C C   . ASP G  1 127 ? 500.911 18.019  416.649 1.00 31.66  ?  184 ASP G C   1 
ATOM   7022  O O   . ASP G  1 127 ? 500.834 18.809  415.703 1.00 31.16  ?  184 ASP G O   1 
ATOM   7023  C CB  . ASP G  1 127 ? 500.386 15.732  415.774 1.00 38.33  ?  184 ASP G CB  1 
ATOM   7024  C CG  . ASP G  1 127 ? 501.807 15.268  416.009 1.00 54.46  ?  184 ASP G CG  1 
ATOM   7025  O OD1 . ASP G  1 127 ? 502.734 15.872  415.429 1.00 68.89  -1 184 ASP G OD1 1 
ATOM   7026  O OD2 . ASP G  1 127 ? 502.000 14.295  416.769 1.00 50.25  ?  184 ASP G OD2 1 
ATOM   7027  N N   . LEU G  1 128 ? 501.809 18.137  417.627 1.00 32.10  ?  185 LEU G N   1 
ATOM   7028  C CA  . LEU G  1 128 ? 502.804 19.198  417.630 1.00 37.25  ?  185 LEU G CA  1 
ATOM   7029  C C   . LEU G  1 128 ? 504.094 18.676  417.018 1.00 42.49  ?  185 LEU G C   1 
ATOM   7030  O O   . LEU G  1 128 ? 504.739 17.800  417.613 1.00 40.89  ?  185 LEU G O   1 
ATOM   7031  C CB  . LEU G  1 128 ? 503.055 19.701  419.050 1.00 35.52  ?  185 LEU G CB  1 
ATOM   7032  C CG  . LEU G  1 128 ? 501.855 20.269  419.810 1.00 29.77  ?  185 LEU G CG  1 
ATOM   7033  C CD1 . LEU G  1 128 ? 502.282 20.756  421.187 1.00 26.63  ?  185 LEU G CD1 1 
ATOM   7034  C CD2 . LEU G  1 128 ? 501.193 21.387  419.024 1.00 31.82  ?  185 LEU G CD2 1 
ATOM   7035  N N   . PRO G  1 129 ? 504.507 19.162  415.851 1.00 51.74  ?  186 PRO G N   1 
ATOM   7036  C CA  . PRO G  1 129 ? 505.734 18.658  415.225 1.00 52.69  ?  186 PRO G CA  1 
ATOM   7037  C C   . PRO G  1 129 ? 506.965 19.132  415.974 1.00 52.37  ?  186 PRO G C   1 
ATOM   7038  O O   . PRO G  1 129 ? 507.019 20.282  416.436 1.00 52.66  ?  186 PRO G O   1 
ATOM   7039  C CB  . PRO G  1 129 ? 505.683 19.256  413.808 1.00 52.74  ?  186 PRO G CB  1 
ATOM   7040  C CG  . PRO G  1 129 ? 504.270 19.728  413.623 1.00 55.21  ?  186 PRO G CG  1 
ATOM   7041  C CD  . PRO G  1 129 ? 503.803 20.120  414.987 1.00 53.48  ?  186 PRO G CD  1 
ATOM   7042  N N   . PRO G  1 130 ? 507.976 18.280  416.114 1.00 26.61  ?  187 PRO G N   1 
ATOM   7043  C CA  . PRO G  1 130 ? 509.219 18.709  416.763 1.00 22.40  ?  187 PRO G CA  1 
ATOM   7044  C C   . PRO G  1 130 ? 510.018 19.640  415.864 1.00 28.48  ?  187 PRO G C   1 
ATOM   7045  O O   . PRO G  1 130 ? 509.802 19.724  414.654 1.00 35.51  ?  187 PRO G O   1 
ATOM   7046  C CB  . PRO G  1 130 ? 509.964 17.393  417.006 1.00 25.48  ?  187 PRO G CB  1 
ATOM   7047  C CG  . PRO G  1 130 ? 509.455 16.483  415.940 1.00 25.68  ?  187 PRO G CG  1 
ATOM   7048  C CD  . PRO G  1 130 ? 508.015 16.860  415.724 1.00 26.94  ?  187 PRO G CD  1 
ATOM   7049  N N   . ALA G  1 131 ? 510.960 20.346  416.484 1.00 32.78  ?  188 ALA G N   1 
ATOM   7050  C CA  . ALA G  1 131 ? 511.748 21.338  415.764 1.00 25.02  ?  188 ALA G CA  1 
ATOM   7051  C C   . ALA G  1 131 ? 512.759 20.662  414.847 1.00 30.70  ?  188 ALA G C   1 
ATOM   7052  O O   . ALA G  1 131 ? 513.491 19.760  415.267 1.00 15.15  ?  188 ALA G O   1 
ATOM   7053  C CB  . ALA G  1 131 ? 512.459 22.261  416.749 1.00 24.22  ?  188 ALA G CB  1 
ATOM   7054  N N   . SER G  1 132 ? 512.793 21.096  413.590 1.00 81.91  ?  189 SER G N   1 
ATOM   7055  C CA  . SER G  1 132 ? 513.705 20.543  412.598 1.00 94.83  ?  189 SER G CA  1 
ATOM   7056  C C   . SER G  1 132 ? 513.885 21.561  411.482 1.00 99.87  ?  189 SER G C   1 
ATOM   7057  O O   . SER G  1 132 ? 513.137 22.536  411.378 1.00 102.31 ?  189 SER G O   1 
ATOM   7058  C CB  . SER G  1 132 ? 513.188 19.211  412.040 1.00 96.85  ?  189 SER G CB  1 
ATOM   7059  O OG  . SER G  1 132 ? 513.113 18.223  413.053 1.00 101.89 ?  189 SER G OG  1 
ATOM   7060  N N   . SER G  1 133 ? 514.904 21.332  410.653 1.00 102.84 ?  190 SER G N   1 
ATOM   7061  C CA  . SER G  1 133 ? 514.986 22.040  409.384 1.00 105.53 ?  190 SER G CA  1 
ATOM   7062  C C   . SER G  1 133 ? 513.720 21.766  408.581 1.00 104.30 ?  190 SER G C   1 
ATOM   7063  O O   . SER G  1 133 ? 513.113 20.697  408.692 1.00 104.71 ?  190 SER G O   1 
ATOM   7064  C CB  . SER G  1 133 ? 516.224 21.608  408.599 1.00 112.89 ?  190 SER G CB  1 
ATOM   7065  O OG  . SER G  1 133 ? 516.107 20.269  408.150 1.00 114.39 ?  190 SER G OG  1 
ATOM   7066  N N   . GLU G  1 134 ? 513.318 22.748  407.770 1.00 126.52 ?  191 GLU G N   1 
ATOM   7067  C CA  . GLU G  1 134 ? 511.942 22.851  407.283 1.00 131.44 ?  191 GLU G CA  1 
ATOM   7068  C C   . GLU G  1 134 ? 510.994 22.961  408.482 1.00 122.35 ?  191 GLU G C   1 
ATOM   7069  O O   . GLU G  1 134 ? 510.216 22.062  408.811 1.00 120.30 ?  191 GLU G O   1 
ATOM   7070  C CB  . GLU G  1 134 ? 511.586 21.669  406.367 1.00 136.10 ?  191 GLU G CB  1 
ATOM   7071  C CG  . GLU G  1 134 ? 510.167 21.671  405.813 1.00 132.56 ?  191 GLU G CG  1 
ATOM   7072  C CD  . GLU G  1 134 ? 509.545 20.285  405.828 1.00 127.79 ?  191 GLU G CD  1 
ATOM   7073  O OE1 . GLU G  1 134 ? 510.281 19.304  406.068 1.00 114.94 ?  191 GLU G OE1 1 
ATOM   7074  O OE2 . GLU G  1 134 ? 508.320 20.177  405.603 1.00 129.46 -1 191 GLU G OE2 1 
ATOM   7075  N N   . ALA G  1 135 ? 511.121 24.105  409.153 1.00 82.77  ?  192 ALA G N   1 
ATOM   7076  C CA  . ALA G  1 135 ? 510.524 24.286  410.468 1.00 78.93  ?  192 ALA G CA  1 
ATOM   7077  C C   . ALA G  1 135 ? 509.004 24.285  410.386 1.00 77.39  ?  192 ALA G C   1 
ATOM   7078  O O   . ALA G  1 135 ? 508.413 24.947  409.526 1.00 79.34  ?  192 ALA G O   1 
ATOM   7079  C CB  . ALA G  1 135 ? 511.015 25.591  411.093 1.00 72.76  ?  192 ALA G CB  1 
ATOM   7080  N N   . ARG G  1 136 ? 508.373 23.535  411.285 1.00 80.56  ?  193 ARG G N   1 
ATOM   7081  C CA  . ARG G  1 136 ? 506.926 23.559  411.458 1.00 78.11  ?  193 ARG G CA  1 
ATOM   7082  C C   . ARG G  1 136 ? 506.634 24.300  412.756 1.00 70.50  ?  193 ARG G C   1 
ATOM   7083  O O   . ARG G  1 136 ? 506.836 23.757  413.848 1.00 70.87  ?  193 ARG G O   1 
ATOM   7084  C CB  . ARG G  1 136 ? 506.361 22.141  411.490 1.00 86.63  ?  193 ARG G CB  1 
ATOM   7085  C CG  . ARG G  1 136 ? 506.425 21.411  410.158 1.00 86.41  ?  193 ARG G CG  1 
ATOM   7086  C CD  . ARG G  1 136 ? 505.270 21.825  409.267 1.00 84.82  ?  193 ARG G CD  1 
ATOM   7087  N NE  . ARG G  1 136 ? 503.985 21.511  409.886 1.00 89.03  ?  193 ARG G NE  1 
ATOM   7088  C CZ  . ARG G  1 136 ? 502.813 21.956  409.447 1.00 85.80  ?  193 ARG G CZ  1 
ATOM   7089  N NH1 . ARG G  1 136 ? 502.756 22.743  408.381 1.00 76.05  ?  193 ARG G NH1 1 
ATOM   7090  N NH2 . ARG G  1 136 ? 501.695 21.615  410.075 1.00 80.73  ?  193 ARG G NH2 1 
ATOM   7091  N N   . ASN G  1 137 ? 506.160 25.536  412.635 1.00 44.55  ?  194 ASN G N   1 
ATOM   7092  C CA  . ASN G  1 137 ? 505.803 26.353  413.784 1.00 42.98  ?  194 ASN G CA  1 
ATOM   7093  C C   . ASN G  1 137 ? 504.308 26.366  414.063 1.00 41.21  ?  194 ASN G C   1 
ATOM   7094  O O   . ASN G  1 137 ? 503.879 26.998  415.033 1.00 45.20  ?  194 ASN G O   1 
ATOM   7095  C CB  . ASN G  1 137 ? 506.308 27.785  413.588 1.00 53.00  ?  194 ASN G CB  1 
ATOM   7096  C CG  . ASN G  1 137 ? 507.821 27.860  413.506 1.00 53.28  ?  194 ASN G CG  1 
ATOM   7097  O OD1 . ASN G  1 137 ? 508.525 27.047  414.106 1.00 45.85  ?  194 ASN G OD1 1 
ATOM   7098  N ND2 . ASN G  1 137 ? 508.327 28.836  412.762 1.00 55.53  ?  194 ASN G ND2 1 
ATOM   7099  N N   . SER G  1 138 ? 503.506 25.687  413.246 1.00 29.71  ?  195 SER G N   1 
ATOM   7100  C CA  . SER G  1 138 ? 502.059 25.756  413.361 1.00 26.78  ?  195 SER G CA  1 
ATOM   7101  C C   . SER G  1 138 ? 501.457 24.373  413.183 1.00 30.98  ?  195 SER G C   1 
ATOM   7102  O O   . SER G  1 138 ? 501.953 23.552  412.406 1.00 39.92  ?  195 SER G O   1 
ATOM   7103  C CB  . SER G  1 138 ? 501.461 26.719  412.328 1.00 24.61  ?  195 SER G CB  1 
ATOM   7104  O OG  . SER G  1 138 ? 502.054 28.002  412.431 1.00 39.10  ?  195 SER G OG  1 
ATOM   7105  N N   . ALA G  1 139 ? 500.375 24.127  413.916 1.00 21.38  ?  196 ALA G N   1 
ATOM   7106  C CA  . ALA G  1 139 ? 499.610 22.895  413.814 1.00 17.70  ?  196 ALA G CA  1 
ATOM   7107  C C   . ALA G  1 139 ? 498.140 23.235  413.991 1.00 13.96  ?  196 ALA G C   1 
ATOM   7108  O O   . ALA G  1 139 ? 497.792 24.101  414.799 1.00 14.72  ?  196 ALA G O   1 
ATOM   7109  C CB  . ALA G  1 139 ? 500.058 21.866  414.856 1.00 21.90  ?  196 ALA G CB  1 
ATOM   7110  N N   . PHE G  1 140 ? 497.278 22.559  413.234 1.00 33.92  ?  197 PHE G N   1 
ATOM   7111  C CA  . PHE G  1 140 ? 495.873 22.933  413.196 1.00 34.33  ?  197 PHE G CA  1 
ATOM   7112  C C   . PHE G  1 140 ? 495.018 21.708  412.910 1.00 32.00  ?  197 PHE G C   1 
ATOM   7113  O O   . PHE G  1 140 ? 495.454 20.765  412.243 1.00 31.89  ?  197 PHE G O   1 
ATOM   7114  C CB  . PHE G  1 140 ? 495.636 24.030  412.145 1.00 38.20  ?  197 PHE G CB  1 
ATOM   7115  C CG  . PHE G  1 140 ? 494.208 24.152  411.701 1.00 42.99  ?  197 PHE G CG  1 
ATOM   7116  C CD1 . PHE G  1 140 ? 493.268 24.781  412.504 1.00 43.75  ?  197 PHE G CD1 1 
ATOM   7117  C CD2 . PHE G  1 140 ? 493.806 23.646  410.478 1.00 45.15  ?  197 PHE G CD2 1 
ATOM   7118  C CE1 . PHE G  1 140 ? 491.952 24.894  412.094 1.00 39.21  ?  197 PHE G CE1 1 
ATOM   7119  C CE2 . PHE G  1 140 ? 492.495 23.758  410.065 1.00 43.88  ?  197 PHE G CE2 1 
ATOM   7120  C CZ  . PHE G  1 140 ? 491.567 24.381  410.872 1.00 38.55  ?  197 PHE G CZ  1 
ATOM   7121  N N   . GLY G  1 141 ? 493.791 21.735  413.427 1.00 13.72  ?  198 GLY G N   1 
ATOM   7122  C CA  . GLY G  1 141 ? 492.829 20.684  413.159 1.00 15.89  ?  198 GLY G CA  1 
ATOM   7123  C C   . GLY G  1 141 ? 491.421 21.237  413.206 1.00 16.52  ?  198 GLY G C   1 
ATOM   7124  O O   . GLY G  1 141 ? 491.163 22.294  413.791 1.00 13.70  ?  198 GLY G O   1 
ATOM   7125  N N   . PHE G  1 142 ? 490.505 20.503  412.575 1.00 23.67  ?  199 PHE G N   1 
ATOM   7126  C CA  . PHE G  1 142 ? 489.106 20.903  412.496 1.00 15.08  ?  199 PHE G CA  1 
ATOM   7127  C C   . PHE G  1 142 ? 488.225 19.683  412.706 1.00 15.63  ?  199 PHE G C   1 
ATOM   7128  O O   . PHE G  1 142 ? 488.476 18.624  412.124 1.00 22.74  ?  199 PHE G O   1 
ATOM   7129  C CB  . PHE G  1 142 ? 488.790 21.559  411.146 1.00 13.85  ?  199 PHE G CB  1 
ATOM   7130  C CG  . PHE G  1 142 ? 487.402 22.131  411.056 1.00 15.63  ?  199 PHE G CG  1 
ATOM   7131  C CD1 . PHE G  1 142 ? 486.340 21.353  410.627 1.00 17.31  ?  199 PHE G CD1 1 
ATOM   7132  C CD2 . PHE G  1 142 ? 487.162 23.454  411.391 1.00 20.15  ?  199 PHE G CD2 1 
ATOM   7133  C CE1 . PHE G  1 142 ? 485.065 21.879  410.541 1.00 18.60  ?  199 PHE G CE1 1 
ATOM   7134  C CE2 . PHE G  1 142 ? 485.890 23.985  411.306 1.00 13.94  ?  199 PHE G CE2 1 
ATOM   7135  C CZ  . PHE G  1 142 ? 484.841 23.198  410.879 1.00 15.35  ?  199 PHE G CZ  1 
ATOM   7136  N N   . GLN G  1 143 ? 487.196 19.839  413.532 1.00 26.72  ?  200 GLN G N   1 
ATOM   7137  C CA  . GLN G  1 143 ? 486.271 18.763  413.848 1.00 24.76  ?  200 GLN G CA  1 
ATOM   7138  C C   . GLN G  1 143 ? 484.872 19.338  413.984 1.00 32.59  ?  200 GLN G C   1 
ATOM   7139  O O   . GLN G  1 143 ? 484.684 20.384  414.611 1.00 41.53  ?  200 GLN G O   1 
ATOM   7140  C CB  . GLN G  1 143 ? 486.681 18.045  415.141 1.00 30.01  ?  200 GLN G CB  1 
ATOM   7141  C CG  . GLN G  1 143 ? 485.552 17.319  415.860 1.00 36.58  ?  200 GLN G CG  1 
ATOM   7142  C CD  . GLN G  1 143 ? 485.198 15.991  415.222 1.00 42.86  ?  200 GLN G CD  1 
ATOM   7143  O OE1 . GLN G  1 143 ? 484.800 15.933  414.058 1.00 42.29  ?  200 GLN G OE1 1 
ATOM   7144  N NE2 . GLN G  1 143 ? 485.345 14.913  415.985 1.00 44.80  ?  200 GLN G NE2 1 
ATOM   7145  N N   . GLY G  1 144 ? 483.892 18.656  413.395 1.00 38.90  ?  201 GLY G N   1 
ATOM   7146  C CA  . GLY G  1 144 ? 482.513 19.078  413.532 1.00 35.61  ?  201 GLY G CA  1 
ATOM   7147  C C   . GLY G  1 144 ? 481.518 18.053  413.036 1.00 33.40  ?  201 GLY G C   1 
ATOM   7148  O O   . GLY G  1 144 ? 481.840 17.231  412.173 1.00 42.14  ?  201 GLY G O   1 
ATOM   7149  N N   . ARG G  1 145 ? 480.302 18.102  413.568 1.00 32.13  ?  202 ARG G N   1 
ATOM   7150  C CA  . ARG G  1 145 ? 479.231 17.185  413.189 1.00 40.53  ?  202 ARG G CA  1 
ATOM   7151  C C   . ARG G  1 145 ? 477.937 17.710  413.799 1.00 37.71  ?  202 ARG G C   1 
ATOM   7152  O O   . ARG G  1 145 ? 477.922 18.745  414.473 1.00 41.72  ?  202 ARG G O   1 
ATOM   7153  C CB  . ARG G  1 145 ? 479.529 15.752  413.640 1.00 44.61  ?  202 ARG G CB  1 
ATOM   7154  C CG  . ARG G  1 145 ? 479.843 15.620  415.119 1.00 40.83  ?  202 ARG G CG  1 
ATOM   7155  C CD  . ARG G  1 145 ? 480.935 14.589  415.367 1.00 43.66  ?  202 ARG G CD  1 
ATOM   7156  N NE  . ARG G  1 145 ? 480.467 13.216  415.218 1.00 57.00  ?  202 ARG G NE  1 
ATOM   7157  C CZ  . ARG G  1 145 ? 480.059 12.457  416.230 1.00 68.25  ?  202 ARG G CZ  1 
ATOM   7158  N NH1 . ARG G  1 145 ? 480.064 12.939  417.465 1.00 61.13  ?  202 ARG G NH1 1 
ATOM   7159  N NH2 . ARG G  1 145 ? 479.650 11.216  416.009 1.00 70.62  ?  202 ARG G NH2 1 
ATOM   7160  N N   . LEU G  1 146 ? 476.848 16.989  413.555 1.00 33.48  ?  203 LEU G N   1 
ATOM   7161  C CA  . LEU G  1 146 ? 475.552 17.349  414.107 1.00 42.74  ?  203 LEU G CA  1 
ATOM   7162  C C   . LEU G  1 146 ? 475.407 16.786  415.516 1.00 47.28  ?  203 LEU G C   1 
ATOM   7163  O O   . LEU G  1 146 ? 475.806 15.651  415.789 1.00 50.86  ?  203 LEU G O   1 
ATOM   7164  C CB  . LEU G  1 146 ? 474.420 16.833  413.215 1.00 43.03  ?  203 LEU G CB  1 
ATOM   7165  C CG  . LEU G  1 146 ? 474.371 17.389  411.790 1.00 39.43  ?  203 LEU G CG  1 
ATOM   7166  C CD1 . LEU G  1 146 ? 473.183 16.827  411.022 1.00 32.89  ?  203 LEU G CD1 1 
ATOM   7167  C CD2 . LEU G  1 146 ? 474.333 18.909  411.806 1.00 38.16  ?  203 LEU G CD2 1 
ATOM   7168  N N   . LEU G  1 147 ? 474.831 17.589  416.408 1.00 27.69  ?  204 LEU G N   1 
ATOM   7169  C CA  . LEU G  1 147 ? 474.634 17.204  417.799 1.00 31.34  ?  204 LEU G CA  1 
ATOM   7170  C C   . LEU G  1 147 ? 473.224 17.571  418.235 1.00 35.48  ?  204 LEU G C   1 
ATOM   7171  O O   . LEU G  1 147 ? 472.803 18.722  418.081 1.00 31.32  ?  204 LEU G O   1 
ATOM   7172  C CB  . LEU G  1 147 ? 475.656 17.881  418.718 1.00 29.02  ?  204 LEU G CB  1 
ATOM   7173  C CG  . LEU G  1 147 ? 477.100 17.386  418.643 1.00 27.71  ?  204 LEU G CG  1 
ATOM   7174  C CD1 . LEU G  1 147 ? 477.964 18.106  419.666 1.00 20.36  ?  204 LEU G CD1 1 
ATOM   7175  C CD2 . LEU G  1 147 ? 477.159 15.880  418.847 1.00 40.20  ?  204 LEU G CD2 1 
ATOM   7176  N N   . HIS G  1 148 ? 472.501 16.592  418.772 1.00 62.95  ?  205 HIS G N   1 
ATOM   7177  C CA  . HIS G  1 148 ? 471.200 16.851  419.369 1.00 63.77  ?  205 HIS G CA  1 
ATOM   7178  C C   . HIS G  1 148 ? 471.389 17.380  420.785 1.00 62.99  ?  205 HIS G C   1 
ATOM   7179  O O   . HIS G  1 148 ? 472.109 16.779  421.589 1.00 65.82  ?  205 HIS G O   1 
ATOM   7180  C CB  . HIS G  1 148 ? 470.351 15.581  419.383 1.00 69.77  ?  205 HIS G CB  1 
ATOM   7181  C CG  . HIS G  1 148 ? 469.067 15.721  420.139 1.00 80.02  ?  205 HIS G CG  1 
ATOM   7182  N ND1 . HIS G  1 148 ? 468.041 16.541  419.719 1.00 80.20  ?  205 HIS G ND1 1 
ATOM   7183  C CD2 . HIS G  1 148 ? 468.643 15.150  421.291 1.00 79.33  ?  205 HIS G CD2 1 
ATOM   7184  C CE1 . HIS G  1 148 ? 467.041 16.466  420.579 1.00 78.33  ?  205 HIS G CE1 1 
ATOM   7185  N NE2 . HIS G  1 148 ? 467.381 15.629  421.542 1.00 81.58  ?  205 HIS G NE2 1 
ATOM   7186  N N   . LEU G  1 149 ? 470.748 18.504  421.085 1.00 70.61  ?  206 LEU G N   1 
ATOM   7187  C CA  . LEU G  1 149 ? 470.892 19.162  422.372 1.00 71.25  ?  206 LEU G CA  1 
ATOM   7188  C C   . LEU G  1 149 ? 469.535 19.282  423.052 1.00 69.99  ?  206 LEU G C   1 
ATOM   7189  O O   . LEU G  1 149 ? 468.483 19.212  422.410 1.00 70.89  ?  206 LEU G O   1 
ATOM   7190  C CB  . LEU G  1 149 ? 471.529 20.549  422.215 1.00 64.77  ?  206 LEU G CB  1 
ATOM   7191  C CG  . LEU G  1 149 ? 472.912 20.575  421.561 1.00 58.60  ?  206 LEU G CG  1 
ATOM   7192  C CD1 . LEU G  1 149 ? 473.414 22.002  421.415 1.00 56.28  ?  206 LEU G CD1 1 
ATOM   7193  C CD2 . LEU G  1 149 ? 473.899 19.732  422.355 1.00 59.51  ?  206 LEU G CD2 1 
ATOM   7194  N N   . SER G  1 150 ? 469.574 19.457  424.368 1.00 58.44  ?  207 SER G N   1 
ATOM   7195  C CA  . SER G  1 150 ? 468.385 19.595  425.192 1.00 62.14  ?  207 SER G CA  1 
ATOM   7196  C C   . SER G  1 150 ? 468.208 21.046  425.624 1.00 64.37  ?  207 SER G C   1 
ATOM   7197  O O   . SER G  1 150 ? 469.000 21.929  425.283 1.00 67.39  ?  207 SER G O   1 
ATOM   7198  C CB  . SER G  1 150 ? 468.466 18.672  426.407 1.00 68.00  ?  207 SER G CB  1 
ATOM   7199  O OG  . SER G  1 150 ? 468.063 17.364  426.063 1.00 74.01  ?  207 SER G OG  1 
ATOM   7200  N N   . ALA G  1 151 ? 467.147 21.283  426.391 1.00 59.90  ?  208 ALA G N   1 
ATOM   7201  C CA  . ALA G  1 151 ? 466.888 22.604  426.943 1.00 51.40  ?  208 ALA G CA  1 
ATOM   7202  C C   . ALA G  1 151 ? 467.838 22.873  428.101 1.00 53.81  ?  208 ALA G C   1 
ATOM   7203  O O   . ALA G  1 151 ? 467.942 22.067  429.032 1.00 53.99  ?  208 ALA G O   1 
ATOM   7204  C CB  . ALA G  1 151 ? 465.437 22.714  427.406 1.00 59.85  ?  208 ALA G CB  1 
ATOM   7205  N N   . GLY G  1 152 ? 468.534 24.006  428.042 1.00 50.37  ?  209 GLY G N   1 
ATOM   7206  C CA  . GLY G  1 152 ? 469.504 24.328  429.069 1.00 52.38  ?  209 GLY G CA  1 
ATOM   7207  C C   . GLY G  1 152 ? 470.748 23.472  429.044 1.00 42.13  ?  209 GLY G C   1 
ATOM   7208  O O   . GLY G  1 152 ? 471.433 23.364  430.063 1.00 36.89  ?  209 GLY G O   1 
ATOM   7209  N N   . GLN G  1 153 ? 471.059 22.857  427.906 1.00 41.56  ?  210 GLN G N   1 
ATOM   7210  C CA  . GLN G  1 153 ? 472.239 22.010  427.801 1.00 41.87  ?  210 GLN G CA  1 
ATOM   7211  C C   . GLN G  1 153 ? 473.500 22.864  427.856 1.00 41.15  ?  210 GLN G C   1 
ATOM   7212  O O   . GLN G  1 153 ? 473.660 23.801  427.066 1.00 41.72  ?  210 GLN G O   1 
ATOM   7213  C CB  . GLN G  1 153 ? 472.193 21.205  426.504 1.00 38.29  ?  210 GLN G CB  1 
ATOM   7214  C CG  . GLN G  1 153 ? 473.289 20.156  426.372 1.00 36.35  ?  210 GLN G CG  1 
ATOM   7215  C CD  . GLN G  1 153 ? 472.922 18.839  427.028 1.00 40.88  ?  210 GLN G CD  1 
ATOM   7216  O OE1 . GLN G  1 153 ? 472.486 17.901  426.359 1.00 41.87  ?  210 GLN G OE1 1 
ATOM   7217  N NE2 . GLN G  1 153 ? 473.097 18.761  428.341 1.00 40.92  ?  210 GLN G NE2 1 
ATOM   7218  N N   . ARG G  1 154 ? 474.393 22.543  428.787 1.00 49.83  ?  211 ARG G N   1 
ATOM   7219  C CA  . ARG G  1 154 ? 475.668 23.237  428.905 1.00 51.71  ?  211 ARG G CA  1 
ATOM   7220  C C   . ARG G  1 154 ? 476.732 22.485  428.116 1.00 47.56  ?  211 ARG G C   1 
ATOM   7221  O O   . ARG G  1 154 ? 476.856 21.262  428.238 1.00 49.06  ?  211 ARG G O   1 
ATOM   7222  C CB  . ARG G  1 154 ? 476.090 23.365  430.369 1.00 54.81  ?  211 ARG G CB  1 
ATOM   7223  C CG  . ARG G  1 154 ? 475.371 24.460  431.147 1.00 51.00  ?  211 ARG G CG  1 
ATOM   7224  C CD  . ARG G  1 154 ? 474.093 23.948  431.787 1.00 59.17  ?  211 ARG G CD  1 
ATOM   7225  N NE  . ARG G  1 154 ? 474.321 22.746  432.582 1.00 67.87  ?  211 ARG G NE  1 
ATOM   7226  C CZ  . ARG G  1 154 ? 474.780 22.747  433.830 1.00 63.78  ?  211 ARG G CZ  1 
ATOM   7227  N NH1 . ARG G  1 154 ? 475.063 23.893  434.433 1.00 59.75  ?  211 ARG G NH1 1 
ATOM   7228  N NH2 . ARG G  1 154 ? 474.957 21.601  434.474 1.00 61.26  ?  211 ARG G NH2 1 
ATOM   7229  N N   . LEU G  1 155 ? 477.495 23.217  427.309 1.00 50.81  ?  212 LEU G N   1 
ATOM   7230  C CA  . LEU G  1 155 ? 478.559 22.642  426.495 1.00 52.41  ?  212 LEU G CA  1 
ATOM   7231  C C   . LEU G  1 155 ? 479.894 23.167  427.008 1.00 45.59  ?  212 LEU G C   1 
ATOM   7232  O O   . LEU G  1 155 ? 480.216 24.346  426.828 1.00 39.30  ?  212 LEU G O   1 
ATOM   7233  C CB  . LEU G  1 155 ? 478.370 22.982  425.016 1.00 47.62  ?  212 LEU G CB  1 
ATOM   7234  C CG  . LEU G  1 155 ? 477.313 22.221  424.205 1.00 43.90  ?  212 LEU G CG  1 
ATOM   7235  C CD1 . LEU G  1 155 ? 475.898 22.602  424.614 1.00 53.54  ?  212 LEU G CD1 1 
ATOM   7236  C CD2 . LEU G  1 155 ? 477.517 22.448  422.713 1.00 42.20  ?  212 LEU G CD2 1 
ATOM   7237  N N   . GLY G  1 156 ? 480.666 22.291  427.648 1.00 63.01  ?  213 GLY G N   1 
ATOM   7238  C CA  . GLY G  1 156 ? 482.010 22.613  428.067 1.00 64.06  ?  213 GLY G CA  1 
ATOM   7239  C C   . GLY G  1 156 ? 483.037 22.128  427.061 1.00 64.73  ?  213 GLY G C   1 
ATOM   7240  O O   . GLY G  1 156 ? 482.775 21.234  426.260 1.00 66.81  ?  213 GLY G O   1 
ATOM   7241  N N   . VAL G  1 157 ? 484.222 22.730  427.112 1.00 29.59  ?  214 VAL G N   1 
ATOM   7242  C CA  . VAL G  1 157 ? 485.331 22.360  426.238 1.00 27.00  ?  214 VAL G CA  1 
ATOM   7243  C C   . VAL G  1 157 ? 486.547 22.108  427.115 1.00 35.16  ?  214 VAL G C   1 
ATOM   7244  O O   . VAL G  1 157 ? 487.060 23.033  427.756 1.00 41.52  ?  214 VAL G O   1 
ATOM   7245  C CB  . VAL G  1 157 ? 485.629 23.435  425.185 1.00 30.15  ?  214 VAL G CB  1 
ATOM   7246  C CG1 . VAL G  1 157 ? 486.924 23.111  424.456 1.00 32.08  ?  214 VAL G CG1 1 
ATOM   7247  C CG2 . VAL G  1 157 ? 484.478 23.541  424.201 1.00 25.00  ?  214 VAL G CG2 1 
ATOM   7248  N N   . HIS G  1 158 ? 487.012 20.862  427.142 1.00 46.65  ?  215 HIS G N   1 
ATOM   7249  C CA  . HIS G  1 158 ? 488.164 20.468  427.940 1.00 46.54  ?  215 HIS G CA  1 
ATOM   7250  C C   . HIS G  1 158 ? 489.389 20.344  427.047 1.00 48.20  ?  215 HIS G C   1 
ATOM   7251  O O   . HIS G  1 158 ? 489.315 19.764  425.959 1.00 50.21  ?  215 HIS G O   1 
ATOM   7252  C CB  . HIS G  1 158 ? 487.906 19.143  428.662 1.00 53.03  ?  215 HIS G CB  1 
ATOM   7253  C CG  . HIS G  1 158 ? 486.962 19.257  429.819 1.00 66.90  ?  215 HIS G CG  1 
ATOM   7254  N ND1 . HIS G  1 158 ? 485.720 19.846  429.713 1.00 69.72  ?  215 HIS G ND1 1 
ATOM   7255  C CD2 . HIS G  1 158 ? 487.079 18.855  431.107 1.00 69.16  ?  215 HIS G CD2 1 
ATOM   7256  C CE1 . HIS G  1 158 ? 485.113 19.803  430.885 1.00 67.27  ?  215 HIS G CE1 1 
ATOM   7257  N NE2 . HIS G  1 158 ? 485.916 19.206  431.749 1.00 76.24  ?  215 HIS G NE2 1 
ATOM   7258  N N   . LEU G  1 159 ? 490.509 20.891  427.508 1.00 48.79  ?  216 LEU G N   1 
ATOM   7259  C CA  . LEU G  1 159 ? 491.788 20.772  426.827 1.00 45.89  ?  216 LEU G CA  1 
ATOM   7260  C C   . LEU G  1 159 ? 492.659 19.790  427.600 1.00 52.51  ?  216 LEU G C   1 
ATOM   7261  O O   . LEU G  1 159 ? 492.719 19.846  428.832 1.00 56.63  ?  216 LEU G O   1 
ATOM   7262  C CB  . LEU G  1 159 ? 492.477 22.135  426.710 1.00 44.75  ?  216 LEU G CB  1 
ATOM   7263  C CG  . LEU G  1 159 ? 493.749 22.249  425.863 1.00 49.67  ?  216 LEU G CG  1 
ATOM   7264  C CD1 . LEU G  1 159 ? 493.817 23.617  425.204 1.00 48.71  ?  216 LEU G CD1 1 
ATOM   7265  C CD2 . LEU G  1 159 ? 494.998 22.008  426.698 1.00 52.99  ?  216 LEU G CD2 1 
ATOM   7266  N N   . HIS G  1 160 ? 493.312 18.885  426.877 1.00 57.60  ?  217 HIS G N   1 
ATOM   7267  C CA  . HIS G  1 160 ? 494.234 17.928  427.475 1.00 60.41  ?  217 HIS G CA  1 
ATOM   7268  C C   . HIS G  1 160 ? 495.470 17.847  426.596 1.00 62.50  ?  217 HIS G C   1 
ATOM   7269  O O   . HIS G  1 160 ? 495.354 17.755  425.371 1.00 66.90  ?  217 HIS G O   1 
ATOM   7270  C CB  . HIS G  1 160 ? 493.593 16.544  427.624 1.00 64.30  ?  217 HIS G CB  1 
ATOM   7271  C CG  . HIS G  1 160 ? 494.523 15.506  428.168 1.00 70.30  ?  217 HIS G CG  1 
ATOM   7272  N ND1 . HIS G  1 160 ? 494.861 15.435  429.502 1.00 71.60  ?  217 HIS G ND1 1 
ATOM   7273  C CD2 . HIS G  1 160 ? 495.191 14.498  427.558 1.00 73.43  ?  217 HIS G CD2 1 
ATOM   7274  C CE1 . HIS G  1 160 ? 495.695 14.428  429.691 1.00 75.73  ?  217 HIS G CE1 1 
ATOM   7275  N NE2 . HIS G  1 160 ? 495.911 13.843  428.526 1.00 79.67  ?  217 HIS G NE2 1 
ATOM   7276  N N   . THR G  1 161 ? 496.645 17.882  427.216 1.00 37.66  ?  218 THR G N   1 
ATOM   7277  C CA  . THR G  1 161 ? 497.895 17.959  426.476 1.00 39.78  ?  218 THR G CA  1 
ATOM   7278  C C   . THR G  1 161 ? 498.917 16.980  427.033 1.00 42.78  ?  218 THR G C   1 
ATOM   7279  O O   . THR G  1 161 ? 499.077 16.851  428.251 1.00 44.14  ?  218 THR G O   1 
ATOM   7280  C CB  . THR G  1 161 ? 498.466 19.388  426.502 1.00 37.78  ?  218 THR G CB  1 
ATOM   7281  O OG1 . THR G  1 161 ? 499.759 19.403  425.883 1.00 44.18  ?  218 THR G OG1 1 
ATOM   7282  C CG2 . THR G  1 161 ? 498.575 19.910  427.930 1.00 44.36  ?  218 THR G CG2 1 
ATOM   7283  N N   . GLU G  1 162 ? 499.591 16.276  426.126 1.00 41.86  ?  219 GLU G N   1 
ATOM   7284  C CA  . GLU G  1 162 ? 500.794 15.508  426.430 1.00 38.04  ?  219 GLU G CA  1 
ATOM   7285  C C   . GLU G  1 162 ? 501.915 16.090  425.585 1.00 39.07  ?  219 GLU G C   1 
ATOM   7286  O O   . GLU G  1 162 ? 501.908 15.949  424.358 1.00 47.36  ?  219 GLU G O   1 
ATOM   7287  C CB  . GLU G  1 162 ? 500.605 14.020  426.137 1.00 40.80  ?  219 GLU G CB  1 
ATOM   7288  C CG  . GLU G  1 162 ? 499.579 13.322  427.010 1.00 63.46  ?  219 GLU G CG  1 
ATOM   7289  C CD  . GLU G  1 162 ? 499.685 11.810  426.921 1.00 74.46  ?  219 GLU G CD  1 
ATOM   7290  O OE1 . GLU G  1 162 ? 500.820 11.290  426.982 1.00 61.02  ?  219 GLU G OE1 1 
ATOM   7291  O OE2 . GLU G  1 162 ? 498.637 11.143  426.785 1.00 73.54  -1 219 GLU G OE2 1 
ATOM   7292  N N   . ALA G  1 163 ? 502.875 16.742  426.234 1.00 36.19  ?  220 ALA G N   1 
ATOM   7293  C CA  . ALA G  1 163 ? 503.959 17.399  425.522 1.00 34.67  ?  220 ALA G CA  1 
ATOM   7294  C C   . ALA G  1 163 ? 505.213 17.361  426.380 1.00 40.77  ?  220 ALA G C   1 
ATOM   7295  O O   . ALA G  1 163 ? 505.137 17.453  427.608 1.00 41.30  ?  220 ALA G O   1 
ATOM   7296  C CB  . ALA G  1 163 ? 503.601 18.846  425.165 1.00 35.97  ?  220 ALA G CB  1 
ATOM   7297  N N   . ARG G  1 164 ? 506.364 17.218  425.721 1.00 68.04  ?  221 ARG G N   1 
ATOM   7298  C CA  . ARG G  1 164 ? 507.629 17.172  426.446 1.00 77.22  ?  221 ARG G CA  1 
ATOM   7299  C C   . ARG G  1 164 ? 507.908 18.500  427.140 1.00 89.14  ?  221 ARG G C   1 
ATOM   7300  O O   . ARG G  1 164 ? 508.169 18.540  428.348 1.00 97.41  ?  221 ARG G O   1 
ATOM   7301  C CB  . ARG G  1 164 ? 508.767 16.809  425.494 1.00 69.79  ?  221 ARG G CB  1 
ATOM   7302  C CG  . ARG G  1 164 ? 508.797 15.343  425.103 1.00 73.37  ?  221 ARG G CG  1 
ATOM   7303  C CD  . ARG G  1 164 ? 510.076 14.995  424.361 1.00 92.31  ?  221 ARG G CD  1 
ATOM   7304  N NE  . ARG G  1 164 ? 510.341 13.559  424.381 1.00 106.20 ?  221 ARG G NE  1 
ATOM   7305  C CZ  . ARG G  1 164 ? 511.416 12.990  423.847 1.00 104.83 ?  221 ARG G CZ  1 
ATOM   7306  N NH1 . ARG G  1 164 ? 512.333 13.736  423.247 1.00 101.47 ?  221 ARG G NH1 1 
ATOM   7307  N NH2 . ARG G  1 164 ? 511.574 11.675  423.912 1.00 105.91 ?  221 ARG G NH2 1 
ATOM   7308  N N   . ALA G  1 165 ? 507.865 19.598  426.386 1.00 51.28  ?  222 ALA G N   1 
ATOM   7309  C CA  . ALA G  1 165 ? 508.043 20.913  426.990 1.00 50.79  ?  222 ALA G CA  1 
ATOM   7310  C C   . ALA G  1 165 ? 506.770 21.380  427.688 1.00 60.28  ?  222 ALA G C   1 
ATOM   7311  O O   . ALA G  1 165 ? 506.822 21.875  428.820 1.00 64.65  ?  222 ALA G O   1 
ATOM   7312  C CB  . ALA G  1 165 ? 508.473 21.924  425.925 1.00 45.61  ?  222 ALA G CB  1 
ATOM   7313  N N   . ARG G  1 166 ? 505.627 21.252  427.005 1.00 75.07  ?  223 ARG G N   1 
ATOM   7314  C CA  . ARG G  1 166 ? 504.316 21.748  427.426 1.00 70.59  ?  223 ARG G CA  1 
ATOM   7315  C C   . ARG G  1 166 ? 504.299 23.275  427.404 1.00 70.20  ?  223 ARG G C   1 
ATOM   7316  O O   . ARG G  1 166 ? 503.231 23.897  427.380 1.00 77.33  ?  223 ARG G O   1 
ATOM   7317  C CB  . ARG G  1 166 ? 503.936 21.208  428.812 1.00 62.84  ?  223 ARG G CB  1 
ATOM   7318  C CG  . ARG G  1 166 ? 502.548 21.602  429.293 1.00 63.61  ?  223 ARG G CG  1 
ATOM   7319  C CD  . ARG G  1 166 ? 502.330 21.192  430.739 1.00 76.28  ?  223 ARG G CD  1 
ATOM   7320  N NE  . ARG G  1 166 ? 501.780 19.846  430.852 1.00 75.89  ?  223 ARG G NE  1 
ATOM   7321  C CZ  . ARG G  1 166 ? 500.527 19.581  431.206 1.00 78.18  ?  223 ARG G CZ  1 
ATOM   7322  N NH1 . ARG G  1 166 ? 499.692 20.574  431.484 1.00 77.79  ?  223 ARG G NH1 1 
ATOM   7323  N NH2 . ARG G  1 166 ? 500.107 18.326  431.284 1.00 80.28  ?  223 ARG G NH2 1 
ATOM   7324  N N   . HIS G  1 167 ? 505.480 23.878  427.376 1.00 38.49  ?  224 HIS G N   1 
ATOM   7325  C CA  . HIS G  1 167 ? 505.691 25.258  426.987 1.00 37.34  ?  224 HIS G CA  1 
ATOM   7326  C C   . HIS G  1 167 ? 506.152 25.255  425.534 1.00 41.09  ?  224 HIS G C   1 
ATOM   7327  O O   . HIS G  1 167 ? 506.060 24.237  424.841 1.00 44.92  ?  224 HIS G O   1 
ATOM   7328  C CB  . HIS G  1 167 ? 506.686 25.942  427.927 1.00 34.93  ?  224 HIS G CB  1 
ATOM   7329  C CG  . HIS G  1 167 ? 508.049 25.326  427.920 1.00 39.47  ?  224 HIS G CG  1 
ATOM   7330  N ND1 . HIS G  1 167 ? 508.992 25.614  426.956 1.00 38.08  ?  224 HIS G ND1 1 
ATOM   7331  C CD2 . HIS G  1 167 ? 508.630 24.436  428.760 1.00 41.41  ?  224 HIS G CD2 1 
ATOM   7332  C CE1 . HIS G  1 167 ? 510.095 24.931  427.204 1.00 38.96  ?  224 HIS G CE1 1 
ATOM   7333  N NE2 . HIS G  1 167 ? 509.902 24.208  428.292 1.00 40.33  ?  224 HIS G NE2 1 
ATOM   7334  N N   . ALA G  1 168 ? 506.608 26.412  425.049 1.00 41.91  ?  225 ALA G N   1 
ATOM   7335  C CA  . ALA G  1 168 ? 507.126 26.555  423.690 1.00 36.48  ?  225 ALA G CA  1 
ATOM   7336  C C   . ALA G  1 168 ? 506.020 26.380  422.657 1.00 33.91  ?  225 ALA G C   1 
ATOM   7337  O O   . ALA G  1 168 ? 506.245 26.579  421.459 1.00 37.72  ?  225 ALA G O   1 
ATOM   7338  C CB  . ALA G  1 168 ? 508.266 25.565  423.425 1.00 35.12  ?  225 ALA G CB  1 
ATOM   7339  N N   . TRP G  1 169 ? 504.826 26.008  423.111 1.00 36.29  ?  226 TRP G N   1 
ATOM   7340  C CA  . TRP G  1 169 ? 503.647 25.888  422.265 1.00 39.11  ?  226 TRP G CA  1 
ATOM   7341  C C   . TRP G  1 169 ? 502.495 26.591  422.964 1.00 36.09  ?  226 TRP G C   1 
ATOM   7342  O O   . TRP G  1 169 ? 502.133 26.224  424.087 1.00 41.52  ?  226 TRP G O   1 
ATOM   7343  C CB  . TRP G  1 169 ? 503.293 24.421  421.996 1.00 38.14  ?  226 TRP G CB  1 
ATOM   7344  C CG  . TRP G  1 169 ? 504.114 23.776  420.924 1.00 36.66  ?  226 TRP G CG  1 
ATOM   7345  C CD1 . TRP G  1 169 ? 505.192 22.956  421.098 1.00 36.30  ?  226 TRP G CD1 1 
ATOM   7346  C CD2 . TRP G  1 169 ? 503.917 23.887  419.511 1.00 34.30  ?  226 TRP G CD2 1 
ATOM   7347  N NE1 . TRP G  1 169 ? 505.680 22.553  419.878 1.00 36.74  ?  226 TRP G NE1 1 
ATOM   7348  C CE2 . TRP G  1 169 ? 504.916 23.111  418.888 1.00 35.94  ?  226 TRP G CE2 1 
ATOM   7349  C CE3 . TRP G  1 169 ? 502.996 24.568  418.710 1.00 34.88  ?  226 TRP G CE3 1 
ATOM   7350  C CZ2 . TRP G  1 169 ? 505.017 22.998  417.504 1.00 38.79  ?  226 TRP G CZ2 1 
ATOM   7351  C CZ3 . TRP G  1 169 ? 503.099 24.456  417.335 1.00 40.69  ?  226 TRP G CZ3 1 
ATOM   7352  C CH2 . TRP G  1 169 ? 504.102 23.676  416.746 1.00 43.01  ?  226 TRP G CH2 1 
ATOM   7353  N N   . GLN G  1 170 ? 501.933 27.603  422.312 1.00 21.27  ?  227 GLN G N   1 
ATOM   7354  C CA  . GLN G  1 170 ? 500.788 28.330  422.833 1.00 21.13  ?  227 GLN G CA  1 
ATOM   7355  C C   . GLN G  1 170 ? 499.664 28.320  421.809 1.00 22.47  ?  227 GLN G C   1 
ATOM   7356  O O   . GLN G  1 170 ? 499.900 28.186  420.604 1.00 26.23  ?  227 GLN G O   1 
ATOM   7357  C CB  . GLN G  1 170 ? 501.157 29.780  423.187 1.00 22.15  ?  227 GLN G CB  1 
ATOM   7358  C CG  . GLN G  1 170 ? 502.024 29.920  424.428 1.00 24.59  ?  227 GLN G CG  1 
ATOM   7359  C CD  . GLN G  1 170 ? 502.371 31.365  424.738 1.00 25.06  ?  227 GLN G CD  1 
ATOM   7360  O OE1 . GLN G  1 170 ? 501.758 32.292  424.209 1.00 23.85  ?  227 GLN G OE1 1 
ATOM   7361  N NE2 . GLN G  1 170 ? 503.361 31.562  425.602 1.00 26.53  ?  227 GLN G NE2 1 
ATOM   7362  N N   . LEU G  1 171 ? 498.435 28.449  422.300 1.00 25.59  ?  228 LEU G N   1 
ATOM   7363  C CA  . LEU G  1 171 ? 497.290 28.567  421.409 1.00 21.16  ?  228 LEU G CA  1 
ATOM   7364  C C   . LEU G  1 171 ? 497.335 29.907  420.685 1.00 22.61  ?  228 LEU G C   1 
ATOM   7365  O O   . LEU G  1 171 ? 497.510 30.957  421.311 1.00 20.44  ?  228 LEU G O   1 
ATOM   7366  C CB  . LEU G  1 171 ? 495.986 28.433  422.191 1.00 21.01  ?  228 LEU G CB  1 
ATOM   7367  C CG  . LEU G  1 171 ? 495.630 27.051  422.744 1.00 16.69  ?  228 LEU G CG  1 
ATOM   7368  C CD1 . LEU G  1 171 ? 495.799 27.018  424.246 1.00 19.70  ?  228 LEU G CD1 1 
ATOM   7369  C CD2 . LEU G  1 171 ? 494.209 26.692  422.370 1.00 18.42  ?  228 LEU G CD2 1 
ATOM   7370  N N   . THR G  1 172 ? 497.194 29.869  419.362 1.00 25.00  ?  229 THR G N   1 
ATOM   7371  C CA  . THR G  1 172 ? 497.122 31.102  418.593 1.00 20.42  ?  229 THR G CA  1 
ATOM   7372  C C   . THR G  1 172 ? 495.883 31.886  419.001 1.00 20.08  ?  229 THR G C   1 
ATOM   7373  O O   . THR G  1 172 ? 494.766 31.361  418.984 1.00 19.94  ?  229 THR G O   1 
ATOM   7374  C CB  . THR G  1 172 ? 497.092 30.797  417.095 1.00 20.94  ?  229 THR G CB  1 
ATOM   7375  O OG1 . THR G  1 172 ? 498.233 30.005  416.745 1.00 21.01  ?  229 THR G OG1 1 
ATOM   7376  C CG2 . THR G  1 172 ? 497.110 32.088  416.290 1.00 23.24  ?  229 THR G CG2 1 
ATOM   7377  N N   . GLN G  1 173 ? 496.086 33.145  419.373 1.00 26.84  ?  230 GLN G N   1 
ATOM   7378  C CA  . GLN G  1 173 ? 494.996 33.945  419.913 1.00 28.55  ?  230 GLN G CA  1 
ATOM   7379  C C   . GLN G  1 173 ? 494.046 34.368  418.800 1.00 25.79  ?  230 GLN G C   1 
ATOM   7380  O O   . GLN G  1 173 ? 494.464 34.947  417.794 1.00 19.72  ?  230 GLN G O   1 
ATOM   7381  C CB  . GLN G  1 173 ? 495.555 35.166  420.642 1.00 29.17  ?  230 GLN G CB  1 
ATOM   7382  C CG  . GLN G  1 173 ? 496.489 34.800  421.786 1.00 29.97  ?  230 GLN G CG  1 
ATOM   7383  C CD  . GLN G  1 173 ? 497.205 36.000  422.368 1.00 29.84  ?  230 GLN G CD  1 
ATOM   7384  O OE1 . GLN G  1 173 ? 496.583 37.010  422.696 1.00 31.67  ?  230 GLN G OE1 1 
ATOM   7385  N NE2 . GLN G  1 173 ? 498.522 35.895  422.500 1.00 34.87  ?  230 GLN G NE2 1 
ATOM   7386  N N   . GLY G  1 174 ? 492.761 34.068  418.985 1.00 60.39  ?  231 GLY G N   1 
ATOM   7387  C CA  . GLY G  1 174 ? 491.745 34.366  418.005 1.00 57.43  ?  231 GLY G CA  1 
ATOM   7388  C C   . GLY G  1 174 ? 491.449 33.247  417.030 1.00 61.77  ?  231 GLY G C   1 
ATOM   7389  O O   . GLY G  1 174 ? 490.371 33.243  416.424 1.00 73.65  ?  231 GLY G O   1 
ATOM   7390  N N   . ALA G  1 175 ? 492.369 32.300  416.858 1.00 25.86  ?  232 ALA G N   1 
ATOM   7391  C CA  . ALA G  1 175 ? 492.174 31.197  415.927 1.00 23.82  ?  232 ALA G CA  1 
ATOM   7392  C C   . ALA G  1 175 ? 491.593 29.949  416.579 1.00 22.10  ?  232 ALA G C   1 
ATOM   7393  O O   . ALA G  1 175 ? 491.286 28.988  415.866 1.00 29.30  ?  232 ALA G O   1 
ATOM   7394  C CB  . ALA G  1 175 ? 493.497 30.844  415.240 1.00 32.67  ?  232 ALA G CB  1 
ATOM   7395  N N   . THR G  1 176 ? 491.434 29.933  417.901 1.00 23.52  ?  233 THR G N   1 
ATOM   7396  C CA  . THR G  1 176 ? 490.811 28.818  418.604 1.00 24.56  ?  233 THR G CA  1 
ATOM   7397  C C   . THR G  1 176 ? 489.356 29.193  418.861 1.00 26.29  ?  233 THR G C   1 
ATOM   7398  O O   . THR G  1 176 ? 489.074 30.111  419.637 1.00 30.00  ?  233 THR G O   1 
ATOM   7399  C CB  . THR G  1 176 ? 491.545 28.504  419.906 1.00 25.18  ?  233 THR G CB  1 
ATOM   7400  O OG1 . THR G  1 176 ? 492.942 28.337  419.640 1.00 32.52  ?  233 THR G OG1 1 
ATOM   7401  C CG2 . THR G  1 176 ? 491.004 27.223  420.524 1.00 22.10  ?  233 THR G CG2 1 
ATOM   7402  N N   . VAL G  1 177 ? 488.437 28.481  418.215 1.00 20.14  ?  234 VAL G N   1 
ATOM   7403  C CA  . VAL G  1 177 ? 487.043 28.904  418.135 1.00 22.65  ?  234 VAL G CA  1 
ATOM   7404  C C   . VAL G  1 177 ? 486.132 27.699  418.324 1.00 25.56  ?  234 VAL G C   1 
ATOM   7405  O O   . VAL G  1 177 ? 486.349 26.646  417.714 1.00 28.74  ?  234 VAL G O   1 
ATOM   7406  C CB  . VAL G  1 177 ? 486.750 29.597  416.789 1.00 29.75  ?  234 VAL G CB  1 
ATOM   7407  C CG1 . VAL G  1 177 ? 485.286 29.454  416.414 1.00 32.95  ?  234 VAL G CG1 1 
ATOM   7408  C CG2 . VAL G  1 177 ? 487.149 31.064  416.851 1.00 34.09  ?  234 VAL G CG2 1 
ATOM   7409  N N   . LEU G  1 178 ? 485.116 27.852  419.172 1.00 19.96  ?  235 LEU G N   1 
ATOM   7410  C CA  . LEU G  1 178 ? 483.994 26.923  419.243 1.00 18.11  ?  235 LEU G CA  1 
ATOM   7411  C C   . LEU G  1 178 ? 482.776 27.635  418.673 1.00 23.18  ?  235 LEU G C   1 
ATOM   7412  O O   . LEU G  1 178 ? 482.219 28.535  419.311 1.00 22.61  ?  235 LEU G O   1 
ATOM   7413  C CB  . LEU G  1 178 ? 483.736 26.468  420.678 1.00 22.20  ?  235 LEU G CB  1 
ATOM   7414  C CG  . LEU G  1 178 ? 482.407 25.739  420.894 1.00 23.61  ?  235 LEU G CG  1 
ATOM   7415  C CD1 . LEU G  1 178 ? 482.410 24.397  420.184 1.00 24.35  ?  235 LEU G CD1 1 
ATOM   7416  C CD2 . LEU G  1 178 ? 482.096 25.570  422.375 1.00 21.98  ?  235 LEU G CD2 1 
ATOM   7417  N N   . GLY G  1 179 ? 482.365 27.236  417.473 1.00 53.78  ?  236 GLY G N   1 
ATOM   7418  C CA  . GLY G  1 179 ? 481.185 27.785  416.849 1.00 53.76  ?  236 GLY G CA  1 
ATOM   7419  C C   . GLY G  1 179 ? 479.992 26.858  416.970 1.00 49.11  ?  236 GLY G C   1 
ATOM   7420  O O   . GLY G  1 179 ? 480.127 25.676  417.277 1.00 52.21  ?  236 GLY G O   1 
ATOM   7421  N N   . LEU G  1 180 ? 478.809 27.417  416.734 1.00 36.92  ?  237 LEU G N   1 
ATOM   7422  C CA  . LEU G  1 180 ? 477.588 26.627  416.745 1.00 39.18  ?  237 LEU G CA  1 
ATOM   7423  C C   . LEU G  1 180 ? 476.538 27.323  415.892 1.00 37.87  ?  237 LEU G C   1 
ATOM   7424  O O   . LEU G  1 180 ? 476.496 28.553  415.823 1.00 41.41  ?  237 LEU G O   1 
ATOM   7425  C CB  . LEU G  1 180 ? 477.096 26.421  418.183 1.00 38.39  ?  237 LEU G CB  1 
ATOM   7426  C CG  . LEU G  1 180 ? 475.738 25.779  418.458 1.00 44.78  ?  237 LEU G CG  1 
