data_6ACQ
# 
_entry.id   6ACQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6ACQ         
WWPDB D_1300008408 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          6AA8 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6ACQ 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Takenoya, M.' 1 ? 
'Taguchi, S.'  2 ? 
'Yajima, S.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr F Struct Biol Commun' 
_citation.journal_id_ASTM           ACSFEN 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2053-230X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            74 
_citation.language                  ? 
_citation.page_first                733 
_citation.page_last                 740 
_citation.title                     
;Crystal structure and kinetic analyses of a hexameric form of (S)-3-hydroxybutyryl-CoA dehydrogenase from Clostridium acetobutylicum.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2053230X18014814 
_citation.pdbx_database_id_PubMed   30387779 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Takenoya, M.' 1 ?                   
primary 'Taguchi, S.'  2 ?                   
primary 'Yajima, S.'   3 0000-0001-7967-4566 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6ACQ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     133.434 
_cell.length_a_esd                 ? 
_cell.length_b                     134.479 
_cell.length_b_esd                 ? 
_cell.length_c                     153.804 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6ACQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man '3-hydroxybutyryl-CoA dehydrogenase' 32793.043 6  1.1.1.157 ? ? ? 
2 water   nat water                                18.015    79 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Beta-hydroxybutyryl-CoA dehydrogenase,BHBD' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA
TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLSITEVASATKRPDKVIGMHFF
NPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVAEAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGA
NHPMGPLELGDFIGLDICLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA
TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLSITEVASATKRPDKVIGMHFF
NPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVAEAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGA
NHPMGPLELGDFIGLDICLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  LYS n 
1 23  LYS n 
1 24  VAL n 
1 25  CYS n 
1 26  VAL n 
1 27  ILE n 
1 28  GLY n 
1 29  ALA n 
1 30  GLY n 
1 31  THR n 
1 32  MET n 
1 33  GLY n 
1 34  SER n 
1 35  GLY n 
1 36  ILE n 
1 37  ALA n 
1 38  GLN n 
1 39  ALA n 
1 40  PHE n 
1 41  ALA n 
1 42  ALA n 
1 43  LYS n 
1 44  GLY n 
1 45  PHE n 
1 46  GLU n 
1 47  VAL n 
1 48  VAL n 
1 49  LEU n 
1 50  ARG n 
1 51  ASP n 
1 52  ILE n 
1 53  LYS n 
1 54  ASP n 
1 55  GLU n 
1 56  PHE n 
1 57  VAL n 
1 58  ASP n 
1 59  ARG n 
1 60  GLY n 
1 61  LEU n 
1 62  ASP n 
1 63  PHE n 
1 64  ILE n 
1 65  ASN n 
1 66  LYS n 
1 67  ASN n 
1 68  LEU n 
1 69  SER n 
1 70  LYS n 
1 71  LEU n 
1 72  VAL n 
1 73  LYS n 
1 74  LYS n 
1 75  GLY n 
1 76  LYS n 
1 77  ILE n 
1 78  GLU n 
1 79  GLU n 
1 80  ALA n 
1 81  THR n 
1 82  LYS n 
1 83  VAL n 
1 84  GLU n 
1 85  ILE n 
1 86  LEU n 
1 87  THR n 
1 88  ARG n 
1 89  ILE n 
1 90  SER n 
1 91  GLY n 
1 92  THR n 
1 93  VAL n 
1 94  ASP n 
1 95  LEU n 
1 96  ASN n 
1 97  MET n 
1 98  ALA n 
1 99  ALA n 
1 100 ASP n 
1 101 CYS n 
1 102 ASP n 
1 103 LEU n 
1 104 VAL n 
1 105 ILE n 
1 106 GLU n 
1 107 ALA n 
1 108 ALA n 
1 109 VAL n 
1 110 GLU n 
1 111 ARG n 
1 112 MET n 
1 113 ASP n 
1 114 ILE n 
1 115 LYS n 
1 116 LYS n 
1 117 GLN n 
1 118 ILE n 
1 119 PHE n 
1 120 ALA n 
1 121 ASP n 
1 122 LEU n 
1 123 ASP n 
1 124 ASN n 
1 125 ILE n 
1 126 CYS n 
1 127 LYS n 
1 128 PRO n 
1 129 GLU n 
1 130 THR n 
1 131 ILE n 
1 132 LEU n 
1 133 ALA n 
1 134 SER n 
1 135 ASN n 
1 136 THR n 
1 137 SER n 
1 138 SER n 
1 139 LEU n 
1 140 SER n 
1 141 ILE n 
1 142 THR n 
1 143 GLU n 
1 144 VAL n 
1 145 ALA n 
1 146 SER n 
1 147 ALA n 
1 148 THR n 
1 149 LYS n 
1 150 ARG n 
1 151 PRO n 
1 152 ASP n 
1 153 LYS n 
1 154 VAL n 
1 155 ILE n 
1 156 GLY n 
1 157 MET n 
1 158 HIS n 
1 159 PHE n 
1 160 PHE n 
1 161 ASN n 
1 162 PRO n 
1 163 ALA n 
1 164 PRO n 
1 165 VAL n 
1 166 MET n 
1 167 LYS n 
1 168 LEU n 
1 169 VAL n 
1 170 GLU n 
1 171 VAL n 
1 172 ILE n 
1 173 ARG n 
1 174 GLY n 
1 175 ILE n 
1 176 ALA n 
1 177 THR n 
1 178 SER n 
1 179 GLN n 
1 180 GLU n 
1 181 THR n 
1 182 PHE n 
1 183 ASP n 
1 184 ALA n 
1 185 VAL n 
1 186 LYS n 
1 187 GLU n 
1 188 THR n 
1 189 SER n 
1 190 ILE n 
1 191 ALA n 
1 192 ILE n 
1 193 GLY n 
1 194 LYS n 
1 195 ASP n 
1 196 PRO n 
1 197 VAL n 
1 198 GLU n 
1 199 VAL n 
1 200 ALA n 
1 201 GLU n 
1 202 ALA n 
1 203 PRO n 
1 204 GLY n 
1 205 PHE n 
1 206 VAL n 
1 207 VAL n 
1 208 ASN n 
1 209 ARG n 
1 210 ILE n 
1 211 LEU n 
1 212 ILE n 
1 213 PRO n 
1 214 MET n 
1 215 ILE n 
1 216 ASN n 
1 217 GLU n 
1 218 ALA n 
1 219 VAL n 
1 220 GLY n 
1 221 ILE n 
1 222 LEU n 
1 223 ALA n 
1 224 GLU n 
1 225 GLY n 
1 226 ILE n 
1 227 ALA n 
1 228 SER n 
1 229 VAL n 
1 230 GLU n 
1 231 ASP n 
1 232 ILE n 
1 233 ASP n 
1 234 LYS n 
1 235 ALA n 
1 236 MET n 
1 237 LYS n 
1 238 LEU n 
1 239 GLY n 
1 240 ALA n 
1 241 ASN n 
1 242 HIS n 
1 243 PRO n 
1 244 MET n 
1 245 GLY n 
1 246 PRO n 
1 247 LEU n 
1 248 GLU n 
1 249 LEU n 
1 250 GLY n 
1 251 ASP n 
1 252 PHE n 
1 253 ILE n 
1 254 GLY n 
1 255 LEU n 
1 256 ASP n 
1 257 ILE n 
1 258 CYS n 
1 259 LEU n 
1 260 ALA n 
1 261 ILE n 
1 262 MET n 
1 263 ASP n 
1 264 VAL n 
1 265 LEU n 
1 266 TYR n 
1 267 SER n 
1 268 GLU n 
1 269 THR n 
1 270 GLY n 
1 271 ASP n 
1 272 SER n 
1 273 LYS n 
1 274 TYR n 
1 275 ARG n 
1 276 PRO n 
1 277 HIS n 
1 278 THR n 
1 279 LEU n 
1 280 LEU n 
1 281 LYS n 
1 282 LYS n 
1 283 TYR n 
1 284 VAL n 
1 285 ARG n 
1 286 ALA n 
1 287 GLY n 
1 288 TRP n 
1 289 LEU n 
1 290 GLY n 
1 291 ARG n 
1 292 LYS n 
1 293 SER n 
1 294 GLY n 
1 295 LYS n 
1 296 GLY n 
1 297 PHE n 
1 298 TYR n 
1 299 ASP n 
1 300 TYR n 
1 301 SER n 
1 302 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   302 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'hbd, CA_C2708' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Clostridium acetobutylicum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     272562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HBD_CLOAB 
_struct_ref.pdbx_db_accession          P52041 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEATKVEILTRISGTVDLNMAAD
CDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLSITEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQE
TFDAVKETSIAIGKDPVEVAEAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLA
IMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6ACQ A 21 ? 302 ? P52041 1 ? 282 ? 1 282 
2 1 6ACQ B 21 ? 302 ? P52041 1 ? 282 ? 1 282 
3 1 6ACQ C 21 ? 302 ? P52041 1 ? 282 ? 1 282 
4 1 6ACQ D 21 ? 302 ? P52041 1 ? 282 ? 1 282 
5 1 6ACQ E 21 ? 302 ? P52041 1 ? 282 ? 1 282 
6 1 6ACQ F 21 ? 302 ? P52041 1 ? 282 ? 1 282 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ACQ MET A 1  ? UNP P52041 ? ? 'expression tag' -19 1   
1 6ACQ GLY A 2  ? UNP P52041 ? ? 'expression tag' -18 2   
1 6ACQ SER A 3  ? UNP P52041 ? ? 'expression tag' -17 3   
1 6ACQ SER A 4  ? UNP P52041 ? ? 'expression tag' -16 4   
1 6ACQ HIS A 5  ? UNP P52041 ? ? 'expression tag' -15 5   
1 6ACQ HIS A 6  ? UNP P52041 ? ? 'expression tag' -14 6   
1 6ACQ HIS A 7  ? UNP P52041 ? ? 'expression tag' -13 7   
1 6ACQ HIS A 8  ? UNP P52041 ? ? 'expression tag' -12 8   
1 6ACQ HIS A 9  ? UNP P52041 ? ? 'expression tag' -11 9   
1 6ACQ HIS A 10 ? UNP P52041 ? ? 'expression tag' -10 10  
1 6ACQ SER A 11 ? UNP P52041 ? ? 'expression tag' -9  11  
1 6ACQ SER A 12 ? UNP P52041 ? ? 'expression tag' -8  12  
1 6ACQ GLY A 13 ? UNP P52041 ? ? 'expression tag' -7  13  
1 6ACQ LEU A 14 ? UNP P52041 ? ? 'expression tag' -6  14  
1 6ACQ VAL A 15 ? UNP P52041 ? ? 'expression tag' -5  15  
1 6ACQ PRO A 16 ? UNP P52041 ? ? 'expression tag' -4  16  
1 6ACQ ARG A 17 ? UNP P52041 ? ? 'expression tag' -3  17  
1 6ACQ GLY A 18 ? UNP P52041 ? ? 'expression tag' -2  18  
1 6ACQ SER A 19 ? UNP P52041 ? ? 'expression tag' -1  19  
1 6ACQ HIS A 20 ? UNP P52041 ? ? 'expression tag' 0   20  
2 6ACQ MET B 1  ? UNP P52041 ? ? 'expression tag' -19 21  
2 6ACQ GLY B 2  ? UNP P52041 ? ? 'expression tag' -18 22  
2 6ACQ SER B 3  ? UNP P52041 ? ? 'expression tag' -17 23  
2 6ACQ SER B 4  ? UNP P52041 ? ? 'expression tag' -16 24  
2 6ACQ HIS B 5  ? UNP P52041 ? ? 'expression tag' -15 25  
2 6ACQ HIS B 6  ? UNP P52041 ? ? 'expression tag' -14 26  
2 6ACQ HIS B 7  ? UNP P52041 ? ? 'expression tag' -13 27  
2 6ACQ HIS B 8  ? UNP P52041 ? ? 'expression tag' -12 28  
2 6ACQ HIS B 9  ? UNP P52041 ? ? 'expression tag' -11 29  
2 6ACQ HIS B 10 ? UNP P52041 ? ? 'expression tag' -10 30  
2 6ACQ SER B 11 ? UNP P52041 ? ? 'expression tag' -9  31  
2 6ACQ SER B 12 ? UNP P52041 ? ? 'expression tag' -8  32  
2 6ACQ GLY B 13 ? UNP P52041 ? ? 'expression tag' -7  33  
2 6ACQ LEU B 14 ? UNP P52041 ? ? 'expression tag' -6  34  
2 6ACQ VAL B 15 ? UNP P52041 ? ? 'expression tag' -5  35  
2 6ACQ PRO B 16 ? UNP P52041 ? ? 'expression tag' -4  36  
2 6ACQ ARG B 17 ? UNP P52041 ? ? 'expression tag' -3  37  
2 6ACQ GLY B 18 ? UNP P52041 ? ? 'expression tag' -2  38  
2 6ACQ SER B 19 ? UNP P52041 ? ? 'expression tag' -1  39  
2 6ACQ HIS B 20 ? UNP P52041 ? ? 'expression tag' 0   40  
3 6ACQ MET C 1  ? UNP P52041 ? ? 'expression tag' -19 41  
3 6ACQ GLY C 2  ? UNP P52041 ? ? 'expression tag' -18 42  
3 6ACQ SER C 3  ? UNP P52041 ? ? 'expression tag' -17 43  
3 6ACQ SER C 4  ? UNP P52041 ? ? 'expression tag' -16 44  
3 6ACQ HIS C 5  ? UNP P52041 ? ? 'expression tag' -15 45  
3 6ACQ HIS C 6  ? UNP P52041 ? ? 'expression tag' -14 46  
3 6ACQ HIS C 7  ? UNP P52041 ? ? 'expression tag' -13 47  
3 6ACQ HIS C 8  ? UNP P52041 ? ? 'expression tag' -12 48  
3 6ACQ HIS C 9  ? UNP P52041 ? ? 'expression tag' -11 49  
3 6ACQ HIS C 10 ? UNP P52041 ? ? 'expression tag' -10 50  
3 6ACQ SER C 11 ? UNP P52041 ? ? 'expression tag' -9  51  
3 6ACQ SER C 12 ? UNP P52041 ? ? 'expression tag' -8  52  
3 6ACQ GLY C 13 ? UNP P52041 ? ? 'expression tag' -7  53  
3 6ACQ LEU C 14 ? UNP P52041 ? ? 'expression tag' -6  54  
3 6ACQ VAL C 15 ? UNP P52041 ? ? 'expression tag' -5  55  
3 6ACQ PRO C 16 ? UNP P52041 ? ? 'expression tag' -4  56  
3 6ACQ ARG C 17 ? UNP P52041 ? ? 'expression tag' -3  57  
3 6ACQ GLY C 18 ? UNP P52041 ? ? 'expression tag' -2  58  
3 6ACQ SER C 19 ? UNP P52041 ? ? 'expression tag' -1  59  
3 6ACQ HIS C 20 ? UNP P52041 ? ? 'expression tag' 0   60  
4 6ACQ MET D 1  ? UNP P52041 ? ? 'expression tag' -19 61  
4 6ACQ GLY D 2  ? UNP P52041 ? ? 'expression tag' -18 62  
4 6ACQ SER D 3  ? UNP P52041 ? ? 'expression tag' -17 63  
4 6ACQ SER D 4  ? UNP P52041 ? ? 'expression tag' -16 64  
4 6ACQ HIS D 5  ? UNP P52041 ? ? 'expression tag' -15 65  
4 6ACQ HIS D 6  ? UNP P52041 ? ? 'expression tag' -14 66  
4 6ACQ HIS D 7  ? UNP P52041 ? ? 'expression tag' -13 67  
4 6ACQ HIS D 8  ? UNP P52041 ? ? 'expression tag' -12 68  
4 6ACQ HIS D 9  ? UNP P52041 ? ? 'expression tag' -11 69  
4 6ACQ HIS D 10 ? UNP P52041 ? ? 'expression tag' -10 70  
4 6ACQ SER D 11 ? UNP P52041 ? ? 'expression tag' -9  71  
4 6ACQ SER D 12 ? UNP P52041 ? ? 'expression tag' -8  72  
4 6ACQ GLY D 13 ? UNP P52041 ? ? 'expression tag' -7  73  
4 6ACQ LEU D 14 ? UNP P52041 ? ? 'expression tag' -6  74  
4 6ACQ VAL D 15 ? UNP P52041 ? ? 'expression tag' -5  75  
4 6ACQ PRO D 16 ? UNP P52041 ? ? 'expression tag' -4  76  
4 6ACQ ARG D 17 ? UNP P52041 ? ? 'expression tag' -3  77  
4 6ACQ GLY D 18 ? UNP P52041 ? ? 'expression tag' -2  78  
4 6ACQ SER D 19 ? UNP P52041 ? ? 'expression tag' -1  79  
4 6ACQ HIS D 20 ? UNP P52041 ? ? 'expression tag' 0   80  
5 6ACQ MET E 1  ? UNP P52041 ? ? 'expression tag' -19 81  
5 6ACQ GLY E 2  ? UNP P52041 ? ? 'expression tag' -18 82  
5 6ACQ SER E 3  ? UNP P52041 ? ? 'expression tag' -17 83  
5 6ACQ SER E 4  ? UNP P52041 ? ? 'expression tag' -16 84  
5 6ACQ HIS E 5  ? UNP P52041 ? ? 'expression tag' -15 85  
5 6ACQ HIS E 6  ? UNP P52041 ? ? 'expression tag' -14 86  
5 6ACQ HIS E 7  ? UNP P52041 ? ? 'expression tag' -13 87  
5 6ACQ HIS E 8  ? UNP P52041 ? ? 'expression tag' -12 88  
5 6ACQ HIS E 9  ? UNP P52041 ? ? 'expression tag' -11 89  
5 6ACQ HIS E 10 ? UNP P52041 ? ? 'expression tag' -10 90  
5 6ACQ SER E 11 ? UNP P52041 ? ? 'expression tag' -9  91  
5 6ACQ SER E 12 ? UNP P52041 ? ? 'expression tag' -8  92  
5 6ACQ GLY E 13 ? UNP P52041 ? ? 'expression tag' -7  93  
5 6ACQ LEU E 14 ? UNP P52041 ? ? 'expression tag' -6  94  
5 6ACQ VAL E 15 ? UNP P52041 ? ? 'expression tag' -5  95  
5 6ACQ PRO E 16 ? UNP P52041 ? ? 'expression tag' -4  96  
5 6ACQ ARG E 17 ? UNP P52041 ? ? 'expression tag' -3  97  
5 6ACQ GLY E 18 ? UNP P52041 ? ? 'expression tag' -2  98  
5 6ACQ SER E 19 ? UNP P52041 ? ? 'expression tag' -1  99  
5 6ACQ HIS E 20 ? UNP P52041 ? ? 'expression tag' 0   100 
6 6ACQ MET F 1  ? UNP P52041 ? ? 'expression tag' -19 101 
6 6ACQ GLY F 2  ? UNP P52041 ? ? 'expression tag' -18 102 
6 6ACQ SER F 3  ? UNP P52041 ? ? 'expression tag' -17 103 
6 6ACQ SER F 4  ? UNP P52041 ? ? 'expression tag' -16 104 
6 6ACQ HIS F 5  ? UNP P52041 ? ? 'expression tag' -15 105 
6 6ACQ HIS F 6  ? UNP P52041 ? ? 'expression tag' -14 106 
6 6ACQ HIS F 7  ? UNP P52041 ? ? 'expression tag' -13 107 
6 6ACQ HIS F 8  ? UNP P52041 ? ? 'expression tag' -12 108 
6 6ACQ HIS F 9  ? UNP P52041 ? ? 'expression tag' -11 109 
6 6ACQ HIS F 10 ? UNP P52041 ? ? 'expression tag' -10 110 
6 6ACQ SER F 11 ? UNP P52041 ? ? 'expression tag' -9  111 
6 6ACQ SER F 12 ? UNP P52041 ? ? 'expression tag' -8  112 
6 6ACQ GLY F 13 ? UNP P52041 ? ? 'expression tag' -7  113 
6 6ACQ LEU F 14 ? UNP P52041 ? ? 'expression tag' -6  114 
6 6ACQ VAL F 15 ? UNP P52041 ? ? 'expression tag' -5  115 
6 6ACQ PRO F 16 ? UNP P52041 ? ? 'expression tag' -4  116 
6 6ACQ ARG F 17 ? UNP P52041 ? ? 'expression tag' -3  117 
6 6ACQ GLY F 18 ? UNP P52041 ? ? 'expression tag' -2  118 
6 6ACQ SER F 19 ? UNP P52041 ? ? 'expression tag' -1  119 
6 6ACQ HIS F 20 ? UNP P52041 ? ? 'expression tag' 0   120 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ACQ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.52 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.06 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.25% PEG 400, 2.2 M ammonium sulfate, 0.1 M HEPES-NaOH, pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NE3A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   AR-NE3A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6ACQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.5 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       95544 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.7 
_reflns.pdbx_Rmerge_I_obs                0.094 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.995 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.50 
_reflns_shell.d_res_low                   2.54 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.90 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4717 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.685 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.855 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            1.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -2.83 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            1.78 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               53.979 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6ACQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             47.9 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     90674 
_refine.ls_number_reflns_R_free                  4780 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.60 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.19979 
_refine.ls_R_factor_R_free                       0.22182 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.19862 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6AA8 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.293 
_refine.pdbx_overall_ESU_R_Free                  0.214 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             8.391 
_refine.overall_SU_ML                            0.178 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        12912 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             79 
_refine_hist.number_atoms_total               12991 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        47.9 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.019  13096 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  12986 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.326  1.984  17647 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.757  3.000  30136 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.610  5.000  1697  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 39.040 24.980 490   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 22.240 15.000 2459  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 20.658 15.000 62    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.070  0.200  2081  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  14337 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  2409  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.565  5.223  6806  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.565  5.222  6805  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 4.046  7.824  8497  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.045  7.825  8498  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.906  5.620  6290  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.905  5.620  6290  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.820  8.245  9151  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.638  63.564 15045 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 6.638  63.569 15044 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.503 
_refine_ls_shell.d_res_low                        2.568 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             338 
_refine_ls_shell.number_reflns_R_work             6389 
_refine_ls_shell.percent_reflns_obs               95.59 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.334 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.299 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6ACQ 
_struct.title                        
'Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase from Clostridium acetobutylicum, apo form' 
_struct.pdbx_descriptor              '3-hydroxybutyryl-CoA dehydrogenase (E.C.1.1.1.157)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ACQ 
_struct_keywords.text            'Rossmann fold, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 30  ? LYS A 43  ? GLY A 10  LYS A 23  1 ? 14 
HELX_P HELX_P2  AA2 LYS A 53  ? LYS A 74  ? LYS A 33  LYS A 54  1 ? 22 
HELX_P HELX_P3  AA3 GLU A 78  ? ARG A 88  ? GLU A 58  ARG A 68  1 ? 11 
HELX_P HELX_P4  AA4 ASP A 94  ? ALA A 99  ? ASP A 74  ALA A 79  5 ? 6  
HELX_P HELX_P5  AA5 ARG A 111 ? CYS A 126 ? ARG A 91  CYS A 106 1 ? 16 
HELX_P HELX_P6  AA6 SER A 140 ? SER A 146 ? SER A 120 SER A 126 1 ? 7  
HELX_P HELX_P7  AA7 ARG A 150 ? ASP A 152 ? ARG A 130 ASP A 132 5 ? 3  
HELX_P HELX_P8  AA8 SER A 178 ? ILE A 192 ? SER A 158 ILE A 172 1 ? 15 
HELX_P HELX_P9  AA9 VAL A 206 ? GLU A 224 ? VAL A 186 GLU A 204 1 ? 19 
HELX_P HELX_P10 AB1 SER A 228 ? ALA A 240 ? SER A 208 ALA A 220 1 ? 13 
HELX_P HELX_P11 AB2 GLY A 245 ? GLY A 254 ? GLY A 225 GLY A 234 1 ? 10 
HELX_P HELX_P12 AB3 GLY A 254 ? GLY A 270 ? GLY A 234 GLY A 250 1 ? 17 
HELX_P HELX_P13 AB4 ASP A 271 ? ARG A 275 ? ASP A 251 ARG A 255 5 ? 5  
HELX_P HELX_P14 AB5 HIS A 277 ? GLY A 287 ? HIS A 257 GLY A 267 1 ? 11 
HELX_P HELX_P15 AB6 GLY A 290 ? GLY A 294 ? GLY A 270 GLY A 274 5 ? 5  
HELX_P HELX_P16 AB7 GLY B 30  ? LYS B 43  ? GLY B 10  LYS B 23  1 ? 14 
HELX_P HELX_P17 AB8 LYS B 53  ? LYS B 74  ? LYS B 33  LYS B 54  1 ? 22 
HELX_P HELX_P18 AB9 GLU B 78  ? THR B 87  ? GLU B 58  THR B 67  1 ? 10 
HELX_P HELX_P19 AC1 ASP B 94  ? CYS B 101 ? ASP B 74  CYS B 81  5 ? 8  
HELX_P HELX_P20 AC2 ARG B 111 ? CYS B 126 ? ARG B 91  CYS B 106 1 ? 16 
HELX_P HELX_P21 AC3 SER B 140 ? SER B 146 ? SER B 120 SER B 126 1 ? 7  
HELX_P HELX_P22 AC4 ARG B 150 ? ASP B 152 ? ARG B 130 ASP B 132 5 ? 3  
HELX_P HELX_P23 AC5 SER B 178 ? ILE B 192 ? SER B 158 ILE B 172 1 ? 15 
HELX_P HELX_P24 AC6 VAL B 206 ? GLU B 224 ? VAL B 186 GLU B 204 1 ? 19 
HELX_P HELX_P25 AC7 SER B 228 ? ASN B 241 ? SER B 208 ASN B 221 1 ? 14 
HELX_P HELX_P26 AC8 GLY B 245 ? GLY B 254 ? GLY B 225 GLY B 234 1 ? 10 
HELX_P HELX_P27 AC9 GLY B 254 ? GLY B 270 ? GLY B 234 GLY B 250 1 ? 17 
HELX_P HELX_P28 AD1 ASP B 271 ? ARG B 275 ? ASP B 251 ARG B 255 5 ? 5  
HELX_P HELX_P29 AD2 HIS B 277 ? GLY B 287 ? HIS B 257 GLY B 267 1 ? 11 
HELX_P HELX_P30 AD3 GLY B 290 ? GLY B 294 ? GLY B 270 GLY B 274 5 ? 5  
HELX_P HELX_P31 AD4 GLY C 30  ? ALA C 42  ? GLY C 10  ALA C 22  1 ? 13 
HELX_P HELX_P32 AD5 LYS C 53  ? LYS C 74  ? LYS C 33  LYS C 54  1 ? 22 
HELX_P HELX_P33 AD6 GLU C 78  ? ARG C 88  ? GLU C 58  ARG C 68  1 ? 11 
HELX_P HELX_P34 AD7 ASP C 94  ? ALA C 99  ? ASP C 74  ALA C 79  5 ? 6  
HELX_P HELX_P35 AD8 ARG C 111 ? CYS C 126 ? ARG C 91  CYS C 106 1 ? 16 
HELX_P HELX_P36 AD9 SER C 140 ? SER C 146 ? SER C 120 SER C 126 1 ? 7  
HELX_P HELX_P37 AE1 ARG C 150 ? ASP C 152 ? ARG C 130 ASP C 132 5 ? 3  
HELX_P HELX_P38 AE2 SER C 178 ? ILE C 192 ? SER C 158 ILE C 172 1 ? 15 
HELX_P HELX_P39 AE3 VAL C 206 ? GLU C 224 ? VAL C 186 GLU C 204 1 ? 19 
HELX_P HELX_P40 AE4 SER C 228 ? ALA C 240 ? SER C 208 ALA C 220 1 ? 13 
HELX_P HELX_P41 AE5 GLY C 245 ? GLY C 254 ? GLY C 225 GLY C 234 1 ? 10 
HELX_P HELX_P42 AE6 GLY C 254 ? GLY C 270 ? GLY C 234 GLY C 250 1 ? 17 
HELX_P HELX_P43 AE7 ASP C 271 ? ARG C 275 ? ASP C 251 ARG C 255 5 ? 5  
HELX_P HELX_P44 AE8 HIS C 277 ? GLY C 287 ? HIS C 257 GLY C 267 1 ? 11 
HELX_P HELX_P45 AE9 GLY C 290 ? GLY C 294 ? GLY C 270 GLY C 274 5 ? 5  
HELX_P HELX_P46 AF1 GLY D 30  ? ALA D 42  ? GLY D 10  ALA D 22  1 ? 13 
HELX_P HELX_P47 AF2 LYS D 53  ? LYS D 73  ? LYS D 33  LYS D 53  1 ? 21 
HELX_P HELX_P48 AF3 GLU D 79  ? ARG D 88  ? GLU D 59  ARG D 68  1 ? 10 
HELX_P HELX_P49 AF4 ASP D 94  ? ALA D 99  ? ASP D 74  ALA D 79  5 ? 6  
HELX_P HELX_P50 AF5 ARG D 111 ? CYS D 126 ? ARG D 91  CYS D 106 1 ? 16 
HELX_P HELX_P51 AF6 SER D 140 ? SER D 146 ? SER D 120 SER D 126 1 ? 7  
HELX_P HELX_P52 AF7 ARG D 150 ? ASP D 152 ? ARG D 130 ASP D 132 5 ? 3  
HELX_P HELX_P53 AF8 SER D 178 ? ILE D 192 ? SER D 158 ILE D 172 1 ? 15 
HELX_P HELX_P54 AF9 VAL D 206 ? GLU D 224 ? VAL D 186 GLU D 204 1 ? 19 
HELX_P HELX_P55 AG1 SER D 228 ? ASN D 241 ? SER D 208 ASN D 221 1 ? 14 
HELX_P HELX_P56 AG2 GLY D 245 ? GLY D 254 ? GLY D 225 GLY D 234 1 ? 10 
HELX_P HELX_P57 AG3 GLY D 254 ? GLY D 270 ? GLY D 234 GLY D 250 1 ? 17 
HELX_P HELX_P58 AG4 ASP D 271 ? ARG D 275 ? ASP D 251 ARG D 255 5 ? 5  
HELX_P HELX_P59 AG5 HIS D 277 ? GLY D 287 ? HIS D 257 GLY D 267 1 ? 11 
HELX_P HELX_P60 AG6 GLY D 290 ? GLY D 294 ? GLY D 270 GLY D 274 5 ? 5  
HELX_P HELX_P61 AG7 GLY E 30  ? ALA E 42  ? GLY E 10  ALA E 22  1 ? 13 
HELX_P HELX_P62 AG8 LYS E 53  ? LYS E 74  ? LYS E 33  LYS E 54  1 ? 22 
HELX_P HELX_P63 AG9 GLU E 78  ? THR E 87  ? GLU E 58  THR E 67  1 ? 10 
HELX_P HELX_P64 AH1 ASP E 94  ? ALA E 99  ? ASP E 74  ALA E 79  5 ? 6  
HELX_P HELX_P65 AH2 ARG E 111 ? CYS E 126 ? ARG E 91  CYS E 106 1 ? 16 
HELX_P HELX_P66 AH3 SER E 140 ? SER E 146 ? SER E 120 SER E 126 1 ? 7  
HELX_P HELX_P67 AH4 ARG E 150 ? ASP E 152 ? ARG E 130 ASP E 132 5 ? 3  
HELX_P HELX_P68 AH5 SER E 178 ? ILE E 192 ? SER E 158 ILE E 172 1 ? 15 
HELX_P HELX_P69 AH6 VAL E 206 ? GLU E 224 ? VAL E 186 GLU E 204 1 ? 19 
HELX_P HELX_P70 AH7 SER E 228 ? ALA E 240 ? SER E 208 ALA E 220 1 ? 13 
HELX_P HELX_P71 AH8 GLY E 245 ? GLY E 254 ? GLY E 225 GLY E 234 1 ? 10 
HELX_P HELX_P72 AH9 GLY E 254 ? GLY E 270 ? GLY E 234 GLY E 250 1 ? 17 
HELX_P HELX_P73 AI1 ASP E 271 ? ARG E 275 ? ASP E 251 ARG E 255 5 ? 5  
HELX_P HELX_P74 AI2 HIS E 277 ? ALA E 286 ? HIS E 257 ALA E 266 1 ? 10 
HELX_P HELX_P75 AI3 GLY E 290 ? GLY E 294 ? GLY E 270 GLY E 274 5 ? 5  
HELX_P HELX_P76 AI4 GLY F 30  ? ALA F 42  ? GLY F 10  ALA F 22  1 ? 13 
HELX_P HELX_P77 AI5 LYS F 53  ? LYS F 74  ? LYS F 33  LYS F 54  1 ? 22 
HELX_P HELX_P78 AI6 GLU F 78  ? ARG F 88  ? GLU F 58  ARG F 68  1 ? 11 
HELX_P HELX_P79 AI7 ASP F 94  ? ALA F 99  ? ASP F 74  ALA F 79  5 ? 6  
HELX_P HELX_P80 AI8 ARG F 111 ? CYS F 126 ? ARG F 91  CYS F 106 1 ? 16 
HELX_P HELX_P81 AI9 SER F 140 ? SER F 146 ? SER F 120 SER F 126 1 ? 7  
HELX_P HELX_P82 AJ1 ARG F 150 ? ASP F 152 ? ARG F 130 ASP F 132 5 ? 3  
HELX_P HELX_P83 AJ2 SER F 178 ? ILE F 192 ? SER F 158 ILE F 172 1 ? 15 
HELX_P HELX_P84 AJ3 VAL F 206 ? GLU F 224 ? VAL F 186 GLU F 204 1 ? 19 
HELX_P HELX_P85 AJ4 SER F 228 ? ALA F 240 ? SER F 208 ALA F 220 1 ? 13 
HELX_P HELX_P86 AJ5 GLY F 245 ? GLY F 254 ? GLY F 225 GLY F 234 1 ? 10 
HELX_P HELX_P87 AJ6 GLY F 254 ? GLY F 270 ? GLY F 234 GLY F 250 1 ? 17 
HELX_P HELX_P88 AJ7 ASP F 271 ? ARG F 275 ? ASP F 251 ARG F 255 5 ? 5  
HELX_P HELX_P89 AJ8 HIS F 277 ? ALA F 286 ? HIS F 257 ALA F 266 1 ? 10 
HELX_P HELX_P90 AJ9 GLY F 290 ? GLY F 294 ? GLY F 270 GLY F 274 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 161 A . ? ASN 141 A PRO 162 A ? PRO 142 A 1 -7.31  
2 ASN 161 B . ? ASN 141 B PRO 162 B ? PRO 142 B 1 3.65   
3 ASN 161 C . ? ASN 141 C PRO 162 C ? PRO 142 C 1 -1.52  
4 ASN 161 D . ? ASN 141 D PRO 162 D ? PRO 142 D 1 3.33   
5 ASN 161 E . ? ASN 141 E PRO 162 E ? PRO 142 E 1 0.14   
6 ASN 161 F . ? ASN 141 F PRO 162 F ? PRO 142 F 1 -10.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 8 ? 
AA3 ? 8 ? 
AA4 ? 8 ? 
AA5 ? 8 ? 
AA6 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA1 7 8 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA2 6 7 ? anti-parallel 
AA2 7 8 ? parallel      
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? anti-parallel 
AA3 7 8 ? parallel      
AA4 1 2 ? parallel      
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
AA4 6 7 ? anti-parallel 
AA4 7 8 ? parallel      
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA5 7 8 ? parallel      
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? parallel      
AA6 6 7 ? anti-parallel 
AA6 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 89  ? THR A 92  ? ILE A 69  THR A 72  
AA1 2 GLU A 46  ? ARG A 50  ? GLU A 26  ARG A 30  
AA1 3 LYS A 23  ? ILE A 27  ? LYS A 3   ILE A 7   
AA1 4 LEU A 103 ? GLU A 106 ? LEU A 83  GLU A 86  
AA1 5 ILE A 131 ? SER A 134 ? ILE A 111 SER A 114 
AA1 6 VAL A 154 ? PHE A 159 ? VAL A 134 PHE A 139 
AA1 7 LEU A 168 ? ARG A 173 ? LEU A 148 ARG A 153 
AA1 8 ASP A 195 ? ALA A 200 ? ASP A 175 ALA A 180 
AA2 1 ILE B 89  ? THR B 92  ? ILE B 69  THR B 72  
AA2 2 GLU B 46  ? ARG B 50  ? GLU B 26  ARG B 30  
AA2 3 LYS B 23  ? ILE B 27  ? LYS B 3   ILE B 7   
AA2 4 LEU B 103 ? GLU B 106 ? LEU B 83  GLU B 86  
AA2 5 ILE B 131 ? SER B 134 ? ILE B 111 SER B 114 
AA2 6 VAL B 154 ? PHE B 159 ? VAL B 134 PHE B 139 
AA2 7 LEU B 168 ? ARG B 173 ? LEU B 148 ARG B 153 
AA2 8 ASP B 195 ? ALA B 200 ? ASP B 175 ALA B 180 
AA3 1 ILE C 89  ? THR C 92  ? ILE C 69  THR C 72  
AA3 2 GLU C 46  ? ARG C 50  ? GLU C 26  ARG C 30  
AA3 3 LYS C 23  ? ILE C 27  ? LYS C 3   ILE C 7   
AA3 4 LEU C 103 ? GLU C 106 ? LEU C 83  GLU C 86  
AA3 5 ILE C 131 ? SER C 134 ? ILE C 111 SER C 114 
AA3 6 VAL C 154 ? PHE C 159 ? VAL C 134 PHE C 139 
AA3 7 LEU C 168 ? ARG C 173 ? LEU C 148 ARG C 153 
AA3 8 ASP C 195 ? ALA C 200 ? ASP C 175 ALA C 180 
AA4 1 ILE D 89  ? THR D 92  ? ILE D 69  THR D 72  
AA4 2 GLU D 46  ? ARG D 50  ? GLU D 26  ARG D 30  
AA4 3 LYS D 23  ? ILE D 27  ? LYS D 3   ILE D 7   
AA4 4 LEU D 103 ? GLU D 106 ? LEU D 83  GLU D 86  
AA4 5 ILE D 131 ? SER D 134 ? ILE D 111 SER D 114 
AA4 6 VAL D 154 ? PHE D 159 ? VAL D 134 PHE D 139 
AA4 7 LEU D 168 ? ARG D 173 ? LEU D 148 ARG D 153 
AA4 8 ASP D 195 ? ALA D 200 ? ASP D 175 ALA D 180 
AA5 1 ILE E 89  ? THR E 92  ? ILE E 69  THR E 72  
AA5 2 GLU E 46  ? ARG E 50  ? GLU E 26  ARG E 30  
AA5 3 LYS E 23  ? ILE E 27  ? LYS E 3   ILE E 7   
AA5 4 LEU E 103 ? GLU E 106 ? LEU E 83  GLU E 86  
AA5 5 ILE E 131 ? SER E 134 ? ILE E 111 SER E 114 
AA5 6 VAL E 154 ? HIS E 158 ? VAL E 134 HIS E 138 
AA5 7 LEU E 168 ? ARG E 173 ? LEU E 148 ARG E 153 
AA5 8 ASP E 195 ? ALA E 200 ? ASP E 175 ALA E 180 
AA6 1 ILE F 89  ? THR F 92  ? ILE F 69  THR F 72  
AA6 2 GLU F 46  ? ARG F 50  ? GLU F 26  ARG F 30  
AA6 3 LYS F 23  ? ILE F 27  ? LYS F 3   ILE F 7   
AA6 4 LEU F 103 ? GLU F 106 ? LEU F 83  GLU F 86  
AA6 5 ILE F 131 ? SER F 134 ? ILE F 111 SER F 114 
AA6 6 VAL F 154 ? PHE F 159 ? VAL F 134 PHE F 139 
AA6 7 LEU F 168 ? ARG F 173 ? LEU F 148 ARG F 153 
AA6 8 ASP F 195 ? ALA F 200 ? ASP F 175 ALA F 180 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O SER A 90  ? O SER A 70  N LEU A 49  ? N LEU A 29  
AA1 2 3 O VAL A 48  ? O VAL A 28  N VAL A 26  ? N VAL A 6   
AA1 3 4 N CYS A 25  ? N CYS A 5   O ILE A 105 ? O ILE A 85  
AA1 4 5 N GLU A 106 ? N GLU A 86  O ALA A 133 ? O ALA A 113 
AA1 5 6 N SER A 134 ? N SER A 114 O MET A 157 ? O MET A 137 
AA1 6 7 N GLY A 156 ? N GLY A 136 O ILE A 172 ? O ILE A 152 
AA1 7 8 N VAL A 171 ? N VAL A 151 O VAL A 197 ? O VAL A 177 
AA2 1 2 O SER B 90  ? O SER B 70  N VAL B 47  ? N VAL B 27  
AA2 2 3 O VAL B 48  ? O VAL B 28  N VAL B 26  ? N VAL B 6   
AA2 3 4 N CYS B 25  ? N CYS B 5   O ILE B 105 ? O ILE B 85  
AA2 4 5 N GLU B 106 ? N GLU B 86  O ALA B 133 ? O ALA B 113 
AA2 5 6 N SER B 134 ? N SER B 114 O MET B 157 ? O MET B 137 
AA2 6 7 N GLY B 156 ? N GLY B 136 O ILE B 172 ? O ILE B 152 
AA2 7 8 N ARG B 173 ? N ARG B 153 O VAL B 199 ? O VAL B 179 
AA3 1 2 O SER C 90  ? O SER C 70  N VAL C 47  ? N VAL C 27  
AA3 2 3 O VAL C 48  ? O VAL C 28  N VAL C 26  ? N VAL C 6   
AA3 3 4 N CYS C 25  ? N CYS C 5   O ILE C 105 ? O ILE C 85  
AA3 4 5 N VAL C 104 ? N VAL C 84  O ALA C 133 ? O ALA C 113 
AA3 5 6 N SER C 134 ? N SER C 114 O MET C 157 ? O MET C 137 
AA3 6 7 N HIS C 158 ? N HIS C 138 O GLU C 170 ? O GLU C 150 
AA3 7 8 N VAL C 171 ? N VAL C 151 O VAL C 197 ? O VAL C 177 
AA4 1 2 O THR D 92  ? O THR D 72  N LEU D 49  ? N LEU D 29  
AA4 2 3 O ARG D 50  ? O ARG D 30  N VAL D 26  ? N VAL D 6   
AA4 3 4 N ILE D 27  ? N ILE D 7   O ILE D 105 ? O ILE D 85  
AA4 4 5 N GLU D 106 ? N GLU D 86  O ALA D 133 ? O ALA D 113 
AA4 5 6 N SER D 134 ? N SER D 114 O MET D 157 ? O MET D 137 
AA4 6 7 N HIS D 158 ? N HIS D 138 O GLU D 170 ? O GLU D 150 
AA4 7 8 N ARG D 173 ? N ARG D 153 O VAL D 199 ? O VAL D 179 
AA5 1 2 O SER E 90  ? O SER E 70  N VAL E 47  ? N VAL E 27  
AA5 2 3 O VAL E 48  ? O VAL E 28  N VAL E 24  ? N VAL E 4   
AA5 3 4 N CYS E 25  ? N CYS E 5   O ILE E 105 ? O ILE E 85  
AA5 4 5 N VAL E 104 ? N VAL E 84  O ALA E 133 ? O ALA E 113 
AA5 5 6 N SER E 134 ? N SER E 114 O MET E 157 ? O MET E 137 
AA5 6 7 N HIS E 158 ? N HIS E 138 O GLU E 170 ? O GLU E 150 
AA5 7 8 N ARG E 173 ? N ARG E 153 O VAL E 199 ? O VAL E 179 
AA6 1 2 O SER F 90  ? O SER F 70  N VAL F 47  ? N VAL F 27  
AA6 2 3 O VAL F 48  ? O VAL F 28  N VAL F 26  ? N VAL F 6   
AA6 3 4 N CYS F 25  ? N CYS F 5   O ILE F 105 ? O ILE F 85  
AA6 4 5 N GLU F 106 ? N GLU F 86  O ALA F 133 ? O ALA F 113 
AA6 5 6 N SER F 134 ? N SER F 114 O MET F 157 ? O MET F 137 
AA6 6 7 N HIS F 158 ? N HIS F 138 O GLU F 170 ? O GLU F 150 
AA6 7 8 N VAL F 171 ? N VAL F 151 O VAL F 199 ? O VAL F 179 
# 
_atom_sites.entry_id                    6ACQ 
_atom_sites.fract_transf_matrix[1][1]   0.007494 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007436 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006502 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 21  ? 11.874  -9.354  -47.489 1.00 63.91  ? 1   MET A N   1 
ATOM   2     C CA  . MET A 1 21  ? 10.379  -9.315  -47.336 1.00 66.35  ? 1   MET A CA  1 
ATOM   3     C C   . MET A 1 21  ? 9.784   -8.555  -48.531 1.00 65.57  ? 1   MET A C   1 
ATOM   4     O O   . MET A 1 21  ? 10.285  -7.500  -48.908 1.00 75.08  ? 1   MET A O   1 
ATOM   5     C CB  . MET A 1 21  ? 10.002  -8.666  -45.989 1.00 68.90  ? 1   MET A CB  1 
ATOM   6     C CG  . MET A 1 21  ? 8.612   -9.017  -45.451 1.00 71.12  ? 1   MET A CG  1 
ATOM   7     S SD  . MET A 1 21  ? 8.559   -9.537  -43.714 1.00 77.32  ? 1   MET A SD  1 
ATOM   8     C CE  . MET A 1 21  ? 9.617   -11.003 -43.741 1.00 85.05  ? 1   MET A CE  1 
ATOM   9     N N   . LYS A 1 22  ? 8.740   -9.087  -49.150 1.00 64.17  ? 2   LYS A N   1 
ATOM   10    C CA  . LYS A 1 22  ? 8.304   -8.548  -50.456 1.00 65.22  ? 2   LYS A CA  1 
ATOM   11    C C   . LYS A 1 22  ? 6.816   -8.521  -50.753 1.00 61.39  ? 2   LYS A C   1 
ATOM   12    O O   . LYS A 1 22  ? 6.355   -7.676  -51.522 1.00 60.75  ? 2   LYS A O   1 
ATOM   13    C CB  . LYS A 1 22  ? 8.983   -9.331  -51.577 1.00 69.97  ? 2   LYS A CB  1 
ATOM   14    C CG  . LYS A 1 22  ? 10.283  -8.705  -52.031 1.00 77.77  ? 2   LYS A CG  1 
ATOM   15    C CD  . LYS A 1 22  ? 11.383  -9.736  -52.163 1.00 82.74  ? 2   LYS A CD  1 
ATOM   16    C CE  . LYS A 1 22  ? 12.745  -9.078  -52.033 1.00 86.24  ? 2   LYS A CE  1 
ATOM   17    N NZ  . LYS A 1 22  ? 13.826  -10.094 -52.110 1.00 89.62  ? 2   LYS A NZ  1 
ATOM   18    N N   . LYS A 1 23  ? 6.081   -9.476  -50.206 1.00 54.50  ? 3   LYS A N   1 
ATOM   19    C CA  . LYS A 1 23  ? 4.673   -9.556  -50.458 1.00 50.67  ? 3   LYS A CA  1 
ATOM   20    C C   . LYS A 1 23  ? 3.974   -9.523  -49.132 1.00 46.93  ? 3   LYS A C   1 
ATOM   21    O O   . LYS A 1 23  ? 4.398   -10.171 -48.172 1.00 48.38  ? 3   LYS A O   1 
ATOM   22    C CB  . LYS A 1 23  ? 4.354   -10.829 -51.195 1.00 52.00  ? 3   LYS A CB  1 
ATOM   23    C CG  . LYS A 1 23  ? 3.013   -10.783 -51.881 1.00 54.71  ? 3   LYS A CG  1 
ATOM   24    C CD  . LYS A 1 23  ? 2.918   -11.872 -52.927 1.00 56.17  ? 3   LYS A CD  1 
ATOM   25    C CE  . LYS A 1 23  ? 1.535   -12.488 -52.939 1.00 57.74  ? 3   LYS A CE  1 
ATOM   26    N NZ  . LYS A 1 23  ? 1.231   -13.003 -54.296 1.00 62.32  ? 3   LYS A NZ  1 
ATOM   27    N N   . VAL A 1 24  ? 2.917   -8.734  -49.074 1.00 41.11  ? 4   VAL A N   1 
ATOM   28    C CA  . VAL A 1 24  ? 2.266   -8.466  -47.824 1.00 39.92  ? 4   VAL A CA  1 
ATOM   29    C C   . VAL A 1 24  ? 0.807   -8.675  -48.022 1.00 38.70  ? 4   VAL A C   1 
ATOM   30    O O   . VAL A 1 24  ? 0.252   -8.311  -49.053 1.00 38.87  ? 4   VAL A O   1 
ATOM   31    C CB  . VAL A 1 24  ? 2.471   -7.015  -47.404 1.00 42.67  ? 4   VAL A CB  1 
ATOM   32    C CG1 . VAL A 1 24  ? 1.775   -6.734  -46.086 1.00 44.38  ? 4   VAL A CG1 1 
ATOM   33    C CG2 . VAL A 1 24  ? 3.949   -6.739  -47.250 1.00 45.40  ? 4   VAL A CG2 1 
ATOM   34    N N   . CYS A 1 25  ? 0.165   -9.233  -47.023 1.00 36.09  ? 5   CYS A N   1 
ATOM   35    C CA  . CYS A 1 25  ? -1.254  -9.307  -47.081 1.00 35.95  ? 5   CYS A CA  1 
ATOM   36    C C   . CYS A 1 25  ? -1.873  -8.484  -45.965 1.00 35.31  ? 5   CYS A C   1 
ATOM   37    O O   . CYS A 1 25  ? -1.414  -8.490  -44.831 1.00 34.13  ? 5   CYS A O   1 
ATOM   38    C CB  . CYS A 1 25  ? -1.686  -10.739 -46.998 1.00 37.71  ? 5   CYS A CB  1 
ATOM   39    S SG  . CYS A 1 25  ? -3.464  -10.884 -46.941 1.00 44.97  ? 5   CYS A SG  1 
ATOM   40    N N   . VAL A 1 26  ? -2.921  -7.760  -46.309 1.00 34.29  ? 6   VAL A N   1 
ATOM   41    C CA  . VAL A 1 26  ? -3.618  -6.964  -45.348 1.00 34.57  ? 6   VAL A CA  1 
ATOM   42    C C   . VAL A 1 26  ? -5.034  -7.435  -45.276 1.00 35.12  ? 6   VAL A C   1 
ATOM   43    O O   . VAL A 1 26  ? -5.731  -7.464  -46.278 1.00 36.87  ? 6   VAL A O   1 
ATOM   44    C CB  . VAL A 1 26  ? -3.632  -5.491  -45.754 1.00 35.77  ? 6   VAL A CB  1 
ATOM   45    C CG1 . VAL A 1 26  ? -4.563  -4.733  -44.846 1.00 36.75  ? 6   VAL A CG1 1 
ATOM   46    C CG2 . VAL A 1 26  ? -2.239  -4.894  -45.639 1.00 35.45  ? 6   VAL A CG2 1 
ATOM   47    N N   . ILE A 1 27  ? -5.468  -7.796  -44.083 1.00 38.77  ? 7   ILE A N   1 
ATOM   48    C CA  . ILE A 1 27  ? -6.830  -8.265  -43.906 1.00 42.79  ? 7   ILE A CA  1 
ATOM   49    C C   . ILE A 1 27  ? -7.641  -7.142  -43.314 1.00 43.46  ? 7   ILE A C   1 
ATOM   50    O O   . ILE A 1 27  ? -7.343  -6.676  -42.221 1.00 44.06  ? 7   ILE A O   1 
ATOM   51    C CB  . ILE A 1 27  ? -6.873  -9.465  -42.959 1.00 44.00  ? 7   ILE A CB  1 
ATOM   52    C CG1 . ILE A 1 27  ? -6.065  -10.607 -43.552 1.00 43.29  ? 7   ILE A CG1 1 
ATOM   53    C CG2 . ILE A 1 27  ? -8.306  -9.914  -42.715 1.00 43.36  ? 7   ILE A CG2 1 
ATOM   54    C CD1 . ILE A 1 27  ? -5.276  -11.311 -42.497 1.00 46.72  ? 7   ILE A CD1 1 
ATOM   55    N N   . GLY A 1 28  ? -8.671  -6.729  -44.035 1.00 43.93  ? 8   GLY A N   1 
ATOM   56    C CA  . GLY A 1 28  ? -9.516  -5.628  -43.614 1.00 42.73  ? 8   GLY A CA  1 
ATOM   57    C C   . GLY A 1 28  ? -9.302  -4.430  -44.508 1.00 43.24  ? 8   GLY A C   1 
ATOM   58    O O   . GLY A 1 28  ? -8.218  -3.864  -44.552 1.00 42.22  ? 8   GLY A O   1 
ATOM   59    N N   . ALA A 1 29  ? -10.353 -4.047  -45.217 1.00 44.96  ? 9   ALA A N   1 
ATOM   60    C CA  . ALA A 1 29  ? -10.288 -2.974  -46.199 1.00 46.45  ? 9   ALA A CA  1 
ATOM   61    C C   . ALA A 1 29  ? -10.934 -1.707  -45.669 1.00 46.68  ? 9   ALA A C   1 
ATOM   62    O O   . ALA A 1 29  ? -11.178 -0.773  -46.428 1.00 46.76  ? 9   ALA A O   1 
ATOM   63    C CB  . ALA A 1 29  ? -10.967 -3.412  -47.488 1.00 44.99  ? 9   ALA A CB  1 
ATOM   64    N N   . GLY A 1 30  ? -11.209 -1.684  -44.369 1.00 47.69  ? 10  GLY A N   1 
ATOM   65    C CA  . GLY A 1 30  ? -11.683 -0.486  -43.699 1.00 49.08  ? 10  GLY A CA  1 
ATOM   66    C C   . GLY A 1 30  ? -10.634 0.602   -43.741 1.00 48.42  ? 10  GLY A C   1 
ATOM   67    O O   . GLY A 1 30  ? -9.733  0.573   -44.564 1.00 45.71  ? 10  GLY A O   1 
ATOM   68    N N   . THR A 1 31  ? -10.727 1.551   -42.826 1.00 49.96  ? 11  THR A N   1 
ATOM   69    C CA  . THR A 1 31  ? -9.911  2.748   -42.930 1.00 51.38  ? 11  THR A CA  1 
ATOM   70    C C   . THR A 1 31  ? -8.430  2.439   -42.702 1.00 47.91  ? 11  THR A C   1 
ATOM   71    O O   . THR A 1 31  ? -7.582  2.805   -43.518 1.00 43.99  ? 11  THR A O   1 
ATOM   72    C CB  . THR A 1 31  ? -10.369 3.851   -41.941 1.00 55.42  ? 11  THR A CB  1 
ATOM   73    O OG1 . THR A 1 31  ? -11.797 3.827   -41.772 1.00 58.38  ? 11  THR A OG1 1 
ATOM   74    C CG2 . THR A 1 31  ? -9.964  5.202   -42.465 1.00 55.61  ? 11  THR A CG2 1 
ATOM   75    N N   . MET A 1 32  ? -8.128  1.777   -41.591 1.00 46.20  ? 12  MET A N   1 
ATOM   76    C CA  . MET A 1 32  ? -6.746  1.406   -41.280 1.00 47.73  ? 12  MET A CA  1 
ATOM   77    C C   . MET A 1 32  ? -6.166  0.406   -42.274 1.00 46.63  ? 12  MET A C   1 
ATOM   78    O O   . MET A 1 32  ? -5.025  0.541   -42.720 1.00 50.25  ? 12  MET A O   1 
ATOM   79    C CB  . MET A 1 32  ? -6.655  0.817   -39.878 1.00 49.75  ? 12  MET A CB  1 
ATOM   80    C CG  . MET A 1 32  ? -6.637  1.861   -38.780 1.00 52.85  ? 12  MET A CG  1 
ATOM   81    S SD  . MET A 1 32  ? -5.388  3.134   -39.041 1.00 61.04  ? 12  MET A SD  1 
ATOM   82    C CE  . MET A 1 32  ? -3.901  2.359   -38.436 1.00 61.51  ? 12  MET A CE  1 
ATOM   83    N N   . GLY A 1 33  ? -6.953  -0.602  -42.614 1.00 43.43  ? 13  GLY A N   1 
ATOM   84    C CA  . GLY A 1 33  ? -6.488  -1.659  -43.496 1.00 42.84  ? 13  GLY A CA  1 
ATOM   85    C C   . GLY A 1 33  ? -6.018  -1.115  -44.825 1.00 43.39  ? 13  GLY A C   1 
ATOM   86    O O   . GLY A 1 33  ? -4.914  -1.420  -45.287 1.00 42.70  ? 13  GLY A O   1 
ATOM   87    N N   . SER A 1 34  ? -6.840  -0.282  -45.443 1.00 42.26  ? 14  SER A N   1 
ATOM   88    C CA  . SER A 1 34  ? -6.458  0.270   -46.732 1.00 44.28  ? 14  SER A CA  1 
ATOM   89    C C   . SER A 1 34  ? -5.377  1.306   -46.598 1.00 42.89  ? 14  SER A C   1 
ATOM   90    O O   . SER A 1 34  ? -4.608  1.497   -47.537 1.00 43.56  ? 14  SER A O   1 
ATOM   91    C CB  . SER A 1 34  ? -7.648  0.840   -47.500 1.00 46.88  ? 14  SER A CB  1 
ATOM   92    O OG  . SER A 1 34  ? -8.753  1.044   -46.660 1.00 51.69  ? 14  SER A OG  1 
ATOM   93    N N   . GLY A 1 35  ? -5.307  1.973   -45.451 1.00 40.59  ? 15  GLY A N   1 
ATOM   94    C CA  . GLY A 1 35  ? -4.204  2.895   -45.204 1.00 40.55  ? 15  GLY A CA  1 
ATOM   95    C C   . GLY A 1 35  ? -2.898  2.124   -45.186 1.00 40.83  ? 15  GLY A C   1 
ATOM   96    O O   . GLY A 1 35  ? -1.908  2.494   -45.838 1.00 37.55  ? 15  GLY A O   1 
ATOM   97    N N   . ILE A 1 36  ? -2.912  1.023   -44.448 1.00 41.91  ? 16  ILE A N   1 
ATOM   98    C CA  . ILE A 1 36  ? -1.722  0.216   -44.313 1.00 41.74  ? 16  ILE A CA  1 
ATOM   99    C C   . ILE A 1 36  ? -1.329  -0.382  -45.654 1.00 40.55  ? 16  ILE A C   1 
ATOM   100   O O   . ILE A 1 36  ? -0.151  -0.469  -45.966 1.00 37.86  ? 16  ILE A O   1 
ATOM   101   C CB  . ILE A 1 36  ? -1.944  -0.869  -43.275 1.00 43.33  ? 16  ILE A CB  1 
ATOM   102   C CG1 . ILE A 1 36  ? -2.020  -0.211  -41.896 1.00 41.77  ? 16  ILE A CG1 1 
ATOM   103   C CG2 . ILE A 1 36  ? -0.830  -1.908  -43.339 1.00 43.98  ? 16  ILE A CG2 1 
ATOM   104   C CD1 . ILE A 1 36  ? -2.626  -1.110  -40.845 1.00 40.51  ? 16  ILE A CD1 1 
ATOM   105   N N   . ALA A 1 37  ? -2.326  -0.764  -46.444 1.00 40.92  ? 17  ALA A N   1 
ATOM   106   C CA  . ALA A 1 37  ? -2.098  -1.322  -47.778 1.00 42.80  ? 17  ALA A CA  1 
ATOM   107   C C   . ALA A 1 37  ? -1.409  -0.305  -48.666 1.00 43.48  ? 17  ALA A C   1 
ATOM   108   O O   . ALA A 1 37  ? -0.419  -0.610  -49.326 1.00 44.33  ? 17  ALA A O   1 
ATOM   109   C CB  . ALA A 1 37  ? -3.423  -1.719  -48.402 1.00 42.66  ? 17  ALA A CB  1 
ATOM   110   N N   . GLN A 1 38  ? -1.958  0.905   -48.669 1.00 43.49  ? 18  GLN A N   1 
ATOM   111   C CA  . GLN A 1 38  ? -1.423  2.000   -49.453 1.00 42.92  ? 18  GLN A CA  1 
ATOM   112   C C   . GLN A 1 38  ? 0.021   2.273   -49.049 1.00 41.16  ? 18  GLN A C   1 
ATOM   113   O O   . GLN A 1 38  ? 0.899   2.400   -49.890 1.00 40.52  ? 18  GLN A O   1 
ATOM   114   C CB  . GLN A 1 38  ? -2.289  3.256   -49.270 1.00 44.18  ? 18  GLN A CB  1 
ATOM   115   C CG  . GLN A 1 38  ? -1.665  4.523   -49.821 1.00 44.36  ? 18  GLN A CG  1 
ATOM   116   C CD  . GLN A 1 38  ? -2.586  5.729   -49.759 1.00 45.26  ? 18  GLN A CD  1 
ATOM   117   O OE1 . GLN A 1 38  ? -3.812  5.608   -49.813 1.00 44.83  ? 18  GLN A OE1 1 
ATOM   118   N NE2 . GLN A 1 38  ? -1.987  6.909   -49.661 1.00 42.06  ? 18  GLN A NE2 1 
ATOM   119   N N   . ALA A 1 39  ? 0.267   2.342   -47.753 1.00 39.61  ? 19  ALA A N   1 
ATOM   120   C CA  . ALA A 1 39  ? 1.618   2.574   -47.258 1.00 40.12  ? 19  ALA A CA  1 
ATOM   121   C C   . ALA A 1 39  ? 2.642   1.609   -47.832 1.00 42.63  ? 19  ALA A C   1 
ATOM   122   O O   . ALA A 1 39  ? 3.762   2.018   -48.136 1.00 47.22  ? 19  ALA A O   1 
ATOM   123   C CB  . ALA A 1 39  ? 1.638   2.495   -45.746 1.00 39.59  ? 19  ALA A CB  1 
ATOM   124   N N   . PHE A 1 40  ? 2.267   0.335   -47.963 1.00 43.78  ? 20  PHE A N   1 
ATOM   125   C CA  . PHE A 1 40  ? 3.198   -0.687  -48.463 1.00 41.36  ? 20  PHE A CA  1 
ATOM   126   C C   . PHE A 1 40  ? 3.351   -0.561  -49.959 1.00 41.36  ? 20  PHE A C   1 
ATOM   127   O O   . PHE A 1 40  ? 4.458   -0.648  -50.488 1.00 40.58  ? 20  PHE A O   1 
ATOM   128   C CB  . PHE A 1 40  ? 2.727   -2.103  -48.115 1.00 40.69  ? 20  PHE A CB  1 
ATOM   129   C CG  . PHE A 1 40  ? 3.197   -2.565  -46.783 1.00 38.69  ? 20  PHE A CG  1 
ATOM   130   C CD1 . PHE A 1 40  ? 4.420   -3.163  -46.654 1.00 37.94  ? 20  PHE A CD1 1 
ATOM   131   C CD2 . PHE A 1 40  ? 2.420   -2.372  -45.651 1.00 40.01  ? 20  PHE A CD2 1 
ATOM   132   C CE1 . PHE A 1 40  ? 4.878   -3.571  -45.413 1.00 39.46  ? 20  PHE A CE1 1 
ATOM   133   C CE2 . PHE A 1 40  ? 2.863   -2.777  -44.403 1.00 40.86  ? 20  PHE A CE2 1 
ATOM   134   C CZ  . PHE A 1 40  ? 4.096   -3.380  -44.285 1.00 40.84  ? 20  PHE A CZ  1 
ATOM   135   N N   . ALA A 1 41  ? 2.225   -0.370  -50.630 1.00 42.37  ? 21  ALA A N   1 
ATOM   136   C CA  . ALA A 1 41  ? 2.207   -0.326  -52.079 1.00 46.64  ? 21  ALA A CA  1 
ATOM   137   C C   . ALA A 1 41  ? 3.027   0.862   -52.556 1.00 48.70  ? 21  ALA A C   1 
ATOM   138   O O   . ALA A 1 41  ? 3.889   0.717   -53.417 1.00 50.83  ? 21  ALA A O   1 
ATOM   139   C CB  . ALA A 1 41  ? 0.777   -0.243  -52.584 1.00 47.97  ? 21  ALA A CB  1 
ATOM   140   N N   . ALA A 1 42  ? 2.803   2.019   -51.946 1.00 48.34  ? 22  ALA A N   1 
ATOM   141   C CA  . ALA A 1 42  ? 3.581   3.221   -52.262 1.00 48.30  ? 22  ALA A CA  1 
ATOM   142   C C   . ALA A 1 42  ? 5.088   3.027   -52.144 1.00 46.37  ? 22  ALA A C   1 
ATOM   143   O O   . ALA A 1 42  ? 5.847   3.715   -52.814 1.00 47.68  ? 22  ALA A O   1 
ATOM   144   C CB  . ALA A 1 42  ? 3.134   4.398   -51.404 1.00 48.52  ? 22  ALA A CB  1 
ATOM   145   N N   . LYS A 1 43  ? 5.531   2.100   -51.311 1.00 45.51  ? 23  LYS A N   1 
ATOM   146   C CA  . LYS A 1 43  ? 6.960   1.851   -51.190 1.00 47.08  ? 23  LYS A CA  1 
ATOM   147   C C   . LYS A 1 43  ? 7.469   0.644   -51.946 1.00 47.22  ? 23  LYS A C   1 
ATOM   148   O O   . LYS A 1 43  ? 8.571   0.173   -51.673 1.00 43.91  ? 23  LYS A O   1 
ATOM   149   C CB  . LYS A 1 43  ? 7.320   1.723   -49.729 1.00 52.10  ? 23  LYS A CB  1 
ATOM   150   C CG  . LYS A 1 43  ? 7.345   3.072   -49.078 1.00 57.18  ? 23  LYS A CG  1 
ATOM   151   C CD  . LYS A 1 43  ? 8.735   3.694   -49.174 1.00 62.33  ? 23  LYS A CD  1 
ATOM   152   C CE  . LYS A 1 43  ? 8.691   5.186   -48.906 1.00 66.24  ? 23  LYS A CE  1 
ATOM   153   N NZ  . LYS A 1 43  ? 7.276   5.662   -48.926 1.00 70.08  ? 23  LYS A NZ  1 
ATOM   154   N N   . GLY A 1 44  ? 6.680   0.136   -52.891 1.00 51.29  ? 24  GLY A N   1 
ATOM   155   C CA  . GLY A 1 44  ? 7.139   -0.940  -53.783 1.00 51.35  ? 24  GLY A CA  1 
ATOM   156   C C   . GLY A 1 44  ? 6.811   -2.379  -53.401 1.00 53.18  ? 24  GLY A C   1 
ATOM   157   O O   . GLY A 1 44  ? 7.248   -3.317  -54.072 1.00 51.41  ? 24  GLY A O   1 
ATOM   158   N N   . PHE A 1 45  ? 6.033   -2.580  -52.349 1.00 49.87  ? 25  PHE A N   1 
ATOM   159   C CA  . PHE A 1 45  ? 5.699   -3.934  -51.963 1.00 47.88  ? 25  PHE A CA  1 
ATOM   160   C C   . PHE A 1 45  ? 4.479   -4.382  -52.722 1.00 45.99  ? 25  PHE A C   1 
ATOM   161   O O   . PHE A 1 45  ? 3.566   -3.609  -52.958 1.00 47.26  ? 25  PHE A O   1 
ATOM   162   C CB  . PHE A 1 45  ? 5.412   -4.015  -50.482 1.00 48.06  ? 25  PHE A CB  1 
ATOM   163   C CG  . PHE A 1 45  ? 6.614   -3.802  -49.648 1.00 48.33  ? 25  PHE A CG  1 
ATOM   164   C CD1 . PHE A 1 45  ? 7.158   -2.545  -49.537 1.00 49.30  ? 25  PHE A CD1 1 
ATOM   165   C CD2 . PHE A 1 45  ? 7.213   -4.860  -48.987 1.00 48.13  ? 25  PHE A CD2 1 
ATOM   166   C CE1 . PHE A 1 45  ? 8.282   -2.342  -48.777 1.00 49.43  ? 25  PHE A CE1 1 
ATOM   167   C CE2 . PHE A 1 45  ? 8.334   -4.664  -48.223 1.00 47.03  ? 25  PHE A CE2 1 
ATOM   168   C CZ  . PHE A 1 45  ? 8.872   -3.402  -48.122 1.00 48.52  ? 25  PHE A CZ  1 
ATOM   169   N N   . GLU A 1 46  ? 4.461   -5.644  -53.098 1.00 46.57  ? 26  GLU A N   1 
ATOM   170   C CA  . GLU A 1 46  ? 3.221   -6.248  -53.541 1.00 49.16  ? 26  GLU A CA  1 
ATOM   171   C C   . GLU A 1 46  ? 2.312   -6.416  -52.338 1.00 41.17  ? 26  GLU A C   1 
ATOM   172   O O   . GLU A 1 46  ? 2.753   -6.839  -51.271 1.00 34.85  ? 26  GLU A O   1 
ATOM   173   C CB  . GLU A 1 46  ? 3.461   -7.602  -54.182 1.00 55.78  ? 26  GLU A CB  1 
ATOM   174   C CG  . GLU A 1 46  ? 3.826   -7.528  -55.649 1.00 64.03  ? 26  GLU A CG  1 
ATOM   175   C CD  . GLU A 1 46  ? 4.339   -8.859  -56.164 1.00 72.17  ? 26  GLU A CD  1 
ATOM   176   O OE1 . GLU A 1 46  ? 3.596   -9.513  -56.925 1.00 77.46  ? 26  GLU A OE1 1 
ATOM   177   O OE2 . GLU A 1 46  ? 5.468   -9.260  -55.789 1.00 77.84  ? 26  GLU A OE2 1 
ATOM   178   N N   . VAL A 1 47  ? 1.045   -6.083  -52.529 1.00 37.35  ? 27  VAL A N   1 
ATOM   179   C CA  . VAL A 1 47  ? 0.083   -6.124  -51.459 1.00 38.88  ? 27  VAL A CA  1 
ATOM   180   C C   . VAL A 1 47  ? -1.152  -6.863  -51.890 1.00 38.65  ? 27  VAL A C   1 
ATOM   181   O O   . VAL A 1 47  ? -1.714  -6.572  -52.942 1.00 38.52  ? 27  VAL A O   1 
ATOM   182   C CB  . VAL A 1 47  ? -0.356  -4.704  -51.058 1.00 39.38  ? 27  VAL A CB  1 
ATOM   183   C CG1 . VAL A 1 47  ? -1.466  -4.760  -50.027 1.00 40.03  ? 27  VAL A CG1 1 
ATOM   184   C CG2 . VAL A 1 47  ? 0.818   -3.943  -50.477 1.00 40.36  ? 27  VAL A CG2 1 
ATOM   185   N N   . VAL A 1 48  ? -1.595  -7.790  -51.048 1.00 38.76  ? 28  VAL A N   1 
ATOM   186   C CA  . VAL A 1 48  ? -2.885  -8.409  -51.241 1.00 38.18  ? 28  VAL A CA  1 
ATOM   187   C C   . VAL A 1 48  ? -3.828  -7.883  -50.186 1.00 39.15  ? 28  VAL A C   1 
ATOM   188   O O   . VAL A 1 48  ? -3.562  -7.989  -48.989 1.00 39.71  ? 28  VAL A O   1 
ATOM   189   C CB  . VAL A 1 48  ? -2.822  -9.932  -51.131 1.00 38.99  ? 28  VAL A CB  1 
ATOM   190   C CG1 . VAL A 1 48  ? -4.223  -10.518 -51.254 1.00 37.56  ? 28  VAL A CG1 1 
ATOM   191   C CG2 . VAL A 1 48  ? -1.920  -10.481 -52.221 1.00 39.85  ? 28  VAL A CG2 1 
ATOM   192   N N   . LEU A 1 49  ? -4.947  -7.335  -50.634 1.00 39.14  ? 29  LEU A N   1 
ATOM   193   C CA  . LEU A 1 49  ? -5.872  -6.718  -49.718 1.00 38.69  ? 29  LEU A CA  1 
ATOM   194   C C   . LEU A 1 49  ? -7.124  -7.547  -49.673 1.00 37.58  ? 29  LEU A C   1 
ATOM   195   O O   . LEU A 1 49  ? -7.827  -7.688  -50.665 1.00 35.41  ? 29  LEU A O   1 
ATOM   196   C CB  . LEU A 1 49  ? -6.182  -5.295  -50.161 1.00 38.94  ? 29  LEU A CB  1 
ATOM   197   C CG  . LEU A 1 49  ? -7.231  -4.549  -49.337 1.00 39.69  ? 29  LEU A CG  1 
ATOM   198   C CD1 . LEU A 1 49  ? -6.672  -4.105  -47.998 1.00 39.94  ? 29  LEU A CD1 1 
ATOM   199   C CD2 . LEU A 1 49  ? -7.729  -3.353  -50.122 1.00 40.20  ? 29  LEU A CD2 1 
ATOM   200   N N   . ARG A 1 50  ? -7.413  -8.077  -48.501 1.00 37.59  ? 30  ARG A N   1 
ATOM   201   C CA  . ARG A 1 50  ? -8.531  -8.972  -48.339 1.00 39.09  ? 30  ARG A CA  1 
ATOM   202   C C   . ARG A 1 50  ? -9.613  -8.454  -47.399 1.00 40.92  ? 30  ARG A C   1 
ATOM   203   O O   . ARG A 1 50  ? -9.327  -8.013  -46.291 1.00 45.76  ? 30  ARG A O   1 
ATOM   204   C CB  . ARG A 1 50  ? -7.991  -10.268 -47.772 1.00 38.89  ? 30  ARG A CB  1 
ATOM   205   C CG  . ARG A 1 50  ? -9.001  -11.381 -47.727 1.00 40.04  ? 30  ARG A CG  1 
ATOM   206   C CD  . ARG A 1 50  ? -9.760  -11.391 -46.424 1.00 40.55  ? 30  ARG A CD  1 
ATOM   207   N NE  . ARG A 1 50  ? -10.700 -12.499 -46.374 1.00 41.38  ? 30  ARG A NE  1 
ATOM   208   C CZ  . ARG A 1 50  ? -11.336 -12.862 -45.267 1.00 44.73  ? 30  ARG A CZ  1 
ATOM   209   N NH1 . ARG A 1 50  ? -11.136 -12.205 -44.133 1.00 46.93  ? 30  ARG A NH1 1 
ATOM   210   N NH2 . ARG A 1 50  ? -12.152 -13.894 -45.273 1.00 45.04  ? 30  ARG A NH2 1 
ATOM   211   N N   . ASP A 1 51  ? -10.861 -8.554  -47.822 1.00 41.91  ? 31  ASP A N   1 
ATOM   212   C CA  . ASP A 1 51  ? -11.973 -8.415  -46.906 1.00 43.71  ? 31  ASP A CA  1 
ATOM   213   C C   . ASP A 1 51  ? -12.981 -9.485  -47.271 1.00 45.72  ? 31  ASP A C   1 
ATOM   214   O O   . ASP A 1 51  ? -12.762 -10.246 -48.201 1.00 48.78  ? 31  ASP A O   1 
ATOM   215   C CB  . ASP A 1 51  ? -12.592 -7.013  -46.955 1.00 44.51  ? 31  ASP A CB  1 
ATOM   216   C CG  . ASP A 1 51  ? -13.019 -6.521  -45.573 1.00 44.41  ? 31  ASP A CG  1 
ATOM   217   O OD1 . ASP A 1 51  ? -13.752 -7.258  -44.893 1.00 46.28  ? 31  ASP A OD1 1 
ATOM   218   O OD2 . ASP A 1 51  ? -12.607 -5.421  -45.151 1.00 44.65  ? 31  ASP A OD2 1 
ATOM   219   N N   . ILE A 1 52  ? -14.088 -9.535  -46.551 1.00 45.31  ? 32  ILE A N   1 
ATOM   220   C CA  . ILE A 1 52  ? -15.000 -10.655 -46.674 1.00 46.91  ? 32  ILE A CA  1 
ATOM   221   C C   . ILE A 1 52  ? -15.962 -10.523 -47.830 1.00 48.14  ? 32  ILE A C   1 
ATOM   222   O O   . ILE A 1 52  ? -16.723 -11.432 -48.095 1.00 52.39  ? 32  ILE A O   1 
ATOM   223   C CB  . ILE A 1 52  ? -15.823 -10.838 -45.400 1.00 50.14  ? 32  ILE A CB  1 
ATOM   224   C CG1 . ILE A 1 52  ? -16.586 -9.552  -45.066 1.00 54.77  ? 32  ILE A CG1 1 
ATOM   225   C CG2 . ILE A 1 52  ? -14.912 -11.211 -44.243 1.00 51.09  ? 32  ILE A CG2 1 
ATOM   226   C CD1 . ILE A 1 52  ? -17.658 -9.736  -44.018 1.00 53.89  ? 32  ILE A CD1 1 
ATOM   227   N N   . LYS A 1 53  ? -15.936 -9.410  -48.532 1.00 48.04  ? 33  LYS A N   1 
ATOM   228   C CA  . LYS A 1 53  ? -16.930 -9.196  -49.555 1.00 49.17  ? 33  LYS A CA  1 
ATOM   229   C C   . LYS A 1 53  ? -16.358 -8.295  -50.589 1.00 47.24  ? 33  LYS A C   1 
ATOM   230   O O   . LYS A 1 53  ? -15.507 -7.483  -50.271 1.00 47.02  ? 33  LYS A O   1 
ATOM   231   C CB  . LYS A 1 53  ? -18.071 -8.476  -48.915 1.00 55.15  ? 33  LYS A CB  1 
ATOM   232   C CG  . LYS A 1 53  ? -19.431 -8.881  -49.392 1.00 60.72  ? 33  LYS A CG  1 
ATOM   233   C CD  . LYS A 1 53  ? -20.455 -8.099  -48.600 1.00 65.89  ? 33  LYS A CD  1 
ATOM   234   C CE  . LYS A 1 53  ? -20.075 -8.054  -47.129 1.00 69.51  ? 33  LYS A CE  1 
ATOM   235   N NZ  . LYS A 1 53  ? -21.278 -8.053  -46.271 1.00 73.46  ? 33  LYS A NZ  1 
ATOM   236   N N   . ASP A 1 54  ? -16.841 -8.394  -51.814 1.00 48.77  ? 34  ASP A N   1 
ATOM   237   C CA  . ASP A 1 54  ? -16.341 -7.526  -52.876 1.00 53.88  ? 34  ASP A CA  1 
ATOM   238   C C   . ASP A 1 54  ? -16.686 -6.100  -52.566 1.00 56.27  ? 34  ASP A C   1 
ATOM   239   O O   . ASP A 1 54  ? -15.877 -5.186  -52.754 1.00 56.27  ? 34  ASP A O   1 
ATOM   240   C CB  . ASP A 1 54  ? -16.972 -7.891  -54.206 1.00 59.27  ? 34  ASP A CB  1 
ATOM   241   C CG  . ASP A 1 54  ? -16.222 -8.980  -54.926 1.00 61.56  ? 34  ASP A CG  1 
ATOM   242   O OD1 . ASP A 1 54  ? -15.051 -9.237  -54.600 1.00 67.67  ? 34  ASP A OD1 1 
ATOM   243   O OD2 . ASP A 1 54  ? -16.801 -9.573  -55.845 1.00 63.96  ? 34  ASP A OD2 1 
ATOM   244   N N   . GLU A 1 55  ? -17.919 -5.937  -52.105 1.00 60.96  ? 35  GLU A N   1 
ATOM   245   C CA  . GLU A 1 55  ? -18.411 -4.668  -51.620 1.00 62.47  ? 35  GLU A CA  1 
ATOM   246   C C   . GLU A 1 55  ? -17.308 -4.003  -50.794 1.00 60.20  ? 35  GLU A C   1 
ATOM   247   O O   . GLU A 1 55  ? -16.881 -2.898  -51.114 1.00 61.62  ? 35  GLU A O   1 
ATOM   248   C CB  . GLU A 1 55  ? -19.669 -4.885  -50.774 1.00 67.57  ? 35  GLU A CB  1 
ATOM   249   C CG  . GLU A 1 55  ? -20.737 -3.815  -50.939 1.00 72.48  ? 35  GLU A CG  1 
ATOM   250   C CD  . GLU A 1 55  ? -21.137 -3.165  -49.618 1.00 76.75  ? 35  GLU A CD  1 
ATOM   251   O OE1 . GLU A 1 55  ? -20.566 -2.098  -49.296 1.00 79.67  ? 35  GLU A OE1 1 
ATOM   252   O OE2 . GLU A 1 55  ? -22.010 -3.714  -48.901 1.00 70.17  ? 35  GLU A OE2 1 
ATOM   253   N N   . PHE A 1 56  ? -16.805 -4.691  -49.772 1.00 54.85  ? 36  PHE A N   1 
ATOM   254   C CA  . PHE A 1 56  ? -15.848 -4.061  -48.853 1.00 55.19  ? 36  PHE A CA  1 
ATOM   255   C C   . PHE A 1 56  ? -14.477 -3.855  -49.443 1.00 52.71  ? 36  PHE A C   1 
ATOM   256   O O   . PHE A 1 56  ? -13.769 -2.935  -49.052 1.00 54.21  ? 36  PHE A O   1 
ATOM   257   C CB  . PHE A 1 56  ? -15.708 -4.848  -47.559 1.00 56.49  ? 36  PHE A CB  1 
ATOM   258   C CG  . PHE A 1 56  ? -16.963 -4.901  -46.757 1.00 58.15  ? 36  PHE A CG  1 
ATOM   259   C CD1 . PHE A 1 56  ? -18.045 -4.092  -47.079 1.00 59.90  ? 36  PHE A CD1 1 
ATOM   260   C CD2 . PHE A 1 56  ? -17.063 -5.741  -45.661 1.00 61.17  ? 36  PHE A CD2 1 
ATOM   261   C CE1 . PHE A 1 56  ? -19.212 -4.132  -46.337 1.00 60.76  ? 36  PHE A CE1 1 
ATOM   262   C CE2 . PHE A 1 56  ? -18.229 -5.782  -44.911 1.00 63.30  ? 36  PHE A CE2 1 
ATOM   263   C CZ  . PHE A 1 56  ? -19.307 -4.973  -45.250 1.00 60.39  ? 36  PHE A CZ  1 
ATOM   264   N N   . VAL A 1 57  ? -14.093 -4.694  -50.383 1.00 47.88  ? 37  VAL A N   1 
ATOM   265   C CA  . VAL A 1 57  ? -12.755 -4.597  -50.912 1.00 45.23  ? 37  VAL A CA  1 
ATOM   266   C C   . VAL A 1 57  ? -12.726 -3.406  -51.849 1.00 45.45  ? 37  VAL A C   1 
ATOM   267   O O   . VAL A 1 57  ? -11.742 -2.673  -51.905 1.00 41.90  ? 37  VAL A O   1 
ATOM   268   C CB  . VAL A 1 57  ? -12.359 -5.880  -51.653 1.00 45.18  ? 37  VAL A CB  1 
ATOM   269   C CG1 . VAL A 1 57  ? -10.950 -5.776  -52.207 1.00 45.89  ? 37  VAL A CG1 1 
ATOM   270   C CG2 . VAL A 1 57  ? -12.439 -7.071  -50.723 1.00 44.32  ? 37  VAL A CG2 1 
ATOM   271   N N   . ASP A 1 58  ? -13.814 -3.218  -52.589 1.00 48.33  ? 38  ASP A N   1 
ATOM   272   C CA  . ASP A 1 58  ? -13.897 -2.129  -53.567 1.00 49.48  ? 38  ASP A CA  1 
ATOM   273   C C   . ASP A 1 58  ? -13.932 -0.787  -52.873 1.00 50.69  ? 38  ASP A C   1 
ATOM   274   O O   . ASP A 1 58  ? -13.216 0.148   -53.258 1.00 44.28  ? 38  ASP A O   1 
ATOM   275   C CB  . ASP A 1 58  ? -15.124 -2.308  -54.436 1.00 49.91  ? 38  ASP A CB  1 
ATOM   276   C CG  . ASP A 1 58  ? -14.997 -3.500  -55.342 1.00 53.34  ? 38  ASP A CG  1 
ATOM   277   O OD1 . ASP A 1 58  ? -13.845 -3.862  -55.667 1.00 58.11  ? 38  ASP A OD1 1 
ATOM   278   O OD2 . ASP A 1 58  ? -16.031 -4.087  -55.720 1.00 54.96  ? 38  ASP A OD2 1 
ATOM   279   N N   . ARG A 1 59  ? -14.754 -0.723  -51.830 1.00 51.76  ? 39  ARG A N   1 
ATOM   280   C CA  . ARG A 1 59  ? -14.823 0.435   -50.952 1.00 55.74  ? 39  ARG A CA  1 
ATOM   281   C C   . ARG A 1 59  ? -13.422 0.863   -50.499 1.00 55.75  ? 39  ARG A C   1 
ATOM   282   O O   . ARG A 1 59  ? -13.069 2.048   -50.556 1.00 54.66  ? 39  ARG A O   1 
ATOM   283   C CB  . ARG A 1 59  ? -15.727 0.111   -49.760 1.00 62.27  ? 39  ARG A CB  1 
ATOM   284   C CG  . ARG A 1 59  ? -15.507 0.961   -48.524 1.00 68.89  ? 39  ARG A CG  1 
ATOM   285   C CD  . ARG A 1 59  ? -16.752 1.011   -47.644 1.00 74.79  ? 39  ARG A CD  1 
ATOM   286   N NE  . ARG A 1 59  ? -16.355 1.123   -46.239 1.00 83.53  ? 39  ARG A NE  1 
ATOM   287   C CZ  . ARG A 1 59  ? -16.394 2.236   -45.505 1.00 87.59  ? 39  ARG A CZ  1 
ATOM   288   N NH1 . ARG A 1 59  ? -16.854 3.381   -46.006 1.00 93.27  ? 39  ARG A NH1 1 
ATOM   289   N NH2 . ARG A 1 59  ? -15.981 2.199   -44.244 1.00 84.93  ? 39  ARG A NH2 1 
ATOM   290   N N   . GLY A 1 60  ? -12.623 -0.109  -50.078 1.00 52.84  ? 40  GLY A N   1 
ATOM   291   C CA  . GLY A 1 60  ? -11.273 0.173   -49.612 1.00 51.43  ? 40  GLY A CA  1 
ATOM   292   C C   . GLY A 1 60  ? -10.348 0.574   -50.737 1.00 48.84  ? 40  GLY A C   1 
ATOM   293   O O   . GLY A 1 60  ? -9.481  1.414   -50.559 1.00 47.62  ? 40  GLY A O   1 
ATOM   294   N N   . LEU A 1 61  ? -10.521 -0.047  -51.895 1.00 49.03  ? 41  LEU A N   1 
ATOM   295   C CA  . LEU A 1 61  ? -9.755  0.328   -53.076 1.00 50.89  ? 41  LEU A CA  1 
ATOM   296   C C   . LEU A 1 61  ? -10.119 1.728   -53.579 1.00 54.97  ? 41  LEU A C   1 
ATOM   297   O O   . LEU A 1 61  ? -9.255  2.485   -54.005 1.00 52.39  ? 41  LEU A O   1 
ATOM   298   C CB  . LEU A 1 61  ? -9.968  -0.691  -54.181 1.00 48.62  ? 41  LEU A CB  1 
ATOM   299   C CG  . LEU A 1 61  ? -9.271  -2.027  -53.938 1.00 48.51  ? 41  LEU A CG  1 
ATOM   300   C CD1 . LEU A 1 61  ? -9.769  -3.037  -54.947 1.00 48.31  ? 41  LEU A CD1 1 
ATOM   301   C CD2 . LEU A 1 61  ? -7.766  -1.903  -54.064 1.00 47.92  ? 41  LEU A CD2 1 
ATOM   302   N N   . ASP A 1 62  ? -11.401 2.063   -53.523 1.00 60.45  ? 42  ASP A N   1 
ATOM   303   C CA  . ASP A 1 62  ? -11.852 3.417   -53.843 1.00 63.41  ? 42  ASP A CA  1 
ATOM   304   C C   . ASP A 1 62  ? -11.222 4.422   -52.907 1.00 61.37  ? 42  ASP A C   1 
ATOM   305   O O   . ASP A 1 62  ? -10.698 5.446   -53.344 1.00 62.32  ? 42  ASP A O   1 
ATOM   306   C CB  . ASP A 1 62  ? -13.370 3.532   -53.715 1.00 66.58  ? 42  ASP A CB  1 
ATOM   307   C CG  . ASP A 1 62  ? -14.105 2.669   -54.712 1.00 69.17  ? 42  ASP A CG  1 
ATOM   308   O OD1 . ASP A 1 62  ? -13.483 2.234   -55.705 1.00 73.03  ? 42  ASP A OD1 1 
ATOM   309   O OD2 . ASP A 1 62  ? -15.309 2.418   -54.498 1.00 70.70  ? 42  ASP A OD2 1 
ATOM   310   N N   . PHE A 1 63  ? -11.286 4.118   -51.618 1.00 60.31  ? 43  PHE A N   1 
ATOM   311   C CA  . PHE A 1 63  ? -10.729 4.986   -50.590 1.00 60.35  ? 43  PHE A CA  1 
ATOM   312   C C   . PHE A 1 63  ? -9.257  5.284   -50.868 1.00 57.16  ? 43  PHE A C   1 
ATOM   313   O O   . PHE A 1 63  ? -8.817  6.421   -50.728 1.00 61.96  ? 43  PHE A O   1 
ATOM   314   C CB  . PHE A 1 63  ? -10.914 4.356   -49.206 1.00 63.24  ? 43  PHE A CB  1 
ATOM   315   C CG  . PHE A 1 63  ? -10.203 5.084   -48.116 1.00 68.59  ? 43  PHE A CG  1 
ATOM   316   C CD1 . PHE A 1 63  ? -8.943  4.672   -47.694 1.00 71.90  ? 43  PHE A CD1 1 
ATOM   317   C CD2 . PHE A 1 63  ? -10.778 6.203   -47.518 1.00 74.09  ? 43  PHE A CD2 1 
ATOM   318   C CE1 . PHE A 1 63  ? -8.271  5.354   -46.685 1.00 73.40  ? 43  PHE A CE1 1 
ATOM   319   C CE2 . PHE A 1 63  ? -10.110 6.893   -46.513 1.00 69.60  ? 43  PHE A CE2 1 
ATOM   320   C CZ  . PHE A 1 63  ? -8.856  6.468   -46.097 1.00 72.75  ? 43  PHE A CZ  1 
ATOM   321   N N   . ILE A 1 64  ? -8.512  4.276   -51.303 1.00 53.49  ? 44  ILE A N   1 
ATOM   322   C CA  . ILE A 1 64  ? -7.089  4.450   -51.592 1.00 52.58  ? 44  ILE A CA  1 
ATOM   323   C C   . ILE A 1 64  ? -6.905  5.240   -52.866 1.00 52.52  ? 44  ILE A C   1 
ATOM   324   O O   . ILE A 1 64  ? -5.932  5.971   -53.027 1.00 51.79  ? 44  ILE A O   1 
ATOM   325   C CB  . ILE A 1 64  ? -6.387  3.094   -51.761 1.00 50.66  ? 44  ILE A CB  1 
ATOM   326   C CG1 . ILE A 1 64  ? -6.434  2.331   -50.443 1.00 50.52  ? 44  ILE A CG1 1 
ATOM   327   C CG2 . ILE A 1 64  ? -4.933  3.260   -52.211 1.00 47.27  ? 44  ILE A CG2 1 
ATOM   328   C CD1 . ILE A 1 64  ? -6.107  0.865   -50.606 1.00 52.23  ? 44  ILE A CD1 1 
ATOM   329   N N   . ASN A 1 65  ? -7.828  5.061   -53.793 1.00 55.10  ? 45  ASN A N   1 
ATOM   330   C CA  . ASN A 1 65  ? -7.754  5.778   -55.037 1.00 59.76  ? 45  ASN A CA  1 
ATOM   331   C C   . ASN A 1 65  ? -7.908  7.263   -54.766 1.00 60.14  ? 45  ASN A C   1 
ATOM   332   O O   . ASN A 1 65  ? -7.113  8.068   -55.244 1.00 59.33  ? 45  ASN A O   1 
ATOM   333   C CB  . ASN A 1 65  ? -8.823  5.314   -56.010 1.00 63.47  ? 45  ASN A CB  1 
ATOM   334   C CG  . ASN A 1 65  ? -8.451  5.627   -57.441 1.00 67.25  ? 45  ASN A CG  1 
ATOM   335   O OD1 . ASN A 1 65  ? -8.898  6.617   -58.006 1.00 68.73  ? 45  ASN A OD1 1 
ATOM   336   N ND2 . ASN A 1 65  ? -7.589  4.806   -58.017 1.00 68.75  ? 45  ASN A ND2 1 
ATOM   337   N N   . LYS A 1 66  ? -8.915  7.617   -53.977 1.00 61.10  ? 46  LYS A N   1 
ATOM   338   C CA  . LYS A 1 66  ? -9.115  9.008   -53.598 1.00 62.40  ? 46  LYS A CA  1 
ATOM   339   C C   . LYS A 1 66  ? -7.880  9.576   -52.926 1.00 59.66  ? 46  LYS A C   1 
ATOM   340   O O   . LYS A 1 66  ? -7.443  10.655  -53.295 1.00 63.38  ? 46  LYS A O   1 
ATOM   341   C CB  . LYS A 1 66  ? -10.318 9.179   -52.689 1.00 67.61  ? 46  LYS A CB  1 
ATOM   342   C CG  . LYS A 1 66  ? -11.645 9.068   -53.416 1.00 76.58  ? 46  LYS A CG  1 
ATOM   343   C CD  . LYS A 1 66  ? -11.980 10.344  -54.192 1.00 87.63  ? 46  LYS A CD  1 
ATOM   344   C CE  . LYS A 1 66  ? -13.485 10.515  -54.415 1.00 90.05  ? 46  LYS A CE  1 
ATOM   345   N NZ  . LYS A 1 66  ? -13.893 11.951  -54.432 1.00 90.17  ? 46  LYS A NZ  1 
ATOM   346   N N   . ASN A 1 67  ? -7.294  8.864   -51.967 1.00 55.98  ? 47  ASN A N   1 
ATOM   347   C CA  . ASN A 1 67  ? -6.090  9.393   -51.313 1.00 58.39  ? 47  ASN A CA  1 
ATOM   348   C C   . ASN A 1 67  ? -4.958  9.672   -52.301 1.00 57.62  ? 47  ASN A C   1 
ATOM   349   O O   . ASN A 1 67  ? -4.232  10.653  -52.157 1.00 55.50  ? 47  ASN A O   1 
ATOM   350   C CB  . ASN A 1 67  ? -5.538  8.448   -50.253 1.00 62.63  ? 47  ASN A CB  1 
ATOM   351   C CG  . ASN A 1 67  ? -6.494  8.206   -49.110 1.00 68.24  ? 47  ASN A CG  1 
ATOM   352   O OD1 . ASN A 1 67  ? -7.422  8.980   -48.865 1.00 74.25  ? 47  ASN A OD1 1 
ATOM   353   N ND2 . ASN A 1 67  ? -6.256  7.116   -48.379 1.00 70.24  ? 47  ASN A ND2 1 
ATOM   354   N N   . LEU A 1 68  ? -4.787  8.807   -53.291 1.00 55.31  ? 48  LEU A N   1 
ATOM   355   C CA  . LEU A 1 68  ? -3.691  8.988   -54.226 1.00 58.21  ? 48  LEU A CA  1 
ATOM   356   C C   . LEU A 1 68  ? -4.043  10.041  -55.262 1.00 60.54  ? 48  LEU A C   1 
ATOM   357   O O   . LEU A 1 68  ? -3.158  10.629  -55.872 1.00 60.59  ? 48  LEU A O   1 
ATOM   358   C CB  . LEU A 1 68  ? -3.343  7.678   -54.914 1.00 57.69  ? 48  LEU A CB  1 
ATOM   359   C CG  . LEU A 1 68  ? -2.795  6.565   -54.029 1.00 55.44  ? 48  LEU A CG  1 
ATOM   360   C CD1 . LEU A 1 68  ? -2.623  5.329   -54.888 1.00 56.17  ? 48  LEU A CD1 1 
ATOM   361   C CD2 . LEU A 1 68  ? -1.470  6.947   -53.389 1.00 52.91  ? 48  LEU A CD2 1 
ATOM   362   N N   . SER A 1 69  ? -5.339  10.262  -55.457 1.00 63.50  ? 49  SER A N   1 
ATOM   363   C CA  . SER A 1 69  ? -5.823  11.370  -56.270 1.00 66.09  ? 49  SER A CA  1 
ATOM   364   C C   . SER A 1 69  ? -5.512  12.715  -55.604 1.00 68.22  ? 49  SER A C   1 
ATOM   365   O O   . SER A 1 69  ? -5.009  13.634  -56.252 1.00 71.55  ? 49  SER A O   1 
ATOM   366   C CB  . SER A 1 69  ? -7.327  11.241  -56.501 1.00 65.22  ? 49  SER A CB  1 
ATOM   367   O OG  . SER A 1 69  ? -7.598  10.238  -57.460 1.00 65.09  ? 49  SER A OG  1 
ATOM   368   N N   . LYS A 1 70  ? -5.814  12.824  -54.313 1.00 67.27  ? 50  LYS A N   1 
ATOM   369   C CA  . LYS A 1 70  ? -5.464  14.023  -53.549 1.00 67.32  ? 50  LYS A CA  1 
ATOM   370   C C   . LYS A 1 70  ? -4.003  14.361  -53.673 1.00 67.66  ? 50  LYS A C   1 
ATOM   371   O O   . LYS A 1 70  ? -3.645  15.526  -53.753 1.00 74.86  ? 50  LYS A O   1 
ATOM   372   C CB  . LYS A 1 70  ? -5.782  13.871  -52.069 1.00 68.08  ? 50  LYS A CB  1 
ATOM   373   C CG  . LYS A 1 70  ? -7.070  14.562  -51.685 1.00 71.76  ? 50  LYS A CG  1 
ATOM   374   C CD  . LYS A 1 70  ? -7.582  14.110  -50.332 1.00 73.75  ? 50  LYS A CD  1 
ATOM   375   C CE  . LYS A 1 70  ? -9.021  13.618  -50.469 1.00 78.57  ? 50  LYS A CE  1 
ATOM   376   N NZ  . LYS A 1 70  ? -9.497  12.841  -49.293 1.00 80.45  ? 50  LYS A NZ  1 
ATOM   377   N N   . LEU A 1 71  ? -3.157  13.342  -53.678 1.00 66.75  ? 51  LEU A N   1 
ATOM   378   C CA  . LEU A 1 71  ? -1.727  13.567  -53.691 1.00 66.32  ? 51  LEU A CA  1 
ATOM   379   C C   . LEU A 1 71  ? -1.208  14.039  -55.041 1.00 68.74  ? 51  LEU A C   1 
ATOM   380   O O   . LEU A 1 71  ? -0.174  14.715  -55.110 1.00 69.83  ? 51  LEU A O   1 
ATOM   381   C CB  . LEU A 1 71  ? -0.991  12.297  -53.287 1.00 65.02  ? 51  LEU A CB  1 
ATOM   382   C CG  . LEU A 1 71  ? -1.224  11.731  -51.887 1.00 65.34  ? 51  LEU A CG  1 
ATOM   383   C CD1 . LEU A 1 71  ? -0.284  10.552  -51.670 1.00 62.24  ? 51  LEU A CD1 1 
ATOM   384   C CD2 . LEU A 1 71  ? -1.006  12.787  -50.817 1.00 63.15  ? 51  LEU A CD2 1 
ATOM   385   N N   . VAL A 1 72  ? -1.892  13.671  -56.115 1.00 68.85  ? 52  VAL A N   1 
ATOM   386   C CA  . VAL A 1 72  ? -1.454  14.134  -57.430 1.00 76.61  ? 52  VAL A CA  1 
ATOM   387   C C   . VAL A 1 72  ? -1.989  15.525  -57.648 1.00 79.30  ? 52  VAL A C   1 
ATOM   388   O O   . VAL A 1 72  ? -1.310  16.361  -58.241 1.00 75.88  ? 52  VAL A O   1 
ATOM   389   C CB  . VAL A 1 72  ? -1.848  13.226  -58.620 1.00 78.37  ? 52  VAL A CB  1 
ATOM   390   C CG1 . VAL A 1 72  ? -0.824  12.135  -58.804 1.00 79.74  ? 52  VAL A CG1 1 
ATOM   391   C CG2 . VAL A 1 72  ? -3.230  12.624  -58.473 1.00 78.06  ? 52  VAL A CG2 1 
ATOM   392   N N   . LYS A 1 73  ? -3.194  15.772  -57.139 1.00 84.49  ? 53  LYS A N   1 
ATOM   393   C CA  . LYS A 1 73  ? -3.809  17.090  -57.221 1.00 85.77  ? 53  LYS A CA  1 
ATOM   394   C C   . LYS A 1 73  ? -2.936  18.142  -56.523 1.00 83.82  ? 53  LYS A C   1 
ATOM   395   O O   . LYS A 1 73  ? -2.772  19.238  -57.036 1.00 87.64  ? 53  LYS A O   1 
ATOM   396   C CB  . LYS A 1 73  ? -5.220  17.075  -56.632 1.00 89.48  ? 53  LYS A CB  1 
ATOM   397   C CG  . LYS A 1 73  ? -6.071  18.241  -57.106 1.00 91.78  ? 53  LYS A CG  1 
ATOM   398   C CD  . LYS A 1 73  ? -7.335  18.406  -56.278 1.00 94.64  ? 53  LYS A CD  1 
ATOM   399   C CE  . LYS A 1 73  ? -8.459  19.020  -57.104 1.00 95.06  ? 53  LYS A CE  1 
ATOM   400   N NZ  . LYS A 1 73  ? -9.795  18.793  -56.487 1.00 93.32  ? 53  LYS A NZ  1 
ATOM   401   N N   . LYS A 1 74  ? -2.364  17.794  -55.374 1.00 83.67  ? 54  LYS A N   1 
ATOM   402   C CA  . LYS A 1 74  ? -1.379  18.650  -54.705 1.00 83.32  ? 54  LYS A CA  1 
ATOM   403   C C   . LYS A 1 74  ? 0.055   18.388  -55.160 1.00 82.33  ? 54  LYS A C   1 
ATOM   404   O O   . LYS A 1 74  ? 0.989   18.654  -54.407 1.00 80.95  ? 54  LYS A O   1 
ATOM   405   C CB  . LYS A 1 74  ? -1.398  18.432  -53.190 1.00 86.75  ? 54  LYS A CB  1 
ATOM   406   C CG  . LYS A 1 74  ? -2.765  18.399  -52.540 1.00 94.51  ? 54  LYS A CG  1 
ATOM   407   C CD  . LYS A 1 74  ? -2.617  18.194  -51.039 1.00 100.82 ? 54  LYS A CD  1 
ATOM   408   C CE  . LYS A 1 74  ? -3.898  18.530  -50.290 1.00 106.01 ? 54  LYS A CE  1 
ATOM   409   N NZ  . LYS A 1 74  ? -3.896  19.926  -49.756 1.00 106.92 ? 54  LYS A NZ  1 
ATOM   410   N N   . GLY A 1 75  ? 0.249   17.840  -56.355 1.00 78.32  ? 55  GLY A N   1 
ATOM   411   C CA  . GLY A 1 75  ? 1.602   17.572  -56.868 1.00 74.96  ? 55  GLY A CA  1 
ATOM   412   C C   . GLY A 1 75  ? 2.641   16.895  -55.971 1.00 74.65  ? 55  GLY A C   1 
ATOM   413   O O   . GLY A 1 75  ? 3.844   17.020  -56.233 1.00 67.60  ? 55  GLY A O   1 
ATOM   414   N N   . LYS A 1 76  ? 2.207   16.172  -54.932 1.00 75.86  ? 56  LYS A N   1 
ATOM   415   C CA  . LYS A 1 76  ? 3.143   15.390  -54.114 1.00 73.07  ? 56  LYS A CA  1 
ATOM   416   C C   . LYS A 1 76  ? 3.664   14.188  -54.892 1.00 67.03  ? 56  LYS A C   1 
ATOM   417   O O   . LYS A 1 76  ? 4.806   13.798  -54.716 1.00 63.63  ? 56  LYS A O   1 
ATOM   418   C CB  . LYS A 1 76  ? 2.507   14.921  -52.808 1.00 77.09  ? 56  LYS A CB  1 
ATOM   419   C CG  . LYS A 1 76  ? 3.522   14.370  -51.809 1.00 81.04  ? 56  LYS A CG  1 
ATOM   420   C CD  . LYS A 1 76  ? 4.235   15.482  -51.055 1.00 84.16  ? 56  LYS A CD  1 
ATOM   421   C CE  . LYS A 1 76  ? 4.959   14.959  -49.822 1.00 84.79  ? 56  LYS A CE  1 
ATOM   422   N NZ  . LYS A 1 76  ? 4.575   15.740  -48.608 1.00 85.78  ? 56  LYS A NZ  1 
ATOM   423   N N   . ILE A 1 77  ? 2.828   13.609  -55.751 1.00 64.27  ? 57  ILE A N   1 
ATOM   424   C CA  . ILE A 1 77  ? 3.238   12.470  -56.577 1.00 65.06  ? 57  ILE A CA  1 
ATOM   425   C C   . ILE A 1 77  ? 2.739   12.639  -57.991 1.00 67.16  ? 57  ILE A C   1 
ATOM   426   O O   . ILE A 1 77  ? 1.703   13.265  -58.216 1.00 66.75  ? 57  ILE A O   1 
ATOM   427   C CB  . ILE A 1 77  ? 2.679   11.120  -56.060 1.00 62.62  ? 57  ILE A CB  1 
ATOM   428   C CG1 . ILE A 1 77  ? 1.167   11.202  -55.858 1.00 60.30  ? 57  ILE A CG1 1 
ATOM   429   C CG2 . ILE A 1 77  ? 3.353   10.727  -54.758 1.00 61.86  ? 57  ILE A CG2 1 
ATOM   430   C CD1 . ILE A 1 77  ? 0.474   9.864   -55.891 1.00 60.10  ? 57  ILE A CD1 1 
ATOM   431   N N   . GLU A 1 78  ? 3.471   12.060  -58.933 1.00 70.57  ? 58  GLU A N   1 
ATOM   432   C CA  . GLU A 1 78  ? 3.025   12.019  -60.318 1.00 77.66  ? 58  GLU A CA  1 
ATOM   433   C C   . GLU A 1 78  ? 1.843   11.065  -60.485 1.00 80.48  ? 58  GLU A C   1 
ATOM   434   O O   . GLU A 1 78  ? 1.725   10.066  -59.770 1.00 82.86  ? 58  GLU A O   1 
ATOM   435   C CB  . GLU A 1 78  ? 4.164   11.598  -61.242 1.00 81.96  ? 58  GLU A CB  1 
ATOM   436   C CG  . GLU A 1 78  ? 4.917   12.772  -61.845 1.00 86.69  ? 58  GLU A CG  1 
ATOM   437   C CD  . GLU A 1 78  ? 5.797   12.359  -63.008 1.00 92.51  ? 58  GLU A CD  1 
ATOM   438   O OE1 . GLU A 1 78  ? 5.341   11.562  -63.859 1.00 94.58  ? 58  GLU A OE1 1 
ATOM   439   O OE2 . GLU A 1 78  ? 6.948   12.839  -63.077 1.00 97.26  ? 58  GLU A OE2 1 
ATOM   440   N N   . GLU A 1 79  ? 0.978   11.377  -61.446 1.00 77.94  ? 59  GLU A N   1 
ATOM   441   C CA  . GLU A 1 79  ? -0.213  10.568  -61.715 1.00 72.96  ? 59  GLU A CA  1 
ATOM   442   C C   . GLU A 1 79  ? 0.102   9.189   -62.286 1.00 72.74  ? 59  GLU A C   1 
ATOM   443   O O   . GLU A 1 79  ? -0.787  8.350   -62.411 1.00 75.37  ? 59  GLU A O   1 
ATOM   444   C CB  . GLU A 1 79  ? -1.152  11.319  -62.656 1.00 70.07  ? 59  GLU A CB  1 
ATOM   445   C CG  . GLU A 1 79  ? -2.217  10.460  -63.341 1.00 67.94  ? 59  GLU A CG  1 
ATOM   446   C CD  . GLU A 1 79  ? -3.457  10.258  -62.499 1.00 65.18  ? 59  GLU A CD  1 
ATOM   447   O OE1 . GLU A 1 79  ? -4.173  9.270   -62.748 1.00 63.60  ? 59  GLU A OE1 1 
ATOM   448   O OE2 . GLU A 1 79  ? -3.730  11.082  -61.601 1.00 64.84  ? 59  GLU A OE2 1 
ATOM   449   N N   . ALA A 1 80  ? 1.357   8.954   -62.636 1.00 71.86  ? 60  ALA A N   1 
ATOM   450   C CA  . ALA A 1 80  ? 1.764   7.648   -63.119 1.00 71.43  ? 60  ALA A CA  1 
ATOM   451   C C   . ALA A 1 80  ? 2.426   6.849   -62.003 1.00 70.80  ? 60  ALA A C   1 
ATOM   452   O O   . ALA A 1 80  ? 2.557   5.625   -62.092 1.00 68.87  ? 60  ALA A O   1 
ATOM   453   C CB  . ALA A 1 80  ? 2.708   7.809   -64.291 1.00 67.63  ? 60  ALA A CB  1 
ATOM   454   N N   . THR A 1 81  ? 2.878   7.552   -60.972 1.00 67.26  ? 61  THR A N   1 
ATOM   455   C CA  . THR A 1 81  ? 3.256   6.902   -59.740 1.00 65.72  ? 61  THR A CA  1 
ATOM   456   C C   . THR A 1 81  ? 1.979   6.387   -59.088 1.00 61.05  ? 61  THR A C   1 
ATOM   457   O O   . THR A 1 81  ? 1.930   5.244   -58.651 1.00 56.66  ? 61  THR A O   1 
ATOM   458   C CB  . THR A 1 81  ? 4.030   7.852   -58.818 1.00 65.16  ? 61  THR A CB  1 
ATOM   459   O OG1 . THR A 1 81  ? 5.294   8.141   -59.420 1.00 62.76  ? 61  THR A OG1 1 
ATOM   460   C CG2 . THR A 1 81  ? 4.280   7.220   -57.456 1.00 66.95  ? 61  THR A CG2 1 
ATOM   461   N N   . LYS A 1 82  ? 0.935   7.206   -59.059 1.00 57.98  ? 62  LYS A N   1 
ATOM   462   C CA  . LYS A 1 82  ? -0.343  6.717   -58.576 1.00 57.89  ? 62  LYS A CA  1 
ATOM   463   C C   . LYS A 1 82  ? -0.687  5.382   -59.226 1.00 63.31  ? 62  LYS A C   1 
ATOM   464   O O   . LYS A 1 82  ? -1.026  4.406   -58.538 1.00 63.18  ? 62  LYS A O   1 
ATOM   465   C CB  . LYS A 1 82  ? -1.457  7.703   -58.859 1.00 55.09  ? 62  LYS A CB  1 
ATOM   466   C CG  . LYS A 1 82  ? -2.817  7.043   -58.885 1.00 55.70  ? 62  LYS A CG  1 
ATOM   467   C CD  . LYS A 1 82  ? -3.924  8.059   -58.721 1.00 57.15  ? 62  LYS A CD  1 
ATOM   468   C CE  . LYS A 1 82  ? -5.190  7.574   -59.398 1.00 58.91  ? 62  LYS A CE  1 
ATOM   469   N NZ  . LYS A 1 82  ? -6.369  8.389   -58.999 1.00 62.52  ? 62  LYS A NZ  1 
ATOM   470   N N   . VAL A 1 83  ? -0.612  5.355   -60.553 1.00 67.09  ? 63  VAL A N   1 
ATOM   471   C CA  . VAL A 1 83  ? -0.938  4.148   -61.314 1.00 68.08  ? 63  VAL A CA  1 
ATOM   472   C C   . VAL A 1 83  ? -0.081  2.952   -60.896 1.00 64.29  ? 63  VAL A C   1 
ATOM   473   O O   . VAL A 1 83  ? -0.603  1.864   -60.669 1.00 63.50  ? 63  VAL A O   1 
ATOM   474   C CB  . VAL A 1 83  ? -0.808  4.390   -62.829 1.00 69.37  ? 63  VAL A CB  1 
ATOM   475   C CG1 . VAL A 1 83  ? -0.672  3.077   -63.591 1.00 67.29  ? 63  VAL A CG1 1 
ATOM   476   C CG2 . VAL A 1 83  ? -2.015  5.167   -63.321 1.00 68.87  ? 63  VAL A CG2 1 
ATOM   477   N N   . GLU A 1 84  ? 1.226   3.160   -60.809 1.00 63.15  ? 64  GLU A N   1 
ATOM   478   C CA  . GLU A 1 84  ? 2.144   2.121   -60.344 1.00 65.50  ? 64  GLU A CA  1 
ATOM   479   C C   . GLU A 1 84  ? 1.703   1.516   -59.018 1.00 63.59  ? 64  GLU A C   1 
ATOM   480   O O   . GLU A 1 84  ? 1.682   0.297   -58.838 1.00 64.66  ? 64  GLU A O   1 
ATOM   481   C CB  . GLU A 1 84  ? 3.530   2.702   -60.144 1.00 70.55  ? 64  GLU A CB  1 
ATOM   482   C CG  . GLU A 1 84  ? 4.543   2.274   -61.177 1.00 74.03  ? 64  GLU A CG  1 
ATOM   483   C CD  . GLU A 1 84  ? 5.821   3.072   -61.045 1.00 81.65  ? 64  GLU A CD  1 
ATOM   484   O OE1 . GLU A 1 84  ? 5.744   4.322   -61.044 1.00 86.85  ? 64  GLU A OE1 1 
ATOM   485   O OE2 . GLU A 1 84  ? 6.900   2.457   -60.926 1.00 86.81  ? 64  GLU A OE2 1 
ATOM   486   N N   . ILE A 1 85  ? 1.364   2.391   -58.088 1.00 58.48  ? 65  ILE A N   1 
ATOM   487   C CA  . ILE A 1 85  ? 0.972   1.964   -56.768 1.00 56.66  ? 65  ILE A CA  1 
ATOM   488   C C   . ILE A 1 85  ? -0.265  1.081   -56.770 1.00 55.46  ? 65  ILE A C   1 
ATOM   489   O O   . ILE A 1 85  ? -0.272  0.045   -56.111 1.00 53.08  ? 65  ILE A O   1 
ATOM   490   C CB  . ILE A 1 85  ? 0.722   3.171   -55.865 1.00 56.44  ? 65  ILE A CB  1 
ATOM   491   C CG1 . ILE A 1 85  ? 2.064   3.737   -55.415 1.00 57.54  ? 65  ILE A CG1 1 
ATOM   492   C CG2 . ILE A 1 85  ? -0.112  2.771   -54.657 1.00 56.09  ? 65  ILE A CG2 1 
ATOM   493   C CD1 . ILE A 1 85  ? 2.038   5.225   -55.137 1.00 56.78  ? 65  ILE A CD1 1 
ATOM   494   N N   . LEU A 1 86  ? -1.308  1.489   -57.486 1.00 54.57  ? 66  LEU A N   1 
ATOM   495   C CA  . LEU A 1 86  ? -2.559  0.717   -57.508 1.00 54.87  ? 66  LEU A CA  1 
ATOM   496   C C   . LEU A 1 86  ? -2.390  -0.656  -58.164 1.00 56.11  ? 66  LEU A C   1 
ATOM   497   O O   . LEU A 1 86  ? -3.080  -1.622  -57.844 1.00 50.23  ? 66  LEU A O   1 
ATOM   498   C CB  . LEU A 1 86  ? -3.632  1.492   -58.242 1.00 52.24  ? 66  LEU A CB  1 
ATOM   499   C CG  . LEU A 1 86  ? -4.183  2.652   -57.428 1.00 53.90  ? 66  LEU A CG  1 
ATOM   500   C CD1 . LEU A 1 86  ? -4.941  3.604   -58.334 1.00 53.91  ? 66  LEU A CD1 1 
ATOM   501   C CD2 . LEU A 1 86  ? -5.085  2.142   -56.317 1.00 51.40  ? 66  LEU A CD2 1 
ATOM   502   N N   . THR A 1 87  ? -1.454  -0.691  -59.097 1.00 57.63  ? 67  THR A N   1 
ATOM   503   C CA  . THR A 1 87  ? -1.034  -1.885  -59.798 1.00 57.13  ? 67  THR A CA  1 
ATOM   504   C C   . THR A 1 87  ? -0.409  -2.903  -58.854 1.00 55.14  ? 67  THR A C   1 
ATOM   505   O O   . THR A 1 87  ? -0.431  -4.106  -59.107 1.00 53.07  ? 67  THR A O   1 
ATOM   506   C CB  . THR A 1 87  ? 0.017   -1.468  -60.853 1.00 59.14  ? 67  THR A CB  1 
ATOM   507   O OG1 . THR A 1 87  ? -0.618  -1.388  -62.124 1.00 58.01  ? 67  THR A OG1 1 
ATOM   508   C CG2 . THR A 1 87  ? 1.235   -2.420  -60.910 1.00 59.48  ? 67  THR A CG2 1 
ATOM   509   N N   . ARG A 1 88  ? 0.186   -2.406  -57.780 1.00 49.21  ? 68  ARG A N   1 
ATOM   510   C CA  . ARG A 1 88  ? 0.799   -3.263  -56.798 1.00 46.38  ? 68  ARG A CA  1 
ATOM   511   C C   . ARG A 1 88  ? -0.184  -3.775  -55.749 1.00 43.59  ? 68  ARG A C   1 
ATOM   512   O O   . ARG A 1 88  ? 0.233   -4.339  -54.749 1.00 45.84  ? 68  ARG A O   1 
ATOM   513   C CB  . ARG A 1 88  ? 1.941   -2.520  -56.124 1.00 48.19  ? 68  ARG A CB  1 
ATOM   514   C CG  . ARG A 1 88  ? 3.209   -2.607  -56.927 1.00 52.26  ? 68  ARG A CG  1 
ATOM   515   C CD  . ARG A 1 88  ? 4.370   -2.059  -56.141 1.00 54.79  ? 68  ARG A CD  1 
ATOM   516   N NE  . ARG A 1 88  ? 4.272   -0.608  -56.065 1.00 58.30  ? 68  ARG A NE  1 
ATOM   517   C CZ  . ARG A 1 88  ? 5.070   0.253   -56.691 1.00 58.41  ? 68  ARG A CZ  1 
ATOM   518   N NH1 . ARG A 1 88  ? 6.065   -0.171  -57.459 1.00 57.98  ? 68  ARG A NH1 1 
ATOM   519   N NH2 . ARG A 1 88  ? 4.874   1.556   -56.537 1.00 58.33  ? 68  ARG A NH2 1 
ATOM   520   N N   . ILE A 1 89  ? -1.481  -3.602  -55.972 1.00 42.43  ? 69  ILE A N   1 
ATOM   521   C CA  . ILE A 1 89  ? -2.471  -3.994  -54.985 1.00 40.46  ? 69  ILE A CA  1 
ATOM   522   C C   . ILE A 1 89  ? -3.559  -4.836  -55.609 1.00 41.75  ? 69  ILE A C   1 
ATOM   523   O O   . ILE A 1 89  ? -4.270  -4.351  -56.485 1.00 41.16  ? 69  ILE A O   1 
ATOM   524   C CB  . ILE A 1 89  ? -3.164  -2.765  -54.403 1.00 41.24  ? 69  ILE A CB  1 
ATOM   525   C CG1 . ILE A 1 89  ? -2.156  -1.892  -53.665 1.00 43.00  ? 69  ILE A CG1 1 
ATOM   526   C CG2 . ILE A 1 89  ? -4.292  -3.184  -53.473 1.00 40.31  ? 69  ILE A CG2 1 
ATOM   527   C CD1 . ILE A 1 89  ? -2.721  -0.580  -53.167 1.00 41.41  ? 69  ILE A CD1 1 
ATOM   528   N N   . SER A 1 90  ? -3.715  -6.070  -55.128 1.00 42.60  ? 70  SER A N   1 
ATOM   529   C CA  . SER A 1 90  ? -4.789  -6.962  -55.587 1.00 41.04  ? 70  SER A CA  1 
ATOM   530   C C   . SER A 1 90  ? -5.812  -7.177  -54.495 1.00 39.80  ? 70  SER A C   1 
ATOM   531   O O   . SER A 1 90  ? -5.461  -7.371  -53.334 1.00 39.41  ? 70  SER A O   1 
ATOM   532   C CB  . SER A 1 90  ? -4.230  -8.315  -55.989 1.00 42.96  ? 70  SER A CB  1 
ATOM   533   O OG  . SER A 1 90  ? -2.992  -8.185  -56.664 1.00 45.60  ? 70  SER A OG  1 
ATOM   534   N N   . GLY A 1 91  ? -7.079  -7.135  -54.878 1.00 40.04  ? 71  GLY A N   1 
ATOM   535   C CA  . GLY A 1 91  ? -8.185  -7.299  -53.946 1.00 41.18  ? 71  GLY A CA  1 
ATOM   536   C C   . GLY A 1 91  ? -8.615  -8.746  -53.935 1.00 41.98  ? 71  GLY A C   1 
ATOM   537   O O   . GLY A 1 91  ? -8.401  -9.455  -54.901 1.00 41.14  ? 71  GLY A O   1 
ATOM   538   N N   . THR A 1 92  ? -9.231  -9.189  -52.852 1.00 41.78  ? 72  THR A N   1 
ATOM   539   C CA  . THR A 1 92  ? -9.631  -10.575 -52.755 1.00 41.58  ? 72  THR A CA  1 
ATOM   540   C C   . THR A 1 92  ? -10.542 -10.758 -51.557 1.00 42.31  ? 72  THR A C   1 
ATOM   541   O O   . THR A 1 92  ? -10.461 -10.001 -50.588 1.00 43.32  ? 72  THR A O   1 
ATOM   542   C CB  . THR A 1 92  ? -8.394  -11.503 -52.622 1.00 42.81  ? 72  THR A CB  1 
ATOM   543   O OG1 . THR A 1 92  ? -8.817  -12.876 -52.617 1.00 45.37  ? 72  THR A OG1 1 
ATOM   544   C CG2 . THR A 1 92  ? -7.614  -11.215 -51.349 1.00 41.63  ? 72  THR A CG2 1 
ATOM   545   N N   . VAL A 1 93  ? -11.399 -11.767 -51.616 1.00 40.30  ? 73  VAL A N   1 
ATOM   546   C CA  . VAL A 1 93  ? -12.185 -12.136 -50.443 1.00 41.19  ? 73  VAL A CA  1 
ATOM   547   C C   . VAL A 1 93  ? -11.655 -13.371 -49.759 1.00 40.57  ? 73  VAL A C   1 
ATOM   548   O O   . VAL A 1 93  ? -12.207 -13.800 -48.755 1.00 42.07  ? 73  VAL A O   1 
ATOM   549   C CB  . VAL A 1 93  ? -13.663 -12.376 -50.777 1.00 42.37  ? 73  VAL A CB  1 
ATOM   550   C CG1 . VAL A 1 93  ? -14.271 -11.117 -51.369 1.00 42.40  ? 73  VAL A CG1 1 
ATOM   551   C CG2 . VAL A 1 93  ? -13.824 -13.562 -51.716 1.00 42.39  ? 73  VAL A CG2 1 
ATOM   552   N N   . ASP A 1 94  ? -10.575 -13.924 -50.297 1.00 42.30  ? 74  ASP A N   1 
ATOM   553   C CA  . ASP A 1 94  ? -10.123 -15.259 -49.930 1.00 41.08  ? 74  ASP A CA  1 
ATOM   554   C C   . ASP A 1 94  ? -8.861  -15.207 -49.086 1.00 40.18  ? 74  ASP A C   1 
ATOM   555   O O   . ASP A 1 94  ? -7.783  -14.869 -49.564 1.00 37.90  ? 74  ASP A O   1 
ATOM   556   C CB  . ASP A 1 94  ? -9.851  -16.050 -51.205 1.00 43.00  ? 74  ASP A CB  1 
ATOM   557   C CG  . ASP A 1 94  ? -9.564  -17.507 -50.944 1.00 43.30  ? 74  ASP A CG  1 
ATOM   558   O OD1 . ASP A 1 94  ? -9.618  -17.937 -49.769 1.00 41.07  ? 74  ASP A OD1 1 
ATOM   559   O OD2 . ASP A 1 94  ? -9.288  -18.225 -51.930 1.00 44.22  ? 74  ASP A OD2 1 
ATOM   560   N N   . LEU A 1 95  ? -8.990  -15.564 -47.824 1.00 41.92  ? 75  LEU A N   1 
ATOM   561   C CA  . LEU A 1 95  ? -7.825  -15.675 -46.968 1.00 44.60  ? 75  LEU A CA  1 
ATOM   562   C C   . LEU A 1 95  ? -6.757  -16.589 -47.522 1.00 46.34  ? 75  LEU A C   1 
ATOM   563   O O   . LEU A 1 95  ? -5.566  -16.390 -47.249 1.00 46.09  ? 75  LEU A O   1 
ATOM   564   C CB  . LEU A 1 95  ? -8.209  -16.249 -45.634 1.00 46.69  ? 75  LEU A CB  1 
ATOM   565   C CG  . LEU A 1 95  ? -8.632  -15.224 -44.623 1.00 51.08  ? 75  LEU A CG  1 
ATOM   566   C CD1 . LEU A 1 95  ? -9.393  -15.970 -43.550 1.00 54.12  ? 75  LEU A CD1 1 
ATOM   567   C CD2 . LEU A 1 95  ? -7.421  -14.528 -44.047 1.00 52.45  ? 75  LEU A CD2 1 
ATOM   568   N N   . ASN A 1 96  ? -7.168  -17.619 -48.257 1.00 45.04  ? 76  ASN A N   1 
ATOM   569   C CA  . ASN A 1 96  ? -6.189  -18.519 -48.859 1.00 45.89  ? 76  ASN A CA  1 
ATOM   570   C C   . ASN A 1 96  ? -5.143  -17.784 -49.684 1.00 43.68  ? 76  ASN A C   1 
ATOM   571   O O   . ASN A 1 96  ? -4.029  -18.263 -49.828 1.00 42.59  ? 76  ASN A O   1 
ATOM   572   C CB  . ASN A 1 96  ? -6.860  -19.597 -49.704 1.00 49.19  ? 76  ASN A CB  1 
ATOM   573   C CG  . ASN A 1 96  ? -7.402  -20.729 -48.859 1.00 51.11  ? 76  ASN A CG  1 
ATOM   574   O OD1 . ASN A 1 96  ? -6.641  -21.563 -48.366 1.00 55.12  ? 76  ASN A OD1 1 
ATOM   575   N ND2 . ASN A 1 96  ? -8.722  -20.753 -48.666 1.00 52.07  ? 76  ASN A ND2 1 
ATOM   576   N N   . MET A 1 97  ? -5.478  -16.610 -50.196 1.00 42.40  ? 77  MET A N   1 
ATOM   577   C CA  . MET A 1 97  ? -4.518  -15.848 -50.985 1.00 44.40  ? 77  MET A CA  1 
ATOM   578   C C   . MET A 1 97  ? -3.398  -15.196 -50.171 1.00 41.67  ? 77  MET A C   1 
ATOM   579   O O   . MET A 1 97  ? -2.545  -14.551 -50.733 1.00 41.53  ? 77  MET A O   1 
ATOM   580   C CB  . MET A 1 97  ? -5.242  -14.758 -51.766 1.00 46.44  ? 77  MET A CB  1 
ATOM   581   C CG  . MET A 1 97  ? -6.291  -15.288 -52.722 1.00 48.75  ? 77  MET A CG  1 
ATOM   582   S SD  . MET A 1 97  ? -5.537  -16.122 -54.131 1.00 50.86  ? 77  MET A SD  1 
ATOM   583   C CE  . MET A 1 97  ? -5.843  -17.831 -53.691 1.00 47.07  ? 77  MET A CE  1 
ATOM   584   N N   . ALA A 1 98  ? -3.395  -15.358 -48.856 1.00 41.29  ? 78  ALA A N   1 
ATOM   585   C CA  . ALA A 1 98  ? -2.263  -14.936 -48.041 1.00 40.07  ? 78  ALA A CA  1 
ATOM   586   C C   . ALA A 1 98  ? -1.120  -15.962 -48.061 1.00 40.81  ? 78  ALA A C   1 
ATOM   587   O O   . ALA A 1 98  ? -0.060  -15.736 -47.476 1.00 42.94  ? 78  ALA A O   1 
ATOM   588   C CB  . ALA A 1 98  ? -2.728  -14.712 -46.617 1.00 38.20  ? 78  ALA A CB  1 
ATOM   589   N N   . ALA A 1 99  ? -1.344  -17.078 -48.747 1.00 41.34  ? 79  ALA A N   1 
ATOM   590   C CA  . ALA A 1 99  ? -0.506  -18.269 -48.636 1.00 40.32  ? 79  ALA A CA  1 
ATOM   591   C C   . ALA A 1 99  ? 0.970   -18.021 -48.821 1.00 39.60  ? 79  ALA A C   1 
ATOM   592   O O   . ALA A 1 99  ? 1.752   -18.518 -48.038 1.00 41.05  ? 79  ALA A O   1 
ATOM   593   C CB  . ALA A 1 99  ? -0.971  -19.335 -49.611 1.00 39.87  ? 79  ALA A CB  1 
ATOM   594   N N   . ASP A 1 100 ? 1.363   -17.269 -49.840 1.00 41.76  ? 80  ASP A N   1 
ATOM   595   C CA  . ASP A 1 100 ? 2.798   -17.052 -50.084 1.00 46.14  ? 80  ASP A CA  1 
ATOM   596   C C   . ASP A 1 100 ? 3.277   -15.669 -49.654 1.00 43.93  ? 80  ASP A C   1 
ATOM   597   O O   . ASP A 1 100 ? 4.316   -15.206 -50.112 1.00 41.01  ? 80  ASP A O   1 
ATOM   598   C CB  . ASP A 1 100 ? 3.154   -17.282 -51.554 1.00 50.86  ? 80  ASP A CB  1 
ATOM   599   C CG  . ASP A 1 100 ? 2.578   -16.214 -52.464 1.00 59.78  ? 80  ASP A CG  1 
ATOM   600   O OD1 . ASP A 1 100 ? 1.476   -15.687 -52.166 1.00 67.75  ? 80  ASP A OD1 1 
ATOM   601   O OD2 . ASP A 1 100 ? 3.232   -15.890 -53.475 1.00 67.45  ? 80  ASP A OD2 1 
ATOM   602   N N   . CYS A 1 101 ? 2.534   -15.017 -48.772 1.00 42.93  ? 81  CYS A N   1 
ATOM   603   C CA  . CYS A 1 101 ? 2.915   -13.695 -48.332 1.00 43.74  ? 81  CYS A CA  1 
ATOM   604   C C   . CYS A 1 101 ? 3.966   -13.825 -47.250 1.00 41.08  ? 81  CYS A C   1 
ATOM   605   O O   . CYS A 1 101 ? 3.970   -14.776 -46.495 1.00 40.30  ? 81  CYS A O   1 
ATOM   606   C CB  . CYS A 1 101 ? 1.702   -12.925 -47.831 1.00 46.62  ? 81  CYS A CB  1 
ATOM   607   S SG  . CYS A 1 101 ? 0.648   -12.313 -49.175 1.00 51.10  ? 81  CYS A SG  1 
ATOM   608   N N   . ASP A 1 102 ? 4.873   -12.870 -47.193 1.00 41.64  ? 82  ASP A N   1 
ATOM   609   C CA  . ASP A 1 102 ? 5.937   -12.913 -46.214 1.00 42.49  ? 82  ASP A CA  1 
ATOM   610   C C   . ASP A 1 102 ? 5.495   -12.308 -44.913 1.00 42.07  ? 82  ASP A C   1 
ATOM   611   O O   . ASP A 1 102 ? 6.076   -12.604 -43.864 1.00 43.00  ? 82  ASP A O   1 
ATOM   612   C CB  . ASP A 1 102 ? 7.120   -12.143 -46.736 1.00 44.12  ? 82  ASP A CB  1 
ATOM   613   C CG  . ASP A 1 102 ? 7.566   -12.656 -48.056 1.00 46.13  ? 82  ASP A CG  1 
ATOM   614   O OD1 . ASP A 1 102 ? 8.046   -13.809 -48.098 1.00 44.57  ? 82  ASP A OD1 1 
ATOM   615   O OD2 . ASP A 1 102 ? 7.385   -11.923 -49.048 1.00 47.12  ? 82  ASP A OD2 1 
ATOM   616   N N   . LEU A 1 103 ? 4.481   -11.447 -45.000 1.00 40.57  ? 83  LEU A N   1 
ATOM   617   C CA  . LEU A 1 103 ? 3.927   -10.749 -43.841 1.00 39.29  ? 83  LEU A CA  1 
ATOM   618   C C   . LEU A 1 103 ? 2.447   -10.579 -44.044 1.00 37.80  ? 83  LEU A C   1 
ATOM   619   O O   . LEU A 1 103 ? 2.008   -10.169 -45.113 1.00 39.42  ? 83  LEU A O   1 
ATOM   620   C CB  . LEU A 1 103 ? 4.529   -9.357  -43.698 1.00 38.93  ? 83  LEU A CB  1 
ATOM   621   C CG  . LEU A 1 103 ? 3.989   -8.495  -42.543 1.00 40.51  ? 83  LEU A CG  1 
ATOM   622   C CD1 . LEU A 1 103 ? 4.342   -9.107  -41.187 1.00 39.08  ? 83  LEU A CD1 1 
ATOM   623   C CD2 . LEU A 1 103 ? 4.549   -7.086  -42.644 1.00 39.65  ? 83  LEU A CD2 1 
ATOM   624   N N   . VAL A 1 104 ? 1.680   -10.887 -43.015 1.00 37.32  ? 84  VAL A N   1 
ATOM   625   C CA  . VAL A 1 104 ? 0.257   -10.649 -43.035 1.00 38.47  ? 84  VAL A CA  1 
ATOM   626   C C   . VAL A 1 104 ? -0.090  -9.686  -41.903 1.00 39.05  ? 84  VAL A C   1 
ATOM   627   O O   . VAL A 1 104 ? 0.348   -9.856  -40.771 1.00 39.75  ? 84  VAL A O   1 