ATOM   7427  C CD1 . LEU G  1 180 ? 475.815 24.906  419.697 1.00 42.68  ?  237 LEU G CD1 1 
ATOM   7428  C CD2 . LEU G  1 180 ? 474.700 26.859  418.648 1.00 48.68  ?  237 LEU G CD2 1 
ATOM   7429  N N   . PHE G  1 181 ? 475.695 26.523  415.240 1.00 37.34  ?  238 PHE G N   1 
ATOM   7430  C CA  . PHE G  1 181 ? 474.478 27.036  414.622 1.00 47.55  ?  238 PHE G CA  1 
ATOM   7431  C C   . PHE G  1 181 ? 473.482 25.893  414.485 1.00 55.73  ?  238 PHE G C   1 
ATOM   7432  O O   . PHE G  1 181 ? 473.855 24.717  414.483 1.00 57.38  ?  238 PHE G O   1 
ATOM   7433  C CB  . PHE G  1 181 ? 474.749 27.712  413.268 1.00 45.98  ?  238 PHE G CB  1 
ATOM   7434  C CG  . PHE G  1 181 ? 475.258 26.788  412.199 1.00 42.02  ?  238 PHE G CG  1 
ATOM   7435  C CD1 . PHE G  1 181 ? 474.379 26.121  411.362 1.00 42.52  ?  238 PHE G CD1 1 
ATOM   7436  C CD2 . PHE G  1 181 ? 476.618 26.623  412.002 1.00 47.18  ?  238 PHE G CD2 1 
ATOM   7437  C CE1 . PHE G  1 181 ? 474.847 25.283  410.368 1.00 46.52  ?  238 PHE G CE1 1 
ATOM   7438  C CE2 . PHE G  1 181 ? 477.091 25.789  411.009 1.00 44.84  ?  238 PHE G CE2 1 
ATOM   7439  C CZ  . PHE G  1 181 ? 476.205 25.118  410.191 1.00 42.89  ?  238 PHE G CZ  1 
ATOM   7440  N N   . ARG G  1 182 ? 472.207 26.259  414.366 1.00 33.49  ?  239 ARG G N   1 
ATOM   7441  C CA  . ARG G  1 182 ? 471.104 25.311  414.466 1.00 32.80  ?  239 ARG G CA  1 
ATOM   7442  C C   . ARG G  1 182 ? 470.635 24.880  413.084 1.00 36.27  ?  239 ARG G C   1 
ATOM   7443  O O   . ARG G  1 182 ? 470.328 25.723  412.234 1.00 38.12  ?  239 ARG G O   1 
ATOM   7444  C CB  . ARG G  1 182 ? 469.939 25.925  415.240 1.00 42.27  ?  239 ARG G CB  1 
ATOM   7445  C CG  . ARG G  1 182 ? 468.820 24.951  415.557 1.00 49.87  ?  239 ARG G CG  1 
ATOM   7446  C CD  . ARG G  1 182 ? 467.751 25.605  416.416 1.00 45.65  ?  239 ARG G CD  1 
ATOM   7447  N NE  . ARG G  1 182 ? 466.627 24.707  416.664 1.00 49.53  ?  239 ARG G NE  1 
ATOM   7448  C CZ  . ARG G  1 182 ? 465.570 25.023  417.403 1.00 56.86  ?  239 ARG G CZ  1 
ATOM   7449  N NH1 . ARG G  1 182 ? 465.487 26.219  417.970 1.00 58.73  ?  239 ARG G NH1 1 
ATOM   7450  N NH2 . ARG G  1 182 ? 464.594 24.142  417.574 1.00 68.64  ?  239 ARG G NH2 1 
ATOM   7451  N N   . VAL G  1 183 ? 470.588 23.566  412.864 1.00 32.56  ?  240 VAL G N   1 
ATOM   7452  C CA  . VAL G  1 183 ? 470.022 23.030  411.629 1.00 32.50  ?  240 VAL G CA  1 
ATOM   7453  C C   . VAL G  1 183 ? 468.501 22.967  411.713 1.00 44.95  ?  240 VAL G C   1 
ATOM   7454  O O   . VAL G  1 183 ? 467.802 23.221  410.724 1.00 50.82  ?  240 VAL G O   1 
ATOM   7455  C CB  . VAL G  1 183 ? 470.635 21.652  411.324 1.00 28.71  ?  240 VAL G CB  1 
ATOM   7456  C CG1 . VAL G  1 183 ? 470.003 21.047  410.081 1.00 36.65  ?  240 VAL G CG1 1 
ATOM   7457  C CG2 . VAL G  1 183 ? 472.140 21.773  411.152 1.00 32.05  ?  240 VAL G CG2 1 
ATOM   7458  N N   . THR G  1 184 ? 467.965 22.634  412.883 1.00 55.26  ?  241 THR G N   1 
ATOM   7459  C CA  . THR G  1 184 ? 466.521 22.478  413.034 1.00 58.30  ?  241 THR G CA  1 
ATOM   7460  C C   . THR G  1 184 ? 465.829 23.835  412.956 1.00 63.30  ?  241 THR G C   1 
ATOM   7461  O O   . THR G  1 184 ? 466.191 24.755  413.699 1.00 60.91  ?  241 THR G O   1 
ATOM   7462  C CB  . THR G  1 184 ? 466.190 21.801  414.365 1.00 50.52  ?  241 THR G CB  1 
ATOM   7463  O OG1 . THR G  1 184 ? 466.643 20.442  414.338 1.00 51.76  ?  241 THR G OG1 1 
ATOM   7464  C CG2 . THR G  1 184 ? 464.691 21.826  414.621 1.00 54.87  ?  241 THR G CG2 1 
ATOM   7465  N N   . PRO G  1 185 ? 464.840 24.001  412.086 1.00 80.79  ?  242 PRO G N   1 
ATOM   7466  C CA  . PRO G  1 185 ? 464.127 25.276  411.986 1.00 85.65  ?  242 PRO G CA  1 
ATOM   7467  C C   . PRO G  1 185 ? 463.093 25.413  413.101 1.00 84.71  ?  242 PRO G C   1 
ATOM   7468  O O   . PRO G  1 185 ? 462.900 24.519  413.922 1.00 82.36  ?  242 PRO G O   1 
ATOM   7469  C CB  . PRO G  1 185 ? 463.464 25.191  410.609 1.00 79.27  ?  242 PRO G CB  1 
ATOM   7470  C CG  . PRO G  1 185 ? 463.219 23.732  410.421 1.00 73.15  ?  242 PRO G CG  1 
ATOM   7471  C CD  . PRO G  1 185 ? 464.372 23.024  411.086 1.00 75.66  ?  242 PRO G CD  1 
ATOM   7472  N N   . GLU G  1 186 ? 462.421 26.561  413.108 1.00 93.56  ?  243 GLU G N   1 
ATOM   7473  C CA  . GLU G  1 186 ? 461.377 26.844  414.088 1.00 99.20  ?  243 GLU G CA  1 
ATOM   7474  C C   . GLU G  1 186 ? 460.324 27.776  413.500 1.00 93.24  ?  243 GLU G C   1 
ATOM   7475  O O   . GLU G  1 186 ? 460.650 28.831  412.957 1.00 88.10  ?  243 GLU G O   1 
ATOM   7476  C CB  . GLU G  1 186 ? 461.975 27.460  415.356 1.00 97.42  ?  243 GLU G CB  1 
ATOM   7477  C CG  . GLU G  1 186 ? 462.362 26.451  416.426 1.00 94.51  ?  243 GLU G CG  1 
ATOM   7478  C CD  . GLU G  1 186 ? 461.161 25.908  417.179 1.00 96.90  ?  243 GLU G CD  1 
ATOM   7479  O OE1 . GLU G  1 186 ? 461.183 25.928  418.428 1.00 95.82  ?  243 GLU G OE1 1 
ATOM   7480  O OE2 . GLU G  1 186 ? 460.196 25.462  416.523 1.00 97.23  -1 243 GLU G OE2 1 
ATOM   7481  N N   . PRO H  2 4   ? 478.188 55.905  407.931 1.00 69.67  ?  27  PRO H N   1 
ATOM   7482  C CA  . PRO H  2 4   ? 478.067 56.448  409.290 1.00 70.25  ?  27  PRO H CA  1 
ATOM   7483  C C   . PRO H  2 4   ? 479.002 55.766  410.288 1.00 73.71  ?  27  PRO H C   1 
ATOM   7484  O O   . PRO H  2 4   ? 479.394 56.365  411.288 1.00 74.82  ?  27  PRO H O   1 
ATOM   7485  C CB  . PRO H  2 4   ? 476.602 56.176  409.641 1.00 62.61  ?  27  PRO H CB  1 
ATOM   7486  C CG  . PRO H  2 4   ? 476.244 54.978  408.830 1.00 64.10  ?  27  PRO H CG  1 
ATOM   7487  C CD  . PRO H  2 4   ? 477.005 55.117  407.541 1.00 62.51  ?  27  PRO H CD  1 
ATOM   7488  N N   . CYS H  2 5   ? 479.338 54.503  410.007 1.00 133.55 ?  28  CYS H N   1 
ATOM   7489  C CA  . CYS H  2 5   ? 480.231 53.738  410.873 1.00 140.87 ?  28  CYS H CA  1 
ATOM   7490  C C   . CYS H  2 5   ? 481.674 54.230  410.836 1.00 142.07 ?  28  CYS H C   1 
ATOM   7491  O O   . CYS H  2 5   ? 482.389 54.067  411.827 1.00 143.05 ?  28  CYS H O   1 
ATOM   7492  C CB  . CYS H  2 5   ? 480.178 52.259  410.488 1.00 143.65 ?  28  CYS H CB  1 
ATOM   7493  S SG  . CYS H  2 5   ? 481.256 51.166  411.453 1.00 180.79 ?  28  CYS H SG  1 
ATOM   7494  N N   . SER H  2 6   ? 482.105 54.833  409.730 1.00 92.63  ?  29  SER H N   1 
ATOM   7495  C CA  . SER H  2 6   ? 483.527 55.078  409.516 1.00 88.66  ?  29  SER H CA  1 
ATOM   7496  C C   . SER H  2 6   ? 484.093 56.133  410.461 1.00 92.41  ?  29  SER H C   1 
ATOM   7497  O O   . SER H  2 6   ? 485.255 56.032  410.866 1.00 100.65 ?  29  SER H O   1 
ATOM   7498  C CB  . SER H  2 6   ? 483.769 55.498  408.065 1.00 92.08  ?  29  SER H CB  1 
ATOM   7499  O OG  . SER H  2 6   ? 483.194 56.765  407.807 1.00 96.97  ?  29  SER H OG  1 
ATOM   7500  N N   . ASN H  2 7   ? 483.299 57.141  410.823 1.00 86.30  ?  30  ASN H N   1 
ATOM   7501  C CA  . ASN H  2 7   ? 483.820 58.329  411.493 1.00 91.80  ?  30  ASN H CA  1 
ATOM   7502  C C   . ASN H  2 7   ? 484.368 58.063  412.888 1.00 96.67  ?  30  ASN H C   1 
ATOM   7503  O O   . ASN H  2 7   ? 485.005 58.957  413.457 1.00 93.64  ?  30  ASN H O   1 
ATOM   7504  C CB  . ASN H  2 7   ? 482.729 59.394  411.586 1.00 89.76  ?  30  ASN H CB  1 
ATOM   7505  C CG  . ASN H  2 7   ? 482.402 60.008  410.245 1.00 97.52  ?  30  ASN H CG  1 
ATOM   7506  O OD1 . ASN H  2 7   ? 481.745 59.388  409.407 1.00 96.35  ?  30  ASN H OD1 1 
ATOM   7507  N ND2 . ASN H  2 7   ? 482.863 61.234  410.028 1.00 100.02 ?  30  ASN H ND2 1 
ATOM   7508  N N   . CYS H  2 8   ? 484.154 56.902  413.440 1.00 104.64 ?  31  CYS H N   1 
ATOM   7509  C CA  . CYS H  2 8   ? 484.545 56.890  414.840 1.00 101.95 ?  31  CYS H CA  1 
ATOM   7510  C C   . CYS H  2 8   ? 485.997 56.449  415.011 1.00 96.02  ?  31  CYS H C   1 
ATOM   7511  O O   . CYS H  2 8   ? 486.505 55.639  414.231 1.00 98.99  ?  31  CYS H O   1 
ATOM   7512  C CB  . CYS H  2 8   ? 483.612 55.986  415.629 1.00 98.27  ?  31  CYS H CB  1 
ATOM   7513  S SG  . CYS H  2 8   ? 481.977 56.734  415.744 1.00 114.47 ?  31  CYS H SG  1 
ATOM   7514  N N   . PRO H  2 9   ? 486.679 56.976  416.037 1.00 74.38  ?  32  PRO H N   1 
ATOM   7515  C CA  . PRO H  2 9   ? 488.142 56.869  416.086 1.00 83.18  ?  32  PRO H CA  1 
ATOM   7516  C C   . PRO H  2 9   ? 488.659 55.556  416.646 1.00 82.52  ?  32  PRO H C   1 
ATOM   7517  O O   . PRO H  2 9   ? 487.894 54.616  416.892 1.00 78.90  ?  32  PRO H O   1 
ATOM   7518  C CB  . PRO H  2 9   ? 488.531 58.036  416.997 1.00 88.96  ?  32  PRO H CB  1 
ATOM   7519  C CG  . PRO H  2 9   ? 487.400 58.098  417.969 1.00 80.73  ?  32  PRO H CG  1 
ATOM   7520  C CD  . PRO H  2 9   ? 486.154 57.749  417.179 1.00 76.26  ?  32  PRO H CD  1 
ATOM   7521  N N   . ALA H  2 10  ? 489.974 55.498  416.844 1.00 88.31  ?  33  ALA H N   1 
ATOM   7522  C CA  . ALA H  2 10  ? 490.593 54.351  417.490 1.00 84.13  ?  33  ALA H CA  1 
ATOM   7523  C C   . ALA H  2 10  ? 490.078 54.203  418.917 1.00 82.82  ?  33  ALA H C   1 
ATOM   7524  O O   . ALA H  2 10  ? 489.725 55.181  419.582 1.00 77.86  ?  33  ALA H O   1 
ATOM   7525  C CB  . ALA H  2 10  ? 492.115 54.504  417.492 1.00 81.37  ?  33  ALA H CB  1 
ATOM   7526  N N   . GLY H  2 11  ? 490.038 52.959  419.388 1.00 96.90  ?  34  GLY H N   1 
ATOM   7527  C CA  . GLY H  2 11  ? 489.496 52.651  420.690 1.00 91.74  ?  34  GLY H CA  1 
ATOM   7528  C C   . GLY H  2 11  ? 488.011 52.363  420.709 1.00 79.32  ?  34  GLY H C   1 
ATOM   7529  O O   . GLY H  2 11  ? 487.487 51.959  421.756 1.00 78.95  ?  34  GLY H O   1 
ATOM   7530  N N   . THR H  2 12  ? 487.316 52.565  419.592 1.00 53.19  ?  35  THR H N   1 
ATOM   7531  C CA  . THR H  2 12  ? 485.892 52.289  419.492 1.00 58.72  ?  35  THR H CA  1 
ATOM   7532  C C   . THR H  2 12  ? 485.613 51.484  418.232 1.00 54.33  ?  35  THR H C   1 
ATOM   7533  O O   . THR H  2 12  ? 486.423 51.435  417.304 1.00 56.93  ?  35  THR H O   1 
ATOM   7534  C CB  . THR H  2 12  ? 485.052 53.578  419.465 1.00 59.81  ?  35  THR H CB  1 
ATOM   7535  O OG1 . THR H  2 12  ? 485.358 54.324  418.279 1.00 66.41  ?  35  THR H OG1 1 
ATOM   7536  C CG2 . THR H  2 12  ? 485.328 54.435  420.692 1.00 58.64  ?  35  THR H CG2 1 
ATOM   7537  N N   . PHE H  2 13  ? 484.450 50.843  418.222 1.00 27.27  ?  36  PHE H N   1 
ATOM   7538  C CA  . PHE H  2 13  ? 483.919 50.162  417.052 1.00 25.03  ?  36  PHE H CA  1 
ATOM   7539  C C   . PHE H  2 13  ? 482.507 50.665  416.814 1.00 31.46  ?  36  PHE H C   1 
ATOM   7540  O O   . PHE H  2 13  ? 481.988 51.500  417.562 1.00 42.89  ?  36  PHE H O   1 
ATOM   7541  C CB  . PHE H  2 13  ? 483.928 48.637  417.234 1.00 27.32  ?  36  PHE H CB  1 
ATOM   7542  C CG  . PHE H  2 13  ? 482.870 48.128  418.182 1.00 24.01  ?  36  PHE H CG  1 
ATOM   7543  C CD1 . PHE H  2 13  ? 482.952 48.382  419.540 1.00 23.25  ?  36  PHE H CD1 1 
ATOM   7544  C CD2 . PHE H  2 13  ? 481.797 47.386  417.709 1.00 24.56  ?  36  PHE H CD2 1 
ATOM   7545  C CE1 . PHE H  2 13  ? 481.985 47.910  420.410 1.00 23.18  ?  36  PHE H CE1 1 
ATOM   7546  C CE2 . PHE H  2 13  ? 480.826 46.913  418.576 1.00 22.79  ?  36  PHE H CE2 1 
ATOM   7547  C CZ  . PHE H  2 13  ? 480.922 47.176  419.927 1.00 22.95  ?  36  PHE H CZ  1 
ATOM   7548  N N   . CYS H  2 14  ? 481.873 50.156  415.763 1.00 49.27  ?  37  CYS H N   1 
ATOM   7549  C CA  . CYS H  2 14  ? 480.446 50.361  415.566 1.00 56.26  ?  37  CYS H CA  1 
ATOM   7550  C C   . CYS H  2 14  ? 479.787 48.992  415.531 1.00 56.89  ?  37  CYS H C   1 
ATOM   7551  O O   . CYS H  2 14  ? 480.219 48.107  414.780 1.00 60.63  ?  37  CYS H O   1 
ATOM   7552  C CB  . CYS H  2 14  ? 480.136 51.155  414.288 1.00 59.89  ?  37  CYS H CB  1 
ATOM   7553  S SG  . CYS H  2 14  ? 480.034 50.213  412.748 1.00 78.07  ?  37  CYS H SG  1 
ATOM   7554  N N   . ASP H  2 15  ? 478.783 48.797  416.376 1.00 59.21  ?  38  ASP H N   1 
ATOM   7555  C CA  . ASP H  2 15  ? 478.034 47.553  416.351 1.00 63.72  ?  38  ASP H CA  1 
ATOM   7556  C C   . ASP H  2 15  ? 476.945 47.643  415.292 1.00 60.51  ?  38  ASP H C   1 
ATOM   7557  O O   . ASP H  2 15  ? 476.220 48.639  415.217 1.00 59.51  ?  38  ASP H O   1 
ATOM   7558  C CB  . ASP H  2 15  ? 477.441 47.245  417.727 1.00 58.64  ?  38  ASP H CB  1 
ATOM   7559  C CG  . ASP H  2 15  ? 476.855 48.470  418.407 1.00 62.88  ?  38  ASP H CG  1 
ATOM   7560  O OD1 . ASP H  2 15  ? 476.746 49.531  417.759 1.00 69.39  ?  38  ASP H OD1 1 
ATOM   7561  O OD2 . ASP H  2 15  ? 476.504 48.373  419.603 1.00 63.07  -1 38  ASP H OD2 1 
ATOM   7562  N N   . ASN H  2 16  ? 476.858 46.617  414.443 1.00 94.10  ?  39  ASN H N   1 
ATOM   7563  C CA  . ASN H  2 16  ? 475.764 46.548  413.486 1.00 91.72  ?  39  ASN H CA  1 
ATOM   7564  C C   . ASN H  2 16  ? 474.465 46.109  414.146 1.00 104.28 ?  39  ASN H C   1 
ATOM   7565  O O   . ASN H  2 16  ? 473.388 46.365  413.598 1.00 111.93 ?  39  ASN H O   1 
ATOM   7566  C CB  . ASN H  2 16  ? 476.135 45.622  412.328 1.00 91.25  ?  39  ASN H CB  1 
ATOM   7567  C CG  . ASN H  2 16  ? 477.185 46.232  411.412 1.00 108.16 ?  39  ASN H CG  1 
ATOM   7568  O OD1 . ASN H  2 16  ? 476.891 46.616  410.280 1.00 115.57 ?  39  ASN H OD1 1 
ATOM   7569  N ND2 . ASN H  2 16  ? 478.415 46.330  411.904 1.00 104.37 ?  39  ASN H ND2 1 
ATOM   7570  N N   . ASN H  2 17  ? 474.548 45.446  415.296 1.00 89.37  ?  40  ASN H N   1 
ATOM   7571  C CA  . ASN H  2 17  ? 473.453 45.472  416.248 1.00 83.41  ?  40  ASN H CA  1 
ATOM   7572  C C   . ASN H  2 17  ? 473.366 46.866  416.859 1.00 83.73  ?  40  ASN H C   1 
ATOM   7573  O O   . ASN H  2 17  ? 474.325 47.640  416.822 1.00 91.81  ?  40  ASN H O   1 
ATOM   7574  C CB  . ASN H  2 17  ? 473.666 44.445  417.363 1.00 76.61  ?  40  ASN H CB  1 
ATOM   7575  C CG  . ASN H  2 17  ? 474.293 43.159  416.869 1.00 84.88  ?  40  ASN H CG  1 
ATOM   7576  O OD1 . ASN H  2 17  ? 473.895 42.611  415.843 1.00 91.60  ?  40  ASN H OD1 1 
ATOM   7577  N ND2 . ASN H  2 17  ? 475.286 42.665  417.605 1.00 84.45  ?  40  ASN H ND2 1 
ATOM   7578  N N   . ARG H  2 18  ? 472.207 47.188  417.433 1.00 55.04  ?  41  ARG H N   1 
ATOM   7579  C CA  . ARG H  2 18  ? 472.050 48.410  418.223 1.00 63.49  ?  41  ARG H CA  1 
ATOM   7580  C C   . ARG H  2 18  ? 472.363 49.645  417.371 1.00 58.67  ?  41  ARG H C   1 
ATOM   7581  O O   . ARG H  2 18  ? 473.398 50.305  417.506 1.00 53.91  ?  41  ARG H O   1 
ATOM   7582  C CB  . ARG H  2 18  ? 472.935 48.344  419.473 1.00 54.84  ?  41  ARG H CB  1 
ATOM   7583  C CG  . ARG H  2 18  ? 472.856 49.541  420.407 1.00 55.55  ?  41  ARG H CG  1 
ATOM   7584  C CD  . ARG H  2 18  ? 473.330 49.142  421.793 1.00 60.26  ?  41  ARG H CD  1 
ATOM   7585  N NE  . ARG H  2 18  ? 474.027 47.859  421.765 1.00 69.39  ?  41  ARG H NE  1 
ATOM   7586  C CZ  . ARG H  2 18  ? 473.631 46.780  422.431 1.00 76.65  ?  41  ARG H CZ  1 
ATOM   7587  N NH1 . ARG H  2 18  ? 472.537 46.826  423.179 1.00 63.16  1  41  ARG H NH1 1 
ATOM   7588  N NH2 . ARG H  2 18  ? 474.325 45.651  422.348 1.00 75.34  ?  41  ARG H NH2 1 
ATOM   7589  N N   . ASN H  2 19  ? 471.434 49.913  416.464 1.00 93.44  ?  42  ASN H N   1 
ATOM   7590  C CA  . ASN H  2 19  ? 471.522 50.989  415.473 1.00 98.69  ?  42  ASN H CA  1 
ATOM   7591  C C   . ASN H  2 19  ? 472.820 50.814  414.680 1.00 95.33  ?  42  ASN H C   1 
ATOM   7592  O O   . ASN H  2 19  ? 473.265 49.686  414.437 1.00 102.55 ?  42  ASN H O   1 
ATOM   7593  C CB  . ASN H  2 19  ? 471.395 52.330  416.183 1.00 108.82 ?  42  ASN H CB  1 
ATOM   7594  C CG  . ASN H  2 19  ? 470.380 52.298  417.312 1.00 107.14 ?  42  ASN H CG  1 
ATOM   7595  O OD1 . ASN H  2 19  ? 469.404 51.551  417.264 1.00 115.35 ?  42  ASN H OD1 1 
ATOM   7596  N ND2 . ASN H  2 19  ? 470.623 53.094  418.348 1.00 86.31  ?  42  ASN H ND2 1 
ATOM   7597  N N   . GLN H  2 20  ? 473.435 51.914  414.251 1.00 66.79  ?  43  GLN H N   1 
ATOM   7598  C CA  . GLN H  2 20  ? 474.763 51.896  413.649 1.00 67.21  ?  43  GLN H CA  1 
ATOM   7599  C C   . GLN H  2 20  ? 475.841 52.533  414.526 1.00 68.27  ?  43  GLN H C   1 
ATOM   7600  O O   . GLN H  2 20  ? 476.943 52.797  414.033 1.00 64.83  ?  43  GLN H O   1 
ATOM   7601  C CB  . GLN H  2 20  ? 474.723 52.512  412.253 1.00 70.61  ?  43  GLN H CB  1 
ATOM   7602  C CG  . GLN H  2 20  ? 473.714 51.779  411.376 1.00 74.09  ?  43  GLN H CG  1 
ATOM   7603  C CD  . GLN H  2 20  ? 474.291 50.538  410.706 1.00 80.77  ?  43  GLN H CD  1 
ATOM   7604  O OE1 . GLN H  2 20  ? 475.362 50.581  410.093 1.00 86.44  ?  43  GLN H OE1 1 
ATOM   7605  N NE2 . GLN H  2 20  ? 473.595 49.418  410.851 1.00 69.21  ?  43  GLN H NE2 1 
ATOM   7606  N N   . ILE H  2 21  ? 475.540 52.817  415.796 1.00 39.27  ?  44  ILE H N   1 
ATOM   7607  C CA  . ILE H  2 21  ? 476.287 53.759  416.629 1.00 28.56  ?  44  ILE H CA  1 
ATOM   7608  C C   . ILE H  2 21  ? 477.703 53.290  416.937 1.00 28.55  ?  44  ILE H C   1 
ATOM   7609  O O   . ILE H  2 21  ? 478.131 52.223  416.488 1.00 34.47  ?  44  ILE H O   1 
ATOM   7610  C CB  . ILE H  2 21  ? 475.547 53.992  417.957 1.00 27.74  ?  44  ILE H CB  1 
ATOM   7611  C CG1 . ILE H  2 21  ? 475.751 52.772  418.866 1.00 25.12  ?  44  ILE H CG1 1 
ATOM   7612  C CG2 . ILE H  2 21  ? 474.075 54.259  417.707 1.00 32.72  ?  44  ILE H CG2 1 
ATOM   7613  C CD1 . ILE H  2 21  ? 474.797 52.681  420.028 1.00 32.19  ?  44  ILE H CD1 1 
ATOM   7614  N N   . CYS H  2 22  ? 478.430 54.087  417.720 1.00 54.13  ?  45  CYS H N   1 
ATOM   7615  C CA  . CYS H  2 22  ? 479.786 53.772  418.148 1.00 49.11  ?  45  CYS H CA  1 
ATOM   7616  C C   . CYS H  2 22  ? 479.837 53.633  419.660 1.00 50.14  ?  45  CYS H C   1 
ATOM   7617  O O   . CYS H  2 22  ? 479.380 54.520  420.388 1.00 59.09  ?  45  CYS H O   1 
ATOM   7618  C CB  . CYS H  2 22  ? 480.769 54.846  417.698 1.00 57.92  ?  45  CYS H CB  1 
ATOM   7619  S SG  . CYS H  2 22  ? 480.737 55.150  415.937 1.00 93.90  ?  45  CYS H SG  1 
ATOM   7620  N N   . SER H  2 23  ? 480.408 52.529  420.122 1.00 34.35  ?  46  SER H N   1 
ATOM   7621  C CA  . SER H  2 23  ? 480.546 52.194  421.527 1.00 39.44  ?  46  SER H CA  1 
ATOM   7622  C C   . SER H  2 23  ? 482.009 51.907  421.839 1.00 39.25  ?  46  SER H C   1 
ATOM   7623  O O   . SER H  2 23  ? 482.799 51.630  420.929 1.00 44.60  ?  46  SER H O   1 
ATOM   7624  C CB  . SER H  2 23  ? 479.682 50.973  421.872 1.00 45.34  ?  46  SER H CB  1 
ATOM   7625  O OG  . SER H  2 23  ? 479.671 50.046  420.800 1.00 45.29  ?  46  SER H OG  1 
ATOM   7626  N N   . PRO H  2 24  ? 482.416 51.974  423.115 1.00 57.32  ?  47  PRO H N   1 
ATOM   7627  C CA  . PRO H  2 24  ? 483.816 51.665  423.443 1.00 55.27  ?  47  PRO H CA  1 
ATOM   7628  C C   . PRO H  2 24  ? 484.168 50.210  423.169 1.00 57.39  ?  47  PRO H C   1 
ATOM   7629  O O   . PRO H  2 24  ? 483.299 49.415  422.792 1.00 55.02  ?  47  PRO H O   1 
ATOM   7630  C CB  . PRO H  2 24  ? 483.908 51.994  424.940 1.00 53.66  ?  47  PRO H CB  1 
ATOM   7631  C CG  . PRO H  2 24  ? 482.509 51.876  425.438 1.00 63.07  ?  47  PRO H CG  1 
ATOM   7632  C CD  . PRO H  2 24  ? 481.653 52.377  424.312 1.00 60.52  ?  47  PRO H CD  1 
ATOM   7633  N N   . CYS H  2 25  ? 485.422 49.852  423.365 1.00 39.83  ?  48  CYS H N   1 
ATOM   7634  C CA  . CYS H  2 25  ? 485.741 48.458  423.101 1.00 38.15  ?  48  CYS H CA  1 
ATOM   7635  C C   . CYS H  2 25  ? 485.508 47.608  424.347 1.00 32.40  ?  48  CYS H C   1 
ATOM   7636  O O   . CYS H  2 25  ? 485.535 48.124  425.469 1.00 31.41  ?  48  CYS H O   1 
ATOM   7637  C CB  . CYS H  2 25  ? 487.194 48.322  422.644 1.00 33.78  ?  48  CYS H CB  1 
ATOM   7638  S SG  . CYS H  2 25  ? 487.502 48.684  420.888 1.00 69.36  ?  48  CYS H SG  1 
ATOM   7639  N N   . PRO H  2 26  ? 485.280 46.309  424.171 1.00 43.26  ?  49  PRO H N   1 
ATOM   7640  C CA  . PRO H  2 26  ? 485.106 45.411  425.320 1.00 49.62  ?  49  PRO H CA  1 
ATOM   7641  C C   . PRO H  2 26  ? 486.333 45.417  426.214 1.00 55.37  ?  49  PRO H C   1 
ATOM   7642  O O   . PRO H  2 26  ? 487.414 45.848  425.784 1.00 56.94  ?  49  PRO H O   1 
ATOM   7643  C CB  . PRO H  2 26  ? 484.900 44.041  424.660 1.00 51.92  ?  49  PRO H CB  1 
ATOM   7644  C CG  . PRO H  2 26  ? 484.306 44.366  423.334 1.00 52.87  ?  49  PRO H CG  1 
ATOM   7645  C CD  . PRO H  2 26  ? 484.965 45.639  422.896 1.00 46.83  ?  49  PRO H CD  1 
ATOM   7646  N N   . PRO H  2 27  ? 486.204 44.953  427.467 1.00 64.78  ?  50  PRO H N   1 
ATOM   7647  C CA  . PRO H  2 27  ? 487.305 45.109  428.440 1.00 73.96  ?  50  PRO H CA  1 
ATOM   7648  C C   . PRO H  2 27  ? 488.677 44.687  427.935 1.00 86.73  ?  50  PRO H C   1 
ATOM   7649  O O   . PRO H  2 27  ? 489.660 45.390  428.199 1.00 93.63  ?  50  PRO H O   1 
ATOM   7650  C CB  . PRO H  2 27  ? 486.839 44.235  429.612 1.00 70.15  ?  50  PRO H CB  1 
ATOM   7651  C CG  . PRO H  2 27  ? 485.356 44.313  429.553 1.00 61.69  ?  50  PRO H CG  1 
ATOM   7652  C CD  . PRO H  2 27  ? 485.005 44.357  428.088 1.00 65.95  ?  50  PRO H CD  1 
ATOM   7653  N N   . ASN H  2 28  ? 488.783 43.570  427.219 1.00 88.78  ?  51  ASN H N   1 
ATOM   7654  C CA  . ASN H  2 28  ? 490.037 43.166  426.591 1.00 93.00  ?  51  ASN H CA  1 
ATOM   7655  C C   . ASN H  2 28  ? 489.850 43.229  425.081 1.00 89.68  ?  51  ASN H C   1 
ATOM   7656  O O   . ASN H  2 28  ? 489.207 42.350  424.496 1.00 97.89  ?  51  ASN H O   1 
ATOM   7657  C CB  . ASN H  2 28  ? 490.445 41.762  427.037 1.00 94.17  ?  51  ASN H CB  1 
ATOM   7658  C CG  . ASN H  2 28  ? 490.588 41.647  428.542 1.00 96.30  ?  51  ASN H CG  1 
ATOM   7659  O OD1 . ASN H  2 28  ? 490.782 42.645  429.237 1.00 94.50  ?  51  ASN H OD1 1 
ATOM   7660  N ND2 . ASN H  2 28  ? 490.494 40.425  429.052 1.00 96.34  ?  51  ASN H ND2 1 
ATOM   7661  N N   . SER H  2 29  ? 490.447 44.243  424.454 1.00 48.20  ?  52  SER H N   1 
ATOM   7662  C CA  . SER H  2 29  ? 490.312 44.501  423.024 1.00 40.70  ?  52  SER H CA  1 
ATOM   7663  C C   . SER H  2 29  ? 491.043 45.798  422.699 1.00 36.75  ?  52  SER H C   1 
ATOM   7664  O O   . SER H  2 29  ? 491.424 46.562  423.590 1.00 38.72  ?  52  SER H O   1 
ATOM   7665  C CB  . SER H  2 29  ? 488.852 44.604  422.586 1.00 42.39  ?  52  SER H CB  1 
ATOM   7666  O OG  . SER H  2 29  ? 488.132 45.465  423.447 1.00 43.32  ?  52  SER H OG  1 
ATOM   7667  N N   . PHE H  2 30  ? 491.236 46.034  421.402 1.00 38.86  ?  53  PHE H N   1 
ATOM   7668  C CA  . PHE H  2 30  ? 491.754 47.306  420.925 1.00 43.22  ?  53  PHE H CA  1 
ATOM   7669  C C   . PHE H  2 30  ? 491.284 47.531  419.495 1.00 47.41  ?  53  PHE H C   1 
ATOM   7670  O O   . PHE H  2 30  ? 491.046 46.580  418.746 1.00 53.08  ?  53  PHE H O   1 
ATOM   7671  C CB  . PHE H  2 30  ? 493.286 47.359  420.988 1.00 52.14  ?  53  PHE H CB  1 
ATOM   7672  C CG  . PHE H  2 30  ? 493.963 46.809  419.764 1.00 48.59  ?  53  PHE H CG  1 
ATOM   7673  C CD1 . PHE H  2 30  ? 494.048 45.442  419.555 1.00 45.36  ?  53  PHE H CD1 1 
ATOM   7674  C CD2 . PHE H  2 30  ? 494.518 47.661  418.822 1.00 48.86  ?  53  PHE H CD2 1 
ATOM   7675  C CE1 . PHE H  2 30  ? 494.670 44.937  418.428 1.00 50.65  ?  53  PHE H CE1 1 
ATOM   7676  C CE2 . PHE H  2 30  ? 495.141 47.160  417.694 1.00 50.22  ?  53  PHE H CE2 1 
ATOM   7677  C CZ  . PHE H  2 30  ? 495.216 45.797  417.497 1.00 49.85  ?  53  PHE H CZ  1 
ATOM   7678  N N   . SER H  2 31  ? 491.147 48.803  419.128 1.00 64.58  ?  54  SER H N   1 
ATOM   7679  C CA  . SER H  2 31  ? 490.942 49.214  417.744 1.00 72.38  ?  54  SER H CA  1 
ATOM   7680  C C   . SER H  2 31  ? 491.864 50.392  417.476 1.00 73.49  ?  54  SER H C   1 
ATOM   7681  O O   . SER H  2 31  ? 491.713 51.447  418.099 1.00 77.63  ?  54  SER H O   1 
ATOM   7682  C CB  . SER H  2 31  ? 489.482 49.594  417.482 1.00 73.62  ?  54  SER H CB  1 
ATOM   7683  O OG  . SER H  2 31  ? 489.303 50.037  416.148 1.00 82.74  ?  54  SER H OG  1 
ATOM   7684  N N   . SER H  2 32  ? 492.826 50.212  416.572 1.00 91.08  ?  55  SER H N   1 
ATOM   7685  C CA  . SER H  2 32  ? 493.831 51.239  416.335 1.00 94.72  ?  55  SER H CA  1 
ATOM   7686  C C   . SER H  2 32  ? 493.542 52.132  415.135 1.00 94.32  ?  55  SER H C   1 
ATOM   7687  O O   . SER H  2 32  ? 494.279 53.100  414.922 1.00 92.22  ?  55  SER H O   1 
ATOM   7688  C CB  . SER H  2 32  ? 495.211 50.596  416.156 1.00 85.63  ?  55  SER H CB  1 
ATOM   7689  O OG  . SER H  2 32  ? 495.748 50.194  417.405 1.00 86.41  ?  55  SER H OG  1 
ATOM   7690  N N   . ALA H  2 33  ? 492.505 51.850  414.350 1.00 87.23  ?  56  ALA H N   1 
ATOM   7691  C CA  . ALA H  2 33  ? 492.255 52.669  413.173 1.00 89.84  ?  56  ALA H CA  1 
ATOM   7692  C C   . ALA H  2 33  ? 490.777 52.671  412.808 1.00 89.97  ?  56  ALA H C   1 
ATOM   7693  O O   . ALA H  2 33  ? 490.093 51.653  412.936 1.00 87.11  ?  56  ALA H O   1 
ATOM   7694  C CB  . ALA H  2 33  ? 493.083 52.184  411.978 1.00 82.69  ?  56  ALA H CB  1 
ATOM   7695  N N   . GLY H  2 34  ? 490.303 53.830  412.364 1.00 66.52  ?  57  GLY H N   1 
ATOM   7696  C CA  . GLY H  2 34  ? 489.112 54.075  411.576 1.00 64.68  ?  57  GLY H CA  1 
ATOM   7697  C C   . GLY H  2 34  ? 487.848 53.437  412.111 1.00 71.01  ?  57  GLY H C   1 
ATOM   7698  O O   . GLY H  2 34  ? 487.637 53.280  413.317 1.00 73.01  ?  57  GLY H O   1 
ATOM   7699  N N   . GLY H  2 35  ? 486.995 53.040  411.169 1.00 65.61  ?  58  GLY H N   1 
ATOM   7700  C CA  . GLY H  2 35  ? 485.632 52.618  411.420 1.00 64.30  ?  58  GLY H CA  1 
ATOM   7701  C C   . GLY H  2 35  ? 485.417 51.132  411.615 1.00 61.47  ?  58  GLY H C   1 
ATOM   7702  O O   . GLY H  2 35  ? 484.336 50.628  411.295 1.00 60.85  ?  58  GLY H O   1 
ATOM   7703  N N   . GLN H  2 36  ? 486.436 50.417  412.092 1.00 81.30  ?  59  GLN H N   1 
ATOM   7704  C CA  . GLN H  2 36  ? 486.347 48.968  412.245 1.00 74.60  ?  59  GLN H CA  1 
ATOM   7705  C C   . GLN H  2 36  ? 485.071 48.574  412.976 1.00 75.70  ?  59  GLN H C   1 
ATOM   7706  O O   . GLN H  2 36  ? 484.744 49.127  414.029 1.00 80.59  ?  59  GLN H O   1 
ATOM   7707  C CB  . GLN H  2 36  ? 487.563 48.444  413.013 1.00 72.13  ?  59  GLN H CB  1 
ATOM   7708  C CG  . GLN H  2 36  ? 488.901 48.758  412.378 1.00 83.27  ?  59  GLN H CG  1 
ATOM   7709  C CD  . GLN H  2 36  ? 490.065 48.388  413.277 1.00 87.61  ?  59  GLN H CD  1 
ATOM   7710  O OE1 . GLN H  2 36  ? 489.897 47.678  414.269 1.00 75.01  ?  59  GLN H OE1 1 
ATOM   7711  N NE2 . GLN H  2 36  ? 491.254 48.873  412.936 1.00 93.00  ?  59  GLN H NE2 1 
ATOM   7712  N N   . ARG H  2 37  ? 484.349 47.613  412.404 1.00 76.48  ?  60  ARG H N   1 
ATOM   7713  C CA  . ARG H  2 37  ? 483.055 47.199  412.930 1.00 74.81  ?  60  ARG H CA  1 
ATOM   7714  C C   . ARG H  2 37  ? 483.174 46.230  414.098 1.00 70.92  ?  60  ARG H C   1 
ATOM   7715  O O   . ARG H  2 37  ? 482.147 45.824  414.652 1.00 69.10  ?  60  ARG H O   1 
ATOM   7716  C CB  . ARG H  2 37  ? 482.216 46.577  411.811 1.00 78.08  ?  60  ARG H CB  1 
ATOM   7717  C CG  . ARG H  2 37  ? 481.678 47.598  410.817 1.00 89.44  ?  60  ARG H CG  1 
ATOM   7718  C CD  . ARG H  2 37  ? 481.073 46.943  409.584 1.00 93.38  ?  60  ARG H CD  1 
ATOM   7719  N NE  . ARG H  2 37  ? 482.087 46.579  408.597 1.00 85.68  ?  60  ARG H NE  1 
ATOM   7720  C CZ  . ARG H  2 37  ? 482.573 45.352  408.439 1.00 91.29  ?  60  ARG H CZ  1 
ATOM   7721  N NH1 . ARG H  2 37  ? 482.136 44.359  409.202 1.00 94.53  ?  60  ARG H NH1 1 
ATOM   7722  N NH2 . ARG H  2 37  ? 483.493 45.116  407.513 1.00 87.26  ?  60  ARG H NH2 1 
ATOM   7723  N N   . THR H  2 38  ? 484.391 45.851  414.480 1.00 69.86  ?  61  THR H N   1 
ATOM   7724  C CA  . THR H  2 38  ? 484.610 45.015  415.650 1.00 62.45  ?  61  THR H CA  1 
ATOM   7725  C C   . THR H  2 38  ? 485.986 45.324  416.224 1.00 65.74  ?  61  THR H C   1 
ATOM   7726  O O   . THR H  2 38  ? 486.924 45.639  415.488 1.00 69.89  ?  61  THR H O   1 
ATOM   7727  C CB  . THR H  2 38  ? 484.491 43.526  415.307 1.00 62.00  ?  61  THR H CB  1 
ATOM   7728  O OG1 . THR H  2 38  ? 484.922 42.743  416.424 1.00 64.94  ?  61  THR H OG1 1 
ATOM   7729  C CG2 . THR H  2 38  ? 485.344 43.183  414.093 1.00 65.75  ?  61  THR H CG2 1 
ATOM   7730  N N   . CYS H  2 39  ? 486.096 45.232  417.547 1.00 54.73  ?  62  CYS H N   1 
ATOM   7731  C CA  . CYS H  2 39  ? 487.366 45.477  418.216 1.00 57.19  ?  62  CYS H CA  1 
ATOM   7732  C C   . CYS H  2 39  ? 488.239 44.230  418.169 1.00 60.02  ?  62  CYS H C   1 
ATOM   7733  O O   . CYS H  2 39  ? 487.745 43.102  418.262 1.00 56.20  ?  62  CYS H O   1 
ATOM   7734  C CB  . CYS H  2 39  ? 487.139 45.903  419.667 1.00 56.33  ?  62  CYS H CB  1 
ATOM   7735  S SG  . CYS H  2 39  ? 486.242 47.459  419.860 1.00 72.53  ?  62  CYS H SG  1 
ATOM   7736  N N   . ASP H  2 40  ? 489.544 44.439  418.019 1.00 54.60  ?  63  ASP H N   1 
ATOM   7737  C CA  . ASP H  2 40  ? 490.501 43.345  417.937 1.00 50.27  ?  63  ASP H CA  1 
ATOM   7738  C C   . ASP H  2 40  ? 490.986 42.978  419.333 1.00 46.69  ?  63  ASP H C   1 
ATOM   7739  O O   . ASP H  2 40  ? 491.334 43.858  420.127 1.00 52.88  ?  63  ASP H O   1 
ATOM   7740  C CB  . ASP H  2 40  ? 491.685 43.731  417.048 1.00 53.26  ?  63  ASP H CB  1 
ATOM   7741  C CG  . ASP H  2 40  ? 491.257 44.139  415.653 1.00 63.81  ?  63  ASP H CG  1 
ATOM   7742  O OD1 . ASP H  2 40  ? 490.269 43.570  415.141 1.00 62.90  ?  63  ASP H OD1 1 
ATOM   7743  O OD2 . ASP H  2 40  ? 491.908 45.030  415.069 1.00 67.51  -1 63  ASP H OD2 1 
ATOM   7744  N N   . ILE H  2 41  ? 491.016 41.677  419.622 1.00 43.70  ?  64  ILE H N   1 
ATOM   7745  C CA  . ILE H  2 41  ? 491.393 41.202  420.948 1.00 41.04  ?  64  ILE H CA  1 
ATOM   7746  C C   . ILE H  2 41  ? 492.853 41.537  421.226 1.00 47.21  ?  64  ILE H C   1 
ATOM   7747  O O   . ILE H  2 41  ? 493.726 41.373  420.362 1.00 57.43  ?  64  ILE H O   1 
ATOM   7748  C CB  . ILE H  2 41  ? 491.136 39.690  421.059 1.00 40.62  ?  64  ILE H CB  1 
ATOM   7749  C CG1 . ILE H  2 41  ? 489.759 39.345  420.489 1.00 42.05  ?  64  ILE H CG1 1 
ATOM   7750  C CG2 . ILE H  2 41  ? 491.246 39.232  422.505 1.00 45.56  ?  64  ILE H CG2 1 
ATOM   7751  C CD1 . ILE H  2 41  ? 489.516 37.861  420.336 1.00 45.64  ?  64  ILE H CD1 1 
ATOM   7752  N N   . CYS H  2 42  ? 493.124 42.010  422.440 1.00 40.91  ?  65  CYS H N   1 
ATOM   7753  C CA  . CYS H  2 42  ? 494.483 42.355  422.832 1.00 40.66  ?  65  CYS H CA  1 
ATOM   7754  C C   . CYS H  2 42  ? 495.356 41.111  422.956 1.00 37.95  ?  65  CYS H C   1 
ATOM   7755  O O   . CYS H  2 42  ? 494.888 40.024  423.300 1.00 32.89  ?  65  CYS H O   1 
ATOM   7756  C CB  . CYS H  2 42  ? 494.486 43.121  424.154 1.00 40.51  ?  65  CYS H CB  1 
ATOM   7757  S SG  . CYS H  2 42  ? 494.545 44.922  423.990 1.00 67.10  ?  65  CYS H SG  1 
ATOM   7758  N N   . ARG H  2 43  ? 496.647 41.289  422.675 1.00 46.98  ?  66  ARG H N   1 
ATOM   7759  C CA  . ARG H  2 43  ? 497.595 40.188  422.780 1.00 49.33  ?  66  ARG H CA  1 
ATOM   7760  C C   . ARG H  2 43  ? 497.848 39.838  424.239 1.00 45.44  ?  66  ARG H C   1 
ATOM   7761  O O   . ARG H  2 43  ? 498.057 40.722  425.076 1.00 43.12  ?  66  ARG H O   1 
ATOM   7762  C CB  . ARG H  2 43  ? 498.914 40.547  422.093 1.00 50.51  ?  66  ARG H CB  1 
ATOM   7763  C CG  . ARG H  2 43  ? 499.047 40.017  420.674 1.00 61.57  ?  66  ARG H CG  1 
ATOM   7764  C CD  . ARG H  2 43  ? 500.493 39.659  420.356 1.00 56.97  ?  66  ARG H CD  1 
ATOM   7765  N NE  . ARG H  2 43  ? 500.966 38.535  421.162 1.00 58.80  ?  66  ARG H NE  1 
ATOM   7766  C CZ  . ARG H  2 43  ? 502.197 38.033  421.101 1.00 55.49  ?  66  ARG H CZ  1 
ATOM   7767  N NH1 . ARG H  2 43  ? 503.088 38.555  420.270 1.00 47.30  ?  66  ARG H NH1 1 
ATOM   7768  N NH2 . ARG H  2 43  ? 502.535 37.008  421.873 1.00 42.38  ?  66  ARG H NH2 1 
ATOM   7769  N N   . GLN H  2 44  ? 497.830 38.544  424.541 1.00 56.45  ?  67  GLN H N   1 
ATOM   7770  C CA  . GLN H  2 44  ? 498.169 38.048  425.866 1.00 52.65  ?  67  GLN H CA  1 
ATOM   7771  C C   . GLN H  2 44  ? 499.645 37.669  425.883 1.00 57.95  ?  67  GLN H C   1 
ATOM   7772  O O   . GLN H  2 44  ? 500.081 36.828  425.089 1.00 60.63  ?  67  GLN H O   1 
ATOM   7773  C CB  . GLN H  2 44  ? 497.302 36.844  426.233 1.00 52.64  ?  67  GLN H CB  1 
ATOM   7774  C CG  . GLN H  2 44  ? 495.806 37.110  426.205 1.00 52.16  ?  67  GLN H CG  1 
ATOM   7775  C CD  . GLN H  2 44  ? 495.297 37.717  427.497 1.00 52.32  ?  67  GLN H CD  1 
ATOM   7776  O OE1 . GLN H  2 44  ? 495.958 37.643  428.533 1.00 56.42  ?  67  GLN H OE1 1 
ATOM   7777  N NE2 . GLN H  2 44  ? 494.116 38.319  427.443 1.00 56.17  ?  67  GLN H NE2 1 
ATOM   7778  N N   . CYS H  2 45  ? 500.410 38.283  426.779 1.00 49.24  ?  68  CYS H N   1 
ATOM   7779  C CA  . CYS H  2 45  ? 501.820 37.955  426.949 1.00 46.55  ?  68  CYS H CA  1 
ATOM   7780  C C   . CYS H  2 45  ? 501.935 37.045  428.165 1.00 45.29  ?  68  CYS H C   1 
ATOM   7781  O O   . CYS H  2 45  ? 501.786 37.498  429.305 1.00 54.60  ?  68  CYS H O   1 
ATOM   7782  C CB  . CYS H  2 45  ? 502.668 39.213  427.125 1.00 52.60  ?  68  CYS H CB  1 
ATOM   7783  S SG  . CYS H  2 45  ? 502.381 40.549  425.933 1.00 65.45  ?  68  CYS H SG  1 
ATOM   7784  N N   . LYS H  2 46  ? 502.211 35.768  427.922 1.00 40.37  ?  69  LYS H N   1 
ATOM   7785  C CA  . LYS H  2 46  ? 502.283 34.774  428.982 1.00 41.10  ?  69  LYS H CA  1 
ATOM   7786  C C   . LYS H  2 46  ? 503.370 33.772  428.623 1.00 46.99  ?  69  LYS H C   1 
ATOM   7787  O O   . LYS H  2 46  ? 504.004 33.865  427.569 1.00 53.36  ?  69  LYS H O   1 
ATOM   7788  C CB  . LYS H  2 46  ? 500.931 34.082  429.190 1.00 38.88  ?  69  LYS H CB  1 
ATOM   7789  C CG  . LYS H  2 46  ? 499.868 34.949  429.848 1.00 42.63  ?  69  LYS H CG  1 
ATOM   7790  C CD  . LYS H  2 46  ? 498.564 34.188  430.027 1.00 38.88  ?  69  LYS H CD  1 
ATOM   7791  C CE  . LYS H  2 46  ? 497.935 34.476  431.378 1.00 39.97  ?  69  LYS H CE  1 
ATOM   7792  N NZ  . LYS H  2 46  ? 497.705 35.931  431.581 1.00 46.55  ?  69  LYS H NZ  1 
ATOM   7793  N N   . GLY H  2 47  ? 503.573 32.801  429.505 1.00 45.70  ?  70  GLY H N   1 
ATOM   7794  C CA  . GLY H  2 47  ? 504.597 31.802  429.257 1.00 48.31  ?  70  GLY H CA  1 
ATOM   7795  C C   . GLY H  2 47  ? 505.962 32.455  429.206 1.00 53.37  ?  70  GLY H C   1 
ATOM   7796  O O   . GLY H  2 47  ? 506.399 33.115  430.157 1.00 62.56  ?  70  GLY H O   1 
ATOM   7797  N N   . VAL H  2 48  ? 506.656 32.272  428.081 1.00 39.23  ?  71  VAL H N   1 
ATOM   7798  C CA  . VAL H  2 48  ? 507.970 32.875  427.909 1.00 41.92  ?  71  VAL H CA  1 
ATOM   7799  C C   . VAL H  2 48  ? 507.891 34.387  427.745 1.00 47.31  ?  71  VAL H C   1 
ATOM   7800  O O   . VAL H  2 48  ? 508.903 35.076  427.911 1.00 55.62  ?  71  VAL H O   1 
ATOM   7801  C CB  . VAL H  2 48  ? 508.696 32.256  426.702 1.00 40.91  ?  71  VAL H CB  1 
ATOM   7802  C CG1 . VAL H  2 48  ? 509.028 30.803  426.973 1.00 47.55  ?  71  VAL H CG1 1 
ATOM   7803  C CG2 . VAL H  2 48  ? 507.844 32.387  425.450 1.00 41.79  ?  71  VAL H CG2 1 
ATOM   7804  N N   . PHE H  2 49  ? 506.716 34.928  427.431 1.00 30.04  ?  72  PHE H N   1 
ATOM   7805  C CA  . PHE H  2 49  ? 506.582 36.339  427.096 1.00 33.87  ?  72  PHE H CA  1 
ATOM   7806  C C   . PHE H  2 49  ? 506.279 37.172  428.335 1.00 38.38  ?  72  PHE H C   1 
ATOM   7807  O O   . PHE H  2 49  ? 505.373 36.842  429.108 1.00 43.35  ?  72  PHE H O   1 
ATOM   7808  C CB  . PHE H  2 49  ? 505.478 36.543  426.058 1.00 33.61  ?  72  PHE H CB  1 
ATOM   7809  C CG  . PHE H  2 49  ? 505.664 35.742  424.805 1.00 27.99  ?  72  PHE H CG  1 
ATOM   7810  C CD1 . PHE H  2 49  ? 506.679 36.049  423.917 1.00 30.03  ?  72  PHE H CD1 1 
ATOM   7811  C CD2 . PHE H  2 49  ? 504.815 34.690  424.509 1.00 26.04  ?  72  PHE H CD2 1 
ATOM   7812  C CE1 . PHE H  2 49  ? 506.851 35.315  422.760 1.00 28.18  ?  72  PHE H CE1 1 
ATOM   7813  C CE2 . PHE H  2 49  ? 504.980 33.954  423.354 1.00 24.25  ?  72  PHE H CE2 1 
ATOM   7814  C CZ  . PHE H  2 49  ? 506.000 34.267  422.478 1.00 24.37  ?  72  PHE H CZ  1 
ATOM   7815  N N   . ARG H  2 50  ? 507.039 38.250  428.515 1.00 68.02  ?  73  ARG H N   1 
ATOM   7816  C CA  . ARG H  2 50  ? 506.700 39.290  429.472 1.00 67.98  ?  73  ARG H CA  1 
ATOM   7817  C C   . ARG H  2 50  ? 505.831 40.340  428.784 1.00 69.91  ?  73  ARG H C   1 
ATOM   7818  O O   . ARG H  2 50  ? 505.563 40.270  427.582 1.00 72.24  ?  73  ARG H O   1 
ATOM   7819  C CB  . ARG H  2 50  ? 507.963 39.924  430.054 1.00 74.42  ?  73  ARG H CB  1 
ATOM   7820  C CG  . ARG H  2 50  ? 508.856 38.976  430.838 1.00 77.13  ?  73  ARG H CG  1 
ATOM   7821  C CD  . ARG H  2 50  ? 510.082 39.695  431.396 1.00 67.74  ?  73  ARG H CD  1 
ATOM   7822  N NE  . ARG H  2 50  ? 511.027 40.084  430.351 1.00 75.74  ?  73  ARG H NE  1 
ATOM   7823  C CZ  . ARG H  2 50  ? 511.086 41.293  429.800 1.00 85.14  ?  73  ARG H CZ  1 
ATOM   7824  N NH1 . ARG H  2 50  ? 511.981 41.551  428.856 1.00 84.39  ?  73  ARG H NH1 1 
ATOM   7825  N NH2 . ARG H  2 50  ? 510.254 42.247  430.194 1.00 88.69  ?  73  ARG H NH2 1 
ATOM   7826  N N   . THR H  2 51  ? 505.402 41.343  429.542 1.00 42.58  ?  74  THR H N   1 
ATOM   7827  C CA  . THR H  2 51  ? 504.555 42.413  429.023 1.00 44.05  ?  74  THR H CA  1 
ATOM   7828  C C   . THR H  2 51  ? 505.367 43.703  428.984 1.00 48.24  ?  74  THR H C   1 
ATOM   7829  O O   . THR H  2 51  ? 505.737 44.243  430.032 1.00 40.19  ?  74  THR H O   1 
ATOM   7830  C CB  . THR H  2 51  ? 503.298 42.582  429.874 1.00 34.53  ?  74  THR H CB  1 
ATOM   7831  O OG1 . THR H  2 51  ? 502.530 41.373  429.838 1.00 30.36  ?  74  THR H OG1 1 
ATOM   7832  C CG2 . THR H  2 51  ? 502.449 43.728  429.344 1.00 37.48  ?  74  THR H CG2 1 
ATOM   7833  N N   . ARG H  2 52  ? 505.647 44.190  427.774 1.00 88.04  ?  75  ARG H N   1 
ATOM   7834  C CA  . ARG H  2 52  ? 506.331 45.474  427.623 1.00 92.57  ?  75  ARG H CA  1 
ATOM   7835  C C   . ARG H  2 52  ? 505.335 46.625  427.729 1.00 96.71  ?  75  ARG H C   1 
ATOM   7836  O O   . ARG H  2 52  ? 505.349 47.389  428.699 1.00 100.80 ?  75  ARG H O   1 
ATOM   7837  C CB  . ARG H  2 52  ? 507.085 45.519  426.290 1.00 93.52  ?  75  ARG H CB  1 
ATOM   7838  C CG  . ARG H  2 52  ? 507.663 46.885  425.955 1.00 91.80  ?  75  ARG H CG  1 
ATOM   7839  C CD  . ARG H  2 52  ? 508.749 46.783  424.900 1.00 106.11 ?  75  ARG H CD  1 
ATOM   7840  N NE  . ARG H  2 52  ? 509.790 45.834  425.289 1.00 118.04 ?  75  ARG H NE  1 
ATOM   7841  C CZ  . ARG H  2 52  ? 510.784 46.113  426.127 1.00 115.00 ?  75  ARG H CZ  1 
ATOM   7842  N NH1 . ARG H  2 52  ? 510.880 47.318  426.670 1.00 114.67 ?  75  ARG H NH1 1 
ATOM   7843  N NH2 . ARG H  2 52  ? 511.683 45.184  426.422 1.00 115.69 ?  75  ARG H NH2 1 
ATOM   7844  N N   . LYS H  2 53  ? 504.460 46.757  426.737 1.00 67.94  ?  76  LYS H N   1 
ATOM   7845  C CA  . LYS H  2 53  ? 503.417 47.772  426.739 1.00 70.31  ?  76  LYS H CA  1 
ATOM   7846  C C   . LYS H  2 53  ? 502.084 47.119  427.073 1.00 68.00  ?  76  LYS H C   1 
ATOM   7847  O O   . LYS H  2 53  ? 501.713 46.107  426.468 1.00 65.15  ?  76  LYS H O   1 
ATOM   7848  C CB  . LYS H  2 53  ? 503.338 48.485  425.387 1.00 66.98  ?  76  LYS H CB  1 
ATOM   7849  C CG  . LYS H  2 53  ? 502.276 49.571  425.322 1.00 62.38  ?  76  LYS H CG  1 
ATOM   7850  C CD  . LYS H  2 53  ? 502.342 50.330  424.007 1.00 68.32  ?  76  LYS H CD  1 
ATOM   7851  C CE  . LYS H  2 53  ? 503.682 51.028  423.838 1.00 75.24  ?  76  LYS H CE  1 
ATOM   7852  N NZ  . LYS H  2 53  ? 503.771 51.759  422.544 1.00 75.34  ?  76  LYS H NZ  1 
ATOM   7853  N N   . GLU H  2 54  ? 501.372 47.695  428.036 1.00 78.67  ?  77  GLU H N   1 
ATOM   7854  C CA  . GLU H  2 54  ? 500.103 47.133  428.467 1.00 74.47  ?  77  GLU H CA  1 
ATOM   7855  C C   . GLU H  2 54  ? 499.023 47.372  427.416 1.00 75.93  ?  77  GLU H C   1 
ATOM   7856  O O   . GLU H  2 54  ? 499.121 48.264  426.569 1.00 71.95  ?  77  GLU H O   1 
ATOM   7857  C CB  . GLU H  2 54  ? 499.675 47.732  429.808 1.00 76.18  ?  77  GLU H CB  1 
ATOM   7858  C CG  . GLU H  2 54  ? 500.706 47.591  430.920 1.00 89.09  ?  77  GLU H CG  1 
ATOM   7859  C CD  . GLU H  2 54  ? 501.774 48.669  430.875 1.00 98.40  ?  77  GLU H CD  1 
ATOM   7860  O OE1 . GLU H  2 54  ? 501.413 49.860  430.773 1.00 97.49  ?  77  GLU H OE1 1 
ATOM   7861  O OE2 . GLU H  2 54  ? 502.973 48.324  430.936 1.00 88.43  -1 77  GLU H OE2 1 
ATOM   7862  N N   . CYS H  2 55  ? 497.981 46.548  427.480 1.00 100.65 ?  78  CYS H N   1 
ATOM   7863  C CA  . CYS H  2 55  ? 496.874 46.657  426.539 1.00 97.16  ?  78  CYS H CA  1 
ATOM   7864  C C   . CYS H  2 55  ? 496.084 47.935  426.790 1.00 95.91  ?  78  CYS H C   1 
ATOM   7865  O O   . CYS H  2 55  ? 495.644 48.199  427.914 1.00 93.66  ?  78  CYS H O   1 
ATOM   7866  C CB  . CYS H  2 55  ? 495.965 45.434  426.655 1.00 99.53  ?  78  CYS H CB  1 
ATOM   7867  S SG  . CYS H  2 55  ? 494.323 45.592  425.894 1.00 123.87 ?  78  CYS H SG  1 
ATOM   7868  N N   . SER H  2 56  ? 495.913 48.732  425.740 1.00 89.57  ?  79  SER H N   1 
ATOM   7869  C CA  . SER H  2 56  ? 495.111 49.943  425.785 1.00 95.51  ?  79  SER H CA  1 
ATOM   7870  C C   . SER H  2 56  ? 494.003 49.848  424.746 1.00 94.60  ?  79  SER H C   1 
ATOM   7871  O O   . SER H  2 56  ? 494.064 49.043  423.812 1.00 99.27  ?  79  SER H O   1 
ATOM   7872  C CB  . SER H  2 56  ? 495.964 51.194  425.532 1.00 93.71  ?  79  SER H CB  1 
ATOM   7873  O OG  . SER H  2 56  ? 496.497 51.193  424.218 1.00 93.32  ?  79  SER H OG  1 
ATOM   7874  N N   . SER H  2 57  ? 492.973 50.677  424.924 1.00 65.84  ?  80  SER H N   1 
ATOM   7875  C CA  . SER H  2 57  ? 491.861 50.666  423.981 1.00 65.54  ?  80  SER H CA  1 
ATOM   7876  C C   . SER H  2 57  ? 492.301 51.110  422.592 1.00 66.40  ?  80  SER H C   1 
ATOM   7877  O O   . SER H  2 57  ? 491.789 50.603  421.588 1.00 63.45  ?  80  SER H O   1 
ATOM   7878  C CB  . SER H  2 57  ? 490.729 51.556  424.492 1.00 67.45  ?  80  SER H CB  1 
ATOM   7879  O OG  . SER H  2 57  ? 491.173 52.889  424.671 1.00 77.87  ?  80  SER H OG  1 
ATOM   7880  N N   . THR H  2 58  ? 493.245 52.046  422.513 1.00 66.83  ?  81  THR H N   1 
ATOM   7881  C CA  . THR H  2 58  ? 493.684 52.594  421.237 1.00 69.29  ?  81  THR H CA  1 
ATOM   7882  C C   . THR H  2 58  ? 494.893 51.880  420.640 1.00 66.86  ?  81  THR H C   1 
ATOM   7883  O O   . THR H  2 58  ? 495.225 52.138  419.477 1.00 62.57  ?  81  THR H O   1 
ATOM   7884  C CB  . THR H  2 58  ? 494.009 54.084  421.392 1.00 74.70  ?  81  THR H CB  1 
ATOM   7885  O OG1 . THR H  2 58  ? 495.054 54.248  422.359 1.00 78.02  ?  81  THR H OG1 1 
ATOM   7886  C CG2 . THR H  2 58  ? 492.778 54.850  421.850 1.00 71.55  ?  81  THR H CG2 1 
ATOM   7887  N N   . SER H  2 59  ? 495.554 50.994  421.383 1.00 74.04  ?  82  SER H N   1 
ATOM   7888  C CA  . SER H  2 59  ? 496.765 50.355  420.883 1.00 76.35  ?  82  SER H CA  1 
ATOM   7889  C C   . SER H  2 59  ? 496.901 48.957  421.468 1.00 76.53  ?  82  SER H C   1 
ATOM   7890  O O   . SER H  2 59  ? 496.550 48.723  422.627 1.00 77.36  ?  82  SER H O   1 
ATOM   7891  C CB  . SER H  2 59  ? 498.012 51.183  421.216 1.00 73.12  ?  82  SER H CB  1 
ATOM   7892  O OG  . SER H  2 59  ? 498.239 51.226  422.613 1.00 68.26  ?  82  SER H OG  1 
ATOM   7893  N N   . ASN H  2 60  ? 497.430 48.041  420.661 1.00 50.07  ?  83  ASN H N   1 
ATOM   7894  C CA  . ASN H  2 60  ? 497.635 46.665  421.082 1.00 44.84  ?  83  ASN H CA  1 
ATOM   7895  C C   . ASN H  2 60  ? 498.845 46.556  422.007 1.00 39.63  ?  83  ASN H C   1 
ATOM   7896  O O   . ASN H  2 60  ? 499.755 47.389  421.989 1.00 42.22  ?  83  ASN H O   1 
ATOM   7897  C CB  . ASN H  2 60  ? 497.820 45.757  419.863 1.00 46.41  ?  83  ASN H CB  1 
ATOM   7898  C CG  . ASN H  2 60  ? 497.822 44.283  420.224 1.00 39.93  ?  83  ASN H CG  1 
ATOM   7899  O OD1 . ASN H  2 60  ? 497.388 43.896  421.309 1.00 38.45  ?  83  ASN H OD1 1 
ATOM   7900  N ND2 . ASN H  2 60  ? 498.312 43.452  419.311 1.00 38.83  ?  83  ASN H ND2 1 
ATOM   7901  N N   . ALA H  2 61  ? 498.843 45.506  422.825 1.00 37.16  ?  84  ALA H N   1 
ATOM   7902  C CA  . ALA H  2 61  ? 499.948 45.259  423.737 1.00 37.39  ?  84  ALA H CA  1 
ATOM   7903  C C   . ALA H  2 61  ? 501.172 44.749  422.978 1.00 37.15  ?  84  ALA H C   1 
ATOM   7904  O O   . ALA H  2 61  ? 501.076 44.222  421.866 1.00 35.63  ?  84  ALA H O   1 
ATOM   7905  C CB  . ALA H  2 61  ? 499.542 44.253  424.813 1.00 29.06  ?  84  ALA H CB  1 
ATOM   7906  N N   . GLU H  2 62  ? 502.335 44.914  423.601 1.00 72.46  ?  85  GLU H N   1 
ATOM   7907  C CA  . GLU H  2 62  ? 503.609 44.497  423.030 1.00 68.98  ?  85  GLU H CA  1 
ATOM   7908  C C   . GLU H  2 62  ? 504.288 43.527  423.986 1.00 70.35  ?  85  GLU H C   1 
ATOM   7909  O O   . GLU H  2 62  ? 504.485 43.847  425.163 1.00 71.22  ?  85  GLU H O   1 
ATOM   7910  C CB  . GLU H  2 62  ? 504.515 45.704  422.769 1.00 69.32  ?  85  GLU H CB  1 
ATOM   7911  C CG  . GLU H  2 62  ? 505.585 45.464  421.720 1.00 75.61  ?  85  GLU H CG  1 
ATOM   7912  C CD  . GLU H  2 62  ? 505.012 45.355  420.321 1.00 86.89  ?  85  GLU H CD  1 
ATOM   7913  O OE1 . GLU H  2 62  ? 505.604 44.638  419.488 1.00 96.20  ?  85  GLU H OE1 1 
ATOM   7914  O OE2 . GLU H  2 62  ? 503.967 45.985  420.055 1.00 83.55  -1 85  GLU H OE2 1 
ATOM   7915  N N   . CYS H  2 63  ? 504.646 42.350  423.482 1.00 78.58  ?  86  CYS H N   1 
ATOM   7916  C CA  . CYS H  2 63  ? 505.254 41.307  424.296 1.00 79.94  ?  86  CYS H CA  1 
ATOM   7917  C C   . CYS H  2 63  ? 506.760 41.269  424.074 1.00 85.74  ?  86  CYS H C   1 
ATOM   7918  O O   . CYS H  2 63  ? 507.242 41.493  422.959 1.00 90.52  ?  86  CYS H O   1 
ATOM   7919  C CB  . CYS H  2 63  ? 504.660 39.933  423.975 1.00 74.52  ?  86  CYS H CB  1 
ATOM   7920  S SG  . CYS H  2 63  ? 502.860 39.762  424.123 1.00 87.74  ?  86  CYS H SG  1 
ATOM   7921  N N   . ASP H  2 64  ? 507.497 40.992  425.146 1.00 85.94  ?  87  ASP H N   1 
ATOM   7922  C CA  . ASP H  2 64  ? 508.911 40.654  425.076 1.00 84.59  ?  87  ASP H CA  1 
ATOM   7923  C C   . ASP H  2 64  ? 509.143 39.408  425.918 1.00 81.24  ?  87  ASP H C   1 
ATOM   7924  O O   . ASP H  2 64  ? 508.306 39.032  426.740 1.00 81.95  ?  87  ASP H O   1 
ATOM   7925  C CB  . ASP H  2 64  ? 509.805 41.805  425.548 1.00 95.34  ?  87  ASP H CB  1 
ATOM   7926  C CG  . ASP H  2 64  ? 510.062 42.822  424.455 1.00 107.50 ?  87  ASP H CG  1 
ATOM   7927  O OD1 . ASP H  2 64  ? 510.966 42.585  423.624 1.00 100.20 ?  87  ASP H OD1 1 
ATOM   7928  O OD2 . ASP H  2 64  ? 509.361 43.854  424.423 1.00 118.10 -1 87  ASP H OD2 1 
ATOM   7929  N N   . CYS H  2 65  ? 510.285 38.761  425.709 1.00 54.77  ?  88  CYS H N   1 
ATOM   7930  C CA  . CYS H  2 65  ? 510.457 37.428  426.256 1.00 52.04  ?  88  CYS H CA  1 
ATOM   7931  C C   . CYS H  2 65  ? 511.102 37.473  427.643 1.00 52.44  ?  88  CYS H C   1 
ATOM   7932  O O   . CYS H  2 65  ? 511.353 38.535  428.216 1.00 62.23  ?  88  CYS H O   1 
ATOM   7933  C CB  . CYS H  2 65  ? 511.270 36.559  425.300 1.00 59.03  ?  88  CYS H CB  1 
ATOM   7934  S SG  . CYS H  2 65  ? 510.703 34.856  425.312 1.00 94.89  ?  88  CYS H SG  1 
ATOM   7935  N N   . THR H  2 66  ? 511.367 36.280  428.192 1.00 36.20  ?  89  THR H N   1 
ATOM   7936  C CA  . THR H  2 66  ? 511.900 36.066  429.530 1.00 38.68  ?  89  THR H CA  1 
ATOM   7937  C C   . THR H  2 66  ? 513.389 36.410  429.581 1.00 46.71  ?  89  THR H C   1 
ATOM   7938  O O   . THR H  2 66  ? 514.082 36.344  428.562 1.00 51.40  ?  89  THR H O   1 
ATOM   7939  C CB  . THR H  2 66  ? 511.700 34.607  429.943 1.00 39.89  ?  89  THR H CB  1 
ATOM   7940  O OG1 . THR H  2 66  ? 510.454 34.135  429.425 1.00 45.70  ?  89  THR H OG1 1 
ATOM   7941  C CG2 . THR H  2 66  ? 511.684 34.454  431.458 1.00 37.55  ?  89  THR H CG2 1 
ATOM   7942  N N   . PRO H  2 67  ? 513.896 36.808  430.749 1.00 50.45  ?  90  PRO H N   1 
ATOM   7943  C CA  . PRO H  2 67  ? 515.349 36.883  430.933 1.00 54.05  ?  90  PRO H CA  1 
ATOM   7944  C C   . PRO H  2 67  ? 516.027 35.582  430.527 1.00 46.76  ?  90  PRO H C   1 
ATOM   7945  O O   . PRO H  2 67  ? 515.570 34.486  430.861 1.00 40.63  ?  90  PRO H O   1 
ATOM   7946  C CB  . PRO H  2 67  ? 515.506 37.158  432.436 1.00 49.04  ?  90  PRO H CB  1 
ATOM   7947  C CG  . PRO H  2 67  ? 514.091 37.294  432.993 1.00 46.54  ?  90  PRO H CG  1 
ATOM   7948  C CD  . PRO H  2 67  ? 513.186 37.509  431.828 1.00 48.14  ?  90  PRO H CD  1 
ATOM   7949  N N   . GLY H  2 68  ? 517.133 35.710  429.796 1.00 68.51  ?  91  GLY H N   1 
ATOM   7950  C CA  . GLY H  2 68  ? 517.811 34.582  429.207 1.00 73.74  ?  91  GLY H CA  1 
ATOM   7951  C C   . GLY H  2 68  ? 517.361 34.242  427.802 1.00 68.52  ?  91  GLY H C   1 
ATOM   7952  O O   . GLY H  2 68  ? 518.112 33.595  427.063 1.00 68.25  ?  91  GLY H O   1 
ATOM   7953  N N   . PHE H  2 69  ? 516.162 34.662  427.413 1.00 49.96  ?  92  PHE H N   1 
ATOM   7954  C CA  . PHE H  2 69  ? 515.671 34.510  426.057 1.00 46.06  ?  92  PHE H CA  1 
ATOM   7955  C C   . PHE H  2 69  ? 515.740 35.852  425.333 1.00 49.45  ?  92  PHE H C   1 
ATOM   7956  O O   . PHE H  2 69  ? 516.172 36.867  425.884 1.00 56.93  ?  92  PHE H O   1 
ATOM   7957  C CB  . PHE H  2 69  ? 514.241 33.964  426.055 1.00 46.23  ?  92  PHE H CB  1 
ATOM   7958  C CG  . PHE H  2 69  ? 514.125 32.550  426.550 1.00 43.25  ?  92  PHE H CG  1 
ATOM   7959  C CD1 . PHE H  2 69  ? 514.400 31.483  425.711 1.00 40.70  ?  92  PHE H CD1 1 
ATOM   7960  C CD2 . PHE H  2 69  ? 513.730 32.288  427.851 1.00 38.70  ?  92  PHE H CD2 1 
ATOM   7961  C CE1 . PHE H  2 69  ? 514.288 30.183  426.163 1.00 32.72  ?  92  PHE H CE1 1 
ATOM   7962  C CE2 . PHE H  2 69  ? 513.617 30.990  428.307 1.00 31.14  ?  92  PHE H CE2 1 
ATOM   7963  C CZ  . PHE H  2 69  ? 513.896 29.938  427.462 1.00 26.11  ?  92  PHE H CZ  1 
ATOM   7964  N N   . HIS H  2 70  ? 515.303 35.850  424.077 1.00 36.27  ?  93  HIS H N   1 
ATOM   7965  C CA  . HIS H  2 70  ? 515.210 37.073  423.292 1.00 41.74  ?  93  HIS H CA  1 
ATOM   7966  C C   . HIS H  2 70  ? 514.185 36.856  422.191 1.00 41.05  ?  93  HIS H C   1 
ATOM   7967  O O   . HIS H  2 70  ? 513.877 35.721  421.820 1.00 40.71  ?  93  HIS H O   1 
ATOM   7968  C CB  . HIS H  2 70  ? 516.566 37.479  422.707 1.00 41.74  ?  93  HIS H CB  1 
ATOM   7969  C CG  . HIS H  2 70  ? 517.102 36.513  421.700 1.00 37.98  ?  93  HIS H CG  1 
ATOM   7970  N ND1 . HIS H  2 70  ? 517.293 36.844  420.376 1.00 48.63  ?  93  HIS H ND1 1 
ATOM   7971  C CD2 . HIS H  2 70  ? 517.487 35.221  421.823 1.00 30.70  ?  93  HIS H CD2 1 
ATOM   7972  C CE1 . HIS H  2 70  ? 517.773 35.799  419.726 1.00 42.38  ?  93  HIS H CE1 1 
ATOM   7973  N NE2 . HIS H  2 70  ? 517.900 34.801  420.581 1.00 36.21  ?  93  HIS H NE2 1 
ATOM   7974  N N   . CYS H  2 71  ? 513.664 37.963  421.669 1.00 57.06  ?  94  CYS H N   1 
ATOM   7975  C CA  . CYS H  2 71  ? 512.603 37.887  420.678 1.00 51.18  ?  94  CYS H CA  1 
ATOM   7976  C C   . CYS H  2 71  ? 513.133 37.406  419.332 1.00 55.19  ?  94  CYS H C   1 
ATOM   7977  O O   . CYS H  2 71  ? 514.286 37.648  418.965 1.00 50.40  ?  94  CYS H O   1 
ATOM   7978  C CB  . CYS H  2 71  ? 511.924 39.244  420.508 1.00 49.13  ?  94  CYS H CB  1 
ATOM   7979  S SG  . CYS H  2 71  ? 510.676 39.627  421.756 1.00 88.94  ?  94  CYS H SG  1 
ATOM   7980  N N   . LEU H  2 72  ? 512.269 36.706  418.600 1.00 62.67  ?  95  LEU H N   1 
ATOM   7981  C CA  . LEU H  2 72  ? 512.552 36.271  417.239 1.00 58.37  ?  95  LEU H CA  1 
ATOM   7982  C C   . LEU H  2 72  ? 511.295 36.495  416.413 1.00 61.35  ?  95  LEU H C   1 
ATOM   7983  O O   . LEU H  2 72  ? 510.225 35.991  416.767 1.00 66.99  ?  95  LEU H O   1 
ATOM   7984  C CB  . LEU H  2 72  ? 512.981 34.798  417.208 1.00 52.59  ?  95  LEU H CB  1 
ATOM   7985  C CG  . LEU H  2 72  ? 513.565 34.239  415.910 1.00 59.72  ?  95  LEU H CG  1 
ATOM   7986  C CD1 . LEU H  2 72  ? 514.636 33.210  416.225 1.00 58.01  ?  95  LEU H CD1 1 
ATOM   7987  C CD2 . LEU H  2 72  ? 512.482 33.623  415.039 1.00 66.06  ?  95  LEU H CD2 1 
ATOM   7988  N N   . GLY H  2 73  ? 511.420 37.242  415.326 1.00 52.29  ?  96  GLY H N   1 
ATOM   7989  C CA  . GLY H  2 73  ? 510.286 37.615  414.503 1.00 62.84  ?  96  GLY H CA  1 
ATOM   7990  C C   . GLY H  2 73  ? 509.911 39.078  414.690 1.00 74.02  ?  96  GLY H C   1 
ATOM   7991  O O   . GLY H  2 73  ? 510.494 39.806  415.495 1.00 85.60  ?  96  GLY H O   1 
ATOM   7992  N N   . ALA H  2 74  ? 508.908 39.494  413.914 1.00 79.49  ?  97  ALA H N   1 
ATOM   7993  C CA  . ALA H  2 74  ? 508.514 40.901  413.901 1.00 83.99  ?  97  ALA H CA  1 
ATOM   7994  C C   . ALA H  2 74  ? 507.786 41.290  415.184 1.00 84.69  ?  97  ALA H C   1 
ATOM   7995  O O   . ALA H  2 74  ? 508.132 42.286  415.829 1.00 86.44  ?  97  ALA H O   1 
ATOM   7996  C CB  . ALA H  2 74  ? 507.643 41.188  412.678 1.00 74.22  ?  97  ALA H CB  1 
ATOM   7997  N N   . GLY H  2 75  ? 506.772 40.519  415.565 1.00 97.36  ?  98  GLY H N   1 
ATOM   7998  C CA  . GLY H  2 75  ? 505.976 40.823  416.738 1.00 93.17  ?  98  GLY H CA  1 
ATOM   7999  C C   . GLY H  2 75  ? 506.348 39.991  417.947 1.00 89.54  ?  98  GLY H C   1 
ATOM   8000  O O   . GLY H  2 75  ? 505.522 39.785  418.842 1.00 85.48  ?  98  GLY H O   1 
ATOM   8001  N N   . CYS H  2 76  ? 507.591 39.505  417.975 1.00 69.94  ?  99  CYS H N   1 
ATOM   8002  C CA  . CYS H  2 76  ? 508.047 38.509  418.946 1.00 66.39  ?  99  CYS H CA  1 
ATOM   8003  C C   . CYS H  2 76  ? 507.199 37.240  418.839 1.00 58.08  ?  99  CYS H C   1 
ATOM   8004  O O   . CYS H  2 76  ? 506.494 36.840  419.768 1.00 53.01  ?  99  CYS H O   1 
ATOM   8005  C CB  . CYS H  2 76  ? 508.035 39.068  420.375 1.00 58.53  ?  99  CYS H CB  1 
ATOM   8006  S SG  . CYS H  2 76  ? 509.169 40.446  420.669 1.00 105.28 ?  99  CYS H SG  1 
ATOM   8007  N N   . SER H  2 77  ? 507.288 36.606  417.668 1.00 42.70  ?  100 SER H N   1 
ATOM   8008  C CA  . SER H  2 77  ? 506.517 35.397  417.411 1.00 40.15  ?  100 SER H CA  1 
ATOM   8009  C C   . SER H  2 77  ? 507.120 34.182  418.099 1.00 37.24  ?  100 SER H C   1 
ATOM   8010  O O   . SER H  2 77  ? 506.384 33.277  418.507 1.00 35.30  ?  100 SER H O   1 
ATOM   8011  C CB  . SER H  2 77  ? 506.412 35.151  415.906 1.00 37.82  ?  100 SER H CB  1 
ATOM   8012  O OG  . SER H  2 77  ? 505.866 36.279  415.246 1.00 49.87  ?  100 SER H OG  1 
ATOM   8013  N N   . MET H  2 78  ? 508.441 34.143  418.237 1.00 43.76  ?  101 MET H N   1 
ATOM   8014  C CA  . MET H  2 78  ? 509.129 33.047  418.899 1.00 46.59  ?  101 MET H CA  1 
ATOM   8015  C C   . MET H  2 78  ? 510.136 33.611  419.891 1.00 41.01  ?  101 MET H C   1 
ATOM   8016  O O   . MET H  2 78  ? 510.332 34.825  419.999 1.00 40.88  ?  101 MET H O   1 
ATOM   8017  C CB  . MET H  2 78  ? 509.823 32.131  417.882 1.00 49.71  ?  101 MET H CB  1 
ATOM   8018  C CG  . MET H  2 78  ? 508.932 31.045  417.318 1.00 50.79  ?  101 MET H CG  1 
ATOM   8019  S SD  . MET H  2 78  ? 509.667 30.149  415.938 1.00 67.52  ?  101 MET H SD  1 
ATOM   8020  C CE  . MET H  2 78  ? 509.588 31.386  414.647 1.00 69.56  ?  101 MET H CE  1 
ATOM   8021  N N   . CYS H  2 79  ? 510.782 32.708  420.623 1.00 44.25  ?  102 CYS H N   1 
ATOM   8022  C CA  . CYS H  2 79  ? 511.882 33.061  421.506 1.00 50.94  ?  102 CYS H CA  1 
ATOM   8023  C C   . CYS H  2 79  ? 512.950 31.989  421.413 1.00 56.62  ?  102 CYS H C   1 
ATOM   8024  O O   . CYS H  2 79  ? 512.656 30.806  421.596 1.00 60.77  ?  102 CYS H O   1 
ATOM   8025  C CB  . CYS H  2 79  ? 511.431 33.181  422.964 1.00 52.22  ?  102 CYS H CB  1 
ATOM   8026  S SG  . CYS H  2 79  ? 510.239 34.461  423.362 1.00 52.20  ?  102 CYS H SG  1 
ATOM   8027  N N   . GLU H  2 80  ? 514.176 32.395  421.133 1.00 49.95  ?  103 GLU H N   1 
ATOM   8028  C CA  . GLU H  2 80  ? 515.319 31.527  421.346 1.00 52.84  ?  103 GLU H CA  1 
ATOM   8029  C C   . GLU H  2 80  ? 516.082 32.000  422.575 1.00 58.80  ?  103 GLU H C   1 
ATOM   8030  O O   . GLU H  2 80  ? 515.769 33.029  423.181 1.00 69.90  ?  103 GLU H O   1 
ATOM   8031  C CB  . GLU H  2 80  ? 516.233 31.507  420.118 1.00 55.39  ?  103 GLU H CB  1 
ATOM   8032  C CG  . GLU H  2 80  ? 515.708 30.694  418.951 1.00 59.40  ?  103 GLU H CG  1 
ATOM   8033  C CD  . GLU H  2 80  ? 516.741 30.529  417.851 1.00 66.60  ?  103 GLU H CD  1 
ATOM   8034  O OE1 . GLU H  2 80  ? 517.788 31.208  417.911 1.00 66.11  ?  103 GLU H OE1 1 
ATOM   8035  O OE2 . GLU H  2 80  ? 516.507 29.717  416.932 1.00 59.17  -1 103 GLU H OE2 1 
ATOM   8036  N N   . GLN H  2 81  ? 517.096 31.228  422.942 1.00 41.40  ?  104 GLN H N   1 
ATOM   8037  C CA  . GLN H  2 81  ? 518.180 31.756  423.744 1.00 41.27  ?  104 GLN H CA  1 
ATOM   8038  C C   . GLN H  2 81  ? 519.062 32.634  422.859 1.00 59.65  ?  104 GLN H C   1 
ATOM   8039  O O   . GLN H  2 81  ? 518.985 32.592  421.628 1.00 72.89  ?  104 GLN H O   1 
ATOM   8040  C CB  . GLN H  2 81  ? 518.978 30.618  424.380 1.00 47.88  ?  104 GLN H CB  1 
ATOM   8041  C CG  . GLN H  2 81  ? 518.121 29.646  425.183 1.00 40.94  ?  104 GLN H CG  1 
ATOM   8042  C CD  . GLN H  2 81  ? 518.923 28.505  425.782 1.00 39.84  ?  104 GLN H CD  1 
ATOM   8043  O OE1 . GLN H  2 81  ? 520.153 28.519  425.767 1.00 45.83  ?  104 GLN H OE1 1 
ATOM   8044  N NE2 . GLN H  2 81  ? 518.226 27.507  426.314 1.00 32.32  ?  104 GLN H NE2 1 
ATOM   8045  N N   . ASP H  2 82  ? 519.919 33.433  423.486 1.00 28.66  ?  105 ASP H N   1 
ATOM   8046  C CA  . ASP H  2 82  ? 520.864 34.232  422.713 1.00 34.67  ?  105 ASP H CA  1 
ATOM   8047  C C   . ASP H  2 82  ? 522.013 33.381  422.198 1.00 33.48  ?  105 ASP H C   1 
ATOM   8048  O O   . ASP H  2 82  ? 523.019 33.912  421.715 1.00 29.87  ?  105 ASP H O   1 
ATOM   8049  C CB  . ASP H  2 82  ? 521.387 35.417  423.527 1.00 27.87  ?  105 ASP H CB  1 
ATOM   8050  C CG  . ASP H  2 82  ? 521.742 36.608  422.648 1.00 41.53  ?  105 ASP H CG  1 
ATOM   8051  O OD1 . ASP H  2 82  ? 521.362 36.602  421.459 1.00 26.87  ?  105 ASP H OD1 1 
ATOM   8052  O OD2 . ASP H  2 82  ? 522.387 37.553  423.140 1.00 27.20  -1 105 ASP H OD2 1 
ATOM   8053  N N   . CYS H  2 83  ? 521.850 32.069  422.317 1.00 106.53 ?  106 CYS H N   1 
ATOM   8054  C CA  . CYS H  2 83  ? 522.742 30.984  421.904 1.00 109.36 ?  106 CYS H CA  1 
ATOM   8055  C C   . CYS H  2 83  ? 524.053 31.079  422.690 1.00 102.26 ?  106 CYS H C   1 
ATOM   8056  O O   . CYS H  2 83  ? 524.052 31.493  423.857 1.00 100.39 ?  106 CYS H O   1 
ATOM   8057  C CB  . CYS H  2 83  ? 522.865 31.043  420.381 1.00 113.91 ?  106 CYS H CB  1 
ATOM   8058  S SG  . CYS H  2 83  ? 521.215 31.102  419.568 1.00 122.88 ?  106 CYS H SG  1 
ATOM   8059  N N   . LYS H  2 84  ? 525.184 30.722  422.092 1.00 68.79  ?  107 LYS H N   1 
ATOM   8060  C CA  . LYS H  2 84  ? 526.348 30.375  422.902 1.00 67.18  ?  107 LYS H CA  1 
ATOM   8061  C C   . LYS H  2 84  ? 527.619 30.658  422.114 1.00 72.50  ?  107 LYS H C   1 
ATOM   8062  O O   . LYS H  2 84  ? 527.591 31.291  421.053 1.00 69.84  ?  107 LYS H O   1 
ATOM   8063  C CB  . LYS H  2 84  ? 526.323 28.901  423.342 1.00 71.70  ?  107 LYS H CB  1 
ATOM   8064  C CG  . LYS H  2 84  ? 525.131 28.458  424.181 1.00 75.69  ?  107 LYS H CG  1 
ATOM   8065  C CD  . LYS H  2 84  ? 524.069 27.801  423.311 1.00 69.18  ?  107 LYS H CD  1 
ATOM   8066  C CE  . LYS H  2 84  ? 522.739 27.709  424.032 1.00 61.36  ?  107 LYS H CE  1 
ATOM   8067  N NZ  . LYS H  2 84  ? 521.667 27.182  423.145 1.00 70.15  ?  107 LYS H NZ  1 
ATOM   8068  N N   . GLN H  2 85  ? 528.739 30.191  422.664 1.00 68.00  ?  108 GLN H N   1 
ATOM   8069  C CA  . GLN H  2 85  ? 530.022 30.279  421.988 1.00 65.59  ?  108 GLN H CA  1 
ATOM   8070  C C   . GLN H  2 85  ? 529.938 29.620  420.620 1.00 63.17  ?  108 GLN H C   1 
ATOM   8071  O O   . GLN H  2 85  ? 529.288 28.585  420.447 1.00 59.60  ?  108 GLN H O   1 
ATOM   8072  C CB  . GLN H  2 85  ? 531.104 29.603  422.831 1.00 68.12  ?  108 GLN H CB  1 
ATOM   8073  C CG  . GLN H  2 85  ? 530.809 29.592  424.322 1.00 69.93  ?  108 GLN H CG  1 
ATOM   8074  C CD  . GLN H  2 85  ? 531.743 28.682  425.095 1.00 72.76  ?  108 GLN H CD  1 
ATOM   8075  O OE1 . GLN H  2 85  ? 532.703 28.145  424.543 1.00 70.19  ?  108 GLN H OE1 1 
ATOM   8076  N NE2 . GLN H  2 85  ? 531.461 28.497  426.380 1.00 73.77  ?  108 GLN H NE2 1 
ATOM   8077  N N   . GLY H  2 86  ? 530.599 30.228  419.641 1.00 102.28 ?  109 GLY H N   1 
ATOM   8078  C CA  . GLY H  2 86  ? 530.502 29.731  418.289 1.00 102.48 ?  109 GLY H CA  1 
ATOM   8079  C C   . GLY H  2 86  ? 529.162 29.955  417.630 1.00 110.91 ?  109 GLY H C   1 
ATOM   8080  O O   . GLY H  2 86  ? 528.885 29.333  416.602 1.00 115.55 ?  109 GLY H O   1 
ATOM   8081  N N   . GLN H  2 87  ? 528.315 30.817  418.190 1.00 58.64  ?  110 GLN H N   1 
ATOM   8082  C CA  . GLN H  2 87  ? 527.004 31.100  417.622 1.00 55.78  ?  110 GLN H CA  1 
ATOM   8083  C C   . GLN H  2 87  ? 526.754 32.599  417.626 1.00 53.02  ?  110 GLN H C   1 
ATOM   8084  O O   . GLN H  2 87  ? 526.894 33.254  418.663 1.00 49.67  ?  110 GLN H O   1 
ATOM   8085  C CB  . GLN H  2 87  ? 525.893 30.377  418.394 1.00 56.44  ?  110 GLN H CB  1 
ATOM   8086  C CG  . GLN H  2 87  ? 525.794 28.892  418.089 1.00 51.95  ?  110 GLN H CG  1 
ATOM   8087  C CD  . GLN H  2 87  ? 524.539 28.258  418.660 1.00 60.74  ?  110 GLN H CD  1 
ATOM   8088  O OE1 . GLN H  2 87  ? 524.334 28.242  419.874 1.00 62.05  ?  110 GLN H OE1 1 
ATOM   8089  N NE2 . GLN H  2 87  ? 523.691 27.733  417.783 1.00 59.35  ?  110 GLN H NE2 1 
ATOM   8090  N N   . GLU H  2 88  ? 526.384 33.132  416.465 1.00 65.78  ?  111 GLU H N   1 
ATOM   8091  C CA  . GLU H  2 88  ? 526.039 34.535  416.297 1.00 67.73  ?  111 GLU H CA  1 
ATOM   8092  C C   . GLU H  2 88  ? 524.571 34.640  415.911 1.00 73.93  ?  111 GLU H C   1 
ATOM   8093  O O   . GLU H  2 88  ? 524.083 33.866  415.082 1.00 71.37  ?  111 GLU H O   1 
ATOM   8094  C CB  . GLU H  2 88  ? 526.915 35.194  415.225 1.00 72.64  ?  111 GLU H CB  1 
ATOM   8095  C CG  . GLU H  2 88  ? 526.719 36.694  415.074 1.00 78.76  ?  111 GLU H CG  1 
ATOM   8096  C CD  . GLU H  2 88  ? 527.371 37.239  413.815 1.00 81.43  ?  111 GLU H CD  1 
ATOM   8097  O OE1 . GLU H  2 88  ? 526.712 37.237  412.753 1.00 73.74  ?  111 GLU H OE1 1 
ATOM   8098  O OE2 . GLU H  2 88  ? 528.543 37.664  413.886 1.00 82.71  -1 111 GLU H OE2 1 
ATOM   8099  N N   . LEU H  2 89  ? 523.865 35.594  416.516 1.00 73.04  ?  112 LEU H N   1 
ATOM   8100  C CA  . LEU H  2 89  ? 522.446 35.755  416.228 1.00 70.56  ?  112 LEU H CA  1 
ATOM   8101  C C   . LEU H  2 89  ? 522.256 36.268  414.804 1.00 68.86  ?  112 LEU H C   1 
ATOM   8102  O O   . LEU H  2 89  ? 522.928 37.210  414.371 1.00 59.13  ?  112 LEU H O   1 
ATOM   8103  C CB  . LEU H  2 89  ? 521.791 36.698  417.240 1.00 66.33  ?  112 LEU H CB  1 
ATOM   8104  C CG  . LEU H  2 89  ? 521.919 38.220  417.128 1.00 68.33  ?  112 LEU H CG  1 
ATOM   8105  C CD1 . LEU H  2 89  ? 521.022 38.891  418.158 1.00 70.29  ?  112 LEU H CD1 1 
ATOM   8106  C CD2 . LEU H  2 89  ? 523.360 38.682  417.293 1.00 74.31  ?  112 LEU H CD2 1 
ATOM   8107  N N   . THR H  2 90  ? 521.355 35.624  414.068 1.00 98.54  ?  113 THR H N   1 
ATOM   8108  C CA  . THR H  2 90  ? 521.108 35.940  412.668 1.00 96.04  ?  113 THR H CA  1 
ATOM   8109  C C   . THR H  2 90  ? 519.938 36.896  412.472 1.00 101.65 ?  113 THR H C   1 
ATOM   8110  O O   . THR H  2 90  ? 519.589 37.185  411.321 1.00 108.52 ?  113 THR H O   1 
ATOM   8111  C CB  . THR H  2 90  ? 520.862 34.650  411.873 1.00 101.84 ?  113 THR H CB  1 
ATOM   8112  O OG1 . THR H  2 90  ? 521.666 33.597  412.415 1.00 105.82 ?  113 THR H OG1 1 
ATOM   8113  C CG2 . THR H  2 90  ? 521.226 34.831  410.401 1.00 102.66 ?  113 THR H CG2 1 
ATOM   8114  N N   . LYS H  2 91  ? 519.331 37.401  413.553 1.00 81.13  ?  114 LYS H N   1 
ATOM   8115  C CA  . LYS H  2 91  ? 518.165 38.271  413.413 1.00 84.24  ?  114 LYS H CA  1 
ATOM   8116  C C   . LYS H  2 91  ? 517.048 37.521  412.697 1.00 78.51  ?  114 LYS H C   1 
ATOM   8117  O O   . LYS H  2 91  ? 516.888 37.672  411.481 1.00 77.19  ?  114 LYS H O   1 
ATOM   8118  C CB  . LYS H  2 91  ? 518.520 39.573  412.685 1.00 91.28  ?  114 LYS H CB  1 
ATOM   8119  C CG  . LYS H  2 91  ? 519.652 40.376  413.323 1.00 88.30  ?  114 LYS H CG  1 
ATOM   8120  C CD  . LYS H  2 91  ? 519.140 41.484  414.244 1.00 84.77  ?  114 LYS H CD  1 
ATOM   8121  C CE  . LYS H  2 91  ? 518.739 40.958  415.615 1.00 80.56  ?  114 LYS H CE  1 
ATOM   8122  N NZ  . LYS H  2 91  ? 518.351 42.053  416.546 1.00 65.22  ?  114 LYS H NZ  1 
ATOM   8123  N N   . LYS H  2 92  ? 516.269 36.728  413.449 1.00 55.72  ?  115 LYS H N   1 
ATOM   8124  C CA  . LYS H  2 92  ? 515.561 35.532  412.990 1.00 55.07  ?  115 LYS H CA  1 
ATOM   8125  C C   . LYS H  2 92  ? 516.520 34.375  412.734 1.00 52.06  ?  115 LYS H C   1 
ATOM   8126  O O   . LYS H  2 92  ? 516.864 34.066  411.588 1.00 40.70  ?  115 LYS H O   1 
ATOM   8127  C CB  . LYS H  2 92  ? 514.718 35.803  411.736 1.00 60.27  ?  115 LYS H CB  1 
ATOM   8128  C CG  . LYS H  2 92  ? 513.289 36.251  412.019 1.00 53.08  ?  115 LYS H CG  1 
ATOM   8129  C CD  . LYS H  2 92  ? 513.224 37.719  412.413 1.00 53.08  ?  115 LYS H CD  1 
ATOM   8130  C CE  . LYS H  2 92  ? 513.520 38.627  411.229 1.00 50.91  ?  115 LYS H CE  1 
ATOM   8131  N NZ  . LYS H  2 92  ? 513.409 40.068  411.589 1.00 45.44  ?  115 LYS H NZ  1 
ATOM   8132  N N   . GLY H  2 93  ? 516.954 33.747  413.820 1.00 59.84  ?  116 GLY H N   1 
ATOM   8133  C CA  . GLY H  2 93  ? 517.811 32.580  413.806 1.00 57.84  ?  116 GLY H CA  1 
ATOM   8134  C C   . GLY H  2 93  ? 519.183 32.863  414.394 1.00 58.28  ?  116 GLY H C   1 
ATOM   8135  O O   . GLY H  2 93  ? 519.570 34.003  414.653 1.00 59.30  ?  116 GLY H O   1 
ATOM   8136  N N   . CYS H  2 94  ? 519.901 31.769  414.649 1.00 47.73  ?  117 CYS H N   1 
ATOM   8137  C CA  . CYS H  2 94  ? 521.277 31.802  415.133 1.00 48.73  ?  117 CYS H CA  1 
ATOM   8138  C C   . CYS H  2 94  ? 522.166 31.070  414.138 1.00 54.86  ?  117 CYS H C   1 
ATOM   8139  O O   . CYS H  2 94  ? 522.024 29.857  413.951 1.00 49.91  ?  117 CYS H O   1 
ATOM   8140  C CB  . CYS H  2 94  ? 521.410 31.168  416.521 1.00 51.15  ?  117 CYS H CB  1 
ATOM   8141  S SG  . CYS H  2 94  ? 521.381 32.311  417.939 1.00 49.44  ?  117 CYS H SG  1 
ATOM   8142  N N   . LYS H  2 95  ? 523.079 31.804  413.509 1.00 84.51  ?  118 LYS H N   1 
ATOM   8143  C CA  . LYS H  2 95  ? 524.176 31.169  412.803 1.00 83.14  ?  118 LYS H CA  1 
ATOM   8144  C C   . LYS H  2 95  ? 525.079 30.463  413.806 1.00 77.82  ?  118 LYS H C   1 
ATOM   8145  O O   . LYS H  2 95  ? 525.053 30.745  415.006 1.00 79.05  ?  118 LYS H O   1 
ATOM   8146  C CB  . LYS H  2 95  ? 525.007 32.197  412.031 1.00 85.59  ?  118 LYS H CB  1 
ATOM   8147  C CG  . LYS H  2 95  ? 524.318 32.861  410.856 1.00 89.53  ?  118 LYS H CG  1 
ATOM   8148  C CD  . LYS H  2 95  ? 524.735 34.324  410.747 1.00 94.82  ?  118 LYS H CD  1 
ATOM   8149  C CE  . LYS H  2 95  ? 526.243 34.501  410.906 1.00 82.97  ?  118 LYS H CE  1 
ATOM   8150  N NZ  . LYS H  2 95  ? 527.005 33.846  409.807 1.00 78.17  ?  118 LYS H NZ  1 
ATOM   8151  N N   . ASP H  2 96  ? 525.892 29.538  413.309 1.00 59.41  ?  119 ASP H N   1 
ATOM   8152  C CA  . ASP H  2 96  ? 527.007 29.043  414.107 1.00 63.07  ?  119 ASP H CA  1 
ATOM   8153  C C   . ASP H  2 96  ? 528.231 29.774  413.573 1.00 69.29  ?  119 ASP H C   1 
ATOM   8154  O O   . ASP H  2 96  ? 528.863 29.330  412.612 1.00 72.77  ?  119 ASP H O   1 
ATOM   8155  C CB  . ASP H  2 96  ? 527.130 27.528  413.974 1.00 59.95  ?  119 ASP H CB  1 
ATOM   8156  C CG  . ASP H  2 96  ? 527.680 26.869  415.224 1.00 68.65  ?  119 ASP H CG  1 
ATOM   8157  O OD1 . ASP H  2 96  ? 526.892 26.631  416.165 1.00 63.89  ?  119 ASP H OD1 1 
ATOM   8158  O OD2 . ASP H  2 96  ? 528.894 26.584  415.268 1.00 69.50  -1 119 ASP H OD2 1 
ATOM   8159  N N   . CYS H  2 97  ? 528.575 30.887  414.230 1.00 97.08  ?  120 CYS H N   1 
ATOM   8160  C CA  . CYS H  2 97  ? 529.702 31.742  413.861 1.00 92.24  ?  120 CYS H CA  1 
ATOM   8161  C C   . CYS H  2 97  ? 529.862 31.886  412.354 1.00 94.01  ?  120 CYS H C   1 
ATOM   8162  O O   . CYS H  2 97  ? 528.945 32.325  411.650 1.00 98.94  ?  120 CYS H O   1 
ATOM   8163  C CB  . CYS H  2 97  ? 531.006 31.262  414.494 1.00 89.25  ?  120 CYS H CB  1 
ATOM   8164  S SG  . CYS H  2 97  ? 531.361 32.168  416.016 1.00 96.79  ?  120 CYS H SG  1 
ATOM   8165  N N   . CYS H  2 98  ? 531.035 31.496  411.870 1.00 97.66  ?  121 CYS H N   1 
ATOM   8166  C CA  . CYS H  2 98  ? 531.442 31.531  410.473 1.00 105.02 ?  121 CYS H CA  1 
ATOM   8167  C C   . CYS H  2 98  ? 532.823 30.892  410.433 1.00 106.62 ?  121 CYS H C   1 
ATOM   8168  O O   . CYS H  2 98  ? 533.402 30.565  411.475 1.00 102.58 ?  121 CYS H O   1 
ATOM   8169  C CB  . CYS H  2 98  ? 531.471 32.950  409.901 1.00 100.95 ?  121 CYS H CB  1 
ATOM   8170  S SG  . CYS H  2 98  ? 531.808 33.037  408.128 1.00 129.02 ?  121 CYS H SG  1 
ATOM   8171  N N   . PHE H  2 99  ? 533.349 30.713  409.227 1.00 96.22  ?  122 PHE H N   1 
ATOM   8172  C CA  . PHE H  2 99  ? 534.651 30.082  409.049 1.00 95.26  ?  122 PHE H CA  1 
ATOM   8173  C C   . PHE H  2 99  ? 535.717 31.169  409.107 1.00 88.10  ?  122 PHE H C   1 
ATOM   8174  O O   . PHE H  2 99  ? 535.779 32.036  408.231 1.00 90.70  ?  122 PHE H O   1 
ATOM   8175  C CB  . PHE H  2 99  ? 534.703 29.308  407.735 1.00 97.33  ?  122 PHE H CB  1 
ATOM   8176  C CG  . PHE H  2 99  ? 533.690 28.201  407.645 1.00 106.88 ?  122 PHE H CG  1 
ATOM   8177  C CD1 . PHE H  2 99  ? 533.940 26.965  408.220 1.00 99.67  ?  122 PHE H CD1 1 
ATOM   8178  C CD2 . PHE H  2 99  ? 532.482 28.398  406.993 1.00 105.32 ?  122 PHE H CD2 1 
ATOM   8179  C CE1 . PHE H  2 99  ? 533.010 25.945  408.141 1.00 95.24  ?  122 PHE H CE1 1 
ATOM   8180  C CE2 . PHE H  2 99  ? 531.547 27.381  406.911 1.00 99.86  ?  122 PHE H CE2 1 
ATOM   8181  C CZ  . PHE H  2 99  ? 531.812 26.153  407.486 1.00 96.34  ?  122 PHE H CZ  1 
ATOM   8182  N N   . GLY H  2 100 ? 536.552 31.122  410.143 1.00 51.21  ?  123 GLY H N   1 
ATOM   8183  C CA  . GLY H  2 100 ? 537.554 32.138  410.393 1.00 50.88  ?  123 GLY H CA  1 
ATOM   8184  C C   . GLY H  2 100 ? 537.231 33.074  411.537 1.00 46.95  ?  123 GLY H C   1 
ATOM   8185  O O   . GLY H  2 100 ? 538.090 33.883  411.911 1.00 43.18  ?  123 GLY H O   1 
ATOM   8186  N N   . THR H  2 101 ? 536.030 32.995  412.108 1.00 63.54  ?  124 THR H N   1 
ATOM   8187  C CA  . THR H  2 101 ? 535.603 33.873  413.187 1.00 61.29  ?  124 THR H CA  1 
ATOM   8188  C C   . THR H  2 101 ? 535.272 33.053  414.428 1.00 60.46  ?  124 THR H C   1 
ATOM   8189  O O   . THR H  2 101 ? 535.002 31.851  414.351 1.00 61.99  ?  124 THR H O   1 
ATOM   8190  C CB  . THR H  2 101 ? 534.384 34.711  412.779 1.00 62.74  ?  124 THR H CB  1 
ATOM   8191  O OG1 . THR H  2 101 ? 533.271 33.846  412.524 1.00 69.13  ?  124 THR H OG1 1 
ATOM   8192  C CG2 . THR H  2 101 ? 534.685 35.521  411.525 1.00 60.21  ?  124 THR H CG2 1 
ATOM   8193  N N   . PHE H  2 102 ? 535.292 33.719  415.583 1.00 55.05  ?  125 PHE H N   1 
ATOM   8194  C CA  . PHE H  2 102 ? 535.028 33.061  416.854 1.00 52.56  ?  125 PHE H CA  1 
ATOM   8195  C C   . PHE H  2 102 ? 534.216 33.976  417.759 1.00 56.67  ?  125 PHE H C   1 
ATOM   8196  O O   . PHE H  2 102 ? 534.371 35.200  417.735 1.00 65.00  ?  125 PHE H O   1 
ATOM   8197  C CB  . PHE H  2 102 ? 536.330 32.652  417.560 1.00 53.78  ?  125 PHE H CB  1 
ATOM   8198  C CG  . PHE H  2 102 ? 536.805 33.641  418.592 1.00 51.17  ?  125 PHE H CG  1 
ATOM   8199  C CD1 . PHE H  2 102 ? 537.479 34.790  418.212 1.00 50.75  ?  125 PHE H CD1 1 
ATOM   8200  C CD2 . PHE H  2 102 ? 536.588 33.413  419.943 1.00 56.15  ?  125 PHE H CD2 1 
ATOM   8201  C CE1 . PHE H  2 102 ? 537.919 35.698  419.158 1.00 58.79  ?  125 PHE H CE1 1 
ATOM   8202  C CE2 . PHE H  2 102 ? 537.025 34.318  420.893 1.00 57.54  ?  125 PHE H CE2 1 
ATOM   8203  C CZ  . PHE H  2 102 ? 537.691 35.462  420.500 1.00 59.60  ?  125 PHE H CZ  1 
ATOM   8204  N N   . ASN H  2 103 ? 533.349 33.365  418.564 1.00 60.64  ?  126 ASN H N   1 
ATOM   8205  C CA  . ASN H  2 103 ? 532.579 34.066  419.581 1.00 62.52  ?  126 ASN H CA  1 
ATOM   8206  C C   . ASN H  2 103 ? 532.734 33.334  420.906 1.00 61.72  ?  126 ASN H C   1 
ATOM   8207  O O   . ASN H  2 103 ? 533.042 32.140  420.947 1.00 65.49  ?  126 ASN H O   1 
ATOM   8208  C CB  . ASN H  2 103 ? 531.093 34.169  419.202 1.00 65.78  ?  126 ASN H CB  1 
ATOM   8209  C CG  . ASN H  2 103 ? 530.282 34.951  420.218 1.00 64.40  ?  126 ASN H CG  1 
ATOM   8210  O OD1 . ASN H  2 103 ? 530.819 35.776  420.957 1.00 60.72  ?  126 ASN H OD1 1 
ATOM   8211  N ND2 . ASN H  2 103 ? 528.980 34.692  420.263 1.00 67.73  ?  126 ASN H ND2 1 
ATOM   8212  N N   . ASP H  2 104 ? 532.520 34.062  421.999 1.00 88.17  ?  127 ASP H N   1 
ATOM   8213  C CA  . ASP H  2 104 ? 532.666 33.506  423.334 1.00 87.37  ?  127 ASP H CA  1 
ATOM   8214  C C   . ASP H  2 104 ? 531.423 33.798  424.163 1.00 91.82  ?  127 ASP H C   1 
ATOM   8215  O O   . ASP H  2 104 ? 530.818 34.868  424.044 1.00 84.46  ?  127 ASP H O   1 
ATOM   8216  C CB  . ASP H  2 104 ? 533.911 34.061  424.027 1.00 90.12  ?  127 ASP H CB  1 
ATOM   8217  C CG  . ASP H  2 104 ? 534.469 33.107  425.061 1.00 104.63 ?  127 ASP H CG  1 
ATOM   8218  O OD1 . ASP H  2 104 ? 534.960 32.029  424.666 1.00 102.10 ?  127 ASP H OD1 1 
ATOM   8219  O OD2 . ASP H  2 104 ? 534.420 33.437  426.264 1.00 111.24 -1 127 ASP H OD2 1 
ATOM   8220  N N   . GLN H  2 105 ? 531.056 32.829  425.003 1.00 70.07  ?  128 GLN H N   1 
ATOM   8221  C CA  . GLN H  2 105 ? 529.879 32.882  425.866 1.00 63.28  ?  128 GLN H CA  1 
ATOM   8222  C C   . GLN H  2 105 ? 528.596 33.198  425.107 1.00 66.83  ?  128 GLN H C   1 
ATOM   8223  O O   . GLN H  2 105 ? 528.395 32.714  423.990 1.00 72.86  ?  128 GLN H O   1 
ATOM   8224  C CB  . GLN H  2 105 ? 530.084 33.891  426.998 1.00 61.25  ?  128 GLN H CB  1 
ATOM   8225  C CG  . GLN H  2 105 ? 530.577 33.260  428.295 1.00 62.62  ?  128 GLN H CG  1 
ATOM   8226  C CD  . GLN H  2 105 ? 529.625 32.202  428.834 1.00 60.43  ?  128 GLN H CD  1 
ATOM   8227  O OE1 . GLN H  2 105 ? 529.674 31.037  428.432 1.00 58.04  ?  128 GLN H OE1 1 
ATOM   8228  N NE2 . GLN H  2 105 ? 528.754 32.605  429.751 1.00 62.16  ?  128 GLN H NE2 1 
ATOM   8229  N N   . LYS H  2 106 ? 527.735 34.030  425.692 1.00 53.54  ?  129 LYS H N   1 
ATOM   8230  C CA  . LYS H  2 106 ? 526.327 34.093  425.277 1.00 50.67  ?  129 LYS H CA  1 
ATOM   8231  C C   . LYS H  2 106 ? 526.073 35.127  424.183 1.00 53.63  ?  129 LYS H C   1 
ATOM   8232  O O   . LYS H  2 106 ? 525.826 34.772  423.026 1.00 58.64  ?  129 LYS H O   1 
ATOM   8233  C CB  . LYS H  2 106 ? 525.446 34.369  426.498 1.00 41.07  ?  129 LYS H CB  1 
ATOM   8234  C CG  . LYS H  2 106 ? 525.533 33.303  427.580 1.00 42.19  ?  129 LYS H CG  1 
ATOM   8235  C CD  . LYS H  2 106 ? 524.748 33.707  428.819 1.00 48.09  ?  129 LYS H CD  1 
ATOM   8236  C CE  . LYS H  2 106 ? 523.279 33.930  428.498 1.00 57.17  ?  129 LYS H CE  1 
ATOM   8237  N NZ  . LYS H  2 106 ? 522.514 34.398  429.689 1.00 49.44  ?  129 LYS H NZ  1 
ATOM   8238  N N   . ARG H  2 107 ? 526.125 36.407  424.538 1.00 54.62  ?  130 ARG H N   1 
ATOM   8239  C CA  . ARG H  2 107 ? 525.585 37.468  423.699 1.00 61.47  ?  130 ARG H CA  1 