ATOM   628   C CB  . VAL A 1 104 ? -0.527  -11.956 -42.869 1.00 40.51  ? 84  VAL A CB  1 
ATOM   629   C CG1 . VAL A 1 104 ? -2.017  -11.675 -42.850 1.00 41.99  ? 84  VAL A CG1 1 
ATOM   630   C CG2 . VAL A 1 104 ? -0.217  -12.902 -44.011 1.00 42.83  ? 84  VAL A CG2 1 
ATOM   631   N N   . ILE A 1 105 ? -0.884  -8.674  -42.219 1.00 39.47  ? 85  ILE A N   1 
ATOM   632   C CA  . ILE A 1 105 ? -1.321  -7.703  -41.234 1.00 38.93  ? 85  ILE A CA  1 
ATOM   633   C C   . ILE A 1 105 ? -2.829  -7.698  -41.103 1.00 37.92  ? 85  ILE A C   1 
ATOM   634   O O   . ILE A 1 105 ? -3.551  -7.286  -42.010 1.00 37.15  ? 85  ILE A O   1 
ATOM   635   C CB  . ILE A 1 105 ? -0.852  -6.302  -41.621 1.00 42.38  ? 85  ILE A CB  1 
ATOM   636   C CG1 . ILE A 1 105 ? 0.671   -6.237  -41.520 1.00 42.31  ? 85  ILE A CG1 1 
ATOM   637   C CG2 . ILE A 1 105 ? -1.477  -5.255  -40.703 1.00 44.52  ? 85  ILE A CG2 1 
ATOM   638   C CD1 . ILE A 1 105 ? 1.265   -5.050  -42.217 1.00 41.82  ? 85  ILE A CD1 1 
ATOM   639   N N   . GLU A 1 106 ? -3.300  -8.156  -39.957 1.00 39.44  ? 86  GLU A N   1 
ATOM   640   C CA  . GLU A 1 106 ? -4.727  -8.199  -39.677 1.00 43.14  ? 86  GLU A CA  1 
ATOM   641   C C   . GLU A 1 106 ? -5.195  -6.859  -39.097 1.00 43.09  ? 86  GLU A C   1 
ATOM   642   O O   . GLU A 1 106 ? -4.662  -6.353  -38.114 1.00 41.85  ? 86  GLU A O   1 
ATOM   643   C CB  . GLU A 1 106 ? -5.022  -9.345  -38.720 1.00 45.29  ? 86  GLU A CB  1 
ATOM   644   C CG  . GLU A 1 106 ? -6.451  -9.386  -38.227 1.00 50.09  ? 86  GLU A CG  1 
ATOM   645   C CD  . GLU A 1 106 ? -6.657  -8.461  -37.056 1.00 54.57  ? 86  GLU A CD  1 
ATOM   646   O OE1 . GLU A 1 106 ? -7.748  -7.869  -36.948 1.00 57.50  ? 86  GLU A OE1 1 
ATOM   647   O OE2 . GLU A 1 106 ? -5.713  -8.307  -36.251 1.00 60.96  ? 86  GLU A OE2 1 
ATOM   648   N N   . ALA A 1 107 ? -6.196  -6.273  -39.711 1.00 45.36  ? 87  ALA A N   1 
ATOM   649   C CA  . ALA A 1 107 ? -6.644  -4.980  -39.248 1.00 51.42  ? 87  ALA A CA  1 
ATOM   650   C C   . ALA A 1 107 ? -8.141  -4.895  -39.301 1.00 54.99  ? 87  ALA A C   1 
ATOM   651   O O   . ALA A 1 107 ? -8.676  -3.983  -39.892 1.00 57.41  ? 87  ALA A O   1 
ATOM   652   C CB  . ALA A 1 107 ? -6.036  -3.883  -40.099 1.00 50.73  ? 87  ALA A CB  1 
ATOM   653   N N   . ALA A 1 108 ? -8.840  -5.838  -38.700 1.00 62.75  ? 88  ALA A N   1 
ATOM   654   C CA  . ALA A 1 108 ? -10.278 -5.678  -38.632 1.00 73.12  ? 88  ALA A CA  1 
ATOM   655   C C   . ALA A 1 108 ? -10.798 -5.844  -37.216 1.00 74.48  ? 88  ALA A C   1 
ATOM   656   O O   . ALA A 1 108 ? -11.007 -4.887  -36.473 1.00 70.68  ? 88  ALA A O   1 
ATOM   657   C CB  . ALA A 1 108 ? -10.969 -6.643  -39.597 1.00 73.23  ? 88  ALA A CB  1 
ATOM   658   N N   . VAL A 1 109 ? -10.895 -7.094  -36.839 1.00 84.28  ? 89  VAL A N   1 
ATOM   659   C CA  . VAL A 1 109 ? -11.875 -7.548  -35.885 1.00 88.89  ? 89  VAL A CA  1 
ATOM   660   C C   . VAL A 1 109 ? -11.395 -7.108  -34.519 1.00 85.13  ? 89  VAL A C   1 
ATOM   661   O O   . VAL A 1 109 ? -10.326 -7.523  -34.111 1.00 93.18  ? 89  VAL A O   1 
ATOM   662   C CB  . VAL A 1 109 ? -12.000 -9.096  -35.996 1.00 94.73  ? 89  VAL A CB  1 
ATOM   663   C CG1 . VAL A 1 109 ? -11.895 -9.539  -37.458 1.00 93.47  ? 89  VAL A CG1 1 
ATOM   664   C CG2 . VAL A 1 109 ? -10.924 -9.832  -35.199 1.00 96.55  ? 89  VAL A CG2 1 
ATOM   665   N N   . GLU A 1 110 ? -12.108 -6.260  -33.792 1.00 80.55  ? 90  GLU A N   1 
ATOM   666   C CA  . GLU A 1 110 ? -11.609 -5.978  -32.434 1.00 77.90  ? 90  GLU A CA  1 
ATOM   667   C C   . GLU A 1 110 ? -12.282 -6.934  -31.432 1.00 69.61  ? 90  GLU A C   1 
ATOM   668   O O   . GLU A 1 110 ? -12.516 -6.599  -30.273 1.00 68.25  ? 90  GLU A O   1 
ATOM   669   C CB  . GLU A 1 110 ? -11.667 -4.480  -32.061 1.00 77.69  ? 90  GLU A CB  1 
ATOM   670   C CG  . GLU A 1 110 ? -10.619 -4.042  -31.011 1.00 79.75  ? 90  GLU A CG  1 
ATOM   671   C CD  . GLU A 1 110 ? -9.171  -3.893  -31.531 1.00 79.01  ? 90  GLU A CD  1 
ATOM   672   O OE1 . GLU A 1 110 ? -8.459  -2.955  -31.099 1.00 73.73  ? 90  GLU A OE1 1 
ATOM   673   O OE2 . GLU A 1 110 ? -8.713  -4.712  -32.358 1.00 76.16  ? 90  GLU A OE2 1 
ATOM   674   N N   . ARG A 1 111 ? -12.529 -8.148  -31.926 1.00 63.70  ? 91  ARG A N   1 
ATOM   675   C CA  . ARG A 1 111 ? -13.075 -9.273  -31.182 1.00 64.44  ? 91  ARG A CA  1 
ATOM   676   C C   . ARG A 1 111 ? -12.045 -10.387 -31.059 1.00 55.08  ? 91  ARG A C   1 
ATOM   677   O O   . ARG A 1 111 ? -11.572 -10.916 -32.056 1.00 51.70  ? 91  ARG A O   1 
ATOM   678   C CB  . ARG A 1 111 ? -14.239 -9.856  -31.956 1.00 73.22  ? 91  ARG A CB  1 
ATOM   679   C CG  . ARG A 1 111 ? -15.606 -9.462  -31.474 1.00 81.02  ? 91  ARG A CG  1 
ATOM   680   C CD  . ARG A 1 111 ? -16.587 -9.843  -32.563 1.00 90.01  ? 91  ARG A CD  1 
ATOM   681   N NE  . ARG A 1 111 ? -17.810 -10.407 -32.011 1.00 100.07 ? 91  ARG A NE  1 
ATOM   682   C CZ  . ARG A 1 111 ? -19.010 -9.843  -32.099 1.00 109.97 ? 91  ARG A CZ  1 
ATOM   683   N NH1 . ARG A 1 111 ? -19.176 -8.685  -32.740 1.00 114.44 ? 91  ARG A NH1 1 
ATOM   684   N NH2 . ARG A 1 111 ? -20.060 -10.444 -31.551 1.00 110.09 ? 91  ARG A NH2 1 
ATOM   685   N N   . MET A 1 112 ? -11.731 -10.793 -29.845 1.00 49.17  ? 92  MET A N   1 
ATOM   686   C CA  . MET A 1 112 ? -10.679 -11.774 -29.663 1.00 48.94  ? 92  MET A CA  1 
ATOM   687   C C   . MET A 1 112 ? -10.960 -13.119 -30.331 1.00 50.97  ? 92  MET A C   1 
ATOM   688   O O   . MET A 1 112 ? -10.066 -13.702 -30.924 1.00 50.18  ? 92  MET A O   1 
ATOM   689   C CB  . MET A 1 112 ? -10.405 -11.998 -28.187 1.00 46.82  ? 92  MET A CB  1 
ATOM   690   C CG  . MET A 1 112 ? -9.342  -13.054 -27.935 1.00 48.07  ? 92  MET A CG  1 
ATOM   691   S SD  . MET A 1 112 ? -7.746  -12.614 -28.656 1.00 50.44  ? 92  MET A SD  1 
ATOM   692   C CE  . MET A 1 112 ? -7.052  -11.705 -27.281 1.00 49.88  ? 92  MET A CE  1 
ATOM   693   N N   . ASP A 1 113 ? -12.179 -13.625 -30.219 1.00 52.85  ? 93  ASP A N   1 
ATOM   694   C CA  . ASP A 1 113 ? -12.483 -14.955 -30.762 1.00 57.01  ? 93  ASP A CA  1 
ATOM   695   C C   . ASP A 1 113 ? -12.366 -15.024 -32.290 1.00 54.81  ? 93  ASP A C   1 
ATOM   696   O O   . ASP A 1 113 ? -11.991 -16.059 -32.844 1.00 51.73  ? 93  ASP A O   1 
ATOM   697   C CB  . ASP A 1 113 ? -13.869 -15.422 -30.323 1.00 62.58  ? 93  ASP A CB  1 
ATOM   698   C CG  . ASP A 1 113 ? -14.980 -14.457 -30.734 1.00 70.33  ? 93  ASP A CG  1 
ATOM   699   O OD1 . ASP A 1 113 ? -14.697 -13.416 -31.367 1.00 78.28  ? 93  ASP A OD1 1 
ATOM   700   O OD2 . ASP A 1 113 ? -16.151 -14.733 -30.399 1.00 73.02  ? 93  ASP A OD2 1 
ATOM   701   N N   . ILE A 1 114 ? -12.678 -13.917 -32.955 1.00 51.11  ? 94  ILE A N   1 
ATOM   702   C CA  . ILE A 1 114 ? -12.602 -13.840 -34.405 1.00 52.11  ? 94  ILE A CA  1 
ATOM   703   C C   . ILE A 1 114 ? -11.159 -13.655 -34.837 1.00 50.95  ? 94  ILE A C   1 
ATOM   704   O O   . ILE A 1 114 ? -10.748 -14.170 -35.880 1.00 50.73  ? 94  ILE A O   1 
ATOM   705   C CB  . ILE A 1 114 ? -13.391 -12.641 -34.965 1.00 56.16  ? 94  ILE A CB  1 
ATOM   706   C CG1 . ILE A 1 114 ? -14.841 -12.662 -34.497 1.00 61.60  ? 94  ILE A CG1 1 
ATOM   707   C CG2 . ILE A 1 114 ? -13.374 -12.652 -36.489 1.00 55.43  ? 94  ILE A CG2 1 
ATOM   708   C CD1 . ILE A 1 114 ? -15.737 -13.589 -35.289 1.00 65.10  ? 94  ILE A CD1 1 
ATOM   709   N N   . LYS A 1 115 ? -10.404 -12.892 -34.053 1.00 46.70  ? 95  LYS A N   1 
ATOM   710   C CA  . LYS A 1 115 ? -8.981  -12.723 -34.309 1.00 47.15  ? 95  LYS A CA  1 
ATOM   711   C C   . LYS A 1 115 ? -8.253  -14.065 -34.195 1.00 44.31  ? 95  LYS A C   1 
ATOM   712   O O   . LYS A 1 115 ? -7.413  -14.400 -35.013 1.00 43.54  ? 95  LYS A O   1 
ATOM   713   C CB  . LYS A 1 115 ? -8.378  -11.726 -33.325 1.00 48.44  ? 95  LYS A CB  1 
ATOM   714   C CG  . LYS A 1 115 ? -7.420  -10.740 -33.950 1.00 51.57  ? 95  LYS A CG  1 
ATOM   715   C CD  . LYS A 1 115 ? -7.611  -9.358  -33.335 1.00 56.76  ? 95  LYS A CD  1 
ATOM   716   C CE  . LYS A 1 115 ? -7.458  -8.277  -34.375 1.00 60.84  ? 95  LYS A CE  1 
ATOM   717   N NZ  . LYS A 1 115 ? -8.292  -7.071  -34.185 1.00 65.30  ? 95  LYS A NZ  1 
ATOM   718   N N   . LYS A 1 116 ? -8.594  -14.839 -33.181 1.00 43.61  ? 96  LYS A N   1 
ATOM   719   C CA  . LYS A 1 116 ? -7.980  -16.145 -33.000 1.00 46.20  ? 96  LYS A CA  1 
ATOM   720   C C   . LYS A 1 116 ? -8.335  -17.052 -34.138 1.00 47.54  ? 96  LYS A C   1 
ATOM   721   O O   . LYS A 1 116 ? -7.509  -17.821 -34.588 1.00 45.52  ? 96  LYS A O   1 
ATOM   722   C CB  . LYS A 1 116 ? -8.454  -16.790 -31.723 1.00 46.06  ? 96  LYS A CB  1 
ATOM   723   C CG  . LYS A 1 116 ? -7.827  -16.181 -30.504 1.00 47.87  ? 96  LYS A CG  1 
ATOM   724   C CD  . LYS A 1 116 ? -8.483  -16.729 -29.261 1.00 48.88  ? 96  LYS A CD  1 
ATOM   725   C CE  . LYS A 1 116 ? -7.427  -16.981 -28.213 1.00 52.56  ? 96  LYS A CE  1 
ATOM   726   N NZ  . LYS A 1 116 ? -7.997  -17.536 -26.966 1.00 53.68  ? 96  LYS A NZ  1 
ATOM   727   N N   . GLN A 1 117 ? -9.576  -16.957 -34.593 1.00 50.04  ? 97  GLN A N   1 
ATOM   728   C CA  . GLN A 1 117 ? -10.048 -17.789 -35.688 1.00 52.37  ? 97  GLN A CA  1 
ATOM   729   C C   . GLN A 1 117 ? -9.232  -17.478 -36.933 1.00 48.52  ? 97  GLN A C   1 
ATOM   730   O O   . GLN A 1 117 ? -8.833  -18.375 -37.664 1.00 45.77  ? 97  GLN A O   1 
ATOM   731   C CB  . GLN A 1 117 ? -11.516 -17.500 -35.976 1.00 59.09  ? 97  GLN A CB  1 
ATOM   732   C CG  . GLN A 1 117 ? -12.418 -18.716 -35.994 1.00 66.21  ? 97  GLN A CG  1 
ATOM   733   C CD  . GLN A 1 117 ? -13.846 -18.367 -35.580 1.00 72.90  ? 97  GLN A CD  1 
ATOM   734   O OE1 . GLN A 1 117 ? -14.537 -17.601 -36.259 1.00 74.40  ? 97  GLN A OE1 1 
ATOM   735   N NE2 . GLN A 1 117 ? -14.291 -18.924 -34.456 1.00 73.88  ? 97  GLN A NE2 1 
ATOM   736   N N   . ILE A 1 118 ? -8.987  -16.194 -37.161 1.00 44.30  ? 98  ILE A N   1 
ATOM   737   C CA  . ILE A 1 118 ? -8.273  -15.754 -38.350 1.00 42.48  ? 98  ILE A CA  1 
ATOM   738   C C   . ILE A 1 118 ? -6.807  -16.145 -38.298 1.00 38.48  ? 98  ILE A C   1 
ATOM   739   O O   . ILE A 1 118 ? -6.245  -16.642 -39.254 1.00 37.62  ? 98  ILE A O   1 
ATOM   740   C CB  . ILE A 1 118 ? -8.378  -14.238 -38.522 1.00 44.06  ? 98  ILE A CB  1 
ATOM   741   C CG1 . ILE A 1 118 ? -9.690  -13.887 -39.214 1.00 47.26  ? 98  ILE A CG1 1 
ATOM   742   C CG2 . ILE A 1 118 ? -7.255  -13.721 -39.396 1.00 45.89  ? 98  ILE A CG2 1 
ATOM   743   C CD1 . ILE A 1 118 ? -9.990  -12.396 -39.253 1.00 47.93  ? 98  ILE A CD1 1 
ATOM   744   N N   . PHE A 1 119 ? -6.178  -15.883 -37.174 1.00 38.59  ? 99  PHE A N   1 
ATOM   745   C CA  . PHE A 1 119 ? -4.797  -16.277 -36.997 1.00 39.78  ? 99  PHE A CA  1 
ATOM   746   C C   . PHE A 1 119 ? -4.616  -17.789 -37.090 1.00 39.11  ? 99  PHE A C   1 
ATOM   747   O O   . PHE A 1 119 ? -3.630  -18.264 -37.626 1.00 40.42  ? 99  PHE A O   1 
ATOM   748   C CB  . PHE A 1 119 ? -4.262  -15.710 -35.693 1.00 39.00  ? 99  PHE A CB  1 
ATOM   749   C CG  . PHE A 1 119 ? -3.713  -14.327 -35.855 1.00 41.01  ? 99  PHE A CG  1 
ATOM   750   C CD1 . PHE A 1 119 ? -4.554  -13.248 -36.097 1.00 41.02  ? 99  PHE A CD1 1 
ATOM   751   C CD2 . PHE A 1 119 ? -2.358  -14.112 -35.830 1.00 41.28  ? 99  PHE A CD2 1 
ATOM   752   C CE1 . PHE A 1 119 ? -4.041  -11.991 -36.286 1.00 39.45  ? 99  PHE A CE1 1 
ATOM   753   C CE2 . PHE A 1 119 ? -1.841  -12.852 -36.007 1.00 41.45  ? 99  PHE A CE2 1 
ATOM   754   C CZ  . PHE A 1 119 ? -2.682  -11.793 -36.236 1.00 40.51  ? 99  PHE A CZ  1 
ATOM   755   N N   . ALA A 1 120 ? -5.581  -18.540 -36.596 1.00 38.68  ? 100 ALA A N   1 
ATOM   756   C CA  . ALA A 1 120 ? -5.512  -19.992 -36.705 1.00 39.52  ? 100 ALA A CA  1 
ATOM   757   C C   . ALA A 1 120 ? -5.549  -20.474 -38.166 1.00 38.89  ? 100 ALA A C   1 
ATOM   758   O O   . ALA A 1 120 ? -4.781  -21.349 -38.500 1.00 36.91  ? 100 ALA A O   1 
ATOM   759   C CB  . ALA A 1 120 ? -6.599  -20.660 -35.873 1.00 38.29  ? 100 ALA A CB  1 
ATOM   760   N N   . ASP A 1 121 ? -6.373  -19.912 -39.049 1.00 39.38  ? 101 ASP A N   1 
ATOM   761   C CA  . ASP A 1 121 ? -6.313  -20.404 -40.435 1.00 46.88  ? 101 ASP A CA  1 
ATOM   762   C C   . ASP A 1 121 ? -5.074  -19.944 -41.126 1.00 46.55  ? 101 ASP A C   1 
ATOM   763   O O   . ASP A 1 121 ? -4.545  -20.654 -41.973 1.00 48.77  ? 101 ASP A O   1 
ATOM   764   C CB  . ASP A 1 121 ? -7.448  -19.977 -41.364 1.00 52.82  ? 101 ASP A CB  1 
ATOM   765   C CG  . ASP A 1 121 ? -8.762  -19.892 -40.693 1.00 56.18  ? 101 ASP A CG  1 
ATOM   766   O OD1 . ASP A 1 121 ? -9.654  -19.309 -41.331 1.00 64.09  ? 101 ASP A OD1 1 
ATOM   767   O OD2 . ASP A 1 121 ? -8.925  -20.394 -39.558 1.00 65.81  ? 101 ASP A OD2 1 
ATOM   768   N N   . LEU A 1 122 ? -4.647  -18.728 -40.822 1.00 45.83  ? 102 LEU A N   1 
ATOM   769   C CA  . LEU A 1 122 ? -3.506  -18.179 -41.510 1.00 42.03  ? 102 LEU A CA  1 
ATOM   770   C C   . LEU A 1 122 ? -2.334  -19.067 -41.194 1.00 38.88  ? 102 LEU A C   1 
ATOM   771   O O   . LEU A 1 122 ? -1.492  -19.313 -42.046 1.00 39.30  ? 102 LEU A O   1 
ATOM   772   C CB  . LEU A 1 122 ? -3.233  -16.748 -41.073 1.00 41.59  ? 102 LEU A CB  1 
ATOM   773   C CG  . LEU A 1 122 ? -4.189  -15.690 -41.624 1.00 41.28  ? 102 LEU A CG  1 
ATOM   774   C CD1 . LEU A 1 122 ? -3.963  -14.398 -40.881 1.00 43.04  ? 102 LEU A CD1 1 
ATOM   775   C CD2 . LEU A 1 122 ? -3.996  -15.437 -43.099 1.00 39.10  ? 102 LEU A CD2 1 
ATOM   776   N N   . ASP A 1 123 ? -2.306  -19.567 -39.968 1.00 37.84  ? 103 ASP A N   1 
ATOM   777   C CA  . ASP A 1 123 ? -1.232  -20.437 -39.528 1.00 40.33  ? 103 ASP A CA  1 
ATOM   778   C C   . ASP A 1 123 ? -1.200  -21.716 -40.374 1.00 41.68  ? 103 ASP A C   1 
ATOM   779   O O   . ASP A 1 123 ? -0.134  -22.196 -40.713 1.00 39.81  ? 103 ASP A O   1 
ATOM   780   C CB  . ASP A 1 123 ? -1.412  -20.787 -38.055 1.00 39.37  ? 103 ASP A CB  1 
ATOM   781   C CG  . ASP A 1 123 ? -0.291  -21.651 -37.516 1.00 38.99  ? 103 ASP A CG  1 
ATOM   782   O OD1 . ASP A 1 123 ? 0.876   -21.479 -37.930 1.00 39.16  ? 103 ASP A OD1 1 
ATOM   783   O OD2 . ASP A 1 123 ? -0.570  -22.490 -36.641 1.00 34.87  ? 103 ASP A OD2 1 
ATOM   784   N N   . ASN A 1 124 ? -2.369  -22.245 -40.724 1.00 41.93  ? 104 ASN A N   1 
ATOM   785   C CA  . ASN A 1 124 ? -2.466  -23.395 -41.638 1.00 42.19  ? 104 ASN A CA  1 
ATOM   786   C C   . ASN A 1 124 ? -2.248  -23.037 -43.093 1.00 42.19  ? 104 ASN A C   1 
ATOM   787   O O   . ASN A 1 124 ? -1.707  -23.818 -43.848 1.00 43.97  ? 104 ASN A O   1 
ATOM   788   C CB  . ASN A 1 124 ? -3.834  -24.032 -41.516 1.00 42.06  ? 104 ASN A CB  1 
ATOM   789   C CG  . ASN A 1 124 ? -4.013  -24.723 -40.199 1.00 44.08  ? 104 ASN A CG  1 
ATOM   790   O OD1 . ASN A 1 124 ? -3.050  -25.251 -39.629 1.00 42.96  ? 104 ASN A OD1 1 
ATOM   791   N ND2 . ASN A 1 124 ? -5.238  -24.708 -39.684 1.00 45.90  ? 104 ASN A ND2 1 
ATOM   792   N N   . ILE A 1 125 ? -2.686  -21.848 -43.470 1.00 43.27  ? 105 ILE A N   1 
ATOM   793   C CA  . ILE A 1 125 ? -2.654  -21.389 -44.851 1.00 40.96  ? 105 ILE A CA  1 
ATOM   794   C C   . ILE A 1 125 ? -1.281  -20.985 -45.375 1.00 40.26  ? 105 ILE A C   1 
ATOM   795   O O   . ILE A 1 125 ? -0.975  -21.213 -46.537 1.00 40.36  ? 105 ILE A O   1 
ATOM   796   C CB  . ILE A 1 125 ? -3.621  -20.209 -44.997 1.00 42.74  ? 105 ILE A CB  1 
ATOM   797   C CG1 . ILE A 1 125 ? -5.045  -20.734 -44.847 1.00 45.30  ? 105 ILE A CG1 1 
ATOM   798   C CG2 . ILE A 1 125 ? -3.466  -19.511 -46.334 1.00 42.81  ? 105 ILE A CG2 1 
ATOM   799   C CD1 . ILE A 1 125 ? -6.113  -19.671 -44.902 1.00 46.52  ? 105 ILE A CD1 1 
ATOM   800   N N   . CYS A 1 126 ? -0.461  -20.383 -44.525 1.00 40.51  ? 106 CYS A N   1 
ATOM   801   C CA  . CYS A 1 126 ? 0.715   -19.649 -44.981 1.00 39.66  ? 106 CYS A CA  1 
ATOM   802   C C   . CYS A 1 126 ? 1.993   -20.451 -44.889 1.00 38.56  ? 106 CYS A C   1 
ATOM   803   O O   . CYS A 1 126 ? 2.175   -21.185 -43.933 1.00 38.12  ? 106 CYS A O   1 
ATOM   804   C CB  . CYS A 1 126 ? 0.882   -18.408 -44.102 1.00 41.78  ? 106 CYS A CB  1 
ATOM   805   S SG  . CYS A 1 126 ? -0.365  -17.115 -44.325 1.00 42.89  ? 106 CYS A SG  1 
ATOM   806   N N   . LYS A 1 127 ? 2.915   -20.251 -45.827 1.00 40.07  ? 107 LYS A N   1 
ATOM   807   C CA  . LYS A 1 127 ? 4.235   -20.860 -45.723 1.00 43.57  ? 107 LYS A CA  1 
ATOM   808   C C   . LYS A 1 127 ? 4.776   -20.673 -44.307 1.00 45.08  ? 107 LYS A C   1 
ATOM   809   O O   . LYS A 1 127 ? 4.346   -19.785 -43.581 1.00 46.01  ? 107 LYS A O   1 
ATOM   810   C CB  . LYS A 1 127 ? 5.215   -20.297 -46.747 1.00 46.76  ? 107 LYS A CB  1 
ATOM   811   C CG  . LYS A 1 127 ? 5.043   -18.837 -47.080 1.00 49.37  ? 107 LYS A CG  1 
ATOM   812   C CD  . LYS A 1 127 ? 6.181   -18.397 -47.968 1.00 52.15  ? 107 LYS A CD  1 
ATOM   813   C CE  . LYS A 1 127 ? 6.232   -16.893 -48.073 1.00 55.35  ? 107 LYS A CE  1 
ATOM   814   N NZ  . LYS A 1 127 ? 7.554   -16.445 -48.553 1.00 56.23  ? 107 LYS A NZ  1 
ATOM   815   N N   . PRO A 1 128 ? 5.694   -21.531 -43.881 1.00 48.64  ? 108 PRO A N   1 
ATOM   816   C CA  . PRO A 1 128 ? 6.124   -21.419 -42.488 1.00 47.09  ? 108 PRO A CA  1 
ATOM   817   C C   . PRO A 1 128 ? 6.794   -20.107 -42.119 1.00 45.34  ? 108 PRO A C   1 
ATOM   818   O O   . PRO A 1 128 ? 6.751   -19.724 -40.962 1.00 46.31  ? 108 PRO A O   1 
ATOM   819   C CB  . PRO A 1 128 ? 7.153   -22.539 -42.345 1.00 47.29  ? 108 PRO A CB  1 
ATOM   820   C CG  . PRO A 1 128 ? 6.763   -23.541 -43.365 1.00 49.04  ? 108 PRO A CG  1 
ATOM   821   C CD  . PRO A 1 128 ? 6.137   -22.789 -44.506 1.00 48.64  ? 108 PRO A CD  1 
ATOM   822   N N   . GLU A 1 129 ? 7.431   -19.435 -43.063 1.00 45.31  ? 109 GLU A N   1 
ATOM   823   C CA  . GLU A 1 129 ? 8.204   -18.227 -42.711 1.00 50.15  ? 109 GLU A CA  1 
ATOM   824   C C   . GLU A 1 129 ? 7.346   -16.955 -42.576 1.00 45.99  ? 109 GLU A C   1 
ATOM   825   O O   . GLU A 1 129 ? 7.794   -15.979 -41.980 1.00 47.84  ? 109 GLU A O   1 
ATOM   826   C CB  . GLU A 1 129 ? 9.413   -17.996 -43.642 1.00 53.35  ? 109 GLU A CB  1 
ATOM   827   C CG  . GLU A 1 129 ? 9.191   -18.328 -45.103 1.00 59.84  ? 109 GLU A CG  1 
ATOM   828   C CD  . GLU A 1 129 ? 9.388   -19.813 -45.389 1.00 63.62  ? 109 GLU A CD  1 
ATOM   829   O OE1 . GLU A 1 129 ? 10.544  -20.277 -45.464 1.00 67.77  ? 109 GLU A OE1 1 
ATOM   830   O OE2 . GLU A 1 129 ? 8.376   -20.526 -45.523 1.00 62.94  ? 109 GLU A OE2 1 
ATOM   831   N N   . THR A 1 130 ? 6.122   -16.984 -43.092 1.00 41.87  ? 110 THR A N   1 
ATOM   832   C CA  . THR A 1 130 ? 5.202   -15.863 -42.979 1.00 40.97  ? 110 THR A CA  1 
ATOM   833   C C   . THR A 1 130 ? 5.107   -15.394 -41.528 1.00 40.86  ? 110 THR A C   1 
ATOM   834   O O   . THR A 1 130 ? 4.912   -16.217 -40.616 1.00 38.40  ? 110 THR A O   1 
ATOM   835   C CB  . THR A 1 130 ? 3.789   -16.253 -43.449 1.00 41.07  ? 110 THR A CB  1 
ATOM   836   O OG1 . THR A 1 130 ? 3.852   -16.802 -44.778 1.00 40.28  ? 110 THR A OG1 1 
ATOM   837   C CG2 . THR A 1 130 ? 2.842   -15.041 -43.430 1.00 40.39  ? 110 THR A CG2 1 
ATOM   838   N N   . ILE A 1 131 ? 5.263   -14.080 -41.336 1.00 35.80  ? 111 ILE A N   1 
ATOM   839   C CA  . ILE A 1 131 ? 5.049   -13.450 -40.050 1.00 35.07  ? 111 ILE A CA  1 
ATOM   840   C C   . ILE A 1 131 ? 3.625   -12.952 -40.009 1.00 33.85  ? 111 ILE A C   1 
ATOM   841   O O   . ILE A 1 131 ? 3.114   -12.442 -41.004 1.00 33.81  ? 111 ILE A O   1 
ATOM   842   C CB  . ILE A 1 131 ? 6.028   -12.290 -39.840 1.00 37.37  ? 111 ILE A CB  1 
ATOM   843   C CG1 . ILE A 1 131 ? 7.438   -12.862 -39.710 1.00 38.10  ? 111 ILE A CG1 1 
ATOM   844   C CG2 . ILE A 1 131 ? 5.670   -11.484 -38.593 1.00 35.62  ? 111 ILE A CG2 1 
ATOM   845   C CD1 . ILE A 1 131 ? 8.493   -11.814 -39.473 1.00 38.85  ? 111 ILE A CD1 1 
ATOM   846   N N   . LEU A 1 132 ? 2.973   -13.114 -38.869 1.00 33.79  ? 112 LEU A N   1 
ATOM   847   C CA  . LEU A 1 132 ? 1.543   -12.763 -38.751 1.00 35.70  ? 112 LEU A CA  1 
ATOM   848   C C   . LEU A 1 132 ? 1.360   -11.634 -37.736 1.00 35.53  ? 112 LEU A C   1 
ATOM   849   O O   . LEU A 1 132 ? 1.741   -11.781 -36.576 1.00 33.62  ? 112 LEU A O   1 
ATOM   850   C CB  . LEU A 1 132 ? 0.727   -13.969 -38.305 1.00 36.52  ? 112 LEU A CB  1 
ATOM   851   C CG  . LEU A 1 132 ? 0.865   -15.273 -39.095 1.00 37.49  ? 112 LEU A CG  1 
ATOM   852   C CD1 . LEU A 1 132 ? 0.040   -16.363 -38.433 1.00 38.16  ? 112 LEU A CD1 1 
ATOM   853   C CD2 . LEU A 1 132 ? 0.389   -15.109 -40.514 1.00 38.44  ? 112 LEU A CD2 1 
ATOM   854   N N   . ALA A 1 133 ? 0.779   -10.522 -38.175 1.00 35.00  ? 113 ALA A N   1 
ATOM   855   C CA  . ALA A 1 133 ? 0.749   -9.320  -37.373 1.00 36.67  ? 113 ALA A CA  1 
ATOM   856   C C   . ALA A 1 133 ? -0.643  -8.785  -37.156 1.00 36.46  ? 113 ALA A C   1 
ATOM   857   O O   . ALA A 1 133 ? -1.478  -8.841  -38.040 1.00 38.40  ? 113 ALA A O   1 
ATOM   858   C CB  . ALA A 1 133 ? 1.595   -8.256  -38.031 1.00 38.48  ? 113 ALA A CB  1 
ATOM   859   N N   . SER A 1 134 ? -0.879  -8.242  -35.975 1.00 37.01  ? 114 SER A N   1 
ATOM   860   C CA  . SER A 1 134 ? -2.116  -7.517  -35.704 1.00 39.91  ? 114 SER A CA  1 
ATOM   861   C C   . SER A 1 134 ? -1.866  -6.020  -35.536 1.00 39.46  ? 114 SER A C   1 
ATOM   862   O O   . SER A 1 134 ? -0.854  -5.592  -34.981 1.00 38.08  ? 114 SER A O   1 
ATOM   863   C CB  . SER A 1 134 ? -2.773  -8.044  -34.433 1.00 41.23  ? 114 SER A CB  1 
ATOM   864   O OG  . SER A 1 134 ? -4.127  -7.633  -34.352 1.00 41.99  ? 114 SER A OG  1 
ATOM   865   N N   . ASN A 1 135 ? -2.824  -5.240  -36.007 1.00 39.81  ? 115 ASN A N   1 
ATOM   866   C CA  . ASN A 1 135 ? -2.847  -3.795  -35.803 1.00 42.31  ? 115 ASN A CA  1 
ATOM   867   C C   . ASN A 1 135 ? -3.678  -3.355  -34.567 1.00 43.17  ? 115 ASN A C   1 
ATOM   868   O O   . ASN A 1 135 ? -3.847  -2.170  -34.309 1.00 43.50  ? 115 ASN A O   1 
ATOM   869   C CB  . ASN A 1 135 ? -3.373  -3.139  -37.076 1.00 43.39  ? 115 ASN A CB  1 
ATOM   870   C CG  . ASN A 1 135 ? -3.656  -1.661  -36.906 1.00 46.51  ? 115 ASN A CG  1 
ATOM   871   O OD1 . ASN A 1 135 ? -2.739  -0.843  -36.720 1.00 42.83  ? 115 ASN A OD1 1 
ATOM   872   N ND2 . ASN A 1 135 ? -4.937  -1.304  -36.974 1.00 46.56  ? 115 ASN A ND2 1 
ATOM   873   N N   . THR A 1 136 ? -4.169  -4.319  -33.797 1.00 43.56  ? 116 THR A N   1 
ATOM   874   C CA  . THR A 1 136 ? -5.020  -4.061  -32.636 1.00 42.45  ? 116 THR A CA  1 
ATOM   875   C C   . THR A 1 136 ? -4.366  -3.128  -31.626 1.00 40.76  ? 116 THR A C   1 
ATOM   876   O O   . THR A 1 136 ? -3.149  -3.072  -31.530 1.00 45.96  ? 116 THR A O   1 
ATOM   877   C CB  . THR A 1 136 ? -5.327  -5.395  -31.914 1.00 43.95  ? 116 THR A CB  1 
ATOM   878   O OG1 . THR A 1 136 ? -6.476  -5.252  -31.074 1.00 46.25  ? 116 THR A OG1 1 
ATOM   879   C CG2 . THR A 1 136 ? -4.160  -5.840  -31.051 1.00 42.77  ? 116 THR A CG2 1 
ATOM   880   N N   . SER A 1 137 ? -5.166  -2.417  -30.848 1.00 42.80  ? 117 SER A N   1 
ATOM   881   C CA  . SER A 1 137 ? -4.620  -1.653  -29.706 1.00 44.21  ? 117 SER A CA  1 
ATOM   882   C C   . SER A 1 137 ? -4.934  -2.260  -28.367 1.00 43.58  ? 117 SER A C   1 
ATOM   883   O O   . SER A 1 137 ? -4.307  -1.905  -27.381 1.00 45.29  ? 117 SER A O   1 
ATOM   884   C CB  . SER A 1 137 ? -5.165  -0.233  -29.640 1.00 43.43  ? 117 SER A CB  1 
ATOM   885   O OG  . SER A 1 137 ? -5.863  0.110   -30.804 1.00 48.42  ? 117 SER A OG  1 
ATOM   886   N N   . SER A 1 138 ? -5.910  -3.151  -28.321 1.00 45.28  ? 118 SER A N   1 
ATOM   887   C CA  . SER A 1 138 ? -6.497  -3.528  -27.053 1.00 48.58  ? 118 SER A CA  1 
ATOM   888   C C   . SER A 1 138 ? -6.437  -5.007  -26.728 1.00 50.39  ? 118 SER A C   1 
ATOM   889   O O   . SER A 1 138 ? -6.552  -5.380  -25.551 1.00 55.86  ? 118 SER A O   1 
ATOM   890   C CB  . SER A 1 138 ? -7.944  -3.074  -27.062 1.00 50.01  ? 118 SER A CB  1 
ATOM   891   O OG  . SER A 1 138 ? -8.453  -3.168  -28.379 1.00 54.34  ? 118 SER A OG  1 
ATOM   892   N N   . LEU A 1 139 ? -6.273  -5.843  -27.750 1.00 46.44  ? 119 LEU A N   1 
ATOM   893   C CA  . LEU A 1 139 ? -6.252  -7.286  -27.554 1.00 41.82  ? 119 LEU A CA  1 
ATOM   894   C C   . LEU A 1 139 ? -4.835  -7.783  -27.426 1.00 37.62  ? 119 LEU A C   1 
ATOM   895   O O   . LEU A 1 139 ? -3.937  -7.287  -28.088 1.00 41.45  ? 119 LEU A O   1 
ATOM   896   C CB  . LEU A 1 139 ? -6.961  -7.966  -28.716 1.00 42.46  ? 119 LEU A CB  1 
ATOM   897   C CG  . LEU A 1 139 ? -8.412  -7.500  -28.842 1.00 41.44  ? 119 LEU A CG  1 
ATOM   898   C CD1 . LEU A 1 139 ? -9.052  -8.088  -30.080 1.00 41.00  ? 119 LEU A CD1 1 
ATOM   899   C CD2 . LEU A 1 139 ? -9.193  -7.924  -27.609 1.00 41.39  ? 119 LEU A CD2 1 
ATOM   900   N N   . SER A 1 140 ? -4.645  -8.773  -26.571 1.00 36.04  ? 120 SER A N   1 
ATOM   901   C CA  . SER A 1 140 ? -3.331  -9.365  -26.322 1.00 33.79  ? 120 SER A CA  1 
ATOM   902   C C   . SER A 1 140 ? -2.784  -10.105 -27.543 1.00 35.83  ? 120 SER A C   1 
ATOM   903   O O   . SER A 1 140 ? -3.431  -10.989 -28.091 1.00 37.93  ? 120 SER A O   1 
ATOM   904   C CB  . SER A 1 140 ? -3.444  -10.333 -25.160 1.00 33.22  ? 120 SER A CB  1 
ATOM   905   O OG  . SER A 1 140 ? -2.253  -11.064 -24.974 1.00 31.39  ? 120 SER A OG  1 
ATOM   906   N N   . ILE A 1 141 ? -1.585  -9.724  -27.954 1.00 36.90  ? 121 ILE A N   1 
ATOM   907   C CA  . ILE A 1 141 ? -0.876  -10.361 -29.046 1.00 38.71  ? 121 ILE A CA  1 
ATOM   908   C C   . ILE A 1 141 ? -0.450  -11.781 -28.650 1.00 38.01  ? 121 ILE A C   1 
ATOM   909   O O   . ILE A 1 141 ? -0.488  -12.718 -29.442 1.00 34.80  ? 121 ILE A O   1 
ATOM   910   C CB  . ILE A 1 141 ? 0.405   -9.572  -29.373 1.00 41.46  ? 121 ILE A CB  1 
ATOM   911   C CG1 . ILE A 1 141 ? 0.072   -8.131  -29.711 1.00 47.54  ? 121 ILE A CG1 1 
ATOM   912   C CG2 . ILE A 1 141 ? 1.132   -10.176 -30.563 1.00 41.23  ? 121 ILE A CG2 1 
ATOM   913   C CD1 . ILE A 1 141 ? -0.805  -7.986  -30.935 1.00 50.18  ? 121 ILE A CD1 1 
ATOM   914   N N   . THR A 1 142 ? 0.034   -11.888 -27.429 1.00 36.55  ? 122 THR A N   1 
ATOM   915   C CA  . THR A 1 142 ? 0.355   -13.147 -26.816 1.00 36.62  ? 122 THR A CA  1 
ATOM   916   C C   . THR A 1 142 ? -0.818  -14.105 -26.851 1.00 37.52  ? 122 THR A C   1 
ATOM   917   O O   . THR A 1 142 ? -0.639  -15.259 -27.214 1.00 38.41  ? 122 THR A O   1 
ATOM   918   C CB  . THR A 1 142 ? 0.737   -12.900 -25.364 1.00 38.18  ? 122 THR A CB  1 
ATOM   919   O OG1 . THR A 1 142 ? 1.821   -11.967 -25.324 1.00 37.27  ? 122 THR A OG1 1 
ATOM   920   C CG2 . THR A 1 142 ? 1.164   -14.161 -24.691 1.00 39.29  ? 122 THR A CG2 1 
ATOM   921   N N   . GLU A 1 143 ? -2.007  -13.637 -26.481 1.00 38.36  ? 123 GLU A N   1 
ATOM   922   C CA  . GLU A 1 143 ? -3.180  -14.501 -26.503 1.00 39.63  ? 123 GLU A CA  1 
ATOM   923   C C   . GLU A 1 143 ? -3.526  -14.914 -27.919 1.00 39.84  ? 123 GLU A C   1 
ATOM   924   O O   . GLU A 1 143 ? -3.950  -16.032 -28.172 1.00 44.81  ? 123 GLU A O   1 
ATOM   925   C CB  . GLU A 1 143 ? -4.384  -13.840 -25.860 1.00 42.03  ? 123 GLU A CB  1 
ATOM   926   C CG  . GLU A 1 143 ? -5.532  -14.814 -25.659 1.00 44.09  ? 123 GLU A CG  1 
ATOM   927   C CD  . GLU A 1 143 ? -6.656  -14.287 -24.780 1.00 46.44  ? 123 GLU A CD  1 
ATOM   928   O OE1 . GLU A 1 143 ? -6.460  -13.373 -23.943 1.00 49.05  ? 123 GLU A OE1 1 
ATOM   929   O OE2 . GLU A 1 143 ? -7.768  -14.809 -24.935 1.00 47.81  ? 123 GLU A OE2 1 
ATOM   930   N N   . VAL A 1 144 ? -3.342  -14.008 -28.854 1.00 39.93  ? 124 VAL A N   1 
ATOM   931   C CA  . VAL A 1 144 ? -3.617  -14.323 -30.239 1.00 38.31  ? 124 VAL A CA  1 
ATOM   932   C C   . VAL A 1 144 ? -2.595  -15.322 -30.802 1.00 37.01  ? 124 VAL A C   1 
ATOM   933   O O   . VAL A 1 144 ? -2.918  -16.154 -31.617 1.00 37.52  ? 124 VAL A O   1 
ATOM   934   C CB  . VAL A 1 144 ? -3.660  -13.032 -31.071 1.00 38.86  ? 124 VAL A CB  1 
ATOM   935   C CG1 . VAL A 1 144 ? -3.457  -13.316 -32.537 1.00 40.77  ? 124 VAL A CG1 1 
ATOM   936   C CG2 . VAL A 1 144 ? -5.004  -12.363 -30.914 1.00 41.28  ? 124 VAL A CG2 1 
ATOM   937   N N   . ALA A 1 145 ? -1.359  -15.226 -30.358 1.00 36.89  ? 125 ALA A N   1 
ATOM   938   C CA  . ALA A 1 145 ? -0.304  -16.032 -30.899 1.00 37.37  ? 125 ALA A CA  1 
ATOM   939   C C   . ALA A 1 145 ? -0.519  -17.504 -30.495 1.00 37.84  ? 125 ALA A C   1 
ATOM   940   O O   . ALA A 1 145 ? -0.233  -18.425 -31.267 1.00 37.77  ? 125 ALA A O   1 
ATOM   941   C CB  . ALA A 1 145 ? 1.026   -15.507 -30.392 1.00 35.88  ? 125 ALA A CB  1 
ATOM   942   N N   . SER A 1 146 ? -1.027  -17.679 -29.280 1.00 36.08  ? 126 SER A N   1 
ATOM   943   C CA  . SER A 1 146 ? -1.452  -18.969 -28.730 1.00 38.86  ? 126 SER A CA  1 
ATOM   944   C C   . SER A 1 146 ? -2.455  -19.780 -29.535 1.00 39.88  ? 126 SER A C   1 
ATOM   945   O O   . SER A 1 146 ? -2.537  -20.980 -29.371 1.00 39.82  ? 126 SER A O   1 
ATOM   946   C CB  . SER A 1 146 ? -2.080  -18.738 -27.372 1.00 38.08  ? 126 SER A CB  1 
ATOM   947   O OG  . SER A 1 146 ? -1.036  -18.742 -26.441 1.00 42.18  ? 126 SER A OG  1 
ATOM   948   N N   . ALA A 1 147 ? -3.250  -19.122 -30.366 1.00 39.80  ? 127 ALA A N   1 
ATOM   949   C CA  . ALA A 1 147 ? -4.124  -19.836 -31.263 1.00 38.13  ? 127 ALA A CA  1 
ATOM   950   C C   . ALA A 1 147 ? -3.378  -20.370 -32.491 1.00 37.84  ? 127 ALA A C   1 
ATOM   951   O O   . ALA A 1 147 ? -4.016  -20.909 -33.388 1.00 37.93  ? 127 ALA A O   1 
ATOM   952   C CB  . ALA A 1 147 ? -5.254  -18.936 -31.692 1.00 36.87  ? 127 ALA A CB  1 
ATOM   953   N N   . THR A 1 148 ? -2.052  -20.214 -32.539 1.00 35.81  ? 128 THR A N   1 
ATOM   954   C CA  . THR A 1 148 ? -1.272  -20.658 -33.685 1.00 35.80  ? 128 THR A CA  1 
ATOM   955   C C   . THR A 1 148 ? -0.182  -21.581 -33.232 1.00 35.21  ? 128 THR A C   1 
ATOM   956   O O   . THR A 1 148 ? 0.118   -21.672 -32.057 1.00 34.83  ? 128 THR A O   1 
ATOM   957   C CB  . THR A 1 148 ? -0.608  -19.479 -34.426 1.00 37.28  ? 128 THR A CB  1 
ATOM   958   O OG1 . THR A 1 148 ? 0.490   -18.976 -33.660 1.00 33.39  ? 128 THR A OG1 1 
ATOM   959   C CG2 . THR A 1 148 ? -1.621  -18.356 -34.663 1.00 39.03  ? 128 THR A CG2 1 
ATOM   960   N N   . LYS A 1 149 ? 0.424   -22.262 -34.182 1.00 39.65  ? 129 LYS A N   1 
ATOM   961   C CA  . LYS A 1 149 ? 1.553   -23.117 -33.882 1.00 46.36  ? 129 LYS A CA  1 
ATOM   962   C C   . LYS A 1 149 ? 2.852   -22.416 -34.247 1.00 46.47  ? 129 LYS A C   1 
ATOM   963   O O   . LYS A 1 149 ? 3.886   -23.069 -34.341 1.00 47.02  ? 129 LYS A O   1 
ATOM   964   C CB  . LYS A 1 149 ? 1.433   -24.468 -34.608 1.00 52.05  ? 129 LYS A CB  1 
ATOM   965   C CG  . LYS A 1 149 ? 0.167   -25.280 -34.286 1.00 58.02  ? 129 LYS A CG  1 
ATOM   966   C CD  . LYS A 1 149 ? -0.184  -25.364 -32.791 1.00 65.62  ? 129 LYS A CD  1 
ATOM   967   C CE  . LYS A 1 149 ? -1.684  -25.132 -32.521 1.00 75.25  ? 129 LYS A CE  1 
ATOM   968   N NZ  . LYS A 1 149 ? -2.012  -24.302 -31.308 1.00 76.86  ? 129 LYS A NZ  1 
ATOM   969   N N   . ARG A 1 150 ? 2.799   -21.094 -34.440 1.00 45.05  ? 130 ARG A N   1 
ATOM   970   C CA  . ARG A 1 150 ? 3.999   -20.298 -34.698 1.00 42.14  ? 130 ARG A CA  1 
ATOM   971   C C   . ARG A 1 150 ? 4.055   -18.988 -33.889 1.00 41.05  ? 130 ARG A C   1 
ATOM   972   O O   . ARG A 1 150 ? 4.231   -17.901 -34.439 1.00 41.11  ? 130 ARG A O   1 
ATOM   973   C CB  . ARG A 1 150 ? 4.103   -20.007 -36.181 1.00 39.93  ? 130 ARG A CB  1 
ATOM   974   C CG  . ARG A 1 150 ? 2.997   -19.115 -36.696 1.00 40.73  ? 130 ARG A CG  1 
ATOM   975   C CD  . ARG A 1 150 ? 3.224   -18.817 -38.161 1.00 39.26  ? 130 ARG A CD  1 
ATOM   976   N NE  . ARG A 1 150 ? 2.580   -19.823 -38.991 1.00 37.69  ? 130 ARG A NE  1 
ATOM   977   C CZ  . ARG A 1 150 ? 2.745   -19.932 -40.298 1.00 36.04  ? 130 ARG A CZ  1 
ATOM   978   N NH1 . ARG A 1 150 ? 3.551   -19.105 -40.942 1.00 34.59  ? 130 ARG A NH1 1 
ATOM   979   N NH2 . ARG A 1 150 ? 2.083   -20.866 -40.963 1.00 35.24  ? 130 ARG A NH2 1 
ATOM   980   N N   . PRO A 1 151 ? 3.940   -19.088 -32.564 1.00 40.34  ? 131 PRO A N   1 
ATOM   981   C CA  . PRO A 1 151 ? 3.893   -17.871 -31.754 1.00 41.05  ? 131 PRO A CA  1 
ATOM   982   C C   . PRO A 1 151 ? 5.158   -17.026 -31.782 1.00 40.94  ? 131 PRO A C   1 
ATOM   983   O O   . PRO A 1 151 ? 5.106   -15.854 -31.434 1.00 46.52  ? 131 PRO A O   1 
ATOM   984   C CB  . PRO A 1 151 ? 3.656   -18.404 -30.337 1.00 39.65  ? 131 PRO A CB  1 
ATOM   985   C CG  . PRO A 1 151 ? 4.142   -19.816 -30.383 1.00 37.13  ? 131 PRO A CG  1 
ATOM   986   C CD  . PRO A 1 151 ? 3.758   -20.293 -31.740 1.00 37.03  ? 131 PRO A CD  1 
ATOM   987   N N   . ASP A 1 152 ? 6.273   -17.624 -32.171 1.00 38.70  ? 132 ASP A N   1 
ATOM   988   C CA  . ASP A 1 152 ? 7.509   -16.894 -32.382 1.00 39.16  ? 132 ASP A CA  1 
ATOM   989   C C   . ASP A 1 152 ? 7.376   -15.945 -33.576 1.00 38.71  ? 132 ASP A C   1 
ATOM   990   O O   . ASP A 1 152 ? 8.136   -14.996 -33.713 1.00 40.10  ? 132 ASP A O   1 
ATOM   991   C CB  . ASP A 1 152 ? 8.680   -17.871 -32.593 1.00 39.75  ? 132 ASP A CB  1 
ATOM   992   C CG  . ASP A 1 152 ? 8.488   -18.794 -33.818 1.00 40.09  ? 132 ASP A CG  1 
ATOM   993   O OD1 . ASP A 1 152 ? 7.478   -19.517 -33.902 1.00 41.40  ? 132 ASP A OD1 1 
ATOM   994   O OD2 . ASP A 1 152 ? 9.346   -18.795 -34.715 1.00 41.91  ? 132 ASP A OD2 1 
ATOM   995   N N   . LYS A 1 153 ? 6.386   -16.205 -34.420 1.00 38.96  ? 133 LYS A N   1 
ATOM   996   C CA  . LYS A 1 153 ? 6.205   -15.488 -35.675 1.00 39.26  ? 133 LYS A CA  1 
ATOM   997   C C   . LYS A 1 153 ? 4.977   -14.597 -35.668 1.00 38.50  ? 133 LYS A C   1 
ATOM   998   O O   . LYS A 1 153 ? 4.505   -14.170 -36.716 1.00 34.96  ? 133 LYS A O   1 
ATOM   999   C CB  . LYS A 1 153 ? 6.075   -16.492 -36.804 1.00 43.01  ? 133 LYS A CB  1 
ATOM   1000  C CG  . LYS A 1 153 ? 7.211   -16.449 -37.799 1.00 46.74  ? 133 LYS A CG  1 
ATOM   1001  C CD  . LYS A 1 153 ? 8.126   -17.656 -37.711 1.00 51.75  ? 133 LYS A CD  1 
ATOM   1002  C CE  . LYS A 1 153 ? 8.912   -17.843 -39.003 1.00 55.97  ? 133 LYS A CE  1 
ATOM   1003  N NZ  . LYS A 1 153 ? 9.295   -16.570 -39.705 1.00 59.08  ? 133 LYS A NZ  1 
ATOM   1004  N N   . VAL A 1 154 ? 4.468   -14.319 -34.475 1.00 38.74  ? 134 VAL A N   1 
ATOM   1005  C CA  . VAL A 1 154 ? 3.300   -13.496 -34.312 1.00 37.85  ? 134 VAL A CA  1 
ATOM   1006  C C   . VAL A 1 154 ? 3.658   -12.235 -33.551 1.00 34.74  ? 134 VAL A C   1 
ATOM   1007  O O   . VAL A 1 154 ? 4.335   -12.263 -32.532 1.00 30.31  ? 134 VAL A O   1 
ATOM   1008  C CB  . VAL A 1 154 ? 2.227   -14.264 -33.565 1.00 40.49  ? 134 VAL A CB  1 
ATOM   1009  C CG1 . VAL A 1 154 ? 1.128   -13.320 -33.106 1.00 41.23  ? 134 VAL A CG1 1 
ATOM   1010  C CG2 . VAL A 1 154 ? 1.659   -15.333 -34.478 1.00 41.26  ? 134 VAL A CG2 1 
ATOM   1011  N N   . ILE A 1 155 ? 3.195   -11.116 -34.056 1.00 33.27  ? 135 ILE A N   1 
ATOM   1012  C CA  . ILE A 1 155 ? 3.655   -9.853  -33.545 1.00 33.04  ? 135 ILE A CA  1 
ATOM   1013  C C   . ILE A 1 155 ? 2.588   -8.785  -33.712 1.00 31.77  ? 135 ILE A C   1 
ATOM   1014  O O   . ILE A 1 155 ? 1.685   -8.901  -34.525 1.00 29.59  ? 135 ILE A O   1 
ATOM   1015  C CB  . ILE A 1 155 ? 4.951   -9.468  -34.265 1.00 33.54  ? 135 ILE A CB  1 
ATOM   1016  C CG1 . ILE A 1 155 ? 5.736   -8.459  -33.453 1.00 34.34  ? 135 ILE A CG1 1 
ATOM   1017  C CG2 . ILE A 1 155 ? 4.655   -8.941  -35.654 1.00 35.64  ? 135 ILE A CG2 1 
ATOM   1018  C CD1 . ILE A 1 155 ? 7.092   -8.158  -34.038 1.00 35.33  ? 135 ILE A CD1 1 
ATOM   1019  N N   . GLY A 1 156 ? 2.676   -7.748  -32.908 1.00 31.44  ? 136 GLY A N   1 
ATOM   1020  C CA  . GLY A 1 156 ? 1.814   -6.604  -33.105 1.00 32.08  ? 136 GLY A CA  1 
ATOM   1021  C C   . GLY A 1 156 ? 2.495   -5.571  -33.988 1.00 31.63  ? 136 GLY A C   1 
ATOM   1022  O O   . GLY A 1 156 ? 3.655   -5.253  -33.799 1.00 30.20  ? 136 GLY A O   1 
ATOM   1023  N N   . MET A 1 157 ? 1.759   -5.049  -34.954 1.00 33.26  ? 137 MET A N   1 
ATOM   1024  C CA  . MET A 1 157 ? 2.215   -3.915  -35.732 1.00 36.77  ? 137 MET A CA  1 
ATOM   1025  C C   . MET A 1 157 ? 1.179   -2.818  -35.633 1.00 36.51  ? 137 MET A C   1 
ATOM   1026  O O   . MET A 1 157 ? 0.153   -2.873  -36.298 1.00 34.20  ? 137 MET A O   1 
ATOM   1027  C CB  . MET A 1 157 ? 2.374   -4.322  -37.168 1.00 39.46  ? 137 MET A CB  1 
ATOM   1028  C CG  . MET A 1 157 ? 3.701   -3.944  -37.717 1.00 43.14  ? 137 MET A CG  1 
ATOM   1029  S SD  . MET A 1 157 ? 4.034   -4.835  -39.232 1.00 49.99  ? 137 MET A SD  1 
ATOM   1030  C CE  . MET A 1 157 ? 4.904   -3.530  -40.099 1.00 46.64  ? 137 MET A CE  1 
ATOM   1031  N N   . HIS A 1 158 ? 1.448   -1.822  -34.798 1.00 36.58  ? 138 HIS A N   1 
ATOM   1032  C CA  . HIS A 1 158 ? 0.435   -0.838  -34.482 1.00 37.03  ? 138 HIS A CA  1 
ATOM   1033  C C   . HIS A 1 158 ? 0.658   0.463   -35.211 1.00 39.10  ? 138 HIS A C   1 
ATOM   1034  O O   . HIS A 1 158 ? 1.618   1.182   -34.939 1.00 38.74  ? 138 HIS A O   1 
ATOM   1035  C CB  . HIS A 1 158 ? 0.410   -0.596  -32.992 1.00 36.58  ? 138 HIS A CB  1 
ATOM   1036  C CG  . HIS A 1 158 ? -0.761  0.207   -32.544 1.00 38.99  ? 138 HIS A CG  1 
ATOM   1037  N ND1 . HIS A 1 158 ? -0.668  1.188   -31.576 1.00 39.09  ? 138 HIS A ND1 1 
ATOM   1038  C CD2 . HIS A 1 158 ? -2.055  0.193   -32.948 1.00 39.60  ? 138 HIS A CD2 1 
ATOM   1039  C CE1 . HIS A 1 158 ? -1.861  1.729   -31.392 1.00 38.96  ? 138 HIS A CE1 1 
ATOM   1040  N NE2 . HIS A 1 158 ? -2.719  1.147   -32.212 1.00 39.45  ? 138 HIS A NE2 1 
ATOM   1041  N N   . PHE A 1 159 ? -0.256  0.759   -36.122 1.00 40.36  ? 139 PHE A N   1 
ATOM   1042  C CA  . PHE A 1 159 ? -0.162  1.926   -36.991 1.00 43.55  ? 139 PHE A CA  1 
ATOM   1043  C C   . PHE A 1 159 ? -0.977  3.086   -36.454 1.00 41.55  ? 139 PHE A C   1 
ATOM   1044  O O   . PHE A 1 159 ? -1.835  2.886   -35.610 1.00 40.21  ? 139 PHE A O   1 
ATOM   1045  C CB  . PHE A 1 159 ? -0.692  1.557   -38.364 1.00 44.57  ? 139 PHE A CB  1 
ATOM   1046  C CG  . PHE A 1 159 ? 0.275   0.794   -39.183 1.00 45.79  ? 139 PHE A CG  1 
ATOM   1047  C CD1 . PHE A 1 159 ? 0.399   -0.571  -39.034 1.00 47.65  ? 139 PHE A CD1 1 
ATOM   1048  C CD2 . PHE A 1 159 ? 1.060   1.442   -40.107 1.00 45.88  ? 139 PHE A CD2 1 
ATOM   1049  C CE1 . PHE A 1 159 ? 1.297   -1.280  -39.800 1.00 46.76  ? 139 PHE A CE1 1 
ATOM   1050  C CE2 . PHE A 1 159 ? 1.961   0.746   -40.871 1.00 46.04  ? 139 PHE A CE2 1 
ATOM   1051  C CZ  . PHE A 1 159 ? 2.081   -0.619  -40.718 1.00 47.01  ? 139 PHE A CZ  1 
ATOM   1052  N N   . PHE A 1 160 ? -0.722  4.290   -36.964 1.00 40.37  ? 140 PHE A N   1 
ATOM   1053  C CA  . PHE A 1 160 ? -1.473  5.476   -36.537 1.00 39.29  ? 140 PHE A CA  1 
ATOM   1054  C C   . PHE A 1 160 ? -2.180  6.123   -37.695 1.00 39.99  ? 140 PHE A C   1 
ATOM   1055  O O   . PHE A 1 160 ? -1.631  6.229   -38.779 1.00 41.96  ? 140 PHE A O   1 
ATOM   1056  C CB  . PHE A 1 160 ? -0.562  6.460   -35.814 1.00 39.14  ? 140 PHE A CB  1 
ATOM   1057  C CG  . PHE A 1 160 ? -0.095  5.931   -34.501 1.00 40.17  ? 140 PHE A CG  1 
ATOM   1058  C CD1 . PHE A 1 160 ? -0.780  6.216   -33.329 1.00 39.66  ? 140 PHE A CD1 1 
ATOM   1059  C CD2 . PHE A 1 160 ? 0.961   5.046   -34.459 1.00 39.21  ? 140 PHE A CD2 1 
ATOM   1060  C CE1 . PHE A 1 160 ? -0.376  5.656   -32.131 1.00 39.98  ? 140 PHE A CE1 1 
ATOM   1061  C CE2 . PHE A 1 160 ? 1.366   4.489   -33.279 1.00 39.36  ? 140 PHE A CE2 1 
ATOM   1062  C CZ  . PHE A 1 160 ? 0.700   4.792   -32.110 1.00 40.22  ? 140 PHE A CZ  1 
ATOM   1063  N N   . ASN A 1 161 ? -3.429  6.497   -37.456 1.00 43.37  ? 141 ASN A N   1 
ATOM   1064  C CA  . ASN A 1 161 ? -4.284  7.147   -38.447 1.00 47.28  ? 141 ASN A CA  1 
ATOM   1065  C C   . ASN A 1 161 ? -3.777  8.560   -38.786 1.00 46.73  ? 141 ASN A C   1 
ATOM   1066  O O   . ASN A 1 161 ? -3.482  9.321   -37.866 1.00 45.69  ? 141 ASN A O   1 
ATOM   1067  C CB  . ASN A 1 161 ? -5.678  7.267   -37.834 1.00 50.45  ? 141 ASN A CB  1 
ATOM   1068  C CG  . ASN A 1 161 ? -6.778  7.379   -38.865 1.00 54.08  ? 141 ASN A CG  1 
ATOM   1069  O OD1 . ASN A 1 161 ? -6.559  7.759   -40.018 1.00 51.59  ? 141 ASN A OD1 1 
ATOM   1070  N ND2 . ASN A 1 161 ? -7.993  7.053   -38.440 1.00 55.93  ? 141 ASN A ND2 1 
ATOM   1071  N N   . PRO A 1 162 ? -3.645  8.928   -40.065 1.00 47.09  ? 142 PRO A N   1 
ATOM   1072  C CA  . PRO A 1 162 ? -3.796  8.061   -41.247 1.00 47.45  ? 142 PRO A CA  1 
ATOM   1073  C C   . PRO A 1 162 ? -2.521  7.321   -41.575 1.00 46.90  ? 142 PRO A C   1 
ATOM   1074  O O   . PRO A 1 162 ? -1.433  7.906   -41.569 1.00 45.44  ? 142 PRO A O   1 
ATOM   1075  C CB  . PRO A 1 162 ? -4.116  9.044   -42.387 1.00 46.73  ? 142 PRO A CB  1 
ATOM   1076  C CG  . PRO A 1 162 ? -4.230  10.393  -41.760 1.00 47.06  ? 142 PRO A CG  1 
ATOM   1077  C CD  . PRO A 1 162 ? -3.495  10.335  -40.454 1.00 46.96  ? 142 PRO A CD  1 
ATOM   1078  N N   . ALA A 1 163 ? -2.673  6.043   -41.886 1.00 50.02  ? 143 ALA A N   1 
ATOM   1079  C CA  . ALA A 1 163 ? -1.539  5.116   -41.950 1.00 49.18  ? 143 ALA A CA  1 
ATOM   1080  C C   . ALA A 1 163 ? -0.479  5.477   -42.981 1.00 42.68  ? 143 ALA A C   1 
ATOM   1081  O O   . ALA A 1 163 ? 0.704   5.307   -42.729 1.00 42.61  ? 143 ALA A O   1 
ATOM   1082  C CB  . ALA A 1 163 ? -2.041  3.708   -42.198 1.00 51.55  ? 143 ALA A CB  1 
ATOM   1083  N N   . PRO A 1 164 ? -0.898  5.979   -44.144 1.00 39.80  ? 144 PRO A N   1 
ATOM   1084  C CA  . PRO A 1 164 ? 0.088   6.398   -45.158 1.00 42.33  ? 144 PRO A CA  1 
ATOM   1085  C C   . PRO A 1 164 ? 0.981   7.568   -44.734 1.00 44.35  ? 144 PRO A C   1 
ATOM   1086  O O   . PRO A 1 164 ? 2.071   7.737   -45.262 1.00 45.72  ? 144 PRO A O   1 
ATOM   1087  C CB  . PRO A 1 164 ? -0.786  6.815   -46.348 1.00 40.42  ? 144 PRO A CB  1 
ATOM   1088  C CG  . PRO A 1 164 ? -2.094  6.121   -46.122 1.00 40.18  ? 144 PRO A CG  1 
ATOM   1089  C CD  . PRO A 1 164 ? -2.281  6.086   -44.637 1.00 38.72  ? 144 PRO A CD  1 
ATOM   1090  N N   . VAL A 1 165 ? 0.531   8.352   -43.771 1.00 45.49  ? 145 VAL A N   1 
ATOM   1091  C CA  . VAL A 1 165 ? 1.225   9.563   -43.420 1.00 46.10  ? 145 VAL A CA  1 
ATOM   1092  C C   . VAL A 1 165 ? 1.946   9.446   -42.106 1.00 43.60  ? 145 VAL A C   1 
ATOM   1093  O O   . VAL A 1 165 ? 3.073   9.876   -41.995 1.00 45.11  ? 145 VAL A O   1 
ATOM   1094  C CB  . VAL A 1 165 ? 0.227   10.725  -43.339 1.00 50.98  ? 145 VAL A CB  1 
ATOM   1095  C CG1 . VAL A 1 165 ? 0.868   11.950  -42.708 1.00 51.86  ? 145 VAL A CG1 1 
ATOM   1096  C CG2 . VAL A 1 165 ? -0.292  11.045  -44.733 1.00 50.70  ? 145 VAL A CG2 1 
ATOM   1097  N N   . MET A 1 166 ? 1.297   8.887   -41.095 1.00 44.11  ? 146 MET A N   1 
ATOM   1098  C CA  . MET A 1 166 ? 1.906   8.847   -39.772 1.00 42.91  ? 146 MET A CA  1 
ATOM   1099  C C   . MET A 1 166 ? 3.047   7.885   -39.810 1.00 41.65  ? 146 MET A C   1 
ATOM   1100  O O   . MET A 1 166 ? 2.921   6.797   -40.335 1.00 45.70  ? 146 MET A O   1 
ATOM   1101  C CB  . MET A 1 166 ? 0.912   8.392   -38.723 1.00 45.12  ? 146 MET A CB  1 
ATOM   1102  C CG  . MET A 1 166 ? -0.300  9.305   -38.623 1.00 47.76  ? 146 MET A CG  1 
ATOM   1103  S SD  . MET A 1 166 ? 0.176   10.881  -37.894 1.00 50.23  ? 146 MET A SD  1 
ATOM   1104  C CE  . MET A 1 166 ? 0.409   10.375  -36.183 1.00 48.76  ? 146 MET A CE  1 
ATOM   1105  N N   . LYS A 1 167 ? 4.147   8.291   -39.217 1.00 42.90  ? 147 LYS A N   1 
ATOM   1106  C CA  . LYS A 1 167 ? 5.394   7.605   -39.360 1.00 44.78  ? 147 LYS A CA  1 
ATOM   1107  C C   . LYS A 1 167 ? 5.638   6.562   -38.320 1.00 43.31  ? 147 LYS A C   1 
ATOM   1108  O O   . LYS A 1 167 ? 6.425   5.647   -38.529 1.00 41.64  ? 147 LYS A O   1 
ATOM   1109  C CB  . LYS A 1 167 ? 6.498   8.625   -39.271 1.00 51.55  ? 147 LYS A CB  1 
ATOM   1110  C CG  . LYS A 1 167 ? 6.470   9.531   -40.471 1.00 60.99  ? 147 LYS A CG  1 
ATOM   1111  C CD  . LYS A 1 167 ? 7.830   9.579   -41.134 1.00 69.64  ? 147 LYS A CD  1 
ATOM   1112  C CE  . LYS A 1 167 ? 7.701   10.030  -42.578 1.00 76.80  ? 147 LYS A CE  1 
ATOM   1113  N NZ  . LYS A 1 167 ? 8.672   11.118  -42.870 1.00 80.29  ? 147 LYS A NZ  1 
ATOM   1114  N N   . LEU A 1 168 ? 4.986   6.712   -37.185 1.00 41.79  ? 148 LEU A N   1 
ATOM   1115  C CA  . LEU A 1 168 ? 5.223   5.822   -36.098 1.00 41.73  ? 148 LEU A CA  1 
ATOM   1116  C C   . LEU A 1 168 ? 4.472   4.517   -36.282 1.00 42.24  ? 148 LEU A C   1 
ATOM   1117  O O   . LEU A 1 168 ? 3.351   4.479   -36.790 1.00 42.13  ? 148 LEU A O   1 
ATOM   1118  C CB  . LEU A 1 168 ? 4.803   6.481   -34.810 1.00 41.34  ? 148 LEU A CB  1 
ATOM   1119  C CG  . LEU A 1 168 ? 4.875   5.606   -33.574 1.00 41.48  ? 148 LEU A CG  1 
ATOM   1120  C CD1 . LEU A 1 168 ? 6.293   5.549   -33.045 1.00 41.17  ? 148 LEU A CD1 1 
ATOM   1121  C CD2 . LEU A 1 168 ? 3.963   6.226   -32.550 1.00 43.00  ? 148 LEU A CD2 1 
ATOM   1122  N N   . VAL A 1 169 ? 5.142   3.457   -35.857 1.00 39.52  ? 149 VAL A N   1 
ATOM   1123  C CA  . VAL A 1 169 ? 4.566   2.143   -35.736 1.00 39.17  ? 149 VAL A CA  1 
ATOM   1124  C C   . VAL A 1 169 ? 5.046   1.603   -34.410 1.00 36.26  ? 149 VAL A C   1 
ATOM   1125  O O   . VAL A 1 169 ? 6.238   1.624   -34.137 1.00 34.45  ? 149 VAL A O   1 
ATOM   1126  C CB  . VAL A 1 169 ? 5.073   1.237   -36.845 1.00 40.59  ? 149 VAL A CB  1 
ATOM   1127  C CG1 . VAL A 1 169 ? 4.742   -0.194  -36.542 1.00 41.63  ? 149 VAL A CG1 1 
ATOM   1128  C CG2 . VAL A 1 169 ? 4.434   1.634   -38.149 1.00 41.91  ? 149 VAL A CG2 1 
ATOM   1129  N N   . GLU A 1 170 ? 4.124   1.168   -33.564 1.00 34.15  ? 150 GLU A N   1 
ATOM   1130  C CA  . GLU A 1 170 ? 4.515   0.540   -32.318 1.00 34.71  ? 150 GLU A CA  1 
ATOM   1131  C C   . GLU A 1 170 ? 4.623   -0.931  -32.637 1.00 34.85  ? 150 GLU A C   1 
ATOM   1132  O O   . GLU A 1 170 ? 3.661   -1.561  -33.105 1.00 33.77  ? 150 GLU A O   1 
ATOM   1133  C CB  . GLU A 1 170 ? 3.503   0.784   -31.206 1.00 34.41  ? 150 GLU A CB  1 
ATOM   1134  C CG  . GLU A 1 170 ? 3.428   2.232   -30.775 1.00 35.86  ? 150 GLU A CG  1 
ATOM   1135  C CD  . GLU A 1 170 ? 2.474   2.460   -29.608 1.00 36.61  ? 150 GLU A CD  1 
ATOM   1136  O OE1 . GLU A 1 170 ? 1.250   2.261   -29.758 1.00 37.21  ? 150 GLU A OE1 1 
ATOM   1137  O OE2 . GLU A 1 170 ? 2.939   2.846   -28.521 1.00 34.68  ? 150 GLU A OE2 1 
ATOM   1138  N N   . VAL A 1 171 ? 5.798   -1.483  -32.424 1.00 33.22  ? 151 VAL A N   1 
ATOM   1139  C CA  . VAL A 1 171 ? 5.988   -2.873  -32.748 1.00 35.09  ? 151 VAL A CA  1 
ATOM   1140  C C   . VAL A 1 171 ? 5.909   -3.651  -31.466 1.00 34.64  ? 151 VAL A C   1 
ATOM   1141  O O   . VAL A 1 171 ? 6.819   -3.596  -30.643 1.00 35.11  ? 151 VAL A O   1 
ATOM   1142  C CB  . VAL A 1 171 ? 7.301   -3.114  -33.487 1.00 35.88  ? 151 VAL A CB  1 
ATOM   1143  C CG1 . VAL A 1 171 ? 7.491   -4.589  -33.755 1.00 36.40  ? 151 VAL A CG1 1 
ATOM   1144  C CG2 . VAL A 1 171 ? 7.272   -2.382  -34.813 1.00 35.33  ? 151 VAL A CG2 1 
ATOM   1145  N N   . ILE A 1 172 ? 4.822   -4.402  -31.332 1.00 32.93  ? 152 ILE A N   1 
ATOM   1146  C CA  . ILE A 1 172 ? 4.463   -5.024  -30.077 1.00 33.46  ? 152 ILE A CA  1 
ATOM   1147  C C   . ILE A 1 172 ? 4.866   -6.485  -30.036 1.00 34.68  ? 152 ILE A C   1 
ATOM   1148  O O   . ILE A 1 172 ? 4.334   -7.301  -30.767 1.00 36.29  ? 152 ILE A O   1 
ATOM   1149  C CB  . ILE A 1 172 ? 2.951   -4.961  -29.858 1.00 33.29  ? 152 ILE A CB  1 
ATOM   1150  C CG1 . ILE A 1 172 ? 2.399   -3.587  -30.259 1.00 35.81  ? 152 ILE A CG1 1 
ATOM   1151  C CG2 . ILE A 1 172 ? 2.630   -5.271  -28.417 1.00 31.92  ? 152 ILE A CG2 1 
ATOM   1152  C CD1 . ILE A 1 172 ? 3.018   -2.421  -29.519 1.00 35.26  ? 152 ILE A CD1 1 
ATOM   1153  N N   . ARG A 1 173 ? 5.784   -6.810  -29.146 1.00 35.30  ? 153 ARG A N   1 
ATOM   1154  C CA  . ARG A 1 173 ? 6.209   -8.190  -28.954 1.00 35.06  ? 153 ARG A CA  1 
ATOM   1155  C C   . ARG A 1 173 ? 5.365   -8.944  -27.956 1.00 33.81  ? 153 ARG A C   1 
ATOM   1156  O O   . ARG A 1 173 ? 5.240   -8.539  -26.808 1.00 32.62  ? 153 ARG A O   1 
ATOM   1157  C CB  . ARG A 1 173 ? 7.641   -8.217  -28.468 1.00 35.17  ? 153 ARG A CB  1 
ATOM   1158  C CG  . ARG A 1 173 ? 8.626   -7.910  -29.570 1.00 36.13  ? 153 ARG A CG  1 
ATOM   1159  C CD  . ARG A 1 173 ? 10.019  -7.817  -29.024 1.00 35.73  ? 153 ARG A CD  1 
ATOM   1160  N NE  . ARG A 1 173 ? 10.629  -9.137  -28.941 1.00 38.95  ? 153 ARG A NE  1 
ATOM   1161  C CZ  . ARG A 1 173 ? 11.934  -9.358  -29.038 1.00 40.66  ? 153 ARG A CZ  1 
ATOM   1162  N NH1 . ARG A 1 173 ? 12.775  -8.343  -29.226 1.00 41.67  ? 153 ARG A NH1 1 
ATOM   1163  N NH2 . ARG A 1 173 ? 12.408  -10.591 -28.968 1.00 40.69  ? 153 ARG A NH2 1 
ATOM   1164  N N   . GLY A 1 174 ? 4.801   -10.066 -28.390 1.00 32.66  ? 154 GLY A N   1 
ATOM   1165  C CA  . GLY A 1 174 ? 4.183   -10.994 -27.464 1.00 30.56  ? 154 GLY A CA  1 
ATOM   1166  C C   . GLY A 1 174 ? 5.333   -11.574 -26.668 1.00 30.49  ? 154 GLY A C   1 
ATOM   1167  O O   . GLY A 1 174 ? 6.482   -11.448 -27.080 1.00 30.68  ? 154 GLY A O   1 
ATOM   1168  N N   . ILE A 1 175 ? 5.049   -12.224 -25.549 1.00 29.68  ? 155 ILE A N   1 
ATOM   1169  C CA  . ILE A 1 175 ? 6.116   -12.797 -24.764 1.00 31.31  ? 155 ILE A CA  1 
ATOM   1170  C C   . ILE A 1 175 ? 6.894   -13.861 -25.548 1.00 32.30  ? 155 ILE A C   1 
ATOM   1171  O O   . ILE A 1 175 ? 8.055   -14.127 -25.255 1.00 32.80  ? 155 ILE A O   1 
ATOM   1172  C CB  . ILE A 1 175 ? 5.586   -13.340 -23.420 1.00 34.68  ? 155 ILE A CB  1 
ATOM   1173  C CG1 . ILE A 1 175 ? 6.733   -13.597 -22.439 1.00 33.80  ? 155 ILE A CG1 1 
ATOM   1174  C CG2 . ILE A 1 175 ? 4.735   -14.592 -23.607 1.00 35.47  ? 155 ILE A CG2 1 
ATOM   1175  C CD1 . ILE A 1 175 ? 6.244   -13.803 -21.019 1.00 34.37  ? 155 ILE A CD1 1 
ATOM   1176  N N   . ALA A 1 176 ? 6.281   -14.439 -26.568 1.00 34.22  ? 156 ALA A N   1 
ATOM   1177  C CA  . ALA A 1 176 ? 6.954   -15.469 -27.357 1.00 36.62  ? 156 ALA A CA  1 
ATOM   1178  C C   . ALA A 1 176 ? 7.489   -14.992 -28.699 1.00 38.44  ? 156 ALA A C   1 
ATOM   1179  O O   . ALA A 1 176 ? 8.066   -15.791 -29.429 1.00 40.99  ? 156 ALA A O   1 
ATOM   1180  C CB  . ALA A 1 176 ? 6.012   -16.642 -27.577 1.00 35.76  ? 156 ALA A CB  1 
ATOM   1181  N N   . THR A 1 177 ? 7.284   -13.721 -29.037 1.00 37.51  ? 157 THR A N   1 
ATOM   1182  C CA  . THR A 1 177 ? 7.798   -13.189 -30.283 1.00 37.14  ? 157 THR A CA  1 
ATOM   1183  C C   . THR A 1 177 ? 9.310   -13.247 -30.250 1.00 37.06  ? 157 THR A C   1 
ATOM   1184  O O   . THR A 1 177 ? 9.922   -12.882 -29.264 1.00 35.47  ? 157 THR A O   1 
ATOM   1185  C CB  . THR A 1 177 ? 7.363   -11.737 -30.516 1.00 38.46  ? 157 THR A CB  1 
ATOM   1186  O OG1 . THR A 1 177 ? 5.935   -11.647 -30.447 1.00 36.95  ? 157 THR A OG1 1 
ATOM   1187  C CG2 . THR A 1 177 ? 7.830   -11.258 -31.892 1.00 37.03  ? 157 THR A CG2 1 
ATOM   1188  N N   . SER A 1 178 ? 9.901   -13.738 -31.327 1.00 36.67  ? 158 SER A N   1 
ATOM   1189  C CA  . SER A 1 178 ? 11.327  -13.955 -31.368 1.00 37.09  ? 158 SER A CA  1 
ATOM   1190  C C   . SER A 1 178 ? 12.039  -12.717 -31.889 1.00 38.32  ? 158 SER A C   1 
ATOM   1191  O O   . SER A 1 178 ? 11.453  -11.877 -32.594 1.00 35.03  ? 158 SER A O   1 
ATOM   1192  C CB  . SER A 1 178 ? 11.650  -15.156 -32.257 1.00 37.26  ? 158 SER A CB  1 
ATOM   1193  O OG  . SER A 1 178 ? 11.644  -14.784 -33.636 1.00 34.88  ? 158 SER A OG  1 
ATOM   1194  N N   . GLN A 1 179 ? 13.318  -12.631 -31.550 1.00 38.50  ? 159 GLN A N   1 
ATOM   1195  C CA  . GLN A 1 179 ? 14.137  -11.513 -31.960 1.00 40.20  ? 159 GLN A CA  1 
ATOM   1196  C C   . GLN A 1 179 ? 14.151  -11.377 -33.468 1.00 41.74  ? 159 GLN A C   1 
ATOM   1197  O O   . GLN A 1 179 ? 14.134  -10.276 -34.030 1.00 43.56  ? 159 GLN A O   1 
ATOM   1198  C CB  . GLN A 1 179 ? 15.558  -11.730 -31.477 1.00 40.21  ? 159 GLN A CB  1 
ATOM   1199  C CG  . GLN A 1 179 ? 16.433  -10.508 -31.618 1.00 38.94  ? 159 GLN A CG  1 
ATOM   1200  C CD  . GLN A 1 179 ? 15.871  -9.305  -30.884 1.00 38.17  ? 159 GLN A CD  1 
ATOM   1201  O OE1 . GLN A 1 179 ? 15.501  -9.385  -29.704 1.00 36.53  ? 159 GLN A OE1 1 
ATOM   1202  N NE2 . GLN A 1 179 ? 15.807  -8.179  -31.580 1.00 36.82  ? 159 GLN A NE2 1 
ATOM   1203  N N   . GLU A 1 180 ? 14.179  -12.521 -34.118 1.00 41.93  ? 160 GLU A N   1 
ATOM   1204  C CA  . GLU A 1 180 ? 14.243  -12.569 -35.554 1.00 43.41  ? 160 GLU A CA  1 
ATOM   1205  C C   . GLU A 1 180 ? 12.993  -11.983 -36.173 1.00 38.50  ? 160 GLU A C   1 
ATOM   1206  O O   . GLU A 1 180 ? 13.035  -11.250 -37.143 1.00 39.51  ? 160 GLU A O   1 
ATOM   1207  C CB  . GLU A 1 180 ? 14.386  -14.014 -35.979 1.00 49.33  ? 160 GLU A CB  1 
ATOM   1208  C CG  . GLU A 1 180 ? 14.967  -14.175 -37.355 1.00 57.14  ? 160 GLU A CG  1 
ATOM   1209  C CD  . GLU A 1 180 ? 15.132  -15.636 -37.723 1.00 65.92  ? 160 GLU A CD  1 
ATOM   1210  O OE1 . GLU A 1 180 ? 16.242  -16.186 -37.520 1.00 67.20  ? 160 GLU A OE1 1 
ATOM   1211  O OE2 . GLU A 1 180 ? 14.139  -16.237 -38.190 1.00 71.65  ? 160 GLU A OE2 1 
ATOM   1212  N N   . THR A 1 181 ? 11.859  -12.341 -35.617 1.00 38.10  ? 161 THR A N   1 
ATOM   1213  C CA  . THR A 1 181 ? 10.602  -11.822 -36.095 1.00 37.62  ? 161 THR A CA  1 
ATOM   1214  C C   . THR A 1 181 ? 10.513  -10.335 -35.824 1.00 37.52  ? 161 THR A C   1 
ATOM   1215  O O   . THR A 1 181 ? 10.076  -9.564  -36.693 1.00 35.85  ? 161 THR A O   1 
ATOM   1216  C CB  . THR A 1 181 ? 9.454   -12.545 -35.398 1.00 37.92  ? 161 THR A CB  1 
ATOM   1217  O OG1 . THR A 1 181 ? 9.428   -13.879 -35.883 1.00 38.33  ? 161 THR A OG1 1 
ATOM   1218  C CG2 . THR A 1 181 ? 8.134   -11.887 -35.687 1.00 37.92  ? 161 THR A CG2 1 
ATOM   1219  N N   . PHE A 1 182 ? 10.922  -9.937  -34.620 1.00 36.51  ? 162 PHE A N   1 
ATOM   1220  C CA  . PHE A 1 182 ? 10.974  -8.521  -34.308 1.00 38.48  ? 162 PHE A CA  1 
ATOM   1221  C C   . PHE A 1 182 ? 11.832  -7.772  -35.308 1.00 37.54  ? 162 PHE A C   1 
ATOM   1222  O O   . PHE A 1 182 ? 11.389  -6.799  -35.892 1.00 35.90  ? 162 PHE A O   1 
ATOM   1223  C CB  . PHE A 1 182 ? 11.529  -8.238  -32.923 1.00 39.53  ? 162 PHE A CB  1 
ATOM   1224  C CG  . PHE A 1 182 ? 11.768  -6.802  -32.721 1.00 39.78  ? 162 PHE A CG  1 
ATOM   1225  C CD1 . PHE A 1 182 ? 10.691  -5.940  -32.576 1.00 39.46  ? 162 PHE A CD1 1 
ATOM   1226  C CD2 . PHE A 1 182 ? 13.044  -6.283  -32.827 1.00 39.68  ? 162 PHE A CD2 1 
ATOM   1227  C CE1 . PHE A 1 182 ? 10.896  -4.584  -32.476 1.00 38.47  ? 162 PHE A CE1 1 
ATOM   1228  C CE2 . PHE A 1 182 ? 13.254  -4.931  -32.708 1.00 38.64  ? 162 PHE A CE2 1 
ATOM   1229  C CZ  . PHE A 1 182 ? 12.180  -4.084  -32.535 1.00 38.67  ? 162 PHE A CZ  1 
ATOM   1230  N N   . ASP A 1 183 ? 13.064  -8.238  -35.494 1.00 39.99  ? 163 ASP A N   1 
ATOM   1231  C CA  . ASP A 1 183 ? 13.995  -7.598  -36.434 1.00 40.96  ? 163 ASP A CA  1 
ATOM   1232  C C   . ASP A 1 183 ? 13.489  -7.495  -37.856 1.00 40.52  ? 163 ASP A C   1 
ATOM   1233  O O   . ASP A 1 183 ? 13.763  -6.503  -38.528 1.00 43.47  ? 163 ASP A O   1 
ATOM   1234  C CB  . ASP A 1 183 ? 15.315  -8.340  -36.479 1.00 41.56  ? 163 ASP A CB  1 
ATOM   1235  C CG  . ASP A 1 183 ? 16.129  -8.146  -35.240 1.00 42.83  ? 163 ASP A CG  1 
ATOM   1236  O OD1 . ASP A 1 183 ? 15.876  -7.207  -34.472 1.00 45.28  ? 163 ASP A OD1 1 
ATOM   1237  O OD2 . ASP A 1 183 ? 17.050  -8.946  -35.034 1.00 49.44  ? 163 ASP A OD2 1 
ATOM   1238  N N   . ALA A 1 184 ? 12.756  -8.499  -38.325 1.00 38.52  ? 164 ALA A N   1 
ATOM   1239  C CA  . ALA A 1 184 ? 12.263  -8.441  -39.694 1.00 40.15  ? 164 ALA A CA  1 
ATOM   1240  C C   . ALA A 1 184 ? 11.180  -7.384  -39.815 1.00 40.37  ? 164 ALA A C   1 
ATOM   1241  O O   . ALA A 1 184 ? 11.138  -6.680  -40.785 1.00 44.38  ? 164 ALA A O   1 
ATOM   1242  C CB  . ALA A 1 184 ? 11.746  -9.788  -40.158 1.00 38.61  ? 164 ALA A CB  1 
ATOM   1243  N N   . VAL A 1 185 ? 10.321  -7.273  -38.814 1.00 40.21  ? 165 VAL A N   1 
ATOM   1244  C CA  . VAL A 1 185 ? 9.237   -6.314  -38.846 1.00 40.70  ? 165 VAL A CA  1 
ATOM   1245  C C   . VAL A 1 185 ? 9.774   -4.899  -38.619 1.00 40.75  ? 165 VAL A C   1 
ATOM   1246  O O   . VAL A 1 185 ? 9.230   -3.917  -39.109 1.00 38.80  ? 165 VAL A O   1 
ATOM   1247  C CB  . VAL A 1 185 ? 8.194   -6.704  -37.798 1.00 41.44  ? 165 VAL A CB  1 
ATOM   1248  C CG1 . VAL A 1 185 ? 7.250   -5.556  -37.482 1.00 41.89  ? 165 VAL A CG1 1 
ATOM   1249  C CG2 . VAL A 1 185 ? 7.422   -7.894  -38.308 1.00 41.37  ? 165 VAL A CG2 1 
ATOM   1250  N N   . LYS A 1 186 ? 10.862  -4.799  -37.889 1.00 42.48  ? 166 LYS A N   1 
ATOM   1251  C CA  . LYS A 1 186 ? 11.510  -3.519  -37.731 1.00 45.16  ? 166 LYS A CA  1 
ATOM   1252  C C   . LYS A 1 186 ? 12.130  -3.041  -39.023 1.00 47.03  ? 166 LYS A C   1 
ATOM   1253  O O   . LYS A 1 186 ? 11.942  -1.894  -39.410 1.00 47.03  ? 166 LYS A O   1 
ATOM   1254  C CB  . LYS A 1 186 ? 12.579  -3.614  -36.680 1.00 45.33  ? 166 LYS A CB  1 
ATOM   1255  C CG  . LYS A 1 186 ? 13.502  -2.432  -36.691 1.00 47.59  ? 166 LYS A CG  1 
ATOM   1256  C CD  . LYS A 1 186 ? 14.264  -2.393  -35.397 1.00 51.23  ? 166 LYS A CD  1 
ATOM   1257  C CE  . LYS A 1 186 ? 15.273  -1.269  -35.424 1.00 55.48  ? 166 LYS A CE  1 
ATOM   1258  N NZ  . LYS A 1 186 ? 16.042  -1.290  -34.157 1.00 57.28  ? 166 LYS A NZ  1 
ATOM   1259  N N   . GLU A 1 187 ? 12.871  -3.915  -39.692 1.00 50.30  ? 167 GLU A N   1 
ATOM   1260  C CA  . GLU A 1 187 ? 13.560  -3.505  -40.904 1.00 50.81  ? 167 GLU A CA  1 
ATOM   1261  C C   . GLU A 1 187 ? 12.541  -3.167  -42.005 1.00 46.49  ? 167 GLU A C   1 
ATOM   1262  O O   . GLU A 1 187 ? 12.757  -2.278  -42.816 1.00 47.70  ? 167 GLU A O   1 
ATOM   1263  C CB  . GLU A 1 187 ? 14.601  -4.547  -41.314 1.00 58.24  ? 167 GLU A CB  1 
ATOM   1264  C CG  . GLU A 1 187 ? 14.326  -5.319  -42.595 1.00 70.84  ? 167 GLU A CG  1 
ATOM   1265  C CD  . GLU A 1 187 ? 15.274  -6.503  -42.797 1.00 78.93  ? 167 GLU A CD  1 
ATOM   1266  O OE1 . GLU A 1 187 ? 16.154  -6.756  -41.933 1.00 84.04  ? 167 GLU A OE1 1 
ATOM   1267  O OE2 . GLU A 1 187 ? 15.129  -7.188  -43.833 1.00 82.25  ? 167 GLU A OE2 1 
ATOM   1268  N N   . THR A 1 188 ? 11.394  -3.820  -41.991 1.00 44.33  ? 168 THR A N   1 
ATOM   1269  C CA  . THR A 1 188 ? 10.408  -3.554  -43.031 1.00 46.24  ? 168 THR A CA  1 
ATOM   1270  C C   . THR A 1 188 ? 9.507   -2.375  -42.662 1.00 45.92  ? 168 THR A C   1 
ATOM   1271  O O   . THR A 1 188 ? 8.953   -1.728  -43.532 1.00 48.87  ? 168 THR A O   1 
ATOM   1272  C CB  . THR A 1 188 ? 9.623   -4.818  -43.461 1.00 49.19  ? 168 THR A CB  1 
ATOM   1273  O OG1 . THR A 1 188 ? 8.212   -4.564  -43.466 1.00 50.18  ? 168 THR A OG1 1 
ATOM   1274  C CG2 . THR A 1 188 ? 9.897   -5.930  -42.564 1.00 50.75  ? 168 THR A CG2 1 
ATOM   1275  N N   . SER A 1 189 ? 9.377   -2.076  -41.380 1.00 45.33  ? 169 SER A N   1 
ATOM   1276  C CA  . SER A 1 189 ? 8.765   -0.818  -40.973 1.00 43.68  ? 169 SER A CA  1 
ATOM   1277  C C   . SER A 1 189 ? 9.574   0.339   -41.538 1.00 42.11  ? 169 SER A C   1 
ATOM   1278  O O   . SER A 1 189 ? 9.040   1.304   -42.071 1.00 37.94  ? 169 SER A O   1 
ATOM   1279  C CB  . SER A 1 189 ? 8.747   -0.710  -39.455 1.00 42.99  ? 169 SER A CB  1 
ATOM   1280  O OG  . SER A 1 189 ? 7.657   -1.428  -38.944 1.00 45.31  ? 169 SER A OG  1 
ATOM   1281  N N   . ILE A 1 190 ? 10.882  0.224   -41.397 1.00 40.92  ? 170 ILE A N   1 
ATOM   1282  C CA  . ILE A 1 190 ? 11.781  1.241   -41.875 1.00 41.08  ? 170 ILE A CA  1 
ATOM   1283  C C   . ILE A 1 190 ? 11.769  1.339   -43.387 1.00 41.93  ? 170 ILE A C   1 
ATOM   1284  O O   . ILE A 1 190 ? 11.902  2.423   -43.932 1.00 44.27  ? 170 ILE A O   1 
ATOM   1285  C CB  . ILE A 1 190 ? 13.201  0.967   -41.389 1.00 40.86  ? 170 ILE A CB  1 
ATOM   1286  C CG1 . ILE A 1 190 ? 13.303  1.374   -39.928 1.00 39.12  ? 170 ILE A CG1 1 
ATOM   1287  C CG2 . ILE A 1 190 ? 14.217  1.756   -42.200 1.00 40.48  ? 170 ILE A CG2 1 
ATOM   1288  C CD1 . ILE A 1 190 ? 14.515  0.793   -39.256 1.00 39.05  ? 170 ILE A CD1 1 
ATOM   1289  N N   . ALA A 1 191 ? 11.594  0.220   -44.069 1.00 42.16  ? 171 ALA A N   1 
ATOM   1290  C CA  . ALA A 1 191 ? 11.585  0.244   -45.533 1.00 43.23  ? 171 ALA A CA  1 
ATOM   1291  C C   . ALA A 1 191 ? 10.322  0.860   -46.111 1.00 42.96  ? 171 ALA A C   1 
ATOM   1292  O O   . ALA A 1 191 ? 10.319  1.305   -47.259 1.00 46.16  ? 171 ALA A O   1 
ATOM   1293  C CB  . ALA A 1 191 ? 11.782  -1.147  -46.098 1.00 44.30  ? 171 ALA A CB  1 
ATOM   1294  N N   . ILE A 1 192 ? 9.250   0.904   -45.338 1.00 43.05  ? 172 ILE A N   1 
ATOM   1295  C CA  . ILE A 1 192 ? 8.076   1.658   -45.786 1.00 43.42  ? 172 ILE A CA  1 
ATOM   1296  C C   . ILE A 1 192 ? 8.076   3.076   -45.245 1.00 44.20  ? 172 ILE A C   1 
ATOM   1297  O O   . ILE A 1 192 ? 7.062   3.761   -45.276 1.00 45.61  ? 172 ILE A O   1 
ATOM   1298  C CB  . ILE A 1 192 ? 6.780   0.949   -45.432 1.00 42.18  ? 172 ILE A CB  1 
ATOM   1299  C CG1 . ILE A 1 192 ? 6.695   0.691   -43.933 1.00 41.97  ? 172 ILE A CG1 1 
ATOM   1300  C CG2 . ILE A 1 192 ? 6.726   -0.361  -46.178 1.00 42.19  ? 172 ILE A CG2 1 
ATOM   1301  C CD1 . ILE A 1 192 ? 5.307   0.283   -43.493 1.00 42.35  ? 172 ILE A CD1 1 
ATOM   1302  N N   . GLY A 1 193 ? 9.227   3.499   -44.735 1.00 49.47  ? 173 GLY A N   1 
ATOM   1303  C CA  . GLY A 1 193 ? 9.464   4.904   -44.390 1.00 51.35  ? 173 GLY A CA  1 
ATOM   1304  C C   . GLY A 1 193 ? 8.872   5.279   -43.056 1.00 51.64  ? 173 GLY A C   1 
ATOM   1305  O O   . GLY A 1 193 ? 8.555   6.446   -42.814 1.00 55.09  ? 173 GLY A O   1 
ATOM   1306  N N   . LYS A 1 194 ? 8.726   4.279   -42.196 1.00 49.26  ? 174 LYS A N   1 
ATOM   1307  C CA  . LYS A 1 194 ? 8.136   4.472   -40.895 1.00 44.72  ? 174 LYS A CA  1 
ATOM   1308  C C   . LYS A 1 194 ? 9.224   4.383   -39.877 1.00 44.35  ? 174 LYS A C   1 
ATOM   1309  O O   . LYS A 1 194 ? 10.373  4.122   -40.209 1.00 43.61  ? 174 LYS A O   1 
ATOM   1310  C CB  . LYS A 1 194 ? 7.077   3.425   -40.654 1.00 43.92  ? 174 LYS A CB  1 
ATOM   1311  C CG  . LYS A 1 194 ? 6.035   3.454   -41.740 1.00 45.60  ? 174 LYS A CG  1 
ATOM   1312  C CD  . LYS A 1 194 ? 4.797   4.199   -41.320 1.00 45.64  ? 174 LYS A CD  1 
ATOM   1313  C CE  . LYS A 1 194 ? 3.724   4.022   -42.374 1.00 46.30  ? 174 LYS A CE  1 
ATOM   1314  N NZ  . LYS A 1 194 ? 2.997   5.292   -42.590 1.00 48.42  ? 174 LYS A NZ  1 
ATOM   1315  N N   . ASP A 1 195 ? 8.847   4.632   -38.636 1.00 45.26  ? 175 ASP A N   1 
ATOM   1316  C CA  . ASP A 1 195 ? 9.778   4.706   -37.551 1.00 47.49  ? 175 ASP A CA  1 
ATOM   1317  C C   . ASP A 1 195 ? 9.305   3.833   -36.393 1.00 46.36  ? 175 ASP A C   1 
ATOM   1318  O O   . ASP A 1 195 ? 8.419   4.207   -35.651 1.00 45.04  ? 175 ASP A O   1 
ATOM   1319  C CB  . ASP A 1 195 ? 9.879   6.152   -37.109 1.00 51.00  ? 175 ASP A CB  1 
ATOM   1320  C CG  . ASP A 1 195 ? 11.254  6.506   -36.643 1.00 55.37  ? 175 ASP A CG  1 
ATOM   1321  O OD1 . ASP A 1 195 ? 12.023  5.597   -36.224 1.00 55.11  ? 175 ASP A OD1 1 
ATOM   1322  O OD2 . ASP A 1 195 ? 11.559  7.709   -36.697 1.00 61.02  ? 175 ASP A OD2 1 
ATOM   1323  N N   . PRO A 1 196 ? 9.891   2.652   -36.249 1.00 46.22  ? 176 PRO A N   1 
ATOM   1324  C CA  . PRO A 1 196 ? 9.411   1.703   -35.276 1.00 43.71  ? 176 PRO A CA  1 
ATOM   1325  C C   . PRO A 1 196 ? 10.000  1.880   -33.908 1.00 39.63  ? 176 PRO A C   1 
ATOM   1326  O O   . PRO A 1 196 ? 11.160  2.236   -33.771 1.00 35.41  ? 176 PRO A O   1 
ATOM   1327  C CB  . PRO A 1 196 ? 9.904   0.374   -35.830 1.00 47.71  ? 176 PRO A CB  1 
ATOM   1328  C CG  . PRO A 1 196 ? 11.116  0.747   -36.612 1.00 48.13  ? 176 PRO A CG  1 
ATOM   1329  C CD  . PRO A 1 196 ? 10.668  1.987   -37.299 1.00 47.59  ? 176 PRO A CD  1 
ATOM   1330  N N   . VAL A 1 197 ? 9.189   1.577   -32.908 1.00 37.44  ? 177 VAL A N   1 
ATOM   1331  C CA  . VAL A 1 197 ? 9.641   1.511   -31.539 1.00 36.85  ? 177 VAL A CA  1 
ATOM   1332  C C   . VAL A 1 197 ? 9.318   0.120   -31.028 1.00 37.54  ? 177 VAL A C   1 
ATOM   1333  O O   . VAL A 1 197 ? 8.303   -0.460  -31.403 1.00 36.74  ? 177 VAL A O   1 
ATOM   1334  C CB  . VAL A 1 197 ? 8.959   2.571   -30.656 1.00 37.27  ? 177 VAL A CB  1 
ATOM   1335  C CG1 . VAL A 1 197 ? 9.340   3.958   -31.116 1.00 36.94  ? 177 VAL A CG1 1 
ATOM   1336  C CG2 . VAL A 1 197 ? 7.442   2.426   -30.668 1.00 35.91  ? 177 VAL A CG2 1 
ATOM   1337  N N   . GLU A 1 198 ? 10.185  -0.402  -30.168 1.00 40.27  ? 178 GLU A N   1 
ATOM   1338  C CA  . GLU A 1 198 ? 10.009  -1.732  -29.612 1.00 41.28  ? 178 GLU A CA  1 
ATOM   1339  C C   . GLU A 1 198 ? 9.247   -1.645  -28.317 1.00 40.44  ? 178 GLU A C   1 
ATOM   1340  O O   . GLU A 1 198 ? 9.662   -0.947  -27.402 1.00 40.86  ? 178 GLU A O   1 
ATOM   1341  C CB  . GLU A 1 198 ? 11.352  -2.414  -29.388 1.00 41.44  ? 178 GLU A CB  1 
ATOM   1342  C CG  . GLU A 1 198 ? 11.216  -3.884  -29.028 1.00 44.60  ? 178 GLU A CG  1 
ATOM   1343  C CD  . GLU A 1 198 ? 12.549  -4.585  -28.824 1.00 47.67  ? 178 GLU A CD  1 
ATOM   1344  O OE1 . GLU A 1 198 ? 13.546  -4.182  -29.463 1.00 49.06  ? 178 GLU A OE1 1 
ATOM   1345  O OE2 . GLU A 1 198 ? 12.597  -5.548  -28.017 1.00 45.21  ? 178 GLU A OE2 1 
ATOM   1346  N N   . VAL A 1 199 ? 8.133   -2.366  -28.257 1.00 39.05  ? 179 VAL A N   1 
ATOM   1347  C CA  . VAL A 1 199 ? 7.258   -2.349  -27.105 1.00 39.72  ? 179 VAL A CA  1 
ATOM   1348  C C   . VAL A 1 199 ? 6.977   -3.776  -26.690 1.00 39.34  ? 179 VAL A C   1 
ATOM   1349  O O   . VAL A 1 199 ? 6.510   -4.572  -27.489 1.00 40.18  ? 179 VAL A O   1 
ATOM   1350  C CB  . VAL A 1 199 ? 5.918   -1.687  -27.457 1.00 40.97  ? 179 VAL A CB  1 
ATOM   1351  C CG1 . VAL A 1 199 ? 5.051   -1.526  -26.232 1.00 39.93  ? 179 VAL A CG1 1 
ATOM   1352  C CG2 . VAL A 1 199 ? 6.151   -0.325  -28.072 1.00 43.43  ? 179 VAL A CG2 1 
ATOM   1353  N N   . ALA A 1 200 ? 7.252   -4.104  -25.439 1.00 37.63  ? 180 ALA A N   1 
ATOM   1354  C CA  . ALA A 1 200 ? 6.827   -5.388  -24.920 1.00 37.22  ? 180 ALA A CA  1 
ATOM   1355  C C   . ALA A 1 200 ? 5.336   -5.293  -24.613 1.00 37.74  ? 180 ALA A C   1 
ATOM   1356  O O   . ALA A 1 200 ? 4.891   -4.352  -23.971 1.00 38.77  ? 180 ALA A O   1 
ATOM   1357  C CB  . ALA A 1 200 ? 7.593   -5.717  -23.671 1.00 34.68  ? 180 ALA A CB  1 
ATOM   1358  N N   . GLU A 1 201 ? 4.563   -6.262  -25.063 1.00 34.25  ? 181 GLU A N   1 
ATOM   1359  C CA  . GLU A 1 201 ? 3.137   -6.250  -24.800 1.00 34.15  ? 181 GLU A CA  1 
ATOM   1360  C C   . GLU A 1 201 ? 2.800   -5.855  -23.379 1.00 33.99  ? 181 GLU A C   1 
ATOM   1361  O O   . GLU A 1 201 ? 3.268   -6.469  -22.436 1.00 31.80  ? 181 GLU A O   1 
ATOM   1362  C CB  . GLU A 1 201 ? 2.523   -7.610  -25.048 1.00 34.73  ? 181 GLU A CB  1 
ATOM   1363  C CG  . GLU A 1 201 ? 1.021   -7.552  -24.903 1.00 35.86  ? 181 GLU A CG  1 
ATOM   1364  C CD  . GLU A 1 201 ? 0.355   -8.907  -24.947 1.00 35.77  ? 181 GLU A CD  1 
ATOM   1365  O OE1 . GLU A 1 201 ? 0.784   -9.782  -25.717 1.00 36.91  ? 181 GLU A OE1 1 
ATOM   1366  O OE2 . GLU A 1 201 ? -0.629  -9.086  -24.230 1.00 35.32  ? 181 GLU A OE2 1 
ATOM   1367  N N   . ALA A 1 202 ? 1.969   -4.826  -23.264 1.00 35.01  ? 182 ALA A N   1 
ATOM   1368  C CA  . ALA A 1 202 ? 1.395   -4.380  -21.999 1.00 35.39  ? 182 ALA A CA  1 
ATOM   1369  C C   . ALA A 1 202 ? 0.237   -3.458  -22.347 1.00 36.48  ? 182 ALA A C   1 
ATOM   1370  O O   . ALA A 1 202 ? 0.160   -2.967  -23.461 1.00 41.91  ? 182 ALA A O   1 
ATOM   1371  C CB  . ALA A 1 202 ? 2.421   -3.655  -21.161 1.00 34.27  ? 182 ALA A CB  1 
ATOM   1372  N N   . PRO A 1 203 ? -0.680  -3.227  -21.413 1.00 34.96  ? 183 PRO A N   1 
ATOM   1373  C CA  . PRO A 1 203 ? -1.905  -2.478  -21.751 1.00 36.81  ? 183 PRO A CA  1 
ATOM   1374  C C   . PRO A 1 203 ? -1.662  -1.055  -22.268 1.00 36.21  ? 183 PRO A C   1 
ATOM   1375  O O   . PRO A 1 203 ? -0.911  -0.304  -21.664 1.00 37.43  ? 183 PRO A O   1 
ATOM   1376  C CB  . PRO A 1 203 ? -2.650  -2.404  -20.417 1.00 37.17  ? 183 PRO A CB  1 
ATOM   1377  C CG  . PRO A 1 203 ? -2.057  -3.485  -19.578 1.00 36.26  ? 183 PRO A CG  1 
ATOM   1378  C CD  . PRO A 1 203 ? -0.626  -3.599  -19.992 1.00 35.02  ? 183 PRO A CD  1 
ATOM   1379  N N   . GLY A 1 204 ? -2.304  -0.714  -23.378 1.00 35.66  ? 184 GLY A N   1 
ATOM   1380  C CA  . GLY A 1 204 ? -2.104  0.567   -24.052 1.00 35.85  ? 184 GLY A CA  1 
ATOM   1381  C C   . GLY A 1 204 ? -0.707  0.843   -24.603 1.00 37.23  ? 184 GLY A C   1 
ATOM   1382  O O   . GLY A 1 204 ? -0.427  1.967   -25.013 1.00 39.32  ? 184 GLY A O   1 
ATOM   1383  N N   . PHE A 1 205 ? 0.178   -0.148  -24.626 1.00 35.26  ? 185 PHE A N   1 
ATOM   1384  C CA  . PHE A 1 205 ? 1.486   0.043   -25.244 1.00 33.89  ? 185 PHE A CA  1 
ATOM   1385  C C   . PHE A 1 205 ? 2.176   1.304   -24.696 1.00 34.19  ? 185 PHE A C   1 
ATOM   1386  O O   . PHE A 1 205 ? 2.306   1.440   -23.493 1.00 30.58  ? 185 PHE A O   1 
ATOM   1387  C CB  . PHE A 1 205 ? 1.336   0.134   -26.761 1.00 34.42  ? 185 PHE A CB  1 
ATOM   1388  C CG  . PHE A 1 205 ? 0.504   -0.956  -27.362 1.00 33.50  ? 185 PHE A CG  1 
ATOM   1389  C CD1 . PHE A 1 205 ? 0.424   -2.215  -26.768 1.00 35.22  ? 185 PHE A CD1 1 
ATOM   1390  C CD2 . PHE A 1 205 ? -0.148  -0.750  -28.553 1.00 31.67  ? 185 PHE A CD2 1 
ATOM   1391  C CE1 . PHE A 1 205 ? -0.326  -3.226  -27.339 1.00 32.77  ? 185 PHE A CE1 1 
ATOM   1392  C CE2 . PHE A 1 205 ? -0.906  -1.757  -29.131 1.00 33.11  ? 185 PHE A CE2 1 
ATOM   1393  C CZ  . PHE A 1 205 ? -0.999  -2.999  -28.521 1.00 31.99  ? 185 PHE A CZ  1 
ATOM   1394  N N   . VAL A 1 206 ? 2.616   2.221   -25.560 1.00 34.25  ? 186 VAL A N   1 
ATOM   1395  C CA  . VAL A 1 206 ? 3.128   3.482   -25.078 1.00 33.31  ? 186 VAL A CA  1 
ATOM   1396  C C   . VAL A 1 206 ? 2.149   4.631   -25.284 1.00 34.17  ? 186 VAL A C   1 
ATOM   1397  O O   . VAL A 1 206 ? 1.728   5.282   -24.327 1.00 35.00  ? 186 VAL A O   1 
ATOM   1398  C CB  . VAL A 1 206 ? 4.446   3.837   -25.743 1.00 34.39  ? 186 VAL A CB  1 
ATOM   1399  C CG1 . VAL A 1 206 ? 4.984   5.117   -25.142 1.00 36.12  ? 186 VAL A CG1 1 
ATOM   1400  C CG2 . VAL A 1 206 ? 5.453   2.730   -25.511 1.00 35.55  ? 186 VAL A CG2 1 
ATOM   1401  N N   . VAL A 1 207 ? 1.797   4.896   -26.526 1.00 31.82  ? 187 VAL A N   1 
ATOM   1402  C CA  . VAL A 1 207 ? 1.022   6.069   -26.809 1.00 31.72  ? 187 VAL A CA  1 
ATOM   1403  C C   . VAL A 1 207 ? -0.289  6.118   -26.041 1.00 33.56  ? 187 VAL A C   1 
ATOM   1404  O O   . VAL A 1 207 ? -0.495  7.040   -25.273 1.00 36.17  ? 187 VAL A O   1 
ATOM   1405  C CB  . VAL A 1 207 ? 0.742   6.229   -28.296 1.00 31.01  ? 187 VAL A CB  1 
ATOM   1406  C CG1 . VAL A 1 207 ? -0.137  7.458   -28.496 1.00 30.48  ? 187 VAL A CG1 1 
ATOM   1407  C CG2 . VAL A 1 207 ? 2.054   6.377   -29.050 1.00 30.20  ? 187 VAL A CG2 1 
ATOM   1408  N N   . ASN A 1 208 ? -1.175  5.152   -26.257 1.00 34.52  ? 188 ASN A N   1 
ATOM   1409  C CA  . ASN A 1 208 ? -2.486  5.179   -25.613 1.00 34.66  ? 188 ASN A CA  1 
ATOM   1410  C C   . ASN A 1 208 ? -2.367  5.146   -24.102 1.00 34.70  ? 188 ASN A C   1 
ATOM   1411  O O   . ASN A 1 208 ? -3.153  5.763   -23.389 1.00 34.52  ? 188 ASN A O   1 
ATOM   1412  C CB  . ASN A 1 208 ? -3.338  4.016   -26.078 1.00 35.35  ? 188 ASN A CB  1 
ATOM   1413  C CG  . ASN A 1 208 ? -3.838  4.191   -27.500 1.00 37.55  ? 188 ASN A CG  1 
ATOM   1414  O OD1 . ASN A 1 208 ? -3.902  5.287   -28.009 1.00 40.40  ? 188 ASN A OD1 1 
ATOM   1415  N ND2 . ASN A 1 208 ? -4.206  3.099   -28.136 1.00 41.54  ? 188 ASN A ND2 1 
ATOM   1416  N N   . ARG A 1 209 ? -1.364  4.435   -23.617 1.00 33.58  ? 189 ARG A N   1 
ATOM   1417  C CA  . ARG A 1 209 ? -1.168  4.285   -22.186 1.00 34.55  ? 189 ARG A CA  1 
ATOM   1418  C C   . ARG A 1 209 ? -0.933  5.630   -21.508 1.00 32.34  ? 189 ARG A C   1 
ATOM   1419  O O   . ARG A 1 209 ? -1.334  5.829   -20.372 1.00 33.87  ? 189 ARG A O   1 
ATOM   1420  C CB  . ARG A 1 209 ? 0.006   3.316   -21.932 1.00 36.65  ? 189 ARG A CB  1 
ATOM   1421  C CG  . ARG A 1 209 ? 0.482   3.160   -20.483 1.00 38.19  ? 189 ARG A CG  1 
ATOM   1422  C CD  . ARG A 1 209 ? -0.535  2.400   -19.699 1.00 40.83  ? 189 ARG A CD  1 
ATOM   1423  N NE  . ARG A 1 209 ? -0.188  2.186   -18.298 1.00 46.83  ? 189 ARG A NE  1 
ATOM   1424  C CZ  . ARG A 1 209 ? -0.125  0.989   -17.705 1.00 46.62  ? 189 ARG A CZ  1 
ATOM   1425  N NH1 . ARG A 1 209 ? -0.349  -0.129  -18.393 1.00 51.95  ? 189 ARG A NH1 1 
ATOM   1426  N NH2 . ARG A 1 209 ? 0.154   0.893   -16.414 1.00 41.52  ? 189 ARG A NH2 1 
ATOM   1427  N N   . ILE A 1 210 ? -0.258  6.538   -22.196 1.00 33.40  ? 190 ILE A N   1 
ATOM   1428  C CA  . ILE A 1 210 ? 0.021   7.870   -21.649 1.00 33.27  ? 190 ILE A CA  1 
ATOM   1429  C C   . ILE A 1 210 ? -1.024  8.896   -22.043 1.00 32.31  ? 190 ILE A C   1 
ATOM   1430  O O   . ILE A 1 210 ? -1.457  9.698   -21.227 1.00 32.34  ? 190 ILE A O   1 
ATOM   1431  C CB  . ILE A 1 210 ? 1.370   8.390   -22.125 1.00 32.66  ? 190 ILE A CB  1 
ATOM   1432  C CG1 . ILE A 1 210 ? 2.477   7.588   -21.475 1.00 32.19  ? 190 ILE A CG1 1 
ATOM   1433  C CG2 . ILE A 1 210 ? 1.544   9.826   -21.706 1.00 33.88  ? 190 ILE A CG2 1 
ATOM   1434  C CD1 . ILE A 1 210 ? 3.768   7.717   -22.215 1.00 31.56  ? 190 ILE A CD1 1 
ATOM   1435  N N   . LEU A 1 211 ? -1.417  8.852   -23.299 1.00 32.20  ? 191 LEU A N   1 
ATOM   1436  C CA  . LEU A 1 211 ? -2.266  9.857   -23.867 1.00 32.57  ? 191 LEU A CA  1 
ATOM   1437  C C   . LEU A 1 211 ? -3.707  9.798   -23.397 1.00 33.73  ? 191 LEU A C   1 
ATOM   1438  O O   . LEU A 1 211 ? -4.311  10.823  -23.140 1.00 35.18  ? 191 LEU A O   1 
ATOM   1439  C CB  . LEU A 1 211 ? -2.252  9.714   -25.367 1.00 32.43  ? 191 LEU A CB  1 
ATOM   1440  C CG  . LEU A 1 211 ? -2.910  10.848  -26.121 1.00 33.95  ? 191 LEU A CG  1 
ATOM   1441  C CD1 . LEU A 1 211 ? -2.100  12.130  -25.962 1.00 34.93  ? 191 LEU A CD1 1 
ATOM   1442  C CD2 . LEU A 1 211 ? -3.008  10.456  -27.576 1.00 33.45  ? 191 LEU A CD2 1 
ATOM   1443  N N   . ILE A 1 212 ? -4.284  8.621   -23.304 1.00 33.28  ? 192 ILE A N   1 
ATOM   1444  C CA  . ILE A 1 212 ? -5.722  8.566   -23.067 1.00 32.65  ? 192 ILE A CA  1 
ATOM   1445  C C   . ILE A 1 212 ? -6.093  8.942   -21.617 1.00 31.94  ? 192 ILE A C   1 
ATOM   1446  O O   . ILE A 1 212 ? -7.090  9.610   -21.384 1.00 31.06  ? 192 ILE A O   1 
ATOM   1447  C CB  . ILE A 1 212 ? -6.308  7.208   -23.504 1.00 33.37  ? 192 ILE A CB  1 
ATOM   1448  C CG1 . ILE A 1 212 ? -5.977  6.933   -24.972 1.00 33.63  ? 192 ILE A CG1 1 
ATOM   1449  C CG2 . ILE A 1 212 ? -7.819  7.197   -23.347 1.00 33.90  ? 192 ILE A CG2 1 
ATOM   1450  C CD1 . ILE A 1 212 ? -6.601  7.924   -25.951 1.00 33.58  ? 192 ILE A CD1 1 
ATOM   1451  N N   . PRO A 1 213 ? -5.296  8.516   -20.641 1.00 32.14  ? 193 PRO A N   1 
ATOM   1452  C CA  . PRO A 1 213 ? -5.480  9.011   -19.279 1.00 33.32  ? 193 PRO A CA  1 
ATOM   1453  C C   . PRO A 1 213 ? -5.317  10.522  -19.138 1.00 33.21  ? 193 PRO A C   1 
ATOM   1454  O O   . PRO A 1 213 ? -5.890  11.123  -18.224 1.00 31.65  ? 193 PRO A O   1 
ATOM   1455  C CB  . PRO A 1 213 ? -4.386  8.288   -18.500 1.00 33.06  ? 193 PRO A CB  1 
ATOM   1456  C CG  . PRO A 1 213 ? -4.205  7.015   -19.233 1.00 32.80  ? 193 PRO A CG  1 
ATOM   1457  C CD  . PRO A 1 213 ? -4.412  7.340   -20.677 1.00 32.92  ? 193 PRO A CD  1 
ATOM   1458  N N   . MET A 1 214 ? -4.550  11.126  -20.030 1.00 34.50  ? 194 MET A N   1 
ATOM   1459  C CA  . MET A 1 214 ? -4.454  12.581  -20.083 1.00 37.67  ? 194 MET A CA  1 
ATOM   1460  C C   . MET A 1 214 ? -5.831  13.162  -20.343 1.00 35.09  ? 194 MET A C   1 
ATOM   1461  O O   . MET A 1 214 ? -6.236  14.129  -19.740 1.00 33.41  ? 194 MET A O   1 
ATOM   1462  C CB  . MET A 1 214 ? -3.583  12.993  -21.244 1.00 44.19  ? 194 MET A CB  1 
ATOM   1463  C CG  . MET A 1 214 ? -2.252  13.614  -20.934 1.00 50.97  ? 194 MET A CG  1 
ATOM   1464  S SD  . MET A 1 214 ? -1.564  14.453  -22.387 1.00 59.03  ? 194 MET A SD  1 
ATOM   1465  C CE  . MET A 1 214 ? -3.022  14.843  -23.383 1.00 52.52  ? 194 MET A CE  1 
ATOM   1466  N N   . ILE A 1 215 ? -6.530  12.564  -21.288 1.00 32.08  ? 195 ILE A N   1 
ATOM   1467  C CA  . ILE A 1 215 ? -7.822  13.036  -21.683 1.00 31.90  ? 195 ILE A CA  1 
ATOM   1468  C C   . ILE A 1 215 ? -8.813  12.769  -20.579 1.00 31.21  ? 195 ILE A C   1 
ATOM   1469  O O   . ILE A 1 215 ? -9.658  13.608  -20.286 1.00 29.66  ? 195 ILE A O   1 
ATOM   1470  C CB  . ILE A 1 215 ? -8.276  12.346  -22.973 1.00 32.10  ? 195 ILE A CB  1 
ATOM   1471  C CG1 . ILE A 1 215 ? -7.368  12.784  -24.108 1.00 33.56  ? 195 ILE A CG1 1 
ATOM   1472  C CG2 . ILE A 1 215 ? -9.709  12.711  -23.310 1.00 31.98  ? 195 ILE A CG2 1 
ATOM   1473  C CD1 . ILE A 1 215 ? -7.465  11.917  -25.342 1.00 34.49  ? 195 ILE A CD1 1 
ATOM   1474  N N   . ASN A 1 216 ? -8.690  11.596  -19.972 1.00 30.03  ? 196 ASN A N   1 
ATOM   1475  C CA  . ASN A 1 216 ? -9.597  11.181  -18.922 1.00 28.61  ? 196 ASN A CA  1 
ATOM   1476  C C   . ASN A 1 216 ? -9.394  12.079  -17.727 1.00 30.04  ? 196 ASN A C   1 
ATOM   1477  O O   . ASN A 1 216 ? -10.318 12.334  -16.985 1.00 31.00  ? 196 ASN A O   1 
ATOM   1478  C CB  . ASN A 1 216 ? -9.318  9.728   -18.541 1.00 28.37  ? 196 ASN A CB  1 
ATOM   1479  C CG  . ASN A 1 216 ? -10.263 9.197   -17.467 1.00 26.11  ? 196 ASN A CG  1 
ATOM   1480  O OD1 . ASN A 1 216 ? -11.447 9.005   -17.711 1.00 25.28  ? 196 ASN A OD1 1 
ATOM   1481  N ND2 . ASN A 1 216 ? -9.732  8.931   -16.291 1.00 23.51  ? 196 ASN A ND2 1 
ATOM   1482  N N   . GLU A 1 217 ? -8.171  12.549  -17.521 1.00 31.34  ? 197 GLU A N   1 
ATOM   1483  C CA  . GLU A 1 217 ? -7.919  13.488  -16.437 1.00 30.85  ? 197 GLU A CA  1 
ATOM   1484  C C   . GLU A 1 217 ? -8.571  14.847  -16.715 1.00 31.32  ? 197 GLU A C   1 
ATOM   1485  O O   . GLU A 1 217 ? -9.170  15.452  -15.840 1.00 30.21  ? 197 GLU A O   1 
ATOM   1486  C CB  . GLU A 1 217 ? -6.431  13.667  -16.237 1.00 31.85  ? 197 GLU A CB  1 
ATOM   1487  C CG  . GLU A 1 217 ? -6.103  14.506  -15.018 1.00 34.77  ? 197 GLU A CG  1 
ATOM   1488  C CD  . GLU A 1 217 ? -6.208  13.725  -13.720 1.00 37.24  ? 197 GLU A CD  1 
ATOM   1489  O OE1 . GLU A 1 217 ? -5.733  12.589  -13.674 1.00 43.06  ? 197 GLU A OE1 1 
ATOM   1490  O OE2 . GLU A 1 217 ? -6.749  14.242  -12.734 1.00 40.77  ? 197 GLU A OE2 1 
ATOM   1491  N N   . ALA A 1 218 ? -8.452  15.319  -17.945 1.00 31.29  ? 198 ALA A N   1 
ATOM   1492  C CA  . ALA A 1 218 ? -9.121  16.541  -18.351 1.00 32.06  ? 198 ALA A CA  1 
ATOM   1493  C C   . ALA A 1 218 ? -10.619 16.467  -18.078 1.00 32.81  ? 198 ALA A C   1 
ATOM   1494  O O   . ALA A 1 218 ? -11.217 17.416  -17.584 1.00 32.31  ? 198 ALA A O   1 
ATOM   1495  C CB  . ALA A 1 218 ? -8.876  16.818  -19.821 1.00 32.11  ? 198 ALA A CB  1 
ATOM   1496  N N   . VAL A 1 219 ? -11.243 15.342  -18.372 1.00 33.59  ? 199 VAL A N   1 
ATOM   1497  C CA  . VAL A 1 219 ? -12.666 15.300  -18.110 1.00 33.66  ? 199 VAL A CA  1 
ATOM   1498  C C   . VAL A 1 219 ? -12.977 15.352  -16.618 1.00 34.27  ? 199 VAL A C   1 
ATOM   1499  O O   . VAL A 1 219 ? -13.998 15.937  -16.233 1.00 35.13  ? 199 VAL A O   1 
ATOM   1500  C CB  . VAL A 1 219 ? -13.462 14.221  -18.886 1.00 35.04  ? 199 VAL A CB  1 
ATOM   1501  C CG1 . VAL A 1 219 ? -12.619 13.450  -19.878 1.00 36.04  ? 199 VAL A CG1 1 
ATOM   1502  C CG2 . VAL A 1 219 ? -14.233 13.323  -17.951 1.00 35.18  ? 199 VAL A CG2 1 
ATOM   1503  N N   . GLY A 1 220 ? -12.098 14.813  -15.777 1.00 32.25  ? 200 GLY A N   1 
ATOM   1504  C CA  . GLY A 1 220 ? -12.303 14.924  -14.325 1.00 32.55  ? 200 GLY A CA  1 
ATOM   1505  C C   . GLY A 1 220 ? -12.201 16.358  -13.815 1.00 34.64  ? 200 GLY A C   1 
ATOM   1506  O O   . GLY A 1 220 ? -12.889 16.759  -12.880 1.00 37.03  ? 200 GLY A O   1 
ATOM   1507  N N   . ILE A 1 221 ? -11.340 17.137  -14.445 1.00 34.48  ? 201 ILE A N   1 
ATOM   1508  C CA  . ILE A 1 221 ? -11.197 18.528  -14.090 1.00 35.29  ? 201 ILE A CA  1 
ATOM   1509  C C   . ILE A 1 221 ? -12.443 19.314  -14.468 1.00 35.31  ? 201 ILE A C   1 
ATOM   1510  O O   . ILE A 1 221 ? -12.958 20.105  -13.679 1.00 34.17  ? 201 ILE A O   1 
ATOM   1511  C CB  . ILE A 1 221 ? -9.982  19.122  -14.785 1.00 34.54  ? 201 ILE A CB  1 
ATOM   1512  C CG1 . ILE A 1 221 ? -8.745  18.539  -14.115 1.00 34.22  ? 201 ILE A CG1 1 
ATOM   1513  C CG2 . ILE A 1 221 ? -9.981  20.624  -14.631 1.00 34.58  ? 201 ILE A CG2 1 
ATOM   1514  C CD1 . ILE A 1 221 ? -7.486  18.714  -14.914 1.00 34.27  ? 201 ILE A CD1 1 
ATOM   1515  N N   . LEU A 1 222 ? -12.910 19.081  -15.683 1.00 32.61  ? 202 LEU A N   1 
ATOM   1516  C CA  . LEU A 1 222 ? -14.170 19.617  -16.129 1.00 32.12  ? 202 LEU A CA  1 
ATOM   1517  C C   . LEU A 1 222 ? -15.340 19.222  -15.226 1.00 34.60  ? 202 LEU A C   1 
ATOM   1518  O O   . LEU A 1 222 ? -16.193 20.047  -14.936 1.00 36.71  ? 202 LEU A O   1 
ATOM   1519  C CB  . LEU A 1 222 ? -14.430 19.164  -17.557 1.00 29.99  ? 202 LEU A CB  1 
ATOM   1520  C CG  . LEU A 1 222 ? -15.792 19.573  -18.100 1.00 29.83  ? 202 LEU A CG  1 
ATOM   1521  C CD1 . LEU A 1 222 ? -15.855 21.075  -18.369 1.00 29.97  ? 202 LEU A CD1 1 
ATOM   1522  C CD2 . LEU A 1 222 ? -16.058 18.805  -19.378 1.00 28.38  ? 202 LEU A CD2 1 
ATOM   1523  N N   . ALA A 1 223 ? -15.362 17.973  -14.770 1.00 37.29  ? 203 ALA A N   1 
ATOM   1524  C CA  . ALA A 1 223 ? -16.507 17.452  -14.021 1.00 37.77  ? 203 ALA A CA  1 
ATOM   1525  C C   . ALA A 1 223 ? -16.654 18.133  -12.689 1.00 39.69  ? 203 ALA A C   1 
ATOM   1526  O O   . ALA A 1 223 ? -17.757 18.245  -12.157 1.00 42.14  ? 203 ALA A O   1 
ATOM   1527  C CB  . ALA A 1 223 ? -16.360 15.959  -13.790 1.00 37.02  ? 203 ALA A CB  1 
ATOM   1528  N N   . GLU A 1 224 ? -15.528 18.548  -12.131 1.00 40.89  ? 204 GLU A N   1 
ATOM   1529  C CA  . GLU A 1 224 ? -15.521 19.157  -10.820 1.00 42.70  ? 204 GLU A CA  1 
ATOM   1530  C C   . GLU A 1 224 ? -15.676 20.665  -10.870 1.00 40.48  ? 204 GLU A C   1 
ATOM   1531  O O   . GLU A 1 224 ? -15.559 21.347  -9.864  1.00 40.81  ? 204 GLU A O   1 
ATOM   1532  C CB  . GLU A 1 224 ? -14.261 18.750  -10.085 1.00 46.70  ? 204 GLU A CB  1 
ATOM   1533  C CG  . GLU A 1 224 ? -14.470 17.438  -9.359  1.00 54.06  ? 204 GLU A CG  1 
ATOM   1534  C CD  . GLU A 1 224 ? -13.249 16.994  -8.594  1.00 58.96  ? 204 GLU A CD  1 
ATOM   1535  O OE1 . GLU A 1 224 ? -13.347 16.911  -7.346  1.00 56.60  ? 204 GLU A OE1 1 
ATOM   1536  O OE2 . GLU A 1 224 ? -12.202 16.742  -9.242  1.00 61.32  ? 204 GLU A OE2 1 
ATOM   1537  N N   . GLY A 1 225 ? -15.951 21.189  -12.049 1.00 38.64  ? 205 GLY A N   1 
ATOM   1538  C CA  . GLY A 1 225 ? -16.128 22.614  -12.199 1.00 38.42  ? 205 GLY A CA  1 
ATOM   1539  C C   . GLY A 1 225 ? -14.852 23.407  -12.010 1.00 37.33  ? 205 GLY A C   1 
ATOM   1540  O O   . GLY A 1 225 ? -14.914 24.593  -11.774 1.00 37.73  ? 205 GLY A O   1 
ATOM   1541  N N   . ILE A 1 226 ? -13.698 22.768  -12.140 1.00 36.43  ? 206 ILE A N   1 
ATOM   1542  C CA  . ILE A 1 226 ? -12.435 23.445  -11.915 1.00 38.13  ? 206 ILE A CA  1 
ATOM   1543  C C   . ILE A 1 226 ? -12.156 24.439  -13.025 1.00 39.84  ? 206 ILE A C   1 
ATOM   1544  O O   . ILE A 1 226 ? -11.665 25.533  -12.770 1.00 36.34  ? 206 ILE A O   1 
ATOM   1545  C CB  . ILE A 1 226 ? -11.268 22.461  -11.840 1.00 39.08  ? 206 ILE A CB  1 
ATOM   1546  C CG1 . ILE A 1 226 ? -11.197 21.784  -10.478 1.00 41.37  ? 206 ILE A CG1 1 
ATOM   1547  C CG2 . ILE A 1 226 ? -9.959  23.181  -11.993 1.00 39.34  ? 206 ILE A CG2 1 
ATOM   1548  C CD1 . ILE A 1 226 ? -12.545 21.478  -9.898  1.00 44.15  ? 206 ILE A CD1 1 
ATOM   1549  N N   . ALA A 1 227 ? -12.445 24.042  -14.254 1.00 38.79  ? 207 ALA A N   1 
ATOM   1550  C CA  . ALA A 1 227 ? -12.274 24.926  -15.379 1.00 37.52  ? 207 ALA A CA  1 
ATOM   1551  C C   . ALA A 1 227 ? -13.281 24.545  -16.440 1.00 37.92  ? 207 ALA A C   1 
ATOM   1552  O O   . ALA A 1 227 ? -13.974 23.535  -16.323 1.00 41.58  ? 207 ALA A O   1 
ATOM   1553  C CB  . ALA A 1 227 ? -10.857 24.814  -15.913 1.00 36.81  ? 207 ALA A CB  1 
ATOM   1554  N N   . SER A 1 228 ? -13.349 25.361  -17.480 1.00 35.25  ? 208 SER A N   1 
ATOM   1555  C CA  . SER A 1 228 ? -14.266 25.130  -18.567 1.00 34.32  ? 208 SER A CA  1 
ATOM   1556  C C   . SER A 1 228 ? -13.532 24.364  -19.645 1.00 34.74  ? 208 SER A C   1 
ATOM   1557  O O   . SER A 1 228 ? -12.296 24.239  -19.604 1.00 34.84  ? 208 SER A O   1 
ATOM   1558  C CB  . SER A 1 228 ? -14.764 26.448  -19.125 1.00 32.55  ? 208 SER A CB  1 
ATOM   1559  O OG  . SER A 1 228 ? -13.697 27.161  -19.713 1.00 33.99  ? 208 SER A OG  1 
ATOM   1560  N N   . VAL A 1 229 ? -14.269 23.861  -20.624 1.00 34.23  ? 209 VAL A N   1 
ATOM   1561  C CA  . VAL A 1 229 ? -13.615 23.011  -21.616 1.00 35.72  ? 209 VAL A CA  1 
ATOM   1562  C C   . VAL A 1 229 ? -12.596 23.853  -22.390 1.00 35.98  ? 209 VAL A C   1 
ATOM   1563  O O   . VAL A 1 229 ? -11.447 23.456  -22.552 1.00 36.99  ? 209 VAL A O   1 
ATOM   1564  C CB  . VAL A 1 229 ? -14.602 22.206  -22.500 1.00 38.50  ? 209 VAL A CB  1 
ATOM   1565  C CG1 . VAL A 1 229 ? -16.028 22.317  -22.004 1.00 40.97  ? 209 VAL A CG1 1 
ATOM   1566  C CG2 . VAL A 1 229 ? -14.530 22.588  -23.959 1.00 39.61  ? 209 VAL A CG2 1 
ATOM   1567  N N   . GLU A 1 230 ? -13.007 25.052  -22.773 1.00 38.27  ? 210 GLU A N   1 
ATOM   1568  C CA  . GLU A 1 230 ? -12.147 25.990  -23.499 1.00 41.04  ? 210 GLU A CA  1 
ATOM   1569  C C   . GLU A 1 230 ? -10.873 26.357  -22.738 1.00 38.57  ? 210 GLU A C   1 
ATOM   1570  O O   . GLU A 1 230 ? -9.793  26.405  -23.326 1.00 32.99  ? 210 GLU A O   1 
ATOM   1571  C CB  . GLU A 1 230 ? -12.927 27.256  -23.858 1.00 45.13  ? 210 GLU A CB  1 
ATOM   1572  C CG  . GLU A 1 230 ? -14.012 27.032  -24.909 1.00 52.49  ? 210 GLU A CG  1 
ATOM   1573  C CD  . GLU A 1 230 ? -15.353 26.490  -24.358 1.00 60.24  ? 210 GLU A CD  1 
ATOM   1574  O OE1 . GLU A 1 230 ? -16.236 26.162  -25.208 1.00 65.20  ? 210 GLU A OE1 1 
ATOM   1575  O OE2 . GLU A 1 230 ? -15.541 26.376  -23.101 1.00 51.93  ? 210 GLU A OE2 1 
ATOM   1576  N N   . ASP A 1 231 ? -10.992 26.598  -21.439 1.00 38.72  ? 211 ASP A N   1 
ATOM   1577  C CA  . ASP A 1 231 ? -9.810  26.948  -20.633 1.00 39.21  ? 211 ASP A CA  1 
ATOM   1578  C C   . ASP A 1 231 ? -8.854  25.800  -20.388 1.00 38.45  ? 211 ASP A C   1 
ATOM   1579  O O   . ASP A 1 231 ? -7.637  25.992  -20.388 1.00 37.79  ? 211 ASP A O   1 
ATOM   1580  C CB  . ASP A 1 231 ? -10.231 27.558  -19.303 1.00 40.64  ? 211 ASP A CB  1 
ATOM   1581  C CG  . ASP A 1 231 ? -10.611 29.030  -19.437 1.00 43.19  ? 211 ASP A CG  1 
ATOM   1582  O OD1 . ASP A 1 231 ? -10.366 29.611  -20.509 1.00 43.83  ? 211 ASP A OD1 1 
ATOM   1583  O OD2 . ASP A 1 231 ? -11.147 29.616  -18.477 1.00 45.92  ? 211 ASP A OD2 1 
ATOM   1584  N N   . ILE A 1 232 ? -9.411  24.617  -20.159 1.00 38.80  ? 212 ILE A N   1 
ATOM   1585  C CA  . ILE A 1 232 ? -8.623  23.413  -20.022 1.00 36.83  ? 212 ILE A CA  1 
ATOM   1586  C C   . ILE A 1 232 ? -7.804  23.194  -21.283 1.00 34.91  ? 212 ILE A C   1 
ATOM   1587  O O   . ILE A 1 232 ? -6.599  23.000  -21.231 1.00 32.98  ? 212 ILE A O   1 
ATOM   1588  C CB  . ILE A 1 232 ? -9.549  22.218  -19.826 1.00 39.24  ? 212 ILE A CB  1 
ATOM   1589  C CG1 . ILE A 1 232 ? -10.152 22.263  -18.437 1.00 39.35  ? 212 ILE A CG1 1 
ATOM   1590  C CG2 . ILE A 1 232 ? -8.794  20.909  -19.965 1.00 40.87  ? 212 ILE A CG2 1 
ATOM   1591  C CD1 . ILE A 1 232 ? -11.367 21.396  -18.292 1.00 39.14  ? 212 ILE A CD1 1 
ATOM   1592  N N   . ASP A 1 233 ? -8.457  23.229  -22.431 1.00 34.94  ? 213 ASP A N   1 
ATOM   1593  C CA  . ASP A 1 233 ? -7.719  23.056  -23.681 1.00 36.10  ? 213 ASP A CA  1 
ATOM   1594  C C   . ASP A 1 233 ? -6.724  24.177  -23.936 1.00 35.92  ? 213 ASP A C   1 
ATOM   1595  O O   . ASP A 1 233 ? -5.616  23.925  -24.407 1.00 36.94  ? 213 ASP A O   1 
ATOM   1596  C CB  . ASP A 1 233 ? -8.673  22.879  -24.865 1.00 35.57  ? 213 ASP A CB  1 
ATOM   1597  C CG  . ASP A 1 233 ? -9.269  21.473  -24.919 1.00 34.78  ? 213 ASP A CG  1 
ATOM   1598  O OD1 . ASP A 1 233 ? -8.882  20.636  -24.088 1.00 31.06  ? 213 ASP A OD1 1 
ATOM   1599  O OD2 . ASP A 1 233 ? -10.108 21.190  -25.790 1.00 34.62  ? 213 ASP A OD2 1 
ATOM   1600  N N   . LYS A 1 234 ? -7.100  25.406  -23.607 1.00 36.56  ? 214 LYS A N   1 
ATOM   1601  C CA  . LYS A 1 234 ? -6.191  26.519  -23.805 1.00 35.74  ? 214 LYS A CA  1 
ATOM   1602  C C   . LYS A 1 234 ? -4.992  26.335  -22.920 1.00 33.82  ? 214 LYS A C   1 
ATOM   1603  O O   . LYS A 1 234 ? -3.866  26.497  -23.368 1.00 33.63  ? 214 LYS A O   1 
ATOM   1604  C CB  . LYS A 1 234 ? -6.869  27.829  -23.483 1.00 38.16  ? 214 LYS A CB  1 
ATOM   1605  C CG  . LYS A 1 234 ? -5.926  29.019  -23.442 1.00 40.85  ? 214 LYS A CG  1 