ATOM   8240  C C   . ARG H  2 107 ? 526.611 38.106  422.772 1.00 62.71  ?  130 ARG H C   1 
ATOM   8241  O O   . ARG H  2 107 ? 526.281 39.079  422.086 1.00 68.79  ?  130 ARG H O   1 
ATOM   8242  C CB  . ARG H  2 107 ? 524.936 38.541  424.582 1.00 63.38  ?  130 ARG H CB  1 
ATOM   8243  C CG  . ARG H  2 107 ? 523.879 37.975  425.519 1.00 62.27  ?  130 ARG H CG  1 
ATOM   8244  C CD  . ARG H  2 107 ? 523.020 39.057  426.147 1.00 66.00  ?  130 ARG H CD  1 
ATOM   8245  N NE  . ARG H  2 107 ? 521.766 38.512  426.660 1.00 71.99  ?  130 ARG H NE  1 
ATOM   8246  C CZ  . ARG H  2 107 ? 521.640 37.893  427.830 1.00 76.76  ?  130 ARG H CZ  1 
ATOM   8247  N NH1 . ARG H  2 107 ? 520.457 37.430  428.211 1.00 77.41  ?  130 ARG H NH1 1 
ATOM   8248  N NH2 . ARG H  2 107 ? 522.695 37.732  428.617 1.00 62.72  ?  130 ARG H NH2 1 
ATOM   8249  N N   . GLY H  2 108 ? 527.836 37.595  422.729 1.00 43.02  ?  131 GLY H N   1 
ATOM   8250  C CA  . GLY H  2 108 ? 528.859 38.162  421.878 1.00 46.32  ?  131 GLY H CA  1 
ATOM   8251  C C   . GLY H  2 108 ? 528.585 37.946  420.398 1.00 44.64  ?  131 GLY H C   1 
ATOM   8252  O O   . GLY H  2 108 ? 527.631 37.285  419.985 1.00 44.54  ?  131 GLY H O   1 
ATOM   8253  N N   . ILE H  2 109 ? 529.458 38.536  419.584 1.00 64.99  ?  132 ILE H N   1 
ATOM   8254  C CA  . ILE H  2 109 ? 529.404 38.432  418.130 1.00 72.12  ?  132 ILE H CA  1 
ATOM   8255  C C   . ILE H  2 109 ? 530.706 37.799  417.656 1.00 75.52  ?  132 ILE H C   1 
ATOM   8256  O O   . ILE H  2 109 ? 531.772 38.064  418.222 1.00 76.47  ?  132 ILE H O   1 
ATOM   8257  C CB  . ILE H  2 109 ? 529.187 39.814  417.477 1.00 73.34  ?  132 ILE H CB  1 
ATOM   8258  C CG1 . ILE H  2 109 ? 527.868 40.426  417.955 1.00 73.41  ?  132 ILE H CG1 1 
ATOM   8259  C CG2 . ILE H  2 109 ? 529.206 39.715  415.960 1.00 69.11  ?  132 ILE H CG2 1 
ATOM   8260  C CD1 . ILE H  2 109 ? 527.571 41.784  417.358 1.00 65.78  ?  132 ILE H CD1 1 
ATOM   8261  N N   . CYS H  2 110 ? 530.622 36.963  416.619 1.00 79.93  ?  133 CYS H N   1 
ATOM   8262  C CA  . CYS H  2 110 ? 531.799 36.233  416.164 1.00 79.40  ?  133 CYS H CA  1 
ATOM   8263  C C   . CYS H  2 110 ? 532.798 37.203  415.540 1.00 84.65  ?  133 CYS H C   1 
ATOM   8264  O O   . CYS H  2 110 ? 532.479 37.902  414.572 1.00 87.11  ?  133 CYS H O   1 
ATOM   8265  C CB  . CYS H  2 110 ? 531.406 35.142  415.166 1.00 82.73  ?  133 CYS H CB  1 
ATOM   8266  S SG  . CYS H  2 110 ? 530.272 33.881  415.830 1.00 101.81 ?  133 CYS H SG  1 
ATOM   8267  N N   . ARG H  2 111 ? 534.005 37.242  416.105 1.00 90.91  ?  134 ARG H N   1 
ATOM   8268  C CA  . ARG H  2 111 ? 535.101 38.112  415.706 1.00 85.18  ?  134 ARG H CA  1 
ATOM   8269  C C   . ARG H  2 111 ? 536.193 37.304  415.025 1.00 86.30  ?  134 ARG H C   1 
ATOM   8270  O O   . ARG H  2 111 ? 536.602 36.264  415.558 1.00 91.05  ?  134 ARG H O   1 
ATOM   8271  C CB  . ARG H  2 111 ? 535.674 38.852  416.922 1.00 89.40  ?  134 ARG H CB  1 
ATOM   8272  C CG  . ARG H  2 111 ? 535.459 38.139  418.247 1.00 82.71  ?  134 ARG H CG  1 
ATOM   8273  C CD  . ARG H  2 111 ? 536.159 38.859  419.386 1.00 79.29  ?  134 ARG H CD  1 
ATOM   8274  N NE  . ARG H  2 111 ? 537.597 38.971  419.156 1.00 91.28  ?  134 ARG H NE  1 
ATOM   8275  C CZ  . ARG H  2 111 ? 538.467 39.404  420.061 1.00 99.26  ?  134 ARG H CZ  1 
ATOM   8276  N NH1 . ARG H  2 111 ? 538.049 39.765  421.267 1.00 96.47  ?  134 ARG H NH1 1 
ATOM   8277  N NH2 . ARG H  2 111 ? 539.757 39.474  419.762 1.00 93.03  ?  134 ARG H NH2 1 
ATOM   8278  N N   . PRO H  2 112 ? 536.661 37.723  413.848 1.00 66.19  ?  135 PRO H N   1 
ATOM   8279  C CA  . PRO H  2 112 ? 537.699 36.958  413.141 1.00 64.70  ?  135 PRO H CA  1 
ATOM   8280  C C   . PRO H  2 112 ? 538.923 36.698  414.013 1.00 68.94  ?  135 PRO H C   1 
ATOM   8281  O O   . PRO H  2 112 ? 539.241 37.465  414.923 1.00 69.08  ?  135 PRO H O   1 
ATOM   8282  C CB  . PRO H  2 112 ? 538.045 37.854  411.947 1.00 56.41  ?  135 PRO H CB  1 
ATOM   8283  C CG  . PRO H  2 112 ? 536.813 38.667  411.722 1.00 63.32  ?  135 PRO H CG  1 
ATOM   8284  C CD  . PRO H  2 112 ? 536.233 38.909  413.087 1.00 66.98  ?  135 PRO H CD  1 
ATOM   8285  N N   . TRP H  2 113 ? 539.607 35.595  413.715 1.00 66.79  ?  136 TRP H N   1 
ATOM   8286  C CA  . TRP H  2 113 ? 540.725 35.127  414.522 1.00 59.50  ?  136 TRP H CA  1 
ATOM   8287  C C   . TRP H  2 113 ? 541.896 36.105  414.475 1.00 66.83  ?  136 TRP H C   1 
ATOM   8288  O O   . TRP H  2 113 ? 542.042 36.907  413.548 1.00 74.62  ?  136 TRP H O   1 
ATOM   8289  C CB  . TRP H  2 113 ? 541.200 33.757  414.038 1.00 63.64  ?  136 TRP H CB  1 
ATOM   8290  C CG  . TRP H  2 113 ? 540.207 32.654  414.224 1.00 61.10  ?  136 TRP H CG  1 
ATOM   8291  C CD1 . TRP H  2 113 ? 539.223 32.584  415.165 1.00 57.83  ?  136 TRP H CD1 1 
ATOM   8292  C CD2 . TRP H  2 113 ? 540.101 31.457  413.442 1.00 53.89  ?  136 TRP H CD2 1 
ATOM   8293  N NE1 . TRP H  2 113 ? 538.513 31.416  415.020 1.00 56.86  ?  136 TRP H NE1 1 
ATOM   8294  C CE2 . TRP H  2 113 ? 539.031 30.709  413.968 1.00 52.68  ?  136 TRP H CE2 1 
ATOM   8295  C CE3 . TRP H  2 113 ? 540.809 30.948  412.348 1.00 53.99  ?  136 TRP H CE3 1 
ATOM   8296  C CZ2 . TRP H  2 113 ? 538.650 29.478  413.438 1.00 54.08  ?  136 TRP H CZ2 1 
ATOM   8297  C CZ3 . TRP H  2 113 ? 540.429 29.726  411.825 1.00 56.76  ?  136 TRP H CZ3 1 
ATOM   8298  C CH2 . TRP H  2 113 ? 539.361 29.004  412.370 1.00 56.93  ?  136 TRP H CH2 1 
ATOM   8299  N N   . THR H  2 114 ? 542.738 36.023  415.501 1.00 83.90  ?  137 THR H N   1 
ATOM   8300  C CA  . THR H  2 114 ? 543.973 36.795  415.527 1.00 84.42  ?  137 THR H CA  1 
ATOM   8301  C C   . THR H  2 114 ? 544.978 36.200  414.548 1.00 91.80  ?  137 THR H C   1 
ATOM   8302  O O   . THR H  2 114 ? 545.293 35.008  414.614 1.00 98.86  ?  137 THR H O   1 
ATOM   8303  C CB  . THR H  2 114 ? 544.561 36.812  416.939 1.00 74.77  ?  137 THR H CB  1 
ATOM   8304  O OG1 . THR H  2 114 ? 543.638 37.436  417.839 1.00 77.45  ?  137 THR H OG1 1 
ATOM   8305  C CG2 . THR H  2 114 ? 545.879 37.572  416.960 1.00 86.43  ?  137 THR H CG2 1 
ATOM   8306  N N   . ASN H  2 115 ? 545.479 37.031  413.638 1.00 87.37  ?  138 ASN H N   1 
ATOM   8307  C CA  . ASN H  2 115 ? 546.470 36.587  412.666 1.00 95.94  ?  138 ASN H CA  1 
ATOM   8308  C C   . ASN H  2 115 ? 547.855 36.644  413.302 1.00 104.99 ?  138 ASN H C   1 
ATOM   8309  O O   . ASN H  2 115 ? 548.305 37.715  413.724 1.00 110.64 ?  138 ASN H O   1 
ATOM   8310  C CB  . ASN H  2 115 ? 546.409 37.457  411.412 1.00 89.27  ?  138 ASN H CB  1 
ATOM   8311  C CG  . ASN H  2 115 ? 547.045 36.792  410.205 1.00 94.99  ?  138 ASN H CG  1 
ATOM   8312  O OD1 . ASN H  2 115 ? 548.099 36.164  410.309 1.00 95.10  ?  138 ASN H OD1 1 
ATOM   8313  N ND2 . ASN H  2 115 ? 546.403 36.928  409.051 1.00 91.32  ?  138 ASN H ND2 1 
ATOM   8314  N N   . CYS H  2 116 ? 548.532 35.495  413.371 1.00 134.19 ?  139 CYS H N   1 
ATOM   8315  C CA  . CYS H  2 116 ? 549.836 35.437  414.020 1.00 140.43 ?  139 CYS H CA  1 
ATOM   8316  C C   . CYS H  2 116 ? 550.939 36.093  413.198 1.00 145.10 ?  139 CYS H C   1 
ATOM   8317  O O   . CYS H  2 116 ? 552.054 36.250  413.709 1.00 147.74 ?  139 CYS H O   1 
ATOM   8318  C CB  . CYS H  2 116 ? 550.220 33.985  414.326 1.00 142.88 ?  139 CYS H CB  1 
ATOM   8319  S SG  . CYS H  2 116 ? 549.151 33.124  415.515 1.00 141.21 ?  139 CYS H SG  1 
ATOM   8320  N N   . SER H  2 117 ? 550.665 36.472  411.947 1.00 112.86 ?  140 SER H N   1 
ATOM   8321  C CA  . SER H  2 117 ? 551.658 37.210  411.174 1.00 109.25 ?  140 SER H CA  1 
ATOM   8322  C C   . SER H  2 117 ? 551.862 38.614  411.727 1.00 109.78 ?  140 SER H C   1 
ATOM   8323  O O   . SER H  2 117 ? 552.940 39.196  411.556 1.00 112.35 ?  140 SER H O   1 
ATOM   8324  C CB  . SER H  2 117 ? 551.248 37.268  409.702 1.00 106.23 ?  140 SER H CB  1 
ATOM   8325  O OG  . SER H  2 117 ? 551.294 35.982  409.110 1.00 98.80  ?  140 SER H OG  1 
ATOM   8326  N N   . LEU H  2 118 ? 550.844 39.172  412.387 1.00 100.33 ?  141 LEU H N   1 
ATOM   8327  C CA  . LEU H  2 118 ? 551.014 40.454  413.062 1.00 102.62 ?  141 LEU H CA  1 
ATOM   8328  C C   . LEU H  2 118 ? 551.969 40.340  414.243 1.00 102.07 ?  141 LEU H C   1 
ATOM   8329  O O   . LEU H  2 118 ? 552.642 41.316  414.593 1.00 98.20  ?  141 LEU H O   1 
ATOM   8330  C CB  . LEU H  2 118 ? 549.658 40.986  413.530 1.00 100.41 ?  141 LEU H CB  1 
ATOM   8331  C CG  . LEU H  2 118 ? 548.627 41.326  412.452 1.00 104.14 ?  141 LEU H CG  1 
ATOM   8332  C CD1 . LEU H  2 118 ? 547.259 41.559  413.076 1.00 96.51  ?  141 LEU H CD1 1 
ATOM   8333  C CD2 . LEU H  2 118 ? 549.066 42.543  411.649 1.00 101.63 ?  141 LEU H CD2 1 
ATOM   8334  N N   . ASP H  2 119 ? 552.042 39.165  414.861 1.00 113.69 ?  142 ASP H N   1 
ATOM   8335  C CA  . ASP H  2 119 ? 552.937 38.932  415.988 1.00 119.49 ?  142 ASP H CA  1 
ATOM   8336  C C   . ASP H  2 119 ? 554.387 38.844  415.525 1.00 122.69 ?  142 ASP H C   1 
ATOM   8337  O O   . ASP H  2 119 ? 554.751 37.955  414.754 1.00 121.16 ?  142 ASP H O   1 
ATOM   8338  C CB  . ASP H  2 119 ? 552.537 37.652  416.728 1.00 120.29 ?  142 ASP H CB  1 
ATOM   8339  C CG  . ASP H  2 119 ? 553.467 37.328  417.882 1.00 122.12 ?  142 ASP H CG  1 
ATOM   8340  O OD1 . ASP H  2 119 ? 553.958 38.272  418.536 1.00 127.59 ?  142 ASP H OD1 1 
ATOM   8341  O OD2 . ASP H  2 119 ? 553.704 36.128  418.134 1.00 112.98 -1 142 ASP H OD2 1 
ATOM   8342  N N   . SER H  2 122 ? 554.141 31.912  415.186 1.00 90.48  ?  145 SER H N   1 
ATOM   8343  C CA  . SER H  2 122 ? 553.384 30.875  414.495 1.00 94.87  ?  145 SER H CA  1 
ATOM   8344  C C   . SER H  2 122 ? 552.207 30.400  415.344 1.00 98.12  ?  145 SER H C   1 
ATOM   8345  O O   . SER H  2 122 ? 551.935 30.956  416.407 1.00 103.16 ?  145 SER H O   1 
ATOM   8346  C CB  . SER H  2 122 ? 554.291 29.697  414.137 1.00 103.31 ?  145 SER H CB  1 
ATOM   8347  O OG  . SER H  2 122 ? 554.974 29.212  415.279 1.00 99.80  ?  145 SER H OG  1 
ATOM   8348  N N   . VAL H  2 123 ? 551.519 29.366  414.872 1.00 88.23  ?  146 VAL H N   1 
ATOM   8349  C CA  . VAL H  2 123 ? 550.299 28.874  415.501 1.00 86.31  ?  146 VAL H CA  1 
ATOM   8350  C C   . VAL H  2 123 ? 550.662 27.724  416.433 1.00 83.03  ?  146 VAL H C   1 
ATOM   8351  O O   . VAL H  2 123 ? 551.098 26.657  415.986 1.00 86.64  ?  146 VAL H O   1 
ATOM   8352  C CB  . VAL H  2 123 ? 549.260 28.445  414.455 1.00 80.63  ?  146 VAL H CB  1 
ATOM   8353  C CG1 . VAL H  2 123 ? 548.546 29.661  413.894 1.00 71.41  ?  146 VAL H CG1 1 
ATOM   8354  C CG2 . VAL H  2 123 ? 549.926 27.667  413.326 1.00 79.63  ?  146 VAL H CG2 1 
ATOM   8355  N N   . LEU H  2 124 ? 550.492 27.941  417.738 1.00 116.71 ?  147 LEU H N   1 
ATOM   8356  C CA  . LEU H  2 124 ? 550.606 26.837  418.685 1.00 118.12 ?  147 LEU H CA  1 
ATOM   8357  C C   . LEU H  2 124 ? 549.325 26.012  418.726 1.00 122.31 ?  147 LEU H C   1 
ATOM   8358  O O   . LEU H  2 124 ? 549.379 24.779  418.785 1.00 128.07 ?  147 LEU H O   1 
ATOM   8359  C CB  . LEU H  2 124 ? 550.945 27.363  420.081 1.00 116.51 ?  147 LEU H CB  1 
ATOM   8360  C CG  . LEU H  2 124 ? 552.297 28.060  420.247 1.00 129.34 ?  147 LEU H CG  1 
ATOM   8361  C CD1 . LEU H  2 124 ? 552.570 28.343  421.717 1.00 129.45 ?  147 LEU H CD1 1 
ATOM   8362  C CD2 . LEU H  2 124 ? 553.412 27.221  419.642 1.00 131.56 ?  147 LEU H CD2 1 
ATOM   8363  N N   . VAL H  2 125 ? 548.170 26.676  418.700 1.00 88.52  ?  148 VAL H N   1 
ATOM   8364  C CA  . VAL H  2 125 ? 546.869 26.016  418.717 1.00 76.98  ?  148 VAL H CA  1 
ATOM   8365  C C   . VAL H  2 125 ? 546.011 26.616  417.611 1.00 78.18  ?  148 VAL H C   1 
ATOM   8366  O O   . VAL H  2 125 ? 545.911 27.842  417.492 1.00 79.36  ?  148 VAL H O   1 
ATOM   8367  C CB  . VAL H  2 125 ? 546.164 26.162  420.078 1.00 70.17  ?  148 VAL H CB  1 
ATOM   8368  C CG1 . VAL H  2 125 ? 544.914 25.296  420.123 1.00 71.59  ?  148 VAL H CG1 1 
ATOM   8369  C CG2 . VAL H  2 125 ? 547.107 25.808  421.212 1.00 67.12  ?  148 VAL H CG2 1 
ATOM   8370  N N   . ASN H  2 126 ? 545.391 25.752  416.811 1.00 67.56  ?  149 ASN H N   1 
ATOM   8371  C CA  . ASN H  2 126 ? 544.514 26.189  415.738 1.00 61.95  ?  149 ASN H CA  1 
ATOM   8372  C C   . ASN H  2 126 ? 543.194 26.704  416.311 1.00 66.23  ?  149 ASN H C   1 
ATOM   8373  O O   . ASN H  2 126 ? 542.807 26.383  417.439 1.00 68.51  ?  149 ASN H O   1 
ATOM   8374  C CB  . ASN H  2 126 ? 544.270 25.035  414.765 1.00 67.88  ?  149 ASN H CB  1 
ATOM   8375  C CG  . ASN H  2 126 ? 543.817 25.493  413.391 1.00 72.65  ?  149 ASN H CG  1 
ATOM   8376  O OD1 . ASN H  2 126 ? 543.664 26.686  413.125 1.00 61.55  ?  149 ASN H OD1 1 
ATOM   8377  N ND2 . ASN H  2 126 ? 543.607 24.523  412.504 1.00 78.28  ?  149 ASN H ND2 1 
ATOM   8378  N N   . GLY H  2 127 ? 542.499 27.525  415.517 1.00 66.87  ?  150 GLY H N   1 
ATOM   8379  C CA  . GLY H  2 127 ? 541.276 28.148  415.975 1.00 66.26  ?  150 GLY H CA  1 
ATOM   8380  C C   . GLY H  2 127 ? 540.017 27.371  415.624 1.00 59.03  ?  150 GLY H C   1 
ATOM   8381  O O   . GLY H  2 127 ? 539.977 26.592  414.675 1.00 61.97  ?  150 GLY H O   1 
ATOM   8382  N N   . THR H  2 128 ? 538.970 27.606  416.418 1.00 55.16  ?  151 THR H N   1 
ATOM   8383  C CA  . THR H  2 128 ? 537.667 26.992  416.194 1.00 56.65  ?  151 THR H CA  1 
ATOM   8384  C C   . THR H  2 128 ? 536.563 28.038  416.295 1.00 59.87  ?  151 THR H C   1 
ATOM   8385  O O   . THR H  2 128 ? 536.843 29.237  416.397 1.00 65.93  ?  151 THR H O   1 
ATOM   8386  C CB  . THR H  2 128 ? 537.405 25.861  417.194 1.00 61.89  ?  151 THR H CB  1 
ATOM   8387  O OG1 . THR H  2 128 ? 537.455 26.376  418.530 1.00 62.33  ?  151 THR H OG1 1 
ATOM   8388  C CG2 . THR H  2 128 ? 538.432 24.746  417.038 1.00 71.67  ?  151 THR H CG2 1 
ATOM   8389  N N   . LYS H  2 129 ? 535.305 27.595  416.258 1.00 55.36  ?  152 LYS H N   1 
ATOM   8390  C CA  . LYS H  2 129 ? 534.188 28.531  416.346 1.00 52.31  ?  152 LYS H CA  1 
ATOM   8391  C C   . LYS H  2 129 ? 534.082 29.145  417.738 1.00 52.39  ?  152 LYS H C   1 
ATOM   8392  O O   . LYS H  2 129 ? 533.731 30.321  417.877 1.00 56.10  ?  152 LYS H O   1 
ATOM   8393  C CB  . LYS H  2 129 ? 532.886 27.824  415.972 1.00 53.81  ?  152 LYS H CB  1 
ATOM   8394  C CG  . LYS H  2 129 ? 532.927 27.115  414.626 1.00 55.91  ?  152 LYS H CG  1 
ATOM   8395  C CD  . LYS H  2 129 ? 531.693 26.251  414.422 1.00 54.82  ?  152 LYS H CD  1 
ATOM   8396  C CE  . LYS H  2 129 ? 531.755 25.484  413.111 1.00 51.39  ?  152 LYS H CE  1 
ATOM   8397  N NZ  . LYS H  2 129 ? 531.742 26.392  411.931 1.00 46.73  ?  152 LYS H NZ  1 
ATOM   8398  N N   . GLU H  2 130 ? 534.373 28.366  418.778 1.00 49.41  ?  153 GLU H N   1 
ATOM   8399  C CA  . GLU H  2 130 ? 534.249 28.819  420.157 1.00 44.72  ?  153 GLU H CA  1 
ATOM   8400  C C   . GLU H  2 130 ? 535.557 29.330  420.746 1.00 47.69  ?  153 GLU H C   1 
ATOM   8401  O O   . GLU H  2 130 ? 535.586 29.699  421.924 1.00 53.27  ?  153 GLU H O   1 
ATOM   8402  C CB  . GLU H  2 130 ? 533.707 27.686  421.035 1.00 48.55  ?  153 GLU H CB  1 
ATOM   8403  C CG  . GLU H  2 130 ? 532.502 26.966  420.454 1.00 55.33  ?  153 GLU H CG  1 
ATOM   8404  C CD  . GLU H  2 130 ? 532.067 25.787  421.303 1.00 65.23  ?  153 GLU H CD  1 
ATOM   8405  O OE1 . GLU H  2 130 ? 530.845 25.561  421.430 1.00 68.33  ?  153 GLU H OE1 1 
ATOM   8406  O OE2 . GLU H  2 130 ? 532.948 25.086  421.844 1.00 63.20  -1 153 GLU H OE2 1 
ATOM   8407  N N   . ARG H  2 131 ? 536.635 29.365  419.965 1.00 34.02  ?  154 ARG H N   1 
ATOM   8408  C CA  . ARG H  2 131 ? 537.964 29.630  420.495 1.00 30.85  ?  154 ARG H CA  1 
ATOM   8409  C C   . ARG H  2 131 ? 538.761 30.446  419.487 1.00 33.15  ?  154 ARG H C   1 
ATOM   8410  O O   . ARG H  2 131 ? 538.470 30.447  418.290 1.00 36.82  ?  154 ARG H O   1 
ATOM   8411  C CB  . ARG H  2 131 ? 538.684 28.314  420.822 1.00 34.64  ?  154 ARG H CB  1 
ATOM   8412  C CG  . ARG H  2 131 ? 539.970 28.437  421.616 1.00 35.94  ?  154 ARG H CG  1 
ATOM   8413  C CD  . ARG H  2 131 ? 540.635 27.078  421.714 1.00 40.85  ?  154 ARG H CD  1 
ATOM   8414  N NE  . ARG H  2 131 ? 540.980 26.552  420.395 1.00 44.65  ?  154 ARG H NE  1 
ATOM   8415  C CZ  . ARG H  2 131 ? 540.988 25.261  420.081 1.00 43.12  ?  154 ARG H CZ  1 
ATOM   8416  N NH1 . ARG H  2 131 ? 540.653 24.352  420.985 1.00 36.65  ?  154 ARG H NH1 1 
ATOM   8417  N NH2 . ARG H  2 131 ? 541.316 24.879  418.854 1.00 47.04  ?  154 ARG H NH2 1 
ATOM   8418  N N   . ASP H  2 132 ? 539.785 31.133  419.984 1.00 64.49  ?  155 ASP H N   1 
ATOM   8419  C CA  . ASP H  2 132 ? 540.642 31.974  419.164 1.00 67.57  ?  155 ASP H CA  1 
ATOM   8420  C C   . ASP H  2 132 ? 542.052 31.400  419.112 1.00 65.14  ?  155 ASP H C   1 
ATOM   8421  O O   . ASP H  2 132 ? 542.494 30.704  420.031 1.00 65.53  ?  155 ASP H O   1 
ATOM   8422  C CB  . ASP H  2 132 ? 540.684 33.409  419.703 1.00 73.00  ?  155 ASP H CB  1 
ATOM   8423  C CG  . ASP H  2 132 ? 541.443 34.353  418.791 1.00 75.86  ?  155 ASP H CG  1 
ATOM   8424  O OD1 . ASP H  2 132 ? 541.462 34.109  417.566 1.00 68.54  ?  155 ASP H OD1 1 
ATOM   8425  O OD2 . ASP H  2 132 ? 542.023 35.336  419.299 1.00 84.61  -1 155 ASP H OD2 1 
ATOM   8426  N N   . VAL H  2 133 ? 542.754 31.701  418.018 1.00 31.80  ?  156 VAL H N   1 
ATOM   8427  C CA  . VAL H  2 133 ? 544.105 31.194  417.820 1.00 34.53  ?  156 VAL H CA  1 
ATOM   8428  C C   . VAL H  2 133 ? 545.056 31.848  418.812 1.00 38.50  ?  156 VAL H C   1 
ATOM   8429  O O   . VAL H  2 133 ? 544.989 33.060  419.063 1.00 43.00  ?  156 VAL H O   1 
ATOM   8430  C CB  . VAL H  2 133 ? 544.561 31.448  416.373 1.00 35.00  ?  156 VAL H CB  1 
ATOM   8431  C CG1 . VAL H  2 133 ? 545.966 30.913  416.152 1.00 48.56  ?  156 VAL H CG1 1 
ATOM   8432  C CG2 . VAL H  2 133 ? 543.585 30.828  415.389 1.00 38.69  ?  156 VAL H CG2 1 
ATOM   8433  N N   . VAL H  2 134 ? 545.950 31.047  419.385 1.00 54.40  ?  157 VAL H N   1 
ATOM   8434  C CA  . VAL H  2 134 ? 547.023 31.541  420.239 1.00 66.21  ?  157 VAL H CA  1 
ATOM   8435  C C   . VAL H  2 134 ? 548.332 31.442  419.467 1.00 76.00  ?  157 VAL H C   1 
ATOM   8436  O O   . VAL H  2 134 ? 548.549 30.491  418.707 1.00 78.52  ?  157 VAL H O   1 
ATOM   8437  C CB  . VAL H  2 134 ? 547.093 30.771  421.575 1.00 62.77  ?  157 VAL H CB  1 
ATOM   8438  C CG1 . VAL H  2 134 ? 547.578 29.346  421.363 1.00 60.92  ?  157 VAL H CG1 1 
ATOM   8439  C CG2 . VAL H  2 134 ? 547.991 31.499  422.564 1.00 74.05  ?  157 VAL H CG2 1 
ATOM   8440  N N   . CYS H  2 135 ? 549.190 32.444  419.636 1.00 76.42  ?  158 CYS H N   1 
ATOM   8441  C CA  . CYS H  2 135 ? 550.491 32.484  418.986 1.00 82.61  ?  158 CYS H CA  1 
ATOM   8442  C C   . CYS H  2 135 ? 551.583 32.437  420.045 1.00 87.74  ?  158 CYS H C   1 
ATOM   8443  O O   . CYS H  2 135 ? 551.428 32.995  421.136 1.00 87.95  ?  158 CYS H O   1 
ATOM   8444  C CB  . CYS H  2 135 ? 550.656 33.745  418.120 1.00 92.73  ?  158 CYS H CB  1 
ATOM   8445  S SG  . CYS H  2 135 ? 549.182 34.272  417.195 1.00 95.03  ?  158 CYS H SG  1 
ATOM   8446  N N   . GLY H  2 136 ? 552.686 31.768  419.720 1.00 107.02 ?  159 GLY H N   1 
ATOM   8447  C CA  . GLY H  2 136 ? 553.800 31.649  420.642 1.00 103.73 ?  159 GLY H CA  1 
ATOM   8448  C C   . GLY H  2 136 ? 555.058 31.107  419.995 1.00 105.93 ?  159 GLY H C   1 
ATOM   8449  O O   . GLY H  2 136 ? 555.096 30.881  418.785 1.00 109.42 ?  159 GLY H O   1 
ATOM   8450  N N   . GLY I  1 33  ? 468.842 29.709  401.138 1.00 75.60  ?  90  GLY I N   1 
ATOM   8451  C CA  . GLY I  1 33  ? 468.637 30.762  400.161 1.00 78.92  ?  90  GLY I CA  1 
ATOM   8452  C C   . GLY I  1 33  ? 469.910 31.156  399.442 1.00 81.59  ?  90  GLY I C   1 
ATOM   8453  O O   . GLY I  1 33  ? 470.108 30.812  398.275 1.00 77.59  ?  90  GLY I O   1 
ATOM   8454  N N   . MET I  1 34  ? 470.777 31.883  400.141 1.00 44.61  ?  91  MET I N   1 
ATOM   8455  C CA  . MET I  1 34  ? 472.047 32.319  399.583 1.00 37.97  ?  91  MET I CA  1 
ATOM   8456  C C   . MET I  1 34  ? 473.150 31.340  399.959 1.00 41.23  ?  91  MET I C   1 
ATOM   8457  O O   . MET I  1 34  ? 473.208 30.858  401.095 1.00 43.97  ?  91  MET I O   1 
ATOM   8458  C CB  . MET I  1 34  ? 472.408 33.721  400.076 1.00 40.25  ?  91  MET I CB  1 
ATOM   8459  C CG  . MET I  1 34  ? 471.555 34.826  399.487 1.00 54.44  ?  91  MET I CG  1 
ATOM   8460  S SD  . MET I  1 34  ? 472.182 36.464  399.904 1.00 78.49  ?  91  MET I SD  1 
ATOM   8461  C CE  . MET I  1 34  ? 471.089 37.502  398.936 1.00 80.93  ?  91  MET I CE  1 
ATOM   8462  N N   . PHE I  1 35  ? 474.035 31.069  399.000 1.00 32.43  ?  92  PHE I N   1 
ATOM   8463  C CA  . PHE I  1 35  ? 475.187 30.196  399.186 1.00 27.08  ?  92  PHE I CA  1 
ATOM   8464  C C   . PHE I  1 35  ? 475.997 30.201  397.898 1.00 29.18  ?  92  PHE I C   1 
ATOM   8465  O O   . PHE I  1 35  ? 475.487 30.541  396.827 1.00 36.94  ?  92  PHE I O   1 
ATOM   8466  C CB  . PHE I  1 35  ? 474.781 28.760  399.546 1.00 27.56  ?  92  PHE I CB  1 
ATOM   8467  C CG  . PHE I  1 35  ? 473.864 28.111  398.549 1.00 29.50  ?  92  PHE I CG  1 
ATOM   8468  C CD1 . PHE I  1 35  ? 472.493 28.280  398.636 1.00 36.90  ?  92  PHE I CD1 1 
ATOM   8469  C CD2 . PHE I  1 35  ? 474.371 27.312  397.538 1.00 33.31  ?  92  PHE I CD2 1 
ATOM   8470  C CE1 . PHE I  1 35  ? 471.646 27.678  397.725 1.00 42.76  ?  92  PHE I CE1 1 
ATOM   8471  C CE2 . PHE I  1 35  ? 473.529 26.708  396.625 1.00 31.40  ?  92  PHE I CE2 1 
ATOM   8472  C CZ  . PHE I  1 35  ? 472.165 26.889  396.719 1.00 33.76  ?  92  PHE I CZ  1 
ATOM   8473  N N   . ALA I  1 36  ? 477.263 29.812  398.017 1.00 28.59  ?  93  ALA I N   1 
ATOM   8474  C CA  . ALA I  1 36  ? 478.162 29.788  396.875 1.00 25.66  ?  93  ALA I CA  1 
ATOM   8475  C C   . ALA I  1 36  ? 479.252 28.752  397.108 1.00 29.04  ?  93  ALA I C   1 
ATOM   8476  O O   . ALA I  1 36  ? 479.679 28.525  398.243 1.00 35.11  ?  93  ALA I O   1 
ATOM   8477  C CB  . ALA I  1 36  ? 478.788 31.164  396.622 1.00 23.52  ?  93  ALA I CB  1 
ATOM   8478  N N   . GLN I  1 37  ? 479.699 28.131  396.018 1.00 17.75  ?  94  GLN I N   1 
ATOM   8479  C CA  . GLN I  1 37  ? 480.845 27.234  396.049 1.00 17.61  ?  94  GLN I CA  1 
ATOM   8480  C C   . GLN I  1 37  ? 481.680 27.475  394.803 1.00 17.94  ?  94  GLN I C   1 
ATOM   8481  O O   . GLN I  1 37  ? 481.145 27.486  393.690 1.00 23.57  ?  94  GLN I O   1 
ATOM   8482  C CB  . GLN I  1 37  ? 480.410 25.765  396.128 1.00 17.34  ?  94  GLN I CB  1 
ATOM   8483  C CG  . GLN I  1 37  ? 481.569 24.782  396.062 1.00 19.26  ?  94  GLN I CG  1 
ATOM   8484  C CD  . GLN I  1 37  ? 481.389 23.595  396.988 1.00 18.08  ?  94  GLN I CD  1 
ATOM   8485  O OE1 . GLN I  1 37  ? 481.189 23.758  398.193 1.00 16.59  ?  94  GLN I OE1 1 
ATOM   8486  N NE2 . GLN I  1 37  ? 481.464 22.392  396.431 1.00 20.17  ?  94  GLN I NE2 1 
ATOM   8487  N N   . LEU I  1 38  ? 482.982 27.676  394.990 1.00 17.97  ?  95  LEU I N   1 
ATOM   8488  C CA  . LEU I  1 38  ? 483.896 27.957  393.894 1.00 18.28  ?  95  LEU I CA  1 
ATOM   8489  C C   . LEU I  1 38  ? 485.045 26.961  393.912 1.00 18.15  ?  95  LEU I C   1 
ATOM   8490  O O   . LEU I  1 38  ? 485.526 26.573  394.981 1.00 17.87  ?  95  LEU I O   1 
ATOM   8491  C CB  . LEU I  1 38  ? 484.444 29.388  393.977 1.00 18.53  ?  95  LEU I CB  1 
ATOM   8492  C CG  . LEU I  1 38  ? 483.411 30.515  394.012 1.00 18.69  ?  95  LEU I CG  1 
ATOM   8493  C CD1 . LEU I  1 38  ? 484.100 31.873  394.001 1.00 21.17  ?  95  LEU I CD1 1 
ATOM   8494  C CD2 . LEU I  1 38  ? 482.437 30.393  392.852 1.00 19.92  ?  95  LEU I CD2 1 
ATOM   8495  N N   . VAL I  1 39  ? 485.484 26.554  392.724 1.00 21.26  ?  96  VAL I N   1 
ATOM   8496  C CA  . VAL I  1 39  ? 486.592 25.619  392.561 1.00 21.50  ?  96  VAL I CA  1 
ATOM   8497  C C   . VAL I  1 39  ? 487.823 26.400  392.124 1.00 25.39  ?  96  VAL I C   1 
ATOM   8498  O O   . VAL I  1 39  ? 487.742 27.250  391.229 1.00 28.97  ?  96  VAL I O   1 
ATOM   8499  C CB  . VAL I  1 39  ? 486.244 24.517  391.545 1.00 22.75  ?  96  VAL I CB  1 
ATOM   8500  C CG1 . VAL I  1 39  ? 487.452 23.634  391.281 1.00 23.39  ?  96  VAL I CG1 1 
ATOM   8501  C CG2 . VAL I  1 39  ? 485.072 23.686  392.046 1.00 18.42  ?  96  VAL I CG2 1 
ATOM   8502  N N   . ALA I  1 40  ? 488.959 26.116  392.755 1.00 29.42  ?  97  ALA I N   1 
ATOM   8503  C CA  . ALA I  1 40  ? 490.185 26.842  392.456 1.00 31.73  ?  97  ALA I CA  1 
ATOM   8504  C C   . ALA I  1 40  ? 490.657 26.537  391.040 1.00 35.18  ?  97  ALA I C   1 
ATOM   8505  O O   . ALA I  1 40  ? 490.802 25.372  390.657 1.00 35.19  ?  97  ALA I O   1 
ATOM   8506  C CB  . ALA I  1 40  ? 491.276 26.487  393.463 1.00 35.63  ?  97  ALA I CB  1 
ATOM   8507  N N   . GLN I  1 41  ? 490.893 27.594  390.265 1.00 45.65  ?  98  GLN I N   1 
ATOM   8508  C CA  . GLN I  1 41  ? 491.381 27.451  388.901 1.00 48.54  ?  98  GLN I CA  1 
ATOM   8509  C C   . GLN I  1 41  ? 492.882 27.199  388.842 1.00 44.63  ?  98  GLN I C   1 
ATOM   8510  O O   . GLN I  1 41  ? 493.362 26.606  387.869 1.00 40.40  ?  98  GLN I O   1 
ATOM   8511  C CB  . GLN I  1 41  ? 491.020 28.706  388.097 1.00 45.56  ?  98  GLN I CB  1 
ATOM   8512  C CG  . GLN I  1 41  ? 491.247 28.612  386.600 1.00 46.28  ?  98  GLN I CG  1 
ATOM   8513  C CD  . GLN I  1 41  ? 490.482 29.679  385.841 1.00 47.71  ?  98  GLN I CD  1 
ATOM   8514  O OE1 . GLN I  1 41  ? 489.379 30.065  386.232 1.00 38.98  ?  98  GLN I OE1 1 
ATOM   8515  N NE2 . GLN I  1 41  ? 491.064 30.161  384.748 1.00 54.91  ?  98  GLN I NE2 1 
ATOM   8516  N N   . ASN I  1 42  ? 493.628 27.620  389.861 1.00 29.17  ?  99  ASN I N   1 
ATOM   8517  C CA  . ASN I  1 42  ? 495.076 27.474  389.846 1.00 25.78  ?  99  ASN I CA  1 
ATOM   8518  C C   . ASN I  1 42  ? 495.481 26.014  390.019 1.00 26.62  ?  99  ASN I C   1 
ATOM   8519  O O   . ASN I  1 42  ? 494.830 25.241  390.726 1.00 31.62  ?  99  ASN I O   1 
ATOM   8520  C CB  . ASN I  1 42  ? 495.712 28.324  390.946 1.00 25.54  ?  99  ASN I CB  1 
ATOM   8521  C CG  . ASN I  1 42  ? 495.419 29.804  390.782 1.00 31.93  ?  99  ASN I CG  1 
ATOM   8522  O OD1 . ASN I  1 42  ? 494.348 30.189  390.316 1.00 35.43  ?  99  ASN I OD1 1 
ATOM   8523  N ND2 . ASN I  1 42  ? 496.379 30.643  391.159 1.00 35.93  ?  99  ASN I ND2 1 
ATOM   8524  N N   . VAL I  1 43  ? 496.578 25.646  389.360 1.00 38.94  ?  100 VAL I N   1 
ATOM   8525  C CA  . VAL I  1 43  ? 497.131 24.299  389.431 1.00 31.89  ?  100 VAL I CA  1 
ATOM   8526  C C   . VAL I  1 43  ? 498.559 24.370  389.968 1.00 30.83  ?  100 VAL I C   1 
ATOM   8527  O O   . VAL I  1 43  ? 498.874 23.760  390.995 1.00 35.98  ?  100 VAL I O   1 
ATOM   8528  C CB  . VAL I  1 43  ? 497.049 23.578  388.070 1.00 38.72  ?  100 VAL I CB  1 
ATOM   8529  C CG1 . VAL I  1 43  ? 497.581 24.451  386.934 1.00 45.85  ?  100 VAL I CG1 1 
ATOM   8530  C CG2 . VAL I  1 43  ? 497.797 22.254  388.129 1.00 37.17  ?  100 VAL I CG2 1 
ATOM   8531  N N   . LEU I  1 44  ? 499.430 25.098  389.272 1.00 24.99  ?  101 LEU I N   1 
ATOM   8532  C CA  . LEU I  1 44  ? 500.790 25.306  389.744 1.00 21.17  ?  101 LEU I CA  1 
ATOM   8533  C C   . LEU I  1 44  ? 500.790 26.080  391.060 1.00 24.17  ?  101 LEU I C   1 
ATOM   8534  O O   . LEU I  1 44  ? 499.835 26.779  391.408 1.00 28.57  ?  101 LEU I O   1 
ATOM   8535  C CB  . LEU I  1 44  ? 501.613 26.056  388.696 1.00 25.87  ?  101 LEU I CB  1 
ATOM   8536  C CG  . LEU I  1 44  ? 502.297 25.206  387.626 1.00 31.28  ?  101 LEU I CG  1 
ATOM   8537  C CD1 . LEU I  1 44  ? 503.116 26.085  386.694 1.00 30.74  ?  101 LEU I CD1 1 
ATOM   8538  C CD2 . LEU I  1 44  ? 503.170 24.140  388.270 1.00 33.07  ?  101 LEU I CD2 1 
ATOM   8539  N N   . LEU I  1 45  ? 501.895 25.954  391.791 1.00 21.70  ?  102 LEU I N   1 
ATOM   8540  C CA  . LEU I  1 45  ? 502.012 26.449  393.154 1.00 25.69  ?  102 LEU I CA  1 
ATOM   8541  C C   . LEU I  1 45  ? 502.467 27.903  393.227 1.00 29.75  ?  102 LEU I C   1 
ATOM   8542  O O   . LEU I  1 45  ? 502.766 28.389  394.323 1.00 33.37  ?  102 LEU I O   1 
ATOM   8543  C CB  . LEU I  1 45  ? 502.972 25.561  393.951 1.00 32.17  ?  102 LEU I CB  1 
ATOM   8544  C CG  . LEU I  1 45  ? 502.552 25.212  395.380 1.00 29.35  ?  102 LEU I CG  1 
ATOM   8545  C CD1 . LEU I  1 45  ? 501.196 24.521  395.387 1.00 24.15  ?  102 LEU I CD1 1 
ATOM   8546  C CD2 . LEU I  1 45  ? 503.604 24.340  396.044 1.00 22.07  ?  102 LEU I CD2 1 
ATOM   8547  N N   . ILE I  1 46  ? 502.554 28.592  392.086 1.00 40.61  ?  103 ILE I N   1 
ATOM   8548  C CA  . ILE I  1 46  ? 503.002 29.979  392.071 1.00 48.62  ?  103 ILE I CA  1 
ATOM   8549  C C   . ILE I  1 46  ? 502.137 30.833  392.992 1.00 50.89  ?  103 ILE I C   1 
ATOM   8550  O O   . ILE I  1 46  ? 500.907 30.691  393.039 1.00 50.80  ?  103 ILE I O   1 
ATOM   8551  C CB  . ILE I  1 46  ? 502.988 30.519  390.631 1.00 53.55  ?  103 ILE I CB  1 
ATOM   8552  C CG1 . ILE I  1 46  ? 503.669 29.525  389.688 1.00 56.15  ?  103 ILE I CG1 1 
ATOM   8553  C CG2 . ILE I  1 46  ? 503.677 31.874  390.560 1.00 64.35  ?  103 ILE I CG2 1 
ATOM   8554  C CD1 . ILE I  1 46  ? 503.673 29.953  388.236 1.00 66.36  ?  103 ILE I CD1 1 
ATOM   8555  N N   . ASP I  1 47  ? 502.787 31.732  393.727 1.00 42.80  ?  104 ASP I N   1 
ATOM   8556  C CA  . ASP I  1 47  ? 502.135 32.563  394.729 1.00 38.70  ?  104 ASP I CA  1 
ATOM   8557  C C   . ASP I  1 47  ? 501.196 33.582  394.088 1.00 46.90  ?  104 ASP I C   1 
ATOM   8558  O O   . ASP I  1 47  ? 501.250 33.858  392.886 1.00 50.83  ?  104 ASP I O   1 
ATOM   8559  C CB  . ASP I  1 47  ? 503.172 33.287  395.585 1.00 43.69  ?  104 ASP I CB  1 
ATOM   8560  C CG  . ASP I  1 47  ? 503.933 32.344  396.492 1.00 54.46  ?  104 ASP I CG  1 
ATOM   8561  O OD1 . ASP I  1 47  ? 503.983 31.139  396.178 1.00 59.67  ?  104 ASP I OD1 1 
ATOM   8562  O OD2 . ASP I  1 47  ? 504.477 32.808  397.517 1.00 53.29  -1 104 ASP I OD2 1 
ATOM   8563  N N   . GLY I  1 48  ? 500.325 34.148  394.923 1.00 57.75  ?  105 GLY I N   1 
ATOM   8564  C CA  . GLY I  1 48  ? 499.361 35.131  394.490 1.00 56.27  ?  105 GLY I CA  1 
ATOM   8565  C C   . GLY I  1 48  ? 497.935 34.617  394.503 1.00 57.48  ?  105 GLY I C   1 
ATOM   8566  O O   . GLY I  1 48  ? 497.664 33.472  394.879 1.00 55.70  ?  105 GLY I O   1 
ATOM   8567  N N   . PRO I  1 49  ? 496.993 35.469  394.097 1.00 37.60  ?  106 PRO I N   1 
ATOM   8568  C CA  . PRO I  1 49  ? 495.573 35.120  394.222 1.00 27.35  ?  106 PRO I CA  1 
ATOM   8569  C C   . PRO I  1 49  ? 495.196 33.920  393.366 1.00 24.64  ?  106 PRO I C   1 
ATOM   8570  O O   . PRO I  1 49  ? 495.784 33.667  392.313 1.00 32.42  ?  106 PRO I O   1 
ATOM   8571  C CB  . PRO I  1 49  ? 494.852 36.387  393.747 1.00 30.50  ?  106 PRO I CB  1 
ATOM   8572  C CG  . PRO I  1 49  ? 495.866 37.482  393.866 1.00 35.51  ?  106 PRO I CG  1 
ATOM   8573  C CD  . PRO I  1 49  ? 497.187 36.837  393.588 1.00 37.90  ?  106 PRO I CD  1 
ATOM   8574  N N   . LEU I  1 50  ? 494.193 33.184  393.834 1.00 35.77  ?  107 LEU I N   1 
ATOM   8575  C CA  . LEU I  1 50  ? 493.685 32.008  393.141 1.00 38.58  ?  107 LEU I CA  1 
ATOM   8576  C C   . LEU I  1 50  ? 492.468 32.388  392.309 1.00 43.88  ?  107 LEU I C   1 
ATOM   8577  O O   . LEU I  1 50  ? 491.506 32.958  392.834 1.00 47.14  ?  107 LEU I O   1 
ATOM   8578  C CB  . LEU I  1 50  ? 493.308 30.904  394.132 1.00 34.78  ?  107 LEU I CB  1 
ATOM   8579  C CG  . LEU I  1 50  ? 494.381 30.371  395.082 1.00 37.11  ?  107 LEU I CG  1 
ATOM   8580  C CD1 . LEU I  1 50  ? 493.801 29.270  395.956 1.00 33.54  ?  107 LEU I CD1 1 
ATOM   8581  C CD2 . LEU I  1 50  ? 495.586 29.865  394.308 1.00 26.30  ?  107 LEU I CD2 1 
ATOM   8582  N N   . SER I  1 51  ? 492.514 32.076  391.017 1.00 42.72  ?  108 SER I N   1 
ATOM   8583  C CA  . SER I  1 51  ? 491.340 32.235  390.177 1.00 44.95  ?  108 SER I CA  1 
ATOM   8584  C C   . SER I  1 51  ? 490.334 31.123  390.471 1.00 42.49  ?  108 SER I C   1 
ATOM   8585  O O   . SER I  1 51  ? 490.680 30.056  390.985 1.00 43.23  ?  108 SER I O   1 
ATOM   8586  C CB  . SER I  1 51  ? 491.731 32.230  388.699 1.00 48.49  ?  108 SER I CB  1 
ATOM   8587  O OG  . SER I  1 51  ? 492.654 33.268  388.413 1.00 36.83  ?  108 SER I OG  1 
ATOM   8588  N N   . TRP I  1 52  ? 489.071 31.385  390.143 1.00 37.47  ?  109 TRP I N   1 
ATOM   8589  C CA  . TRP I  1 52  ? 487.987 30.465  390.453 1.00 37.59  ?  109 TRP I CA  1 
ATOM   8590  C C   . TRP I  1 52  ? 487.077 30.297  389.243 1.00 38.20  ?  109 TRP I C   1 
ATOM   8591  O O   . TRP I  1 52  ? 487.001 31.165  388.371 1.00 47.63  ?  109 TRP I O   1 
ATOM   8592  C CB  . TRP I  1 52  ? 487.161 30.955  391.654 1.00 39.30  ?  109 TRP I CB  1 
ATOM   8593  C CG  . TRP I  1 52  ? 487.983 31.318  392.853 1.00 33.59  ?  109 TRP I CG  1 
ATOM   8594  C CD1 . TRP I  1 52  ? 488.507 32.544  393.145 1.00 32.52  ?  109 TRP I CD1 1 
ATOM   8595  C CD2 . TRP I  1 52  ? 488.372 30.451  393.924 1.00 28.72  ?  109 TRP I CD2 1 
ATOM   8596  N NE1 . TRP I  1 52  ? 489.200 32.492  394.330 1.00 29.27  ?  109 TRP I NE1 1 
ATOM   8597  C CE2 . TRP I  1 52  ? 489.133 31.218  394.828 1.00 25.72  ?  109 TRP I CE2 1 
ATOM   8598  C CE3 . TRP I  1 52  ? 488.153 29.099  394.206 1.00 27.52  ?  109 TRP I CE3 1 
ATOM   8599  C CZ2 . TRP I  1 52  ? 489.674 30.680  395.992 1.00 25.44  ?  109 TRP I CZ2 1 
ATOM   8600  C CZ3 . TRP I  1 52  ? 488.692 28.566  395.362 1.00 26.56  ?  109 TRP I CZ3 1 
ATOM   8601  C CH2 . TRP I  1 52  ? 489.444 29.355  396.241 1.00 25.99  ?  109 TRP I CH2 1 
ATOM   8602  N N   . TYR I  1 53  ? 486.385 29.157  389.200 1.00 43.75  ?  110 TYR I N   1 
ATOM   8603  C CA  . TYR I  1 53  ? 485.334 28.911  388.218 1.00 50.22  ?  110 TYR I CA  1 
ATOM   8604  C C   . TYR I  1 53  ? 483.999 29.267  388.864 1.00 58.96  ?  110 TYR I C   1 
ATOM   8605  O O   . TYR I  1 53  ? 483.539 28.569  389.775 1.00 58.41  ?  110 TYR I O   1 
ATOM   8606  C CB  . TYR I  1 53  ? 485.334 27.455  387.752 1.00 51.78  ?  110 TYR I CB  1 
ATOM   8607  C CG  . TYR I  1 53  ? 486.655 26.946  387.215 1.00 52.88  ?  110 TYR I CG  1 
ATOM   8608  C CD1 . TYR I  1 53  ? 487.071 27.258  385.927 1.00 48.91  ?  110 TYR I CD1 1 
ATOM   8609  C CD2 . TYR I  1 53  ? 487.471 26.130  387.987 1.00 54.49  ?  110 TYR I CD2 1 
ATOM   8610  C CE1 . TYR I  1 53  ? 488.272 26.785  385.430 1.00 53.19  ?  110 TYR I CE1 1 
ATOM   8611  C CE2 . TYR I  1 53  ? 488.672 25.653  387.499 1.00 52.64  ?  110 TYR I CE2 1 
ATOM   8612  C CZ  . TYR I  1 53  ? 489.068 25.983  386.221 1.00 55.71  ?  110 TYR I CZ  1 
ATOM   8613  O OH  . TYR I  1 53  ? 490.264 25.509  385.733 1.00 52.70  ?  110 TYR I OH  1 
ATOM   8614  N N   . SER I  1 54  ? 483.382 30.352  388.403 1.00 85.63  ?  111 SER I N   1 
ATOM   8615  C CA  . SER I  1 54  ? 482.103 30.801  388.934 1.00 84.01  ?  111 SER I CA  1 
ATOM   8616  C C   . SER I  1 54  ? 480.912 30.383  388.082 1.00 85.58  ?  111 SER I C   1 
ATOM   8617  O O   . SER I  1 54  ? 479.772 30.682  388.450 1.00 85.93  ?  111 SER I O   1 
ATOM   8618  C CB  . SER I  1 54  ? 482.103 32.323  389.093 1.00 87.97  ?  111 SER I CB  1 
ATOM   8619  O OG  . SER I  1 54  ? 482.331 32.966  387.851 1.00 90.82  ?  111 SER I OG  1 
ATOM   8620  N N   . ASP I  1 55  ? 481.141 29.705  386.960 1.00 71.00  ?  112 ASP I N   1 
ATOM   8621  C CA  . ASP I  1 55  ? 480.082 29.424  385.999 1.00 73.11  ?  112 ASP I CA  1 
ATOM   8622  C C   . ASP I  1 55  ? 479.290 28.186  386.402 1.00 70.57  ?  112 ASP I C   1 
ATOM   8623  O O   . ASP I  1 55  ? 479.837 27.076  386.401 1.00 68.23  ?  112 ASP I O   1 
ATOM   8624  C CB  . ASP I  1 55  ? 480.680 29.239  384.601 1.00 73.92  ?  112 ASP I CB  1 
ATOM   8625  C CG  . ASP I  1 55  ? 479.639 29.319  383.498 1.00 78.42  ?  112 ASP I CG  1 
ATOM   8626  O OD1 . ASP I  1 55  ? 478.442 29.096  383.773 1.00 77.94  ?  112 ASP I OD1 1 
ATOM   8627  O OD2 . ASP I  1 55  ? 480.026 29.601  382.344 1.00 86.20  -1 112 ASP I OD2 1 
ATOM   8628  N N   . PRO I  1 56  ? 478.007 28.327  386.738 1.00 100.21 ?  113 PRO I N   1 
ATOM   8629  C CA  . PRO I  1 56  ? 477.185 27.140  387.002 1.00 101.68 ?  113 PRO I CA  1 
ATOM   8630  C C   . PRO I  1 56  ? 477.121 26.246  385.772 1.00 103.77 ?  113 PRO I C   1 
ATOM   8631  O O   . PRO I  1 56  ? 477.070 26.723  384.636 1.00 105.28 ?  113 PRO I O   1 
ATOM   8632  C CB  . PRO I  1 56  ? 475.813 27.726  387.353 1.00 103.30 ?  113 PRO I CB  1 
ATOM   8633  C CG  . PRO I  1 56  ? 476.098 29.129  387.787 1.00 101.23 ?  113 PRO I CG  1 
ATOM   8634  C CD  . PRO I  1 56  ? 477.253 29.574  386.941 1.00 101.51 ?  113 PRO I CD  1 
ATOM   8635  N N   . GLY I  1 57  ? 477.119 24.939  386.012 1.00 57.99  ?  114 GLY I N   1 
ATOM   8636  C CA  . GLY I  1 57  ? 477.316 23.950  384.977 1.00 61.99  ?  114 GLY I CA  1 
ATOM   8637  C C   . GLY I  1 57  ? 478.681 23.300  385.016 1.00 54.12  ?  114 GLY I C   1 
ATOM   8638  O O   . GLY I  1 57  ? 478.868 22.239  384.405 1.00 56.60  ?  114 GLY I O   1 
ATOM   8639  N N   . LEU I  1 58  ? 479.640 23.913  385.704 1.00 30.95  ?  115 LEU I N   1 
ATOM   8640  C CA  . LEU I  1 58  ? 480.895 23.249  386.015 1.00 30.35  ?  115 LEU I CA  1 
ATOM   8641  C C   . LEU I  1 58  ? 480.674 22.208  387.110 1.00 29.73  ?  115 LEU I C   1 
ATOM   8642  O O   . LEU I  1 58  ? 479.670 22.225  387.827 1.00 30.99  ?  115 LEU I O   1 
ATOM   8643  C CB  . LEU I  1 58  ? 481.956 24.265  386.444 1.00 28.03  ?  115 LEU I CB  1 
ATOM   8644  C CG  . LEU I  1 58  ? 482.819 24.900  385.346 1.00 22.27  ?  115 LEU I CG  1 
ATOM   8645  C CD1 . LEU I  1 58  ? 483.535 23.829  384.544 1.00 27.19  ?  115 LEU I CD1 1 
ATOM   8646  C CD2 . LEU I  1 58  ? 482.004 25.797  384.428 1.00 29.45  ?  115 LEU I CD2 1 
ATOM   8647  N N   . ALA I  1 59  ? 481.631 21.284  387.221 1.00 61.40  ?  116 ALA I N   1 
ATOM   8648  C CA  . ALA I  1 59  ? 481.507 20.098  388.063 1.00 58.20  ?  116 ALA I CA  1 
ATOM   8649  C C   . ALA I  1 59  ? 481.021 20.399  389.477 1.00 60.44  ?  116 ALA I C   1 
ATOM   8650  O O   . ALA I  1 59  ? 479.889 20.058  389.831 1.00 83.95  ?  116 ALA I O   1 
ATOM   8651  C CB  . ALA I  1 59  ? 482.847 19.363  388.129 1.00 74.71  ?  116 ALA I CB  1 
ATOM   8652  N N   . GLY I  1 60  ? 481.859 21.039  390.291 1.00 48.82  ?  117 GLY I N   1 
ATOM   8653  C CA  . GLY I  1 60  ? 481.554 21.247  391.693 1.00 45.04  ?  117 GLY I CA  1 
ATOM   8654  C C   . GLY I  1 60  ? 481.191 22.652  392.115 1.00 44.48  ?  117 GLY I C   1 
ATOM   8655  O O   . GLY I  1 60  ? 481.126 22.917  393.324 1.00 44.80  ?  117 GLY I O   1 
ATOM   8656  N N   . VAL I  1 61  ? 480.953 23.565  391.185 1.00 41.52  ?  118 VAL I N   1 
ATOM   8657  C CA  . VAL I  1 61  ? 480.663 24.955  391.519 1.00 36.64  ?  118 VAL I CA  1 
ATOM   8658  C C   . VAL I  1 61  ? 479.165 25.129  391.729 1.00 39.49  ?  118 VAL I C   1 
ATOM   8659  O O   . VAL I  1 61  ? 478.336 24.463  391.099 1.00 41.20  ?  118 VAL I O   1 
ATOM   8660  C CB  . VAL I  1 61  ? 481.199 25.912  390.435 1.00 34.62  ?  118 VAL I CB  1 
ATOM   8661  C CG1 . VAL I  1 61  ? 482.611 25.518  390.036 1.00 40.24  ?  118 VAL I CG1 1 
ATOM   8662  C CG2 . VAL I  1 61  ? 480.284 25.926  389.230 1.00 49.30  ?  118 VAL I CG2 1 
ATOM   8663  N N   . SER I  1 62  ? 478.815 26.017  392.657 1.00 45.38  ?  119 SER I N   1 
ATOM   8664  C CA  . SER I  1 62  ? 477.431 26.379  392.919 1.00 41.73  ?  119 SER I CA  1 
ATOM   8665  C C   . SER I  1 62  ? 477.358 27.870  393.210 1.00 44.34  ?  119 SER I C   1 
ATOM   8666  O O   . SER I  1 62  ? 478.184 28.404  393.955 1.00 38.52  ?  119 SER I O   1 
ATOM   8667  C CB  . SER I  1 62  ? 476.854 25.582  394.095 1.00 33.79  ?  119 SER I CB  1 
ATOM   8668  O OG  . SER I  1 62  ? 475.515 25.958  394.352 1.00 43.62  ?  119 SER I OG  1 
ATOM   8669  N N   . LEU I  1 63  ? 476.370 28.539  392.619 1.00 64.36  ?  120 LEU I N   1 
ATOM   8670  C CA  . LEU I  1 63  ? 476.230 29.981  392.764 1.00 64.12  ?  120 LEU I CA  1 
ATOM   8671  C C   . LEU I  1 63  ? 474.756 30.354  392.728 1.00 66.41  ?  120 LEU I C   1 
ATOM   8672  O O   . LEU I  1 63  ? 473.975 29.754  391.984 1.00 64.25  ?  120 LEU I O   1 
ATOM   8673  C CB  . LEU I  1 63  ? 476.994 30.725  391.663 1.00 59.11  ?  120 LEU I CB  1 
ATOM   8674  C CG  . LEU I  1 63  ? 477.506 32.125  392.004 1.00 54.16  ?  120 LEU I CG  1 
ATOM   8675  C CD1 . LEU I  1 63  ? 478.596 32.049  393.058 1.00 55.13  ?  120 LEU I CD1 1 
ATOM   8676  C CD2 . LEU I  1 63  ? 478.012 32.831  390.756 1.00 62.48  ?  120 LEU I CD2 1 
ATOM   8677  N N   . THR I  1 64  ? 474.385 31.348  393.536 1.00 37.01  ?  121 THR I N   1 
ATOM   8678  C CA  . THR I  1 64  ? 473.012 31.824  393.623 1.00 38.62  ?  121 THR I CA  1 
ATOM   8679  C C   . THR I  1 64  ? 473.004 33.345  393.615 1.00 48.74  ?  121 THR I C   1 
ATOM   8680  O O   . THR I  1 64  ? 474.048 33.995  393.733 1.00 52.76  ?  121 THR I O   1 
ATOM   8681  C CB  . THR I  1 64  ? 472.299 31.311  394.881 1.00 31.65  ?  121 THR I CB  1 
ATOM   8682  O OG1 . THR I  1 64  ? 473.029 31.719  396.045 1.00 34.14  ?  121 THR I OG1 1 
ATOM   8683  C CG2 . THR I  1 64  ? 472.179 29.798  394.854 1.00 36.09  ?  121 THR I CG2 1 
ATOM   8684  N N   . GLY I  1 65  ? 471.809 33.908  393.464 1.00 71.05  ?  122 GLY I N   1 
ATOM   8685  C CA  . GLY I  1 65  ? 471.670 35.353  393.527 1.00 64.92  ?  122 GLY I CA  1 
ATOM   8686  C C   . GLY I  1 65  ? 472.142 35.893  394.866 1.00 67.75  ?  122 GLY I C   1 
ATOM   8687  O O   . GLY I  1 65  ? 471.975 35.258  395.910 1.00 62.73  ?  122 GLY I O   1 
ATOM   8688  N N   . GLY I  1 66  ? 472.740 37.083  394.829 1.00 89.45  ?  123 GLY I N   1 
ATOM   8689  C CA  . GLY I  1 66  ? 473.358 37.674  395.990 1.00 86.97  ?  123 GLY I CA  1 
ATOM   8690  C C   . GLY I  1 66  ? 474.840 37.401  396.122 1.00 93.68  ?  123 GLY I C   1 
ATOM   8691  O O   . GLY I  1 66  ? 475.516 38.082  396.903 1.00 95.95  ?  123 GLY I O   1 
ATOM   8692  N N   . LEU I  1 67  ? 475.363 36.423  395.388 1.00 52.49  ?  124 LEU I N   1 
ATOM   8693  C CA  . LEU I  1 67  ? 476.790 36.120  395.360 1.00 45.91  ?  124 LEU I CA  1 
ATOM   8694  C C   . LEU I  1 67  ? 477.274 36.274  393.925 1.00 43.21  ?  124 LEU I C   1 
ATOM   8695  O O   . LEU I  1 67  ? 476.892 35.491  393.048 1.00 45.35  ?  124 LEU I O   1 
ATOM   8696  C CB  . LEU I  1 67  ? 477.072 34.711  395.883 1.00 44.83  ?  124 LEU I CB  1 
ATOM   8697  C CG  . LEU I  1 67  ? 477.001 34.455  397.392 1.00 40.57  ?  124 LEU I CG  1 
ATOM   8698  C CD1 . LEU I  1 67  ? 477.782 35.513  398.155 1.00 31.48  ?  124 LEU I CD1 1 
ATOM   8699  C CD2 . LEU I  1 67  ? 475.562 34.372  397.890 1.00 44.16  ?  124 LEU I CD2 1 
ATOM   8700  N N   . SER I  1 68  ? 478.107 37.280  393.685 1.00 49.48  ?  125 SER I N   1 
ATOM   8701  C CA  . SER I  1 68  ? 478.728 37.468  392.387 1.00 54.74  ?  125 SER I CA  1 
ATOM   8702  C C   . SER I  1 68  ? 480.180 37.008  392.449 1.00 51.78  ?  125 SER I C   1 
ATOM   8703  O O   . SER I  1 68  ? 480.693 36.622  393.501 1.00 57.04  ?  125 SER I O   1 
ATOM   8704  C CB  . SER I  1 68  ? 478.632 38.932  391.953 1.00 64.65  ?  125 SER I CB  1 
ATOM   8705  O OG  . SER I  1 68  ? 477.328 39.444  392.169 1.00 73.17  ?  125 SER I OG  1 
ATOM   8706  N N   . TYR I  1 69  ? 480.849 37.046  391.302 1.00 53.88  ?  126 TYR I N   1 
ATOM   8707  C CA  . TYR I  1 69  ? 482.289 36.826  391.235 1.00 62.55  ?  126 TYR I CA  1 
ATOM   8708  C C   . TYR I  1 69  ? 482.877 37.883  390.320 1.00 64.23  ?  126 TYR I C   1 
ATOM   8709  O O   . TYR I  1 69  ? 482.563 37.913  389.126 1.00 69.54  ?  126 TYR I O   1 
ATOM   8710  C CB  . TYR I  1 69  ? 482.622 35.419  390.725 1.00 61.32  ?  126 TYR I CB  1 
ATOM   8711  C CG  . TYR I  1 69  ? 484.096 35.190  390.463 1.00 62.02  ?  126 TYR I CG  1 
ATOM   8712  C CD1 . TYR I  1 69  ? 485.036 35.365  391.471 1.00 63.26  ?  126 TYR I CD1 1 
ATOM   8713  C CD2 . TYR I  1 69  ? 484.547 34.794  389.210 1.00 66.74  ?  126 TYR I CD2 1 
ATOM   8714  C CE1 . TYR I  1 69  ? 486.384 35.155  391.237 1.00 54.19  ?  126 TYR I CE1 1 
ATOM   8715  C CE2 . TYR I  1 69  ? 485.892 34.580  388.967 1.00 64.16  ?  126 TYR I CE2 1 
ATOM   8716  C CZ  . TYR I  1 69  ? 486.805 34.762  389.984 1.00 58.29  ?  126 TYR I CZ  1 
ATOM   8717  O OH  . TYR I  1 69  ? 488.144 34.552  389.747 1.00 65.90  ?  126 TYR I OH  1 
ATOM   8718  N N   . LYS I  1 70  ? 483.730 38.741  390.869 1.00 55.07  ?  127 LYS I N   1 
ATOM   8719  C CA  . LYS I  1 70  ? 484.360 39.800  390.090 1.00 58.38  ?  127 LYS I CA  1 
ATOM   8720  C C   . LYS I  1 70  ? 485.689 39.268  389.574 1.00 60.60  ?  127 LYS I C   1 
ATOM   8721  O O   . LYS I  1 70  ? 486.626 39.053  390.350 1.00 64.96  ?  127 LYS I O   1 
ATOM   8722  C CB  . LYS I  1 70  ? 484.543 41.058  390.934 1.00 66.43  ?  127 LYS I CB  1 
ATOM   8723  C CG  . LYS I  1 70  ? 485.234 42.200  390.208 1.00 73.56  ?  127 LYS I CG  1 
ATOM   8724  C CD  . LYS I  1 70  ? 484.727 43.544  390.706 1.00 75.59  ?  127 LYS I CD  1 
ATOM   8725  C CE  . LYS I  1 70  ? 483.275 43.761  390.300 1.00 67.73  ?  127 LYS I CE  1 
ATOM   8726  N NZ  . LYS I  1 70  ? 482.667 44.930  390.991 1.00 76.70  ?  127 LYS I NZ  1 
ATOM   8727  N N   . GLU I  1 71  ? 485.770 39.059  388.261 1.00 68.35  ?  128 GLU I N   1 
ATOM   8728  C CA  . GLU I  1 71  ? 486.934 38.416  387.669 1.00 70.32  ?  128 GLU I CA  1 
ATOM   8729  C C   . GLU I  1 71  ? 488.111 39.367  387.510 1.00 72.94  ?  128 GLU I C   1 
ATOM   8730  O O   . GLU I  1 71  ? 489.247 38.904  387.362 1.00 77.78  ?  128 GLU I O   1 
ATOM   8731  C CB  . GLU I  1 71  ? 486.559 37.816  386.313 1.00 69.02  ?  128 GLU I CB  1 
ATOM   8732  C CG  . GLU I  1 71  ? 487.112 36.425  386.076 1.00 70.01  ?  128 GLU I CG  1 
ATOM   8733  C CD  . GLU I  1 71  ? 486.238 35.607  385.148 1.00 75.17  ?  128 GLU I CD  1 
ATOM   8734  O OE1 . GLU I  1 71  ? 486.691 34.539  384.687 1.00 93.00  ?  128 GLU I OE1 1 
ATOM   8735  O OE2 . GLU I  1 71  ? 485.094 36.032  384.884 1.00 73.59  -1 128 GLU I OE2 1 
ATOM   8736  N N   . ASP I  1 72  ? 487.866 40.678  387.540 1.00 87.53  ?  129 ASP I N   1 
ATOM   8737  C CA  . ASP I  1 72  ? 488.956 41.641  387.423 1.00 87.12  ?  129 ASP I CA  1 
ATOM   8738  C C   . ASP I  1 72  ? 489.914 41.525  388.601 1.00 81.33  ?  129 ASP I C   1 
ATOM   8739  O O   . ASP I  1 72  ? 491.127 41.366  388.421 1.00 78.31  ?  129 ASP I O   1 
ATOM   8740  C CB  . ASP I  1 72  ? 488.390 43.058  387.321 1.00 87.99  ?  129 ASP I CB  1 
ATOM   8741  C CG  . ASP I  1 72  ? 487.287 43.173  386.286 1.00 88.15  ?  129 ASP I CG  1 
ATOM   8742  O OD1 . ASP I  1 72  ? 486.124 42.859  386.619 1.00 88.43  ?  129 ASP I OD1 1 
ATOM   8743  O OD2 . ASP I  1 72  ? 487.581 43.580  385.142 1.00 79.07  -1 129 ASP I OD2 1 
ATOM   8744  N N   . THR I  1 73  ? 489.385 41.604  389.820 1.00 51.23  ?  130 THR I N   1 
ATOM   8745  C CA  . THR I  1 73  ? 490.180 41.473  391.032 1.00 48.36  ?  130 THR I CA  1 
ATOM   8746  C C   . THR I  1 73  ? 490.169 40.059  391.603 1.00 51.03  ?  130 THR I C   1 
ATOM   8747  O O   . THR I  1 73  ? 490.784 39.826  392.648 1.00 55.17  ?  130 THR I O   1 
ATOM   8748  C CB  . THR I  1 73  ? 489.689 42.465  392.093 1.00 49.10  ?  130 THR I CB  1 
ATOM   8749  O OG1 . THR I  1 73  ? 488.261 42.571  392.026 1.00 49.35  ?  130 THR I OG1 1 
ATOM   8750  C CG2 . THR I  1 73  ? 490.307 43.836  391.865 1.00 54.35  ?  130 THR I CG2 1 
ATOM   8751  N N   . LYS I  1 74  ? 489.484 39.119  390.946 1.00 64.77  ?  131 LYS I N   1 
ATOM   8752  C CA  . LYS I  1 74  ? 489.462 37.712  391.357 1.00 63.67  ?  131 LYS I CA  1 
ATOM   8753  C C   . LYS I  1 74  ? 488.949 37.550  392.787 1.00 58.32  ?  131 LYS I C   1 
ATOM   8754  O O   . LYS I  1 74  ? 489.503 36.791  393.584 1.00 58.17  ?  131 LYS I O   1 
ATOM   8755  C CB  . LYS I  1 74  ? 490.842 37.068  391.199 1.00 59.14  ?  131 LYS I CB  1 
ATOM   8756  C CG  . LYS I  1 74  ? 491.341 37.016  389.764 1.00 63.90  ?  131 LYS I CG  1 
ATOM   8757  C CD  . LYS I  1 74  ? 492.847 36.826  389.710 1.00 54.58  ?  131 LYS I CD  1 
ATOM   8758  C CE  . LYS I  1 74  ? 493.565 37.996  390.364 1.00 57.45  ?  131 LYS I CE  1 
ATOM   8759  N NZ  . LYS I  1 74  ? 495.045 37.867  390.280 1.00 58.18  ?  131 LYS I NZ  1 
ATOM   8760  N N   . GLU I  1 75  ? 487.882 38.276  393.116 1.00 65.89  ?  132 GLU I N   1 
ATOM   8761  C CA  . GLU I  1 75  ? 487.280 38.223  394.441 1.00 69.56  ?  132 GLU I CA  1 
ATOM   8762  C C   . GLU I  1 75  ? 485.766 38.215  394.301 1.00 74.72  ?  132 GLU I C   1 
ATOM   8763  O O   . GLU I  1 75  ? 485.196 39.100  393.655 1.00 80.43  ?  132 GLU I O   1 
ATOM   8764  C CB  . GLU I  1 75  ? 487.736 39.410  395.298 1.00 76.14  ?  132 GLU I CB  1 
ATOM   8765  C CG  . GLU I  1 75  ? 487.704 40.743  394.566 1.00 79.86  ?  132 GLU I CG  1 
ATOM   8766  C CD  . GLU I  1 75  ? 488.404 41.854  395.322 1.00 84.34  ?  132 GLU I CD  1 
ATOM   8767  O OE1 . GLU I  1 75  ? 487.767 42.899  395.575 1.00 78.41  ?  132 GLU I OE1 1 
ATOM   8768  O OE2 . GLU I  1 75  ? 489.594 41.686  395.661 1.00 94.09  -1 132 GLU I OE2 1 
ATOM   8769  N N   . LEU I  1 76  ? 485.117 37.216  394.895 1.00 43.81  ?  133 LEU I N   1 
ATOM   8770  C CA  . LEU I  1 76  ? 483.664 37.154  394.865 1.00 38.91  ?  133 LEU I CA  1 
ATOM   8771  C C   . LEU I  1 76  ? 483.083 38.171  395.839 1.00 37.66  ?  133 LEU I C   1 
ATOM   8772  O O   . LEU I  1 76  ? 483.636 38.411  396.916 1.00 34.96  ?  133 LEU I O   1 
ATOM   8773  C CB  . LEU I  1 76  ? 483.169 35.744  395.200 1.00 35.59  ?  133 LEU I CB  1 
ATOM   8774  C CG  . LEU I  1 76  ? 483.093 35.273  396.653 1.00 34.51  ?  133 LEU I CG  1 
ATOM   8775  C CD1 . LEU I  1 76  ? 482.154 34.084  396.769 1.00 24.22  ?  133 LEU I CD1 1 
ATOM   8776  C CD2 . LEU I  1 76  ? 484.472 34.906  397.167 1.00 44.50  ?  133 LEU I CD2 1 
ATOM   8777  N N   . VAL I  1 77  ? 481.968 38.781  395.445 1.00 51.67  ?  134 VAL I N   1 
ATOM   8778  C CA  . VAL I  1 77  ? 481.360 39.881  396.187 1.00 53.09  ?  134 VAL I CA  1 
ATOM   8779  C C   . VAL I  1 77  ? 480.042 39.397  396.774 1.00 44.98  ?  134 VAL I C   1 
ATOM   8780  O O   . VAL I  1 77  ? 479.136 38.988  396.037 1.00 44.80  ?  134 VAL I O   1 
ATOM   8781  C CB  . VAL I  1 77  ? 481.142 41.112  395.294 1.00 58.36  ?  134 VAL I CB  1 
ATOM   8782  C CG1 . VAL I  1 77  ? 480.749 42.316  396.139 1.00 59.03  ?  134 VAL I CG1 1 
ATOM   8783  C CG2 . VAL I  1 77  ? 482.391 41.403  394.475 1.00 53.68  ?  134 VAL I CG2 1 
ATOM   8784  N N   . VAL I  1 78  ? 479.934 39.449  398.098 1.00 44.27  ?  135 VAL I N   1 
ATOM   8785  C CA  . VAL I  1 78  ? 478.688 39.123  398.783 1.00 46.72  ?  135 VAL I CA  1 
ATOM   8786  C C   . VAL I  1 78  ? 477.805 40.364  398.783 1.00 50.30  ?  135 VAL I C   1 
ATOM   8787  O O   . VAL I  1 78  ? 478.191 41.412  399.311 1.00 54.37  ?  135 VAL I O   1 
ATOM   8788  C CB  . VAL I  1 78  ? 478.954 38.635  400.214 1.00 41.09  ?  135 VAL I CB  1 
ATOM   8789  C CG1 . VAL I  1 78  ? 477.662 38.171  400.867 1.00 47.00  ?  135 VAL I CG1 1 
ATOM   8790  C CG2 . VAL I  1 78  ? 479.993 37.523  400.215 1.00 35.05  ?  135 VAL I CG2 1 
ATOM   8791  N N   . ALA I  1 79  ? 476.614 40.248  398.193 1.00 40.79  ?  136 ALA I N   1 
ATOM   8792  C CA  . ALA I  1 79  ? 475.724 41.405  398.081 1.00 48.24  ?  136 ALA I CA  1 
ATOM   8793  C C   . ALA I  1 79  ? 475.060 41.720  399.418 1.00 50.90  ?  136 ALA I C   1 
ATOM   8794  O O   . ALA I  1 79  ? 475.338 42.751  400.037 1.00 47.09  ?  136 ALA I O   1 
ATOM   8795  C CB  . ALA I  1 79  ? 474.677 41.160  396.989 1.00 56.40  ?  136 ALA I CB  1 
ATOM   8796  N N   . LYS I  1 80  ? 474.175 40.839  399.875 1.00 77.86  ?  137 LYS I N   1 
ATOM   8797  C CA  . LYS I  1 80  ? 473.487 41.045  401.141 1.00 77.60  ?  137 LYS I CA  1 
ATOM   8798  C C   . LYS I  1 80  ? 474.393 40.682  402.308 1.00 79.50  ?  137 LYS I C   1 
ATOM   8799  O O   . LYS I  1 80  ? 475.119 39.685  402.265 1.00 85.87  ?  137 LYS I O   1 
ATOM   8800  C CB  . LYS I  1 80  ? 472.205 40.215  401.196 1.00 76.41  ?  137 LYS I CB  1 
ATOM   8801  C CG  . LYS I  1 80  ? 471.007 40.883  400.545 1.00 86.71  ?  137 LYS I CG  1 
ATOM   8802  C CD  . LYS I  1 80  ? 470.445 41.983  401.433 1.00 90.91  ?  137 LYS I CD  1 
ATOM   8803  C CE  . LYS I  1 80  ? 469.491 42.881  400.666 1.00 82.82  ?  137 LYS I CE  1 
ATOM   8804  N NZ  . LYS I  1 80  ? 468.466 42.096  399.928 1.00 73.61  ?  137 LYS I NZ  1 
ATOM   8805  N N   . ALA I  1 81  ? 474.348 41.501  403.356 1.00 30.78  ?  138 ALA I N   1 
ATOM   8806  C CA  . ALA I  1 81  ? 475.142 41.255  404.548 1.00 24.43  ?  138 ALA I CA  1 
ATOM   8807  C C   . ALA I  1 81  ? 474.523 40.126  405.370 1.00 20.18  ?  138 ALA I C   1 
ATOM   8808  O O   . ALA I  1 81  ? 473.475 39.571  405.029 1.00 19.70  ?  138 ALA I O   1 
ATOM   8809  C CB  . ALA I  1 81  ? 475.264 42.531  405.376 1.00 25.70  ?  138 ALA I CB  1 
ATOM   8810  N N   . GLY I  1 82  ? 475.181 39.779  406.463 1.00 47.14  ?  139 GLY I N   1 
ATOM   8811  C CA  . GLY I  1 82  ? 474.676 38.768  407.366 1.00 48.77  ?  139 GLY I CA  1 
ATOM   8812  C C   . GLY I  1 82  ? 475.820 38.002  407.998 1.00 38.89  ?  139 GLY I C   1 
ATOM   8813  O O   . GLY I  1 82  ? 476.975 38.414  407.946 1.00 48.20  ?  139 GLY I O   1 
ATOM   8814  N N   . VAL I  1 83  ? 475.466 36.871  408.601 1.00 17.02  ?  140 VAL I N   1 
ATOM   8815  C CA  . VAL I  1 83  ? 476.426 35.942  409.186 1.00 16.73  ?  140 VAL I CA  1 
ATOM   8816  C C   . VAL I  1 83  ? 476.467 34.706  408.299 1.00 16.61  ?  140 VAL I C   1 
ATOM   8817  O O   . VAL I  1 83  ? 475.460 34.003  408.158 1.00 18.89  ?  140 VAL I O   1 
ATOM   8818  C CB  . VAL I  1 83  ? 476.058 35.575  410.631 1.00 16.40  ?  140 VAL I CB  1 
ATOM   8819  C CG1 . VAL I  1 83  ? 477.038 34.551  411.182 1.00 32.29  ?  140 VAL I CG1 1 
ATOM   8820  C CG2 . VAL I  1 83  ? 476.034 36.821  411.503 1.00 19.04  ?  140 VAL I CG2 1 
ATOM   8821  N N   . TYR I  1 84  ? 477.624 34.446  407.701 1.00 27.35  ?  141 TYR I N   1 
ATOM   8822  C CA  . TYR I  1 84  ? 477.784 33.355  406.754 1.00 29.14  ?  141 TYR I CA  1 
ATOM   8823  C C   . TYR I  1 84  ? 478.789 32.341  407.281 1.00 32.63  ?  141 TYR I C   1 
ATOM   8824  O O   . TYR I  1 84  ? 479.678 32.671  408.072 1.00 33.87  ?  141 TYR I O   1 
ATOM   8825  C CB  . TYR I  1 84  ? 478.244 33.875  405.385 1.00 32.92  ?  141 TYR I CB  1 
ATOM   8826  C CG  . TYR I  1 84  ? 477.267 34.820  404.716 1.00 41.99  ?  141 TYR I CG  1 
ATOM   8827  C CD1 . TYR I  1 84  ? 476.275 34.342  403.870 1.00 41.12  ?  141 TYR I CD1 1 
ATOM   8828  C CD2 . TYR I  1 84  ? 477.342 36.191  404.926 1.00 47.29  ?  141 TYR I CD2 1 
ATOM   8829  C CE1 . TYR I  1 84  ? 475.389 35.198  403.249 1.00 41.80  ?  141 TYR I CE1 1 
ATOM   8830  C CE2 . TYR I  1 84  ? 476.455 37.057  404.311 1.00 53.13  ?  141 TYR I CE2 1 
ATOM   8831  C CZ  . TYR I  1 84  ? 475.480 36.553  403.475 1.00 49.23  ?  141 TYR I CZ  1 
ATOM   8832  O OH  . TYR I  1 84  ? 474.593 37.408  402.861 1.00 56.01  ?  141 TYR I OH  1 
ATOM   8833  N N   . TYR I  1 85  ? 478.634 31.097  406.836 1.00 31.00  ?  142 TYR I N   1 
ATOM   8834  C CA  . TYR I  1 85  ? 479.577 30.027  407.134 1.00 28.26  ?  142 TYR I CA  1 
ATOM   8835  C C   . TYR I  1 85  ? 480.509 29.866  405.938 1.00 33.61  ?  142 TYR I C   1 
ATOM   8836  O O   . TYR I  1 85  ? 480.059 29.524  404.839 1.00 38.38  ?  142 TYR I O   1 
ATOM   8837  C CB  . TYR I  1 85  ? 478.842 28.720  407.435 1.00 23.61  ?  142 TYR I CB  1 
ATOM   8838  C CG  . TYR I  1 85  ? 479.742 27.576  407.856 1.00 25.68  ?  142 TYR I CG  1 
ATOM   8839  C CD1 . TYR I  1 85  ? 480.320 26.737  406.911 1.00 26.34  ?  142 TYR I CD1 1 
ATOM   8840  C CD2 . TYR I  1 85  ? 480.009 27.333  409.196 1.00 31.01  ?  142 TYR I CD2 1 
ATOM   8841  C CE1 . TYR I  1 85  ? 481.140 25.692  407.289 1.00 27.98  ?  142 TYR I CE1 1 
ATOM   8842  C CE2 . TYR I  1 85  ? 480.829 26.288  409.584 1.00 33.78  ?  142 TYR I CE2 1 
ATOM   8843  C CZ  . TYR I  1 85  ? 481.391 25.471  408.624 1.00 31.14  ?  142 TYR I CZ  1 
ATOM   8844  O OH  . TYR I  1 85  ? 482.208 24.428  409.000 1.00 33.44  ?  142 TYR I OH  1 
ATOM   8845  N N   . VAL I  1 86  ? 481.798 30.120  406.150 1.00 24.30  ?  143 VAL I N   1 
ATOM   8846  C CA  . VAL I  1 86  ? 482.802 30.078  405.094 1.00 26.11  ?  143 VAL I CA  1 
ATOM   8847  C C   . VAL I  1 86  ? 483.822 29.004  405.441 1.00 29.03  ?  143 VAL I C   1 
ATOM   8848  O O   . VAL I  1 86  ? 484.400 29.023  406.534 1.00 35.91  ?  143 VAL I O   1 
ATOM   8849  C CB  . VAL I  1 86  ? 483.488 31.444  404.914 1.00 29.29  ?  143 VAL I CB  1 
ATOM   8850  C CG1 . VAL I  1 86  ? 484.552 31.366  403.833 1.00 38.18  ?  143 VAL I CG1 1 
ATOM   8851  C CG2 . VAL I  1 86  ? 482.460 32.515  404.583 1.00 29.65  ?  143 VAL I CG2 1 
ATOM   8852  N N   . PHE I  1 87  ? 484.048 28.075  404.512 1.00 23.41  ?  144 PHE I N   1 
ATOM   8853  C CA  . PHE I  1 87  ? 484.955 26.961  404.740 1.00 25.65  ?  144 PHE I CA  1 
ATOM   8854  C C   . PHE I  1 87  ? 486.016 26.902  403.648 1.00 23.46  ?  144 PHE I C   1 
ATOM   8855  O O   . PHE I  1 87  ? 485.843 27.434  402.548 1.00 21.97  ?  144 PHE I O   1 
ATOM   8856  C CB  . PHE I  1 87  ? 484.203 25.622  404.823 1.00 25.71  ?  144 PHE I CB  1 
ATOM   8857  C CG  . PHE I  1 87  ? 483.293 25.356  403.657 1.00 21.96  ?  144 PHE I CG  1 
ATOM   8858  C CD1 . PHE I  1 87  ? 483.766 24.717  402.522 1.00 25.05  ?  144 PHE I CD1 1 
ATOM   8859  C CD2 . PHE I  1 87  ? 481.962 25.735  403.700 1.00 19.60  ?  144 PHE I CD2 1 
ATOM   8860  C CE1 . PHE I  1 87  ? 482.930 24.467  401.452 1.00 21.58  ?  144 PHE I CE1 1 
ATOM   8861  C CE2 . PHE I  1 87  ? 481.122 25.486  402.633 1.00 20.38  ?  144 PHE I CE2 1 
ATOM   8862  C CZ  . PHE I  1 87  ? 481.607 24.850  401.508 1.00 23.49  ?  144 PHE I CZ  1 
ATOM   8863  N N   . PHE I  1 88  ? 487.121 26.232  403.971 1.00 37.92  ?  145 PHE I N   1 
ATOM   8864  C CA  . PHE I  1 88  ? 488.291 26.137  403.111 1.00 38.47  ?  145 PHE I CA  1 
ATOM   8865  C C   . PHE I  1 88  ? 488.623 24.680  402.821 1.00 44.15  ?  145 PHE I C   1 
ATOM   8866  O O   . PHE I  1 88  ? 488.467 23.813  403.685 1.00 53.13  ?  145 PHE I O   1 
ATOM   8867  C CB  . PHE I  1 88  ? 489.505 26.809  403.761 1.00 43.75  ?  145 PHE I CB  1 
ATOM   8868  C CG  . PHE I  1 88  ? 489.818 28.165  403.210 1.00 37.13  ?  145 PHE I CG  1 
ATOM   8869  C CD1 . PHE I  1 88  ? 488.841 28.917  402.587 1.00 36.54  ?  145 PHE I CD1 1 
ATOM   8870  C CD2 . PHE I  1 88  ? 491.095 28.687  403.319 1.00 43.50  ?  145 PHE I CD2 1 
ATOM   8871  C CE1 . PHE I  1 88  ? 489.133 30.168  402.080 1.00 48.49  ?  145 PHE I CE1 1 
ATOM   8872  C CE2 . PHE I  1 88  ? 491.393 29.935  402.816 1.00 51.15  ?  145 PHE I CE2 1 
ATOM   8873  C CZ  . PHE I  1 88  ? 490.411 30.676  402.194 1.00 55.89  ?  145 PHE I CZ  1 
ATOM   8874  N N   . GLN I  1 89  ? 489.092 24.421  401.602 1.00 26.93  ?  146 GLN I N   1 
ATOM   8875  C CA  . GLN I  1 89  ? 489.580 23.105  401.216 1.00 23.71  ?  146 GLN I CA  1 
ATOM   8876  C C   . GLN I  1 89  ? 490.866 23.265  400.423 1.00 33.31  ?  146 GLN I C   1 
ATOM   8877  O O   . GLN I  1 89  ? 490.902 24.009  399.439 1.00 39.83  ?  146 GLN I O   1 
ATOM   8878  C CB  . GLN I  1 89  ? 488.552 22.338  400.379 1.00 32.75  ?  146 GLN I CB  1 
ATOM   8879  C CG  . GLN I  1 89  ? 487.408 21.744  401.171 1.00 34.16  ?  146 GLN I CG  1 
ATOM   8880  C CD  . GLN I  1 89  ? 486.726 20.621  400.421 1.00 41.52  ?  146 GLN I CD  1 
ATOM   8881  O OE1 . GLN I  1 89  ? 487.233 20.137  399.410 1.00 47.32  ?  146 GLN I OE1 1 
ATOM   8882  N NE2 . GLN I  1 89  ? 485.574 20.191  400.917 1.00 41.03  ?  146 GLN I NE2 1 
ATOM   8883  N N   . LEU I  1 90  ? 491.915 22.569  400.854 1.00 58.79  ?  147 LEU I N   1 
ATOM   8884  C CA  . LEU I  1 90  ? 493.190 22.564  400.147 1.00 51.89  ?  147 LEU I CA  1 
ATOM   8885  C C   . LEU I  1 90  ? 493.687 21.131  400.075 1.00 48.81  ?  147 LEU I C   1 
ATOM   8886  O O   . LEU I  1 90  ? 493.901 20.498  401.113 1.00 52.97  ?  147 LEU I O   1 
ATOM   8887  C CB  . LEU I  1 90  ? 494.217 23.460  400.848 1.00 45.56  ?  147 LEU I CB  1 
ATOM   8888  C CG  . LEU I  1 90  ? 495.486 23.764  400.053 1.00 53.05  ?  147 LEU I CG  1 
ATOM   8889  C CD1 . LEU I  1 90  ? 495.141 24.503  398.774 1.00 55.05  ?  147 LEU I CD1 1 
ATOM   8890  C CD2 . LEU I  1 90  ? 496.471 24.567  400.889 1.00 58.73  ?  147 LEU I CD2 1 
ATOM   8891  N N   . GLU I  1 91  ? 493.864 20.620  398.859 1.00 25.45  ?  148 GLU I N   1 
ATOM   8892  C CA  . GLU I  1 91  ? 494.337 19.259  398.639 1.00 28.16  ?  148 GLU I CA  1 
ATOM   8893  C C   . GLU I  1 91  ? 495.450 19.287  397.605 1.00 30.94  ?  148 GLU I C   1 
ATOM   8894  O O   . GLU I  1 91  ? 495.309 19.922  396.554 1.00 36.31  ?  148 GLU I O   1 
ATOM   8895  C CB  . GLU I  1 91  ? 493.200 18.343  398.176 1.00 34.77  ?  148 GLU I CB  1 
ATOM   8896  C CG  . GLU I  1 91  ? 493.487 16.857  398.337 1.00 41.54  ?  148 GLU I CG  1 
ATOM   8897  C CD  . GLU I  1 91  ? 492.436 15.982  397.675 1.00 51.71  ?  148 GLU I CD  1 
ATOM   8898  O OE1 . GLU I  1 91  ? 492.780 15.256  396.719 1.00 57.15  ?  148 GLU I OE1 1 
ATOM   8899  O OE2 . GLU I  1 91  ? 491.264 16.024  398.110 1.00 45.35  -1 148 GLU I OE2 1 
ATOM   8900  N N   . LEU I  1 92  ? 496.550 18.599  397.901 1.00 16.68  ?  149 LEU I N   1 
ATOM   8901  C CA  . LEU I  1 92  ? 497.726 18.609  397.047 1.00 16.95  ?  149 LEU I CA  1 
ATOM   8902  C C   . LEU I  1 92  ? 498.163 17.181  396.752 1.00 16.85  ?  149 LEU I C   1 
ATOM   8903  O O   . LEU I  1 92  ? 497.896 16.258  397.526 1.00 19.38  ?  149 LEU I O   1 
ATOM   8904  C CB  . LEU I  1 92  ? 498.888 19.383  397.688 1.00 17.02  ?  149 LEU I CB  1 
ATOM   8905  C CG  . LEU I  1 92  ? 498.705 20.878  397.966 1.00 17.17  ?  149 LEU I CG  1 
ATOM   8906  C CD1 . LEU I  1 92  ? 497.948 21.124  399.262 1.00 16.88  ?  149 LEU I CD1 1 
ATOM   8907  C CD2 . LEU I  1 92  ? 500.053 21.577  397.996 1.00 17.38  ?  149 LEU I CD2 1 
ATOM   8908  N N   . ARG I  1 93  ? 498.842 17.013  395.619 1.00 27.22  ?  150 ARG I N   1 
ATOM   8909  C CA  . ARG I  1 93  ? 499.377 15.727  395.204 1.00 29.49  ?  150 ARG I CA  1 
ATOM   8910  C C   . ARG I  1 93  ? 500.822 15.903  394.760 1.00 29.97  ?  150 ARG I C   1 
ATOM   8911  O O   . ARG I  1 93  ? 501.252 16.999  394.388 1.00 28.97  ?  150 ARG I O   1 
ATOM   8912  C CB  . ARG I  1 93  ? 498.547 15.108  394.070 1.00 28.96  ?  150 ARG I CB  1 
ATOM   8913  C CG  . ARG I  1 93  ? 498.350 16.024  392.872 1.00 35.02  ?  150 ARG I CG  1 
ATOM   8914  C CD  . ARG I  1 93  ? 497.477 15.374  391.808 1.00 43.29  ?  150 ARG I CD  1 
ATOM   8915  N NE  . ARG I  1 93  ? 498.250 14.555  390.879 1.00 48.09  ?  150 ARG I NE  1 
ATOM   8916  C CZ  . ARG I  1 93  ? 498.721 14.990  389.713 1.00 51.48  ?  150 ARG I CZ  1 
ATOM   8917  N NH1 . ARG I  1 93  ? 498.499 16.241  389.331 1.00 51.34  ?  150 ARG I NH1 1 
ATOM   8918  N NH2 . ARG I  1 93  ? 499.413 14.174  388.929 1.00 48.96  ?  150 ARG I NH2 1 
ATOM   8919  N N   . ARG I  1 94  ? 501.574 14.807  394.806 1.00 32.30  ?  151 ARG I N   1 
ATOM   8920  C CA  . ARG I  1 94  ? 502.974 14.807  394.400 1.00 34.24  ?  151 ARG I CA  1 
ATOM   8921  C C   . ARG I  1 94  ? 503.052 14.427  392.926 1.00 39.31  ?  151 ARG I C   1 
ATOM   8922  O O   . ARG I  1 94  ? 502.703 13.303  392.549 1.00 38.67  ?  151 ARG I O   1 
ATOM   8923  C CB  . ARG I  1 94  ? 503.787 13.844  395.261 1.00 35.87  ?  151 ARG I CB  1 
ATOM   8924  C CG  . ARG I  1 94  ? 505.287 13.945  395.050 1.00 28.22  ?  151 ARG I CG  1 
ATOM   8925  C CD  . ARG I  1 94  ? 506.033 12.883  395.839 1.00 32.79  ?  151 ARG I CD  1 
ATOM   8926  N NE  . ARG I  1 94  ? 505.658 12.883  397.250 1.00 39.61  ?  151 ARG I NE  1 
ATOM   8927  C CZ  . ARG I  1 94  ? 506.185 13.692  398.164 1.00 34.32  ?  151 ARG I CZ  1 
ATOM   8928  N NH1 . ARG I  1 94  ? 507.110 14.575  397.814 1.00 33.50  ?  151 ARG I NH1 1 
ATOM   8929  N NH2 . ARG I  1 94  ? 505.785 13.621  399.426 1.00 35.37  ?  151 ARG I NH2 1 
ATOM   8930  N N   . VAL I  1 95  ? 503.497 15.370  392.087 1.00 23.03  ?  152 VAL I N   1 
ATOM   8931  C CA  . VAL I  1 95  ? 503.614 15.108  390.654 1.00 21.46  ?  152 VAL I CA  1 
ATOM   8932  C C   . VAL I  1 95  ? 505.000 14.629  390.243 1.00 22.59  ?  152 VAL I C   1 
ATOM   8933  O O   . VAL I  1 95  ? 505.177 14.200  389.092 1.00 30.11  ?  152 VAL I O   1 
ATOM   8934  C CB  . VAL I  1 95  ? 503.243 16.358  389.831 1.00 25.03  ?  152 VAL I CB  1 
ATOM   8935  C CG1 . VAL I  1 95  ? 501.885 16.894  390.264 1.00 26.09  ?  152 VAL I CG1 1 
ATOM   8936  C CG2 . VAL I  1 95  ? 504.312 17.424  389.961 1.00 23.42  ?  152 VAL I CG2 1 
ATOM   8937  N N   . VAL I  1 96  ? 505.986 14.684  391.136 1.00 20.02  ?  153 VAL I N   1 
ATOM   8938  C CA  . VAL I  1 96  ? 507.330 14.182  390.866 1.00 18.62  ?  153 VAL I CA  1 
ATOM   8939  C C   . VAL I  1 96  ? 507.766 13.342  392.057 1.00 19.54  ?  153 VAL I C   1 
ATOM   8940  O O   . VAL I  1 96  ? 507.882 13.859  393.174 1.00 23.68  ?  153 VAL I O   1 
ATOM   8941  C CB  . VAL I  1 96  ? 508.336 15.316  390.609 1.00 18.92  ?  153 VAL I CB  1 
ATOM   8942  C CG1 . VAL I  1 96  ? 509.758 14.776  390.609 1.00 19.02  ?  153 VAL I CG1 1 
ATOM   8943  C CG2 . VAL I  1 96  ? 508.031 16.004  389.295 1.00 19.25  ?  153 VAL I CG2 1 
ATOM   8944  N N   . ALA I  1 97  ? 508.016 12.060  391.817 1.00 29.33  ?  154 ALA I N   1 
ATOM   8945  C CA  . ALA I  1 97  ? 508.361 11.151  392.900 1.00 28.72  ?  154 ALA I CA  1 
ATOM   8946  C C   . ALA I  1 97  ? 509.730 11.484  393.478 1.00 29.60  ?  154 ALA I C   1 
ATOM   8947  O O   . ALA I  1 97  ? 510.685 11.759  392.747 1.00 34.67  ?  154 ALA I O   1 
ATOM   8948  C CB  . ALA I  1 97  ? 508.342 9.705   392.405 1.00 39.78  ?  154 ALA I CB  1 
ATOM   8949  N N   . GLY I  1 98  ? 509.817 11.461  394.806 1.00 35.41  ?  155 GLY I N   1 
ATOM   8950  C CA  . GLY I  1 98  ? 511.090 11.607  395.479 1.00 37.43  ?  155 GLY I CA  1 
ATOM   8951  C C   . GLY I  1 98  ? 511.591 13.021  395.647 1.00 37.27  ?  155 GLY I C   1 
ATOM   8952  O O   . GLY I  1 98  ? 512.793 13.213  395.852 1.00 40.99  ?  155 GLY I O   1 
ATOM   8953  N N   . GLU I  1 99  ? 510.715 14.021  395.581 1.00 35.00  ?  156 GLU I N   1 
ATOM   8954  C CA  . GLU I  1 99  ? 511.161 15.403  395.692 1.00 41.52  ?  156 GLU I CA  1 
ATOM   8955  C C   . GLU I  1 99  ? 510.099 16.262  396.362 1.00 43.39  ?  156 GLU I C   1 
ATOM   8956  O O   . GLU I  1 99  ? 508.898 16.047  396.175 1.00 36.44  ?  156 GLU I O   1 
ATOM   8957  C CB  . GLU I  1 99  ? 511.510 15.993  394.320 1.00 42.61  ?  156 GLU I CB  1 
ATOM   8958  C CG  . GLU I  1 99  ? 512.935 15.719  393.864 1.00 48.77  ?  156 GLU I CG  1 
ATOM   8959  C CD  . GLU I  1 99  ? 513.265 16.398  392.548 1.00 56.94  ?  156 GLU I CD  1 
ATOM   8960  O OE1 . GLU I  1 99  ? 512.342 16.588  391.728 1.00 53.77  ?  156 GLU I OE1 1 
ATOM   8961  O OE2 . GLU I  1 99  ? 514.446 16.744  392.335 1.00 57.40  -1 156 GLU I OE2 1 
ATOM   8962  N N   . GLY I  1 100 ? 510.565 17.225  397.151 1.00 37.35  ?  157 GLY I N   1 
ATOM   8963  C CA  . GLY I  1 100 ? 509.757 18.316  397.659 1.00 35.40  ?  157 GLY I CA  1 
ATOM   8964  C C   . GLY I  1 100 ? 509.242 18.155  399.073 1.00 35.47  ?  157 GLY I C   1 
ATOM   8965  O O   . GLY I  1 100 ? 508.870 17.057  399.499 1.00 33.36  ?  157 GLY I O   1 
ATOM   8966  N N   . SER I  1 101 ? 509.216 19.267  399.803 1.00 50.84  ?  158 SER I N   1 
ATOM   8967  C CA  . SER I  1 101 ? 508.624 19.348  401.131 1.00 51.88  ?  158 SER I CA  1 
ATOM   8968  C C   . SER I  1 101 ? 508.388 20.816  401.444 1.00 48.64  ?  158 SER I C   1 
ATOM   8969  O O   . SER I  1 101 ? 509.003 21.700  400.842 1.00 59.85  ?  158 SER I O   1 
ATOM   8970  C CB  . SER I  1 101 ? 509.520 18.703  402.193 1.00 60.06  ?  158 SER I CB  1 
ATOM   8971  O OG  . SER I  1 101 ? 510.809 19.293  402.198 1.00 61.19  ?  158 SER I OG  1 
ATOM   8972  N N   . GLY I  1 102 ? 507.503 21.072  402.394 1.00 32.27  ?  159 GLY I N   1 
ATOM   8973  C CA  . GLY I  1 102 ? 507.306 22.426  402.868 1.00 40.96  ?  159 GLY I CA  1 
ATOM   8974  C C   . GLY I  1 102 ? 505.867 22.656  403.283 1.00 37.51  ?  159 GLY I C   1 
ATOM   8975  O O   . GLY I  1 102 ? 505.104 21.715  403.481 1.00 35.32  ?  159 GLY I O   1 
ATOM   8976  N N   . SER I  1 103 ? 505.527 23.936  403.411 1.00 22.44  ?  160 SER I N   1 
ATOM   8977  C CA  . SER I  1 103 ? 504.199 24.377  403.807 1.00 17.11  ?  160 SER I CA  1 
ATOM   8978  C C   . SER I  1 103 ? 503.531 25.129  402.665 1.00 17.37  ?  160 SER I C   1 
ATOM   8979  O O   . SER I  1 103 ? 504.187 25.840  401.898 1.00 19.45  ?  160 SER I O   1 
ATOM   8980  C CB  . SER I  1 103 ? 504.265 25.278  405.044 1.00 24.22  ?  160 SER I CB  1 
ATOM   8981  O OG  . SER I  1 103 ? 504.753 24.574  406.173 1.00 40.15  ?  160 SER I OG  1 
ATOM   8982  N N   . VAL I  1 104 ? 502.215 24.964  402.563 1.00 28.65  ?  161 VAL I N   1 
ATOM   8983  C CA  . VAL I  1 104 ? 501.390 25.680  401.598 1.00 28.47  ?  161 VAL I CA  1 
ATOM   8984  C C   . VAL I  1 104 ? 500.241 26.315  402.366 1.00 30.07  ?  161 VAL I C   1 
ATOM   8985  O O   . VAL I  1 104 ? 499.420 25.605  402.960 1.00 33.95  ?  161 VAL I O   1 
ATOM   8986  C CB  . VAL I  1 104 ? 500.858 24.757  400.490 1.00 36.53  ?  161 VAL I CB  1 
ATOM   8987  C CG1 . VAL I  1 104 ? 499.913 25.520  399.574 1.00 36.79  ?  161 VAL I CG1 1 
ATOM   8988  C CG2 . VAL I  1 104 ? 502.014 24.164  399.697 1.00 35.48  ?  161 VAL I CG2 1 
ATOM   8989  N N   . SER I  1 105 ? 500.180 27.643  402.358 1.00 47.09  ?  162 SER I N   1 
ATOM   8990  C CA  . SER I  1 105 ? 499.257 28.391  403.200 1.00 50.00  ?  162 SER I CA  1 
ATOM   8991  C C   . SER I  1 105 ? 498.146 29.006  402.359 1.00 48.74  ?  162 SER I C   1 
ATOM   8992  O O   . SER I  1 105 ? 498.411 29.619  401.320 1.00 46.65  ?  162 SER I O   1 
ATOM   8993  C CB  . SER I  1 105 ? 499.992 29.483  403.979 1.00 52.24  ?  162 SER I CB  1 
ATOM   8994  O OG  . SER I  1 105 ? 501.036 28.934  404.765 1.00 58.69  ?  162 SER I OG  1 
ATOM   8995  N N   . LEU I  1 106 ? 496.907 28.835  402.817 1.00 30.57  ?  163 LEU I N   1 
ATOM   8996  C CA  . LEU I  1 106 ? 495.746 29.511  402.257 1.00 25.64  ?  163 LEU I CA  1 
ATOM   8997  C C   . LEU I  1 106 ? 495.280 30.589  403.223 1.00 25.69  ?  163 LEU I C   1 
ATOM   8998  O O   . LEU I  1 106 ? 495.249 30.373  404.439 1.00 27.12  ?  163 LEU I O   1 
ATOM   8999  C CB  . LEU I  1 106 ? 494.603 28.527  401.989 1.00 25.82  ?  163 LEU I CB  1 
ATOM   9000  C CG  . LEU I  1 106 ? 494.527 27.899  400.599 1.00 29.71  ?  163 LEU I CG  1 
ATOM   9001  C CD1 . LEU I  1 106 ? 493.199 27.182  400.417 1.00 24.08  ?  163 LEU I CD1 1 
ATOM   9002  C CD2 . LEU I  1 106 ? 494.724 28.956  399.524 1.00 33.31  ?  163 LEU I CD2 1 
ATOM   9003  N N   . ALA I  1 107 ? 494.918 31.748  402.680 1.00 18.11  ?  164 ALA I N   1 
ATOM   9004  C CA  . ALA I  1 107 ? 494.475 32.869  403.495 1.00 17.85  ?  164 ALA I CA  1 
ATOM   9005  C C   . ALA I  1 107 ? 493.337 33.589  402.792 1.00 19.21  ?  164 ALA I C   1 
ATOM   9006  O O   . ALA I  1 107 ? 493.408 33.844  401.587 1.00 26.15  ?  164 ALA I O   1 
ATOM   9007  C CB  . ALA I  1 107 ? 495.621 33.848  403.774 1.00 28.57  ?  164 ALA I CB  1 
ATOM   9008  N N   . LEU I  1 108 ? 492.294 33.916  403.551 1.00 32.70  ?  165 LEU I N   1 
ATOM   9009  C CA  . LEU I  1 108 ? 491.146 34.660  403.045 1.00 34.98  ?  165 LEU I CA  1 
ATOM   9010  C C   . LEU I  1 108 ? 491.150 36.035  403.699 1.00 39.83  ?  165 LEU I C   1 
ATOM   9011  O O   . LEU I  1 108 ? 490.912 36.158  404.905 1.00 45.92  ?  165 LEU I O   1 
ATOM   9012  C CB  . LEU I  1 108 ? 489.840 33.916  403.325 1.00 31.28  ?  165 LEU I CB  1 
ATOM   9013  C CG  . LEU I  1 108 ? 488.545 34.532  402.783 1.00 35.33  ?  165 LEU I CG  1 
ATOM   9014  C CD1 . LEU I  1 108 ? 487.611 33.442  402.287 1.00 36.60  ?  165 LEU I CD1 1 
ATOM   9015  C CD2 . LEU I  1 108 ? 487.849 35.376  403.842 1.00 39.07  ?  165 LEU I CD2 1 
ATOM   9016  N N   . HIS I  1 109 ? 491.424 37.065  402.905 1.00 49.03  ?  166 HIS I N   1 
ATOM   9017  C CA  . HIS I  1 109 ? 491.388 38.443  403.368 1.00 55.37  ?  166 HIS I CA  1 
ATOM   9018  C C   . HIS I  1 109 ? 490.126 39.119  402.853 1.00 57.49  ?  166 HIS I C   1 
ATOM   9019  O O   . HIS I  1 109 ? 489.683 38.854  401.731 1.00 59.86  ?  166 HIS I O   1 
ATOM   9020  C CB  . HIS I  1 109 ? 492.623 39.218  402.897 1.00 57.44  ?  166 HIS I CB  1 
ATOM   9021  C CG  . HIS I  1 109 ? 493.923 38.583  403.285 1.00 55.30  ?  166 HIS I CG  1 
ATOM   9022  N ND1 . HIS I  1 109 ? 494.622 37.743  402.445 1.00 59.91  ?  166 HIS I ND1 1 
ATOM   9023  C CD2 . HIS I  1 109 ? 494.653 38.670  404.422 1.00 51.65  ?  166 HIS I CD2 1 
ATOM   9024  C CE1 . HIS I  1 109 ? 495.726 37.340  403.047 1.00 53.97  ?  166 HIS I CE1 1 
ATOM   9025  N NE2 . HIS I  1 109 ? 495.769 37.886  404.248 1.00 51.04  ?  166 HIS I NE2 1 
ATOM   9026  N N   . LEU I  1 110 ? 489.551 39.994  403.674 1.00 55.36  ?  167 LEU I N   1 
ATOM   9027  C CA  . LEU I  1 110 ? 488.382 40.771  403.278 1.00 59.97  ?  167 LEU I CA  1 
ATOM   9028  C C   . LEU I  1 110 ? 488.877 42.086  402.687 1.00 66.00  ?  167 LEU I C   1 
ATOM   9029  O O   . LEU I  1 110 ? 489.419 42.934  403.404 1.00 72.65  ?  167 LEU I O   1 
ATOM   9030  C CB  . LEU I  1 110 ? 487.454 41.006  404.467 1.00 63.86  ?  167 LEU I CB  1 
ATOM   9031  C CG  . LEU I  1 110 ? 486.832 39.757  405.100 1.00 49.29  ?  167 LEU I CG  1 
ATOM   9032  C CD1 . LEU I  1 110 ? 485.905 40.135  406.246 1.00 43.77  ?  167 LEU I CD1 1 
ATOM   9033  C CD2 . LEU I  1 110 ? 486.092 38.939  404.055 1.00 42.26  ?  167 LEU I CD2 1 
ATOM   9034  N N   . GLN I  1 111 ? 488.684 42.254  401.383 1.00 101.49 ?  168 GLN I N   1 
ATOM   9035  C CA  . GLN I  1 111 ? 489.264 43.358  400.627 1.00 99.04  ?  168 GLN I CA  1 
ATOM   9036  C C   . GLN I  1 111 ? 488.694 44.714  401.044 1.00 104.25 ?  168 GLN I C   1 
ATOM   9037  O O   . GLN I  1 111 ? 489.463 45.677  401.176 1.00 104.07 ?  168 GLN I O   1 
ATOM   9038  C CB  . GLN I  1 111 ? 489.068 43.125  399.126 1.00 101.15 ?  168 GLN I CB  1 
ATOM   9039  C CG  . GLN I  1 111 ? 489.359 41.694  398.668 1.00 103.51 ?  168 GLN I CG  1 
ATOM   9040  C CD  . GLN I  1 111 ? 490.844 41.357  398.628 1.00 108.07 ?  168 GLN I CD  1 
ATOM   9041  O OE1 . GLN I  1 111 ? 491.558 41.499  399.620 1.00 106.11 ?  168 GLN I OE1 1 
ATOM   9042  N NE2 . GLN I  1 111 ? 491.311 40.897  397.472 1.00 103.44 ?  168 GLN I NE2 1 
ATOM   9043  N N   . PRO I  1 112 ? 487.368 44.854  401.246 1.00 69.24  ?  169 PRO I N   1 
ATOM   9044  C CA  . PRO I  1 112 ? 486.910 46.159  401.742 1.00 68.79  ?  169 PRO I CA  1 
ATOM   9045  C C   . PRO I  1 112 ? 487.424 46.475  403.145 1.00 69.47  ?  169 PRO I C   1 
ATOM   9046  O O   . PRO I  1 112 ? 486.958 45.860  404.104 1.00 67.96  ?  169 PRO I O   1 
ATOM   9047  C CB  . PRO I  1 112 ? 485.384 46.020  401.749 1.00 66.47  ?  169 PRO I CB  1 
ATOM   9048  C CG  . PRO I  1 112 ? 485.096 44.946  400.769 1.00 60.94  ?  169 PRO I CG  1 
ATOM   9049  C CD  . PRO I  1 112 ? 486.233 43.984  400.892 1.00 58.30  ?  169 PRO I CD  1 
ATOM   9050  N N   . ALA I  1 120 ? 493.808 38.314  408.892 1.00 31.90  ?  177 ALA I N   1 
ATOM   9051  C CA  . ALA I  1 120 ? 493.168 37.360  407.994 1.00 32.54  ?  177 ALA I CA  1 