ATOM   1606  C CD  . LYS A 1 234 ? -6.541  30.175  -24.201 1.00 43.78  ? 214 LYS A CD  1 
ATOM   1607  C CE  . LYS A 1 234 ? -7.187  31.160  -23.264 1.00 46.74  ? 214 LYS A CE  1 
ATOM   1608  N NZ  . LYS A 1 234 ? -8.258  31.915  -23.960 1.00 47.58  ? 214 LYS A NZ  1 
ATOM   1609  N N   . ALA A 1 235 ? -5.235  25.981  -21.664 1.00 32.06  ? 215 ALA A N   1 
ATOM   1610  C CA  . ALA A 1 235 ? -4.148  25.806  -20.713 1.00 33.12  ? 215 ALA A CA  1 
ATOM   1611  C C   . ALA A 1 235 ? -3.133  24.796  -21.194 1.00 34.61  ? 215 ALA A C   1 
ATOM   1612  O O   . ALA A 1 235 ? -1.950  24.978  -20.978 1.00 37.16  ? 215 ALA A O   1 
ATOM   1613  C CB  . ALA A 1 235 ? -4.675  25.400  -19.350 1.00 32.91  ? 215 ALA A CB  1 
ATOM   1614  N N   . MET A 1 236 ? -3.583  23.737  -21.852 1.00 35.31  ? 216 MET A N   1 
ATOM   1615  C CA  . MET A 1 236 ? -2.658  22.711  -22.317 1.00 35.17  ? 216 MET A CA  1 
ATOM   1616  C C   . MET A 1 236 ? -1.956  23.076  -23.612 1.00 35.28  ? 216 MET A C   1 
ATOM   1617  O O   . MET A 1 236 ? -0.803  22.722  -23.802 1.00 35.82  ? 216 MET A O   1 
ATOM   1618  C CB  . MET A 1 236 ? -3.375  21.373  -22.467 1.00 36.21  ? 216 MET A CB  1 
ATOM   1619  C CG  . MET A 1 236 ? -3.851  20.771  -21.147 1.00 34.80  ? 216 MET A CG  1 
ATOM   1620  S SD  . MET A 1 236 ? -2.549  20.540  -19.917 1.00 36.28  ? 216 MET A SD  1 
ATOM   1621  C CE  . MET A 1 236 ? -1.467  19.365  -20.728 1.00 34.46  ? 216 MET A CE  1 
ATOM   1622  N N   . LYS A 1 237 ? -2.630  23.777  -24.503 1.00 35.88  ? 217 LYS A N   1 
ATOM   1623  C CA  . LYS A 1 237 ? -1.940  24.246  -25.694 1.00 38.71  ? 217 LYS A CA  1 
ATOM   1624  C C   . LYS A 1 237 ? -0.853  25.241  -25.350 1.00 38.60  ? 217 LYS A C   1 
ATOM   1625  O O   . LYS A 1 237 ? 0.259   25.123  -25.848 1.00 38.59  ? 217 LYS A O   1 
ATOM   1626  C CB  . LYS A 1 237 ? -2.907  24.858  -26.692 1.00 41.71  ? 217 LYS A CB  1 
ATOM   1627  C CG  . LYS A 1 237 ? -3.915  23.839  -27.177 1.00 44.45  ? 217 LYS A CG  1 
ATOM   1628  C CD  . LYS A 1 237 ? -4.628  24.294  -28.429 1.00 47.54  ? 217 LYS A CD  1 
ATOM   1629  C CE  . LYS A 1 237 ? -5.979  24.877  -28.083 1.00 51.58  ? 217 LYS A CE  1 
ATOM   1630  N NZ  . LYS A 1 237 ? -6.507  25.614  -29.255 1.00 54.85  ? 217 LYS A NZ  1 
ATOM   1631  N N   . LEU A 1 238 ? -1.167  26.207  -24.493 1.00 37.29  ? 218 LEU A N   1 
ATOM   1632  C CA  . LEU A 1 238 ? -0.186  27.219  -24.118 1.00 36.30  ? 218 LEU A CA  1 
ATOM   1633  C C   . LEU A 1 238 ? 0.780   26.751  -23.043 1.00 36.93  ? 218 LEU A C   1 
ATOM   1634  O O   . LEU A 1 238 ? 1.937   27.119  -23.061 1.00 38.31  ? 218 LEU A O   1 
ATOM   1635  C CB  . LEU A 1 238 ? -0.878  28.486  -23.628 1.00 36.67  ? 218 LEU A CB  1 
ATOM   1636  C CG  . LEU A 1 238 ? -1.936  29.062  -24.573 1.00 38.01  ? 218 LEU A CG  1 
ATOM   1637  C CD1 . LEU A 1 238 ? -2.508  30.349  -24.023 1.00 37.15  ? 218 LEU A CD1 1 
ATOM   1638  C CD2 . LEU A 1 238 ? -1.360  29.298  -25.957 1.00 36.73  ? 218 LEU A CD2 1 
ATOM   1639  N N   . GLY A 1 239 ? 0.304   25.964  -22.093 1.00 37.14  ? 219 GLY A N   1 
ATOM   1640  C CA  . GLY A 1 239 ? 1.106   25.652  -20.928 1.00 37.78  ? 219 GLY A CA  1 
ATOM   1641  C C   . GLY A 1 239 ? 2.073   24.544  -21.224 1.00 39.45  ? 219 GLY A C   1 
ATOM   1642  O O   . GLY A 1 239 ? 3.192   24.533  -20.733 1.00 41.30  ? 219 GLY A O   1 
ATOM   1643  N N   . ALA A 1 240 ? 1.642   23.598  -22.035 1.00 40.58  ? 220 ALA A N   1 
ATOM   1644  C CA  . ALA A 1 240 ? 2.488   22.471  -22.365 1.00 39.96  ? 220 ALA A CA  1 
ATOM   1645  C C   . ALA A 1 240 ? 2.841   22.429  -23.842 1.00 39.02  ? 220 ALA A C   1 
ATOM   1646  O O   . ALA A 1 240 ? 3.457   21.464  -24.294 1.00 39.36  ? 220 ALA A O   1 
ATOM   1647  C CB  . ALA A 1 240 ? 1.791   21.184  -21.957 1.00 40.03  ? 220 ALA A CB  1 
ATOM   1648  N N   . ASN A 1 241 ? 2.410   23.435  -24.604 1.00 37.83  ? 221 ASN A N   1 
ATOM   1649  C CA  . ASN A 1 241 ? 2.754   23.529  -26.017 1.00 38.15  ? 221 ASN A CA  1 
ATOM   1650  C C   . ASN A 1 241 ? 2.230   22.318  -26.794 1.00 35.94  ? 221 ASN A C   1 
ATOM   1651  O O   . ASN A 1 241 ? 2.874   21.813  -27.696 1.00 35.47  ? 221 ASN A O   1 
ATOM   1652  C CB  . ASN A 1 241 ? 4.273   23.667  -26.145 1.00 39.73  ? 221 ASN A CB  1 
ATOM   1653  C CG  . ASN A 1 241 ? 4.716   24.209  -27.492 1.00 43.49  ? 221 ASN A CG  1 
ATOM   1654  O OD1 . ASN A 1 241 ? 4.014   24.992  -28.148 1.00 42.49  ? 221 ASN A OD1 1 
ATOM   1655  N ND2 . ASN A 1 241 ? 5.911   23.799  -27.913 1.00 47.04  ? 221 ASN A ND2 1 
ATOM   1656  N N   . HIS A 1 242 ? 1.056   21.842  -26.420 1.00 35.91  ? 222 HIS A N   1 
ATOM   1657  C CA  . HIS A 1 242 ? 0.416   20.819  -27.197 1.00 37.51  ? 222 HIS A CA  1 
ATOM   1658  C C   . HIS A 1 242 ? -0.382  21.446  -28.315 1.00 40.86  ? 222 HIS A C   1 
ATOM   1659  O O   . HIS A 1 242 ? -1.003  22.490  -28.145 1.00 42.90  ? 222 HIS A O   1 
ATOM   1660  C CB  . HIS A 1 242 ? -0.481  19.921  -26.346 1.00 35.74  ? 222 HIS A CB  1 
ATOM   1661  C CG  . HIS A 1 242 ? 0.275   19.083  -25.372 1.00 34.48  ? 222 HIS A CG  1 
ATOM   1662  N ND1 . HIS A 1 242 ? -0.318  18.519  -24.268 1.00 34.24  ? 222 HIS A ND1 1 
ATOM   1663  C CD2 . HIS A 1 242 ? 1.591   18.758  -25.304 1.00 35.38  ? 222 HIS A CD2 1 
ATOM   1664  C CE1 . HIS A 1 242 ? 0.592   17.853  -23.576 1.00 36.09  ? 222 HIS A CE1 1 
ATOM   1665  N NE2 . HIS A 1 242 ? 1.760   17.983  -24.182 1.00 37.32  ? 222 HIS A NE2 1 
ATOM   1666  N N   . PRO A 1 243 ? -0.368  20.786  -29.472 1.00 45.53  ? 223 PRO A N   1 
ATOM   1667  C CA  . PRO A 1 243 ? -1.076  21.209  -30.664 1.00 45.10  ? 223 PRO A CA  1 
ATOM   1668  C C   . PRO A 1 243 ? -2.591  21.179  -30.501 1.00 43.46  ? 223 PRO A C   1 
ATOM   1669  O O   . PRO A 1 243 ? -3.289  21.967  -31.127 1.00 44.27  ? 223 PRO A O   1 
ATOM   1670  C CB  . PRO A 1 243 ? -0.644  20.174  -31.697 1.00 47.33  ? 223 PRO A CB  1 
ATOM   1671  C CG  . PRO A 1 243 ? -0.392  18.942  -30.898 1.00 48.62  ? 223 PRO A CG  1 
ATOM   1672  C CD  . PRO A 1 243 ? 0.216   19.436  -29.627 1.00 48.06  ? 223 PRO A CD  1 
ATOM   1673  N N   . MET A 1 244 ? -3.087  20.282  -29.664 1.00 41.02  ? 224 MET A N   1 
ATOM   1674  C CA  . MET A 1 244 ? -4.491  20.218  -29.382 1.00 42.07  ? 224 MET A CA  1 
ATOM   1675  C C   . MET A 1 244 ? -4.692  20.084  -27.904 1.00 39.57  ? 224 MET A C   1 
ATOM   1676  O O   . MET A 1 244 ? -3.840  19.566  -27.205 1.00 39.58  ? 224 MET A O   1 
ATOM   1677  C CB  . MET A 1 244 ? -5.089  19.014  -30.058 1.00 48.98  ? 224 MET A CB  1 
ATOM   1678  C CG  . MET A 1 244 ? -6.025  19.372  -31.174 1.00 52.82  ? 224 MET A CG  1 
ATOM   1679  S SD  . MET A 1 244 ? -6.894  17.901  -31.727 1.00 58.44  ? 224 MET A SD  1 
ATOM   1680  C CE  . MET A 1 244 ? -5.798  17.474  -33.069 1.00 61.99  ? 224 MET A CE  1 
ATOM   1681  N N   . GLY A 1 245 ? -5.833  20.554  -27.426 1.00 39.97  ? 225 GLY A N   1 
ATOM   1682  C CA  . GLY A 1 245 ? -6.181  20.362  -26.036 1.00 38.00  ? 225 GLY A CA  1 
ATOM   1683  C C   . GLY A 1 245 ? -6.754  18.973  -25.852 1.00 36.50  ? 225 GLY A C   1 
ATOM   1684  O O   . GLY A 1 245 ? -7.216  18.354  -26.792 1.00 34.36  ? 225 GLY A O   1 
ATOM   1685  N N   . PRO A 1 246 ? -6.733  18.480  -24.627 1.00 34.15  ? 226 PRO A N   1 
ATOM   1686  C CA  . PRO A 1 246 ? -7.130  17.122  -24.377 1.00 34.48  ? 226 PRO A CA  1 
ATOM   1687  C C   . PRO A 1 246 ? -8.586  16.879  -24.680 1.00 33.76  ? 226 PRO A C   1 
ATOM   1688  O O   . PRO A 1 246 ? -8.928  15.832  -25.221 1.00 34.22  ? 226 PRO A O   1 
ATOM   1689  C CB  . PRO A 1 246 ? -6.811  16.928  -22.902 1.00 34.52  ? 226 PRO A CB  1 
ATOM   1690  C CG  . PRO A 1 246 ? -6.746  18.295  -22.351 1.00 35.61  ? 226 PRO A CG  1 
ATOM   1691  C CD  . PRO A 1 246 ? -6.200  19.133  -23.435 1.00 34.99  ? 226 PRO A CD  1 
ATOM   1692  N N   . LEU A 1 247 ? -9.442  17.837  -24.382 1.00 33.45  ? 227 LEU A N   1 
ATOM   1693  C CA  . LEU A 1 247 ? -10.844 17.631  -24.693 1.00 36.61  ? 227 LEU A CA  1 
ATOM   1694  C C   . LEU A 1 247 ? -11.160 17.653  -26.202 1.00 38.18  ? 227 LEU A C   1 
ATOM   1695  O O   . LEU A 1 247 ? -11.865 16.773  -26.691 1.00 40.36  ? 227 LEU A O   1 
ATOM   1696  C CB  . LEU A 1 247 ? -11.726 18.573  -23.902 1.00 36.88  ? 227 LEU A CB  1 
ATOM   1697  C CG  . LEU A 1 247 ? -11.501 18.467  -22.397 1.00 37.23  ? 227 LEU A CG  1 
ATOM   1698  C CD1 . LEU A 1 247 ? -12.398 19.469  -21.732 1.00 38.34  ? 227 LEU A CD1 1 
ATOM   1699  C CD2 . LEU A 1 247 ? -11.817 17.092  -21.837 1.00 37.81  ? 227 LEU A CD2 1 
ATOM   1700  N N   . GLU A 1 248 ? -10.631 18.599  -26.965 1.00 38.69  ? 228 GLU A N   1 
ATOM   1701  C CA  . GLU A 1 248 ? -10.860 18.505  -28.395 1.00 39.07  ? 228 GLU A CA  1 
ATOM   1702  C C   . GLU A 1 248 ? -10.158 17.268  -28.994 1.00 36.89  ? 228 GLU A C   1 
ATOM   1703  O O   . GLU A 1 248 ? -10.599 16.714  -30.007 1.00 34.95  ? 228 GLU A O   1 
ATOM   1704  C CB  . GLU A 1 248 ? -10.460 19.778  -29.115 1.00 42.91  ? 228 GLU A CB  1 
ATOM   1705  C CG  . GLU A 1 248 ? -8.975  20.004  -29.224 1.00 49.93  ? 228 GLU A CG  1 
ATOM   1706  C CD  . GLU A 1 248 ? -8.631  21.383  -29.771 1.00 51.94  ? 228 GLU A CD  1 
ATOM   1707  O OE1 . GLU A 1 248 ? -8.000  22.177  -29.013 1.00 48.17  ? 228 GLU A OE1 1 
ATOM   1708  O OE2 . GLU A 1 248 ? -8.979  21.634  -30.955 1.00 48.64  ? 228 GLU A OE2 1 
ATOM   1709  N N   . LEU A 1 249 ? -9.068  16.837  -28.377 1.00 34.91  ? 229 LEU A N   1 
ATOM   1710  C CA  . LEU A 1 249 ? -8.372  15.664  -28.866 1.00 34.34  ? 229 LEU A CA  1 
ATOM   1711  C C   . LEU A 1 249 ? -9.251  14.444  -28.660 1.00 34.40  ? 229 LEU A C   1 
ATOM   1712  O O   . LEU A 1 249 ? -9.351  13.601  -29.534 1.00 31.88  ? 229 LEU A O   1 
ATOM   1713  C CB  . LEU A 1 249 ? -7.058  15.472  -28.136 1.00 35.22  ? 229 LEU A CB  1 
ATOM   1714  C CG  . LEU A 1 249 ? -6.276  14.223  -28.517 1.00 34.66  ? 229 LEU A CG  1 
ATOM   1715  C CD1 . LEU A 1 249 ? -5.892  14.264  -29.984 1.00 34.38  ? 229 LEU A CD1 1 
ATOM   1716  C CD2 . LEU A 1 249 ? -5.039  14.154  -27.646 1.00 34.92  ? 229 LEU A CD2 1 
ATOM   1717  N N   . GLY A 1 250 ? -9.900  14.373  -27.500 1.00 34.45  ? 230 GLY A N   1 
ATOM   1718  C CA  . GLY A 1 250 ? -10.867 13.326  -27.231 1.00 34.27  ? 230 GLY A CA  1 
ATOM   1719  C C   . GLY A 1 250 ? -11.982 13.343  -28.250 1.00 35.21  ? 230 GLY A C   1 
ATOM   1720  O O   . GLY A 1 250 ? -12.356 12.306  -28.770 1.00 36.95  ? 230 GLY A O   1 
ATOM   1721  N N   . ASP A 1 251 ? -12.508 14.522  -28.560 1.00 36.98  ? 231 ASP A N   1 
ATOM   1722  C CA  . ASP A 1 251 ? -13.545 14.626  -29.590 1.00 36.55  ? 231 ASP A CA  1 
ATOM   1723  C C   . ASP A 1 251 ? -13.088 14.116  -30.950 1.00 36.45  ? 231 ASP A C   1 
ATOM   1724  O O   . ASP A 1 251 ? -13.870 13.602  -31.725 1.00 35.96  ? 231 ASP A O   1 
ATOM   1725  C CB  . ASP A 1 251 ? -13.977 16.068  -29.755 1.00 37.60  ? 231 ASP A CB  1 
ATOM   1726  C CG  . ASP A 1 251 ? -15.005 16.494  -28.725 1.00 38.12  ? 231 ASP A CG  1 
ATOM   1727  O OD1 . ASP A 1 251 ? -15.325 15.689  -27.840 1.00 35.51  ? 231 ASP A OD1 1 
ATOM   1728  O OD2 . ASP A 1 251 ? -15.497 17.638  -28.795 1.00 39.97  ? 231 ASP A OD2 1 
ATOM   1729  N N   . PHE A 1 252 ? -11.810 14.273  -31.216 1.00 36.67  ? 232 PHE A N   1 
ATOM   1730  C CA  . PHE A 1 252 ? -11.238 13.997  -32.503 1.00 39.31  ? 232 PHE A CA  1 
ATOM   1731  C C   . PHE A 1 252 ? -10.956 12.511  -32.665 1.00 39.86  ? 232 PHE A C   1 
ATOM   1732  O O   . PHE A 1 252 ? -11.202 11.922  -33.709 1.00 41.42  ? 232 PHE A O   1 
ATOM   1733  C CB  . PHE A 1 252 ? -9.949  14.814  -32.614 1.00 42.90  ? 232 PHE A CB  1 
ATOM   1734  C CG  . PHE A 1 252 ? -9.278  14.716  -33.941 1.00 46.35  ? 232 PHE A CG  1 
ATOM   1735  C CD1 . PHE A 1 252 ? -9.989  14.930  -35.114 1.00 49.48  ? 232 PHE A CD1 1 
ATOM   1736  C CD2 . PHE A 1 252 ? -7.933  14.418  -34.023 1.00 51.46  ? 232 PHE A CD2 1 
ATOM   1737  C CE1 . PHE A 1 252 ? -9.371  14.835  -36.349 1.00 48.18  ? 232 PHE A CE1 1 
ATOM   1738  C CE2 . PHE A 1 252 ? -7.304  14.331  -35.254 1.00 51.40  ? 232 PHE A CE2 1 
ATOM   1739  C CZ  . PHE A 1 252 ? -8.027  14.536  -36.417 1.00 48.42  ? 232 PHE A CZ  1 
ATOM   1740  N N   . ILE A 1 253 ? -10.408 11.922  -31.621 1.00 39.85  ? 233 ILE A N   1 
ATOM   1741  C CA  . ILE A 1 253 ? -10.265 10.490  -31.514 1.00 36.56  ? 233 ILE A CA  1 
ATOM   1742  C C   . ILE A 1 253 ? -11.618 9.782   -31.461 1.00 38.05  ? 233 ILE A C   1 
ATOM   1743  O O   . ILE A 1 253 ? -11.821 8.742   -32.074 1.00 42.18  ? 233 ILE A O   1 
ATOM   1744  C CB  . ILE A 1 253 ? -9.485  10.183  -30.245 1.00 37.53  ? 233 ILE A CB  1 
ATOM   1745  C CG1 . ILE A 1 253 ? -8.009  10.471  -30.505 1.00 37.57  ? 233 ILE A CG1 1 
ATOM   1746  C CG2 . ILE A 1 253 ? -9.675  8.736   -29.828 1.00 39.30  ? 233 ILE A CG2 1 
ATOM   1747  C CD1 . ILE A 1 253 ? -7.179  10.582  -29.255 1.00 37.05  ? 233 ILE A CD1 1 
ATOM   1748  N N   . GLY A 1 254 ? -12.547 10.353  -30.717 1.00 38.95  ? 234 GLY A N   1 
ATOM   1749  C CA  . GLY A 1 254 ? -13.855 9.744   -30.510 1.00 37.24  ? 234 GLY A CA  1 
ATOM   1750  C C   . GLY A 1 254 ? -13.918 9.336   -29.059 1.00 37.18  ? 234 GLY A C   1 
ATOM   1751  O O   . GLY A 1 254 ? -13.027 8.651   -28.552 1.00 37.14  ? 234 GLY A O   1 
ATOM   1752  N N   . LEU A 1 255 ? -14.949 9.782   -28.366 1.00 35.88  ? 235 LEU A N   1 
ATOM   1753  C CA  . LEU A 1 255 ? -15.038 9.503   -26.938 1.00 37.41  ? 235 LEU A CA  1 
ATOM   1754  C C   . LEU A 1 255 ? -15.341 8.031   -26.644 1.00 36.05  ? 235 LEU A C   1 
ATOM   1755  O O   . LEU A 1 255 ? -14.948 7.504   -25.618 1.00 36.98  ? 235 LEU A O   1 
ATOM   1756  C CB  . LEU A 1 255 ? -16.065 10.430  -26.284 1.00 38.13  ? 235 LEU A CB  1 
ATOM   1757  C CG  . LEU A 1 255 ? -15.774 11.920  -26.446 1.00 37.47  ? 235 LEU A CG  1 
ATOM   1758  C CD1 . LEU A 1 255 ? -16.772 12.706  -25.635 1.00 38.82  ? 235 LEU A CD1 1 
ATOM   1759  C CD2 . LEU A 1 255 ? -14.376 12.267  -25.974 1.00 38.84  ? 235 LEU A CD2 1 
ATOM   1760  N N   . ASP A 1 256 ? -16.032 7.374   -27.558 1.00 36.74  ? 236 ASP A N   1 
ATOM   1761  C CA  . ASP A 1 256 ? -16.284 5.937   -27.461 1.00 38.20  ? 236 ASP A CA  1 
ATOM   1762  C C   . ASP A 1 256 ? -14.980 5.145   -27.467 1.00 38.12  ? 236 ASP A C   1 
ATOM   1763  O O   . ASP A 1 256 ? -14.815 4.198   -26.707 1.00 39.36  ? 236 ASP A O   1 
ATOM   1764  C CB  . ASP A 1 256 ? -17.235 5.468   -28.574 1.00 38.43  ? 236 ASP A CB  1 
ATOM   1765  C CG  . ASP A 1 256 ? -16.718 5.771   -30.011 1.00 42.46  ? 236 ASP A CG  1 
ATOM   1766  O OD1 . ASP A 1 256 ? -15.962 6.755   -30.239 1.00 44.33  ? 236 ASP A OD1 1 
ATOM   1767  O OD2 . ASP A 1 256 ? -17.108 5.020   -30.935 1.00 42.60  ? 236 ASP A OD2 1 
ATOM   1768  N N   . ILE A 1 257 ? -14.036 5.563   -28.291 1.00 39.09  ? 237 ILE A N   1 
ATOM   1769  C CA  . ILE A 1 257 ? -12.731 4.921   -28.321 1.00 39.29  ? 237 ILE A CA  1 
ATOM   1770  C C   . ILE A 1 257 ? -11.881 5.243   -27.111 1.00 38.72  ? 237 ILE A C   1 
ATOM   1771  O O   . ILE A 1 257 ? -11.169 4.365   -26.626 1.00 41.12  ? 237 ILE A O   1 
ATOM   1772  C CB  . ILE A 1 257 ? -11.975 5.335   -29.571 1.00 41.81  ? 237 ILE A CB  1 
ATOM   1773  C CG1 . ILE A 1 257 ? -12.702 4.757   -30.784 1.00 45.19  ? 237 ILE A CG1 1 
ATOM   1774  C CG2 . ILE A 1 257 ? -10.531 4.849   -29.523 1.00 40.00  ? 237 ILE A CG2 1 
ATOM   1775  C CD1 . ILE A 1 257 ? -12.721 5.716   -31.939 1.00 47.78  ? 237 ILE A CD1 1 
ATOM   1776  N N   . CYS A 1 258 ? -11.934 6.493   -26.646 1.00 35.87  ? 238 CYS A N   1 
ATOM   1777  C CA  . CYS A 1 258 ? -11.175 6.903   -25.464 1.00 35.42  ? 238 CYS A CA  1 
ATOM   1778  C C   . CYS A 1 258 ? -11.672 6.124   -24.257 1.00 34.83  ? 238 CYS A C   1 
ATOM   1779  O O   . CYS A 1 258 ? -10.889 5.636   -23.441 1.00 34.32  ? 238 CYS A O   1 
ATOM   1780  C CB  . CYS A 1 258 ? -11.342 8.399   -25.188 1.00 36.75  ? 238 CYS A CB  1 
ATOM   1781  S SG  . CYS A 1 258 ? -10.562 9.510   -26.383 1.00 38.11  ? 238 CYS A SG  1 
ATOM   1782  N N   . LEU A 1 259 ? -12.987 6.010   -24.158 1.00 33.30  ? 239 LEU A N   1 
ATOM   1783  C CA  . LEU A 1 259 ? -13.583 5.280   -23.074 1.00 33.94  ? 239 LEU A CA  1 
ATOM   1784  C C   . LEU A 1 259 ? -13.229 3.802   -23.143 1.00 35.73  ? 239 LEU A C   1 
ATOM   1785  O O   . LEU A 1 259 ? -13.013 3.167   -22.121 1.00 38.18  ? 239 LEU A O   1 
ATOM   1786  C CB  . LEU A 1 259 ? -15.098 5.451   -23.079 1.00 33.83  ? 239 LEU A CB  1 
ATOM   1787  C CG  . LEU A 1 259 ? -15.872 4.545   -22.094 1.00 33.83  ? 239 LEU A CG  1 
ATOM   1788  C CD1 . LEU A 1 259 ? -15.584 4.908   -20.656 1.00 35.33  ? 239 LEU A CD1 1 
ATOM   1789  C CD2 . LEU A 1 259 ? -17.365 4.647   -22.291 1.00 33.39  ? 239 LEU A CD2 1 
ATOM   1790  N N   . ALA A 1 260 ? -13.185 3.240   -24.337 1.00 36.52  ? 240 ALA A N   1 
ATOM   1791  C CA  . ALA A 1 260 ? -12.867 1.818   -24.459 1.00 35.57  ? 240 ALA A CA  1 
ATOM   1792  C C   . ALA A 1 260 ? -11.427 1.566   -24.097 1.00 35.01  ? 240 ALA A C   1 
ATOM   1793  O O   . ALA A 1 260 ? -11.132 0.588   -23.437 1.00 38.02  ? 240 ALA A O   1 
ATOM   1794  C CB  . ALA A 1 260 ? -13.137 1.316   -25.859 1.00 35.44  ? 240 ALA A CB  1 
ATOM   1795  N N   . ILE A 1 261 ? -10.525 2.446   -24.506 1.00 32.90  ? 241 ILE A N   1 
ATOM   1796  C CA  . ILE A 1 261 ? -9.153  2.264   -24.093 1.00 32.90  ? 241 ILE A CA  1 
ATOM   1797  C C   . ILE A 1 261 ? -9.028  2.324   -22.567 1.00 34.65  ? 241 ILE A C   1 
ATOM   1798  O O   . ILE A 1 261 ? -8.282  1.542   -21.975 1.00 35.60  ? 241 ILE A O   1 
ATOM   1799  C CB  . ILE A 1 261 ? -8.230  3.282   -24.755 1.00 34.05  ? 241 ILE A CB  1 
ATOM   1800  C CG1 . ILE A 1 261 ? -8.016  2.897   -26.216 1.00 36.61  ? 241 ILE A CG1 1 
ATOM   1801  C CG2 . ILE A 1 261 ? -6.877  3.336   -24.065 1.00 32.82  ? 241 ILE A CG2 1 
ATOM   1802  C CD1 . ILE A 1 261 ? -7.589  4.066   -27.087 1.00 39.42  ? 241 ILE A CD1 1 
ATOM   1803  N N   . MET A 1 262 ? -9.737  3.241   -21.914 1.00 35.61  ? 242 MET A N   1 
ATOM   1804  C CA  . MET A 1 262 ? -9.601  3.333   -20.461 1.00 35.16  ? 242 MET A CA  1 
ATOM   1805  C C   . MET A 1 262 ? -10.213 2.095   -19.826 1.00 34.86  ? 242 MET A C   1 
ATOM   1806  O O   . MET A 1 262 ? -9.736  1.625   -18.810 1.00 31.86  ? 242 MET A O   1 
ATOM   1807  C CB  . MET A 1 262 ? -10.272 4.579   -19.912 1.00 35.61  ? 242 MET A CB  1 
ATOM   1808  C CG  . MET A 1 262 ? -9.632  5.875   -20.360 1.00 35.54  ? 242 MET A CG  1 
ATOM   1809  S SD  . MET A 1 262 ? -7.979  6.186   -19.714 1.00 37.72  ? 242 MET A SD  1 
ATOM   1810  C CE  . MET A 1 262 ? -8.222  6.082   -17.943 1.00 35.03  ? 242 MET A CE  1 
ATOM   1811  N N   . ASP A 1 263 ? -11.269 1.566   -20.438 1.00 34.78  ? 243 ASP A N   1 
ATOM   1812  C CA  . ASP A 1 263 ? -11.874 0.315   -19.970 1.00 34.61  ? 243 ASP A CA  1 
ATOM   1813  C C   . ASP A 1 263 ? -10.873 -0.798  -20.007 1.00 33.22  ? 243 ASP A C   1 
ATOM   1814  O O   . ASP A 1 263 ? -10.759 -1.560  -19.071 1.00 30.49  ? 243 ASP A O   1 
ATOM   1815  C CB  . ASP A 1 263 ? -13.062 -0.097  -20.834 1.00 36.90  ? 243 ASP A CB  1 
ATOM   1816  C CG  . ASP A 1 263 ? -14.322 0.659   -20.482 1.00 39.30  ? 243 ASP A CG  1 
ATOM   1817  O OD1 . ASP A 1 263 ? -14.437 1.096   -19.326 1.00 40.67  ? 243 ASP A OD1 1 
ATOM   1818  O OD2 . ASP A 1 263 ? -15.200 0.826   -21.356 1.00 43.57  ? 243 ASP A OD2 1 
ATOM   1819  N N   . VAL A 1 264 ? -10.136 -0.879  -21.098 1.00 33.22  ? 244 VAL A N   1 
ATOM   1820  C CA  . VAL A 1 264 ? -9.099  -1.870  -21.214 1.00 34.29  ? 244 VAL A CA  1 
ATOM   1821  C C   . VAL A 1 264 ? -8.004  -1.693  -20.167 1.00 34.54  ? 244 VAL A C   1 
ATOM   1822  O O   . VAL A 1 264 ? -7.565  -2.674  -19.568 1.00 35.24  ? 244 VAL A O   1 
ATOM   1823  C CB  . VAL A 1 264 ? -8.486  -1.870  -22.628 1.00 35.73  ? 244 VAL A CB  1 
ATOM   1824  C CG1 . VAL A 1 264 ? -7.150  -2.608  -22.654 1.00 36.22  ? 244 VAL A CG1 1 
ATOM   1825  C CG2 . VAL A 1 264 ? -9.455  -2.493  -23.607 1.00 34.42  ? 244 VAL A CG2 1 
ATOM   1826  N N   . LEU A 1 265 ? -7.546  -0.469  -19.946 1.00 34.76  ? 245 LEU A N   1 
ATOM   1827  C CA  . LEU A 1 265 ? -6.429  -0.272  -19.008 1.00 35.88  ? 245 LEU A CA  1 
ATOM   1828  C C   . LEU A 1 265 ? -6.802  -0.680  -17.598 1.00 34.93  ? 245 LEU A C   1 
ATOM   1829  O O   . LEU A 1 265 ? -5.985  -1.204  -16.831 1.00 32.74  ? 245 LEU A O   1 
ATOM   1830  C CB  . LEU A 1 265 ? -5.990  1.181   -18.976 1.00 37.49  ? 245 LEU A CB  1 
ATOM   1831  C CG  . LEU A 1 265 ? -5.449  1.707   -20.297 1.00 40.30  ? 245 LEU A CG  1 
ATOM   1832  C CD1 . LEU A 1 265 ? -5.300  3.215   -20.213 1.00 41.13  ? 245 LEU A CD1 1 
ATOM   1833  C CD2 . LEU A 1 265 ? -4.122  1.064   -20.631 1.00 40.71  ? 245 LEU A CD2 1 
ATOM   1834  N N   . TYR A 1 266 ? -8.046  -0.404  -17.250 1.00 34.49  ? 246 TYR A N   1 
ATOM   1835  C CA  . TYR A 1 266 ? -8.541  -0.718  -15.924 1.00 36.01  ? 246 TYR A CA  1 
ATOM   1836  C C   . TYR A 1 266 ? -8.752  -2.200  -15.813 1.00 34.61  ? 246 TYR A C   1 
ATOM   1837  O O   . TYR A 1 266 ? -8.386  -2.816  -14.848 1.00 35.00  ? 246 TYR A O   1 
ATOM   1838  C CB  . TYR A 1 266 ? -9.855  0.003   -15.700 1.00 35.72  ? 246 TYR A CB  1 
ATOM   1839  C CG  . TYR A 1 266 ? -10.463 -0.212  -14.359 1.00 35.26  ? 246 TYR A CG  1 
ATOM   1840  C CD1 . TYR A 1 266 ? -9.678  -0.433  -13.234 1.00 35.96  ? 246 TYR A CD1 1 
ATOM   1841  C CD2 . TYR A 1 266 ? -11.831 -0.153  -14.201 1.00 36.13  ? 246 TYR A CD2 1 
ATOM   1842  C CE1 . TYR A 1 266 ? -10.248 -0.604  -11.993 1.00 34.05  ? 246 TYR A CE1 1 
ATOM   1843  C CE2 . TYR A 1 266 ? -12.405 -0.336  -12.969 1.00 34.84  ? 246 TYR A CE2 1 
ATOM   1844  C CZ  . TYR A 1 266 ? -11.607 -0.558  -11.885 1.00 33.18  ? 246 TYR A CZ  1 
ATOM   1845  O OH  . TYR A 1 266 ? -12.200 -0.723  -10.688 1.00 34.63  ? 246 TYR A OH  1 
ATOM   1846  N N   . SER A 1 267 ? -9.354  -2.745  -16.846 1.00 36.44  ? 247 SER A N   1 
ATOM   1847  C CA  . SER A 1 267 ? -9.628  -4.159  -16.940 1.00 37.09  ? 247 SER A CA  1 
ATOM   1848  C C   . SER A 1 267 ? -8.362  -4.985  -16.834 1.00 37.39  ? 247 SER A C   1 
ATOM   1849  O O   . SER A 1 267 ? -8.309  -5.948  -16.077 1.00 35.92  ? 247 SER A O   1 
ATOM   1850  C CB  . SER A 1 267 ? -10.264 -4.435  -18.279 1.00 37.38  ? 247 SER A CB  1 
ATOM   1851  O OG  . SER A 1 267 ? -10.844 -5.687  -18.231 1.00 42.13  ? 247 SER A OG  1 
ATOM   1852  N N   . GLU A 1 268 ? -7.346  -4.597  -17.596 1.00 35.94  ? 248 GLU A N   1 
ATOM   1853  C CA  . GLU A 1 268 ? -6.114  -5.366  -17.649 1.00 35.73  ? 248 GLU A CA  1 
ATOM   1854  C C   . GLU A 1 268 ? -5.275  -5.249  -16.409 1.00 35.12  ? 248 GLU A C   1 
ATOM   1855  O O   . GLU A 1 268 ? -4.740  -6.239  -15.957 1.00 37.67  ? 248 GLU A O   1 
ATOM   1856  C CB  . GLU A 1 268 ? -5.271  -4.952  -18.841 1.00 37.57  ? 248 GLU A CB  1 
ATOM   1857  C CG  . GLU A 1 268 ? -5.760  -5.549  -20.141 1.00 39.26  ? 248 GLU A CG  1 
ATOM   1858  C CD  . GLU A 1 268 ? -5.765  -7.062  -20.108 1.00 39.90  ? 248 GLU A CD  1 
ATOM   1859  O OE1 . GLU A 1 268 ? -4.684  -7.666  -19.999 1.00 38.10  ? 248 GLU A OE1 1 
ATOM   1860  O OE2 . GLU A 1 268 ? -6.862  -7.633  -20.162 1.00 44.41  ? 248 GLU A OE2 1 
ATOM   1861  N N   . THR A 1 269 ? -5.141  -4.052  -15.862 1.00 32.66  ? 249 THR A N   1 
ATOM   1862  C CA  . THR A 1 269 ? -4.217  -3.850  -14.765 1.00 30.87  ? 249 THR A CA  1 
ATOM   1863  C C   . THR A 1 269 ? -4.877  -4.078  -13.430 1.00 31.01  ? 249 THR A C   1 
ATOM   1864  O O   . THR A 1 269 ? -4.195  -4.196  -12.399 1.00 32.34  ? 249 THR A O   1 
ATOM   1865  C CB  . THR A 1 269 ? -3.635  -2.406  -14.743 1.00 30.56  ? 249 THR A CB  1 
ATOM   1866  O OG1 . THR A 1 269 ? -4.659  -1.472  -14.396 1.00 30.22  ? 249 THR A OG1 1 
ATOM   1867  C CG2 . THR A 1 269 ? -3.053  -2.029  -16.073 1.00 30.86  ? 249 THR A CG2 1 
ATOM   1868  N N   . GLY A 1 270 ? -6.203  -4.048  -13.424 1.00 30.35  ? 250 GLY A N   1 
ATOM   1869  C CA  . GLY A 1 270 ? -6.951  -4.087  -12.177 1.00 32.24  ? 250 GLY A CA  1 
ATOM   1870  C C   . GLY A 1 270 ? -6.655  -2.939  -11.220 1.00 35.26  ? 250 GLY A C   1 
ATOM   1871  O O   . GLY A 1 270 ? -6.916  -3.066  -10.020 1.00 35.92  ? 250 GLY A O   1 
ATOM   1872  N N   . ASP A 1 271 ? -6.122  -1.827  -11.735 1.00 37.34  ? 251 ASP A N   1 
ATOM   1873  C CA  . ASP A 1 271 ? -5.743  -0.681  -10.903 1.00 37.36  ? 251 ASP A CA  1 
ATOM   1874  C C   . ASP A 1 271 ? -6.756  0.448   -11.093 1.00 37.52  ? 251 ASP A C   1 
ATOM   1875  O O   . ASP A 1 271 ? -7.027  0.880   -12.206 1.00 34.62  ? 251 ASP A O   1 
ATOM   1876  C CB  . ASP A 1 271 ? -4.333  -0.230  -11.277 1.00 38.78  ? 251 ASP A CB  1 
ATOM   1877  C CG  . ASP A 1 271 ? -3.753  0.825   -10.312 1.00 40.73  ? 251 ASP A CG  1 
ATOM   1878  O OD1 . ASP A 1 271 ? -4.514  1.442   -9.546  1.00 42.71  ? 251 ASP A OD1 1 
ATOM   1879  O OD2 . ASP A 1 271 ? -2.522  1.064   -10.336 1.00 39.34  ? 251 ASP A OD2 1 
ATOM   1880  N N   . SER A 1 272 ? -7.294  0.939   -9.987  1.00 39.58  ? 252 SER A N   1 
ATOM   1881  C CA  . SER A 1 272 ? -8.305  2.011   -10.013 1.00 40.15  ? 252 SER A CA  1 
ATOM   1882  C C   . SER A 1 272 ? -7.824  3.317   -10.626 1.00 38.45  ? 252 SER A C   1 
ATOM   1883  O O   . SER A 1 272 ? -8.596  4.157   -11.118 1.00 36.86  ? 252 SER A O   1 
ATOM   1884  C CB  . SER A 1 272 ? -8.769  2.301   -8.601  1.00 41.81  ? 252 SER A CB  1 
ATOM   1885  O OG  . SER A 1 272 ? -10.007 1.668   -8.401  1.00 49.61  ? 252 SER A OG  1 
ATOM   1886  N N   . LYS A 1 273 ? -6.527  3.484   -10.569 1.00 34.10  ? 253 LYS A N   1 
ATOM   1887  C CA  . LYS A 1 273 ? -5.884  4.583   -11.191 1.00 35.32  ? 253 LYS A CA  1 
ATOM   1888  C C   . LYS A 1 273 ? -6.409  4.892   -12.582 1.00 34.93  ? 253 LYS A C   1 
ATOM   1889  O O   . LYS A 1 273 ? -6.487  6.063   -12.980 1.00 37.40  ? 253 LYS A O   1 
ATOM   1890  C CB  . LYS A 1 273 ? -4.424  4.237   -11.275 1.00 36.96  ? 253 LYS A CB  1 
ATOM   1891  C CG  . LYS A 1 273 ? -3.698  5.009   -12.327 1.00 38.74  ? 253 LYS A CG  1 
ATOM   1892  C CD  . LYS A 1 273 ? -2.227  4.955   -12.032 1.00 40.09  ? 253 LYS A CD  1 
ATOM   1893  C CE  . LYS A 1 273 ? -1.532  5.781   -13.094 1.00 40.93  ? 253 LYS A CE  1 
ATOM   1894  N NZ  . LYS A 1 273 ? -0.077  5.809   -12.859 1.00 41.49  ? 253 LYS A NZ  1 
ATOM   1895  N N   . TYR A 1 274 ? -6.759  3.841   -13.314 1.00 33.13  ? 254 TYR A N   1 
ATOM   1896  C CA  . TYR A 1 274 ? -7.181  3.975   -14.697 1.00 31.19  ? 254 TYR A CA  1 
ATOM   1897  C C   . TYR A 1 274 ? -8.670  3.929   -14.872 1.00 29.70  ? 254 TYR A C   1 
ATOM   1898  O O   . TYR A 1 274 ? -9.159  3.727   -15.980 1.00 26.32  ? 254 TYR A O   1 
ATOM   1899  C CB  . TYR A 1 274 ? -6.566  2.868   -15.528 1.00 31.32  ? 254 TYR A CB  1 
ATOM   1900  C CG  . TYR A 1 274 ? -5.093  2.892   -15.438 1.00 32.31  ? 254 TYR A CG  1 
ATOM   1901  C CD1 . TYR A 1 274 ? -4.362  3.772   -16.208 1.00 32.49  ? 254 TYR A CD1 1 
ATOM   1902  C CD2 . TYR A 1 274 ? -4.423  2.082   -14.537 1.00 33.38  ? 254 TYR A CD2 1 
ATOM   1903  C CE1 . TYR A 1 274 ? -2.991  3.828   -16.116 1.00 31.73  ? 254 TYR A CE1 1 
ATOM   1904  C CE2 . TYR A 1 274 ? -3.049  2.138   -14.424 1.00 32.98  ? 254 TYR A CE2 1 
ATOM   1905  C CZ  . TYR A 1 274 ? -2.341  3.009   -15.223 1.00 32.51  ? 254 TYR A CZ  1 
ATOM   1906  O OH  . TYR A 1 274 ? -0.982  3.074   -15.131 1.00 32.02  ? 254 TYR A OH  1 
ATOM   1907  N N   . ARG A 1 275 ? -9.408  4.120   -13.794 1.00 29.98  ? 255 ARG A N   1 
ATOM   1908  C CA  . ARG A 1 275 ? -10.851 4.127   -13.927 1.00 32.37  ? 255 ARG A CA  1 
ATOM   1909  C C   . ARG A 1 275 ? -11.292 5.303   -14.793 1.00 31.25  ? 255 ARG A C   1 
ATOM   1910  O O   . ARG A 1 275 ? -10.839 6.413   -14.613 1.00 32.77  ? 255 ARG A O   1 
ATOM   1911  C CB  . ARG A 1 275 ? -11.526 4.172   -12.562 1.00 34.79  ? 255 ARG A CB  1 
ATOM   1912  C CG  . ARG A 1 275 ? -11.538 5.525   -11.873 1.00 35.56  ? 255 ARG A CG  1 
ATOM   1913  C CD  . ARG A 1 275 ? -11.720 5.270   -10.401 1.00 38.14  ? 255 ARG A CD  1 
ATOM   1914  N NE  . ARG A 1 275 ? -11.735 6.482   -9.600  1.00 38.98  ? 255 ARG A NE  1 
ATOM   1915  C CZ  . ARG A 1 275 ? -10.689 6.965   -8.925  1.00 40.44  ? 255 ARG A CZ  1 
ATOM   1916  N NH1 . ARG A 1 275 ? -9.493  6.382   -8.956  1.00 42.85  ? 255 ARG A NH1 1 
ATOM   1917  N NH2 . ARG A 1 275 ? -10.840 8.053   -8.203  1.00 40.43  ? 255 ARG A NH2 1 
ATOM   1918  N N   . PRO A 1 276 ? -12.161 5.046   -15.758 1.00 31.68  ? 256 PRO A N   1 
ATOM   1919  C CA  . PRO A 1 276 ? -12.675 6.099   -16.601 1.00 31.74  ? 256 PRO A CA  1 
ATOM   1920  C C   . PRO A 1 276 ? -13.639 6.985   -15.867 1.00 33.19  ? 256 PRO A C   1 
ATOM   1921  O O   . PRO A 1 276 ? -14.423 6.494   -15.058 1.00 30.81  ? 256 PRO A O   1 
ATOM   1922  C CB  . PRO A 1 276 ? -13.411 5.352   -17.706 1.00 31.62  ? 256 PRO A CB  1 
ATOM   1923  C CG  . PRO A 1 276 ? -13.593 3.971   -17.196 1.00 31.17  ? 256 PRO A CG  1 
ATOM   1924  C CD  . PRO A 1 276 ? -12.454 3.715   -16.292 1.00 31.60  ? 256 PRO A CD  1 
ATOM   1925  N N   . HIS A 1 277 ? -13.602 8.275   -16.175 1.00 32.44  ? 257 HIS A N   1 
ATOM   1926  C CA  . HIS A 1 277 ? -14.484 9.169   -15.508 1.00 35.25  ? 257 HIS A CA  1 
ATOM   1927  C C   . HIS A 1 277 ? -15.944 8.888   -15.864 1.00 37.28  ? 257 HIS A C   1 
ATOM   1928  O O   . HIS A 1 277 ? -16.339 8.572   -16.978 1.00 43.15  ? 257 HIS A O   1 
ATOM   1929  C CB  . HIS A 1 277 ? -14.126 10.644  -15.733 1.00 35.51  ? 257 HIS A CB  1 
ATOM   1930  C CG  . HIS A 1 277 ? -14.583 11.533  -14.618 1.00 34.14  ? 257 HIS A CG  1 
ATOM   1931  N ND1 . HIS A 1 277 ? -15.900 11.926  -14.467 1.00 30.80  ? 257 HIS A ND1 1 
ATOM   1932  C CD2 . HIS A 1 277 ? -13.908 12.058  -13.565 1.00 33.49  ? 257 HIS A CD2 1 
ATOM   1933  C CE1 . HIS A 1 277 ? -16.010 12.677  -13.384 1.00 29.69  ? 257 HIS A CE1 1 
ATOM   1934  N NE2 . HIS A 1 277 ? -14.819 12.769  -12.812 1.00 30.03  ? 257 HIS A NE2 1 
ATOM   1935  N N   . THR A 1 278 ? -16.723 9.031   -14.831 1.00 38.60  ? 258 THR A N   1 
ATOM   1936  C CA  . THR A 1 278 ? -18.151 8.860   -14.833 1.00 38.31  ? 258 THR A CA  1 
ATOM   1937  C C   . THR A 1 278 ? -18.828 9.755   -15.887 1.00 36.17  ? 258 THR A C   1 
ATOM   1938  O O   . THR A 1 278 ? -19.812 9.373   -16.516 1.00 34.53  ? 258 THR A O   1 
ATOM   1939  C CB  . THR A 1 278 ? -18.568 9.145   -13.369 1.00 39.21  ? 258 THR A CB  1 
ATOM   1940  O OG1 . THR A 1 278 ? -19.218 8.002   -12.838 1.00 41.52  ? 258 THR A OG1 1 
ATOM   1941  C CG2 . THR A 1 278 ? -19.378 10.397  -13.198 1.00 41.81  ? 258 THR A CG2 1 
ATOM   1942  N N   . LEU A 1 279 ? -18.265 10.944  -16.070 1.00 35.44  ? 259 LEU A N   1 
ATOM   1943  C CA  . LEU A 1 279 ? -18.789 11.935  -17.001 1.00 34.29  ? 259 LEU A CA  1 
ATOM   1944  C C   . LEU A 1 279 ? -18.490 11.587  -18.452 1.00 33.56  ? 259 LEU A C   1 
ATOM   1945  O O   . LEU A 1 279 ? -19.322 11.787  -19.325 1.00 33.96  ? 259 LEU A O   1 
ATOM   1946  C CB  . LEU A 1 279 ? -18.248 13.331  -16.681 1.00 33.34  ? 259 LEU A CB  1 
ATOM   1947  C CG  . LEU A 1 279 ? -18.752 14.406  -17.639 1.00 34.28  ? 259 LEU A CG  1 
ATOM   1948  C CD1 . LEU A 1 279 ? -20.269 14.526  -17.595 1.00 33.03  ? 259 LEU A CD1 1 
ATOM   1949  C CD2 . LEU A 1 279 ? -18.100 15.745  -17.319 1.00 35.52  ? 259 LEU A CD2 1 
ATOM   1950  N N   . LEU A 1 280 ? -17.297 11.070  -18.710 1.00 34.35  ? 260 LEU A N   1 
ATOM   1951  C CA  . LEU A 1 280 ? -16.974 10.530  -20.023 1.00 33.75  ? 260 LEU A CA  1 
ATOM   1952  C C   . LEU A 1 280 ? -17.983 9.439   -20.401 1.00 35.16  ? 260 LEU A C   1 
ATOM   1953  O O   . LEU A 1 280 ? -18.434 9.357   -21.538 1.00 33.46  ? 260 LEU A O   1 
ATOM   1954  C CB  . LEU A 1 280 ? -15.573 9.947   -19.989 1.00 34.15  ? 260 LEU A CB  1 
ATOM   1955  C CG  . LEU A 1 280 ? -15.149 9.125   -21.191 1.00 34.88  ? 260 LEU A CG  1 
ATOM   1956  C CD1 . LEU A 1 280 ? -15.131 9.982   -22.429 1.00 35.93  ? 260 LEU A CD1 1 
ATOM   1957  C CD2 . LEU A 1 280 ? -13.768 8.583   -20.957 1.00 35.44  ? 260 LEU A CD2 1 
ATOM   1958  N N   . LYS A 1 281 ? -18.328 8.605   -19.427 1.00 36.44  ? 261 LYS A N   1 
ATOM   1959  C CA  . LYS A 1 281 ? -19.321 7.573   -19.635 1.00 37.68  ? 261 LYS A CA  1 
ATOM   1960  C C   . LYS A 1 281 ? -20.659 8.148   -20.033 1.00 37.11  ? 261 LYS A C   1 
ATOM   1961  O O   . LYS A 1 281 ? -21.344 7.614   -20.901 1.00 35.39  ? 261 LYS A O   1 
ATOM   1962  C CB  . LYS A 1 281 ? -19.522 6.778   -18.363 1.00 38.54  ? 261 LYS A CB  1 
ATOM   1963  C CG  . LYS A 1 281 ? -18.514 5.679   -18.188 1.00 38.25  ? 261 LYS A CG  1 
ATOM   1964  C CD  . LYS A 1 281 ? -18.688 5.039   -16.832 1.00 37.41  ? 261 LYS A CD  1 
ATOM   1965  C CE  . LYS A 1 281 ? -17.528 4.112   -16.535 1.00 37.70  ? 261 LYS A CE  1 
ATOM   1966  N NZ  . LYS A 1 281 ? -17.906 3.102   -15.524 1.00 37.23  ? 261 LYS A NZ  1 
ATOM   1967  N N   . LYS A 1 282 ? -21.044 9.230   -19.378 1.00 36.07  ? 262 LYS A N   1 
ATOM   1968  C CA  . LYS A 1 282 ? -22.331 9.817   -19.665 1.00 35.28  ? 262 LYS A CA  1 
ATOM   1969  C C   . LYS A 1 282 ? -22.395 10.386  -21.073 1.00 36.53  ? 262 LYS A C   1 
ATOM   1970  O O   . LYS A 1 282 ? -23.417 10.273  -21.740 1.00 35.70  ? 262 LYS A O   1 
ATOM   1971  C CB  . LYS A 1 282 ? -22.654 10.893  -18.652 1.00 35.35  ? 262 LYS A CB  1 
ATOM   1972  C CG  . LYS A 1 282 ? -24.091 11.375  -18.761 1.00 35.32  ? 262 LYS A CG  1 
ATOM   1973  C CD  . LYS A 1 282 ? -24.587 11.844  -17.424 1.00 35.66  ? 262 LYS A CD  1 
ATOM   1974  C CE  . LYS A 1 282 ? -23.953 13.180  -17.093 1.00 36.91  ? 262 LYS A CE  1 
ATOM   1975  N NZ  . LYS A 1 282 ? -24.290 13.555  -15.697 1.00 37.32  ? 262 LYS A NZ  1 
ATOM   1976  N N   . TYR A 1 283 ? -21.305 11.013  -21.508 1.00 37.18  ? 263 TYR A N   1 
ATOM   1977  C CA  . TYR A 1 283 ? -21.203 11.502  -22.877 1.00 37.85  ? 263 TYR A CA  1 
ATOM   1978  C C   . TYR A 1 283 ? -21.330 10.388  -23.917 1.00 38.58  ? 263 TYR A C   1 
ATOM   1979  O O   . TYR A 1 283 ? -22.056 10.519  -24.901 1.00 39.45  ? 263 TYR A O   1 
ATOM   1980  C CB  . TYR A 1 283 ? -19.866 12.213  -23.081 1.00 39.33  ? 263 TYR A CB  1 
ATOM   1981  C CG  . TYR A 1 283 ? -19.867 13.682  -22.728 1.00 39.11  ? 263 TYR A CG  1 
ATOM   1982  C CD1 . TYR A 1 283 ? -19.752 14.099  -21.413 1.00 39.12  ? 263 TYR A CD1 1 
ATOM   1983  C CD2 . TYR A 1 283 ? -19.943 14.654  -23.720 1.00 41.45  ? 263 TYR A CD2 1 
ATOM   1984  C CE1 . TYR A 1 283 ? -19.735 15.434  -21.083 1.00 39.36  ? 263 TYR A CE1 1 
ATOM   1985  C CE2 . TYR A 1 283 ? -19.913 16.003  -23.403 1.00 41.10  ? 263 TYR A CE2 1 
ATOM   1986  C CZ  . TYR A 1 283 ? -19.814 16.382  -22.084 1.00 41.85  ? 263 TYR A CZ  1 
ATOM   1987  O OH  . TYR A 1 283 ? -19.808 17.719  -21.775 1.00 43.52  ? 263 TYR A OH  1 
ATOM   1988  N N   . VAL A 1 284 ? -20.616 9.292   -23.720 1.00 39.57  ? 264 VAL A N   1 
ATOM   1989  C CA  . VAL A 1 284 ? -20.657 8.223   -24.710 1.00 38.55  ? 264 VAL A CA  1 
ATOM   1990  C C   . VAL A 1 284 ? -22.042 7.593   -24.729 1.00 38.37  ? 264 VAL A C   1 
ATOM   1991  O O   . VAL A 1 284 ? -22.551 7.233   -25.774 1.00 41.88  ? 264 VAL A O   1 
ATOM   1992  C CB  . VAL A 1 284 ? -19.590 7.161   -24.441 1.00 38.58  ? 264 VAL A CB  1 
ATOM   1993  C CG1 . VAL A 1 284 ? -19.703 6.021   -25.441 1.00 39.71  ? 264 VAL A CG1 1 
ATOM   1994  C CG2 . VAL A 1 284 ? -18.218 7.781   -24.550 1.00 38.95  ? 264 VAL A CG2 1 
ATOM   1995  N N   . ARG A 1 285 ? -22.654 7.475   -23.567 1.00 37.36  ? 265 ARG A N   1 
ATOM   1996  C CA  . ARG A 1 285 ? -24.028 6.991   -23.484 1.00 39.23  ? 265 ARG A CA  1 
ATOM   1997  C C   . ARG A 1 285 ? -25.048 7.848   -24.206 1.00 40.75  ? 265 ARG A C   1 
ATOM   1998  O O   . ARG A 1 285 ? -26.072 7.339   -24.639 1.00 42.89  ? 265 ARG A O   1 
ATOM   1999  C CB  . ARG A 1 285 ? -24.454 6.885   -22.031 1.00 37.26  ? 265 ARG A CB  1 
ATOM   2000  C CG  . ARG A 1 285 ? -24.106 5.547   -21.482 1.00 38.19  ? 265 ARG A CG  1 
ATOM   2001  C CD  . ARG A 1 285 ? -23.848 5.639   -20.015 1.00 39.70  ? 265 ARG A CD  1 
ATOM   2002  N NE  . ARG A 1 285 ? -23.613 4.310   -19.482 1.00 37.69  ? 265 ARG A NE  1 
ATOM   2003  C CZ  . ARG A 1 285 ? -23.288 4.073   -18.223 1.00 37.88  ? 265 ARG A CZ  1 
ATOM   2004  N NH1 . ARG A 1 285 ? -23.162 5.063   -17.365 1.00 39.49  ? 265 ARG A NH1 1 
ATOM   2005  N NH2 . ARG A 1 285 ? -23.099 2.842   -17.805 1.00 37.59  ? 265 ARG A NH2 1 
ATOM   2006  N N   . ALA A 1 286 ? -24.775 9.146   -24.282 1.00 40.98  ? 266 ALA A N   1 
ATOM   2007  C CA  . ALA A 1 286 ? -25.624 10.085  -24.982 1.00 40.50  ? 266 ALA A CA  1 
ATOM   2008  C C   . ALA A 1 286 ? -25.449 10.001  -26.494 1.00 40.92  ? 266 ALA A C   1 
ATOM   2009  O O   . ALA A 1 286 ? -26.261 10.517  -27.264 1.00 42.18  ? 266 ALA A O   1 
ATOM   2010  C CB  . ALA A 1 286 ? -25.297 11.492  -24.529 1.00 41.95  ? 266 ALA A CB  1 
ATOM   2011  N N   . GLY A 1 287 ? -24.365 9.382   -26.924 1.00 40.12  ? 267 GLY A N   1 
ATOM   2012  C CA  . GLY A 1 287 ? -24.012 9.406   -28.325 1.00 39.42  ? 267 GLY A CA  1 
ATOM   2013  C C   . GLY A 1 287 ? -23.322 10.690  -28.739 1.00 37.94  ? 267 GLY A C   1 
ATOM   2014  O O   . GLY A 1 287 ? -23.184 10.946  -29.917 1.00 40.12  ? 267 GLY A O   1 
ATOM   2015  N N   . TRP A 1 288 ? -22.879 11.494  -27.780 1.00 36.99  ? 268 TRP A N   1 
ATOM   2016  C CA  . TRP A 1 288 ? -22.078 12.673  -28.085 1.00 37.60  ? 268 TRP A CA  1 
ATOM   2017  C C   . TRP A 1 288 ? -20.635 12.243  -28.120 1.00 39.06  ? 268 TRP A C   1 
ATOM   2018  O O   . TRP A 1 288 ? -19.913 12.387  -27.136 1.00 38.58  ? 268 TRP A O   1 
ATOM   2019  C CB  . TRP A 1 288 ? -22.243 13.732  -27.007 1.00 37.87  ? 268 TRP A CB  1 
ATOM   2020  C CG  . TRP A 1 288 ? -23.625 14.201  -26.831 1.00 38.10  ? 268 TRP A CG  1 
ATOM   2021  C CD1 . TRP A 1 288 ? -24.709 13.899  -27.604 1.00 39.17  ? 268 TRP A CD1 1 
ATOM   2022  C CD2 . TRP A 1 288 ? -24.083 15.085  -25.830 1.00 38.43  ? 268 TRP A CD2 1 
ATOM   2023  N NE1 . TRP A 1 288 ? -25.818 14.527  -27.126 1.00 37.76  ? 268 TRP A NE1 1 
ATOM   2024  C CE2 . TRP A 1 288 ? -25.464 15.274  -26.038 1.00 38.34  ? 268 TRP A CE2 1 
ATOM   2025  C CE3 . TRP A 1 288 ? -23.464 15.736  -24.763 1.00 39.04  ? 268 TRP A CE3 1 
ATOM   2026  C CZ2 . TRP A 1 288 ? -26.241 16.089  -25.214 1.00 37.48  ? 268 TRP A CZ2 1 
ATOM   2027  C CZ3 . TRP A 1 288 ? -24.230 16.559  -23.955 1.00 38.68  ? 268 TRP A CZ3 1 
ATOM   2028  C CH2 . TRP A 1 288 ? -25.606 16.722  -24.180 1.00 39.35  ? 268 TRP A CH2 1 
ATOM   2029  N N   . LEU A 1 289 ? -20.209 11.717  -29.258 1.00 39.14  ? 269 LEU A N   1 
ATOM   2030  C CA  . LEU A 1 289 ? -18.919 11.064  -29.339 1.00 39.41  ? 269 LEU A CA  1 
ATOM   2031  C C   . LEU A 1 289 ? -17.788 11.947  -29.805 1.00 39.44  ? 269 LEU A C   1 
ATOM   2032  O O   . LEU A 1 289 ? -16.639 11.511  -29.819 1.00 39.37  ? 269 LEU A O   1 
ATOM   2033  C CB  . LEU A 1 289 ? -19.022 9.867   -30.257 1.00 39.79  ? 269 LEU A CB  1 
ATOM   2034  C CG  . LEU A 1 289 ? -20.093 8.855   -29.855 1.00 42.79  ? 269 LEU A CG  1 
ATOM   2035  C CD1 . LEU A 1 289 ? -19.933 7.586   -30.661 1.00 39.76  ? 269 LEU A CD1 1 
ATOM   2036  C CD2 . LEU A 1 289 ? -19.998 8.508   -28.387 1.00 44.22  ? 269 LEU A CD2 1 
ATOM   2037  N N   . GLY A 1 290 ? -18.109 13.177  -30.182 1.00 40.65  ? 270 GLY A N   1 
ATOM   2038  C CA  . GLY A 1 290 ? -17.097 14.116  -30.648 1.00 42.37  ? 270 GLY A CA  1 
ATOM   2039  C C   . GLY A 1 290 ? -17.342 14.534  -32.081 1.00 43.08  ? 270 GLY A C   1 
ATOM   2040  O O   . GLY A 1 290 ? -18.488 14.664  -32.515 1.00 45.28  ? 270 GLY A O   1 
ATOM   2041  N N   . ARG A 1 291 ? -16.266 14.743  -32.824 1.00 44.60  ? 271 ARG A N   1 
ATOM   2042  C CA  . ARG A 1 291 ? -16.384 15.237  -34.190 1.00 47.85  ? 271 ARG A CA  1 
ATOM   2043  C C   . ARG A 1 291 ? -17.270 14.364  -35.035 1.00 49.19  ? 271 ARG A C   1 
ATOM   2044  O O   . ARG A 1 291 ? -18.161 14.865  -35.708 1.00 48.09  ? 271 ARG A O   1 
ATOM   2045  C CB  . ARG A 1 291 ? -15.025 15.359  -34.847 1.00 50.82  ? 271 ARG A CB  1 
ATOM   2046  C CG  . ARG A 1 291 ? -14.384 16.714  -34.609 1.00 57.81  ? 271 ARG A CG  1 
ATOM   2047  C CD  . ARG A 1 291 ? -13.114 16.907  -35.432 1.00 64.41  ? 271 ARG A CD  1 
ATOM   2048  N NE  . ARG A 1 291 ? -12.894 18.323  -35.752 1.00 73.02  ? 271 ARG A NE  1 
ATOM   2049  C CZ  . ARG A 1 291 ? -13.510 19.004  -36.728 1.00 77.86  ? 271 ARG A CZ  1 
ATOM   2050  N NH1 . ARG A 1 291 ? -14.400 18.418  -37.531 1.00 79.87  ? 271 ARG A NH1 1 
ATOM   2051  N NH2 . ARG A 1 291 ? -13.237 20.293  -36.906 1.00 79.60  ? 271 ARG A NH2 1 
ATOM   2052  N N   . LYS A 1 292 ? -17.047 13.055  -34.969 1.00 52.85  ? 272 LYS A N   1 
ATOM   2053  C CA  . LYS A 1 292 ? -17.785 12.123  -35.818 1.00 53.37  ? 272 LYS A CA  1 
ATOM   2054  C C   . LYS A 1 292 ? -19.285 12.140  -35.598 1.00 53.20  ? 272 LYS A C   1 
ATOM   2055  O O   . LYS A 1 292 ? -20.010 11.714  -36.473 1.00 57.88  ? 272 LYS A O   1 
ATOM   2056  C CB  . LYS A 1 292 ? -17.302 10.686  -35.650 1.00 55.39  ? 272 LYS A CB  1 
ATOM   2057  C CG  . LYS A 1 292 ? -17.462 10.135  -34.240 1.00 59.15  ? 272 LYS A CG  1 
ATOM   2058  C CD  . LYS A 1 292 ? -17.539 8.617   -34.242 1.00 59.25  ? 272 LYS A CD  1 
ATOM   2059  C CE  . LYS A 1 292 ? -16.662 7.986   -33.174 1.00 59.42  ? 272 LYS A CE  1 
ATOM   2060  N NZ  . LYS A 1 292 ? -15.266 7.800   -33.667 1.00 62.49  ? 272 LYS A NZ  1 
ATOM   2061  N N   . SER A 1 293 ? -19.775 12.580  -34.449 1.00 49.89  ? 273 SER A N   1 
ATOM   2062  C CA  . SER A 1 293 ? -21.230 12.683  -34.313 1.00 47.20  ? 273 SER A CA  1 
ATOM   2063  C C   . SER A 1 293 ? -21.765 14.106  -34.259 1.00 45.54  ? 273 SER A C   1 
ATOM   2064  O O   . SER A 1 293 ? -22.941 14.296  -33.995 1.00 45.06  ? 273 SER A O   1 
ATOM   2065  C CB  . SER A 1 293 ? -21.747 11.878  -33.119 1.00 46.27  ? 273 SER A CB  1 
ATOM   2066  O OG  . SER A 1 293 ? -20.931 12.031  -31.998 1.00 46.68  ? 273 SER A OG  1 
ATOM   2067  N N   . GLY A 1 294 ? -20.930 15.101  -34.530 1.00 45.02  ? 274 GLY A N   1 
ATOM   2068  C CA  . GLY A 1 294 ? -21.372 16.503  -34.473 1.00 43.84  ? 274 GLY A CA  1 
ATOM   2069  C C   . GLY A 1 294 ? -21.347 17.122  -33.088 1.00 44.33  ? 274 GLY A C   1 
ATOM   2070  O O   . GLY A 1 294 ? -21.578 18.319  -32.937 1.00 44.19  ? 274 GLY A O   1 
ATOM   2071  N N   . LYS A 1 295 ? -21.030 16.318  -32.079 1.00 45.32  ? 275 LYS A N   1 
ATOM   2072  C CA  . LYS A 1 295 ? -21.036 16.790  -30.723 1.00 45.69  ? 275 LYS A CA  1 
ATOM   2073  C C   . LYS A 1 295 ? -20.274 15.891  -29.768 1.00 44.98  ? 275 LYS A C   1 
ATOM   2074  O O   . LYS A 1 295 ? -20.425 14.661  -29.801 1.00 42.97  ? 275 LYS A O   1 
ATOM   2075  C CB  . LYS A 1 295 ? -22.462 16.872  -30.256 1.00 46.73  ? 275 LYS A CB  1 
ATOM   2076  C CG  . LYS A 1 295 ? -22.615 17.618  -28.955 1.00 49.22  ? 275 LYS A CG  1 
ATOM   2077  C CD  . LYS A 1 295 ? -24.087 17.916  -28.782 1.00 51.28  ? 275 LYS A CD  1 
ATOM   2078  C CE  . LYS A 1 295 ? -24.437 18.220  -27.352 1.00 52.40  ? 275 LYS A CE  1 
ATOM   2079  N NZ  . LYS A 1 295 ? -24.198 19.659  -27.143 1.00 55.41  ? 275 LYS A NZ  1 
ATOM   2080  N N   . GLY A 1 296 ? -19.476 16.530  -28.915 1.00 43.08  ? 276 GLY A N   1 
ATOM   2081  C CA  . GLY A 1 296 ? -18.758 15.865  -27.838 1.00 42.06  ? 276 GLY A CA  1 
ATOM   2082  C C   . GLY A 1 296 ? -18.609 16.889  -26.740 1.00 40.17  ? 276 GLY A C   1 
ATOM   2083  O O   . GLY A 1 296 ? -19.583 17.443  -26.278 1.00 39.32  ? 276 GLY A O   1 
ATOM   2084  N N   . PHE A 1 297 ? -17.390 17.174  -26.330 1.00 41.24  ? 277 PHE A N   1 
ATOM   2085  C CA  . PHE A 1 297 ? -17.179 18.307  -25.431 1.00 43.09  ? 277 PHE A CA  1 
ATOM   2086  C C   . PHE A 1 297 ? -17.446 19.635  -26.115 1.00 41.77  ? 277 PHE A C   1 
ATOM   2087  O O   . PHE A 1 297 ? -17.817 20.599  -25.453 1.00 40.75  ? 277 PHE A O   1 
ATOM   2088  C CB  . PHE A 1 297 ? -15.778 18.265  -24.820 1.00 42.92  ? 277 PHE A CB  1 
ATOM   2089  C CG  . PHE A 1 297 ? -15.590 17.100  -23.918 1.00 42.07  ? 277 PHE A CG  1 
ATOM   2090  C CD1 . PHE A 1 297 ? -16.367 16.978  -22.768 1.00 43.74  ? 277 PHE A CD1 1 
ATOM   2091  C CD2 . PHE A 1 297 ? -14.720 16.073  -24.256 1.00 42.24  ? 277 PHE A CD2 1 
ATOM   2092  C CE1 . PHE A 1 297 ? -16.249 15.874  -21.947 1.00 42.53  ? 277 PHE A CE1 1 
ATOM   2093  C CE2 . PHE A 1 297 ? -14.597 14.967  -23.441 1.00 40.81  ? 277 PHE A CE2 1 
ATOM   2094  C CZ  . PHE A 1 297 ? -15.355 14.868  -22.283 1.00 41.50  ? 277 PHE A CZ  1 
ATOM   2095  N N   . TYR A 1 298 ? -17.251 19.669  -27.431 1.00 41.88  ? 278 TYR A N   1 
ATOM   2096  C CA  . TYR A 1 298 ? -17.655 20.800  -28.247 1.00 42.20  ? 278 TYR A CA  1 
ATOM   2097  C C   . TYR A 1 298 ? -18.827 20.402  -29.128 1.00 42.73  ? 278 TYR A C   1 
ATOM   2098  O O   . TYR A 1 298 ? -19.071 19.227  -29.381 1.00 41.48  ? 278 TYR A O   1 
ATOM   2099  C CB  . TYR A 1 298 ? -16.513 21.271  -29.149 1.00 42.46  ? 278 TYR A CB  1 
ATOM   2100  C CG  . TYR A 1 298 ? -15.270 21.731  -28.426 1.00 43.41  ? 278 TYR A CG  1 
ATOM   2101  C CD1 . TYR A 1 298 ? -14.329 20.812  -27.966 1.00 42.71  ? 278 TYR A CD1 1 
ATOM   2102  C CD2 . TYR A 1 298 ? -15.015 23.079  -28.234 1.00 42.56  ? 278 TYR A CD2 1 
ATOM   2103  C CE1 . TYR A 1 298 ? -13.181 21.227  -27.318 1.00 41.60  ? 278 TYR A CE1 1 
ATOM   2104  C CE2 . TYR A 1 298 ? -13.873 23.502  -27.578 1.00 42.08  ? 278 TYR A CE2 1 
ATOM   2105  C CZ  . TYR A 1 298 ? -12.958 22.575  -27.125 1.00 42.24  ? 278 TYR A CZ  1 
ATOM   2106  O OH  . TYR A 1 298 ? -11.825 22.995  -26.474 1.00 39.86  ? 278 TYR A OH  1 
ATOM   2107  N N   . ASP A 1 299 ? -19.533 21.423  -29.585 1.00 45.76  ? 279 ASP A N   1 
ATOM   2108  C CA  . ASP A 1 299 ? -20.551 21.329  -30.608 1.00 47.81  ? 279 ASP A CA  1 
ATOM   2109  C C   . ASP A 1 299 ? -19.888 21.553  -31.949 1.00 47.96  ? 279 ASP A C   1 
ATOM   2110  O O   . ASP A 1 299 ? -19.153 22.509  -32.106 1.00 49.51  ? 279 ASP A O   1 
ATOM   2111  C CB  . ASP A 1 299 ? -21.533 22.461  -30.395 1.00 51.34  ? 279 ASP A CB  1 
ATOM   2112  C CG  . ASP A 1 299 ? -22.940 21.994  -30.378 1.00 59.33  ? 279 ASP A CG  1 
ATOM   2113  O OD1 . ASP A 1 299 ? -23.493 21.717  -31.466 1.00 63.76  ? 279 ASP A OD1 1 
ATOM   2114  O OD2 . ASP A 1 299 ? -23.496 21.912  -29.263 1.00 64.62  ? 279 ASP A OD2 1 
ATOM   2115  N N   . TYR A 1 300 ? -20.132 20.692  -32.922 1.00 51.47  ? 280 TYR A N   1 
ATOM   2116  C CA  . TYR A 1 300 ? -19.531 20.885  -34.244 1.00 55.20  ? 280 TYR A CA  1 
ATOM   2117  C C   . TYR A 1 300 ? -20.537 21.324  -35.301 1.00 64.63  ? 280 TYR A C   1 
ATOM   2118  O O   . TYR A 1 300 ? -20.157 21.606  -36.436 1.00 73.29  ? 280 TYR A O   1 
ATOM   2119  C CB  . TYR A 1 300 ? -18.771 19.634  -34.660 1.00 52.55  ? 280 TYR A CB  1 
ATOM   2120  C CG  . TYR A 1 300 ? -17.630 19.374  -33.703 1.00 49.92  ? 280 TYR A CG  1 
ATOM   2121  C CD1 . TYR A 1 300 ? -16.393 19.970  -33.891 1.00 46.14  ? 280 TYR A CD1 1 
ATOM   2122  C CD2 . TYR A 1 300 ? -17.812 18.578  -32.572 1.00 47.98  ? 280 TYR A CD2 1 
ATOM   2123  C CE1 . TYR A 1 300 ? -15.360 19.761  -33.002 1.00 46.19  ? 280 TYR A CE1 1 
ATOM   2124  C CE2 . TYR A 1 300 ? -16.783 18.367  -31.673 1.00 46.36  ? 280 TYR A CE2 1 
ATOM   2125  C CZ  . TYR A 1 300 ? -15.562 18.958  -31.893 1.00 45.86  ? 280 TYR A CZ  1 
ATOM   2126  O OH  . TYR A 1 300 ? -14.543 18.746  -31.003 1.00 43.27  ? 280 TYR A OH  1 
ATOM   2127  N N   . SER A 1 301 ? -21.809 21.403  -34.921 1.00 76.92  ? 281 SER A N   1 
ATOM   2128  C CA  . SER A 1 301 ? -22.861 21.927  -35.797 1.00 83.76  ? 281 SER A CA  1 
ATOM   2129  C C   . SER A 1 301 ? -22.284 22.546  -37.083 1.00 88.86  ? 281 SER A C   1 
ATOM   2130  O O   . SER A 1 301 ? -23.014 22.905  -38.011 1.00 91.86  ? 281 SER A O   1 
ATOM   2131  C CB  . SER A 1 301 ? -23.678 22.992  -35.055 1.00 83.29  ? 281 SER A CB  1 
ATOM   2132  O OG  . SER A 1 301 ? -23.647 22.800  -33.654 1.00 80.84  ? 281 SER A OG  1 
ATOM   2133  N N   . SER B 1 12  ? 47.303  -12.835 5.783   1.00 78.09  ? -8  SER B N   1 
ATOM   2134  C CA  . SER B 1 12  ? 46.273  -12.340 4.804   1.00 77.59  ? -8  SER B CA  1 
ATOM   2135  C C   . SER B 1 12  ? 45.979  -13.322 3.686   1.00 78.16  ? -8  SER B C   1 
ATOM   2136  O O   . SER B 1 12  ? 44.962  -13.198 2.989   1.00 78.99  ? -8  SER B O   1 
ATOM   2137  C CB  . SER B 1 12  ? 46.728  -11.031 4.161   1.00 75.88  ? -8  SER B CB  1 
ATOM   2138  O OG  . SER B 1 12  ? 46.199  -10.892 2.845   1.00 70.84  ? -8  SER B OG  1 
ATOM   2139  N N   . GLY B 1 13  ? 46.883  -14.282 3.502   1.00 75.12  ? -7  GLY B N   1 
ATOM   2140  C CA  . GLY B 1 13  ? 46.712  -15.340 2.521   1.00 65.43  ? -7  GLY B CA  1 
ATOM   2141  C C   . GLY B 1 13  ? 45.714  -16.355 3.046   1.00 58.80  ? -7  GLY B C   1 
ATOM   2142  O O   . GLY B 1 13  ? 45.443  -17.358 2.395   1.00 55.30  ? -7  GLY B O   1 
ATOM   2143  N N   . LEU B 1 14  ? 45.160  -16.074 4.226   1.00 54.39  ? -6  LEU B N   1 
ATOM   2144  C CA  . LEU B 1 14  ? 44.073  -16.857 4.779   1.00 54.06  ? -6  LEU B CA  1 
ATOM   2145  C C   . LEU B 1 14  ? 42.725  -16.420 4.235   1.00 53.89  ? -6  LEU B C   1 
ATOM   2146  O O   . LEU B 1 14  ? 41.702  -17.005 4.564   1.00 58.52  ? -6  LEU B O   1 
ATOM   2147  C CB  . LEU B 1 14  ? 44.041  -16.706 6.295   1.00 53.97  ? -6  LEU B CB  1 
ATOM   2148  C CG  . LEU B 1 14  ? 45.165  -17.326 7.116   1.00 56.53  ? -6  LEU B CG  1 
ATOM   2149  C CD1 . LEU B 1 14  ? 44.647  -17.500 8.527   1.00 59.73  ? -6  LEU B CD1 1 
ATOM   2150  C CD2 . LEU B 1 14  ? 45.601  -18.677 6.586   1.00 54.68  ? -6  LEU B CD2 1 
ATOM   2151  N N   . VAL B 1 15  ? 42.712  -15.372 3.430   1.00 52.83  ? -5  VAL B N   1 
ATOM   2152  C CA  . VAL B 1 15  ? 41.489  -14.946 2.841   1.00 50.71  ? -5  VAL B CA  1 
ATOM   2153  C C   . VAL B 1 15  ? 41.412  -15.596 1.491   1.00 49.13  ? -5  VAL B C   1 
ATOM   2154  O O   . VAL B 1 15  ? 42.372  -15.565 0.724   1.00 52.61  ? -5  VAL B O   1 
ATOM   2155  C CB  . VAL B 1 15  ? 41.414  -13.430 2.695   1.00 55.02  ? -5  VAL B CB  1 
ATOM   2156  C CG1 . VAL B 1 15  ? 40.392  -13.041 1.638   1.00 55.29  ? -5  VAL B CG1 1 
ATOM   2157  C CG2 . VAL B 1 15  ? 41.011  -12.816 4.012   1.00 58.15  ? -5  VAL B CG2 1 
ATOM   2158  N N   . PRO B 1 16  ? 40.253  -16.166 1.187   1.00 48.11  ? -4  PRO B N   1 
ATOM   2159  C CA  . PRO B 1 16  ? 40.030  -16.890 -0.041  1.00 48.86  ? -4  PRO B CA  1 
ATOM   2160  C C   . PRO B 1 16  ? 40.376  -16.032 -1.223  1.00 52.87  ? -4  PRO B C   1 
ATOM   2161  O O   . PRO B 1 16  ? 40.101  -14.841 -1.232  1.00 54.37  ? -4  PRO B O   1 
ATOM   2162  C CB  . PRO B 1 16  ? 38.534  -17.160 -0.026  1.00 49.22  ? -4  PRO B CB  1 
ATOM   2163  C CG  . PRO B 1 16  ? 38.140  -17.050 1.400   1.00 47.81  ? -4  PRO B CG  1 
ATOM   2164  C CD  . PRO B 1 16  ? 39.039  -16.061 2.013   1.00 47.40  ? -4  PRO B CD  1 
ATOM   2165  N N   . ARG B 1 17  ? 40.960  -16.662 -2.221  1.00 59.21  ? -3  ARG B N   1 
ATOM   2166  C CA  . ARG B 1 17  ? 41.521  -15.965 -3.357  1.00 64.18  ? -3  ARG B CA  1 
ATOM   2167  C C   . ARG B 1 17  ? 40.448  -15.283 -4.200  1.00 62.21  ? -3  ARG B C   1 
ATOM   2168  O O   . ARG B 1 17  ? 40.735  -14.350 -4.942  1.00 61.32  ? -3  ARG B O   1 
ATOM   2169  C CB  . ARG B 1 17  ? 42.263  -16.976 -4.218  1.00 71.39  ? -3  ARG B CB  1 
ATOM   2170  C CG  . ARG B 1 17  ? 43.604  -16.505 -4.729  1.00 78.93  ? -3  ARG B CG  1 
ATOM   2171  C CD  . ARG B 1 17  ? 44.178  -17.549 -5.671  1.00 86.23  ? -3  ARG B CD  1 
ATOM   2172  N NE  . ARG B 1 17  ? 43.462  -17.552 -6.948  1.00 93.82  ? -3  ARG B NE  1 
ATOM   2173  C CZ  . ARG B 1 17  ? 43.850  -16.895 -8.042  1.00 100.17 ? -3  ARG B CZ  1 
ATOM   2174  N NH1 . ARG B 1 17  ? 44.975  -16.179 -8.044  1.00 100.38 ? -3  ARG B NH1 1 
ATOM   2175  N NH2 . ARG B 1 17  ? 43.112  -16.963 -9.148  1.00 101.60 ? -3  ARG B NH2 1 
ATOM   2176  N N   . GLY B 1 18  ? 39.212  -15.755 -4.080  1.00 59.80  ? -2  GLY B N   1 
ATOM   2177  C CA  . GLY B 1 18  ? 38.121  -15.256 -4.897  1.00 57.70  ? -2  GLY B CA  1 
ATOM   2178  C C   . GLY B 1 18  ? 37.790  -13.814 -4.595  1.00 55.72  ? -2  GLY B C   1 
ATOM   2179  O O   . GLY B 1 18  ? 37.309  -13.095 -5.459  1.00 60.79  ? -2  GLY B O   1 
ATOM   2180  N N   . SER B 1 19  ? 38.071  -13.393 -3.369  1.00 52.35  ? -1  SER B N   1 
ATOM   2181  C CA  . SER B 1 19  ? 37.812  -12.027 -2.931  1.00 50.01  ? -1  SER B CA  1 
ATOM   2182  C C   . SER B 1 19  ? 39.063  -11.164 -2.930  1.00 49.92  ? -1  SER B C   1 
ATOM   2183  O O   . SER B 1 19  ? 39.913  -11.323 -2.076  1.00 47.49  ? -1  SER B O   1 
ATOM   2184  C CB  . SER B 1 19  ? 37.207  -12.049 -1.527  1.00 49.16  ? -1  SER B CB  1 
ATOM   2185  O OG  . SER B 1 19  ? 37.513  -10.877 -0.795  1.00 49.91  ? -1  SER B OG  1 
ATOM   2186  N N   . HIS B 1 20  ? 39.145  -10.229 -3.871  1.00 54.42  ? 0   HIS B N   1 
ATOM   2187  C CA  . HIS B 1 20  ? 40.235  -9.246  -3.908  1.00 61.45  ? 0   HIS B CA  1 
ATOM   2188  C C   . HIS B 1 20  ? 40.321  -8.392  -2.649  1.00 59.41  ? 0   HIS B C   1 
ATOM   2189  O O   . HIS B 1 20  ? 41.402  -7.942  -2.261  1.00 59.07  ? 0   HIS B O   1 
ATOM   2190  C CB  . HIS B 1 20  ? 40.107  -8.353  -5.142  1.00 67.18  ? 0   HIS B CB  1 
ATOM   2191  C CG  . HIS B 1 20  ? 40.573  -9.023  -6.395  1.00 84.61  ? 0   HIS B CG  1 
ATOM   2192  N ND1 . HIS B 1 20  ? 39.906  -10.091 -6.964  1.00 93.12  ? 0   HIS B ND1 1 
ATOM   2193  C CD2 . HIS B 1 20  ? 41.665  -8.808  -7.166  1.00 92.21  ? 0   HIS B CD2 1 
ATOM   2194  C CE1 . HIS B 1 20  ? 40.556  -10.489 -8.043  1.00 93.97  ? 0   HIS B CE1 1 
ATOM   2195  N NE2 . HIS B 1 20  ? 41.627  -9.729  -8.187  1.00 96.40  ? 0   HIS B NE2 1 
ATOM   2196  N N   . MET B 1 21  ? 39.181  -8.177  -2.013  1.00 57.23  ? 1   MET B N   1 
ATOM   2197  C CA  . MET B 1 21  ? 39.135  -7.368  -0.829  1.00 59.81  ? 1   MET B CA  1 
ATOM   2198  C C   . MET B 1 21  ? 39.601  -8.217  0.318   1.00 61.08  ? 1   MET B C   1 
ATOM   2199  O O   . MET B 1 21  ? 39.270  -9.394  0.384   1.00 63.60  ? 1   MET B O   1 
ATOM   2200  C CB  . MET B 1 21  ? 37.713  -6.890  -0.571  1.00 62.20  ? 1   MET B CB  1 
ATOM   2201  C CG  . MET B 1 21  ? 37.144  -5.983  -1.661  1.00 61.48  ? 1   MET B CG  1 
ATOM   2202  S SD  . MET B 1 21  ? 35.662  -5.149  -1.051  1.00 61.25  ? 1   MET B SD  1 
ATOM   2203  C CE  . MET B 1 21  ? 34.362  -6.204  -1.649  1.00 61.58  ? 1   MET B CE  1 
ATOM   2204  N N   . LYS B 1 22  ? 40.360  -7.616  1.225   1.00 63.50  ? 2   LYS B N   1 
ATOM   2205  C CA  . LYS B 1 22  ? 41.011  -8.383  2.277   1.00 65.42  ? 2   LYS B CA  1 
ATOM   2206  C C   . LYS B 1 22  ? 40.865  -7.883  3.706   1.00 66.84  ? 2   LYS B C   1 
ATOM   2207  O O   . LYS B 1 22  ? 41.218  -8.592  4.657   1.00 63.86  ? 2   LYS B O   1 
ATOM   2208  C CB  . LYS B 1 22  ? 42.483  -8.526  1.928   1.00 65.22  ? 2   LYS B CB  1 
ATOM   2209  C CG  . LYS B 1 22  ? 42.787  -9.881  1.335   1.00 69.56  ? 2   LYS B CG  1 
ATOM   2210  C CD  . LYS B 1 22  ? 42.619  -9.941  -0.169  1.00 67.36  ? 2   LYS B CD  1 
ATOM   2211  C CE  . LYS B 1 22  ? 42.519  -11.400 -0.579  1.00 67.63  ? 2   LYS B CE  1 
ATOM   2212  N NZ  . LYS B 1 22  ? 42.852  -11.619 -2.009  1.00 69.80  ? 2   LYS B NZ  1 
ATOM   2213  N N   . LYS B 1 23  ? 40.334  -6.680  3.862   1.00 68.43  ? 3   LYS B N   1 
ATOM   2214  C CA  . LYS B 1 23  ? 40.150  -6.114  5.177   1.00 66.33  ? 3   LYS B CA  1 
ATOM   2215  C C   . LYS B 1 23  ? 38.791  -5.461  5.271   1.00 60.28  ? 3   LYS B C   1 
ATOM   2216  O O   . LYS B 1 23  ? 38.368  -4.766  4.356   1.00 60.73  ? 3   LYS B O   1 
ATOM   2217  C CB  . LYS B 1 23  ? 41.230  -5.091  5.435   1.00 71.86  ? 3   LYS B CB  1 
ATOM   2218  C CG  . LYS B 1 23  ? 41.481  -4.903  6.903   1.00 78.19  ? 3   LYS B CG  1 
ATOM   2219  C CD  . LYS B 1 23  ? 42.605  -3.929  7.122   1.00 82.29  ? 3   LYS B CD  1 
ATOM   2220  C CE  . LYS B 1 23  ? 42.321  -3.119  8.362   1.00 86.74  ? 3   LYS B CE  1 
ATOM   2221  N NZ  . LYS B 1 23  ? 43.570  -2.911  9.127   1.00 92.75  ? 3   LYS B NZ  1 
ATOM   2222  N N   . VAL B 1 24  ? 38.112  -5.672  6.385   1.00 56.13  ? 4   VAL B N   1 
ATOM   2223  C CA  . VAL B 1 24  ? 36.734  -5.247  6.508   1.00 54.34  ? 4   VAL B CA  1 
ATOM   2224  C C   . VAL B 1 24  ? 36.522  -4.494  7.783   1.00 56.04  ? 4   VAL B C   1 
ATOM   2225  O O   . VAL B 1 24  ? 36.953  -4.937  8.841   1.00 59.14  ? 4   VAL B O   1 
ATOM   2226  C CB  . VAL B 1 24  ? 35.790  -6.450  6.548   1.00 53.66  ? 4   VAL B CB  1 
ATOM   2227  C CG1 . VAL B 1 24  ? 34.346  -5.992  6.566   1.00 52.80  ? 4   VAL B CG1 1 
ATOM   2228  C CG2 . VAL B 1 24  ? 36.022  -7.325  5.340   1.00 54.06  ? 4   VAL B CG2 1 
ATOM   2229  N N   . CYS B 1 25  ? 35.828  -3.366  7.685   1.00 56.57  ? 5   CYS B N   1 
ATOM   2230  C CA  . CYS B 1 25  ? 35.377  -2.677  8.869   1.00 55.12  ? 5   CYS B CA  1 
ATOM   2231  C C   . CYS B 1 25  ? 33.878  -2.855  8.994   1.00 53.49  ? 5   CYS B C   1 
ATOM   2232  O O   . CYS B 1 25  ? 33.140  -2.658  8.041   1.00 55.91  ? 5   CYS B O   1 
ATOM   2233  C CB  . CYS B 1 25  ? 35.718  -1.196  8.810   1.00 56.84  ? 5   CYS B CB  1 
ATOM   2234  S SG  . CYS B 1 25  ? 35.145  -0.284  10.267  1.00 61.09  ? 5   CYS B SG  1 
ATOM   2235  N N   . VAL B 1 26  ? 33.438  -3.239  10.177  1.00 49.75  ? 6   VAL B N   1 
ATOM   2236  C CA  . VAL B 1 26  ? 32.041  -3.309  10.466  1.00 50.44  ? 6   VAL B CA  1 
ATOM   2237  C C   . VAL B 1 26  ? 31.749  -2.226  11.485  1.00 55.05  ? 6   VAL B C   1 
ATOM   2238  O O   . VAL B 1 26  ? 32.413  -2.137  12.508  1.00 56.18  ? 6   VAL B O   1 
ATOM   2239  C CB  . VAL B 1 26  ? 31.666  -4.677  11.026  1.00 49.43  ? 6   VAL B CB  1 
ATOM   2240  C CG1 . VAL B 1 26  ? 30.247  -4.680  11.555  1.00 47.40  ? 6   VAL B CG1 1 
ATOM   2241  C CG2 . VAL B 1 26  ? 31.786  -5.705  9.928   1.00 49.94  ? 6   VAL B CG2 1 
ATOM   2242  N N   . ILE B 1 27  ? 30.758  -1.399  11.188  1.00 55.92  ? 7   ILE B N   1 
ATOM   2243  C CA  . ILE B 1 27  ? 30.379  -0.327  12.073  1.00 55.48  ? 7   ILE B CA  1 
ATOM   2244  C C   . ILE B 1 27  ? 29.117  -0.705  12.786  1.00 56.62  ? 7   ILE B C   1 
ATOM   2245  O O   . ILE B 1 27  ? 28.096  -0.975  12.140  1.00 58.10  ? 7   ILE B O   1 
ATOM   2246  C CB  . ILE B 1 27  ? 30.044  0.943   11.306  1.00 57.12  ? 7   ILE B CB  1 
ATOM   2247  C CG1 . ILE B 1 27  ? 31.273  1.806   11.144  1.00 58.80  ? 7   ILE B CG1 1 
ATOM   2248  C CG2 . ILE B 1 27  ? 29.053  1.772   12.085  1.00 58.09  ? 7   ILE B CG2 1 
ATOM   2249  C CD1 . ILE B 1 27  ? 32.063  1.444   9.927   1.00 59.79  ? 7   ILE B CD1 1 
ATOM   2250  N N   . GLY B 1 28  ? 29.168  -0.688  14.112  1.00 57.38  ? 8   GLY B N   1 
ATOM   2251  C CA  . GLY B 1 28  ? 27.999  -1.048  14.912  1.00 54.48  ? 8   GLY B CA  1 
ATOM   2252  C C   . GLY B 1 28  ? 28.217  -2.436  15.459  1.00 55.77  ? 8   GLY B C   1 
ATOM   2253  O O   . GLY B 1 28  ? 28.483  -3.374  14.715  1.00 56.58  ? 8   GLY B O   1 
ATOM   2254  N N   . ALA B 1 29  ? 28.128  -2.566  16.769  1.00 57.03  ? 9   ALA B N   1 
ATOM   2255  C CA  . ALA B 1 29  ? 28.472  -3.814  17.421  1.00 56.78  ? 9   ALA B CA  1 
ATOM   2256  C C   . ALA B 1 29  ? 27.261  -4.404  18.120  1.00 57.85  ? 9   ALA B C   1 
ATOM   2257  O O   . ALA B 1 29  ? 27.363  -5.002  19.197  1.00 60.99  ? 9   ALA B O   1 
ATOM   2258  C CB  . ALA B 1 29  ? 29.611  -3.587  18.397  1.00 57.12  ? 9   ALA B CB  1 
ATOM   2259  N N   . GLY B 1 30  ? 26.101  -4.237  17.500  1.00 57.86  ? 10  GLY B N   1 
ATOM   2260  C CA  . GLY B 1 30  ? 24.907  -4.879  18.003  1.00 59.58  ? 10  GLY B CA  1 
ATOM   2261  C C   . GLY B 1 30  ? 24.905  -6.320  17.553  1.00 59.31  ? 10  GLY B C   1 
ATOM   2262  O O   . GLY B 1 30  ? 25.925  -6.866  17.124  1.00 57.04  ? 10  GLY B O   1 
ATOM   2263  N N   . THR B 1 31  ? 23.733  -6.924  17.630  1.00 59.79  ? 11  THR B N   1 
ATOM   2264  C CA  . THR B 1 31  ? 23.532  -8.281  17.165  1.00 60.80  ? 11  THR B CA  1 
ATOM   2265  C C   . THR B 1 31  ? 24.032  -8.478  15.735  1.00 60.41  ? 11  THR B C   1 
ATOM   2266  O O   . THR B 1 31  ? 24.934  -9.274  15.500  1.00 64.54  ? 11  THR B O   1 
ATOM   2267  C CB  . THR B 1 31  ? 22.048  -8.649  17.242  1.00 63.08  ? 11  THR B CB  1 
ATOM   2268  O OG1 . THR B 1 31  ? 21.520  -8.212  18.501  1.00 63.63  ? 11  THR B OG1 1 
ATOM   2269  C CG2 . THR B 1 31  ? 21.872  -10.141 17.108  1.00 66.43  ? 11  THR B CG2 1 
ATOM   2270  N N   . MET B 1 32  ? 23.455  -7.755  14.785  1.00 59.58  ? 12  MET B N   1 
ATOM   2271  C CA  . MET B 1 32  ? 23.813  -7.941  13.385  1.00 59.49  ? 12  MET B CA  1 
ATOM   2272  C C   . MET B 1 32  ? 25.265  -7.607  13.108  1.00 56.60  ? 12  MET B C   1 
ATOM   2273  O O   . MET B 1 32  ? 25.927  -8.291  12.343  1.00 55.42  ? 12  MET B O   1 
ATOM   2274  C CB  . MET B 1 32  ? 22.909  -7.099  12.487  1.00 60.81  ? 12  MET B CB  1 
ATOM   2275  C CG  . MET B 1 32  ? 21.519  -7.691  12.337  1.00 61.50  ? 12  MET B CG  1 
ATOM   2276  S SD  . MET B 1 32  ? 21.513  -9.348  11.635  1.00 60.75  ? 12  MET B SD  1 
ATOM   2277  C CE  . MET B 1 32  ? 22.634  -9.120  10.255  1.00 59.68  ? 12  MET B CE  1 
ATOM   2278  N N   . GLY B 1 33  ? 25.763  -6.562  13.743  1.00 54.14  ? 13  GLY B N   1 
ATOM   2279  C CA  . GLY B 1 33  ? 27.120  -6.108  13.478  1.00 53.21  ? 13  GLY B CA  1 
ATOM   2280  C C   . GLY B 1 33  ? 28.168  -7.061  14.023  1.00 55.09  ? 13  GLY B C   1 
ATOM   2281  O O   . GLY B 1 33  ? 29.189  -7.312  13.382  1.00 53.81  ? 13  GLY B O   1 
ATOM   2282  N N   . SER B 1 34  ? 27.926  -7.591  15.214  1.00 54.45  ? 14  SER B N   1 
ATOM   2283  C CA  . SER B 1 34  ? 28.822  -8.585  15.787  1.00 56.78  ? 14  SER B CA  1 
ATOM   2284  C C   . SER B 1 34  ? 28.849  -9.815  14.913  1.00 56.15  ? 14  SER B C   1 
ATOM   2285  O O   . SER B 1 34  ? 29.926  -10.329 14.563  1.00 57.80  ? 14  SER B O   1 
ATOM   2286  C CB  . SER B 1 34  ? 28.349  -8.980  17.175  1.00 58.60  ? 14  SER B CB  1 
ATOM   2287  O OG  . SER B 1 34  ? 28.304  -7.841  18.012  1.00 61.39  ? 14  SER B OG  1 
ATOM   2288  N N   . GLY B 1 35  ? 27.645  -10.265 14.566  1.00 54.60  ? 15  GLY B N   1 
ATOM   2289  C CA  . GLY B 1 35  ? 27.442  -11.426 13.706  1.00 53.34  ? 15  GLY B CA  1 
ATOM   2290  C C   . GLY B 1 35  ? 28.193  -11.327 12.396  1.00 49.00  ? 15  GLY B C   1 
ATOM   2291  O O   . GLY B 1 35  ? 28.729  -12.306 11.906  1.00 53.89  ? 15  GLY B O   1 
ATOM   2292  N N   . ILE B 1 36  ? 28.250  -10.139 11.833  1.00 46.02  ? 16  ILE B N   1 
ATOM   2293  C CA  . ILE B 1 36  ? 28.815  -9.990  10.510  1.00 46.53  ? 16  ILE B CA  1 
ATOM   2294  C C   . ILE B 1 36  ? 30.329  -9.986  10.566  1.00 46.77  ? 16  ILE B C   1 
ATOM   2295  O O   . ILE B 1 36  ? 31.009  -10.418 9.636   1.00 44.21  ? 16  ILE B O   1 
ATOM   2296  C CB  . ILE B 1 36  ? 28.313  -8.700  9.879   1.00 46.29  ? 16  ILE B CB  1 
ATOM   2297  C CG1 . ILE B 1 36  ? 26.822  -8.845  9.613   1.00 47.30  ? 16  ILE B CG1 1 
ATOM   2298  C CG2 . ILE B 1 36  ? 29.065  -8.400  8.588   1.00 46.74  ? 16  ILE B CG2 1 
ATOM   2299  C CD1 . ILE B 1 36  ? 26.129  -7.519  9.421   1.00 49.57  ? 16  ILE B CD1 1 
ATOM   2300  N N   . ALA B 1 37  ? 30.844  -9.477  11.670  1.00 47.73  ? 17  ALA B N   1 
ATOM   2301  C CA  . ALA B 1 37  ? 32.265  -9.435  11.892  1.00 47.30  ? 17  ALA B CA  1 
ATOM   2302  C C   . ALA B 1 37  ? 32.737  -10.844 12.134  1.00 47.55  ? 17  ALA B C   1 
ATOM   2303  O O   . ALA B 1 37  ? 33.813  -11.243 11.683  1.00 47.53  ? 17  ALA B O   1 
ATOM   2304  C CB  . ALA B 1 37  ? 32.557  -8.595  13.106  1.00 47.15  ? 17  ALA B CB  1 
ATOM   2305  N N   . GLN B 1 38  ? 31.920  -11.584 12.872  1.00 46.93  ? 18  GLN B N   1 
ATOM   2306  C CA  . GLN B 1 38  ? 32.225  -12.962 13.178  1.00 47.44  ? 18  GLN B CA  1 
ATOM   2307  C C   . GLN B 1 38  ? 32.296  -13.767 11.896  1.00 46.61  ? 18  GLN B C   1 
ATOM   2308  O O   . GLN B 1 38  ? 33.197  -14.569 11.716  1.00 44.75  ? 18  GLN B O   1 
ATOM   2309  C CB  . GLN B 1 38  ? 31.168  -13.547 14.094  1.00 47.96  ? 18  GLN B CB  1 
ATOM   2310  C CG  . GLN B 1 38  ? 31.442  -14.991 14.444  1.00 49.78  ? 18  GLN B CG  1 
ATOM   2311  C CD  . GLN B 1 38  ? 30.427  -15.548 15.414  1.00 51.61  ? 18  GLN B CD  1 
ATOM   2312  O OE1 . GLN B 1 38  ? 29.927  -14.833 16.288  1.00 54.87  ? 18  GLN B OE1 1 
ATOM   2313  N NE2 . GLN B 1 38  ? 30.111  -16.829 15.266  1.00 48.14  ? 18  GLN B NE2 1 
ATOM   2314  N N   . ALA B 1 39  ? 31.349  -13.527 11.000  1.00 46.69  ? 19  ALA B N   1 
ATOM   2315  C CA  . ALA B 1 39  ? 31.282  -14.266 9.738   1.00 48.01  ? 19  ALA B CA  1 
ATOM   2316  C C   . ALA B 1 39  ? 32.494  -14.027 8.854   1.00 47.92  ? 19  ALA B C   1 
ATOM   2317  O O   . ALA B 1 39  ? 32.942  -14.930 8.150   1.00 49.61  ? 19  ALA B O   1 
ATOM   2318  C CB  . ALA B 1 39  ? 30.014  -13.907 8.979   1.00 45.29  ? 19  ALA B CB  1 
ATOM   2319  N N   . PHE B 1 40  ? 33.006  -12.805 8.883   1.00 46.63  ? 20  PHE B N   1 
ATOM   2320  C CA  . PHE B 1 40  ? 34.178  -12.458 8.098   1.00 49.09  ? 20  PHE B CA  1 
ATOM   2321  C C   . PHE B 1 40  ? 35.440  -13.010 8.735   1.00 50.63  ? 20  PHE B C   1 
ATOM   2322  O O   . PHE B 1 40  ? 36.313  -13.537 8.052   1.00 49.09  ? 20  PHE B O   1 
ATOM   2323  C CB  . PHE B 1 40  ? 34.304  -10.941 7.960   1.00 49.01  ? 20  PHE B CB  1 
ATOM   2324  C CG  . PHE B 1 40  ? 33.538  -10.398 6.810   1.00 48.43  ? 20  PHE B CG  1 
ATOM   2325  C CD1 . PHE B 1 40  ? 34.081  -10.430 5.545   1.00 47.80  ? 20  PHE B CD1 1 
ATOM   2326  C CD2 . PHE B 1 40  ? 32.257  -9.904  6.979   1.00 46.76  ? 20  PHE B CD2 1 
ATOM   2327  C CE1 . PHE B 1 40  ? 33.369  -9.955  4.462   1.00 49.54  ? 20  PHE B CE1 1 
ATOM   2328  C CE2 . PHE B 1 40  ? 31.534  -9.440  5.902   1.00 46.69  ? 20  PHE B CE2 1 
ATOM   2329  C CZ  . PHE B 1 40  ? 32.089  -9.464  4.641   1.00 46.66  ? 20  PHE B CZ  1 
ATOM   2330  N N   . ALA B 1 41  ? 35.534  -12.853 10.046  1.00 51.25  ? 21  ALA B N   1 
ATOM   2331  C CA  . ALA B 1 41  ? 36.713  -13.267 10.782  1.00 55.10  ? 21  ALA B CA  1 
ATOM   2332  C C   . ALA B 1 41  ? 36.857  -14.779 10.691  1.00 54.17  ? 21  ALA B C   1 
ATOM   2333  O O   . ALA B 1 41  ? 37.958  -15.301 10.512  1.00 54.74  ? 21  ALA B O   1 
ATOM   2334  C CB  . ALA B 1 41  ? 36.615  -12.820 12.238  1.00 55.43  ? 21  ALA B CB  1 
ATOM   2335  N N   . ALA B 1 42  ? 35.729  -15.470 10.781  1.00 51.26  ? 22  ALA B N   1 
ATOM   2336  C CA  . ALA B 1 42  ? 35.706  -16.925 10.694  1.00 50.29  ? 22  ALA B CA  1 
ATOM   2337  C C   . ALA B 1 42  ? 36.261  -17.436 9.360   1.00 49.79  ? 22  ALA B C   1 
ATOM   2338  O O   . ALA B 1 42  ? 36.812  -18.519 9.289   1.00 50.75  ? 22  ALA B O   1 
ATOM   2339  C CB  . ALA B 1 42  ? 34.290  -17.433 10.904  1.00 47.02  ? 22  ALA B CB  1 
ATOM   2340  N N   . LYS B 1 43  ? 36.132  -16.653 8.305   1.00 51.04  ? 23  LYS B N   1 
ATOM   2341  C CA  . LYS B 1 43  ? 36.595  -17.094 6.994   1.00 52.76  ? 23  LYS B CA  1 
ATOM   2342  C C   . LYS B 1 43  ? 37.953  -16.522 6.646   1.00 49.99  ? 23  LYS B C   1 
ATOM   2343  O O   . LYS B 1 43  ? 38.429  -16.679 5.526   1.00 49.77  ? 23  LYS B O   1 
ATOM   2344  C CB  . LYS B 1 43  ? 35.569  -16.723 5.925   1.00 55.40  ? 23  LYS B CB  1 
ATOM   2345  C CG  . LYS B 1 43  ? 34.287  -17.518 6.071   1.00 58.86  ? 23  LYS B CG  1 
ATOM   2346  C CD  . LYS B 1 43  ? 34.383  -18.862 5.359   1.00 60.93  ? 23  LYS B CD  1 
ATOM   2347  C CE  . LYS B 1 43  ? 33.282  -19.818 5.792   1.00 66.61  ? 23  LYS B CE  1 
ATOM   2348  N NZ  . LYS B 1 43  ? 32.892  -19.656 7.228   1.00 71.38  ? 23  LYS B NZ  1 
ATOM   2349  N N   . GLY B 1 44  ? 38.579  -15.853 7.601   1.00 48.42  ? 24  GLY B N   1 
ATOM   2350  C CA  . GLY B 1 44  ? 39.967  -15.429 7.424   1.00 52.89  ? 24  GLY B CA  1 
ATOM   2351  C C   . GLY B 1 44  ? 40.269  -13.941 7.332   1.00 52.39  ? 24  GLY B C   1 
ATOM   2352  O O   . GLY B 1 44  ? 41.437  -13.562 7.226   1.00 51.44  ? 24  GLY B O   1 
ATOM   2353  N N   . PHE B 1 45  ? 39.248  -13.093 7.370   1.00 51.60  ? 25  PHE B N   1 
ATOM   2354  C CA  . PHE B 1 45  ? 39.471  -11.677 7.149   1.00 53.34  ? 25  PHE B CA  1 
ATOM   2355  C C   . PHE B 1 45  ? 39.965  -11.034 8.412   1.00 52.96  ? 25  PHE B C   1 
ATOM   2356  O O   . PHE B 1 45  ? 39.552  -11.403 9.513   1.00 50.39  ? 25  PHE B O   1 
ATOM   2357  C CB  . PHE B 1 45  ? 38.196  -10.961 6.719   1.00 53.95  ? 25  PHE B CB  1 
ATOM   2358  C CG  . PHE B 1 45  ? 37.748  -11.323 5.353   1.00 53.82  ? 25  PHE B CG  1 
ATOM   2359  C CD1 . PHE B 1 45  ? 37.020  -12.466 5.156   1.00 54.69  ? 25  PHE B CD1 1 
ATOM   2360  C CD2 . PHE B 1 45  ? 38.062  -10.531 4.266   1.00 53.86  ? 25  PHE B CD2 1 
ATOM   2361  C CE1 . PHE B 1 45  ? 36.606  -12.822 3.901   1.00 52.56  ? 25  PHE B CE1 1 
ATOM   2362  C CE2 . PHE B 1 45  ? 37.644  -10.877 3.003   1.00 52.35  ? 25  PHE B CE2 1 
ATOM   2363  C CZ  . PHE B 1 45  ? 36.918  -12.029 2.826   1.00 55.08  ? 25  PHE B CZ  1 
ATOM   2364  N N   . GLU B 1 46  ? 40.835  -10.050 8.239   1.00 57.96  ? 26  GLU B N   1 
ATOM   2365  C CA  . GLU B 1 46  ? 41.105  -9.107  9.301   1.00 63.28  ? 26  GLU B CA  1 
ATOM   2366  C C   . GLU B 1 46  ? 39.853  -8.239  9.395   1.00 58.43  ? 26  GLU B C   1 
ATOM   2367  O O   . GLU B 1 46  ? 39.368  -7.730  8.394   1.00 57.46  ? 26  GLU B O   1 
ATOM   2368  C CB  . GLU B 1 46  ? 42.341  -8.258  8.995   1.00 70.83  ? 26  GLU B CB  1 
ATOM   2369  C CG  . GLU B 1 46  ? 43.151  -7.896  10.240  1.00 81.31  ? 26  GLU B CG  1 
ATOM   2370  C CD  . GLU B 1 46  ? 43.845  -6.533  10.147  1.00 90.04  ? 26  GLU B CD  1 
ATOM   2371  O OE1 . GLU B 1 46  ? 44.822  -6.393  9.371   1.00 92.87  ? 26  GLU B OE1 1 
ATOM   2372  O OE2 . GLU B 1 46  ? 43.424  -5.597  10.872  1.00 90.56  ? 26  GLU B OE2 1 
ATOM   2373  N N   . VAL B 1 47  ? 39.320  -8.097  10.592  1.00 54.25  ? 27  VAL B N   1 
ATOM   2374  C CA  . VAL B 1 47  ? 38.098  -7.354  10.780  1.00 57.14  ? 27  VAL B CA  1 
ATOM   2375  C C   . VAL B 1 47  ? 38.270  -6.251  11.813  1.00 58.22  ? 27  VAL B C   1 
ATOM   2376  O O   . VAL B 1 47  ? 38.704  -6.513  12.947  1.00 57.13  ? 27  VAL B O   1 
ATOM   2377  C CB  . VAL B 1 47  ? 36.981  -8.295  11.239  1.00 56.44  ? 27  VAL B CB  1 
ATOM   2378  C CG1 . VAL B 1 47  ? 35.739  -7.523  11.628  1.00 54.30  ? 27  VAL B CG1 1 
ATOM   2379  C CG2 . VAL B 1 47  ? 36.644  -9.243  10.116  1.00 59.35  ? 27  VAL B CG2 1 
ATOM   2380  N N   . VAL B 1 48  ? 37.896  -5.031  11.424  1.00 55.94  ? 28  VAL B N   1 
ATOM   2381  C CA  . VAL B 1 48  ? 37.793  -3.922  12.368  1.00 54.36  ? 28  VAL B CA  1 
ATOM   2382  C C   . VAL B 1 48  ? 36.349  -3.703  12.781  1.00 52.78  ? 28  VAL B C   1 
ATOM   2383  O O   . VAL B 1 48  ? 35.484  -3.470  11.946  1.00 54.34  ? 28  VAL B O   1 
ATOM   2384  C CB  . VAL B 1 48  ? 38.307  -2.613  11.781  1.00 56.20  ? 28  VAL B CB  1 
ATOM   2385  C CG1 . VAL B 1 48  ? 38.381  -1.559  12.873  1.00 57.25  ? 28  VAL B CG1 1 
ATOM   2386  C CG2 . VAL B 1 48  ? 39.667  -2.816  11.142  1.00 54.62  ? 28  VAL B CG2 1 
ATOM   2387  N N   . LEU B 1 49  ? 36.105  -3.760  14.078  1.00 51.25  ? 29  LEU B N   1 
ATOM   2388  C CA  . LEU B 1 49  ? 34.766  -3.623  14.596  1.00 54.84  ? 29  LEU B CA  1 
ATOM   2389  C C   . LEU B 1 49  ? 34.663  -2.355  15.432  1.00 57.61  ? 29  LEU B C   1 
ATOM   2390  O O   . LEU B 1 49  ? 35.266  -2.241  16.497  1.00 53.91  ? 29  LEU B O   1 
ATOM   2391  C CB  . LEU B 1 49  ? 34.399  -4.840  15.433  1.00 54.60  ? 29  LEU B CB  1 
ATOM   2392  C CG  . LEU B 1 49  ? 33.047  -4.747  16.153  1.00 54.82  ? 29  LEU B CG  1 
ATOM   2393  C CD1 . LEU B 1 49  ? 31.895  -5.096  15.233  1.00 54.03  ? 29  LEU B CD1 1 
ATOM   2394  C CD2 . LEU B 1 49  ? 33.040  -5.671  17.353  1.00 55.58  ? 29  LEU B CD2 1 
ATOM   2395  N N   . ARG B 1 50  ? 33.847  -1.430  14.951  1.00 61.06  ? 30  ARG B N   1 
ATOM   2396  C CA  . ARG B 1 50  ? 33.744  -0.115  15.532  1.00 61.07  ? 30  ARG B CA  1 
ATOM   2397  C C   . ARG B 1 50  ? 32.370  0.172   16.119  1.00 61.69  ? 30  ARG B C   1 
ATOM   2398  O O   . ARG B 1 50  ? 31.340  -0.131  15.521  1.00 59.16  ? 30  ARG B O   1 
ATOM   2399  C CB  . ARG B 1 50  ? 34.056  0.905   14.456  1.00 63.59  ? 30  ARG B CB  1 
ATOM   2400  C CG  . ARG B 1 50  ? 34.368  2.277   15.002  1.00 69.16  ? 30  ARG B CG  1 
ATOM   2401  C CD  . ARG B 1 50  ? 33.104  3.046   15.282  1.00 70.23  ? 30  ARG B CD  1 
ATOM   2402  N NE  . ARG B 1 50  ? 33.365  4.464   15.417  1.00 70.20  ? 30  ARG B NE  1 
ATOM   2403  C CZ  . ARG B 1 50  ? 32.426  5.394   15.368  1.00 70.21  ? 30  ARG B CZ  1 
ATOM   2404  N NH1 . ARG B 1 50  ? 31.157  5.063   15.177  1.00 72.06  ? 30  ARG B NH1 1 
ATOM   2405  N NH2 . ARG B 1 50  ? 32.760  6.660   15.510  1.00 73.01  ? 30  ARG B NH2 1 
ATOM   2406  N N   . ASP B 1 51  ? 32.367  0.768   17.301  1.00 62.72  ? 31  ASP B N   1 
ATOM   2407  C CA  . ASP B 1 51  ? 31.171  1.413   17.798  1.00 67.42  ? 31  ASP B CA  1 
ATOM   2408  C C   . ASP B 1 51  ? 31.563  2.711   18.533  1.00 70.75  ? 31  ASP B C   1 
ATOM   2409  O O   . ASP B 1 51  ? 32.685  3.191   18.391  1.00 67.37  ? 31  ASP B O   1 
ATOM   2410  C CB  . ASP B 1 51  ? 30.361  0.447   18.660  1.00 67.80  ? 31  ASP B CB  1 
ATOM   2411  C CG  . ASP B 1 51  ? 28.867  0.720   18.590  1.00 71.60  ? 31  ASP B CG  1 
ATOM   2412  O OD1 . ASP B 1 51  ? 28.483  1.883   18.338  1.00 76.69  ? 31  ASP B OD1 1 
ATOM   2413  O OD2 . ASP B 1 51  ? 28.071  -0.220  18.784  1.00 72.41  ? 31  ASP B OD2 1 
ATOM   2414  N N   . ILE B 1 52  ? 30.648  3.294   19.295  1.00 74.93  ? 32  ILE B N   1 
ATOM   2415  C CA  . ILE B 1 52  ? 30.885  4.628   19.862  1.00 82.35  ? 32  ILE B CA  1 
ATOM   2416  C C   . ILE B 1 52  ? 31.478  4.583   21.273  1.00 86.09  ? 32  ILE B C   1 
ATOM   2417  O O   . ILE B 1 52  ? 32.442  5.292   21.564  1.00 82.01  ? 32  ILE B O   1 
ATOM   2418  C CB  . ILE B 1 52  ? 29.612  5.502   19.818  1.00 83.56  ? 32  ILE B CB  1 
ATOM   2419  C CG1 . ILE B 1 52  ? 28.505  4.916   20.708  1.00 86.14  ? 32  ILE B CG1 1 
ATOM   2420  C CG2 . ILE B 1 52  ? 29.155  5.665   18.372  1.00 81.89  ? 32  ILE B CG2 1 
ATOM   2421  C CD1 . ILE B 1 52  ? 27.096  5.227   20.253  1.00 87.24  ? 32  ILE B CD1 1 
ATOM   2422  N N   . LYS B 1 53  ? 30.914  3.739   22.130  1.00 90.58  ? 33  LYS B N   1 
ATOM   2423  C CA  . LYS B 1 53  ? 31.408  3.575   23.490  1.00 95.19  ? 33  LYS B CA  1 
ATOM   2424  C C   . LYS B 1 53  ? 32.115  2.231   23.617  1.00 91.14  ? 33  LYS B C   1 
ATOM   2425  O O   . LYS B 1 53  ? 31.705  1.242   23.004  1.00 86.32  ? 33  LYS B O   1 
ATOM   2426  C CB  . LYS B 1 53  ? 30.261  3.679   24.502  1.00 101.80 ? 33  LYS B CB  1 
ATOM   2427  C CG  . LYS B 1 53  ? 29.409  4.932   24.324  1.00 106.67 ? 33  LYS B CG  1 
ATOM   2428  C CD  . LYS B 1 53  ? 29.305  5.774   25.588  1.00 110.41 ? 33  LYS B CD  1 
ATOM   2429  C CE  . LYS B 1 53  ? 27.990  5.562   26.321  1.00 112.57 ? 33  LYS B CE  1 
ATOM   2430  N NZ  . LYS B 1 53  ? 27.932  6.409   27.545  1.00 112.95 ? 33  LYS B NZ  1 
ATOM   2431  N N   . ASP B 1 54  ? 33.186  2.205   24.405  1.00 87.96  ? 34  ASP B N   1 
ATOM   2432  C CA  . ASP B 1 54  ? 33.901  0.961   24.685  1.00 89.54  ? 34  ASP B CA  1 
ATOM   2433  C C   . ASP B 1 54  ? 32.979  -0.088  25.265  1.00 91.78  ? 34  ASP B C   1 
ATOM   2434  O O   . ASP B 1 54  ? 33.179  -1.277  25.024  1.00 89.61  ? 34  ASP B O   1 
ATOM   2435  C CB  . ASP B 1 54  ? 35.029  1.181   25.687  1.00 90.94  ? 34  ASP B CB  1 
ATOM   2436  C CG  . ASP B 1 54  ? 36.247  1.829   25.070  1.00 93.03  ? 34  ASP B CG  1 
ATOM   2437  O OD1 . ASP B 1 54  ? 37.258  1.968   25.788  1.00 96.56  ? 34  ASP B OD1 1 
ATOM   2438  O OD2 . ASP B 1 54  ? 36.205  2.209   23.880  1.00 92.99  ? 34  ASP B OD2 1 
ATOM   2439  N N   . GLU B 1 55  ? 31.999  0.351   26.060  1.00 93.89  ? 35  GLU B N   1 
ATOM   2440  C CA  . GLU B 1 55  ? 30.988  -0.554  26.613  1.00 92.23  ? 35  GLU B CA  1 
ATOM   2441  C C   . GLU B 1 55  ? 30.351  -1.381  25.495  1.00 89.57  ? 35  GLU B C   1 
ATOM   2442  O O   . GLU B 1 55  ? 30.286  -2.609  25.590  1.00 84.04  ? 35  GLU B O   1 
ATOM   2443  C CB  . GLU B 1 55  ? 29.890  0.210   27.368  1.00 93.10  ? 35  GLU B CB  1 
ATOM   2444  C CG  . GLU B 1 55  ? 29.108  -0.685  28.330  1.00 96.08  ? 35  GLU B CG  1 
ATOM   2445  C CD  . GLU B 1 55  ? 27.694  -0.197  28.647  1.00 96.59  ? 35  GLU B CD  1 
ATOM   2446  O OE1 . GLU B 1 55  ? 26.731  -0.942  28.367  1.00 94.01  ? 35  GLU B OE1 1 
ATOM   2447  O OE2 . GLU B 1 55  ? 27.532  0.918   29.188  1.00 92.48  ? 35  GLU B OE2 1 
ATOM   2448  N N   . PHE B 1 56  ? 29.900  -0.687  24.446  1.00 85.96  ? 36  PHE B N   1 
ATOM   2449  C CA  . PHE B 1 56  ? 29.203  -1.302  23.302  1.00 85.91  ? 36  PHE B CA  1 
ATOM   2450  C C   . PHE B 1 56  ? 30.044  -2.273  22.486  1.00 78.24  ? 36  PHE B C   1 
ATOM   2451  O O   . PHE B 1 56  ? 29.548  -3.320  22.057  1.00 76.67  ? 36  PHE B O   1 
ATOM   2452  C CB  . PHE B 1 56  ? 28.668  -0.225  22.352  1.00 90.87  ? 36  PHE B CB  1 
ATOM   2453  C CG  . PHE B 1 56  ? 27.542  0.582   22.924  1.00 94.84  ? 36  PHE B CG  1 
ATOM   2454  C CD1 . PHE B 1 56  ? 26.470  -0.042  23.552  1.00 98.54  ? 36  PHE B CD1 1 
ATOM   2455  C CD2 . PHE B 1 56  ? 27.543  1.963   22.828  1.00 96.97  ? 36  PHE B CD2 1 
ATOM   2456  C CE1 . PHE B 1 56  ? 25.434  0.700   24.087  1.00 99.67  ? 36  PHE B CE1 1 
ATOM   2457  C CE2 . PHE B 1 56  ? 26.508  2.711   23.358  1.00 97.98  ? 36  PHE B CE2 1 
ATOM   2458  C CZ  . PHE B 1 56  ? 25.452  2.079   23.990  1.00 97.85  ? 36  PHE B CZ  1 
ATOM   2459  N N   . VAL B 1 57  ? 31.298  -1.904  22.250  1.00 69.03  ? 37  VAL B N   1 
ATOM   2460  C CA  . VAL B 1 57  ? 32.224  -2.758  21.522  1.00 68.33  ? 37  VAL B CA  1 
ATOM   2461  C C   . VAL B 1 57  ? 32.484  -4.031  22.296  1.00 70.47  ? 37  VAL B C   1 
ATOM   2462  O O   . VAL B 1 57  ? 32.480  -5.126  21.730  1.00 73.22  ? 37  VAL B O   1 
ATOM   2463  C CB  . VAL B 1 57  ? 33.581  -2.078  21.335  1.00 66.83  ? 37  VAL B CB  1 
ATOM   2464  C CG1 . VAL B 1 57  ? 34.583  -3.036  20.705  1.00 65.09  ? 37  VAL B CG1 1 
ATOM   2465  C CG2 . VAL B 1 57  ? 33.431  -0.839  20.477  1.00 68.30  ? 37  VAL B CG2 1 
ATOM   2466  N N   . ASP B 1 58  ? 32.741  -3.869  23.591  1.00 72.09  ? 38  ASP B N   1 
ATOM   2467  C CA  . ASP B 1 58  ? 32.982  -5.000  24.476  1.00 71.49  ? 38  ASP B CA  1 
ATOM   2468  C C   . ASP B 1 58  ? 31.759  -5.882  24.586  1.00 71.30  ? 38  ASP B C   1 
ATOM   2469  O O   . ASP B 1 58  ? 31.881  -7.077  24.787  1.00 79.05  ? 38  ASP B O   1 
ATOM   2470  C CB  . ASP B 1 58  ? 33.412  -4.519  25.863  1.00 72.10  ? 38  ASP B CB  1 
ATOM   2471  C CG  . ASP B 1 58  ? 34.788  -3.843  25.848  1.00 76.52  ? 38  ASP B CG  1 
ATOM   2472  O OD1 . ASP B 1 58  ? 35.551  -3.988  24.850  1.00 71.33  ? 38  ASP B OD1 1 
ATOM   2473  O OD2 . ASP B 1 58  ? 35.105  -3.158  26.844  1.00 73.98  ? 38  ASP B OD2 1 
ATOM   2474  N N   . ARG B 1 59  ? 30.581  -5.301  24.443  1.00 73.50  ? 39  ARG B N   1 
ATOM   2475  C CA  . ARG B 1 59  ? 29.369  -6.091  24.446  1.00 76.98  ? 39  ARG B CA  1 
ATOM   2476  C C   . ARG B 1 59  ? 29.267  -6.959  23.174  1.00 72.84  ? 39  ARG B C   1 
ATOM   2477  O O   . ARG B 1 59  ? 28.758  -8.078  23.219  1.00 68.07  ? 39  ARG B O   1 
ATOM   2478  C CB  . ARG B 1 59  ? 28.183  -5.155  24.580  1.00 85.02  ? 39  ARG B CB  1 
ATOM   2479  C CG  . ARG B 1 59  ? 26.881  -5.824  24.994  1.00 92.60  ? 39  ARG B CG  1 
ATOM   2480  C CD  . ARG B 1 59  ? 25.818  -5.759  23.904  1.00 100.16 ? 39  ARG B CD  1 
ATOM   2481  N NE  . ARG B 1 59  ? 26.070  -4.683  22.937  1.00 108.77 ? 39  ARG B NE  1 
ATOM   2482  C CZ  . ARG B 1 59  ? 25.170  -4.154  22.121  1.00 110.68 ? 39  ARG B CZ  1 
ATOM   2483  N NH1 . ARG B 1 59  ? 23.907  -4.575  22.127  1.00 111.37 ? 39  ARG B NH1 1 
ATOM   2484  N NH2 . ARG B 1 59  ? 25.549  -3.183  21.297  1.00 109.49 ? 39  ARG B NH2 1 
ATOM   2485  N N   . GLY B 1 60  ? 29.772  -6.444  22.056  1.00 67.29  ? 40  GLY B N   1 
ATOM   2486  C CA  . GLY B 1 60  ? 29.786  -7.182  20.804  1.00 65.13  ? 40  GLY B CA  1 
ATOM   2487  C C   . GLY B 1 60  ? 30.846  -8.269  20.786  1.00 65.94  ? 40  GLY B C   1 
ATOM   2488  O O   . GLY B 1 60  ? 30.603  -9.371  20.303  1.00 66.42  ? 40  GLY B O   1 
ATOM   2489  N N   . LEU B 1 61  ? 32.025  -7.971  21.316  1.00 64.08  ? 41  LEU B N   1 
ATOM   2490  C CA  . LEU B 1 61  ? 33.105  -8.938  21.282  1.00 64.14  ? 41  LEU B CA  1 
ATOM   2491  C C   . LEU B 1 61  ? 32.814  -10.186 22.076  1.00 67.02  ? 41  LEU B C   1 
ATOM   2492  O O   . LEU B 1 61  ? 33.131  -11.290 21.626  1.00 67.38  ? 41  LEU B O   1 
ATOM   2493  C CB  . LEU B 1 61  ? 34.398  -8.317  21.762  1.00 64.57  ? 41  LEU B CB  1 
ATOM   2494  C CG  . LEU B 1 61  ? 35.024  -7.485  20.659  1.00 67.14  ? 41  LEU B CG  1 
ATOM   2495  C CD1 . LEU B 1 61  ? 36.362  -6.953  21.125  1.00 69.04  ? 41  LEU B CD1 1 
ATOM   2496  C CD2 . LEU B 1 61  ? 35.205  -8.306  19.393  1.00 67.60  ? 41  LEU B CD2 1 
ATOM   2497  N N   . ASP B 1 62  ? 32.197  -10.033 23.241  1.00 67.61  ? 42  ASP B N   1 
ATOM   2498  C CA  . ASP B 1 62  ? 31.894  -11.213 24.040  1.00 72.42  ? 42  ASP B CA  1 
ATOM   2499  C C   . ASP B 1 62  ? 30.501  -11.756 23.748  1.00 68.66  ? 42  ASP B C   1 
ATOM   2500  O O   . ASP B 1 62  ? 30.049  -12.690 24.395  1.00 72.02  ? 42  ASP B O   1 
ATOM   2501  C CB  . ASP B 1 62  ? 32.179  -11.004 25.542  1.00 78.25  ? 42  ASP B CB  1 
ATOM   2502  C CG  . ASP B 1 62  ? 31.331  -9.922  26.170  1.00 81.42  ? 42  ASP B CG  1 
ATOM   2503  O OD1 . ASP B 1 62  ? 30.106  -9.900  25.913  1.00 86.30  ? 42  ASP B OD1 1 
ATOM   2504  O OD2 . ASP B 1 62  ? 31.894  -9.108  26.947  1.00 77.00  ? 42  ASP B OD2 1 
ATOM   2505  N N   . PHE B 1 63  ? 29.837  -11.170 22.759  1.00 70.46  ? 43  PHE B N   1 
ATOM   2506  C CA  . PHE B 1 63  ? 28.691  -11.803 22.124  1.00 70.49  ? 43  PHE B CA  1 
ATOM   2507  C C   . PHE B 1 63  ? 29.199  -12.773 21.055  1.00 65.27  ? 43  PHE B C   1 
ATOM   2508  O O   . PHE B 1 63  ? 28.612  -13.832 20.829  1.00 62.12  ? 43  PHE B O   1 
ATOM   2509  C CB  . PHE B 1 63  ? 27.766  -10.758 21.502  1.00 74.92  ? 43  PHE B CB  1 
ATOM   2510  C CG  . PHE B 1 63  ? 26.684  -11.353 20.649  1.00 82.46  ? 43  PHE B CG  1 
ATOM   2511  C CD1 . PHE B 1 63  ? 26.759  -11.297 19.261  1.00 86.34  ? 43  PHE B CD1 1 
ATOM   2512  C CD2 . PHE B 1 63  ? 25.613  -12.013 21.229  1.00 86.23  ? 43  PHE B CD2 1 
ATOM   2513  C CE1 . PHE B 1 63  ? 25.771  -11.865 18.466  1.00 83.49  ? 43  PHE B CE1 1 
ATOM   2514  C CE2 . PHE B 1 63  ? 24.623  -12.586 20.439  1.00 85.59  ? 43  PHE B CE2 1 
ATOM   2515  C CZ  . PHE B 1 63  ? 24.701  -12.511 19.057  1.00 80.80  ? 43  PHE B CZ  1 
ATOM   2516  N N   . ILE B 1 64  ? 30.297  -12.397 20.406  1.00 60.19  ? 44  ILE B N   1 
ATOM   2517  C CA  . ILE B 1 64  ? 30.953  -13.248 19.427  1.00 60.25  ? 44  ILE B CA  1 
ATOM   2518  C C   . ILE B 1 64  ? 31.620  -14.390 20.176  1.00 64.21  ? 44  ILE B C   1 
ATOM   2519  O O   . ILE B 1 64  ? 31.554  -15.550 19.761  1.00 60.65  ? 44  ILE B O   1 
ATOM   2520  C CB  . ILE B 1 64  ? 32.012  -12.461 18.641  1.00 58.16  ? 44  ILE B CB  1 
ATOM   2521  C CG1 . ILE B 1 64  ? 31.342  -11.330 17.850  1.00 58.74  ? 44  ILE B CG1 1 
ATOM   2522  C CG2 . ILE B 1 64  ? 32.769  -13.373 17.690  1.00 57.05  ? 44  ILE B CG2 1 
ATOM   2523  C CD1 . ILE B 1 64  ? 32.305  -10.355 17.209  1.00 57.05  ? 44  ILE B CD1 1 
ATOM   2524  N N   . ASN B 1 65  ? 32.264  -14.043 21.284  1.00 66.91  ? 45  ASN B N   1 
ATOM   2525  C CA  . ASN B 1 65  ? 32.839  -15.035 22.172  1.00 68.66  ? 45  ASN B CA  1 
ATOM   2526  C C   . ASN B 1 65  ? 31.790  -16.058 22.564  1.00 67.36  ? 45  ASN B C   1 
ATOM   2527  O O   . ASN B 1 65  ? 31.991  -17.252 22.383  1.00 67.70  ? 45  ASN B O   1 
ATOM   2528  C CB  . ASN B 1 65  ? 33.392  -14.366 23.424  1.00 73.26  ? 45  ASN B CB  1 
ATOM   2529  C CG  . ASN B 1 65  ? 34.246  -15.300 24.261  1.00 71.61  ? 45  ASN B CG  1 
ATOM   2530  O OD1 . ASN B 1 65  ? 33.728  -16.118 25.019  1.00 71.95  ? 45  ASN B OD1 1 
ATOM   2531  N ND2 . ASN B 1 65  ? 35.564  -15.159 24.149  1.00 67.27  ? 45  ASN B ND2 1 
ATOM   2532  N N   . LYS B 1 66  ? 30.666  -15.583 23.083  1.00 66.67  ? 46  LYS B N   1 
ATOM   2533  C CA  . LYS B 1 66  ? 29.610  -16.475 23.520  1.00 68.74  ? 46  LYS B CA  1 
ATOM   2534  C C   . LYS B 1 66  ? 29.185  -17.429 22.396  1.00 69.30  ? 46  LYS B C   1 
ATOM   2535  O O   . LYS B 1 66  ? 28.909  -18.606 22.652  1.00 68.47  ? 46  LYS B O   1 
ATOM   2536  C CB  . LYS B 1 66  ? 28.408  -15.682 24.019  1.00 73.45  ? 46  LYS B CB  1 
ATOM   2537  C CG  . LYS B 1 66  ? 27.705  -16.347 25.186  1.00 79.27  ? 46  LYS B CG  1 
ATOM   2538  C CD  . LYS B 1 66  ? 26.300  -15.798 25.382  1.00 85.31  ? 46  LYS B CD  1 
ATOM   2539  C CE  . LYS B 1 66  ? 25.322  -16.892 25.791  1.00 89.53  ? 46  LYS B CE  1 
ATOM   2540  N NZ  . LYS B 1 66  ? 23.936  -16.577 25.344  1.00 90.63  ? 46  LYS B NZ  1 
ATOM   2541  N N   . ASN B 1 67  ? 29.152  -16.917 21.161  1.00 66.74  ? 47  ASN B N   1 
ATOM   2542  C CA  . ASN B 1 67  ? 28.763  -17.708 19.981  1.00 64.88  ? 47  ASN B CA  1 
ATOM   2543  C C   . ASN B 1 67  ? 29.790  -18.750 19.598  1.00 61.62  ? 47  ASN B C   1 
ATOM   2544  O O   . ASN B 1 67  ? 29.442  -19.894 19.284  1.00 59.56  ? 47  ASN B O   1 
ATOM   2545  C CB  . ASN B 1 67  ? 28.557  -16.812 18.753  1.00 65.88  ? 47  ASN B CB  1 
ATOM   2546  C CG  . ASN B 1 67  ? 27.190  -16.168 18.714  1.00 67.71  ? 47  ASN B CG  1 
ATOM   2547  O OD1 . ASN B 1 67  ? 26.222  -16.681 19.277  1.00 65.47  ? 47  ASN B OD1 1 
ATOM   2548  N ND2 . ASN B 1 67  ? 27.101  -15.036 18.029  1.00 69.15  ? 47  ASN B ND2 1 
ATOM   2549  N N   . LEU B 1 68  ? 31.047  -18.327 19.565  1.00 56.73  ? 48  LEU B N   1 
ATOM   2550  C CA  . LEU B 1 68  ? 32.133  -19.222 19.229  1.00 56.54  ? 48  LEU B CA  1 
ATOM   2551  C C   . LEU B 1 68  ? 32.267  -20.268 20.304  1.00 56.14  ? 48  LEU B C   1 
ATOM   2552  O O   . LEU B 1 68  ? 32.472  -21.436 20.013  1.00 55.67  ? 48  LEU B O   1 
ATOM   2553  C CB  . LEU B 1 68  ? 33.427  -18.446 19.068  1.00 56.10  ? 48  LEU B CB  1 
ATOM   2554  C CG  . LEU B 1 68  ? 33.374  -17.575 17.818  1.00 56.80  ? 48  LEU B CG  1 
ATOM   2555  C CD1 . LEU B 1 68  ? 34.571  -16.660 17.747  1.00 57.77  ? 48  LEU B CD1 1 
ATOM   2556  C CD2 . LEU B 1 68  ? 33.330  -18.429 16.569  1.00 57.87  ? 48  LEU B CD2 1 
ATOM   2557  N N   . SER B 1 69  ? 32.086  -19.853 21.548  1.00 57.76  ? 49  SER B N   1 
ATOM   2558  C CA  . SER B 1 69  ? 32.092  -20.786 22.671  1.00 60.25  ? 49  SER B CA  1 
ATOM   2559  C C   . SER B 1 69  ? 31.083  -21.894 22.492  1.00 59.82  ? 49  SER B C   1 
ATOM   2560  O O   . SER B 1 69  ? 31.293  -23.011 22.943  1.00 62.04  ? 49  SER B O   1 
ATOM   2561  C CB  . SER B 1 69  ? 31.767  -20.051 23.969  1.00 60.73  ? 49  SER B CB  1 
ATOM   2562  O OG  . SER B 1 69  ? 32.752  -19.074 24.251  1.00 61.83  ? 49  SER B OG  1 
ATOM   2563  N N   . LYS B 1 70  ? 29.976  -21.563 21.851  1.00 63.39  ? 50  LYS B N   1 
ATOM   2564  C CA  . LYS B 1 70  ? 28.880  -22.493 21.679  1.00 67.26  ? 50  LYS B CA  1 
ATOM   2565  C C   . LYS B 1 70  ? 29.257  -23.523 20.620  1.00 63.46  ? 50  LYS B C   1 
ATOM   2566  O O   . LYS B 1 70  ? 28.888  -24.691 20.709  1.00 57.93  ? 50  LYS B O   1 
ATOM   2567  C CB  . LYS B 1 70  ? 27.623  -21.729 21.261  1.00 73.77  ? 50  LYS B CB  1 
ATOM   2568  C CG  . LYS B 1 70  ? 26.359  -22.147 21.983  1.00 79.53  ? 50  LYS B CG  1 
ATOM   2569  C CD  . LYS B 1 70  ? 25.261  -22.472 20.978  1.00 87.79  ? 50  LYS B CD  1 
ATOM   2570  C CE  . LYS B 1 70  ? 23.926  -22.775 21.644  1.00 89.40  ? 50  LYS B CE  1 
ATOM   2571  N NZ  . LYS B 1 70  ? 23.171  -21.533 21.974  1.00 90.98  ? 50  LYS B NZ  1 
ATOM   2572  N N   . LEU B 1 71  ? 30.016  -23.073 19.629  1.00 60.14  ? 51  LEU B N   1 
ATOM   2573  C CA  . LEU B 1 71  ? 30.491  -23.945 18.575  1.00 60.54  ? 51  LEU B CA  1 
ATOM   2574  C C   . LEU B 1 71  ? 31.585  -24.911 19.014  1.00 63.43  ? 51  LEU B C   1 
ATOM   2575  O O   . LEU B 1 71  ? 31.627  -26.043 18.529  1.00 65.12  ? 51  LEU B O   1 
ATOM   2576  C CB  . LEU B 1 71  ? 30.982  -23.115 17.398  1.00 58.71  ? 51  LEU B CB  1 
ATOM   2577  C CG  . LEU B 1 71  ? 29.891  -22.263 16.744  1.00 58.39  ? 51  LEU B CG  1 
ATOM   2578  C CD1 . LEU B 1 71  ? 30.498  -21.410 15.652  1.00 55.86  ? 51  LEU B CD1 1 
ATOM   2579  C CD2 . LEU B 1 71  ? 28.780  -23.111 16.143  1.00 59.40  ? 51  LEU B CD2 1 
ATOM   2580  N N   . VAL B 1 72  ? 32.459  -24.492 19.927  1.00 64.24  ? 52  VAL B N   1 
ATOM   2581  C CA  . VAL B 1 72  ? 33.501  -25.407 20.397  1.00 69.28  ? 52  VAL B CA  1 
ATOM   2582  C C   . VAL B 1 72  ? 32.857  -26.500 21.254  1.00 71.07  ? 52  VAL B C   1 
ATOM   2583  O O   . VAL B 1 72  ? 33.382  -27.604 21.376  1.00 69.05  ? 52  VAL B O   1 
ATOM   2584  C CB  . VAL B 1 72  ? 34.680  -24.725 21.152  1.00 72.12  ? 52  VAL B CB  1 
ATOM   2585  C CG1 . VAL B 1 72  ? 34.794  -23.246 20.816  1.00 71.40  ? 52  VAL B CG1 1 
ATOM   2586  C CG2 . VAL B 1 72  ? 34.586  -24.914 22.660  1.00 71.11  ? 52  VAL B CG2 1 
ATOM   2587  N N   . LYS B 1 73  ? 31.703  -26.180 21.819  1.00 74.48  ? 53  LYS B N   1 
ATOM   2588  C CA  . LYS B 1 73  ? 31.029  -27.060 22.741  1.00 76.42  ? 53  LYS B CA  1 
ATOM   2589  C C   . LYS B 1 73  ? 30.206  -28.123 22.015  1.00 75.68  ? 53  LYS B C   1 
ATOM   2590  O O   . LYS B 1 73  ? 29.958  -29.191 22.567  1.00 75.03  ? 53  LYS B O   1 
ATOM   2591  C CB  . LYS B 1 73  ? 30.158  -26.216 23.664  1.00 80.96  ? 53  LYS B CB  1 
ATOM   2592  C CG  . LYS B 1 73  ? 28.911  -26.910 24.176  1.00 87.75  ? 53  LYS B CG  1 
ATOM   2593  C CD  . LYS B 1 73  ? 28.997  -27.220 25.653  1.00 90.85  ? 53  LYS B CD  1 
ATOM   2594  C CE  . LYS B 1 73  ? 27.602  -27.391 26.222  1.00 91.99  ? 53  LYS B CE  1 
ATOM   2595  N NZ  . LYS B 1 73  ? 27.429  -26.477 27.378  1.00 93.42  ? 53  LYS B NZ  1 
ATOM   2596  N N   . LYS B 1 74  ? 29.791  -27.840 20.784  1.00 75.22  ? 54  LYS B N   1 
ATOM   2597  C CA  . LYS B 1 74  ? 29.059  -28.818 19.983  1.00 72.93  ? 54  LYS B CA  1 
ATOM   2598  C C   . LYS B 1 74  ? 30.031  -29.547 19.073  1.00 72.27  ? 54  LYS B C   1 
ATOM   2599  O O   . LYS B 1 74  ? 29.628  -30.237 18.134  1.00 70.54  ? 54  LYS B O   1 
ATOM   2600  C CB  . LYS B 1 74  ? 27.994  -28.133 19.143  1.00 76.25  ? 54  LYS B CB  1 
ATOM   2601  C CG  . LYS B 1 74  ? 27.182  -27.088 19.889  1.00 82.44  ? 54  LYS B CG  1 
ATOM   2602  C CD  . LYS B 1 74  ? 25.930  -26.678 19.122  1.00 86.33  ? 54  LYS B CD  1 
ATOM   2603  C CE  . LYS B 1 74  ? 26.236  -26.335 17.662  1.00 90.10  ? 54  LYS B CE  1 
ATOM   2604  N NZ  . LYS B 1 74  ? 25.081  -25.745 16.928  1.00 87.83  ? 54  LYS B NZ  1 
ATOM   2605  N N   . GLY B 1 75  ? 31.320  -29.370 19.342  1.00 70.41  ? 55  GLY B N   1 
ATOM   2606  C CA  . GLY B 1 75  ? 32.360  -29.975 18.535  1.00 69.32  ? 55  GLY B CA  1 
ATOM   2607  C C   . GLY B 1 75  ? 32.372  -29.503 17.091  1.00 70.06  ? 55  GLY B C   1 
ATOM   2608  O O   . GLY B 1 75  ? 32.925  -30.192 16.236  1.00 71.73  ? 55  GLY B O   1 
ATOM   2609  N N   . LYS B 1 76  ? 31.785  -28.334 16.814  1.00 71.56  ? 56  LYS B N   1 
ATOM   2610  C CA  . LYS B 1 76  ? 31.750  -27.778 15.447  1.00 68.63  ? 56  LYS B CA  1 
ATOM   2611  C C   . LYS B 1 76  ? 33.077  -27.144 15.107  1.00 61.30  ? 56  LYS B C   1 
ATOM   2612  O O   . LYS B 1 76  ? 33.495  -27.170 13.969  1.00 55.20  ? 56  LYS B O   1 
ATOM   2613  C CB  . LYS B 1 76  ? 30.668  -26.716 15.293  1.00 76.64  ? 56  LYS B CB  1 
ATOM   2614  C CG  . LYS B 1 76  ? 29.265  -27.226 15.538  1.00 86.37  ? 56  LYS B CG  1 
ATOM   2615  C CD  . LYS B 1 76  ? 28.731  -28.004 14.345  1.00 91.06  ? 56  LYS B CD  1 
ATOM   2616  C CE  . LYS B 1 76  ? 27.218  -27.859 14.218  1.00 94.00  ? 56  LYS B CE  1 
ATOM   2617  N NZ  . LYS B 1 76  ? 26.785  -27.746 12.797  1.00 94.08  ? 56  LYS B NZ  1 
ATOM   2618  N N   . ILE B 1 77  ? 33.724  -26.540 16.094  1.00 58.97  ? 57  ILE B N   1 
ATOM   2619  C CA  . ILE B 1 77  ? 35.084  -26.042 15.911  1.00 58.91  ? 57  ILE B CA  1 
ATOM   2620  C C   . ILE B 1 77  ? 35.902  -26.290 17.155  1.00 57.32  ? 57  ILE B C   1 
ATOM   2621  O O   . ILE B 1 77  ? 35.379  -26.501 18.243  1.00 57.10  ? 57  ILE B O   1 
ATOM   2622  C CB  . ILE B 1 77  ? 35.154  -24.529 15.578  1.00 58.46  ? 57  ILE B CB  1 
ATOM   2623  C CG1 . ILE B 1 77  ? 34.241  -23.708 16.489  1.00 59.00  ? 57  ILE B CG1 1 
ATOM   2624  C CG2 . ILE B 1 77  ? 34.786  -24.288 14.128  1.00 57.99  ? 57  ILE B CG2 1 
ATOM   2625  C CD1 . ILE B 1 77  ? 34.880  -22.429 16.973  1.00 60.05  ? 57  ILE B CD1 1 
ATOM   2626  N N   . GLU B 1 78  ? 37.204  -26.240 16.976  1.00 57.15  ? 58  GLU B N   1 
ATOM   2627  C CA  . GLU B 1 78  ? 38.105  -26.475 18.070  1.00 63.06  ? 58  GLU B CA  1 
ATOM   2628  C C   . GLU B 1 78  ? 38.277  -25.192 18.855  1.00 61.84  ? 58  GLU B C   1 
ATOM   2629  O O   . GLU B 1 78  ? 38.136  -24.102 18.307  1.00 65.31  ? 58  GLU B O   1 
ATOM   2630  C CB  . GLU B 1 78  ? 39.452  -26.982 17.556  1.00 68.83  ? 58  GLU B CB  1 
ATOM   2631  C CG  . GLU B 1 78  ? 39.848  -28.317 18.182  1.00 76.88  ? 58  GLU B CG  1 
ATOM   2632  C CD  . GLU B 1 78  ? 39.376  -29.515 17.377  1.00 75.82  ? 58  GLU B CD  1 
ATOM   2633  O OE1 . GLU B 1 78  ? 40.217  -30.391 17.082  1.00 79.96  ? 58  GLU B OE1 1 
ATOM   2634  O OE2 . GLU B 1 78  ? 38.179  -29.579 17.036  1.00 73.29  ? 58  GLU B OE2 1 
ATOM   2635  N N   . GLU B 1 79  ? 38.587  -25.328 20.137  1.00 59.56  ? 59  GLU B N   1 
ATOM   2636  C CA  . GLU B 1 79  ? 38.765  -24.174 21.002  1.00 58.36  ? 59  GLU B CA  1 
ATOM   2637  C C   . GLU B 1 79  ? 39.890  -23.278 20.497  1.00 58.52  ? 59  GLU B C   1 
ATOM   2638  O O   . GLU B 1 79  ? 39.795  -22.050 20.586  1.00 60.31  ? 59  GLU B O   1 
ATOM   2639  C CB  . GLU B 1 79  ? 39.037  -24.625 22.437  1.00 58.85  ? 59  GLU B CB  1 
ATOM   2640  C CG  . GLU B 1 79  ? 39.644  -23.562 23.341  1.00 60.91  ? 59  GLU B CG  1 
ATOM   2641  C CD  . GLU B 1 79  ? 38.637  -22.572 23.908  1.00 64.32  ? 59  GLU B CD  1 
ATOM   2642  O OE1 . GLU B 1 79  ? 39.068  -21.474 24.318  1.00 67.92  ? 59  GLU B OE1 1 
ATOM   2643  O OE2 . GLU B 1 79  ? 37.427  -22.879 23.969  1.00 64.88  ? 59  GLU B OE2 1 
ATOM   2644  N N   . ALA B 1 80  ? 40.945  -23.881 19.954  1.00 56.38  ? 60  ALA B N   1 
ATOM   2645  C CA  . ALA B 1 80  ? 42.084  -23.103 19.455  1.00 56.91  ? 60  ALA B CA  1 
ATOM   2646  C C   . ALA B 1 80  ? 41.739  -22.312 18.189  1.00 56.40  ? 60  ALA B C   1 
ATOM   2647  O O   . ALA B 1 80  ? 42.467  -21.388 17.803  1.00 55.76  ? 60  ALA B O   1 
ATOM   2648  C CB  . ALA B 1 80  ? 43.271  -24.013 19.189  1.00 56.29  ? 60  ALA B CB  1 
ATOM   2649  N N   . THR B 1 81  ? 40.645  -22.703 17.543  1.00 53.67  ? 61  THR B N   1 
ATOM   2650  C CA  . THR B 1 81  ? 40.168  -22.022 16.354  1.00 51.74  ? 61  THR B CA  1 
ATOM   2651  C C   . THR B 1 81  ? 39.358  -20.807 16.769  1.00 50.04  ? 61  THR B C   1 
ATOM   2652  O O   . THR B 1 81  ? 39.474  -19.749 16.158  1.00 46.49  ? 61  THR B O   1 
ATOM   2653  C CB  . THR B 1 81  ? 39.368  -22.969 15.424  1.00 50.08  ? 61  THR B CB  1 
ATOM   2654  O OG1 . THR B 1 81  ? 40.256  -23.513 14.441  1.00 47.29  ? 61  THR B OG1 1 
ATOM   2655  C CG2 . THR B 1 81  ? 38.266  -22.232 14.681  1.00 51.28  ? 61  THR B CG2 1 
ATOM   2656  N N   . LYS B 1 82  ? 38.548  -20.956 17.809  1.00 48.92  ? 62  LYS B N   1 
ATOM   2657  C CA  . LYS B 1 82  ? 37.819  -19.822 18.333  1.00 52.37  ? 62  LYS B CA  1 
ATOM   2658  C C   . LYS B 1 82  ? 38.783  -18.686 18.615  1.00 53.01  ? 62  LYS B C   1 
ATOM   2659  O O   . LYS B 1 82  ? 38.589  -17.561 18.173  1.00 57.32  ? 62  LYS B O   1 
ATOM   2660  C CB  . LYS B 1 82  ? 37.066  -20.203 19.594  1.00 53.78  ? 62  LYS B CB  1 
ATOM   2661  C CG  . LYS B 1 82  ? 37.154  -19.164 20.691  1.00 57.08  ? 62  LYS B CG  1 
ATOM   2662  C CD  . LYS B 1 82  ? 35.926  -19.239 21.558  1.00 62.16  ? 62  LYS B CD  1 
ATOM   2663  C CE  . LYS B 1 82  ? 36.269  -19.113 23.026  1.00 65.38  ? 62  LYS B CE  1 
ATOM   2664  N NZ  . LYS B 1 82  ? 35.005  -19.241 23.783  1.00 66.40  ? 62  LYS B NZ  1 
ATOM   2665  N N   . VAL B 1 83  ? 39.839  -19.010 19.338  1.00 55.13  ? 63  VAL B N   1 
ATOM   2666  C CA  . VAL B 1 83  ? 40.842  -18.032 19.732  1.00 55.27  ? 63  VAL B CA  1 
ATOM   2667  C C   . VAL B 1 83  ? 41.439  -17.315 18.532  1.00 53.06  ? 63  VAL B C   1 
ATOM   2668  O O   . VAL B 1 83  ? 41.645  -16.102 18.556  1.00 56.09  ? 63  VAL B O   1 
ATOM   2669  C CB  . VAL B 1 83  ? 41.991  -18.708 20.501  1.00 55.51  ? 63  VAL B CB  1 
ATOM   2670  C CG1 . VAL B 1 83  ? 43.070  -17.693 20.849  1.00 55.27  ? 63  VAL B CG1 1 
ATOM   2671  C CG2 . VAL B 1 83  ? 41.461  -19.335 21.777  1.00 54.89  ? 63  VAL B CG2 1 
ATOM   2672  N N   . GLU B 1 84  ? 41.746  -18.076 17.497  1.00 52.49  ? 64  GLU B N   1 
ATOM   2673  C CA  . GLU B 1 84  ? 42.352  -17.503 16.317  1.00 53.10  ? 64  GLU B CA  1 
ATOM   2674  C C   . GLU B 1 84  ? 41.399  -16.529 15.619  1.00 52.69  ? 64  GLU B C   1 
ATOM   2675  O O   . GLU B 1 84  ? 41.833  -15.543 15.036  1.00 55.38  ? 64  GLU B O   1 
ATOM   2676  C CB  . GLU B 1 84  ? 42.760  -18.608 15.359  1.00 52.21  ? 64  GLU B CB  1 
ATOM   2677  C CG  . GLU B 1 84  ? 43.434  -18.077 14.110  1.00 54.71  ? 64  GLU B CG  1 
ATOM   2678  C CD  . GLU B 1 84  ? 43.905  -19.181 13.193  1.00 58.95  ? 64  GLU B CD  1 
ATOM   2679  O OE1 . GLU B 1 84  ? 44.880  -19.871 13.557  1.00 61.90  ? 64  GLU B OE1 1 
ATOM   2680  O OE2 . GLU B 1 84  ? 43.301  -19.355 12.110  1.00 60.76  ? 64  GLU B OE2 1 
ATOM   2681  N N   . ILE B 1 85  ? 40.107  -16.823 15.684  1.00 48.88  ? 65  ILE B N   1 
ATOM   2682  C CA  . ILE B 1 85  ? 39.082  -16.003 15.065  1.00 51.42  ? 65  ILE B CA  1 
ATOM   2683  C C   . ILE B 1 85  ? 38.908  -14.673 15.804  1.00 49.19  ? 65  ILE B C   1 
ATOM   2684  O O   . ILE B 1 85  ? 38.901  -13.615 15.178  1.00 43.00  ? 65  ILE B O   1 
ATOM   2685  C CB  . ILE B 1 85  ? 37.749  -16.782 14.996  1.00 53.54  ? 65  ILE B CB  1 
ATOM   2686  C CG1 . ILE B 1 85  ? 37.884  -17.900 13.972  1.00 54.58  ? 65  ILE B CG1 1 
ATOM   2687  C CG2 . ILE B 1 85  ? 36.590  -15.894 14.571  1.00 54.33  ? 65  ILE B CG2 1 
ATOM   2688  C CD1 . ILE B 1 85  ? 36.695  -18.827 13.916  1.00 54.63  ? 65  ILE B CD1 1 
ATOM   2689  N N   . LEU B 1 86  ? 38.800  -14.730 17.128  1.00 51.05  ? 66  LEU B N   1 
ATOM   2690  C CA  . LEU B 1 86  ? 38.676  -13.515 17.945  1.00 55.00  ? 66  LEU B CA  1 
ATOM   2691  C C   . LEU B 1 86  ? 39.899  -12.643 17.827  1.00 55.72  ? 66  LEU B C   1 
ATOM   2692  O O   . LEU B 1 86  ? 39.852  -11.437 18.049  1.00 64.31  ? 66  LEU B O   1 
ATOM   2693  C CB  . LEU B 1 86  ? 38.468  -13.868 19.407  1.00 54.07  ? 66  LEU B CB  1 
ATOM   2694  C CG  . LEU B 1 86  ? 37.150  -14.600 19.625  1.00 58.14  ? 66  LEU B CG  1 
ATOM   2695  C CD1 . LEU B 1 86  ? 37.007  -15.025 21.073  1.00 59.81  ? 66  LEU B CD1 1 
ATOM   2696  C CD2 . LEU B 1 86  ? 35.976  -13.727 19.218  1.00 58.87  ? 66  LEU B CD2 1 
ATOM   2697  N N   . THR B 1 87  ? 40.994  -13.281 17.466  1.00 55.27  ? 67  THR B N   1 
ATOM   2698  C CA  . THR B 1 87  ? 42.251  -12.612 17.244  1.00 53.26  ? 67  THR B CA  1 
ATOM   2699  C C   . THR B 1 87  ? 42.219  -11.738 15.995  1.00 54.17  ? 67  THR B C   1 
ATOM   2700  O O   . THR B 1 87  ? 42.988  -10.797 15.876  1.00 53.80  ? 67  THR B O   1 
ATOM   2701  C CB  . THR B 1 87  ? 43.349  -13.693 17.149  1.00 54.58  ? 67  THR B CB  1 
ATOM   2702  O OG1 . THR B 1 87  ? 44.143  -13.650 18.334  1.00 52.11  ? 67  THR B OG1 1 
ATOM   2703  C CG2 . THR B 1 87  ? 44.238  -13.556 15.896  1.00 53.84  ? 67  THR B CG2 1 
ATOM   2704  N N   . ARG B 1 88  ? 41.335  -12.064 15.058  1.00 56.00  ? 68  ARG B N   1 
ATOM   2705  C CA  . ARG B 1 88  ? 41.266  -11.356 13.785  1.00 53.63  ? 68  ARG B CA  1 
ATOM   2706  C C   . ARG B 1 88  ? 40.282  -10.187 13.846  1.00 53.76  ? 68  ARG B C   1 
ATOM   2707  O O   . ARG B 1 88  ? 40.115  -9.466  12.868  1.00 53.32  ? 68  ARG B O   1 
ATOM   2708  C CB  . ARG B 1 88  ? 40.887  -12.333 12.666  1.00 54.45  ? 68  ARG B CB  1 
ATOM   2709  C CG  . ARG B 1 88  ? 42.093  -13.002 12.028  1.00 52.94  ? 68  ARG B CG  1 
ATOM   2710  C CD  . ARG B 1 88  ? 41.738  -13.683 10.728  1.00 51.26  ? 68  ARG B CD  1 
ATOM   2711  N NE  . ARG B 1 88  ? 40.812  -14.774 10.988  1.00 56.42  ? 68  ARG B NE  1 
ATOM   2712  C CZ  . ARG B 1 88  ? 41.156  -16.053 11.155  1.00 56.90  ? 68  ARG B CZ  1 
ATOM   2713  N NH1 . ARG B 1 88  ? 42.426  -16.440 11.060  1.00 56.39  ? 68  ARG B NH1 1 
ATOM   2714  N NH2 . ARG B 1 88  ? 40.217  -16.960 11.403  1.00 55.38  ? 68  ARG B NH2 1 
ATOM   2715  N N   . ILE B 1 89  ? 39.655  -10.004 15.008  1.00 54.10  ? 69  ILE B N   1 
ATOM   2716  C CA  . ILE B 1 89  ? 38.694  -8.933  15.244  1.00 56.68  ? 69  ILE B CA  1 
ATOM   2717  C C   . ILE B 1 89  ? 39.228  -7.951  16.274  1.00 58.28  ? 69  ILE B C   1 
ATOM   2718  O O   . ILE B 1 89  ? 39.407  -8.313  17.440  1.00 60.54  ? 69  ILE B O   1 
ATOM   2719  C CB  . ILE B 1 89  ? 37.371  -9.501  15.779  1.00 55.15  ? 69  ILE B CB  1 
ATOM   2720  C CG1 . ILE B 1 89  ? 36.853  -10.585 14.831  1.00 56.97  ? 69  ILE B CG1 1 
ATOM   2721  C CG2 . ILE B 1 89  ? 36.346  -8.388  15.955  1.00 54.35  ? 69  ILE B CG2 1 
ATOM   2722  C CD1 . ILE B 1 89  ? 35.713  -11.395 15.397  1.00 56.93  ? 69  ILE B CD1 1 
ATOM   2723  N N   . SER B 1 90  ? 39.446  -6.709  15.850  1.00 59.92  ? 70  SER B N   1 
ATOM   2724  C CA  . SER B 1 90  ? 39.958  -5.658  16.740  1.00 59.26  ? 70  SER B CA  1 
ATOM   2725  C C   . SER B 1 90  ? 38.913  -4.583  16.982  1.00 57.99  ? 70  SER B C   1 
ATOM   2726  O O   . SER B 1 90  ? 38.598  -3.809  16.084  1.00 59.64  ? 70  SER B O   1 
ATOM   2727  C CB  . SER B 1 90  ? 41.197  -5.007  16.125  1.00 59.00  ? 70  SER B CB  1 
ATOM   2728  O OG  . SER B 1 90  ? 41.650  -5.749  15.003  1.00 62.80  ? 70  SER B OG  1 
ATOM   2729  N N   . GLY B 1 91  ? 38.393  -4.529  18.201  1.00 60.75  ? 71  GLY B N   1 
ATOM   2730  C CA  . GLY B 1 91  ? 37.456  -3.480  18.601  1.00 62.40  ? 71  GLY B CA  1 
ATOM   2731  C C   . GLY B 1 91  ? 38.083  -2.094  18.674  1.00 64.89  ? 71  GLY B C   1 
ATOM   2732  O O   . GLY B 1 91  ? 39.293  -1.949  18.828  1.00 62.61  ? 71  GLY B O   1 
ATOM   2733  N N   . THR B 1 92  ? 37.242  -1.074  18.562  1.00 68.30  ? 72  THR B N   1 
ATOM   2734  C CA  . THR B 1 92  ? 37.687  0.311   18.533  1.00 66.20  ? 72  THR B CA  1 
ATOM   2735  C C   . THR B 1 92  ? 36.480  1.216   18.590  1.00 67.06  ? 72  THR B C   1 
ATOM   2736  O O   . THR B 1 92  ? 35.365  0.792   18.288  1.00 66.85  ? 72  THR B O   1 
ATOM   2737  C CB  . THR B 1 92  ? 38.412  0.633   17.221  1.00 66.08  ? 72  THR B CB  1 
ATOM   2738  O OG1 . THR B 1 92  ? 39.137  1.861   17.345  1.00 67.83  ? 72  THR B OG1 1 
ATOM   2739  C CG2 . THR B 1 92  ? 37.415  0.786   16.118  1.00 66.54  ? 72  THR B CG2 1 
ATOM   2740  N N   . VAL B 1 93  ? 36.716  2.466   18.961  1.00 68.54  ? 73  VAL B N   1 
ATOM   2741  C CA  . VAL B 1 93  ? 35.713  3.527   18.821  1.00 65.52  ? 73  VAL B CA  1 
ATOM   2742  C C   . VAL B 1 93  ? 36.150  4.545   17.782  1.00 65.43  ? 73  VAL B C   1 
ATOM   2743  O O   . VAL B 1 93  ? 35.392  5.449   17.434  1.00 66.95  ? 73  VAL B O   1 
ATOM   2744  C CB  . VAL B 1 93  ? 35.460  4.250   20.147  1.00 64.37  ? 73  VAL B CB  1 
ATOM   2745  C CG1 . VAL B 1 93  ? 34.719  3.334   21.103  1.00 64.51  ? 73  VAL B CG1 1 
ATOM   2746  C CG2 . VAL B 1 93  ? 36.775  4.718   20.765  1.00 64.29  ? 73  VAL B CG2 1 
ATOM   2747  N N   . ASP B 1 94  ? 37.369  4.380   17.279  1.00 63.97  ? 74  ASP B N   1 
ATOM   2748  C CA  . ASP B 1 94  ? 37.939  5.340   16.374  1.00 66.94  ? 74  ASP B CA  1 
ATOM   2749  C C   . ASP B 1 94  ? 37.559  5.000   14.946  1.00 67.62  ? 74  ASP B C   1 
ATOM   2750  O O   . ASP B 1 94  ? 38.160  4.140   14.295  1.00 65.41  ? 74  ASP B O   1 
ATOM   2751  C CB  . ASP B 1 94  ? 39.456  5.395   16.528  1.00 71.66  ? 74  ASP B CB  1 
ATOM   2752  C CG  . ASP B 1 94  ? 40.108  6.402   15.584  1.00 73.18  ? 74  ASP B CG  1 
ATOM   2753  O OD1 . ASP B 1 94  ? 39.412  7.320   15.098  1.00 76.98  ? 74  ASP B OD1 1 
ATOM   2754  O OD2 . ASP B 1 94  ? 41.324  6.273   15.319  1.00 76.37  ? 74  ASP B OD2 1 
ATOM   2755  N N   . LEU B 1 95  ? 36.567  5.724   14.456  1.00 67.77  ? 75  LEU B N   1 
ATOM   2756  C CA  . LEU B 1 95  ? 36.153  5.628   13.066  1.00 65.92  ? 75  LEU B CA  1 
ATOM   2757  C C   . LEU B 1 95  ? 37.302  5.747   12.061  1.00 61.49  ? 75  LEU B C   1 
ATOM   2758  O O   . LEU B 1 95  ? 37.136  5.422   10.890  1.00 61.23  ? 75  LEU B O   1 
ATOM   2759  C CB  . LEU B 1 95  ? 35.119  6.718   12.756  1.00 68.17  ? 75  LEU B CB  1 
ATOM   2760  C CG  . LEU B 1 95  ? 33.896  6.369   11.898  1.00 68.54  ? 75  LEU B CG  1 
ATOM   2761  C CD1 . LEU B 1 95  ? 33.578  7.533   10.972  1.00 67.00  ? 75  LEU B CD1 1 
ATOM   2762  C CD2 . LEU B 1 95  ? 34.074  5.103   11.078  1.00 68.28  ? 75  LEU B CD2 1 
ATOM   2763  N N   . ASN B 1 96  ? 38.462  6.226   12.490  1.00 61.30  ? 76  ASN B N   1 
ATOM   2764  C CA  . ASN B 1 96  ? 39.571  6.393   11.551  1.00 63.83  ? 76  ASN B CA  1 
ATOM   2765  C C   . ASN B 1 96  ? 40.237  5.072   11.227  1.00 62.92  ? 76  ASN B C   1 
ATOM   2766  O O   . ASN B 1 96  ? 40.943  4.971   10.223  1.00 55.77  ? 76  ASN B O   1 
ATOM   2767  C CB  . ASN B 1 96  ? 40.607  7.410   12.053  1.00 66.36  ? 76  ASN B CB  1 
ATOM   2768  C CG  . ASN B 1 96  ? 40.357  8.811   11.518  1.00 66.22  ? 76  ASN B CG  1 
ATOM   2769  O OD1 . ASN B 1 96  ? 40.875  9.201   10.466  1.00 68.20  ? 76  ASN B OD1 1 
ATOM   2770  N ND2 . ASN B 1 96  ? 39.563  9.575   12.245  1.00 65.91  ? 76  ASN B ND2 1 
ATOM   2771  N N   . MET B 1 97  ? 39.996  4.064   12.068  1.00 68.22  ? 77  MET B N   1 
ATOM   2772  C CA  . MET B 1 97  ? 40.564  2.725   11.868  1.00 70.21  ? 77  MET B CA  1 
ATOM   2773  C C   . MET B 1 97  ? 40.035  2.066   10.587  1.00 67.34  ? 77  MET B C   1 
ATOM   2774  O O   . MET B 1 97  ? 40.676  1.177   10.024  1.00 63.04  ? 77  MET B O   1 
ATOM   2775  C CB  . MET B 1 97  ? 40.326  1.839   13.105  1.00 75.82  ? 77  MET B CB  1 
ATOM   2776  C CG  . MET B 1 97  ? 41.268  2.154   14.271  1.00 80.46  ? 77  MET B CG  1 
ATOM   2777  S SD  . MET B 1 97  ? 43.021  2.011   13.815  1.00 82.31  ? 77  MET B SD  1 
ATOM   2778  C CE  . MET B 1 97  ? 43.695  3.593   14.347  1.00 82.96  ? 77  MET B CE  1 
ATOM   2779  N N   . ALA B 1 98  ? 38.889  2.544   10.108  1.00 64.06  ? 78  ALA B N   1 
ATOM   2780  C CA  . ALA B 1 98  ? 38.320  2.099   8.843   1.00 60.69  ? 78  ALA B CA  1 
ATOM   2781  C C   . ALA B 1 98  ? 39.107  2.548   7.611   1.00 59.52  ? 78  ALA B C   1 
ATOM   2782  O O   . ALA B 1 98  ? 38.823  2.092   6.509   1.00 60.95  ? 78  ALA B O   1 
ATOM   2783  C CB  . ALA B 1 98  ? 36.885  2.588   8.736   1.00 61.34  ? 78  ALA B CB  1 
ATOM   2784  N N   . ALA B 1 99  ? 40.096  3.422   7.790   1.00 57.93  ? 79  ALA B N   1 
ATOM   2785  C CA  . ALA B 1 99  ? 40.703  4.172   6.667   1.00 60.67  ? 79  ALA B CA  1 
ATOM   2786  C C   . ALA B 1 99  ? 41.316  3.354   5.536   1.00 58.94  ? 79  ALA B C   1 
ATOM   2787  O O   . ALA B 1 99  ? 41.311  3.781   4.383   1.00 58.17  ? 79  ALA B O   1 
ATOM   2788  C CB  . ALA B 1 99  ? 41.752  5.144   7.198   1.00 61.33  ? 79  ALA B CB  1 
ATOM   2789  N N   . ASP B 1 100 ? 41.890  2.212   5.872   1.00 59.65  ? 80  ASP B N   1 
ATOM   2790  C CA  . ASP B 1 100 ? 42.606  1.411   4.884   1.00 65.08  ? 80  ASP B CA  1 
ATOM   2791  C C   . ASP B 1 100 ? 41.837  0.134   4.544   1.00 62.72  ? 80  ASP B C   1 
ATOM   2792  O O   . ASP B 1 100 ? 42.255  -0.635  3.669   1.00 57.68  ? 80  ASP B O   1 
ATOM   2793  C CB  . ASP B 1 100 ? 44.022  1.099   5.379   1.00 69.13  ? 80  ASP B CB  1 
ATOM   2794  C CG  . ASP B 1 100 ? 44.031  0.286   6.674   1.00 75.93  ? 80  ASP B CG  1 
ATOM   2795  O OD1 . ASP B 1 100 ? 43.186  0.540   7.563   1.00 77.57  ? 80  ASP B OD1 1 
ATOM   2796  O OD2 . ASP B 1 100 ? 44.881  -0.620  6.793   1.00 79.76  ? 80  ASP B OD2 1 
ATOM   2797  N N   . CYS B 1 101 ? 40.712  -0.071  5.232   1.00 61.15  ? 81  CYS B N   1 
ATOM   2798  C CA  . CYS B 1 101 ? 39.818  -1.187  4.962   1.00 57.90  ? 81  CYS B CA  1 
ATOM   2799  C C   . CYS B 1 101 ? 39.327  -1.126  3.539   1.00 55.98  ? 81  CYS B C   1 
ATOM   2800  O O   . CYS B 1 101 ? 39.208  -0.048  2.956   1.00 56.81  ? 81  CYS B O   1 
ATOM   2801  C CB  . CYS B 1 101 ? 38.629  -1.153  5.894   1.00 57.55  ? 81  CYS B CB  1 
ATOM   2802  S SG  . CYS B 1 101 ? 39.093  -1.607  7.571   1.00 64.82  ? 81  CYS B SG  1 
ATOM   2803  N N   . ASP B 1 102 ? 39.075  -2.296  2.973   1.00 53.88  ? 82  ASP B N   1 
ATOM   2804  C CA  . ASP B 1 102 ? 38.632  -2.389  1.592   1.00 52.42  ? 82  ASP B CA  1 
ATOM   2805  C C   . ASP B 1 102 ? 37.130  -2.355  1.512   1.00 47.71  ? 82  ASP B C   1 
ATOM   2806  O O   . ASP B 1 102 ? 36.579  -2.025  0.476   1.00 45.08  ? 82  ASP B O   1 
ATOM   2807  C CB  . ASP B 1 102 ? 39.102  -3.695  0.980   1.00 55.96  ? 82  ASP B CB  1 
ATOM   2808  C CG  . ASP B 1 102 ? 40.588  -3.804  0.951   1.00 56.85  ? 82  ASP B CG  1 
ATOM   2809  O OD1 . ASP B 1 102 ? 41.203  -3.068  0.146   1.00 55.51  ? 82  ASP B OD1 1 
ATOM   2810  O OD2 . ASP B 1 102 ? 41.129  -4.622  1.735   1.00 59.71  ? 82  ASP B OD2 1 
ATOM   2811  N N   . LEU B 1 103 ? 36.478  -2.743  2.598   1.00 43.22  ? 83  LEU B N   1 
ATOM   2812  C CA  . LEU B 1 103 ? 35.040  -2.753  2.651   1.00 43.91  ? 83  LEU B CA  1 
ATOM   2813  C C   . LEU B 1 103 ? 34.617  -2.323  4.031   1.00 42.87  ? 83  LEU B C   1 
ATOM   2814  O O   . LEU B 1 103 ? 35.247  -2.661  5.023   1.00 46.16  ? 83  LEU B O   1 
ATOM   2815  C CB  . LEU B 1 103 ? 34.510  -4.150  2.349   1.00 43.96  ? 83  LEU B CB  1 
ATOM   2816  C CG  . LEU B 1 103 ? 33.008  -4.407  2.537   1.00 44.86  ? 83  LEU B CG  1 
ATOM   2817  C CD1 . LEU B 1 103 ? 32.220  -3.713  1.438   1.00 45.69  ? 83  LEU B CD1 1 
ATOM   2818  C CD2 . LEU B 1 103 ? 32.714  -5.900  2.523   1.00 44.36  ? 83  LEU B CD2 1 
ATOM   2819  N N   . VAL B 1 104 ? 33.549  -1.561  4.093   1.00 43.15  ? 84  VAL B N   1 
ATOM   2820  C CA  . VAL B 1 104 ? 33.007  -1.164  5.368   1.00 44.63  ? 84  VAL B CA  1 
ATOM   2821  C C   . VAL B 1 104 ? 31.548  -1.522  5.314   1.00 44.55  ? 84  VAL B C   1 
ATOM   2822  O O   . VAL B 1 104 ? 30.884  -1.227  4.327   1.00 45.74  ? 84  VAL B O   1 
ATOM   2823  C CB  . VAL B 1 104 ? 33.130  0.349   5.561   1.00 46.14  ? 84  VAL B CB  1 
ATOM   2824  C CG1 . VAL B 1 104 ? 32.697  0.746   6.954   1.00 44.61  ? 84  VAL B CG1 1 
ATOM   2825  C CG2 . VAL B 1 104 ? 34.563  0.795   5.297   1.00 47.09  ? 84  VAL B CG2 1 
ATOM   2826  N N   . ILE B 1 105 ? 31.051  -2.156  6.360   1.00 42.63  ? 85  ILE B N   1 
ATOM   2827  C CA  . ILE B 1 105 ? 29.651  -2.486  6.420   1.00 43.06  ? 85  ILE B CA  1 
ATOM   2828  C C   . ILE B 1 105 ? 29.081  -1.794  7.618   1.00 42.33  ? 85  ILE B C   1 
ATOM   2829  O O   . ILE B 1 105 ? 29.453  -2.102  8.731   1.00 39.42  ? 85  ILE B O   1 
ATOM   2830  C CB  . ILE B 1 105 ? 29.422  -3.987  6.581   1.00 43.59  ? 85  ILE B CB  1 
ATOM   2831  C CG1 . ILE B 1 105 ? 30.077  -4.726  5.424   1.00 46.91  ? 85  ILE B CG1 1 
ATOM   2832  C CG2 . ILE B 1 105 ? 27.932  -4.286  6.619   1.00 41.83  ? 85  ILE B CG2 1 
ATOM   2833  C CD1 . ILE B 1 105 ? 30.169  -6.218  5.646   1.00 49.12  ? 85  ILE B CD1 1 
ATOM   2834  N N   . GLU B 1 106 ? 28.165  -0.869  7.379   1.00 45.64  ? 86  GLU B N   1 
ATOM   2835  C CA  . GLU B 1 106 ? 27.491  -0.173  8.451   1.00 48.04  ? 86  GLU B CA  1 
ATOM   2836  C C   . GLU B 1 106 ? 26.262  -0.964  8.886   1.00 48.35  ? 86  GLU B C   1 
ATOM   2837  O O   . GLU B 1 106 ? 25.425  -1.338  8.057   1.00 44.90  ? 86  GLU B O   1 
ATOM   2838  C CB  . GLU B 1 106 ? 27.109  1.229   7.989   1.00 50.59  ? 86  GLU B CB  1 
ATOM   2839  C CG  . GLU B 1 106 ? 26.196  1.969   8.957   1.00 55.35  ? 86  GLU B CG  1 
ATOM   2840  C CD  . GLU B 1 106 ? 24.726  1.610   8.783   1.00 59.98  ? 86  GLU B CD  1 
ATOM   2841  O OE1 . GLU B 1 106 ? 24.258  1.486   7.637   1.00 64.18  ? 86  GLU B OE1 1 
ATOM   2842  O OE2 . GLU B 1 106 ? 24.011  1.449   9.787   1.00 68.97  ? 86  GLU B OE2 1 
ATOM   2843  N N   . ALA B 1 107 ? 26.158  -1.185  10.192  1.00 52.58  ? 87  ALA B N   1 
ATOM   2844  C CA  . ALA B 1 107 ? 25.062  -1.938  10.784  1.00 59.06  ? 87  ALA B CA  1 
ATOM   2845  C C   . ALA B 1 107 ? 24.531  -1.176  11.981  1.00 64.69  ? 87  ALA B C   1 
ATOM   2846  O O   . ALA B 1 107 ? 24.147  -1.752  13.003  1.00 65.78  ? 87  ALA B O   1 
ATOM   2847  C CB  . ALA B 1 107 ? 25.553  -3.306  11.192  1.00 61.00  ? 87  ALA B CB  1 
ATOM   2848  N N   . ALA B 1 108 ? 24.489  0.147   11.821  1.00 76.15  ? 88  ALA B N   1 
ATOM   2849  C CA  . ALA B 1 108 ? 24.062  1.073   12.861  1.00 78.40  ? 88  ALA B CA  1 
ATOM   2850  C C   . ALA B 1 108 ? 22.546  1.089   12.934  1.00 78.21  ? 88  ALA B C   1 
ATOM   2851  O O   . ALA B 1 108 ? 21.862  0.233   12.353  1.00 74.06  ? 88  ALA B O   1 
ATOM   2852  C CB  . ALA B 1 108 ? 24.604  2.476   12.578  1.00 79.94  ? 88  ALA B CB  1 
ATOM   2853  N N   . VAL B 1 109 ? 22.027  2.059   13.676  1.00 80.94  ? 89  VAL B N   1 
ATOM   2854  C CA  . VAL B 1 109 ? 20.594  2.272   13.765  1.00 86.33  ? 89  VAL B CA  1 
ATOM   2855  C C   . VAL B 1 109 ? 20.074  2.891   12.471  1.00 80.53  ? 89  VAL B C   1 
ATOM   2856  O O   . VAL B 1 109 ? 20.840  3.448   11.674  1.00 67.14  ? 89  VAL B O   1 
ATOM   2857  C CB  . VAL B 1 109 ? 20.229  3.175   14.966  1.00 91.42  ? 89  VAL B CB  1 
ATOM   2858  C CG1 . VAL B 1 109 ? 20.530  4.643   14.657  1.00 92.04  ? 89  VAL B CG1 1 
ATOM   2859  C CG2 . VAL B 1 109 ? 18.773  2.971   15.379  1.00 90.34  ? 89  VAL B CG2 1 
ATOM   2860  N N   . GLU B 1 110 ? 18.760  2.796   12.297  1.00 77.53  ? 90  GLU B N   1 
ATOM   2861  C CA  . GLU B 1 110 ? 18.102  3.188   11.069  1.00 82.72  ? 90  GLU B CA  1 
ATOM   2862  C C   . GLU B 1 110 ? 17.594  4.621   11.093  1.00 81.49  ? 90  GLU B C   1 
ATOM   2863  O O   . GLU B 1 110 ? 16.402  4.860   11.273  1.00 86.12  ? 90  GLU B O   1 
ATOM   2864  C CB  . GLU B 1 110 ? 16.944  2.228   10.797  1.00 84.47  ? 90  GLU B CB  1 
ATOM   2865  C CG  . GLU B 1 110 ? 17.391  0.782   10.623  1.00 85.55  ? 90  GLU B CG  1 
ATOM   2866  C CD  . GLU B 1 110 ? 17.398  0.344   9.176   1.00 84.29  ? 90  GLU B CD  1 
ATOM   2867  O OE1 . GLU B 1 110 ? 18.312  0.770   8.446   1.00 79.82  ? 90  GLU B OE1 1 
ATOM   2868  O OE2 . GLU B 1 110 ? 16.504  -0.434  8.779   1.00 87.00  ? 90  GLU B OE2 1 
ATOM   2869  N N   . ARG B 1 111 ? 18.502  5.566   10.885  1.00 78.05  ? 91  ARG B N   1 
ATOM   2870  C CA  . ARG B 1 111 ? 18.134  6.960   10.796  1.00 79.44  ? 91  ARG B CA  1 
ATOM   2871  C C   . ARG B 1 111 ? 18.851  7.553   9.616   1.00 72.24  ? 91  ARG B C   1 
ATOM   2872  O O   . ARG B 1 111 ? 20.072  7.653   9.623   1.00 75.94  ? 91  ARG B O   1 
ATOM   2873  C CB  . ARG B 1 111 ? 18.508  7.687   12.079  1.00 90.43  ? 91  ARG B CB  1 
ATOM   2874  C CG  . ARG B 1 111 ? 17.661  7.257   13.264  1.00 100.26 ? 91  ARG B CG  1 
ATOM   2875  C CD  . ARG B 1 111 ? 18.064  7.968   14.547  1.00 112.50 ? 91  ARG B CD  1 
ATOM   2876  N NE  . ARG B 1 111 ? 17.352  7.449   15.717  1.00 120.31 ? 91  ARG B NE  1 
ATOM   2877  C CZ  . ARG B 1 111 ? 17.622  7.770   16.986  1.00 121.41 ? 91  ARG B CZ  1 
ATOM   2878  N NH1 . ARG B 1 111 ? 18.598  8.625   17.286  1.00 122.05 ? 91  ARG B NH1 1 
ATOM   2879  N NH2 . ARG B 1 111 ? 16.905  7.230   17.968  1.00 117.14 ? 91  ARG B NH2 1 
ATOM   2880  N N   . MET B 1 112 ? 18.092  7.949   8.603   1.00 64.71  ? 92  MET B N   1 
ATOM   2881  C CA  . MET B 1 112 ? 18.686  8.440   7.380   1.00 62.48  ? 92  MET B CA  1 
ATOM   2882  C C   . MET B 1 112 ? 19.756  9.472   7.695   1.00 63.58  ? 92  MET B C   1 
ATOM   2883  O O   . MET B 1 112 ? 20.855  9.424   7.138   1.00 61.14  ? 92  MET B O   1 
ATOM   2884  C CB  . MET B 1 112 ? 17.619  9.022   6.457   1.00 57.53  ? 92  MET B CB  1 
ATOM   2885  C CG  . MET B 1 112 ? 18.106  9.284   5.045   1.00 56.66  ? 92  MET B CG  1 
ATOM   2886  S SD  . MET B 1 112 ? 19.211  8.022   4.392   1.00 57.72  ? 92  MET B SD  1 
ATOM   2887  C CE  . MET B 1 112 ? 18.074  7.163   3.305   1.00 55.74  ? 92  MET B CE  1 
ATOM   2888  N N   . ASP B 1 113 ? 19.448  10.377  8.618   1.00 67.10  ? 93  ASP B N   1 
ATOM   2889  C CA  . ASP B 1 113 ? 20.345  11.501  8.879   1.00 72.10  ? 93  ASP B CA  1 
ATOM   2890  C C   . ASP B 1 113 ? 21.656  11.096  9.591   1.00 68.22  ? 93  ASP B C   1 
ATOM   2891  O O   . ASP B 1 113 ? 22.713  11.617  9.262   1.00 61.84  ? 93  ASP B O   1 
ATOM   2892  C CB  . ASP B 1 113 ? 19.615  12.639  9.609   1.00 78.55  ? 93  ASP B CB  1 
ATOM   2893  C CG  . ASP B 1 113 ? 19.234  12.293  11.051  1.00 88.68  ? 93  ASP B CG  1 
ATOM   2894  O OD1 . ASP B 1 113 ? 19.388  11.130  11.496  1.00 95.67  ? 93  ASP B OD1 1 
ATOM   2895  O OD2 . ASP B 1 113 ? 18.756  13.209  11.749  1.00 97.83  ? 93  ASP B OD2 1 
ATOM   2896  N N   . ILE B 1 114 ? 21.600  10.170  10.545  1.00 65.60  ? 94  ILE B N   1 
ATOM   2897  C CA  . ILE B 1 114 ? 22.831  9.632   11.150  1.00 67.63  ? 94  ILE B CA  1 
ATOM   2898  C C   . ILE B 1 114 ? 23.626  8.849   10.123  1.00 64.66  ? 94  ILE B C   1 
ATOM   2899  O O   . ILE B 1 114 ? 24.832  9.052   9.943   1.00 64.09  ? 94  ILE B O   1 
ATOM   2900  C CB  . ILE B 1 114 ? 22.523  8.681   12.324  1.00 74.73  ? 94  ILE B CB  1 
ATOM   2901  C CG1 . ILE B 1 114 ? 22.389  9.477   13.619  1.00 79.33  ? 94  ILE B CG1 1 
ATOM   2902  C CG2 . ILE B 1 114 ? 23.612  7.621   12.489  1.00 74.86  ? 94  ILE B CG2 1 
ATOM   2903  C CD1 . ILE B 1 114 ? 21.156  9.106   14.399  1.00 82.55  ? 94  ILE B CD1 1 
ATOM   2904  N N   . LYS B 1 115 ? 22.923  7.934   9.464   1.00 60.82  ? 95  LYS B N   1 
ATOM   2905  C CA  . LYS B 1 115 ? 23.507  7.078   8.457   1.00 56.72  ? 95  LYS B CA  1 
ATOM   2906  C C   . LYS B 1 115 ? 24.203  7.881   7.374   1.00 57.42  ? 95  LYS B C   1 
ATOM   2907  O O   . LYS B 1 115 ? 25.216  7.465   6.841   1.00 59.28  ? 95  LYS B O   1 
ATOM   2908  C CB  . LYS B 1 115 ? 22.429  6.226   7.812   1.00 57.46  ? 95  LYS B CB  1 
ATOM   2909  C CG  . LYS B 1 115 ? 22.936  4.856   7.439   1.00 60.15  ? 95  LYS B CG  1 
ATOM   2910  C CD  . LYS B 1 115 ? 21.845  3.987   6.828   1.00 59.97  ? 95  LYS B CD  1 
ATOM   2911  C CE  . LYS B 1 115 ? 21.176  3.055   7.838   1.00 61.79  ? 95  LYS B CE  1 
ATOM   2912  N NZ  . LYS B 1 115 ? 21.792  2.942   9.189   1.00 65.06  ? 95  LYS B NZ  1 
ATOM   2913  N N   . LYS B 1 116 ? 23.658  9.037   7.038   1.00 55.39  ? 96  LYS B N   1 
ATOM   2914  C CA  . LYS B 1 116 ? 24.270  9.845   6.001   1.00 54.22  ? 96  LYS B CA  1 
ATOM   2915  C C   . LYS B 1 116 ? 25.566  10.454  6.462   1.00 54.55  ? 96  LYS B C   1 
ATOM   2916  O O   . LYS B 1 116 ? 26.485  10.663  5.668   1.00 48.48  ? 96  LYS B O   1 
ATOM   2917  C CB  . LYS B 1 116 ? 23.329  10.936  5.582   1.00 55.28  ? 96  LYS B CB  1 
ATOM   2918  C CG  . LYS B 1 116 ? 22.457  10.489  4.447   1.00 58.35  ? 96  LYS B CG  1 
ATOM   2919  C CD  . LYS B 1 116 ? 21.180  11.276  4.436   1.00 59.06  ? 96  LYS B CD  1 
ATOM   2920  C CE  . LYS B 1 116 ? 20.945  11.851  3.061   1.00 61.81  ? 96  LYS B CE  1 
ATOM   2921  N NZ  . LYS B 1 116 ? 19.523  12.251  2.955   1.00 63.39  ? 96  LYS B NZ  1 
ATOM   2922  N N   . GLN B 1 117 ? 25.620  10.737  7.757   1.00 57.30  ? 97  GLN B N   1 
ATOM   2923  C CA  . GLN B 1 117 ? 26.776  11.362  8.371   1.00 62.97  ? 97  GLN B CA  1 
ATOM   2924  C C   . GLN B 1 117 ? 27.944  10.369  8.371   1.00 60.03  ? 97  GLN B C   1 
ATOM   2925  O O   . GLN B 1 117 ? 29.046  10.669  7.893   1.00 53.45  ? 97  GLN B O   1 
ATOM   2926  C CB  . GLN B 1 117 ? 26.421  11.825  9.796   1.00 67.01  ? 97  GLN B CB  1 
ATOM   2927  C CG  . GLN B 1 117 ? 27.308  12.936  10.355  1.00 72.21  ? 97  GLN B CG  1 
ATOM   2928  C CD  . GLN B 1 117 ? 27.415  14.153  9.434   1.00 74.13  ? 97  GLN B CD  1 
ATOM   2929  O OE1 . GLN B 1 117 ? 26.485  14.966  9.331   1.00 73.18  ? 97  GLN B OE1 1 
ATOM   2930  N NE2 . GLN B 1 117 ? 28.564  14.282  8.761   1.00 67.92  ? 97  GLN B NE2 1 
ATOM   2931  N N   . ILE B 1 118 ? 27.673  9.173   8.877   1.00 57.00  ? 98  ILE B N   1 
ATOM   2932  C CA  . ILE B 1 118 ? 28.635  8.085   8.835   1.00 54.48  ? 98  ILE B CA  1 
ATOM   2933  C C   . ILE B 1 118 ? 29.234  7.882   7.448   1.00 52.63  ? 98  ILE B C   1 
ATOM   2934  O O   . ILE B 1 118 ? 30.443  7.707   7.297   1.00 54.98  ? 98  ILE B O   1 
ATOM   2935  C CB  . ILE B 1 118 ? 27.973  6.790   9.288   1.00 58.19  ? 98  ILE B CB  1 
ATOM   2936  C CG1 . ILE B 1 118 ? 28.276  6.553   10.757  1.00 61.47  ? 98  ILE B CG1 1 
ATOM   2937  C CG2 . ILE B 1 118 ? 28.464  5.599   8.477   1.00 62.07  ? 98  ILE B CG2 1 
ATOM   2938  C CD1 . ILE B 1 118 ? 27.315  5.576   11.395  1.00 64.43  ? 98  ILE B CD1 1 
ATOM   2939  N N   . PHE B 1 119 ? 28.387  7.889   6.434   1.00 50.26  ? 99  PHE B N   1 
ATOM   2940  C CA  . PHE B 1 119 ? 28.859  7.636   5.083   1.00 50.40  ? 99  PHE B CA  1 
ATOM   2941  C C   . PHE B 1 119 ? 29.633  8.829   4.553   1.00 51.62  ? 99  PHE B C   1 
ATOM   2942  O O   . PHE B 1 119 ? 30.547  8.685   3.731   1.00 49.01  ? 99  PHE B O   1 
ATOM   2943  C CB  . PHE B 1 119 ? 27.689  7.284   4.167   1.00 47.54  ? 99  PHE B CB  1 
ATOM   2944  C CG  . PHE B 1 119 ? 27.347  5.831   4.190   1.00 47.94  ? 99  PHE B CG  1 
ATOM   2945  C CD1 . PHE B 1 119 ? 26.644  5.279   5.253   1.00 45.60  ? 99  PHE B CD1 1 
ATOM   2946  C CD2 . PHE B 1 119 ? 27.773  5.004   3.170   1.00 48.30  ? 99  PHE B CD2 1 
ATOM   2947  C CE1 . PHE B 1 119 ? 26.347  3.940   5.279   1.00 45.24  ? 99  PHE B CE1 1 
ATOM   2948  C CE2 . PHE B 1 119 ? 27.481  3.659   3.192   1.00 46.24  ? 99  PHE B CE2 1 
ATOM   2949  C CZ  . PHE B 1 119 ? 26.769  3.127   4.247   1.00 45.61  ? 99  PHE B CZ  1 
ATOM   2950  N N   . ALA B 1 120 ? 29.251  10.008  5.026   1.00 54.07  ? 100 ALA B N   1 
ATOM   2951  C CA  . ALA B 1 120 ? 29.921  11.237  4.645   1.00 55.13  ? 100 ALA B CA  1 
ATOM   2952  C C   . ALA B 1 120 ? 31.309  11.217  5.256   1.00 53.09  ? 100 ALA B C   1 
ATOM   2953  O O   . ALA B 1 120 ? 32.313  11.468  4.575   1.00 49.09  ? 100 ALA B O   1 
ATOM   2954  C CB  . ALA B 1 120 ? 29.140  12.439  5.146   1.00 57.32  ? 100 ALA B CB  1 
ATOM   2955  N N   . ASP B 1 121 ? 31.353  10.884  6.542   1.00 51.66  ? 101 ASP B N   1 
ATOM   2956  C CA  . ASP B 1 121 ? 32.617  10.729  7.256   1.00 53.39  ? 101 ASP B CA  1 
ATOM   2957  C C   . ASP B 1 121 ? 33.507  9.722   6.545   1.00 53.68  ? 101 ASP B C   1 
ATOM   2958  O O   . ASP B 1 121 ? 34.622  10.055  6.126   1.00 54.15  ? 101 ASP B O   1 
ATOM   2959  C CB  . ASP B 1 121 ? 32.374  10.284  8.700   1.00 56.28  ? 101 ASP B CB  1 
ATOM   2960  C CG  . ASP B 1 121 ? 31.733  11.376  9.555   1.00 59.90  ? 101 ASP B CG  1 
ATOM   2961  O OD1 . ASP B 1 121 ? 31.342  11.078  10.704  1.00 59.54  ? 101 ASP B OD1 1 
ATOM   2962  O OD2 . ASP B 1 121 ? 31.604  12.531  9.076   1.00 66.35  ? 101 ASP B OD2 1 
ATOM   2963  N N   . LEU B 1 122 ? 32.995  8.502   6.391   1.00 52.19  ? 102 LEU B N   1 
ATOM   2964  C CA  . LEU B 1 122 ? 33.740  7.416   5.757   1.00 51.01  ? 102 LEU B CA  1 
ATOM   2965  C C   . LEU B 1 122 ? 34.252  7.786   4.392   1.00 49.72  ? 102 LEU B C   1 
ATOM   2966  O O   . LEU B 1 122 ? 35.383  7.459   4.030   1.00 48.72  ? 102 LEU B O   1 
ATOM   2967  C CB  . LEU B 1 122 ? 32.856  6.194   5.610   1.00 52.53  ? 102 LEU B CB  1 
ATOM   2968  C CG  . LEU B 1 122 ? 32.528  5.573   6.957   1.00 53.33  ? 102 LEU B CG  1 
ATOM   2969  C CD1 . LEU B 1 122 ? 31.412  4.568   6.823   1.00 54.37  ? 102 LEU B CD1 1 
ATOM   2970  C CD2 . LEU B 1 122 ? 33.760  4.903   7.521   1.00 55.87  ? 102 LEU B CD2 1 
ATOM   2971  N N   . ASP B 1 123 ? 33.412  8.461   3.623   1.00 48.08  ? 103 ASP B N   1 
ATOM   2972  C CA  . ASP B 1 123 ? 33.805  8.855   2.279   1.00 50.12  ? 103 ASP B CA  1 
ATOM   2973  C C   . ASP B 1 123 ? 35.108  9.679   2.319   1.00 52.19  ? 103 ASP B C   1 
ATOM   2974  O O   . ASP B 1 123 ? 35.961  9.561   1.439   1.00 48.66  ? 103 ASP B O   1 
ATOM   2975  C CB  . ASP B 1 123 ? 32.674  9.645   1.625   1.00 48.25  ? 103 ASP B CB  1 
ATOM   2976  C CG  . ASP B 1 123 ? 33.048  10.194  0.272   1.00 46.63  ? 103 ASP B CG  1 
ATOM   2977  O OD1 . ASP B 1 123 ? 33.755  9.508   -0.491  1.00 44.48  ? 103 ASP B OD1 1 
ATOM   2978  O OD2 . ASP B 1 123 ? 32.616  11.319  -0.042  1.00 47.99  ? 103 ASP B OD2 1 
ATOM   2979  N N   . ASN B 1 124 ? 35.253  10.504  3.353   1.00 54.14  ? 104 ASN B N   1 
ATOM   2980  C CA  . ASN B 1 124 ? 36.439  11.352  3.508   1.00 58.69  ? 104 ASN B CA  1 
ATOM   2981  C C   . ASN B 1 124 ? 37.599  10.600  4.121   1.00 59.37  ? 104 ASN B C   1 
ATOM   2982  O O   . ASN B 1 124 ? 38.730  10.741  3.673   1.00 60.88  ? 104 ASN B O   1 
ATOM   2983  C CB  . ASN B 1 124 ? 36.116  12.572  4.367   1.00 60.30  ? 104 ASN B CB  1 
ATOM   2984  C CG  . ASN B 1 124 ? 35.226  13.555  3.643   1.00 61.72  ? 104 ASN B CG  1 
ATOM   2985  O OD1 . ASN B 1 124 ? 35.531  13.961  2.520   1.00 64.45  ? 104 ASN B OD1 1 
ATOM   2986  N ND2 . ASN B 1 124 ? 34.114  13.932  4.269   1.00 60.73  ? 104 ASN B ND2 1 
ATOM   2987  N N   . ILE B 1 125 ? 37.307  9.804   5.143   1.00 58.21  ? 105 ILE B N   1 
ATOM   2988  C CA  . ILE B 1 125 ? 38.321  8.994   5.796   1.00 56.48  ? 105 ILE B CA  1 
ATOM   2989  C C   . ILE B 1 125 ? 38.978  7.938   4.909   1.00 55.51  ? 105 ILE B C   1 
ATOM   2990  O O   . ILE B 1 125 ? 40.194  7.788   4.939   1.00 56.79  ? 105 ILE B O   1 
ATOM   2991  C CB  . ILE B 1 125 ? 37.724  8.235   6.981   1.00 56.27  ? 105 ILE B CB  1 
ATOM   2992  C CG1 . ILE B 1 125 ? 37.460  9.183   8.140   1.00 55.26  ? 105 ILE B CG1 1 
ATOM   2993  C CG2 . ILE B 1 125 ? 38.674  7.141   7.431   1.00 58.42  ? 105 ILE B CG2 1 
ATOM   2994  C CD1 . ILE B 1 125 ? 36.523  8.607   9.179   1.00 54.12  ? 105 ILE B CD1 1 
ATOM   2995  N N   . CYS B 1 126 ? 38.179  7.175   4.168   1.00 56.34  ? 106 CYS B N   1 
ATOM   2996  C CA  . CYS B 1 126 ? 38.664  5.927   3.578   1.00 54.03  ? 106 CYS B CA  1 
ATOM   2997  C C   . CYS B 1 126 ? 39.334  6.177   2.254   1.00 49.17  ? 106 CYS B C   1 
ATOM   2998  O O   . CYS B 1 126 ? 38.996  7.102   1.540   1.00 47.68  ? 106 CYS B O   1 
ATOM   2999  C CB  . CYS B 1 126 ? 37.521  4.918   3.399   1.00 55.39  ? 106 CYS B CB  1 
ATOM   3000  S SG  . CYS B 1 126 ? 36.686  4.459   4.938   1.00 56.29  ? 106 CYS B SG  1 
ATOM   3001  N N   . LYS B 1 127 ? 40.287  5.333   1.915   1.00 50.77  ? 107 LYS B N   1 
ATOM   3002  C CA  . LYS B 1 127 ? 40.970  5.484   0.644   1.00 54.13  ? 107 LYS B CA  1 
ATOM   3003  C C   . LYS B 1 127 ? 39.977  5.339   -0.508  1.00 54.70  ? 107 LYS B C   1 
ATOM   3004  O O   . LYS B 1 127 ? 38.894  4.806   -0.327  1.00 57.28  ? 107 LYS B O   1 
ATOM   3005  C CB  . LYS B 1 127 ? 42.104  4.472   0.521   1.00 54.57  ? 107 LYS B CB  1 
ATOM   3006  C CG  . LYS B 1 127 ? 41.735  3.061   0.934   1.00 57.41  ? 107 LYS B CG  1 
ATOM   3007  C CD  . LYS B 1 127 ? 42.350  2.038   -0.011  1.00 59.00  ? 107 LYS B CD  1 
ATOM   3008  C CE  . LYS B 1 127 ? 41.724  0.658   0.165   1.00 60.32  ? 107 LYS B CE  1 
ATOM   3009  N NZ  . LYS B 1 127 ? 42.570  -0.247  0.981   1.00 57.44  ? 107 LYS B NZ  1 
ATOM   3010  N N   . PRO B 1 128 ? 40.351  5.809   -1.701  1.00 57.40  ? 108 PRO B N   1 
ATOM   3011  C CA  . PRO B 1 128 ? 39.401  5.881   -2.818  1.00 57.86  ? 108 PRO B CA  1 
ATOM   3012  C C   . PRO B 1 128 ? 38.731  4.569   -3.229  1.00 59.69  ? 108 PRO B C   1 
ATOM   3013  O O   . PRO B 1 128 ? 37.592  4.573   -3.704  1.00 63.16  ? 108 PRO B O   1 
ATOM   3014  C CB  . PRO B 1 128 ? 40.255  6.380   -3.987  1.00 57.50  ? 108 PRO B CB  1 
ATOM   3015  C CG  . PRO B 1 128 ? 41.489  6.955   -3.395  1.00 57.55  ? 108 PRO B CG  1 
ATOM   3016  C CD  . PRO B 1 128 ? 41.605  6.534   -1.969  1.00 57.47  ? 108 PRO B CD  1 
ATOM   3017  N N   . GLU B 1 129 ? 39.431  3.468   -3.045  1.00 56.75  ? 109 GLU B N   1 
ATOM   3018  C CA  . GLU B 1 129 ? 38.991  2.182   -3.579  1.00 54.93  ? 109 GLU B CA  1 
ATOM   3019  C C   . GLU B 1 129 ? 37.984  1.480   -2.646  1.00 49.33  ? 109 GLU B C   1 
ATOM   3020  O O   . GLU B 1 129 ? 37.214  0.625   -3.078  1.00 44.58  ? 109 GLU B O   1 
ATOM   3021  C CB  . GLU B 1 129 ? 40.200  1.296   -3.887  1.00 57.97  ? 109 GLU B CB  1 
ATOM   3022  C CG  . GLU B 1 129 ? 41.463  1.666   -3.101  1.00 66.59  ? 109 GLU B CG  1 
ATOM   3023  C CD  . GLU B 1 129 ? 42.519  2.434   -3.900  1.00 68.43  ? 109 GLU B CD  1 
ATOM   3024  O OE1 . GLU B 1 129 ? 42.702  2.152   -5.107  1.00 68.73  ? 109 GLU B OE1 1 
ATOM   3025  O OE2 . GLU B 1 129 ? 43.195  3.306   -3.304  1.00 67.20  ? 109 GLU B OE2 1 
ATOM   3026  N N   . THR B 1 130 ? 37.975  1.869   -1.380  1.00 43.29  ? 110 THR B N   1 
ATOM   3027  C CA  . THR B 1 130 ? 37.031  1.331   -0.432  1.00 44.90  ? 110 THR B CA  1 
ATOM   3028  C C   . THR B 1 130 ? 35.588  1.374   -0.904  1.00 49.17  ? 110 THR B C   1 
ATOM   3029  O O   . THR B 1 130 ? 35.149  2.355   -1.494  1.00 55.51  ? 110 THR B O   1 
ATOM   3030  C CB  . THR B 1 130 ? 37.085  2.117   0.867   1.00 45.02  ? 110 THR B CB  1 
ATOM   3031  O OG1 . THR B 1 130 ? 38.447  2.241   1.274   1.00 45.96  ? 110 THR B OG1 1 
ATOM   3032  C CG2 . THR B 1 130 ? 36.304  1.420   1.946   1.00 42.89  ? 110 THR B CG2 1 
ATOM   3033  N N   . ILE B 1 131 ? 34.868  0.297   -0.607  1.00 47.13  ? 111 ILE B N   1 
ATOM   3034  C CA  . ILE B 1 131 ? 33.457  0.177   -0.877  1.00 44.69  ? 111 ILE B CA  1 
ATOM   3035  C C   . ILE B 1 131 ? 32.726  0.315   0.441   1.00 45.32  ? 111 ILE B C   1 
ATOM   3036  O O   . ILE B 1 131 ? 33.130  -0.265  1.454   1.00 43.11  ? 111 ILE B O   1 
ATOM   3037  C CB  . ILE B 1 131 ? 33.138  -1.194  -1.474  1.00 44.81  ? 111 ILE B CB  1 
ATOM   3038  C CG1 . ILE B 1 131 ? 33.626  -1.241  -2.917  1.00 44.71  ? 111 ILE B CG1 1 
ATOM   3039  C CG2 . ILE B 1 131 ? 31.643  -1.478  -1.436  1.00 42.74  ? 111 ILE B CG2 1 
ATOM   3040  C CD1 . ILE B 1 131 ? 33.478  -2.598  -3.553  1.00 42.42  ? 111 ILE B CD1 1 
ATOM   3041  N N   . LEU B 1 132 ? 31.633  1.064   0.425   1.00 45.46  ? 112 LEU B N   1 
ATOM   3042  C CA  . LEU B 1 132 ? 30.889  1.333   1.647   1.00 46.81  ? 112 LEU B CA  1 
ATOM   3043  C C   . LEU B 1 132 ? 29.512  0.717   1.546   1.00 43.86  ? 112 LEU B C   1 
ATOM   3044  O O   . LEU B 1 132 ? 28.779  0.974   0.594   1.00 44.48  ? 112 LEU B O   1 
ATOM   3045  C CB  . LEU B 1 132 ? 30.743  2.832   1.846   1.00 50.01  ? 112 LEU B CB  1 
ATOM   3046  C CG  . LEU B 1 132 ? 32.013  3.673   1.788   1.00 51.98  ? 112 LEU B CG  1 
ATOM   3047  C CD1 . LEU B 1 132 ? 31.629  5.140   1.692   1.00 52.60  ? 112 LEU B CD1 1 
ATOM   3048  C CD2 . LEU B 1 132 ? 32.836  3.428   3.036   1.00 51.60  ? 112 LEU B CD2 1 
ATOM   3049  N N   . ALA B 1 133 ? 29.153  -0.084  2.532   1.00 41.71  ? 113 ALA B N   1 
ATOM   3050  C CA  . ALA B 1 133 ? 27.930  -0.837  2.452   1.00 41.22  ? 113 ALA B CA  1 
ATOM   3051  C C   . ALA B 1 133 ? 27.096  -0.652  3.675   1.00 42.75  ? 113 ALA B C   1 
ATOM   3052  O O   . ALA B 1 133 ? 27.623  -0.474  4.774   1.00 43.10  ? 113 ALA B O   1 
ATOM   3053  C CB  . ALA B 1 133 ? 28.236  -2.304  2.260   1.00 42.17  ? 113 ALA B CB  1 
ATOM   3054  N N   . SER B 1 134 ? 25.784  -0.699  3.476   1.00 43.35  ? 114 SER B N   1 
ATOM   3055  C CA  . SER B 1 134 ? 24.859  -0.698  4.584   1.00 44.42  ? 114 SER B CA  1 
ATOM   3056  C C   . SER B 1 134 ? 24.097  -1.997  4.600   1.00 43.69  ? 114 SER B C   1 
ATOM   3057  O O   . SER B 1 134 ? 23.841  -2.586  3.564   1.00 42.03  ? 114 SER B O   1 
ATOM   3058  C CB  . SER B 1 134 ? 23.871  0.446   4.452   1.00 46.08  ? 114 SER B CB  1 
ATOM   3059  O OG  . SER B 1 134 ? 23.186  0.670   5.686   1.00 46.31  ? 114 SER B OG  1 
ATOM   3060  N N   . ASN B 1 135 ? 23.722  -2.402  5.800   1.00 45.38  ? 115 ASN B N   1 
ATOM   3061  C CA  . ASN B 1 135 ? 22.951  -3.600  6.051   1.00 47.57  ? 115 ASN B CA  1 
ATOM   3062  C C   . ASN B 1 135 ? 21.498  -3.253  6.317   1.00 49.24  ? 115 ASN B C   1 
ATOM   3063  O O   . ASN B 1 135 ? 20.738  -4.084  6.802   1.00 54.59  ? 115 ASN B O   1 
ATOM   3064  C CB  . ASN B 1 135 ? 23.537  -4.290  7.286   1.00 50.98  ? 115 ASN B CB  1 
ATOM   3065  C CG  . ASN B 1 135 ? 22.660  -5.418  7.814   1.00 53.05  ? 115 ASN B CG  1 
ATOM   3066  O OD1 . ASN B 1 135 ? 22.411  -6.403  7.117   1.00 51.72  ? 115 ASN B OD1 1 
ATOM   3067  N ND2 . ASN B 1 135 ? 22.190  -5.277  9.053   1.00 52.21  ? 115 ASN B ND2 1 
ATOM   3068  N N   . THR B 1 136 ? 21.101  -2.026  6.012   1.00 50.41  ? 116 THR B N   1 
ATOM   3069  C CA  . THR B 1 136 ? 19.739  -1.576  6.281   1.00 50.13  ? 116 THR B CA  1 
ATOM   3070  C C   . THR B 1 136 ? 18.676  -2.412  5.567   1.00 49.83  ? 116 THR B C   1 
ATOM   3071  O O   . THR B 1 136 ? 18.910  -2.937  4.474   1.00 47.61  ? 116 THR B O   1 
ATOM   3072  C CB  . THR B 1 136 ? 19.567  -0.112  5.837   1.00 51.23  ? 116 THR B CB  1 
ATOM   3073  O OG1 . THR B 1 136 ? 18.321  0.400   6.315   1.00 50.27  ? 116 THR B OG1 1 
ATOM   3074  C CG2 . THR B 1 136 ? 19.585  0.007   4.332   1.00 50.24  ? 116 THR B CG2 1 
ATOM   3075  N N   . SER B 1 137 ? 17.502  -2.516  6.181   1.00 52.57  ? 117 SER B N   1 
ATOM   3076  C CA  . SER B 1 137 ? 16.367  -3.211  5.556   1.00 54.39  ? 117 SER B CA  1 
ATOM   3077  C C   . SER B 1 137 ? 15.470  -2.261  4.824   1.00 53.19  ? 117 SER B C   1 
ATOM   3078  O O   . SER B 1 137 ? 14.821  -2.667  3.880   1.00 50.92  ? 117 SER B O   1 
ATOM   3079  C CB  . SER B 1 137 ? 15.476  -3.883  6.595   1.00 54.76  ? 117 SER B CB  1 
ATOM   3080  O OG  . SER B 1 137 ? 16.169  -4.899  7.273   1.00 63.81  ? 117 SER B OG  1 
ATOM   3081  N N   . SER B 1 138 ? 15.403  -1.014  5.288   1.00 54.06  ? 118 SER B N   1 
ATOM   3082  C CA  . SER B 1 138 ? 14.291  -0.132  4.940   1.00 56.50  ? 118 SER B CA  1 
ATOM   3083  C C   . SER B 1 138 ? 14.659  1.290   4.493   1.00 58.02  ? 118 SER B C   1 
ATOM   3084  O O   . SER B 1 138 ? 13.773  2.115   4.266   1.00 63.88  ? 118 SER B O   1 
ATOM   3085  C CB  . SER B 1 138 ? 13.350  -0.055  6.138   1.00 55.08  ? 118 SER B CB  1 
ATOM   3086  O OG  . SER B 1 138 ? 14.047  0.406   7.276   1.00 55.13  ? 118 SER B OG  1 
ATOM   3087  N N   . LEU B 1 139 ? 15.945  1.567   4.345   1.00 55.14  ? 119 LEU B N   1 
ATOM   3088  C CA  . LEU B 1 139 ? 16.400  2.892   3.958   1.00 49.45  ? 119 LEU B CA  1 
ATOM   3089  C C   . LEU B 1 139 ? 17.018  2.813   2.594   1.00 44.25  ? 119 LEU B C   1 
ATOM   3090  O O   . LEU B 1 139 ? 17.638  1.817   2.256   1.00 45.34  ? 119 LEU B O   1 
ATOM   3091  C CB  . LEU B 1 139 ? 17.424  3.425   4.952   1.00 51.56  ? 119 LEU B CB  1 
ATOM   3092  C CG  . LEU B 1 139 ? 16.872  3.718   6.349   1.00 55.41  ? 119 LEU B CG  1 
ATOM   3093  C CD1 . LEU B 1 139 ? 17.991  4.267   7.213   1.00 54.86  ? 119 LEU B CD1 1 
ATOM   3094  C CD2 . LEU B 1 139 ? 15.718  4.710   6.321   1.00 54.89  ? 119 LEU B CD2 1 
ATOM   3095  N N   . SER B 1 140 ? 16.857  3.875   1.816   1.00 40.91  ? 120 SER B N   1 
ATOM   3096  C CA  . SER B 1 140 ? 17.344  3.907   0.453   1.00 39.65  ? 120 SER B CA  1 
ATOM   3097  C C   . SER B 1 140 ? 18.858  3.999   0.360   1.00 40.91  ? 120 SER B C   1 
ATOM   3098  O O   . SER B 1 140 ? 19.458  4.954   0.845   1.00 42.63  ? 120 SER B O   1 
ATOM   3099  C CB  . SER B 1 140 ? 16.759  5.090   -0.303  1.00 40.91  ? 120 SER B CB  1 
ATOM   3100  O OG  . SER B 1 140 ? 17.383  5.226   -1.578  1.00 39.95  ? 120 SER B OG  1 
ATOM   3101  N N   . ILE B 1 141 ? 19.442  3.024   -0.327  1.00 39.59  ? 121 ILE B N   1 
ATOM   3102  C CA  . ILE B 1 141 ? 20.866  2.978   -0.606  1.00 39.96  ? 121 ILE B CA  1 
ATOM   3103  C C   . ILE B 1 141 ? 21.283  4.161   -1.463  1.00 38.85  ? 121 ILE B C   1 
ATOM   3104  O O   . ILE B 1 141 ? 22.325  4.758   -1.233  1.00 40.90  ? 121 ILE B O   1 
ATOM   3105  C CB  . ILE B 1 141 ? 21.273  1.710   -1.399  1.00 40.59  ? 121 ILE B CB  1 
ATOM   3106  C CG1 . ILE B 1 141 ? 20.627  0.459   -0.841  1.00 44.54  ? 121 ILE B CG1 1 
ATOM   3107  C CG2 . ILE B 1 141 ? 22.772  1.476   -1.302  1.00 41.20  ? 121 ILE B CG2 1 
ATOM   3108  C CD1 . ILE B 1 141 ? 21.127  0.059   0.543   1.00 45.53  ? 121 ILE B CD1 1 
ATOM   3109  N N   . THR B 1 142 ? 20.479  4.462   -2.473  1.00 39.49  ? 122 THR B N   1 
ATOM   3110  C CA  . THR B 1 142 ? 20.726  5.574   -3.384  1.00 40.28  ? 122 THR B CA  1 
ATOM   3111  C C   . THR B 1 142 ? 20.818  6.934   -2.669  1.00 41.31  ? 122 THR B C   1 
ATOM   3112  O O   . THR B 1 142 ? 21.718  7.709   -2.948  1.00 40.31  ? 122 THR B O   1 
ATOM   3113  C CB  . THR B 1 142 ? 19.616  5.627   -4.440  1.00 41.50  ? 122 THR B CB  1 
ATOM   3114  O OG1 . THR B 1 142 ? 19.381  4.306   -4.938  1.00 41.49  ? 122 THR B OG1 1 
ATOM   3115  C CG2 . THR B 1 142 ? 20.012  6.477   -5.589  1.00 42.04  ? 122 THR B CG2 1 
ATOM   3116  N N   . GLU B 1 143 ? 19.897  7.198   -1.747  1.00 43.34  ? 123 GLU B N   1 
ATOM   3117  C CA  . GLU B 1 143 ? 19.908  8.428   -0.954  1.00 46.06  ? 123 GLU B CA  1 
ATOM   3118  C C   . GLU B 1 143 ? 21.161  8.551   -0.118  1.00 48.10  ? 123 GLU B C   1 
ATOM   3119  O O   . GLU B 1 143 ? 21.801  9.603   -0.086  1.00 54.24  ? 123 GLU B O   1 
ATOM   3120  C CB  . GLU B 1 143 ? 18.726  8.472   0.006   1.00 46.26  ? 123 GLU B CB  1 
ATOM   3121  C CG  . GLU B 1 143 ? 18.024  9.810   -0.029  1.00 47.65  ? 123 GLU B CG  1 
ATOM   3122  C CD  . GLU B 1 143 ? 16.976  9.961   1.039   1.00 47.28  ? 123 GLU B CD  1 
ATOM   3123  O OE1 . GLU B 1 143 ? 15.882  9.347   0.963   1.00 44.03  ? 123 GLU B OE1 1 
ATOM   3124  O OE2 . GLU B 1 143 ? 17.268  10.724  1.970   1.00 51.88  ? 123 GLU B OE2 1 
ATOM   3125  N N   . VAL B 1 144 ? 21.482  7.470   0.582   1.00 47.19  ? 124 VAL B N   1 
ATOM   3126  C CA  . VAL B 1 144 ? 22.685  7.402   1.390   1.00 45.67  ? 124 VAL B CA  1 
ATOM   3127  C C   . VAL B 1 144 ? 23.929  7.605   0.532   1.00 43.53  ? 124 VAL B C   1 
ATOM   3128  O O   . VAL B 1 144 ? 24.860  8.311   0.930   1.00 46.10  ? 124 VAL B O   1 
ATOM   3129  C CB  . VAL B 1 144 ? 22.750  6.070   2.143   1.00 44.47  ? 124 VAL B CB  1 
ATOM   3130  C CG1 . VAL B 1 144 ? 24.122  5.858   2.748   1.00 45.60  ? 124 VAL B CG1 1 
ATOM   3131  C CG2 . VAL B 1 144 ? 21.699  6.057   3.229   1.00 43.20  ? 124 VAL B CG2 1 
ATOM   3132  N N   . ALA B 1 145 ? 23.927  7.025   -0.657  1.00 40.32  ? 125 ALA B N   1 
ATOM   3133  C CA  . ALA B 1 145 ? 25.053  7.190   -1.561  1.00 41.77  ? 125 ALA B CA  1 
ATOM   3134  C C   . ALA B 1 145 ? 25.231  8.654   -1.984  1.00 44.52  ? 125 ALA B C   1 
ATOM   3135  O O   . ALA B 1 145 ? 26.323  9.079   -2.340  1.00 47.00  ? 125 ALA B O   1 
ATOM   3136  C CB  . ALA B 1 145 ? 24.871  6.307   -2.785  1.00 38.78  ? 125 ALA B CB  1 
ATOM   3137  N N   . SER B 1 146 ? 24.149  9.417   -1.946  1.00 48.22  ? 126 SER B N   1 
ATOM   3138  C CA  . SER B 1 146 ? 24.171  10.814  -2.369  1.00 47.73  ? 126 SER B CA  1 
ATOM   3139  C C   . SER B 1 146 ? 24.805  11.726  -1.329  1.00 47.19  ? 126 SER B C   1 
ATOM   3140  O O   . SER B 1 146 ? 25.110  12.868  -1.608  1.00 44.10  ? 126 SER B O   1 
ATOM   3141  C CB  . SER B 1 146 ? 22.757  11.290  -2.661  1.00 45.44  ? 126 SER B CB  1 
ATOM   3142  O OG  . SER B 1 146 ? 22.475  11.001  -4.011  1.00 46.04  ? 126 SER B OG  1 
ATOM   3143  N N   . ALA B 1 147 ? 24.990  11.214  -0.124  1.00 46.59  ? 127 ALA B N   1 
ATOM   3144  C CA  . ALA B 1 147 ? 25.695  11.954  0.895   1.00 47.70  ? 127 ALA B CA  1 
ATOM   3145  C C   . ALA B 1 147 ? 27.209  11.726  0.783   1.00 48.66  ? 127 ALA B C   1 
ATOM   3146  O O   . ALA B 1 147 ? 27.946  12.113  1.689   1.00 50.06  ? 127 ALA B O   1 
ATOM   3147  C CB  . ALA B 1 147 ? 25.196  11.524  2.260   1.00 46.72  ? 127 ALA B CB  1 
ATOM   3148  N N   . THR B 1 148 ? 27.654  11.083  -0.306  1.00 45.51  ? 128 THR B N   1 
ATOM   3149  C CA  . THR B 1 148 ? 29.065  10.773  -0.513  1.00 43.46  ? 128 THR B CA  1 
ATOM   3150  C C   . THR B 1 148 ? 29.468  11.215  -1.884  1.00 45.68  ? 128 THR B C   1 
ATOM   3151  O O   . THR B 1 148 ? 28.634  11.532  -2.726  1.00 48.05  ? 128 THR B O   1 
ATOM   3152  C CB  . THR B 1 148 ? 29.405  9.247   -0.429  1.00 42.51  ? 128 THR B CB  1 
ATOM   3153  O OG1 . THR B 1 148 ? 29.092  8.568   -1.667  1.00 38.63  ? 128 THR B OG1 1 
ATOM   3154  C CG2 . THR B 1 148 ? 28.692  8.586   0.706   1.00 40.49  ? 128 THR B CG2 1 
ATOM   3155  N N   . LYS B 1 149 ? 30.765  11.184  -2.122  1.00 49.56  ? 129 LYS B N   1 
ATOM   3156  C CA  . LYS B 1 149 ? 31.306  11.567  -3.408  1.00 54.68  ? 129 LYS B CA  1 
ATOM   3157  C C   . LYS B 1 149 ? 31.800  10.328  -4.122  1.00 51.95  ? 129 LYS B C   1 
ATOM   3158  O O   . LYS B 1 149 ? 32.609  10.415  -5.032  1.00 47.99  ? 129 LYS B O   1 
ATOM   3159  C CB  . LYS B 1 149 ? 32.428  12.608  -3.234  1.00 60.04  ? 129 LYS B CB  1 
ATOM   3160  C CG  . LYS B 1 149 ? 32.048  13.807  -2.365  1.00 67.46  ? 129 LYS B CG  1 
ATOM   3161  C CD  . LYS B 1 149 ? 30.835  14.575  -2.911  1.00 79.36  ? 129 LYS B CD  1 
ATOM   3162  C CE  . LYS B 1 149 ? 29.730  14.812  -1.864  1.00 85.52  ? 129 LYS B CE  1 
ATOM   3163  N NZ  . LYS B 1 149 ? 28.341  14.851  -2.434  1.00 83.97  ? 129 LYS B NZ  1 
ATOM   3164  N N   . ARG B 1 150 ? 31.312  9.168   -3.697  1.00 54.04  ? 130 ARG B N   1 
ATOM   3165  C CA  . ARG B 1 150 ? 31.614  7.918   -4.387  1.00 54.72  ? 130 ARG B CA  1 
ATOM   3166  C C   . ARG B 1 150 ? 30.377  7.010   -4.422  1.00 54.92  ? 130 ARG B C   1 
ATOM   3167  O O   . ARG B 1 150 ? 30.399  5.878   -3.934  1.00 52.08  ? 130 ARG B O   1 
ATOM   3168  C CB  . ARG B 1 150 ? 32.754  7.216   -3.681  1.00 53.28  ? 130 ARG B CB  1 
ATOM   3169  C CG  . ARG B 1 150 ? 32.443  6.965   -2.218  1.00 53.50  ? 130 ARG B CG  1 
ATOM   3170  C CD  . ARG B 1 150 ? 33.405  5.968   -1.634  1.00 54.13  ? 130 ARG B CD  1 
ATOM   3171  N NE  . ARG B 1 150 ? 34.379  6.651   -0.796  1.00 56.25  ? 130 ARG B NE  1 
ATOM   3172  C CZ  . ARG B 1 150 ? 35.678  6.382   -0.763  1.00 56.48  ? 130 ARG B CZ  1 
ATOM   3173  N NH1 . ARG B 1 150 ? 36.206  5.444   -1.533  1.00 57.37  ? 130 ARG B NH1 1 
ATOM   3174  N NH2 . ARG B 1 150 ? 36.460  7.079   0.038   1.00 56.41  ? 130 ARG B NH2 1 
ATOM   3175  N N   . PRO B 1 151 ? 29.287  7.505   -5.014  1.00 54.06  ? 131 PRO B N   1 
ATOM   3176  C CA  . PRO B 1 151 ? 28.067  6.718   -5.042  1.00 52.55  ? 131 PRO B CA  1 
ATOM   3177  C C   . PRO B 1 151 ? 28.197  5.427   -5.861  1.00 48.90  ? 131 PRO B C   1 
ATOM   3178  O O   . PRO B 1 151 ? 27.444  4.484   -5.617  1.00 48.43  ? 131 PRO B O   1 
ATOM   3179  C CB  . PRO B 1 151 ? 27.044  7.681   -5.661  1.00 52.18  ? 131 PRO B CB  1 
ATOM   3180  C CG  . PRO B 1 151 ? 27.860  8.602   -6.497  1.00 53.21  ? 131 PRO B CG  1 
ATOM   3181  C CD  . PRO B 1 151 ? 29.141  8.780   -5.739  1.00 55.29  ? 131 PRO B CD  1 
ATOM   3182  N N   . ASP B 1 152 ? 29.139  5.377   -6.803  1.00 45.11  ? 132 ASP B N   1 
ATOM   3183  C CA  . ASP B 1 152 ? 29.451  4.125   -7.517  1.00 44.37  ? 132 ASP B CA  1 
ATOM   3184  C C   . ASP B 1 152 ? 30.049  3.040   -6.630  1.00 41.36  ? 132 ASP B C   1 
ATOM   3185  O O   . ASP B 1 152 ? 30.177  1.890   -7.048  1.00 42.05  ? 132 ASP B O   1 
ATOM   3186  C CB  . ASP B 1 152 ? 30.427  4.377   -8.648  1.00 46.95  ? 132 ASP B CB  1 
ATOM   3187  C CG  . ASP B 1 152 ? 31.764  4.904   -8.149  1.00 51.23  ? 132 ASP B CG  1 
ATOM   3188  O OD1 . ASP B 1 152 ? 31.768  5.894   -7.383  1.00 55.64  ? 132 ASP B OD1 1 
ATOM   3189  O OD2 . ASP B 1 152 ? 32.809  4.321   -8.512  1.00 54.16  ? 132 ASP B OD2 1 
ATOM   3190  N N   . LYS B 1 153 ? 30.416  3.409   -5.412  1.00 42.37  ? 133 LYS B N   1 
ATOM   3191  C CA  . LYS B 1 153 ? 31.003  2.480   -4.467  1.00 43.42  ? 133 LYS B CA  1 
ATOM   3192  C C   . LYS B 1 153 ? 30.172  2.313   -3.248  1.00 39.69  ? 133 LYS B C   1 
ATOM   3193  O O   . LYS B 1 153 ? 30.665  1.870   -2.217  1.00 41.89  ? 133 LYS B O   1 
ATOM   3194  C CB  . LYS B 1 153 ? 32.358  3.002   -4.047  1.00 46.32  ? 133 LYS B CB  1 
ATOM   3195  C CG  . LYS B 1 153 ? 33.389  2.743   -5.111  1.00 48.58  ? 133 LYS B CG  1 
ATOM   3196  C CD  . LYS B 1 153 ? 34.736  3.149   -4.591  1.00 51.56  ? 133 LYS B CD  1 
ATOM   3197  C CE  . LYS B 1 153 ? 35.790  2.200   -5.096  1.00 53.70  ? 133 LYS B CE  1 
ATOM   3198  N NZ  . LYS B 1 153 ? 35.989  2.415   -6.544  1.00 56.39  ? 133 LYS B NZ  1 
ATOM   3199  N N   . VAL B 1 154 ? 28.914  2.689   -3.344  1.00 37.10  ? 134 VAL B N   1 
ATOM   3200  C CA  . VAL B 1 154 ? 28.049  2.542   -2.220  1.00 37.38  ? 134 VAL B CA  1 
ATOM   3201  C C   . VAL B 1 154 ? 27.095  1.430   -2.595  1.00 37.79  ? 134 VAL B C   1 
ATOM   3202  O O   . VAL B 1 154 ? 26.709  1.280   -3.757  1.00 36.82  ? 134 VAL B O   1 
ATOM   3203  C CB  . VAL B 1 154 ? 27.333  3.853   -1.879  1.00 38.79  ? 134 VAL B CB  1 
ATOM   3204  C CG1 . VAL B 1 154 ? 26.299  3.637   -0.777  1.00 39.45  ? 134 VAL B CG1 1 
ATOM   3205  C CG2 . VAL B 1 154 ? 28.334  4.888   -1.397  1.00 40.92  ? 134 VAL B CG2 1 
ATOM   3206  N N   . ILE B 1 155 ? 26.729  0.627   -1.615  1.00 38.29  ? 135 ILE B N   1 
ATOM   3207  C CA  . ILE B 1 155 ? 25.935  -0.535  -1.916  1.00 39.39  ? 135 ILE B CA  1 
ATOM   3208  C C   . ILE B 1 155 ? 25.306  -1.070  -0.669  1.00 38.40  ? 135 ILE B C   1 
ATOM   3209  O O   . ILE B 1 155 ? 25.788  -0.826  0.421   1.00 37.30  ? 135 ILE B O   1 
ATOM   3210  C CB  . ILE B 1 155 ? 26.814  -1.635  -2.529  1.00 40.30  ? 135 ILE B CB  1 
ATOM   3211  C CG1 . ILE B 1 155 ? 25.953  -2.656  -3.234  1.00 40.00  ? 135 ILE B CG1 1 
ATOM   3212  C CG2 . ILE B 1 155 ? 27.641  -2.330  -1.463  1.00 40.91  ? 135 ILE B CG2 1 
ATOM   3213  C CD1 . ILE B 1 155 ? 26.766  -3.547  -4.121  1.00 40.73  ? 135 ILE B CD1 1 
ATOM   3214  N N   . GLY B 1 156 ? 24.227  -1.812  -0.841  1.00 38.20  ? 136 GLY B N   1 
ATOM   3215  C CA  . GLY B 1 156 ? 23.593  -2.485  0.268   1.00 39.20  ? 136 GLY B CA  1 
ATOM   3216  C C   . GLY B 1 156 ? 24.066  -3.916  0.376   1.00 40.62  ? 136 GLY B C   1 
ATOM   3217  O O   . GLY B 1 156 ? 24.311  -4.574  -0.628  1.00 40.78  ? 136 GLY B O   1 
ATOM   3218  N N   . MET B 1 157 ? 24.211  -4.390  1.600   1.00 41.92  ? 137 MET B N   1 
ATOM   3219  C CA  . MET B 1 157 ? 24.562  -5.770  1.842   1.00 40.79  ? 137 MET B CA  1 
ATOM   3220  C C   . MET B 1 157 ? 23.705  -6.237  2.949   1.00 40.51  ? 137 MET B C   1 
ATOM   3221  O O   . MET B 1 157 ? 24.007  -6.009  4.115   1.00 39.92  ? 137 MET B O   1 
ATOM   3222  C CB  . MET B 1 157 ? 25.994  -5.902  2.271   1.00 45.31  ? 137 MET B CB  1 
ATOM   3223  C CG  . MET B 1 157 ? 26.873  -6.435  1.180   1.00 49.64  ? 137 MET B CG  1 
ATOM   3224  S SD  . MET B 1 157 ? 28.586  -6.450  1.726   1.00 53.51  ? 137 MET B SD  1 
ATOM   3225  C CE  . MET B 1 157 ? 28.889  -8.212  1.809   1.00 53.61  ? 137 MET B CE  1 
ATOM   3226  N N   . HIS B 1 158 ? 22.623  -6.899  2.582   1.00 42.57  ? 138 HIS B N   1 
ATOM   3227  C CA  . HIS B 1 158 ? 21.625  -7.231  3.550   1.00 40.08  ? 138 HIS B CA  1 
ATOM   3228  C C   . HIS B 1 158 ? 21.792  -8.640  4.051   1.00 42.08  ? 138 HIS B C   1 
ATOM   3229  O O   . HIS B 1 158 ? 21.555  -9.609  3.324   1.00 40.24  ? 138 HIS B O   1 
ATOM   3230  C CB  . HIS B 1 158 ? 20.264  -7.061  2.933   1.00 39.17  ? 138 HIS B CB  1 
ATOM   3231  C CG  . HIS B 1 158 ? 19.178  -7.042  3.942   1.00 38.72  ? 138 HIS B CG  1 
ATOM   3232  N ND1 . HIS B 1 158 ? 17.988  -7.720  3.778   1.00 37.64  ? 138 HIS B ND1 1 
ATOM   3233  C CD2 . HIS B 1 158 ? 19.116  -6.442  5.152   1.00 40.60  ? 138 HIS B CD2 1 
ATOM   3234  C CE1 . HIS B 1 158 ? 17.235  -7.527  4.849   1.00 39.62  ? 138 HIS B CE1 1 
ATOM   3235  N NE2 . HIS B 1 158 ? 17.892  -6.747  5.692   1.00 41.26  ? 138 HIS B NE2 1 
ATOM   3236  N N   . PHE B 1 159 ? 22.186  -8.731  5.311   1.00 45.15  ? 139 PHE B N   1 
ATOM   3237  C CA  . PHE B 1 159 ? 22.421  -9.998  5.975   1.00 44.93  ? 139 PHE B CA  1 
ATOM   3238  C C   . PHE B 1 159 ? 21.170  -10.406 6.712   1.00 47.35  ? 139 PHE B C   1 
ATOM   3239  O O   . PHE B 1 159 ? 20.294  -9.583  6.947   1.00 52.28  ? 139 PHE B O   1 
ATOM   3240  C CB  . PHE B 1 159 ? 23.546  -9.839  6.967   1.00 43.58  ? 139 PHE B CB  1 
ATOM   3241  C CG  . PHE B 1 159 ? 24.886  -9.771  6.334   1.00 44.35  ? 139 PHE B CG  1 
ATOM   3242  C CD1 . PHE B 1 159 ? 25.383  -8.583  5.844   1.00 44.41  ? 139 PHE B CD1 1 
ATOM   3243  C CD2 . PHE B 1 159 ? 25.659  -10.900 6.237   1.00 45.58  ? 139 PHE B CD2 1 
ATOM   3244  C CE1 . PHE B 1 159 ? 26.635  -8.530  5.262   1.00 44.19  ? 139 PHE B CE1 1 
ATOM   3245  C CE2 . PHE B 1 159 ? 26.906  -10.859 5.651   1.00 45.39  ? 139 PHE B CE2 1 
ATOM   3246  C CZ  . PHE B 1 159 ? 27.395  -9.672  5.161   1.00 44.43  ? 139 PHE B CZ  1 
ATOM   3247  N N   . PHE B 1 160 ? 21.101  -11.682 7.071   1.00 48.86  ? 140 PHE B N   1 
ATOM   3248  C CA  . PHE B 1 160 ? 19.956  -12.236 7.775   1.00 46.29  ? 140 PHE B CA  1 
ATOM   3249  C C   . PHE B 1 160 ? 20.396  -12.844 9.065   1.00 49.20  ? 140 PHE B C   1 
ATOM   3250  O O   . PHE B 1 160 ? 21.376  -13.567 9.113   1.00 49.07  ? 140 PHE B O   1 
ATOM   3251  C CB  . PHE B 1 160 ? 19.287  -13.297 6.933   1.00 46.26  ? 140 PHE B CB  1 
ATOM   3252  C CG  . PHE B 1 160 ? 18.640  -12.738 5.748   1.00 46.78  ? 140 PHE B CG  1 
ATOM   3253  C CD1 . PHE B 1 160 ? 17.276  -12.545 5.723   1.00 46.98  ? 140 PHE B CD1 1 
ATOM   3254  C CD2 . PHE B 1 160 ? 19.408  -12.310 4.684   1.00 45.55  ? 140 PHE B CD2 1 
ATOM   3255  C CE1 . PHE B 1 160 ? 16.673  -11.963 4.623   1.00 48.99  ? 140 PHE B CE1 1 
ATOM   3256  C CE2 . PHE B 1 160 ? 18.814  -11.731 3.587   1.00 48.41  ? 140 PHE B CE2 1 
ATOM   3257  C CZ  . PHE B 1 160 ? 17.442  -11.551 3.553   1.00 46.15  ? 140 PHE B CZ  1 
ATOM   3258  N N   . ASN B 1 161 ? 19.638  -12.554 10.108  1.00 53.60  ? 141 ASN B N   1 
ATOM   3259  C CA  . ASN B 1 161 ? 19.969  -12.967 11.452  1.00 57.27  ? 141 ASN B CA  1 
ATOM   3260  C C   . ASN B 1 161 ? 19.617  -14.429 11.630  1.00 55.94  ? 141 ASN B C   1 
ATOM   3261  O O   . ASN B 1 161 ? 18.498  -14.797 11.332  1.00 57.25  ? 141 ASN B O   1 
ATOM   3262  C CB  . ASN B 1 161 ? 19.137  -12.144 12.421  1.00 61.29  ? 141 ASN B CB  1 
ATOM   3263  C CG  . ASN B 1 161 ? 19.619  -12.268 13.841  1.00 64.43  ? 141 ASN B CG  1 
ATOM   3264  O OD1 . ASN B 1 161 ? 20.763  -11.954 14.146  1.00 70.38  ? 141 ASN B OD1 1 
ATOM   3265  N ND2 . ASN B 1 161 ? 18.747  -12.720 14.720  1.00 62.13  ? 141 ASN B ND2 1 
ATOM   3266  N N   . PRO B 1 162 ? 20.530  -15.270 12.124  1.00 59.78  ? 142 PRO B N   1 
ATOM   3267  C CA  . PRO B 1 162 ? 21.873  -14.898 12.601  1.00 57.52  ? 142 PRO B CA  1 
ATOM   3268  C C   . PRO B 1 162 ? 22.907  -14.852 11.486  1.00 56.59  ? 142 PRO B C   1 
ATOM   3269  O O   . PRO B 1 162 ? 23.030  -15.795 10.697  1.00 55.74  ? 142 PRO B O   1 
ATOM   3270  C CB  . PRO B 1 162 ? 22.231  -16.034 13.564  1.00 58.59  ? 142 PRO B CB  1 
ATOM   3271  C CG  . PRO B 1 162 ? 20.946  -16.696 13.899  1.00 59.17  ? 142 PRO B CG  1 
ATOM   3272  C CD  . PRO B 1 162 ? 20.078  -16.548 12.697  1.00 60.61  ? 142 PRO B CD  1 
ATOM   3273  N N   . ALA B 1 163 ? 23.667  -13.771 11.456  1.00 53.22  ? 143 ALA B N   1 
ATOM   3274  C CA  . ALA B 1 163 ? 24.545  -13.495 10.341  1.00 55.49  ? 143 ALA B CA  1 
ATOM   3275  C C   . ALA B 1 163 ? 25.588  -14.581 10.073  1.00 55.93  ? 143 ALA B C   1 
ATOM   3276  O O   . ALA B 1 163 ? 25.888  -14.857 8.915   1.00 58.35  ? 143 ALA B O   1 
ATOM   3277  C CB  . ALA B 1 163 ? 25.232  -12.162 10.550  1.00 56.34  ? 143 ALA B CB  1 
ATOM   3278  N N   . PRO B 1 164 ? 26.157  -15.189 11.133  1.00 54.33  ? 144 PRO B N   1 
ATOM   3279  C CA  . PRO B 1 164 ? 27.220  -16.190 10.951  1.00 54.20  ? 144 PRO B CA  1 
ATOM   3280  C C   . PRO B 1 164 ? 26.727  -17.512 10.385  1.00 53.00  ? 144 PRO B C   1 
ATOM   3281  O O   . PRO B 1 164 ? 27.500  -18.276 9.819   1.00 52.58  ? 144 PRO B O   1 
ATOM   3282  C CB  . PRO B 1 164 ? 27.746  -16.405 12.376  1.00 53.86  ? 144 PRO B CB  1 
ATOM   3283  C CG  . PRO B 1 164 ? 27.256  -15.231 13.155  1.00 54.56  ? 144 PRO B CG  1 
ATOM   3284  C CD  . PRO B 1 164 ? 25.924  -14.929 12.562  1.00 54.66  ? 144 PRO B CD  1 
ATOM   3285  N N   . VAL B 1 165 ? 25.439  -17.760 10.536  1.00 52.49  ? 145 VAL B N   1 
ATOM   3286  C CA  . VAL B 1 165 ? 24.823  -18.979 10.058  1.00 51.85  ? 145 VAL B CA  1 
ATOM   3287  C C   . VAL B 1 165 ? 24.112  -18.768 8.733   1.00 50.77  ? 145 VAL B C   1 
ATOM   3288  O O   . VAL B 1 165 ? 24.315  -19.509 7.784   1.00 51.60  ? 145 VAL B O   1 
ATOM   3289  C CB  . VAL B 1 165 ? 23.788  -19.462 11.079  1.00 53.51  ? 145 VAL B CB  1 
ATOM   3290  C CG1 . VAL B 1 165 ? 22.944  -20.585 10.501  1.00 55.03  ? 145 VAL B CG1 1 
ATOM   3291  C CG2 . VAL B 1 165 ? 24.482  -19.914 12.347  1.00 51.98  ? 145 VAL B CG2 1 
ATOM   3292  N N   . MET B 1 166 ? 23.244  -17.772 8.676   1.00 52.43  ? 146 MET B N   1 
ATOM   3293  C CA  . MET B 1 166 ? 22.403  -17.588 7.497   1.00 50.21  ? 146 MET B CA  1 
ATOM   3294  C C   . MET B 1 166 ? 23.233  -17.254 6.281   1.00 45.99  ? 146 MET B C   1 
ATOM   3295  O O   . MET B 1 166 ? 24.079  -16.378 6.316   1.00 46.99  ? 146 MET B O   1 
ATOM   3296  C CB  . MET B 1 166 ? 21.401  -16.481 7.733   1.00 52.55  ? 146 MET B CB  1 
ATOM   3297  C CG  . MET B 1 166 ? 20.428  -16.802 8.846   1.00 56.52  ? 146 MET B CG  1 
ATOM   3298  S SD  . MET B 1 166 ? 19.081  -17.804 8.208   1.00 60.27  ? 146 MET B SD  1 
ATOM   3299  C CE  . MET B 1 166 ? 18.477  -18.506 9.735   1.00 65.50  ? 146 MET B CE  1 
ATOM   3300  N N   . LYS B 1 167 ? 22.948  -17.945 5.195   1.00 46.17  ? 147 LYS B N   1 
ATOM   3301  C CA  . LYS B 1 167 ? 23.789  -17.926 4.018   1.00 48.26  ? 147 LYS B CA  1 
ATOM   3302  C C   . LYS B 1 167 ? 23.408  -16.894 2.986   1.00 47.06  ? 147 LYS B C   1 
ATOM   3303  O O   . LYS B 1 167 ? 24.230  -16.529 2.135   1.00 46.38  ? 147 LYS B O   1 
ATOM   3304  C CB  . LYS B 1 167 ? 23.728  -19.281 3.344   1.00 55.22  ? 147 LYS B CB  1 
ATOM   3305  C CG  . LYS B 1 167 ? 24.431  -20.364 4.119   1.00 61.49  ? 147 LYS B CG  1 
ATOM   3306  C CD  . LYS B 1 167 ? 24.773  -21.509 3.194   1.00 66.90  ? 147 LYS B CD  1 
ATOM   3307  C CE  . LYS B 1 167 ? 25.863  -22.363 3.811   1.00 72.40  ? 147 LYS B CE  1 
ATOM   3308  N NZ  . LYS B 1 167 ? 25.878  -23.707 3.179   1.00 76.57  ? 147 LYS B NZ  1 
ATOM   3309  N N   . LEU B 1 168 ? 22.153  -16.461 3.011   1.00 44.64  ? 148 LEU B N   1 
ATOM   3310  C CA  . LEU B 1 168 ? 21.708  -15.475 2.057   1.00 43.38  ? 148 LEU B CA  1 
ATOM   3311  C C   . LEU B 1 168 ? 22.226  -14.083 2.391   1.00 44.63  ? 148 LEU B C   1 
ATOM   3312  O O   . LEU B 1 168 ? 22.231  -13.646 3.547   1.00 44.43  ? 148 LEU B O   1 
ATOM   3313  C CB  . LEU B 1 168 ? 20.205  -15.451 1.980   1.00 42.99  ? 148 LEU B CB  1 
ATOM   3314  C CG  . LEU B 1 168 ? 19.588  -14.391 1.073   1.00 41.64  ? 148 LEU B CG  1 
ATOM   3315  C CD1 . LEU B 1 168 ? 19.826  -14.708 -0.390  1.00 40.43  ? 148 LEU B CD1 1 
ATOM   3316  C CD2 . LEU B 1 168 ? 18.100  -14.335 1.363   1.00 41.95  ? 148 LEU B CD2 1 
ATOM   3317  N N   . VAL B 1 169 ? 22.683  -13.414 1.341   1.00 44.45  ? 149 VAL B N   1 
ATOM   3318  C CA  . VAL B 1 169 ? 22.986  -12.013 1.380   1.00 43.79  ? 149 VAL B CA  1 
ATOM   3319  C C   . VAL B 1 169 ? 22.250  -11.374 0.223   1.00 40.93  ? 149 VAL B C   1 
ATOM   3320  O O   . VAL B 1 169 ? 22.386  -11.789 -0.920  1.00 38.56  ? 149 VAL B O   1 
ATOM   3321  C CB  . VAL B 1 169 ? 24.491  -11.753 1.283   1.00 45.13  ? 149 VAL B CB  1 
ATOM   3322  C CG1 . VAL B 1 169 ? 24.765  -10.276 1.068   1.00 47.08  ? 149 VAL B CG1 1 
ATOM   3323  C CG2 . VAL B 1 169 ? 25.150  -12.164 2.578   1.00 47.16  ? 149 VAL B CG2 1 
ATOM   3324  N N   . GLU B 1 170 ? 21.454  -10.365 0.537   1.00 41.44  ? 150 GLU B N   1 
ATOM   3325  C CA  . GLU B 1 170 ? 20.721  -9.640  -0.481  1.00 42.55  ? 150 GLU B CA  1 
ATOM   3326  C C   . GLU B 1 170 ? 21.552  -8.405  -0.858  1.00 42.17  ? 150 GLU B C   1 
ATOM   3327  O O   . GLU B 1 170 ? 21.475  -7.352  -0.207  1.00 43.77  ? 150 GLU B O   1 
ATOM   3328  C CB  . GLU B 1 170 ? 19.327  -9.252  0.025   1.00 42.52  ? 150 GLU B CB  1 
ATOM   3329  C CG  . GLU B 1 170 ? 18.218  -10.202 -0.376  1.00 44.60  ? 150 GLU B CG  1 
ATOM   3330  C CD  . GLU B 1 170 ? 16.855  -9.687  0.081   1.00 44.51  ? 150 GLU B CD  1 
ATOM   3331  O OE1 . GLU B 1 170 ? 16.777  -8.981  1.116   1.00 42.67  ? 150 GLU B OE1 1 
ATOM   3332  O OE2 . GLU B 1 170 ? 15.854  -9.995  -0.591  1.00 42.15  ? 150 GLU B OE2 1 
ATOM   3333  N N   . VAL B 1 171 ? 22.352  -8.538  -1.906  1.00 39.33  ? 151 VAL B N   1 
ATOM   3334  C CA  . VAL B 1 171 ? 23.151  -7.416  -2.387  1.00 38.69  ? 151 VAL B CA  1 
ATOM   3335  C C   . VAL B 1 171 ? 22.275  -6.373  -3.072  1.00 38.00  ? 151 VAL B C   1 
ATOM   3336  O O   . VAL B 1 171 ? 21.798  -6.594  -4.186  1.00 36.83  ? 151 VAL B O   1 
ATOM   3337  C CB  . VAL B 1 171 ? 24.203  -7.881  -3.405  1.00 40.16  ? 151 VAL B CB  1 
ATOM   3338  C CG1 . VAL B 1 171 ? 25.083  -6.726  -3.823  1.00 39.26  ? 151 VAL B CG1 1 
ATOM   3339  C CG2 . VAL B 1 171 ? 25.052  -9.001  -2.829  1.00 40.52  ? 151 VAL B CG2 1 
ATOM   3340  N N   . ILE B 1 172 ? 22.082  -5.238  -2.407  1.00 37.28  ? 152 ILE B N   1 
ATOM   3341  C CA  . ILE B 1 172 ? 21.191  -4.174  -2.892  1.00 37.48  ? 152 ILE B CA  1 
ATOM   3342  C C   . ILE B 1 172 ? 21.981  -3.147  -3.689  1.00 38.21  ? 152 ILE B C   1 
ATOM   3343  O O   . ILE B 1 172 ? 22.736  -2.364  -3.131  1.00 37.47  ? 152 ILE B O   1 
ATOM   3344  C CB  . ILE B 1 172 ? 20.470  -3.447  -1.741  1.00 37.83  ? 152 ILE B CB  1 
ATOM   3345  C CG1 . ILE B 1 172 ? 19.953  -4.451  -0.687  1.00 37.42  ? 152 ILE B CG1 1 
ATOM   3346  C CG2 . ILE B 1 172 ? 19.331  -2.610  -2.285  1.00 37.36  ? 152 ILE B CG2 1 
ATOM   3347  C CD1 . ILE B 1 172 ? 19.157  -5.600  -1.271  1.00 36.13  ? 152 ILE B CD1 1 
ATOM   3348  N N   . ARG B 1 173 ? 21.803  -3.168  -5.005  1.00 37.69  ? 153 ARG B N   1 
ATOM   3349  C CA  . ARG B 1 173 ? 22.502  -2.256  -5.895  1.00 36.80  ? 153 ARG B CA  1 
ATOM   3350  C C   . ARG B 1 173 ? 21.733  -0.946  -6.011  1.00 40.27  ? 153 ARG B C   1 
ATOM   3351  O O   . ARG B 1 173 ? 20.522  -0.920  -6.219  1.00 39.24  ? 153 ARG B O   1 
ATOM   3352  C CB  . ARG B 1 173 ? 22.712  -2.870  -7.277  1.00 36.16  ? 153 ARG B CB  1 
ATOM   3353  C CG  . ARG B 1 173 ? 23.863  -3.852  -7.329  1.00 38.44  ? 153 ARG B CG  1 
ATOM   3354  C CD  . ARG B 1 173 ? 24.105  -4.298  -8.757  1.00 39.48  ? 153 ARG B CD  1 
ATOM   3355  N NE  . ARG B 1 173 ? 24.481  -3.194  -9.616  1.00 40.00  ? 153 ARG B NE  1 
ATOM   3356  C CZ  . ARG B 1 173 ? 24.942  -3.332  -10.854 1.00 41.08  ? 153 ARG B CZ  1 
ATOM   3357  N NH1 . ARG B 1 173 ? 25.058  -4.536  -11.406 1.00 41.36  ? 153 ARG B NH1 1 
ATOM   3358  N NH2 . ARG B 1 173 ? 25.299  -2.263  -11.541 1.00 40.98  ? 153 ARG B NH2 1 
ATOM   3359  N N   . GLY B 1 174 ? 22.449  0.164   -5.853  1.00 41.18  ? 154 GLY B N   1 
ATOM   3360  C CA  . GLY B 1 174 ? 21.857  1.480   -6.024  1.00 35.51  ? 154 GLY B CA  1 
ATOM   3361  C C   . GLY B 1 174 ? 21.796  1.859   -7.487  1.00 35.02  ? 154 GLY B C   1 
ATOM   3362  O O   . GLY B 1 174 ? 22.446  1.238   -8.346  1.00 37.28  ? 154 GLY B O   1 
ATOM   3363  N N   . ILE B 1 175 ? 21.026  2.897   -7.778  1.00 34.72  ? 155 ILE B N   1 
ATOM   3364  C CA  . ILE B 1 175 ? 20.897  3.359   -9.148  1.00 36.00  ? 155 ILE B CA  1 
ATOM   3365  C C   . ILE B 1 175 ? 22.282  3.736   -9.703  1.00 38.43  ? 155 ILE B C   1 
ATOM   3366  O O   . ILE B 1 175 ? 22.498  3.733   -10.915 1.00 42.00  ? 155 ILE B O   1 
ATOM   3367  C CB  . ILE B 1 175 ? 19.920  4.538   -9.243  1.00 37.91  ? 155 ILE B CB  1 
ATOM   3368  C CG1 . ILE B 1 175 ? 19.461  4.733   -10.689 1.00 38.61  ? 155 ILE B CG1 1 
ATOM   3369  C CG2 . ILE B 1 175 ? 20.558  5.816   -8.695  1.00 39.58  ? 155 ILE B CG2 1 
ATOM   3370  C CD1 . ILE B 1 175 ? 18.014  5.209   -10.787 1.00 44.11  ? 155 ILE B CD1 1 
ATOM   3371  N N   . ALA B 1 176 ? 23.212  4.084   -8.809  1.00 39.40  ? 156 ALA B N   1 
ATOM   3372  C CA  . ALA B 1 176 ? 24.548  4.530   -9.208  1.00 40.26  ? 156 ALA B CA  1 
ATOM   3373  C C   . ALA B 1 176 ? 25.654  3.522   -8.897  1.00 41.92  ? 156 ALA B C   1 
ATOM   3374  O O   . ALA B 1 176 ? 26.793  3.711   -9.332  1.00 43.80  ? 156 ALA B O   1 
ATOM   3375  C CB  . ALA B 1 176 ? 24.860  5.842   -8.517  1.00 37.51  ? 156 ALA B CB  1 
ATOM   3376  N N   . THR B 1 177 ? 25.340  2.489   -8.119  1.00 40.64  ? 157 THR B N   1 
ATOM   3377  C CA  . THR B 1 177 ? 26.300  1.451   -7.810  1.00 41.97  ? 157 THR B CA  1 
ATOM   3378  C C   . THR B 1 177 ? 26.813  0.890   -9.112  1.00 42.38  ? 157 THR B C   1 
ATOM   3379  O O   . THR B 1 177 ? 26.025  0.540   -9.982  1.00 46.53  ? 157 THR B O   1 
ATOM   3380  C CB  . THR B 1 177 ? 25.663  0.300   -7.015  1.00 42.63  ? 157 THR B CB  1 
ATOM   3381  O OG1 . THR B 1 177 ? 25.243  0.759   -5.724  1.00 37.05  ? 157 THR B OG1 1 
ATOM   3382  C CG2 . THR B 1 177 ? 26.659  -0.833  -6.848  1.00 43.46  ? 157 THR B CG2 1 
ATOM   3383  N N   . SER B 1 178 ? 28.129  0.797   -9.245  1.00 43.30  ? 158 SER B N   1 
ATOM   3384  C CA  . SER B 1 178 ? 28.740  0.286   -10.477 1.00 42.51  ? 158 SER B CA  1 
ATOM   3385  C C   . SER B 1 178 ? 28.834  -1.235  -10.493 1.00 42.15  ? 158 SER B C   1 
ATOM   3386  O O   . SER B 1 178 ? 28.894  -1.882  -9.440  1.00 39.55  ? 158 SER B O   1 
ATOM   3387  C CB  . SER B 1 178 ? 30.148  0.833   -10.620 1.00 42.81  ? 158 SER B CB  1 
ATOM   3388  O OG  . SER B 1 178 ? 30.939  0.436   -9.506  1.00 42.82  ? 158 SER B OG  1 
ATOM   3389  N N   . GLN B 1 179 ? 28.911  -1.785  -11.696 1.00 42.85  ? 159 GLN B N   1 
ATOM   3390  C CA  . GLN B 1 179 ? 29.071  -3.212  -11.887 1.00 47.13  ? 159 GLN B CA  1 
ATOM   3391  C C   . GLN B 1 179 ? 30.304  -3.728  -11.167 1.00 48.33  ? 159 GLN B C   1 
ATOM   3392  O O   . GLN B 1 179 ? 30.276  -4.757  -10.511 1.00 49.33  ? 159 GLN B O   1 
ATOM   3393  C CB  . GLN B 1 179 ? 29.195  -3.524  -13.371 1.00 49.64  ? 159 GLN B CB  1 
ATOM   3394  C CG  . GLN B 1 179 ? 29.094  -5.004  -13.691 1.00 50.20  ? 159 GLN B CG  1 
ATOM   3395  C CD  . GLN B 1 179 ? 27.774  -5.599  -13.244 1.00 50.42  ? 159 GLN B CD  1 
ATOM   3396  O OE1 . GLN B 1 179 ? 26.714  -5.204  -13.712 1.00 49.35  ? 159 GLN B OE1 1 
ATOM   3397  N NE2 . GLN B 1 179 ? 27.835  -6.548  -12.327 1.00 50.71  ? 159 GLN B NE2 1 
ATOM   3398  N N   . GLU B 1 180 ? 31.387  -2.990  -11.286 1.00 51.82  ? 160 GLU B N   1 
ATOM   3399  C CA  . GLU B 1 180 ? 32.627  -3.350  -10.623 1.00 52.88  ? 160 GLU B CA  1 
ATOM   3400  C C   . GLU B 1 180 ? 32.457  -3.439  -9.093  1.00 48.48  ? 160 GLU B C   1 
ATOM   3401  O O   . GLU B 1 180 ? 33.058  -4.296  -8.440  1.00 47.61  ? 160 GLU B O   1 
ATOM   3402  C CB  . GLU B 1 180 ? 33.708  -2.361  -11.065 1.00 59.76  ? 160 GLU B CB  1 
ATOM   3403  C CG  . GLU B 1 180 ? 34.887  -2.164  -10.129 1.00 69.31  ? 160 GLU B CG  1 
ATOM   3404  C CD  . GLU B 1 180 ? 35.809  -1.032  -10.588 1.00 74.21  ? 160 GLU B CD  1 
ATOM   3405  O OE1 . GLU B 1 180 ? 36.337  -0.305  -9.713  1.00 72.07  ? 160 GLU B OE1 1 
ATOM   3406  O OE2 . GLU B 1 180 ? 35.996  -0.859  -11.820 1.00 75.96  ? 160 GLU B OE2 1 
ATOM   3407  N N   . THR B 1 181 ? 31.616  -2.588  -8.521  1.00 44.80  ? 161 THR B N   1 
ATOM   3408  C CA  . THR B 1 181 ? 31.410  -2.618  -7.078  1.00 43.37  ? 161 THR B CA  1 
ATOM   3409  C C   . THR B 1 181 ? 30.498  -3.772  -6.689  1.00 44.32  ? 161 THR B C   1 
ATOM   3410  O O   . THR B 1 181 ? 30.674  -4.409  -5.643  1.00 41.70  ? 161 THR B O   1 
ATOM   3411  C CB  . THR B 1 181 ? 30.795  -1.305  -6.564  1.00 42.74  ? 161 THR B CB  1 
ATOM   3412  O OG1 . THR B 1 181 ? 31.749  -0.246  -6.695  1.00 44.94  ? 161 THR B OG1 1 
ATOM   3413  C CG2 . THR B 1 181 ? 30.429  -1.427  -5.118  1.00 40.09  ? 161 THR B CG2 1 
ATOM   3414  N N   . PHE B 1 182 ? 29.496  -4.026  -7.508  1.00 42.37  ? 162 PHE B N   1 
ATOM   3415  C CA  . PHE B 1 182 ? 28.664  -5.156  -7.240  1.00 43.76  ? 162 PHE B CA  1 
ATOM   3416  C C   . PHE B 1 182 ? 29.486  -6.452  -7.379  1.00 44.79  ? 162 PHE B C   1 
ATOM   3417  O O   . PHE B 1 182 ? 29.355  -7.372  -6.562  1.00 43.04  ? 162 PHE B O   1 
ATOM   3418  C CB  . PHE B 1 182 ? 27.469  -5.196  -8.177  1.00 42.26  ? 162 PHE B CB  1 
ATOM   3419  C CG  . PHE B 1 182 ? 26.802  -6.524  -8.183  1.00 40.12  ? 162 PHE B CG  1 
ATOM   3420  C CD1 . PHE B 1 182 ? 26.017  -6.903  -7.131  1.00 40.32  ? 162 PHE B CD1 1 
ATOM   3421  C CD2 . PHE B 1 182 ? 27.036  -7.418  -9.197  1.00 41.52  ? 162 PHE B CD2 1 
ATOM   3422  C CE1 . PHE B 1 182 ? 25.434  -8.146  -7.101  1.00 40.65  ? 162 PHE B CE1 1 
ATOM   3423  C CE2 . PHE B 1 182 ? 26.455  -8.665  -9.180  1.00 41.05  ? 162 PHE B CE2 1 
ATOM   3424  C CZ  . PHE B 1 182 ? 25.659  -9.030  -8.127  1.00 39.63  ? 162 PHE B CZ  1 
ATOM   3425  N N   . ASP B 1 183 ? 30.323  -6.521  -8.415  1.00 44.41  ? 163 ASP B N   1 
ATOM   3426  C CA  . ASP B 1 183 ? 31.106  -7.739  -8.695  1.00 45.07  ? 163 ASP B CA  1 
ATOM   3427  C C   . ASP B 1 183 ? 32.011  -8.076  -7.527  1.00 46.22  ? 163 ASP B C   1 
ATOM   3428  O O   . ASP B 1 183 ? 32.149  -9.239  -7.169  1.00 45.08  ? 163 ASP B O   1 
ATOM   3429  C CB  . ASP B 1 183 ? 31.941  -7.611  -9.975  1.00 43.46  ? 163 ASP B CB  1 
ATOM   3430  C CG  . ASP B 1 183 ? 31.111  -7.836  -11.247 1.00 48.30  ? 163 ASP B CG  1 
ATOM   3431  O OD1 . ASP B 1 183 ? 29.962  -8.317  -11.138 1.00 50.06  ? 163 ASP B OD1 1 
ATOM   3432  O OD2 . ASP B 1 183 ? 31.595  -7.523  -12.360 1.00 49.41  ? 163 ASP B OD2 1 
ATOM   3433  N N   . ALA B 1 184 ? 32.583  -7.049  -6.908  1.00 45.30  ? 164 ALA B N   1 
ATOM   3434  C CA  . ALA B 1 184 ? 33.497  -7.266  -5.806  1.00 45.03  ? 164 ALA B CA  1 
ATOM   3435  C C   . ALA B 1 184 ? 32.771  -7.740  -4.563  1.00 44.79  ? 164 ALA B C   1 
ATOM   3436  O O   . ALA B 1 184 ? 33.242  -8.643  -3.893  1.00 46.09  ? 164 ALA B O   1 
ATOM   3437  C CB  . ALA B 1 184 ? 34.287  -6.004  -5.505  1.00 42.68  ? 164 ALA B CB  1 
ATOM   3438  N N   . VAL B 1 185 ? 31.622  -7.143  -4.267  1.00 46.11  ? 165 VAL B N   1 
ATOM   3439  C CA  . VAL B 1 185 ? 30.852  -7.512  -3.078  1.00 42.78  ? 165 VAL B CA  1 
ATOM   3440  C C   . VAL B 1 185 ? 30.286  -8.906  -3.218  1.00 44.98  ? 165 VAL B C   1 
ATOM   3441  O O   . VAL B 1 185 ? 30.080  -9.620  -2.232  1.00 41.26  ? 165 VAL B O   1 
ATOM   3442  C CB  . VAL B 1 185 ? 29.678  -6.554  -2.879  1.00 42.37  ? 165 VAL B CB  1 
ATOM   3443  C CG1 . VAL B 1 185 ? 28.583  -7.177  -2.001  1.00 43.48  ? 165 VAL B CG1 1 
ATOM   3444  C CG2 . VAL B 1 185 ? 30.184  -5.264  -2.262  1.00 43.14  ? 165 VAL B CG2 1 
ATOM   3445  N N   . LYS B 1 186 ? 29.979  -9.260  -4.457  1.00 47.22  ? 166 LYS B N   1 
ATOM   3446  C CA  . LYS B 1 186 ? 29.497  -10.584 -4.768  1.00 49.04  ? 166 LYS B CA  1 
ATOM   3447  C C   . LYS B 1 186 ? 30.561  -11.641 -4.503  1.00 49.24  ? 166 LYS B C   1 
ATOM   3448  O O   . LYS B 1 186 ? 30.272  -12.634 -3.835  1.00 48.66  ? 166 LYS B O   1 
ATOM   3449  C CB  . LYS B 1 186 ? 29.074  -10.661 -6.222  1.00 49.24  ? 166 LYS B CB  1 
ATOM   3450  C CG  . LYS B 1 186 ? 28.352  -11.946 -6.523  1.00 48.50  ? 166 LYS B CG  1 
ATOM   3451  C CD  . LYS B 1 186 ? 28.309  -12.238 -7.998  1.00 50.13  ? 166 LYS B CD  1 
ATOM   3452  C CE  . LYS B 1 186 ? 27.553  -13.540 -8.213  1.00 53.94  ? 166 LYS B CE  1 
ATOM   3453  N NZ  . LYS B 1 186 ? 26.872  -13.596 -9.532  1.00 56.55  ? 166 LYS B NZ  1 
ATOM   3454  N N   . GLU B 1 187 ? 31.774  -11.428 -5.030  1.00 48.80  ? 167 GLU B N   1 
ATOM   3455  C CA  . GLU B 1 187 ? 32.870  -12.402 -4.827  1.00 50.58  ? 167 GLU B CA  1 
ATOM   3456  C C   . GLU B 1 187 ? 33.238  -12.571 -3.366  1.00 48.64  ? 167 GLU B C   1 
ATOM   3457  O O   . GLU B 1 187 ? 33.597  -13.670 -2.961  1.00 50.24  ? 167 GLU B O   1 
ATOM   3458  C CB  . GLU B 1 187 ? 34.176  -12.077 -5.551  1.00 52.32  ? 167 GLU B CB  1 
ATOM   3459  C CG  . GLU B 1 187 ? 34.106  -11.106 -6.700  1.00 59.45  ? 167 GLU B CG  1 
ATOM   3460  C CD  . GLU B 1 187 ? 35.471  -10.571 -7.133  1.00 60.64  ? 167 GLU B CD  1 
ATOM   3461  O OE1 . GLU B 1 187 ? 35.643  -10.359 -8.348  1.00 70.77  ? 167 GLU B OE1 1 
ATOM   3462  O OE2 . GLU B 1 187 ? 36.367  -10.340 -6.285  1.00 51.04  ? 167 GLU B OE2 1 
ATOM   3463  N N   . THR B 1 188 ? 33.181  -11.505 -2.576  1.00 45.06  ? 168 THR B N   1 
ATOM   3464  C CA  . THR B 1 188 ? 33.592  -11.661 -1.187  1.00 45.76  ? 168 THR B CA  1 
ATOM   3465  C C   . THR B 1 188 ? 32.461  -12.231 -0.359  1.00 45.84  ? 168 THR B C   1 
ATOM   3466  O O   . THR B 1 188 ? 32.706  -12.827 0.679   1.00 48.02  ? 168 THR B O   1 
ATOM   3467  C CB  . THR B 1 188 ? 34.278  -10.409 -0.549  1.00 47.64  ? 168 THR B CB  1 
ATOM   3468  O OG1 . THR B 1 188 ? 33.523  -9.883  0.555   1.00 44.98  ? 168 THR B OG1 1 
ATOM   3469  C CG2 . THR B 1 188 ? 34.557  -9.371  -1.555  1.00 48.49  ? 168 THR B CG2 1 
ATOM   3470  N N   . SER B 1 189 ? 31.229  -12.092 -0.832  1.00 47.19  ? 169 SER B N   1 
ATOM   3471  C CA  . SER B 1 189 ? 30.093  -12.740 -0.185  1.00 45.41  ? 169 SER B CA  1 
ATOM   3472  C C   . SER B 1 189 ? 30.210  -14.250 -0.336  1.00 44.51  ? 169 SER B C   1 
ATOM   3473  O O   . SER B 1 189 ? 29.933  -15.015 0.585   1.00 43.96  ? 169 SER B O   1 
ATOM   3474  C CB  . SER B 1 189 ? 28.796  -12.278 -0.821  1.00 44.96  ? 169 SER B CB  1 
ATOM   3475  O OG  . SER B 1 189 ? 28.601  -10.908 -0.581  1.00 41.42  ? 169 SER B OG  1 
ATOM   3476  N N   . ILE B 1 190 ? 30.618  -14.658 -1.523  1.00 43.45  ? 170 ILE B N   1 
ATOM   3477  C CA  . ILE B 1 190 ? 30.879  -16.056 -1.821  1.00 46.80  ? 170 ILE B CA  1 
ATOM   3478  C C   . ILE B 1 190 ? 32.069  -16.570 -1.012  1.00 49.40  ? 170 ILE B C   1 
ATOM   3479  O O   . ILE B 1 190 ? 32.009  -17.631 -0.392  1.00 48.33  ? 170 ILE B O   1 
ATOM   3480  C CB  . ILE B 1 190 ? 31.153  -16.204 -3.319  1.00 45.41  ? 170 ILE B CB  1 
ATOM   3481  C CG1 . ILE B 1 190 ? 29.832  -16.049 -4.061  1.00 45.45  ? 170 ILE B CG1 1 
ATOM   3482  C CG2 . ILE B 1 190 ? 31.763  -17.553 -3.636  1.00 43.14  ? 170 ILE B CG2 1 
ATOM   3483  C CD1 . ILE B 1 190 ? 29.967  -15.914 -5.558  1.00 44.81  ? 170 ILE B CD1 1 
ATOM   3484  N N   . ALA B 1 191 ? 33.127  -15.773 -0.994  1.00 50.61  ? 171 ALA B N   1 
ATOM   3485  C CA  . ALA B 1 191 ? 34.348  -16.094 -0.268  1.00 51.00  ? 171 ALA B CA  1 
ATOM   3486  C C   . ALA B 1 191 ? 34.160  -16.310 1.226   1.00 50.28  ? 171 ALA B C   1 
ATOM   3487  O O   . ALA B 1 191 ? 34.980  -16.970 1.858   1.00 53.18  ? 171 ALA B O   1 
ATOM   3488  C CB  . ALA B 1 191 ? 35.366  -14.999 -0.487  1.00 52.59  ? 171 ALA B CB  1 
ATOM   3489  N N   . ILE B 1 192 ? 33.107  -15.749 1.801   1.00 48.27  ? 172 ILE B N   1 
ATOM   3490  C CA  . ILE B 1 192 ? 32.797  -16.037 3.196   1.00 48.17  ? 172 ILE B CA  1 
ATOM   3491  C C   . ILE B 1 192 ? 31.664  -17.050 3.305   1.00 47.94  ? 172 ILE B C   1 
ATOM   3492  O O   . ILE B 1 192 ? 31.007  -17.184 4.342   1.00 45.75  ? 172 ILE B O   1 
ATOM   3493  C CB  . ILE B 1 192 ? 32.472  -14.765 3.979   1.00 50.45  ? 172 ILE B CB  1 
ATOM   3494  C CG1 . ILE B 1 192 ? 31.231  -14.080 3.443   1.00 52.27  ? 172 ILE B CG1 1 
ATOM   3495  C CG2 . ILE B 1 192 ? 33.646  -13.822 3.899   1.00 51.83  ? 172 ILE B CG2 1 
ATOM   3496  C CD1 . ILE B 1 192 ? 30.711  -13.022 4.384   1.00 53.49  ? 172 ILE B CD1 1 
ATOM   3497  N N   . GLY B 1 193 ? 31.436  -17.762 2.210   1.00 48.04  ? 173 GLY B N   1 
ATOM   3498  C CA  . GLY B 1 193 ? 30.522  -18.889 2.211   1.00 51.11  ? 173 GLY B CA  1 
ATOM   3499  C C   . GLY B 1 193 ? 29.071  -18.482 2.232   1.00 51.49  ? 173 GLY B C   1 
ATOM   3500  O O   . GLY B 1 193 ? 28.218  -19.228 2.715   1.00 52.09  ? 173 GLY B O   1 
ATOM   3501  N N   . LYS B 1 194 ? 28.788  -17.299 1.700   1.00 50.08  ? 174 LYS B N   1 
ATOM   3502  C CA  . LYS B 1 194 ? 27.423  -16.825 1.631   1.00 47.38  ? 174 LYS B CA  1 
ATOM   3503  C C   . LYS B 1 194 ? 26.951  -16.959 0.213   1.00 46.70  ? 174 LYS B C   1 
ATOM   3504  O O   . LYS B 1 194 ? 27.739  -17.201 -0.702  1.00 43.53  ? 174 LYS B O   1 
ATOM   3505  C CB  . LYS B 1 194 ? 27.320  -15.384 2.103   1.00 46.90  ? 174 LYS B CB  1 
ATOM   3506  C CG  . LYS B 1 194 ? 27.829  -15.201 3.518   1.00 45.37  ? 174 LYS B CG  1 
ATOM   3507  C CD  . LYS B 1 194 ? 26.803  -15.605 4.547   1.00 43.97  ? 174 LYS B CD  1 
ATOM   3508  C CE  . LYS B 1 194 ? 27.239  -15.088 5.895   1.00 45.20  ? 174 LYS B CE  1 
ATOM   3509  N NZ  . LYS B 1 194 ? 26.489  -15.718 7.006   1.00 47.87  ? 174 LYS B NZ  1 
ATOM   3510  N N   . ASP B 1 195 ? 25.650  -16.814 0.048   1.00 49.01  ? 175 ASP B N   1 
ATOM   3511  C CA  . ASP B 1 195 ? 25.026  -16.978 -1.240  1.00 50.66  ? 175 ASP B CA  1 
ATOM   3512  C C   . ASP B 1 195 ? 24.339  -15.668 -1.587  1.00 48.27  ? 175 ASP B C   1 
ATOM   3513  O O   . ASP B 1 195 ? 23.263  -15.372 -1.080  1.00 45.57  ? 175 ASP B O   1 
ATOM   3514  C CB  . ASP B 1 195 ? 24.021  -18.119 -1.176  1.00 53.90  ? 175 ASP B CB  1 
ATOM   3515  C CG  . ASP B 1 195 ? 23.971  -18.913 -2.457  1.00 58.01  ? 175 ASP B CG  1 
ATOM   3516  O OD1 . ASP B 1 195 ? 24.348  -18.371 -3.523  1.00 57.16  ? 175 ASP B OD1 1 
ATOM   3517  O OD2 . ASP B 1 195 ? 23.548  -20.085 -2.394  1.00 61.64  ? 175 ASP B OD2 1 
ATOM   3518  N N   . PRO B 1 196 ? 24.985  -14.852 -2.417  1.00 47.74  ? 176 PRO B N   1 
ATOM   3519  C CA  . PRO B 1 196 ? 24.458  -13.521 -2.716  1.00 45.51  ? 176 PRO B CA  1 
ATOM   3520  C C   . PRO B 1 196 ? 23.430  -13.495 -3.838  1.00 44.95  ? 176 PRO B C   1 
ATOM   3521  O O   . PRO B 1 196 ? 23.583  -14.194 -4.841  1.00 45.24  ? 176 PRO B O   1 
ATOM   3522  C CB  . PRO B 1 196 ? 25.705  -12.748 -3.149  1.00 44.78  ? 176 PRO B CB  1 
ATOM   3523  C CG  . PRO B 1 196 ? 26.610  -13.795 -3.707  1.00 47.06  ? 176 PRO B CG  1 
ATOM   3524  C CD  . PRO B 1 196 ? 26.393  -14.994 -2.830  1.00 47.57  ? 176 PRO B CD  1 
ATOM   3525  N N   . VAL B 1 197 ? 22.402  -12.673 -3.672  1.00 44.69  ? 177 VAL B N   1 
ATOM   3526  C CA  . VAL B 1 197 ? 21.496  -12.359 -4.779  1.00 44.01  ? 177 VAL B CA  1 
ATOM   3527  C C   . VAL B 1 197 ? 21.573  -10.886 -5.142  1.00 43.55  ? 177 VAL B C   1 
ATOM   3528  O O   . VAL B 1 197 ? 21.787  -10.017 -4.279  1.00 44.44  ? 177 VAL B O   1 
ATOM   3529  C CB  . VAL B 1 197 ? 20.037  -12.733 -4.471  1.00 44.63  ? 177 VAL B CB  1 
ATOM   3530  C CG1 . VAL B 1 197 ? 19.922  -14.232 -4.320  1.00 46.31  ? 177 VAL B CG1 1 
ATOM   3531  C CG2 . VAL B 1 197 ? 19.510  -12.028 -3.227  1.00 42.51  ? 177 VAL B CG2 1 
ATOM   3532  N N   . GLU B 1 198 ? 21.400  -10.611 -6.426  1.00 41.96  ? 178 GLU B N   1 
ATOM   3533  C CA  . GLU B 1 198 ? 21.530  -9.260  -6.938  1.00 43.92  ? 178 GLU B CA  1 
ATOM   3534  C C   . GLU B 1 198 ? 20.159  -8.608  -6.998  1.00 44.55  ? 178 GLU B C   1 
ATOM   3535  O O   . GLU B 1 198 ? 19.254  -9.093  -7.685  1.00 43.80  ? 178 GLU B O   1 
ATOM   3536  C CB  . GLU B 1 198 ? 22.157  -9.272  -8.315  1.00 44.84  ? 178 GLU B CB  1 
ATOM   3537  C CG  . GLU B 1 198 ? 22.267  -7.904  -8.964  1.00 46.30  ? 178 GLU B CG  1 
ATOM   3538  C CD  . GLU B 1 198 ? 22.887  -7.980  -10.347 1.00 50.08  ? 178 GLU B CD  1 
ATOM   3539  O OE1 . GLU B 1 198 ? 23.160  -9.105  -10.847 1.00 51.88  ? 178 GLU B OE1 1 
ATOM   3540  O OE2 . GLU B 1 198 ? 23.115  -6.905  -10.935 1.00 49.67  ? 178 GLU B OE2 1 
ATOM   3541  N N   . VAL B 1 199 ? 20.037  -7.504  -6.265  1.00 42.01  ? 179 VAL B N   1 
ATOM   3542  C CA  . VAL B 1 199 ? 18.800  -6.769  -6.146  1.00 40.07  ? 179 VAL B CA  1 
ATOM   3543  C C   . VAL B 1 199 ? 18.961  -5.286  -6.489  1.00 39.06  ? 179 VAL B C   1 
ATOM   3544  O O   . VAL B 1 199 ? 19.805  -4.582  -5.952  1.00 39.46  ? 179 VAL B O   1 
ATOM   3545  C CB  . VAL B 1 199 ? 18.247  -6.862  -4.728  1.00 39.01  ? 179 VAL B CB  1 
ATOM   3546  C CG1 . VAL B 1 199 ? 16.859  -6.263  -4.681  1.00 39.78  ? 179 VAL B CG1 1 
ATOM   3547  C CG2 . VAL B 1 199 ? 18.162  -8.306  -4.295  1.00 38.95  ? 179 VAL B CG2 1 
ATOM   3548  N N   . ALA B 1 200 ? 18.116  -4.810  -7.384  1.00 38.79  ? 180 ALA B N   1 
ATOM   3549  C CA  . ALA B 1 200 ? 18.050  -3.389  -7.666  1.00 37.41  ? 180 ALA B CA  1 
ATOM   3550  C C   . ALA B 1 200 ? 17.198  -2.774  -6.572  1.00 38.02  ? 180 ALA B C   1 
ATOM   3551  O O   . ALA B 1 200 ? 16.086  -3.249  -6.321  1.00 40.22  ? 180 ALA B O   1 
ATOM   3552  C CB  . ALA B 1 200 ? 17.410  -3.169  -9.014  1.00 34.60  ? 180 ALA B CB  1 
ATOM   3553  N N   . GLU B 1 201 ? 17.708  -1.742  -5.913  1.00 34.60  ? 181 GLU B N   1 
ATOM   3554  C CA  . GLU B 1 201 ? 16.982  -1.116  -4.808  1.00 35.29  ? 181 GLU B CA  1 
ATOM   3555  C C   . GLU B 1 201 ? 15.524  -0.958  -5.107  1.00 31.31  ? 181 GLU B C   1 
ATOM   3556  O O   . GLU B 1 201 ? 15.168  -0.402  -6.124  1.00 30.18  ? 181 GLU B O   1 
ATOM   3557  C CB  . GLU B 1 201 ? 17.534  0.261   -4.498  1.00 38.52  ? 181 GLU B CB  1 
ATOM   3558  C CG  . GLU B 1 201 ? 16.829  0.925   -3.329  1.00 42.04  ? 181 GLU B CG  1 
ATOM   3559  C CD  . GLU B 1 201 ? 17.275  2.359   -3.114  1.00 42.03  ? 181 GLU B CD  1 
ATOM   3560  O OE1 . GLU B 1 201 ? 18.423  2.677   -3.482  1.00 41.42  ? 181 GLU B OE1 1 
ATOM   3561  O OE2 . GLU B 1 201 ? 16.479  3.152   -2.569  1.00 38.76  ? 181 GLU B OE2 1 