ATOM   9052  C C   . ALA I  1 120 ? 491.987 36.686  408.681 1.00 36.74  ?  177 ALA I C   1 
ATOM   9053  O O   . ALA I  1 120 ? 492.104 36.205  409.807 1.00 40.45  ?  177 ALA I O   1 
ATOM   9054  C CB  . ALA I  1 120 ? 494.173 36.322  407.518 1.00 35.64  ?  177 ALA I CB  1 
ATOM   9055  N N   . ALA I  1 121 ? 490.844 36.652  407.993 1.00 48.16  ?  178 ALA I N   1 
ATOM   9056  C CA  . ALA I  1 121 ? 489.641 36.071  408.576 1.00 48.51  ?  178 ALA I CA  1 
ATOM   9057  C C   . ALA I  1 121 ? 489.658 34.549  408.538 1.00 52.12  ?  178 ALA I C   1 
ATOM   9058  O O   . ALA I  1 121 ? 489.113 33.906  409.441 1.00 50.83  ?  178 ALA I O   1 
ATOM   9059  C CB  . ALA I  1 121 ? 488.399 36.598  407.856 1.00 44.98  ?  178 ALA I CB  1 
ATOM   9060  N N   . LEU I  1 122 ? 490.266 33.959  407.510 1.00 59.80  ?  179 LEU I N   1 
ATOM   9061  C CA  . LEU I  1 122 ? 490.333 32.511  407.370 1.00 55.80  ?  179 LEU I CA  1 
ATOM   9062  C C   . LEU I  1 122 ? 491.720 32.128  406.882 1.00 50.44  ?  179 LEU I C   1 
ATOM   9063  O O   . LEU I  1 122 ? 492.189 32.656  405.869 1.00 53.28  ?  179 LEU I O   1 
ATOM   9064  C CB  . LEU I  1 122 ? 489.263 32.000  406.400 1.00 58.16  ?  179 LEU I CB  1 
ATOM   9065  C CG  . LEU I  1 122 ? 488.717 30.599  406.666 1.00 55.01  ?  179 LEU I CG  1 
ATOM   9066  C CD1 . LEU I  1 122 ? 488.176 30.509  408.078 1.00 50.69  ?  179 LEU I CD1 1 
ATOM   9067  C CD2 . LEU I  1 122 ? 487.633 30.254  405.659 1.00 51.50  ?  179 LEU I CD2 1 
ATOM   9068  N N   . ALA I  1 123 ? 492.368 31.210  407.595 1.00 31.90  ?  180 ALA I N   1 
ATOM   9069  C CA  . ALA I  1 123 ? 493.731 30.812  407.277 1.00 36.29  ?  180 ALA I CA  1 
ATOM   9070  C C   . ALA I  1 123 ? 493.861 29.299  407.368 1.00 35.51  ?  180 ALA I C   1 
ATOM   9071  O O   . ALA I  1 123 ? 493.214 28.650  408.193 1.00 40.12  ?  180 ALA I O   1 
ATOM   9072  C CB  . ALA I  1 123 ? 494.746 31.484  408.213 1.00 35.42  ?  180 ALA I CB  1 
ATOM   9073  N N   . LEU I  1 124 ? 494.712 28.747  406.505 1.00 37.94  ?  181 LEU I N   1 
ATOM   9074  C CA  . LEU I  1 124 ? 494.975 27.316  406.459 1.00 37.88  ?  181 LEU I CA  1 
ATOM   9075  C C   . LEU I  1 124 ? 496.445 27.081  406.147 1.00 41.03  ?  181 LEU I C   1 
ATOM   9076  O O   . LEU I  1 124 ? 497.068 27.844  405.406 1.00 43.78  ?  181 LEU I O   1 
ATOM   9077  C CB  . LEU I  1 124 ? 494.107 26.608  405.409 1.00 40.72  ?  181 LEU I CB  1 
ATOM   9078  C CG  . LEU I  1 124 ? 493.140 25.547  405.934 1.00 41.25  ?  181 LEU I CG  1 
ATOM   9079  C CD1 . LEU I  1 124 ? 492.536 24.750  404.785 1.00 39.01  ?  181 LEU I CD1 1 
ATOM   9080  C CD2 . LEU I  1 124 ? 493.848 24.623  406.919 1.00 33.96  ?  181 LEU I CD2 1 
ATOM   9081  N N   . THR I  1 125 ? 496.994 26.017  406.727 1.00 24.31  ?  182 THR I N   1 
ATOM   9082  C CA  . THR I  1 125 ? 498.369 25.613  406.459 1.00 21.02  ?  182 THR I CA  1 
ATOM   9083  C C   . THR I  1 125 ? 498.400 24.103  406.285 1.00 23.06  ?  182 THR I C   1 
ATOM   9084  O O   . THR I  1 125 ? 497.976 23.364  407.180 1.00 22.33  ?  182 THR I O   1 
ATOM   9085  C CB  . THR I  1 125 ? 499.311 26.045  407.587 1.00 18.40  ?  182 THR I CB  1 
ATOM   9086  O OG1 . THR I  1 125 ? 499.064 27.419  407.914 1.00 26.13  ?  182 THR I OG1 1 
ATOM   9087  C CG2 . THR I  1 125 ? 500.760 25.891  407.153 1.00 18.02  ?  182 THR I CG2 1 
ATOM   9088  N N   . VAL I  1 126 ? 498.899 23.649  405.138 1.00 26.59  ?  183 VAL I N   1 
ATOM   9089  C CA  . VAL I  1 126 ? 498.961 22.231  404.799 1.00 21.06  ?  183 VAL I CA  1 
ATOM   9090  C C   . VAL I  1 126 ? 500.422 21.816  404.734 1.00 22.59  ?  183 VAL I C   1 
ATOM   9091  O O   . VAL I  1 126 ? 501.236 22.479  404.080 1.00 24.35  ?  183 VAL I O   1 
ATOM   9092  C CB  . VAL I  1 126 ? 498.242 21.939  403.471 1.00 17.63  ?  183 VAL I CB  1 
ATOM   9093  C CG1 . VAL I  1 126 ? 498.541 20.527  403.002 1.00 17.19  ?  183 VAL I CG1 1 
ATOM   9094  C CG2 . VAL I  1 126 ? 496.744 22.140  403.628 1.00 24.28  ?  183 VAL I CG2 1 
ATOM   9095  N N   . ASP I  1 127 ? 500.754 20.720  405.412 1.00 65.19  ?  184 ASP I N   1 
ATOM   9096  C CA  . ASP I  1 127 ? 502.117 20.215  405.452 1.00 66.52  ?  184 ASP I CA  1 
ATOM   9097  C C   . ASP I  1 127 ? 502.366 19.257  404.295 1.00 64.64  ?  184 ASP I C   1 
ATOM   9098  O O   . ASP I  1 127 ? 501.500 18.451  403.943 1.00 61.71  ?  184 ASP I O   1 
ATOM   9099  C CB  . ASP I  1 127 ? 502.385 19.510  406.783 1.00 78.36  ?  184 ASP I CB  1 
ATOM   9100  C CG  . ASP I  1 127 ? 503.783 18.933  406.869 1.00 91.71  ?  184 ASP I CG  1 
ATOM   9101  O OD1 . ASP I  1 127 ? 504.726 19.574  406.357 1.00 93.02  ?  184 ASP I OD1 1 
ATOM   9102  O OD2 . ASP I  1 127 ? 503.940 17.836  407.447 1.00 95.86  -1 184 ASP I OD2 1 
ATOM   9103  N N   . LEU I  1 128 ? 503.555 19.357  403.703 1.00 35.37  ?  185 LEU I N   1 
ATOM   9104  C CA  . LEU I  1 128 ? 503.970 18.468  402.625 1.00 29.26  ?  185 LEU I CA  1 
ATOM   9105  C C   . LEU I  1 128 ? 505.048 17.527  403.139 1.00 29.63  ?  185 LEU I C   1 
ATOM   9106  O O   . LEU I  1 128 ? 506.117 17.994  403.560 1.00 32.13  ?  185 LEU I O   1 
ATOM   9107  C CB  . LEU I  1 128 ? 504.484 19.267  401.430 1.00 25.45  ?  185 LEU I CB  1 
ATOM   9108  C CG  . LEU I  1 128 ? 503.506 20.273  400.825 1.00 23.86  ?  185 LEU I CG  1 
ATOM   9109  C CD1 . LEU I  1 128 ? 504.128 20.973  399.626 1.00 26.91  ?  185 LEU I CD1 1 
ATOM   9110  C CD2 . LEU I  1 128 ? 502.209 19.585  400.436 1.00 27.77  ?  185 LEU I CD2 1 
ATOM   9111  N N   . PRO I  1 129 ? 504.821 16.217  403.130 1.00 34.53  ?  186 PRO I N   1 
ATOM   9112  C CA  . PRO I  1 129 ? 505.816 15.286  403.671 1.00 39.40  ?  186 PRO I CA  1 
ATOM   9113  C C   . PRO I  1 129 ? 506.985 15.121  402.718 1.00 43.42  ?  186 PRO I C   1 
ATOM   9114  O O   . PRO I  1 129 ? 506.829 15.271  401.496 1.00 49.68  ?  186 PRO I O   1 
ATOM   9115  C CB  . PRO I  1 129 ? 505.030 13.971  403.817 1.00 44.91  ?  186 PRO I CB  1 
ATOM   9116  C CG  . PRO I  1 129 ? 503.579 14.341  403.632 1.00 42.30  ?  186 PRO I CG  1 
ATOM   9117  C CD  . PRO I  1 129 ? 503.585 15.530  402.733 1.00 37.83  ?  186 PRO I CD  1 
ATOM   9118  N N   . PRO I  1 130 ? 508.177 14.815  403.236 1.00 33.02  ?  187 PRO I N   1 
ATOM   9119  C CA  . PRO I  1 130 ? 509.311 14.524  402.349 1.00 35.20  ?  187 PRO I CA  1 
ATOM   9120  C C   . PRO I  1 130 ? 509.196 13.150  401.707 1.00 46.35  ?  187 PRO I C   1 
ATOM   9121  O O   . PRO I  1 130 ? 508.204 12.442  401.910 1.00 47.82  ?  187 PRO I O   1 
ATOM   9122  C CB  . PRO I  1 130 ? 510.520 14.614  403.287 1.00 32.94  ?  187 PRO I CB  1 
ATOM   9123  C CG  . PRO I  1 130 ? 509.971 14.277  404.629 1.00 30.00  ?  187 PRO I CG  1 
ATOM   9124  C CD  . PRO I  1 130 ? 508.570 14.826  404.655 1.00 35.38  ?  187 PRO I CD  1 
ATOM   9125  N N   . ALA I  1 131 ? 510.208 12.763  400.937 1.00 33.55  ?  188 ALA I N   1 
ATOM   9126  C CA  . ALA I  1 131 ? 510.169 11.509  400.200 1.00 33.28  ?  188 ALA I CA  1 
ATOM   9127  C C   . ALA I  1 131 ? 510.516 10.328  401.098 1.00 40.86  ?  188 ALA I C   1 
ATOM   9128  O O   . ALA I  1 131 ? 511.308 10.443  402.038 1.00 39.24  ?  188 ALA I O   1 
ATOM   9129  C CB  . ALA I  1 131 ? 511.134 11.556  399.017 1.00 29.25  ?  188 ALA I CB  1 
ATOM   9130  N N   . SER I  1 132 ? 509.911 9.183   400.795 1.00 92.51  ?  189 SER I N   1 
ATOM   9131  C CA  . SER I  1 132 ? 510.207 7.935   401.494 1.00 101.44 ?  189 SER I CA  1 
ATOM   9132  C C   . SER I  1 132 ? 509.774 6.734   400.660 1.00 109.87 ?  189 SER I C   1 
ATOM   9133  O O   . SER I  1 132 ? 508.734 6.763   400.001 1.00 106.12 ?  189 SER I O   1 
ATOM   9134  C CB  . SER I  1 132 ? 509.521 7.899   402.863 1.00 103.04 ?  189 SER I CB  1 
ATOM   9135  O OG  . SER I  1 132 ? 510.049 8.886   403.731 1.00 102.30 ?  189 SER I OG  1 
ATOM   9136  N N   . ALA I  1 135 ? 505.754 6.531   400.890 1.00 73.81  ?  192 ALA I N   1 
ATOM   9137  C CA  . ALA I  1 135 ? 505.490 7.770   401.612 1.00 71.45  ?  192 ALA I CA  1 
ATOM   9138  C C   . ALA I  1 135 ? 504.072 8.263   401.352 1.00 72.86  ?  192 ALA I C   1 
ATOM   9139  O O   . ALA I  1 135 ? 503.209 7.500   400.918 1.00 79.89  ?  192 ALA I O   1 
ATOM   9140  C CB  . ALA I  1 135 ? 506.499 8.838   401.219 1.00 70.77  ?  192 ALA I CB  1 
ATOM   9141  N N   . ARG I  1 136 ? 503.841 9.545   401.618 1.00 54.71  ?  193 ARG I N   1 
ATOM   9142  C CA  . ARG I  1 136 ? 502.550 10.177  401.386 1.00 52.00  ?  193 ARG I CA  1 
ATOM   9143  C C   . ARG I  1 136 ? 502.595 10.953  400.077 1.00 54.93  ?  193 ARG I C   1 
ATOM   9144  O O   . ARG I  1 136 ? 503.387 11.891  399.932 1.00 52.30  ?  193 ARG I O   1 
ATOM   9145  C CB  . ARG I  1 136 ? 502.175 11.107  402.539 1.00 60.54  ?  193 ARG I CB  1 
ATOM   9146  C CG  . ARG I  1 136 ? 501.576 10.406  403.740 1.00 69.46  ?  193 ARG I CG  1 
ATOM   9147  C CD  . ARG I  1 136 ? 500.740 11.371  404.563 1.00 63.97  ?  193 ARG I CD  1 
ATOM   9148  N NE  . ARG I  1 136 ? 499.659 11.962  403.777 1.00 63.81  ?  193 ARG I NE  1 
ATOM   9149  C CZ  . ARG I  1 136 ? 498.494 11.367  403.536 1.00 65.14  ?  193 ARG I CZ  1 
ATOM   9150  N NH1 . ARG I  1 136 ? 498.254 10.154  404.016 1.00 60.69  ?  193 ARG I NH1 1 
ATOM   9151  N NH2 . ARG I  1 136 ? 497.570 11.983  402.810 1.00 63.02  ?  193 ARG I NH2 1 
ATOM   9152  N N   . ASN I  1 137 ? 501.750 10.560  399.130 1.00 63.49  ?  194 ASN I N   1 
ATOM   9153  C CA  . ASN I  1 137 ? 501.580 11.294  397.884 1.00 60.00  ?  194 ASN I CA  1 
ATOM   9154  C C   . ASN I  1 137 ? 500.416 12.274  397.937 1.00 55.73  ?  194 ASN I C   1 
ATOM   9155  O O   . ASN I  1 137 ? 500.124 12.922  396.927 1.00 58.33  ?  194 ASN I O   1 
ATOM   9156  C CB  . ASN I  1 137 ? 501.382 10.322  396.718 1.00 66.90  ?  194 ASN I CB  1 
ATOM   9157  C CG  . ASN I  1 137 ? 502.646 9.556   396.380 1.00 70.41  ?  194 ASN I CG  1 
ATOM   9158  O OD1 . ASN I  1 137 ? 503.753 10.086  396.485 1.00 60.08  ?  194 ASN I OD1 1 
ATOM   9159  N ND2 . ASN I  1 137 ? 502.486 8.302   395.971 1.00 68.49  ?  194 ASN I ND2 1 
ATOM   9160  N N   . SER I  1 138 ? 499.746 12.394  399.081 1.00 52.46  ?  195 SER I N   1 
ATOM   9161  C CA  . SER I  1 138 ? 498.590 13.264  399.223 1.00 47.91  ?  195 SER I CA  1 
ATOM   9162  C C   . SER I  1 138 ? 498.735 14.126  400.467 1.00 47.69  ?  195 SER I C   1 
ATOM   9163  O O   . SER I  1 138 ? 499.219 13.665  401.505 1.00 55.52  ?  195 SER I O   1 
ATOM   9164  C CB  . SER I  1 138 ? 497.290 12.455  399.307 1.00 54.49  ?  195 SER I CB  1 
ATOM   9165  O OG  . SER I  1 138 ? 497.034 11.774  398.091 1.00 66.80  ?  195 SER I OG  1 
ATOM   9166  N N   . ALA I  1 139 ? 498.316 15.380  400.349 1.00 50.56  ?  196 ALA I N   1 
ATOM   9167  C CA  . ALA I  1 139 ? 498.208 16.304  401.465 1.00 50.15  ?  196 ALA I CA  1 
ATOM   9168  C C   . ALA I  1 139 ? 496.829 16.942  401.410 1.00 49.90  ?  196 ALA I C   1 
ATOM   9169  O O   . ALA I  1 139 ? 496.133 16.865  400.393 1.00 56.44  ?  196 ALA I O   1 
ATOM   9170  C CB  . ALA I  1 139 ? 499.312 17.369  401.427 1.00 48.25  ?  196 ALA I CB  1 
ATOM   9171  N N   . PHE I  1 140 ? 496.439 17.602  402.498 1.00 52.30  ?  197 PHE I N   1 
ATOM   9172  C CA  . PHE I  1 140 ? 495.047 18.018  402.616 1.00 48.76  ?  197 PHE I CA  1 
ATOM   9173  C C   . PHE I  1 140 ? 494.869 18.848  403.881 1.00 53.32  ?  197 PHE I C   1 
ATOM   9174  O O   . PHE I  1 140 ? 495.682 18.786  404.810 1.00 53.53  ?  197 PHE I O   1 
ATOM   9175  C CB  . PHE I  1 140 ? 494.118 16.792  402.635 1.00 52.57  ?  197 PHE I CB  1 
ATOM   9176  C CG  . PHE I  1 140 ? 492.700 17.101  402.998 1.00 58.90  ?  197 PHE I CG  1 
ATOM   9177  C CD1 . PHE I  1 140 ? 491.838 17.660  402.071 1.00 61.42  ?  197 PHE I CD1 1 
ATOM   9178  C CD2 . PHE I  1 140 ? 492.226 16.825  404.269 1.00 53.39  ?  197 PHE I CD2 1 
ATOM   9179  C CE1 . PHE I  1 140 ? 490.532 17.944  402.407 1.00 56.20  ?  197 PHE I CE1 1 
ATOM   9180  C CE2 . PHE I  1 140 ? 490.925 17.105  404.609 1.00 56.80  ?  197 PHE I CE2 1 
ATOM   9181  C CZ  . PHE I  1 140 ? 490.074 17.665  403.678 1.00 57.27  ?  197 PHE I CZ  1 
ATOM   9182  N N   . GLY I  1 141 ? 493.788 19.622  403.900 1.00 32.76  ?  198 GLY I N   1 
ATOM   9183  C CA  . GLY I  1 141 ? 493.423 20.412  405.059 1.00 33.96  ?  198 GLY I CA  1 
ATOM   9184  C C   . GLY I  1 141 ? 492.042 20.997  404.873 1.00 32.71  ?  198 GLY I C   1 
ATOM   9185  O O   . GLY I  1 141 ? 491.562 21.159  403.747 1.00 36.01  ?  198 GLY I O   1 
ATOM   9186  N N   . PHE I  1 142 ? 491.406 21.308  406.000 1.00 37.24  ?  199 PHE I N   1 
ATOM   9187  C CA  . PHE I  1 142 ? 490.064 21.875  405.984 1.00 31.45  ?  199 PHE I CA  1 
ATOM   9188  C C   . PHE I  1 142 ? 489.931 22.864  407.131 1.00 36.17  ?  199 PHE I C   1 
ATOM   9189  O O   . PHE I  1 142 ? 490.395 22.599  408.243 1.00 40.19  ?  199 PHE I O   1 
ATOM   9190  C CB  . PHE I  1 142 ? 488.995 20.780  406.097 1.00 30.05  ?  199 PHE I CB  1 
ATOM   9191  C CG  . PHE I  1 142 ? 487.585 21.293  406.006 1.00 36.66  ?  199 PHE I CG  1 
ATOM   9192  C CD1 . PHE I  1 142 ? 486.905 21.707  407.139 1.00 37.82  ?  199 PHE I CD1 1 
ATOM   9193  C CD2 . PHE I  1 142 ? 486.933 21.348  404.785 1.00 41.08  ?  199 PHE I CD2 1 
ATOM   9194  C CE1 . PHE I  1 142 ? 485.607 22.176  407.057 1.00 38.60  ?  199 PHE I CE1 1 
ATOM   9195  C CE2 . PHE I  1 142 ? 485.635 21.816  404.696 1.00 35.82  ?  199 PHE I CE2 1 
ATOM   9196  C CZ  . PHE I  1 142 ? 484.972 22.229  405.833 1.00 37.26  ?  199 PHE I CZ  1 
ATOM   9197  N N   . GLN I  1 143 ? 489.284 23.995  406.858 1.00 27.74  ?  200 GLN I N   1 
ATOM   9198  C CA  . GLN I  1 143 ? 489.085 25.029  407.863 1.00 29.48  ?  200 GLN I CA  1 
ATOM   9199  C C   . GLN I  1 143 ? 487.782 25.759  407.579 1.00 33.00  ?  200 GLN I C   1 
ATOM   9200  O O   . GLN I  1 143 ? 487.441 25.999  406.418 1.00 34.04  ?  200 GLN I O   1 
ATOM   9201  C CB  . GLN I  1 143 ? 490.262 26.013  407.877 1.00 31.13  ?  200 GLN I CB  1 
ATOM   9202  C CG  . GLN I  1 143 ? 489.982 27.372  408.507 1.00 34.00  ?  200 GLN I CG  1 
ATOM   9203  C CD  . GLN I  1 143 ? 490.006 27.344  410.024 1.00 44.58  ?  200 GLN I CD  1 
ATOM   9204  O OE1 . GLN I  1 143 ? 489.388 26.487  410.656 1.00 45.56  ?  200 GLN I OE1 1 
ATOM   9205  N NE2 . GLN I  1 143 ? 490.725 28.291  410.619 1.00 42.39  ?  200 GLN I NE2 1 
ATOM   9206  N N   . GLY I  1 144 ? 487.060 26.109  408.641 1.00 31.46  ?  201 GLY I N   1 
ATOM   9207  C CA  . GLY I  1 144 ? 485.869 26.923  408.503 1.00 30.03  ?  201 GLY I CA  1 
ATOM   9208  C C   . GLY I  1 144 ? 485.394 27.513  409.814 1.00 30.61  ?  201 GLY I C   1 
ATOM   9209  O O   . GLY I  1 144 ? 485.654 26.957  410.885 1.00 31.59  ?  201 GLY I O   1 
ATOM   9210  N N   . ARG I  1 145 ? 484.695 28.642  409.741 1.00 33.59  ?  202 ARG I N   1 
ATOM   9211  C CA  . ARG I  1 145 ? 484.153 29.282  410.931 1.00 37.72  ?  202 ARG I CA  1 
ATOM   9212  C C   . ARG I  1 145 ? 483.024 30.209  410.515 1.00 37.65  ?  202 ARG I C   1 
ATOM   9213  O O   . ARG I  1 145 ? 482.926 30.615  409.353 1.00 38.04  ?  202 ARG I O   1 
ATOM   9214  C CB  . ARG I  1 145 ? 485.233 30.051  411.701 1.00 40.34  ?  202 ARG I CB  1 
ATOM   9215  C CG  . ARG I  1 145 ? 485.923 31.140  410.897 1.00 42.11  ?  202 ARG I CG  1 
ATOM   9216  C CD  . ARG I  1 145 ? 487.302 31.459  411.462 1.00 39.30  ?  202 ARG I CD  1 
ATOM   9217  N NE  . ARG I  1 145 ? 487.241 32.078  412.783 1.00 41.82  ?  202 ARG I NE  1 
ATOM   9218  C CZ  . ARG I  1 145 ? 487.293 33.389  412.995 1.00 45.59  ?  202 ARG I CZ  1 
ATOM   9219  N NH1 . ARG I  1 145 ? 487.406 34.224  411.971 1.00 39.09  ?  202 ARG I NH1 1 
ATOM   9220  N NH2 . ARG I  1 145 ? 487.233 33.867  414.232 1.00 42.28  ?  202 ARG I NH2 1 
ATOM   9221  N N   . LEU I  1 146 ? 482.173 30.544  411.481 1.00 36.37  ?  203 LEU I N   1 
ATOM   9222  C CA  . LEU I  1 146 ? 481.123 31.525  411.245 1.00 32.01  ?  203 LEU I CA  1 
ATOM   9223  C C   . LEU I  1 146 ? 481.750 32.907  411.113 1.00 35.91  ?  203 LEU I C   1 
ATOM   9224  O O   . LEU I  1 146 ? 482.467 33.358  412.012 1.00 40.83  ?  203 LEU I O   1 
ATOM   9225  C CB  . LEU I  1 146 ? 480.106 31.500  412.384 1.00 21.01  ?  203 LEU I CB  1 
ATOM   9226  C CG  . LEU I  1 146 ? 479.235 30.248  412.475 1.00 25.20  ?  203 LEU I CG  1 
ATOM   9227  C CD1 . LEU I  1 146 ? 478.584 30.143  413.844 1.00 28.17  ?  203 LEU I CD1 1 
ATOM   9228  C CD2 . LEU I  1 146 ? 478.183 30.257  411.381 1.00 29.11  ?  203 LEU I CD2 1 
ATOM   9229  N N   . LEU I  1 147 ? 481.485 33.576  409.996 1.00 25.17  ?  204 LEU I N   1 
ATOM   9230  C CA  . LEU I  1 147 ? 482.069 34.876  409.714 1.00 29.03  ?  204 LEU I CA  1 
ATOM   9231  C C   . LEU I  1 147 ? 480.979 35.933  409.613 1.00 33.96  ?  204 LEU I C   1 
ATOM   9232  O O   . LEU I  1 147 ? 479.827 35.637  409.283 1.00 28.55  ?  204 LEU I O   1 
ATOM   9233  C CB  . LEU I  1 147 ? 482.887 34.853  408.417 1.00 22.88  ?  204 LEU I CB  1 
ATOM   9234  C CG  . LEU I  1 147 ? 484.264 34.195  408.515 1.00 24.69  ?  204 LEU I CG  1 
ATOM   9235  C CD1 . LEU I  1 147 ? 484.996 34.281  407.186 1.00 27.16  ?  204 LEU I CD1 1 
ATOM   9236  C CD2 . LEU I  1 147 ? 485.082 34.836  409.623 1.00 33.69  ?  204 LEU I CD2 1 
ATOM   9237  N N   . HIS I  1 148 ? 481.359 37.172  409.910 1.00 90.73  ?  205 HIS I N   1 
ATOM   9238  C CA  . HIS I  1 148 ? 480.466 38.321  409.811 1.00 89.87  ?  205 HIS I CA  1 
ATOM   9239  C C   . HIS I  1 148 ? 480.819 39.084  408.540 1.00 89.14  ?  205 HIS I C   1 
ATOM   9240  O O   . HIS I  1 148 ? 481.871 39.726  408.463 1.00 90.96  ?  205 HIS I O   1 
ATOM   9241  C CB  . HIS I  1 148 ? 480.592 39.208  411.048 1.00 95.24  ?  205 HIS I CB  1 
ATOM   9242  C CG  . HIS I  1 148 ? 479.784 40.466  410.977 1.00 102.45 ?  205 HIS I CG  1 
ATOM   9243  N ND1 . HIS I  1 148 ? 480.356 41.709  410.819 1.00 107.88 ?  205 HIS I ND1 1 
ATOM   9244  C CD2 . HIS I  1 148 ? 478.447 40.672  411.049 1.00 104.53 ?  205 HIS I CD2 1 
ATOM   9245  C CE1 . HIS I  1 148 ? 479.406 42.629  410.794 1.00 112.34 ?  205 HIS I CE1 1 
ATOM   9246  N NE2 . HIS I  1 148 ? 478.240 42.025  410.931 1.00 113.40 ?  205 HIS I NE2 1 
ATOM   9247  N N   . LEU I  1 149 ? 479.936 39.018  407.548 1.00 50.86  ?  206 LEU I N   1 
ATOM   9248  C CA  . LEU I  1 149 ? 480.141 39.671  406.267 1.00 57.00  ?  206 LEU I CA  1 
ATOM   9249  C C   . LEU I  1 149 ? 479.171 40.835  406.119 1.00 57.45  ?  206 LEU I C   1 
ATOM   9250  O O   . LEU I  1 149 ? 478.049 40.800  406.634 1.00 58.10  ?  206 LEU I O   1 
ATOM   9251  C CB  . LEU I  1 149 ? 479.963 38.683  405.108 1.00 54.48  ?  206 LEU I CB  1 
ATOM   9252  C CG  . LEU I  1 149 ? 480.961 37.523  405.045 1.00 47.40  ?  206 LEU I CG  1 
ATOM   9253  C CD1 . LEU I  1 149 ? 480.670 36.614  403.861 1.00 38.64  ?  206 LEU I CD1 1 
ATOM   9254  C CD2 . LEU I  1 149 ? 482.389 38.044  404.981 1.00 50.50  ?  206 LEU I CD2 1 
ATOM   9255  N N   . SER I  1 150 ? 479.611 41.866  405.409 1.00 73.57  ?  207 SER I N   1 
ATOM   9256  C CA  . SER I  1 150 ? 478.849 43.093  405.244 1.00 73.40  ?  207 SER I CA  1 
ATOM   9257  C C   . SER I  1 150 ? 478.404 43.243  403.791 1.00 76.79  ?  207 SER I C   1 
ATOM   9258  O O   . SER I  1 150 ? 478.694 42.405  402.933 1.00 80.50  ?  207 SER I O   1 
ATOM   9259  C CB  . SER I  1 150 ? 479.673 44.300  405.697 1.00 80.76  ?  207 SER I CB  1 
ATOM   9260  O OG  . SER I  1 150 ? 480.083 44.153  407.044 1.00 90.76  ?  207 SER I OG  1 
ATOM   9261  N N   . ALA I  1 151 ? 477.689 44.333  403.525 1.00 80.25  ?  208 ALA I N   1 
ATOM   9262  C CA  . ALA I  1 151 ? 477.171 44.584  402.187 1.00 76.22  ?  208 ALA I CA  1 
ATOM   9263  C C   . ALA I  1 151 ? 478.312 44.901  401.229 1.00 77.69  ?  208 ALA I C   1 
ATOM   9264  O O   . ALA I  1 151 ? 479.171 45.739  401.523 1.00 81.47  ?  208 ALA I O   1 
ATOM   9265  C CB  . ALA I  1 151 ? 476.166 45.733  402.215 1.00 76.67  ?  208 ALA I CB  1 
ATOM   9266  N N   . GLY I  1 152 ? 478.318 44.230  400.080 1.00 65.37  ?  209 GLY I N   1 
ATOM   9267  C CA  . GLY I  1 152 ? 479.373 44.429  399.108 1.00 62.72  ?  209 GLY I CA  1 
ATOM   9268  C C   . GLY I  1 152 ? 480.734 43.944  399.546 1.00 59.40  ?  209 GLY I C   1 
ATOM   9269  O O   . GLY I  1 152 ? 481.746 44.415  399.024 1.00 63.90  ?  209 GLY I O   1 
ATOM   9270  N N   . GLN I  1 153 ? 480.788 43.016  400.497 1.00 57.23  ?  210 GLN I N   1 
ATOM   9271  C CA  . GLN I  1 153 ? 482.065 42.513  400.983 1.00 54.93  ?  210 GLN I CA  1 
ATOM   9272  C C   . GLN I  1 153 ? 482.722 41.636  399.925 1.00 51.81  ?  210 GLN I C   1 
ATOM   9273  O O   . GLN I  1 153 ? 482.122 40.672  399.441 1.00 56.31  ?  210 GLN I O   1 
ATOM   9274  C CB  . GLN I  1 153 ? 481.866 41.726  402.277 1.00 50.05  ?  210 GLN I CB  1 
ATOM   9275  C CG  . GLN I  1 153 ? 483.150 41.438  403.038 1.00 56.19  ?  210 GLN I CG  1 
ATOM   9276  C CD  . GLN I  1 153 ? 483.617 42.621  403.865 1.00 62.29  ?  210 GLN I CD  1 
ATOM   9277  O OE1 . GLN I  1 153 ? 484.700 43.161  403.642 1.00 64.09  ?  210 GLN I OE1 1 
ATOM   9278  N NE2 . GLN I  1 153 ? 482.800 43.026  404.831 1.00 64.72  ?  210 GLN I NE2 1 
ATOM   9279  N N   . ARG I  1 154 ? 483.956 41.974  399.565 1.00 50.55  ?  211 ARG I N   1 
ATOM   9280  C CA  . ARG I  1 154 ? 484.734 41.197  398.610 1.00 54.67  ?  211 ARG I CA  1 
ATOM   9281  C C   . ARG I  1 154 ? 485.658 40.252  399.365 1.00 52.41  ?  211 ARG I C   1 
ATOM   9282  O O   . ARG I  1 154 ? 486.379 40.676  400.275 1.00 56.26  ?  211 ARG I O   1 
ATOM   9283  C CB  . ARG I  1 154 ? 485.546 42.110  397.689 1.00 60.52  ?  211 ARG I CB  1 
ATOM   9284  C CG  . ARG I  1 154 ? 484.710 42.960  396.746 1.00 63.11  ?  211 ARG I CG  1 
ATOM   9285  C CD  . ARG I  1 154 ? 484.526 44.374  397.269 1.00 60.91  ?  211 ARG I CD  1 
ATOM   9286  N NE  . ARG I  1 154 ? 485.801 45.069  397.422 1.00 56.70  ?  211 ARG I NE  1 
ATOM   9287  C CZ  . ARG I  1 154 ? 486.427 45.707  396.438 1.00 61.62  ?  211 ARG I CZ  1 
ATOM   9288  N NH1 . ARG I  1 154 ? 485.898 45.739  395.223 1.00 62.16  ?  211 ARG I NH1 1 
ATOM   9289  N NH2 . ARG I  1 154 ? 487.585 46.312  396.668 1.00 64.17  ?  211 ARG I NH2 1 
ATOM   9290  N N   . LEU I  1 155 ? 485.632 38.976  398.991 1.00 36.12  ?  212 LEU I N   1 
ATOM   9291  C CA  . LEU I  1 155 ? 486.437 37.946  399.639 1.00 36.33  ?  212 LEU I CA  1 
ATOM   9292  C C   . LEU I  1 155 ? 487.533 37.507  398.675 1.00 38.53  ?  212 LEU I C   1 
ATOM   9293  O O   . LEU I  1 155 ? 487.253 36.855  397.663 1.00 37.79  ?  212 LEU I O   1 
ATOM   9294  C CB  . LEU I  1 155 ? 485.575 36.758  400.061 1.00 32.89  ?  212 LEU I CB  1 
ATOM   9295  C CG  . LEU I  1 155 ? 484.741 36.857  401.342 1.00 36.42  ?  212 LEU I CG  1 
ATOM   9296  C CD1 . LEU I  1 155 ? 483.619 37.880  401.214 1.00 43.02  ?  212 LEU I CD1 1 
ATOM   9297  C CD2 . LEU I  1 155 ? 484.178 35.493  401.709 1.00 40.76  ?  212 LEU I CD2 1 
ATOM   9298  N N   . GLY I  1 156 ? 488.776 37.867  398.989 1.00 44.41  ?  213 GLY I N   1 
ATOM   9299  C CA  . GLY I  1 156 ? 489.920 37.407  398.239 1.00 43.48  ?  213 GLY I CA  1 
ATOM   9300  C C   . GLY I  1 156 ? 490.596 36.227  398.912 1.00 39.88  ?  213 GLY I C   1 
ATOM   9301  O O   . GLY I  1 156 ? 490.417 35.981  400.102 1.00 42.44  ?  213 GLY I O   1 
ATOM   9302  N N   . VAL I  1 157 ? 491.381 35.491  398.127 1.00 26.74  ?  214 VAL I N   1 
ATOM   9303  C CA  . VAL I  1 157 ? 492.138 34.345  398.624 1.00 23.44  ?  214 VAL I CA  1 
ATOM   9304  C C   . VAL I  1 157 ? 493.534 34.404  398.022 1.00 31.88  ?  214 VAL I C   1 
ATOM   9305  O O   . VAL I  1 157 ? 493.683 34.435  396.795 1.00 39.37  ?  214 VAL I O   1 
ATOM   9306  C CB  . VAL I  1 157 ? 491.468 33.003  398.284 1.00 19.91  ?  214 VAL I CB  1 
ATOM   9307  C CG1 . VAL I  1 157 ? 492.413 31.851  398.583 1.00 20.08  ?  214 VAL I CG1 1 
ATOM   9308  C CG2 . VAL I  1 157 ? 490.170 32.840  399.063 1.00 24.93  ?  214 VAL I CG2 1 
ATOM   9309  N N   . HIS I  1 158 ? 494.555 34.415  398.876 1.00 57.26  ?  215 HIS I N   1 
ATOM   9310  C CA  . HIS I  1 158 ? 495.945 34.448  398.445 1.00 57.74  ?  215 HIS I CA  1 
ATOM   9311  C C   . HIS I  1 158 ? 496.655 33.203  398.953 1.00 57.64  ?  215 HIS I C   1 
ATOM   9312  O O   . HIS I  1 158 ? 496.498 32.825  400.118 1.00 61.16  ?  215 HIS I O   1 
ATOM   9313  C CB  . HIS I  1 158 ? 496.655 35.707  398.953 1.00 63.53  ?  215 HIS I CB  1 
ATOM   9314  C CG  . HIS I  1 158 ? 496.050 36.984  398.459 1.00 63.52  ?  215 HIS I CG  1 
ATOM   9315  N ND1 . HIS I  1 158 ? 495.151 37.720  399.200 1.00 66.26  ?  215 HIS I ND1 1 
ATOM   9316  C CD2 . HIS I  1 158 ? 496.216 37.657  397.296 1.00 66.50  ?  215 HIS I CD2 1 
ATOM   9317  C CE1 . HIS I  1 158 ? 494.788 38.790  398.516 1.00 69.57  ?  215 HIS I CE1 1 
ATOM   9318  N NE2 . HIS I  1 158 ? 495.421 38.775  397.357 1.00 71.56  ?  215 HIS I NE2 1 
ATOM   9319  N N   . LEU I  1 159 ? 497.431 32.571  398.079 1.00 47.09  ?  216 LEU I N   1 
ATOM   9320  C CA  . LEU I  1 159 ? 498.198 31.382  398.425 1.00 39.91  ?  216 LEU I CA  1 
ATOM   9321  C C   . LEU I  1 159 ? 499.651 31.776  398.651 1.00 43.90  ?  216 LEU I C   1 
ATOM   9322  O O   . LEU I  1 159 ? 500.250 32.465  397.818 1.00 56.37  ?  216 LEU I O   1 
ATOM   9323  C CB  . LEU I  1 159 ? 498.088 30.326  397.324 1.00 36.55  ?  216 LEU I CB  1 
ATOM   9324  C CG  . LEU I  1 159 ? 498.502 28.889  397.652 1.00 35.92  ?  216 LEU I CG  1 
ATOM   9325  C CD1 . LEU I  1 159 ? 497.700 27.915  396.805 1.00 32.06  ?  216 LEU I CD1 1 
ATOM   9326  C CD2 . LEU I  1 159 ? 499.992 28.673  397.433 1.00 46.80  ?  216 LEU I CD2 1 
ATOM   9327  N N   . HIS I  1 160 ? 500.211 31.339  399.776 1.00 54.53  ?  217 HIS I N   1 
ATOM   9328  C CA  . HIS I  1 160 ? 501.595 31.624  400.134 1.00 59.13  ?  217 HIS I CA  1 
ATOM   9329  C C   . HIS I  1 160 ? 502.279 30.311  400.480 1.00 60.34  ?  217 HIS I C   1 
ATOM   9330  O O   . HIS I  1 160 ? 501.900 29.652  401.453 1.00 64.56  ?  217 HIS I O   1 
ATOM   9331  C CB  . HIS I  1 160 ? 501.669 32.600  401.313 1.00 63.68  ?  217 HIS I CB  1 
ATOM   9332  C CG  . HIS I  1 160 ? 503.064 32.912  401.758 1.00 72.54  ?  217 HIS I CG  1 
ATOM   9333  N ND1 . HIS I  1 160 ? 504.157 32.786  400.929 1.00 73.61  ?  217 HIS I ND1 1 
ATOM   9334  C CD2 . HIS I  1 160 ? 503.542 33.346  402.948 1.00 81.44  ?  217 HIS I CD2 1 
ATOM   9335  C CE1 . HIS I  1 160 ? 505.249 33.127  401.590 1.00 74.06  ?  217 HIS I CE1 1 
ATOM   9336  N NE2 . HIS I  1 160 ? 504.904 33.471  402.818 1.00 79.58  ?  217 HIS I NE2 1 
ATOM   9337  N N   . THR I  1 161 ? 503.278 29.930  399.690 1.00 45.04  ?  218 THR I N   1 
ATOM   9338  C CA  . THR I  1 161 ? 503.978 28.671  399.886 1.00 46.74  ?  218 THR I CA  1 
ATOM   9339  C C   . THR I  1 161 ? 505.398 28.919  400.375 1.00 45.08  ?  218 THR I C   1 
ATOM   9340  O O   . THR I  1 161 ? 506.033 29.914  400.010 1.00 49.65  ?  218 THR I O   1 
ATOM   9341  C CB  . THR I  1 161 ? 504.005 27.836  398.599 1.00 49.63  ?  218 THR I CB  1 
ATOM   9342  O OG1 . THR I  1 161 ? 504.465 26.512  398.897 1.00 49.64  ?  218 THR I OG1 1 
ATOM   9343  C CG2 . THR I  1 161 ? 504.924 28.458  397.556 1.00 50.43  ?  218 THR I CG2 1 
ATOM   9344  N N   . GLU I  1 162 ? 505.871 28.024  401.240 1.00 34.23  ?  219 GLU I N   1 
ATOM   9345  C CA  . GLU I  1 162 ? 507.272 27.958  401.641 1.00 39.35  ?  219 GLU I CA  1 
ATOM   9346  C C   . GLU I  1 162 ? 507.709 26.511  401.471 1.00 43.42  ?  219 GLU I C   1 
ATOM   9347  O O   . GLU I  1 162 ? 507.225 25.626  402.185 1.00 44.03  ?  219 GLU I O   1 
ATOM   9348  C CB  . GLU I  1 162 ? 507.464 28.429  403.083 1.00 40.06  ?  219 GLU I CB  1 
ATOM   9349  C CG  . GLU I  1 162 ? 508.915 28.477  403.532 1.00 52.97  ?  219 GLU I CG  1 
ATOM   9350  C CD  . GLU I  1 162 ? 509.058 28.765  405.015 1.00 68.54  ?  219 GLU I CD  1 
ATOM   9351  O OE1 . GLU I  1 162 ? 510.203 28.767  405.516 1.00 62.36  ?  219 GLU I OE1 1 
ATOM   9352  O OE2 . GLU I  1 162 ? 508.024 28.991  405.679 1.00 75.11  -1 219 GLU I OE2 1 
ATOM   9353  N N   . ALA I  1 163 ? 508.616 26.265  400.530 1.00 36.14  ?  220 ALA I N   1 
ATOM   9354  C CA  . ALA I  1 163 ? 508.971 24.896  400.189 1.00 31.91  ?  220 ALA I CA  1 
ATOM   9355  C C   . ALA I  1 163 ? 510.354 24.870  399.559 1.00 41.10  ?  220 ALA I C   1 
ATOM   9356  O O   . ALA I  1 163 ? 510.874 25.894  399.108 1.00 48.52  ?  220 ALA I O   1 
ATOM   9357  C CB  . ALA I  1 163 ? 507.939 24.271  399.245 1.00 27.37  ?  220 ALA I CB  1 
ATOM   9358  N N   . ARG I  1 164 ? 510.940 23.673  399.536 1.00 64.40  ?  221 ARG I N   1 
ATOM   9359  C CA  . ARG I  1 164 ? 512.223 23.469  398.873 1.00 68.56  ?  221 ARG I CA  1 
ATOM   9360  C C   . ARG I  1 164 ? 512.052 23.440  397.358 1.00 78.74  ?  221 ARG I C   1 
ATOM   9361  O O   . ARG I  1 164 ? 512.610 24.277  396.640 1.00 90.08  ?  221 ARG I O   1 
ATOM   9362  C CB  . ARG I  1 164 ? 512.871 22.172  399.366 1.00 78.47  ?  221 ARG I CB  1 
ATOM   9363  C CG  . ARG I  1 164 ? 513.493 22.262  400.750 1.00 82.47  ?  221 ARG I CG  1 
ATOM   9364  C CD  . ARG I  1 164 ? 514.221 20.973  401.100 1.00 106.36 ?  221 ARG I CD  1 
ATOM   9365  N NE  . ARG I  1 164 ? 515.002 21.091  402.329 1.00 125.30 ?  221 ARG I NE  1 
ATOM   9366  C CZ  . ARG I  1 164 ? 515.747 20.114  402.837 1.00 122.06 ?  221 ARG I CZ  1 
ATOM   9367  N NH1 . ARG I  1 164 ? 515.814 18.941  402.224 1.00 106.70 ?  221 ARG I NH1 1 
ATOM   9368  N NH2 . ARG I  1 164 ? 516.426 20.311  403.960 1.00 120.76 ?  221 ARG I NH2 1 
ATOM   9369  N N   . ALA I  1 165 ? 511.282 22.472  396.858 1.00 74.38  ?  222 ALA I N   1 
ATOM   9370  C CA  . ALA I  1 165 ? 511.111 22.312  395.419 1.00 70.26  ?  222 ALA I CA  1 
ATOM   9371  C C   . ALA I  1 165 ? 510.210 23.400  394.845 1.00 79.36  ?  222 ALA I C   1 
ATOM   9372  O O   . ALA I  1 165 ? 510.623 24.158  393.959 1.00 83.72  ?  222 ALA I O   1 
ATOM   9373  C CB  . ALA I  1 165 ? 510.548 20.924  395.111 1.00 58.14  ?  222 ALA I CB  1 
ATOM   9374  N N   . ARG I  1 166 ? 508.957 23.451  395.313 1.00 69.61  ?  223 ARG I N   1 
ATOM   9375  C CA  . ARG I  1 166 ? 507.874 24.300  394.812 1.00 64.31  ?  223 ARG I CA  1 
ATOM   9376  C C   . ARG I  1 166 ? 507.335 23.718  393.510 1.00 63.67  ?  223 ARG I C   1 
ATOM   9377  O O   . ARG I  1 166 ? 506.215 24.034  393.092 1.00 71.41  ?  223 ARG I O   1 
ATOM   9378  C CB  . ARG I  1 166 ? 508.328 25.756  394.631 1.00 71.41  ?  223 ARG I CB  1 
ATOM   9379  C CG  . ARG I  1 166 ? 507.256 26.700  394.110 1.00 67.28  ?  223 ARG I CG  1 
ATOM   9380  C CD  . ARG I  1 166 ? 507.855 28.016  393.647 1.00 72.42  ?  223 ARG I CD  1 
ATOM   9381  N NE  . ARG I  1 166 ? 507.978 28.975  394.738 1.00 83.33  ?  223 ARG I NE  1 
ATOM   9382  C CZ  . ARG I  1 166 ? 507.122 29.969  394.954 1.00 94.18  ?  223 ARG I CZ  1 
ATOM   9383  N NH1 . ARG I  1 166 ? 506.080 30.133  394.150 1.00 88.83  ?  223 ARG I NH1 1 
ATOM   9384  N NH2 . ARG I  1 166 ? 507.307 30.800  395.971 1.00 85.82  ?  223 ARG I NH2 1 
ATOM   9385  N N   . HIS I  1 167 ? 508.108 22.841  392.884 1.00 35.55  ?  224 HIS I N   1 
ATOM   9386  C CA  . HIS I  1 167 ? 507.589 21.906  391.905 1.00 34.27  ?  224 HIS I CA  1 
ATOM   9387  C C   . HIS I  1 167 ? 507.351 20.584  392.627 1.00 33.83  ?  224 HIS I C   1 
ATOM   9388  O O   . HIS I  1 167 ? 507.437 20.509  393.858 1.00 35.64  ?  224 HIS I O   1 
ATOM   9389  C CB  . HIS I  1 167 ? 508.540 21.783  390.711 1.00 27.53  ?  224 HIS I CB  1 
ATOM   9390  C CG  . HIS I  1 167 ? 509.864 21.170  391.044 1.00 28.31  ?  224 HIS I CG  1 
ATOM   9391  N ND1 . HIS I  1 167 ? 510.065 19.807  391.085 1.00 29.23  ?  224 HIS I ND1 1 
ATOM   9392  C CD2 . HIS I  1 167 ? 511.058 21.735  391.341 1.00 30.92  ?  224 HIS I CD2 1 
ATOM   9393  C CE1 . HIS I  1 167 ? 511.324 19.559  391.397 1.00 30.21  ?  224 HIS I CE1 1 
ATOM   9394  N NE2 . HIS I  1 167 ? 511.948 20.712  391.558 1.00 26.94  ?  224 HIS I NE2 1 
ATOM   9395  N N   . ALA I  1 168 ? 507.006 19.541  391.870 1.00 46.17  ?  225 ALA I N   1 
ATOM   9396  C CA  . ALA I  1 168 ? 506.722 18.217  392.421 1.00 47.98  ?  225 ALA I CA  1 
ATOM   9397  C C   . ALA I  1 168 ? 505.462 18.225  393.283 1.00 46.05  ?  225 ALA I C   1 
ATOM   9398  O O   . ALA I  1 168 ? 504.993 17.167  393.711 1.00 48.81  ?  225 ALA I O   1 
ATOM   9399  C CB  . ALA I  1 168 ? 507.915 17.683  393.223 1.00 44.97  ?  225 ALA I CB  1 
ATOM   9400  N N   . TRP I  1 169 ? 504.909 19.408  393.542 1.00 30.23  ?  226 TRP I N   1 
ATOM   9401  C CA  . TRP I  1 169 ? 503.674 19.555  394.303 1.00 31.48  ?  226 TRP I CA  1 
ATOM   9402  C C   . TRP I  1 169 ? 502.786 20.556  393.582 1.00 29.28  ?  226 TRP I C   1 
ATOM   9403  O O   . TRP I  1 169 ? 503.203 21.691  393.336 1.00 28.61  ?  226 TRP I O   1 
ATOM   9404  C CB  . TRP I  1 169 ? 503.947 20.018  395.738 1.00 35.17  ?  226 TRP I CB  1 
ATOM   9405  C CG  . TRP I  1 169 ? 504.338 18.919  396.682 1.00 35.53  ?  226 TRP I CG  1 
ATOM   9406  C CD1 . TRP I  1 169 ? 505.600 18.596  397.089 1.00 39.08  ?  226 TRP I CD1 1 
ATOM   9407  C CD2 . TRP I  1 169 ? 503.458 18.001  397.342 1.00 36.86  ?  226 TRP I CD2 1 
ATOM   9408  N NE1 . TRP I  1 169 ? 505.560 17.534  397.961 1.00 36.10  ?  226 TRP I NE1 1 
ATOM   9409  C CE2 . TRP I  1 169 ? 504.257 17.150  398.132 1.00 34.81  ?  226 TRP I CE2 1 
ATOM   9410  C CE3 . TRP I  1 169 ? 502.072 17.815  397.341 1.00 34.28  ?  226 TRP I CE3 1 
ATOM   9411  C CZ2 . TRP I  1 169 ? 503.715 16.129  398.911 1.00 38.50  ?  226 TRP I CZ2 1 
ATOM   9412  C CZ3 . TRP I  1 169 ? 501.536 16.802  398.116 1.00 31.54  ?  226 TRP I CZ3 1 
ATOM   9413  C CH2 . TRP I  1 169 ? 502.356 15.973  398.889 1.00 37.80  ?  226 TRP I CH2 1 
ATOM   9414  N N   . GLN I  1 170 ? 501.572 20.134  393.241 1.00 25.82  ?  227 GLN I N   1 
ATOM   9415  C CA  . GLN I  1 170 ? 500.600 20.996  392.589 1.00 27.61  ?  227 GLN I CA  1 
ATOM   9416  C C   . GLN I  1 170 ? 499.243 20.780  393.237 1.00 34.30  ?  227 GLN I C   1 
ATOM   9417  O O   . GLN I  1 170 ? 498.959 19.705  393.773 1.00 46.35  ?  227 GLN I O   1 
ATOM   9418  C CB  . GLN I  1 170 ? 500.514 20.723  391.081 1.00 36.77  ?  227 GLN I CB  1 
ATOM   9419  C CG  . GLN I  1 170 ? 501.822 20.924  390.330 1.00 37.23  ?  227 GLN I CG  1 
ATOM   9420  C CD  . GLN I  1 170 ? 501.708 20.588  388.856 1.00 35.07  ?  227 GLN I CD  1 
ATOM   9421  O OE1 . GLN I  1 170 ? 500.608 20.430  388.325 1.00 37.56  ?  227 GLN I OE1 1 
ATOM   9422  N NE2 . GLN I  1 170 ? 502.848 20.479  388.184 1.00 33.79  ?  227 GLN I NE2 1 
ATOM   9423  N N   . LEU I  1 171 ? 498.407 21.815  393.189 1.00 31.45  ?  228 LEU I N   1 
ATOM   9424  C CA  . LEU I  1 171 ? 497.073 21.719  393.768 1.00 35.07  ?  228 LEU I CA  1 
ATOM   9425  C C   . LEU I  1 171 ? 496.248 20.684  393.016 1.00 35.50  ?  228 LEU I C   1 
ATOM   9426  O O   . LEU I  1 171 ? 496.186 20.701  391.783 1.00 43.43  ?  228 LEU I O   1 
ATOM   9427  C CB  . LEU I  1 171 ? 496.379 23.080  393.730 1.00 37.85  ?  228 LEU I CB  1 
ATOM   9428  C CG  . LEU I  1 171 ? 497.083 24.237  394.440 1.00 35.77  ?  228 LEU I CG  1 
ATOM   9429  C CD1 . LEU I  1 171 ? 496.293 25.527  394.283 1.00 29.30  ?  228 LEU I CD1 1 
ATOM   9430  C CD2 . LEU I  1 171 ? 497.306 23.914  395.908 1.00 36.09  ?  228 LEU I CD2 1 
ATOM   9431  N N   . THR I  1 172 ? 495.624 19.772  393.759 1.00 23.93  ?  229 THR I N   1 
ATOM   9432  C CA  . THR I  1 172 ? 494.770 18.771  393.135 1.00 23.68  ?  229 THR I CA  1 
ATOM   9433  C C   . THR I  1 172 ? 493.590 19.450  392.455 1.00 29.04  ?  229 THR I C   1 
ATOM   9434  O O   . THR I  1 172 ? 492.864 20.234  393.074 1.00 32.96  ?  229 THR I O   1 
ATOM   9435  C CB  . THR I  1 172 ? 494.277 17.760  394.172 1.00 24.62  ?  229 THR I CB  1 
ATOM   9436  O OG1 . THR I  1 172 ? 495.394 17.030  394.696 1.00 34.82  ?  229 THR I OG1 1 
ATOM   9437  C CG2 . THR I  1 172 ? 493.300 16.782  393.539 1.00 21.78  ?  229 THR I CG2 1 
ATOM   9438  N N   . GLN I  1 173 ? 493.402 19.145  391.174 1.00 32.57  ?  230 GLN I N   1 
ATOM   9439  C CA  . GLN I  1 173 ? 492.418 19.850  390.364 1.00 29.40  ?  230 GLN I CA  1 
ATOM   9440  C C   . GLN I  1 173 ? 491.009 19.484  390.811 1.00 31.78  ?  230 GLN I C   1 
ATOM   9441  O O   . GLN I  1 173 ? 490.647 18.303  390.850 1.00 33.76  ?  230 GLN I O   1 
ATOM   9442  C CB  . GLN I  1 173 ? 492.629 19.516  388.890 1.00 31.96  ?  230 GLN I CB  1 
ATOM   9443  C CG  . GLN I  1 173 ? 494.097 19.454  388.493 1.00 33.65  ?  230 GLN I CG  1 
ATOM   9444  C CD  . GLN I  1 173 ? 494.336 19.873  387.059 1.00 38.67  ?  230 GLN I CD  1 
ATOM   9445  O OE1 . GLN I  1 173 ? 493.447 20.418  386.404 1.00 44.88  ?  230 GLN I OE1 1 
ATOM   9446  N NE2 . GLN I  1 173 ? 495.542 19.624  386.564 1.00 34.74  ?  230 GLN I NE2 1 
ATOM   9447  N N   . GLY I  1 174 ? 490.215 20.501  391.147 1.00 45.19  ?  231 GLY I N   1 
ATOM   9448  C CA  . GLY I  1 174 ? 488.862 20.309  391.612 1.00 40.80  ?  231 GLY I CA  1 
ATOM   9449  C C   . GLY I  1 174 ? 488.720 20.079  393.103 1.00 42.38  ?  231 GLY I C   1 
ATOM   9450  O O   . GLY I  1 174 ? 487.608 20.191  393.628 1.00 45.15  ?  231 GLY I O   1 
ATOM   9451  N N   . ALA I  1 175 ? 489.810 19.755  393.797 1.00 60.68  ?  232 ALA I N   1 
ATOM   9452  C CA  . ALA I  1 175 ? 489.754 19.478  395.226 1.00 65.97  ?  232 ALA I CA  1 
ATOM   9453  C C   . ALA I  1 175 ? 490.018 20.700  396.095 1.00 60.96  ?  232 ALA I C   1 
ATOM   9454  O O   . ALA I  1 175 ? 489.819 20.625  397.312 1.00 65.94  ?  232 ALA I O   1 
ATOM   9455  C CB  . ALA I  1 175 ? 490.752 18.373  395.585 1.00 67.89  ?  232 ALA I CB  1 
ATOM   9456  N N   . THR I  1 176 ? 490.456 21.814  395.514 1.00 19.35  ?  233 THR I N   1 
ATOM   9457  C CA  . THR I  1 176 ? 490.680 23.050  396.255 1.00 20.57  ?  233 THR I CA  1 