ATOM   3562  N N   . ALA B 1 202 ? 14.694  -1.494  -4.233  1.00 30.38  ? 182 ALA B N   1 
ATOM   3563  C CA  . ALA B 1 202 ? 13.267  -1.296  -4.301  1.00 31.28  ? 182 ALA B CA  1 
ATOM   3564  C C   . ALA B 1 202 ? 12.778  -1.679  -2.934  1.00 33.47  ? 182 ALA B C   1 
ATOM   3565  O O   . ALA B 1 202 ? 13.491  -2.338  -2.196  1.00 36.24  ? 182 ALA B O   1 
ATOM   3566  C CB  . ALA B 1 202 ? 12.642  -2.158  -5.370  1.00 31.46  ? 182 ALA B CB  1 
ATOM   3567  N N   . PRO B 1 203 ? 11.588  -1.229  -2.563  1.00 36.84  ? 183 PRO B N   1 
ATOM   3568  C CA  . PRO B 1 203 ? 11.108  -1.410  -1.211  1.00 38.03  ? 183 PRO B CA  1 
ATOM   3569  C C   . PRO B 1 203 ? 10.953  -2.885  -0.851  1.00 40.21  ? 183 PRO B C   1 
ATOM   3570  O O   . PRO B 1 203 ? 10.354  -3.648  -1.611  1.00 41.78  ? 183 PRO B O   1 
ATOM   3571  C CB  . PRO B 1 203 ? 9.739   -0.747  -1.243  1.00 39.16  ? 183 PRO B CB  1 
ATOM   3572  C CG  . PRO B 1 203 ? 9.771   0.180   -2.402  1.00 40.60  ? 183 PRO B CG  1 
ATOM   3573  C CD  . PRO B 1 203 ? 10.614  -0.519  -3.406  1.00 40.53  ? 183 PRO B CD  1 
ATOM   3574  N N   . GLY B 1 204 ? 11.514  -3.269  0.291   1.00 40.75  ? 184 GLY B N   1 
ATOM   3575  C CA  . GLY B 1 204 ? 11.510  -4.659  0.753   1.00 40.98  ? 184 GLY B CA  1 
ATOM   3576  C C   . GLY B 1 204 ? 12.527  -5.576  0.084   1.00 40.62  ? 184 GLY B C   1 
ATOM   3577  O O   . GLY B 1 204 ? 12.646  -6.749  0.452   1.00 40.76  ? 184 GLY B O   1 
ATOM   3578  N N   . PHE B 1 205 ? 13.274  -5.066  -0.890  1.00 39.31  ? 185 PHE B N   1 
ATOM   3579  C CA  . PHE B 1 205 ? 14.170  -5.926  -1.650  1.00 38.48  ? 185 PHE B CA  1 
ATOM   3580  C C   . PHE B 1 205 ? 13.352  -7.097  -2.164  1.00 38.82  ? 185 PHE B C   1 
ATOM   3581  O O   . PHE B 1 205 ? 12.343  -6.883  -2.829  1.00 40.38  ? 185 PHE B O   1 
ATOM   3582  C CB  . PHE B 1 205 ? 15.330  -6.369  -0.758  1.00 37.88  ? 185 PHE B CB  1 
ATOM   3583  C CG  . PHE B 1 205 ? 15.978  -5.244  -0.031  1.00 36.16  ? 185 PHE B CG  1 
ATOM   3584  C CD1 . PHE B 1 205 ? 16.049  -3.973  -0.618  1.00 38.28  ? 185 PHE B CD1 1 
ATOM   3585  C CD2 . PHE B 1 205 ? 16.516  -5.432  1.223   1.00 36.51  ? 185 PHE B CD2 1 
ATOM   3586  C CE1 . PHE B 1 205 ? 16.634  -2.917  0.036   1.00 36.27  ? 185 PHE B CE1 1 
ATOM   3587  C CE2 . PHE B 1 205 ? 17.115  -4.375  1.896   1.00 39.45  ? 185 PHE B CE2 1 
ATOM   3588  C CZ  . PHE B 1 205 ? 17.167  -3.109  1.303   1.00 38.38  ? 185 PHE B CZ  1 
ATOM   3589  N N   . VAL B 1 206 ? 13.734  -8.317  -1.829  1.00 37.59  ? 186 VAL B N   1 
ATOM   3590  C CA  . VAL B 1 206 ? 12.931  -9.455  -2.209  1.00 39.14  ? 186 VAL B CA  1 
ATOM   3591  C C   . VAL B 1 206 ? 12.231  -10.115 -1.034  1.00 38.78  ? 186 VAL B C   1 
ATOM   3592  O O   . VAL B 1 206 ? 11.026  -10.304 -1.055  1.00 37.83  ? 186 VAL B O   1 
ATOM   3593  C CB  . VAL B 1 206 ? 13.789  -10.491 -2.901  1.00 39.65  ? 186 VAL B CB  1 
ATOM   3594  C CG1 . VAL B 1 206 ? 12.943  -11.685 -3.227  1.00 42.00  ? 186 VAL B CG1 1 
ATOM   3595  C CG2 . VAL B 1 206 ? 14.365  -9.904  -4.173  1.00 42.67  ? 186 VAL B CG2 1 
ATOM   3596  N N   . VAL B 1 207 ? 13.000  -10.486 -0.021  1.00 38.46  ? 187 VAL B N   1 
ATOM   3597  C CA  . VAL B 1 207 ? 12.497  -11.344 1.022   1.00 37.01  ? 187 VAL B CA  1 
ATOM   3598  C C   . VAL B 1 207 ? 11.371  -10.659 1.758   1.00 38.25  ? 187 VAL B C   1 
ATOM   3599  O O   . VAL B 1 207 ? 10.245  -11.126 1.723   1.00 42.70  ? 187 VAL B O   1 
ATOM   3600  C CB  . VAL B 1 207 ? 13.613  -11.752 1.991   1.00 37.35  ? 187 VAL B CB  1 
ATOM   3601  C CG1 . VAL B 1 207 ? 13.040  -12.552 3.145   1.00 37.02  ? 187 VAL B CG1 1 
ATOM   3602  C CG2 . VAL B 1 207 ? 14.647  -12.593 1.260   1.00 38.87  ? 187 VAL B CG2 1 
ATOM   3603  N N   . ASN B 1 208 ? 11.684  -9.550  2.407   1.00 37.70  ? 188 ASN B N   1 
ATOM   3604  C CA  . ASN B 1 208 ? 10.708  -8.814  3.169   1.00 38.78  ? 188 ASN B CA  1 
ATOM   3605  C C   . ASN B 1 208 ? 9.507   -8.376  2.364   1.00 38.50  ? 188 ASN B C   1 
ATOM   3606  O O   . ASN B 1 208 ? 8.386   -8.360  2.886   1.00 35.88  ? 188 ASN B O   1 
ATOM   3607  C CB  . ASN B 1 208 ? 11.358  -7.586  3.785   1.00 40.91  ? 188 ASN B CB  1 
ATOM   3608  C CG  . ASN B 1 208 ? 12.083  -7.909  5.071   1.00 43.30  ? 188 ASN B CG  1 
ATOM   3609  O OD1 . ASN B 1 208 ? 11.866  -8.952  5.681   1.00 43.24  ? 188 ASN B OD1 1 
ATOM   3610  N ND2 . ASN B 1 208 ? 12.944  -7.009  5.494   1.00 46.60  ? 188 ASN B ND2 1 
ATOM   3611  N N   . ARG B 1 209 ? 9.752   -8.014  1.106   1.00 37.33  ? 189 ARG B N   1 
ATOM   3612  C CA  . ARG B 1 209 ? 8.701   -7.572  0.202   1.00 38.38  ? 189 ARG B CA  1 
ATOM   3613  C C   . ARG B 1 209 ? 7.627   -8.626  0.053   1.00 39.18  ? 189 ARG B C   1 
ATOM   3614  O O   . ARG B 1 209 ? 6.455   -8.302  0.025   1.00 38.15  ? 189 ARG B O   1 
ATOM   3615  C CB  . ARG B 1 209 ? 9.297   -7.270  -1.164  1.00 40.52  ? 189 ARG B CB  1 
ATOM   3616  C CG  . ARG B 1 209 ? 8.297   -6.960  -2.260  1.00 43.32  ? 189 ARG B CG  1 
ATOM   3617  C CD  . ARG B 1 209 ? 7.827   -5.557  -2.070  1.00 46.49  ? 189 ARG B CD  1 
ATOM   3618  N NE  . ARG B 1 209 ? 6.760   -5.148  -2.964  1.00 50.84  ? 189 ARG B NE  1 
ATOM   3619  C CZ  . ARG B 1 209 ? 6.771   -4.012  -3.661  1.00 50.48  ? 189 ARG B CZ  1 
ATOM   3620  N NH1 . ARG B 1 209 ? 7.804   -3.182  -3.585  1.00 54.15  ? 189 ARG B NH1 1 
ATOM   3621  N NH2 . ARG B 1 209 ? 5.742   -3.682  -4.425  1.00 47.71  ? 189 ARG B NH2 1 
ATOM   3622  N N   . ILE B 1 210 ? 8.041   -9.883  -0.060  1.00 40.36  ? 190 ILE B N   1 
ATOM   3623  C CA  . ILE B 1 210 ? 7.122   -11.007 -0.188  1.00 39.61  ? 190 ILE B CA  1 
ATOM   3624  C C   . ILE B 1 210 ? 6.664   -11.511 1.163   1.00 38.48  ? 190 ILE B C   1 
ATOM   3625  O O   . ILE B 1 210 ? 5.510   -11.860 1.358   1.00 39.08  ? 190 ILE B O   1 
ATOM   3626  C CB  . ILE B 1 210 ? 7.820   -12.181 -0.887  1.00 40.39  ? 190 ILE B CB  1 
ATOM   3627  C CG1 . ILE B 1 210 ? 8.059   -11.830 -2.338  1.00 39.25  ? 190 ILE B CG1 1 
ATOM   3628  C CG2 . ILE B 1 210 ? 6.989   -13.452 -0.799  1.00 40.08  ? 190 ILE B CG2 1 
ATOM   3629  C CD1 . ILE B 1 210 ? 9.001   -12.772 -3.033  1.00 39.70  ? 190 ILE B CD1 1 
ATOM   3630  N N   . LEU B 1 211 ? 7.595   -11.565 2.093   1.00 40.34  ? 191 LEU B N   1 
ATOM   3631  C CA  . LEU B 1 211 ? 7.373   -12.282 3.331   1.00 42.25  ? 191 LEU B CA  1 
ATOM   3632  C C   . LEU B 1 211 ? 6.525   -11.543 4.364   1.00 41.99  ? 191 LEU B C   1 
ATOM   3633  O O   . LEU B 1 211 ? 5.684   -12.159 5.018   1.00 39.99  ? 191 LEU B O   1 
ATOM   3634  C CB  . LEU B 1 211 ? 8.716   -12.671 3.939   1.00 42.94  ? 191 LEU B CB  1 
ATOM   3635  C CG  . LEU B 1 211 ? 8.618   -13.481 5.224   1.00 45.74  ? 191 LEU B CG  1 
ATOM   3636  C CD1 . LEU B 1 211 ? 8.015   -14.837 4.917   1.00 47.23  ? 191 LEU B CD1 1 
ATOM   3637  C CD2 . LEU B 1 211 ? 9.994   -13.635 5.833   1.00 45.47  ? 191 LEU B CD2 1 
ATOM   3638  N N   . ILE B 1 212 ? 6.747   -10.245 4.543   1.00 39.92  ? 192 ILE B N   1 
ATOM   3639  C CA  . ILE B 1 212 ? 6.016   -9.544  5.607   1.00 39.63  ? 192 ILE B CA  1 
ATOM   3640  C C   . ILE B 1 212 ? 4.525   -9.338  5.303   1.00 38.16  ? 192 ILE B C   1 
ATOM   3641  O O   . ILE B 1 212 ? 3.680   -9.381  6.205   1.00 38.14  ? 192 ILE B O   1 
ATOM   3642  C CB  . ILE B 1 212 ? 6.647   -8.204  5.971   1.00 38.53  ? 192 ILE B CB  1 
ATOM   3643  C CG1 . ILE B 1 212 ? 8.130   -8.390  6.280   1.00 39.14  ? 192 ILE B CG1 1 
ATOM   3644  C CG2 . ILE B 1 212 ? 5.917   -7.616  7.164   1.00 38.01  ? 192 ILE B CG2 1 
ATOM   3645  C CD1 . ILE B 1 212 ? 8.410   -9.232  7.507   1.00 40.67  ? 192 ILE B CD1 1 
ATOM   3646  N N   . PRO B 1 213 ? 4.188   -9.116  4.035   1.00 36.43  ? 193 PRO B N   1 
ATOM   3647  C CA  . PRO B 1 213 ? 2.773   -9.003  3.654   1.00 40.01  ? 193 PRO B CA  1 
ATOM   3648  C C   . PRO B 1 213 ? 2.028   -10.308 3.835   1.00 40.61  ? 193 PRO B C   1 
ATOM   3649  O O   . PRO B 1 213 ? 0.808   -10.333 3.973   1.00 40.06  ? 193 PRO B O   1 
ATOM   3650  C CB  . PRO B 1 213 ? 2.837   -8.622  2.177   1.00 36.74  ? 193 PRO B CB  1 
ATOM   3651  C CG  . PRO B 1 213 ? 4.117   -7.904  2.061   1.00 36.90  ? 193 PRO B CG  1 
ATOM   3652  C CD  . PRO B 1 213 ? 5.073   -8.602  2.989   1.00 37.17  ? 193 PRO B CD  1 
ATOM   3653  N N   . MET B 1 214 ? 2.789   -11.385 3.834   1.00 44.97  ? 194 MET B N   1 
ATOM   3654  C CA  . MET B 1 214 ? 2.268   -12.700 4.143   1.00 45.48  ? 194 MET B CA  1 
ATOM   3655  C C   . MET B 1 214 ? 1.751   -12.748 5.581   1.00 42.15  ? 194 MET B C   1 
ATOM   3656  O O   . MET B 1 214 ? 0.628   -13.163 5.855   1.00 42.07  ? 194 MET B O   1 
ATOM   3657  C CB  . MET B 1 214 ? 3.398   -13.676 3.971   1.00 49.26  ? 194 MET B CB  1 
ATOM   3658  C CG  . MET B 1 214 ? 2.970   -15.102 3.952   1.00 54.98  ? 194 MET B CG  1 
ATOM   3659  S SD  . MET B 1 214 ? 4.440   -16.114 4.113   1.00 62.35  ? 194 MET B SD  1 
ATOM   3660  C CE  . MET B 1 214 ? 4.839   -16.184 2.393   1.00 63.01  ? 194 MET B CE  1 
ATOM   3661  N N   . ILE B 1 215 ? 2.585   -12.291 6.495   1.00 40.20  ? 195 ILE B N   1 
ATOM   3662  C CA  . ILE B 1 215 ? 2.208   -12.169 7.888   1.00 37.77  ? 195 ILE B CA  1 
ATOM   3663  C C   . ILE B 1 215 ? 1.019   -11.234 8.025   1.00 38.17  ? 195 ILE B C   1 
ATOM   3664  O O   . ILE B 1 215 ? 0.067   -11.537 8.731   1.00 39.45  ? 195 ILE B O   1 
ATOM   3665  C CB  . ILE B 1 215 ? 3.383   -11.610 8.691   1.00 35.26  ? 195 ILE B CB  1 
ATOM   3666  C CG1 . ILE B 1 215 ? 4.519   -12.615 8.674   1.00 35.91  ? 195 ILE B CG1 1 
ATOM   3667  C CG2 . ILE B 1 215 ? 2.998   -11.331 10.127  1.00 34.45  ? 195 ILE B CG2 1 
ATOM   3668  C CD1 . ILE B 1 215 ? 5.764   -12.112 9.374   1.00 38.59  ? 195 ILE B CD1 1 
ATOM   3669  N N   . ASN B 1 216 ? 1.095   -10.095 7.345   1.00 37.91  ? 196 ASN B N   1 
ATOM   3670  C CA  . ASN B 1 216 ? 0.041   -9.091  7.398   1.00 34.73  ? 196 ASN B CA  1 
ATOM   3671  C C   . ASN B 1 216 ? -1.263  -9.643  6.852   1.00 33.62  ? 196 ASN B C   1 
ATOM   3672  O O   . ASN B 1 216 ? -2.322  -9.328  7.371   1.00 34.80  ? 196 ASN B O   1 
ATOM   3673  C CB  . ASN B 1 216 ? 0.464   -7.849  6.618   1.00 36.02  ? 196 ASN B CB  1 
ATOM   3674  C CG  . ASN B 1 216 ? -0.505  -6.686  6.787   1.00 34.37  ? 196 ASN B CG  1 
ATOM   3675  O OD1 . ASN B 1 216 ? -0.554  -6.029  7.823   1.00 33.78  ? 196 ASN B OD1 1 
ATOM   3676  N ND2 . ASN B 1 216 ? -1.254  -6.419  5.757   1.00 32.18  ? 196 ASN B ND2 1 
ATOM   3677  N N   . GLU B 1 217 ? -1.191  -10.481 5.822   1.00 33.59  ? 197 GLU B N   1 
ATOM   3678  C CA  . GLU B 1 217 ? -2.392  -11.103 5.300   1.00 35.81  ? 197 GLU B CA  1 
ATOM   3679  C C   . GLU B 1 217 ? -3.004  -12.004 6.370   1.00 37.26  ? 197 GLU B C   1 
ATOM   3680  O O   . GLU B 1 217 ? -4.210  -12.038 6.558   1.00 36.60  ? 197 GLU B O   1 
ATOM   3681  C CB  . GLU B 1 217 ? -2.081  -11.909 4.053   1.00 38.32  ? 197 GLU B CB  1 
ATOM   3682  C CG  . GLU B 1 217 ? -3.341  -12.373 3.326   1.00 43.25  ? 197 GLU B CG  1 
ATOM   3683  C CD  . GLU B 1 217 ? -4.110  -11.223 2.684   1.00 46.87  ? 197 GLU B CD  1 
ATOM   3684  O OE1 . GLU B 1 217 ? -3.456  -10.295 2.167   1.00 51.20  ? 197 GLU B OE1 1 
ATOM   3685  O OE2 . GLU B 1 217 ? -5.362  -11.239 2.687   1.00 46.55  ? 197 GLU B OE2 1 
ATOM   3686  N N   . ALA B 1 218 ? -2.147  -12.719 7.086   1.00 39.38  ? 198 ALA B N   1 
ATOM   3687  C CA  . ALA B 1 218 ? -2.612  -13.612 8.126   1.00 41.87  ? 198 ALA B CA  1 
ATOM   3688  C C   . ALA B 1 218 ? -3.360  -12.891 9.231   1.00 41.65  ? 198 ALA B C   1 
ATOM   3689  O O   . ALA B 1 218 ? -4.364  -13.394 9.734   1.00 45.15  ? 198 ALA B O   1 
ATOM   3690  C CB  . ALA B 1 218 ? -1.451  -14.403 8.704   1.00 42.46  ? 198 ALA B CB  1 
ATOM   3691  N N   . VAL B 1 219 ? -2.906  -11.710 9.610   1.00 41.62  ? 199 VAL B N   1 
ATOM   3692  C CA  . VAL B 1 219 ? -3.578  -11.051 10.724  1.00 43.26  ? 199 VAL B CA  1 
ATOM   3693  C C   . VAL B 1 219 ? -4.962  -10.557 10.288  1.00 42.17  ? 199 VAL B C   1 
ATOM   3694  O O   . VAL B 1 219 ? -5.878  -10.450 11.114  1.00 39.83  ? 199 VAL B O   1 
ATOM   3695  C CB  . VAL B 1 219 ? -2.723  -9.967  11.429  1.00 45.11  ? 199 VAL B CB  1 
ATOM   3696  C CG1 . VAL B 1 219 ? -1.293  -9.962  10.919  1.00 46.40  ? 199 VAL B CG1 1 
ATOM   3697  C CG2 . VAL B 1 219 ? -3.340  -8.597  11.310  1.00 46.62  ? 199 VAL B CG2 1 
ATOM   3698  N N   . GLY B 1 220 ? -5.114  -10.290 8.991   1.00 41.23  ? 200 GLY B N   1 
ATOM   3699  C CA  . GLY B 1 220 ? -6.412  -9.894  8.445   1.00 42.00  ? 200 GLY B CA  1 
ATOM   3700  C C   . GLY B 1 220 ? -7.405  -11.043 8.509   1.00 44.39  ? 200 GLY B C   1 
ATOM   3701  O O   . GLY B 1 220 ? -8.566  -10.865 8.871   1.00 46.64  ? 200 GLY B O   1 
ATOM   3702  N N   . ILE B 1 221 ? -6.938  -12.233 8.171   1.00 41.81  ? 201 ILE B N   1 
ATOM   3703  C CA  . ILE B 1 221 ? -7.754  -13.422 8.311   1.00 43.65  ? 201 ILE B CA  1 
ATOM   3704  C C   . ILE B 1 221 ? -8.175  -13.621 9.769   1.00 42.26  ? 201 ILE B C   1 
ATOM   3705  O O   . ILE B 1 221 ? -9.353  -13.833 10.094  1.00 39.91  ? 201 ILE B O   1 
ATOM   3706  C CB  . ILE B 1 221 ? -6.978  -14.643 7.851   1.00 44.99  ? 201 ILE B CB  1 
ATOM   3707  C CG1 . ILE B 1 221 ? -6.634  -14.473 6.379   1.00 45.49  ? 201 ILE B CG1 1 
ATOM   3708  C CG2 . ILE B 1 221 ? -7.799  -15.898 8.057   1.00 45.79  ? 201 ILE B CG2 1 
ATOM   3709  C CD1 . ILE B 1 221 ? -5.731  -15.555 5.831   1.00 45.92  ? 201 ILE B CD1 1 
ATOM   3710  N N   . LEU B 1 222 ? -7.203  -13.547 10.656  1.00 40.40  ? 202 LEU B N   1 
ATOM   3711  C CA  . LEU B 1 222 ? -7.514  -13.626 12.061  1.00 41.24  ? 202 LEU B CA  1 
ATOM   3712  C C   . LEU B 1 222 ? -8.579  -12.612 12.436  1.00 44.10  ? 202 LEU B C   1 
ATOM   3713  O O   . LEU B 1 222 ? -9.568  -12.954 13.073  1.00 43.96  ? 202 LEU B O   1 
ATOM   3714  C CB  . LEU B 1 222 ? -6.274  -13.360 12.867  1.00 41.48  ? 202 LEU B CB  1 
ATOM   3715  C CG  . LEU B 1 222 ? -6.503  -13.308 14.364  1.00 42.29  ? 202 LEU B CG  1 
ATOM   3716  C CD1 . LEU B 1 222 ? -6.845  -14.702 14.882  1.00 44.22  ? 202 LEU B CD1 1 
ATOM   3717  C CD2 . LEU B 1 222 ? -5.218  -12.792 14.986  1.00 42.16  ? 202 LEU B CD2 1 
ATOM   3718  N N   . ALA B 1 223 ? -8.381  -11.372 12.007  1.00 44.49  ? 203 ALA B N   1 
ATOM   3719  C CA  . ALA B 1 223 ? -9.241  -10.280 12.430  1.00 44.76  ? 203 ALA B CA  1 
ATOM   3720  C C   . ALA B 1 223 ? -10.696 -10.369 11.993  1.00 46.39  ? 203 ALA B C   1 
ATOM   3721  O O   . ALA B 1 223 ? -11.560 -9.814  12.661  1.00 43.69  ? 203 ALA B O   1 
ATOM   3722  C CB  . ALA B 1 223 ? -8.664  -8.967  11.966  1.00 46.77  ? 203 ALA B CB  1 
ATOM   3723  N N   . GLU B 1 224 ? -10.982 -11.042 10.882  1.00 50.71  ? 204 GLU B N   1 
ATOM   3724  C CA  . GLU B 1 224 ? -12.389 -11.205 10.477  1.00 53.33  ? 204 GLU B CA  1 
ATOM   3725  C C   . GLU B 1 224 ? -12.932 -12.524 11.012  1.00 51.90  ? 204 GLU B C   1 
ATOM   3726  O O   . GLU B 1 224 ? -13.965 -12.997 10.557  1.00 49.16  ? 204 GLU B O   1 
ATOM   3727  C CB  . GLU B 1 224 ? -12.598 -11.164 8.957   1.00 59.50  ? 204 GLU B CB  1 
ATOM   3728  C CG  . GLU B 1 224 ? -11.396 -10.740 8.132   1.00 66.80  ? 204 GLU B CG  1 
ATOM   3729  C CD  . GLU B 1 224 ? -11.760 -9.909  6.912   1.00 70.93  ? 204 GLU B CD  1 
ATOM   3730  O OE1 . GLU B 1 224 ? -12.821 -9.250  6.929   1.00 71.90  ? 204 GLU B OE1 1 
ATOM   3731  O OE2 . GLU B 1 224 ? -10.967 -9.898  5.940   1.00 73.83  ? 204 GLU B OE2 1 
ATOM   3732  N N   . GLY B 1 225 ? -12.224 -13.125 11.961  1.00 48.40  ? 205 GLY B N   1 
ATOM   3733  C CA  . GLY B 1 225 ? -12.595 -14.432 12.493  1.00 47.69  ? 205 GLY B CA  1 
ATOM   3734  C C   . GLY B 1 225 ? -12.741 -15.551 11.485  1.00 46.12  ? 205 GLY B C   1 
ATOM   3735  O O   . GLY B 1 225 ? -13.639 -16.363 11.602  1.00 45.67  ? 205 GLY B O   1 
ATOM   3736  N N   . ILE B 1 226 ? -11.858 -15.621 10.501  1.00 45.50  ? 206 ILE B N   1 
ATOM   3737  C CA  . ILE B 1 226 ? -11.952 -16.681 9.515   1.00 46.01  ? 206 ILE B CA  1 
ATOM   3738  C C   . ILE B 1 226 ? -11.431 -17.960 10.140  1.00 47.57  ? 206 ILE B C   1 
ATOM   3739  O O   . ILE B 1 226 ? -12.019 -19.033 9.975   1.00 46.23  ? 206 ILE B O   1 
ATOM   3740  C CB  . ILE B 1 226 ? -11.154 -16.333 8.252   1.00 46.78  ? 206 ILE B CB  1 
ATOM   3741  C CG1 . ILE B 1 226 ? -11.879 -15.305 7.380   1.00 50.28  ? 206 ILE B CG1 1 
ATOM   3742  C CG2 . ILE B 1 226 ? -10.949 -17.559 7.385   1.00 46.97  ? 206 ILE B CG2 1 
ATOM   3743  C CD1 . ILE B 1 226 ? -13.164 -14.770 7.956   1.00 52.26  ? 206 ILE B CD1 1 
ATOM   3744  N N   . ALA B 1 227 ? -10.325 -17.828 10.855  1.00 46.06  ? 207 ALA B N   1 
ATOM   3745  C CA  . ALA B 1 227 ? -9.706  -18.948 11.508  1.00 46.71  ? 207 ALA B CA  1 
ATOM   3746  C C   . ALA B 1 227 ? -9.122  -18.434 12.792  1.00 47.73  ? 207 ALA B C   1 
ATOM   3747  O O   . ALA B 1 227 ? -8.997  -17.228 13.001  1.00 53.38  ? 207 ALA B O   1 
ATOM   3748  C CB  . ALA B 1 227 ? -8.611  -19.521 10.633  1.00 46.46  ? 207 ALA B CB  1 
ATOM   3749  N N   . SER B 1 228 ? -8.763  -19.372 13.648  1.00 47.57  ? 208 SER B N   1 
ATOM   3750  C CA  . SER B 1 228 ? -8.080  -19.080 14.897  1.00 44.63  ? 208 SER B CA  1 
ATOM   3751  C C   . SER B 1 228 ? -6.608  -18.959 14.567  1.00 42.36  ? 208 SER B C   1 
ATOM   3752  O O   . SER B 1 228 ? -6.179  -19.393 13.496  1.00 41.48  ? 208 SER B O   1 
ATOM   3753  C CB  . SER B 1 228 ? -8.265  -20.248 15.862  1.00 41.66  ? 208 SER B CB  1 
ATOM   3754  O OG  . SER B 1 228 ? -7.616  -21.411 15.348  1.00 42.55  ? 208 SER B OG  1 
ATOM   3755  N N   . VAL B 1 229 ? -5.815  -18.443 15.486  1.00 43.57  ? 209 VAL B N   1 
ATOM   3756  C CA  . VAL B 1 229 ? -4.388  -18.290 15.171  1.00 48.22  ? 209 VAL B CA  1 
ATOM   3757  C C   . VAL B 1 229 ? -3.691  -19.633 15.033  1.00 49.80  ? 209 VAL B C   1 
ATOM   3758  O O   . VAL B 1 229 ? -2.820  -19.788 14.178  1.00 50.19  ? 209 VAL B O   1 
ATOM   3759  C CB  . VAL B 1 229 ? -3.610  -17.335 16.111  1.00 48.68  ? 209 VAL B CB  1 
ATOM   3760  C CG1 . VAL B 1 229 ? -4.494  -16.766 17.196  1.00 50.05  ? 209 VAL B CG1 1 
ATOM   3761  C CG2 . VAL B 1 229 ? -2.379  -17.999 16.692  1.00 48.59  ? 209 VAL B CG2 1 
ATOM   3762  N N   . GLU B 1 230 ? -4.096  -20.601 15.847  1.00 53.01  ? 210 GLU B N   1 
ATOM   3763  C CA  . GLU B 1 230 ? -3.509  -21.935 15.780  1.00 53.89  ? 210 GLU B CA  1 
ATOM   3764  C C   . GLU B 1 230 ? -3.788  -22.548 14.432  1.00 48.23  ? 210 GLU B C   1 
ATOM   3765  O O   . GLU B 1 230 ? -2.939  -23.228 13.870  1.00 43.81  ? 210 GLU B O   1 
ATOM   3766  C CB  . GLU B 1 230 ? -4.065  -22.860 16.870  1.00 60.75  ? 210 GLU B CB  1 
ATOM   3767  C CG  . GLU B 1 230 ? -3.439  -22.669 18.245  1.00 65.72  ? 210 GLU B CG  1 
ATOM   3768  C CD  . GLU B 1 230 ? -4.015  -21.485 19.019  1.00 73.70  ? 210 GLU B CD  1 
ATOM   3769  O OE1 . GLU B 1 230 ? -3.395  -21.092 20.038  1.00 78.05  ? 210 GLU B OE1 1 
ATOM   3770  O OE2 . GLU B 1 230 ? -5.080  -20.941 18.623  1.00 74.63  ? 210 GLU B OE2 1 
ATOM   3771  N N   . ASP B 1 231 ? -4.984  -22.308 13.913  1.00 47.57  ? 211 ASP B N   1 
ATOM   3772  C CA  . ASP B 1 231 ? -5.384  -22.952 12.663  1.00 49.72  ? 211 ASP B CA  1 
ATOM   3773  C C   . ASP B 1 231 ? -4.786  -22.281 11.448  1.00 47.47  ? 211 ASP B C   1 
ATOM   3774  O O   . ASP B 1 231 ? -4.580  -22.922 10.413  1.00 45.61  ? 211 ASP B O   1 
ATOM   3775  C CB  . ASP B 1 231 ? -6.905  -23.016 12.540  1.00 52.78  ? 211 ASP B CB  1 
ATOM   3776  C CG  . ASP B 1 231 ? -7.512  -24.162 13.351  1.00 51.29  ? 211 ASP B CG  1 
ATOM   3777  O OD1 . ASP B 1 231 ? -6.753  -24.901 14.024  1.00 52.09  ? 211 ASP B OD1 1 
ATOM   3778  O OD2 . ASP B 1 231 ? -8.751  -24.325 13.305  1.00 50.97  ? 211 ASP B OD2 1 
ATOM   3779  N N   . ILE B 1 232 ? -4.500  -20.992 11.591  1.00 46.89  ? 212 ILE B N   1 
ATOM   3780  C CA  . ILE B 1 232 ? -3.839  -20.240 10.538  1.00 43.52  ? 212 ILE B CA  1 
ATOM   3781  C C   . ILE B 1 232 ? -2.413  -20.763 10.390  1.00 40.96  ? 212 ILE B C   1 
ATOM   3782  O O   . ILE B 1 232 ? -1.945  -21.024 9.293   1.00 38.89  ? 212 ILE B O   1 
ATOM   3783  C CB  . ILE B 1 232 ? -3.860  -18.719 10.844  1.00 42.56  ? 212 ILE B CB  1 
ATOM   3784  C CG1 . ILE B 1 232 ? -5.222  -18.132 10.469  1.00 41.12  ? 212 ILE B CG1 1 
ATOM   3785  C CG2 . ILE B 1 232 ? -2.786  -17.975 10.062  1.00 41.44  ? 212 ILE B CG2 1 
ATOM   3786  C CD1 . ILE B 1 232 ? -5.607  -16.899 11.263  1.00 40.43  ? 212 ILE B CD1 1 
ATOM   3787  N N   . ASP B 1 233 ? -1.727  -20.923 11.508  1.00 43.20  ? 213 ASP B N   1 
ATOM   3788  C CA  . ASP B 1 233 ? -0.332  -21.346 11.477  1.00 45.67  ? 213 ASP B CA  1 
ATOM   3789  C C   . ASP B 1 233 ? -0.218  -22.794 11.083  1.00 47.53  ? 213 ASP B C   1 
ATOM   3790  O O   . ASP B 1 233 ? 0.712   -23.186 10.371  1.00 49.30  ? 213 ASP B O   1 
ATOM   3791  C CB  . ASP B 1 233 ? 0.330   -21.077 12.825  1.00 47.30  ? 213 ASP B CB  1 
ATOM   3792  C CG  . ASP B 1 233 ? 0.724   -19.609 12.983  1.00 49.76  ? 213 ASP B CG  1 
ATOM   3793  O OD1 . ASP B 1 233 ? 0.610   -18.853 11.992  1.00 48.92  ? 213 ASP B OD1 1 
ATOM   3794  O OD2 . ASP B 1 233 ? 1.153   -19.198 14.079  1.00 50.26  ? 213 ASP B OD2 1 
ATOM   3795  N N   . LYS B 1 234 ? -1.193  -23.580 11.516  1.00 50.41  ? 214 LYS B N   1 
ATOM   3796  C CA  . LYS B 1 234 ? -1.241  -24.986 11.156  1.00 51.83  ? 214 LYS B CA  1 
ATOM   3797  C C   . LYS B 1 234 ? -1.478  -25.154 9.658   1.00 48.31  ? 214 LYS B C   1 
ATOM   3798  O O   . LYS B 1 234 ? -0.864  -26.010 9.004   1.00 45.92  ? 214 LYS B O   1 
ATOM   3799  C CB  . LYS B 1 234 ? -2.335  -25.685 11.942  1.00 56.10  ? 214 LYS B CB  1 
ATOM   3800  C CG  . LYS B 1 234 ? -2.596  -27.087 11.436  1.00 61.17  ? 214 LYS B CG  1 
ATOM   3801  C CD  . LYS B 1 234 ? -2.659  -28.071 12.580  1.00 65.16  ? 214 LYS B CD  1 
ATOM   3802  C CE  . LYS B 1 234 ? -4.078  -28.536 12.809  1.00 66.82  ? 214 LYS B CE  1 
ATOM   3803  N NZ  . LYS B 1 234 ? -4.356  -28.635 14.262  1.00 68.17  ? 214 LYS B NZ  1 
ATOM   3804  N N   . ALA B 1 235 ? -2.375  -24.333 9.121   1.00 45.76  ? 215 ALA B N   1 
ATOM   3805  C CA  . ALA B 1 235 ? -2.739  -24.421 7.704   1.00 46.08  ? 215 ALA B CA  1 
ATOM   3806  C C   . ALA B 1 235 ? -1.582  -24.097 6.768   1.00 45.08  ? 215 ALA B C   1 
ATOM   3807  O O   . ALA B 1 235 ? -1.401  -24.751 5.744   1.00 46.89  ? 215 ALA B O   1 
ATOM   3808  C CB  . ALA B 1 235 ? -3.914  -23.513 7.410   1.00 47.80  ? 215 ALA B CB  1 
ATOM   3809  N N   . MET B 1 236 ? -0.800  -23.088 7.127   1.00 42.53  ? 216 MET B N   1 
ATOM   3810  C CA  . MET B 1 236 ? 0.350   -22.704 6.328   1.00 43.12  ? 216 MET B CA  1 
ATOM   3811  C C   . MET B 1 236 ? 1.498   -23.707 6.455   1.00 43.82  ? 216 MET B C   1 
ATOM   3812  O O   . MET B 1 236 ? 2.182   -24.017 5.476   1.00 42.19  ? 216 MET B O   1 
ATOM   3813  C CB  . MET B 1 236 ? 0.827   -21.305 6.743   1.00 43.47  ? 216 MET B CB  1 
ATOM   3814  C CG  . MET B 1 236 ? -0.158  -20.194 6.424   1.00 40.94  ? 216 MET B CG  1 
ATOM   3815  S SD  . MET B 1 236 ? -0.760  -20.359 4.730   1.00 42.68  ? 216 MET B SD  1 
ATOM   3816  C CE  . MET B 1 236 ? 0.746   -20.035 3.816   1.00 40.02  ? 216 MET B CE  1 
ATOM   3817  N N   . LYS B 1 237 ? 1.718   -24.212 7.660   1.00 43.45  ? 217 LYS B N   1 
ATOM   3818  C CA  . LYS B 1 237 ? 2.749   -25.221 7.837   1.00 47.58  ? 217 LYS B CA  1 
ATOM   3819  C C   . LYS B 1 237 ? 2.453   -26.513 7.076   1.00 47.99  ? 217 LYS B C   1 
ATOM   3820  O O   . LYS B 1 237 ? 3.296   -27.019 6.355   1.00 45.73  ? 217 LYS B O   1 
ATOM   3821  C CB  . LYS B 1 237 ? 2.958   -25.509 9.307   1.00 50.74  ? 217 LYS B CB  1 
ATOM   3822  C CG  . LYS B 1 237 ? 4.009   -24.593 9.896   1.00 55.50  ? 217 LYS B CG  1 
ATOM   3823  C CD  . LYS B 1 237 ? 4.353   -24.968 11.312  1.00 59.17  ? 217 LYS B CD  1 
ATOM   3824  C CE  . LYS B 1 237 ? 3.111   -24.844 12.156  1.00 65.49  ? 217 LYS B CE  1 
ATOM   3825  N NZ  . LYS B 1 237 ? 3.425   -25.146 13.562  1.00 71.97  ? 217 LYS B NZ  1 
ATOM   3826  N N   . LEU B 1 238 ? 1.244   -27.030 7.208   1.00 51.00  ? 218 LEU B N   1 
ATOM   3827  C CA  . LEU B 1 238 ? 0.898   -28.281 6.533   1.00 53.25  ? 218 LEU B CA  1 
ATOM   3828  C C   . LEU B 1 238 ? 0.563   -28.080 5.065   1.00 53.45  ? 218 LEU B C   1 
ATOM   3829  O O   . LEU B 1 238 ? 0.894   -28.917 4.229   1.00 59.59  ? 218 LEU B O   1 
ATOM   3830  C CB  . LEU B 1 238 ? -0.270  -28.957 7.249   1.00 53.74  ? 218 LEU B CB  1 
ATOM   3831  C CG  . LEU B 1 238 ? -0.080  -29.232 8.758   1.00 55.03  ? 218 LEU B CG  1 
ATOM   3832  C CD1 . LEU B 1 238 ? -1.265  -30.013 9.302   1.00 53.48  ? 218 LEU B CD1 1 
ATOM   3833  C CD2 . LEU B 1 238 ? 1.220   -29.976 9.071   1.00 53.03  ? 218 LEU B CD2 1 
ATOM   3834  N N   . GLY B 1 239 ? -0.101  -26.977 4.751   1.00 51.75  ? 219 GLY B N   1 
ATOM   3835  C CA  . GLY B 1 239 ? -0.563  -26.740 3.396   1.00 47.82  ? 219 GLY B CA  1 
ATOM   3836  C C   . GLY B 1 239 ? 0.541   -26.247 2.491   1.00 45.92  ? 219 GLY B C   1 
ATOM   3837  O O   . GLY B 1 239 ? 0.567   -26.547 1.304   1.00 43.32  ? 219 GLY B O   1 
ATOM   3838  N N   . ALA B 1 240 ? 1.450   -25.467 3.039   1.00 45.61  ? 220 ALA B N   1 
ATOM   3839  C CA  . ALA B 1 240 ? 2.504   -24.914 2.225   1.00 48.53  ? 220 ALA B CA  1 
ATOM   3840  C C   . ALA B 1 240 ? 3.843   -25.458 2.623   1.00 49.62  ? 220 ALA B C   1 
ATOM   3841  O O   . ALA B 1 240 ? 4.855   -25.095 2.012   1.00 51.89  ? 220 ALA B O   1 
ATOM   3842  C CB  . ALA B 1 240 ? 2.507   -23.406 2.348   1.00 51.44  ? 220 ALA B CB  1 
ATOM   3843  N N   . ASN B 1 241 ? 3.874   -26.297 3.658   1.00 48.15  ? 221 ASN B N   1 
ATOM   3844  C CA  . ASN B 1 241 ? 5.117   -26.920 4.038   1.00 49.06  ? 221 ASN B CA  1 
ATOM   3845  C C   . ASN B 1 241 ? 6.103   -25.839 4.472   1.00 47.09  ? 221 ASN B C   1 
ATOM   3846  O O   . ASN B 1 241 ? 7.268   -25.864 4.100   1.00 44.16  ? 221 ASN B O   1 
ATOM   3847  C CB  . ASN B 1 241 ? 5.655   -27.719 2.843   1.00 50.95  ? 221 ASN B CB  1 
ATOM   3848  C CG  . ASN B 1 241 ? 6.733   -28.700 3.235   1.00 52.42  ? 221 ASN B CG  1 
ATOM   3849  O OD1 . ASN B 1 241 ? 6.803   -29.114 4.383   1.00 55.03  ? 221 ASN B OD1 1 
ATOM   3850  N ND2 . ASN B 1 241 ? 7.585   -29.076 2.283   1.00 52.92  ? 221 ASN B ND2 1 
ATOM   3851  N N   . HIS B 1 242 ? 5.606   -24.866 5.226   1.00 47.73  ? 222 HIS B N   1 
ATOM   3852  C CA  . HIS B 1 242 ? 6.461   -23.839 5.779   1.00 49.28  ? 222 HIS B CA  1 
ATOM   3853  C C   . HIS B 1 242 ? 6.913   -24.267 7.147   1.00 48.92  ? 222 HIS B C   1 
ATOM   3854  O O   . HIS B 1 242 ? 6.158   -24.829 7.928   1.00 45.76  ? 222 HIS B O   1 
ATOM   3855  C CB  . HIS B 1 242 ? 5.764   -22.473 5.874   1.00 49.84  ? 222 HIS B CB  1 
ATOM   3856  C CG  . HIS B 1 242 ? 5.544   -21.818 4.546   1.00 49.52  ? 222 HIS B CG  1 
ATOM   3857  N ND1 . HIS B 1 242 ? 4.742   -20.708 4.389   1.00 46.97  ? 222 HIS B ND1 1 
ATOM   3858  C CD2 . HIS B 1 242 ? 5.982   -22.146 3.307   1.00 51.13  ? 222 HIS B CD2 1 
ATOM   3859  C CE1 . HIS B 1 242 ? 4.712   -20.372 3.113   1.00 48.86  ? 222 HIS B CE1 1 
ATOM   3860  N NE2 . HIS B 1 242 ? 5.460   -21.224 2.434   1.00 50.91  ? 222 HIS B NE2 1 
ATOM   3861  N N   . PRO B 1 243 ? 8.155   -23.962 7.455   1.00 52.72  ? 223 PRO B N   1 
ATOM   3862  C CA  . PRO B 1 243 ? 8.739   -24.292 8.745   1.00 53.35  ? 223 PRO B CA  1 
ATOM   3863  C C   . PRO B 1 243 ? 8.024   -23.610 9.898   1.00 52.91  ? 223 PRO B C   1 
ATOM   3864  O O   . PRO B 1 243 ? 8.042   -24.133 11.002  1.00 56.16  ? 223 PRO B O   1 
ATOM   3865  C CB  . PRO B 1 243 ? 10.164  -23.761 8.620   1.00 54.07  ? 223 PRO B CB  1 
ATOM   3866  C CG  . PRO B 1 243 ? 10.059  -22.649 7.622   1.00 56.72  ? 223 PRO B CG  1 
ATOM   3867  C CD  . PRO B 1 243 ? 9.014   -23.080 6.647   1.00 54.01  ? 223 PRO B CD  1 
ATOM   3868  N N   . MET B 1 244 ? 7.415   -22.454 9.636   1.00 52.56  ? 224 MET B N   1 
ATOM   3869  C CA  . MET B 1 244 ? 6.664   -21.721 10.649  1.00 51.96  ? 224 MET B CA  1 
ATOM   3870  C C   . MET B 1 244 ? 5.387   -21.127 10.102  1.00 48.56  ? 224 MET B C   1 
ATOM   3871  O O   . MET B 1 244 ? 5.266   -20.870 8.911   1.00 50.02  ? 224 MET B O   1 
ATOM   3872  C CB  . MET B 1 244 ? 7.505   -20.589 11.217  1.00 57.36  ? 224 MET B CB  1 
ATOM   3873  C CG  . MET B 1 244 ? 8.046   -20.894 12.589  1.00 61.65  ? 224 MET B CG  1 
ATOM   3874  S SD  . MET B 1 244 ? 8.543   -19.390 13.428  1.00 68.06  ? 224 MET B SD  1 
ATOM   3875  C CE  . MET B 1 244 ? 10.318  -19.488 13.254  1.00 67.97  ? 224 MET B CE  1 
ATOM   3876  N N   . GLY B 1 245 ? 4.431   -20.911 10.989  1.00 46.43  ? 225 GLY B N   1 
ATOM   3877  C CA  . GLY B 1 245 ? 3.206   -20.259 10.612  1.00 45.96  ? 225 GLY B CA  1 
ATOM   3878  C C   . GLY B 1 245 ? 3.436   -18.761 10.627  1.00 47.30  ? 225 GLY B C   1 
ATOM   3879  O O   . GLY B 1 245 ? 4.248   -18.267 11.413  1.00 46.06  ? 225 GLY B O   1 
ATOM   3880  N N   . PRO B 1 246 ? 2.715   -18.025 9.765   1.00 46.20  ? 226 PRO B N   1 
ATOM   3881  C CA  . PRO B 1 246 ? 2.904   -16.597 9.646   1.00 44.70  ? 226 PRO B CA  1 
ATOM   3882  C C   . PRO B 1 246 ? 2.792   -15.892 10.979  1.00 44.74  ? 226 PRO B C   1 
ATOM   3883  O O   . PRO B 1 246 ? 3.657   -15.074 11.290  1.00 47.93  ? 226 PRO B O   1 
ATOM   3884  C CB  . PRO B 1 246 ? 1.792   -16.166 8.687   1.00 45.06  ? 226 PRO B CB  1 
ATOM   3885  C CG  . PRO B 1 246 ? 0.841   -17.300 8.652   1.00 46.55  ? 226 PRO B CG  1 
ATOM   3886  C CD  . PRO B 1 246 ? 1.687   -18.504 8.833   1.00 46.74  ? 226 PRO B CD  1 
ATOM   3887  N N   . LEU B 1 247 ? 1.779   -16.212 11.775  1.00 40.66  ? 227 LEU B N   1 
ATOM   3888  C CA  . LEU B 1 247 ? 1.598   -15.483 13.024  1.00 43.40  ? 227 LEU B CA  1 
ATOM   3889  C C   . LEU B 1 247 ? 2.726   -15.705 14.017  1.00 47.85  ? 227 LEU B C   1 
ATOM   3890  O O   . LEU B 1 247 ? 3.270   -14.750 14.546  1.00 53.07  ? 227 LEU B O   1 
ATOM   3891  C CB  . LEU B 1 247 ? 0.244   -15.770 13.642  1.00 42.94  ? 227 LEU B CB  1 
ATOM   3892  C CG  . LEU B 1 247 ? -0.859  -15.338 12.669  1.00 42.38  ? 227 LEU B CG  1 
ATOM   3893  C CD1 . LEU B 1 247 ? -2.228  -15.651 13.241  1.00 41.48  ? 227 LEU B CD1 1 
ATOM   3894  C CD2 . LEU B 1 247 ? -0.767  -13.851 12.327  1.00 42.22  ? 227 LEU B CD2 1 
ATOM   3895  N N   . GLU B 1 248 ? 3.116   -16.949 14.246  1.00 52.99  ? 228 GLU B N   1 
ATOM   3896  C CA  . GLU B 1 248 ? 4.248   -17.208 15.142  1.00 54.13  ? 228 GLU B CA  1 
ATOM   3897  C C   . GLU B 1 248 ? 5.560   -16.630 14.565  1.00 49.91  ? 228 GLU B C   1 
ATOM   3898  O O   . GLU B 1 248 ? 6.485   -16.258 15.298  1.00 48.49  ? 228 GLU B O   1 
ATOM   3899  C CB  . GLU B 1 248 ? 4.380   -18.712 15.427  1.00 58.94  ? 228 GLU B CB  1 
ATOM   3900  C CG  . GLU B 1 248 ? 4.973   -19.526 14.297  1.00 64.28  ? 228 GLU B CG  1 
ATOM   3901  C CD  . GLU B 1 248 ? 4.968   -21.021 14.580  1.00 68.08  ? 228 GLU B CD  1 
ATOM   3902  O OE1 . GLU B 1 248 ? 4.238   -21.762 13.867  1.00 64.76  ? 228 GLU B OE1 1 
ATOM   3903  O OE2 . GLU B 1 248 ? 5.704   -21.447 15.505  1.00 64.47  ? 228 GLU B OE2 1 
ATOM   3904  N N   . LEU B 1 249 ? 5.633   -16.565 13.245  1.00 46.34  ? 229 LEU B N   1 
ATOM   3905  C CA  . LEU B 1 249 ? 6.785   -15.969 12.590  1.00 47.02  ? 229 LEU B CA  1 
ATOM   3906  C C   . LEU B 1 249 ? 6.824   -14.463 12.824  1.00 47.22  ? 229 LEU B C   1 
ATOM   3907  O O   . LEU B 1 249 ? 7.893   -13.888 12.971  1.00 46.36  ? 229 LEU B O   1 
ATOM   3908  C CB  . LEU B 1 249 ? 6.736   -16.238 11.101  1.00 46.61  ? 229 LEU B CB  1 
ATOM   3909  C CG  . LEU B 1 249 ? 7.834   -15.572 10.292  1.00 47.74  ? 229 LEU B CG  1 
ATOM   3910  C CD1 . LEU B 1 249 ? 9.187   -16.198 10.601  1.00 49.33  ? 229 LEU B CD1 1 
ATOM   3911  C CD2 . LEU B 1 249 ? 7.499   -15.703 8.820   1.00 46.58  ? 229 LEU B CD2 1 
ATOM   3912  N N   . GLY B 1 250 ? 5.655   -13.836 12.845  1.00 44.29  ? 230 GLY B N   1 
ATOM   3913  C CA  . GLY B 1 250 ? 5.561   -12.419 13.147  1.00 45.93  ? 230 GLY B CA  1 
ATOM   3914  C C   . GLY B 1 250 ? 6.012   -12.181 14.563  1.00 45.84  ? 230 GLY B C   1 
ATOM   3915  O O   . GLY B 1 250 ? 6.824   -11.293 14.821  1.00 45.53  ? 230 GLY B O   1 
ATOM   3916  N N   . ASP B 1 251 ? 5.500   -13.013 15.471  1.00 45.96  ? 231 ASP B N   1 
ATOM   3917  C CA  . ASP B 1 251 ? 5.947   -13.034 16.867  1.00 44.32  ? 231 ASP B CA  1 
ATOM   3918  C C   . ASP B 1 251 ? 7.446   -13.262 17.005  1.00 44.13  ? 231 ASP B C   1 
ATOM   3919  O O   . ASP B 1 251 ? 8.068   -12.792 17.951  1.00 40.59  ? 231 ASP B O   1 
ATOM   3920  C CB  . ASP B 1 251 ? 5.246   -14.141 17.628  1.00 44.54  ? 231 ASP B CB  1 
ATOM   3921  C CG  . ASP B 1 251 ? 3.847   -13.774 18.051  1.00 47.35  ? 231 ASP B CG  1 
ATOM   3922  O OD1 . ASP B 1 251 ? 3.255   -12.810 17.515  1.00 44.56  ? 231 ASP B OD1 1 
ATOM   3923  O OD2 . ASP B 1 251 ? 3.321   -14.476 18.935  1.00 49.64  ? 231 ASP B OD2 1 
ATOM   3924  N N   . PHE B 1 252 ? 8.021   -14.002 16.073  1.00 46.16  ? 232 PHE B N   1 
ATOM   3925  C CA  . PHE B 1 252 ? 9.424   -14.323 16.158  1.00 51.98  ? 232 PHE B CA  1 
ATOM   3926  C C   . PHE B 1 252 ? 10.287  -13.173 15.653  1.00 51.39  ? 232 PHE B C   1 
ATOM   3927  O O   . PHE B 1 252 ? 11.296  -12.812 16.257  1.00 50.93  ? 232 PHE B O   1 
ATOM   3928  C CB  . PHE B 1 252 ? 9.701   -15.596 15.364  1.00 56.80  ? 232 PHE B CB  1 
ATOM   3929  C CG  . PHE B 1 252 ? 11.113  -16.065 15.470  1.00 62.44  ? 232 PHE B CG  1 
ATOM   3930  C CD1 . PHE B 1 252 ? 11.678  -16.295 16.708  1.00 68.41  ? 232 PHE B CD1 1 
ATOM   3931  C CD2 . PHE B 1 252 ? 11.886  -16.263 14.337  1.00 69.92  ? 232 PHE B CD2 1 
ATOM   3932  C CE1 . PHE B 1 252 ? 12.992  -16.710 16.822  1.00 70.73  ? 232 PHE B CE1 1 
ATOM   3933  C CE2 . PHE B 1 252 ? 13.199  -16.688 14.442  1.00 70.68  ? 232 PHE B CE2 1 
ATOM   3934  C CZ  . PHE B 1 252 ? 13.752  -16.909 15.687  1.00 69.07  ? 232 PHE B CZ  1 
ATOM   3935  N N   . ILE B 1 253 ? 9.875   -12.606 14.531  1.00 51.84  ? 233 ILE B N   1 
ATOM   3936  C CA  . ILE B 1 253 ? 10.570  -11.482 13.943  1.00 48.41  ? 233 ILE B CA  1 
ATOM   3937  C C   . ILE B 1 253 ? 10.397  -10.292 14.858  1.00 46.31  ? 233 ILE B C   1 
ATOM   3938  O O   . ILE B 1 253 ? 11.315  -9.508  15.061  1.00 43.66  ? 233 ILE B O   1 
ATOM   3939  C CB  . ILE B 1 253 ? 9.995   -11.161 12.560  1.00 48.16  ? 233 ILE B CB  1 
ATOM   3940  C CG1 . ILE B 1 253 ? 10.566  -12.136 11.540  1.00 47.50  ? 233 ILE B CG1 1 
ATOM   3941  C CG2 . ILE B 1 253 ? 10.316  -9.733  12.159  1.00 49.37  ? 233 ILE B CG2 1 
ATOM   3942  C CD1 . ILE B 1 253 ? 9.733   -12.243 10.295  1.00 47.96  ? 233 ILE B CD1 1 
ATOM   3943  N N   . GLY B 1 254 ? 9.208   -10.186 15.430  1.00 45.10  ? 234 GLY B N   1 
ATOM   3944  C CA  . GLY B 1 254 ? 8.858   -9.032  16.228  1.00 45.12  ? 234 GLY B CA  1 
ATOM   3945  C C   . GLY B 1 254 ? 7.791   -8.284  15.473  1.00 45.40  ? 234 GLY B C   1 
ATOM   3946  O O   . GLY B 1 254 ? 8.005   -7.888  14.334  1.00 45.33  ? 234 GLY B O   1 
ATOM   3947  N N   . LEU B 1 255 ? 6.635   -8.112  16.101  1.00 45.75  ? 235 LEU B N   1 
ATOM   3948  C CA  . LEU B 1 255 ? 5.500   -7.488  15.445  1.00 44.73  ? 235 LEU B CA  1 
ATOM   3949  C C   . LEU B 1 255 ? 5.718   -6.002  15.156  1.00 46.18  ? 235 LEU B C   1 
ATOM   3950  O O   . LEU B 1 255 ? 5.232   -5.489  14.158  1.00 48.22  ? 235 LEU B O   1 
ATOM   3951  C CB  . LEU B 1 255 ? 4.247   -7.675  16.284  1.00 43.85  ? 235 LEU B CB  1 
ATOM   3952  C CG  . LEU B 1 255 ? 3.710   -9.099  16.413  1.00 43.53  ? 235 LEU B CG  1 
ATOM   3953  C CD1 . LEU B 1 255 ? 2.376   -9.049  17.115  1.00 43.27  ? 235 LEU B CD1 1 
ATOM   3954  C CD2 . LEU B 1 255 ? 3.515   -9.772  15.073  1.00 45.15  ? 235 LEU B CD2 1 
ATOM   3955  N N   . ASP B 1 256 ? 6.450   -5.324  16.025  1.00 45.60  ? 236 ASP B N   1 
ATOM   3956  C CA  . ASP B 1 256 ? 6.840   -3.933  15.789  1.00 47.84  ? 236 ASP B CA  1 
ATOM   3957  C C   . ASP B 1 256 ? 7.702   -3.845  14.537  1.00 47.77  ? 236 ASP B C   1 
ATOM   3958  O O   . ASP B 1 256 ? 7.636   -2.875  13.777  1.00 48.44  ? 236 ASP B O   1 
ATOM   3959  C CB  . ASP B 1 256 ? 7.626   -3.357  16.986  1.00 48.62  ? 236 ASP B CB  1 
ATOM   3960  C CG  . ASP B 1 256 ? 8.891   -4.179  17.342  1.00 50.70  ? 236 ASP B CG  1 
ATOM   3961  O OD1 . ASP B 1 256 ? 8.966   -5.395  17.044  1.00 55.57  ? 236 ASP B OD1 1 
ATOM   3962  O OD2 . ASP B 1 256 ? 9.812   -3.608  17.944  1.00 50.77  ? 236 ASP B OD2 1 
ATOM   3963  N N   . ILE B 1 257 ? 8.525   -4.866  14.342  1.00 46.62  ? 237 ILE B N   1 
ATOM   3964  C CA  . ILE B 1 257 ? 9.423   -4.904  13.209  1.00 47.03  ? 237 ILE B CA  1 
ATOM   3965  C C   . ILE B 1 257 ? 8.621   -5.123  11.935  1.00 47.02  ? 237 ILE B C   1 
ATOM   3966  O O   . ILE B 1 257 ? 8.954   -4.575  10.885  1.00 49.12  ? 237 ILE B O   1 
ATOM   3967  C CB  . ILE B 1 257 ? 10.459  -6.035  13.362  1.00 47.78  ? 237 ILE B CB  1 
ATOM   3968  C CG1 . ILE B 1 257 ? 11.412  -5.725  14.527  1.00 47.85  ? 237 ILE B CG1 1 
ATOM   3969  C CG2 . ILE B 1 257 ? 11.206  -6.296  12.043  1.00 44.45  ? 237 ILE B CG2 1 
ATOM   3970  C CD1 . ILE B 1 257 ? 12.459  -4.682  14.224  1.00 47.86  ? 237 ILE B CD1 1 
ATOM   3971  N N   . CYS B 1 258 ? 7.562   -5.916  12.040  1.00 43.98  ? 238 CYS B N   1 
ATOM   3972  C CA  . CYS B 1 258 ? 6.737   -6.222  10.890  1.00 42.67  ? 238 CYS B CA  1 
ATOM   3973  C C   . CYS B 1 258 ? 5.924   -5.012  10.447  1.00 44.30  ? 238 CYS B C   1 
ATOM   3974  O O   . CYS B 1 258 ? 5.752   -4.759  9.250   1.00 45.21  ? 238 CYS B O   1 
ATOM   3975  C CB  . CYS B 1 258 ? 5.782   -7.341  11.242  1.00 44.02  ? 238 CYS B CB  1 
ATOM   3976  S SG  . CYS B 1 258 ? 6.582   -8.946  11.362  1.00 45.35  ? 238 CYS B SG  1 
ATOM   3977  N N   . LEU B 1 259 ? 5.402   -4.279  11.421  1.00 42.69  ? 239 LEU B N   1 
ATOM   3978  C CA  . LEU B 1 259 ? 4.582   -3.130  11.132  1.00 42.24  ? 239 LEU B CA  1 
ATOM   3979  C C   . LEU B 1 259 ? 5.381   -2.043  10.439  1.00 41.67  ? 239 LEU B C   1 
ATOM   3980  O O   . LEU B 1 259 ? 4.891   -1.398  9.520   1.00 42.26  ? 239 LEU B O   1 
ATOM   3981  C CB  . LEU B 1 259 ? 4.004   -2.574  12.407  1.00 41.34  ? 239 LEU B CB  1 
ATOM   3982  C CG  . LEU B 1 259 ? 3.180   -1.312  12.171  1.00 42.96  ? 239 LEU B CG  1 
ATOM   3983  C CD1 . LEU B 1 259 ? 1.991   -1.582  11.264  1.00 42.09  ? 239 LEU B CD1 1 
ATOM   3984  C CD2 . LEU B 1 259 ? 2.722   -0.783  13.516  1.00 42.92  ? 239 LEU B CD2 1 
ATOM   3985  N N   . ALA B 1 260 ? 6.616   -1.867  10.891  1.00 39.93  ? 240 ALA B N   1 
ATOM   3986  C CA  . ALA B 1 260 ? 7.503   -0.838  10.374  1.00 38.69  ? 240 ALA B CA  1 
ATOM   3987  C C   . ALA B 1 260 ? 7.888   -1.158  8.966   1.00 39.84  ? 240 ALA B C   1 
ATOM   3988  O O   . ALA B 1 260 ? 8.121   -0.261  8.150   1.00 46.28  ? 240 ALA B O   1 
ATOM   3989  C CB  . ALA B 1 260 ? 8.761   -0.735  11.227  1.00 35.58  ? 240 ALA B CB  1 
ATOM   3990  N N   . ILE B 1 261 ? 7.972   -2.440  8.671   1.00 38.76  ? 241 ILE B N   1 
ATOM   3991  C CA  . ILE B 1 261 ? 8.310   -2.820  7.322   1.00 38.23  ? 241 ILE B CA  1 
ATOM   3992  C C   . ILE B 1 261 ? 7.134   -2.589  6.395   1.00 37.52  ? 241 ILE B C   1 
ATOM   3993  O O   . ILE B 1 261 ? 7.326   -2.144  5.275   1.00 34.62  ? 241 ILE B O   1 
ATOM   3994  C CB  . ILE B 1 261 ? 8.799   -4.250  7.262   1.00 37.76  ? 241 ILE B CB  1 
ATOM   3995  C CG1 . ILE B 1 261 ? 10.234  -4.255  7.770   1.00 39.57  ? 241 ILE B CG1 1 
ATOM   3996  C CG2 . ILE B 1 261 ? 8.725   -4.768  5.839   1.00 37.07  ? 241 ILE B CG2 1 
ATOM   3997  C CD1 . ILE B 1 261 ? 10.780  -5.627  8.044   1.00 42.25  ? 241 ILE B CD1 1 
ATOM   3998  N N   . MET B 1 262 ? 5.926   -2.892  6.866   1.00 38.25  ? 242 MET B N   1 
ATOM   3999  C CA  . MET B 1 262 ? 4.718   -2.621  6.089   1.00 38.22  ? 242 MET B CA  1 
ATOM   4000  C C   . MET B 1 262 ? 4.500   -1.119  5.973   1.00 38.53  ? 242 MET B C   1 
ATOM   4001  O O   . MET B 1 262 ? 4.035   -0.634  4.957   1.00 39.82  ? 242 MET B O   1 
ATOM   4002  C CB  . MET B 1 262 ? 3.486   -3.262  6.727   1.00 38.47  ? 242 MET B CB  1 
ATOM   4003  C CG  . MET B 1 262 ? 3.462   -4.780  6.704   1.00 38.57  ? 242 MET B CG  1 
ATOM   4004  S SD  . MET B 1 262 ? 3.360   -5.527  5.068   1.00 40.16  ? 242 MET B SD  1 
ATOM   4005  C CE  . MET B 1 262 ? 1.786   -4.955  4.424   1.00 39.63  ? 242 MET B CE  1 
ATOM   4006  N N   . ASP B 1 263 ? 4.835   -0.377  7.016   1.00 39.65  ? 243 ASP B N   1 
ATOM   4007  C CA  . ASP B 1 263 ? 4.756   1.087   6.950   1.00 39.68  ? 243 ASP B CA  1 
ATOM   4008  C C   . ASP B 1 263 ? 5.641   1.555   5.819   1.00 37.81  ? 243 ASP B C   1 
ATOM   4009  O O   . ASP B 1 263 ? 5.240   2.386   5.023   1.00 36.29  ? 243 ASP B O   1 
ATOM   4010  C CB  . ASP B 1 263 ? 5.223   1.753   8.254   1.00 41.01  ? 243 ASP B CB  1 
ATOM   4011  C CG  . ASP B 1 263 ? 4.167   1.731   9.355   1.00 42.03  ? 243 ASP B CG  1 
ATOM   4012  O OD1 . ASP B 1 263 ? 2.956   1.582   9.080   1.00 43.56  ? 243 ASP B OD1 1 
ATOM   4013  O OD2 . ASP B 1 263 ? 4.563   1.870   10.527  1.00 48.24  ? 243 ASP B OD2 1 
ATOM   4014  N N   . VAL B 1 264 ? 6.842   0.998   5.730   1.00 38.28  ? 244 VAL B N   1 
ATOM   4015  C CA  . VAL B 1 264 ? 7.766   1.424   4.680   1.00 39.11  ? 244 VAL B CA  1 
ATOM   4016  C C   . VAL B 1 264 ? 7.260   1.065   3.290   1.00 38.54  ? 244 VAL B C   1 
ATOM   4017  O O   . VAL B 1 264 ? 7.436   1.831   2.354   1.00 39.26  ? 244 VAL B O   1 
ATOM   4018  C CB  . VAL B 1 264 ? 9.185   0.870   4.927   1.00 39.18  ? 244 VAL B CB  1 
ATOM   4019  C CG1 . VAL B 1 264 ? 10.017  0.812   3.652   1.00 38.65  ? 244 VAL B CG1 1 
ATOM   4020  C CG2 . VAL B 1 264 ? 9.883   1.751   5.936   1.00 39.31  ? 244 VAL B CG2 1 
ATOM   4021  N N   . LEU B 1 265 ? 6.633   -0.097  3.165   1.00 38.54  ? 245 LEU B N   1 
ATOM   4022  C CA  . LEU B 1 265 ? 6.150   -0.557  1.874   1.00 38.04  ? 245 LEU B CA  1 
ATOM   4023  C C   . LEU B 1 265 ? 5.022   0.305   1.365   1.00 36.80  ? 245 LEU B C   1 
ATOM   4024  O O   . LEU B 1 265 ? 4.892   0.553   0.171   1.00 34.60  ? 245 LEU B O   1 
ATOM   4025  C CB  . LEU B 1 265 ? 5.656   -1.992  1.987   1.00 40.59  ? 245 LEU B CB  1 
ATOM   4026  C CG  . LEU B 1 265 ? 6.752   -3.052  2.041   1.00 42.52  ? 245 LEU B CG  1 
ATOM   4027  C CD1 . LEU B 1 265 ? 6.151   -4.428  2.281   1.00 41.98  ? 245 LEU B CD1 1 
ATOM   4028  C CD2 . LEU B 1 265 ? 7.542   -3.049  0.741   1.00 44.21  ? 245 LEU B CD2 1 
ATOM   4029  N N   . TYR B 1 266 ? 4.191   0.754   2.286   1.00 37.04  ? 246 TYR B N   1 
ATOM   4030  C CA  . TYR B 1 266 ? 3.054   1.585   1.936   1.00 39.39  ? 246 TYR B CA  1 
ATOM   4031  C C   . TYR B 1 266 ? 3.503   3.012   1.603   1.00 38.71  ? 246 TYR B C   1 
ATOM   4032  O O   . TYR B 1 266 ? 3.147   3.579   0.590   1.00 39.37  ? 246 TYR B O   1 
ATOM   4033  C CB  . TYR B 1 266 ? 2.079   1.563   3.093   1.00 37.69  ? 246 TYR B CB  1 
ATOM   4034  C CG  . TYR B 1 266 ? 0.829   2.328   2.850   1.00 38.29  ? 246 TYR B CG  1 
ATOM   4035  C CD1 . TYR B 1 266 ? 0.352   2.528   1.561   1.00 37.98  ? 246 TYR B CD1 1 
ATOM   4036  C CD2 . TYR B 1 266 ? 0.094   2.845   3.911   1.00 38.19  ? 246 TYR B CD2 1 
ATOM   4037  C CE1 . TYR B 1 266 ? -0.808  3.237   1.331   1.00 35.74  ? 246 TYR B CE1 1 
ATOM   4038  C CE2 . TYR B 1 266 ? -1.068  3.551   3.685   1.00 37.20  ? 246 TYR B CE2 1 
ATOM   4039  C CZ  . TYR B 1 266 ? -1.506  3.740   2.390   1.00 35.75  ? 246 TYR B CZ  1 
ATOM   4040  O OH  . TYR B 1 266 ? -2.653  4.432   2.139   1.00 38.21  ? 246 TYR B OH  1 
ATOM   4041  N N   . SER B 1 267 ? 4.334   3.548   2.469   1.00 41.75  ? 247 SER B N   1 
ATOM   4042  C CA  . SER B 1 267 ? 4.979   4.832   2.276   1.00 41.31  ? 247 SER B CA  1 
ATOM   4043  C C   . SER B 1 267 ? 5.751   4.908   0.970   1.00 41.24  ? 247 SER B C   1 
ATOM   4044  O O   . SER B 1 267 ? 5.587   5.846   0.208   1.00 40.23  ? 247 SER B O   1 
ATOM   4045  C CB  . SER B 1 267 ? 5.966   5.048   3.414   1.00 42.90  ? 247 SER B CB  1 
ATOM   4046  O OG  . SER B 1 267 ? 5.981   6.383   3.798   1.00 47.45  ? 247 SER B OG  1 
ATOM   4047  N N   . GLU B 1 268 ? 6.630   3.950   0.730   1.00 40.58  ? 248 GLU B N   1 
ATOM   4048  C CA  . GLU B 1 268 ? 7.457   4.014   -0.461  1.00 39.01  ? 248 GLU B CA  1 
ATOM   4049  C C   . GLU B 1 268 ? 6.651   3.859   -1.729  1.00 39.34  ? 248 GLU B C   1 
ATOM   4050  O O   . GLU B 1 268 ? 6.901   4.554   -2.698  1.00 44.50  ? 248 GLU B O   1 
ATOM   4051  C CB  . GLU B 1 268 ? 8.567   2.969   -0.431  1.00 39.07  ? 248 GLU B CB  1 
ATOM   4052  C CG  . GLU B 1 268 ? 9.713   3.355   0.472   1.00 39.42  ? 248 GLU B CG  1 
ATOM   4053  C CD  . GLU B 1 268 ? 10.388  4.643   0.032   1.00 41.80  ? 248 GLU B CD  1 
ATOM   4054  O OE1 . GLU B 1 268 ? 10.688  4.800   -1.174  1.00 41.39  ? 248 GLU B OE1 1 
ATOM   4055  O OE2 . GLU B 1 268 ? 10.625  5.511   0.898   1.00 46.49  ? 248 GLU B OE2 1 
ATOM   4056  N N   . THR B 1 269 ? 5.690   2.950   -1.741  1.00 39.15  ? 249 THR B N   1 
ATOM   4057  C CA  . THR B 1 269 ? 5.017   2.614   -3.000  1.00 37.44  ? 249 THR B CA  1 
ATOM   4058  C C   . THR B 1 269 ? 3.822   3.507   -3.236  1.00 36.93  ? 249 THR B C   1 
ATOM   4059  O O   . THR B 1 269 ? 3.391   3.700   -4.378  1.00 36.33  ? 249 THR B O   1 
ATOM   4060  C CB  . THR B 1 269 ? 4.518   1.149   -3.027  1.00 37.81  ? 249 THR B CB  1 
ATOM   4061  O OG1 . THR B 1 269 ? 3.634   0.908   -1.924  1.00 33.78  ? 249 THR B OG1 1 
ATOM   4062  C CG2 . THR B 1 269 ? 5.688   0.192   -2.973  1.00 38.48  ? 249 THR B CG2 1 
ATOM   4063  N N   . GLY B 1 270 ? 3.261   4.004   -2.140  1.00 35.49  ? 250 GLY B N   1 
ATOM   4064  C CA  . GLY B 1 270 ? 2.023   4.744   -2.182  1.00 38.22  ? 250 GLY B CA  1 
ATOM   4065  C C   . GLY B 1 270 ? 0.841   3.854   -2.524  1.00 41.02  ? 250 GLY B C   1 
ATOM   4066  O O   . GLY B 1 270 ? -0.212  4.366   -2.906  1.00 40.80  ? 250 GLY B O   1 
ATOM   4067  N N   . ASP B 1 271 ? 0.986   2.536   -2.360  1.00 40.90  ? 251 ASP B N   1 
ATOM   4068  C CA  . ASP B 1 271 ? -0.071  1.625   -2.764  1.00 41.67  ? 251 ASP B CA  1 
ATOM   4069  C C   . ASP B 1 271 ? -0.745  0.975   -1.574  1.00 41.24  ? 251 ASP B C   1 
ATOM   4070  O O   . ASP B 1 271 ? -0.097  0.329   -0.751  1.00 38.87  ? 251 ASP B O   1 
ATOM   4071  C CB  . ASP B 1 271 ? 0.482   0.556   -3.706  1.00 43.41  ? 251 ASP B CB  1 
ATOM   4072  C CG  . ASP B 1 271 ? -0.617  -0.288  -4.364  1.00 43.39  ? 251 ASP B CG  1 
ATOM   4073  O OD1 . ASP B 1 271 ? -1.811  -0.159  -4.017  1.00 43.07  ? 251 ASP B OD1 1 
ATOM   4074  O OD2 . ASP B 1 271 ? -0.271  -1.101  -5.244  1.00 43.69  ? 251 ASP B OD2 1 
ATOM   4075  N N   . SER B 1 272 ? -2.063  1.116   -1.527  1.00 41.04  ? 252 SER B N   1 
ATOM   4076  C CA  . SER B 1 272 ? -2.886  0.557   -0.456  1.00 40.88  ? 252 SER B CA  1 
ATOM   4077  C C   . SER B 1 272 ? -2.806  -0.948  -0.274  1.00 40.23  ? 252 SER B C   1 
ATOM   4078  O O   . SER B 1 272 ? -3.133  -1.472  0.784   1.00 41.66  ? 252 SER B O   1 
ATOM   4079  C CB  . SER B 1 272 ? -4.332  0.901   -0.715  1.00 42.68  ? 252 SER B CB  1 
ATOM   4080  O OG  . SER B 1 272 ? -4.665  1.986   0.116   1.00 50.73  ? 252 SER B OG  1 
ATOM   4081  N N   . LYS B 1 273 ? -2.439  -1.638  -1.336  1.00 37.65  ? 253 LYS B N   1 
ATOM   4082  C CA  . LYS B 1 273 ? -2.024  -3.020  -1.260  1.00 39.44  ? 253 LYS B CA  1 
ATOM   4083  C C   . LYS B 1 273 ? -1.284  -3.369  0.026   1.00 37.45  ? 253 LYS B C   1 
ATOM   4084  O O   . LYS B 1 273 ? -1.551  -4.408  0.659   1.00 39.52  ? 253 LYS B O   1 
ATOM   4085  C CB  . LYS B 1 273 ? -1.058  -3.276  -2.388  1.00 42.51  ? 253 LYS B CB  1 
ATOM   4086  C CG  . LYS B 1 273 ? -1.195  -4.632  -3.017  1.00 43.44  ? 253 LYS B CG  1 
ATOM   4087  C CD  . LYS B 1 273 ? 0.174   -5.114  -3.401  1.00 45.30  ? 253 LYS B CD  1 
ATOM   4088  C CE  . LYS B 1 273 ? 0.154   -6.595  -3.693  1.00 46.07  ? 253 LYS B CE  1 
ATOM   4089  N NZ  . LYS B 1 273 ? 0.861   -6.854  -4.966  1.00 43.48  ? 253 LYS B NZ  1 
ATOM   4090  N N   . TYR B 1 274 ? -0.353  -2.497  0.396   1.00 34.09  ? 254 TYR B N   1 
ATOM   4091  C CA  . TYR B 1 274 ? 0.555   -2.778  1.477   1.00 34.85  ? 254 TYR B CA  1 
ATOM   4092  C C   . TYR B 1 274 ? 0.185   -2.098  2.762   1.00 34.84  ? 254 TYR B C   1 
ATOM   4093  O O   . TYR B 1 274 ? 1.030   -1.948  3.653   1.00 37.54  ? 254 TYR B O   1 
ATOM   4094  C CB  . TYR B 1 274 ? 1.955   -2.345  1.093   1.00 35.50  ? 254 TYR B CB  1 
ATOM   4095  C CG  . TYR B 1 274 ? 2.374   -2.939  -0.202  1.00 35.35  ? 254 TYR B CG  1 
ATOM   4096  C CD1 . TYR B 1 274 ? 2.838   -4.245  -0.266  1.00 33.41  ? 254 TYR B CD1 1 
ATOM   4097  C CD2 . TYR B 1 274 ? 2.272   -2.211  -1.368  1.00 34.41  ? 254 TYR B CD2 1 
ATOM   4098  C CE1 . TYR B 1 274 ? 3.222   -4.789  -1.458  1.00 33.12  ? 254 TYR B CE1 1 
ATOM   4099  C CE2 . TYR B 1 274 ? 2.643   -2.754  -2.565  1.00 34.15  ? 254 TYR B CE2 1 
ATOM   4100  C CZ  . TYR B 1 274 ? 3.126   -4.035  -2.601  1.00 34.36  ? 254 TYR B CZ  1 
ATOM   4101  O OH  . TYR B 1 274 ? 3.490   -4.580  -3.810  1.00 35.90  ? 254 TYR B OH  1 
ATOM   4102  N N   . ARG B 1 275 ? -1.057  -1.672  2.892   1.00 33.44  ? 255 ARG B N   1 
ATOM   4103  C CA  . ARG B 1 275 ? -1.426  -1.080  4.153   1.00 35.16  ? 255 ARG B CA  1 
ATOM   4104  C C   . ARG B 1 275 ? -1.323  -2.118  5.230   1.00 35.87  ? 255 ARG B C   1 
ATOM   4105  O O   . ARG B 1 275 ? -1.745  -3.242  5.047   1.00 39.77  ? 255 ARG B O   1 
ATOM   4106  C CB  . ARG B 1 275 ? -2.824  -0.538  4.134   1.00 35.46  ? 255 ARG B CB  1 
ATOM   4107  C CG  . ARG B 1 275 ? -3.899  -1.581  4.020   1.00 34.33  ? 255 ARG B CG  1 
ATOM   4108  C CD  . ARG B 1 275 ? -5.103  -0.822  3.561   1.00 37.35  ? 255 ARG B CD  1 
ATOM   4109  N NE  . ARG B 1 275 ? -6.306  -1.613  3.409   1.00 38.67  ? 255 ARG B NE  1 
ATOM   4110  C CZ  . ARG B 1 275 ? -6.619  -2.300  2.313   1.00 41.64  ? 255 ARG B CZ  1 
ATOM   4111  N NH1 . ARG B 1 275 ? -5.789  -2.371  1.268   1.00 42.30  ? 255 ARG B NH1 1 
ATOM   4112  N NH2 . ARG B 1 275 ? -7.777  -2.934  2.260   1.00 41.51  ? 255 ARG B NH2 1 
ATOM   4113  N N   . PRO B 1 276 ? -0.739  -1.744  6.360   1.00 39.34  ? 256 PRO B N   1 
ATOM   4114  C CA  . PRO B 1 276 ? -0.723  -2.637  7.511   1.00 39.52  ? 256 PRO B CA  1 
ATOM   4115  C C   . PRO B 1 276 ? -2.098  -2.814  8.085   1.00 37.74  ? 256 PRO B C   1 
ATOM   4116  O O   . PRO B 1 276 ? -2.916  -1.901  8.015   1.00 39.33  ? 256 PRO B O   1 
ATOM   4117  C CB  . PRO B 1 276 ? 0.167   -1.905  8.524   1.00 39.53  ? 256 PRO B CB  1 
ATOM   4118  C CG  . PRO B 1 276 ? 0.320   -0.510  8.007   1.00 37.18  ? 256 PRO B CG  1 
ATOM   4119  C CD  . PRO B 1 276 ? 0.159   -0.595  6.535   1.00 37.70  ? 256 PRO B CD  1 
ATOM   4120  N N   . HIS B 1 277 ? -2.348  -3.982  8.651   1.00 38.10  ? 257 HIS B N   1 
ATOM   4121  C CA  . HIS B 1 277 ? -3.657  -4.236  9.205   1.00 37.17  ? 257 HIS B CA  1 
ATOM   4122  C C   . HIS B 1 277 ? -3.860  -3.468  10.525  1.00 36.61  ? 257 HIS B C   1 
ATOM   4123  O O   . HIS B 1 277 ? -2.984  -3.323  11.369  1.00 37.32  ? 257 HIS B O   1 
ATOM   4124  C CB  . HIS B 1 277 ? -3.945  -5.733  9.362   1.00 35.35  ? 257 HIS B CB  1 
ATOM   4125  C CG  . HIS B 1 277 ? -5.406  -6.030  9.473   1.00 36.26  ? 257 HIS B CG  1 
ATOM   4126  N ND1 . HIS B 1 277 ? -6.124  -5.813  10.633  1.00 35.76  ? 257 HIS B ND1 1 
ATOM   4127  C CD2 . HIS B 1 277 ? -6.303  -6.457  8.550   1.00 35.47  ? 257 HIS B CD2 1 
ATOM   4128  C CE1 . HIS B 1 277 ? -7.394  -6.113  10.427  1.00 34.35  ? 257 HIS B CE1 1 
ATOM   4129  N NE2 . HIS B 1 277 ? -7.530  -6.512  9.175   1.00 35.45  ? 257 HIS B NE2 1 
ATOM   4130  N N   . THR B 1 278 ? -5.053  -2.958  10.663  1.00 37.44  ? 258 THR B N   1 
ATOM   4131  C CA  . THR B 1 278 ? -5.462  -2.256  11.844  1.00 40.35  ? 258 THR B CA  1 
ATOM   4132  C C   . THR B 1 278 ? -5.177  -3.038  13.135  1.00 43.04  ? 258 THR B C   1 
ATOM   4133  O O   . THR B 1 278 ? -4.804  -2.467  14.156  1.00 42.62  ? 258 THR B O   1 
ATOM   4134  C CB  . THR B 1 278 ? -6.950  -1.952  11.636  1.00 42.37  ? 258 THR B CB  1 
ATOM   4135  O OG1 . THR B 1 278 ? -7.059  -0.577  11.288  1.00 44.95  ? 258 THR B OG1 1 
ATOM   4136  C CG2 . THR B 1 278 ? -7.829  -2.285  12.841  1.00 45.98  ? 258 THR B CG2 1 
ATOM   4137  N N   . LEU B 1 279 ? -5.350  -4.355  13.061  1.00 44.97  ? 259 LEU B N   1 
ATOM   4138  C CA  . LEU B 1 279 ? -5.190  -5.217  14.201  1.00 42.87  ? 259 LEU B CA  1 
ATOM   4139  C C   . LEU B 1 279 ? -3.726  -5.345  14.558  1.00 41.29  ? 259 LEU B C   1 
ATOM   4140  O O   . LEU B 1 279 ? -3.380  -5.436  15.725  1.00 41.50  ? 259 LEU B O   1 
ATOM   4141  C CB  . LEU B 1 279 ? -5.779  -6.599  13.920  1.00 43.41  ? 259 LEU B CB  1 
ATOM   4142  C CG  . LEU B 1 279 ? -5.735  -7.501  15.157  1.00 46.01  ? 259 LEU B CG  1 
ATOM   4143  C CD1 . LEU B 1 279 ? -6.500  -6.865  16.322  1.00 45.74  ? 259 LEU B CD1 1 
ATOM   4144  C CD2 . LEU B 1 279 ? -6.289  -8.880  14.838  1.00 45.97  ? 259 LEU B CD2 1 
ATOM   4145  N N   . LEU B 1 280 ? -2.869  -5.363  13.551  1.00 38.80  ? 260 LEU B N   1 
ATOM   4146  C CA  . LEU B 1 280 ? -1.447  -5.410  13.797  1.00 40.89  ? 260 LEU B CA  1 
ATOM   4147  C C   . LEU B 1 280 ? -0.974  -4.137  14.494  1.00 42.03  ? 260 LEU B C   1 
ATOM   4148  O O   . LEU B 1 280 ? -0.110  -4.186  15.348  1.00 47.05  ? 260 LEU B O   1 
ATOM   4149  C CB  . LEU B 1 280 ? -0.711  -5.606  12.482  1.00 41.38  ? 260 LEU B CB  1 
ATOM   4150  C CG  . LEU B 1 280 ? 0.793   -5.427  12.542  1.00 41.91  ? 260 LEU B CG  1 
ATOM   4151  C CD1 . LEU B 1 280 ? 1.441   -6.476  13.436  1.00 42.97  ? 260 LEU B CD1 1 
ATOM   4152  C CD2 . LEU B 1 280 ? 1.321   -5.524  11.131  1.00 42.56  ? 260 LEU B CD2 1 
ATOM   4153  N N   . LYS B 1 281 ? -1.540  -2.997  14.131  1.00 43.07  ? 261 LYS B N   1 
ATOM   4154  C CA  . LYS B 1 281 ? -1.190  -1.756  14.801  1.00 42.38  ? 261 LYS B CA  1 
ATOM   4155  C C   . LYS B 1 281 ? -1.558  -1.863  16.260  1.00 41.89  ? 261 LYS B C   1 
ATOM   4156  O O   . LYS B 1 281 ? -0.798  -1.469  17.139  1.00 44.37  ? 261 LYS B O   1 
ATOM   4157  C CB  . LYS B 1 281 ? -1.932  -0.580  14.189  1.00 41.60  ? 261 LYS B CB  1 
ATOM   4158  C CG  . LYS B 1 281 ? -1.297  -0.093  12.902  1.00 43.96  ? 261 LYS B CG  1 
ATOM   4159  C CD  . LYS B 1 281 ? -2.252  0.742   12.064  1.00 43.40  ? 261 LYS B CD  1 
ATOM   4160  C CE  . LYS B 1 281 ? -1.516  1.489   10.966  1.00 41.82  ? 261 LYS B CE  1 
ATOM   4161  N NZ  . LYS B 1 281 ? -2.412  2.473   10.303  1.00 40.50  ? 261 LYS B NZ  1 
ATOM   4162  N N   . LYS B 1 282 ? -2.733  -2.413  16.502  1.00 39.48  ? 262 LYS B N   1 
ATOM   4163  C CA  . LYS B 1 282 ? -3.262  -2.478  17.836  1.00 40.97  ? 262 LYS B CA  1 
ATOM   4164  C C   . LYS B 1 282 ? -2.431  -3.400  18.776  1.00 43.83  ? 262 LYS B C   1 
ATOM   4165  O O   . LYS B 1 282 ? -2.211  -3.060  19.938  1.00 43.78  ? 262 LYS B O   1 
ATOM   4166  C CB  . LYS B 1 282 ? -4.734  -2.867  17.776  1.00 38.89  ? 262 LYS B CB  1 
ATOM   4167  C CG  . LYS B 1 282 ? -5.329  -3.073  19.150  1.00 39.40  ? 262 LYS B CG  1 
ATOM   4168  C CD  . LYS B 1 282 ? -6.803  -2.772  19.142  1.00 39.63  ? 262 LYS B CD  1 
ATOM   4169  C CE  . LYS B 1 282 ? -7.592  -4.045  18.979  1.00 40.41  ? 262 LYS B CE  1 
ATOM   4170  N NZ  . LYS B 1 282 ? -8.979  -3.737  18.561  1.00 40.66  ? 262 LYS B NZ  1 
ATOM   4171  N N   . TYR B 1 283 ? -1.946  -4.533  18.275  1.00 45.24  ? 263 TYR B N   1 
ATOM   4172  C CA  . TYR B 1 283 ? -1.043  -5.369  19.072  1.00 46.40  ? 263 TYR B CA  1 
ATOM   4173  C C   . TYR B 1 283 ? 0.241   -4.624  19.364  1.00 47.75  ? 263 TYR B C   1 
ATOM   4174  O O   . TYR B 1 283 ? 0.740   -4.659  20.484  1.00 55.11  ? 263 TYR B O   1 
ATOM   4175  C CB  . TYR B 1 283 ? -0.678  -6.652  18.353  1.00 47.58  ? 263 TYR B CB  1 
ATOM   4176  C CG  . TYR B 1 283 ? -1.648  -7.801  18.534  1.00 48.55  ? 263 TYR B CG  1 
ATOM   4177  C CD1 . TYR B 1 283 ? -2.902  -7.792  17.919  1.00 48.47  ? 263 TYR B CD1 1 
ATOM   4178  C CD2 . TYR B 1 283 ? -1.285  -8.930  19.272  1.00 48.74  ? 263 TYR B CD2 1 
ATOM   4179  C CE1 . TYR B 1 283 ? -3.782  -8.851  18.066  1.00 49.89  ? 263 TYR B CE1 1 
ATOM   4180  C CE2 . TYR B 1 283 ? -2.155  -9.996  19.423  1.00 47.90  ? 263 TYR B CE2 1 
ATOM   4181  C CZ  . TYR B 1 283 ? -3.404  -9.953  18.820  1.00 50.12  ? 263 TYR B CZ  1 
ATOM   4182  O OH  . TYR B 1 283 ? -4.286  -11.001 18.949  1.00 45.09  ? 263 TYR B OH  1 
ATOM   4183  N N   . VAL B 1 284 ? 0.785   -3.942  18.366  1.00 48.38  ? 264 VAL B N   1 
ATOM   4184  C CA  . VAL B 1 284 ? 2.050   -3.235  18.577  1.00 47.70  ? 264 VAL B CA  1 
ATOM   4185  C C   . VAL B 1 284 ? 1.870   -2.134  19.597  1.00 48.69  ? 264 VAL B C   1 
ATOM   4186  O O   . VAL B 1 284 ? 2.792   -1.817  20.347  1.00 48.42  ? 264 VAL B O   1 
ATOM   4187  C CB  . VAL B 1 284 ? 2.623   -2.613  17.293  1.00 47.12  ? 264 VAL B CB  1 
ATOM   4188  C CG1 . VAL B 1 284 ? 3.781   -1.677  17.621  1.00 45.36  ? 264 VAL B CG1 1 
ATOM   4189  C CG2 . VAL B 1 284 ? 3.131   -3.691  16.354  1.00 47.30  ? 264 VAL B CG2 1 
ATOM   4190  N N   . ARG B 1 285 ? 0.687   -1.548  19.626  1.00 49.15  ? 265 ARG B N   1 
ATOM   4191  C CA  . ARG B 1 285 ? 0.433   -0.456  20.541  1.00 51.78  ? 265 ARG B CA  1 
ATOM   4192  C C   . ARG B 1 285 ? 0.247   -0.902  21.965  1.00 54.91  ? 265 ARG B C   1 
ATOM   4193  O O   . ARG B 1 285 ? 0.451   -0.124  22.885  1.00 54.93  ? 265 ARG B O   1 
ATOM   4194  C CB  . ARG B 1 285 ? -0.813  0.280   20.134  1.00 51.40  ? 265 ARG B CB  1 
ATOM   4195  C CG  . ARG B 1 285 ? -0.510  1.363   19.149  1.00 49.78  ? 265 ARG B CG  1 
ATOM   4196  C CD  . ARG B 1 285 ? -1.787  1.711   18.454  1.00 50.54  ? 265 ARG B CD  1 
ATOM   4197  N NE  . ARG B 1 285 ? -1.611  2.828   17.548  1.00 50.13  ? 265 ARG B NE  1 
ATOM   4198  C CZ  . ARG B 1 285 ? -2.478  3.138   16.598  1.00 47.44  ? 265 ARG B CZ  1 
ATOM   4199  N NH1 . ARG B 1 285 ? -3.574  2.419   16.433  1.00 47.50  ? 265 ARG B NH1 1 
ATOM   4200  N NH2 . ARG B 1 285 ? -2.250  4.165   15.815  1.00 48.08  ? 265 ARG B NH2 1 
ATOM   4201  N N   . ALA B 1 286 ? -0.191  -2.141  22.140  1.00 58.75  ? 266 ALA B N   1 
ATOM   4202  C CA  . ALA B 1 286 ? -0.311  -2.711  23.471  1.00 57.41  ? 266 ALA B CA  1 
ATOM   4203  C C   . ALA B 1 286 ? 1.066   -3.074  23.992  1.00 56.34  ? 266 ALA B C   1 
ATOM   4204  O O   . ALA B 1 286 ? 1.255   -3.189  25.191  1.00 55.67  ? 266 ALA B O   1 
ATOM   4205  C CB  . ALA B 1 286 ? -1.199  -3.933  23.446  1.00 57.94  ? 266 ALA B CB  1 
ATOM   4206  N N   . GLY B 1 287 ? 2.018   -3.251  23.080  1.00 53.69  ? 267 GLY B N   1 
ATOM   4207  C CA  . GLY B 1 287 ? 3.368   -3.647  23.434  1.00 51.20  ? 267 GLY B CA  1 
ATOM   4208  C C   . GLY B 1 287 ? 3.503   -5.151  23.374  1.00 50.39  ? 267 GLY B C   1 
ATOM   4209  O O   . GLY B 1 287 ? 4.482   -5.709  23.877  1.00 50.10  ? 267 GLY B O   1 
ATOM   4210  N N   . TRP B 1 288 ? 2.518   -5.805  22.756  1.00 48.60  ? 268 TRP B N   1 
ATOM   4211  C CA  . TRP B 1 288 ? 2.551   -7.253  22.547  1.00 44.66  ? 268 TRP B CA  1 
ATOM   4212  C C   . TRP B 1 288 ? 3.286   -7.553  21.280  1.00 43.68  ? 268 TRP B C   1 
ATOM   4213  O O   . TRP B 1 288 ? 2.692   -7.947  20.277  1.00 41.17  ? 268 TRP B O   1 
ATOM   4214  C CB  . TRP B 1 288 ? 1.157   -7.831  22.443  1.00 43.70  ? 268 TRP B CB  1 
ATOM   4215  C CG  . TRP B 1 288 ? 0.376   -7.584  23.626  1.00 42.30  ? 268 TRP B CG  1 
ATOM   4216  C CD1 . TRP B 1 288 ? 0.802   -6.981  24.777  1.00 42.63  ? 268 TRP B CD1 1 
ATOM   4217  C CD2 . TRP B 1 288 ? -0.992  -7.934  23.830  1.00 41.89  ? 268 TRP B CD2 1 
ATOM   4218  N NE1 . TRP B 1 288 ? -0.231  -6.914  25.675  1.00 43.70  ? 268 TRP B NE1 1 
ATOM   4219  C CE2 . TRP B 1 288 ? -1.344  -7.487  25.118  1.00 42.68  ? 268 TRP B CE2 1 
ATOM   4220  C CE3 . TRP B 1 288 ? -1.960  -8.567  23.044  1.00 43.46  ? 268 TRP B CE3 1 
ATOM   4221  C CZ2 . TRP B 1 288 ? -2.622  -7.660  25.647  1.00 44.01  ? 268 TRP B CZ2 1 
ATOM   4222  C CZ3 . TRP B 1 288 ? -3.238  -8.747  23.574  1.00 44.26  ? 268 TRP B CZ3 1 
ATOM   4223  C CH2 . TRP B 1 288 ? -3.556  -8.292  24.866  1.00 43.70  ? 268 TRP B CH2 1 
ATOM   4224  N N   . LEU B 1 289 ? 4.595   -7.386  21.355  1.00 43.74  ? 269 LEU B N   1 
ATOM   4225  C CA  . LEU B 1 289 ? 5.444   -7.449  20.193  1.00 45.70  ? 269 LEU B CA  1 
ATOM   4226  C C   . LEU B 1 289 ? 5.894   -8.851  19.838  1.00 49.45  ? 269 LEU B C   1 
ATOM   4227  O O   . LEU B 1 289 ? 6.659   -9.014  18.897  1.00 51.26  ? 269 LEU B O   1 
ATOM   4228  C CB  . LEU B 1 289 ? 6.666   -6.570  20.429  1.00 46.89  ? 269 LEU B CB  1 
ATOM   4229  C CG  . LEU B 1 289 ? 6.352   -5.147  20.913  1.00 48.42  ? 269 LEU B CG  1 
ATOM   4230  C CD1 . LEU B 1 289 ? 7.631   -4.331  20.901  1.00 49.00  ? 269 LEU B CD1 1 
ATOM   4231  C CD2 . LEU B 1 289 ? 5.290   -4.464  20.063  1.00 47.40  ? 269 LEU B CD2 1 
ATOM   4232  N N   . GLY B 1 290 ? 5.431   -9.859  20.575  1.00 54.24  ? 270 GLY B N   1 
ATOM   4233  C CA  . GLY B 1 290 ? 5.803   -11.254 20.300  1.00 57.10  ? 270 GLY B CA  1 
ATOM   4234  C C   . GLY B 1 290 ? 6.723   -11.879 21.335  1.00 58.67  ? 270 GLY B C   1 
ATOM   4235  O O   . GLY B 1 290 ? 6.621   -11.589 22.526  1.00 56.52  ? 270 GLY B O   1 
ATOM   4236  N N   . ARG B 1 291 ? 7.617   -12.746 20.866  1.00 61.69  ? 271 ARG B N   1 
ATOM   4237  C CA  . ARG B 1 291 ? 8.517   -13.502 21.738  1.00 64.37  ? 271 ARG B CA  1 
ATOM   4238  C C   . ARG B 1 291 ? 9.307   -12.593 22.670  1.00 63.33  ? 271 ARG B C   1 
ATOM   4239  O O   . ARG B 1 291 ? 9.281   -12.765 23.890  1.00 64.16  ? 271 ARG B O   1 
ATOM   4240  C CB  . ARG B 1 291 ? 9.497   -14.333 20.908  1.00 68.93  ? 271 ARG B CB  1 
ATOM   4241  C CG  . ARG B 1 291 ? 9.089   -15.781 20.692  1.00 74.99  ? 271 ARG B CG  1 
ATOM   4242  C CD  . ARG B 1 291 ? 10.236  -16.577 20.070  1.00 83.28  ? 271 ARG B CD  1 
ATOM   4243  N NE  . ARG B 1 291 ? 11.038  -17.313 21.063  1.00 92.93  ? 271 ARG B NE  1 
ATOM   4244  C CZ  . ARG B 1 291 ? 12.375  -17.284 21.190  1.00 96.27  ? 271 ARG B CZ  1 
ATOM   4245  N NH1 . ARG B 1 291 ? 13.158  -16.562 20.382  1.00 96.04  ? 271 ARG B NH1 1 
ATOM   4246  N NH2 . ARG B 1 291 ? 12.946  -18.006 22.149  1.00 95.90  ? 271 ARG B NH2 1 
ATOM   4247  N N   . LYS B 1 292 ? 9.992   -11.620 22.081  1.00 62.11  ? 272 LYS B N   1 
ATOM   4248  C CA  . LYS B 1 292 ? 10.847  -10.679 22.811  1.00 63.89  ? 272 LYS B CA  1 
ATOM   4249  C C   . LYS B 1 292 ? 10.185  -10.005 24.016  1.00 63.08  ? 272 LYS B C   1 
ATOM   4250  O O   . LYS B 1 292 ? 10.870  -9.546  24.922  1.00 69.05  ? 272 LYS B O   1 
ATOM   4251  C CB  . LYS B 1 292 ? 11.295  -9.564  21.866  1.00 69.29  ? 272 LYS B CB  1 
ATOM   4252  C CG  . LYS B 1 292 ? 10.121  -8.724  21.349  1.00 72.54  ? 272 LYS B CG  1 
ATOM   4253  C CD  . LYS B 1 292 ? 10.528  -7.341  20.883  1.00 70.13  ? 272 LYS B CD  1 
ATOM   4254  C CE  . LYS B 1 292 ? 10.718  -7.320  19.381  1.00 69.82  ? 272 LYS B CE  1 
ATOM   4255  N NZ  . LYS B 1 292 ? 11.642  -6.233  18.981  1.00 70.43  ? 272 LYS B NZ  1 
ATOM   4256  N N   . SER B 1 293 ? 8.867   -9.885  23.997  1.00 58.90  ? 273 SER B N   1 
ATOM   4257  C CA  . SER B 1 293 ? 8.159   -9.180  25.054  1.00 57.83  ? 273 SER B CA  1 
ATOM   4258  C C   . SER B 1 293 ? 7.284   -10.141 25.872  1.00 56.58  ? 273 SER B C   1 
ATOM   4259  O O   . SER B 1 293 ? 6.580   -9.715  26.796  1.00 53.10  ? 273 SER B O   1 
ATOM   4260  C CB  . SER B 1 293 ? 7.325   -8.034  24.448  1.00 57.66  ? 273 SER B CB  1 
ATOM   4261  O OG  . SER B 1 293 ? 6.033   -8.467  24.052  1.00 58.67  ? 273 SER B OG  1 
ATOM   4262  N N   . GLY B 1 294 ? 7.326   -11.427 25.523  1.00 53.47  ? 274 GLY B N   1 
ATOM   4263  C CA  . GLY B 1 294 ? 6.534   -12.436 26.209  1.00 53.53  ? 274 GLY B CA  1 
ATOM   4264  C C   . GLY B 1 294 ? 5.103   -12.598 25.738  1.00 55.67  ? 274 GLY B C   1 
ATOM   4265  O O   . GLY B 1 294 ? 4.381   -13.468 26.235  1.00 55.20  ? 274 GLY B O   1 
ATOM   4266  N N   . LYS B 1 295 ? 4.677   -11.785 24.776  1.00 56.48  ? 275 LYS B N   1 
ATOM   4267  C CA  . LYS B 1 295 ? 3.326   -11.909 24.274  1.00 53.81  ? 275 LYS B CA  1 
ATOM   4268  C C   . LYS B 1 295 ? 3.140   -11.295 22.900  1.00 50.93  ? 275 LYS B C   1 
ATOM   4269  O O   . LYS B 1 295 ? 3.566   -10.178 22.625  1.00 45.96  ? 275 LYS B O   1 
ATOM   4270  C CB  . LYS B 1 295 ? 2.354   -11.263 25.244  1.00 54.10  ? 275 LYS B CB  1 
ATOM   4271  C CG  . LYS B 1 295 ? 0.985   -11.915 25.227  1.00 57.38  ? 275 LYS B CG  1 
ATOM   4272  C CD  . LYS B 1 295 ? -0.092  -10.854 25.326  1.00 60.06  ? 275 LYS B CD  1 
ATOM   4273  C CE  . LYS B 1 295 ? -1.189  -11.238 26.296  1.00 61.93  ? 275 LYS B CE  1 
ATOM   4274  N NZ  . LYS B 1 295 ? -2.417  -11.647 25.573  1.00 63.45  ? 275 LYS B NZ  1 
ATOM   4275  N N   . GLY B 1 296 ? 2.461   -12.035 22.049  1.00 47.87  ? 276 GLY B N   1 
ATOM   4276  C CA  . GLY B 1 296 ? 2.232   -11.606 20.685  1.00 49.35  ? 276 GLY B CA  1 
ATOM   4277  C C   . GLY B 1 296 ? 0.899   -12.158 20.296  1.00 46.33  ? 276 GLY B C   1 
ATOM   4278  O O   . GLY B 1 296 ? -0.071  -12.001 21.003  1.00 46.98  ? 276 GLY B O   1 
ATOM   4279  N N   . PHE B 1 297 ? 0.844   -12.835 19.178  1.00 49.45  ? 277 PHE B N   1 
ATOM   4280  C CA  . PHE B 1 297 ? -0.346  -13.590 18.869  1.00 52.42  ? 277 PHE B CA  1 
ATOM   4281  C C   . PHE B 1 297 ? -0.404  -14.822 19.736  1.00 53.40  ? 277 PHE B C   1 
ATOM   4282  O O   . PHE B 1 297 ? -1.470  -15.384 19.939  1.00 56.78  ? 277 PHE B O   1 
ATOM   4283  C CB  . PHE B 1 297 ? -0.366  -13.948 17.397  1.00 53.22  ? 277 PHE B CB  1 
ATOM   4284  C CG  . PHE B 1 297 ? -0.582  -12.764 16.535  1.00 51.89  ? 277 PHE B CG  1 
ATOM   4285  C CD1 . PHE B 1 297 ? -1.814  -12.123 16.548  1.00 51.94  ? 277 PHE B CD1 1 
ATOM   4286  C CD2 . PHE B 1 297 ? 0.442   -12.250 15.766  1.00 51.23  ? 277 PHE B CD2 1 
ATOM   4287  C CE1 . PHE B 1 297 ? -2.030  -11.000 15.787  1.00 50.04  ? 277 PHE B CE1 1 
ATOM   4288  C CE2 . PHE B 1 297 ? 0.234   -11.127 15.002  1.00 51.23  ? 277 PHE B CE2 1 
ATOM   4289  C CZ  . PHE B 1 297 ? -1.002  -10.500 15.014  1.00 50.26  ? 277 PHE B CZ  1 
ATOM   4290  N N   . TYR B 1 298 ? 0.753   -15.239 20.228  1.00 53.50  ? 278 TYR B N   1 
ATOM   4291  C CA  . TYR B 1 298 ? 0.820   -16.267 21.237  1.00 56.75  ? 278 TYR B CA  1 
ATOM   4292  C C   . TYR B 1 298 ? 1.329   -15.701 22.539  1.00 57.29  ? 278 TYR B C   1 
ATOM   4293  O O   . TYR B 1 298 ? 2.087   -14.748 22.567  1.00 57.36  ? 278 TYR B O   1 
ATOM   4294  C CB  . TYR B 1 298 ? 1.789   -17.354 20.827  1.00 56.63  ? 278 TYR B CB  1 
ATOM   4295  C CG  . TYR B 1 298 ? 1.402   -18.096 19.597  1.00 56.06  ? 278 TYR B CG  1 
ATOM   4296  C CD1 . TYR B 1 298 ? 1.892   -17.713 18.364  1.00 53.82  ? 278 TYR B CD1 1 
ATOM   4297  C CD2 . TYR B 1 298 ? 0.585   -19.216 19.668  1.00 54.38  ? 278 TYR B CD2 1 
ATOM   4298  C CE1 . TYR B 1 298 ? 1.554   -18.405 17.228  1.00 51.73  ? 278 TYR B CE1 1 
ATOM   4299  C CE2 . TYR B 1 298 ? 0.244   -19.914 18.532  1.00 52.81  ? 278 TYR B CE2 1 
ATOM   4300  C CZ  . TYR B 1 298 ? 0.732   -19.498 17.319  1.00 51.27  ? 278 TYR B CZ  1 
ATOM   4301  O OH  . TYR B 1 298 ? 0.402   -20.185 16.196  1.00 44.12  ? 278 TYR B OH  1 
ATOM   4302  N N   . ASP B 1 299 ? 0.923   -16.339 23.619  1.00 62.77  ? 279 ASP B N   1 
ATOM   4303  C CA  . ASP B 1 299 ? 1.450   -16.055 24.940  1.00 64.89  ? 279 ASP B CA  1 
ATOM   4304  C C   . ASP B 1 299 ? 2.757   -16.840 25.123  1.00 63.73  ? 279 ASP B C   1 
ATOM   4305  O O   . ASP B 1 299 ? 2.812   -18.016 24.779  1.00 56.53  ? 279 ASP B O   1 
ATOM   4306  C CB  . ASP B 1 299 ? 0.412   -16.496 25.962  1.00 69.25  ? 279 ASP B CB  1 
ATOM   4307  C CG  . ASP B 1 299 ? 0.281   -15.532 27.094  1.00 76.20  ? 279 ASP B CG  1 
ATOM   4308  O OD1 . ASP B 1 299 ? 1.275   -15.380 27.837  1.00 80.75  ? 279 ASP B OD1 1 
ATOM   4309  O OD2 . ASP B 1 299 ? -0.809  -14.926 27.235  1.00 77.42  ? 279 ASP B OD2 1 
ATOM   4310  N N   . TYR B 1 300 ? 3.805   -16.212 25.653  1.00 64.40  ? 280 TYR B N   1 
ATOM   4311  C CA  . TYR B 1 300 ? 5.122   -16.883 25.753  1.00 64.31  ? 280 TYR B CA  1 
ATOM   4312  C C   . TYR B 1 300 ? 5.690   -17.029 27.172  1.00 62.63  ? 280 TYR B C   1 
ATOM   4313  O O   . TYR B 1 300 ? 4.975   -16.910 28.163  1.00 65.17  ? 280 TYR B O   1 
ATOM   4314  C CB  . TYR B 1 300 ? 6.142   -16.158 24.875  1.00 64.66  ? 280 TYR B CB  1 
ATOM   4315  C CG  . TYR B 1 300 ? 5.856   -16.294 23.400  1.00 65.29  ? 280 TYR B CG  1 
ATOM   4316  C CD1 . TYR B 1 300 ? 5.078   -15.360 22.736  1.00 64.73  ? 280 TYR B CD1 1 
ATOM   4317  C CD2 . TYR B 1 300 ? 6.355   -17.365 22.673  1.00 62.19  ? 280 TYR B CD2 1 
ATOM   4318  C CE1 . TYR B 1 300 ? 4.808   -15.490 21.391  1.00 62.57  ? 280 TYR B CE1 1 
ATOM   4319  C CE2 . TYR B 1 300 ? 6.089   -17.499 21.327  1.00 60.77  ? 280 TYR B CE2 1 
ATOM   4320  C CZ  . TYR B 1 300 ? 5.316   -16.559 20.692  1.00 60.39  ? 280 TYR B CZ  1 
ATOM   4321  O OH  . TYR B 1 300 ? 5.043   -16.692 19.356  1.00 56.62  ? 280 TYR B OH  1 
ATOM   4322  N N   . MET C 1 21  ? -19.755 -42.416 10.583  1.00 71.66  ? 1   MET C N   1 
ATOM   4323  C CA  . MET C 1 21  ? -19.613 -42.327 9.097   1.00 72.58  ? 1   MET C CA  1 
ATOM   4324  C C   . MET C 1 21  ? -18.850 -43.517 8.566   1.00 68.96  ? 1   MET C C   1 
ATOM   4325  O O   . MET C 1 21  ? -17.787 -43.871 9.076   1.00 62.54  ? 1   MET C O   1 
ATOM   4326  C CB  . MET C 1 21  ? -18.891 -41.058 8.686   1.00 75.67  ? 1   MET C CB  1 
ATOM   4327  C CG  . MET C 1 21  ? -19.641 -39.806 9.078   1.00 81.27  ? 1   MET C CG  1 
ATOM   4328  S SD  . MET C 1 21  ? -19.340 -38.472 7.918   1.00 88.42  ? 1   MET C SD  1 
ATOM   4329  C CE  . MET C 1 21  ? -20.943 -38.400 7.149   1.00 88.68  ? 1   MET C CE  1 
ATOM   4330  N N   . LYS C 1 22  ? -19.399 -44.118 7.524   1.00 65.68  ? 2   LYS C N   1 
ATOM   4331  C CA  . LYS C 1 22  ? -18.898 -45.392 7.047   1.00 66.63  ? 2   LYS C CA  1 
ATOM   4332  C C   . LYS C 1 22  ? -18.815 -45.496 5.538   1.00 59.84  ? 2   LYS C C   1 
ATOM   4333  O O   . LYS C 1 22  ? -17.913 -46.141 5.020   1.00 59.09  ? 2   LYS C O   1 
ATOM   4334  C CB  . LYS C 1 22  ? -19.757 -46.517 7.615   1.00 71.94  ? 2   LYS C CB  1 
ATOM   4335  C CG  . LYS C 1 22  ? -19.274 -46.966 8.986   1.00 80.08  ? 2   LYS C CG  1 
ATOM   4336  C CD  . LYS C 1 22  ? -20.339 -47.753 9.741   1.00 86.15  ? 2   LYS C CD  1 
ATOM   4337  C CE  . LYS C 1 22  ? -19.963 -47.980 11.201  1.00 86.54  ? 2   LYS C CE  1 
ATOM   4338  N NZ  . LYS C 1 22  ? -20.876 -47.253 12.129  1.00 88.55  ? 2   LYS C NZ  1 
ATOM   4339  N N   . LYS C 1 23  ? -19.753 -44.886 4.831   1.00 56.19  ? 3   LYS C N   1 
ATOM   4340  C CA  . LYS C 1 23  ? -19.715 -44.919 3.395   1.00 54.32  ? 3   LYS C CA  1 
ATOM   4341  C C   . LYS C 1 23  ? -19.575 -43.516 2.841   1.00 54.98  ? 3   LYS C C   1 
ATOM   4342  O O   . LYS C 1 23  ? -20.267 -42.585 3.265   1.00 57.86  ? 3   LYS C O   1 
ATOM   4343  C CB  . LYS C 1 23  ? -20.959 -45.579 2.842   1.00 54.42  ? 3   LYS C CB  1 
ATOM   4344  C CG  . LYS C 1 23  ? -20.668 -46.504 1.683   1.00 54.98  ? 3   LYS C CG  1 
ATOM   4345  C CD  . LYS C 1 23  ? -21.833 -46.520 0.723   1.00 59.61  ? 3   LYS C CD  1 
ATOM   4346  C CE  . LYS C 1 23  ? -22.094 -47.898 0.152   1.00 62.86  ? 3   LYS C CE  1 
ATOM   4347  N NZ  . LYS C 1 23  ? -23.325 -47.854 -0.684  1.00 65.71  ? 3   LYS C NZ  1 
ATOM   4348  N N   . VAL C 1 24  ? -18.672 -43.394 1.881   1.00 51.22  ? 4   VAL C N   1 
ATOM   4349  C CA  . VAL C 1 24  ? -18.315 -42.122 1.305   1.00 50.51  ? 4   VAL C CA  1 
ATOM   4350  C C   . VAL C 1 24  ? -18.416 -42.209 -0.201  1.00 49.64  ? 4   VAL C C   1 
ATOM   4351  O O   . VAL C 1 24  ? -17.975 -43.184 -0.795  1.00 49.53  ? 4   VAL C O   1 
ATOM   4352  C CB  . VAL C 1 24  ? -16.877 -41.778 1.682   1.00 51.20  ? 4   VAL C CB  1 
ATOM   4353  C CG1 . VAL C 1 24  ? -16.399 -40.568 0.914   1.00 53.64  ? 4   VAL C CG1 1 
ATOM   4354  C CG2 . VAL C 1 24  ? -16.797 -41.518 3.169   1.00 50.06  ? 4   VAL C CG2 1 
ATOM   4355  N N   . CYS C 1 25  ? -18.991 -41.188 -0.814  1.00 47.87  ? 5   CYS C N   1 
ATOM   4356  C CA  . CYS C 1 25  ? -19.043 -41.107 -2.259  1.00 50.47  ? 5   CYS C CA  1 
ATOM   4357  C C   . CYS C 1 25  ? -18.208 -39.922 -2.723  1.00 53.45  ? 5   CYS C C   1 
ATOM   4358  O O   . CYS C 1 25  ? -18.323 -38.825 -2.174  1.00 53.05  ? 5   CYS C O   1 
ATOM   4359  C CB  . CYS C 1 25  ? -20.478 -40.918 -2.718  1.00 51.58  ? 5   CYS C CB  1 
ATOM   4360  S SG  . CYS C 1 25  ? -20.672 -40.784 -4.511  1.00 60.27  ? 5   CYS C SG  1 
ATOM   4361  N N   . VAL C 1 26  ? -17.364 -40.138 -3.727  1.00 52.85  ? 6   VAL C N   1 
ATOM   4362  C CA  . VAL C 1 26  ? -16.602 -39.047 -4.311  1.00 48.25  ? 6   VAL C CA  1 
ATOM   4363  C C   . VAL C 1 26  ? -17.070 -38.846 -5.720  1.00 46.05  ? 6   VAL C C   1 
ATOM   4364  O O   . VAL C 1 26  ? -17.096 -39.783 -6.491  1.00 48.52  ? 6   VAL C O   1 
ATOM   4365  C CB  . VAL C 1 26  ? -15.098 -39.330 -4.329  1.00 49.03  ? 6   VAL C CB  1 
ATOM   4366  C CG1 . VAL C 1 26  ? -14.360 -38.220 -5.050  1.00 50.65  ? 6   VAL C CG1 1 
ATOM   4367  C CG2 . VAL C 1 26  ? -14.566 -39.415 -2.922  1.00 48.53  ? 6   VAL C CG2 1 
ATOM   4368  N N   . ILE C 1 27  ? -17.419 -37.615 -6.053  1.00 47.99  ? 7   ILE C N   1 
ATOM   4369  C CA  . ILE C 1 27  ? -17.863 -37.274 -7.399  1.00 49.95  ? 7   ILE C CA  1 
ATOM   4370  C C   . ILE C 1 27  ? -16.705 -36.646 -8.163  1.00 51.69  ? 7   ILE C C   1 
ATOM   4371  O O   . ILE C 1 27  ? -16.197 -35.589 -7.771  1.00 52.02  ? 7   ILE C O   1 
ATOM   4372  C CB  . ILE C 1 27  ? -18.987 -36.237 -7.359  1.00 49.91  ? 7   ILE C CB  1 
ATOM   4373  C CG1 . ILE C 1 27  ? -20.021 -36.616 -6.297  1.00 51.68  ? 7   ILE C CG1 1 
ATOM   4374  C CG2 . ILE C 1 27  ? -19.607 -36.093 -8.739  1.00 48.32  ? 7   ILE C CG2 1 
ATOM   4375  C CD1 . ILE C 1 27  ? -20.987 -37.677 -6.749  1.00 52.36  ? 7   ILE C CD1 1 
ATOM   4376  N N   . GLY C 1 28  ? -16.306 -37.276 -9.259  1.00 48.90  ? 8   GLY C N   1 
ATOM   4377  C CA  . GLY C 1 28  ? -15.156 -36.801 -10.011 1.00 47.87  ? 8   GLY C CA  1 
ATOM   4378  C C   . GLY C 1 28  ? -13.921 -37.635 -9.739  1.00 46.24  ? 8   GLY C C   1 
ATOM   4379  O O   . GLY C 1 28  ? -13.451 -37.755 -8.604  1.00 42.80  ? 8   GLY C O   1 
ATOM   4380  N N   . ALA C 1 29  ? -13.404 -38.217 -10.805 1.00 48.03  ? 9   ALA C N   1 
ATOM   4381  C CA  . ALA C 1 29  ? -12.301 -39.151 -10.710 1.00 53.79  ? 9   ALA C CA  1 
ATOM   4382  C C   . ALA C 1 29  ? -11.076 -38.572 -11.379 1.00 53.99  ? 9   ALA C C   1 
ATOM   4383  O O   . ALA C 1 29  ? -10.301 -39.289 -11.991 1.00 50.27  ? 9   ALA C O   1 
ATOM   4384  C CB  . ALA C 1 29  ? -12.679 -40.473 -11.353 1.00 56.85  ? 9   ALA C CB  1 
ATOM   4385  N N   . GLY C 1 30  ? -10.900 -37.265 -11.248 1.00 54.48  ? 10  GLY C N   1 
ATOM   4386  C CA  . GLY C 1 30  ? -9.685  -36.634 -11.701 1.00 53.12  ? 10  GLY C CA  1 
ATOM   4387  C C   . GLY C 1 30  ? -8.655  -36.843 -10.621 1.00 52.51  ? 10  GLY C C   1 
ATOM   4388  O O   . GLY C 1 30  ? -8.822  -37.677 -9.735  1.00 49.21  ? 10  GLY C O   1 
ATOM   4389  N N   . THR C 1 31  ? -7.599  -36.058 -10.686 1.00 52.51  ? 11  THR C N   1 
ATOM   4390  C CA  . THR C 1 31  ? -6.471  -36.212 -9.788  1.00 53.66  ? 11  THR C CA  1 
ATOM   4391  C C   . THR C 1 31  ? -6.883  -36.065 -8.320  1.00 51.84  ? 11  THR C C   1 
ATOM   4392  O O   . THR C 1 31  ? -6.424  -36.810 -7.445  1.00 51.62  ? 11  THR C O   1 
ATOM   4393  C CB  . THR C 1 31  ? -5.389  -35.184 -10.166 1.00 55.05  ? 11  THR C CB  1 
ATOM   4394  O OG1 . THR C 1 31  ? -5.030  -35.384 -11.542 1.00 53.34  ? 11  THR C OG1 1 
ATOM   4395  C CG2 . THR C 1 31  ? -4.150  -35.304 -9.267  1.00 54.67  ? 11  THR C CG2 1 
ATOM   4396  N N   . MET C 1 32  ? -7.757  -35.111 -8.049  1.00 51.66  ? 12  MET C N   1 
ATOM   4397  C CA  . MET C 1 32  ? -8.203  -34.904 -6.681  1.00 52.85  ? 12  MET C CA  1 
ATOM   4398  C C   . MET C 1 32  ? -9.266  -35.925 -6.266  1.00 50.60  ? 12  MET C C   1 
ATOM   4399  O O   . MET C 1 32  ? -9.157  -36.522 -5.202  1.00 53.07  ? 12  MET C O   1 
ATOM   4400  C CB  . MET C 1 32  ? -8.706  -33.470 -6.488  1.00 53.87  ? 12  MET C CB  1 
ATOM   4401  C CG  . MET C 1 32  ? -7.586  -32.441 -6.383  1.00 54.01  ? 12  MET C CG  1 
ATOM   4402  S SD  . MET C 1 32  ? -6.449  -32.679 -4.996  1.00 55.80  ? 12  MET C SD  1 
ATOM   4403  C CE  . MET C 1 32  ? -7.575  -32.703 -3.608  1.00 57.66  ? 12  MET C CE  1 
ATOM   4404  N N   . GLY C 1 33  ? -10.278 -36.134 -7.100  1.00 46.95  ? 13  GLY C N   1 
ATOM   4405  C CA  . GLY C 1 33  ? -11.322 -37.108 -6.801  1.00 47.24  ? 13  GLY C CA  1 
ATOM   4406  C C   . GLY C 1 33  ? -10.742 -38.456 -6.407  1.00 47.35  ? 13  GLY C C   1 
ATOM   4407  O O   . GLY C 1 33  ? -11.046 -39.018 -5.342  1.00 39.95  ? 13  GLY C O   1 
ATOM   4408  N N   . SER C 1 34  ? -9.854  -38.939 -7.260  1.00 49.29  ? 14  SER C N   1 
ATOM   4409  C CA  . SER C 1 34  ? -9.230  -40.233 -7.072  1.00 49.91  ? 14  SER C CA  1 
ATOM   4410  C C   . SER C 1 34  ? -8.331  -40.213 -5.860  1.00 46.98  ? 14  SER C C   1 
ATOM   4411  O O   . SER C 1 34  ? -8.287  -41.170 -5.101  1.00 47.54  ? 14  SER C O   1 
ATOM   4412  C CB  . SER C 1 34  ? -8.419  -40.594 -8.305  1.00 54.41  ? 14  SER C CB  1 
ATOM   4413  O OG  . SER C 1 34  ? -9.124  -40.243 -9.500  1.00 59.29  ? 14  SER C OG  1 
ATOM   4414  N N   . GLY C 1 35  ? -7.603  -39.128 -5.668  1.00 45.30  ? 15  GLY C N   1 
ATOM   4415  C CA  . GLY C 1 35  ? -6.664  -39.089 -4.556  1.00 46.11  ? 15  GLY C CA  1 
ATOM   4416  C C   . GLY C 1 35  ? -7.427  -39.105 -3.252  1.00 47.81  ? 15  GLY C C   1 
ATOM   4417  O O   . GLY C 1 35  ? -7.003  -39.723 -2.271  1.00 49.45  ? 15  GLY C O   1 
ATOM   4418  N N   . ILE C 1 36  ? -8.559  -38.406 -3.250  1.00 48.63  ? 16  ILE C N   1 
ATOM   4419  C CA  . ILE C 1 36  ? -9.414  -38.309 -2.073  1.00 46.42  ? 16  ILE C CA  1 
ATOM   4420  C C   . ILE C 1 36  ? -10.009 -39.693 -1.784  1.00 45.99  ? 16  ILE C C   1 
ATOM   4421  O O   . ILE C 1 36  ? -10.007 -40.160 -0.647  1.00 39.96  ? 16  ILE C O   1 
ATOM   4422  C CB  . ILE C 1 36  ? -10.538 -37.266 -2.290  1.00 46.24  ? 16  ILE C CB  1 
ATOM   4423  C CG1 . ILE C 1 36  ? -9.972  -35.860 -2.123  1.00 46.56  ? 16  ILE C CG1 1 
ATOM   4424  C CG2 . ILE C 1 36  ? -11.675 -37.452 -1.292  1.00 44.71  ? 16  ILE C CG2 1 
ATOM   4425  C CD1 . ILE C 1 36  ? -10.953 -34.751 -2.406  1.00 44.44  ? 16  ILE C CD1 1 
ATOM   4426  N N   . ALA C 1 37  ? -10.512 -40.334 -2.833  1.00 44.72  ? 17  ALA C N   1 
ATOM   4427  C CA  . ALA C 1 37  ? -11.077 -41.674 -2.724  1.00 48.38  ? 17  ALA C CA  1 
ATOM   4428  C C   . ALA C 1 37  ? -10.092 -42.634 -2.077  1.00 52.54  ? 17  ALA C C   1 
ATOM   4429  O O   . ALA C 1 37  ? -10.445 -43.400 -1.176  1.00 53.65  ? 17  ALA C O   1 
ATOM   4430  C CB  . ALA C 1 37  ? -11.469 -42.181 -4.097  1.00 47.58  ? 17  ALA C CB  1 
ATOM   4431  N N   . GLN C 1 38  ? -8.851  -42.573 -2.539  1.00 52.96  ? 18  GLN C N   1 
ATOM   4432  C CA  . GLN C 1 38  ? -7.811  -43.437 -2.031  1.00 49.68  ? 18  GLN C CA  1 
ATOM   4433  C C   . GLN C 1 38  ? -7.513  -43.192 -0.561  1.00 50.85  ? 18  GLN C C   1 
ATOM   4434  O O   . GLN C 1 38  ? -7.251  -44.128 0.193   1.00 56.03  ? 18  GLN C O   1 
ATOM   4435  C CB  . GLN C 1 38  ? -6.543  -43.218 -2.826  1.00 48.73  ? 18  GLN C CB  1 
ATOM   4436  C CG  . GLN C 1 38  ? -5.371  -43.948 -2.226  1.00 47.35  ? 18  GLN C CG  1 
ATOM   4437  C CD  . GLN C 1 38  ? -4.123  -43.810 -3.047  1.00 48.22  ? 18  GLN C CD  1 
ATOM   4438  O OE1 . GLN C 1 38  ? -4.161  -43.715 -4.290  1.00 44.78  ? 18  GLN C OE1 1 
ATOM   4439  N NE2 . GLN C 1 38  ? -2.987  -43.812 -2.356  1.00 47.11  ? 18  GLN C NE2 1 
ATOM   4440  N N   . ALA C 1 39  ? -7.531  -41.936 -0.147  1.00 51.33  ? 19  ALA C N   1 
ATOM   4441  C CA  . ALA C 1 39  ? -7.181  -41.622 1.236   1.00 50.61  ? 19  ALA C CA  1 
ATOM   4442  C C   . ALA C 1 39  ? -8.260  -42.125 2.168   1.00 50.29  ? 19  ALA C C   1 
ATOM   4443  O O   . ALA C 1 39  ? -7.988  -42.438 3.320   1.00 52.06  ? 19  ALA C O   1 
ATOM   4444  C CB  . ALA C 1 39  ? -6.981  -40.129 1.420   1.00 48.76  ? 19  ALA C CB  1 
ATOM   4445  N N   . PHE C 1 40  ? -9.485  -42.189 1.661   1.00 49.33  ? 20  PHE C N   1 
ATOM   4446  C CA  . PHE C 1 40  ? -10.596 -42.692 2.441   1.00 49.52  ? 20  PHE C CA  1 
ATOM   4447  C C   . PHE C 1 40  ? -10.536 -44.197 2.542   1.00 48.93  ? 20  PHE C C   1 
ATOM   4448  O O   . PHE C 1 40  ? -10.678 -44.757 3.629   1.00 45.48  ? 20  PHE C O   1 
ATOM   4449  C CB  . PHE C 1 40  ? -11.919 -42.274 1.822   1.00 49.33  ? 20  PHE C CB  1 
ATOM   4450  C CG  . PHE C 1 40  ? -12.455 -41.020 2.409   1.00 51.37  ? 20  PHE C CG  1 
ATOM   4451  C CD1 . PHE C 1 40  ? -13.148 -41.050 3.601   1.00 51.83  ? 20  PHE C CD1 1 
ATOM   4452  C CD2 . PHE C 1 40  ? -12.225 -39.801 1.800   1.00 50.59  ? 20  PHE C CD2 1 
ATOM   4453  C CE1 . PHE C 1 40  ? -13.638 -39.882 4.163   1.00 51.04  ? 20  PHE C CE1 1 
ATOM   4454  C CE2 . PHE C 1 40  ? -12.703 -38.634 2.357   1.00 48.81  ? 20  PHE C CE2 1 
ATOM   4455  C CZ  . PHE C 1 40  ? -13.418 -38.676 3.536   1.00 49.91  ? 20  PHE C CZ  1 
ATOM   4456  N N   . ALA C 1 41  ? -10.341 -44.829 1.390   1.00 48.91  ? 21  ALA C N   1 
ATOM   4457  C CA  . ALA C 1 41  ? -10.261 -46.286 1.279   1.00 50.11  ? 21  ALA C CA  1 
ATOM   4458  C C   . ALA C 1 41  ? -9.100  -46.847 2.075   1.00 51.56  ? 21  ALA C C   1 
ATOM   4459  O O   . ALA C 1 41  ? -9.216  -47.885 2.707   1.00 54.72  ? 21  ALA C O   1 
ATOM   4460  C CB  . ALA C 1 41  ? -10.113 -46.683 -0.170  1.00 48.80  ? 21  ALA C CB  1 
ATOM   4461  N N   . ALA C 1 42  ? -7.983  -46.140 2.068   1.00 53.64  ? 22  ALA C N   1 
ATOM   4462  C CA  . ALA C 1 42  ? -6.789  -46.624 2.747   1.00 57.63  ? 22  ALA C CA  1 
ATOM   4463  C C   . ALA C 1 42  ? -6.993  -46.714 4.251   1.00 59.35  ? 22  ALA C C   1 
ATOM   4464  O O   . ALA C 1 42  ? -6.301  -47.459 4.943   1.00 62.50  ? 22  ALA C O   1 
ATOM   4465  C CB  . ALA C 1 42  ? -5.612  -45.722 2.434   1.00 56.59  ? 22  ALA C CB  1 
ATOM   4466  N N   . LYS C 1 43  ? -7.950  -45.954 4.753   1.00 59.39  ? 23  LYS C N   1 
ATOM   4467  C CA  . LYS C 1 43  ? -8.171  -45.883 6.180   1.00 59.58  ? 23  LYS C CA  1 
ATOM   4468  C C   . LYS C 1 43  ? -9.407  -46.651 6.614   1.00 54.17  ? 23  LYS C C   1 
ATOM   4469  O O   . LYS C 1 43  ? -9.845  -46.536 7.754   1.00 51.12  ? 23  LYS C O   1 
ATOM   4470  C CB  . LYS C 1 43  ? -8.262  -44.415 6.590   1.00 62.97  ? 23  LYS C CB  1 
ATOM   4471  C CG  . LYS C 1 43  ? -6.895  -43.832 6.811   1.00 65.74  ? 23  LYS C CG  1 
ATOM   4472  C CD  . LYS C 1 43  ? -6.400  -44.142 8.223   1.00 69.46  ? 23  LYS C CD  1 
ATOM   4473  C CE  . LYS C 1 43  ? -4.948  -43.733 8.415   1.00 70.20  ? 23  LYS C CE  1 
ATOM   4474  N NZ  . LYS C 1 43  ? -4.254  -43.546 7.101   1.00 69.99  ? 23  LYS C NZ  1 
ATOM   4475  N N   . GLY C 1 44  ? -9.963  -47.440 5.705   1.00 53.12  ? 24  GLY C N   1 
ATOM   4476  C CA  . GLY C 1 44  ? -11.028 -48.364 6.064   1.00 56.66  ? 24  GLY C CA  1 
ATOM   4477  C C   . GLY C 1 44  ? -12.426 -47.968 5.654   1.00 57.44  ? 24  GLY C C   1 
ATOM   4478  O O   . GLY C 1 44  ? -13.386 -48.620 6.050   1.00 59.26  ? 24  GLY C O   1 
ATOM   4479  N N   . PHE C 1 45  ? -12.557 -46.917 4.857   1.00 55.55  ? 25  PHE C N   1 
ATOM   4480  C CA  . PHE C 1 45  ? -13.877 -46.495 4.443   1.00 55.93  ? 25  PHE C CA  1 
ATOM   4481  C C   . PHE C 1 45  ? -14.231 -47.143 3.134   1.00 54.52  ? 25  PHE C C   1 
ATOM   4482  O O   . PHE C 1 45  ? -13.379 -47.438 2.315   1.00 55.37  ? 25  PHE C O   1 
ATOM   4483  C CB  . PHE C 1 45  ? -13.965 -44.984 4.310   1.00 55.65  ? 25  PHE C CB  1 
ATOM   4484  C CG  . PHE C 1 45  ? -13.915 -44.278 5.617   1.00 55.74  ? 25  PHE C CG  1 
ATOM   4485  C CD1 . PHE C 1 45  ? -12.720 -44.173 6.309   1.00 55.60  ? 25  PHE C CD1 1 
ATOM   4486  C CD2 . PHE C 1 45  ? -15.060 -43.735 6.168   1.00 55.93  ? 25  PHE C CD2 1 
ATOM   4487  C CE1 . PHE C 1 45  ? -12.665 -43.530 7.526   1.00 55.08  ? 25  PHE C CE1 1 
ATOM   4488  C CE2 . PHE C 1 45  ? -15.013 -43.085 7.383   1.00 55.64  ? 25  PHE C CE2 1 
ATOM   4489  C CZ  . PHE C 1 45  ? -13.816 -42.989 8.065   1.00 55.26  ? 25  PHE C CZ  1 
ATOM   4490  N N   . GLU C 1 46  ? -15.513 -47.361 2.954   1.00 54.35  ? 26  GLU C N   1 
ATOM   4491  C CA  . GLU C 1 46  ? -16.022 -47.803 1.689   1.00 57.82  ? 26  GLU C CA  1 
ATOM   4492  C C   . GLU C 1 46  ? -16.239 -46.564 0.869   1.00 53.16  ? 26  GLU C C   1 
ATOM   4493  O O   . GLU C 1 46  ? -16.715 -45.550 1.386   1.00 52.73  ? 26  GLU C O   1 
ATOM   4494  C CB  . GLU C 1 46  ? -17.350 -48.504 1.881   1.00 64.48  ? 26  GLU C CB  1 
ATOM   4495  C CG  . GLU C 1 46  ? -17.298 -49.997 1.673   1.00 71.69  ? 26  GLU C CG  1 
ATOM   4496  C CD  . GLU C 1 46  ? -18.692 -50.591 1.643   1.00 78.61  ? 26  GLU C CD  1 
ATOM   4497  O OE1 . GLU C 1 46  ? -19.257 -50.740 0.531   1.00 86.78  ? 26  GLU C OE1 1 
ATOM   4498  O OE2 . GLU C 1 46  ? -19.245 -50.870 2.732   1.00 78.96  ? 26  GLU C OE2 1 
ATOM   4499  N N   . VAL C 1 47  ? -15.921 -46.646 -0.411  1.00 46.26  ? 27  VAL C N   1 
ATOM   4500  C CA  . VAL C 1 47  ? -15.896 -45.469 -1.226  1.00 45.20  ? 27  VAL C CA  1 
ATOM   4501  C C   . VAL C 1 47  ? -16.596 -45.741 -2.514  1.00 43.76  ? 27  VAL C C   1 
ATOM   4502  O O   . VAL C 1 47  ? -16.324 -46.725 -3.165  1.00 44.46  ? 27  VAL C O   1 
ATOM   4503  C CB  . VAL C 1 47  ? -14.445 -45.042 -1.500  1.00 45.65  ? 27  VAL C CB  1 
ATOM   4504  C CG1 . VAL C 1 47  ? -14.403 -43.879 -2.464  1.00 45.63  ? 27  VAL C CG1 1 
ATOM   4505  C CG2 . VAL C 1 47  ? -13.770 -44.647 -0.195  1.00 43.53  ? 27  VAL C CG2 1 
ATOM   4506  N N   . VAL C 1 48  ? -17.510 -44.865 -2.885  1.00 46.52  ? 28  VAL C N   1 
ATOM   4507  C CA  . VAL C 1 48  ? -18.066 -44.926 -4.213  1.00 49.13  ? 28  VAL C CA  1 
ATOM   4508  C C   . VAL C 1 48  ? -17.485 -43.777 -4.998  1.00 52.34  ? 28  VAL C C   1 
ATOM   4509  O O   . VAL C 1 48  ? -17.613 -42.615 -4.609  1.00 51.96  ? 28  VAL C O   1 
ATOM   4510  C CB  . VAL C 1 48  ? -19.586 -44.806 -4.223  1.00 52.15  ? 28  VAL C CB  1 
ATOM   4511  C CG1 . VAL C 1 48  ? -20.112 -44.881 -5.649  1.00 51.38  ? 28  VAL C CG1 1 
ATOM   4512  C CG2 . VAL C 1 48  ? -20.184 -45.921 -3.408  1.00 52.65  ? 28  VAL C CG2 1 
ATOM   4513  N N   . LEU C 1 49  ? -16.850 -44.110 -6.108  1.00 50.59  ? 29  LEU C N   1 
ATOM   4514  C CA  . LEU C 1 49  ? -16.230 -43.121 -6.923  1.00 48.85  ? 29  LEU C CA  1 
ATOM   4515  C C   . LEU C 1 49  ? -17.001 -43.039 -8.195  1.00 48.04  ? 29  LEU C C   1 
ATOM   4516  O O   . LEU C 1 49  ? -17.068 -44.011 -8.948  1.00 47.20  ? 29  LEU C O   1 
ATOM   4517  C CB  . LEU C 1 49  ? -14.809 -43.528 -7.206  1.00 51.23  ? 29  LEU C CB  1 
ATOM   4518  C CG  . LEU C 1 49  ? -13.970 -42.531 -7.990  1.00 52.19  ? 29  LEU C CG  1 
ATOM   4519  C CD1 . LEU C 1 49  ? -13.516 -41.403 -7.093  1.00 51.61  ? 29  LEU C CD1 1 
ATOM   4520  C CD2 . LEU C 1 49  ? -12.766 -43.269 -8.528  1.00 53.36  ? 29  LEU C CD2 1 
ATOM   4521  N N   . ARG C 1 50  ? -17.569 -41.867 -8.435  1.00 47.05  ? 30  ARG C N   1 
ATOM   4522  C CA  . ARG C 1 50  ? -18.466 -41.677 -9.541  1.00 48.83  ? 30  ARG C CA  1 
ATOM   4523  C C   . ARG C 1 50  ? -17.938 -40.655 -10.532 1.00 50.68  ? 30  ARG C C   1 
ATOM   4524  O O   . ARG C 1 50  ? -17.242 -39.714 -10.152 1.00 48.41  ? 30  ARG C O   1 
ATOM   4525  C CB  . ARG C 1 50  ? -19.801 -41.210 -8.995  1.00 49.75  ? 30  ARG C CB  1 
ATOM   4526  C CG  . ARG C 1 50  ? -20.880 -41.093 -10.051 1.00 51.83  ? 30  ARG C CG  1 
ATOM   4527  C CD  . ARG C 1 50  ? -20.898 -39.723 -10.683 1.00 49.89  ? 30  ARG C CD  1 
ATOM   4528  N NE  . ARG C 1 50  ? -22.010 -39.592 -11.607 1.00 50.71  ? 30  ARG C NE  1 
ATOM   4529  C CZ  . ARG C 1 50  ? -22.314 -38.459 -12.230 1.00 48.76  ? 30  ARG C CZ  1 
ATOM   4530  N NH1 . ARG C 1 50  ? -21.589 -37.375 -12.030 1.00 51.61  ? 30  ARG C NH1 1 
ATOM   4531  N NH2 . ARG C 1 50  ? -23.335 -38.402 -13.060 1.00 47.13  ? 30  ARG C NH2 1 
ATOM   4532  N N   . ASP C 1 51  ? -18.288 -40.834 -11.800 1.00 49.99  ? 31  ASP C N   1 
ATOM   4533  C CA  . ASP C 1 51  ? -18.028 -39.821 -12.811 1.00 51.76  ? 31  ASP C CA  1 
ATOM   4534  C C   . ASP C 1 51  ? -19.009 -40.053 -13.942 1.00 54.39  ? 31  ASP C C   1 
ATOM   4535  O O   . ASP C 1 51  ? -19.829 -40.943 -13.859 1.00 55.77  ? 31  ASP C O   1 
ATOM   4536  C CB  . ASP C 1 51  ? -16.578 -39.884 -13.297 1.00 53.20  ? 31  ASP C CB  1 
ATOM   4537  C CG  . ASP C 1 51  ? -16.005 -38.504 -13.612 1.00 51.78  ? 31  ASP C CG  1 
ATOM   4538  O OD1 . ASP C 1 51  ? -16.664 -37.731 -14.335 1.00 51.79  ? 31  ASP C OD1 1 
ATOM   4539  O OD2 . ASP C 1 51  ? -14.899 -38.193 -13.133 1.00 48.90  ? 31  ASP C OD2 1 
ATOM   4540  N N   . ILE C 1 52  ? -18.935 -39.264 -14.998 1.00 55.65  ? 32  ILE C N   1 