ATOM   9458  C C   . THR I  1 176 ? 489.459 23.939  396.053 1.00 22.94  ?  233 THR I C   1 
ATOM   9459  O O   . THR I  1 176 ? 489.199 24.404  394.938 1.00 24.54  ?  233 THR I O   1 
ATOM   9460  C CB  . THR I  1 176 ? 491.957 23.746  395.792 1.00 23.12  ?  233 THR I CB  1 
ATOM   9461  O OG1 . THR I  1 176 ? 493.065 22.848  395.929 1.00 23.45  ?  233 THR I OG1 1 
ATOM   9462  C CG2 . THR I  1 176 ? 492.216 24.990  396.629 1.00 21.64  ?  233 THR I CG2 1 
ATOM   9463  N N   . VAL I  1 177 ? 488.707 24.171  397.127 1.00 22.85  ?  234 VAL I N   1 
ATOM   9464  C CA  . VAL I  1 177 ? 487.388 24.783  397.032 1.00 18.13  ?  234 VAL I CA  1 
ATOM   9465  C C   . VAL I  1 177 ? 487.206 25.799  398.150 1.00 19.10  ?  234 VAL I C   1 
ATOM   9466  O O   . VAL I  1 177 ? 487.433 25.488  399.324 1.00 26.48  ?  234 VAL I O   1 
ATOM   9467  C CB  . VAL I  1 177 ? 486.270 23.723  397.091 1.00 18.46  ?  234 VAL I CB  1 
ATOM   9468  C CG1 . VAL I  1 177 ? 484.926 24.377  397.372 1.00 22.52  ?  234 VAL I CG1 1 
ATOM   9469  C CG2 . VAL I  1 177 ? 486.219 22.937  395.794 1.00 24.41  ?  234 VAL I CG2 1 
ATOM   9470  N N   . LEU I  1 178 ? 486.804 27.011  397.782 1.00 27.27  ?  235 LEU I N   1 
ATOM   9471  C CA  . LEU I  1 178 ? 486.204 27.954  398.713 1.00 24.98  ?  235 LEU I CA  1 
ATOM   9472  C C   . LEU I  1 178 ? 484.690 27.819  398.627 1.00 29.92  ?  235 LEU I C   1 
ATOM   9473  O O   . LEU I  1 178 ? 484.136 27.637  397.540 1.00 36.81  ?  235 LEU I O   1 
ATOM   9474  C CB  . LEU I  1 178 ? 486.630 29.387  398.387 1.00 28.23  ?  235 LEU I CB  1 
ATOM   9475  C CG  . LEU I  1 178 ? 485.817 30.523  399.012 1.00 27.64  ?  235 LEU I CG  1 
ATOM   9476  C CD1 . LEU I  1 178 ? 485.955 30.518  400.524 1.00 26.84  ?  235 LEU I CD1 1 
ATOM   9477  C CD2 . LEU I  1 178 ? 486.237 31.867  398.435 1.00 34.41  ?  235 LEU I CD2 1 
ATOM   9478  N N   . GLY I  1 179 ? 484.021 27.913  399.772 1.00 41.95  ?  236 GLY I N   1 
ATOM   9479  C CA  . GLY I  1 179 ? 482.587 27.699  399.799 1.00 39.48  ?  236 GLY I CA  1 
ATOM   9480  C C   . GLY I  1 179 ? 481.913 28.543  400.858 1.00 37.82  ?  236 GLY I C   1 
ATOM   9481  O O   . GLY I  1 179 ? 482.534 28.983  401.830 1.00 41.64  ?  236 GLY I O   1 
ATOM   9482  N N   . LEU I  1 180 ? 480.617 28.761  400.649 1.00 18.48  ?  237 LEU I N   1 
ATOM   9483  C CA  . LEU I  1 180 ? 479.868 29.729  401.433 1.00 17.59  ?  237 LEU I CA  1 
ATOM   9484  C C   . LEU I  1 180 ? 478.404 29.314  401.492 1.00 16.82  ?  237 LEU I C   1 
ATOM   9485  O O   . LEU I  1 180 ? 477.861 28.805  400.509 1.00 18.92  ?  237 LEU I O   1 
ATOM   9486  C CB  . LEU I  1 180 ? 480.017 31.121  400.810 1.00 19.39  ?  237 LEU I CB  1 
ATOM   9487  C CG  . LEU I  1 180 ? 479.932 32.385  401.660 1.00 23.44  ?  237 LEU I CG  1 
ATOM   9488  C CD1 . LEU I  1 180 ? 480.538 33.551  400.899 1.00 30.58  ?  237 LEU I CD1 1 
ATOM   9489  C CD2 . LEU I  1 180 ? 478.493 32.677  401.982 1.00 26.84  ?  237 LEU I CD2 1 
ATOM   9490  N N   . PHE I  1 181 ? 477.774 29.533  402.645 1.00 23.77  ?  238 PHE I N   1 
ATOM   9491  C CA  . PHE I  1 181 ? 476.320 29.483  402.733 1.00 32.69  ?  238 PHE I CA  1 
ATOM   9492  C C   . PHE I  1 181 ? 475.873 30.330  403.917 1.00 35.23  ?  238 PHE I C   1 
ATOM   9493  O O   . PHE I  1 181 ? 476.652 30.612  404.833 1.00 35.48  ?  238 PHE I O   1 
ATOM   9494  C CB  . PHE I  1 181 ? 475.780 28.046  402.831 1.00 31.58  ?  238 PHE I CB  1 
ATOM   9495  C CG  . PHE I  1 181 ? 476.208 27.297  404.060 1.00 24.25  ?  238 PHE I CG  1 
ATOM   9496  C CD1 . PHE I  1 181 ? 475.501 27.418  405.246 1.00 27.83  ?  238 PHE I CD1 1 
ATOM   9497  C CD2 . PHE I  1 181 ? 477.286 26.434  404.016 1.00 25.69  ?  238 PHE I CD2 1 
ATOM   9498  C CE1 . PHE I  1 181 ? 475.884 26.716  406.372 1.00 34.57  ?  238 PHE I CE1 1 
ATOM   9499  C CE2 . PHE I  1 181 ? 477.673 25.727  405.136 1.00 25.59  ?  238 PHE I CE2 1 
ATOM   9500  C CZ  . PHE I  1 181 ? 476.972 25.868  406.316 1.00 30.39  ?  238 PHE I CZ  1 
ATOM   9501  N N   . ARG I  1 182 ? 474.604 30.725  403.883 1.00 40.59  ?  239 ARG I N   1 
ATOM   9502  C CA  . ARG I  1 182 ? 474.087 31.752  404.777 1.00 41.59  ?  239 ARG I CA  1 
ATOM   9503  C C   . ARG I  1 182 ? 473.481 31.143  406.035 1.00 44.08  ?  239 ARG I C   1 
ATOM   9504  O O   . ARG I  1 182 ? 472.842 30.088  405.986 1.00 50.55  ?  239 ARG I O   1 
ATOM   9505  C CB  . ARG I  1 182 ? 473.043 32.605  404.052 1.00 49.04  ?  239 ARG I CB  1 
ATOM   9506  C CG  . ARG I  1 182 ? 472.359 33.631  404.932 1.00 47.18  ?  239 ARG I CG  1 
ATOM   9507  C CD  . ARG I  1 182 ? 472.043 34.903  404.170 1.00 47.53  ?  239 ARG I CD  1 
ATOM   9508  N NE  . ARG I  1 182 ? 471.468 35.917  405.046 1.00 62.94  ?  239 ARG I NE  1 
ATOM   9509  C CZ  . ARG I  1 182 ? 471.443 37.216  404.772 1.00 74.35  ?  239 ARG I CZ  1 
ATOM   9510  N NH1 . ARG I  1 182 ? 471.965 37.667  403.639 1.00 76.07  ?  239 ARG I NH1 1 
ATOM   9511  N NH2 . ARG I  1 182 ? 470.899 38.066  405.633 1.00 69.12  ?  239 ARG I NH2 1 
ATOM   9512  N N   . VAL I  1 183 ? 473.691 31.820  407.163 1.00 32.71  ?  240 VAL I N   1 
ATOM   9513  C CA  . VAL I  1 183 ? 473.105 31.429  408.440 1.00 33.92  ?  240 VAL I CA  1 
ATOM   9514  C C   . VAL I  1 183 ? 471.956 32.372  408.776 1.00 45.58  ?  240 VAL I C   1 
ATOM   9515  O O   . VAL I  1 183 ? 470.805 31.940  408.911 1.00 50.59  ?  240 VAL I O   1 
ATOM   9516  C CB  . VAL I  1 183 ? 474.158 31.414  409.563 1.00 21.15  ?  240 VAL I CB  1 
ATOM   9517  C CG1 . VAL I  1 183 ? 473.485 31.274  410.918 1.00 30.71  ?  240 VAL I CG1 1 
ATOM   9518  C CG2 . VAL I  1 183 ? 475.144 30.282  409.340 1.00 22.59  ?  240 VAL I CG2 1 
ATOM   9519  N N   . THR I  1 184 ? 472.261 33.657  408.927 1.00 29.64  ?  241 THR I N   1 
ATOM   9520  C CA  . THR I  1 184 ? 471.251 34.650  409.282 1.00 29.98  ?  241 THR I CA  1 
ATOM   9521  C C   . THR I  1 184 ? 470.205 34.770  408.176 1.00 38.26  ?  241 THR I C   1 
ATOM   9522  O O   . THR I  1 184 ? 470.538 35.199  407.062 1.00 40.27  ?  241 THR I O   1 
ATOM   9523  C CB  . THR I  1 184 ? 471.903 36.007  409.532 1.00 26.18  ?  241 THR I CB  1 
ATOM   9524  O OG1 . THR I  1 184 ? 472.735 35.932  410.697 1.00 31.82  ?  241 THR I OG1 1 
ATOM   9525  C CG2 . THR I  1 184 ? 470.843 37.078  409.743 1.00 38.02  ?  241 THR I CG2 1 
ATOM   9526  N N   . PRO I  1 185 ? 468.948 34.424  408.437 1.00 49.09  ?  242 PRO I N   1 
ATOM   9527  C CA  . PRO I  1 185 ? 467.928 34.462  407.386 1.00 55.21  ?  242 PRO I CA  1 
ATOM   9528  C C   . PRO I  1 185 ? 467.418 35.872  407.123 1.00 54.48  ?  242 PRO I C   1 
ATOM   9529  O O   . PRO I  1 185 ? 467.527 36.776  407.954 1.00 46.67  ?  242 PRO I O   1 
ATOM   9530  C CB  . PRO I  1 185 ? 466.814 33.578  407.957 1.00 51.32  ?  242 PRO I CB  1 
ATOM   9531  C CG  . PRO I  1 185 ? 466.927 33.781  409.429 1.00 49.58  ?  242 PRO I CG  1 
ATOM   9532  C CD  . PRO I  1 185 ? 468.400 33.953  409.719 1.00 46.83  ?  242 PRO I CD  1 
ATOM   9533  N N   . GLU I  1 186 ? 466.849 36.039  405.935 1.00 101.72 ?  243 GLU I N   1 
ATOM   9534  C CA  . GLU I  1 186 ? 466.198 37.288  405.555 1.00 108.26 ?  243 GLU I CA  1 
ATOM   9535  C C   . GLU I  1 186 ? 464.753 37.040  405.135 1.00 114.49 ?  243 GLU I C   1 
ATOM   9536  O O   . GLU I  1 186 ? 464.218 35.948  405.330 1.00 119.58 ?  243 GLU I O   1 
ATOM   9537  C CB  . GLU I  1 186 ? 466.964 37.978  404.425 1.00 111.06 ?  243 GLU I CB  1 
ATOM   9538  C CG  . GLU I  1 186 ? 467.868 39.112  404.885 1.00 112.58 ?  243 GLU I CG  1 
ATOM   9539  C CD  . GLU I  1 186 ? 467.093 40.349  405.301 1.00 115.00 ?  243 GLU I CD  1 
ATOM   9540  O OE1 . GLU I  1 186 ? 467.701 41.439  405.360 1.00 119.12 ?  243 GLU I OE1 1 
ATOM   9541  O OE2 . GLU I  1 186 ? 465.877 40.237  405.566 1.00 108.11 -1 243 GLU I OE2 1 
ATOM   9542  N N   . ALA J  2 10  ? 478.618 13.848  375.854 1.00 39.57  ?  33  ALA J N   1 
ATOM   9543  C CA  . ALA J  2 10  ? 479.150 14.761  374.847 1.00 47.54  ?  33  ALA J CA  1 
ATOM   9544  C C   . ALA J  2 10  ? 478.190 15.924  374.619 1.00 47.97  ?  33  ALA J C   1 
ATOM   9545  O O   . ALA J  2 10  ? 477.059 15.724  374.174 1.00 49.53  ?  33  ALA J O   1 
ATOM   9546  C CB  . ALA J  2 10  ? 479.412 14.020  373.547 1.00 56.18  ?  33  ALA J CB  1 
ATOM   9547  N N   . GLY J  2 11  ? 478.646 17.138  374.915 1.00 45.60  ?  34  GLY J N   1 
ATOM   9548  C CA  . GLY J  2 11  ? 477.753 18.285  374.849 1.00 51.00  ?  34  GLY J CA  1 
ATOM   9549  C C   . GLY J  2 11  ? 476.674 18.141  375.904 1.00 55.07  ?  34  GLY J C   1 
ATOM   9550  O O   . GLY J  2 11  ? 476.965 17.964  377.094 1.00 53.83  ?  34  GLY J O   1 
ATOM   9551  N N   . THR J  2 12  ? 475.411 18.211  375.468 1.00 116.21 ?  35  THR J N   1 
ATOM   9552  C CA  . THR J  2 12  ? 474.263 17.876  376.307 1.00 124.48 ?  35  THR J CA  1 
ATOM   9553  C C   . THR J  2 12  ? 474.281 18.634  377.630 1.00 129.00 ?  35  THR J C   1 
ATOM   9554  O O   . THR J  2 12  ? 474.031 19.841  377.661 1.00 126.76 ?  35  THR J O   1 
ATOM   9555  C CB  . THR J  2 12  ? 474.193 16.363  376.561 1.00 124.95 ?  35  THR J CB  1 
ATOM   9556  O OG1 . THR J  2 12  ? 475.379 15.920  377.236 1.00 124.62 ?  35  THR J OG1 1 
ATOM   9557  C CG2 . THR J  2 12  ? 474.044 15.607  375.245 1.00 110.18 ?  35  THR J CG2 1 
ATOM   9558  N N   . PHE J  2 13  ? 474.468 17.895  378.725 1.00 106.66 ?  36  PHE J N   1 
ATOM   9559  C CA  . PHE J  2 13  ? 474.688 18.382  380.089 1.00 97.98  ?  36  PHE J CA  1 
ATOM   9560  C C   . PHE J  2 13  ? 473.456 19.062  380.685 1.00 101.79 ?  36  PHE J C   1 
ATOM   9561  O O   . PHE J  2 13  ? 473.425 19.324  381.892 1.00 108.56 ?  36  PHE J O   1 
ATOM   9562  C CB  . PHE J  2 13  ? 475.941 19.281  380.167 1.00 96.31  ?  36  PHE J CB  1 
ATOM   9563  C CG  . PHE J  2 13  ? 475.680 20.775  380.122 1.00 100.72 ?  36  PHE J CG  1 
ATOM   9564  C CD1 . PHE J  2 13  ? 475.411 21.484  381.285 1.00 97.70  ?  36  PHE J CD1 1 
ATOM   9565  C CD2 . PHE J  2 13  ? 475.843 21.489  378.948 1.00 102.16 ?  36  PHE J CD2 1 
ATOM   9566  C CE1 . PHE J  2 13  ? 475.203 22.852  381.250 1.00 90.94  ?  36  PHE J CE1 1 
ATOM   9567  C CE2 . PHE J  2 13  ? 475.637 22.853  378.909 1.00 106.12 ?  36  PHE J CE2 1 
ATOM   9568  C CZ  . PHE J  2 13  ? 475.323 23.537  380.062 1.00 102.08 ?  36  PHE J CZ  1 
ATOM   9569  N N   . CYS J  2 14  ? 472.433 19.309  379.870 1.00 95.46  ?  37  CYS J N   1 
ATOM   9570  C CA  . CYS J  2 14  ? 471.088 19.675  380.345 1.00 93.11  ?  37  CYS J CA  1 
ATOM   9571  C C   . CYS J  2 14  ? 471.199 20.894  381.259 1.00 94.08  ?  37  CYS J C   1 
ATOM   9572  O O   . CYS J  2 14  ? 471.878 21.866  380.891 1.00 101.42 ?  37  CYS J O   1 
ATOM   9573  C CB  . CYS J  2 14  ? 470.453 18.437  380.970 1.00 91.43  ?  37  CYS J CB  1 
ATOM   9574  S SG  . CYS J  2 14  ? 468.902 18.741  381.845 1.00 100.44 ?  37  CYS J SG  1 
ATOM   9575  N N   . ASP J  2 15  ? 470.575 20.892  382.433 1.00 71.70  ?  38  ASP J N   1 
ATOM   9576  C CA  . ASP J  2 15  ? 470.643 22.018  383.356 1.00 75.42  ?  38  ASP J CA  1 
ATOM   9577  C C   . ASP J  2 15  ? 470.354 21.572  384.787 1.00 77.63  ?  38  ASP J C   1 
ATOM   9578  O O   . ASP J  2 15  ? 469.200 21.538  385.216 1.00 72.33  ?  38  ASP J O   1 
ATOM   9579  C CB  . ASP J  2 15  ? 469.660 23.114  382.939 1.00 75.44  ?  38  ASP J CB  1 
ATOM   9580  C CG  . ASP J  2 15  ? 469.851 24.397  383.725 1.00 72.96  ?  38  ASP J CG  1 
ATOM   9581  O OD1 . ASP J  2 15  ? 470.741 25.192  383.359 1.00 62.89  -1 38  ASP J OD1 1 
ATOM   9582  O OD2 . ASP J  2 15  ? 469.109 24.609  384.708 1.00 67.07  ?  38  ASP J OD2 1 
ATOM   9583  N N   . CYS J  2 22  ? 469.555 20.556  377.326 1.00 67.69  ?  45  CYS J N   1 
ATOM   9584  C CA  . CYS J  2 22  ? 470.901 20.475  376.773 1.00 73.03  ?  45  CYS J CA  1 
ATOM   9585  C C   . CYS J  2 22  ? 471.388 21.846  376.312 1.00 77.87  ?  45  CYS J C   1 
ATOM   9586  O O   . CYS J  2 22  ? 470.591 22.764  376.116 1.00 82.01  ?  45  CYS J O   1 
ATOM   9587  C CB  . CYS J  2 22  ? 470.946 19.476  375.616 1.00 73.96  ?  45  CYS J CB  1 
ATOM   9588  S SG  . CYS J  2 22  ? 470.619 17.766  376.106 1.00 84.17  ?  45  CYS J SG  1 
ATOM   9589  N N   . SER J  2 23  ? 472.705 21.964  376.126 1.00 83.22  ?  46  SER J N   1 
ATOM   9590  C CA  . SER J  2 23  ? 473.383 23.212  375.797 1.00 83.15  ?  46  SER J CA  1 
ATOM   9591  C C   . SER J  2 23  ? 474.869 22.932  375.595 1.00 85.87  ?  46  SER J C   1 
ATOM   9592  O O   . SER J  2 23  ? 475.344 21.849  375.960 1.00 82.90  ?  46  SER J O   1 
ATOM   9593  C CB  . SER J  2 23  ? 473.174 24.253  376.903 1.00 79.19  ?  46  SER J CB  1 
ATOM   9594  O OG  . SER J  2 23  ? 471.837 24.721  376.930 1.00 89.23  ?  46  SER J OG  1 
ATOM   9595  N N   . PRO J  2 24  ? 475.631 23.853  375.003 1.00 86.88  ?  47  PRO J N   1 
ATOM   9596  C CA  . PRO J  2 24  ? 477.078 23.634  374.895 1.00 79.46  ?  47  PRO J CA  1 
ATOM   9597  C C   . PRO J  2 24  ? 477.755 23.744  376.252 1.00 78.65  ?  47  PRO J C   1 
ATOM   9598  O O   . PRO J  2 24  ? 477.422 24.609  377.065 1.00 77.86  ?  47  PRO J O   1 
ATOM   9599  C CB  . PRO J  2 24  ? 477.538 24.749  373.948 1.00 82.25  ?  47  PRO J CB  1 
ATOM   9600  C CG  . PRO J  2 24  ? 476.496 25.806  374.080 1.00 84.11  ?  47  PRO J CG  1 
ATOM   9601  C CD  . PRO J  2 24  ? 475.206 25.069  374.286 1.00 81.29  ?  47  PRO J CD  1 
ATOM   9602  N N   . CYS J  2 25  ? 478.720 22.851  376.490 1.00 91.72  ?  48  CYS J N   1 
ATOM   9603  C CA  . CYS J  2 25  ? 479.477 22.881  377.731 1.00 82.63  ?  48  CYS J CA  1 
ATOM   9604  C C   . CYS J  2 25  ? 480.278 24.178  377.829 1.00 80.02  ?  48  CYS J C   1 
ATOM   9605  O O   . CYS J  2 25  ? 480.570 24.819  376.815 1.00 84.95  ?  48  CYS J O   1 
ATOM   9606  C CB  . CYS J  2 25  ? 480.416 21.676  377.818 1.00 74.74  ?  48  CYS J CB  1 
ATOM   9607  S SG  . CYS J  2 25  ? 479.668 20.160  378.476 1.00 83.06  ?  48  CYS J SG  1 
ATOM   9608  N N   . PRO J  2 26  ? 480.642 24.584  379.043 1.00 79.84  ?  49  PRO J N   1 
ATOM   9609  C CA  . PRO J  2 26  ? 481.459 25.792  379.216 1.00 75.65  ?  49  PRO J CA  1 
ATOM   9610  C C   . PRO J  2 26  ? 482.813 25.641  378.541 1.00 76.69  ?  49  PRO J C   1 
ATOM   9611  O O   . PRO J  2 26  ? 483.145 24.556  378.040 1.00 81.80  ?  49  PRO J O   1 
ATOM   9612  C CB  . PRO J  2 26  ? 481.595 25.892  380.743 1.00 82.55  ?  49  PRO J CB  1 
ATOM   9613  C CG  . PRO J  2 26  ? 480.335 25.289  381.250 1.00 85.24  ?  49  PRO J CG  1 
ATOM   9614  C CD  . PRO J  2 26  ? 480.015 24.159  380.308 1.00 83.02  ?  49  PRO J CD  1 
ATOM   9615  N N   . PRO J  2 27  ? 483.631 26.702  378.512 1.00 64.07  ?  50  PRO J N   1 
ATOM   9616  C CA  . PRO J  2 27  ? 484.865 26.635  377.703 1.00 75.24  ?  50  PRO J CA  1 
ATOM   9617  C C   . PRO J  2 27  ? 485.856 25.567  378.142 1.00 75.11  ?  50  PRO J C   1 
ATOM   9618  O O   . PRO J  2 27  ? 486.391 24.839  377.296 1.00 78.70  ?  50  PRO J O   1 
ATOM   9619  C CB  . PRO J  2 27  ? 485.447 28.048  377.852 1.00 76.24  ?  50  PRO J CB  1 
ATOM   9620  C CG  . PRO J  2 27  ? 484.271 28.909  378.128 1.00 72.38  ?  50  PRO J CG  1 
ATOM   9621  C CD  . PRO J  2 27  ? 483.364 28.076  378.978 1.00 61.65  ?  50  PRO J CD  1 
ATOM   9622  N N   . ASN J  2 28  ? 486.118 25.449  379.441 1.00 81.31  ?  51  ASN J N   1 
ATOM   9623  C CA  . ASN J  2 28  ? 487.187 24.595  379.941 1.00 73.60  ?  51  ASN J CA  1 
ATOM   9624  C C   . ASN J  2 28  ? 486.719 23.197  380.329 1.00 76.99  ?  51  ASN J C   1 
ATOM   9625  O O   . ASN J  2 28  ? 487.519 22.421  380.859 1.00 80.78  ?  51  ASN J O   1 
ATOM   9626  C CB  . ASN J  2 28  ? 487.871 25.257  381.141 1.00 75.03  ?  51  ASN J CB  1 
ATOM   9627  C CG  . ASN J  2 28  ? 488.599 26.531  380.767 1.00 77.29  ?  51  ASN J CG  1 
ATOM   9628  O OD1 . ASN J  2 28  ? 489.695 26.493  380.208 1.00 79.57  ?  51  ASN J OD1 1 
ATOM   9629  N ND2 . ASN J  2 28  ? 487.994 27.672  381.081 1.00 72.77  ?  51  ASN J ND2 1 
ATOM   9630  N N   . SER J  2 29  ? 485.459 22.856  380.088 1.00 68.32  ?  52  SER J N   1 
ATOM   9631  C CA  . SER J  2 29  ? 484.880 21.629  380.615 1.00 66.59  ?  52  SER J CA  1 
ATOM   9632  C C   . SER J  2 29  ? 484.554 20.646  379.492 1.00 68.15  ?  52  SER J C   1 
ATOM   9633  O O   . SER J  2 29  ? 484.770 20.912  378.307 1.00 66.07  ?  52  SER J O   1 
ATOM   9634  C CB  . SER J  2 29  ? 483.633 21.948  381.440 1.00 62.67  ?  52  SER J CB  1 
ATOM   9635  O OG  . SER J  2 29  ? 482.677 22.633  380.656 1.00 60.14  ?  52  SER J OG  1 
ATOM   9636  N N   . PHE J  2 30  ? 484.021 19.490  379.892 1.00 59.82  ?  53  PHE J N   1 
ATOM   9637  C CA  . PHE J  2 30  ? 483.685 18.412  378.972 1.00 54.56  ?  53  PHE J CA  1 
ATOM   9638  C C   . PHE J  2 30  ? 482.611 17.545  379.610 1.00 56.54  ?  53  PHE J C   1 
ATOM   9639  O O   . PHE J  2 30  ? 482.410 17.571  380.827 1.00 62.88  ?  53  PHE J O   1 
ATOM   9640  C CB  . PHE J  2 30  ? 484.911 17.559  378.628 1.00 56.11  ?  53  PHE J CB  1 
ATOM   9641  C CG  . PHE J  2 30  ? 485.284 16.576  379.705 1.00 51.83  ?  53  PHE J CG  1 
ATOM   9642  C CD1 . PHE J  2 30  ? 486.065 16.969  380.777 1.00 55.67  ?  53  PHE J CD1 1 
ATOM   9643  C CD2 . PHE J  2 30  ? 484.851 15.260  379.646 1.00 54.55  ?  53  PHE J CD2 1 
ATOM   9644  C CE1 . PHE J  2 30  ? 486.405 16.070  381.771 1.00 56.72  ?  53  PHE J CE1 1 
ATOM   9645  C CE2 . PHE J  2 30  ? 485.186 14.358  380.636 1.00 51.08  ?  53  PHE J CE2 1 
ATOM   9646  C CZ  . PHE J  2 30  ? 485.964 14.764  381.700 1.00 56.36  ?  53  PHE J CZ  1 
ATOM   9647  N N   . SER J  2 31  ? 481.940 16.754  378.774 1.00 65.96  ?  54  SER J N   1 
ATOM   9648  C CA  . SER J  2 31  ? 480.943 15.794  379.231 1.00 65.89  ?  54  SER J CA  1 
ATOM   9649  C C   . SER J  2 31  ? 481.201 14.453  378.560 1.00 65.59  ?  54  SER J C   1 
ATOM   9650  O O   . SER J  2 31  ? 481.331 14.385  377.334 1.00 59.10  ?  54  SER J O   1 
ATOM   9651  C CB  . SER J  2 31  ? 479.520 16.278  378.932 1.00 64.11  ?  54  SER J CB  1 
ATOM   9652  O OG  . SER J  2 31  ? 479.376 16.633  377.569 1.00 76.07  ?  54  SER J OG  1 
ATOM   9653  N N   . SER J  2 32  ? 481.281 13.391  379.366 1.00 67.85  ?  55  SER J N   1 
ATOM   9654  C CA  . SER J  2 32  ? 481.570 12.065  378.829 1.00 62.03  ?  55  SER J CA  1 
ATOM   9655  C C   . SER J  2 32  ? 480.333 11.419  378.216 1.00 64.56  ?  55  SER J C   1 
ATOM   9656  O O   . SER J  2 32  ? 480.415 10.814  377.141 1.00 64.44  ?  55  SER J O   1 
ATOM   9657  C CB  . SER J  2 32  ? 482.148 11.169  379.924 1.00 58.99  ?  55  SER J CB  1 
ATOM   9658  O OG  . SER J  2 32  ? 483.359 11.699  380.432 1.00 63.45  ?  55  SER J OG  1 
ATOM   9659  N N   . ALA J  2 33  ? 479.187 11.531  378.879 1.00 90.46  ?  56  ALA J N   1 
ATOM   9660  C CA  . ALA J  2 33  ? 477.957 10.922  378.387 1.00 92.91  ?  56  ALA J CA  1 
ATOM   9661  C C   . ALA J  2 33  ? 476.730 11.670  378.895 1.00 98.07  ?  56  ALA J C   1 
ATOM   9662  O O   . ALA J  2 33  ? 476.597 12.876  378.688 1.00 100.40 ?  56  ALA J O   1 
ATOM   9663  C CB  . ALA J  2 33  ? 477.891 9.457   378.795 1.00 92.27  ?  56  ALA J CB  1 
ATOM   9664  N N   . GLN J  2 36  ? 474.258 13.602  381.264 1.00 42.41  ?  59  GLN J N   1 
ATOM   9665  C CA  . GLN J  2 36  ? 474.833 14.131  382.496 1.00 47.68  ?  59  GLN J CA  1 
ATOM   9666  C C   . GLN J  2 36  ? 474.192 15.462  382.871 1.00 41.83  ?  59  GLN J C   1 
ATOM   9667  O O   . GLN J  2 36  ? 473.621 16.145  382.024 1.00 43.27  ?  59  GLN J O   1 
ATOM   9668  C CB  . GLN J  2 36  ? 476.347 14.294  382.355 1.00 48.88  ?  59  GLN J CB  1 
ATOM   9669  C CG  . GLN J  2 36  ? 477.092 12.987  382.146 1.00 58.73  ?  59  GLN J CG  1 
ATOM   9670  C CD  . GLN J  2 36  ? 478.590 13.181  382.015 1.00 60.54  ?  59  GLN J CD  1 
ATOM   9671  O OE1 . GLN J  2 36  ? 479.068 14.299  381.820 1.00 58.72  ?  59  GLN J OE1 1 
ATOM   9672  N NE2 . GLN J  2 36  ? 479.340 12.090  382.125 1.00 58.86  ?  59  GLN J NE2 1 
ATOM   9673  N N   . ARG J  2 37  ? 474.274 15.815  384.152 1.00 54.07  ?  60  ARG J N   1 
ATOM   9674  C CA  . ARG J  2 37  ? 473.733 17.075  384.644 1.00 53.22  ?  60  ARG J CA  1 
ATOM   9675  C C   . ARG J  2 37  ? 474.758 18.203  384.669 1.00 61.70  ?  60  ARG J C   1 
ATOM   9676  O O   . ARG J  2 37  ? 474.379 19.354  384.912 1.00 59.23  ?  60  ARG J O   1 
ATOM   9677  C CB  . ARG J  2 37  ? 473.153 16.883  386.049 1.00 51.83  ?  60  ARG J CB  1 
ATOM   9678  C CG  . ARG J  2 37  ? 473.888 15.847  386.883 1.00 57.08  ?  60  ARG J CG  1 
ATOM   9679  C CD  . ARG J  2 37  ? 473.255 15.688  388.255 1.00 68.29  ?  60  ARG J CD  1 
ATOM   9680  N NE  . ARG J  2 37  ? 473.632 14.427  388.885 1.00 71.36  ?  60  ARG J NE  1 
ATOM   9681  C CZ  . ARG J  2 37  ? 473.304 14.083  390.127 1.00 68.74  ?  60  ARG J CZ  1 
ATOM   9682  N NH1 . ARG J  2 37  ? 472.590 14.910  390.878 1.00 62.03  ?  60  ARG J NH1 1 
ATOM   9683  N NH2 . ARG J  2 37  ? 473.690 12.913  390.617 1.00 64.67  ?  60  ARG J NH2 1 
ATOM   9684  N N   . THR J  2 38  ? 476.032 17.909  384.422 1.00 101.42 ?  61  THR J N   1 
ATOM   9685  C CA  . THR J  2 38  ? 477.073 18.926  384.487 1.00 95.94  ?  61  THR J CA  1 
ATOM   9686  C C   . THR J  2 38  ? 478.251 18.490  383.629 1.00 100.28 ?  61  THR J C   1 
ATOM   9687  O O   . THR J  2 38  ? 478.414 17.307  383.320 1.00 107.42 ?  61  THR J O   1 
ATOM   9688  C CB  . THR J  2 38  ? 477.528 19.173  385.930 1.00 87.33  ?  61  THR J CB  1 
ATOM   9689  O OG1 . THR J  2 38  ? 478.642 20.073  385.935 1.00 96.99  ?  61  THR J OG1 1 
ATOM   9690  C CG2 . THR J  2 38  ? 477.937 17.863  386.589 1.00 87.99  ?  61  THR J CG2 1 
ATOM   9691  N N   . CYS J  2 39  ? 479.073 19.466  383.250 1.00 62.25  ?  62  CYS J N   1 
ATOM   9692  C CA  . CYS J  2 39  ? 480.288 19.217  382.488 1.00 65.56  ?  62  CYS J CA  1 
ATOM   9693  C C   . CYS J  2 39  ? 481.476 19.170  383.441 1.00 66.32  ?  62  CYS J C   1 
ATOM   9694  O O   . CYS J  2 39  ? 481.678 20.096  384.234 1.00 67.11  ?  62  CYS J O   1 
ATOM   9695  C CB  . CYS J  2 39  ? 480.509 20.297  381.425 1.00 68.10  ?  62  CYS J CB  1 
ATOM   9696  S SG  . CYS J  2 39  ? 479.086 20.651  380.363 1.00 80.68  ?  62  CYS J SG  1 
ATOM   9697  N N   . ASP J  2 40  ? 482.254 18.093  383.365 1.00 76.91  ?  63  ASP J N   1 
ATOM   9698  C CA  . ASP J  2 40  ? 483.427 17.949  384.212 1.00 75.05  ?  63  ASP J CA  1 
ATOM   9699  C C   . ASP J  2 40  ? 484.556 18.847  383.719 1.00 72.07  ?  63  ASP J C   1 
ATOM   9700  O O   . ASP J  2 40  ? 484.690 19.110  382.521 1.00 72.34  ?  63  ASP J O   1 
ATOM   9701  C CB  . ASP J  2 40  ? 483.892 16.492  384.242 1.00 81.33  ?  63  ASP J CB  1 
ATOM   9702  C CG  . ASP J  2 40  ? 482.836 15.557  384.796 1.00 88.19  ?  63  ASP J CG  1 
ATOM   9703  O OD1 . ASP J  2 40  ? 482.143 15.946  385.760 1.00 87.13  ?  63  ASP J OD1 1 
ATOM   9704  O OD2 . ASP J  2 40  ? 482.697 14.434  384.267 1.00 89.11  -1 63  ASP J OD2 1 
ATOM   9705  N N   . ILE J  2 41  ? 485.373 19.315  384.657 1.00 43.98  ?  64  ILE J N   1 
ATOM   9706  C CA  . ILE J  2 41  ? 486.440 20.261  384.345 1.00 36.48  ?  64  ILE J CA  1 
ATOM   9707  C C   . ILE J  2 41  ? 487.628 19.508  383.760 1.00 40.30  ?  64  ILE J C   1 
ATOM   9708  O O   . ILE J  2 41  ? 488.067 18.490  384.310 1.00 41.39  ?  64  ILE J O   1 
ATOM   9709  C CB  . ILE J  2 41  ? 486.843 21.050  385.601 1.00 33.48  ?  64  ILE J CB  1 
ATOM   9710  C CG1 . ILE J  2 41  ? 485.595 21.481  386.375 1.00 28.37  ?  64  ILE J CG1 1 
ATOM   9711  C CG2 . ILE J  2 41  ? 487.681 22.259  385.221 1.00 36.04  ?  64  ILE J CG2 1 
ATOM   9712  C CD1 . ILE J  2 41  ? 485.888 22.301  387.610 1.00 28.35  ?  64  ILE J CD1 1 
ATOM   9713  N N   . CYS J  2 42  ? 488.157 20.012  382.646 1.00 54.69  ?  65  CYS J N   1 
ATOM   9714  C CA  . CYS J  2 42  ? 489.274 19.366  381.969 1.00 52.55  ?  65  CYS J CA  1 
ATOM   9715  C C   . CYS J  2 42  ? 490.548 19.448  382.807 1.00 53.03  ?  65  CYS J C   1 
ATOM   9716  O O   . CYS J  2 42  ? 490.716 20.327  383.656 1.00 52.84  ?  65  CYS J O   1 
ATOM   9717  C CB  . CYS J  2 42  ? 489.525 20.001  380.599 1.00 54.11  ?  65  CYS J CB  1 
ATOM   9718  S SG  . CYS J  2 42  ? 488.640 19.251  379.200 1.00 73.84  ?  65  CYS J SG  1 
ATOM   9719  N N   . ARG J  2 43  ? 491.457 18.511  382.545 1.00 57.09  ?  66  ARG J N   1 
ATOM   9720  C CA  . ARG J  2 43  ? 492.743 18.502  383.227 1.00 52.25  ?  66  ARG J CA  1 
ATOM   9721  C C   . ARG J  2 43  ? 493.597 19.684  382.785 1.00 46.29  ?  66  ARG J C   1 
ATOM   9722  O O   . ARG J  2 43  ? 493.474 20.188  381.666 1.00 46.45  ?  66  ARG J O   1 
ATOM   9723  C CB  . ARG J  2 43  ? 493.493 17.198  382.954 1.00 53.21  ?  66  ARG J CB  1 
ATOM   9724  C CG  . ARG J  2 43  ? 493.143 16.058  383.898 1.00 63.39  ?  66  ARG J CG  1 
ATOM   9725  C CD  . ARG J  2 43  ? 494.359 15.181  384.170 1.00 63.87  ?  66  ARG J CD  1 
ATOM   9726  N NE  . ARG J  2 43  ? 495.408 15.910  384.881 1.00 75.02  ?  66  ARG J NE  1 
ATOM   9727  C CZ  . ARG J  2 43  ? 496.610 15.414  385.160 1.00 79.98  ?  66  ARG J CZ  1 
ATOM   9728  N NH1 . ARG J  2 43  ? 496.925 14.180  384.790 1.00 78.18  ?  66  ARG J NH1 1 
ATOM   9729  N NH2 . ARG J  2 43  ? 497.499 16.153  385.811 1.00 66.08  ?  66  ARG J NH2 1 
ATOM   9730  N N   . GLN J  2 44  ? 494.467 20.125  383.687 1.00 37.09  ?  67  GLN J N   1 
ATOM   9731  C CA  . GLN J  2 44  ? 495.433 21.182  383.414 1.00 32.86  ?  67  GLN J CA  1 
ATOM   9732  C C   . GLN J  2 44  ? 496.823 20.564  383.468 1.00 36.73  ?  67  GLN J C   1 
ATOM   9733  O O   . GLN J  2 44  ? 497.300 20.191  384.546 1.00 40.33  ?  67  GLN J O   1 
ATOM   9734  C CB  . GLN J  2 44  ? 495.300 22.321  384.423 1.00 37.27  ?  67  GLN J CB  1 
ATOM   9735  C CG  . GLN J  2 44  ? 493.982 23.072  384.351 1.00 42.49  ?  67  GLN J CG  1 
ATOM   9736  C CD  . GLN J  2 44  ? 494.113 24.411  383.652 1.00 48.08  ?  67  GLN J CD  1 
ATOM   9737  O OE1 . GLN J  2 44  ? 495.217 24.931  383.484 1.00 48.70  ?  67  GLN J OE1 1 
ATOM   9738  N NE2 . GLN J  2 44  ? 492.985 24.977  383.240 1.00 58.26  ?  67  GLN J NE2 1 
ATOM   9739  N N   . CYS J  2 45  ? 497.472 20.454  382.313 1.00 39.77  ?  68  CYS J N   1 
ATOM   9740  C CA  . CYS J  2 45  ? 498.820 19.907  382.234 1.00 37.14  ?  68  CYS J CA  1 
ATOM   9741  C C   . CYS J  2 45  ? 499.805 21.071  382.279 1.00 29.63  ?  68  CYS J C   1 
ATOM   9742  O O   . CYS J  2 45  ? 499.897 21.851  381.327 1.00 35.27  ?  68  CYS J O   1 
ATOM   9743  C CB  . CYS J  2 45  ? 498.999 19.081  380.964 1.00 39.73  ?  68  CYS J CB  1 
ATOM   9744  S SG  . CYS J  2 45  ? 497.629 17.956  380.573 1.00 38.24  ?  68  CYS J SG  1 
ATOM   9745  N N   . LYS J  2 46  ? 500.543 21.183  383.381 1.00 32.84  ?  69  LYS J N   1 
ATOM   9746  C CA  . LYS J  2 46  ? 501.511 22.254  383.561 1.00 34.69  ?  69  LYS J CA  1 
ATOM   9747  C C   . LYS J  2 46  ? 502.678 21.719  384.382 1.00 32.94  ?  69  LYS J C   1 
ATOM   9748  O O   . LYS J  2 46  ? 502.675 20.566  384.823 1.00 36.33  ?  69  LYS J O   1 
ATOM   9749  C CB  . LYS J  2 46  ? 500.871 23.476  384.229 1.00 33.90  ?  69  LYS J CB  1 
ATOM   9750  C CG  . LYS J  2 46  ? 500.044 24.344  383.293 1.00 35.73  ?  69  LYS J CG  1 
ATOM   9751  C CD  . LYS J  2 46  ? 499.452 25.540  384.018 1.00 36.27  ?  69  LYS J CD  1 
ATOM   9752  C CE  . LYS J  2 46  ? 498.859 26.540  383.039 1.00 30.33  ?  69  LYS J CE  1 
ATOM   9753  N NZ  . LYS J  2 46  ? 497.853 25.908  382.142 1.00 33.82  ?  69  LYS J NZ  1 
ATOM   9754  N N   . GLY J  2 47  ? 503.669 22.573  384.599 1.00 36.11  ?  70  GLY J N   1 
ATOM   9755  C CA  . GLY J  2 47  ? 504.852 22.146  385.328 1.00 41.44  ?  70  GLY J CA  1 
ATOM   9756  C C   . GLY J  2 47  ? 505.569 21.052  384.562 1.00 43.29  ?  70  GLY J C   1 
ATOM   9757  O O   . GLY J  2 47  ? 505.936 21.219  383.393 1.00 46.22  ?  70  GLY J O   1 
ATOM   9758  N N   . VAL J  2 48  ? 505.776 19.908  385.222 1.00 25.21  ?  71  VAL J N   1 
ATOM   9759  C CA  . VAL J  2 48  ? 506.363 18.756  384.549 1.00 25.39  ?  71  VAL J CA  1 
ATOM   9760  C C   . VAL J  2 48  ? 505.454 18.218  383.456 1.00 25.74  ?  71  VAL J C   1 
ATOM   9761  O O   . VAL J  2 48  ? 505.929 17.527  382.547 1.00 27.29  ?  71  VAL J O   1 
ATOM   9762  C CB  . VAL J  2 48  ? 506.678 17.633  385.554 1.00 25.20  ?  71  VAL J CB  1 
ATOM   9763  C CG1 . VAL J  2 48  ? 507.883 17.989  386.391 1.00 24.91  ?  71  VAL J CG1 1 
ATOM   9764  C CG2 . VAL J  2 48  ? 505.472 17.364  386.439 1.00 25.09  ?  71  VAL J CG2 1 
ATOM   9765  N N   . PHE J  2 49  ? 504.160 18.518  383.515 1.00 51.52  ?  72  PHE J N   1 
ATOM   9766  C CA  . PHE J  2 49  ? 503.191 17.887  382.632 1.00 54.70  ?  72  PHE J CA  1 
ATOM   9767  C C   . PHE J  2 49  ? 503.111 18.607  381.292 1.00 54.99  ?  72  PHE J C   1 
ATOM   9768  O O   . PHE J  2 49  ? 502.983 19.835  381.239 1.00 56.81  ?  72  PHE J O   1 
ATOM   9769  C CB  . PHE J  2 49  ? 501.815 17.854  383.295 1.00 56.99  ?  72  PHE J CB  1 
ATOM   9770  C CG  . PHE J  2 49  ? 501.762 17.010  384.535 1.00 51.85  ?  72  PHE J CG  1 
ATOM   9771  C CD1 . PHE J  2 49  ? 502.490 15.835  384.617 1.00 48.25  ?  72  PHE J CD1 1 
ATOM   9772  C CD2 . PHE J  2 49  ? 500.985 17.388  385.616 1.00 57.59  ?  72  PHE J CD2 1 
ATOM   9773  C CE1 . PHE J  2 49  ? 502.445 15.054  385.753 1.00 52.20  ?  72  PHE J CE1 1 
ATOM   9774  C CE2 . PHE J  2 49  ? 500.935 16.610  386.756 1.00 58.12  ?  72  PHE J CE2 1 
ATOM   9775  C CZ  . PHE J  2 49  ? 501.666 15.441  386.825 1.00 55.10  ?  72  PHE J CZ  1 
ATOM   9776  N N   . ARG J  2 50  ? 503.187 17.836  380.212 1.00 50.71  ?  73  ARG J N   1 
ATOM   9777  C CA  . ARG J  2 50  ? 502.937 18.324  378.865 1.00 49.03  ?  73  ARG J CA  1 
ATOM   9778  C C   . ARG J  2 50  ? 501.560 17.867  378.403 1.00 50.62  ?  73  ARG J C   1 
ATOM   9779  O O   . ARG J  2 50  ? 501.101 16.776  378.749 1.00 49.47  ?  73  ARG J O   1 
ATOM   9780  C CB  . ARG J  2 50  ? 503.997 17.819  377.883 1.00 51.16  ?  73  ARG J CB  1 
ATOM   9781  C CG  . ARG J  2 50  ? 505.382 18.411  378.066 1.00 57.77  ?  73  ARG J CG  1 
ATOM   9782  C CD  . ARG J  2 50  ? 506.284 18.080  376.880 1.00 65.66  ?  73  ARG J CD  1 
ATOM   9783  N NE  . ARG J  2 50  ? 506.493 16.642  376.715 1.00 67.61  ?  73  ARG J NE  1 
ATOM   9784  C CZ  . ARG J  2 50  ? 505.842 15.882  375.837 1.00 68.07  ?  73  ARG J CZ  1 
ATOM   9785  N NH1 . ARG J  2 50  ? 506.102 14.583  375.762 1.00 66.48  ?  73  ARG J NH1 1 
ATOM   9786  N NH2 . ARG J  2 50  ? 504.933 16.419  375.035 1.00 67.64  ?  73  ARG J NH2 1 
ATOM   9787  N N   . THR J  2 51  ? 500.902 18.712  377.617 1.00 62.53  ?  74  THR J N   1 
ATOM   9788  C CA  . THR J  2 51  ? 499.614 18.351  377.041 1.00 59.37  ?  74  THR J CA  1 
ATOM   9789  C C   . THR J  2 51  ? 499.844 17.473  375.817 1.00 61.47  ?  74  THR J C   1 
ATOM   9790  O O   . THR J  2 51  ? 500.487 17.899  374.852 1.00 66.73  ?  74  THR J O   1 
ATOM   9791  C CB  . THR J  2 51  ? 498.819 19.600  376.667 1.00 56.18  ?  74  THR J CB  1 
ATOM   9792  O OG1 . THR J  2 51  ? 498.758 20.484  377.793 1.00 63.14  ?  74  THR J OG1 1 
ATOM   9793  C CG2 . THR J  2 51  ? 497.405 19.222  376.251 1.00 55.83  ?  74  THR J CG2 1 
ATOM   9794  N N   . ARG J  2 52  ? 499.322 16.249  375.858 1.00 40.55  ?  75  ARG J N   1 
ATOM   9795  C CA  . ARG J  2 52  ? 499.453 15.332  374.734 1.00 45.62  ?  75  ARG J CA  1 
ATOM   9796  C C   . ARG J  2 52  ? 498.162 15.326  373.926 1.00 53.03  ?  75  ARG J C   1 
ATOM   9797  O O   . ARG J  2 52  ? 498.137 15.777  372.777 1.00 60.55  ?  75  ARG J O   1 
ATOM   9798  C CB  . ARG J  2 52  ? 499.795 13.925  375.221 1.00 45.35  ?  75  ARG J CB  1 
ATOM   9799  C CG  . ARG J  2 52  ? 500.228 12.975  374.120 1.00 52.20  ?  75  ARG J CG  1 
ATOM   9800  C CD  . ARG J  2 52  ? 500.404 11.572  374.661 1.00 54.49  ?  75  ARG J CD  1 
ATOM   9801  N NE  . ARG J  2 52  ? 499.145 11.024  375.154 1.00 56.49  ?  75  ARG J NE  1 
ATOM   9802  C CZ  . ARG J  2 52  ? 499.032 9.861   375.784 1.00 61.74  ?  75  ARG J CZ  1 
ATOM   9803  N NH1 . ARG J  2 52  ? 497.846 9.439   376.197 1.00 62.77  ?  75  ARG J NH1 1 
ATOM   9804  N NH2 . ARG J  2 52  ? 500.110 9.121   376.005 1.00 60.74  ?  75  ARG J NH2 1 
ATOM   9805  N N   . LYS J  2 53  ? 497.089 14.812  374.520 1.00 58.09  ?  76  LYS J N   1 
ATOM   9806  C CA  . LYS J  2 53  ? 495.757 14.933  373.945 1.00 58.95  ?  76  LYS J CA  1 
ATOM   9807  C C   . LYS J  2 53  ? 495.077 16.161  374.534 1.00 59.67  ?  76  LYS J C   1 
ATOM   9808  O O   . LYS J  2 53  ? 495.017 16.318  375.757 1.00 68.14  ?  76  LYS J O   1 
ATOM   9809  C CB  . LYS J  2 53  ? 494.924 13.678  374.212 1.00 64.17  ?  76  LYS J CB  1 
ATOM   9810  C CG  . LYS J  2 53  ? 493.427 13.882  374.027 1.00 66.68  ?  76  LYS J CG  1 
ATOM   9811  C CD  . LYS J  2 53  ? 492.701 12.568  373.787 1.00 63.09  ?  76  LYS J CD  1 
ATOM   9812  C CE  . LYS J  2 53  ? 492.980 12.035  372.390 1.00 61.60  ?  76  LYS J CE  1 
ATOM   9813  N NZ  . LYS J  2 53  ? 492.165 10.827  372.083 1.00 65.30  ?  76  LYS J NZ  1 
ATOM   9814  N N   . GLU J  2 54  ? 494.567 17.026  373.662 1.00 54.44  ?  77  GLU J N   1 
ATOM   9815  C CA  . GLU J  2 54  ? 493.985 18.282  374.102 1.00 56.22  ?  77  GLU J CA  1 
ATOM   9816  C C   . GLU J  2 54  ? 492.627 18.035  374.759 1.00 61.32  ?  77  GLU J C   1 
ATOM   9817  O O   . GLU J  2 54  ? 492.131 16.906  374.835 1.00 60.78  ?  77  GLU J O   1 
ATOM   9818  C CB  . GLU J  2 54  ? 493.860 19.246  372.922 1.00 62.31  ?  77  GLU J CB  1 
ATOM   9819  C CG  . GLU J  2 54  ? 495.166 19.504  372.175 1.00 66.09  ?  77  GLU J CG  1 
ATOM   9820  C CD  . GLU J  2 54  ? 495.510 18.405  371.181 1.00 70.75  ?  77  GLU J CD  1 
ATOM   9821  O OE1 . GLU J  2 54  ? 494.692 17.476  371.012 1.00 68.66  ?  77  GLU J OE1 1 
ATOM   9822  O OE2 . GLU J  2 54  ? 496.599 18.466  370.572 1.00 69.20  -1 77  GLU J OE2 1 
ATOM   9823  N N   . CYS J  2 55  ? 492.014 19.114  375.238 1.00 85.45  ?  78  CYS J N   1 
ATOM   9824  C CA  . CYS J  2 55  ? 490.726 19.051  375.915 1.00 79.26  ?  78  CYS J CA  1 
ATOM   9825  C C   . CYS J  2 55  ? 489.622 19.321  374.902 1.00 78.58  ?  78  CYS J C   1 
ATOM   9826  O O   . CYS J  2 55  ? 489.598 20.383  374.271 1.00 83.17  ?  78  CYS J O   1 
ATOM   9827  C CB  . CYS J  2 55  ? 490.669 20.054  377.068 1.00 78.19  ?  78  CYS J CB  1 
ATOM   9828  S SG  . CYS J  2 55  ? 489.010 20.512  377.646 1.00 103.81 ?  78  CYS J SG  1 
ATOM   9829  N N   . SER J  2 56  ? 488.714 18.363  374.751 1.00 76.89  ?  79  SER J N   1 
ATOM   9830  C CA  . SER J  2 56  ? 487.593 18.466  373.834 1.00 75.32  ?  79  SER J CA  1 
ATOM   9831  C C   . SER J  2 56  ? 486.295 18.466  374.628 1.00 76.48  ?  79  SER J C   1 
ATOM   9832  O O   . SER J  2 56  ? 486.245 18.012  375.773 1.00 80.82  ?  79  SER J O   1 
ATOM   9833  C CB  . SER J  2 56  ? 487.590 17.314  372.820 1.00 75.78  ?  79  SER J CB  1 
ATOM   9834  O OG  . SER J  2 56  ? 487.355 16.071  373.461 1.00 80.80  ?  79  SER J OG  1 
ATOM   9835  N N   . SER J  2 57  ? 485.240 19.002  374.014 1.00 47.17  ?  80  SER J N   1 
ATOM   9836  C CA  . SER J  2 57  ? 483.950 19.043  374.695 1.00 45.86  ?  80  SER J CA  1 
ATOM   9837  C C   . SER J  2 57  ? 483.410 17.643  374.960 1.00 52.09  ?  80  SER J C   1 
ATOM   9838  O O   . SER J  2 57  ? 482.655 17.440  375.917 1.00 52.82  ?  80  SER J O   1 
ATOM   9839  C CB  . SER J  2 57  ? 482.947 19.852  373.874 1.00 40.56  ?  80  SER J CB  1 
ATOM   9840  O OG  . SER J  2 57  ? 482.701 19.234  372.624 1.00 48.74  ?  80  SER J OG  1 
ATOM   9841  N N   . THR J  2 58  ? 483.781 16.669  374.130 1.00 68.64  ?  81  THR J N   1 
ATOM   9842  C CA  . THR J  2 58  ? 483.258 15.314  374.246 1.00 67.18  ?  81  THR J CA  1 
ATOM   9843  C C   . THR J  2 58  ? 484.126 14.386  375.089 1.00 60.66  ?  81  THR J C   1 
ATOM   9844  O O   . THR J  2 58  ? 483.672 13.286  375.426 1.00 60.27  ?  81  THR J O   1 
ATOM   9845  C CB  . THR J  2 58  ? 483.081 14.701  372.853 1.00 70.78  ?  81  THR J CB  1 
ATOM   9846  O OG1 . THR J  2 58  ? 484.367 14.479  372.261 1.00 81.77  ?  81  THR J OG1 1 
ATOM   9847  C CG2 . THR J  2 58  ? 482.282 15.638  371.960 1.00 67.58  ?  81  THR J CG2 1 
ATOM   9848  N N   . SER J  2 59  ? 485.346 14.784  375.444 1.00 57.44  ?  82  SER J N   1 
ATOM   9849  C CA  . SER J  2 59  ? 486.220 13.893  376.199 1.00 61.01  ?  82  SER J CA  1 
ATOM   9850  C C   . SER J  2 59  ? 487.261 14.709  376.950 1.00 62.02  ?  82  SER J C   1 
ATOM   9851  O O   . SER J  2 59  ? 487.578 15.842  376.579 1.00 58.05  ?  82  SER J O   1 
ATOM   9852  C CB  . SER J  2 59  ? 486.901 12.868  375.283 1.00 61.50  ?  82  SER J CB  1 
ATOM   9853  O OG  . SER J  2 59  ? 487.679 13.508  374.287 1.00 63.17  ?  82  SER J OG  1 
ATOM   9854  N N   . ASN J  2 60  ? 487.804 14.104  378.003 1.00 41.87  ?  83  ASN J N   1 
ATOM   9855  C CA  . ASN J  2 60  ? 488.805 14.767  378.826 1.00 34.34  ?  83  ASN J CA  1 
ATOM   9856  C C   . ASN J  2 60  ? 490.151 14.806  378.108 1.00 32.96  ?  83  ASN J C   1 
ATOM   9857  O O   . ASN J  2 60  ? 490.433 14.015  377.204 1.00 42.30  ?  83  ASN J O   1 
ATOM   9858  C CB  . ASN J  2 60  ? 488.952 14.055  380.170 1.00 28.19  ?  83  ASN J CB  1 
ATOM   9859  C CG  . ASN J  2 60  ? 489.611 14.925  381.225 1.00 27.81  ?  83  ASN J CG  1 
ATOM   9860  O OD1 . ASN J  2 60  ? 490.393 15.823  380.909 1.00 27.75  ?  83  ASN J OD1 1 
ATOM   9861  N ND2 . ASN J  2 60  ? 489.297 14.662  382.488 1.00 27.56  ?  83  ASN J ND2 1 
ATOM   9862  N N   . ALA J  2 61  ? 490.992 15.748  378.528 1.00 28.27  ?  84  ALA J N   1 
ATOM   9863  C CA  . ALA J  2 61  ? 492.339 15.840  377.992 1.00 28.26  ?  84  ALA J CA  1 
ATOM   9864  C C   . ALA J  2 61  ? 493.214 14.738  378.587 1.00 28.09  ?  84  ALA J C   1 