ATOM   4541  C CA  . ILE C 1 52  ? -20.021 -39.255 -15.987 1.00 58.63  ? 32  ILE C CA  1 
ATOM   4542  C C   . ILE C 1 52  ? -19.890 -40.334 -17.064 1.00 61.49  ? 32  ILE C C   1 
ATOM   4543  O O   . ILE C 1 52  ? -20.861 -40.639 -17.756 1.00 63.60  ? 32  ILE C O   1 
ATOM   4544  C CB  . ILE C 1 52  ? -20.178 -37.865 -16.634 1.00 57.67  ? 32  ILE C CB  1 
ATOM   4545  C CG1 . ILE C 1 52  ? -18.848 -37.364 -17.196 1.00 61.36  ? 32  ILE C CG1 1 
ATOM   4546  C CG2 . ILE C 1 52  ? -20.659 -36.848 -15.616 1.00 55.70  ? 32  ILE C CG2 1 
ATOM   4547  C CD1 . ILE C 1 52  ? -18.761 -37.425 -18.700 1.00 63.22  ? 32  ILE C CD1 1 
ATOM   4548  N N   . LYS C 1 53  ? -18.690 -40.893 -17.202 1.00 62.99  ? 33  LYS C N   1 
ATOM   4549  C CA  . LYS C 1 53  ? -18.401 -41.932 -18.195 1.00 63.27  ? 33  LYS C CA  1 
ATOM   4550  C C   . LYS C 1 53  ? -17.510 -42.951 -17.545 1.00 61.15  ? 33  LYS C C   1 
ATOM   4551  O O   . LYS C 1 53  ? -16.734 -42.631 -16.643 1.00 55.92  ? 33  LYS C O   1 
ATOM   4552  C CB  . LYS C 1 53  ? -17.611 -41.378 -19.373 1.00 73.64  ? 33  LYS C CB  1 
ATOM   4553  C CG  . LYS C 1 53  ? -18.391 -40.669 -20.464 1.00 79.59  ? 33  LYS C CG  1 
ATOM   4554  C CD  . LYS C 1 53  ? -17.444 -39.696 -21.177 1.00 84.80  ? 33  LYS C CD  1 
ATOM   4555  C CE  . LYS C 1 53  ? -17.476 -39.811 -22.693 1.00 88.48  ? 33  LYS C CE  1 
ATOM   4556  N NZ  . LYS C 1 53  ? -18.396 -38.827 -23.325 1.00 89.68  ? 33  LYS C NZ  1 
ATOM   4557  N N   . ASP C 1 54  ? -17.588 -44.177 -18.032 1.00 61.86  ? 34  ASP C N   1 
ATOM   4558  C CA  . ASP C 1 54  ? -16.729 -45.233 -17.521 1.00 63.78  ? 34  ASP C CA  1 
ATOM   4559  C C   . ASP C 1 54  ? -15.251 -44.882 -17.658 1.00 62.25  ? 34  ASP C C   1 
ATOM   4560  O O   . ASP C 1 54  ? -14.449 -45.139 -16.749 1.00 53.66  ? 34  ASP C O   1 
ATOM   4561  C CB  . ASP C 1 54  ? -16.981 -46.538 -18.280 1.00 68.15  ? 34  ASP C CB  1 
ATOM   4562  C CG  . ASP C 1 54  ? -18.180 -47.306 -17.760 1.00 69.13  ? 34  ASP C CG  1 
ATOM   4563  O OD1 . ASP C 1 54  ? -18.448 -47.267 -16.541 1.00 73.78  ? 34  ASP C OD1 1 
ATOM   4564  O OD2 . ASP C 1 54  ? -18.844 -47.981 -18.572 1.00 67.20  ? 34  ASP C OD2 1 
ATOM   4565  N N   . GLU C 1 55  ? -14.895 -44.310 -18.805 1.00 62.45  ? 35  GLU C N   1 
ATOM   4566  C CA  . GLU C 1 55  ? -13.494 -44.080 -19.131 1.00 65.54  ? 35  GLU C CA  1 
ATOM   4567  C C   . GLU C 1 55  ? -12.825 -43.179 -18.089 1.00 62.40  ? 35  GLU C C   1 
ATOM   4568  O O   . GLU C 1 55  ? -11.635 -43.345 -17.798 1.00 61.26  ? 35  GLU C O   1 
ATOM   4569  C CB  . GLU C 1 55  ? -13.339 -43.517 -20.551 1.00 71.89  ? 35  GLU C CB  1 
ATOM   4570  C CG  . GLU C 1 55  ? -13.699 -42.046 -20.695 1.00 78.65  ? 35  GLU C CG  1 
ATOM   4571  C CD  . GLU C 1 55  ? -13.133 -41.409 -21.953 1.00 82.17  ? 35  GLU C CD  1 
ATOM   4572  O OE1 . GLU C 1 55  ? -13.713 -41.639 -23.035 1.00 86.04  ? 35  GLU C OE1 1 
ATOM   4573  O OE2 . GLU C 1 55  ? -12.127 -40.662 -21.860 1.00 79.57  ? 35  GLU C OE2 1 
ATOM   4574  N N   . PHE C 1 56  ? -13.600 -42.255 -17.516 1.00 57.39  ? 36  PHE C N   1 
ATOM   4575  C CA  . PHE C 1 56  ? -13.106 -41.393 -16.449 1.00 56.89  ? 36  PHE C CA  1 
ATOM   4576  C C   . PHE C 1 56  ? -12.947 -42.152 -15.158 1.00 56.39  ? 36  PHE C C   1 
ATOM   4577  O O   . PHE C 1 56  ? -11.925 -42.051 -14.490 1.00 58.23  ? 36  PHE C O   1 
ATOM   4578  C CB  . PHE C 1 56  ? -14.059 -40.244 -16.210 1.00 61.98  ? 36  PHE C CB  1 
ATOM   4579  C CG  . PHE C 1 56  ? -14.172 -39.298 -17.362 1.00 67.06  ? 36  PHE C CG  1 
ATOM   4580  C CD1 . PHE C 1 56  ? -13.353 -39.416 -18.476 1.00 71.09  ? 36  PHE C CD1 1 
ATOM   4581  C CD2 . PHE C 1 56  ? -15.084 -38.261 -17.320 1.00 71.77  ? 36  PHE C CD2 1 
ATOM   4582  C CE1 . PHE C 1 56  ? -13.465 -38.538 -19.534 1.00 70.51  ? 36  PHE C CE1 1 
ATOM   4583  C CE2 . PHE C 1 56  ? -15.199 -37.375 -18.376 1.00 72.15  ? 36  PHE C CE2 1 
ATOM   4584  C CZ  . PHE C 1 56  ? -14.389 -37.514 -19.484 1.00 70.46  ? 36  PHE C CZ  1 
ATOM   4585  N N   . VAL C 1 57  ? -13.971 -42.913 -14.813 1.00 57.08  ? 37  VAL C N   1 
ATOM   4586  C CA  . VAL C 1 57  ? -13.918 -43.769 -13.640 1.00 59.16  ? 37  VAL C CA  1 
ATOM   4587  C C   . VAL C 1 57  ? -12.711 -44.695 -13.754 1.00 59.32  ? 37  VAL C C   1 
ATOM   4588  O O   . VAL C 1 57  ? -11.886 -44.765 -12.844 1.00 59.24  ? 37  VAL C O   1 
ATOM   4589  C CB  . VAL C 1 57  ? -15.190 -44.635 -13.478 1.00 61.31  ? 37  VAL C CB  1 
ATOM   4590  C CG1 . VAL C 1 57  ? -15.182 -45.310 -12.121 1.00 61.16  ? 37  VAL C CG1 1 
ATOM   4591  C CG2 . VAL C 1 57  ? -16.459 -43.806 -13.612 1.00 62.27  ? 37  VAL C CG2 1 
ATOM   4592  N N   . ASP C 1 58  ? -12.625 -45.405 -14.874 1.00 61.02  ? 38  ASP C N   1 
ATOM   4593  C CA  . ASP C 1 58  ? -11.495 -46.291 -15.154 1.00 64.38  ? 38  ASP C CA  1 
ATOM   4594  C C   . ASP C 1 58  ? -10.166 -45.559 -14.965 1.00 62.92  ? 38  ASP C C   1 
ATOM   4595  O O   . ASP C 1 58  ? -9.252  -46.063 -14.321 1.00 56.75  ? 38  ASP C O   1 
ATOM   4596  C CB  . ASP C 1 58  ? -11.602 -46.841 -16.584 1.00 66.38  ? 38  ASP C CB  1 
ATOM   4597  C CG  . ASP C 1 58  ? -12.658 -47.954 -16.717 1.00 68.33  ? 38  ASP C CG  1 
ATOM   4598  O OD1 . ASP C 1 58  ? -12.997 -48.600 -15.702 1.00 63.49  ? 38  ASP C OD1 1 
ATOM   4599  O OD2 . ASP C 1 58  ? -13.143 -48.192 -17.844 1.00 68.74  ? 38  ASP C OD2 1 
ATOM   4600  N N   . ARG C 1 59  ? -10.094 -44.349 -15.500 1.00 63.98  ? 39  ARG C N   1 
ATOM   4601  C CA  . ARG C 1 59  ? -8.875  -43.563 -15.454 1.00 65.35  ? 39  ARG C CA  1 
ATOM   4602  C C   . ARG C 1 59  ? -8.445  -43.305 -14.012 1.00 61.14  ? 39  ARG C C   1 
ATOM   4603  O O   . ARG C 1 59  ? -7.282  -43.515 -13.644 1.00 58.06  ? 39  ARG C O   1 
ATOM   4604  C CB  . ARG C 1 59  ? -9.079  -42.240 -16.193 1.00 73.28  ? 39  ARG C CB  1 
ATOM   4605  C CG  . ARG C 1 59  ? -7.805  -41.647 -16.770 1.00 79.15  ? 39  ARG C CG  1 
ATOM   4606  C CD  . ARG C 1 59  ? -8.063  -40.289 -17.405 1.00 84.33  ? 39  ARG C CD  1 
ATOM   4607  N NE  . ARG C 1 59  ? -8.189  -39.202 -16.421 1.00 90.77  ? 39  ARG C NE  1 
ATOM   4608  C CZ  . ARG C 1 59  ? -7.189  -38.422 -15.999 1.00 89.34  ? 39  ARG C CZ  1 
ATOM   4609  N NH1 . ARG C 1 59  ? -5.950  -38.592 -16.452 1.00 91.68  ? 39  ARG C NH1 1 
ATOM   4610  N NH2 . ARG C 1 59  ? -7.425  -37.461 -15.110 1.00 83.80  ? 39  ARG C NH2 1 
ATOM   4611  N N   . GLY C 1 60  ? -9.389  -42.851 -13.199 1.00 55.10  ? 40  GLY C N   1 
ATOM   4612  C CA  . GLY C 1 60  ? -9.108  -42.579 -11.795 1.00 52.68  ? 40  GLY C CA  1 
ATOM   4613  C C   . GLY C 1 60  ? -8.735  -43.828 -11.026 1.00 53.14  ? 40  GLY C C   1 
ATOM   4614  O O   . GLY C 1 60  ? -7.896  -43.778 -10.126 1.00 48.88  ? 40  GLY C O   1 
ATOM   4615  N N   . LEU C 1 61  ? -9.358  -44.949 -11.388 1.00 54.99  ? 41  LEU C N   1 
ATOM   4616  C CA  . LEU C 1 61  ? -9.040  -46.240 -10.775 1.00 53.61  ? 41  LEU C CA  1 
ATOM   4617  C C   . LEU C 1 61  ? -7.619  -46.639 -11.157 1.00 52.31  ? 41  LEU C C   1 
ATOM   4618  O O   . LEU C 1 61  ? -6.844  -47.044 -10.289 1.00 44.65  ? 41  LEU C O   1 
ATOM   4619  C CB  . LEU C 1 61  ? -10.051 -47.316 -11.201 1.00 52.66  ? 41  LEU C CB  1 
ATOM   4620  C CG  . LEU C 1 61  ? -11.471 -47.134 -10.639 1.00 54.27  ? 41  LEU C CG  1 
ATOM   4621  C CD1 . LEU C 1 61  ? -12.420 -48.147 -11.264 1.00 51.35  ? 41  LEU C CD1 1 
ATOM   4622  C CD2 . LEU C 1 61  ? -11.514 -47.219 -9.111  1.00 54.29  ? 41  LEU C CD2 1 
ATOM   4623  N N   . ASP C 1 62  ? -7.283  -46.490 -12.444 1.00 53.68  ? 42  ASP C N   1 
ATOM   4624  C CA  . ASP C 1 62  ? -5.913  -46.719 -12.930 1.00 59.71  ? 42  ASP C CA  1 
ATOM   4625  C C   . ASP C 1 62  ? -4.934  -45.878 -12.134 1.00 60.70  ? 42  ASP C C   1 
ATOM   4626  O O   . ASP C 1 62  ? -3.912  -46.376 -11.674 1.00 59.99  ? 42  ASP C O   1 
ATOM   4627  C CB  . ASP C 1 62  ? -5.764  -46.376 -14.424 1.00 62.87  ? 42  ASP C CB  1 
ATOM   4628  C CG  . ASP C 1 62  ? -6.554  -47.317 -15.330 1.00 68.42  ? 42  ASP C CG  1 
ATOM   4629  O OD1 . ASP C 1 62  ? -6.999  -48.386 -14.846 1.00 69.08  ? 42  ASP C OD1 1 
ATOM   4630  O OD2 . ASP C 1 62  ? -6.735  -46.987 -16.528 1.00 65.87  ? 42  ASP C OD2 1 
ATOM   4631  N N   . PHE C 1 63  ? -5.280  -44.607 -11.962 1.00 62.31  ? 43  PHE C N   1 
ATOM   4632  C CA  . PHE C 1 63  ? -4.395  -43.648 -11.336 1.00 68.05  ? 43  PHE C CA  1 
ATOM   4633  C C   . PHE C 1 63  ? -4.154  -44.047 -9.880  1.00 66.60  ? 43  PHE C C   1 
ATOM   4634  O O   . PHE C 1 63  ? -3.048  -43.886 -9.352  1.00 71.32  ? 43  PHE C O   1 
ATOM   4635  C CB  . PHE C 1 63  ? -4.979  -42.231 -11.479 1.00 76.54  ? 43  PHE C CB  1 
ATOM   4636  C CG  . PHE C 1 63  ? -4.336  -41.211 -10.589 1.00 85.67  ? 43  PHE C CG  1 
ATOM   4637  C CD1 . PHE C 1 63  ? -3.117  -40.638 -10.923 1.00 90.40  ? 43  PHE C CD1 1 
ATOM   4638  C CD2 . PHE C 1 63  ? -4.955  -40.822 -9.402  1.00 94.86  ? 43  PHE C CD2 1 
ATOM   4639  C CE1 . PHE C 1 63  ? -2.525  -39.699 -10.085 1.00 95.08  ? 43  PHE C CE1 1 
ATOM   4640  C CE2 . PHE C 1 63  ? -4.371  -39.885 -8.558  1.00 95.18  ? 43  PHE C CE2 1 
ATOM   4641  C CZ  . PHE C 1 63  ? -3.153  -39.321 -8.901  1.00 95.94  ? 43  PHE C CZ  1 
ATOM   4642  N N   . ILE C 1 64  ? -5.178  -44.609 -9.253  1.00 61.55  ? 44  ILE C N   1 
ATOM   4643  C CA  . ILE C 1 64  ? -5.084  -45.036 -7.852  1.00 61.39  ? 44  ILE C CA  1 
ATOM   4644  C C   . ILE C 1 64  ? -4.229  -46.291 -7.716  1.00 60.88  ? 44  ILE C C   1 
ATOM   4645  O O   . ILE C 1 64  ? -3.503  -46.482 -6.738  1.00 56.90  ? 44  ILE C O   1 
ATOM   4646  C CB  . ILE C 1 64  ? -6.473  -45.368 -7.292  1.00 60.35  ? 44  ILE C CB  1 
ATOM   4647  C CG1 . ILE C 1 64  ? -7.400  -44.180 -7.491  1.00 61.05  ? 44  ILE C CG1 1 
ATOM   4648  C CG2 . ILE C 1 64  ? -6.383  -45.735 -5.824  1.00 60.22  ? 44  ILE C CG2 1 
ATOM   4649  C CD1 . ILE C 1 64  ? -8.564  -44.112 -6.533  1.00 61.12  ? 44  ILE C CD1 1 
ATOM   4650  N N   . ASN C 1 65  ? -4.364  -47.154 -8.707  1.00 61.59  ? 45  ASN C N   1 
ATOM   4651  C CA  . ASN C 1 65  ? -3.685  -48.425 -8.729  1.00 67.03  ? 45  ASN C CA  1 
ATOM   4652  C C   . ASN C 1 65  ? -2.184  -48.208 -8.755  1.00 69.12  ? 45  ASN C C   1 
ATOM   4653  O O   . ASN C 1 65  ? -1.429  -48.803 -7.972  1.00 65.53  ? 45  ASN C O   1 
ATOM   4654  C CB  . ASN C 1 65  ? -4.118  -49.203 -9.965  1.00 69.24  ? 45  ASN C CB  1 
ATOM   4655  C CG  . ASN C 1 65  ? -4.101  -50.686 -9.733  1.00 71.08  ? 45  ASN C CG  1 
ATOM   4656  O OD1 . ASN C 1 65  ? -3.086  -51.237 -9.330  1.00 71.63  ? 45  ASN C OD1 1 
ATOM   4657  N ND2 . ASN C 1 65  ? -5.235  -51.340 -9.961  1.00 74.51  ? 45  ASN C ND2 1 
ATOM   4658  N N   . LYS C 1 66  ? -1.775  -47.326 -9.660  1.00 70.17  ? 46  LYS C N   1 
ATOM   4659  C CA  . LYS C 1 66  ? -0.376  -46.957 -9.793  1.00 73.92  ? 46  LYS C CA  1 
ATOM   4660  C C   . LYS C 1 66  ? 0.176   -46.380 -8.496  1.00 68.17  ? 46  LYS C C   1 
ATOM   4661  O O   . LYS C 1 66  ? 1.255   -46.780 -8.059  1.00 66.42  ? 46  LYS C O   1 
ATOM   4662  C CB  . LYS C 1 66  ? -0.172  -45.960 -10.930 1.00 77.24  ? 46  LYS C CB  1 
ATOM   4663  C CG  . LYS C 1 66  ? -0.802  -46.408 -12.228 1.00 82.67  ? 46  LYS C CG  1 
ATOM   4664  C CD  . LYS C 1 66  ? -0.324  -45.584 -13.403 1.00 88.71  ? 46  LYS C CD  1 
ATOM   4665  C CE  . LYS C 1 66  ? -1.339  -45.655 -14.540 1.00 93.92  ? 46  LYS C CE  1 
ATOM   4666  N NZ  . LYS C 1 66  ? -0.785  -45.167 -15.832 1.00 94.42  ? 46  LYS C NZ  1 
ATOM   4667  N N   . ASN C 1 67  ? -0.544  -45.452 -7.872  1.00 62.53  ? 47  ASN C N   1 
ATOM   4668  C CA  . ASN C 1 67  ? 0.013   -44.808 -6.671  1.00 65.42  ? 47  ASN C CA  1 
ATOM   4669  C C   . ASN C 1 67  ? 0.263   -45.841 -5.599  1.00 60.15  ? 47  ASN C C   1 
ATOM   4670  O O   . ASN C 1 67  ? 1.267   -45.779 -4.880  1.00 51.12  ? 47  ASN C O   1 
ATOM   4671  C CB  . ASN C 1 67  ? -0.887  -43.710 -6.111  1.00 69.31  ? 47  ASN C CB  1 
ATOM   4672  C CG  . ASN C 1 67  ? -1.114  -42.601 -7.104  1.00 75.70  ? 47  ASN C CG  1 
ATOM   4673  O OD1 . ASN C 1 67  ? -0.168  -42.020 -7.630  1.00 83.12  ? 47  ASN C OD1 1 
ATOM   4674  N ND2 . ASN C 1 67  ? -2.376  -42.308 -7.381  1.00 81.00  ? 47  ASN C ND2 1 
ATOM   4675  N N   . LEU C 1 68  ? -0.654  -46.796 -5.504  1.00 58.85  ? 48  LEU C N   1 
ATOM   4676  C CA  . LEU C 1 68  ? -0.540  -47.828 -4.500  1.00 61.22  ? 48  LEU C CA  1 
ATOM   4677  C C   . LEU C 1 68  ? 0.613   -48.734 -4.879  1.00 62.61  ? 48  LEU C C   1 
ATOM   4678  O O   . LEU C 1 68  ? 1.432   -49.071 -4.028  1.00 60.53  ? 48  LEU C O   1 
ATOM   4679  C CB  . LEU C 1 68  ? -1.839  -48.616 -4.376  1.00 61.40  ? 48  LEU C CB  1 
ATOM   4680  C CG  . LEU C 1 68  ? -3.007  -47.907 -3.678  1.00 58.95  ? 48  LEU C CG  1 
ATOM   4681  C CD1 . LEU C 1 68  ? -4.214  -48.832 -3.630  1.00 56.48  ? 48  LEU C CD1 1 
ATOM   4682  C CD2 . LEU C 1 68  ? -2.649  -47.434 -2.274  1.00 56.34  ? 48  LEU C CD2 1 
ATOM   4683  N N   . SER C 1 69  ? 0.680   -49.092 -6.164  1.00 64.07  ? 49  SER C N   1 
ATOM   4684  C CA  . SER C 1 69  ? 1.805   -49.857 -6.722  1.00 65.48  ? 49  SER C CA  1 
ATOM   4685  C C   . SER C 1 69  ? 3.157   -49.300 -6.302  1.00 68.46  ? 49  SER C C   1 
ATOM   4686  O O   . SER C 1 69  ? 4.046   -50.053 -5.883  1.00 67.49  ? 49  SER C O   1 
ATOM   4687  C CB  . SER C 1 69  ? 1.747   -49.871 -8.245  1.00 63.21  ? 49  SER C CB  1 
ATOM   4688  O OG  . SER C 1 69  ? 0.556   -50.479 -8.686  1.00 62.63  ? 49  SER C OG  1 
ATOM   4689  N N   . LYS C 1 70  ? 3.316   -47.988 -6.436  1.00 68.83  ? 50  LYS C N   1 
ATOM   4690  C CA  . LYS C 1 70  ? 4.533   -47.344 -5.959  1.00 75.18  ? 50  LYS C CA  1 
ATOM   4691  C C   . LYS C 1 70  ? 4.772   -47.680 -4.503  1.00 72.49  ? 50  LYS C C   1 
ATOM   4692  O O   . LYS C 1 70  ? 5.864   -48.098 -4.143  1.00 74.42  ? 50  LYS C O   1 
ATOM   4693  C CB  . LYS C 1 70  ? 4.484   -45.824 -6.120  1.00 81.32  ? 50  LYS C CB  1 
ATOM   4694  C CG  . LYS C 1 70  ? 5.171   -45.325 -7.375  1.00 86.64  ? 50  LYS C CG  1 
ATOM   4695  C CD  . LYS C 1 70  ? 4.405   -44.179 -8.016  1.00 92.36  ? 50  LYS C CD  1 
ATOM   4696  C CE  . LYS C 1 70  ? 4.643   -44.130 -9.518  1.00 93.08  ? 50  LYS C CE  1 
ATOM   4697  N NZ  . LYS C 1 70  ? 3.725   -43.173 -10.188 1.00 91.95  ? 50  LYS C NZ  1 
ATOM   4698  N N   . LEU C 1 71  ? 3.750   -47.513 -3.670  1.00 70.14  ? 51  LEU C N   1 
ATOM   4699  C CA  . LEU C 1 71  ? 3.922   -47.672 -2.225  1.00 72.94  ? 51  LEU C CA  1 
ATOM   4700  C C   . LEU C 1 71  ? 4.337   -49.091 -1.854  1.00 75.46  ? 51  LEU C C   1 
ATOM   4701  O O   . LEU C 1 71  ? 5.029   -49.308 -0.851  1.00 72.66  ? 51  LEU C O   1 
ATOM   4702  C CB  . LEU C 1 71  ? 2.645   -47.301 -1.477  1.00 72.24  ? 51  LEU C CB  1 
ATOM   4703  C CG  . LEU C 1 71  ? 2.172   -45.847 -1.585  1.00 72.17  ? 51  LEU C CG  1 
ATOM   4704  C CD1 . LEU C 1 71  ? 0.720   -45.782 -1.149  1.00 72.19  ? 51  LEU C CD1 1 
ATOM   4705  C CD2 . LEU C 1 71  ? 3.012   -44.891 -0.748  1.00 70.40  ? 51  LEU C CD2 1 
ATOM   4706  N N   . VAL C 1 72  ? 3.904   -50.052 -2.664  1.00 76.88  ? 52  VAL C N   1 
ATOM   4707  C CA  . VAL C 1 72  ? 4.309   -51.438 -2.483  1.00 78.78  ? 52  VAL C CA  1 
ATOM   4708  C C   . VAL C 1 72  ? 5.747   -51.608 -2.914  1.00 78.55  ? 52  VAL C C   1 
ATOM   4709  O O   . VAL C 1 72  ? 6.571   -52.091 -2.139  1.00 76.70  ? 52  VAL C O   1 
ATOM   4710  C CB  . VAL C 1 72  ? 3.426   -52.406 -3.282  1.00 80.77  ? 52  VAL C CB  1 
ATOM   4711  C CG1 . VAL C 1 72  ? 4.117   -53.753 -3.461  1.00 81.48  ? 52  VAL C CG1 1 
ATOM   4712  C CG2 . VAL C 1 72  ? 2.098   -52.583 -2.573  1.00 79.91  ? 52  VAL C CG2 1 
ATOM   4713  N N   . LYS C 1 73  ? 6.039   -51.206 -4.149  1.00 79.31  ? 53  LYS C N   1 
ATOM   4714  C CA  . LYS C 1 73  ? 7.409   -51.219 -4.660  1.00 85.39  ? 53  LYS C CA  1 
ATOM   4715  C C   . LYS C 1 73  ? 8.373   -50.487 -3.722  1.00 83.12  ? 53  LYS C C   1 
ATOM   4716  O O   . LYS C 1 73  ? 9.493   -50.929 -3.498  1.00 78.02  ? 53  LYS C O   1 
ATOM   4717  C CB  . LYS C 1 73  ? 7.462   -50.567 -6.030  1.00 93.29  ? 53  LYS C CB  1 
ATOM   4718  C CG  . LYS C 1 73  ? 8.861   -50.527 -6.619  1.00 100.28 ? 53  LYS C CG  1 
ATOM   4719  C CD  . LYS C 1 73  ? 8.933   -49.541 -7.766  1.00 105.88 ? 53  LYS C CD  1 
ATOM   4720  C CE  . LYS C 1 73  ? 9.518   -50.185 -9.008  1.00 108.89 ? 53  LYS C CE  1 
ATOM   4721  N NZ  . LYS C 1 73  ? 9.226   -49.357 -10.208 1.00 111.04 ? 53  LYS C NZ  1 
ATOM   4722  N N   . LYS C 1 74  ? 7.917   -49.369 -3.176  1.00 87.48  ? 54  LYS C N   1 
ATOM   4723  C CA  . LYS C 1 74  ? 8.691   -48.592 -2.210  1.00 89.87  ? 54  LYS C CA  1 
ATOM   4724  C C   . LYS C 1 74  ? 8.720   -49.220 -0.803  1.00 86.89  ? 54  LYS C C   1 
ATOM   4725  O O   . LYS C 1 74  ? 9.279   -48.632 0.134   1.00 79.22  ? 54  LYS C O   1 
ATOM   4726  C CB  . LYS C 1 74  ? 8.128   -47.169 -2.113  1.00 95.10  ? 54  LYS C CB  1 
ATOM   4727  C CG  . LYS C 1 74  ? 8.718   -46.177 -3.099  1.00 96.79  ? 54  LYS C CG  1 
ATOM   4728  C CD  . LYS C 1 74  ? 8.658   -44.783 -2.497  1.00 100.60 ? 54  LYS C CD  1 
ATOM   4729  C CE  . LYS C 1 74  ? 9.427   -43.773 -3.323  1.00 102.75 ? 54  LYS C CE  1 
ATOM   4730  N NZ  . LYS C 1 74  ? 9.517   -42.470 -2.612  1.00 103.89 ? 54  LYS C NZ  1 
ATOM   4731  N N   . GLY C 1 75  ? 8.106   -50.391 -0.651  1.00 81.27  ? 55  GLY C N   1 
ATOM   4732  C CA  . GLY C 1 75  ? 8.076   -51.089 0.633   1.00 82.19  ? 55  GLY C CA  1 
ATOM   4733  C C   . GLY C 1 75  ? 7.371   -50.335 1.755   1.00 85.92  ? 55  GLY C C   1 
ATOM   4734  O O   . GLY C 1 75  ? 7.699   -50.515 2.931   1.00 74.64  ? 55  GLY C O   1 
ATOM   4735  N N   . LYS C 1 76  ? 6.402   -49.492 1.399   1.00 89.20  ? 56  LYS C N   1 
ATOM   4736  C CA  . LYS C 1 76  ? 5.629   -48.743 2.399   1.00 88.37  ? 56  LYS C CA  1 
ATOM   4737  C C   . LYS C 1 76  ? 4.403   -49.522 2.821   1.00 82.48  ? 56  LYS C C   1 
ATOM   4738  O O   . LYS C 1 76  ? 3.951   -49.408 3.959   1.00 79.61  ? 56  LYS C O   1 
ATOM   4739  C CB  . LYS C 1 76  ? 5.230   -47.355 1.876   1.00 93.66  ? 56  LYS C CB  1 
ATOM   4740  C CG  . LYS C 1 76  ? 5.908   -46.208 2.614   1.00 97.49  ? 56  LYS C CG  1 
ATOM   4741  C CD  . LYS C 1 76  ? 6.762   -45.339 1.694   1.00 99.61  ? 56  LYS C CD  1 
ATOM   4742  C CE  . LYS C 1 76  ? 7.878   -44.621 2.452   1.00 99.65  ? 56  LYS C CE  1 
ATOM   4743  N NZ  . LYS C 1 76  ? 8.736   -45.514 3.296   1.00 98.48  ? 56  LYS C NZ  1 
ATOM   4744  N N   . ILE C 1 77  ? 3.863   -50.302 1.894   1.00 73.23  ? 57  ILE C N   1 
ATOM   4745  C CA  . ILE C 1 77  ? 2.761   -51.198 2.198   1.00 75.49  ? 57  ILE C CA  1 
ATOM   4746  C C   . ILE C 1 77  ? 2.947   -52.465 1.407   1.00 77.68  ? 57  ILE C C   1 
ATOM   4747  O O   . ILE C 1 77  ? 3.813   -52.551 0.535   1.00 76.86  ? 57  ILE C O   1 
ATOM   4748  C CB  . ILE C 1 77  ? 1.395   -50.613 1.800   1.00 73.22  ? 57  ILE C CB  1 
ATOM   4749  C CG1 . ILE C 1 77  ? 1.427   -50.160 0.334   1.00 70.62  ? 57  ILE C CG1 1 
ATOM   4750  C CG2 . ILE C 1 77  ? 1.000   -49.487 2.742   1.00 74.22  ? 57  ILE C CG2 1 
ATOM   4751  C CD1 . ILE C 1 77  ? 0.228   -50.618 -0.457  1.00 68.25  ? 57  ILE C CD1 1 
ATOM   4752  N N   . GLU C 1 78  ? 2.089   -53.429 1.689   1.00 78.77  ? 58  GLU C N   1 
ATOM   4753  C CA  . GLU C 1 78  ? 2.188   -54.726 1.069   1.00 82.05  ? 58  GLU C CA  1 
ATOM   4754  C C   . GLU C 1 78  ? 1.136   -54.871 -0.006  1.00 79.70  ? 58  GLU C C   1 
ATOM   4755  O O   . GLU C 1 78  ? 0.042   -54.312 0.101   1.00 79.50  ? 58  GLU C O   1 
ATOM   4756  C CB  . GLU C 1 78  ? 2.023   -55.790 2.138   1.00 87.78  ? 58  GLU C CB  1 
ATOM   4757  C CG  . GLU C 1 78  ? 2.518   -55.299 3.492   1.00 93.21  ? 58  GLU C CG  1 
ATOM   4758  C CD  . GLU C 1 78  ? 3.385   -56.306 4.200   1.00 97.09  ? 58  GLU C CD  1 
ATOM   4759  O OE1 . GLU C 1 78  ? 3.035   -56.684 5.336   1.00 100.81 ? 58  GLU C OE1 1 
ATOM   4760  O OE2 . GLU C 1 78  ? 4.419   -56.711 3.622   1.00 96.10  ? 58  GLU C OE2 1 
ATOM   4761  N N   . GLU C 1 79  ? 1.484   -55.615 -1.051  1.00 75.29  ? 59  GLU C N   1 
ATOM   4762  C CA  . GLU C 1 79  ? 0.530   -56.010 -2.076  1.00 73.35  ? 59  GLU C CA  1 
ATOM   4763  C C   . GLU C 1 79  ? -0.819  -56.382 -1.455  1.00 74.16  ? 59  GLU C C   1 
ATOM   4764  O O   . GLU C 1 79  ? -1.877  -56.100 -2.018  1.00 72.95  ? 59  GLU C O   1 
ATOM   4765  C CB  . GLU C 1 79  ? 1.077   -57.205 -2.848  1.00 68.91  ? 59  GLU C CB  1 
ATOM   4766  C CG  . GLU C 1 79  ? 0.182   -57.682 -3.983  1.00 70.11  ? 59  GLU C CG  1 
ATOM   4767  C CD  . GLU C 1 79  ? 0.136   -56.720 -5.164  1.00 69.84  ? 59  GLU C CD  1 
ATOM   4768  O OE1 . GLU C 1 79  ? 0.929   -55.748 -5.210  1.00 65.35  ? 59  GLU C OE1 1 
ATOM   4769  O OE2 . GLU C 1 79  ? -0.707  -56.947 -6.060  1.00 67.51  ? 59  GLU C OE2 1 
ATOM   4770  N N   . ALA C 1 80  ? -0.763  -57.018 -0.290  1.00 73.90  ? 60  ALA C N   1 
ATOM   4771  C CA  . ALA C 1 80  ? -1.960  -57.369 0.470   1.00 75.04  ? 60  ALA C CA  1 
ATOM   4772  C C   . ALA C 1 80  ? -2.764  -56.149 0.916   1.00 74.34  ? 60  ALA C C   1 
ATOM   4773  O O   . ALA C 1 80  ? -3.973  -56.093 0.720   1.00 75.13  ? 60  ALA C O   1 
ATOM   4774  C CB  . ALA C 1 80  ? -1.568  -58.183 1.689   1.00 78.52  ? 60  ALA C CB  1 
ATOM   4775  N N   . THR C 1 81  ? -2.097  -55.194 1.554   1.00 73.91  ? 61  THR C N   1 
ATOM   4776  C CA  . THR C 1 81  ? -2.746  -53.948 1.939   1.00 73.22  ? 61  THR C CA  1 
ATOM   4777  C C   . THR C 1 81  ? -3.354  -53.255 0.711   1.00 69.66  ? 61  THR C C   1 
ATOM   4778  O O   . THR C 1 81  ? -4.423  -52.649 0.797   1.00 62.54  ? 61  THR C O   1 
ATOM   4779  C CB  . THR C 1 81  ? -1.767  -52.978 2.627   1.00 77.00  ? 61  THR C CB  1 
ATOM   4780  O OG1 . THR C 1 81  ? -1.137  -53.617 3.748   1.00 75.97  ? 61  THR C OG1 1 
ATOM   4781  C CG2 . THR C 1 81  ? -2.499  -51.727 3.103   1.00 77.55  ? 61  THR C CG2 1 
ATOM   4782  N N   . LYS C 1 82  ? -2.688  -53.369 -0.433  1.00 66.45  ? 62  LYS C N   1 
ATOM   4783  C CA  . LYS C 1 82  ? -3.147  -52.692 -1.639  1.00 67.00  ? 62  LYS C CA  1 
ATOM   4784  C C   . LYS C 1 82  ? -4.426  -53.257 -2.249  1.00 67.52  ? 62  LYS C C   1 
ATOM   4785  O O   . LYS C 1 82  ? -5.182  -52.531 -2.897  1.00 67.02  ? 62  LYS C O   1 
ATOM   4786  C CB  . LYS C 1 82  ? -2.045  -52.678 -2.683  1.00 68.46  ? 62  LYS C CB  1 
ATOM   4787  C CG  . LYS C 1 82  ? -2.550  -52.812 -4.108  1.00 73.06  ? 62  LYS C CG  1 
ATOM   4788  C CD  . LYS C 1 82  ? -1.578  -52.189 -5.090  1.00 74.72  ? 62  LYS C CD  1 
ATOM   4789  C CE  . LYS C 1 82  ? -1.305  -53.101 -6.275  1.00 73.87  ? 62  LYS C CE  1 
ATOM   4790  N NZ  . LYS C 1 82  ? -2.089  -52.712 -7.473  1.00 73.29  ? 62  LYS C NZ  1 
ATOM   4791  N N   . VAL C 1 83  ? -4.666  -54.546 -2.057  1.00 69.24  ? 63  VAL C N   1 
ATOM   4792  C CA  . VAL C 1 83  ? -5.851  -55.177 -2.642  1.00 67.87  ? 63  VAL C CA  1 
ATOM   4793  C C   . VAL C 1 83  ? -7.047  -54.986 -1.725  1.00 65.55  ? 63  VAL C C   1 
ATOM   4794  O O   . VAL C 1 83  ? -8.169  -54.822 -2.197  1.00 62.44  ? 63  VAL C O   1 
ATOM   4795  C CB  . VAL C 1 83  ? -5.646  -56.669 -2.963  1.00 70.30  ? 63  VAL C CB  1 
ATOM   4796  C CG1 . VAL C 1 83  ? -4.839  -56.802 -4.240  1.00 69.35  ? 63  VAL C CG1 1 
ATOM   4797  C CG2 . VAL C 1 83  ? -4.966  -57.404 -1.816  1.00 74.02  ? 63  VAL C CG2 1 
ATOM   4798  N N   . GLU C 1 84  ? -6.798  -55.017 -0.419  1.00 64.61  ? 64  GLU C N   1 
ATOM   4799  C CA  . GLU C 1 84  ? -7.775  -54.559 0.570   1.00 68.00  ? 64  GLU C CA  1 
ATOM   4800  C C   . GLU C 1 84  ? -8.346  -53.202 0.161   1.00 66.90  ? 64  GLU C C   1 
ATOM   4801  O O   . GLU C 1 84  ? -9.560  -53.025 0.048   1.00 65.51  ? 64  GLU C O   1 
ATOM   4802  C CB  . GLU C 1 84  ? -7.108  -54.393 1.938   1.00 72.01  ? 64  GLU C CB  1 
ATOM   4803  C CG  . GLU C 1 84  ? -7.336  -55.537 2.905   1.00 76.30  ? 64  GLU C CG  1 
ATOM   4804  C CD  . GLU C 1 84  ? -6.364  -55.502 4.075   1.00 81.62  ? 64  GLU C CD  1 
ATOM   4805  O OE1 . GLU C 1 84  ? -6.231  -54.436 4.717   1.00 85.52  ? 64  GLU C OE1 1 
ATOM   4806  O OE2 . GLU C 1 84  ? -5.724  -56.541 4.350   1.00 83.12  ? 64  GLU C OE2 1 
ATOM   4807  N N   . ILE C 1 85  ? -7.437  -52.261 -0.074  1.00 63.11  ? 65  ILE C N   1 
ATOM   4808  C CA  . ILE C 1 85  ? -7.781  -50.872 -0.333  1.00 59.37  ? 65  ILE C CA  1 
ATOM   4809  C C   . ILE C 1 85  ? -8.555  -50.712 -1.614  1.00 58.75  ? 65  ILE C C   1 
ATOM   4810  O O   . ILE C 1 85  ? -9.549  -50.000 -1.658  1.00 58.30  ? 65  ILE C O   1 
ATOM   4811  C CB  . ILE C 1 85  ? -6.520  -50.007 -0.412  1.00 54.93  ? 65  ILE C CB  1 
ATOM   4812  C CG1 . ILE C 1 85  ? -5.972  -49.809 1.000   1.00 53.58  ? 65  ILE C CG1 1 
ATOM   4813  C CG2 . ILE C 1 85  ? -6.838  -48.662 -1.032  1.00 55.21  ? 65  ILE C CG2 1 
ATOM   4814  C CD1 . ILE C 1 85  ? -4.554  -49.299 1.069   1.00 50.70  ? 65  ILE C CD1 1 
ATOM   4815  N N   . LEU C 1 86  ? -8.096  -51.379 -2.656  1.00 58.86  ? 66  LEU C N   1 
ATOM   4816  C CA  . LEU C 1 86  ? -8.782  -51.318 -3.931  1.00 64.03  ? 66  LEU C CA  1 
ATOM   4817  C C   . LEU C 1 86  ? -10.165 -51.933 -3.864  1.00 62.10  ? 66  LEU C C   1 
ATOM   4818  O O   . LEU C 1 86  ? -11.060 -51.596 -4.649  1.00 62.06  ? 66  LEU C O   1 
ATOM   4819  C CB  . LEU C 1 86  ? -7.971  -52.042 -4.993  1.00 67.31  ? 66  LEU C CB  1 
ATOM   4820  C CG  . LEU C 1 86  ? -6.759  -51.243 -5.431  1.00 70.17  ? 66  LEU C CG  1 
ATOM   4821  C CD1 . LEU C 1 86  ? -5.892  -52.108 -6.330  1.00 71.50  ? 66  LEU C CD1 1 
ATOM   4822  C CD2 . LEU C 1 86  ? -7.220  -49.979 -6.143  1.00 70.87  ? 66  LEU C CD2 1 
ATOM   4823  N N   . THR C 1 87  ? -10.326 -52.845 -2.921  1.00 59.22  ? 67  THR C N   1 
ATOM   4824  C CA  . THR C 1 87  ? -11.563 -53.579 -2.787  1.00 59.96  ? 67  THR C CA  1 
ATOM   4825  C C   . THR C 1 87  ? -12.626 -52.681 -2.177  1.00 58.52  ? 67  THR C C   1 
ATOM   4826  O O   . THR C 1 87  ? -13.810 -52.850 -2.450  1.00 58.16  ? 67  THR C O   1 
ATOM   4827  C CB  . THR C 1 87  ? -11.337 -54.856 -1.950  1.00 61.02  ? 67  THR C CB  1 
ATOM   4828  O OG1 . THR C 1 87  ? -10.748 -55.857 -2.789  1.00 59.93  ? 67  THR C OG1 1 
ATOM   4829  C CG2 . THR C 1 87  ? -12.619 -55.387 -1.385  1.00 60.70  ? 67  THR C CG2 1 
ATOM   4830  N N   . ARG C 1 88  ? -12.211 -51.699 -1.387  1.00 56.01  ? 68  ARG C N   1 
ATOM   4831  C CA  . ARG C 1 88  ? -13.184 -50.826 -0.751  1.00 56.21  ? 68  ARG C CA  1 
ATOM   4832  C C   . ARG C 1 88  ? -13.625 -49.684 -1.645  1.00 56.07  ? 68  ARG C C   1 
ATOM   4833  O O   . ARG C 1 88  ? -14.307 -48.778 -1.167  1.00 61.99  ? 68  ARG C O   1 
ATOM   4834  C CB  . ARG C 1 88  ? -12.631 -50.242 0.537   1.00 57.38  ? 68  ARG C CB  1 
ATOM   4835  C CG  . ARG C 1 88  ? -11.951 -51.260 1.416   1.00 59.15  ? 68  ARG C CG  1 
ATOM   4836  C CD  . ARG C 1 88  ? -11.714 -50.699 2.796   1.00 60.46  ? 68  ARG C CD  1 
ATOM   4837  N NE  . ARG C 1 88  ? -10.291 -50.467 3.024   1.00 63.97  ? 68  ARG C NE  1 
ATOM   4838  C CZ  . ARG C 1 88  ? -9.504  -51.246 3.763   1.00 65.70  ? 68  ARG C CZ  1 
ATOM   4839  N NH1 . ARG C 1 88  ? -9.995  -52.324 4.372   1.00 67.62  ? 68  ARG C NH1 1 
ATOM   4840  N NH2 . ARG C 1 88  ? -8.217  -50.937 3.903   1.00 64.61  ? 68  ARG C NH2 1 
ATOM   4841  N N   . ILE C 1 89  ? -13.247 -49.716 -2.921  1.00 50.93  ? 69  ILE C N   1 
ATOM   4842  C CA  . ILE C 1 89  ? -13.594 -48.653 -3.839  1.00 49.04  ? 69  ILE C CA  1 
ATOM   4843  C C   . ILE C 1 89  ? -14.447 -49.168 -4.968  1.00 49.50  ? 69  ILE C C   1 
ATOM   4844  O O   . ILE C 1 89  ? -14.016 -50.036 -5.715  1.00 52.93  ? 69  ILE C O   1 
ATOM   4845  C CB  . ILE C 1 89  ? -12.335 -48.060 -4.463  1.00 49.61  ? 69  ILE C CB  1 
ATOM   4846  C CG1 . ILE C 1 89  ? -11.372 -47.663 -3.356  1.00 51.23  ? 69  ILE C CG1 1 
ATOM   4847  C CG2 . ILE C 1 89  ? -12.682 -46.854 -5.327  1.00 48.10  ? 69  ILE C CG2 1 
ATOM   4848  C CD1 . ILE C 1 89  ? -10.077 -47.089 -3.872  1.00 52.43  ? 69  ILE C CD1 1 
ATOM   4849  N N   . SER C 1 90  ? -15.634 -48.611 -5.135  1.00 48.16  ? 70  SER C N   1 
ATOM   4850  C CA  . SER C 1 90  ? -16.513 -49.094 -6.185  1.00 50.18  ? 70  SER C CA  1 
ATOM   4851  C C   . SER C 1 90  ? -16.730 -47.984 -7.175  1.00 51.67  ? 70  SER C C   1 
ATOM   4852  O O   . SER C 1 90  ? -17.011 -46.852 -6.797  1.00 59.01  ? 70  SER C O   1 
ATOM   4853  C CB  . SER C 1 90  ? -17.846 -49.587 -5.601  1.00 49.83  ? 70  SER C CB  1 
ATOM   4854  O OG  . SER C 1 90  ? -17.615 -50.331 -4.402  1.00 49.94  ? 70  SER C OG  1 
ATOM   4855  N N   . GLY C 1 91  ? -16.596 -48.312 -8.447  1.00 49.69  ? 71  GLY C N   1 
ATOM   4856  C CA  . GLY C 1 91  ? -16.719 -47.325 -9.494  1.00 50.38  ? 71  GLY C CA  1 
ATOM   4857  C C   . GLY C 1 91  ? -18.127 -47.321 -10.027 1.00 50.49  ? 71  GLY C C   1 
ATOM   4858  O O   . GLY C 1 91  ? -18.814 -48.329 -9.942  1.00 54.61  ? 71  GLY C O   1 
ATOM   4859  N N   . THR C 1 92  ? -18.552 -46.192 -10.584 1.00 48.53  ? 72  THR C N   1 
ATOM   4860  C CA  . THR C 1 92  ? -19.891 -46.067 -11.141 1.00 45.67  ? 72  THR C CA  1 
ATOM   4861  C C   . THR C 1 92  ? -20.038 -44.733 -11.841 1.00 46.18  ? 72  THR C C   1 
ATOM   4862  O O   . THR C 1 92  ? -19.362 -43.766 -11.488 1.00 49.44  ? 72  THR C O   1 
ATOM   4863  C CB  . THR C 1 92  ? -20.992 -46.158 -10.044 1.00 44.33  ? 72  THR C CB  1 
ATOM   4864  O OG1 . THR C 1 92  ? -22.294 -46.020 -10.635 1.00 41.09  ? 72  THR C OG1 1 
ATOM   4865  C CG2 . THR C 1 92  ? -20.829 -45.062 -8.995  1.00 43.01  ? 72  THR C CG2 1 
ATOM   4866  N N   . VAL C 1 93  ? -20.954 -44.687 -12.801 1.00 45.71  ? 73  VAL C N   1 
ATOM   4867  C CA  . VAL C 1 93  ? -21.347 -43.438 -13.463 1.00 47.49  ? 73  VAL C CA  1 
ATOM   4868  C C   . VAL C 1 93  ? -22.716 -42.896 -13.024 1.00 51.26  ? 73  VAL C C   1 
ATOM   4869  O O   . VAL C 1 93  ? -23.239 -41.926 -13.618 1.00 46.95  ? 73  VAL C O   1 
ATOM   4870  C CB  . VAL C 1 93  ? -21.360 -43.598 -15.003 1.00 46.58  ? 73  VAL C CB  1 
ATOM   4871  C CG1 . VAL C 1 93  ? -20.089 -44.278 -15.468 1.00 45.08  ? 73  VAL C CG1 1 
ATOM   4872  C CG2 . VAL C 1 93  ? -22.578 -44.389 -15.485 1.00 47.28  ? 73  VAL C CG2 1 
ATOM   4873  N N   . ASP C 1 94  ? -23.278 -43.531 -11.992 1.00 54.53  ? 74  ASP C N   1 
ATOM   4874  C CA  . ASP C 1 94  ? -24.641 -43.275 -11.561 1.00 52.83  ? 74  ASP C CA  1 
ATOM   4875  C C   . ASP C 1 94  ? -24.640 -42.541 -10.241 1.00 52.57  ? 74  ASP C C   1 
ATOM   4876  O O   . ASP C 1 94  ? -24.193 -43.040 -9.200  1.00 49.87  ? 74  ASP C O   1 
ATOM   4877  C CB  . ASP C 1 94  ? -25.417 -44.574 -11.409 1.00 56.98  ? 74  ASP C CB  1 
ATOM   4878  C CG  . ASP C 1 94  ? -26.895 -44.349 -11.130 1.00 58.57  ? 74  ASP C CG  1 
ATOM   4879  O OD1 . ASP C 1 94  ? -27.385 -43.206 -11.253 1.00 65.42  ? 74  ASP C OD1 1 
ATOM   4880  O OD2 . ASP C 1 94  ? -27.581 -45.330 -10.784 1.00 61.52  ? 74  ASP C OD2 1 
ATOM   4881  N N   . LEU C 1 95  ? -25.184 -41.344 -10.297 1.00 52.22  ? 75  LEU C N   1 
ATOM   4882  C CA  . LEU C 1 95  ? -25.181 -40.465 -9.160  1.00 52.01  ? 75  LEU C CA  1 
ATOM   4883  C C   . LEU C 1 95  ? -26.047 -41.037 -8.041  1.00 48.51  ? 75  LEU C C   1 
ATOM   4884  O O   . LEU C 1 95  ? -25.772 -40.815 -6.865  1.00 42.51  ? 75  LEU C O   1 
ATOM   4885  C CB  . LEU C 1 95  ? -25.703 -39.113 -9.621  1.00 55.48  ? 75  LEU C CB  1 
ATOM   4886  C CG  . LEU C 1 95  ? -25.323 -37.854 -8.870  1.00 58.15  ? 75  LEU C CG  1 
ATOM   4887  C CD1 . LEU C 1 95  ? -23.835 -37.743 -8.624  1.00 58.32  ? 75  LEU C CD1 1 
ATOM   4888  C CD2 . LEU C 1 95  ? -25.798 -36.712 -9.743  1.00 61.39  ? 75  LEU C CD2 1 
ATOM   4889  N N   . ASN C 1 96  ? -27.091 -41.774 -8.418  1.00 48.58  ? 76  ASN C N   1 
ATOM   4890  C CA  . ASN C 1 96  ? -27.956 -42.460 -7.450  1.00 50.89  ? 76  ASN C CA  1 
ATOM   4891  C C   . ASN C 1 96  ? -27.239 -43.350 -6.450  1.00 50.57  ? 76  ASN C C   1 
ATOM   4892  O O   . ASN C 1 96  ? -27.734 -43.548 -5.339  1.00 51.85  ? 76  ASN C O   1 
ATOM   4893  C CB  . ASN C 1 96  ? -28.962 -43.322 -8.173  1.00 54.00  ? 76  ASN C CB  1 
ATOM   4894  C CG  . ASN C 1 96  ? -30.039 -42.510 -8.831  1.00 56.34  ? 76  ASN C CG  1 
ATOM   4895  O OD1 . ASN C 1 96  ? -30.869 -41.908 -8.150  1.00 60.77  ? 76  ASN C OD1 1 
ATOM   4896  N ND2 . ASN C 1 96  ? -30.038 -42.485 -10.164 1.00 56.20  ? 76  ASN C ND2 1 
ATOM   4897  N N   . MET C 1 97  ? -26.080 -43.881 -6.830  1.00 50.03  ? 77  MET C N   1 
ATOM   4898  C CA  . MET C 1 97  ? -25.306 -44.734 -5.935  1.00 51.25  ? 77  MET C CA  1 
ATOM   4899  C C   . MET C 1 97  ? -24.844 -43.972 -4.704  1.00 50.35  ? 77  MET C C   1 
ATOM   4900  O O   . MET C 1 97  ? -24.205 -44.521 -3.815  1.00 46.38  ? 77  MET C O   1 
ATOM   4901  C CB  . MET C 1 97  ? -24.105 -45.320 -6.669  1.00 52.17  ? 77  MET C CB  1 
ATOM   4902  C CG  . MET C 1 97  ? -24.482 -46.288 -7.779  1.00 56.09  ? 77  MET C CG  1 
ATOM   4903  S SD  . MET C 1 97  ? -25.494 -47.693 -7.249  1.00 60.00  ? 77  MET C SD  1 
ATOM   4904  C CE  . MET C 1 97  ? -27.019 -47.388 -8.130  1.00 61.12  ? 77  MET C CE  1 
ATOM   4905  N N   . ALA C 1 98  ? -25.172 -42.692 -4.652  1.00 53.15  ? 78  ALA C N   1 
ATOM   4906  C CA  . ALA C 1 98  ? -24.827 -41.891 -3.502  1.00 53.15  ? 78  ALA C CA  1 
ATOM   4907  C C   . ALA C 1 98  ? -25.930 -41.919 -2.469  1.00 49.90  ? 78  ALA C C   1 
ATOM   4908  O O   . ALA C 1 98  ? -25.697 -41.566 -1.320  1.00 46.90  ? 78  ALA C O   1 
ATOM   4909  C CB  . ALA C 1 98  ? -24.578 -40.472 -3.939  1.00 53.27  ? 78  ALA C CB  1 
ATOM   4910  N N   . ALA C 1 99  ? -27.123 -42.341 -2.886  1.00 50.73  ? 79  ALA C N   1 
ATOM   4911  C CA  . ALA C 1 99  ? -28.317 -42.323 -2.041  1.00 50.69  ? 79  ALA C CA  1 
ATOM   4912  C C   . ALA C 1 99  ? -28.018 -42.723 -0.613  1.00 50.29  ? 79  ALA C C   1 
ATOM   4913  O O   . ALA C 1 99  ? -28.597 -42.215 0.323   1.00 50.14  ? 79  ALA C O   1 
ATOM   4914  C CB  . ALA C 1 99  ? -29.352 -43.261 -2.612  1.00 49.76  ? 79  ALA C CB  1 
ATOM   4915  N N   . ASP C 1 100 ? -27.068 -43.622 -0.470  1.00 54.79  ? 80  ASP C N   1 
ATOM   4916  C CA  . ASP C 1 100 ? -26.856 -44.341 0.749   1.00 56.41  ? 80  ASP C CA  1 
ATOM   4917  C C   . ASP C 1 100 ? -25.621 -43.894 1.544   1.00 53.73  ? 80  ASP C C   1 
ATOM   4918  O O   . ASP C 1 100 ? -25.343 -44.418 2.633   1.00 48.74  ? 80  ASP C O   1 
ATOM   4919  C CB  . ASP C 1 100 ? -26.683 -45.796 0.330   1.00 63.56  ? 80  ASP C CB  1 
ATOM   4920  C CG  . ASP C 1 100 ? -26.574 -46.716 1.494   1.00 67.72  ? 80  ASP C CG  1 
ATOM   4921  O OD1 . ASP C 1 100 ? -27.501 -46.677 2.335   1.00 73.94  ? 80  ASP C OD1 1 
ATOM   4922  O OD2 . ASP C 1 100 ? -25.566 -47.459 1.577   1.00 65.77  ? 80  ASP C OD2 1 
ATOM   4923  N N   . CYS C 1 101 ? -24.865 -42.941 1.010   1.00 51.54  ? 81  CYS C N   1 
ATOM   4924  C CA  . CYS C 1 101 ? -23.599 -42.584 1.632   1.00 48.43  ? 81  CYS C CA  1 
ATOM   4925  C C   . CYS C 1 101 ? -23.827 -41.609 2.768   1.00 43.99  ? 81  CYS C C   1 
ATOM   4926  O O   . CYS C 1 101 ? -24.818 -40.890 2.801   1.00 39.77  ? 81  CYS C O   1 
ATOM   4927  C CB  . CYS C 1 101 ? -22.616 -42.026 0.613   1.00 50.13  ? 81  CYS C CB  1 
ATOM   4928  S SG  . CYS C 1 101 ? -22.223 -43.201 -0.706  1.00 54.42  ? 81  CYS C SG  1 
ATOM   4929  N N   . ASP C 1 102 ? -22.914 -41.629 3.721   1.00 44.40  ? 82  ASP C N   1 
ATOM   4930  C CA  . ASP C 1 102 ? -22.969 -40.716 4.847   1.00 47.61  ? 82  ASP C CA  1 
ATOM   4931  C C   . ASP C 1 102 ? -22.369 -39.373 4.456   1.00 49.15  ? 82  ASP C C   1 
ATOM   4932  O O   . ASP C 1 102 ? -22.736 -38.329 5.002   1.00 45.53  ? 82  ASP C O   1 
ATOM   4933  C CB  . ASP C 1 102 ? -22.197 -41.311 6.006   1.00 49.07  ? 82  ASP C CB  1 
ATOM   4934  C CG  . ASP C 1 102 ? -22.608 -42.728 6.287   1.00 52.81  ? 82  ASP C CG  1 
ATOM   4935  O OD1 . ASP C 1 102 ? -23.822 -42.945 6.486   1.00 54.50  ? 82  ASP C OD1 1 
ATOM   4936  O OD2 . ASP C 1 102 ? -21.726 -43.616 6.280   1.00 51.90  ? 82  ASP C OD2 1 
ATOM   4937  N N   . LEU C 1 103 ? -21.440 -39.432 3.503   1.00 51.01  ? 83  LEU C N   1 
ATOM   4938  C CA  . LEU C 1 103 ? -20.681 -38.285 3.067   1.00 49.03  ? 83  LEU C CA  1 
ATOM   4939  C C   . LEU C 1 103 ? -20.485 -38.347 1.570   1.00 49.19  ? 83  LEU C C   1 
ATOM   4940  O O   . LEU C 1 103 ? -19.963 -39.330 1.057   1.00 53.73  ? 83  LEU C O   1 
ATOM   4941  C CB  . LEU C 1 103 ? -19.315 -38.288 3.737   1.00 48.27  ? 83  LEU C CB  1 
ATOM   4942  C CG  . LEU C 1 103 ? -18.438 -37.096 3.355   1.00 48.62  ? 83  LEU C CG  1 
ATOM   4943  C CD1 . LEU C 1 103 ? -19.135 -35.809 3.734   1.00 50.99  ? 83  LEU C CD1 1 
ATOM   4944  C CD2 . LEU C 1 103 ? -17.111 -37.158 4.067   1.00 47.15  ? 83  LEU C CD2 1 
ATOM   4945  N N   . VAL C 1 104 ? -20.927 -37.314 0.868   1.00 45.78  ? 84  VAL C N   1 
ATOM   4946  C CA  . VAL C 1 104 ? -20.555 -37.146 -0.520  1.00 48.49  ? 84  VAL C CA  1 
ATOM   4947  C C   . VAL C 1 104 ? -19.562 -35.988 -0.660  1.00 50.22  ? 84  VAL C C   1 
ATOM   4948  O O   . VAL C 1 104 ? -19.776 -34.899 -0.120  1.00 47.79  ? 84  VAL C O   1 
ATOM   4949  C CB  . VAL C 1 104 ? -21.758 -36.812 -1.387  1.00 48.79  ? 84  VAL C CB  1 
ATOM   4950  C CG1 . VAL C 1 104 ? -21.368 -36.865 -2.855  1.00 50.12  ? 84  VAL C CG1 1 
ATOM   4951  C CG2 . VAL C 1 104 ? -22.890 -37.771 -1.097  1.00 50.64  ? 84  VAL C CG2 1 
ATOM   4952  N N   . ILE C 1 105 ? -18.488 -36.220 -1.397  1.00 49.09  ? 85  ILE C N   1 
ATOM   4953  C CA  . ILE C 1 105 ? -17.521 -35.176 -1.651  1.00 47.38  ? 85  ILE C CA  1 
ATOM   4954  C C   . ILE C 1 105 ? -17.442 -34.900 -3.115  1.00 49.00  ? 85  ILE C C   1 
ATOM   4955  O O   . ILE C 1 105 ? -17.159 -35.781 -3.921  1.00 45.47  ? 85  ILE C O   1 
ATOM   4956  C CB  . ILE C 1 105 ? -16.128 -35.560 -1.214  1.00 48.77  ? 85  ILE C CB  1 
ATOM   4957  C CG1 . ILE C 1 105 ? -16.102 -35.682 0.292   1.00 48.28  ? 85  ILE C CG1 1 
ATOM   4958  C CG2 . ILE C 1 105 ? -15.140 -34.485 -1.642  1.00 52.15  ? 85  ILE C CG2 1 
ATOM   4959  C CD1 . ILE C 1 105 ? -14.811 -36.257 0.802   1.00 48.02  ? 85  ILE C CD1 1 
ATOM   4960  N N   . GLU C 1 106 ? -17.651 -33.641 -3.445  1.00 53.46  ? 86  GLU C N   1 
ATOM   4961  C CA  . GLU C 1 106 ? -17.710 -33.228 -4.812  1.00 54.86  ? 86  GLU C CA  1 
ATOM   4962  C C   . GLU C 1 106 ? -16.370 -32.614 -5.211  1.00 53.03  ? 86  GLU C C   1 
ATOM   4963  O O   . GLU C 1 106 ? -15.845 -31.725 -4.536  1.00 47.87  ? 86  GLU C O   1 
ATOM   4964  C CB  . GLU C 1 106 ? -18.871 -32.265 -4.979  1.00 58.04  ? 86  GLU C CB  1 
ATOM   4965  C CG  . GLU C 1 106 ? -19.091 -31.858 -6.412  1.00 65.29  ? 86  GLU C CG  1 
ATOM   4966  C CD  . GLU C 1 106 ? -18.127 -30.770 -6.801  1.00 74.17  ? 86  GLU C CD  1 
ATOM   4967  O OE1 . GLU C 1 106 ? -17.931 -29.831 -5.989  1.00 71.41  ? 86  GLU C OE1 1 
ATOM   4968  O OE2 . GLU C 1 106 ? -17.544 -30.870 -7.895  1.00 80.47  ? 86  GLU C OE2 1 
ATOM   4969  N N   . ALA C 1 107 ? -15.830 -33.114 -6.316  1.00 53.90  ? 87  ALA C N   1 
ATOM   4970  C CA  . ALA C 1 107 ? -14.564 -32.635 -6.860  1.00 56.63  ? 87  ALA C CA  1 
ATOM   4971  C C   . ALA C 1 107 ? -14.688 -32.524 -8.373  1.00 57.22  ? 87  ALA C C   1 
ATOM   4972  O O   . ALA C 1 107 ? -13.929 -33.115 -9.119  1.00 55.05  ? 87  ALA C O   1 
ATOM   4973  C CB  . ALA C 1 107 ? -13.446 -33.591 -6.483  1.00 56.94  ? 87  ALA C CB  1 
ATOM   4974  N N   . ALA C 1 108 ? -15.680 -31.777 -8.821  1.00 65.24  ? 88  ALA C N   1 
ATOM   4975  C CA  . ALA C 1 108 ? -15.921 -31.594 -10.246 1.00 68.74  ? 88  ALA C CA  1 
ATOM   4976  C C   . ALA C 1 108 ? -15.210 -30.326 -10.681 1.00 68.84  ? 88  ALA C C   1 
ATOM   4977  O O   . ALA C 1 108 ? -14.388 -29.769 -9.955  1.00 67.07  ? 88  ALA C O   1 
ATOM   4978  C CB  . ALA C 1 108 ? -17.419 -31.501 -10.539 1.00 72.10  ? 88  ALA C CB  1 
ATOM   4979  N N   . VAL C 1 109 ? -15.534 -29.879 -11.878 1.00 73.92  ? 89  VAL C N   1 
ATOM   4980  C CA  . VAL C 1 109 ? -14.949 -28.665 -12.417 1.00 77.21  ? 89  VAL C CA  1 
ATOM   4981  C C   . VAL C 1 109 ? -15.455 -27.461 -11.625 1.00 73.93  ? 89  VAL C C   1 
ATOM   4982  O O   . VAL C 1 109 ? -16.561 -27.474 -11.087 1.00 69.19  ? 89  VAL C O   1 
ATOM   4983  C CB  . VAL C 1 109 ? -15.222 -28.508 -13.938 1.00 80.29  ? 89  VAL C CB  1 
ATOM   4984  C CG1 . VAL C 1 109 ? -16.665 -28.853 -14.299 1.00 82.61  ? 89  VAL C CG1 1 
ATOM   4985  C CG2 . VAL C 1 109 ? -14.890 -27.101 -14.413 1.00 81.77  ? 89  VAL C CG2 1 
ATOM   4986  N N   . GLU C 1 110 ? -14.627 -26.426 -11.571 1.00 71.25  ? 90  GLU C N   1 
ATOM   4987  C CA  . GLU C 1 110 ? -14.896 -25.239 -10.779 1.00 70.37  ? 90  GLU C CA  1 
ATOM   4988  C C   . GLU C 1 110 ? -15.933 -24.289 -11.446 1.00 67.36  ? 90  GLU C C   1 
ATOM   4989  O O   . GLU C 1 110 ? -15.702 -23.078 -11.572 1.00 65.62  ? 90  GLU C O   1 
ATOM   4990  C CB  . GLU C 1 110 ? -13.558 -24.539 -10.485 1.00 68.78  ? 90  GLU C CB  1 
ATOM   4991  C CG  . GLU C 1 110 ? -13.462 -23.929 -9.097  1.00 69.89  ? 90  GLU C CG  1 
ATOM   4992  C CD  . GLU C 1 110 ? -13.155 -24.958 -8.013  1.00 70.30  ? 90  GLU C CD  1 
ATOM   4993  O OE1 . GLU C 1 110 ? -14.067 -25.742 -7.645  1.00 71.77  ? 90  GLU C OE1 1 
ATOM   4994  O OE2 . GLU C 1 110 ? -12.007 -24.982 -7.510  1.00 64.06  ? 90  GLU C OE2 1 
ATOM   4995  N N   . ARG C 1 111 ? -17.080 -24.851 -11.837 1.00 64.02  ? 91  ARG C N   1 
ATOM   4996  C CA  . ARG C 1 111 ? -18.170 -24.104 -12.465 1.00 66.57  ? 91  ARG C CA  1 
ATOM   4997  C C   . ARG C 1 111 ? -19.394 -24.092 -11.539 1.00 65.52  ? 91  ARG C C   1 
ATOM   4998  O O   . ARG C 1 111 ? -19.804 -25.136 -11.060 1.00 70.86  ? 91  ARG C O   1 
ATOM   4999  C CB  . ARG C 1 111 ? -18.520 -24.774 -13.791 1.00 75.39  ? 91  ARG C CB  1 
ATOM   5000  C CG  . ARG C 1 111 ? -18.658 -23.831 -14.980 1.00 85.07  ? 91  ARG C CG  1 
ATOM   5001  C CD  . ARG C 1 111 ? -17.833 -24.321 -16.168 1.00 94.68  ? 91  ARG C CD  1 
ATOM   5002  N NE  . ARG C 1 111 ? -16.389 -24.125 -15.947 1.00 104.99 ? 91  ARG C NE  1 
ATOM   5003  C CZ  . ARG C 1 111 ? -15.439 -24.234 -16.882 1.00 107.60 ? 91  ARG C CZ  1 
ATOM   5004  N NH1 . ARG C 1 111 ? -15.750 -24.543 -18.140 1.00 108.88 ? 91  ARG C NH1 1 
ATOM   5005  N NH2 . ARG C 1 111 ? -14.162 -24.029 -16.555 1.00 104.63 ? 91  ARG C NH2 1 
ATOM   5006  N N   . MET C 1 112 ? -19.986 -22.927 -11.297 1.00 61.70  ? 92  MET C N   1 
ATOM   5007  C CA  . MET C 1 112 ? -21.065 -22.807 -10.303 1.00 59.25  ? 92  MET C CA  1 
ATOM   5008  C C   . MET C 1 112 ? -22.414 -23.361 -10.732 1.00 58.28  ? 92  MET C C   1 
ATOM   5009  O O   . MET C 1 112 ? -23.115 -23.939 -9.912  1.00 56.39  ? 92  MET C O   1 
ATOM   5010  C CB  . MET C 1 112 ? -21.291 -21.348 -9.893  1.00 57.26  ? 92  MET C CB  1 
ATOM   5011  C CG  . MET C 1 112 ? -22.343 -21.168 -8.798  1.00 56.72  ? 92  MET C CG  1 
ATOM   5012  S SD  . MET C 1 112 ? -21.946 -22.027 -7.247  1.00 59.32  ? 92  MET C SD  1 
ATOM   5013  C CE  . MET C 1 112 ? -21.496 -20.685 -6.152  1.00 58.95  ? 92  MET C CE  1 
ATOM   5014  N N   . ASP C 1 113 ? -22.810 -23.148 -11.981 1.00 59.33  ? 93  ASP C N   1 
ATOM   5015  C CA  . ASP C 1 113 ? -24.130 -23.621 -12.423 1.00 59.90  ? 93  ASP C CA  1 
ATOM   5016  C C   . ASP C 1 113 ? -24.174 -25.147 -12.332 1.00 59.53  ? 93  ASP C C   1 
ATOM   5017  O O   . ASP C 1 113 ? -25.220 -25.746 -12.098 1.00 57.33  ? 93  ASP C O   1 
ATOM   5018  C CB  . ASP C 1 113 ? -24.483 -23.132 -13.836 1.00 61.16  ? 93  ASP C CB  1 
ATOM   5019  C CG  . ASP C 1 113 ? -23.376 -23.401 -14.883 1.00 69.21  ? 93  ASP C CG  1 
ATOM   5020  O OD1 . ASP C 1 113 ? -22.283 -23.940 -14.565 1.00 73.25  ? 93  ASP C OD1 1 
ATOM   5021  O OD2 . ASP C 1 113 ? -23.616 -23.049 -16.058 1.00 72.24  ? 93  ASP C OD2 1 
ATOM   5022  N N   . ILE C 1 114 ? -22.997 -25.744 -12.476 1.00 58.76  ? 94  ILE C N   1 
ATOM   5023  C CA  . ILE C 1 114 ? -22.823 -27.183 -12.504 1.00 61.47  ? 94  ILE C CA  1 
ATOM   5024  C C   . ILE C 1 114 ? -22.825 -27.754 -11.104 1.00 56.48  ? 94  ILE C C   1 
ATOM   5025  O O   . ILE C 1 114 ? -23.508 -28.738 -10.831 1.00 56.96  ? 94  ILE C O   1 
ATOM   5026  C CB  . ILE C 1 114 ? -21.491 -27.556 -13.204 1.00 71.07  ? 94  ILE C CB  1 
ATOM   5027  C CG1 . ILE C 1 114 ? -21.764 -27.971 -14.648 1.00 77.91  ? 94  ILE C CG1 1 
ATOM   5028  C CG2 . ILE C 1 114 ? -20.742 -28.683 -12.482 1.00 73.02  ? 94  ILE C CG2 1 
ATOM   5029  C CD1 . ILE C 1 114 ? -20.512 -28.039 -15.497 1.00 82.62  ? 94  ILE C CD1 1 
ATOM   5030  N N   . LYS C 1 115 ? -22.023 -27.153 -10.232 1.00 51.55  ? 95  LYS C N   1 
ATOM   5031  C CA  . LYS C 1 115 ? -21.987 -27.552 -8.836  1.00 51.08  ? 95  LYS C CA  1 
ATOM   5032  C C   . LYS C 1 115 ? -23.350 -27.423 -8.194  1.00 50.76  ? 95  LYS C C   1 
ATOM   5033  O O   . LYS C 1 115 ? -23.682 -28.151 -7.272  1.00 46.74  ? 95  LYS C O   1 
ATOM   5034  C CB  . LYS C 1 115 ? -20.982 -26.729 -8.051  1.00 49.85  ? 95  LYS C CB  1 
ATOM   5035  C CG  . LYS C 1 115 ? -19.643 -27.408 -8.039  1.00 55.50  ? 95  LYS C CG  1 
ATOM   5036  C CD  . LYS C 1 115 ? -18.669 -26.671 -7.163  1.00 60.74  ? 95  LYS C CD  1 
ATOM   5037  C CE  . LYS C 1 115 ? -17.424 -27.501 -6.916  1.00 67.23  ? 95  LYS C CE  1 
ATOM   5038  N NZ  . LYS C 1 115 ? -16.650 -27.872 -8.141  1.00 68.67  ? 95  LYS C NZ  1 
ATOM   5039  N N   . LYS C 1 116 ? -24.143 -26.492 -8.689  1.00 53.93  ? 96  LYS C N   1 
ATOM   5040  C CA  . LYS C 1 116 ? -25.450 -26.303 -8.127  1.00 56.93  ? 96  LYS C CA  1 
ATOM   5041  C C   . LYS C 1 116 ? -26.365 -27.438 -8.531  1.00 59.04  ? 96  LYS C C   1 
ATOM   5042  O O   . LYS C 1 116 ? -27.105 -27.951 -7.690  1.00 56.87  ? 96  LYS C O   1 
ATOM   5043  C CB  . LYS C 1 116 ? -26.023 -24.957 -8.531  1.00 55.77  ? 96  LYS C CB  1 
ATOM   5044  C CG  . LYS C 1 116 ? -25.774 -23.911 -7.469  1.00 56.82  ? 96  LYS C CG  1 
ATOM   5045  C CD  . LYS C 1 116 ? -25.517 -22.545 -8.073  1.00 59.93  ? 96  LYS C CD  1 
ATOM   5046  C CE  . LYS C 1 116 ? -26.782 -21.709 -8.199  1.00 60.74  ? 96  LYS C CE  1 
ATOM   5047  N NZ  . LYS C 1 116 ? -26.740 -20.591 -7.223  1.00 60.96  ? 96  LYS C NZ  1 
ATOM   5048  N N   . GLN C 1 117 ? -26.303 -27.837 -9.798  1.00 61.07  ? 97  GLN C N   1 
ATOM   5049  C CA  . GLN C 1 117 ? -27.141 -28.935 -10.264 1.00 64.55  ? 97  GLN C CA  1 
ATOM   5050  C C   . GLN C 1 117 ? -26.738 -30.259 -9.640  1.00 58.61  ? 97  GLN C C   1 
ATOM   5051  O O   . GLN C 1 117 ? -27.574 -31.105 -9.381  1.00 63.62  ? 97  GLN C O   1 
ATOM   5052  C CB  . GLN C 1 117 ? -27.162 -29.066 -11.796 1.00 71.61  ? 97  GLN C CB  1 
ATOM   5053  C CG  . GLN C 1 117 ? -28.427 -28.524 -12.477 1.00 79.05  ? 97  GLN C CG  1 
ATOM   5054  C CD  . GLN C 1 117 ? -29.760 -28.911 -11.810 1.00 85.69  ? 97  GLN C CD  1 
ATOM   5055  O OE1 . GLN C 1 117 ? -30.798 -28.331 -12.131 1.00 89.76  ? 97  GLN C OE1 1 
ATOM   5056  N NE2 . GLN C 1 117 ? -29.738 -29.884 -10.892 1.00 87.42  ? 97  GLN C NE2 1 
ATOM   5057  N N   . ILE C 1 118 ? -25.458 -30.444 -9.400  1.00 53.12  ? 98  ILE C N   1 
ATOM   5058  C CA  . ILE C 1 118 ? -25.024 -31.648 -8.738  1.00 51.49  ? 98  ILE C CA  1 
ATOM   5059  C C   . ILE C 1 118 ? -25.572 -31.698 -7.331  1.00 50.59  ? 98  ILE C C   1 
ATOM   5060  O O   . ILE C 1 118 ? -26.032 -32.733 -6.864  1.00 50.60  ? 98  ILE C O   1 
ATOM   5061  C CB  . ILE C 1 118 ? -23.504 -31.697 -8.619  1.00 52.69  ? 98  ILE C CB  1 
ATOM   5062  C CG1 . ILE C 1 118 ? -22.913 -32.265 -9.893  1.00 54.90  ? 98  ILE C CG1 1 
ATOM   5063  C CG2 . ILE C 1 118 ? -23.073 -32.584 -7.457  1.00 50.48  ? 98  ILE C CG2 1 
ATOM   5064  C CD1 . ILE C 1 118 ? -21.414 -32.095 -9.958  1.00 57.21  ? 98  ILE C CD1 1 
ATOM   5065  N N   . PHE C 1 119 ? -25.476 -30.578 -6.640  1.00 47.44  ? 99  PHE C N   1 
ATOM   5066  C CA  . PHE C 1 119 ? -25.835 -30.543 -5.244  1.00 44.18  ? 99  PHE C CA  1 
ATOM   5067  C C   . PHE C 1 119 ? -27.330 -30.600 -5.055  1.00 44.62  ? 99  PHE C C   1 
ATOM   5068  O O   . PHE C 1 119 ? -27.815 -31.044 -4.022  1.00 43.86  ? 99  PHE C O   1 
ATOM   5069  C CB  . PHE C 1 119 ? -25.291 -29.294 -4.604  1.00 42.75  ? 99  PHE C CB  1 
ATOM   5070  C CG  . PHE C 1 119 ? -23.966 -29.501 -3.975  1.00 41.26  ? 99  PHE C CG  1 
ATOM   5071  C CD1 . PHE C 1 119 ? -22.840 -29.626 -4.749  1.00 38.79  ? 99  PHE C CD1 1 
ATOM   5072  C CD2 . PHE C 1 119 ? -23.861 -29.603 -2.602  1.00 40.17  ? 99  PHE C CD2 1 
ATOM   5073  C CE1 . PHE C 1 119 ? -21.625 -29.837 -4.159  1.00 39.40  ? 99  PHE C CE1 1 
ATOM   5074  C CE2 . PHE C 1 119 ? -22.644 -29.809 -2.000  1.00 39.65  ? 99  PHE C CE2 1 
ATOM   5075  C CZ  . PHE C 1 119 ? -21.523 -29.936 -2.784  1.00 39.37  ? 99  PHE C CZ  1 
ATOM   5076  N N   . ALA C 1 120 ? -28.055 -30.146 -6.064  1.00 46.32  ? 100 ALA C N   1 
ATOM   5077  C CA  . ALA C 1 120 ? -29.509 -30.183 -6.040  1.00 47.87  ? 100 ALA C CA  1 
ATOM   5078  C C   . ALA C 1 120 ? -30.027 -31.600 -6.240  1.00 49.48  ? 100 ALA C C   1 
ATOM   5079  O O   . ALA C 1 120 ? -31.017 -31.969 -5.621  1.00 50.29  ? 100 ALA C O   1 
ATOM   5080  C CB  . ALA C 1 120 ? -30.079 -29.273 -7.107  1.00 46.39  ? 100 ALA C CB  1 
ATOM   5081  N N   . ASP C 1 121 ? -29.377 -32.380 -7.104  1.00 48.18  ? 101 ASP C N   1 
ATOM   5082  C CA  . ASP C 1 121 ? -29.767 -33.770 -7.298  1.00 50.83  ? 101 ASP C CA  1 
ATOM   5083  C C   . ASP C 1 121 ? -29.448 -34.560 -6.059  1.00 48.24  ? 101 ASP C C   1 
ATOM   5084  O O   . ASP C 1 121 ? -30.287 -35.290 -5.547  1.00 46.41  ? 101 ASP C O   1 
ATOM   5085  C CB  . ASP C 1 121 ? -29.057 -34.398 -8.485  1.00 58.36  ? 101 ASP C CB  1 
ATOM   5086  C CG  . ASP C 1 121 ? -29.341 -33.675 -9.769  1.00 64.73  ? 101 ASP C CG  1 
ATOM   5087  O OD1 . ASP C 1 121 ? -30.064 -32.656 -9.729  1.00 76.26  ? 101 ASP C OD1 1 
ATOM   5088  O OD2 . ASP C 1 121 ? -28.835 -34.116 -10.822 1.00 71.55  ? 101 ASP C OD2 1 
ATOM   5089  N N   . LEU C 1 122 ? -28.235 -34.398 -5.567  1.00 46.21  ? 102 LEU C N   1 
ATOM   5090  C CA  . LEU C 1 122 ? -27.846 -35.051 -4.353  1.00 48.12  ? 102 LEU C CA  1 
ATOM   5091  C C   . LEU C 1 122 ? -28.830 -34.792 -3.228  1.00 51.20  ? 102 LEU C C   1 
ATOM   5092  O O   . LEU C 1 122 ? -29.118 -35.694 -2.434  1.00 50.56  ? 102 LEU C O   1 
ATOM   5093  C CB  . LEU C 1 122 ? -26.470 -34.565 -3.922  1.00 49.64  ? 102 LEU C CB  1 
ATOM   5094  C CG  . LEU C 1 122 ? -25.282 -34.995 -4.784  1.00 49.12  ? 102 LEU C CG  1 
ATOM   5095  C CD1 . LEU C 1 122 ? -24.016 -34.630 -4.027  1.00 49.41  ? 102 LEU C CD1 1 
ATOM   5096  C CD2 . LEU C 1 122 ? -25.310 -36.485 -5.112  1.00 49.63  ? 102 LEU C CD2 1 
ATOM   5097  N N   . ASP C 1 123 ? -29.341 -33.566 -3.149  1.00 52.89  ? 103 ASP C N   1 
ATOM   5098  C CA  . ASP C 1 123 ? -30.272 -33.221 -2.085  1.00 50.68  ? 103 ASP C CA  1 
ATOM   5099  C C   . ASP C 1 123 ? -31.446 -34.201 -2.135  1.00 51.05  ? 103 ASP C C   1 
ATOM   5100  O O   . ASP C 1 123 ? -31.909 -34.684 -1.109  1.00 46.43  ? 103 ASP C O   1 
ATOM   5101  C CB  . ASP C 1 123 ? -30.766 -31.789 -2.262  1.00 50.50  ? 103 ASP C CB  1 
ATOM   5102  C CG  . ASP C 1 123 ? -31.537 -31.271 -1.049  1.00 49.55  ? 103 ASP C CG  1 
ATOM   5103  O OD1 . ASP C 1 123 ? -31.228 -31.683 0.095   1.00 46.08  ? 103 ASP C OD1 1 
ATOM   5104  O OD2 . ASP C 1 123 ? -32.440 -30.417 -1.250  1.00 45.92  ? 103 ASP C OD2 1 
ATOM   5105  N N   . ASN C 1 124 ? -31.903 -34.495 -3.348  1.00 51.78  ? 104 ASN C N   1 
ATOM   5106  C CA  . ASN C 1 124 ? -33.026 -35.401 -3.563  1.00 55.86  ? 104 ASN C CA  1 
ATOM   5107  C C   . ASN C 1 124 ? -32.667 -36.863 -3.550  1.00 55.54  ? 104 ASN C C   1 
ATOM   5108  O O   . ASN C 1 124 ? -33.511 -37.697 -3.262  1.00 57.63  ? 104 ASN C O   1 
ATOM   5109  C CB  . ASN C 1 124 ? -33.678 -35.100 -4.896  1.00 56.97  ? 104 ASN C CB  1 
ATOM   5110  C CG  . ASN C 1 124 ? -34.363 -33.759 -4.898  1.00 59.00  ? 104 ASN C CG  1 
ATOM   5111  O OD1 . ASN C 1 124 ? -34.726 -33.226 -3.842  1.00 61.76  ? 104 ASN C OD1 1 
ATOM   5112  N ND2 . ASN C 1 124 ? -34.532 -33.189 -6.082  1.00 58.31  ? 104 ASN C ND2 1 
ATOM   5113  N N   . ILE C 1 125 ? -31.433 -37.177 -3.890  1.00 52.07  ? 105 ILE C N   1 
ATOM   5114  C CA  . ILE C 1 125 ? -31.016 -38.556 -3.951  1.00 51.14  ? 105 ILE C CA  1 
ATOM   5115  C C   . ILE C 1 125 ? -30.676 -39.112 -2.575  1.00 52.12  ? 105 ILE C C   1 
ATOM   5116  O O   . ILE C 1 125 ? -31.084 -40.218 -2.226  1.00 58.03  ? 105 ILE C O   1 
ATOM   5117  C CB  . ILE C 1 125 ? -29.834 -38.690 -4.913  1.00 50.70  ? 105 ILE C CB  1 
ATOM   5118  C CG1 . ILE C 1 125 ? -30.349 -38.552 -6.333  1.00 49.21  ? 105 ILE C CG1 1 
ATOM   5119  C CG2 . ILE C 1 125 ? -29.100 -40.013 -4.732  1.00 50.79  ? 105 ILE C CG2 1 
ATOM   5120  C CD1 . ILE C 1 125 ? -29.243 -38.467 -7.354  1.00 53.19  ? 105 ILE C CD1 1 
ATOM   5121  N N   . CYS C 1 126 ? -29.925 -38.353 -1.797  1.00 53.23  ? 106 CYS C N   1 
ATOM   5122  C CA  . CYS C 1 126 ? -29.351 -38.894 -0.574  1.00 53.60  ? 106 CYS C CA  1 
ATOM   5123  C C   . CYS C 1 126 ? -30.323 -38.885 0.593   1.00 52.12  ? 106 CYS C C   1 
ATOM   5124  O O   . CYS C 1 126 ? -31.230 -38.076 0.659   1.00 54.84  ? 106 CYS C O   1 
ATOM   5125  C CB  . CYS C 1 126 ? -28.053 -38.154 -0.223  1.00 52.27  ? 106 CYS C CB  1 
ATOM   5126  S SG  . CYS C 1 126 ? -26.897 -38.149 -1.608  1.00 53.76  ? 106 CYS C SG  1 
ATOM   5127  N N   . LYS C 1 127 ? -30.117 -39.812 1.511   1.00 51.95  ? 107 LYS C N   1 
ATOM   5128  C CA  . LYS C 1 127 ? -30.854 -39.809 2.754   1.00 53.33  ? 107 LYS C CA  1 
ATOM   5129  C C   . LYS C 1 127 ? -30.631 -38.468 3.439   1.00 52.15  ? 107 LYS C C   1 
ATOM   5130  O O   . LYS C 1 127 ? -29.660 -37.786 3.171   1.00 52.13  ? 107 LYS C O   1 
ATOM   5131  C CB  . LYS C 1 127 ? -30.425 -40.952 3.685   1.00 52.49  ? 107 LYS C CB  1 
ATOM   5132  C CG  . LYS C 1 127 ? -29.086 -41.569 3.365   1.00 53.11  ? 107 LYS C CG  1 
ATOM   5133  C CD  . LYS C 1 127 ? -28.617 -42.552 4.419   1.00 52.86  ? 107 LYS C CD  1 
ATOM   5134  C CE  . LYS C 1 127 ? -27.353 -42.064 5.109   1.00 52.74  ? 107 LYS C CE  1 
ATOM   5135  N NZ  . LYS C 1 127 ? -26.407 -43.165 5.428   1.00 50.05  ? 107 LYS C NZ  1 
ATOM   5136  N N   . PRO C 1 128 ? -31.531 -38.097 4.344   1.00 55.90  ? 108 PRO C N   1 
ATOM   5137  C CA  . PRO C 1 128 ? -31.438 -36.804 5.005   1.00 54.60  ? 108 PRO C CA  1 
ATOM   5138  C C   . PRO C 1 128 ? -30.173 -36.621 5.814   1.00 54.32  ? 108 PRO C C   1 
ATOM   5139  O O   . PRO C 1 128 ? -29.792 -35.497 6.115   1.00 56.99  ? 108 PRO C O   1 
ATOM   5140  C CB  . PRO C 1 128 ? -32.635 -36.813 5.959   1.00 54.57  ? 108 PRO C CB  1 
ATOM   5141  C CG  . PRO C 1 128 ? -33.610 -37.739 5.337   1.00 56.51  ? 108 PRO C CG  1 
ATOM   5142  C CD  . PRO C 1 128 ? -32.787 -38.798 4.667   1.00 56.78  ? 108 PRO C CD  1 
ATOM   5143  N N   . GLU C 1 129 ? -29.537 -37.718 6.181   1.00 55.85  ? 109 GLU C N   1 
ATOM   5144  C CA  . GLU C 1 129 ? -28.384 -37.651 7.054   1.00 55.92  ? 109 GLU C CA  1 
ATOM   5145  C C   . GLU C 1 129 ? -27.119 -37.352 6.269   1.00 51.56  ? 109 GLU C C   1 
ATOM   5146  O O   . GLU C 1 129 ? -26.145 -36.876 6.831   1.00 49.93  ? 109 GLU C O   1 
ATOM   5147  C CB  . GLU C 1 129 ? -28.212 -38.967 7.814   1.00 60.88  ? 109 GLU C CB  1 
ATOM   5148  C CG  . GLU C 1 129 ? -29.356 -39.287 8.775   1.00 65.43  ? 109 GLU C CG  1 
ATOM   5149  C CD  . GLU C 1 129 ? -30.506 -40.094 8.159   1.00 67.83  ? 109 GLU C CD  1 
ATOM   5150  O OE1 . GLU C 1 129 ? -30.456 -40.475 6.972   1.00 64.59  ? 109 GLU C OE1 1 
ATOM   5151  O OE2 . GLU C 1 129 ? -31.489 -40.349 8.879   1.00 74.45  ? 109 GLU C OE2 1 
ATOM   5152  N N   . THR C 1 130 ? -27.123 -37.643 4.979   1.00 47.64  ? 110 THR C N   1 
ATOM   5153  C CA  . THR C 1 130 ? -25.940 -37.446 4.186   1.00 48.84  ? 110 THR C CA  1 
ATOM   5154  C C   . THR C 1 130 ? -25.454 -36.010 4.254   1.00 48.83  ? 110 THR C C   1 
ATOM   5155  O O   . THR C 1 130 ? -26.223 -35.082 4.034   1.00 49.74  ? 110 THR C O   1 
ATOM   5156  C CB  . THR C 1 130 ? -26.222 -37.739 2.720   1.00 50.10  ? 110 THR C CB  1 
ATOM   5157  O OG1 . THR C 1 130 ? -26.804 -39.041 2.610   1.00 46.56  ? 110 THR C OG1 1 
ATOM   5158  C CG2 . THR C 1 130 ? -24.925 -37.685 1.923   1.00 51.05  ? 110 THR C CG2 1 
ATOM   5159  N N   . ILE C 1 131 ? -24.175 -35.837 4.538   1.00 45.68  ? 111 ILE C N   1 
ATOM   5160  C CA  . ILE C 1 131 ? -23.563 -34.539 4.414   1.00 46.27  ? 111 ILE C CA  1 
ATOM   5161  C C   . ILE C 1 131 ? -23.019 -34.364 3.007   1.00 46.93  ? 111 ILE C C   1 
ATOM   5162  O O   . ILE C 1 131 ? -22.426 -35.282 2.444   1.00 44.37  ? 111 ILE C O   1 
ATOM   5163  C CB  . ILE C 1 131 ? -22.432 -34.387 5.414   1.00 46.60  ? 111 ILE C CB  1 
ATOM   5164  C CG1 . ILE C 1 131 ? -23.038 -34.279 6.804   1.00 45.04  ? 111 ILE C CG1 1 
ATOM   5165  C CG2 . ILE C 1 131 ? -21.611 -33.146 5.094   1.00 44.71  ? 111 ILE C CG2 1 
ATOM   5166  C CD1 . ILE C 1 131 ? -22.035 -34.468 7.904   1.00 44.19  ? 111 ILE C CD1 1 
ATOM   5167  N N   . LEU C 1 132 ? -23.235 -33.179 2.445   1.00 47.00  ? 112 LEU C N   1 
ATOM   5168  C CA  . LEU C 1 132 ? -22.768 -32.864 1.098   1.00 46.45  ? 112 LEU C CA  1 
ATOM   5169  C C   . LEU C 1 132 ? -21.613 -31.870 1.154   1.00 45.22  ? 112 LEU C C   1 
ATOM   5170  O O   . LEU C 1 132 ? -21.753 -30.774 1.677   1.00 44.17  ? 112 LEU C O   1 
ATOM   5171  C CB  . LEU C 1 132 ? -23.912 -32.300 0.277   1.00 46.38  ? 112 LEU C CB  1 
ATOM   5172  C CG  . LEU C 1 132 ? -25.163 -33.177 0.253   1.00 48.41  ? 112 LEU C CG  1 
ATOM   5173  C CD1 . LEU C 1 132 ? -26.182 -32.632 -0.725  1.00 48.40  ? 112 LEU C CD1 1 
ATOM   5174  C CD2 . LEU C 1 132 ? -24.814 -34.602 -0.131  1.00 48.16  ? 112 LEU C CD2 1 
ATOM   5175  N N   . ALA C 1 133 ? -20.465 -32.267 0.628   1.00 42.87  ? 113 ALA C N   1 
ATOM   5176  C CA  . ALA C 1 133 ? -19.272 -31.451 0.747   1.00 42.43  ? 113 ALA C CA  1 
ATOM   5177  C C   . ALA C 1 133 ? -18.656 -31.159 -0.602  1.00 43.14  ? 113 ALA C C   1 
ATOM   5178  O O   . ALA C 1 133 ? -18.833 -31.932 -1.545  1.00 42.07  ? 113 ALA C O   1 
ATOM   5179  C CB  . ALA C 1 133 ? -18.270 -32.138 1.631   1.00 42.71  ? 113 ALA C CB  1 
ATOM   5180  N N   . SER C 1 134 ? -17.948 -30.032 -0.690  1.00 42.50  ? 114 SER C N   1 
ATOM   5181  C CA  . SER C 1 134 ? -17.257 -29.648 -1.916  1.00 41.11  ? 114 SER C CA  1 
ATOM   5182  C C   . SER C 1 134 ? -15.802 -29.445 -1.635  1.00 39.54  ? 114 SER C C   1 
ATOM   5183  O O   . SER C 1 134 ? -15.427 -28.844 -0.624  1.00 40.79  ? 114 SER C O   1 
ATOM   5184  C CB  . SER C 1 134 ? -17.831 -28.355 -2.498  1.00 44.30  ? 114 SER C CB  1 
ATOM   5185  O OG  . SER C 1 134 ? -17.383 -28.127 -3.829  1.00 45.95  ? 114 SER C OG  1 
ATOM   5186  N N   . ASN C 1 135 ? -14.976 -29.932 -2.554  1.00 39.47  ? 115 ASN C N   1 
ATOM   5187  C CA  . ASN C 1 135 ? -13.530 -29.716 -2.494  1.00 41.13  ? 115 ASN C CA  1 
ATOM   5188  C C   . ASN C 1 135 ? -13.091 -28.419 -3.214  1.00 41.88  ? 115 ASN C C   1 
ATOM   5189  O O   . ASN C 1 135 ? -11.902 -28.188 -3.463  1.00 39.01  ? 115 ASN C O   1 
ATOM   5190  C CB  . ASN C 1 135 ? -12.842 -30.935 -3.094  1.00 43.01  ? 115 ASN C CB  1 
ATOM   5191  C CG  . ASN C 1 135 ? -11.338 -30.777 -3.189  1.00 44.31  ? 115 ASN C CG  1 
ATOM   5192  O OD1 . ASN C 1 135 ? -10.667 -30.473 -2.201  1.00 44.94  ? 115 ASN C OD1 1 
ATOM   5193  N ND2 . ASN C 1 135 ? -10.801 -30.977 -4.390  1.00 45.46  ? 115 ASN C ND2 1 
ATOM   5194  N N   . THR C 1 136 ? -14.060 -27.569 -3.530  1.00 43.20  ? 116 THR C N   1 
ATOM   5195  C CA  . THR C 1 136 ? -13.800 -26.350 -4.256  1.00 46.84  ? 116 THR C CA  1 
ATOM   5196  C C   . THR C 1 136 ? -12.821 -25.458 -3.522  1.00 45.73  ? 116 THR C C   1 
ATOM   5197  O O   . THR C 1 136 ? -12.808 -25.384 -2.292  1.00 47.13  ? 116 THR C O   1 
ATOM   5198  C CB  . THR C 1 136 ? -15.092 -25.541 -4.490  1.00 48.93  ? 116 THR C CB  1 
ATOM   5199  O OG1 . THR C 1 136 ? -14.895 -24.641 -5.581  1.00 49.55  ? 116 THR C OG1 1 
ATOM   5200  C CG2 . THR C 1 136 ? -15.483 -24.737 -3.256  1.00 48.41  ? 116 THR C CG2 1 
ATOM   5201  N N   . SER C 1 137 ? -12.002 -24.775 -4.295  1.00 48.03  ? 117 SER C N   1 
ATOM   5202  C CA  . SER C 1 137 ? -11.062 -23.829 -3.731  1.00 51.07  ? 117 SER C CA  1 
ATOM   5203  C C   . SER C 1 137 ? -11.559 -22.377 -3.883  1.00 48.32  ? 117 SER C C   1 
ATOM   5204  O O   . SER C 1 137 ? -11.102 -21.503 -3.164  1.00 44.28  ? 117 SER C O   1 
ATOM   5205  C CB  . SER C 1 137 ? -9.700  -24.024 -4.388  1.00 53.07  ? 117 SER C CB  1 
ATOM   5206  O OG  . SER C 1 137 ? -9.708  -23.489 -5.704  1.00 58.47  ? 117 SER C OG  1 
ATOM   5207  N N   . SER C 1 138 ? -12.535 -22.146 -4.761  1.00 48.70  ? 118 SER C N   1 
ATOM   5208  C CA  . SER C 1 138 ? -12.926 -20.789 -5.128  1.00 53.39  ? 118 SER C CA  1 
ATOM   5209  C C   . SER C 1 138 ? -14.423 -20.463 -5.264  1.00 54.83  ? 118 SER C C   1 
ATOM   5210  O O   . SER C 1 138 ? -14.765 -19.300 -5.478  1.00 56.47  ? 118 SER C O   1 
ATOM   5211  C CB  . SER C 1 138 ? -12.252 -20.449 -6.451  1.00 56.03  ? 118 SER C CB  1 
ATOM   5212  O OG  . SER C 1 138 ? -12.542 -21.438 -7.417  1.00 57.94  ? 118 SER C OG  1 
ATOM   5213  N N   . LEU C 1 139 ? -15.309 -21.449 -5.163  1.00 52.66  ? 119 LEU C N   1 
ATOM   5214  C CA  . LEU C 1 139 ? -16.746 -21.165 -5.212  1.00 49.56  ? 119 LEU C CA  1 
ATOM   5215  C C   . LEU C 1 139 ? -17.343 -21.073 -3.810  1.00 47.00  ? 119 LEU C C   1 
ATOM   5216  O O   . LEU C 1 139 ? -16.826 -21.658 -2.850  1.00 42.89  ? 119 LEU C O   1 
ATOM   5217  C CB  . LEU C 1 139 ? -17.477 -22.214 -6.036  1.00 50.57  ? 119 LEU C CB  1 
ATOM   5218  C CG  . LEU C 1 139 ? -16.949 -22.390 -7.459  1.00 51.40  ? 119 LEU C CG  1 
ATOM   5219  C CD1 . LEU C 1 139 ? -17.475 -23.694 -7.991  1.00 53.45  ? 119 LEU C CD1 1 
ATOM   5220  C CD2 . LEU C 1 139 ? -17.394 -21.271 -8.380  1.00 51.01  ? 119 LEU C CD2 1 
ATOM   5221  N N   . SER C 1 140 ? -18.431 -20.321 -3.701  1.00 44.53  ? 120 SER C N   1 
ATOM   5222  C CA  . SER C 1 140 ? -19.034 -20.052 -2.409  1.00 41.64  ? 120 SER C CA  1 
ATOM   5223  C C   . SER C 1 140 ? -19.843 -21.235 -1.898  1.00 42.61  ? 120 SER C C   1 
ATOM   5224  O O   . SER C 1 140 ? -20.834 -21.624 -2.516  1.00 40.32  ? 120 SER C O   1 
ATOM   5225  C CB  . SER C 1 140 ? -19.969 -18.870 -2.507  1.00 40.10  ? 120 SER C CB  1 
ATOM   5226  O OG  . SER C 1 140 ? -20.585 -18.671 -1.249  1.00 36.64  ? 120 SER C OG  1 
ATOM   5227  N N   . ILE C 1 141 ? -19.435 -21.756 -0.744  1.00 43.72  ? 121 ILE C N   1 
ATOM   5228  C CA  . ILE C 1 141 ? -20.098 -22.882 -0.107  1.00 44.58  ? 121 ILE C CA  1 
ATOM   5229  C C   . ILE C 1 141 ? -21.520 -22.491 0.195   1.00 42.94  ? 121 ILE C C   1 
ATOM   5230  O O   . ILE C 1 141 ? -22.453 -23.202 -0.146  1.00 42.37  ? 121 ILE C O   1 
ATOM   5231  C CB  . ILE C 1 141 ? -19.392 -23.290 1.202   1.00 46.99  ? 121 ILE C CB  1 
ATOM   5232  C CG1 . ILE C 1 141 ? -18.023 -23.884 0.902   1.00 47.96  ? 121 ILE C CG1 1 
ATOM   5233  C CG2 . ILE C 1 141 ? -20.181 -24.368 1.937   1.00 48.08  ? 121 ILE C CG2 1 
ATOM   5234  C CD1 . ILE C 1 141 ? -18.057 -24.954 -0.173  1.00 48.21  ? 121 ILE C CD1 1 
ATOM   5235  N N   . THR C 1 142 ? -21.673 -21.343 0.827   1.00 40.95  ? 122 THR C N   1 
ATOM   5236  C CA  . THR C 1 142 ? -22.991 -20.793 1.080   1.00 40.12  ? 122 THR C CA  1 
ATOM   5237  C C   . THR C 1 142 ? -23.870 -20.747 -0.162  1.00 40.81  ? 122 THR C C   1 
ATOM   5238  O O   . THR C 1 142 ? -25.043 -21.071 -0.104  1.00 42.60  ? 122 THR C O   1 
ATOM   5239  C CB  . THR C 1 142 ? -22.876 -19.372 1.631   1.00 38.74  ? 122 THR C CB  1 
ATOM   5240  O OG1 . THR C 1 142 ? -22.102 -19.388 2.840   1.00 35.59  ? 122 THR C OG1 1 
ATOM   5241  C CG2 . THR C 1 142 ? -24.245 -18.799 1.929   1.00 38.72  ? 122 THR C CG2 1 
ATOM   5242  N N   . GLU C 1 143 ? -23.322 -20.331 -1.288  1.00 44.22  ? 123 GLU C N   1 
ATOM   5243  C CA  . GLU C 1 143 ? -24.157 -20.198 -2.456  1.00 44.89  ? 123 GLU C CA  1 
ATOM   5244  C C   . GLU C 1 143 ? -24.537 -21.574 -2.977  1.00 45.98  ? 123 GLU C C   1 
ATOM   5245  O O   . GLU C 1 143 ? -25.654 -21.781 -3.472  1.00 46.85  ? 123 GLU C O   1 
ATOM   5246  C CB  . GLU C 1 143 ? -23.461 -19.389 -3.527  1.00 45.68  ? 123 GLU C CB  1 
ATOM   5247  C CG  . GLU C 1 143 ? -24.427 -18.882 -4.587  1.00 47.03  ? 123 GLU C CG  1 
ATOM   5248  C CD  . GLU C 1 143 ? -23.744 -18.228 -5.781  1.00 49.15  ? 123 GLU C CD  1 
ATOM   5249  O OE1 . GLU C 1 143 ? -22.630 -17.658 -5.644  1.00 49.53  ? 123 GLU C OE1 1 
ATOM   5250  O OE2 . GLU C 1 143 ? -24.336 -18.290 -6.873  1.00 48.40  ? 123 GLU C OE2 1 
ATOM   5251  N N   . VAL C 1 144 ? -23.615 -22.518 -2.853  1.00 45.40  ? 124 VAL C N   1 
ATOM   5252  C CA  . VAL C 1 144 ? -23.902 -23.891 -3.254  1.00 47.88  ? 124 VAL C CA  1 
ATOM   5253  C C   . VAL C 1 144 ? -24.947 -24.498 -2.339  1.00 45.69  ? 124 VAL C C   1 
ATOM   5254  O O   . VAL C 1 144 ? -25.901 -25.105 -2.806  1.00 42.62  ? 124 VAL C O   1 
ATOM   5255  C CB  . VAL C 1 144 ? -22.651 -24.772 -3.233  1.00 49.35  ? 124 VAL C CB  1 
ATOM   5256  C CG1 . VAL C 1 144 ? -23.029 -26.232 -3.451  1.00 49.67  ? 124 VAL C CG1 1 
ATOM   5257  C CG2 . VAL C 1 144 ? -21.691 -24.305 -4.313  1.00 48.24  ? 124 VAL C CG2 1 
ATOM   5258  N N   . ALA C 1 145 ? -24.760 -24.294 -1.038  1.00 44.38  ? 125 ALA C N   1 
ATOM   5259  C CA  . ALA C 1 145 ? -25.691 -24.775 -0.030  1.00 43.77  ? 125 ALA C CA  1 
ATOM   5260  C C   . ALA C 1 145 ? -27.109 -24.336 -0.335  1.00 46.86  ? 125 ALA C C   1 
ATOM   5261  O O   . ALA C 1 145 ? -28.071 -25.057 -0.071  1.00 52.58  ? 125 ALA C O   1 
ATOM   5262  C CB  . ALA C 1 145 ? -25.281 -24.269 1.330   1.00 41.87  ? 125 ALA C CB  1 
ATOM   5263  N N   . SER C 1 146 ? -27.228 -23.153 -0.917  1.00 48.83  ? 126 SER C N   1 
ATOM   5264  C CA  . SER C 1 146 ? -28.527 -22.554 -1.185  1.00 48.94  ? 126 SER C CA  1 
ATOM   5265  C C   . SER C 1 146 ? -29.264 -23.210 -2.326  1.00 46.58  ? 126 SER C C   1 
ATOM   5266  O O   . SER C 1 146 ? -30.436 -22.956 -2.518  1.00 45.42  ? 126 SER C O   1 
ATOM   5267  C CB  . SER C 1 146 ? -28.383 -21.060 -1.487  1.00 50.60  ? 126 SER C CB  1 
ATOM   5268  O OG  . SER C 1 146 ? -28.408 -20.322 -0.278  1.00 52.70  ? 126 SER C OG  1 
ATOM   5269  N N   . ALA C 1 147 ? -28.590 -24.030 -3.113  1.00 45.30  ? 127 ALA C N   1 
ATOM   5270  C CA  . ALA C 1 147 ? -29.296 -24.732 -4.170  1.00 45.15  ? 127 ALA C CA  1 
ATOM   5271  C C   . ALA C 1 147 ? -30.008 -25.970 -3.651  1.00 45.14  ? 127 ALA C C   1 
ATOM   5272  O O   . ALA C 1 147 ? -30.697 -26.625 -4.416  1.00 44.17  ? 127 ALA C O   1 
ATOM   5273  C CB  . ALA C 1 147 ? -28.340 -25.111 -5.269  1.00 46.32  ? 127 ALA C CB  1 
ATOM   5274  N N   . THR C 1 148 ? -29.838 -26.265 -2.360  1.00 47.52  ? 128 THR C N   1 
ATOM   5275  C CA  . THR C 1 148 ? -30.392 -27.449 -1.717  1.00 49.32  ? 128 THR C CA  1 
ATOM   5276  C C   . THR C 1 148 ? -31.361 -27.049 -0.624  1.00 53.12  ? 128 THR C C   1 
ATOM   5277  O O   . THR C 1 148 ? -31.484 -25.875 -0.276  1.00 53.34  ? 128 THR C O   1 
ATOM   5278  C CB  . THR C 1 148 ? -29.292 -28.275 -1.011  1.00 48.36  ? 128 THR C CB  1 
ATOM   5279  O OG1 . THR C 1 148 ? -28.903 -27.633 0.221   1.00 42.39  ? 128 THR C OG1 1 
ATOM   5280  C CG2 . THR C 1 148 ? -28.082 -28.436 -1.895  1.00 49.47  ? 128 THR C CG2 1 
ATOM   5281  N N   . LYS C 1 149 ? -32.011 -28.056 -0.054  1.00 55.34  ? 129 LYS C N   1 
ATOM   5282  C CA  . LYS C 1 149 ? -32.844 -27.868 1.116   1.00 56.01  ? 129 LYS C CA  1 
ATOM   5283  C C   . LYS C 1 149 ? -32.184 -28.310 2.393   1.00 52.02  ? 129 LYS C C   1 
ATOM   5284  O O   . LYS C 1 149 ? -32.817 -28.269 3.432   1.00 53.00  ? 129 LYS C O   1 
ATOM   5285  C CB  . LYS C 1 149 ? -34.171 -28.580 0.941   1.00 59.87  ? 129 LYS C CB  1 
ATOM   5286  C CG  . LYS C 1 149 ? -35.090 -27.809 0.016   1.00 67.72  ? 129 LYS C CG  1 
ATOM   5287  C CD  . LYS C 1 149 ? -36.203 -28.672 -0.547  1.00 75.42  ? 129 LYS C CD  1 
ATOM   5288  C CE  . LYS C 1 149 ? -35.705 -29.583 -1.669  1.00 82.98  ? 129 LYS C CE  1 
ATOM   5289  N NZ  . LYS C 1 149 ? -36.709 -29.699 -2.765  1.00 86.29  ? 129 LYS C NZ  1 
ATOM   5290  N N   . ARG C 1 150 ? -30.911 -28.686 2.337   1.00 52.86  ? 130 ARG C N   1 
ATOM   5291  C CA  . ARG C 1 150 ? -30.163 -29.035 3.559   1.00 51.63  ? 130 ARG C CA  1 
ATOM   5292  C C   . ARG C 1 150 ? -28.890 -28.194 3.793   1.00 49.85  ? 130 ARG C C   1 
ATOM   5293  O O   . ARG C 1 150 ? -27.807 -28.735 4.038   1.00 49.29  ? 130 ARG C O   1 
ATOM   5294  C CB  . ARG C 1 150 ? -29.818 -30.521 3.552   1.00 51.02  ? 130 ARG C CB  1 
ATOM   5295  C CG  . ARG C 1 150 ? -29.001 -30.970 2.357   1.00 49.84  ? 130 ARG C CG  1 
ATOM   5296  C CD  . ARG C 1 150 ? -28.714 -32.450 2.456   1.00 47.79  ? 130 ARG C CD  1 
ATOM   5297  N NE  . ARG C 1 150 ? -29.708 -33.244 1.747   1.00 45.12  ? 130 ARG C NE  1 
ATOM   5298  C CZ  . ARG C 1 150 ? -29.816 -34.559 1.856   1.00 42.42  ? 130 ARG C CZ  1 
ATOM   5299  N NH1 . ARG C 1 150 ? -28.983 -35.221 2.646   1.00 43.23  ? 130 ARG C NH1 1 
ATOM   5300  N NH2 . ARG C 1 150 ? -30.745 -35.213 1.168   1.00 41.88  ? 130 ARG C NH2 1 
ATOM   5301  N N   . PRO C 1 151 ? -29.027 -26.861 3.777   1.00 47.20  ? 131 PRO C N   1 
ATOM   5302  C CA  . PRO C 1 151 ? -27.866 -25.978 3.936   1.00 48.32  ? 131 PRO C CA  1 
ATOM   5303  C C   . PRO C 1 151 ? -27.072 -26.225 5.196   1.00 46.47  ? 131 PRO C C   1 
ATOM   5304  O O   . PRO C 1 151 ? -25.858 -26.024 5.206   1.00 49.04  ? 131 PRO C O   1 
ATOM   5305  C CB  . PRO C 1 151 ? -28.477 -24.567 3.974   1.00 47.73  ? 131 PRO C CB  1 
ATOM   5306  C CG  . PRO C 1 151 ? -29.959 -24.755 4.040   1.00 46.28  ? 131 PRO C CG  1 
ATOM   5307  C CD  . PRO C 1 151 ? -30.247 -26.102 3.466   1.00 46.50  ? 131 PRO C CD  1 
ATOM   5308  N N   . ASP C 1 152 ? -27.762 -26.640 6.253   1.00 48.68  ? 132 ASP C N   1 
ATOM   5309  C CA  . ASP C 1 152 ? -27.104 -27.046 7.506   1.00 47.71  ? 132 ASP C CA  1 
ATOM   5310  C C   . ASP C 1 152 ? -26.139 -28.193 7.289   1.00 46.08  ? 132 ASP C C   1 
ATOM   5311  O O   . ASP C 1 152 ? -25.218 -28.380 8.081   1.00 41.40  ? 132 ASP C O   1 
ATOM   5312  C CB  . ASP C 1 152 ? -28.131 -27.424 8.592   1.00 49.13  ? 132 ASP C CB  1 
ATOM   5313  C CG  . ASP C 1 152 ? -29.080 -28.557 8.174   1.00 50.24  ? 132 ASP C CG  1 
ATOM   5314  O OD1 . ASP C 1 152 ? -29.774 -28.444 7.137   1.00 49.04  ? 132 ASP C OD1 1 
ATOM   5315  O OD2 . ASP C 1 152 ? -29.150 -29.555 8.924   1.00 51.78  ? 132 ASP C OD2 1 
ATOM   5316  N N   . LYS C 1 153 ? -26.353 -28.934 6.200   1.00 46.96  ? 133 LYS C N   1 
ATOM   5317  C CA  . LYS C 1 153 ? -25.554 -30.103 5.862   1.00 50.35  ? 133 LYS C CA  1 
ATOM   5318  C C   . LYS C 1 153 ? -24.620 -29.961 4.668   1.00 49.58  ? 133 LYS C C   1 
ATOM   5319  O O   . LYS C 1 153 ? -24.166 -30.967 4.109   1.00 50.47  ? 133 LYS C O   1 
ATOM   5320  C CB  . LYS C 1 153 ? -26.503 -31.259 5.598   1.00 54.74  ? 133 LYS C CB  1 
ATOM   5321  C CG  . LYS C 1 153 ? -27.156 -31.730 6.875   1.00 57.53  ? 133 LYS C CG  1 
ATOM   5322  C CD  . LYS C 1 153 ? -27.693 -33.129 6.731   1.00 60.51  ? 133 LYS C CD  1 
ATOM   5323  C CE  . LYS C 1 153 ? -28.005 -33.714 8.095   1.00 61.53  ? 133 LYS C CE  1 
ATOM   5324  N NZ  . LYS C 1 153 ? -26.949 -34.685 8.504   1.00 62.83  ? 133 LYS C NZ  1 
ATOM   5325  N N   . VAL C 1 154 ? -24.326 -28.729 4.275   1.00 46.72  ? 134 VAL C N   1 
ATOM   5326  C CA  . VAL C 1 154 ? -23.436 -28.501 3.158   1.00 43.11  ? 134 VAL C CA  1 
ATOM   5327  C C   . VAL C 1 154 ? -22.215 -27.872 3.738   1.00 40.67  ? 134 VAL C C   1 
ATOM   5328  O O   . VAL C 1 154 ? -22.304 -27.079 4.662   1.00 38.03  ? 134 VAL C O   1 
ATOM   5329  C CB  . VAL C 1 154 ? -24.070 -27.597 2.124   1.00 44.19  ? 134 VAL C CB  1 
ATOM   5330  C CG1 . VAL C 1 154 ? -23.058 -27.210 1.063   1.00 44.19  ? 134 VAL C CG1 1 
ATOM   5331  C CG2 . VAL C 1 154 ? -25.247 -28.322 1.503   1.00 43.71  ? 134 VAL C CG2 1 
ATOM   5332  N N   . ILE C 1 155 ? -21.062 -28.268 3.243   1.00 40.39  ? 135 ILE C N   1 
ATOM   5333  C CA  . ILE C 1 155 ? -19.835 -27.852 3.890   1.00 41.98  ? 135 ILE C CA  1 
ATOM   5334  C C   . ILE C 1 155 ? -18.691 -27.958 2.911   1.00 42.47  ? 135 ILE C C   1 
ATOM   5335  O O   . ILE C 1 155 ? -18.794 -28.618 1.882   1.00 41.02  ? 135 ILE C O   1 
ATOM   5336  C CB  . ILE C 1 155 ? -19.553 -28.707 5.140   1.00 42.82  ? 135 ILE C CB  1 
ATOM   5337  C CG1 . ILE C 1 155 ? -18.682 -27.928 6.115   1.00 42.94  ? 135 ILE C CG1 1 
ATOM   5338  C CG2 . ILE C 1 155 ? -18.892 -30.024 4.764   1.00 43.08  ? 135 ILE C CG2 1 
ATOM   5339  C CD1 . ILE C 1 155 ? -18.306 -28.689 7.353   1.00 42.75  ? 135 ILE C CD1 1 
ATOM   5340  N N   . GLY C 1 156 ? -17.599 -27.289 3.217   1.00 43.77  ? 136 GLY C N   1 
ATOM   5341  C CA  . GLY C 1 156 ? -16.443 -27.376 2.357   1.00 44.14  ? 136 GLY C CA  1 
ATOM   5342  C C   . GLY C 1 156 ? -15.414 -28.284 2.971   1.00 43.05  ? 136 GLY C C   1 
ATOM   5343  O O   . GLY C 1 156 ? -15.099 -28.180 4.148   1.00 43.56  ? 136 GLY C O   1 
ATOM   5344  N N   . MET C 1 157 ? -14.887 -29.183 2.168   1.00 44.77  ? 137 MET C N   1 
ATOM   5345  C CA  . MET C 1 157 ? -13.791 -30.009 2.604   1.00 48.10  ? 137 MET C CA  1 
ATOM   5346  C C   . MET C 1 157 ? -12.688 -29.879 1.592   1.00 44.67  ? 137 MET C C   1 
ATOM   5347  O O   . MET C 1 157 ? -12.758 -30.482 0.532   1.00 40.95  ? 137 MET C O   1 
ATOM   5348  C CB  . MET C 1 157 ? -14.253 -31.445 2.658   1.00 53.81  ? 137 MET C CB  1 
ATOM   5349  C CG  . MET C 1 157 ? -14.003 -32.086 3.990   1.00 57.57  ? 137 MET C CG  1 
ATOM   5350  S SD  . MET C 1 157 ? -14.706 -33.733 3.975   1.00 63.57  ? 137 MET C SD  1 
ATOM   5351  C CE  . MET C 1 157 ? -13.415 -34.586 4.857   1.00 62.37  ? 137 MET C CE  1 
ATOM   5352  N N   . HIS C 1 158 ? -11.673 -29.095 1.922   1.00 42.92  ? 138 HIS C N   1 
ATOM   5353  C CA  . HIS C 1 158 ? -10.683 -28.697 0.940   1.00 45.16  ? 138 HIS C CA  1 
ATOM   5354  C C   . HIS C 1 158 ? -9.428  -29.486 1.179   1.00 44.57  ? 138 HIS C C   1 
ATOM   5355  O O   . HIS C 1 158 ? -8.778  -29.292 2.195   1.00 41.74  ? 138 HIS C O   1 
ATOM   5356  C CB  . HIS C 1 158 ? -10.407 -27.192 1.066   1.00 46.05  ? 138 HIS C CB  1 
ATOM   5357  C CG  . HIS C 1 158 ? -9.548  -26.645 -0.029  1.00 46.51  ? 138 HIS C CG  1 
ATOM   5358  N ND1 . HIS C 1 158 ? -8.462  -25.828 0.217   1.00 45.99  ? 138 HIS C ND1 1 
ATOM   5359  C CD2 . HIS C 1 158 ? -9.600  -26.815 -1.374  1.00 45.68  ? 138 HIS C CD2 1 
ATOM   5360  C CE1 . HIS C 1 158 ? -7.887  -25.513 -0.932  1.00 45.86  ? 138 HIS C CE1 1 
ATOM   5361  N NE2 . HIS C 1 158 ? -8.553  -26.104 -1.912  1.00 46.56  ? 138 HIS C NE2 1 
ATOM   5362  N N   . PHE C 1 159 ? -9.107  -30.377 0.246   1.00 47.17  ? 139 PHE C N   1 
ATOM   5363  C CA  . PHE C 1 159 ? -7.942  -31.248 0.354   1.00 50.03  ? 139 PHE C CA  1 
ATOM   5364  C C   . PHE C 1 159 ? -6.807  -30.692 -0.473  1.00 49.42  ? 139 PHE C C   1 
ATOM   5365  O O   . PHE C 1 159 ? -7.035  -30.036 -1.486  1.00 52.51  ? 139 PHE C O   1 
ATOM   5366  C CB  . PHE C 1 159 ? -8.274  -32.615 -0.202  1.00 52.86  ? 139 PHE C CB  1 
ATOM   5367  C CG  . PHE C 1 159 ? -9.138  -33.427 0.682   1.00 54.42  ? 139 PHE C CG  1 
ATOM   5368  C CD1 . PHE C 1 159 ? -10.505 -33.260 0.675   1.00 56.38  ? 139 PHE C CD1 1 
ATOM   5369  C CD2 . PHE C 1 159 ? -8.585  -34.383 1.499   1.00 54.09  ? 139 PHE C CD2 1 
ATOM   5370  C CE1 . PHE C 1 159 ? -11.308 -34.029 1.491   1.00 57.59  ? 139 PHE C CE1 1 
ATOM   5371  C CE2 . PHE C 1 159 ? -9.379  -35.157 2.314   1.00 54.97  ? 139 PHE C CE2 1 
ATOM   5372  C CZ  . PHE C 1 159 ? -10.740 -34.976 2.315   1.00 55.79  ? 139 PHE C CZ  1 
ATOM   5373  N N   . PHE C 1 160 ? -5.586  -31.000 -0.075  1.00 48.18  ? 140 PHE C N   1 
ATOM   5374  C CA  . PHE C 1 160 ? -4.422  -30.531 -0.816  1.00 46.59  ? 140 PHE C CA  1 
ATOM   5375  C C   . PHE C 1 160 ? -3.730  -31.626 -1.600  1.00 49.43  ? 140 PHE C C   1 
ATOM   5376  O O   . PHE C 1 160 ? -3.519  -32.725 -1.100  1.00 48.71  ? 140 PHE C O   1 
ATOM   5377  C CB  . PHE C 1 160 ? -3.466  -29.860 0.134   1.00 43.18  ? 140 PHE C CB  1 
ATOM   5378  C CG  . PHE C 1 160 ? -4.025  -28.615 0.687   1.00 44.44  ? 140 PHE C CG  1 
ATOM   5379  C CD1 . PHE C 1 160 ? -5.034  -28.670 1.626   1.00 44.42  ? 140 PHE C CD1 1 
ATOM   5380  C CD2 . PHE C 1 160 ? -3.609  -27.391 0.213   1.00 43.35  ? 140 PHE C CD2 1 
ATOM   5381  C CE1 . PHE C 1 160 ? -5.594  -27.519 2.118   1.00 45.54  ? 140 PHE C CE1 1 
ATOM   5382  C CE2 . PHE C 1 160 ? -4.158  -26.238 0.706   1.00 45.36  ? 140 PHE C CE2 1 
ATOM   5383  C CZ  . PHE C 1 160 ? -5.156  -26.300 1.658   1.00 45.51  ? 140 PHE C CZ  1 
ATOM   5384  N N   . ASN C 1 161 ? -3.381  -31.308 -2.839  1.00 51.98  ? 141 ASN C N   1 
ATOM   5385  C CA  . ASN C 1 161 ? -2.725  -32.262 -3.706  1.00 55.01  ? 141 ASN C CA  1 
ATOM   5386  C C   . ASN C 1 161 ? -1.285  -32.502 -3.231  1.00 57.77  ? 141 ASN C C   1 
ATOM   5387  O O   . ASN C 1 161 ? -0.582  -31.530 -2.918  1.00 55.32  ? 141 ASN C O   1 
ATOM   5388  C CB  . ASN C 1 161 ? -2.729  -31.759 -5.148  1.00 53.69  ? 141 ASN C CB  1 
ATOM   5389  C CG  . ASN C 1 161 ? -2.007  -32.702 -6.085  1.00 56.35  ? 141 ASN C CG  1 
ATOM   5390  O OD1 . ASN C 1 161 ? -1.174  -33.498 -5.665  1.00 57.42  ? 141 ASN C OD1 1 
ATOM   5391  N ND2 . ASN C 1 161 ? -2.323  -32.619 -7.366  1.00 55.14  ? 141 ASN C ND2 1 
ATOM   5392  N N   . PRO C 1 162 ? -0.838  -33.771 -3.169  1.00 58.11  ? 142 PRO C N   1 
ATOM   5393  C CA  . PRO C 1 162 ? -1.643  -34.975 -3.496  1.00 56.75  ? 142 PRO C CA  1 
ATOM   5394  C C   . PRO C 1 162 ? -2.378  -35.497 -2.276  1.00 54.44  ? 142 PRO C C   1 
ATOM   5395  O O   . PRO C 1 162 ? -1.789  -35.653 -1.198  1.00 51.81  ? 142 PRO C O   1 
ATOM   5396  C CB  . PRO C 1 162 ? -0.591  -35.991 -3.961  1.00 55.71  ? 142 PRO C CB  1 
ATOM   5397  C CG  . PRO C 1 162 ? 0.667   -35.582 -3.251  1.00 56.39  ? 142 PRO C CG  1 
ATOM   5398  C CD  . PRO C 1 162 ? 0.546   -34.135 -2.812  1.00 57.02  ? 142 PRO C CD  1 
ATOM   5399  N N   . ALA C 1 163 ? -3.659  -35.780 -2.454  1.00 55.41  ? 143 ALA C N   1 
ATOM   5400  C CA  . ALA C 1 163 ? -4.559  -35.966 -1.310  1.00 53.58  ? 143 ALA C CA  1 
ATOM   5401  C C   . ALA C 1 163 ? -4.209  -37.115 -0.357  1.00 53.25  ? 143 ALA C C   1 
ATOM   5402  O O   . ALA C 1 163 ? -4.416  -36.989 0.838   1.00 54.08  ? 143 ALA C O   1 
ATOM   5403  C CB  . ALA C 1 163 ? -5.985  -36.110 -1.796  1.00 52.02  ? 143 ALA C CB  1 
ATOM   5404  N N   . PRO C 1 164 ? -3.680  -38.235 -0.878  1.00 51.92  ? 144 PRO C N   1 
ATOM   5405  C CA  . PRO C 1 164 ? -3.367  -39.346 0.024   1.00 52.32  ? 144 PRO C CA  1 
ATOM   5406  C C   . PRO C 1 164 ? -2.273  -39.054 1.014   1.00 55.05  ? 144 PRO C C   1 
ATOM   5407  O O   . PRO C 1 164 ? -2.209  -39.707 2.049   1.00 58.41  ? 144 PRO C O   1 
ATOM   5408  C CB  . PRO C 1 164 ? -2.896  -40.444 -0.922  1.00 48.97  ? 144 PRO C CB  1 
ATOM   5409  C CG  . PRO C 1 164 ? -3.607  -40.134 -2.191  1.00 51.38  ? 144 PRO C CG  1 
ATOM   5410  C CD  . PRO C 1 164 ? -3.565  -38.641 -2.287  1.00 49.93  ? 144 PRO C CD  1 
ATOM   5411  N N   . VAL C 1 165 ? -1.425  -38.085 0.694   1.00 54.26  ? 145 VAL C N   1 
ATOM   5412  C CA  . VAL C 1 165 ? -0.239  -37.824 1.477   1.00 52.48  ? 145 VAL C CA  1 
ATOM   5413  C C   . VAL C 1 165 ? -0.392  -36.585 2.326   1.00 53.73  ? 145 VAL C C   1 
ATOM   5414  O O   . VAL C 1 165 ? -0.039  -36.580 3.504   1.00 51.43  ? 145 VAL C O   1 
ATOM   5415  C CB  . VAL C 1 165 ? 0.961   -37.613 0.562   1.00 52.99  ? 145 VAL C CB  1 
ATOM   5416  C CG1 . VAL C 1 165 ? 2.242   -37.611 1.382   1.00 52.27  ? 145 VAL C CG1 1 
ATOM   5417  C CG2 . VAL C 1 165 ? 1.002   -38.709 -0.487  1.00 52.83  ? 145 VAL C CG2 1 
ATOM   5418  N N   . MET C 1 166 ? -0.903  -35.527 1.717   1.00 56.29  ? 146 MET C N   1 
ATOM   5419  C CA  . MET C 1 166 ? -1.048  -34.256 2.414   1.00 57.50  ? 146 MET C CA  1 
ATOM   5420  C C   . MET C 1 166 ? -2.055  -34.364 3.554   1.00 54.01  ? 146 MET C C   1 
ATOM   5421  O O   . MET C 1 166 ? -3.200  -34.751 3.354   1.00 53.05  ? 146 MET C O   1 
ATOM   5422  C CB  . MET C 1 166 ? -1.478  -33.163 1.439   1.00 61.31  ? 146 MET C CB  1 
ATOM   5423  C CG  . MET C 1 166 ? -0.464  -32.905 0.337   1.00 61.58  ? 146 MET C CG  1 
ATOM   5424  S SD  . MET C 1 166 ? 1.008   -32.110 1.010   1.00 58.13  ? 146 MET C SD  1 
ATOM   5425  C CE  . MET C 1 166 ? 0.383   -30.448 1.302   1.00 59.45  ? 146 MET C CE  1 
ATOM   5426  N N   . LYS C 1 167 ? -1.609  -33.985 4.740   1.00 54.12  ? 147 LYS C N   1 
ATOM   5427  C CA  . LYS C 1 167 ? -2.360  -34.172 5.966   1.00 59.11  ? 147 LYS C CA  1 
ATOM   5428  C C   . LYS C 1 167 ? -3.482  -33.165 6.168   1.00 57.74  ? 147 LYS C C   1 
ATOM   5429  O O   . LYS C 1 167 ? -4.442  -33.415 6.899   1.00 57.46  ? 147 LYS C O   1 
ATOM   5430  C CB  . LYS C 1 167 ? -1.397  -34.068 7.149   1.00 65.05  ? 147 LYS C CB  1 
ATOM   5431  C CG  . LYS C 1 167 ? -0.314  -35.135 7.136   1.00 74.81  ? 147 LYS C CG  1 
ATOM   5432  C CD  . LYS C 1 167 ? -0.789  -36.422 7.811   1.00 82.76  ? 147 LYS C CD  1 
ATOM   5433  C CE  . LYS C 1 167 ? -0.002  -37.655 7.371   1.00 86.05  ? 147 LYS C CE  1 
ATOM   5434  N NZ  . LYS C 1 167 ? 1.323   -37.743 8.045   1.00 87.22  ? 147 LYS C NZ  1 
ATOM   5435  N N   . LEU C 1 168 ? -3.357  -32.009 5.542   1.00 55.37  ? 148 LEU C N   1 
ATOM   5436  C CA  . LEU C 1 168 ? -4.219  -30.909 5.872   1.00 48.94  ? 148 LEU C CA  1 
ATOM   5437  C C   . LEU C 1 168 ? -5.485  -30.921 5.059   1.00 47.73  ? 148 LEU C C   1 
ATOM   5438  O O   . LEU C 1 168 ? -5.480  -31.280 3.876   1.00 43.62  ? 148 LEU C O   1 
ATOM   5439  C CB  . LEU C 1 168 ? -3.478  -29.622 5.654   1.00 50.09  ? 148 LEU C CB  1 
ATOM   5440  C CG  . LEU C 1 168 ? -4.285  -28.335 5.734   1.00 51.70  ? 148 LEU C CG  1 
ATOM   5441  C CD1 . LEU C 1 168 ? -4.313  -27.795 7.149   1.00 50.74  ? 148 LEU C CD1 1 
ATOM   5442  C CD2 . LEU C 1 168 ? -3.617  -27.344 4.814   1.00 54.29  ? 148 LEU C CD2 1 
ATOM   5443  N N   . VAL C 1 169 ? -6.572  -30.539 5.725   1.00 45.42  ? 149 VAL C N   1 
ATOM   5444  C CA  . VAL C 1 169 ? -7.823  -30.256 5.053   1.00 48.03  ? 149 VAL C CA  1 
ATOM   5445  C C   . VAL C 1 169 ? -8.443  -29.029 5.699   1.00 45.46  ? 149 VAL C C   1 
ATOM   5446  O O   . VAL C 1 169 ? -8.408  -28.854 6.909   1.00 41.81  ? 149 VAL C O   1 
ATOM   5447  C CB  . VAL C 1 169 ? -8.799  -31.463 5.038   1.00 52.06  ? 149 VAL C CB  1 
ATOM   5448  C CG1 . VAL C 1 169 ? -8.264  -32.616 5.850   1.00 54.70  ? 149 VAL C CG1 1 
ATOM   5449  C CG2 . VAL C 1 169 ? -10.168 -31.075 5.555   1.00 51.93  ? 149 VAL C CG2 1 
ATOM   5450  N N   . GLU C 1 170 ? -8.992  -28.158 4.871   1.00 45.37  ? 150 GLU C N   1 
ATOM   5451  C CA  . GLU C 1 170 ? -9.619  -26.963 5.379   1.00 43.16  ? 150 GLU C CA  1 
ATOM   5452  C C   . GLU C 1 170 ? -11.096 -27.211 5.378   1.00 39.44  ? 150 GLU C C   1 
ATOM   5453  O O   . GLU C 1 170 ? -11.692 -27.486 4.353   1.00 35.69  ? 150 GLU C O   1 
ATOM   5454  C CB  . GLU C 1 170 ? -9.299  -25.763 4.509   1.00 45.35  ? 150 GLU C CB  1 
ATOM   5455  C CG  . GLU C 1 170 ? -7.832  -25.352 4.489   1.00 46.49  ? 150 GLU C CG  1 
ATOM   5456  C CD  . GLU C 1 170 ? -7.595  -24.099 3.627   1.00 47.34  ? 150 GLU C CD  1 
ATOM   5457  O OE1 . GLU C 1 170 ? -7.758  -24.140 2.380   1.00 46.18  ? 150 GLU C OE1 1 
ATOM   5458  O OE2 . GLU C 1 170 ? -7.257  -23.048 4.199   1.00 44.34  ? 150 GLU C OE2 1 
ATOM   5459  N N   . VAL C 1 171 ? -11.696 -27.124 6.542   1.00 39.76  ? 151 VAL C N   1 
ATOM   5460  C CA  . VAL C 1 171 ? -13.100 -27.392 6.646   1.00 41.75  ? 151 VAL C CA  1 
ATOM   5461  C C   . VAL C 1 171 ? -13.801 -26.063 6.560   1.00 42.03  ? 151 VAL C C   1 
ATOM   5462  O O   . VAL C 1 171 ? -13.640 -25.218 7.435   1.00 44.98  ? 151 VAL C O   1 
ATOM   5463  C CB  . VAL C 1 171 ? -13.419 -28.105 7.955   1.00 42.54  ? 151 VAL C CB  1 
ATOM   5464  C CG1 . VAL C 1 171 ? -14.884 -28.476 7.998   1.00 42.93  ? 151 VAL C CG1 1 
ATOM   5465  C CG2 . VAL C 1 171 ? -12.599 -29.376 8.034   1.00 42.62  ? 151 VAL C CG2 1 
ATOM   5466  N N   . ILE C 1 172 ? -14.564 -25.880 5.493   1.00 40.10  ? 152 ILE C N   1 
ATOM   5467  C CA  . ILE C 1 172 ? -15.099 -24.573 5.156   1.00 40.72  ? 152 ILE C CA  1 
ATOM   5468  C C   . ILE C 1 172 ? -16.561 -24.484 5.519   1.00 40.28  ? 152 ILE C C   1 
ATOM   5469  O O   . ILE C 1 172 ? -17.408 -25.046 4.832   1.00 38.63  ? 152 ILE C O   1 
ATOM   5470  C CB  . ILE C 1 172 ? -14.957 -24.241 3.650   1.00 39.90  ? 152 ILE C CB  1 
ATOM   5471  C CG1 . ILE C 1 172 ? -13.578 -24.640 3.114   1.00 41.15  ? 152 ILE C CG1 1 
ATOM   5472  C CG2 . ILE C 1 172 ? -15.160 -22.760 3.431   1.00 37.84  ? 152 ILE C CG2 1 
ATOM   5473  C CD1 . ILE C 1 172 ? -12.425 -23.996 3.841   1.00 41.00  ? 152 ILE C CD1 1 
ATOM   5474  N N   . ARG C 1 173 ? -16.853 -23.737 6.574   1.00 39.54  ? 153 ARG C N   1 
ATOM   5475  C CA  . ARG C 1 173 ? -18.234 -23.528 6.987   1.00 42.03  ? 153 ARG C CA  1 
ATOM   5476  C C   . ARG C 1 173 ? -18.902 -22.417 6.201   1.00 40.93  ? 153 ARG C C   1 
ATOM   5477  O O   . ARG C 1 173 ? -18.485 -21.261 6.245   1.00 42.23  ? 153 ARG C O   1 
ATOM   5478  C CB  . ARG C 1 173 ? -18.302 -23.202 8.470   1.00 42.43  ? 153 ARG C CB  1 
ATOM   5479  C CG  . ARG C 1 173 ? -17.847 -24.359 9.331   1.00 44.06  ? 153 ARG C CG  1 
ATOM   5480  C CD  . ARG C 1 173 ? -17.924 -24.024 10.788  1.00 44.93  ? 153 ARG C CD  1 
ATOM   5481  N NE  . ARG C 1 173 ? -19.310 -23.919 11.229  1.00 48.15  ? 153 ARG C NE  1 
ATOM   5482  C CZ  . ARG C 1 173 ? -19.699 -24.048 12.494  1.00 47.89  ? 153 ARG C CZ  1 
ATOM   5483  N NH1 . ARG C 1 173 ? -18.807 -24.304 13.446  1.00 47.15  ? 153 ARG C NH1 1 
ATOM   5484  N NH2 . ARG C 1 173 ? -20.980 -23.931 12.810  1.00 47.12  ? 153 ARG C NH2 1 
ATOM   5485  N N   . GLY C 1 174 ? -19.958 -22.790 5.492   1.00 38.37  ? 154 GLY C N   1 
ATOM   5486  C CA  . GLY C 1 174 ? -20.873 -21.839 4.924   1.00 35.69  ? 154 GLY C CA  1 
ATOM   5487  C C   . GLY C 1 174 ? -21.575 -21.199 6.082   1.00 35.84  ? 154 GLY C C   1 
ATOM   5488  O O   . GLY C 1 174 ? -21.365 -21.554 7.232   1.00 35.23  ? 154 GLY C O   1 
ATOM   5489  N N   . ILE C 1 175 ? -22.423 -20.246 5.798   1.00 40.85  ? 155 ILE C N   1 
ATOM   5490  C CA  . ILE C 1 175 ? -22.913 -19.431 6.885   1.00 42.53  ? 155 ILE C CA  1 
ATOM   5491  C C   . ILE C 1 175 ? -24.018 -20.156 7.637   1.00 41.73  ? 155 ILE C C   1 
ATOM   5492  O O   . ILE C 1 175 ? -24.221 -19.914 8.812   1.00 42.70  ? 155 ILE C O   1 
ATOM   5493  C CB  . ILE C 1 175 ? -23.312 -18.032 6.390   1.00 42.31  ? 155 ILE C CB  1 
ATOM   5494  C CG1 . ILE C 1 175 ? -23.307 -17.052 7.554   1.00 44.40  ? 155 ILE C CG1 1 
ATOM   5495  C CG2 . ILE C 1 175 ? -24.649 -18.044 5.667   1.00 42.50  ? 155 ILE C CG2 1 
ATOM   5496  C CD1 . ILE C 1 175 ? -24.136 -15.808 7.295   1.00 47.55  ? 155 ILE C CD1 1 
ATOM   5497  N N   . ALA C 1 176 ? -24.681 -21.078 6.956   1.00 41.24  ? 156 ALA C N   1 
ATOM   5498  C CA  . ALA C 1 176 ? -25.712 -21.892 7.562   1.00 43.02  ? 156 ALA C CA  1 
ATOM   5499  C C   . ALA C 1 176 ? -25.230 -23.314 7.875   1.00 45.25  ? 156 ALA C C   1 
ATOM   5500  O O   . ALA C 1 176 ? -26.024 -24.156 8.261   1.00 46.89  ? 156 ALA C O   1 
ATOM   5501  C CB  . ALA C 1 176 ? -26.904 -21.950 6.633   1.00 41.93  ? 156 ALA C CB  1 
ATOM   5502  N N   . THR C 1 177 ? -23.944 -23.587 7.701   1.00 45.38  ? 157 THR C N   1 
ATOM   5503  C CA  . THR C 1 177 ? -23.416 -24.902 7.998   1.00 45.40  ? 157 THR C CA  1 
ATOM   5504  C C   . THR C 1 177 ? -23.577 -25.134 9.484   1.00 46.55  ? 157 THR C C   1 
ATOM   5505  O O   . THR C 1 177 ? -23.164 -24.302 10.285  1.00 49.34  ? 157 THR C O   1 
ATOM   5506  C CB  . THR C 1 177 ? -21.935 -25.028 7.596   1.00 45.23  ? 157 THR C CB  1 
ATOM   5507  O OG1 . THR C 1 177 ? -21.830 -25.280 6.188   1.00 44.66  ? 157 THR C OG1 1 
ATOM   5508  C CG2 . THR C 1 177 ? -21.285 -26.173 8.304   1.00 45.08  ? 157 THR C CG2 1 
ATOM   5509  N N   . SER C 1 178 ? -24.180 -26.263 9.853   1.00 48.02  ? 158 SER C N   1 
ATOM   5510  C CA  . SER C 1 178 ? -24.457 -26.543 11.267  1.00 45.38  ? 158 SER C CA  1 
ATOM   5511  C C   . SER C 1 178 ? -23.212 -26.963 12.030  1.00 43.62  ? 158 SER C C   1 
ATOM   5512  O O   . SER C 1 178 ? -22.235 -27.459 11.458  1.00 38.57  ? 158 SER C O   1 
ATOM   5513  C CB  . SER C 1 178 ? -25.517 -27.618 11.415  1.00 45.31  ? 158 SER C CB  1 
ATOM   5514  O OG  . SER C 1 178 ? -24.934 -28.904 11.425  1.00 48.78  ? 158 SER C OG  1 
ATOM   5515  N N   . GLN C 1 179 ? -23.251 -26.749 13.333  1.00 44.74  ? 159 GLN C N   1 
ATOM   5516  C CA  . GLN C 1 179 ? -22.157 -27.162 14.185  1.00 48.43  ? 159 GLN C CA  1 
ATOM   5517  C C   . GLN C 1 179 ? -22.047 -28.696 14.223  1.00 51.10  ? 159 GLN C C   1 
ATOM   5518  O O   . GLN C 1 179 ? -20.964 -29.268 14.389  1.00 51.61  ? 159 GLN C O   1 