ATOM   9865  O O   . ALA J  2 61  ? 492.790 13.964  379.450 1.00 27.97  ?  84  ALA J O   1 
ATOM   9866  C CB  . ALA J  2 61  ? 492.929 17.220  378.267 1.00 28.06  ?  84  ALA J CB  1 
ATOM   9867  N N   . GLU J  2 62  ? 494.458 14.670  378.122 1.00 41.31  ?  85  GLU J N   1 
ATOM   9868  C CA  . GLU J  2 62  ? 495.415 13.689  378.613 1.00 37.48  ?  85  GLU J CA  1 
ATOM   9869  C C   . GLU J  2 62  ? 496.782 14.347  378.685 1.00 33.53  ?  85  GLU J C   1 
ATOM   9870  O O   . GLU J  2 62  ? 497.205 15.005  377.729 1.00 39.60  ?  85  GLU J O   1 
ATOM   9871  C CB  . GLU J  2 62  ? 495.457 12.454  377.707 1.00 43.06  ?  85  GLU J CB  1 
ATOM   9872  C CG  . GLU J  2 62  ? 495.427 11.136  378.461 1.00 52.65  ?  85  GLU J CG  1 
ATOM   9873  C CD  . GLU J  2 62  ? 494.993 9.975   377.588 1.00 61.72  ?  85  GLU J CD  1 
ATOM   9874  O OE1 . GLU J  2 62  ? 495.469 8.844   377.819 1.00 67.98  ?  85  GLU J OE1 1 
ATOM   9875  O OE2 . GLU J  2 62  ? 494.176 10.194  376.669 1.00 62.58  -1 85  GLU J OE2 1 
ATOM   9876  N N   . CYS J  2 63  ? 497.466 14.175  379.811 1.00 40.48  ?  86  CYS J N   1 
ATOM   9877  C CA  . CYS J  2 63  ? 498.734 14.845  380.038 1.00 46.41  ?  86  CYS J CA  1 
ATOM   9878  C C   . CYS J  2 63  ? 499.902 13.937  379.656 1.00 51.20  ?  86  CYS J C   1 
ATOM   9879  O O   . CYS J  2 63  ? 499.737 12.774  379.281 1.00 53.72  ?  86  CYS J O   1 
ATOM   9880  C CB  . CYS J  2 63  ? 498.854 15.294  381.497 1.00 49.41  ?  86  CYS J CB  1 
ATOM   9881  S SG  . CYS J  2 63  ? 497.665 16.556  382.047 1.00 70.83  ?  86  CYS J SG  1 
ATOM   9882  N N   . ASP J  2 64  ? 501.103 14.495  379.772 1.00 51.57  ?  87  ASP J N   1 
ATOM   9883  C CA  . ASP J  2 64  ? 502.361 13.817  379.495 1.00 46.94  ?  87  ASP J CA  1 
ATOM   9884  C C   . ASP J  2 64  ? 503.390 14.397  380.457 1.00 50.15  ?  87  ASP J C   1 
ATOM   9885  O O   . ASP J  2 64  ? 503.035 15.065  381.431 1.00 50.19  ?  87  ASP J O   1 
ATOM   9886  C CB  . ASP J  2 64  ? 502.759 13.979  378.023 1.00 53.53  ?  87  ASP J CB  1 
ATOM   9887  C CG  . ASP J  2 64  ? 503.546 12.795  377.497 1.00 62.99  ?  87  ASP J CG  1 
ATOM   9888  O OD1 . ASP J  2 64  ? 504.177 12.091  378.314 1.00 71.96  ?  87  ASP J OD1 1 
ATOM   9889  O OD2 . ASP J  2 64  ? 503.531 12.569  376.269 1.00 67.73  -1 87  ASP J OD2 1 
ATOM   9890  N N   . CYS J  2 65  ? 504.670 14.129  380.212 1.00 61.41  ?  88  CYS J N   1 
ATOM   9891  C CA  . CYS J  2 65  ? 505.700 14.715  381.057 1.00 57.96  ?  88  CYS J CA  1 
ATOM   9892  C C   . CYS J  2 65  ? 506.869 15.215  380.222 1.00 60.21  ?  88  CYS J C   1 
ATOM   9893  O O   . CYS J  2 65  ? 507.222 14.632  379.193 1.00 63.25  ?  88  CYS J O   1 
ATOM   9894  C CB  . CYS J  2 65  ? 506.171 13.730  382.132 1.00 59.90  ?  88  CYS J CB  1 
ATOM   9895  S SG  . CYS J  2 65  ? 505.323 14.018  383.708 1.00 91.12  ?  88  CYS J SG  1 
ATOM   9896  N N   . THR J  2 66  ? 507.454 16.316  380.691 1.00 44.22  ?  89  THR J N   1 
ATOM   9897  C CA  . THR J  2 66  ? 508.544 16.979  379.991 1.00 45.20  ?  89  THR J CA  1 
ATOM   9898  C C   . THR J  2 66  ? 509.701 16.006  379.770 1.00 45.64  ?  89  THR J C   1 
ATOM   9899  O O   . THR J  2 66  ? 509.958 15.148  380.625 1.00 45.00  ?  89  THR J O   1 
ATOM   9900  C CB  . THR J  2 66  ? 509.002 18.200  380.801 1.00 45.49  ?  89  THR J CB  1 
ATOM   9901  O OG1 . THR J  2 66  ? 508.099 19.291  380.572 1.00 39.88  ?  89  THR J OG1 1 
ATOM   9902  C CG2 . THR J  2 66  ? 510.423 18.635  380.451 1.00 43.55  ?  89  THR J CG2 1 
ATOM   9903  N N   . PRO J  2 67  ? 510.388 16.081  378.627 1.00 43.14  ?  90  PRO J N   1 
ATOM   9904  C CA  . PRO J  2 67  ? 511.550 15.213  378.400 1.00 41.98  ?  90  PRO J CA  1 
ATOM   9905  C C   . PRO J  2 67  ? 512.541 15.284  379.554 1.00 38.63  ?  90  PRO J C   1 
ATOM   9906  O O   . PRO J  2 67  ? 512.796 16.351  380.119 1.00 32.14  ?  90  PRO J O   1 
ATOM   9907  C CB  . PRO J  2 67  ? 512.153 15.758  377.097 1.00 47.63  ?  90  PRO J CB  1 
ATOM   9908  C CG  . PRO J  2 67  ? 511.458 17.077  376.847 1.00 51.40  ?  90  PRO J CG  1 
ATOM   9909  C CD  . PRO J  2 67  ? 510.108 16.928  377.458 1.00 47.87  ?  90  PRO J CD  1 
ATOM   9910  N N   . GLY J  2 68  ? 513.098 14.128  379.899 1.00 31.10  ?  91  GLY J N   1 
ATOM   9911  C CA  . GLY J  2 68  ? 513.851 13.951  381.116 1.00 35.98  ?  91  GLY J CA  1 
ATOM   9912  C C   . GLY J  2 68  ? 513.059 13.308  382.235 1.00 29.01  ?  91  GLY J C   1 
ATOM   9913  O O   . GLY J  2 68  ? 513.658 12.770  383.173 1.00 35.33  ?  91  GLY J O   1 
ATOM   9914  N N   . PHE J  2 69  ? 511.732 13.352  382.155 1.00 40.94  ?  92  PHE J N   1 
ATOM   9915  C CA  . PHE J  2 69  ? 510.849 12.716  383.119 1.00 43.17  ?  92  PHE J CA  1 
ATOM   9916  C C   . PHE J  2 69  ? 509.933 11.740  382.396 1.00 45.86  ?  92  PHE J C   1 
ATOM   9917  O O   . PHE J  2 69  ? 509.428 12.039  381.309 1.00 60.64  ?  92  PHE J O   1 
ATOM   9918  C CB  . PHE J  2 69  ? 510.011 13.751  383.874 1.00 45.42  ?  92  PHE J CB  1 
ATOM   9919  C CG  . PHE J  2 69  ? 510.824 14.731  384.666 1.00 43.12  ?  92  PHE J CG  1 
ATOM   9920  C CD1 . PHE J  2 69  ? 511.223 14.434  385.957 1.00 36.54  ?  92  PHE J CD1 1 
ATOM   9921  C CD2 . PHE J  2 69  ? 511.187 15.949  384.119 1.00 48.12  ?  92  PHE J CD2 1 
ATOM   9922  C CE1 . PHE J  2 69  ? 511.969 15.333  386.688 1.00 33.21  ?  92  PHE J CE1 1 
ATOM   9923  C CE2 . PHE J  2 69  ? 511.935 16.853  384.846 1.00 42.97  ?  92  PHE J CE2 1 
ATOM   9924  C CZ  . PHE J  2 69  ? 512.325 16.545  386.132 1.00 32.40  ?  92  PHE J CZ  1 
ATOM   9925  N N   . HIS J  2 70  ? 509.721 10.577  383.001 1.00 25.97  ?  93  HIS J N   1 
ATOM   9926  C CA  . HIS J  2 70  ? 508.845 9.554   382.453 1.00 26.21  ?  93  HIS J CA  1 
ATOM   9927  C C   . HIS J  2 70  ? 507.645 9.355   383.368 1.00 26.11  ?  93  HIS J C   1 
ATOM   9928  O O   . HIS J  2 70  ? 507.745 9.500   384.589 1.00 25.82  ?  93  HIS J O   1 
ATOM   9929  C CB  . HIS J  2 70  ? 509.595 8.232   382.268 1.00 26.28  ?  93  HIS J CB  1 
ATOM   9930  C CG  . HIS J  2 70  ? 510.179 7.687   383.533 1.00 26.00  ?  93  HIS J CG  1 
ATOM   9931  N ND1 . HIS J  2 70  ? 509.604 6.648   384.231 1.00 25.96  ?  93  HIS J ND1 1 
ATOM   9932  C CD2 . HIS J  2 70  ? 511.285 8.041   384.228 1.00 25.75  ?  93  HIS J CD2 1 
ATOM   9933  C CE1 . HIS J  2 70  ? 510.332 6.383   385.301 1.00 25.70  ?  93  HIS J CE1 1 
ATOM   9934  N NE2 . HIS J  2 70  ? 511.358 7.214   385.323 1.00 25.57  ?  93  HIS J NE2 1 
ATOM   9935  N N   . CYS J  2 71  ? 506.505 9.018   382.766 1.00 39.75  ?  94  CYS J N   1 
ATOM   9936  C CA  . CYS J  2 71  ? 505.270 8.887   383.525 1.00 43.63  ?  94  CYS J CA  1 
ATOM   9937  C C   . CYS J  2 71  ? 505.357 7.737   384.524 1.00 37.26  ?  94  CYS J C   1 
ATOM   9938  O O   . CYS J  2 71  ? 506.127 6.785   384.363 1.00 37.83  ?  94  CYS J O   1 
ATOM   9939  C CB  . CYS J  2 71  ? 504.078 8.665   382.595 1.00 52.74  ?  94  CYS J CB  1 
ATOM   9940  S SG  . CYS J  2 71  ? 503.220 10.165  382.061 1.00 63.73  ?  94  CYS J SG  1 
ATOM   9941  N N   . LEU J  2 72  ? 504.544 7.841   385.572 1.00 56.24  ?  95  LEU J N   1 
ATOM   9942  C CA  . LEU J  2 72  ? 504.443 6.818   386.602 1.00 59.46  ?  95  LEU J CA  1 
ATOM   9943  C C   . LEU J  2 72  ? 502.980 6.686   386.993 1.00 56.03  ?  95  LEU J C   1 
ATOM   9944  O O   . LEU J  2 72  ? 502.313 7.693   387.253 1.00 58.25  ?  95  LEU J O   1 
ATOM   9945  C CB  . LEU J  2 72  ? 505.298 7.175   387.824 1.00 59.95  ?  95  LEU J CB  1 
ATOM   9946  C CG  . LEU J  2 72  ? 505.766 6.028   388.718 1.00 58.71  ?  95  LEU J CG  1 
ATOM   9947  C CD1 . LEU J  2 72  ? 506.825 5.208   388.002 1.00 58.10  ?  95  LEU J CD1 1 
ATOM   9948  C CD2 . LEU J  2 72  ? 506.298 6.563   390.038 1.00 56.71  ?  95  LEU J CD2 1 
ATOM   9949  N N   . GLY J  2 73  ? 502.483 5.455   387.032 1.00 53.70  ?  96  GLY J N   1 
ATOM   9950  C CA  . GLY J  2 73  ? 501.084 5.209   387.306 1.00 54.47  ?  96  GLY J CA  1 
ATOM   9951  C C   . GLY J  2 73  ? 500.223 5.283   386.056 1.00 63.99  ?  96  GLY J C   1 
ATOM   9952  O O   . GLY J  2 73  ? 500.660 5.678   384.973 1.00 71.03  ?  96  GLY J O   1 
ATOM   9953  N N   . ALA J  2 74  ? 498.964 4.880   386.223 1.00 61.45  ?  97  ALA J N   1 
ATOM   9954  C CA  . ALA J  2 74  ? 498.007 4.836   385.124 1.00 61.74  ?  97  ALA J CA  1 
ATOM   9955  C C   . ALA J  2 74  ? 497.818 6.201   384.471 1.00 65.43  ?  97  ALA J C   1 
ATOM   9956  O O   . ALA J  2 74  ? 498.211 6.404   383.318 1.00 77.71  ?  97  ALA J O   1 
ATOM   9957  C CB  . ALA J  2 74  ? 496.660 4.300   385.614 1.00 58.41  ?  97  ALA J CB  1 
ATOM   9958  N N   . GLY J  2 75  ? 497.223 7.141   385.201 1.00 42.90  ?  98  GLY J N   1 
ATOM   9959  C CA  . GLY J  2 75  ? 496.902 8.444   384.654 1.00 54.03  ?  98  GLY J CA  1 
ATOM   9960  C C   . GLY J  2 75  ? 498.039 9.445   384.709 1.00 59.35  ?  98  GLY J C   1 
ATOM   9961  O O   . GLY J  2 75  ? 497.805 10.655  384.625 1.00 64.83  ?  98  GLY J O   1 
ATOM   9962  N N   . CYS J  2 76  ? 499.270 8.951   384.854 1.00 101.56 ?  99  CYS J N   1 
ATOM   9963  C CA  . CYS J  2 76  ? 500.453 9.788   385.055 1.00 105.00 ?  99  CYS J CA  1 
ATOM   9964  C C   . CYS J  2 76  ? 500.275 10.680  386.286 1.00 98.25  ?  99  CYS J C   1 
ATOM   9965  O O   . CYS J  2 76  ? 500.249 11.910  386.205 1.00 95.18  ?  99  CYS J O   1 
ATOM   9966  C CB  . CYS J  2 76  ? 500.772 10.626  383.809 1.00 105.43 ?  99  CYS J CB  1 
ATOM   9967  S SG  . CYS J  2 76  ? 501.258 9.703   382.328 1.00 135.83 ?  99  CYS J SG  1 
ATOM   9968  N N   . SER J  2 77  ? 500.153 10.028  387.441 1.00 72.85  ?  100 SER J N   1 
ATOM   9969  C CA  . SER J  2 77  ? 500.051 10.740  388.706 1.00 70.32  ?  100 SER J CA  1 
ATOM   9970  C C   . SER J  2 77  ? 501.396 11.252  389.196 1.00 69.40  ?  100 SER J C   1 
ATOM   9971  O O   . SER J  2 77  ? 501.429 12.092  390.103 1.00 76.23  ?  100 SER J O   1 
ATOM   9972  C CB  . SER J  2 77  ? 499.429 9.833   389.771 1.00 76.23  ?  100 SER J CB  1 
ATOM   9973  O OG  . SER J  2 77  ? 498.229 9.243   389.303 1.00 84.44  ?  100 SER J OG  1 
ATOM   9974  N N   . MET J  2 78  ? 502.494 10.767  388.625 1.00 48.82  ?  101 MET J N   1 
ATOM   9975  C CA  . MET J  2 78  ? 503.828 11.145  389.062 1.00 50.31  ?  101 MET J CA  1 
ATOM   9976  C C   . MET J  2 78  ? 504.785 10.947  387.898 1.00 50.62  ?  101 MET J C   1 
ATOM   9977  O O   . MET J  2 78  ? 504.520 10.165  386.983 1.00 57.06  ?  101 MET J O   1 
ATOM   9978  C CB  . MET J  2 78  ? 504.267 10.311  390.270 1.00 50.47  ?  101 MET J CB  1 
ATOM   9979  C CG  . MET J  2 78  ? 504.814 11.112  391.428 1.00 45.03  ?  101 MET J CG  1 
ATOM   9980  S SD  . MET J  2 78  ? 504.816 10.119  392.928 1.00 60.89  ?  101 MET J SD  1 
ATOM   9981  C CE  . MET J  2 78  ? 503.122 9.539   392.933 1.00 48.62  ?  101 MET J CE  1 
ATOM   9982  N N   . CYS J  2 79  ? 505.899 11.675  387.935 1.00 51.89  ?  102 CYS J N   1 
ATOM   9983  C CA  . CYS J  2 79  ? 506.961 11.484  386.954 1.00 49.71  ?  102 CYS J CA  1 
ATOM   9984  C C   . CYS J  2 79  ? 508.310 11.525  387.652 1.00 50.48  ?  102 CYS J C   1 
ATOM   9985  O O   . CYS J  2 79  ? 508.685 12.551  388.227 1.00 57.05  ?  102 CYS J O   1 
ATOM   9986  C CB  . CYS J  2 79  ? 506.888 12.539  385.848 1.00 57.34  ?  102 CYS J CB  1 
ATOM   9987  S SG  . CYS J  2 79  ? 505.502 12.274  384.724 1.00 79.99  ?  102 CYS J SG  1 
ATOM   9988  N N   . GLU J  2 80  ? 509.032 10.410  387.597 1.00 44.64  ?  103 GLU J N   1 
ATOM   9989  C CA  . GLU J  2 80  ? 510.401 10.346  388.078 1.00 46.02  ?  103 GLU J CA  1 
ATOM   9990  C C   . GLU J  2 80  ? 511.358 10.938  387.048 1.00 44.35  ?  103 GLU J C   1 
ATOM   9991  O O   . GLU J  2 80  ? 511.057 11.020  385.855 1.00 46.72  ?  103 GLU J O   1 
ATOM   9992  C CB  . GLU J  2 80  ? 510.810 8.902   388.368 1.00 49.63  ?  103 GLU J CB  1 
ATOM   9993  C CG  . GLU J  2 80  ? 510.097 8.252   389.535 1.00 54.62  ?  103 GLU J CG  1 
ATOM   9994  C CD  . GLU J  2 80  ? 510.480 6.794   389.696 1.00 69.81  ?  103 GLU J CD  1 
ATOM   9995  O OE1 . GLU J  2 80  ? 510.618 6.099   388.667 1.00 67.28  ?  103 GLU J OE1 1 
ATOM   9996  O OE2 . GLU J  2 80  ? 510.648 6.343   390.848 1.00 78.26  -1 103 GLU J OE2 1 
ATOM   9997  N N   . GLN J  2 81  ? 512.527 11.355  387.529 1.00 38.06  ?  104 GLN J N   1 
ATOM   9998  C CA  . GLN J  2 81  ? 513.654 11.542  386.630 1.00 37.21  ?  104 GLN J CA  1 
ATOM   9999  C C   . GLN J  2 81  ? 513.966 10.222  385.936 1.00 41.66  ?  104 GLN J C   1 
ATOM   10000 O O   . GLN J  2 81  ? 513.724 9.142   386.481 1.00 48.02  ?  104 GLN J O   1 
ATOM   10001 C CB  . GLN J  2 81  ? 514.890 12.017  387.393 1.00 29.69  ?  104 GLN J CB  1 
ATOM   10002 C CG  . GLN J  2 81  ? 514.941 13.499  387.702 1.00 32.96  ?  104 GLN J CG  1 
ATOM   10003 C CD  . GLN J  2 81  ? 516.316 13.927  388.184 1.00 38.21  ?  104 GLN J CD  1 
ATOM   10004 O OE1 . GLN J  2 81  ? 517.311 13.245  387.936 1.00 38.51  ?  104 GLN J OE1 1 
ATOM   10005 N NE2 . GLN J  2 81  ? 516.376 15.053  388.884 1.00 37.57  ?  104 GLN J NE2 1 
ATOM   10006 N N   . ASP J  2 82  ? 514.492 10.307  384.718 1.00 52.04  ?  105 ASP J N   1 
ATOM   10007 C CA  . ASP J  2 82  ? 515.000 9.101   384.080 1.00 52.73  ?  105 ASP J CA  1 
ATOM   10008 C C   . ASP J  2 82  ? 516.083 8.505   384.969 1.00 49.28  ?  105 ASP J C   1 
ATOM   10009 O O   . ASP J  2 82  ? 517.079 9.165   385.279 1.00 47.09  ?  105 ASP J O   1 
ATOM   10010 C CB  . ASP J  2 82  ? 515.540 9.421   382.687 1.00 68.34  ?  105 ASP J CB  1 
ATOM   10011 C CG  . ASP J  2 82  ? 516.382 10.684  382.660 1.00 76.72  ?  105 ASP J CG  1 
ATOM   10012 O OD1 . ASP J  2 82  ? 516.298 11.476  383.622 1.00 74.37  ?  105 ASP J OD1 1 
ATOM   10013 O OD2 . ASP J  2 82  ? 517.121 10.886  381.674 1.00 80.68  -1 105 ASP J OD2 1 
ATOM   10014 N N   . CYS J  2 83  ? 515.887 7.254   385.375 1.00 49.03  ?  106 CYS J N   1 
ATOM   10015 C CA  . CYS J  2 83  ? 516.617 6.705   386.510 1.00 56.91  ?  106 CYS J CA  1 
ATOM   10016 C C   . CYS J  2 83  ? 518.057 6.391   386.124 1.00 51.46  ?  106 CYS J C   1 
ATOM   10017 O O   . CYS J  2 83  ? 518.310 5.696   385.137 1.00 42.31  ?  106 CYS J O   1 
ATOM   10018 C CB  . CYS J  2 83  ? 515.892 5.471   387.048 1.00 58.35  ?  106 CYS J CB  1 
ATOM   10019 S SG  . CYS J  2 83  ? 514.272 5.905   387.765 1.00 69.42  ?  106 CYS J SG  1 
ATOM   10020 N N   . LYS J  2 84  ? 518.994 6.884   386.930 1.00 66.40  ?  107 LYS J N   1 
ATOM   10021 C CA  . LYS J  2 84  ? 520.398 6.994   386.555 1.00 62.62  ?  107 LYS J CA  1 
ATOM   10022 C C   . LYS J  2 84  ? 521.087 5.631   386.607 1.00 62.89  ?  107 LYS J C   1 
ATOM   10023 O O   . LYS J  2 84  ? 520.448 4.584   386.748 1.00 64.83  ?  107 LYS J O   1 
ATOM   10024 C CB  . LYS J  2 84  ? 521.089 8.013   387.454 1.00 62.55  ?  107 LYS J CB  1 
ATOM   10025 C CG  . LYS J  2 84  ? 520.650 7.923   388.903 1.00 67.12  ?  107 LYS J CG  1 
ATOM   10026 C CD  . LYS J  2 84  ? 521.094 9.133   389.698 1.00 72.61  ?  107 LYS J CD  1 
ATOM   10027 C CE  . LYS J  2 84  ? 520.188 9.362   390.899 1.00 67.46  ?  107 LYS J CE  1 
ATOM   10028 N NZ  . LYS J  2 84  ? 518.787 9.659   390.488 1.00 60.30  ?  107 LYS J NZ  1 
ATOM   10029 N N   . GLN J  2 85  ? 522.414 5.646   386.474 1.00 33.45  ?  108 GLN J N   1 
ATOM   10030 C CA  . GLN J  2 85  ? 523.201 4.423   386.387 1.00 25.60  ?  108 GLN J CA  1 
ATOM   10031 C C   . GLN J  2 85  ? 522.962 3.528   387.596 1.00 29.76  ?  108 GLN J C   1 
ATOM   10032 O O   . GLN J  2 85  ? 522.742 3.997   388.716 1.00 38.09  ?  108 GLN J O   1 
ATOM   10033 C CB  . GLN J  2 85  ? 524.689 4.758   386.287 1.00 32.75  ?  108 GLN J CB  1 
ATOM   10034 C CG  . GLN J  2 85  ? 525.007 5.937   385.387 1.00 36.84  ?  108 GLN J CG  1 
ATOM   10035 C CD  . GLN J  2 85  ? 526.478 6.296   385.406 1.00 37.57  ?  108 GLN J CD  1 
ATOM   10036 O OE1 . GLN J  2 85  ? 527.309 5.528   385.892 1.00 32.08  ?  108 GLN J OE1 1 
ATOM   10037 N NE2 . GLN J  2 85  ? 526.809 7.469   384.878 1.00 44.36  ?  108 GLN J NE2 1 
ATOM   10038 N N   . GLY J  2 86  ? 523.012 2.220   387.358 1.00 24.83  ?  109 GLY J N   1 
ATOM   10039 C CA  . GLY J  2 86  ? 522.737 1.260   388.404 1.00 24.70  ?  109 GLY J CA  1 
ATOM   10040 C C   . GLY J  2 86  ? 521.276 1.115   388.750 1.00 24.72  ?  109 GLY J C   1 
ATOM   10041 O O   . GLY J  2 86  ? 520.956 0.618   389.834 1.00 25.05  ?  109 GLY J O   1 
ATOM   10042 N N   . GLN J  2 87  ? 520.376 1.537   387.864 1.00 57.36  ?  110 GLN J N   1 
ATOM   10043 C CA  . GLN J  2 87  ? 518.945 1.469   388.115 1.00 60.10  ?  110 GLN J CA  1 
ATOM   10044 C C   . GLN J  2 87  ? 518.220 1.100   386.830 1.00 49.87  ?  110 GLN J C   1 
ATOM   10045 O O   . GLN J  2 87  ? 518.773 1.189   385.731 1.00 53.22  ?  110 GLN J O   1 
ATOM   10046 C CB  . GLN J  2 87  ? 518.400 2.796   388.661 1.00 60.69  ?  110 GLN J CB  1 
ATOM   10047 C CG  . GLN J  2 87  ? 518.872 3.139   390.064 1.00 65.09  ?  110 GLN J CG  1 
ATOM   10048 C CD  . GLN J  2 87  ? 518.352 4.481   390.538 1.00 77.61  ?  110 GLN J CD  1 
ATOM   10049 O OE1 . GLN J  2 87  ? 518.749 5.528   390.029 1.00 74.22  ?  110 GLN J OE1 1 
ATOM   10050 N NE2 . GLN J  2 87  ? 517.454 4.455   391.518 1.00 82.50  ?  110 GLN J NE2 1 
ATOM   10051 N N   . GLU J  2 88  ? 516.967 0.683   386.987 1.00 58.47  ?  111 GLU J N   1 
ATOM   10052 C CA  . GLU J  2 88  ? 516.111 0.332   385.866 1.00 69.04  ?  111 GLU J CA  1 
ATOM   10053 C C   . GLU J  2 88  ? 514.684 0.746   386.195 1.00 71.81  ?  111 GLU J C   1 
ATOM   10054 O O   . GLU J  2 88  ? 514.332 0.960   387.357 1.00 71.10  ?  111 GLU J O   1 
ATOM   10055 C CB  . GLU J  2 88  ? 516.178 -1.171  385.554 1.00 69.05  ?  111 GLU J CB  1 
ATOM   10056 C CG  . GLU J  2 88  ? 515.736 -1.544  384.149 1.00 73.99  ?  111 GLU J CG  1 
ATOM   10057 C CD  . GLU J  2 88  ? 515.564 -3.039  383.974 1.00 86.11  ?  111 GLU J CD  1 
ATOM   10058 O OE1 . GLU J  2 88  ? 514.747 -3.633  384.710 1.00 82.12  ?  111 GLU J OE1 1 
ATOM   10059 O OE2 . GLU J  2 88  ? 516.246 -3.620  383.104 1.00 84.73  -1 111 GLU J OE2 1 
ATOM   10060 N N   . LEU J  2 89  ? 513.859 0.855   385.157 1.00 27.95  ?  112 LEU J N   1 
ATOM   10061 C CA  . LEU J  2 89  ? 512.465 1.240   385.341 1.00 32.53  ?  112 LEU J CA  1 
ATOM   10062 C C   . LEU J  2 89  ? 511.675 0.021   385.809 1.00 39.36  ?  112 LEU J C   1 
ATOM   10063 O O   . LEU J  2 89  ? 511.590 -0.986  385.097 1.00 43.06  ?  112 LEU J O   1 
ATOM   10064 C CB  . LEU J  2 89  ? 511.894 1.800   384.040 1.00 30.81  ?  112 LEU J CB  1 
ATOM   10065 C CG  . LEU J  2 89  ? 510.836 2.910   384.100 1.00 26.16  ?  112 LEU J CG  1 
ATOM   10066 C CD1 . LEU J  2 89  ? 510.411 3.305   382.690 1.00 26.45  ?  112 LEU J CD1 1 
ATOM   10067 C CD2 . LEU J  2 89  ? 509.624 2.518   384.938 1.00 33.79  ?  112 LEU J CD2 1 
ATOM   10068 N N   . THR J  2 90  ? 511.098 0.115   387.004 1.00 81.76  ?  113 THR J N   1 
ATOM   10069 C CA  . THR J  2 90  ? 510.393 -0.995  387.629 1.00 84.15  ?  113 THR J CA  1 
ATOM   10070 C C   . THR J  2 90  ? 508.888 -0.946  387.392 1.00 85.75  ?  113 THR J C   1 
ATOM   10071 O O   . THR J  2 90  ? 508.160 -1.769  387.957 1.00 92.02  ?  113 THR J O   1 
ATOM   10072 C CB  . THR J  2 90  ? 510.697 -1.037  389.131 1.00 95.01  ?  113 THR J CB  1 
ATOM   10073 O OG1 . THR J  2 90  ? 512.056 -0.641  389.344 1.00 96.94  ?  113 THR J OG1 1 
ATOM   10074 C CG2 . THR J  2 90  ? 510.525 -2.451  389.687 1.00 94.16  ?  113 THR J CG2 1 
ATOM   10075 N N   . LYS J  2 91  ? 508.404 -0.007  386.570 1.00 53.64  ?  114 LYS J N   1 
ATOM   10076 C CA  . LYS J  2 91  ? 506.985 0.030   386.227 1.00 55.27  ?  114 LYS J CA  1 
ATOM   10077 C C   . LYS J  2 91  ? 506.130 0.242   387.473 1.00 50.54  ?  114 LYS J C   1 
ATOM   10078 O O   . LYS J  2 91  ? 505.628 -0.730  388.047 1.00 51.44  ?  114 LYS J O   1 
ATOM   10079 C CB  . LYS J  2 91  ? 506.570 -1.242  385.479 1.00 60.84  ?  114 LYS J CB  1 
ATOM   10080 C CG  . LYS J  2 91  ? 507.487 -1.595  384.310 1.00 70.17  ?  114 LYS J CG  1 
ATOM   10081 C CD  . LYS J  2 91  ? 507.699 -0.405  383.384 1.00 59.13  ?  114 LYS J CD  1 
ATOM   10082 C CE  . LYS J  2 91  ? 508.708 -0.723  382.289 1.00 48.13  ?  114 LYS J CE  1 
ATOM   10083 N NZ  . LYS J  2 91  ? 508.204 -1.751  381.338 1.00 53.16  ?  114 LYS J NZ  1 
ATOM   10084 N N   . LYS J  2 92  ? 505.960 1.508   387.882 1.00 74.57  ?  115 LYS J N   1 
ATOM   10085 C CA  . LYS J  2 92  ? 505.632 1.939   389.243 1.00 79.01  ?  115 LYS J CA  1 
ATOM   10086 C C   . LYS J  2 92  ? 506.815 1.760   390.186 1.00 76.34  ?  115 LYS J C   1 
ATOM   10087 O O   . LYS J  2 92  ? 506.864 0.821   390.988 1.00 71.59  ?  115 LYS J O   1 
ATOM   10088 C CB  . LYS J  2 92  ? 504.399 1.210   389.795 1.00 81.17  ?  115 LYS J CB  1 
ATOM   10089 C CG  . LYS J  2 92  ? 503.133 2.055   389.822 1.00 71.00  ?  115 LYS J CG  1 
ATOM   10090 C CD  . LYS J  2 92  ? 502.432 2.071   388.473 1.00 71.51  ?  115 LYS J CD  1 
ATOM   10091 C CE  . LYS J  2 92  ? 501.704 0.761   388.210 1.00 67.42  ?  115 LYS J CE  1 
ATOM   10092 N NZ  . LYS J  2 92  ? 500.846 0.838   386.996 1.00 61.25  ?  115 LYS J NZ  1 
ATOM   10093 N N   . GLY J  2 93  ? 507.771 2.674   390.073 1.00 45.98  ?  116 GLY J N   1 
ATOM   10094 C CA  . GLY J  2 93  ? 508.984 2.698   390.862 1.00 37.74  ?  116 GLY J CA  1 
ATOM   10095 C C   . GLY J  2 93  ? 510.218 2.424   390.018 1.00 43.83  ?  116 GLY J C   1 
ATOM   10096 O O   . GLY J  2 93  ? 510.147 2.020   388.857 1.00 40.92  ?  116 GLY J O   1 
ATOM   10097 N N   . CYS J  2 94  ? 511.371 2.701   390.626 1.00 71.04  ?  117 CYS J N   1 
ATOM   10098 C CA  . CYS J  2 94  ? 512.669 2.399   390.027 1.00 65.22  ?  117 CYS J CA  1 
ATOM   10099 C C   . CYS J  2 94  ? 513.475 1.553   391.002 1.00 59.21  ?  117 CYS J C   1 
ATOM   10100 O O   . CYS J  2 94  ? 513.877 2.031   392.066 1.00 54.11  ?  117 CYS J O   1 
ATOM   10101 C CB  . CYS J  2 94  ? 513.433 3.670   389.653 1.00 55.17  ?  117 CYS J CB  1 
ATOM   10102 S SG  . CYS J  2 94  ? 513.246 4.160   387.921 1.00 69.34  ?  117 CYS J SG  1 
ATOM   10103 N N   . LYS J  2 95  ? 513.706 0.300   390.628 1.00 68.59  ?  118 LYS J N   1 
ATOM   10104 C CA  . LYS J  2 95  ? 514.622 -0.568  391.346 1.00 77.01  ?  118 LYS J CA  1 
ATOM   10105 C C   . LYS J  2 95  ? 516.049 -0.061  391.165 1.00 75.92  ?  118 LYS J C   1 
ATOM   10106 O O   . LYS J  2 95  ? 516.363 0.653   390.209 1.00 72.03  ?  118 LYS J O   1 
ATOM   10107 C CB  . LYS J  2 95  ? 514.483 -2.003  390.828 1.00 84.67  ?  118 LYS J CB  1 
ATOM   10108 C CG  . LYS J  2 95  ? 515.221 -3.080  391.600 1.00 82.75  ?  118 LYS J CG  1 
ATOM   10109 C CD  . LYS J  2 95  ? 514.901 -4.457  391.027 1.00 78.73  ?  118 LYS J CD  1 
ATOM   10110 C CE  . LYS J  2 95  ? 514.994 -4.462  389.503 1.00 80.11  ?  118 LYS J CE  1 
ATOM   10111 N NZ  . LYS J  2 95  ? 514.828 -5.825  388.923 1.00 87.28  ?  118 LYS J NZ  1 
ATOM   10112 N N   . ASP J  2 96  ? 516.924 -0.433  392.094 1.00 71.07  ?  119 ASP J N   1 
ATOM   10113 C CA  . ASP J  2 96  ? 518.342 -0.130  391.948 1.00 60.27  ?  119 ASP J CA  1 
ATOM   10114 C C   . ASP J  2 96  ? 518.989 -1.410  391.439 1.00 64.26  ?  119 ASP J C   1 
ATOM   10115 O O   . ASP J  2 96  ? 519.310 -2.313  392.217 1.00 64.39  ?  119 ASP J O   1 
ATOM   10116 C CB  . ASP J  2 96  ? 518.938 0.328   393.275 1.00 57.23  ?  119 ASP J CB  1 
ATOM   10117 C CG  . ASP J  2 96  ? 520.212 1.130   393.102 1.00 63.90  ?  119 ASP J CG  1 
ATOM   10118 O OD1 . ASP J  2 96  ? 520.123 2.370   392.990 1.00 66.68  ?  119 ASP J OD1 1 
ATOM   10119 O OD2 . ASP J  2 96  ? 521.304 0.523   393.089 1.00 69.02  -1 119 ASP J OD2 1 
ATOM   10120 N N   . CYS J  2 97  ? 519.205 -1.455  390.123 1.00 109.94 ?  120 CYS J N   1 
ATOM   10121 C CA  . CYS J  2 97  ? 519.774 -2.594  389.412 1.00 105.65 ?  120 CYS J CA  1 
ATOM   10122 C C   . CYS J  2 97  ? 519.234 -3.915  389.941 1.00 113.96 ?  120 CYS J C   1 
ATOM   10123 O O   . CYS J  2 97  ? 518.025 -4.082  390.115 1.00 119.42 ?  120 CYS J O   1 
ATOM   10124 C CB  . CYS J  2 97  ? 521.298 -2.580  389.482 1.00 101.62 ?  120 CYS J CB  1 
ATOM   10125 S SG  . CYS J  2 97  ? 522.019 -3.185  387.953 1.00 134.59 ?  120 CYS J SG  1 
ATOM   10126 N N   . CYS J  2 98  ? 520.142 -4.846  390.214 1.00 91.51  ?  121 CYS J N   1 
ATOM   10127 C CA  . CYS J  2 98  ? 519.828 -6.086  390.908 1.00 94.31  ?  121 CYS J CA  1 
ATOM   10128 C C   . CYS J  2 98  ? 521.135 -6.628  391.470 1.00 90.60  ?  121 CYS J C   1 
ATOM   10129 O O   . CYS J  2 98  ? 522.185 -5.988  391.372 1.00 92.60  ?  121 CYS J O   1 
ATOM   10130 C CB  . CYS J  2 98  ? 519.143 -7.093  389.981 1.00 91.59  ?  121 CYS J CB  1 
ATOM   10131 S SG  . CYS J  2 98  ? 518.613 -8.615  390.800 1.00 112.60 ?  121 CYS J SG  1 
ATOM   10132 N N   . PHE J  2 99  ? 521.067 -7.814  392.062 1.00 90.77  ?  122 PHE J N   1 
ATOM   10133 C CA  . PHE J  2 99  ? 522.258 -8.480  392.577 1.00 87.57  ?  122 PHE J CA  1 
ATOM   10134 C C   . PHE J  2 99  ? 522.777 -9.421  391.496 1.00 75.64  ?  122 PHE J C   1 
ATOM   10135 O O   . PHE J  2 99  ? 522.137 -10.429 391.178 1.00 77.54  ?  122 PHE J O   1 
ATOM   10136 C CB  . PHE J  2 99  ? 521.945 -9.222  393.873 1.00 93.02  ?  122 PHE J CB  1 
ATOM   10137 C CG  . PHE J  2 99  ? 521.461 -8.325  394.980 1.00 100.22 ?  122 PHE J CG  1 
ATOM   10138 C CD1 . PHE J  2 99  ? 522.362 -7.691  395.821 1.00 102.98 ?  122 PHE J CD1 1 
ATOM   10139 C CD2 . PHE J  2 99  ? 520.105 -8.112  395.177 1.00 95.56  ?  122 PHE J CD2 1 
ATOM   10140 C CE1 . PHE J  2 99  ? 521.922 -6.864  396.838 1.00 103.85 ?  122 PHE J CE1 1 
ATOM   10141 C CE2 . PHE J  2 99  ? 519.659 -7.286  396.192 1.00 96.62  ?  122 PHE J CE2 1 
ATOM   10142 C CZ  . PHE J  2 99  ? 520.568 -6.662  397.024 1.00 108.79 ?  122 PHE J CZ  1 
ATOM   10143 N N   . GLY J  2 100 ? 523.936 -9.091  390.932 1.00 44.27  ?  123 GLY J N   1 
ATOM   10144 C CA  . GLY J  2 100 ? 524.521 -9.850  389.846 1.00 46.30  ?  123 GLY J CA  1 
ATOM   10145 C C   . GLY J  2 100 ? 524.447 -9.179  388.491 1.00 47.89  ?  123 GLY J C   1 
ATOM   10146 O O   . GLY J  2 100 ? 525.044 -9.693  387.537 1.00 44.29  ?  123 GLY J O   1 
ATOM   10147 N N   . THR J  2 101 ? 523.741 -8.057  388.369 1.00 44.27  ?  124 THR J N   1 
ATOM   10148 C CA  . THR J  2 101 ? 523.609 -7.346  387.104 1.00 38.75  ?  124 THR J CA  1 
ATOM   10149 C C   . THR J  2 101 ? 524.277 -5.976  387.197 1.00 32.54  ?  124 THR J C   1 
ATOM   10150 O O   . THR J  2 101 ? 524.765 -5.561  388.252 1.00 30.89  ?  124 THR J O   1 
ATOM   10151 C CB  . THR J  2 101 ? 522.134 -7.206  386.716 1.00 38.29  ?  124 THR J CB  1 
ATOM   10152 O OG1 . THR J  2 101 ? 521.422 -6.539  387.766 1.00 46.44  ?  124 THR J OG1 1 
ATOM   10153 C CG2 . THR J  2 101 ? 521.513 -8.574  386.478 1.00 39.41  ?  124 THR J CG2 1 
ATOM   10154 N N   . PHE J  2 102 ? 524.287 -5.266  386.069 1.00 37.89  ?  125 PHE J N   1 
ATOM   10155 C CA  . PHE J  2 102 ? 524.897 -3.946  385.997 1.00 38.99  ?  125 PHE J CA  1 
ATOM   10156 C C   . PHE J  2 102 ? 524.207 -3.124  384.919 1.00 42.09  ?  125 PHE J C   1 
ATOM   10157 O O   . PHE J  2 102 ? 523.784 -3.656  383.889 1.00 50.96  ?  125 PHE J O   1 
ATOM   10158 C CB  . PHE J  2 102 ? 526.396 -4.030  385.685 1.00 37.73  ?  125 PHE J CB  1 
ATOM   10159 C CG  . PHE J  2 102 ? 526.693 -4.186  384.221 1.00 37.51  ?  125 PHE J CG  1 
ATOM   10160 C CD1 . PHE J  2 102 ? 526.540 -5.413  383.598 1.00 39.88  ?  125 PHE J CD1 1 
ATOM   10161 C CD2 . PHE J  2 102 ? 527.110 -3.103  383.464 1.00 39.43  ?  125 PHE J CD2 1 
ATOM   10162 C CE1 . PHE J  2 102 ? 526.803 -5.558  382.250 1.00 45.28  ?  125 PHE J CE1 1 
ATOM   10163 C CE2 . PHE J  2 102 ? 527.373 -3.242  382.116 1.00 44.12  ?  125 PHE J CE2 1 
ATOM   10164 C CZ  . PHE J  2 102 ? 527.221 -4.471  381.508 1.00 45.17  ?  125 PHE J CZ  1 
ATOM   10165 N N   . ASN J  2 103 ? 524.098 -1.820  385.166 1.00 29.39  ?  126 ASN J N   1 
ATOM   10166 C CA  . ASN J  2 103 ? 523.706 -0.862  384.136 1.00 29.72  ?  126 ASN J CA  1 
ATOM   10167 C C   . ASN J  2 103 ? 524.548 0.392   384.290 1.00 28.78  ?  126 ASN J C   1 
ATOM   10168 O O   . ASN J  2 103 ? 524.500 1.042   385.338 1.00 37.99  ?  126 ASN J O   1 
ATOM   10169 C CB  . ASN J  2 103 ? 522.217 -0.514  384.230 1.00 33.79  ?  126 ASN J CB  1 
ATOM   10170 C CG  . ASN J  2 103 ? 521.811 0.582   383.263 1.00 35.94  ?  126 ASN J CG  1 
ATOM   10171 O OD1 . ASN J  2 103 ? 522.388 0.721   382.185 1.00 41.86  ?  126 ASN J OD1 1 
ATOM   10172 N ND2 . ASN J  2 103 ? 520.813 1.369   383.649 1.00 29.31  ?  126 ASN J ND2 1 
ATOM   10173 N N   . ASP J  2 104 ? 525.311 0.738   383.259 1.00 54.56  ?  127 ASP J N   1 
ATOM   10174 C CA  . ASP J  2 104 ? 525.900 2.069   383.159 1.00 58.40  ?  127 ASP J CA  1 
ATOM   10175 C C   . ASP J  2 104 ? 525.270 2.750   381.950 1.00 60.61  ?  127 ASP J C   1 
ATOM   10176 O O   . ASP J  2 104 ? 525.654 2.482   380.807 1.00 72.08  ?  127 ASP J O   1 
ATOM   10177 C CB  . ASP J  2 104 ? 527.420 1.991   383.039 1.00 56.87  ?  127 ASP J CB  1 
ATOM   10178 C CG  . ASP J  2 104 ? 527.872 0.945   382.041 1.00 66.36  ?  127 ASP J CG  1 
ATOM   10179 O OD1 . ASP J  2 104 ? 527.193 -0.097  381.927 1.00 65.30  ?  127 ASP J OD1 1 
ATOM   10180 O OD2 . ASP J  2 104 ? 528.903 1.164   381.369 1.00 84.19  -1 127 ASP J OD2 1 
ATOM   10181 N N   . GLN J  2 105 ? 524.330 3.657   382.221 1.00 47.82  ?  128 GLN J N   1 
ATOM   10182 C CA  . GLN J  2 105 ? 523.658 4.483   381.223 1.00 51.94  ?  128 GLN J CA  1 
ATOM   10183 C C   . GLN J  2 105 ? 522.540 5.261   381.903 1.00 57.89  ?  128 GLN J C   1 
ATOM   10184 O O   . GLN J  2 105 ? 522.096 4.885   382.992 1.00 55.64  ?  128 GLN J O   1 
ATOM   10185 C CB  . GLN J  2 105 ? 523.088 3.634   380.082 1.00 60.53  ?  128 GLN J CB  1 
ATOM   10186 C CG  . GLN J  2 105 ? 522.743 4.418   378.830 1.00 60.86  ?  128 GLN J CG  1 
ATOM   10187 C CD  . GLN J  2 105 ? 522.923 3.602   377.570 1.00 60.74  ?  128 GLN J CD  1 
ATOM   10188 O OE1 . GLN J  2 105 ? 523.325 2.439   377.619 1.00 53.25  ?  128 GLN J OE1 1 
ATOM   10189 N NE2 . GLN J  2 105 ? 522.623 4.207   376.430 1.00 57.75  ?  128 GLN J NE2 1 
ATOM   10190 N N   . LYS J  2 106 ? 522.075 6.341   381.277 1.00 60.89  ?  129 LYS J N   1 
ATOM   10191 C CA  . LYS J  2 106 ? 520.867 7.001   381.751 1.00 50.40  ?  129 LYS J CA  1 
ATOM   10192 C C   . LYS J  2 106 ? 519.673 6.055   381.687 1.00 53.22  ?  129 LYS J C   1 
ATOM   10193 O O   . LYS J  2 106 ? 519.205 5.568   382.717 1.00 57.90  ?  129 LYS J O   1 
ATOM   10194 C CB  . LYS J  2 106 ? 520.590 8.265   380.937 1.00 58.32  ?  129 LYS J CB  1 
ATOM   10195 C CG  . LYS J  2 106 ? 521.660 9.331   381.069 1.00 55.13  ?  129 LYS J CG  1 
ATOM   10196 C CD  . LYS J  2 106 ? 521.381 10.493  380.136 1.00 63.34  ?  129 LYS J CD  1 
ATOM   10197 C CE  . LYS J  2 106 ? 520.021 11.113  380.420 1.00 73.77  ?  129 LYS J CE  1 
ATOM   10198 N NZ  . LYS J  2 106 ? 519.720 12.248  379.505 1.00 77.92  ?  129 LYS J NZ  1 
ATOM   10199 N N   . ARG J  2 107 ? 519.203 5.758   380.479 1.00 48.77  ?  130 ARG J N   1 
ATOM   10200 C CA  . ARG J  2 107 ? 517.976 4.998   380.279 1.00 43.68  ?  130 ARG J CA  1 
ATOM   10201 C C   . ARG J  2 107 ? 518.214 3.504   380.089 1.00 50.08  ?  130 ARG J C   1 
ATOM   10202 O O   . ARG J  2 107 ? 517.265 2.775   379.782 1.00 48.02  ?  130 ARG J O   1 
ATOM   10203 C CB  . ARG J  2 107 ? 517.195 5.565   379.091 1.00 58.98  ?  130 ARG J CB  1 
ATOM   10204 C CG  . ARG J  2 107 ? 516.546 6.910   379.385 1.00 67.21  ?  130 ARG J CG  1 
ATOM   10205 C CD  . ARG J  2 107 ? 515.305 7.139   378.538 1.00 76.57  ?  130 ARG J CD  1 
ATOM   10206 N NE  . ARG J  2 107 ? 514.441 8.165   379.116 1.00 86.03  ?  130 ARG J NE  1 
ATOM   10207 C CZ  . ARG J  2 107 ? 514.521 9.461   378.829 1.00 97.48  ?  130 ARG J CZ  1 
ATOM   10208 N NH1 . ARG J  2 107 ? 513.693 10.321  379.407 1.00 88.59  ?  130 ARG J NH1 1 
ATOM   10209 N NH2 . ARG J  2 107 ? 515.428 9.895   377.965 1.00 94.67  ?  130 ARG J NH2 1 
ATOM   10210 N N   . GLY J  2 108 ? 519.447 3.035   380.252 1.00 63.13  ?  131 GLY J N   1 
ATOM   10211 C CA  . GLY J  2 108 ? 519.764 1.640   380.034 1.00 62.80  ?  131 GLY J CA  1 
ATOM   10212 C C   . GLY J  2 108 ? 519.089 0.711   381.033 1.00 58.10  ?  131 GLY J C   1 
ATOM   10213 O O   . GLY J  2 108 ? 518.371 1.119   381.946 1.00 56.02  ?  131 GLY J O   1 
ATOM   10214 N N   . ILE J  2 109 ? 519.334 -0.583  380.836 1.00 42.75  ?  132 ILE J N   1 
ATOM   10215 C CA  . ILE J  2 109 ? 518.737 -1.638  381.643 1.00 43.30  ?  132 ILE J CA  1 
ATOM   10216 C C   . ILE J  2 109 ? 519.846 -2.478  382.261 1.00 51.39  ?  132 ILE J C   1 
ATOM   10217 O O   . ILE J  2 109 ? 520.944 -2.596  381.707 1.00 52.85  ?  132 ILE J O   1 
ATOM   10218 C CB  . ILE J  2 109 ? 517.788 -2.521  380.805 1.00 40.63  ?  132 ILE J CB  1 
ATOM   10219 C CG1 . ILE J  2 109 ? 518.487 -2.979  379.522 1.00 41.59  ?  132 ILE J CG1 1 
ATOM   10220 C CG2 . ILE J  2 109 ? 516.507 -1.768  380.486 1.00 39.99  ?  132 ILE J CG2 1 
ATOM   10221 C CD1 . ILE J  2 109 ? 517.612 -3.805  378.608 1.00 42.43  ?  132 ILE J CD1 1 
ATOM   10222 N N   . CYS J  2 110 ? 519.549 -3.070  383.418 1.00 56.89  ?  133 CYS J N   1 
ATOM   10223 C CA  . CYS J  2 110 ? 520.526 -3.895  384.120 1.00 50.71  ?  133 CYS J CA  1 
ATOM   10224 C C   . CYS J  2 110 ? 520.585 -5.277  383.479 1.00 49.61  ?  133 CYS J C   1 
ATOM   10225 O O   . CYS J  2 110 ? 519.575 -5.984  383.411 1.00 50.01  ?  133 CYS J O   1 
ATOM   10226 C CB  . CYS J  2 110 ? 520.189 -3.990  385.608 1.00 49.94  ?  133 CYS J CB  1 
ATOM   10227 S SG  . CYS J  2 110 ? 520.706 -2.521  386.539 1.00 65.09  ?  133 CYS J SG  1 
ATOM   10228 N N   . ARG J  2 111 ? 521.773 -5.653  383.008 1.00 66.53  ?  134 ARG J N   1 
ATOM   10229 C CA  . ARG J  2 111 ? 522.051 -6.920  382.359 1.00 61.82  ?  134 ARG J CA  1 
ATOM   10230 C C   . ARG J  2 111 ? 523.025 -7.732  383.203 1.00 60.65  ?  134 ARG J C   1 
ATOM   10231 O O   . ARG J  2 111 ? 523.830 -7.160  383.945 1.00 59.75  ?  134 ARG J O   1 
ATOM   10232 C CB  . ARG J  2 111 ? 522.655 -6.708  380.966 1.00 63.67  ?  134 ARG J CB  1 
ATOM   10233 C CG  . ARG J  2 111 ? 522.144 -5.479  380.235 1.00 74.76  ?  134 ARG J CG  1 
ATOM   10234 C CD  . ARG J  2 111 ? 523.100 -5.055  379.123 1.00 74.17  ?  134 ARG J CD  1 
ATOM   10235 N NE  . ARG J  2 111 ? 523.134 -6.005  378.012 1.00 78.87  ?  134 ARG J NE  1 
ATOM   10236 C CZ  . ARG J  2 111 ? 524.038 -6.972  377.876 1.00 68.59  ?  134 ARG J CZ  1 
ATOM   10237 N NH1 . ARG J  2 111 ? 524.989 -7.128  378.785 1.00 54.63  ?  134 ARG J NH1 1 
ATOM   10238 N NH2 . ARG J  2 111 ? 523.989 -7.786  376.831 1.00 66.86  ?  134 ARG J NH2 1 
ATOM   10239 N N   . PRO J  2 112 ? 522.980 -9.062  383.115 1.00 38.85  ?  135 PRO J N   1 
ATOM   10240 C CA  . PRO J  2 112 ? 523.930 -9.882  383.877 1.00 38.41  ?  135 PRO J CA  1 
ATOM   10241 C C   . PRO J  2 112 ? 525.373 -9.540  383.533 1.00 38.98  ?  135 PRO J C   1 
ATOM   10242 O O   . PRO J  2 112 ? 525.688 -9.104  382.423 1.00 37.48  ?  135 PRO J O   1 
ATOM   10243 C CB  . PRO J  2 112 ? 523.579 -11.314 383.455 1.00 32.13  ?  135 PRO J CB  1 
ATOM   10244 C CG  . PRO J  2 112 ? 522.151 -11.238 383.037 1.00 34.85  ?  135 PRO J CG  1 
ATOM   10245 C CD  . PRO J  2 112 ? 521.984 -9.885  382.408 1.00 37.05  ?  135 PRO J CD  1 
ATOM   10246 N N   . TRP J  2 113 ? 526.252 -9.736  384.513 1.00 42.52  ?  136 TRP J N   1 
ATOM   10247 C CA  . TRP J  2 113 ? 527.662 -9.431  384.338 1.00 43.56  ?  136 TRP J CA  1 
ATOM   10248 C C   . TRP J  2 113 ? 528.293 -10.348 383.297 1.00 38.29  ?  136 TRP J C   1 
ATOM   10249 O O   . TRP J  2 113 ? 527.814 -11.452 383.024 1.00 35.46  ?  136 TRP J O   1 
ATOM   10250 C CB  . TRP J  2 113 ? 528.412 -9.573  385.663 1.00 50.30  ?  136 TRP J CB  1 
ATOM   10251 C CG  . TRP J  2 113 ? 528.142 -8.476  386.645 1.00 49.34  ?  136 TRP J CG  1 
ATOM   10252 C CD1 . TRP J  2 113 ? 527.847 -7.176  386.363 1.00 48.38  ?  136 TRP J CD1 1 
ATOM   10253 C CD2 . TRP J  2 113 ? 528.141 -8.587  388.074 1.00 49.69  ?  136 TRP J CD2 1 
ATOM   10254 N NE1 . TRP J  2 113 ? 527.665 -6.468  387.528 1.00 49.34  ?  136 TRP J NE1 1 
ATOM   10255 C CE2 . TRP J  2 113 ? 527.839 -7.313  388.592 1.00 47.91  ?  136 TRP J CE2 1 
ATOM   10256 C CE3 . TRP J  2 113 ? 528.366 -9.641  388.965 1.00 47.98  ?  136 TRP J CE3 1 
ATOM   10257 C CZ2 . TRP J  2 113 ? 527.754 -7.063  389.960 1.00 48.75  ?  136 TRP J CZ2 1 
ATOM   10258 C CZ3 . TRP J  2 113 ? 528.283 -9.391  390.322 1.00 53.32  ?  136 TRP J CZ3 1 
ATOM   10259 C CH2 . TRP J  2 113 ? 527.980 -8.113  390.806 1.00 53.52  ?  136 TRP J CH2 1 
ATOM   10260 N N   . THR J  2 114 ? 529.387 -9.871  382.708 1.00 44.91  ?  137 THR J N   1 
ATOM   10261 C CA  . THR J  2 114 ? 530.163 -10.703 381.801 1.00 54.62  ?  137 THR J CA  1 
ATOM   10262 C C   . THR J  2 114 ? 530.818 -11.836 382.582 1.00 53.73  ?  137 THR J C   1 
ATOM   10263 O O   . THR J  2 114 ? 531.518 -11.599 383.571 1.00 59.68  ?  137 THR J O   1 
ATOM   10264 C CB  . THR J  2 114 ? 531.226 -9.871  381.087 1.00 49.61  ?  137 THR J CB  1 
ATOM   10265 O OG1 . THR J  2 114 ? 530.592 -8.853  380.301 1.00 52.12  ?  137 THR J OG1 1 
ATOM   10266 C CG2 . THR J  2 114 ? 532.073 -10.752 380.181 1.00 42.93  ?  137 THR J CG2 1 
ATOM   10267 N N   . ASN J  2 115 ? 530.588 -13.067 382.138 1.00 44.97  ?  138 ASN J N   1 
ATOM   10268 C CA  . ASN J  2 115 ? 531.144 -14.232 382.812 1.00 45.29  ?  138 ASN J CA  1 
ATOM   10269 C C   . ASN J  2 115 ? 532.575 -14.449 382.334 1.00 57.23  ?  138 ASN J C   1 
ATOM   10270 O O   . ASN J  2 115 ? 532.810 -14.663 381.140 1.00 67.