ATOM   5519  C CB  . GLN C 1 179 ? -22.385 -26.631 15.580  1.00 48.28  ? 159 GLN C CB  1 
ATOM   5520  C CG  . GLN C 1 179 ? -21.329 -27.092 16.563  1.00 48.24  ? 159 GLN C CG  1 
ATOM   5521  C CD  . GLN C 1 179 ? -19.988 -26.435 16.301  1.00 49.84  ? 159 GLN C CD  1 
ATOM   5522  O OE1 . GLN C 1 179 ? -19.880 -25.214 16.275  1.00 51.65  ? 159 GLN C OE1 1 
ATOM   5523  N NE2 . GLN C 1 179 ? -18.955 -27.244 16.118  1.00 52.37  ? 159 GLN C NE2 1 
ATOM   5524  N N   . GLU C 1 180 ? -23.188 -29.349 14.083  1.00 53.59  ? 160 GLU C N   1 
ATOM   5525  C CA  . GLU C 1 180 ? -23.227 -30.795 13.971  1.00 56.41  ? 160 GLU C CA  1 
ATOM   5526  C C   . GLU C 1 180 ? -22.444 -31.227 12.763  1.00 50.75  ? 160 GLU C C   1 
ATOM   5527  O O   . GLU C 1 180 ? -21.581 -32.098 12.851  1.00 48.31  ? 160 GLU C O   1 
ATOM   5528  C CB  . GLU C 1 180 ? -24.666 -31.292 13.808  1.00 64.18  ? 160 GLU C CB  1 
ATOM   5529  C CG  . GLU C 1 180 ? -25.208 -32.054 15.002  1.00 70.32  ? 160 GLU C CG  1 
ATOM   5530  C CD  . GLU C 1 180 ? -26.603 -32.622 14.757  1.00 75.74  ? 160 GLU C CD  1 
ATOM   5531  O OE1 . GLU C 1 180 ? -26.949 -32.919 13.583  1.00 77.20  ? 160 GLU C OE1 1 
ATOM   5532  O OE2 . GLU C 1 180 ? -27.357 -32.776 15.747  1.00 70.75  ? 160 GLU C OE2 1 
ATOM   5533  N N   . THR C 1 181 ? -22.777 -30.634 11.621  1.00 47.79  ? 161 THR C N   1 
ATOM   5534  C CA  . THR C 1 181 ? -22.133 -30.994 10.364  1.00 44.95  ? 161 THR C CA  1 
ATOM   5535  C C   . THR C 1 181 ? -20.632 -30.759 10.397  1.00 44.44  ? 161 THR C C   1 
ATOM   5536  O O   . THR C 1 181 ? -19.860 -31.562 9.869   1.00 46.89  ? 161 THR C O   1 
ATOM   5537  C CB  . THR C 1 181 ? -22.715 -30.223 9.189   1.00 42.87  ? 161 THR C CB  1 
ATOM   5538  O OG1 . THR C 1 181 ? -24.125 -30.465 9.109   1.00 42.21  ? 161 THR C OG1 1 
ATOM   5539  C CG2 . THR C 1 181 ? -22.079 -30.682 7.918   1.00 43.74  ? 161 THR C CG2 1 
ATOM   5540  N N   . PHE C 1 182 ? -20.210 -29.673 11.019  1.00 41.78  ? 162 PHE C N   1 
ATOM   5541  C CA  . PHE C 1 182 ? -18.796 -29.415 11.091  1.00 44.41  ? 162 PHE C CA  1 
ATOM   5542  C C   . PHE C 1 182 ? -18.112 -30.461 11.944  1.00 46.64  ? 162 PHE C C   1 
ATOM   5543  O O   . PHE C 1 182 ? -17.020 -30.923 11.623  1.00 47.65  ? 162 PHE C O   1 
ATOM   5544  C CB  . PHE C 1 182 ? -18.499 -28.049 11.683  1.00 43.81  ? 162 PHE C CB  1 
ATOM   5545  C CG  . PHE C 1 182 ? -17.068 -27.893 12.077  1.00 42.36  ? 162 PHE C CG  1 
ATOM   5546  C CD1 . PHE C 1 182 ? -16.092 -27.729 11.115  1.00 45.88  ? 162 PHE C CD1 1 
ATOM   5547  C CD2 . PHE C 1 182 ? -16.694 -27.962 13.400  1.00 42.46  ? 162 PHE C CD2 1 
ATOM   5548  C CE1 . PHE C 1 182 ? -14.757 -27.606 11.474  1.00 46.88  ? 162 PHE C CE1 1 
ATOM   5549  C CE2 . PHE C 1 182 ? -15.370 -27.846 13.771  1.00 44.05  ? 162 PHE C CE2 1 
ATOM   5550  C CZ  . PHE C 1 182 ? -14.395 -27.670 12.807  1.00 45.97  ? 162 PHE C CZ  1 
ATOM   5551  N N   . ASP C 1 183 ? -18.742 -30.799 13.059  1.00 50.29  ? 163 ASP C N   1 
ATOM   5552  C CA  . ASP C 1 183 ? -18.153 -31.752 13.990  1.00 50.26  ? 163 ASP C CA  1 
ATOM   5553  C C   . ASP C 1 183 ? -17.991 -33.130 13.358  1.00 46.77  ? 163 ASP C C   1 
ATOM   5554  O O   . ASP C 1 183 ? -16.978 -33.805 13.555  1.00 45.09  ? 163 ASP C O   1 
ATOM   5555  C CB  . ASP C 1 183 ? -18.961 -31.810 15.286  1.00 53.07  ? 163 ASP C CB  1 
ATOM   5556  C CG  . ASP C 1 183 ? -18.543 -30.735 16.273  1.00 56.12  ? 163 ASP C CG  1 
ATOM   5557  O OD1 . ASP C 1 183 ? -17.356 -30.318 16.265  1.00 52.41  ? 163 ASP C OD1 1 
ATOM   5558  O OD2 . ASP C 1 183 ? -19.406 -30.310 17.065  1.00 59.69  ? 163 ASP C OD2 1 
ATOM   5559  N N   . ALA C 1 184 ? -18.958 -33.530 12.552  1.00 43.00  ? 164 ALA C N   1 
ATOM   5560  C CA  . ALA C 1 184 ? -18.868 -34.827 11.908  1.00 42.69  ? 164 ALA C CA  1 
ATOM   5561  C C   . ALA C 1 184 ? -17.744 -34.842 10.900  1.00 44.84  ? 164 ALA C C   1 
ATOM   5562  O O   . ALA C 1 184 ? -16.958 -35.787 10.866  1.00 49.18  ? 164 ALA C O   1 
ATOM   5563  C CB  . ALA C 1 184 ? -20.174 -35.173 11.231  1.00 41.66  ? 164 ALA C CB  1 
ATOM   5564  N N   . VAL C 1 185 ? -17.672 -33.796 10.078  1.00 47.32  ? 165 VAL C N   1 
ATOM   5565  C CA  . VAL C 1 185 ? -16.652 -33.711 9.034   1.00 47.10  ? 165 VAL C CA  1 
ATOM   5566  C C   . VAL C 1 185 ? -15.259 -33.611 9.627   1.00 48.66  ? 165 VAL C C   1 
ATOM   5567  O O   . VAL C 1 185 ? -14.279 -34.101 9.056   1.00 51.93  ? 165 VAL C O   1 
ATOM   5568  C CB  . VAL C 1 185 ? -16.887 -32.511 8.122   1.00 47.09  ? 165 VAL C CB  1 
ATOM   5569  C CG1 . VAL C 1 185 ? -15.697 -32.298 7.207   1.00 46.50  ? 165 VAL C CG1 1 
ATOM   5570  C CG2 . VAL C 1 185 ? -18.137 -32.743 7.300   1.00 48.86  ? 165 VAL C CG2 1 
ATOM   5571  N N   . LYS C 1 186 ? -15.167 -32.979 10.780  1.00 47.78  ? 166 LYS C N   1 
ATOM   5572  C CA  . LYS C 1 186 ? -13.893 -32.907 11.455  1.00 51.68  ? 166 LYS C CA  1 
ATOM   5573  C C   . LYS C 1 186 ? -13.459 -34.272 12.009  1.00 53.54  ? 166 LYS C C   1 
ATOM   5574  O O   . LYS C 1 186 ? -12.302 -34.664 11.833  1.00 52.08  ? 166 LYS C O   1 
ATOM   5575  C CB  . LYS C 1 186 ? -13.967 -31.888 12.574  1.00 53.16  ? 166 LYS C CB  1 
ATOM   5576  C CG  . LYS C 1 186 ? -12.794 -31.965 13.510  1.00 54.83  ? 166 LYS C CG  1 
ATOM   5577  C CD  . LYS C 1 186 ? -13.027 -31.083 14.710  1.00 57.87  ? 166 LYS C CD  1 
ATOM   5578  C CE  . LYS C 1 186 ? -11.691 -30.579 15.225  1.00 61.89  ? 166 LYS C CE  1 
ATOM   5579  N NZ  . LYS C 1 186 ? -11.777 -30.215 16.659  1.00 65.21  ? 166 LYS C NZ  1 
ATOM   5580  N N   . GLU C 1 187 ? -14.376 -34.972 12.691  1.00 56.00  ? 167 GLU C N   1 
ATOM   5581  C CA  . GLU C 1 187 ? -14.085 -36.301 13.264  1.00 58.11  ? 167 GLU C CA  1 
ATOM   5582  C C   . GLU C 1 187 ? -13.676 -37.234 12.130  1.00 55.05  ? 167 GLU C C   1 
ATOM   5583  O O   . GLU C 1 187 ? -12.703 -37.990 12.244  1.00 50.58  ? 167 GLU C O   1 
ATOM   5584  C CB  . GLU C 1 187 ? -15.289 -36.881 14.030  1.00 60.77  ? 167 GLU C CB  1 
ATOM   5585  C CG  . GLU C 1 187 ? -15.643 -36.145 15.327  1.00 67.41  ? 167 GLU C CG  1 
ATOM   5586  C CD  . GLU C 1 187 ? -17.133 -36.233 15.730  1.00 74.21  ? 167 GLU C CD  1 
ATOM   5587  O OE1 . GLU C 1 187 ? -17.934 -36.935 15.064  1.00 79.97  ? 167 GLU C OE1 1 
ATOM   5588  O OE2 . GLU C 1 187 ? -17.519 -35.581 16.728  1.00 69.97  ? 167 GLU C OE2 1 
ATOM   5589  N N   . THR C 1 188 ? -14.395 -37.141 11.016  1.00 51.75  ? 168 THR C N   1 
ATOM   5590  C CA  . THR C 1 188 ? -14.080 -37.974 9.863   1.00 54.21  ? 168 THR C CA  1 
ATOM   5591  C C   . THR C 1 188 ? -12.710 -37.655 9.290   1.00 54.20  ? 168 THR C C   1 
ATOM   5592  O O   . THR C 1 188 ? -12.055 -38.530 8.727   1.00 54.85  ? 168 THR C O   1 
ATOM   5593  C CB  . THR C 1 188 ? -15.086 -37.780 8.728   1.00 54.65  ? 168 THR C CB  1 
ATOM   5594  O OG1 . THR C 1 188 ? -16.381 -38.194 9.161   1.00 54.13  ? 168 THR C OG1 1 
ATOM   5595  C CG2 . THR C 1 188 ? -14.689 -38.613 7.518   1.00 55.65  ? 168 THR C CG2 1 
ATOM   5596  N N   . SER C 1 189 ? -12.291 -36.401 9.410   1.00 53.72  ? 169 SER C N   1 
ATOM   5597  C CA  . SER C 1 189 ? -11.012 -35.972 8.851   1.00 53.78  ? 169 SER C CA  1 
ATOM   5598  C C   . SER C 1 189 ? -9.903  -36.560 9.691   1.00 50.71  ? 169 SER C C   1 
ATOM   5599  O O   . SER C 1 189 ? -8.941  -37.125 9.180   1.00 44.22  ? 169 SER C O   1 
ATOM   5600  C CB  . SER C 1 189 ? -10.897 -34.443 8.849   1.00 53.90  ? 169 SER C CB  1 
ATOM   5601  O OG  . SER C 1 189 ? -11.730 -33.870 7.856   1.00 53.79  ? 169 SER C OG  1 
ATOM   5602  N N   . ILE C 1 190 ? -10.066 -36.425 10.997  1.00 50.39  ? 170 ILE C N   1 
ATOM   5603  C CA  . ILE C 1 190 ? -9.142  -37.014 11.933  1.00 51.67  ? 170 ILE C CA  1 
ATOM   5604  C C   . ILE C 1 190 ? -9.066  -38.514 11.734  1.00 50.70  ? 170 ILE C C   1 
ATOM   5605  O O   . ILE C 1 190 ? -8.013  -39.115 11.903  1.00 51.06  ? 170 ILE C O   1 
ATOM   5606  C CB  . ILE C 1 190 ? -9.556  -36.692 13.374  1.00 54.18  ? 170 ILE C CB  1 
ATOM   5607  C CG1 . ILE C 1 190 ? -9.009  -35.316 13.752  1.00 52.79  ? 170 ILE C CG1 1 
ATOM   5608  C CG2 . ILE C 1 190 ? -9.016  -37.725 14.355  1.00 53.89  ? 170 ILE C CG2 1 
ATOM   5609  C CD1 . ILE C 1 190 ? -9.970  -34.519 14.596  1.00 55.01  ? 170 ILE C CD1 1 
ATOM   5610  N N   . ALA C 1 191 ? -10.180 -39.104 11.344  1.00 49.80  ? 171 ALA C N   1 
ATOM   5611  C CA  . ALA C 1 191 ? -10.255 -40.537 11.211  1.00 51.77  ? 171 ALA C CA  1 
ATOM   5612  C C   . ALA C 1 191 ? -9.552  -41.077 9.973   1.00 52.27  ? 171 ALA C C   1 
ATOM   5613  O O   . ALA C 1 191 ? -9.175  -42.241 9.942   1.00 52.53  ? 171 ALA C O   1 
ATOM   5614  C CB  . ALA C 1 191 ? -11.702 -40.972 11.233  1.00 53.38  ? 171 ALA C CB  1 
ATOM   5615  N N   . ILE C 1 192 ? -9.362  -40.255 8.951   1.00 53.67  ? 172 ILE C N   1 
ATOM   5616  C CA  . ILE C 1 192 ? -8.516  -40.694 7.829   1.00 51.63  ? 172 ILE C CA  1 
ATOM   5617  C C   . ILE C 1 192 ? -7.080  -40.207 7.973   1.00 50.19  ? 172 ILE C C   1 
ATOM   5618  O O   . ILE C 1 192 ? -6.300  -40.261 7.037   1.00 45.84  ? 172 ILE C O   1 
ATOM   5619  C CB  . ILE C 1 192 ? -9.106  -40.306 6.482   1.00 52.33  ? 172 ILE C CB  1 
ATOM   5620  C CG1 . ILE C 1 192 ? -9.331  -38.797 6.405   1.00 50.17  ? 172 ILE C CG1 1 
ATOM   5621  C CG2 . ILE C 1 192 ? -10.414 -41.058 6.309   1.00 54.25  ? 172 ILE C CG2 1 
ATOM   5622  C CD1 . ILE C 1 192 ? -9.876  -38.355 5.065   1.00 49.81  ? 172 ILE C CD1 1 
ATOM   5623  N N   . GLY C 1 193 ? -6.751  -39.741 9.172   1.00 53.52  ? 173 GLY C N   1 
ATOM   5624  C CA  . GLY C 1 193 ? -5.379  -39.444 9.534   1.00 56.89  ? 173 GLY C CA  1 
ATOM   5625  C C   . GLY C 1 193 ? -4.974  -38.055 9.115   1.00 58.45  ? 173 GLY C C   1 
ATOM   5626  O O   . GLY C 1 193 ? -3.783  -37.765 9.001   1.00 59.42  ? 173 GLY C O   1 
ATOM   5627  N N   . LYS C 1 194 ? -5.970  -37.200 8.901   1.00 56.64  ? 174 LYS C N   1 
ATOM   5628  C CA  . LYS C 1 194 ? -5.739  -35.845 8.455   1.00 55.79  ? 174 LYS C CA  1 
ATOM   5629  C C   . LYS C 1 194 ? -5.828  -34.893 9.618   1.00 57.03  ? 174 LYS C C   1 
ATOM   5630  O O   . LYS C 1 194 ? -6.233  -35.270 10.714  1.00 55.75  ? 174 LYS C O   1 
ATOM   5631  C CB  . LYS C 1 194 ? -6.771  -35.445 7.417   1.00 55.26  ? 174 LYS C CB  1 
ATOM   5632  C CG  . LYS C 1 194 ? -6.753  -36.335 6.203   1.00 57.80  ? 174 LYS C CG  1 
ATOM   5633  C CD  . LYS C 1 194 ? -5.593  -36.046 5.275   1.00 56.96  ? 174 LYS C CD  1 
ATOM   5634  C CE  . LYS C 1 194 ? -5.860  -36.738 3.949   1.00 54.80  ? 174 LYS C CE  1 
ATOM   5635  N NZ  . LYS C 1 194 ? -4.590  -36.897 3.204   1.00 56.96  ? 174 LYS C NZ  1 
ATOM   5636  N N   . ASP C 1 195 ? -5.453  -33.650 9.344   1.00 56.28  ? 175 ASP C N   1 
ATOM   5637  C CA  . ASP C 1 195 ? -5.410  -32.614 10.335  1.00 57.62  ? 175 ASP C CA  1 
ATOM   5638  C C   . ASP C 1 195 ? -6.262  -31.420 9.874   1.00 58.34  ? 175 ASP C C   1 
ATOM   5639  O O   . ASP C 1 195 ? -5.868  -30.661 8.985   1.00 61.95  ? 175 ASP C O   1 
ATOM   5640  C CB  . ASP C 1 195 ? -3.966  -32.207 10.558  1.00 59.93  ? 175 ASP C CB  1 
ATOM   5641  C CG  . ASP C 1 195 ? -3.713  -31.773 11.970  1.00 62.29  ? 175 ASP C CG  1 
ATOM   5642  O OD1 . ASP C 1 195 ? -4.706  -31.420 12.655  1.00 64.98  ? 175 ASP C OD1 1 
ATOM   5643  O OD2 . ASP C 1 195 ? -2.534  -31.777 12.393  1.00 61.15  ? 175 ASP C OD2 1 
ATOM   5644  N N   . PRO C 1 196 ? -7.457  -31.281 10.456  1.00 54.43  ? 176 PRO C N   1 
ATOM   5645  C CA  . PRO C 1 196 ? -8.420  -30.304 9.982   1.00 49.62  ? 176 PRO C CA  1 
ATOM   5646  C C   . PRO C 1 196 ? -8.374  -28.974 10.688  1.00 46.87  ? 176 PRO C C   1 
ATOM   5647  O O   . PRO C 1 196 ? -8.090  -28.889 11.873  1.00 44.15  ? 176 PRO C O   1 
ATOM   5648  C CB  . PRO C 1 196 ? -9.766  -30.984 10.236  1.00 51.69  ? 176 PRO C CB  1 
ATOM   5649  C CG  . PRO C 1 196 ? -9.506  -31.947 11.332  1.00 53.32  ? 176 PRO C CG  1 
ATOM   5650  C CD  . PRO C 1 196 ? -8.111  -32.422 11.125  1.00 55.45  ? 176 PRO C CD  1 
ATOM   5651  N N   . VAL C 1 197 ? -8.687  -27.933 9.939   1.00 45.70  ? 177 VAL C N   1 
ATOM   5652  C CA  . VAL C 1 197 ? -8.738  -26.598 10.494  1.00 43.70  ? 177 VAL C CA  1 
ATOM   5653  C C   . VAL C 1 197 ? -10.109 -26.056 10.158  1.00 41.85  ? 177 VAL C C   1 
ATOM   5654  O O   . VAL C 1 197 ? -10.689 -26.358 9.110   1.00 40.44  ? 177 VAL C O   1 
ATOM   5655  C CB  . VAL C 1 197 ? -7.609  -25.700 9.935   1.00 46.00  ? 177 VAL C CB  1 
ATOM   5656  C CG1 . VAL C 1 197 ? -6.261  -26.177 10.434  1.00 44.96  ? 177 VAL C CG1 1 
ATOM   5657  C CG2 . VAL C 1 197 ? -7.583  -25.701 8.412   1.00 45.18  ? 177 VAL C CG2 1 
ATOM   5658  N N   . GLU C 1 198 ? -10.647 -25.269 11.059  1.00 42.33  ? 178 GLU C N   1 
ATOM   5659  C CA  . GLU C 1 198 ? -11.961 -24.705 10.847  1.00 44.73  ? 178 GLU C CA  1 
ATOM   5660  C C   . GLU C 1 198 ? -11.843 -23.321 10.213  1.00 43.95  ? 178 GLU C C   1 
ATOM   5661  O O   . GLU C 1 198 ? -11.139 -22.442 10.707  1.00 43.76  ? 178 GLU C O   1 
ATOM   5662  C CB  . GLU C 1 198 ? -12.671 -24.614 12.171  1.00 46.79  ? 178 GLU C CB  1 
ATOM   5663  C CG  . GLU C 1 198 ? -14.124 -24.218 12.078  1.00 51.14  ? 178 GLU C CG  1 
ATOM   5664  C CD  . GLU C 1 198 ? -14.760 -24.116 13.452  1.00 56.59  ? 178 GLU C CD  1 
ATOM   5665  O OE1 . GLU C 1 198 ? -14.057 -24.340 14.473  1.00 58.05  ? 178 GLU C OE1 1 
ATOM   5666  O OE2 . GLU C 1 198 ? -15.970 -23.810 13.514  1.00 60.53  ? 178 GLU C OE2 1 
ATOM   5667  N N   . VAL C 1 199 ? -12.535 -23.145 9.106   1.00 43.91  ? 179 VAL C N   1 
ATOM   5668  C CA  . VAL C 1 199 ? -12.466 -21.915 8.357   1.00 44.30  ? 179 VAL C CA  1 
ATOM   5669  C C   . VAL C 1 199 ? -13.855 -21.491 7.983   1.00 43.10  ? 179 VAL C C   1 
ATOM   5670  O O   . VAL C 1 199 ? -14.552 -22.221 7.282   1.00 45.77  ? 179 VAL C O   1 
ATOM   5671  C CB  . VAL C 1 199 ? -11.706 -22.110 7.035   1.00 46.04  ? 179 VAL C CB  1 
ATOM   5672  C CG1 . VAL C 1 199 ? -11.577 -20.788 6.313   1.00 44.68  ? 179 VAL C CG1 1 
ATOM   5673  C CG2 . VAL C 1 199 ? -10.323 -22.695 7.278   1.00 46.79  ? 179 VAL C CG2 1 
ATOM   5674  N N   . ALA C 1 200 ? -14.260 -20.310 8.420   1.00 41.57  ? 180 ALA C N   1 
ATOM   5675  C CA  . ALA C 1 200 ? -15.507 -19.726 7.917   1.00 40.22  ? 180 ALA C CA  1 
ATOM   5676  C C   . ALA C 1 200 ? -15.285 -19.280 6.486   1.00 39.71  ? 180 ALA C C   1 
ATOM   5677  O O   . ALA C 1 200 ? -14.232 -18.766 6.141   1.00 43.98  ? 180 ALA C O   1 
ATOM   5678  C CB  . ALA C 1 200 ? -15.922 -18.547 8.757   1.00 39.10  ? 180 ALA C CB  1 
ATOM   5679  N N   . GLU C 1 201 ? -16.284 -19.470 5.653   1.00 38.61  ? 181 GLU C N   1 
ATOM   5680  C CA  . GLU C 1 201 ? -16.150 -19.133 4.262   1.00 40.35  ? 181 GLU C CA  1 
ATOM   5681  C C   . GLU C 1 201 ? -15.649 -17.713 4.005   1.00 44.19  ? 181 GLU C C   1 
ATOM   5682  O O   . GLU C 1 201 ? -16.258 -16.724 4.424   1.00 46.81  ? 181 GLU C O   1 
ATOM   5683  C CB  . GLU C 1 201 ? -17.470 -19.292 3.582   1.00 38.45  ? 181 GLU C CB  1 
ATOM   5684  C CG  . GLU C 1 201 ? -17.353 -19.082 2.094   1.00 39.49  ? 181 GLU C CG  1 
ATOM   5685  C CD  . GLU C 1 201 ? -18.713 -18.995 1.460   1.00 39.60  ? 181 GLU C CD  1 
ATOM   5686  O OE1 . GLU C 1 201 ? -19.654 -19.541 2.059   1.00 41.90  ? 181 GLU C OE1 1 
ATOM   5687  O OE2 . GLU C 1 201 ? -18.850 -18.385 0.388   1.00 37.15  ? 181 GLU C OE2 1 
ATOM   5688  N N   . ALA C 1 202 ? -14.539 -17.636 3.290   1.00 45.82  ? 182 ALA C N   1 
ATOM   5689  C CA  . ALA C 1 202 ? -13.993 -16.370 2.825   1.00 45.68  ? 182 ALA C CA  1 
ATOM   5690  C C   . ALA C 1 202 ? -13.054 -16.656 1.662   1.00 46.11  ? 182 ALA C C   1 
ATOM   5691  O O   . ALA C 1 202 ? -12.449 -17.736 1.598   1.00 45.92  ? 182 ALA C O   1 
ATOM   5692  C CB  . ALA C 1 202 ? -13.255 -15.658 3.940   1.00 46.43  ? 182 ALA C CB  1 
ATOM   5693  N N   . PRO C 1 203 ? -12.916 -15.691 0.747   1.00 43.34  ? 183 PRO C N   1 
ATOM   5694  C CA  . PRO C 1 203 ? -12.180 -15.885 -0.502  1.00 42.88  ? 183 PRO C CA  1 
ATOM   5695  C C   . PRO C 1 203 ? -10.756 -16.428 -0.270  1.00 39.96  ? 183 PRO C C   1 
ATOM   5696  O O   . PRO C 1 203 ? -9.990  -15.846 0.495   1.00 36.84  ? 183 PRO C O   1 
ATOM   5697  C CB  . PRO C 1 203 ? -12.146 -14.475 -1.109  1.00 45.38  ? 183 PRO C CB  1 
ATOM   5698  C CG  . PRO C 1 203 ? -13.204 -13.706 -0.392  1.00 44.98  ? 183 PRO C CG  1 
ATOM   5699  C CD  . PRO C 1 203 ? -13.226 -14.272 0.982   1.00 43.77  ? 183 PRO C CD  1 
ATOM   5700  N N   . GLY C 1 204 ? -10.445 -17.575 -0.868  1.00 38.37  ? 184 GLY C N   1 
ATOM   5701  C CA  . GLY C 1 204 ? -9.152  -18.230 -0.664  1.00 38.34  ? 184 GLY C CA  1 
ATOM   5702  C C   . GLY C 1 204 ? -8.934  -18.911 0.686   1.00 39.98  ? 184 GLY C C   1 
ATOM   5703  O O   . GLY C 1 204 ? -7.837  -19.387 0.951   1.00 45.11  ? 184 GLY C O   1 
ATOM   5704  N N   . PHE C 1 205 ? -9.954  -18.961 1.543   1.00 39.10  ? 185 PHE C N   1 
ATOM   5705  C CA  . PHE C 1 205 ? -9.860  -19.661 2.819   1.00 38.59  ? 185 PHE C CA  1 
ATOM   5706  C C   . PHE C 1 205 ? -8.629  -19.176 3.553   1.00 41.03  ? 185 PHE C C   1 
ATOM   5707  O O   . PHE C 1 205 ? -8.485  -17.973 3.758   1.00 45.89  ? 185 PHE C O   1 
ATOM   5708  C CB  . PHE C 1 205 ? -9.825  -21.187 2.617   1.00 37.99  ? 185 PHE C CB  1 
ATOM   5709  C CG  . PHE C 1 205 ? -10.847 -21.690 1.659   1.00 35.06  ? 185 PHE C CG  1 
ATOM   5710  C CD1 . PHE C 1 205 ? -12.085 -21.094 1.577   1.00 33.75  ? 185 PHE C CD1 1 
ATOM   5711  C CD2 . PHE C 1 205 ? -10.578 -22.778 0.864   1.00 36.40  ? 185 PHE C CD2 1 
ATOM   5712  C CE1 . PHE C 1 205 ? -13.025 -21.546 0.680   1.00 34.13  ? 185 PHE C CE1 1 
ATOM   5713  C CE2 . PHE C 1 205 ? -11.524 -23.259 -0.021  1.00 36.03  ? 185 PHE C CE2 1 
ATOM   5714  C CZ  . PHE C 1 205 ? -12.751 -22.631 -0.121  1.00 35.48  ? 185 PHE C CZ  1 
ATOM   5715  N N   . VAL C 1 206 ? -7.738  -20.078 3.954   1.00 42.03  ? 186 VAL C N   1 
ATOM   5716  C CA  . VAL C 1 206 ? -6.537  -19.639 4.632   1.00 41.72  ? 186 VAL C CA  1 
ATOM   5717  C C   . VAL C 1 206 ? -5.308  -19.750 3.754   1.00 43.12  ? 186 VAL C C   1 
ATOM   5718  O O   . VAL C 1 206 ? -4.496  -18.826 3.732   1.00 46.84  ? 186 VAL C O   1 
ATOM   5719  C CB  . VAL C 1 206 ? -6.297  -20.390 5.942   1.00 41.96  ? 186 VAL C CB  1 
ATOM   5720  C CG1 . VAL C 1 206 ? -4.986  -19.959 6.553   1.00 43.66  ? 186 VAL C CG1 1 
ATOM   5721  C CG2 . VAL C 1 206 ? -7.392  -20.083 6.932   1.00 43.11  ? 186 VAL C CG2 1 
ATOM   5722  N N   . VAL C 1 207 ? -5.165  -20.854 3.030   1.00 40.81  ? 187 VAL C N   1 
ATOM   5723  C CA  . VAL C 1 207 ? -3.889  -21.155 2.391   1.00 42.37  ? 187 VAL C CA  1 
ATOM   5724  C C   . VAL C 1 207 ? -3.682  -20.425 1.080   1.00 43.28  ? 187 VAL C C   1 
ATOM   5725  O O   . VAL C 1 207 ? -2.621  -19.850 0.858   1.00 43.73  ? 187 VAL C O   1 
ATOM   5726  C CB  . VAL C 1 207 ? -3.686  -22.660 2.172   1.00 43.72  ? 187 VAL C CB  1 
ATOM   5727  C CG1 . VAL C 1 207 ? -2.445  -22.928 1.327   1.00 42.83  ? 187 VAL C CG1 1 
ATOM   5728  C CG2 . VAL C 1 207 ? -3.524  -23.341 3.515   1.00 46.28  ? 187 VAL C CG2 1 
ATOM   5729  N N   . ASN C 1 208 ? -4.673  -20.458 0.206   1.00 42.66  ? 188 ASN C N   1 
ATOM   5730  C CA  . ASN C 1 208 ? -4.545  -19.774 -1.066  1.00 42.17  ? 188 ASN C CA  1 
ATOM   5731  C C   . ASN C 1 208 ? -4.527  -18.273 -0.860  1.00 40.80  ? 188 ASN C C   1 
ATOM   5732  O O   . ASN C 1 208 ? -3.927  -17.532 -1.627  1.00 38.11  ? 188 ASN C O   1 
ATOM   5733  C CB  . ASN C 1 208 ? -5.665  -20.181 -1.998  1.00 43.54  ? 188 ASN C CB  1 
ATOM   5734  C CG  . ASN C 1 208 ? -5.512  -21.604 -2.475  1.00 45.40  ? 188 ASN C CG  1 
ATOM   5735  O OD1 . ASN C 1 208 ? -4.408  -22.095 -2.596  1.00 48.33  ? 188 ASN C OD1 1 
ATOM   5736  N ND2 . ASN C 1 208 ? -6.616  -22.276 -2.726  1.00 46.69  ? 188 ASN C ND2 1 
ATOM   5737  N N   . ARG C 1 209 ? -5.158  -17.850 0.216   1.00 39.34  ? 189 ARG C N   1 
ATOM   5738  C CA  . ARG C 1 209 ? -5.249  -16.454 0.546   1.00 41.59  ? 189 ARG C CA  1 
ATOM   5739  C C   . ARG C 1 209 ? -3.909  -15.849 0.890   1.00 39.90  ? 189 ARG C C   1 
ATOM   5740  O O   . ARG C 1 209 ? -3.641  -14.690 0.586   1.00 39.63  ? 189 ARG C O   1 
ATOM   5741  C CB  . ARG C 1 209 ? -6.158  -16.308 1.741   1.00 46.43  ? 189 ARG C CB  1 
ATOM   5742  C CG  . ARG C 1 209 ? -7.183  -15.245 1.569   1.00 50.12  ? 189 ARG C CG  1 
ATOM   5743  C CD  . ARG C 1 209 ? -6.817  -14.024 2.351   1.00 53.78  ? 189 ARG C CD  1 
ATOM   5744  N NE  . ARG C 1 209 ? -7.621  -12.925 1.838   1.00 61.81  ? 189 ARG C NE  1 
ATOM   5745  C CZ  . ARG C 1 209 ? -8.634  -12.342 2.477   1.00 64.51  ? 189 ARG C CZ  1 
ATOM   5746  N NH1 . ARG C 1 209 ? -8.998  -12.701 3.717   1.00 61.97  ? 189 ARG C NH1 1 
ATOM   5747  N NH2 . ARG C 1 209 ? -9.275  -11.361 1.863   1.00 65.33  ? 189 ARG C NH2 1 
ATOM   5748  N N   . ILE C 1 210 ? -3.076  -16.632 1.554   1.00 39.77  ? 190 ILE C N   1 
ATOM   5749  C CA  . ILE C 1 210 ? -1.738  -16.179 1.881   1.00 39.77  ? 190 ILE C CA  1 
ATOM   5750  C C   . ILE C 1 210 ? -0.743  -16.517 0.780   1.00 39.64  ? 190 ILE C C   1 
ATOM   5751  O O   . ILE C 1 210 ? 0.089   -15.699 0.399   1.00 43.99  ? 190 ILE C O   1 
ATOM   5752  C CB  . ILE C 1 210 ? -1.278  -16.779 3.196   1.00 38.58  ? 190 ILE C CB  1 
ATOM   5753  C CG1 . ILE C 1 210 ? -2.305  -16.431 4.281   1.00 40.90  ? 190 ILE C CG1 1 
ATOM   5754  C CG2 . ILE C 1 210 ? 0.084   -16.235 3.532   1.00 38.10  ? 190 ILE C CG2 1 
ATOM   5755  C CD1 . ILE C 1 210 ? -1.940  -16.844 5.698   1.00 40.65  ? 190 ILE C CD1 1 
ATOM   5756  N N   . LEU C 1 211 ? -0.880  -17.710 0.234   1.00 39.82  ? 191 LEU C N   1 
ATOM   5757  C CA  . LEU C 1 211 ? 0.136   -18.273 -0.619  1.00 38.80  ? 191 LEU C CA  1 
ATOM   5758  C C   . LEU C 1 211 ? 0.197   -17.668 -2.005  1.00 36.80  ? 191 LEU C C   1 
ATOM   5759  O O   . LEU C 1 211 ? 1.265   -17.343 -2.494  1.00 33.60  ? 191 LEU C O   1 
ATOM   5760  C CB  . LEU C 1 211 ? -0.108  -19.776 -0.769  1.00 40.37  ? 191 LEU C CB  1 
ATOM   5761  C CG  . LEU C 1 211 ? 1.108   -20.526 -1.281  1.00 41.19  ? 191 LEU C CG  1 
ATOM   5762  C CD1 . LEU C 1 211 ? 2.175   -20.556 -0.195  1.00 43.05  ? 191 LEU C CD1 1 
ATOM   5763  C CD2 . LEU C 1 211 ? 0.700   -21.928 -1.663  1.00 42.50  ? 191 LEU C CD2 1 
ATOM   5764  N N   . ILE C 1 212 ? -0.947  -17.571 -2.657  1.00 34.71  ? 192 ILE C N   1 
ATOM   5765  C CA  . ILE C 1 212 ? -0.972  -17.156 -4.041  1.00 34.67  ? 192 ILE C CA  1 
ATOM   5766  C C   . ILE C 1 212 ? -0.596  -15.674 -4.234  1.00 36.14  ? 192 ILE C C   1 
ATOM   5767  O O   . ILE C 1 212 ? 0.124   -15.364 -5.170  1.00 35.60  ? 192 ILE C O   1 
ATOM   5768  C CB  . ILE C 1 212 ? -2.323  -17.504 -4.676  1.00 36.93  ? 192 ILE C CB  1 
ATOM   5769  C CG1 . ILE C 1 212 ? -2.693  -18.974 -4.404  1.00 39.73  ? 192 ILE C CG1 1 
ATOM   5770  C CG2 . ILE C 1 212 ? -2.279  -17.337 -6.177  1.00 37.07  ? 192 ILE C CG2 1 
ATOM   5771  C CD1 . ILE C 1 212 ? -1.700  -19.993 -4.947  1.00 39.76  ? 192 ILE C CD1 1 
ATOM   5772  N N   . PRO C 1 213 ? -1.057  -14.751 -3.359  1.00 37.76  ? 193 PRO C N   1 
ATOM   5773  C CA  . PRO C 1 213 ? -0.517  -13.378 -3.436  1.00 39.71  ? 193 PRO C CA  1 
ATOM   5774  C C   . PRO C 1 213 ? 0.988   -13.275 -3.259  1.00 38.89  ? 193 PRO C C   1 
ATOM   5775  O O   . PRO C 1 213 ? 1.625   -12.438 -3.873  1.00 40.74  ? 193 PRO C O   1 
ATOM   5776  C CB  . PRO C 1 213 ? -1.228  -12.660 -2.295  1.00 38.45  ? 193 PRO C CB  1 
ATOM   5777  C CG  . PRO C 1 213 ? -2.553  -13.329 -2.267  1.00 39.79  ? 193 PRO C CG  1 
ATOM   5778  C CD  . PRO C 1 213 ? -2.230  -14.791 -2.467  1.00 39.16  ? 193 PRO C CD  1 
ATOM   5779  N N   . MET C 1 214 ? 1.541   -14.142 -2.438  1.00 41.35  ? 194 MET C N   1 
ATOM   5780  C CA  . MET C 1 214 ? 2.979   -14.293 -2.309  1.00 41.59  ? 194 MET C CA  1 
ATOM   5781  C C   . MET C 1 214 ? 3.634   -14.568 -3.658  1.00 38.71  ? 194 MET C C   1 
ATOM   5782  O O   . MET C 1 214 ? 4.677   -14.004 -3.984  1.00 39.55  ? 194 MET C O   1 
ATOM   5783  C CB  . MET C 1 214 ? 3.222   -15.498 -1.460  1.00 47.13  ? 194 MET C CB  1 
ATOM   5784  C CG  . MET C 1 214 ? 4.074   -15.321 -0.262  1.00 53.12  ? 194 MET C CG  1 
ATOM   5785  S SD  . MET C 1 214 ? 4.375   -17.004 0.357   1.00 65.06  ? 194 MET C SD  1 
ATOM   5786  C CE  . MET C 1 214 ? 5.076   -17.862 -1.046  1.00 58.82  ? 194 MET C CE  1 
ATOM   5787  N N   . ILE C 1 215 ? 3.038   -15.469 -4.433  1.00 35.36  ? 195 ILE C N   1 
ATOM   5788  C CA  . ILE C 1 215 ? 3.573   -15.798 -5.755  1.00 33.94  ? 195 ILE C CA  1 
ATOM   5789  C C   . ILE C 1 215 ? 3.378   -14.625 -6.690  1.00 32.38  ? 195 ILE C C   1 
ATOM   5790  O O   . ILE C 1 215 ? 4.227   -14.310 -7.485  1.00 30.85  ? 195 ILE C O   1 
ATOM   5791  C CB  . ILE C 1 215 ? 2.874   -17.023 -6.343  1.00 35.16  ? 195 ILE C CB  1 
ATOM   5792  C CG1 . ILE C 1 215 ? 3.208   -18.244 -5.495  1.00 36.32  ? 195 ILE C CG1 1 
ATOM   5793  C CG2 . ILE C 1 215 ? 3.296   -17.270 -7.791  1.00 35.48  ? 195 ILE C CG2 1 
ATOM   5794  C CD1 . ILE C 1 215 ? 2.330   -19.436 -5.786  1.00 37.07  ? 195 ILE C CD1 1 
ATOM   5795  N N   . ASN C 1 216 ? 2.242   -13.971 -6.560  1.00 34.09  ? 196 ASN C N   1 
ATOM   5796  C CA  . ASN C 1 216 ? 1.891   -12.851 -7.399  1.00 32.54  ? 196 ASN C CA  1 
ATOM   5797  C C   . ASN C 1 216 ? 2.787   -11.650 -7.101  1.00 33.44  ? 196 ASN C C   1 
ATOM   5798  O O   . ASN C 1 216 ? 3.163   -10.923 -7.995  1.00 33.97  ? 196 ASN C O   1 
ATOM   5799  C CB  . ASN C 1 216 ? 0.422   -12.523 -7.196  1.00 32.03  ? 196 ASN C CB  1 
ATOM   5800  C CG  . ASN C 1 216 ? -0.046  -11.371 -8.065  1.00 32.10  ? 196 ASN C CG  1 
ATOM   5801  O OD1 . ASN C 1 216 ? -0.204  -11.518 -9.273  1.00 30.15  ? 196 ASN C OD1 1 
ATOM   5802  N ND2 . ASN C 1 216 ? -0.295  -10.224 -7.444  1.00 28.16  ? 196 ASN C ND2 1 
ATOM   5803  N N   . GLU C 1 217 ? 3.147   -11.462 -5.846  1.00 35.23  ? 197 GLU C N   1 
ATOM   5804  C CA  . GLU C 1 217 ? 4.116   -10.437 -5.469  1.00 36.40  ? 197 GLU C CA  1 
ATOM   5805  C C   . GLU C 1 217 ? 5.462   -10.737 -6.122  1.00 37.62  ? 197 GLU C C   1 
ATOM   5806  O O   . GLU C 1 217 ? 6.165   -9.839  -6.592  1.00 36.55  ? 197 GLU C O   1 
ATOM   5807  C CB  . GLU C 1 217 ? 4.271   -10.430 -3.952  1.00 37.26  ? 197 GLU C CB  1 
ATOM   5808  C CG  . GLU C 1 217 ? 5.097   -9.291  -3.397  1.00 40.18  ? 197 GLU C CG  1 
ATOM   5809  C CD  . GLU C 1 217 ? 4.407   -7.942  -3.546  1.00 43.02  ? 197 GLU C CD  1 
ATOM   5810  O OE1 . GLU C 1 217 ? 3.215   -7.829  -3.236  1.00 46.63  ? 197 GLU C OE1 1 
ATOM   5811  O OE2 . GLU C 1 217 ? 5.054   -6.975  -3.978  1.00 44.27  ? 197 GLU C OE2 1 
ATOM   5812  N N   . ALA C 1 218 ? 5.834   -12.010 -6.151  1.00 38.82  ? 198 ALA C N   1 
ATOM   5813  C CA  . ALA C 1 218 ? 7.102   -12.359 -6.763  1.00 38.20  ? 198 ALA C CA  1 
ATOM   5814  C C   . ALA C 1 218 ? 7.100   -12.044 -8.261  1.00 35.13  ? 198 ALA C C   1 
ATOM   5815  O O   . ALA C 1 218 ? 8.121   -11.676 -8.835  1.00 32.45  ? 198 ALA C O   1 
ATOM   5816  C CB  . ALA C 1 218 ? 7.448   -13.816 -6.528  1.00 38.97  ? 198 ALA C CB  1 
ATOM   5817  N N   . VAL C 1 219 ? 5.969   -12.157 -8.917  1.00 34.01  ? 199 VAL C N   1 
ATOM   5818  C CA  . VAL C 1 219 ? 6.048   -11.897 -10.331 1.00 36.10  ? 199 VAL C CA  1 
ATOM   5819  C C   . VAL C 1 219 ? 6.191   -10.398 -10.549 1.00 35.59  ? 199 VAL C C   1 
ATOM   5820  O O   . VAL C 1 219 ? 6.818   -9.987  -11.515 1.00 32.41  ? 199 VAL C O   1 
ATOM   5821  C CB  . VAL C 1 219 ? 4.976   -12.614 -11.190 1.00 38.08  ? 199 VAL C CB  1 
ATOM   5822  C CG1 . VAL C 1 219 ? 4.054   -13.451 -10.343 1.00 41.87  ? 199 VAL C CG1 1 
ATOM   5823  C CG2 . VAL C 1 219 ? 4.223   -11.665 -12.090 1.00 36.56  ? 199 VAL C CG2 1 
ATOM   5824  N N   . GLY C 1 220 ? 5.664   -9.607  -9.613  1.00 34.66  ? 200 GLY C N   1 
ATOM   5825  C CA  . GLY C 1 220 ? 5.807   -8.158  -9.625  1.00 34.67  ? 200 GLY C CA  1 
ATOM   5826  C C   . GLY C 1 220 ? 7.244   -7.670  -9.467  1.00 36.26  ? 200 GLY C C   1 
ATOM   5827  O O   . GLY C 1 220 ? 7.685   -6.753  -10.143 1.00 40.38  ? 200 GLY C O   1 
ATOM   5828  N N   . ILE C 1 221 ? 7.976   -8.292  -8.568  1.00 36.56  ? 201 ILE C N   1 
ATOM   5829  C CA  . ILE C 1 221 ? 9.381   -8.003  -8.390  1.00 35.23  ? 201 ILE C CA  1 
ATOM   5830  C C   . ILE C 1 221 ? 10.152  -8.339  -9.655  1.00 36.31  ? 201 ILE C C   1 
ATOM   5831  O O   . ILE C 1 221 ? 11.021  -7.589  -10.081 1.00 37.07  ? 201 ILE C O   1 
ATOM   5832  C CB  . ILE C 1 221 ? 9.923   -8.839  -7.230  1.00 35.66  ? 201 ILE C CB  1 
ATOM   5833  C CG1 . ILE C 1 221 ? 9.303   -8.343  -5.926  1.00 34.88  ? 201 ILE C CG1 1 
ATOM   5834  C CG2 . ILE C 1 221 ? 11.436  -8.790  -7.167  1.00 35.37  ? 201 ILE C CG2 1 
ATOM   5835  C CD1 . ILE C 1 221 ? 9.694   -9.167  -4.723  1.00 36.38  ? 201 ILE C CD1 1 
ATOM   5836  N N   . LEU C 1 222 ? 9.835   -9.481  -10.249 1.00 35.34  ? 202 LEU C N   1 
ATOM   5837  C CA  . LEU C 1 222 ? 10.487  -9.887  -11.484 1.00 33.14  ? 202 LEU C CA  1 
ATOM   5838  C C   . LEU C 1 222 ? 10.185  -8.918  -12.620 1.00 35.11  ? 202 LEU C C   1 
ATOM   5839  O O   . LEU C 1 222 ? 11.046  -8.636  -13.454 1.00 36.51  ? 202 LEU C O   1 
ATOM   5840  C CB  . LEU C 1 222 ? 10.024  -11.289 -11.887 1.00 31.51  ? 202 LEU C CB  1 
ATOM   5841  C CG  . LEU C 1 222 ? 10.539  -11.705 -13.268 1.00 31.52  ? 202 LEU C CG  1 
ATOM   5842  C CD1 . LEU C 1 222 ? 11.990  -12.124 -13.146 1.00 31.29  ? 202 LEU C CD1 1 
ATOM   5843  C CD2 . LEU C 1 222 ? 9.709   -12.819 -13.865 1.00 31.72  ? 202 LEU C CD2 1 
ATOM   5844  N N   . ALA C 1 223 ? 8.953   -8.426  -12.643 1.00 34.55  ? 203 ALA C N   1 
ATOM   5845  C CA  . ALA C 1 223 ? 8.439   -7.635  -13.744 1.00 34.44  ? 203 ALA C CA  1 
ATOM   5846  C C   . ALA C 1 223 ? 9.087   -6.252  -13.763 1.00 37.94  ? 203 ALA C C   1 
ATOM   5847  O O   . ALA C 1 223 ? 9.211   -5.611  -14.801 1.00 38.78  ? 203 ALA C O   1 
ATOM   5848  C CB  . ALA C 1 223 ? 6.929   -7.507  -13.596 1.00 34.36  ? 203 ALA C CB  1 
ATOM   5849  N N   . GLU C 1 224 ? 9.499   -5.800  -12.589 1.00 41.49  ? 204 GLU C N   1 
ATOM   5850  C CA  . GLU C 1 224 ? 10.172  -4.522  -12.453 1.00 42.31  ? 204 GLU C CA  1 
ATOM   5851  C C   . GLU C 1 224 ? 11.688  -4.628  -12.509 1.00 40.16  ? 204 GLU C C   1 
ATOM   5852  O O   . GLU C 1 224 ? 12.379  -3.650  -12.262 1.00 37.27  ? 204 GLU C O   1 
ATOM   5853  C CB  . GLU C 1 224 ? 9.711   -3.862  -11.173 1.00 45.81  ? 204 GLU C CB  1 
ATOM   5854  C CG  . GLU C 1 224 ? 8.347   -3.240  -11.387 1.00 53.35  ? 204 GLU C CG  1 
ATOM   5855  C CD  . GLU C 1 224 ? 7.966   -2.272  -10.304 1.00 59.67  ? 204 GLU C CD  1 
ATOM   5856  O OE1 . GLU C 1 224 ? 8.621   -1.213  -10.180 1.00 67.48  ? 204 GLU C OE1 1 
ATOM   5857  O OE2 . GLU C 1 224 ? 7.003   -2.575  -9.574  1.00 70.12  ? 204 GLU C OE2 1 
ATOM   5858  N N   . GLY C 1 225 ? 12.187  -5.813  -12.868 1.00 37.41  ? 205 GLY C N   1 
ATOM   5859  C CA  . GLY C 1 225 ? 13.617  -6.053  -13.031 1.00 35.77  ? 205 GLY C CA  1 
ATOM   5860  C C   . GLY C 1 225 ? 14.400  -6.009  -11.735 1.00 36.05  ? 205 GLY C C   1 
ATOM   5861  O O   . GLY C 1 225 ? 15.597  -5.757  -11.740 1.00 35.70  ? 205 GLY C O   1 
ATOM   5862  N N   . ILE C 1 226 ? 13.741  -6.256  -10.617 1.00 35.69  ? 206 ILE C N   1 
ATOM   5863  C CA  . ILE C 1 226 ? 14.391  -6.075  -9.337  1.00 37.82  ? 206 ILE C CA  1 
ATOM   5864  C C   . ILE C 1 226 ? 15.360  -7.211  -9.127  1.00 41.04  ? 206 ILE C C   1 
ATOM   5865  O O   . ILE C 1 226 ? 16.478  -7.027  -8.665  1.00 43.09  ? 206 ILE C O   1 
ATOM   5866  C CB  . ILE C 1 226 ? 13.378  -6.077  -8.201  1.00 37.93  ? 206 ILE C CB  1 
ATOM   5867  C CG1 . ILE C 1 226 ? 12.300  -5.019  -8.419  1.00 38.88  ? 206 ILE C CG1 1 
ATOM   5868  C CG2 . ILE C 1 226 ? 14.046  -5.795  -6.875  1.00 38.91  ? 206 ILE C CG2 1 
ATOM   5869  C CD1 . ILE C 1 226 ? 12.840  -3.651  -8.740  1.00 40.23  ? 206 ILE C CD1 1 
ATOM   5870  N N   . ALA C 1 227 ? 14.908  -8.395  -9.472  1.00 41.41  ? 207 ALA C N   1 
ATOM   5871  C CA  . ALA C 1 227 ? 15.734  -9.539  -9.344  1.00 40.35  ? 207 ALA C CA  1 
ATOM   5872  C C   . ALA C 1 227 ? 15.293  -10.539 -10.374 1.00 38.67  ? 207 ALA C C   1 
ATOM   5873  O O   . ALA C 1 227 ? 14.208  -10.441 -10.929 1.00 41.01  ? 207 ALA C O   1 
ATOM   5874  C CB  . ALA C 1 227 ? 15.607  -10.102 -7.945  1.00 42.00  ? 207 ALA C CB  1 
ATOM   5875  N N   . SER C 1 228 ? 16.166  -11.490 -10.634 1.00 37.70  ? 208 SER C N   1 
ATOM   5876  C CA  . SER C 1 228 ? 15.925  -12.534 -11.600 1.00 37.52  ? 208 SER C CA  1 
ATOM   5877  C C   . SER C 1 228 ? 15.081  -13.660 -10.964 1.00 36.85  ? 208 SER C C   1 
ATOM   5878  O O   . SER C 1 228 ? 14.973  -13.769 -9.735  1.00 34.48  ? 208 SER C O   1 
ATOM   5879  C CB  . SER C 1 228 ? 17.259  -13.099 -12.049 1.00 36.44  ? 208 SER C CB  1 
ATOM   5880  O OG  . SER C 1 228 ? 17.812  -13.856 -10.987 1.00 37.48  ? 208 SER C OG  1 
ATOM   5881  N N   . VAL C 1 229 ? 14.476  -14.486 -11.803 1.00 36.95  ? 209 VAL C N   1 
ATOM   5882  C CA  . VAL C 1 229 ? 13.642  -15.580 -11.286 1.00 38.60  ? 209 VAL C CA  1 
ATOM   5883  C C   . VAL C 1 229 ? 14.453  -16.517 -10.382 1.00 36.10  ? 209 VAL C C   1 
ATOM   5884  O O   . VAL C 1 229 ? 14.009  -16.894 -9.317  1.00 36.67  ? 209 VAL C O   1 
ATOM   5885  C CB  . VAL C 1 229 ? 12.819  -16.342 -12.371 1.00 40.58  ? 209 VAL C CB  1 
ATOM   5886  C CG1 . VAL C 1 229 ? 13.061  -15.838 -13.777 1.00 40.76  ? 209 VAL C CG1 1 
ATOM   5887  C CG2 . VAL C 1 229 ? 13.043  -17.842 -12.292 1.00 41.66  ? 209 VAL C CG2 1 
ATOM   5888  N N   . GLU C 1 230 ? 15.673  -16.822 -10.763 1.00 38.26  ? 210 GLU C N   1 
ATOM   5889  C CA  . GLU C 1 230 ? 16.516  -17.700 -9.940  1.00 41.18  ? 210 GLU C CA  1 
ATOM   5890  C C   . GLU C 1 230 ? 16.816  -17.035 -8.613  1.00 40.20  ? 210 GLU C C   1 
ATOM   5891  O O   . GLU C 1 230 ? 16.739  -17.664 -7.551  1.00 41.17  ? 210 GLU C O   1 
ATOM   5892  C CB  . GLU C 1 230 ? 17.820  -18.028 -10.665 1.00 46.67  ? 210 GLU C CB  1 
ATOM   5893  C CG  . GLU C 1 230 ? 17.639  -18.381 -12.148 1.00 53.29  ? 210 GLU C CG  1 
ATOM   5894  C CD  . GLU C 1 230 ? 17.783  -17.160 -13.064 1.00 59.83  ? 210 GLU C CD  1 
ATOM   5895  O OE1 . GLU C 1 230 ? 16.802  -16.798 -13.755 1.00 59.41  ? 210 GLU C OE1 1 
ATOM   5896  O OE2 . GLU C 1 230 ? 18.875  -16.536 -13.075 1.00 69.64  ? 210 GLU C OE2 1 
ATOM   5897  N N   . ASP C 1 231 ? 17.149  -15.750 -8.673  1.00 40.16  ? 211 ASP C N   1 
ATOM   5898  C CA  . ASP C 1 231 ? 17.520  -15.023 -7.462  1.00 38.77  ? 211 ASP C CA  1 
ATOM   5899  C C   . ASP C 1 231 ? 16.347  -14.824 -6.532  1.00 35.97  ? 211 ASP C C   1 
ATOM   5900  O O   . ASP C 1 231 ? 16.508  -14.848 -5.303  1.00 34.21  ? 211 ASP C O   1 
ATOM   5901  C CB  . ASP C 1 231 ? 18.180  -13.678 -7.783  1.00 39.98  ? 211 ASP C CB  1 
ATOM   5902  C CG  . ASP C 1 231 ? 19.686  -13.800 -7.986  1.00 41.84  ? 211 ASP C CG  1 
ATOM   5903  O OD1 . ASP C 1 231 ? 20.230  -14.891 -7.714  1.00 42.89  ? 211 ASP C OD1 1 
ATOM   5904  O OD2 . ASP C 1 231 ? 20.326  -12.812 -8.420  1.00 41.18  ? 211 ASP C OD2 1 
ATOM   5905  N N   . ILE C 1 232 ? 15.164  -14.638 -7.099  1.00 36.00  ? 212 ILE C N   1 
ATOM   5906  C CA  . ILE C 1 232 ? 13.983  -14.448 -6.263  1.00 36.78  ? 212 ILE C CA  1 
ATOM   5907  C C   . ILE C 1 232 ? 13.696  -15.722 -5.500  1.00 35.85  ? 212 ILE C C   1 
ATOM   5908  O O   . ILE C 1 232 ? 13.466  -15.699 -4.297  1.00 38.03  ? 212 ILE C O   1 
ATOM   5909  C CB  . ILE C 1 232 ? 12.744  -14.070 -7.083  1.00 37.70  ? 212 ILE C CB  1 
ATOM   5910  C CG1 . ILE C 1 232 ? 12.885  -12.664 -7.634  1.00 39.66  ? 212 ILE C CG1 1 
ATOM   5911  C CG2 . ILE C 1 232 ? 11.496  -14.090 -6.214  1.00 36.95  ? 212 ILE C CG2 1 
ATOM   5912  C CD1 . ILE C 1 232 ? 11.909  -12.369 -8.750  1.00 40.77  ? 212 ILE C CD1 1 
ATOM   5913  N N   . ASP C 1 233 ? 13.699  -16.836 -6.213  1.00 36.41  ? 213 ASP C N   1 
ATOM   5914  C CA  . ASP C 1 233 ? 13.379  -18.099 -5.593  1.00 37.20  ? 213 ASP C CA  1 
ATOM   5915  C C   . ASP C 1 233 ? 14.423  -18.473 -4.574  1.00 38.06  ? 213 ASP C C   1 
ATOM   5916  O O   . ASP C 1 233 ? 14.106  -18.929 -3.479  1.00 38.02  ? 213 ASP C O   1 
ATOM   5917  C CB  . ASP C 1 233 ? 13.261  -19.187 -6.637  1.00 37.82  ? 213 ASP C CB  1 
ATOM   5918  C CG  . ASP C 1 233 ? 11.888  -19.228 -7.259  1.00 38.88  ? 213 ASP C CG  1 
ATOM   5919  O OD1 . ASP C 1 233 ? 10.965  -18.561 -6.750  1.00 40.34  ? 213 ASP C OD1 1 
ATOM   5920  O OD2 . ASP C 1 233 ? 11.727  -19.929 -8.262  1.00 38.30  ? 213 ASP C OD2 1 
ATOM   5921  N N   . LYS C 1 234 ? 15.680  -18.272 -4.925  1.00 37.86  ? 214 LYS C N   1 
ATOM   5922  C CA  . LYS C 1 234 ? 16.725  -18.547 -3.977  1.00 38.87  ? 214 LYS C CA  1 
ATOM   5923  C C   . LYS C 1 234 ? 16.643  -17.692 -2.691  1.00 40.96  ? 214 LYS C C   1 
ATOM   5924  O O   . LYS C 1 234 ? 16.871  -18.190 -1.577  1.00 41.19  ? 214 LYS C O   1 
ATOM   5925  C CB  . LYS C 1 234 ? 18.063  -18.375 -4.643  1.00 42.49  ? 214 LYS C CB  1 
ATOM   5926  C CG  . LYS C 1 234 ? 19.142  -18.069 -3.622  1.00 45.43  ? 214 LYS C CG  1 
ATOM   5927  C CD  . LYS C 1 234 ? 20.445  -18.707 -3.975  1.00 46.05  ? 214 LYS C CD  1 
ATOM   5928  C CE  . LYS C 1 234 ? 20.853  -18.368 -5.385  1.00 48.54  ? 214 LYS C CE  1 
ATOM   5929  N NZ  . LYS C 1 234 ? 22.328  -18.269 -5.360  1.00 50.92  ? 214 LYS C NZ  1 
ATOM   5930  N N   . ALA C 1 235 ? 16.326  -16.412 -2.841  1.00 40.63  ? 215 ALA C N   1 
ATOM   5931  C CA  . ALA C 1 235 ? 16.148  -15.539 -1.679  1.00 39.79  ? 215 ALA C CA  1 
ATOM   5932  C C   . ALA C 1 235 ? 15.057  -16.040 -0.746  1.00 38.52  ? 215 ALA C C   1 
ATOM   5933  O O   . ALA C 1 235 ? 15.205  -16.025 0.466   1.00 38.58  ? 215 ALA C O   1 
ATOM   5934  C CB  . ALA C 1 235 ? 15.789  -14.142 -2.137  1.00 42.04  ? 215 ALA C CB  1 
ATOM   5935  N N   . MET C 1 236 ? 13.936  -16.449 -1.307  1.00 37.19  ? 216 MET C N   1 
ATOM   5936  C CA  . MET C 1 236 ? 12.866  -16.950 -0.478  1.00 37.84  ? 216 MET C CA  1 
ATOM   5937  C C   . MET C 1 236 ? 13.245  -18.291 0.148   1.00 40.30  ? 216 MET C C   1 
ATOM   5938  O O   . MET C 1 236 ? 12.882  -18.574 1.299   1.00 41.03  ? 216 MET C O   1 
ATOM   5939  C CB  . MET C 1 236 ? 11.586  -17.076 -1.284  1.00 39.14  ? 216 MET C CB  1 
ATOM   5940  C CG  . MET C 1 236 ? 11.006  -15.742 -1.695  1.00 39.06  ? 216 MET C CG  1 
ATOM   5941  S SD  . MET C 1 236 ? 10.961  -14.582 -0.320  1.00 45.27  ? 216 MET C SD  1 
ATOM   5942  C CE  . MET C 1 236 ? 9.713   -15.277 0.769   1.00 42.39  ? 216 MET C CE  1 
ATOM   5943  N N   . LYS C 1 237 ? 14.003  -19.105 -0.578  1.00 40.94  ? 217 LYS C N   1 
ATOM   5944  C CA  . LYS C 1 237 ? 14.421  -20.399 -0.023  1.00 43.82  ? 217 LYS C CA  1 
ATOM   5945  C C   . LYS C 1 237 ? 15.368  -20.283 1.157   1.00 42.49  ? 217 LYS C C   1 
ATOM   5946  O O   . LYS C 1 237 ? 15.152  -20.897 2.182   1.00 39.85  ? 217 LYS C O   1 
ATOM   5947  C CB  . LYS C 1 237 ? 15.065  -21.257 -1.083  1.00 44.84  ? 217 LYS C CB  1 
ATOM   5948  C CG  . LYS C 1 237 ? 14.034  -22.058 -1.827  1.00 46.66  ? 217 LYS C CG  1 
ATOM   5949  C CD  . LYS C 1 237 ? 14.696  -23.100 -2.696  1.00 51.12  ? 217 LYS C CD  1 
ATOM   5950  C CE  . LYS C 1 237 ? 14.990  -22.503 -4.055  1.00 56.53  ? 217 LYS C CE  1 
ATOM   5951  N NZ  . LYS C 1 237 ? 15.901  -23.365 -4.843  1.00 59.83  ? 217 LYS C NZ  1 
ATOM   5952  N N   . LEU C 1 238 ? 16.407  -19.483 0.998   1.00 41.89  ? 218 LEU C N   1 
ATOM   5953  C CA  . LEU C 1 238 ? 17.373  -19.281 2.057   1.00 41.06  ? 218 LEU C CA  1 
ATOM   5954  C C   . LEU C 1 238 ? 16.970  -18.223 3.062   1.00 42.41  ? 218 LEU C C   1 
ATOM   5955  O O   . LEU C 1 238 ? 17.388  -18.266 4.206   1.00 43.08  ? 218 LEU C O   1 
ATOM   5956  C CB  . LEU C 1 238 ? 18.689  -18.854 1.442   1.00 42.95  ? 218 LEU C CB  1 
ATOM   5957  C CG  . LEU C 1 238 ? 19.208  -19.752 0.335   1.00 44.24  ? 218 LEU C CG  1 
ATOM   5958  C CD1 . LEU C 1 238 ? 20.484  -19.158 -0.191  1.00 45.84  ? 218 LEU C CD1 1 
ATOM   5959  C CD2 . LEU C 1 238 ? 19.466  -21.144 0.860   1.00 42.92  ? 218 LEU C CD2 1 
ATOM   5960  N N   . GLY C 1 239 ? 16.196  -17.242 2.630   1.00 43.93  ? 219 GLY C N   1 
ATOM   5961  C CA  . GLY C 1 239 ? 15.881  -16.113 3.486   1.00 43.71  ? 219 GLY C CA  1 
ATOM   5962  C C   . GLY C 1 239 ? 14.734  -16.401 4.418   1.00 42.02  ? 219 GLY C C   1 
ATOM   5963  O O   . GLY C 1 239 ? 14.721  -15.951 5.555   1.00 40.60  ? 219 GLY C O   1 
ATOM   5964  N N   . ALA C 1 240 ? 13.759  -17.138 3.920   1.00 42.30  ? 220 ALA C N   1 
ATOM   5965  C CA  . ALA C 1 240 ? 12.561  -17.441 4.687   1.00 44.77  ? 220 ALA C CA  1 
ATOM   5966  C C   . ALA C 1 240 ? 12.489  -18.901 5.042   1.00 45.91  ? 220 ALA C C   1 
ATOM   5967  O O   . ALA C 1 240 ? 11.517  -19.349 5.646   1.00 44.37  ? 220 ALA C O   1 
ATOM   5968  C CB  . ALA C 1 240 ? 11.344  -17.067 3.875   1.00 45.97  ? 220 ALA C CB  1 
ATOM   5969  N N   . ASN C 1 241 ? 13.513  -19.637 4.629   1.00 47.97  ? 221 ASN C N   1 
ATOM   5970  C CA  . ASN C 1 241 ? 13.595  -21.063 4.839   1.00 48.82  ? 221 ASN C CA  1 
ATOM   5971  C C   . ASN C 1 241 ? 12.419  -21.834 4.243   1.00 49.04  ? 221 ASN C C   1 
ATOM   5972  O O   . ASN C 1 241 ? 11.842  -22.701 4.889   1.00 45.45  ? 221 ASN C O   1 
ATOM   5973  C CB  . ASN C 1 241 ? 13.711  -21.355 6.323   1.00 50.20  ? 221 ASN C CB  1 
ATOM   5974  C CG  . ASN C 1 241 ? 14.257  -22.739 6.585   1.00 53.09  ? 221 ASN C CG  1 
ATOM   5975  O OD1 . ASN C 1 241 ? 14.912  -23.337 5.729   1.00 56.31  ? 221 ASN C OD1 1 
ATOM   5976  N ND2 . ASN C 1 241 ? 13.980  -23.263 7.763   1.00 52.17  ? 221 ASN C ND2 1 
ATOM   5977  N N   . HIS C 1 242 ? 12.070  -21.506 3.011   1.00 49.19  ? 222 HIS C N   1 
ATOM   5978  C CA  . HIS C 1 242 ? 10.981  -22.182 2.328   1.00 49.85  ? 222 HIS C CA  1 
ATOM   5979  C C   . HIS C 1 242 ? 11.528  -23.331 1.502   1.00 49.92  ? 222 HIS C C   1 
ATOM   5980  O O   . HIS C 1 242 ? 12.683  -23.323 1.109   1.00 49.38  ? 222 HIS C O   1 
ATOM   5981  C CB  . HIS C 1 242 ? 10.242  -21.200 1.432   1.00 49.39  ? 222 HIS C CB  1 
ATOM   5982  C CG  . HIS C 1 242 ? 9.375   -20.249 2.186   1.00 48.74  ? 222 HIS C CG  1 
ATOM   5983  N ND1 . HIS C 1 242 ? 8.549   -19.342 1.561   1.00 45.62  ? 222 HIS C ND1 1 
ATOM   5984  C CD2 . HIS C 1 242 ? 9.192   -20.079 3.516   1.00 48.94  ? 222 HIS C CD2 1 
ATOM   5985  C CE1 . HIS C 1 242 ? 7.908   -18.641 2.476   1.00 45.89  ? 222 HIS C CE1 1 
ATOM   5986  N NE2 . HIS C 1 242 ? 8.276   -19.070 3.670   1.00 48.52  ? 222 HIS C NE2 1 
ATOM   5987  N N   . PRO C 1 243 ? 10.695  -24.336 1.245   1.00 53.52  ? 223 PRO C N   1 
ATOM   5988  C CA  . PRO C 1 243 ? 11.135  -25.490 0.469   1.00 53.18  ? 223 PRO C CA  1 
ATOM   5989  C C   . PRO C 1 243 ? 11.216  -25.218 -1.032  1.00 50.47  ? 223 PRO C C   1 
ATOM   5990  O O   . PRO C 1 243 ? 12.073  -25.784 -1.707  1.00 46.85  ? 223 PRO C O   1 
ATOM   5991  C CB  . PRO C 1 243 ? 10.067  -26.544 0.779   1.00 54.04  ? 223 PRO C CB  1 
ATOM   5992  C CG  . PRO C 1 243 ? 8.851   -25.763 1.130   1.00 56.03  ? 223 PRO C CG  1 
ATOM   5993  C CD  . PRO C 1 243 ? 9.359   -24.539 1.833   1.00 56.67  ? 223 PRO C CD  1 
ATOM   5994  N N   . MET C 1 244 ? 10.324  -24.376 -1.537  1.00 47.68  ? 224 MET C N   1 
ATOM   5995  C CA  . MET C 1 244 ? 10.373  -23.923 -2.914  1.00 48.08  ? 224 MET C CA  1 
ATOM   5996  C C   . MET C 1 244 ? 10.285  -22.405 -2.943  1.00 46.24  ? 224 MET C C   1 
ATOM   5997  O O   . MET C 1 244 ? 9.623   -21.806 -2.115  1.00 42.17  ? 224 MET C O   1 
ATOM   5998  C CB  . MET C 1 244 ? 9.193   -24.489 -3.684  1.00 52.43  ? 224 MET C CB  1 
ATOM   5999  C CG  . MET C 1 244 ? 9.516   -25.716 -4.510  1.00 58.79  ? 224 MET C CG  1 
ATOM   6000  S SD  . MET C 1 244 ? 8.231   -26.052 -5.739  1.00 63.87  ? 224 MET C SD  1 
ATOM   6001  C CE  . MET C 1 244 ? 6.930   -26.683 -4.684  1.00 64.41  ? 224 MET C CE  1 
ATOM   6002  N N   . GLY C 1 245 ? 10.935  -21.781 -3.909  1.00 44.34  ? 225 GLY C N   1 
ATOM   6003  C CA  . GLY C 1 245 ? 10.698  -20.373 -4.153  1.00 44.36  ? 225 GLY C CA  1 
ATOM   6004  C C   . GLY C 1 245 ? 9.341   -20.145 -4.814  1.00 42.49  ? 225 GLY C C   1 
ATOM   6005  O O   . GLY C 1 245 ? 8.819   -21.007 -5.492  1.00 41.24  ? 225 GLY C O   1 
ATOM   6006  N N   . PRO C 1 246 ? 8.775   -18.957 -4.642  1.00 41.47  ? 226 PRO C N   1 
ATOM   6007  C CA  . PRO C 1 246 ? 7.443   -18.670 -5.152  1.00 40.55  ? 226 PRO C CA  1 
ATOM   6008  C C   . PRO C 1 246 ? 7.273   -18.885 -6.648  1.00 39.93  ? 226 PRO C C   1 
ATOM   6009  O O   . PRO C 1 246 ? 6.214   -19.344 -7.069  1.00 36.41  ? 226 PRO C O   1 
ATOM   6010  C CB  . PRO C 1 246 ? 7.248   -17.198 -4.800  1.00 41.32  ? 226 PRO C CB  1 
ATOM   6011  C CG  . PRO C 1 246 ? 8.617   -16.672 -4.569  1.00 41.49  ? 226 PRO C CG  1 
ATOM   6012  C CD  . PRO C 1 246 ? 9.356   -17.803 -3.953  1.00 41.18  ? 226 PRO C CD  1 
ATOM   6013  N N   . LEU C 1 247 ? 8.278   -18.557 -7.448  1.00 40.17  ? 227 LEU C N   1 
ATOM   6014  C CA  . LEU C 1 247 ? 8.115   -18.716 -8.879  1.00 42.65  ? 227 LEU C CA  1 
ATOM   6015  C C   . LEU C 1 247 ? 8.109   -20.184 -9.290  1.00 43.86  ? 227 LEU C C   1 
ATOM   6016  O O   . LEU C 1 247 ? 7.255   -20.596 -10.077 1.00 43.23  ? 227 LEU C O   1 
ATOM   6017  C CB  . LEU C 1 247 ? 9.158   -17.922 -9.651  1.00 42.50  ? 227 LEU C CB  1 
ATOM   6018  C CG  . LEU C 1 247 ? 9.034   -16.430 -9.385  1.00 45.30  ? 227 LEU C CG  1 
ATOM   6019  C CD1 . LEU C 1 247 ? 9.981   -15.665 -10.288 1.00 45.73  ? 227 LEU C CD1 1 
ATOM   6020  C CD2 . LEU C 1 247 ? 7.619   -15.933 -9.602  1.00 45.51  ? 227 LEU C CD2 1 
ATOM   6021  N N   . GLU C 1 248 ? 9.032   -20.983 -8.764  1.00 44.52  ? 228 GLU C N   1 
ATOM   6022  C CA  . GLU C 1 248 ? 9.018   -22.416 -9.108  1.00 46.15  ? 228 GLU C CA  1 
ATOM   6023  C C   . GLU C 1 248 ? 7.766   -23.076 -8.518  1.00 40.97  ? 228 GLU C C   1 
ATOM   6024  O O   . GLU C 1 248 ? 7.258   -24.049 -9.055  1.00 38.06  ? 228 GLU C O   1 
ATOM   6025  C CB  . GLU C 1 248 ? 10.280  -23.152 -8.651  1.00 49.45  ? 228 GLU C CB  1 
ATOM   6026  C CG  . GLU C 1 248 ? 10.454  -23.260 -7.149  1.00 55.79  ? 228 GLU C CG  1 
ATOM   6027  C CD  . GLU C 1 248 ? 11.848  -23.739 -6.756  1.00 61.11  ? 228 GLU C CD  1 
ATOM   6028  O OE1 . GLU C 1 248 ? 12.542  -23.011 -5.984  1.00 55.08  ? 228 GLU C OE1 1 
ATOM   6029  O OE2 . GLU C 1 248 ? 12.237  -24.841 -7.230  1.00 60.08  ? 228 GLU C OE2 1 
ATOM   6030  N N   . LEU C 1 249 ? 7.278   -22.523 -7.416  1.00 36.81  ? 229 LEU C N   1 
ATOM   6031  C CA  . LEU C 1 249 ? 6.051   -22.985 -6.812  1.00 36.97  ? 229 LEU C CA  1 
ATOM   6032  C C   . LEU C 1 249 ? 4.846   -22.665 -7.669  1.00 39.25  ? 229 LEU C C   1 
ATOM   6033  O O   . LEU C 1 249 ? 3.931   -23.478 -7.769  1.00 38.43  ? 229 LEU C O   1 
ATOM   6034  C CB  . LEU C 1 249 ? 5.869   -22.377 -5.433  1.00 36.30  ? 229 LEU C CB  1 
ATOM   6035  C CG  . LEU C 1 249 ? 4.530   -22.718 -4.772  1.00 39.07  ? 229 LEU C CG  1 
ATOM   6036  C CD1 . LEU C 1 249 ? 4.428   -24.202 -4.484  1.00 41.11  ? 229 LEU C CD1 1 
ATOM   6037  C CD2 . LEU C 1 249 ? 4.337   -21.975 -3.467  1.00 38.07  ? 229 LEU C CD2 1 
ATOM   6038  N N   . GLY C 1 250 ? 4.834   -21.484 -8.281  1.00 40.00  ? 230 GLY C N   1 
ATOM   6039  C CA  . GLY C 1 250 ? 3.744   -21.129 -9.173  1.00 37.52  ? 230 GLY C CA  1 
ATOM   6040  C C   . GLY C 1 250 ? 3.707   -22.060 -10.364 1.00 36.51  ? 230 GLY C C   1 
ATOM   6041  O O   . GLY C 1 250 ? 2.638   -22.441 -10.829 1.00 37.03  ? 230 GLY C O   1 
ATOM   6042  N N   . ASP C 1 251 ? 4.888   -22.416 -10.855 1.00 36.93  ? 231 ASP C N   1 
ATOM   6043  C CA  . ASP C 1 251 ? 5.020   -23.316 -11.994 1.00 39.22  ? 231 ASP C CA  1 
ATOM   6044  C C   . ASP C 1 251 ? 4.522   -24.729 -11.633 1.00 41.60  ? 231 ASP C C   1 
ATOM   6045  O O   . ASP C 1 251 ? 4.065   -25.489 -12.487 1.00 40.17  ? 231 ASP C O   1 
ATOM   6046  C CB  . ASP C 1 251 ? 6.482   -23.404 -12.423 1.00 39.97  ? 231 ASP C CB  1 
ATOM   6047  C CG  . ASP C 1 251 ? 6.924   -22.253 -13.334 1.00 41.83  ? 231 ASP C CG  1 
ATOM   6048  O OD1 . ASP C 1 251 ? 6.111   -21.376 -13.687 1.00 42.47  ? 231 ASP C OD1 1 
ATOM   6049  O OD2 . ASP C 1 251 ? 8.121   -22.229 -13.715 1.00 40.49  ? 231 ASP C OD2 1 
ATOM   6050  N N   . PHE C 1 252 ? 4.621   -25.052 -10.354 1.00 42.76  ? 232 PHE C N   1 
ATOM   6051  C CA  . PHE C 1 252 ? 4.273   -26.353 -9.856  1.00 46.82  ? 232 PHE C CA  1 
ATOM   6052  C C   . PHE C 1 252 ? 2.776   -26.484 -9.581  1.00 45.50  ? 232 PHE C C   1 
ATOM   6053  O O   . PHE C 1 252 ? 2.170   -27.514 -9.881  1.00 45.77  ? 232 PHE C O   1 
ATOM   6054  C CB  . PHE C 1 252 ? 5.054   -26.619 -8.583  1.00 52.14  ? 232 PHE C CB  1 
ATOM   6055  C CG  . PHE C 1 252 ? 4.796   -27.965 -8.007  1.00 60.44  ? 232 PHE C CG  1 
ATOM   6056  C CD1 . PHE C 1 252 ? 5.214   -29.093 -8.681  1.00 67.65  ? 232 PHE C CD1 1 
ATOM   6057  C CD2 . PHE C 1 252 ? 4.105   -28.114 -6.820  1.00 66.75  ? 232 PHE C CD2 1 
ATOM   6058  C CE1 . PHE C 1 252 ? 4.979   -30.360 -8.175  1.00 68.49  ? 232 PHE C CE1 1 
ATOM   6059  C CE2 . PHE C 1 252 ? 3.859   -29.376 -6.303  1.00 68.42  ? 232 PHE C CE2 1 
ATOM   6060  C CZ  . PHE C 1 252 ? 4.299   -30.501 -6.982  1.00 67.50  ? 232 PHE C CZ  1 
ATOM   6061  N N   . ILE C 1 253 ? 2.197   -25.447 -8.990  1.00 42.29  ? 233 ILE C N   1 
ATOM   6062  C CA  . ILE C 1 253 ? 0.759   -25.361 -8.839  1.00 39.86  ? 233 ILE C CA  1 
ATOM   6063  C C   . ILE C 1 253 ? 0.097   -25.212 -10.191 1.00 38.63  ? 233 ILE C C   1 
ATOM   6064  O O   . ILE C 1 253 ? -1.009  -25.693 -10.399 1.00 40.57  ? 233 ILE C O   1 
ATOM   6065  C CB  . ILE C 1 253 ? 0.370   -24.156 -7.978  1.00 41.81  ? 233 ILE C CB  1 
ATOM   6066  C CG1 . ILE C 1 253 ? 0.789   -24.411 -6.535  1.00 45.14  ? 233 ILE C CG1 1 
ATOM   6067  C CG2 . ILE C 1 253 ? -1.130  -23.919 -8.020  1.00 41.43  ? 233 ILE C CG2 1 
ATOM   6068  C CD1 . ILE C 1 253 ? 0.718   -23.194 -5.635  1.00 46.32  ? 233 ILE C CD1 1 
ATOM   6069  N N   . GLY C 1 254 ? 0.772   -24.536 -11.111 1.00 39.55  ? 234 GLY C N   1 
ATOM   6070  C CA  . GLY C 1 254 ? 0.171   -24.182 -12.387 1.00 38.84  ? 234 GLY C CA  1 
ATOM   6071  C C   . GLY C 1 254 ? -0.193  -22.708 -12.364 1.00 38.60  ? 234 GLY C C   1 
ATOM   6072  O O   . GLY C 1 254 ? -0.950  -22.251 -11.503 1.00 34.56  ? 234 GLY C O   1 
ATOM   6073  N N   . LEU C 1 255 ? 0.357   -21.972 -13.321 1.00 38.30  ? 235 LEU C N   1 
ATOM   6074  C CA  . LEU C 1 255 ? 0.165   -20.537 -13.398 1.00 37.24  ? 235 LEU C CA  1 
ATOM   6075  C C   . LEU C 1 255 ? -1.266  -20.135 -13.693 1.00 38.04  ? 235 LEU C C   1 
ATOM   6076  O O   . LEU C 1 255 ? -1.745  -19.141 -13.168 1.00 39.86  ? 235 LEU C O   1 
ATOM   6077  C CB  . LEU C 1 255 ? 1.110   -19.948 -14.426 1.00 37.79  ? 235 LEU C CB  1 
ATOM   6078  C CG  . LEU C 1 255 ? 2.572   -20.001 -13.970 1.00 38.36  ? 235 LEU C CG  1 
ATOM   6079  C CD1 . LEU C 1 255 ? 3.451   -19.182 -14.889 1.00 38.22  ? 235 LEU C CD1 1 
ATOM   6080  C CD2 . LEU C 1 255 ? 2.729   -19.483 -12.553 1.00 39.06  ? 235 LEU C CD2 1 
ATOM   6081  N N   . ASP C 1 256 ? -1.957  -20.919 -14.502 1.00 38.04  ? 236 ASP C N   1 
ATOM   6082  C CA  . ASP C 1 256 ? -3.386  -20.692 -14.755 1.00 40.45  ? 236 ASP C CA  1 
ATOM   6083  C C   . ASP C 1 256 ? -4.212  -20.783 -13.488 1.00 41.00  ? 236 ASP C C   1 
ATOM   6084  O O   . ASP C 1 256 ? -5.173  -20.033 -13.296 1.00 42.43  ? 236 ASP C O   1 
ATOM   6085  C CB  . ASP C 1 256 ? -3.938  -21.689 -15.773 1.00 42.71  ? 236 ASP C CB  1 
ATOM   6086  C CG  . ASP C 1 256 ? -3.612  -23.160 -15.428 1.00 47.84  ? 236 ASP C CG  1 
ATOM   6087  O OD1 . ASP C 1 256 ? -2.726  -23.432 -14.576 1.00 48.45  ? 236 ASP C OD1 1 
ATOM   6088  O OD2 . ASP C 1 256 ? -4.234  -24.051 -16.046 1.00 49.09  ? 236 ASP C OD2 1 
ATOM   6089  N N   . ILE C 1 257 ? -3.832  -21.704 -12.618 1.00 41.05  ? 237 ILE C N   1 
ATOM   6090  C CA  . ILE C 1 257 ? -4.546  -21.875 -11.371 1.00 39.73  ? 237 ILE C CA  1 
ATOM   6091  C C   . ILE C 1 257 ? -4.248  -20.712 -10.443 1.00 39.58  ? 237 ILE C C   1 
ATOM   6092  O O   . ILE C 1 257 ? -5.150  -20.206 -9.760  1.00 35.62  ? 237 ILE C O   1 
ATOM   6093  C CB  . ILE C 1 257 ? -4.174  -23.208 -10.690 1.00 41.14  ? 237 ILE C CB  1 
ATOM   6094  C CG1 . ILE C 1 257 ? -5.109  -24.308 -11.156 1.00 41.77  ? 237 ILE C CG1 1 
ATOM   6095  C CG2 . ILE C 1 257 ? -4.339  -23.156 -9.179  1.00 40.81  ? 237 ILE C CG2 1 
ATOM   6096  C CD1 . ILE C 1 257 ? -4.503  -25.139 -12.237 1.00 43.22  ? 237 ILE C CD1 1 
ATOM   6097  N N   . CYS C 1 258 ? -2.973  -20.324 -10.399 1.00 38.61  ? 238 CYS C N   1 
ATOM   6098  C CA  . CYS C 1 258 ? -2.553  -19.160 -9.632  1.00 40.15  ? 238 CYS C CA  1 
ATOM   6099  C C   . CYS C 1 258 ? -3.325  -17.911 -10.079 1.00 39.58  ? 238 CYS C C   1 
ATOM   6100  O O   . CYS C 1 258 ? -3.804  -17.159 -9.246  1.00 38.63  ? 238 CYS C O   1 
ATOM   6101  C CB  . CYS C 1 258 ? -1.059  -18.912 -9.795  1.00 41.06  ? 238 CYS C CB  1 
ATOM   6102  S SG  . CYS C 1 258 ? -0.012  -19.998 -8.827  1.00 42.37  ? 238 CYS C SG  1 
ATOM   6103  N N   . LEU C 1 259 ? -3.448  -17.705 -11.389 1.00 37.87  ? 239 LEU C N   1 
ATOM   6104  C CA  . LEU C 1 259 ? -4.173  -16.555 -11.915 1.00 37.80  ? 239 LEU C CA  1 
ATOM   6105  C C   . LEU C 1 259 ? -5.659  -16.621 -11.584 1.00 38.80  ? 239 LEU C C   1 
ATOM   6106  O O   . LEU C 1 259 ? -6.246  -15.630 -11.171 1.00 40.01  ? 239 LEU C O   1 
ATOM   6107  C CB  . LEU C 1 259 ? -3.988  -16.450 -13.416 1.00 36.22  ? 239 LEU C CB  1 
ATOM   6108  C CG  . LEU C 1 259 ? -4.754  -15.335 -14.128 1.00 36.63  ? 239 LEU C CG  1 
ATOM   6109  C CD1 . LEU C 1 259 ? -4.413  -13.959 -13.573 1.00 36.97  ? 239 LEU C CD1 1 
ATOM   6110  C CD2 . LEU C 1 259 ? -4.427  -15.395 -15.611 1.00 35.58  ? 239 LEU C CD2 1 
ATOM   6111  N N   . ALA C 1 260 ? -6.267  -17.788 -11.735 1.00 39.84  ? 240 ALA C N   1 
ATOM   6112  C CA  . ALA C 1 260 ? -7.690  -17.920 -11.427 1.00 38.09  ? 240 ALA C CA  1 
ATOM   6113  C C   . ALA C 1 260 ? -7.991  -17.604 -9.976  1.00 38.18  ? 240 ALA C C   1 
ATOM   6114  O O   . ALA C 1 260 ? -9.059  -17.080 -9.660  1.00 38.20  ? 240 ALA C O   1 
ATOM   6115  C CB  . ALA C 1 260 ? -8.192  -19.306 -11.769 1.00 37.91  ? 240 ALA C CB  1 
ATOM   6116  N N   . ILE C 1 261 ? -7.055  -17.919 -9.092  1.00 37.73  ? 241 ILE C N   1 
ATOM   6117  C CA  . ILE C 1 261 ? -7.262  -17.641 -7.675  1.00 38.81  ? 241 ILE C CA  1 
ATOM   6118  C C   . ILE C 1 261 ? -7.087  -16.156 -7.361  1.00 39.42  ? 241 ILE C C   1 
ATOM   6119  O O   . ILE C 1 261 ? -7.796  -15.603 -6.512  1.00 38.24  ? 241 ILE C O   1 
ATOM   6120  C CB  . ILE C 1 261 ? -6.332  -18.506 -6.815  1.00 39.45  ? 241 ILE C CB  1 
ATOM   6121  C CG1 . ILE C 1 261 ? -6.834  -19.953 -6.835  1.00 41.83  ? 241 ILE C CG1 1 
ATOM   6122  C CG2 . ILE C 1 261 ? -6.310  -18.021 -5.383  1.00 38.66  ? 241 ILE C CG2 1 
ATOM   6123  C CD1 . ILE C 1 261 ? -5.863  -20.961 -6.260  1.00 42.98  ? 241 ILE C CD1 1 
ATOM   6124  N N   . MET C 1 262 ? -6.129  -15.518 -8.027  1.00 38.52  ? 242 MET C N   1 
ATOM   6125  C CA  . MET C 1 262 ? -5.938  -14.091 -7.857  1.00 37.02  ? 242 MET C CA  1 
ATOM   6126  C C   . MET C 1 262 ? -7.207  -13.432 -8.374  1.00 34.49  ? 242 MET C C   1 
ATOM   6127  O O   . MET C 1 262 ? -7.767  -12.571 -7.717  1.00 31.19  ? 242 MET C O   1 
ATOM   6128  C CB  . MET C 1 262 ? -4.699  -13.583 -8.615  1.00 39.02  ? 242 MET C CB  1 
ATOM   6129  C CG  . MET C 1 262 ? -3.345  -13.829 -7.947  1.00 37.16  ? 242 MET C CG  1 
ATOM   6130  S SD  . MET C 1 262 ? -3.288  -13.615 -6.151  1.00 39.79  ? 242 MET C SD  1 
ATOM   6131  C CE  . MET C 1 262 ? -3.322  -11.839 -5.935  1.00 38.80  ? 242 MET C CE  1 
ATOM   6132  N N   . ASP C 1 263 ? -7.679  -13.875 -9.532  1.00 33.69  ? 243 ASP C N   1 
ATOM   6133  C CA  . ASP C 1 263 ? -8.934  -13.365 -10.086 1.00 36.23  ? 243 ASP C CA  1 
ATOM   6134  C C   . ASP C 1 263 ? -10.093 -13.433 -9.087  1.00 38.18  ? 243 ASP C C   1 
ATOM   6135  O O   . ASP C 1 263 ? -10.865 -12.492 -8.950  1.00 37.70  ? 243 ASP C O   1 
ATOM   6136  C CB  . ASP C 1 263 ? -9.336  -14.139 -11.337 1.00 37.27  ? 243 ASP C CB  1 
ATOM   6137  C CG  . ASP C 1 263 ? -8.544  -13.748 -12.553 1.00 39.48  ? 243 ASP C CG  1 
ATOM   6138  O OD1 . ASP C 1 263 ? -8.009  -12.627 -12.598 1.00 44.26  ? 243 ASP C OD1 1 
ATOM   6139  O OD2 . ASP C 1 263 ? -8.462  -14.575 -13.483 1.00 45.90  ? 243 ASP C OD2 1 
ATOM   6140  N N   . VAL C 1 264 ? -10.193 -14.548 -8.381  1.00 40.57  ? 244 VAL C N   1 
ATOM   6141  C CA  . VAL C 1 264 ? -11.262 -14.745 -7.417  1.00 39.35  ? 244 VAL C CA  1 
ATOM   6142  C C   . VAL C 1 264 ? -11.098 -13.831 -6.207  1.00 37.38  ? 244 VAL C C   1 
ATOM   6143  O O   . VAL C 1 264 ? -12.073 -13.279 -5.712  1.00 35.03  ? 244 VAL C O   1 
ATOM   6144  C CB  . VAL C 1 264 ? -11.330 -16.230 -6.983  1.00 43.24  ? 244 VAL C CB  1 
ATOM   6145  C CG1 . VAL C 1 264 ? -12.211 -16.428 -5.753  1.00 43.35  ? 244 VAL C CG1 1 
ATOM   6146  C CG2 . VAL C 1 264 ? -11.845 -17.073 -8.141  1.00 42.55  ? 244 VAL C CG2 1 
ATOM   6147  N N   . LEU C 1 265 ? -9.878  -13.679 -5.717  1.00 37.37  ? 245 LEU C N   1 
ATOM   6148  C CA  . LEU C 1 265 ? -9.645  -12.795 -4.584  1.00 38.17  ? 245 LEU C CA  1 
ATOM   6149  C C   . LEU C 1 265 ? -10.101 -11.412 -4.907  1.00 39.65  ? 245 LEU C C   1 
ATOM   6150  O O   . LEU C 1 265 ? -10.815 -10.768 -4.142  1.00 40.85  ? 245 LEU C O   1 
ATOM   6151  C CB  . LEU C 1 265 ? -8.168  -12.754 -4.241  1.00 38.46  ? 245 LEU C CB  1 
ATOM   6152  C CG  . LEU C 1 265 ? -7.672  -14.077 -3.643  1.00 39.51  ? 245 LEU C CG  1 
ATOM   6153  C CD1 . LEU C 1 265 ? -6.233  -13.939 -3.185  1.00 38.84  ? 245 LEU C CD1 1 
ATOM   6154  C CD2 . LEU C 1 265 ? -8.536  -14.518 -2.475  1.00 39.30  ? 245 LEU C CD2 1 
ATOM   6155  N N   . TYR C 1 266 ? -9.686  -10.962 -6.072  1.00 41.47  ? 246 TYR C N   1 
ATOM   6156  C CA  . TYR C 1 266 ? -9.954  -9.608  -6.479  1.00 41.64  ? 246 TYR C CA  1 
ATOM   6157  C C   . TYR C 1 266 ? -11.449 -9.415  -6.734  1.00 39.28  ? 246 TYR C C   1 
ATOM   6158  O O   . TYR C 1 266 ? -12.054 -8.465  -6.265  1.00 36.86  ? 246 TYR C O   1 
ATOM   6159  C CB  . TYR C 1 266 ? -9.116  -9.289  -7.710  1.00 41.02  ? 246 TYR C CB  1 
ATOM   6160  C CG  . TYR C 1 266 ? -9.300  -7.909  -8.254  1.00 38.57  ? 246 TYR C CG  1 
ATOM   6161  C CD1 . TYR C 1 266 ? -9.430  -6.814  -7.409  1.00 38.72  ? 246 TYR C CD1 1 
ATOM   6162  C CD2 . TYR C 1 266 ? -9.313  -7.695  -9.614  1.00 38.36  ? 246 TYR C CD2 1 
ATOM   6163  C CE1 . TYR C 1 266 ? -9.599  -5.536  -7.915  1.00 39.00  ? 246 TYR C CE1 1 
ATOM   6164  C CE2 . TYR C 1 266 ? -9.474  -6.431  -10.133 1.00 39.57  ? 246 TYR C CE2 1 
ATOM   6165  C CZ  . TYR C 1 266 ? -9.614  -5.354  -9.280  1.00 39.58  ? 246 TYR C CZ  1 
ATOM   6166  O OH  . TYR C 1 266 ? -9.770  -4.102  -9.804  1.00 42.10  ? 246 TYR C OH  1 
ATOM   6167  N N   . SER C 1 267 ? -12.049 -10.346 -7.447  1.00 39.53  ? 247 SER C N   1 
ATOM   6168  C CA  . SER C 1 267 ? -13.473 -10.265 -7.715  1.00 39.71  ? 247 SER C CA  1 
ATOM   6169  C C   . SER C 1 267 ? -14.337 -10.278 -6.439  1.00 40.78  ? 247 SER C C   1 
ATOM   6170  O O   . SER C 1 267 ? -15.229 -9.455  -6.290  1.00 39.01  ? 247 SER C O   1 
ATOM   6171  C CB  . SER C 1 267 ? -13.887 -11.399 -8.625  1.00 40.04  ? 247 SER C CB  1 
ATOM   6172  O OG  . SER C 1 267 ? -15.262 -11.291 -8.883  1.00 44.01  ? 247 SER C OG  1 
ATOM   6173  N N   . GLU C 1 268 ? -14.062 -11.209 -5.530  1.00 40.19  ? 248 GLU C N   1 
ATOM   6174  C CA  . GLU C 1 268 ? -14.811 -11.314 -4.282  1.00 39.46  ? 248 GLU C CA  1 
ATOM   6175  C C   . GLU C 1 268 ? -14.641 -10.118 -3.362  1.00 39.40  ? 248 GLU C C   1 
ATOM   6176  O O   . GLU C 1 268 ? -15.620 -9.553  -2.893  1.00 38.60  ? 248 GLU C O   1 
ATOM   6177  C CB  . GLU C 1 268 ? -14.380 -12.556 -3.504  1.00 42.81  ? 248 GLU C CB  1 
ATOM   6178  C CG  . GLU C 1 268 ? -14.933 -13.863 -4.048  1.00 43.11  ? 248 GLU C CG  1 
ATOM   6179  C CD  . GLU C 1 268 ? -16.451 -13.901 -4.019  1.00 43.93  ? 248 GLU C CD  1 
ATOM   6180  O OE1 . GLU C 1 268 ? -17.042 -13.621 -2.951  1.00 47.40  ? 248 GLU C OE1 1 
ATOM   6181  O OE2 . GLU C 1 268 ? -17.052 -14.212 -5.061  1.00 42.73  ? 248 GLU C OE2 1 
ATOM   6182  N N   . THR C 1 269 ? -13.402 -9.761  -3.065  1.00 37.52  ? 249 THR C N   1 
ATOM   6183  C CA  . THR C 1 269 ? -13.167 -8.639  -2.170  1.00 37.29  ? 249 THR C CA  1 
ATOM   6184  C C   . THR C 1 269 ? -13.460 -7.287  -2.813  1.00 37.33  ? 249 THR C C   1 
ATOM   6185  O O   . THR C 1 269 ? -13.816 -6.336  -2.125  1.00 37.87  ? 249 THR C O   1 
ATOM   6186  C CB  . THR C 1 269 ? -11.707 -8.589  -1.702  1.00 37.73  ? 249 THR C CB  1 
ATOM   6187  O OG1 . THR C 1 269 ? -10.855 -8.588  -2.851  1.00 37.54  ? 249 THR C OG1 1 
ATOM   6188  C CG2 . THR C 1 269 ? -11.391 -9.780  -0.820  1.00 37.07  ? 249 THR C CG2 1 
ATOM   6189  N N   . GLY C 1 270 ? -13.274 -7.189  -4.122  1.00 36.99  ? 250 GLY C N   1 
ATOM   6190  C CA  . GLY C 1 270 ? -13.342 -5.891  -4.791  1.00 39.13  ? 250 GLY C CA  1 
ATOM   6191  C C   . GLY C 1 270 ? -12.163 -4.967  -4.480  1.00 39.71  ? 250 GLY C C   1 
ATOM   6192  O O   . GLY C 1 270 ? -12.197 -3.771  -4.790  1.00 41.78  ? 250 GLY C O   1 
ATOM   6193  N N   . ASP C 1 271 ? -11.100 -5.523  -3.909  1.00 38.63  ? 251 ASP C N   1 
ATOM   6194  C CA  . ASP C 1 271 ? -9.988  -4.720  -3.462  1.00 38.96  ? 251 ASP C CA  1 
ATOM   6195  C C   . ASP C 1 271 ? -8.786  -4.905  -4.382  1.00 38.59  ? 251 ASP C C   1 
ATOM   6196  O O   . ASP C 1 271 ? -8.254  -5.997  -4.493  1.00 36.32  ? 251 ASP C O   1 
ATOM   6197  C CB  . ASP C 1 271 ? -9.636  -5.083  -2.016  1.00 39.76  ? 251 ASP C CB  1 
ATOM   6198  C CG  . ASP C 1 271 ? -8.507  -4.226  -1.452  1.00 42.46  ? 251 ASP C CG  1 
ATOM   6199  O OD1 . ASP C 1 271 ? -7.899  -3.448  -2.223  1.00 44.42  ? 251 ASP C OD1 1 
ATOM   6200  O OD2 . ASP C 1 271 ? -8.215  -4.328  -0.236  1.00 42.71  ? 251 ASP C OD2 1 
ATOM   6201  N N   . SER C 1 272 ? -8.351  -3.805  -4.994  1.00 38.82  ? 252 SER C N   1 
ATOM   6202  C CA  . SER C 1 272 ? -7.160  -3.749  -5.850  1.00 38.35  ? 252 SER C CA  1 
ATOM   6203  C C   . SER C 1 272 ? -5.928  -4.413  -5.278  1.00 36.53  ? 252 SER C C   1 
ATOM   6204  O O   . SER C 1 272 ? -5.034  -4.824  -6.006  1.00 34.72  ? 252 SER C O   1 
ATOM   6205  C CB  . SER C 1 272 ? -6.780  -2.298  -6.100  1.00 42.02  ? 252 SER C CB  1 
ATOM   6206  O OG  . SER C 1 272 ? -7.260  -1.892  -7.358  1.00 49.65  ? 252 SER C OG  1 
ATOM   6207  N N   . LYS C 1 273 ? -5.857  -4.478  -3.966  1.00 34.62  ? 253 LYS C N   1 
ATOM   6208  C CA  . LYS C 1 273 ? -4.777  -5.176  -3.309  1.00 36.01  ? 253 LYS C CA  1 
ATOM   6209  C C   . LYS C 1 273 ? -4.456  -6.542  -3.922  1.00 35.36  ? 253 LYS C C   1 
ATOM   6210  O O   . LYS C 1 273 ? -3.297  -6.911  -3.986  1.00 34.16  ? 253 LYS C O   1 
ATOM   6211  C CB  . LYS C 1 273 ? -5.170  -5.360  -1.854  1.00 39.14  ? 253 LYS C CB  1 
ATOM   6212  C CG  . LYS C 1 273 ? -4.328  -6.339  -1.104  1.00 40.58  ? 253 LYS C CG  1 
ATOM   6213  C CD  . LYS C 1 273 ? -4.679  -6.292  0.358   1.00 40.83  ? 253 LYS C CD  1 
ATOM   6214  C CE  . LYS C 1 273 ? -3.793  -7.293  1.066   1.00 40.60  ? 253 LYS C CE  1 
ATOM   6215  N NZ  . LYS C 1 273 ? -4.005  -7.221  2.518   1.00 40.31  ? 253 LYS C NZ  1 
ATOM   6216  N N   . TYR C 1 274 ? -5.478  -7.271  -4.375  1.00 32.76  ? 254 TYR C N   1 
ATOM   6217  C CA  . TYR C 1 274 ? -5.296  -8.626  -4.886  1.00 34.07  ? 254 TYR C CA  1 
ATOM   6218  C C   . TYR C 1 274 ? -5.345  -8.683  -6.395  1.00 35.86  ? 254 TYR C C   1 
ATOM   6219  O O   . TYR C 1 274 ? -5.642  -9.743  -6.964  1.00 38.52  ? 254 TYR C O   1 
ATOM   6220  C CB  . TYR C 1 274 ? -6.387  -9.562  -4.342  1.00 32.87  ? 254 TYR C CB  1 
ATOM   6221  C CG  . TYR C 1 274 ? -6.470  -9.528  -2.863  1.00 32.08  ? 254 TYR C CG  1 
ATOM   6222  C CD1 . TYR C 1 274 ? -5.496  -10.143 -2.100  1.00 33.65  ? 254 TYR C CD1 1 
ATOM   6223  C CD2 . TYR C 1 274 ? -7.489  -8.857  -2.217  1.00 32.50  ? 254 TYR C CD2 1 
ATOM   6224  C CE1 . TYR C 1 274 ? -5.526  -10.096 -0.722  1.00 33.57  ? 254 TYR C CE1 1 
ATOM   6225  C CE2 . TYR C 1 274 ? -7.536  -8.807  -0.831  1.00 32.78  ? 254 TYR C CE2 1 
ATOM   6226  C CZ  . TYR C 1 274 ? -6.543  -9.421  -0.092  1.00 33.53  ? 254 TYR C CZ  1 
ATOM   6227  O OH  . TYR C 1 274 ? -6.551  -9.386  1.281   1.00 32.41  ? 254 TYR C OH  1 
ATOM   6228  N N   . ARG C 1 275 ? -5.075  -7.571  -7.065  1.00 34.24  ? 255 ARG C N   1 
ATOM   6229  C CA  . ARG C 1 275 ? -5.110  -7.615  -8.511  1.00 32.73  ? 255 ARG C CA  1 
ATOM   6230  C C   . ARG C 1 275 ? -3.944  -8.453  -8.992  1.00 31.60  ? 255 ARG C C   1 
ATOM   6231  O O   . ARG C 1 275 ? -2.824  -8.358  -8.485  1.00 32.46  ? 255 ARG C O   1 
ATOM   6232  C CB  . ARG C 1 275 ? -5.061  -6.235  -9.133  1.00 34.84  ? 255 ARG C CB  1 
ATOM   6233  C CG  . ARG C 1 275 ? -3.711  -5.561  -9.037  1.00 36.40  ? 255 ARG C CG  1 
ATOM   6234  C CD  . ARG C 1 275 ? -3.848  -4.057  -9.065  1.00 37.70  ? 255 ARG C CD  1 
ATOM   6235  N NE  . ARG C 1 275 ? -2.553  -3.384  -9.015  1.00 38.20  ? 255 ARG C NE  1 
ATOM   6236  C CZ  . ARG C 1 275 ? -2.029  -2.798  -7.934  1.00 39.88  ? 255 ARG C CZ  1 
ATOM   6237  N NH1 . ARG C 1 275 ? -2.662  -2.780  -6.764  1.00 37.67  ? 255 ARG C NH1 1 
ATOM   6238  N NH2 . ARG C 1 275 ? -0.843  -2.222  -8.013  1.00 39.80  ? 255 ARG C NH2 1 
ATOM   6239  N N   . PRO C 1 276 ? -4.213  -9.321  -9.952  1.00 30.31  ? 256 PRO C N   1 
ATOM   6240  C CA  . PRO C 1 276 ? -3.163  -10.163 -10.450 1.00 30.50  ? 256 PRO C CA  1 
ATOM   6241  C C   . PRO C 1 276 ? -2.239  -9.360  -11.273 1.00 31.20  ? 256 PRO C C   1 
ATOM   6242  O O   . PRO C 1 276 ? -2.673  -8.479  -11.997 1.00 33.69  ? 256 PRO C O   1 
ATOM   6243  C CB  . PRO C 1 276 ? -3.891  -11.144 -11.364 1.00 29.47  ? 256 PRO C CB  1 
ATOM   6244  C CG  . PRO C 1 276 ? -5.225  -10.559 -11.606 1.00 27.99  ? 256 PRO C CG  1 
ATOM   6245  C CD  . PRO C 1 276 ? -5.539  -9.780  -10.391 1.00 29.59  ? 256 PRO C CD  1 
ATOM   6246  N N   . HIS C 1 277 ? -0.971  -9.697  -11.211 1.00 32.57  ? 257 HIS C N   1 
ATOM   6247  C CA  . HIS C 1 277 ? -0.028  -8.982  -11.998 1.00 34.09  ? 257 HIS C CA  1 
ATOM   6248  C C   . HIS C 1 277 ? -0.253  -9.191  -13.498 1.00 36.11  ? 257 HIS C C   1 
ATOM   6249  O O   . HIS C 1 277 ? -0.777  -10.180 -13.971 1.00 38.04  ? 257 HIS C O   1 
ATOM   6250  C CB  . HIS C 1 277 ? 1.400   -9.337  -11.615 1.00 33.42  ? 257 HIS C CB  1 
ATOM   6251  C CG  . HIS C 1 277 ? 2.358   -8.246  -11.932 1.00 33.19  ? 257 HIS C CG  1 
ATOM   6252  N ND1 . HIS C 1 277 ? 2.894   -8.073  -13.192 1.00 33.26  ? 257 HIS C ND1 1 
ATOM   6253  C CD2 . HIS C 1 277 ? 2.798   -7.208  -11.186 1.00 32.57  ? 257 HIS C CD2 1 
ATOM   6254  C CE1 . HIS C 1 277 ? 3.657   -6.995  -13.193 1.00 32.21  ? 257 HIS C CE1 1 
ATOM   6255  N NE2 . HIS C 1 277 ? 3.610   -6.450  -11.990 1.00 32.06  ? 257 HIS C NE2 1 
ATOM   6256  N N   . THR C 1 278 ? 0.191   -8.208  -14.229 1.00 38.53  ? 258 THR C N   1 
ATOM   6257  C CA  . THR C 1 278 ? -0.010  -8.114  -15.644 1.00 38.39  ? 258 THR C CA  1 
ATOM   6258  C C   . THR C 1 278 ? 0.857   -9.141  -16.400 1.00 39.41  ? 258 THR C C   1 
ATOM   6259  O O   . THR C 1 278 ? 0.475   -9.650  -17.454 1.00 37.32  ? 258 THR C O   1 
ATOM   6260  C CB  . THR C 1 278 ? 0.248   -6.632  -16.000 1.00 37.82  ? 258 THR C CB  1 
ATOM   6261  O OG1 . THR C 1 278 ? -0.934  -6.102  -16.584 1.00 40.94  ? 258 THR C OG1 1 
ATOM   6262  C CG2 . THR C 1 278 ? 1.466   -6.388  -16.873 1.00 38.22  ? 258 THR C CG2 1 
ATOM   6263  N N   . LEU C 1 279 ? 2.011   -9.446  -15.818 1.00 38.59  ? 259 LEU C N   1 
ATOM   6264  C CA  . LEU C 1 279 ? 2.944   -10.408 -16.366 1.00 38.98  ? 259 LEU C CA  1 
ATOM   6265  C C   . LEU C 1 279 ? 2.422   -11.829 -16.172 1.00 37.01  ? 259 LEU C C   1 
ATOM   6266  O O   . LEU C 1 279 ? 2.635   -12.682 -17.004 1.00 34.98  ? 259 LEU C O   1 
ATOM   6267  C CB  . LEU C 1 279 ? 4.280   -10.309 -15.628 1.00 40.10  ? 259 LEU C CB  1 
ATOM   6268  C CG  . LEU C 1 279 ? 5.608   -10.347 -16.382 1.00 40.11  ? 259 LEU C CG  1 
ATOM   6269  C CD1 . LEU C 1 279 ? 6.651   -11.037 -15.527 1.00 40.17  ? 259 LEU C CD1 1 
ATOM   6270  C CD2 . LEU C 1 279 ? 5.517   -11.010 -17.742 1.00 39.13  ? 259 LEU C CD2 1 
ATOM   6271  N N   . LEU C 1 280 ? 1.766   -12.083 -15.050 1.00 36.23  ? 260 LEU C N   1 
ATOM   6272  C CA  . LEU C 1 280 ? 1.206   -13.389 -14.807 1.00 36.69  ? 260 LEU C CA  1 
ATOM   6273  C C   . LEU C 1 280 ? 0.162   -13.646 -15.879 1.00 36.83  ? 260 LEU C C   1 
ATOM   6274  O O   . LEU C 1 280 ? 0.142   -14.716 -16.472 1.00 36.57  ? 260 LEU C O   1 
ATOM   6275  C CB  . LEU C 1 280 ? 0.614   -13.468 -13.413 1.00 37.07  ? 260 LEU C CB  1 
ATOM   6276  C CG  . LEU C 1 280 ? -0.174  -14.736 -13.091 1.00 38.51  ? 260 LEU C CG  1 
ATOM   6277  C CD1 . LEU C 1 280 ? 0.727   -15.952 -13.016 1.00 38.00  ? 260 LEU C CD1 1 
ATOM   6278  C CD2 . LEU C 1 280 ? -0.889  -14.534 -11.771 1.00 38.53  ? 260 LEU C CD2 1 
ATOM   6279  N N   . LYS C 1 281 ? -0.664  -12.642 -16.156 1.00 36.66  ? 261 LYS C N   1 
ATOM   6280  C CA  . LYS C 1 281 ? -1.626  -12.723 -17.252 1.00 35.95  ? 261 LYS C CA  1 
ATOM   6281  C C   . LYS C 1 281 ? -0.981  -13.085 -18.557 1.00 35.27  ? 261 LYS C C   1 
ATOM   6282  O O   . LYS C 1 281 ? -1.512  -13.888 -19.324 1.00 38.38  ? 261 LYS C O   1 
ATOM   6283  C CB  . LYS C 1 281 ? -2.353  -11.409 -17.440 1.00 36.02  ? 261 LYS C CB  1 
ATOM   6284  C CG  . LYS C 1 281 ? -3.518  -11.262 -16.501 1.00 35.90  ? 261 LYS C CG  1 
ATOM   6285  C CD  . LYS C 1 281 ? -4.039  -9.846  -16.542 1.00 34.99  ? 261 LYS C CD  1 
ATOM   6286  C CE  . LYS C 1 281 ? -5.000  -9.602  -15.401 1.00 34.95  ? 261 LYS C CE  1 
ATOM   6287  N NZ  . LYS C 1 281 ? -6.066  -8.667  -15.828 1.00 35.03  ? 261 LYS C NZ  1 
ATOM   6288  N N   . LYS C 1 282 ? 0.158   -12.475 -18.824 1.00 34.54  ? 262 LYS C N   1 
ATOM   6289  C CA  . LYS C 1 282 ? 0.816   -12.696 -20.091 1.00 34.14  ? 262 LYS C CA  1 
ATOM   6290  C C   . LYS C 1 282 ? 1.378   -14.111 -20.193 1.00 33.06  ? 262 LYS C C   1 
ATOM   6291  O O   . LYS C 1 282 ? 1.244   -14.742 -21.231 1.00 33.78  ? 262 LYS C O   1 
ATOM   6292  C CB  . LYS C 1 282 ? 1.911   -11.662 -20.320 1.00 34.56  ? 262 LYS C CB  1 
ATOM   6293  C CG  . LYS C 1 282 ? 2.505   -11.731 -21.723 1.00 35.69  ? 262 LYS C CG  1 
ATOM   6294  C CD  . LYS C 1 282 ? 2.987   -10.372 -22.195 1.00 38.00  ? 262 LYS C CD  1 
ATOM   6295  C CE  . LYS C 1 282 ? 4.171   -9.897  -21.364 1.00 41.05  ? 262 LYS C CE  1 
ATOM   6296  N NZ  . LYS C 1 282 ? 4.894   -8.823  -22.090 1.00 41.76  ? 262 LYS C NZ  1 
ATOM   6297  N N   . TYR C 1 283 ? 1.995   -14.607 -19.127 1.00 32.75  ? 263 TYR C N   1 
ATOM   6298  C CA  . TYR C 1 283 ? 2.476   -15.990 -19.113 1.00 34.99  ? 263 TYR C CA  1 
ATOM   6299  C C   . TYR C 1 283 ? 1.335   -16.956 -19.390 1.00 35.20  ? 263 TYR C C   1 
ATOM   6300  O O   . TYR C 1 283 ? 1.462   -17.861 -20.193 1.00 38.95  ? 263 TYR C O   1 
ATOM   6301  C CB  . TYR C 1 283 ? 3.103   -16.352 -17.777 1.00 35.91  ? 263 TYR C CB  1 
ATOM   6302  C CG  . TYR C 1 283 ? 4.557   -16.045 -17.710 1.00 36.89  ? 263 TYR C CG  1 
ATOM   6303  C CD1 . TYR C 1 283 ? 5.000   -14.765 -17.464 1.00 37.28  ? 263 TYR C CD1 1 
ATOM   6304  C CD2 . TYR C 1 283 ? 5.500   -17.040 -17.884 1.00 38.88  ? 263 TYR C CD2 1 
ATOM   6305  C CE1 . TYR C 1 283 ? 6.349   -14.470 -17.409 1.00 38.29  ? 263 TYR C CE1 1 
ATOM   6306  C CE2 . TYR C 1 283 ? 6.853   -16.758 -17.832 1.00 38.47  ? 263 TYR C CE2 1 
ATOM   6307  C CZ  . TYR C 1 283 ? 7.271   -15.468 -17.593 1.00 39.33  ? 263 TYR C CZ  1 
ATOM   6308  O OH  . TYR C 1 283 ? 8.609   -15.166 -17.539 1.00 39.99  ? 263 TYR C OH  1 
ATOM   6309  N N   . VAL C 1 284 ? 0.208   -16.759 -18.738 1.00 33.42  ? 264 VAL C N   1 
ATOM   6310  C CA  . VAL C 1 284 ? -0.874  -17.692 -18.894 1.00 32.72  ? 264 VAL C CA  1 
ATOM   6311  C C   . VAL C 1 284 ? -1.407  -17.639 -20.311 1.00 34.76  ? 264 VAL C C   1 
ATOM   6312  O O   . VAL C 1 284 ? -1.659  -18.650 -20.924 1.00 37.20  ? 264 VAL C O   1 
ATOM   6313  C CB  . VAL C 1 284 ? -1.976  -17.404 -17.888 1.00 30.92  ? 264 VAL C CB  1 
ATOM   6314  C CG1 . VAL C 1 284 ? -3.222  -18.227 -18.195 1.00 30.21  ? 264 VAL C CG1 1 
ATOM   6315  C CG2 . VAL C 1 284 ? -1.469  -17.716 -16.499 1.00 29.99  ? 264 VAL C CG2 1 
ATOM   6316  N N   . ARG C 1 285 ? -1.564  -16.444 -20.835 1.00 36.63  ? 265 ARG C N   1 
ATOM   6317  C CA  . ARG C 1 285 ? -2.034  -16.274 -22.186 1.00 35.64  ? 265 ARG C CA  1 
ATOM   6318  C C   . ARG C 1 285 ? -1.146  -16.936 -23.206 1.00 35.45  ? 265 ARG C C   1 
ATOM   6319  O O   . ARG C 1 285 ? -1.585  -17.241 -24.295 1.00 35.45  ? 265 ARG C O   1 
ATOM   6320  C CB  . ARG C 1 285 ? -2.067  -14.794 -22.506 1.00 39.40  ? 265 ARG C CB  1 
ATOM   6321  C CG  . ARG C 1 285 ? -3.419  -14.208 -22.278 1.00 40.58  ? 265 ARG C CG  1 
ATOM   6322  C CD  . ARG C 1 285 ? -3.320  -12.815 -21.749 1.00 39.16  ? 265 ARG C CD  1 
ATOM   6323  N NE  . ARG C 1 285 ? -4.646  -12.240 -21.732 1.00 41.16  ? 265 ARG C NE  1 
ATOM   6324  C CZ  . ARG C 1 285 ? -4.931  -11.001 -21.342 1.00 44.30  ? 265 ARG C CZ  1 
ATOM   6325  N NH1 . ARG C 1 285 ? -3.977  -10.171 -20.946 1.00 42.65  ? 265 ARG C NH1 1 
ATOM   6326  N NH2 . ARG C 1 285 ? -6.187  -10.582 -21.356 1.00 44.19  ? 265 ARG C NH2 1 
ATOM   6327  N N   . ALA C 1 286 ? 0.129   -17.073 -22.885 1.00 36.31  ? 266 ALA C N   1 
ATOM   6328  C CA  . ALA C 1 286 ? 1.067   -17.760 -23.756 1.00 38.68  ? 266 ALA C CA  1 
ATOM   6329  C C   . ALA C 1 286 ? 0.942   -19.287 -23.714 1.00 41.47  ? 266 ALA C C   1 
ATOM   6330  O O   . ALA C 1 286 ? 1.486   -19.978 -24.579 1.00 40.85  ? 266 ALA C O   1 
ATOM   6331  C CB  . ALA C 1 286 ? 2.471   -17.385 -23.351 1.00 39.67  ? 266 ALA C CB  1 
ATOM   6332  N N   . GLY C 1 287 ? 0.283   -19.803 -22.674 1.00 41.19  ? 267 GLY C N   1 
ATOM   6333  C CA  . GLY C 1 287 ? 0.220   -21.237 -22.433 1.00 41.07  ? 267 GLY C CA  1 
ATOM   6334  C C   . GLY C 1 287 ? 1.433   -21.731 -21.671 1.00 40.95  ? 267 GLY C C   1 
ATOM   6335  O O   . GLY C 1 287 ? 1.666   -22.936 -21.576 1.00 43.54  ? 267 GLY C O   1 
ATOM   6336  N N   . TRP C 1 288 ? 2.212   -20.801 -21.133 1.00 38.72  ? 268 TRP C N   1 
ATOM   6337  C CA  . TRP C 1 288 ? 3.365   -21.147 -20.328 1.00 36.74  ? 268 TRP C CA  1 
ATOM   6338  C C   . TRP C 1 288 ? 2.912   -21.293 -18.896 1.00 36.80  ? 268 TRP C C   1 
ATOM   6339  O O   . TRP C 1 288 ? 3.122   -20.418 -18.060 1.00 36.06  ? 268 TRP C O   1 
ATOM   6340  C CB  . TRP C 1 288 ? 4.423   -20.059 -20.434 1.00 36.01  ? 268 TRP C CB  1 
ATOM   6341  C CG  . TRP C 1 288 ? 4.923   -19.884 -21.791 1.00 34.81  ? 268 TRP C CG  1 
ATOM   6342  C CD1 . TRP C 1 288 ? 4.489   -20.521 -22.924 1.00 34.55  ? 268 TRP C CD1 1 
ATOM   6343  C CD2 . TRP C 1 288 ? 5.932   -18.971 -22.204 1.00 33.08  ? 268 TRP C CD2 1 
ATOM   6344  N NE1 . TRP C 1 288 ? 5.201   -20.074 -24.012 1.00 34.18  ? 268 TRP C NE1 1 
ATOM   6345  C CE2 . TRP C 1 288 ? 6.085   -19.117 -23.597 1.00 32.49  ? 268 TRP C CE2 1 
ATOM   6346  C CE3 . TRP C 1 288 ? 6.733   -18.045 -21.533 1.00 34.30  ? 268 TRP C CE3 1 
ATOM   6347  C CZ2 . TRP C 1 288 ? 7.007   -18.373 -24.328 1.00 34.22  ? 268 TRP C CZ2 1 
ATOM   6348  C CZ3 . TRP C 1 288 ? 7.661   -17.298 -22.269 1.00 33.47  ? 268 TRP C CZ3 1 
ATOM   6349  C CH2 . TRP C 1 288 ? 7.789   -17.467 -23.647 1.00 32.47  ? 268 TRP C CH2 1 
ATOM   6350  N N   . LEU C 1 289 ? 2.315   -22.431 -18.604 1.00 36.70  ? 269 LEU C N   1 
ATOM   6351  C CA  . LEU C 1 289 ? 1.660   -22.600 -17.327 1.00 36.86  ? 269 LEU C CA  1 
ATOM   6352  C C   . LEU C 1 289 ? 2.503   -23.224 -16.240 1.00 36.20  ? 269 LEU C C   1 
ATOM   6353  O O   . LEU C 1 289 ? 2.053   -23.318 -15.105 1.00 35.76  ? 269 LEU C O   1 
ATOM   6354  C CB  . LEU C 1 289 ? 0.385   -23.390 -17.518 1.00 37.21  ? 269 LEU C CB  1 
ATOM   6355  C CG  . LEU C 1 289 ? -0.495  -22.854 -18.659 1.00 39.35  ? 269 LEU C CG  1 
ATOM   6356  C CD1 . LEU C 1 289 ? -1.745  -23.704 -18.780 1.00 37.70  ? 269 LEU C CD1 1 
ATOM   6357  C CD2 . LEU C 1 289 ? -0.887  -21.392 -18.440 1.00 40.66  ? 269 LEU C CD2 1 
ATOM   6358  N N   . GLY C 1 290 ? 3.720   -23.632 -16.557 1.00 37.14  ? 270 GLY C N   1 
ATOM   6359  C CA  . GLY C 1 290 ? 4.585   -24.225 -15.547 1.00 40.39  ? 270 GLY C CA  1 
ATOM   6360  C C   . GLY C 1 290 ? 5.029   -25.627 -15.937 1.00 43.45  ? 270 GLY C C   1 
ATOM   6361  O O   . GLY C 1 290 ? 5.248   -25.926 -17.119 1.00 41.32  ? 270 GLY C O   1 
ATOM   6362  N N   . ARG C 1 291 ? 5.178   -26.494 -14.945 1.00 45.54  ? 271 ARG C N   1 
ATOM   6363  C CA  . ARG C 1 291 ? 5.596   -27.858 -15.223 1.00 47.65  ? 271 ARG C CA  1 
ATOM   6364  C C   . ARG C 1 291 ? 4.694   -28.545 -16.215 1.00 46.10  ? 271 ARG C C   1 
ATOM   6365  O O   . ARG C 1 291 ? 5.169   -29.124 -17.171 1.00 43.71  ? 271 ARG C O   1 
ATOM   6366  C CB  . ARG C 1 291 ? 5.584   -28.670 -13.971 1.00 51.93  ? 271 ARG C CB  1 
ATOM   6367  C CG  . ARG C 1 291 ? 6.617   -28.205 -12.986 1.00 57.92  ? 271 ARG C CG  1 
ATOM   6368  C CD  . ARG C 1 291 ? 7.510   -29.351 -12.583 1.00 62.78  ? 271 ARG C CD  1 
ATOM   6369  N NE  . ARG C 1 291 ? 7.493   -29.486 -11.139 1.00 68.70  ? 271 ARG C NE  1 
ATOM   6370  C CZ  . ARG C 1 291 ? 8.564   -29.460 -10.348 1.00 72.93  ? 271 ARG C CZ  1 
ATOM   6371  N NH1 . ARG C 1 291 ? 9.798   -29.337 -10.849 1.00 71.94  ? 271 ARG C NH1 1 
ATOM   6372  N NH2 . ARG C 1 291 ? 8.404   -29.585 -9.037  1.00 73.91  ? 271 ARG C NH2 1 
ATOM   6373  N N   . LYS C 1 292 ? 3.389   -28.462 -16.011 1.00 45.53  ? 272 LYS C N   1 
ATOM   6374  C CA  . LYS C 1 292 ? 2.460   -29.104 -16.941 1.00 47.72  ? 272 LYS C CA  1 
ATOM   6375  C C   . LYS C 1 292 ? 2.535   -28.699 -18.416 1.00 47.26  ? 272 LYS C C   1 
ATOM   6376  O O   . LYS C 1 292 ? 1.855   -29.293 -19.230 1.00 50.45  ? 272 LYS C O   1 
ATOM   6377  C CB  . LYS C 1 292 ? 1.006   -28.965 -16.473 1.00 50.09  ? 272 LYS C CB  1 
ATOM   6378  C CG  . LYS C 1 292 ? 0.606   -27.603 -15.948 1.00 55.42  ? 272 LYS C CG  1 
ATOM   6379  C CD  . LYS C 1 292 ? -0.844  -27.305 -16.272 1.00 55.49  ? 272 LYS C CD  1 
ATOM   6380  C CE  . LYS C 1 292 ? -1.495  -26.474 -15.190 1.00 57.33  ? 272 LYS C CE  1 
ATOM   6381  N NZ  . LYS C 1 292 ? -2.971  -26.618 -15.292 1.00 60.79  ? 272 LYS C NZ  1 
ATOM   6382  N N   . SER C 1 293 ? 3.320   -27.694 -18.779 1.00 47.68  ? 273 SER C N   1 
ATOM   6383  C CA  . SER C 1 293 ? 3.408   -27.321 -20.190 1.00 45.85  ? 273 SER C CA  1 
ATOM   6384  C C   . SER C 1 293 ? 4.813   -27.442 -20.711 1.00 43.95  ? 273 SER C C   1 
ATOM   6385  O O   . SER C 1 293 ? 5.051   -27.246 -21.900 1.00 45.40  ? 273 SER C O   1 
ATOM   6386  C CB  . SER C 1 293 ? 2.936   -25.880 -20.400 1.00 47.22  ? 273 SER C CB  1 
ATOM   6387  O OG  . SER C 1 293 ? 2.106   -25.470 -19.343 1.00 49.09  ? 273 SER C OG  1 
ATOM   6388  N N   . GLY C 1 294 ? 5.750   -27.733 -19.823 1.00 41.24  ? 274 GLY C N   1 
ATOM   6389  C CA  . GLY C 1 294 ? 7.141   -27.743 -20.184 1.00 42.91  ? 274 GLY C CA  1 
ATOM   6390  C C   . GLY C 1 294 ? 7.736   -26.367 -20.016 1.00 46.00  ? 274 GLY C C   1 
ATOM   6391  O O   . GLY C 1 294 ? 8.926   -26.182 -20.275 1.00 47.33  ? 274 GLY C O   1 
ATOM   6392  N N   . LYS C 1 295 ? 6.923   -25.403 -19.575 1.00 46.72  ? 275 LYS C N   1 
ATOM   6393  C CA  . LYS C 1 295 ? 7.388   -24.028 -19.463 1.00 47.38  ? 275 LYS C CA  1 
ATOM   6394  C C   . LYS C 1 295 ? 6.522   -23.127 -18.629 1.00 43.08  ? 275 LYS C C   1 
ATOM   6395  O O   . LYS C 1 295 ? 5.323   -23.027 -18.851 1.00 42.35  ? 275 LYS C O   1 
ATOM   6396  C CB  . LYS C 1 295 ? 7.471   -23.403 -20.838 1.00 50.88  ? 275 LYS C CB  1 
ATOM   6397  C CG  . LYS C 1 295 ? 8.427   -22.237 -20.879 1.00 54.68  ? 275 LYS C CG  1 
ATOM   6398  C CD  . LYS C 1 295 ? 8.308   -21.535 -22.212 1.00 57.06  ? 275 LYS C CD  1 
ATOM   6399  C CE  . LYS C 1 295 ? 9.611   -20.894 -22.651 1.00 59.25  ? 275 LYS C CE  1 
ATOM   6400  N NZ  . LYS C 1 295 ? 10.247  -20.132 -21.549 1.00 61.84  ? 275 LYS C NZ  1 
ATOM   6401  N N   . GLY C 1 296 ? 7.144   -22.458 -17.679 1.00 40.93  ? 276 GLY C N   1 
ATOM   6402  C CA  . GLY C 1 296 ? 6.518   -21.314 -17.030 1.00 42.49  ? 276 GLY C CA  1 
ATOM   6403  C C   . GLY C 1 296 ? 7.583   -20.259 -16.815 1.00 40.28  ? 276 GLY C C   1 
ATOM   6404  O O   . GLY C 1 296 ? 8.261   -19.830 -17.755 1.00 39.43  ? 276 GLY C O   1 
ATOM   6405  N N   . PHE C 1 297 ? 7.748   -19.853 -15.568 1.00 38.17  ? 277 PHE C N   1 
ATOM   6406  C CA  . PHE C 1 297 ? 8.894   -19.047 -15.204 1.00 38.66  ? 277 PHE C CA  1 
ATOM   6407  C C   . PHE C 1 297 ? 10.199  -19.772 -15.431 1.00 40.19  ? 277 PHE C C   1 
ATOM   6408  O O   . PHE C 1 297 ? 11.221  -19.128 -15.607 1.00 40.59  ? 277 PHE C O   1 
ATOM   6409  C CB  . PHE C 1 297 ? 8.781   -18.565 -13.757 1.00 39.31  ? 277 PHE C CB  1 
ATOM   6410  C CG  . PHE C 1 297 ? 7.658   -17.611 -13.575 1.00 39.31  ? 277 PHE C CG  1 
ATOM   6411  C CD1 . PHE C 1 297 ? 7.620   -16.453 -14.335 1.00 41.21  ? 277 PHE C CD1 1 
ATOM   6412  C CD2 . PHE C 1 297 ? 6.608   -17.893 -12.733 1.00 40.54  ? 277 PHE C CD2 1 
ATOM   6413  C CE1 . PHE C 1 297 ? 6.572   -15.573 -14.244 1.00 40.64  ? 277 PHE C CE1 1 
ATOM   6414  C CE2 . PHE C 1 297 ? 5.545   -17.022 -12.641 1.00 40.91  ? 277 PHE C CE2 1 
ATOM   6415  C CZ  . PHE C 1 297 ? 5.531   -15.859 -13.399 1.00 40.86  ? 277 PHE C CZ  1 
ATOM   6416  N N   . TYR C 1 298 ? 10.178  -21.102 -15.408 1.00 42.75  ? 278 TYR C N   1 
ATOM   6417  C CA  . TYR C 1 298 ? 11.366  -21.865 -15.769 1.00 39.76  ? 278 TYR C CA  1 
ATOM   6418  C C   . TYR C 1 298 ? 11.065  -22.673 -16.997 1.00 42.07  ? 278 TYR C C   1 
ATOM   6419  O O   . TYR C 1 298 ? 9.907   -22.953 -17.322 1.00 42.39  ? 278 TYR C O   1 
ATOM   6420  C CB  . TYR C 1 298 ? 11.773  -22.821 -14.674 1.00 36.58  ? 278 TYR C CB  1 
ATOM   6421  C CG  . TYR C 1 298 ? 12.240  -22.200 -13.386 1.00 36.46  ? 278 TYR C CG  1 
ATOM   6422  C CD1 . TYR C 1 298 ? 11.343  -21.868 -12.390 1.00 34.96  ? 278 TYR C CD1 1 
ATOM   6423  C CD2 . TYR C 1 298 ? 13.593  -22.018 -13.136 1.00 37.04  ? 278 TYR C CD2 1 
ATOM   6424  C CE1 . TYR C 1 298 ? 11.772  -21.356 -11.187 1.00 33.70  ? 278 TYR C CE1 1 
ATOM   6425  C CE2 . TYR C 1 298 ? 14.032  -21.488 -11.943 1.00 35.71  ? 278 TYR C CE2 1 
ATOM   6426  C CZ  . TYR C 1 298 ? 13.116  -21.168 -10.973 1.00 35.82  ? 278 TYR C CZ  1 
ATOM   6427  O OH  . TYR C 1 298 ? 13.553  -20.631 -9.796  1.00 35.78  ? 278 TYR C OH  1 
ATOM   6428  N N   . ASP C 1 299 ? 12.125  -23.066 -17.676 1.00 47.23  ? 279 ASP C N   1 
ATOM   6429  C CA  . ASP C 1 299 ? 12.005  -24.011 -18.756 1.00 51.80  ? 279 ASP C CA  1 
ATOM   6430  C C   . ASP C 1 299 ? 12.248  -25.414 -18.205 1.00 52.91  ? 279 ASP C C   1 
ATOM   6431  O O   . ASP C 1 299 ? 13.147  -25.629 -17.401 1.00 51.98  ? 279 ASP C O   1 
ATOM   6432  C CB  . ASP C 1 299 ? 12.987  -23.673 -19.862 1.00 53.79  ? 279 ASP C CB  1 
ATOM   6433  C CG  . ASP C 1 299 ? 12.462  -24.047 -21.228 1.00 61.01  ? 279 ASP C CG  1 
ATOM   6434  O OD1 . ASP C 1 299 ? 11.674  -25.017 -21.347 1.00 63.02  ? 279 ASP C OD1 1 
ATOM   6435  O OD2 . ASP C 1 299 ? 12.832  -23.354 -22.192 1.00 66.60  ? 279 ASP C OD2 1 
ATOM   6436  N N   . TYR C 1 300 ? 11.419  -26.357 -18.627 1.00 58.06  ? 280 TYR C N   1 
ATOM   6437  C CA  . TYR C 1 300 ? 11.478  -27.725 -18.124 1.00 59.27  ? 280 TYR C CA  1 
ATOM   6438  C C   . TYR C 1 300 ? 11.852  -28.681 -19.261 1.00 63.62  ? 280 TYR C C   1 
ATOM   6439  O O   . TYR C 1 300 ? 11.277  -29.750 -19.408 1.00 67.32  ? 280 TYR C O   1 
ATOM   6440  C CB  . TYR C 1 300 ? 10.143  -28.082 -17.463 1.00 54.34  ? 280 TYR C CB  1 
ATOM   6441  C CG  . TYR C 1 300 ? 9.873   -27.230 -16.242 1.00 52.07  ? 280 TYR C CG  1 
ATOM   6442  C CD1 . TYR C 1 300 ? 9.047   -26.112 -16.313 1.00 51.01  ? 280 TYR C CD1 1 
ATOM   6443  C CD2 . TYR C 1 300 ? 10.471  -27.527 -15.020 1.00 51.17  ? 280 TYR C CD2 1 
ATOM   6444  C CE1 . TYR C 1 300 ? 8.815   -25.327 -15.198 1.00 47.88  ? 280 TYR C CE1 1 
ATOM   6445  C CE2 . TYR C 1 300 ? 10.246  -26.751 -13.899 1.00 47.71  ? 280 TYR C CE2 1 
ATOM   6446  C CZ  . TYR C 1 300 ? 9.420   -25.653 -13.998 1.00 48.01  ? 280 TYR C CZ  1 
ATOM   6447  O OH  . TYR C 1 300 ? 9.196   -24.883 -12.889 1.00 46.30  ? 280 TYR C OH  1 
ATOM   6448  N N   . SER C 1 301 ? 12.832  -28.260 -20.063 1.00 74.53  ? 281 SER C N   1 
ATOM   6449  C CA  . SER C 1 301 ? 13.439  -29.089 -21.114 1.00 76.87  ? 281 SER C CA  1 
ATOM   6450  C C   . SER C 1 301 ? 14.636  -29.866 -20.564 1.00 79.31  ? 281 SER C C   1 
ATOM   6451  O O   . SER C 1 301 ? 14.910  -30.992 -20.995 1.00 80.70  ? 281 SER C O   1 
ATOM   6452  C CB  . SER C 1 301 ? 13.906  -28.217 -22.278 1.00 74.15  ? 281 SER C CB  1 
ATOM   6453  O OG  . SER C 1 301 ? 12.828  -27.903 -23.126 1.00 71.41  ? 281 SER C OG  1 
ATOM   6454  N N   . MET D 1 21  ? -17.395 2.442   43.271  1.00 119.19 ? 1   MET D N   1 
ATOM   6455  C CA  . MET D 1 21  ? -18.425 2.813   42.235  1.00 114.47 ? 1   MET D CA  1 
ATOM   6456  C C   . MET D 1 21  ? -19.135 4.132   42.539  1.00 112.90 ? 1   MET D C   1 
ATOM   6457  O O   . MET D 1 21  ? -20.232 4.374   42.040  1.00 113.85 ? 1   MET D O   1 
ATOM   6458  C CB  . MET D 1 21  ? -19.460 1.689   42.062  1.00 111.99 ? 1   MET D CB  1 
ATOM   6459  C CG  . MET D 1 21  ? -19.523 0.689   43.208  1.00 113.30 ? 1   MET D CG  1 
ATOM   6460  S SD  . MET D 1 21  ? -20.051 -0.932  42.638  1.00 117.32 ? 1   MET D SD  1 
ATOM   6461  C CE  . MET D 1 21  ? -18.627 -1.901  43.135  1.00 110.83 ? 1   MET D CE  1 
ATOM   6462  N N   . LYS D 1 22  ? -18.489 4.997   43.319  1.00 110.91 ? 2   LYS D N   1 
ATOM   6463  C CA  . LYS D 1 22  ? -19.145 6.181   43.872  1.00 108.13 ? 2   LYS D CA  1 
ATOM   6464  C C   . LYS D 1 22  ? -18.420 7.478   43.545  1.00 100.19 ? 2   LYS D C   1 
ATOM   6465  O O   . LYS D 1 22  ? -19.058 8.460   43.158  1.00 94.39  ? 2   LYS D O   1 
ATOM   6466  C CB  . LYS D 1 22  ? -19.308 6.049   45.393  1.00 111.51 ? 2   LYS D CB  1 
ATOM   6467  C CG  . LYS D 1 22  ? -19.817 7.325   46.071  1.00 113.94 ? 2   LYS D CG  1 
ATOM   6468  C CD  . LYS D 1 22  ? -21.033 7.090   46.959  1.00 112.56 ? 2   LYS D CD  1 
ATOM   6469  C CE  . LYS D 1 22  ? -20.649 6.731   48.386  1.00 109.48 ? 2   LYS D CE  1 
ATOM   6470  N NZ  . LYS D 1 22  ? -21.697 5.900   49.043  1.00 107.58 ? 2   LYS D NZ  1 
ATOM   6471  N N   . LYS D 1 23  ? -17.103 7.493   43.726  1.00 95.53  ? 3   LYS D N   1 
ATOM   6472  C CA  . LYS D 1 23  ? -16.332 8.712   43.526  1.00 93.99  ? 3   LYS D CA  1 
ATOM   6473  C C   . LYS D 1 23  ? -15.745 8.726   42.122  1.00 95.46  ? 3   LYS D C   1 
ATOM   6474  O O   . LYS D 1 23  ? -15.235 7.709   41.638  1.00 92.52  ? 3   LYS D O   1 
ATOM   6475  C CB  . LYS D 1 23  ? -15.229 8.838   44.581  1.00 95.92  ? 3   LYS D CB  1 
ATOM   6476  C CG  . LYS D 1 23  ? -15.169 10.211  45.252  1.00 98.67  ? 3   LYS D CG  1 
ATOM   6477  C CD  . LYS D 1 23  ? -13.985 11.074  44.831  1.00 101.20 ? 3   LYS D CD  1 
ATOM   6478  C CE  . LYS D 1 23  ? -12.904 11.154  45.909  1.00 101.46 ? 3   LYS D CE  1 
ATOM   6479  N NZ  . LYS D 1 23  ? -13.264 12.052  47.045  1.00 99.38  ? 3   LYS D NZ  1 
ATOM   6480  N N   . VAL D 1 24  ? -15.821 9.895   41.487  1.00 94.67  ? 4   VAL D N   1 
ATOM   6481  C CA  . VAL D 1 24  ? -15.489 10.060  40.077  1.00 88.86  ? 4   VAL D CA  1 
ATOM   6482  C C   . VAL D 1 24  ? -14.726 11.331  39.852  1.00 84.46  ? 4   VAL D C   1 
ATOM   6483  O O   . VAL D 1 24  ? -15.197 12.408  40.199  1.00 90.00  ? 4   VAL D O   1 
ATOM   6484  C CB  . VAL D 1 24  ? -16.747 10.233  39.221  1.00 91.15  ? 4   VAL D CB  1 
ATOM   6485  C CG1 . VAL D 1 24  ? -16.502 9.700   37.823  1.00 90.24  ? 4   VAL D CG1 1 
ATOM   6486  C CG2 . VAL D 1 24  ? -17.920 9.536   39.873  1.00 96.39  ? 4   VAL D CG2 1 
ATOM   6487  N N   . CYS D 1 25  ? -13.565 11.219  39.238  1.00 80.58  ? 5   CYS D N   1 
ATOM   6488  C CA  . CYS D 1 25  ? -12.826 12.401  38.882  1.00 80.57  ? 5   CYS D CA  1 
ATOM   6489  C C   . CYS D 1 25  ? -13.014 12.628  37.404  1.00 78.97  ? 5   CYS D C   1 
ATOM   6490  O O   . CYS D 1 25  ? -13.297 11.695  36.661  1.00 79.62  ? 5   CYS D O   1 
ATOM   6491  C CB  . CYS D 1 25  ? -11.350 12.233  39.204  1.00 83.19  ? 5   CYS D CB  1 
ATOM   6492  S SG  . CYS D 1 25  ? -10.345 13.653  38.714  1.00 88.25  ? 5   CYS D SG  1 
ATOM   6493  N N   . VAL D 1 26  ? -12.866 13.879  36.994  1.00 77.04  ? 6   VAL D N   1 
ATOM   6494  C CA  . VAL D 1 26  ? -12.927 14.258  35.600  1.00 71.39  ? 6   VAL D CA  1 
ATOM   6495  C C   . VAL D 1 26  ? -11.797 15.220  35.363  1.00 75.37  ? 6   VAL D C   1 
ATOM   6496  O O   . VAL D 1 26  ? -11.642 16.182  36.110  1.00 83.49  ? 6   VAL D O   1 
ATOM   6497  C CB  . VAL D 1 26  ? -14.209 15.033  35.272  1.00 69.64  ? 6   VAL D CB  1 
ATOM   6498  C CG1 . VAL D 1 26  ? -14.097 15.689  33.904  1.00 71.22  ? 6   VAL D CG1 1 
ATOM   6499  C CG2 . VAL D 1 26  ? -15.411 14.122  35.296  1.00 67.23  ? 6   VAL D CG2 1 
ATOM   6500  N N   . ILE D 1 27  ? -11.019 14.978  34.321  1.00 77.34  ? 7   ILE D N   1 
ATOM   6501  C CA  . ILE D 1 27  ? -9.977  15.905  33.941  1.00 77.17  ? 7   ILE D CA  1 
ATOM   6502  C C   . ILE D 1 27  ? -10.491 16.658  32.744  1.00 81.15  ? 7   ILE D C   1 
ATOM   6503  O O   . ILE D 1 27  ? -11.144 16.075  31.884  1.00 85.45  ? 7   ILE D O   1 
ATOM   6504  C CB  . ILE D 1 27  ? -8.687  15.181  33.561  1.00 74.85  ? 7   ILE D CB  1 
ATOM   6505  C CG1 . ILE D 1 27  ? -8.098  14.479  34.785  1.00 74.75  ? 7   ILE D CG1 1 
ATOM   6506  C CG2 . ILE D 1 27  ? -7.678  16.162  32.986  1.00 73.63  ? 7   ILE D CG2 1 
ATOM   6507  C CD1 . ILE D 1 27  ? -8.491  13.027  34.897  1.00 75.63  ? 7   ILE D CD1 1 
ATOM   6508  N N   . GLY D 1 28  ? -10.202 17.950  32.687  1.00 86.75  ? 8   GLY D N   1 
ATOM   6509  C CA  . GLY D 1 28  ? -10.645 18.773  31.567  1.00 86.97  ? 8   GLY D CA  1 
ATOM   6510  C C   . GLY D 1 28  ? -11.961 19.470  31.856  1.00 85.79  ? 8   GLY D C   1 
ATOM   6511  O O   . GLY D 1 28  ? -12.990 18.826  32.075  1.00 79.44  ? 8   GLY D O   1 
ATOM   6512  N N   . ALA D 1 29  ? -11.920 20.798  31.843  1.00 86.38  ? 9   ALA D N   1 
ATOM   6513  C CA  . ALA D 1 29  ? -13.087 21.611  32.158  1.00 88.60  ? 9   ALA D CA  1 
ATOM   6514  C C   . ALA D 1 29  ? -13.596 22.350  30.930  1.00 87.89  ? 9   ALA D C   1 
ATOM   6515  O O   . ALA D 1 29  ? -14.186 23.422  31.047  1.00 85.26  ? 9   ALA D O   1 
ATOM   6516  C CB  . ALA D 1 29  ? -12.741 22.598  33.255  1.00 90.70  ? 9   ALA D CB  1 
ATOM   6517  N N   . GLY D 1 30  ? -13.371 21.775  29.752  1.00 87.49  ? 10  GLY D N   1 
ATOM   6518  C CA  . GLY D 1 30  ? -13.936 22.313  28.523  1.00 84.44  ? 10  GLY D CA  1 
ATOM   6519  C C   . GLY D 1 30  ? -15.409 21.964  28.464  1.00 85.13  ? 10  GLY D C   1 
ATOM   6520  O O   . GLY D 1 30  ? -16.030 21.669  29.475  1.00 81.16  ? 10  GLY D O   1 
ATOM   6521  N N   . THR D 1 31  ? -15.973 21.980  27.269  1.00 85.84  ? 11  THR D N   1 
ATOM   6522  C CA  . THR D 1 31  ? -17.383 21.647  27.103  1.00 85.01  ? 11  THR D CA  1 
ATOM   6523  C C   . THR D 1 31  ? -17.681 20.197  27.505  1.00 85.38  ? 11  THR D C   1 
ATOM   6524  O O   . THR D 1 31  ? -18.661 19.929  28.210  1.00 82.96  ? 11  THR D O   1 
ATOM   6525  C CB  . THR D 1 31  ? -17.844 21.875  25.650  1.00 84.34  ? 11  THR D CB  1 
ATOM   6526  O OG1 . THR D 1 31  ? -17.531 23.214  25.241  1.00 79.48  ? 11  THR D OG1 1 
ATOM   6527  C CG2 . THR D 1 31  ? -19.341 21.659  25.525  1.00 83.76  ? 11  THR D CG2 1 
ATOM   6528  N N   . MET D 1 32  ? -16.834 19.272  27.058  1.00 83.12  ? 12  MET D N   1 
ATOM   6529  C CA  . MET D 1 32  ? -17.097 17.840  27.240  1.00 80.28  ? 12  MET D CA  1 
ATOM   6530  C C   . MET D 1 32  ? -16.937 17.396  28.675  1.00 74.41  ? 12  MET D C   1 
ATOM   6531  O O   . MET D 1 32  ? -17.814 16.731  29.224  1.00 64.04  ? 12  MET D O   1 
ATOM   6532  C CB  . MET D 1 32  ? -16.166 16.992  26.365  1.00 81.90  ? 12  MET D CB  1 
ATOM   6533  C CG  . MET D 1 32  ? -16.600 16.864  24.911  1.00 80.50  ? 12  MET D CG  1 
ATOM   6534  S SD  . MET D 1 32  ? -18.373 16.578  24.661  1.00 78.94  ? 12  MET D SD  1 
ATOM   6535  C CE  . MET D 1 32  ? -18.627 15.129  25.691  1.00 76.11  ? 12  MET D CE  1 
ATOM   6536  N N   . GLY D 1 33  ? -15.794 17.747  29.255  1.00 74.59  ? 13  GLY D N   1 
ATOM   6537  C CA  . GLY D 1 33  ? -15.481 17.392  30.630  1.00 74.83  ? 13  GLY D CA  1 
ATOM   6538  C C   . GLY D 1 33  ? -16.483 17.980  31.601  1.00 75.85  ? 13  GLY D C   1 
ATOM   6539  O O   . GLY D 1 33  ? -16.923 17.315  32.540  1.00 75.91  ? 13  GLY D O   1 
ATOM   6540  N N   . SER D 1 34  ? -16.867 19.225  31.352  1.00 76.76  ? 14  SER D N   1 
ATOM   6541  C CA  . SER D 1 34  ? -17.814 19.914  32.216  1.00 80.17  ? 14  SER D CA  1 
ATOM   6542  C C   . SER D 1 34  ? -19.177 19.230  32.158  1.00 81.13  ? 14  SER D C   1 
ATOM   6543  O O   . SER D 1 34  ? -19.825 19.021  33.189  1.00 81.03  ? 14  SER D O   1 
ATOM   6544  C CB  . SER D 1 34  ? -17.939 21.384  31.815  1.00 83.56  ? 14  SER D CB  1 
ATOM   6545  O OG  . SER D 1 34  ? -16.689 21.876  31.293  1.00 89.55  ? 14  SER D OG  1 
ATOM   6546  N N   . GLY D 1 35  ? -19.602 18.860  30.955  1.00 79.99  ? 15  GLY D N   1 
ATOM   6547  C CA  . GLY D 1 35  ? -20.877 18.173  30.787  1.00 74.78  ? 15  GLY D CA  1 
ATOM   6548  C C   . GLY D 1 35  ? -20.871 16.796  31.411  1.00 72.70  ? 15  GLY D C   1 
ATOM   6549  O O   . GLY D 1 35  ? -21.910 16.302  31.868  1.00 69.43  ? 15  GLY D O   1 
ATOM   6550  N N   . ILE D 1 36  ? -19.707 16.161  31.426  1.00 71.34  ? 16  ILE D N   1 
ATOM   6551  C CA  . ILE D 1 36  ? -19.631 14.813  31.961  1.00 75.45  ? 16  ILE D CA  1 
ATOM   6552  C C   . ILE D 1 36  ? -19.752 14.869  33.471  1.00 78.06  ? 16  ILE D C   1 
ATOM   6553  O O   . ILE D 1 36  ? -20.460 14.054  34.077  1.00 73.88  ? 16  ILE D O   1 
ATOM   6554  C CB  . ILE D 1 36  ? -18.343 14.110  31.535  1.00 74.92  ? 16  ILE D CB  1 
ATOM   6555  C CG1 . ILE D 1 36  ? -18.485 13.663  30.088  1.00 76.39  ? 16  ILE D CG1 1 
ATOM   6556  C CG2 . ILE D 1 36  ? -18.086 12.887  32.396  1.00 73.94  ? 16  ILE D CG2 1 
ATOM   6557  C CD1 . ILE D 1 36  ? -17.166 13.484  29.383  1.00 76.91  ? 16  ILE D CD1 1 
ATOM   6558  N N   . ALA D 1 37  ? -19.071 15.851  34.061  1.00 79.89  ? 17  ALA D N   1 
ATOM   6559  C CA  . ALA D 1 37  ? -19.129 16.083  35.503  1.00 78.19  ? 17  ALA D CA  1 
ATOM   6560  C C   . ALA D 1 37  ? -20.570 16.326  35.920  1.00 75.41  ? 17  ALA D C   1 
ATOM   6561  O O   . ALA D 1 37  ? -21.085 15.661  36.820  1.00 70.26  ? 17  ALA D O   1 
ATOM   6562  C CB  . ALA D 1 37  ? -18.266 17.270  35.880  1.00 77.28  ? 17  ALA D CB  1 
ATOM   6563  N N   . GLN D 1 38  ? -21.216 17.265  35.234  1.00 72.08  ? 18  GLN D N   1 
ATOM   6564  C CA  . GLN D 1 38  ? -22.622 17.545  35.474  1.00 72.82  ? 18  GLN D CA  1 
ATOM   6565  C C   . GLN D 1 38  ? -23.465 16.262  35.422  1.00 75.87  ? 18  GLN D C   1 
ATOM   6566  O O   . GLN D 1 38  ? -24.214 15.963  36.357  1.00 72.30  ? 18  GLN D O   1 
ATOM   6567  C CB  . GLN D 1 38  ? -23.163 18.565  34.471  1.00 70.52  ? 18  GLN D CB  1 
ATOM   6568  C CG  . GLN D 1 38  ? -24.651 18.829  34.669  1.00 68.77  ? 18  GLN D CG  1 
ATOM   6569  C CD  . GLN D 1 38  ? -25.236 19.829  33.697  1.00 71.26  ? 18  GLN D CD  1 
ATOM   6570  O OE1 . GLN D 1 38  ? -24.542 20.720  33.190  1.00 73.92  ? 18  GLN D OE1 1 
ATOM   6571  N NE2 . GLN D 1 38  ? -26.535 19.700  33.446  1.00 71.13  ? 18  GLN D NE2 1 
ATOM   6572  N N   . ALA D 1 39  ? -23.327 15.509  34.334  1.00 80.64  ? 19  ALA D N   1 
ATOM   6573  C CA  . ALA D 1 39  ? -24.114 14.281  34.121  1.00 83.39  ? 19  ALA D CA  1 
ATOM   6574  C C   . ALA D 1 39  ? -23.960 13.273  35.256  1.00 81.99  ? 19  ALA D C   1 
ATOM   6575  O O   . ALA D 1 39  ? -24.912 12.562  35.597  1.00 78.33  ? 19  ALA D O   1 
ATOM   6576  C CB  . ALA D 1 39  ? -23.722 13.628  32.810  1.00 85.13  ? 19  ALA D CB  1 
ATOM   6577  N N   . PHE D 1 40  ? -22.751 13.218  35.815  1.00 79.49  ? 20  PHE D N   1 
ATOM   6578  C CA  . PHE D 1 40  ? -22.442 12.357  36.958  1.00 82.42  ? 20  PHE D CA  1 
ATOM   6579  C C   . PHE D 1 40  ? -23.054 12.853  38.267  1.00 83.60  ? 20  PHE D C   1 
ATOM   6580  O O   . PHE D 1 40  ? -23.791 12.118  38.935  1.00 83.23  ? 20  PHE D O   1 
ATOM   6581  C CB  . PHE D 1 40  ? -20.926 12.193  37.120  1.00 85.69  ? 20  PHE D CB  1 
ATOM   6582  C CG  . PHE D 1 40  ? -20.389 10.976  36.434  1.00 88.15  ? 20  PHE D CG  1 
ATOM   6583  C CD1 . PHE D 1 40  ? -20.625 9.720   36.965  1.00 86.35  ? 20  PHE D CD1 1 
ATOM   6584  C CD2 . PHE D 1 40  ? -19.686 11.077  35.242  1.00 88.24  ? 20  PHE D CD2 1 
ATOM   6585  C CE1 . PHE D 1 40  ? -20.160 8.585   36.327  1.00 89.43  ? 20  PHE D CE1 1 
ATOM   6586  C CE2 . PHE D 1 40  ? -19.216 9.946   34.600  1.00 86.46  ? 20  PHE D CE2 1 
ATOM   6587  C CZ  . PHE D 1 40  ? -19.454 8.697   35.142  1.00 88.57  ? 20  PHE D CZ  1 
ATOM   6588  N N   . ALA D 1 41  ? -22.736 14.090  38.634  1.00 82.68  ? 21  ALA D N   1 
ATOM   6589  C CA  . ALA D 1 41  ? -23.314 14.710  39.825  1.00 85.33  ? 21  ALA D CA  1 
ATOM   6590  C C   . ALA D 1 41  ? -24.831 14.577  39.812  1.00 86.59  ? 21  ALA D C   1 
ATOM   6591  O O   . ALA D 1 41  ? -25.422 14.094  40.779  1.00 92.05  ? 21  ALA D O   1 
ATOM   6592  C CB  . ALA D 1 41  ? -22.925 16.168  39.906  1.00 83.61  ? 21  ALA D CB  1 
ATOM   6593  N N   . ALA D 1 42  ? -25.445 14.978  38.701  1.00 82.94  ? 22  ALA D N   1 
ATOM   6594  C CA  . ALA D 1 42  ? -26.901 14.881  38.506  1.00 81.17  ? 22  ALA D CA  1 
ATOM   6595  C C   . ALA D 1 42  ? -27.537 13.570  38.969  1.00 80.96  ? 22  ALA D C   1 
ATOM   6596  O O   . ALA D 1 42  ? -28.738 13.530  39.213  1.00 80.10  ? 22  ALA D O   1 
ATOM   6597  C CB  . ALA D 1 42  ? -27.257 15.125  37.045  1.00 81.69  ? 22  ALA D CB  1 
ATOM   6598  N N   . LYS D 1 43  ? -26.754 12.501  39.070  1.00 84.94  ? 23  LYS D N   1 
ATOM   6599  C CA  . LYS D 1 43  ? -27.273 11.217  39.549  1.00 88.28  ? 23  LYS D CA  1 
ATOM   6600  C C   . LYS D 1 43  ? -26.788 10.838  40.956  1.00 88.61  ? 23  LYS D C   1 
ATOM   6601  O O   . LYS D 1 43  ? -27.103 9.759   41.453  1.00 91.43  ? 23  LYS D O   1 
ATOM   6602  C CB  . LYS D 1 43  ? -26.952 10.116  38.530  1.00 89.26  ? 23  LYS D CB  1 
ATOM   6603  C CG  . LYS D 1 43  ? -27.998 9.994   37.425  1.00 88.11  ? 23  LYS D CG  1 
ATOM   6604  C CD  . LYS D 1 43  ? -29.185 9.139   37.871  1.00 90.44  ? 23  LYS D CD  1 
ATOM   6605  C CE  . LYS D 1 43  ? -30.145 8.780   36.739  1.00 88.24  ? 23  LYS D CE  1 
ATOM   6606  N NZ  . LYS D 1 43  ? -30.617 9.972   35.985  1.00 86.43  ? 23  LYS D NZ  1 
ATOM   6607  N N   . GLY D 1 44  ? -26.037 11.724  41.598  1.00 87.19  ? 24  GLY D N   1 
ATOM   6608  C CA  . GLY D 1 44  ? -25.604 11.499  42.973  1.00 92.37  ? 24  GLY D CA  1 
ATOM   6609  C C   . GLY D 1 44  ? -24.288 10.754  43.059  1.00 95.34  ? 24  GLY D C   1 
ATOM   6610  O O   . GLY D 1 44  ? -24.191 9.695   43.688  1.00 92.45  ? 24  GLY D O   1 
ATOM   6611  N N   . PHE D 1 45  ? -23.283 11.315  42.399  1.00 97.31  ? 25  PHE D N   1 
ATOM   6612  C CA  . PHE D 1 45  ? -21.917 10.824  42.476  1.00 99.77  ? 25  PHE D CA  1 
ATOM   6613  C C   . PHE D 1 45  ? -21.092 11.968  43.012  1.00 100.83 ? 25  PHE D C   1 
ATOM   6614  O O   . PHE D 1 45  ? -21.358 13.129  42.698  1.00 99.10  ? 25  PHE D O   1 
ATOM   6615  C CB  . PHE D 1 45  ? -21.386 10.427  41.092  1.00 99.74  ? 25  PHE D CB  1 
ATOM   6616  C CG  . PHE D 1 45  ? -21.847 9.075   40.626  1.00 96.54  ? 25  PHE D CG  1 
ATOM   6617  C CD1 . PHE D 1 45  ? -23.184 8.854   40.332  1.00 96.05  ? 25  PHE D CD1 1 
ATOM   6618  C CD2 . PHE D 1 45  ? -20.944 8.026   40.467  1.00 93.29  ? 25  PHE D CD2 1 
ATOM   6619  C CE1 . PHE D 1 45  ? -23.618 7.612   39.903  1.00 95.95  ? 25  PHE D CE1 1 
ATOM   6620  C CE2 . PHE D 1 45  ? -21.371 6.784   40.035  1.00 91.73  ? 25  PHE D CE2 1 
ATOM   6621  C CZ  . PHE D 1 45  ? -22.710 6.576   39.752  1.00 93.58  ? 25  PHE D CZ  1 
ATOM   6622  N N   . GLU D 1 46  ? -20.095 11.645  43.821  1.00 100.46 ? 26  GLU D N   1 
ATOM   6623  C CA  . GLU D 1 46  ? -19.163 12.653  44.273  1.00 103.61 ? 26  GLU D CA  1 
ATOM   6624  C C   . GLU D 1 46  ? -18.228 12.896  43.111  1.00 96.85  ? 26  GLU D C   1 
ATOM   6625  O O   . GLU D 1 46  ? -17.629 11.954  42.597  1.00 96.66  ? 26  GLU D O   1 
ATOM   6626  C CB  . GLU D 1 46  ? -18.390 12.161  45.488  1.00 111.99 ? 26  GLU D CB  1 
ATOM   6627  C CG  . GLU D 1 46  ? -17.492 13.214  46.123  1.00 114.51 ? 26  GLU D CG  1 
ATOM   6628  C CD  . GLU D 1 46  ? -16.647 12.655  47.252  1.00 118.34 ? 26  GLU D CD  1 
ATOM   6629  O OE1 . GLU D 1 46  ? -17.019 11.601  47.821  1.00 119.35 ? 26  GLU D OE1 1 
ATOM   6630  O OE2 . GLU D 1 46  ? -15.609 13.277  47.572  1.00 115.71 ? 26  GLU D OE2 1 
ATOM   6631  N N   . VAL D 1 47  ? -18.100 14.146  42.691  1.00 90.51  ? 27  VAL D N   1 
ATOM   6632  C CA  . VAL D 1 47  ? -17.344 14.433  41.485  1.00 89.45  ? 27  VAL D CA  1 
ATOM   6633  C C   . VAL D 1 47  ? -16.254 15.443  41.725  1.00 85.28  ? 27  VAL D C   1 
ATOM   6634  O O   . VAL D 1 47  ? -16.517 16.525  42.238  1.00 88.66  ? 27  VAL D O   1 
ATOM   6635  C CB  . VAL D 1 47  ? -18.231 15.009  40.370  1.00 93.01  ? 27  VAL D CB  1 
ATOM   6636  C CG1 . VAL D 1 47  ? -17.418 15.183  39.094  1.00 94.70  ? 27  VAL D CG1 1 
ATOM   6637  C CG2 . VAL D 1 47  ? -19.429 14.112  40.109  1.00 95.15  ? 27  VAL D CG2 1 
ATOM   6638  N N   . VAL D 1 48  ? -15.038 15.096  41.317  1.00 80.88  ? 28  VAL D N   1 
ATOM   6639  C CA  . VAL D 1 48  ? -13.951 16.065  41.239  1.00 79.17  ? 28  VAL D CA  1 
ATOM   6640  C C   . VAL D 1 48  ? -13.883 16.587  39.816  1.00 79.20  ? 28  VAL D C   1 
ATOM   6641  O O   . VAL D 1 48  ? -14.322 15.922  38.882  1.00 79.98  ? 28  VAL D O   1 
ATOM   6642  C CB  . VAL D 1 48  ? -12.580 15.451  41.568  1.00 78.88  ? 28  VAL D CB  1 
ATOM   6643  C CG1 . VAL D 1 48  ? -11.527 16.540  41.748  1.00 76.45  ? 28  VAL D CG1 1 
ATOM   6644  C CG2 . VAL D 1 48  ? -12.655 14.595  42.818  1.00 78.47  ? 28  VAL D CG2 1 
ATOM   6645  N N   . LEU D 1 49  ? -13.308 17.769  39.658  1.00 77.68  ? 29  LEU D N   1 
ATOM   6646  C CA  . LEU D 1 49  ? -13.165 18.383  38.358  1.00 80.13  ? 29  LEU D CA  1 
ATOM   6647  C C   . LEU D 1 49  ? -11.829 19.099  38.280  1.00 86.12  ? 29  LEU D C   1 
ATOM   6648  O O   . LEU D 1 49  ? -11.631 20.155  38.880  1.00 89.43  ? 29  LEU D O   1 
ATOM   6649  C CB  . LEU D 1 49  ? -14.303 19.369  38.135  1.00 82.76  ? 29  LEU D CB  1 
ATOM   6650  C CG  . LEU D 1 49  ? -14.662 19.673  36.680  1.00 85.99  ? 29  LEU D CG  1 
ATOM   6651  C CD1 . LEU D 1 49  ? -16.087 20.189  36.624  1.00 88.71  ? 29  LEU D CD1 1 
ATOM   6652  C CD2 . LEU D 1 49  ? -13.720 20.677  36.030  1.00 84.66  ? 29  LEU D CD2 1 
ATOM   6653  N N   . ARG D 1 50  ? -10.922 18.530  37.507  1.00 87.15  ? 30  ARG D N   1 
ATOM   6654  C CA  . ARG D 1 50  ? -9.557  18.991  37.479  1.00 86.08  ? 30  ARG D CA  1 
ATOM   6655  C C   . ARG D 1 50  ? -9.255  19.683  36.150  1.00 85.12  ? 30  ARG D C   1 
ATOM   6656  O O   . ARG D 1 50  ? -9.615  19.177  35.091  1.00 89.39  ? 30  ARG D O   1 
ATOM   6657  C CB  . ARG D 1 50  ? -8.652  17.769  37.700  1.00 89.38  ? 30  ARG D CB  1 
ATOM   6658  C CG  . ARG D 1 50  ? -7.150  17.999  37.682  1.00 89.59  ? 30  ARG D CG  1 
ATOM   6659  C CD  . ARG D 1 50  ? -6.764  19.232  36.903  1.00 88.52  ? 30  ARG D CD  1 
ATOM   6660  N NE  . ARG D 1 50  ? -5.501  19.198  36.182  1.00 87.62  ? 30  ARG D NE  1 
ATOM   6661  C CZ  . ARG D 1 50  ? -4.381  18.653  36.623  1.00 84.80  ? 30  ARG D CZ  1 
ATOM   6662  N NH1 . ARG D 1 50  ? -4.322  18.080  37.807  1.00 86.70  ? 30  ARG D NH1 1 
ATOM   6663  N NH2 . ARG D 1 50  ? -3.298  18.694  35.871  1.00 84.13  ? 30  ARG D NH2 1 
ATOM   6664  N N   . ASP D 1 51  ? -8.601  20.846  36.215  1.00 88.53  ? 31  ASP D N   1 
ATOM   6665  C CA  . ASP D 1 51  ? -7.825  21.368  35.067  1.00 91.52  ? 31  ASP D CA  1 
ATOM   6666  C C   . ASP D 1 51  ? -6.458  21.957  35.495  1.00 93.33  ? 31  ASP D C   1 
ATOM   6667  O O   . ASP D 1 51  ? -6.035  21.806  36.639  1.00 91.61  ? 31  ASP D O   1 
ATOM   6668  C CB  . ASP D 1 51  ? -8.637  22.376  34.260  1.00 92.19  ? 31  ASP D CB  1 
ATOM   6669  C CG  . ASP D 1 51  ? -8.278  22.352  32.776  1.00 91.41  ? 31  ASP D CG  1 
ATOM   6670  O OD1 . ASP D 1 51  ? -9.199  22.407  31.934  1.00 86.83  ? 31  ASP D OD1 1 
ATOM   6671  O OD2 . ASP D 1 51  ? -7.071  22.249  32.453  1.00 84.78  ? 31  ASP D OD2 1 
ATOM   6672  N N   . ILE D 1 52  ? -5.767  22.621  34.575  1.00 99.16  ? 32  ILE D N   1 
ATOM   6673  C CA  . ILE D 1 52  ? -4.399  23.101  34.830  1.00 105.44 ? 32  ILE D CA  1 
ATOM   6674  C C   . ILE D 1 52  ? -4.346  24.554  35.319  1.00 110.85 ? 32  ILE D C   1 
ATOM   6675  O O   . ILE D 1 52  ? -3.263  25.130  35.423  1.00 107.85 ? 32  ILE D O   1 
ATOM   6676  C CB  . ILE D 1 52  ? -3.498  22.949  33.578  1.00 103.42 ? 32  ILE D CB  1 
ATOM   6677  C CG1 . ILE D 1 52  ? -4.074  23.738  32.390  1.00 101.46 ? 32  ILE D CG1 1 
ATOM   6678  C CG2 . ILE D 1 52  ? -3.310  21.474  33.239  1.00 103.15 ? 32  ILE D CG2 1 
ATOM   6679  C CD1 . ILE D 1 52  ? -3.298  23.580  31.101  1.00 98.73  ? 32  ILE D CD1 1 
ATOM   6680  N N   . LYS D 1 53  ? -5.507  25.133  35.628  1.00 119.11 ? 33  LYS D N   1 
ATOM   6681  C CA  . LYS D 1 53  ? -5.607  26.541  36.047  1.00 125.22 ? 33  LYS D CA  1 
ATOM   6682  C C   . LYS D 1 53  ? -7.054  26.902  36.399  1.00 129.87 ? 33  LYS D C   1 
ATOM   6683  O O   . LYS D 1 53  ? -7.986  26.502  35.701  1.00 139.06 ? 33  LYS D O   1 
ATOM   6684  C CB  . LYS D 1 53  ? -5.055  27.485  34.953  1.00 125.17 ? 33  LYS D CB  1 
ATOM   6685  C CG  . LYS D 1 53  ? -5.451  28.968  35.028  1.00 124.98 ? 33  LYS D CG  1 
ATOM   6686  C CD  . LYS D 1 53  ? -5.074  29.717  36.315  1.00 121.52 ? 33  LYS D CD  1 
ATOM   6687  C CE  . LYS D 1 53  ? -3.799  29.208  36.980  1.00 115.57 ? 33  LYS D CE  1 
ATOM   6688  N NZ  . LYS D 1 53  ? -3.329  30.084  38.084  1.00 109.67 ? 33  LYS D NZ  1 
ATOM   6689  N N   . ASP D 1 54  ? -7.220  27.665  37.479  1.00 125.80 ? 34  ASP D N   1 
ATOM   6690  C CA  . ASP D 1 54  ? -8.536  28.104  37.960  1.00 121.40 ? 34  ASP D CA  1 
ATOM   6691  C C   . ASP D 1 54  ? -9.452  28.736  36.907  1.00 117.77 ? 34  ASP D C   1 
ATOM   6692  O O   . ASP D 1 54  ? -10.651 28.461  36.913  1.00 118.85 ? 34  ASP D O   1 
ATOM   6693  C CB  . ASP D 1 54  ? -8.375  29.065  39.141  1.00 122.12 ? 34  ASP D CB  1 
ATOM   6694  C CG  . ASP D 1 54  ? -8.004  28.351  40.427  1.00 122.72 ? 34  ASP D CG  1 
ATOM   6695  O OD1 . ASP D 1 54  ? -8.608  27.299  40.734  1.00 123.47 ? 34  ASP D OD1 1 
ATOM   6696  O OD2 . ASP D 1 54  ? -7.110  28.847  41.141  1.00 120.16 ? 34  ASP D OD2 1 
ATOM   6697  N N   . GLU D 1 55  ? -8.913  29.580  36.025  1.00 110.72 ? 35  GLU D N   1 
ATOM   6698  C CA  . GLU D 1 55  ? -9.726  30.157  34.937  1.00 109.32 ? 35  GLU D CA  1 
ATOM   6699  C C   . GLU D 1 55  ? -10.638 29.085  34.388  1.00 106.14 ? 35  GLU D C   1 
ATOM   6700  O O   . GLU D 1 55  ? -11.856 29.226  34.404  1.00 99.89  ? 35  GLU D O   1 
ATOM   6701  C CB  . GLU D 1 55  ? -8.888  30.667  33.763  1.00 108.95 ? 35  GLU D CB  1 
ATOM   6702  C CG  . GLU D 1 55  ? -7.797  31.657  34.103  1.00 111.20 ? 35  GLU D CG  1 
ATOM   6703  C CD  . GLU D 1 55  ? -7.128  32.213  32.863  1.00 111.09 ? 35  GLU D CD  1 
ATOM   6704  O OE1 . GLU D 1 55  ? -6.046  32.811  33.010  1.00 109.69 ? 35  GLU D OE1 1 
ATOM   6705  O OE2 . GLU D 1 55  ? -7.669  32.045  31.746  1.00 106.45 ? 35  GLU D OE2 1 
ATOM   6706  N N   . PHE D 1 56  ? -10.006 28.001  33.938  1.00 105.50 ? 36  PHE D N   1 
ATOM   6707  C CA  . PHE D 1 56  ? -10.669 26.893  33.260  1.00 102.37 ? 36  PHE D CA  1 
ATOM   6708  C C   . PHE D 1 56  ? -11.639 26.202  34.188  1.00 98.62  ? 36  PHE D C   1 
ATOM   6709  O O   . PHE D 1 56  ? -12.786 25.931  33.819  1.00 101.28 ? 36  PHE D O   1 
ATOM   6710  C CB  . PHE D 1 56  ? -9.639  25.863  32.787  1.00 104.09 ? 36  PHE D CB  1 
ATOM   6711  C CG  . PHE D 1 56  ? -8.560  26.437  31.909  1.00 107.34 ? 36  PHE D CG  1 
ATOM   6712  C CD1 . PHE D 1 56  ? -8.879  27.297  30.863  1.00 107.24 ? 36  PHE D CD1 1 
ATOM   6713  C CD2 . PHE D 1 56  ? -7.222  26.116  32.126  1.00 108.07 ? 36  PHE D CD2 1 
ATOM   6714  C CE1 . PHE D 1 56  ? -7.886  27.832  30.058  1.00 106.31 ? 36  PHE D CE1 1 
ATOM   6715  C CE2 . PHE D 1 56  ? -6.226  26.647  31.320  1.00 105.43 ? 36  PHE D CE2 1 
ATOM   6716  C CZ  . PHE D 1 56  ? -6.558  27.505  30.285  1.00 104.24 ? 36  PHE D CZ  1 
ATOM   6717  N N   . VAL D 1 57  ? -11.166 25.908  35.392  1.00 89.67  ? 37  VAL D N   1 
ATOM   6718  C CA  . VAL D 1 57  ? -12.005 25.213  36.363  1.00 93.09  ? 37  VAL D CA  1 
ATOM   6719  C C   . VAL D 1 57  ? -13.256 26.040  36.613  1.00 100.08 ? 37  VAL D C   1 
ATOM   6720  O O   . VAL D 1 57  ? -14.384 25.570  36.421  1.00 103.57 ? 37  VAL D O   1 
ATOM   6721  C CB  . VAL D 1 57  ? -11.303 24.974  37.712  1.00 88.72  ? 37  VAL D CB  1 
ATOM   6722  C CG1 . VAL D 1 57  ? -12.036 23.884  38.484  1.00 87.41  ? 37  VAL D CG1 1 
ATOM   6723  C CG2 . VAL D 1 57  ? -9.845  24.592  37.517  1.00 87.28  ? 37  VAL D CG2 1 
ATOM   6724  N N   . ASP D 1 58  ? -13.028 27.280  37.038  1.00 108.93 ? 38  ASP D N   1 
ATOM   6725  C CA  . ASP D 1 58  ? -14.098 28.237  37.266  1.00 110.64 ? 38  ASP D CA  1 
ATOM   6726  C C   . ASP D 1 58  ? -14.948 28.349  36.004  1.00 105.00 ? 38  ASP D C   1 
ATOM   6727  O O   . ASP D 1 58  ? -16.144 28.069  36.042  1.00 103.91 ? 38  ASP D O   1 
ATOM   6728  C CB  . ASP D 1 58  ? -13.520 29.603  37.675  1.00 114.97 ? 38  ASP D CB  1 
ATOM   6729  C CG  . ASP D 1 58  ? -12.847 29.576  39.061  1.00 117.46 ? 38  ASP D CG  1 
ATOM   6730  O OD1 . ASP D 1 58  ? -13.224 28.725  39.902  1.00 110.55 ? 38  ASP D OD1 1 
ATOM   6731  O OD2 . ASP D 1 58  ? -11.945 30.411  39.313  1.00 112.42 ? 38  ASP D OD2 1 
ATOM   6732  N N   . ARG D 1 59  ? -14.314 28.716  34.890  1.00 99.44  ? 39  ARG D N   1 
ATOM   6733  C CA  . ARG D 1 59  ? -14.973 28.808  33.575  1.00 98.60  ? 39  ARG D CA  1 
ATOM   6734  C C   . ARG D 1 59  ? -15.903 27.625  33.257  1.00 97.42  ? 39  ARG D C   1 
ATOM   6735  O O   . ARG D 1 59  ? -16.937 27.792  32.598  1.00 91.13  ? 39  ARG D O   1 
ATOM   6736  C CB  . ARG D 1 59  ? -13.920 28.903  32.473  1.00 99.37  ? 39  ARG D CB  1 
ATOM   6737  C CG  . ARG D 1 59  ? -14.490 28.893  31.069  1.00 101.16 ? 39  ARG D CG  1 
ATOM   6738  C CD  . ARG D 1 59  ? -13.429 28.518  30.055  1.00 105.83 ? 39  ARG D CD  1 
ATOM   6739  N NE  . ARG D 1 59  ? -13.992 27.682  28.993  1.00 109.71 ? 39  ARG D NE  1 
ATOM   6740  C CZ  . ARG D 1 59  ? -13.952 27.955  27.689  1.00 107.64 ? 39  ARG D CZ  1 
ATOM   6741  N NH1 . ARG D 1 59  ? -13.353 29.052  27.231  1.00 109.22 ? 39  ARG D NH1 1 
ATOM   6742  N NH2 . ARG D 1 59  ? -14.510 27.112  26.829  1.00 104.14 ? 39  ARG D NH2 1 
ATOM   6743  N N   . GLY D 1 60  ? -15.509 26.436  33.705  1.00 94.61  ? 40  GLY D N   1 
ATOM   6744  C CA  . GLY D 1 60  ? -16.300 25.224  33.529  1.00 93.57  ? 40  GLY D CA  1 
ATOM   6745  C C   . GLY D 1 60  ? -17.423 25.089  34.537  1.00 94.85  ? 40  GLY D C   1 
ATOM   6746  O O   . GLY D 1 60  ? -18.560 24.812  34.158  1.00 97.79  ? 40  GLY D O   1 
ATOM   6747  N N   . LEU D 1 61  ? -17.110 25.287  35.816  1.00 92.81  ? 41  LEU D N   1 
ATOM   6748  C CA  . LEU D 1 61  ? -18.139 25.308  36.864  1.00 92.34  ? 41  LEU D CA  1 
ATOM   6749  C C   . LEU D 1 61  ? -19.172 26.363  36.527  1.00 90.22  ? 41  LEU D C   1 
ATOM   6750  O O   . LEU D 1 61  ? -20.369 26.194  36.775  1.00 78.97  ? 41  LEU D O   1 
ATOM   6751  C CB  . LEU D 1 61  ? -17.513 25.585  38.225  1.00 92.03  ? 41  LEU D CB  1 
ATOM   6752  C CG  . LEU D 1 61  ? -16.565 24.448  38.611  1.00 96.21  ? 41  LEU D CG  1 
ATOM   6753  C CD1 . LEU D 1 61  ? -15.785 24.781  39.872  1.00 93.91  ? 41  LEU D CD1 1 
ATOM   6754  C CD2 . LEU D 1 61  ? -17.325 23.129  38.757  1.00 97.80  ? 41  LEU D CD2 1 
ATOM   6755  N N   . ASP D 1 62  ? -18.683 27.439  35.920  1.00 94.05  ? 42  ASP D N   1 
ATOM   6756  C CA  . ASP D 1 62  ? -19.524 28.502  35.386  1.00 99.98  ? 42  ASP D CA  1 
ATOM   6757  C C   . ASP D 1 62  ? -20.520 27.979  34.342  1.00 99.35  ? 42  ASP D C   1 
ATOM   6758  O O   . ASP D 1 62  ? -21.711 28.282  34.408  1.00 95.92  ? 42  ASP D O   1 
ATOM   6759  C CB  . ASP D 1 62  ? -18.639 29.595  34.768  1.00 102.73 ? 42  ASP D CB  1 
ATOM   6760  C CG  . ASP D 1 62  ? -19.413 30.543  33.864  1.00 105.45 ? 42  ASP D CG  1 
ATOM   6761  O OD1 . ASP D 1 62  ? -20.540 30.946  34.228  1.00 106.54 ? 42  ASP D OD1 1 
ATOM   6762  O OD2 . ASP D 1 62  ? -18.889 30.889  32.783  1.00 109.01 ? 42  ASP D OD2 1 
ATOM   6763  N N   . PHE D 1 63  ? -20.009 27.215  33.379  1.00 96.89  ? 43  PHE D N   1 
ATOM   6764  C CA  . PHE D 1 63  ? -20.809 26.656  32.284  1.00 95.52  ? 43  PHE D CA  1 
ATOM   6765  C C   . PHE D 1 63  ? -21.901 25.724  32.803  1.00 89.04  ? 43  PHE D C   1 
ATOM   6766  O O   . PHE D 1 63  ? -23.046 25.761  32.341  1.00 84.20  ? 43  PHE D O   1 
ATOM   6767  C CB  . PHE D 1 63  ? -19.888 25.890  31.333  1.00 101.31 ? 43  PHE D CB  1 
ATOM   6768  C CG  . PHE D 1 63  ? -20.577 25.357  30.114  1.00 106.27 ? 43  PHE D CG  1 
ATOM   6769  C CD1 . PHE D 1 63  ? -20.720 23.988  29.921  1.00 106.13 ? 43  PHE D CD1 1 
ATOM   6770  C CD2 . PHE D 1 63  ? -21.086 26.225  29.158  1.00 109.24 ? 43  PHE D CD2 1 
ATOM   6771  C CE1 . PHE D 1 63  ? -21.355 23.496  28.795  1.00 106.50 ? 43  PHE D CE1 1 
ATOM   6772  C CE2 . PHE D 1 63  ? -21.724 25.740  28.031  1.00 109.79 ? 43  PHE D CE2 1 
ATOM   6773  C CZ  . PHE D 1 63  ? -21.859 24.373  27.849  1.00 107.95 ? 43  PHE D CZ  1 
ATOM   6774  N N   . ILE D 1 64  ? -21.518 24.895  33.766  1.00 83.07  ? 44  ILE D N   1 
ATOM   6775  C CA  . ILE D 1 64  ? -22.447 24.008  34.461  1.00 86.12  ? 44  ILE D CA  1 
ATOM   6776  C C   . ILE D 1 64  ? -23.537 24.810  35.140  1.00 94.71  ? 44  ILE D C   1 
ATOM   6777  O O   . ILE D 1 64  ? -24.721 24.460  35.066  1.00 101.40 ? 44  ILE D O   1 
ATOM   6778  C CB  . ILE D 1 64  ? -21.754 23.207  35.575  1.00 82.69  ? 44  ILE D CB  1 
ATOM   6779  C CG1 . ILE D 1 64  ? -20.366 22.748  35.113  1.00 80.73  ? 44  ILE D CG1 1 
ATOM   6780  C CG2 . ILE D 1 64  ? -22.661 22.071  36.034  1.00 77.62  ? 44  ILE D CG2 1 
ATOM   6781  C CD1 . ILE D 1 64  ? -19.886 21.463  35.729  1.00 80.74  ? 44  ILE D CD1 1 
ATOM   6782  N N   . ASN D 1 65  ? -23.113 25.874  35.822  1.00 98.77  ? 45  ASN D N   1 
ATOM   6783  C CA  . ASN D 1 65  ? -24.033 26.767  36.521  1.00 97.83  ? 45  ASN D CA  1 
ATOM   6784  C C   . ASN D 1 65  ? -25.173 27.167  35.599  1.00 91.86  ? 45  ASN D C   1 
ATOM   6785  O O   . ASN D 1 65  ? -26.324 27.185  36.016  1.00 89.01  ? 45  ASN D O   1 
ATOM   6786  C CB  . ASN D 1 65  ? -23.312 28.019  37.048  1.00 98.91  ? 45  ASN D CB  1 
ATOM   6787  C CG  . ASN D 1 65  ? -24.103 28.744  38.137  1.00 95.98  ? 45  ASN D CG  1 
ATOM   6788  O OD1 . ASN D 1 65  ? -24.505 28.151  39.144  1.00 93.72  ? 45  ASN D OD1 1 
ATOM   6789  N ND2 . ASN D 1 65  ? -24.315 30.038  37.943  1.00 92.61  ? 45  ASN D ND2 1 
ATOM   6790  N N   . LYS D 1 66  ? -24.852 27.447  34.341  1.00 90.01  ? 46  LYS D N   1 
ATOM   6791  C CA  . LYS D 1 66  ? -25.855 27.901  33.382  1.00 96.19  ? 46  LYS D CA  1 
ATOM   6792  C C   . LYS D 1 66  ? -26.820 26.839  32.879  1.00 98.77  ? 46  LYS D C   1 
ATOM   6793  O O   . LYS D 1 66  ? -28.026 27.061  32.870  1.00 101.87 ? 46  LYS D O   1 
ATOM   6794  C CB  . LYS D 1 66  ? -25.192 28.489  32.167  1.00 96.15  ? 46  LYS D CB  1 
ATOM   6795  C CG  . LYS D 1 66  ? -24.093 29.490  32.457  1.00 96.22  ? 46  LYS D CG  1 
ATOM   6796  C CD  . LYS D 1 66  ? -24.056 30.570  31.394  1.00 97.38  ? 46  LYS D CD  1 
ATOM   6797  C CE  . LYS D 1 66  ? -24.891 30.201  30.169  1.00 97.07  ? 46  LYS D CE  1 
ATOM   6798  N NZ  . LYS D 1 66  ? -24.191 30.490  28.902  1.00 98.13  ? 46  LYS D NZ  1 
ATOM   6799  N N   . ASN D 1 67  ? -26.294 25.713  32.406  1.00 100.90 ? 47  ASN D N   1 
ATOM   6800  C CA  . ASN D 1 67  ? -27.156 24.648  31.883  1.00 101.35 ? 47  ASN D CA  1 
ATOM   6801  C C   . ASN D 1 67  ? -28.117 24.218  32.964  1.00 100.04 ? 47  ASN D C   1 
ATOM   6802  O O   . ASN D 1 67  ? -29.289 23.976  32.697  1.00 98.95  ? 47  ASN D O   1 
ATOM   6803  C CB  . ASN D 1 67  ? -26.368 23.416  31.450  1.00 104.56 ? 47  ASN D CB  1 
ATOM   6804  C CG  . ASN D 1 67  ? -25.162 23.751  30.606  1.00 106.63 ? 47  ASN D CG  1 
ATOM   6805  O OD1 . ASN D 1 67  ? -25.268 24.433  29.587  1.00 105.84 ? 47  ASN D OD1 1 
ATOM   6806  N ND2 . ASN D 1 67  ? -24.000 23.260  31.022  1.00 105.00 ? 47  ASN D ND2 1 
ATOM   6807  N N   . LEU D 1 68  ? -27.595 24.108  34.183  1.00 98.80  ? 48  LEU D N   1 
ATOM   6808  C CA  . LEU D 1 68  ? -28.411 23.799  35.355  1.00 98.56  ? 48  LEU D CA  1 
ATOM   6809  C C   . LEU D 1 68  ? -29.430 24.893  35.601  1.00 97.63  ? 48  LEU D C   1 
ATOM   6810  O O   . LEU D 1 68  ? -30.549 24.626  36.039  1.00 96.69  ? 48  LEU D O   1 
ATOM   6811  C CB  . LEU D 1 68  ? -27.532 23.684  36.589  1.00 95.61  ? 48  LEU D CB  1 
ATOM   6812  C CG  . LEU D 1 68  ? -26.744 22.391  36.695  1.00 95.11  ? 48  LEU D CG  1 
ATOM   6813  C CD1 . LEU D 1 68  ? -25.659 22.577  37.738  1.00 97.32  ? 48  LEU D CD1 1 
ATOM   6814  C CD2 . LEU D 1 68  ? -27.668 21.239  37.062  1.00 92.50  ? 48  LEU D CD2 1 
ATOM   6815  N N   . SER D 1 69  ? -29.010 26.129  35.335  1.00 100.02 ? 49  SER D N   1 
ATOM   6816  C CA  . SER D 1 69  ? -29.871 27.313  35.431  1.00 102.22 ? 49  SER D CA  1 
ATOM   6817  C C   . SER D 1 69  ? -30.916 27.345  34.329  1.00 103.43 ? 49  SER D C   1 
ATOM   6818  O O   . SER D 1 69  ? -32.114 27.460  34.607  1.00 109.33 ? 49  SER D O   1 
ATOM   6819  C CB  . SER D 1 69  ? -29.050 28.605  35.346  1.00 102.24 ? 49  SER D CB  1 
ATOM   6820  O OG  . SER D 1 69  ? -28.018 28.644  36.313  1.00 101.99 ? 49  SER D OG  1 
ATOM   6821  N N   . LYS D 1 70  ? -30.452 27.272  33.081  1.00 98.76  ? 50  LYS D N   1 
ATOM   6822  C CA  . LYS D 1 70  ? -31.341 27.119  31.936  1.00 96.67  ? 50  LYS D CA  1 
ATOM   6823  C C   . LYS D 1 70  ? -32.348 25.992  32.215  1.00 89.73  ? 50  LYS D C   1 
ATOM   6824  O O   . LYS D 1 70  ? -33.482 26.034  31.746  1.00 84.69  ? 50  LYS D O   1 
ATOM   6825  C CB  . LYS D 1 70  ? -30.540 26.821  30.662  1.00 102.22 ? 50  LYS D CB  1 
ATOM   6826  C CG  . LYS D 1 70  ? -30.969 27.652  29.462  1.00 106.22 ? 50  LYS D CG  1 
ATOM   6827  C CD  . LYS D 1 70  ? -30.173 27.302  28.206  1.00 106.27 ? 50  LYS D CD  1 
ATOM   6828  C CE  . LYS D 1 70  ? -31.060 27.225  26.970  1.00 105.27 ? 50  LYS D CE  1 
ATOM   6829  N NZ  . LYS D 1 70  ? -32.085 26.144  27.087  1.00 104.36 ? 50  LYS D NZ  1 
ATOM   6830  N N   . LEU D 1 71  ? -31.930 24.992  32.991  1.00 90.16  ? 51  LEU D N   1 
ATOM   6831  C CA  . LEU D 1 71  ? -32.821 23.905  33.416  1.00 92.26  ? 51  LEU D CA  1 
ATOM   6832  C C   . LEU D 1 71  ? -33.891 24.330  34.426  1.00 97.54  ? 51  LEU D C   1 
ATOM   6833  O O   . LEU D 1 71  ? -35.080 24.215  34.130  1.00 100.26 ? 51  LEU D O   1 
ATOM   6834  C CB  . LEU D 1 71  ? -32.026 22.694  33.946  1.00 91.99  ? 51  LEU D CB  1 
ATOM   6835  C CG  . LEU D 1 71  ? -31.415 21.716  32.913  1.00 89.01  ? 51  LEU D CG  1 
ATOM   6836  C CD1 . LEU D 1 71  ? -31.027 20.384  33.546  1.00 85.31  ? 51  LEU D CD1 1 
ATOM   6837  C CD2 . LEU D 1 71  ? -32.349 21.454  31.744  1.00 89.49  ? 51  LEU D CD2 1 
ATOM   6838  N N   . VAL D 1 72  ? -33.494 24.833  35.597  1.00 102.01 ? 52  VAL D N   1 
ATOM   6839  C CA  . VAL D 1 72  ? -34.486 25.275  36.607  1.00 106.76 ? 52  VAL D CA  1 
ATOM   6840  C C   . VAL D 1 72  ? -35.365 26.445  36.151  1.00 107.34 ? 52  VAL D C   1 
ATOM   6841  O O   . VAL D 1 72  ? -36.192 26.932  36.917  1.00 110.93 ? 52  VAL D O   1 
ATOM   6842  C CB  . VAL D 1 72  ? -33.859 25.694  37.963  1.00 111.24 ? 52  VAL D CB  1 
ATOM   6843  C CG1 . VAL D 1 72  ? -33.150 24.539  38.623  1.00 114.56 ? 52  VAL D CG1 1 
ATOM   6844  C CG2 . VAL D 1 72  ? -32.913 26.873  37.805  1.00 110.81 ? 52  VAL D CG2 1 
ATOM   6845  N N   . LYS D 1 73  ? -35.179 26.894  34.914  1.00 105.01 ? 53  LYS D N   1 
ATOM   6846  C CA  . LYS D 1 73  ? -35.986 27.960  34.327  1.00 107.96 ? 53  LYS D CA  1 
ATOM   6847  C C   . LYS D 1 73  ? -37.115 27.355  33.486  1.00 109.96 ? 53  LYS D C   1 
ATOM   6848  O O   . LYS D 1 73  ? -37.834 28.048  32.766  1.00 108.59 ? 53  LYS D O   1 
ATOM   6849  C CB  . LYS D 1 73  ? -35.082 28.867  33.488  1.00 107.97 ? 53  LYS D CB  1 
ATOM   6850  C CG  . LYS D 1 73  ? -35.798 29.732  32.459  1.00 106.78 ? 53  LYS D CG  1 
ATOM   6851  C CD  . LYS D 1 73  ? -35.730 31.204  32.800  1.00 108.20 ? 53  LYS D CD  1 
ATOM   6852  C CE  . LYS D 1 73  ? -34.488 31.841  32.195  1.00 108.98 ? 53  LYS D CE  1 
ATOM   6853  N NZ  . LYS D 1 73  ? -34.851 32.845  31.157  1.00 106.53 ? 53  LYS D NZ  1 
ATOM   6854  N N   . LYS D 1 74  ? -37.251 26.045  33.576  1.00 116.82 ? 54  LYS D N   1 
ATOM   6855  C CA  . LYS D 1 74  ? -38.391 25.349  33.031  1.00 120.60 ? 54  LYS D CA  1 
ATOM   6856  C C   . LYS D 1 74  ? -38.794 24.420  34.154  1.00 120.47 ? 54  LYS D C   1 
ATOM   6857  O O   . LYS D 1 74  ? -38.167 24.427  35.218  1.00 118.19 ? 54  LYS D O   1 
ATOM   6858  C CB  . LYS D 1 74  ? -37.990 24.556  31.782  1.00 123.94 ? 54  LYS D CB  1 
ATOM   6859  C CG  . LYS D 1 74  ? -38.824 24.846  30.546  1.00 127.49 ? 54  LYS D CG  1 
ATOM   6860  C CD  . LYS D 1 74  ? -37.964 25.515  29.491  1.00 131.16 ? 54  LYS D CD  1 
ATOM   6861  C CE  . LYS D 1 74  ? -38.762 25.887  28.260  1.00 132.13 ? 54  LYS D CE  1 
ATOM   6862  N NZ  . LYS D 1 74  ? -37.987 26.848  27.423  1.00 132.71 ? 54  LYS D NZ  1 
ATOM   6863  N N   . GLY D 1 75  ? -39.816 23.606  33.929  1.00 120.52 ? 55  GLY D N   1 
ATOM   6864  C CA  . GLY D 1 75  ? -40.169 22.576  34.895  1.00 119.18 ? 55  GLY D CA  1 
ATOM   6865  C C   . GLY D 1 75  ? -39.028 21.598  35.129  1.00 119.81 ? 55  GLY D C   1 
ATOM   6866  O O   . GLY D 1 75  ? -39.114 20.758  36.023  1.00 121.85 ? 55  GLY D O   1 
ATOM   6867  N N   . LYS D 1 76  ? -37.954 21.720  34.346  1.00 121.45 ? 56  LYS D N   1 
ATOM   6868  C CA  . LYS D 1 76  ? -36.932 20.682  34.275  1.00 122.57 ? 56  LYS D CA  1 
ATOM   6869  C C   . LYS D 1 76  ? -36.437 20.221  35.637  1.00 120.17 ? 56  LYS D C   1 
ATOM   6870  O O   . LYS D 1 76  ? -36.608 19.051  35.987  1.00 113.24 ? 56  LYS D O   1 
ATOM   6871  C CB  . LYS D 1 76  ? -35.778 21.073  33.335  1.00 126.24 ? 56  LYS D CB  1 
ATOM   6872  C CG  . LYS D 1 76  ? -35.976 20.692  31.858  1.00 127.54 ? 56  LYS D CG  1 
ATOM   6873  C CD  . LYS D 1 76  ? -37.263 19.916  31.544  1.00 126.98 ? 56  LYS D CD  1 
ATOM   6874  C CE  . LYS D 1 76  ? -37.059 18.782  30.550  1.00 125.73 ? 56  LYS D CE  1 
ATOM   6875  N NZ  . LYS D 1 76  ? -36.716 17.506  31.240  1.00 124.82 ? 56  LYS D NZ  1 
ATOM   6876  N N   . ILE D 1 77  ? -35.843 21.111  36.418  1.00 119.64 ? 57  ILE D N   1 
ATOM   6877  C CA  . ILE D 1 77  ? -35.435 20.711  37.762  1.00 121.69 ? 57  ILE D CA  1 
ATOM   6878  C C   . ILE D 1 77  ? -35.805 21.764  38.791  1.00 121.95 ? 57  ILE D C   1 
ATOM   6879  O O   . ILE D 1 77  ? -36.081 22.919  38.454  1.00 115.46 ? 57  ILE D O   1 
ATOM   6880  C CB  . ILE D 1 77  ? -33.921 20.383  37.843  1.00 124.01 ? 57  ILE D CB  1 
ATOM   6881  C CG1 . ILE D 1 77  ? -33.099 21.677  37.863  1.00 122.56 ? 57  ILE D CG1 1 
ATOM   6882  C CG2 . ILE D 1 77  ? -33.515 19.441  36.714  1.00 123.04 ? 57  ILE D CG2 1 
ATOM   6883  C CD1 . ILE D 1 77  ? -31.610 21.549  37.623  1.00 120.67 ? 57  ILE D CD1 1 
ATOM   6884  N N   . GLU D 1 78  ? -35.808 21.335  40.049  1.00 119.88 ? 58  GLU D N   1 
ATOM   6885  C CA  . GLU D 1 78  ? -36.024 22.221  41.188  1.00 117.00 ? 58  GLU D CA  1 
ATOM   6886  C C   . GLU D 1 78  ? -34.695 22.892  41.559  1.00 113.94 ? 58  GLU D C   1 
ATOM   6887  O O   . GLU D 1 78  ? -33.636 22.260  41.464  1.00 112.78 ? 58  GLU D O   1 
ATOM   6888  C CB  . GLU D 1 78  ? -36.559 21.408  42.372  1.00 116.53 ? 58  GLU D CB  1 
ATOM   6889  C CG  . GLU D 1 78  ? -37.796 20.560  42.064  1.00 113.93 ? 58  GLU D CG  1 
ATOM   6890  C CD  . GLU D 1 78  ? -39.066 21.064  42.736  1.00 113.19 ? 58  GLU D CD  1 
ATOM   6891  O OE1 . GLU D 1 78  ? -40.116 21.129  42.057  1.00 111.18 ? 58  GLU D OE1 1 
ATOM   6892  O OE2 . GLU D 1 78  ? -39.019 21.385  43.944  1.00 106.34 ? 58  GLU D OE2 1 
ATOM   6893  N N   . GLU D 1 79  ? -34.745 24.155  41.991  1.00 107.50 ? 59  GLU D N   1 
ATOM   6894  C CA  . GLU D 1 79  ? -33.528 24.887  42.400  1.00 106.95 ? 59  GLU D CA  1 
ATOM   6895  C C   . GLU D 1 79  ? -32.820 24.275  43.622  1.00 107.48 ? 59  GLU D C   1 
ATOM   6896  O O   . GLU D 1 79  ? -31.707 24.682  43.957  1.00 102.49 ? 59  GLU D O   1 
ATOM   6897  C CB  . GLU D 1 79  ? -33.834 26.362  42.680  1.00 104.00 ? 59  GLU D CB  1 
ATOM   6898  C CG  . GLU D 1 79  ? -32.609 27.282  42.626  1.00 102.34 ? 59  GLU D CG  1 
ATOM   6899  C CD  . GLU D 1 79  ? -32.618 28.240  41.445  1.00 104.66 ? 59  GLU D CD  1 
ATOM   6900  O OE1 . GLU D 1 79  ? -31.525 28.626  40.971  1.00 100.51 ? 59  GLU D OE1 1 
ATOM   6901  O OE2 . GLU D 1 79  ? -33.718 28.625  40.995  1.00 107.34 ? 59  GLU D OE2 1 
ATOM   6902  N N   . ALA D 1 80  ? -33.467 23.316  44.288  1.00 113.27 ? 60  ALA D N   1 
ATOM   6903  C CA  . ALA D 1 80  ? -32.838 22.515  45.349  1.00 115.08 ? 60  ALA D CA  1 
ATOM   6904  C C   . ALA D 1 80  ? -31.718 21.628  44.781  1.00 117.79 ? 60  ALA D C   1 
ATOM   6905  O O   . ALA D 1 80  ? -30.566 21.717  45.223  1.00 109.13 ? 60  ALA D O   1 
ATOM   6906  C CB  . ALA D 1 80  ? -33.884 21.666  46.065  1.00 112.35 ? 60  ALA D CB  1 
ATOM   6907  N N   . THR D 1 81  ? -32.065 20.788  43.797  1.00 120.50 ? 61  THR D N   1 
ATOM   6908  C CA  . THR D 1 81  ? -31.065 20.025  43.020  1.00 120.23 ? 61  THR D CA  1 
ATOM   6909  C C   . THR D 1 81  ? -30.537 20.806  41.817  1.00 113.27 ? 61  THR D C   1 
ATOM   6910  O O   . THR D 1 81  ? -30.232 20.231  40.778  1.00 122.66 ? 61  THR D O   1 
ATOM   6911  C CB  . THR D 1 81  ? -31.559 18.622  42.555  1.00 123.82 ? 61  THR D CB  1 
ATOM   6912  O OG1 . THR D 1 81  ? -32.985 18.533  42.676  1.00 119.15 ? 61  THR D OG1 1 
ATOM   6913  C CG2 . THR D 1 81  ? -30.894 17.500  43.373  1.00 123.79 ? 61  THR D CG2 1 
ATOM   6914  N N   . LYS D 1 82  ? -30.460 22.121  41.948  1.00 106.60 ? 62  LYS D N   1 
ATOM   6915  C CA  . LYS D 1 82  ? -29.440 22.864  41.247  1.00 100.68 ? 62  LYS D CA  1 
ATOM   6916  C C   . LYS D 1 82  ? -28.291 22.879  42.237  1.00 101.94 ? 62  LYS D C   1 
ATOM   6917  O O   . LYS D 1 82  ? -27.261 22.254  42.014  1.00 105.17 ? 62  LYS D O   1 
ATOM   6918  C CB  . LYS D 1 82  ? -29.872 24.291  40.914  1.00 96.95  ? 62  LYS D CB  1 
ATOM   6919  C CG  . LYS D 1 82  ? -28.982 24.947  39.863  1.00 95.16  ? 62  LYS D CG  1 
ATOM   6920  C CD  . LYS D 1 82  ? -28.598 26.387  40.191  1.00 92.97  ? 62  LYS D CD  1 
ATOM   6921  C CE  . LYS D 1 82  ? -28.807 27.313  38.997  1.00 91.95  ? 62  LYS D CE  1 
ATOM   6922  N NZ  . LYS D 1 82  ? -27.736 28.339  38.864  1.00 90.49  ? 62  LYS D NZ  1 
ATOM   6923  N N   . VAL D 1 83  ? -28.525 23.519  43.380  1.00 103.51 ? 63  VAL D N   1 
ATOM   6924  C CA  . VAL D 1 83  ? -27.455 23.811  44.337  1.00 100.64 ? 63  VAL D CA  1 
ATOM   6925  C C   . VAL D 1 83  ? -26.944 22.526  44.993  1.00 99.68  ? 63  VAL D C   1 
ATOM   6926  O O   . VAL D 1 83  ? -25.783 22.472  45.401  1.00 93.46  ? 63  VAL D O   1 
ATOM   6927  C CB  . VAL D 1 83  ? -27.854 24.869  45.415  1.00 98.94  ? 63  VAL D CB  1 
ATOM   6928  C CG1 . VAL D 1 83  ? -28.796 25.925  44.839  1.00 96.18  ? 63  VAL D CG1 1 
ATOM   6929  C CG2 . VAL D 1 83  ? -28.459 24.227  46.663  1.00 96.95  ? 63  VAL D CG2 1 
ATOM   6930  N N   . GLU D 1 84  ? -27.807 21.509  45.091  1.00 99.00  ? 64  GLU D N   1 
ATOM   6931  C CA  . GLU D 1 84  ? -27.401 20.189  45.591  1.00 103.58 ? 64  GLU D CA  1 
ATOM   6932  C C   . GLU D 1 84  ? -26.393 19.515  44.634  1.00 102.59 ? 64  GLU D C   1 
ATOM   6933  O O   . GLU D 1 84  ? -25.459 18.833  45.074  1.00 93.70  ? 64  GLU D O   1 
ATOM   6934  C CB  . GLU D 1 84  ? -28.629 19.295  45.840  1.00 106.26 ? 64  GLU D CB  1 
ATOM   6935  C CG  . GLU D 1 84  ? -28.304 17.824  46.073  1.00 111.73 ? 64  GLU D CG  1 
ATOM   6936  C CD  . GLU D 1 84  ? -29.410 17.062  46.780  1.00 117.10 ? 64  GLU D CD  1 
ATOM   6937  O OE1 . GLU D 1 84  ? -30.599 17.413  46.607  1.00 121.81 ? 64  GLU D OE1 1 
ATOM   6938  O OE2 . GLU D 1 84  ? -29.080 16.100  47.508  1.00 115.92 ? 64  GLU D OE2 1 
ATOM   6939  N N   . ILE D 1 85  ? -26.583 19.725  43.332  1.00 100.05 ? 65  ILE D N   1 
ATOM   6940  C CA  . ILE D 1 85  ? -25.662 19.200  42.319  1.00 97.25  ? 65  ILE D CA  1 
ATOM   6941  C C   . ILE D 1 85  ? -24.276 19.849  42.424  1.00 93.88  ? 65  ILE D C   1 
ATOM   6942  O O   . ILE D 1 85  ? -23.275 19.138  42.513  1.00 91.75  ? 65  ILE D O   1 
ATOM   6943  C CB  . ILE D 1 85  ? -26.244 19.332  40.888  1.00 97.26  ? 65  ILE D CB  1 
ATOM   6944  C CG1 . ILE D 1 85  ? -27.246 18.192  40.639  1.00 96.73  ? 65  ILE D CG1 1 
ATOM   6945  C CG2 . ILE D 1 85  ? -25.140 19.305  39.835  1.00 96.24  ? 65  ILE D CG2 1 
ATOM   6946  C CD1 . ILE D 1 85  ? -28.072 18.328  39.374  1.00 91.14  ? 65  ILE D CD1 1 
ATOM   6947  N N   . LEU D 1 86  ? -24.219 21.181  42.447  1.00 92.04  ? 66  LEU D N   1 
ATOM   6948  C CA  . LEU D 1 86  ? -22.922 21.899  42.493  1.00 93.99  ? 66  LEU D CA  1 
ATOM   6949  C C   . LEU D 1 86  ? -22.145 21.614  43.789  1.00 96.76  ? 66  LEU D C   1 
ATOM   6950  O O   . LEU D 1 86  ? -20.934 21.837  43.849  1.00 95.72  ? 66  LEU D O   1 
ATOM   6951  C CB  . LEU D 1 86  ? -23.079 23.418  42.320  1.00 91.25  ? 66  LEU D CB  1 
ATOM   6952  C CG  . LEU D 1 86  ? -23.659 23.976  41.013  1.00 93.41  ? 66  LEU D CG  1 
ATOM   6953  C CD1 . LEU D 1 86  ? -25.177 23.971  41.030  1.00 91.91  ? 66  LEU D CD1 1 
ATOM   6954  C CD2 . LEU D 1 86  ? -23.175 25.395  40.750  1.00 93.27  ? 66  LEU D CD2 1 
ATOM   6955  N N   . THR D 1 87  ? -22.848 21.128  44.814  1.00 99.95  ? 67  THR D N   1 
ATOM   6956  C CA  . THR D 1 87  ? -22.233 20.669  46.072  1.00 103.87 ? 67  THR D CA  1 
ATOM   6957  C C   . THR D 1 87  ? -21.345 19.441  45.887  1.00 105.03 ? 67  THR D C   1 
ATOM   6958  O O   . THR D 1 87  ? -20.271 19.338  46.489  1.00 99.14  ? 67  THR D O   1 
ATOM   6959  C CB  . THR D 1 87  ? -23.304 20.260  47.107  1.00 102.68 ? 67  THR D CB  1 
ATOM   6960  O OG1 . THR D 1 87  ? -24.311 21.273  47.189  1.00 104.19 ? 67  THR D OG1 1 
ATOM   6961  C CG2 . THR D 1 87  ? -22.679 20.040  48.490  1.00 99.88  ? 67  THR D CG2 1 
ATOM   6962  N N   . ARG D 1 88  ? -21.827 18.497  45.083  1.00 105.26 ? 68  ARG D N   1 
ATOM   6963  C CA  . ARG D 1 88  ? -21.114 17.247  44.816  1.00 101.08 ? 68  ARG D CA  1 
ATOM   6964  C C   . ARG D 1 88  ? -19.902 17.445  43.910  1.00 97.24  ? 68  ARG D C   1 
ATOM   6965  O O   . ARG D 1 88  ? -18.987 16.621  43.893  1.00 95.91  ? 68  ARG D O   1 
ATOM   6966  C CB  . ARG D 1 88  ? -22.057 16.251  44.154  1.00 99.16  ? 68  ARG D CB  1 
ATOM   6967  C CG  . ARG D 1 88  ? -23.158 15.731  45.055  1.00 97.77  ? 68  ARG D CG  1 
ATOM   6968  C CD  . ARG D 1 88  ? -23.978 14.699  44.304  1.00 100.64 ? 68  ARG D CD  1 
ATOM   6969  N NE  . ARG D 1 88  ? -25.251 14.384  44.950  1.00 101.82 ? 68  ARG D NE  1 
ATOM   6970  C CZ  . ARG D 1 88  ? -26.438 14.908  44.630  1.00 102.71 ? 68  ARG D CZ  1 
ATOM   6971  N NH1 . ARG D 1 88  ? -26.568 15.817  43.660  1.00 100.75 ? 68  ARG D NH1 1 
ATOM   6972  N NH2 . ARG D 1 88  ? -27.517 14.516  45.302  1.00 103.62 ? 68  ARG D NH2 1 
ATOM   6973  N N   . ILE D 1 89  ? -19.917 18.534  43.150  1.00 94.37  ? 69  ILE D N   1 
ATOM   6974  C CA  . ILE D 1 89  ? -18.889 18.808  42.172  1.00 92.86  ? 69  ILE D CA  1 
ATOM   6975  C C   . ILE D 1 89  ? -17.896 19.786  42.758  1.00 93.09  ? 69  ILE D C   1 
ATOM   6976  O O   . ILE D 1 89  ? -18.185 20.982  42.877  1.00 92.59  ? 69  ILE D O   1 
ATOM   6977  C CB  . ILE D 1 89  ? -19.496 19.439  40.914  1.00 91.40  ? 69  ILE D CB  1 
ATOM   6978  C CG1 . ILE D 1 89  ? -20.346 18.415  40.177  1.00 89.84  ? 69  ILE D CG1 1 
ATOM   6979  C CG2 . ILE D 1 89  ? -18.409 19.962  39.985  1.00 89.56  ? 69  ILE D CG2 1 
ATOM   6980  C CD1 . ILE D 1 89  ? -21.439 19.062  39.366  1.00 89.61  ? 69  ILE D CD1 1 
ATOM   6981  N N   . SER D 1 90  ? -16.733 19.275  43.133  1.00 94.32  ? 70  SER D N   1 
ATOM   6982  C CA  . SER D 1 90  ? -15.667 20.109  43.666  1.00 92.82  ? 70  SER D CA  1 
ATOM   6983  C C   . SER D 1 90  ? -14.513 20.155  42.685  1.00 90.82  ? 70  SER D C   1 
ATOM   6984  O O   . SER D 1 90  ? -13.982 19.117  42.303  1.00 90.57  ? 70  SER D O   1 
ATOM   6985  C CB  . SER D 1 90  ? -15.190 19.562  45.007  1.00 92.97  ? 70  SER D CB  1 
ATOM   6986  O OG  . SER D 1 90  ? -15.692 18.256  45.230  1.00 96.52  ? 70  SER D OG  1 
ATOM   6987  N N   . GLY D 1 91  ? -14.118 21.365  42.302  1.00 87.59  ? 71  GLY D N   1 
ATOM   6988  C CA  . GLY D 1 91  ? -13.113 21.558  41.268  1.00 87.19  ? 71  GLY D CA  1 
ATOM   6989  C C   . GLY D 1 91  ? -11.763 21.909  41.846  1.00 88.70  ? 71  GLY D C   1 
ATOM   6990  O O   . GLY D 1 91  ? -11.677 22.621  42.838  1.00 93.67  ? 71  GLY D O   1 
ATOM   6991  N N   . THR D 1 92  ? -10.709 21.417  41.209  1.00 90.78  ? 72  THR D N   1 
ATOM   6992  C CA  . THR D 1 92  ? -9.352  21.584  41.708  1.00 88.22  ? 72  THR D CA  1 
ATOM   6993  C C   . THR D 1 92  ? -8.395  21.673  40.544  1.00 85.85  ? 72  THR D C   1 
ATOM   6994  O O   . THR D 1 92  ? -8.802  21.598  39.390  1.00 80.89  ? 72  THR D O   1 
ATOM   6995  C CB  . THR D 1 92  ? -8.949  20.372  42.574  1.00 90.62  ? 72  THR D CB  1 
ATOM   6996  O OG1 . THR D 1 92  ? -7.522  20.360  42.784  1.00 90.81  ? 72  THR D OG1 1 
ATOM   6997  C CG2 . THR D 1 92  ? -9.372  19.074  41.888  1.00 90.71  ? 72  THR D CG2 1 
ATOM   6998  N N   . VAL D 1 93  ? -7.119  21.833  40.852  1.00 88.74  ? 73  VAL D N   1 
ATOM   6999  C CA  . VAL D 1 93  ? -6.075  21.614  39.855  1.00 95.69  ? 73  VAL D CA  1 
ATOM   7000  C C   . VAL D 1 93  ? -5.109  20.560  40.383  1.00 100.52 ? 73  VAL D C   1 
ATOM   7001  O O   . VAL D 1 93  ? -4.044  20.304  39.801  1.00 105.04 ? 73  VAL D O   1 
ATOM   7002  C CB  . VAL D 1 93  ? -5.320  22.910  39.505  1.00 92.54  ? 73  VAL D CB  1 
ATOM   7003  C CG1 . VAL D 1 93  ? -5.997  24.108  40.147  1.00 91.51  ? 73  VAL D CG1 1 
ATOM   7004  C CG2 . VAL D 1 93  ? -3.868  22.838  39.950  1.00 89.99  ? 73  VAL D CG2 1 
ATOM   7005  N N   . ASP D 1 94  ? -5.503  19.919  41.472  1.00 104.15 ? 74  ASP D N   1 
ATOM   7006  C CA  . ASP D 1 94  ? -4.615  19.054  42.194  1.00 108.26 ? 74  ASP D CA  1 
ATOM   7007  C C   . ASP D 1 94  ? -4.828  17.649  41.680  1.00 105.72 ? 74  ASP D C   1 
ATOM   7008  O O   . ASP D 1 94  ? -5.681  16.923  42.186  1.00 103.05 ? 74  ASP D O   1 
ATOM   7009  C CB  . ASP D 1 94  ? -4.916  19.145  43.688  1.00 113.09 ? 74  ASP D CB  1 
ATOM   7010  C CG  . ASP D 1 94  ? -3.828  18.529  44.544  1.00 116.12 ? 74  ASP D CG  1 
ATOM   7011  O OD1 . ASP D 1 94  ? -4.139  18.089  45.675  1.00 119.38 ? 74  ASP D OD1 1 
ATOM   7012  O OD2 . ASP D 1 94  ? -2.661  18.489  44.093  1.00 112.72 ? 74  ASP D OD2 1 
ATOM   7013  N N   . LEU D 1 95  ? -4.059  17.271  40.662  1.00 106.16 ? 75  LEU D N   1 
ATOM   7014  C CA  . LEU D 1 95  ? -4.177  15.928  40.081  1.00 104.74 ? 75  LEU D CA  1 
ATOM   7015  C C   . LEU D 1 95  ? -4.236  14.895  41.186  1.00 104.44 ? 75  LEU D C   1 
ATOM   7016  O O   . LEU D 1 95  ? -4.959  13.895  41.100  1.00 107.83 ? 75  LEU D O   1 
ATOM   7017  C CB  . LEU D 1 95  ? -2.987  15.584  39.185  1.00 103.32 ? 75  LEU D CB  1 
ATOM   7018  C CG  . LEU D 1 95  ? -3.373  14.994  37.821  1.00 102.35 ? 75  LEU D CG  1 
ATOM   7019  C CD1 . LEU D 1 95  ? -2.156  14.349  37.180  1.00 100.26 ? 75  LEU D CD1 1 
ATOM   7020  C CD2 . LEU D 1 95  ? -4.517  13.989  37.917  1.00 101.92 ? 75  LEU D CD2 1 
ATOM   7021  N N   . ASN D 1 96  ? -3.452  15.158  42.225  1.00 100.86 ? 76  ASN D N   1 
ATOM   7022  C CA  . ASN D 1 96  ? -3.434  14.331  43.422  1.00 98.06  ? 76  ASN D CA  1 
ATOM   7023  C C   . ASN D 1 96  ? -4.812  14.101  44.070  1.00 93.60  ? 76  ASN D C   1 
ATOM   7024  O O   . ASN D 1 96  ? -4.984  13.138  44.818  1.00 89.63  ? 76  ASN D O   1 
ATOM   7025  C CB  . ASN D 1 96  ? -2.431  14.905  44.425  1.00 96.55  ? 76  ASN D CB  1 
ATOM   7026  C CG  . ASN D 1 96  ? -1.028  14.369  44.201  1.00 96.68  ? 76  ASN D CG  1 
ATOM   7027  O OD1 . ASN D 1 96  ? -0.772  13.181  44.411  1.00 97.19  ? 76  ASN D OD1 1 
ATOM   7028  N ND2 . ASN D 1 96  ? -0.117  15.232  43.768  1.00 90.90  ? 76  ASN D ND2 1 
ATOM   7029  N N   . MET D 1 97  ? -5.789  14.947  43.734  1.00 94.90  ? 77  MET D N   1 
ATOM   7030  C CA  . MET D 1 97  ? -7.162  14.851  44.256  1.00 100.23 ? 77  MET D CA  1 
ATOM   7031  C C   . MET D 1 97  ? -7.971  13.683  43.686  1.00 101.52 ? 77  MET D C   1 
ATOM   7032  O O   . MET D 1 97  ? -9.099  13.438  44.121  1.00 99.15  ? 77  MET D O   1 
ATOM   7033  C CB  . MET D 1 97  ? -7.932  16.156  43.988  1.00 105.05 ? 77  MET D CB  1 
ATOM   7034  C CG  . MET D 1 97  ? -7.517  17.327  44.869  1.00 109.21 ? 77  MET D CG  1 
ATOM   7035  S SD  . MET D 1 97  ? -8.312  17.330  46.492  1.00 109.15 ? 77  MET D SD  1 
ATOM   7036  C CE  . MET D 1 97  ? -7.150  16.362  47.463  1.00 103.90 ? 77  MET D CE  1 
ATOM   7037  N N   . ALA D 1 98  ? -7.396  12.977  42.713  1.00 103.52 ? 78  ALA D N   1 
ATOM   7038  C CA  . ALA D 1 98  ? -8.045  11.843  42.054  1.00 98.35  ? 78  ALA D CA  1 
ATOM   7039  C C   . ALA D 1 98  ? -7.819  10.529  42.799  1.00 92.55  ? 78  ALA D C   1 
ATOM   7040  O O   . ALA D 1 98  ? -8.641  9.605   42.714  1.00 79.42  ? 78  ALA D O   1 
ATOM   7041  C CB  . ALA D 1 98  ? -7.513  11.725  40.638  1.00 102.76 ? 78  ALA D CB  1 
ATOM   7042  N N   . ALA D 1 99  ? -6.705  10.479  43.535  1.00 90.77  ? 79  ALA D N   1 
ATOM   7043  C CA  . ALA D 1 99  ? -6.212  9.286   44.245  1.00 87.83  ? 79  ALA D CA  1 
ATOM   7044  C C   . ALA D 1 99  ? -7.282  8.383   44.863  1.00 89.31  ? 79  ALA D C   1 
ATOM   7045  O O   . ALA D 1 99  ? -7.132  7.165   44.864  1.00 79.60  ? 79  ALA D O   1 
ATOM   7046  C CB  . ALA D 1 99  ? -5.222  9.714   45.316  1.00 85.34  ? 79  ALA D CB  1 
ATOM   7047  N N   . ASP D 1 100 ? -8.344  8.990   45.388  1.00 95.19  ? 80  ASP D N   1 
ATOM   7048  C CA  . ASP D 1 100 ? -9.441  8.269   46.053  1.00 100.37 ? 80  ASP D CA  1 
ATOM   7049  C C   . ASP D 1 100 ? -10.416 7.569   45.100  1.00 99.41  ? 80  ASP D C   1 
ATOM   7050  O O   . ASP D 1 100 ? -10.997 6.518   45.435  1.00 85.14  ? 80  ASP D O   1 
ATOM   7051  C CB  . ASP D 1 100 ? -10.259 9.248   46.914  1.00 106.62 ? 80  ASP D CB  1 
ATOM   7052  C CG  . ASP D 1 100 ? -9.799  9.303   48.362  1.00 110.54 ? 80  ASP D CG  1 
ATOM   7053  O OD1 . ASP D 1 100 ? -8.576  9.294   48.619  1.00 114.44 ? 80  ASP D OD1 1 
ATOM   7054  O OD2 . ASP D 1 100 ? -10.676 9.373   49.251  1.00 111.68 ? 80  ASP D OD2 1 
ATOM   7055  N N   . CYS D 1 101 ? -10.608 8.177   43.930  1.00 100.39 ? 81  CYS D N   1 
ATOM   7056  C CA  . CYS D 1 101 ? -11.729 7.851   43.043  1.00 99.13  ? 81  CYS D CA  1 
ATOM   7057  C C   . CYS D 1 101 ? -11.800 6.385   42.638  1.00 95.92  ? 81  CYS D C   1 
ATOM   7058  O O   . CYS D 1 101 ? -10.810 5.683   42.666  1.00 93.93  ? 81  CYS D O   1 
ATOM   7059  C CB  . CYS D 1 101 ? -11.686 8.736   41.801  1.00 99.65  ? 81  CYS D CB  1 
ATOM   7060  S SG  . CYS D 1 101 ? -12.194 10.443  42.111  1.00 101.21 ? 81  CYS D SG  1 
ATOM   7061  N N   . ASP D 1 102 ? -12.995 5.930   42.290  1.00 94.90  ? 82  ASP D N   1 
ATOM   7062  C CA  . ASP D 1 102 ? -13.186 4.572   41.775  1.00 97.65  ? 82  ASP D CA  1 
ATOM   7063  C C   . ASP D 1 102 ? -13.122 4.540   40.255  1.00 94.38  ? 82  ASP D C   1 
ATOM   7064  O O   . ASP D 1 102 ? -12.944 3.481   39.654  1.00 89.03  ? 82  ASP D O   1 
ATOM   7065  C CB  . ASP D 1 102 ? -14.535 4.045   42.228  1.00 101.25 ? 82  ASP D CB  1 
ATOM   7066  C CG  . ASP D 1 102 ? -14.745 4.224   43.708  1.00 104.04 ? 82  ASP D CG  1 
ATOM   7067  O OD1 . ASP D 1 102 ? -13.907 3.705   44.480  1.00 100.74 ? 82  ASP D OD1 1 
ATOM   7068  O OD2 . ASP D 1 102 ? -15.731 4.894   44.092  1.00 103.04 ? 82  ASP D OD2 1 
ATOM   7069  N N   . LEU D 1 103 ? -13.290 5.712   39.650  1.00 92.63  ? 83  LEU D N   1 
ATOM   7070  C CA  . LEU D 1 103 ? -13.292 5.873   38.206  1.00 86.47  ? 83  LEU D CA  1 
ATOM   7071  C C   . LEU D 1 103 ? -12.799 7.265   37.810  1.00 85.58  ? 83  LEU D C   1 
ATOM   7072  O O   . LEU D 1 103 ? -13.236 8.265   38.373  1.00 83.49  ? 83  LEU D O   1 
ATOM   7073  C CB  . LEU D 1 103 ? -14.705 5.668   37.661  1.00 86.53  ? 83  LEU D CB  1 
ATOM   7074  C CG  . LEU D 1 103 ? -14.875 6.100   36.195  1.00 90.00  ? 83  LEU D CG  1 
ATOM   7075  C CD1 . LEU D 1 103 ? -14.092 5.173   35.276  1.00 92.01  ? 83  LEU D CD1 1 
ATOM   7076  C CD2 . LEU D 1 103 ? -16.335 6.160   35.775  1.00 86.09  ? 83  LEU D CD2 1 
ATOM   7077  N N   . VAL D 1 104 ? -11.912 7.320   36.818  1.00 84.96  ? 84  VAL D N   1 
ATOM   7078  C CA  . VAL D 1 104 ? -11.376 8.587   36.312  1.00 81.61  ? 84  VAL D CA  1 
ATOM   7079  C C   . VAL D 1 104 ? -11.584 8.715   34.817  1.00 82.00  ? 84  VAL D C   1 
ATOM   7080  O O   . VAL D 1 104 ? -11.430 7.745   34.081  1.00 87.57  ? 84  VAL D O   1 
ATOM   7081  C CB  . VAL D 1 104 ? -9.868  8.681   36.526  1.00 80.35  ? 84  VAL D CB  1 
ATOM   7082  C CG1 . VAL D 1 104 ? -9.365  10.073  36.164  1.00 77.72  ? 84  VAL D CG1 1 
ATOM   7083  C CG2 . VAL D 1 104 ? -9.521  8.335   37.962  1.00 85.62  ? 84  VAL D CG2 1 
ATOM   7084  N N   . ILE D 1 105 ? -11.878 9.931   34.372  1.00 76.76  ? 85  ILE D N   1 
ATOM   7085  C CA  . ILE D 1 105 ? -12.175 10.192  32.971  1.00 69.47  ? 85  ILE D CA  1 
ATOM   7086  C C   . ILE D 1 105 ? -11.460 11.403  32.422  1.00 69.44  ? 85  ILE D C   1 
ATOM   7087  O O   . ILE D 1 105 ? -11.751 12.527  32.821  1.00 68.12  ? 85  ILE D O   1 
ATOM   7088  C CB  . ILE D 1 105 ? -13.656 10.486  32.759  1.00 67.11  ? 85  ILE D CB  1 
ATOM   7089  C CG1 . ILE D 1 105 ? -14.497 9.405   33.432  1.00 65.99  ? 85  ILE D CG1 1 
ATOM   7090  C CG2 . ILE D 1 105 ? -13.927 10.610  31.263  1.00 65.63  ? 85  ILE D CG2 1 
ATOM   7091  C CD1 . ILE D 1 105 ? -15.982 9.580   33.219  1.00 66.77  ? 85  ILE D CD1 1 
ATOM   7092  N N   . GLU D 1 106 ? -10.577 11.175  31.460  1.00 70.32  ? 86  GLU D N   1 
ATOM   7093  C CA  . GLU D 1 106 ? -9.859  12.257  30.833  1.00 74.84  ? 86  GLU D CA  1 
ATOM   7094  C C   . GLU D 1 106 ? -10.654 12.804  29.648  1.00 76.77  ? 86  GLU D C   1 
ATOM   7095  O O   . GLU D 1 106 ? -11.124 12.049  28.791  1.00 81.17  ? 86  GLU D O   1 
ATOM   7096  C CB  . GLU D 1 106 ? -8.479  11.781  30.411  1.00 80.35  ? 86  GLU D CB  1 
ATOM   7097  C CG  . GLU D 1 106 ? -7.545  12.911  30.033  1.00 86.74  ? 86  GLU D CG  1 
ATOM   7098  C CD  . GLU D 1 106 ? -7.633  13.232  28.567  1.00 94.81  ? 86  GLU D CD  1 
ATOM   7099  O OE1 . GLU D 1 106 ? -8.047  12.319  27.814  1.00 99.26  ? 86  GLU D OE1 1 
ATOM   7100  O OE2 . GLU D 1 106 ? -7.290  14.370  28.155  1.00 103.74 ? 86  GLU D OE2 1 
ATOM   7101  N N   . ALA D 1 107 ? -10.825 14.120  29.639  1.00 76.97  ? 87  ALA D N   1 
ATOM   7102  C CA  . ALA D 1 107 ? -11.500 14.825  28.554  1.00 75.72  ? 87  ALA D CA  1 
ATOM   7103  C C   . ALA D 1 107 ? -10.666 16.019  28.104  1.00 76.24  ? 87  ALA D C   1 
ATOM   7104  O O   . ALA D 1 107 ? -11.191 16.976  27.542  1.00 72.56  ? 87  ALA D O   1 
ATOM   7105  C CB  . ALA D 1 107 ? -12.870 15.286  29.006  1.00 76.07  ? 87  ALA D CB  1 
ATOM   7106  N N   . ALA D 1 108 ? -9.361  15.955  28.348  1.00 85.94  ? 88  ALA D N   1 
ATOM   7107  C CA  . ALA D 1 108 ? -8.453  17.012  27.917  1.00 94.76  ? 88  ALA D CA  1 
ATOM   7108  C C   . ALA D 1 108 ? -8.237  16.926  26.410  1.00 101.82 ? 88  ALA D C   1 
ATOM   7109  O O   . ALA D 1 108 ? -8.957  16.218  25.696  1.00 97.16  ? 88  ALA D O   1 
ATOM   7110  C CB  . ALA D 1 108 ? -7.122  16.951  28.674  1.00 95.13  ? 88  ALA D CB  1 
ATOM   7111  N N   . VAL D 1 109 ? -7.244  17.666  25.940  1.00 107.35 ? 89  VAL D N   1 
ATOM   7112  C CA  . VAL D 1 109 ? -7.066  17.885  24.516  1.00 109.58 ? 89  VAL D CA  1 
ATOM   7113  C C   . VAL D 1 109 ? -6.443  16.683  23.819  1.00 104.52 ? 89  VAL D C   1 
ATOM   7114  O O   . VAL D 1 109 ? -5.720  15.889  24.432  1.00 100.06 ? 89  VAL D O   1 
ATOM   7115  C CB  . VAL D 1 109 ? -6.266  19.175  24.234  1.00 113.87 ? 89  VAL D CB  1 
ATOM   7116  C CG1 . VAL D 1 109 ? -7.069  20.387  24.704  1.00 112.83 ? 89  VAL D CG1 1 
ATOM   7117  C CG2 . VAL D 1 109 ? -4.876  19.132  24.878  1.00 114.68 ? 89  VAL D CG2 1 
ATOM   7118  N N   . GLU D 1 110 ? -6.741  16.586  22.524  1.00 99.72  ? 90  GLU D N   1 
ATOM   7119  C CA  . GLU D 1 110 ? -6.387  15.437  21.687  1.00 97.00  ? 90  GLU D CA  1 
ATOM   7120  C C   . GLU D 1 110 ? -4.934  15.467  21.221  1.00 91.48  ? 90  GLU D C   1 
ATOM   7121  O O   . GLU D 1 110 ? -4.657  15.469  20.020  1.00 82.91  ? 90  GLU D O   1 
ATOM   7122  C CB  . GLU D 1 110 ? -7.306  15.364  20.453  1.00 96.88  ? 90  GLU D CB  1 
ATOM   7123  C CG  . GLU D 1 110 ? -8.795  15.218  20.749  1.00 98.87  ? 90  GLU D CG  1 
ATOM   7124  C CD  . GLU D 1 110 ? -9.229  13.772  20.937  1.00 95.50  ? 90  GLU D CD  1 
ATOM   7125  O OE1 . GLU D 1 110 ? -10.196 13.342  20.272  1.00 96.43  ? 90  GLU D OE1 1 
ATOM   7126  O OE2 . GLU D 1 110 ? -8.600  13.063  21.747  1.00 90.31  ? 90  GLU D OE2 1 
ATOM   7127  N N   . ARG D 1 111 ? -4.012  15.488  22.173  1.00 89.63  ? 91  ARG D N   1 
ATOM   7128  C CA  . ARG D 1 111 ? -2.608  15.292  21.872  1.00 91.43  ? 91  ARG D CA  1 
ATOM   7129  C C   . ARG D 1 111 ? -2.167  14.056  22.634  1.00 86.95  ? 91  ARG D C   1 
ATOM   7130  O O   . ARG D 1 111 ? -2.409  13.955  23.836  1.00 89.97  ? 91  ARG D O   1 
ATOM   7131  C CB  . ARG D 1 111 ? -1.797  16.509  22.291  1.00 97.18  ? 91  ARG D CB  1 
ATOM   7132  C CG  . ARG D 1 111 ? -0.556  16.731  21.436  1.00 103.62 ? 91  ARG D CG  1 
ATOM   7133  C CD  . ARG D 1 111 ? 0.276   17.884  21.974  1.00 111.05 ? 91  ARG D CD  1 
ATOM   7134  N NE  . ARG D 1 111 ? -0.497  19.126  21.946  1.00 117.56 ? 91  ARG D NE  1 
ATOM   7135  C CZ  . ARG D 1 111 ? -0.048  20.322  22.322  1.00 119.51 ? 91  ARG D CZ  1 
ATOM   7136  N NH1 . ARG D 1 111 ? 1.193   20.476  22.772  1.00 120.27 ? 91  ARG D NH1 1 
ATOM   7137  N NH2 . ARG D 1 111 ? -0.854  21.376  22.246  1.00 118.28 ? 91  ARG D NH2 1 
ATOM   7138  N N   . MET D 1 112 ? -1.536  13.113  21.939  1.00 79.53  ? 92  MET D N   1 
ATOM   7139  C CA  . MET D 1 112 ? -1.204  11.815  22.537  1.00 74.61  ? 92  MET D CA  1 
ATOM   7140  C C   . MET D 1 112 ? -0.027  11.883  23.509  1.00 77.84  ? 92  MET D C   1 
ATOM   7141  O O   . MET D 1 112 ? -0.087  11.292  24.591  1.00 76.57  ? 92  MET D O   1 
ATOM   7142  C CB  . MET D 1 112 ? -0.929  10.766  21.457  1.00 69.89  ? 92  MET D CB  1 
ATOM   7143  C CG  . MET D 1 112 ? -0.326  9.450   21.966  1.00 70.79  ? 92  MET D CG  1 
ATOM   7144  S SD  . MET D 1 112 ? -1.427  8.254   22.783  1.00 70.25  ? 92  MET D SD  1 
ATOM   7145  C CE  . MET D 1 112 ? -2.636  7.965   21.491  1.00 76.40  ? 92  MET D CE  1 
ATOM   7146  N N   . ASP D 1 113 ? 1.047   12.568  23.124  1.00 82.27  ? 93  ASP D N   1 
ATOM   7147  C CA  . ASP D 1 113 ? 2.164   12.819  24.051  1.00 84.65  ? 93  ASP D CA  1 
ATOM   7148  C C   . ASP D 1 113 ? 1.640   13.261  25.429  1.00 83.34  ? 93  ASP D C   1 
ATOM   7149  O O   . ASP D 1 113 ? 2.168   12.869  26.467  1.00 79.43  ? 93  ASP D O   1 
ATOM   7150  C CB  . ASP D 1 113 ? 3.080   13.904  23.494  1.00 89.01  ? 93  ASP D CB  1 
ATOM   7151  C CG  . ASP D 1 113 ? 2.314   15.150  23.087  1.00 96.99  ? 93  ASP D CG  1 
ATOM   7152  O OD1 . ASP D 1 113 ? 1.076   15.043  22.966  1.00 104.89 ? 93  ASP D OD1 1 
ATOM   7153  O OD2 . ASP D 1 113 ? 2.930   16.220  22.890  1.00 98.56  ? 93  ASP D OD2 1 
ATOM   7154  N N   . ILE D 1 114 ? 0.587   14.073  25.418  1.00 82.70  ? 94  ILE D N   1 
ATOM   7155  C CA  . ILE D 1 114 ? 0.011   14.612  26.643  1.00 82.26  ? 94  ILE D CA  1 
ATOM   7156  C C   . ILE D 1 114 ? -0.882  13.607  27.351  1.00 79.99  ? 94  ILE D C   1 
ATOM   7157  O O   . ILE D 1 114 ? -0.786  13.445  28.567  1.00 76.51  ? 94  ILE D O   1 
ATOM   7158  C CB  . ILE D 1 114 ? -0.784  15.905  26.362  1.00 85.16  ? 94  ILE D CB  1 
ATOM   7159  C CG1 . ILE D 1 114 ? 0.146   17.116  26.473  1.00 87.34  ? 94  ILE D CG1 1 
ATOM   7160  C CG2 . ILE D 1 114 ? -1.958  16.065  27.324  1.00 86.08  ? 94  ILE D CG2 1 
ATOM   7161  C CD1 . ILE D 1 114 ? -0.333  18.320  25.687  1.00 88.51  ? 94  ILE D CD1 1 
ATOM   7162  N N   . LYS D 1 115 ? -1.757  12.941  26.604  1.00 77.11  ? 95  LYS D N   1 
ATOM   7163  C CA  . LYS D 1 115 ? -2.660  11.961  27.214  1.00 78.25  ? 95  LYS D CA  1 
ATOM   7164  C C   . LYS D 1 115 ? -1.918  10.831  27.941  1.00 78.49  ? 95  LYS D C   1 
ATOM   7165  O O   . LYS D 1 115 ? -2.433  10.259  28.905  1.00 73.02  ? 95  LYS D O   1 
ATOM   7166  C CB  . LYS D 1 115 ? -3.619  11.373  26.182  1.00 77.80  ? 95  LYS D CB  1 
ATOM   7167  C CG  . LYS D 1 115 ? -5.007  11.958  26.293  1.00 81.51  ? 95  LYS D CG  1 
ATOM   7168  C CD  . LYS D 1 115 ? -5.908  11.421  25.201  1.00 82.95  ? 95  LYS D CD  1 
ATOM   7169  C CE  . LYS D 1 115 ? -6.935  12.456  24.775  1.00 84.23  ? 95  LYS D CE  1 
ATOM   7170  N NZ  . LYS D 1 115 ? -8.023  12.575  25.769  1.00 87.00  ? 95  LYS D NZ  1 
ATOM   7171  N N   . LYS D 1 116 ? -0.716  10.522  27.471  1.00 75.69  ? 96  LYS D N   1 
ATOM   7172  C CA  . LYS D 1 116 ? 0.095   9.473   28.069  1.00 79.82  ? 96  LYS D CA  1 
ATOM   7173  C C   . LYS D 1 116 ? 0.651   9.917   29.410  1.00 82.62  ? 96  LYS D C   1 
ATOM   7174  O O   . LYS D 1 116 ? 0.600   9.161   30.387  1.00 80.02  ? 96  LYS D O   1 
ATOM   7175  C CB  . LYS D 1 116 ? 1.233   9.068   27.128  1.00 80.54  ? 96  LYS D CB  1 
ATOM   7176  C CG  . LYS D 1 116 ? 0.904   7.849   26.274  1.00 79.99  ? 96  LYS D CG  1 
ATOM   7177  C CD  . LYS D 1 116 ? 1.239   8.054   24.807  1.00 80.15  ? 96  LYS D CD  1 
ATOM   7178  C CE  . LYS D 1 116 ? 2.661   7.664   24.442  1.00 79.15  ? 96  LYS D CE  1 
ATOM   7179  N NZ  . LYS D 1 116 ? 2.662   6.336   23.773  1.00 79.31  ? 96  LYS D NZ  1 
ATOM   7180  N N   . GLN D 1 117 ? 1.185   11.135  29.461  1.00 85.81  ? 97  GLN D N   1 
ATOM   7181  C CA  . GLN D 1 117 ? 1.636   11.696  30.733  1.00 87.00  ? 97  GLN D CA  1 
ATOM   7182  C C   . GLN D 1 117 ? 0.466   11.830  31.714  1.00 85.74  ? 97  GLN D C   1 
ATOM   7183  O O   . GLN D 1 117 ? 0.533   11.329  32.841  1.00 81.53  ? 97  GLN D O   1 
ATOM   7184  C CB  . GLN D 1 117 ? 2.328   13.040  30.537  1.00 87.33  ? 97  GLN D CB  1 
ATOM   7185  C CG  . GLN D 1 117 ? 3.101   13.493  31.769  1.00 91.61  ? 97  GLN D CG  1 
ATOM   7186  C CD  . GLN D 1 117 ? 4.163   12.488  32.205  1.00 92.04  ? 97  GLN D CD  1 
ATOM   7187  O OE1 . GLN D 1 117 ? 4.056   11.868  33.258  1.00 94.86  ? 97  GLN D OE1 1 
ATOM   7188  N NE2 . GLN D 1 117 ? 5.187   12.315  31.383  1.00 87.55  ? 97  GLN D NE2 1 
ATOM   7189  N N   . ILE D 1 118 ? -0.619  12.459  31.276  1.00 82.10  ? 98  ILE D N   1 
ATOM   7190  C CA  . ILE D 1 118 ? -1.820  12.514  32.114  1.00 77.46  ? 98  ILE D CA  1 
ATOM   7191  C C   . ILE D 1 118 ? -2.084  11.142  32.729  1.00 73.72  ? 98  ILE D C   1 
ATOM   7192  O O   . ILE D 1 118 ? -2.458  11.029  33.894  1.00 82.54  ? 98  ILE D O   1 
ATOM   7193  C CB  . ILE D 1 118 ? -3.100  12.869  31.336  1.00 79.95  ? 98  ILE D CB  1 
ATOM   7194  C CG1 . ILE D 1 118 ? -2.931  14.158  30.514  1.00 83.23  ? 98  ILE D CG1 1 
ATOM   7195  C CG2 . ILE D 1 118 ? -4.266  12.991  32.312  1.00 78.64  ? 98  ILE D CG2 1 
ATOM   7196  C CD1 . ILE D 1 118 ? -3.501  15.412  31.140  1.00 85.85  ? 98  ILE D CD1 1 
ATOM   7197  N N   . PHE D 1 119 ? -1.892  10.102  31.929  1.00 69.74  ? 99  PHE D N   1 
ATOM   7198  C CA  . PHE D 1 119 ? -2.330  8.762   32.284  1.00 66.93  ? 99  PHE D CA  1 
ATOM   7199  C C   . PHE D 1 119 ? -1.300  7.991   33.097  1.00 71.20  ? 99  PHE D C   1 
ATOM   7200  O O   . PHE D 1 119 ? -1.666  7.182   33.953  1.00 74.42  ? 99  PHE D O   1 
ATOM   7201  C CB  . PHE D 1 119 ? -2.691  7.966   31.020  1.00 62.71  ? 99  PHE D CB  1 
ATOM   7202  C CG  . PHE D 1 119 ? -4.167  7.880   30.760  1.00 56.34  ? 99  PHE D CG  1 
ATOM   7203  C CD1 . PHE D 1 119 ? -4.869  8.954   30.207  1.00 55.59  ? 99  PHE D CD1 1 
ATOM   7204  C CD2 . PHE D 1 119 ? -4.861  6.723   31.067  1.00 53.92  ? 99  PHE D CD2 1 
ATOM   7205  C CE1 . PHE D 1 119 ? -6.237  8.870   29.974  1.00 52.39  ? 99  PHE D CE1 1 
ATOM   7206  C CE2 . PHE D 1 119 ? -6.232  6.631   30.838  1.00 54.52  ? 99  PHE D CE2 1 
ATOM   7207  C CZ  . PHE D 1 119 ? -6.920  7.706   30.293  1.00 51.77  ? 99  PHE D CZ  1 
ATOM   7208  N N   . ALA D 1 120 ? -0.022  8.210   32.796  1.00 75.17  ? 100 ALA D N   1 
ATOM   7209  C CA  . ALA D 1 120 ? 1.075   7.619   33.571  1.00 79.16  ? 100 ALA D CA  1 
ATOM   7210  C C   . ALA D 1 120 ? 0.988   8.056   35.025  1.00 81.41  ? 100 ALA D C   1 
ATOM   7211  O O   . ALA D 1 120 ? 0.948   7.234   35.938  1.00 81.21  ? 100 ALA D O   1 
ATOM   7212  C CB  . ALA D 1 120 ? 2.422   8.037   32.997  1.00 77.99  ? 100 ALA D CB  1 
ATOM   7213  N N   . ASP D 1 121 ? 0.946   9.366   35.228  1.00 81.04  ? 101 ASP D N   1 
ATOM   7214  C CA  . ASP D 1 121 ? 0.925   9.922   36.573  1.00 81.57  ? 101 ASP D CA  1 
ATOM   7215  C C   . ASP D 1 121 ? -0.222  9.358   37.350  1.00 83.85  ? 101 ASP D C   1 
ATOM   7216  O O   . ASP D 1 121 ? -0.036  8.796   38.432  1.00 88.83  ? 101 ASP D O   1 
ATOM   7217  C CB  . ASP D 1 121 ? 0.820   11.433  36.520  1.00 81.92  ? 101 ASP D CB  1 
ATOM   7218  C CG  . ASP D 1 121 ? 1.932   12.037  35.722  1.00 82.73  ? 101 ASP D CG  1 
ATOM   7219  O OD1 . ASP D 1 121 ? 1.898   13.253  35.446  1.00 84.08  ? 101 ASP D OD1 1 
ATOM   7220  O OD2 . ASP D 1 121 ? 2.844   11.268  35.353  1.00 84.09  ? 101 ASP D OD2 1 
ATOM   7221  N N   . LEU D 1 122 ? -1.405  9.476   36.776  1.00 82.31  ? 102 LEU D N   1 
ATOM   7222  C CA  . LEU D 1 122 ? -2.578  8.903   37.375  1.00 87.75  ? 102 LEU D CA  1 
ATOM   7223  C C   . LEU D 1 122 ? -2.378  7.417   37.752  1.00 87.32  ? 102 LEU D C   1 
ATOM   7224  O O   . LEU D 1 122 ? -2.994  6.908   38.699  1.00 81.61  ? 102 LEU D O   1 
ATOM   7225  C CB  . LEU D 1 122 ? -3.717  9.055   36.394  1.00 96.95  ? 102 LEU D CB  1 
ATOM   7226  C CG  . LEU D 1 122 ? -5.035  8.555   36.924  1.00 109.56 ? 102 LEU D CG  1 
ATOM   7227  C CD1 . LEU D 1 122 ? -5.490  9.306   38.157  1.00 113.42 ? 102 LEU D CD1 1 
ATOM   7228  C CD2 . LEU D 1 122 ? -6.030  8.756   35.810  1.00 111.20 ? 102 LEU D CD2 1 
ATOM   7229  N N   . ASP D 1 123 ? -1.514  6.735   37.004  1.00 86.10  ? 103 ASP D N   1 
ATOM   7230  C CA  . ASP D 1 123 ? -1.202  5.332   37.258  1.00 86.97  ? 103 ASP D CA  1 
ATOM   7231  C C   . ASP D 1 123 ? -0.514  5.140   38.611  1.00 89.47  ? 103 ASP D C   1 
ATOM   7232  O O   . ASP D 1 123 ? -0.781  4.163   39.315  1.00 89.58  ? 103 ASP D O   1 
ATOM   7233  C CB  . ASP D 1 123 ? -0.303  4.765   36.154  1.00 84.39  ? 103 ASP D CB  1 
ATOM   7234  C CG  . ASP D 1 123 ? 0.014   3.300   36.360  1.00 80.52  ? 103 ASP D CG  1 
ATOM   7235  O OD1 . ASP D 1 123 ? -0.902  2.548   36.775  1.00 68.70  ? 103 ASP D OD1 1 
ATOM   7236  O OD2 . ASP D 1 123 ? 1.181   2.909   36.106  1.00 76.95  ? 103 ASP D OD2 1 
ATOM   7237  N N   . ASN D 1 124 ? 0.387   6.058   38.947  1.00 87.65  ? 104 ASN D N   1 
ATOM   7238  C CA  . ASN D 1 124 ? 1.039   6.073   40.260  1.00 92.01  ? 104 ASN D CA  1 
ATOM   7239  C C   . ASN D 1 124 ? 0.106   6.611   41.352  1.00 92.44  ? 104 ASN D C   1 
ATOM   7240  O O   . ASN D 1 124 ? 0.009   6.030   42.432  1.00 91.18  ? 104 ASN D O   1 
ATOM   7241  C CB  . ASN D 1 124 ? 2.315   6.922   40.205  1.00 91.31  ? 104 ASN D CB  1 
ATOM   7242  C CG  . ASN D 1 124 ? 3.316   6.410   39.179  1.00 88.74  ? 104 ASN D CG  1 
ATOM   7243  O OD1 . ASN D 1 124 ? 3.387   5.211   38.900  1.00 83.79  ? 104 ASN D OD1 1 
ATOM   7244  N ND2 . ASN D 1 124 ? 4.100   7.321   38.617  1.00 83.83  ? 104 ASN D ND2 1 
ATOM   7245  N N   . ILE D 1 125 ? -0.596  7.700   41.040  1.00 90.38  ? 105 ILE D N   1 
ATOM   7246  C CA  . ILE D 1 125 ? -1.389  8.457   42.018  1.00 86.39  ? 105 ILE D CA  1 
ATOM   7247  C C   . ILE D 1 125 ? -2.611  7.740   42.580  1.00 88.95  ? 105 ILE D C   1 
ATOM   7248  O O   . ILE D 1 125 ? -3.151  8.157   43.608  1.00 91.30  ? 105 ILE D O   1 
ATOM   7249  C CB  . ILE D 1 125 ? -1.880  9.784   41.398  1.00 85.33  ? 105 ILE D CB  1 
ATOM   7250  C CG1 . ILE D 1 125 ? -0.693  10.728  41.182  1.00 86.93  ? 105 ILE D CG1 1 
ATOM   7251  C CG2 . ILE D 1 125 ? -2.944  10.458  42.264  1.00 84.18  ? 105 ILE D CG2 1 
ATOM   7252  C CD1 . ILE D 1 125 ? -1.081  12.128  40.741  1.00 86.06  ? 105 ILE D CD1 1 
ATOM   7253  N N   . CYS D 1 126 ? -3.047  6.662   41.943  1.00 90.53  ? 106 CYS D N   1 
ATOM   7254  C CA  . CYS D 1 126 ? -4.320  6.098   42.322  1.00 90.56  ? 106 CYS D CA  1 
ATOM   7255  C C   . CYS D 1 126 ? -4.208  4.715   42.874  1.00 88.51  ? 106 CYS D C   1 
ATOM   7256  O O   . CYS D 1 126 ? -3.194  4.036   42.774  1.00 79.82  ? 106 CYS D O   1 
ATOM   7257  C CB  . CYS D 1 126 ? -5.296  6.109   41.150  1.00 94.30  ? 106 CYS D CB  1 
ATOM   7258  S SG  . CYS D 1 126 ? -5.600  7.772   40.540  1.00 99.72  ? 106 CYS D SG  1 
ATOM   7259  N N   . LYS D 1 127 ? -5.322  4.327   43.452  1.00 96.04  ? 107 LYS D N   1 
ATOM   7260  C CA  . LYS D 1 127 ? -5.480  3.068   44.118  1.00 98.50  ? 107 LYS D CA  1 
ATOM   7261  C C   . LYS D 1 127 ? -5.693  1.976   43.089  1.00 101.46 ? 107 LYS D C   1 
ATOM   7262  O O   . LYS D 1 127 ? -6.504  2.125   42.182  1.00 103.18 ? 107 LYS D O   1 
ATOM   7263  C CB  . LYS D 1 127 ? -6.683  3.122   45.049  1.00 97.44  ? 107 LYS D CB  1 
ATOM   7264  C CG  . LYS D 1 127 ? -7.492  4.414   44.968  1.00 97.92  ? 107 LYS D CG  1 
ATOM   7265  C CD  . LYS D 1 127 ? -8.988  4.214   44.975  1.00 99.24  ? 107 LYS D CD  1 
ATOM   7266  C CE  . LYS D 1 127 ? -9.391  2.843   45.471  1.00 100.45 ? 107 LYS D CE  1 
ATOM   7267  N NZ  . LYS D 1 127 ? -10.785 2.858   45.967  1.00 99.57  ? 107 LYS D NZ  1 
ATOM   7268  N N   . PRO D 1 128 ? -4.992  0.854   43.244  1.00 105.95 ? 108 PRO D N   1 
ATOM   7269  C CA  . PRO D 1 128 ? -5.095  -0.287  42.342  1.00 105.71 ? 108 PRO D CA  1 
ATOM   7270  C C   . PRO D 1 128 ? -6.460  -0.457  41.663  1.00 102.58 ? 108 PRO D C   1 
ATOM   7271  O O   . PRO D 1 128 ? -6.516  -0.734  40.465  1.00 105.12 ? 108 PRO D O   1 
ATOM   7272  C CB  . PRO D 1 128 ? -4.823  -1.465  43.272  1.00 106.07 ? 108 PRO D CB  1 
ATOM   7273  C CG  . PRO D 1 128 ? -3.863  -0.921  44.273  1.00 107.47 ? 108 PRO D CG  1 
ATOM   7274  C CD  . PRO D 1 128 ? -4.168  0.542   44.425  1.00 108.11 ? 108 PRO D CD  1 
ATOM   7275  N N   . GLU D 1 129 ? -7.537  -0.289  42.424  1.00 98.32  ? 109 GLU D N   1 
ATOM   7276  C CA  . GLU D 1 129 ? -8.890  -0.507  41.909  1.00 97.68  ? 109 GLU D CA  1 
ATOM   7277  C C   . GLU D 1 129 ? -9.373  0.578   40.920  1.00 92.70  ? 109 GLU D C   1 
ATOM   7278  O O   . GLU D 1 129 ? -10.255 0.319   40.106  1.00 83.96  ? 109 GLU D O   1 
ATOM   7279  C CB  . GLU D 1 129 ? -9.882  -0.648  43.072  1.00 101.61 ? 109 GLU D CB  1 
ATOM   7280  C CG  . GLU D 1 129 ? -11.050 -1.578  42.765  1.00 105.33 ? 109 GLU D CG  1 
ATOM   7281  C CD  . GLU D 1 129 ? -12.299 -1.274  43.583  1.00 111.77 ? 109 GLU D CD  1 
ATOM   7282  O OE1 . GLU D 1 129 ? -12.180 -0.704  44.691  1.00 117.14 ? 109 GLU D OE1 1 
ATOM   7283  O OE2 . GLU D 1 129 ? -13.409 -1.614  43.114  1.00 109.44 ? 109 GLU D OE2 1 
ATOM   7284  N N   . THR D 1 130 ? -8.800  1.777   40.988  1.00 91.81  ? 110 THR D N   1 
ATOM   7285  C CA  . THR D 1 130 ? -9.194  2.892   40.113  1.00 92.74  ? 110 THR D CA  1 
ATOM   7286  C C   . THR D 1 130 ? -9.066  2.601   38.631  1.00 89.95  ? 110 THR D C   1 
ATOM   7287  O O   . THR D 1 130 ? -7.984  2.269   38.137  1.00 91.59  ? 110 THR D O   1 
ATOM   7288  C CB  . THR D 1 130 ? -8.326  4.138   40.347  1.00 98.73  ? 110 THR D CB  1 
ATOM   7289  O OG1 . THR D 1 130 ? -7.157  3.769   41.077  1.00 104.99 ? 110 THR D OG1 1 
ATOM   7290  C CG2 . THR D 1 130 ? -9.066  5.151   41.117  1.00 101.18 ? 110 THR D CG2 1 
ATOM   7291  N N   . ILE D 1 131 ? -10.176 2.786   37.928  1.00 82.81  ? 111 ILE D N   1 
ATOM   7292  C CA  . ILE D 1 131 ? -10.246 2.554   36.497  1.00 77.29  ? 111 ILE D CA  1 
ATOM   7293  C C   . ILE D 1 131 ? -10.139 3.864   35.749  1.00 80.13  ? 111 ILE D C   1 
ATOM   7294  O O   . ILE D 1 131 ? -10.844 4.820   36.053  1.00 79.49  ? 111 ILE D O   1 
ATOM   7295  C CB  . ILE D 1 131 ? -11.580 1.928   36.102  1.00 72.04  ? 111 ILE D CB  1 
ATOM   7296  C CG1 . ILE D 1 131 ? -11.712 0.559   36.746  1.00 68.48  ? 111 ILE D CG1 1 
ATOM   7297  C CG2 . ILE D 1 131 ? -11.670 1.806   34.590  1.00 71.46  ? 111 ILE D CG2 1 
ATOM   7298  C CD1 . ILE D 1 131 ? -12.958 -0.181  36.323  1.00 68.44  ? 111 ILE D CD1 1 
ATOM   7299  N N   . LEU D 1 132 ? -9.282  3.880   34.739  1.00 81.33  ? 112 LEU D N   1 
ATOM   7300  C CA  . LEU D 1 132 ? -9.002  5.094   33.996  1.00 80.45  ? 112 LEU D CA  1 
ATOM   7301  C C   . LEU D 1 132 ? -9.687  5.041   32.650  1.00 78.08  ? 112 LEU D C   1 
ATOM   7302  O O   . LEU D 1 132 ? -9.739  3.994   32.012  1.00 76.60  ? 112 LEU D O   1 
ATOM   7303  C CB  . LEU D 1 132 ? -7.504  5.229   33.810  1.00 79.87  ? 112 LEU D CB  1 
ATOM   7304  C CG  . LEU D 1 132 ? -6.784  5.090   35.147  1.00 80.02  ? 112 LEU D CG  1 
ATOM   7305  C CD1 . LEU D 1 132 ? -5.348  4.643   34.997  1.00 78.86  ? 112 LEU D CD1 1 
ATOM   7306  C CD2 . LEU D 1 132 ? -6.814  6.419   35.796  1.00 83.11  ? 112 LEU D CD2 1 
ATOM   7307  N N   . ALA D 1 133 ? -10.218 6.175   32.221  1.00 75.62  ? 113 ALA D N   1 
ATOM   7308  C CA  . ALA D 1 133 ? -11.000 6.216   31.001  1.00 72.60  ? 113 ALA D CA  1 
ATOM   7309  C C   . ALA D 1 133 ? -10.762 7.509   30.260  1.00 68.03  ? 113 ALA D C   1 
ATOM   7310  O O   . ALA D 1 133 ? -10.501 8.536   30.867  1.00 67.05  ? 113 ALA D O   1 
ATOM   7311  C CB  . ALA D 1 133 ? -12.474 6.044   31.317  1.00 71.82  ? 113 ALA D CB  1 
ATOM   7312  N N   . SER D 1 134 ? -10.830 7.437   28.937  1.00 67.24  ? 114 SER D N   1 
ATOM   7313  C CA  . SER D 1 134 ? -10.688 8.613   28.093  1.00 65.34  ? 114 SER D CA  1 
ATOM   7314  C C   . SER D 1 134 ? -11.949 8.812   27.258  1.00 64.52  ? 114 SER D C   1 
ATOM   7315  O O   . SER D 1 134 ? -12.723 7.872   27.027  1.00 62.94  ? 114 SER D O   1 
ATOM   7316  C CB  . SER D 1 134 ? -9.471  8.474   27.191  1.00 62.50  ? 114 SER D CB  1 
ATOM   7317  O OG  . SER D 1 134 ? -9.156  9.716   26.592  1.00 63.32  ? 114 SER D OG  1 
ATOM   7318  N N   . ASN D 1 135 ? -12.144 10.046  26.813  1.00 61.83  ? 115 ASN D N   1 
ATOM   7319  C CA  . ASN D 1 135 ? -13.309 10.406  26.026  1.00 58.77  ? 115 ASN D CA  1 
ATOM   7320  C C   . ASN D 1 135 ? -12.889 10.721  24.610  1.00 57.74  ? 115 ASN D C   1 
ATOM   7321  O O   . ASN D 1 135 ? -13.667 11.240  23.812  1.00 57.89  ? 115 ASN D O   1 
ATOM   7322  C CB  . ASN D 1 135 ? -13.971 11.630  26.639  1.00 58.61  ? 115 ASN D CB  1 
ATOM   7323  C CG  . ASN D 1 135 ? -15.263 12.005  25.943  1.00 60.06  ? 115 ASN D CG  1 
ATOM   7324  O OD1 . ASN D 1 135 ? -16.172 11.179  25.793  1.00 62.55  ? 115 ASN D OD1 1 
ATOM   7325  N ND2 . ASN D 1 135 ? -15.354 13.259  25.509  1.00 55.80  ? 115 ASN D ND2 1 
ATOM   7326  N N   . THR D 1 136 ? -11.641 10.418  24.299  1.00 58.03  ? 116 THR D N   1 
ATOM   7327  C CA  . THR D 1 136 ? -11.104 10.698  22.984  1.00 57.26  ? 116 THR D CA  1 
ATOM   7328  C C   . THR D 1 136 ? -11.963 10.031  21.920  1.00 57.15  ? 116 THR D C   1 
ATOM   7329  O O   . THR D 1 136 ? -12.611 9.002   22.167  1.00 58.28  ? 116 THR D O   1 
ATOM   7330  C CB  . THR D 1 136 ? -9.659  10.180  22.861  1.00 56.26  ? 116 THR D CB  1 
ATOM   7331  O OG1 . THR D 1 136 ? -9.113  10.537  21.587  1.00 57.06  ? 116 THR D OG1 1 
ATOM   7332  C CG2 . THR D 1 136 ? -9.613  8.669   23.018  1.00 55.84  ? 116 THR D CG2 1 
ATOM   7333  N N   . SER D 1 137 ? -11.963 10.634  20.740  1.00 57.59  ? 117 SER D N   1 
ATOM   7334  C CA  . SER D 1 137 ? -12.652 10.080  19.584  1.00 59.07  ? 117 SER D CA  1 
ATOM   7335  C C   . SER D 1 137 ? -11.685 9.461   18.597  1.00 56.70  ? 117 SER D C   1 
ATOM   7336  O O   . SER D 1 137 ? -12.081 8.670   17.755  1.00 59.11  ? 117 SER D O   1 
ATOM   7337  C CB  . SER D 1 137 ? -13.415 11.181  18.865  1.00 59.86  ? 117 SER D CB  1 
ATOM   7338  O OG  . SER D 1 137 ? -14.486 11.655  19.662  1.00 69.22  ? 117 SER D OG  1 
ATOM   7339  N N   . SER D 1 138 ? -10.414 9.811   18.719  1.00 60.49  ? 118 SER D N   1 
ATOM   7340  C CA  . SER D 1 138 ? -9.468  9.636   17.629  1.00 63.82  ? 118 SER D CA  1 
ATOM   7341  C C   . SER D 1 138 ? -8.075  9.142   18.021  1.00 62.78  ? 118 SER D C   1 
ATOM   7342  O O   . SER D 1 138 ? -7.227  8.927   17.146  1.00 62.52  ? 118 SER D O   1 
ATOM   7343  C CB  . SER D 1 138 ? -9.322  10.984  16.945  1.00 65.58  ? 118 SER D CB  1 
ATOM   7344  O OG  . SER D 1 138 ? -8.873  11.936  17.895  1.00 65.98  ? 118 SER D OG  1 
ATOM   7345  N N   . LEU D 1 139 ? -7.827  8.979   19.317  1.00 60.11  ? 119 LEU D N   1 
ATOM   7346  C CA  . LEU D 1 139 ? -6.564  8.440   19.780  1.00 57.19  ? 119 LEU D CA  1 
ATOM   7347  C C   . LEU D 1 139 ? -6.771  7.042   20.307  1.00 55.56  ? 119 LEU D C   1 
ATOM   7348  O O   . LEU D 1 139 ? -7.855  6.721   20.799  1.00 56.64  ? 119 LEU D O   1 
ATOM   7349  C CB  . LEU D 1 139 ? -5.992  9.346   20.848  1.00 59.15  ? 119 LEU D CB  1 
ATOM   7350  C CG  . LEU D 1 139 ? -5.656  10.734  20.309  1.00 61.68  ? 119 LEU D CG  1 
ATOM   7351  C CD1 . LEU D 1 139 ? -5.040  11.575  21.412  1.00 64.97  ? 119 LEU D CD1 1 
ATOM   7352  C CD2 . LEU D 1 139 ? -4.704  10.663  19.120  1.00 61.77  ? 119 LEU D CD2 1 
ATOM   7353  N N   . SER D 1 140 ? -5.737  6.213   20.192  1.00 51.65  ? 120 SER D N   1 
ATOM   7354  C CA  . SER D 1 140 ? -5.842  4.793   20.554  1.00 51.06  ? 120 SER D CA  1 
ATOM   7355  C C   . SER D 1 140 ? -5.835  4.554   22.070  1.00 52.71  ? 120 SER D C   1 
ATOM   7356  O O   . SER D 1 140 ? -4.853  4.855   22.754  1.00 49.88  ? 120 SER D O   1 
ATOM   7357  C CB  . SER D 1 140 ? -4.706  3.989   19.920  1.00 48.45  ? 120 SER D CB  1 
ATOM   7358  O OG  . SER D 1 140 ? -4.621  2.691   20.488  1.00 43.12  ? 120 SER D OG  1 
ATOM   7359  N N   . ILE D 1 141 ? -6.919  3.968   22.567  1.00 52.66  ? 121 ILE D N   1 
ATOM   7360  C CA  . ILE D 1 141 ? -7.041  3.606   23.977  1.00 55.41  ? 121 ILE D CA  1 
ATOM   7361  C C   . ILE D 1 141 ? -5.892  2.708   24.370  1.00 55.54  ? 121 ILE D C   1 
ATOM   7362  O O   . ILE D 1 141 ? -5.292  2.867   25.432  1.00 54.00  ? 121 ILE D O   1 
ATOM   7363  C CB  . ILE D 1 141 ? -8.320  2.791   24.252  1.00 58.94  ? 121 ILE D CB  1 
ATOM   7364  C CG1 . ILE D 1 141 ? -9.577  3.536   23.794  1.00 64.73  ? 121 ILE D CG1 1 
ATOM   7365  C CG2 . ILE D 1 141 ? -8.450  2.478   25.737  1.00 61.24  ? 121 ILE D CG2 1 
ATOM   7366  C CD1 . ILE D 1 141 ? -9.865  4.831   24.531  1.00 64.61  ? 121 ILE D CD1 1 
ATOM   7367  N N   . THR D 1 142 ? -5.633  1.739   23.499  1.00 56.57  ? 122 THR D N   1 
ATOM   7368  C CA  . THR D 1 142 ? -4.593  0.747   23.695  1.00 56.14  ? 122 THR D CA  1 
ATOM   7369  C C   . THR D 1 142 ? -3.229  1.386   23.866  1.00 57.96  ? 122 THR D C   1 
ATOM   7370  O O   . THR D 1 142 ? -2.446  0.959   24.704  1.00 62.03  ? 122 THR D O   1 
ATOM   7371  C CB  . THR D 1 142 ? -4.507  -0.199  22.487  1.00 55.22  ? 122 THR D CB  1 
ATOM   7372  O OG1 . THR D 1 142 ? -5.693  -1.001  22.407  1.00 52.96  ? 122 THR D OG1 1 
ATOM   7373  C CG2 . THR D 1 142 ? -3.293  -1.106  22.590  1.00 53.58  ? 122 THR D CG2 1 
ATOM   7374  N N   . GLU D 1 143 ? -2.935  2.387   23.052  1.00 61.01  ? 123 GLU D N   1 
ATOM   7375  C CA  . GLU D 1 143 ? -1.607  2.975   23.061  1.00 61.69  ? 123 GLU D CA  1 
ATOM   7376  C C   . GLU D 1 143 ? -1.429  3.764   24.333  1.00 62.79  ? 123 GLU D C   1 
ATOM   7377  O O   . GLU D 1 143 ? -0.332  3.835   24.895  1.00 61.50  ? 123 GLU D O   1 
ATOM   7378  C CB  . GLU D 1 143 ? -1.414  3.895   21.868  1.00 61.92  ? 123 GLU D CB  1 
ATOM   7379  C CG  . GLU D 1 143 ? -0.006  4.463   21.762  1.00 62.00  ? 123 GLU D CG  1 
ATOM   7380  C CD  . GLU D 1 143 ? 0.184   5.297   20.507  1.00 62.68  ? 123 GLU D CD  1 
ATOM   7381  O OE1 . GLU D 1 143 ? -0.591  5.117   19.546  1.00 61.54  ? 123 GLU D OE1 1 
ATOM   7382  O OE2 . GLU D 1 143 ? 1.109   6.130   20.470  1.00 61.03  ? 123 GLU D OE2 1 
ATOM   7383  N N   . VAL D 1 144 ? -2.521  4.374   24.768  1.00 63.69  ? 124 VAL D N   1 
ATOM   7384  C CA  . VAL D 1 144 ? -2.508  5.159   25.982  1.00 69.60  ? 124 VAL D CA  1 
ATOM   7385  C C   . VAL D 1 144 ? -2.312  4.266   27.200  1.00 74.14  ? 124 VAL D C   1 
ATOM   7386  O O   . VAL D 1 144 ? -1.502  4.572   28.078  1.00 73.92  ? 124 VAL D O   1 
ATOM   7387  C CB  . VAL D 1 144 ? -3.814  5.935   26.139  1.00 69.99  ? 124 VAL D CB  1 
ATOM   7388  C CG1 . VAL D 1 144 ? -4.041  6.288   27.592  1.00 73.33  ? 124 VAL D CG1 1 
ATOM   7389  C CG2 . VAL D 1 144 ? -3.764  7.193   25.302  1.00 71.17  ? 124 VAL D CG2 1 
ATOM   7390  N N   . ALA D 1 145 ? -3.059  3.162   27.237  1.00 74.82  ? 125 ALA D N   1 
ATOM   7391  C CA  . ALA D 1 145 ? -2.969  2.178   28.320  1.00 71.28  ? 125 ALA D CA  1 
ATOM   7392  C C   . ALA D 1 145 ? -1.525  1.732   28.521  1.00 69.91  ? 125 ALA D C   1 
ATOM   7393  O O   . ALA D 1 145 ? -1.098  1.412   29.629  1.00 75.49  ? 125 ALA D O   1 
ATOM   7394  C CB  . ALA D 1 145 ? -3.842  0.978   28.002  1.00 66.87  ? 125 ALA D CB  1 
ATOM   7395  N N   . SER D 1 146 ? -0.781  1.734   27.425  1.00 66.66  ? 126 SER D N   1 
ATOM   7396  C CA  . SER D 1 146 ? 0.624   1.360   27.418  1.00 63.67  ? 126 SER D CA  1 
ATOM   7397  C C   . SER D 1 146 ? 1.527   2.306   28.172  1.00 63.24  ? 126 SER D C   1 
ATOM   7398  O O   . SER D 1 146 ? 2.713   2.028   28.303  1.00 60.50  ? 126 SER D O   1 
ATOM   7399  C CB  . SER D 1 146 ? 1.137   1.273   25.980  1.00 60.41  ? 126 SER D CB  1 
ATOM   7400  O OG  . SER D 1 146 ? 1.085   -0.060  25.526  1.00 57.57  ? 126 SER D OG  1 
ATOM   7401  N N   . ALA D 1 147 ? 0.992   3.434   28.625  1.00 66.45  ? 127 ALA D N   1 
ATOM   7402  C CA  . ALA D 1 147 ? 1.767   4.360   29.446  1.00 70.88  ? 127 ALA D CA  1 
ATOM   7403  C C   . ALA D 1 147 ? 1.697   3.957   30.914  1.00 72.85  ? 127 ALA D C   1 
ATOM   7404  O O   . ALA D 1 147 ? 2.497   4.407   31.733  1.00 75.46  ? 127 ALA D O   1 
ATOM   7405  C CB  . ALA D 1 147 ? 1.247   5.766   29.277  1.00 70.82  ? 127 ALA D CB  1 
ATOM   7406  N N   . THR D 1 148 ? 0.736   3.095   31.220  1.00 70.48  ? 128 THR D N   1 
ATOM   7407  C CA  . THR D 1 148 ? 0.407   2.738   32.573  1.00 68.95  ? 128 THR D CA  1 
ATOM   7408  C C   . THR D 1 148 ? 0.791   1.302   32.781  1.00 72.93  ? 128 THR D C   1 
ATOM   7409  O O   . THR D 1 148 ? 1.186   0.613   31.843  1.00 71.24  ? 128 THR D O   1 
ATOM   7410  C CB  . THR D 1 148 ? -1.109  2.845   32.839  1.00 66.67  ? 128 THR D CB  1 
ATOM   7411  O OG1 . THR D 1 148 ? -1.775  1.664   32.368  1.00 65.01  ? 128 THR D OG1 1 
ATOM   7412  C CG2 . THR D 1 148 ? -1.704  4.076   32.170  1.00 66.28  ? 128 THR D CG2 1 
ATOM   7413  N N   . LYS D 1 149 ? 0.633   0.856   34.020  1.00 79.54  ? 129 LYS D N   1 
ATOM   7414  C CA  . LYS D 1 149 ? 0.886   -0.527  34.396  1.00 85.32  ? 129 LYS D CA  1 
ATOM   7415  C C   . LYS D 1 149 ? -0.409  -1.197  34.854  1.00 84.04  ? 129 LYS D C   1 
ATOM   7416  O O   . LYS D 1 149 ? -0.376  -2.206  35.552  1.00 82.80  ? 129 LYS D O   1 
ATOM   7417  C CB  . LYS D 1 149 ? 1.941   -0.592  35.507  1.00 90.30  ? 129 LYS D CB  1 
ATOM   7418  C CG  . LYS D 1 149 ? 3.066   0.433   35.376  1.00 97.16  ? 129 LYS D CG  1 
ATOM   7419  C CD  . LYS D 1 149 ? 4.262   -0.089  34.586  1.00 103.54 ? 129 LYS D CD  1 
ATOM   7420  C CE  . LYS D 1 149 ? 4.998   1.019   33.831  1.00 107.78 ? 129 LYS D CE  1 
ATOM   7421  N NZ  . LYS D 1 149 ? 4.983   0.838   32.348  1.00 107.81 ? 129 LYS D NZ  1 
ATOM   7422  N N   . ARG D 1 150 ? -1.547  -0.644  34.445  1.00 85.01  ? 130 ARG D N   1 
ATOM   7423  C CA  . ARG D 1 150 ? -2.844  -1.266  34.703  1.00 82.14  ? 130 ARG D CA  1 
ATOM   7424  C C   . ARG D 1 150 ? -3.741  -1.242  33.452  1.00 79.42  ? 130 ARG D C   1 
ATOM   7425  O O   . ARG D 1 150 ? -4.942  -0.925  33.521  1.00 73.54  ? 130 ARG D O   1 
ATOM   7426  C CB  . ARG D 1 150 ? -3.504  -0.546  35.855  1.00 80.89  ? 130 ARG D CB  1 
ATOM   7427  C CG  . ARG D 1 150 ? -3.753  0.911   35.545  1.00 81.05  ? 130 ARG D CG  1 
ATOM   7428  C CD  . ARG D 1 150 ? -4.560  1.532   36.645  1.00 82.59  ? 130 ARG D CD  1 
ATOM   7429  N NE  . ARG D 1 150 ? -3.722  2.334   37.522  1.00 86.05  ? 130 ARG D NE  1 
ATOM   7430  C CZ  . ARG D 1 150 ? -4.050  2.662   38.765  1.00 87.10  ? 130 ARG D CZ  1 
ATOM   7431  N NH1 . ARG D 1 150 ? -5.196  2.240   39.299  1.00 87.66  ? 130 ARG D NH1 1 
ATOM   7432  N NH2 . ARG D 1 150 ? -3.223  3.407   39.480  1.00 85.81  ? 130 ARG D NH2 1 
ATOM   7433  N N   . PRO D 1 151 ? -3.159  -1.595  32.297  1.00 74.56  ? 131 PRO D N   1 
ATOM   7434  C CA  . PRO D 1 151 ? -3.886  -1.676  31.044  1.00 74.47  ? 131 PRO D CA  1 
ATOM   7435  C C   . PRO D 1 151 ? -5.210  -2.390  31.183  1.00 70.87  ? 131 PRO D C   1 
ATOM   7436  O O   . PRO D 1 151 ? -6.152  -2.092  30.449  1.00 72.47  ? 131 PRO D O   1 
ATOM   7437  C CB  . PRO D 1 151 ? -2.955  -2.503  30.140  1.00 73.72  ? 131 PRO D CB  1 
ATOM   7438  C CG  . PRO D 1 151 ? -1.669  -2.673  30.874  1.00 74.07  ? 131 PRO D CG  1 
ATOM   7439  C CD  . PRO D 1 151 ? -1.721  -1.825  32.095  1.00 75.58  ? 131 PRO D CD  1 
ATOM   7440  N N   . ASP D 1 152 ? -5.267  -3.331  32.120  1.00 71.49  ? 132 ASP D N   1 
ATOM   7441  C CA  . ASP D 1 152 ? -6.443  -4.166  32.311  1.00 72.62  ? 132 ASP D CA  1 
ATOM   7442  C C   . ASP D 1 152 ? -7.647  -3.346  32.719  1.00 68.92  ? 132 ASP D C   1 
ATOM   7443  O O   . ASP D 1 152 ? -8.784  -3.782  32.553  1.00 66.59  ? 132 ASP D O   1 
ATOM   7444  C CB  . ASP D 1 152 ? -6.171  -5.266  33.350  1.00 74.59  ? 132 ASP D CB  1 
ATOM   7445  C CG  . ASP D 1 152 ? -6.113  -4.739  34.784  1.00 78.35  ? 132 ASP D CG  1 
ATOM   7446  O OD1 . ASP D 1 152 ? -5.089  -4.116  35.161  1.00 78.35  ? 132 ASP D OD1 1 
ATOM   7447  O OD2 . ASP D 1 152 ? -7.090  -4.969  35.539  1.00 81.33  ? 132 ASP D OD2 1 
ATOM   7448  N N   . LYS D 1 153 ? -7.386  -2.156  33.241  1.00 70.27  ? 133 LYS D N   1 
ATOM   7449  C CA  . LYS D 1 153 ? -8.441  -1.257  33.652  1.00 70.83  ? 133 LYS D CA  1 
ATOM   7450  C C   . LYS D 1 153 ? -8.226  0.094   33.035  1.00 67.29  ? 133 LYS D C   1 
ATOM   7451  O O   . LYS D 1 153 ? -8.310  1.128   33.696  1.00 69.93  ? 133 LYS D O   1 
ATOM   7452  C CB  . LYS D 1 153 ? -8.483  -1.153  35.161  1.00 78.57  ? 133 LYS D CB  1 
ATOM   7453  C CG  . LYS D 1 153 ? -7.181  -1.536  35.846  1.00 83.88  ? 133 LYS D CG  1 
ATOM   7454  C CD  . LYS D 1 153 ? -7.315  -1.536  37.352  1.00 87.54  ? 133 LYS D CD  1 
ATOM   7455  C CE  . LYS D 1 153 ? -8.760  -1.761  37.776  1.00 89.41  ? 133 LYS D CE  1 
ATOM   7456  N NZ  . LYS D 1 153 ? -8.877  -2.822  38.794  1.00 89.26  ? 133 LYS D NZ  1 
ATOM   7457  N N   . VAL D 1 154 ? -7.913  0.073   31.752  1.00 64.66  ? 134 VAL D N   1 
ATOM   7458  C CA  . VAL D 1 154 ? -7.940  1.273   30.953  1.00 62.01  ? 134 VAL D CA  1 
ATOM   7459  C C   . VAL D 1 154 ? -8.989  1.023   29.896  1.00 59.44  ? 134 VAL D C   1 
ATOM   7460  O O   . VAL D 1 154 ? -9.140  -0.090  29.397  1.00 63.42  ? 134 VAL D O   1 
ATOM   7461  C CB  . VAL D 1 154 ? -6.582  1.576   30.336  1.00 60.98  ? 134 VAL D CB  1 
ATOM   7462  C CG1 . VAL D 1 154 ? -6.710  2.662   29.287  1.00 60.44  ? 134 VAL D CG1 1 
ATOM   7463  C CG2 . VAL D 1 154 ? -5.625  2.006   31.428  1.00 61.17  ? 134 VAL D CG2 1 
ATOM   7464  N N   . ILE D 1 155 ? -9.740  2.056   29.581  1.00 54.34  ? 135 ILE D N   1 
ATOM   7465  C CA  . ILE D 1 155 ? -10.892 1.881   28.748  1.00 52.26  ? 135 ILE D CA  1 
ATOM   7466  C C   . ILE D 1 155 ? -11.250 3.220   28.127  1.00 55.02  ? 135 ILE D C   1 
ATOM   7467  O O   . ILE D 1 155 ? -10.675 4.258   28.470  1.00 54.28  ? 135 ILE D O   1 
ATOM   7468  C CB  . ILE D 1 155 ? -12.049 1.373   29.606  1.00 51.78  ? 135 ILE D CB  1 
ATOM   7469  C CG1 . ILE D 1 155 ? -13.141 0.750   28.761  1.00 51.98  ? 135 ILE D CG1 1 
ATOM   7470  C CG2 . ILE D 1 155 ? -12.633 2.511   30.429  1.00 54.23  ? 135 ILE D CG2 1 
ATOM   7471  C CD1 . ILE D 1 155 ? -14.116 -0.052  29.588  1.00 53.76  ? 135 ILE D CD1 1 
ATOM   7472  N N   . GLY D 1 156 ? -12.203 3.196   27.208  1.00 53.94  ? 136 GLY D N   1 
ATOM   7473  C CA  . GLY D 1 156 ? -12.697 4.410   26.617  1.00 51.46  ? 136 GLY D CA  1 
ATOM   7474  C C   . GLY D 1 156 ? -14.143 4.594   26.977  1.00 53.07  ? 136 GLY D C   1 
ATOM   7475  O O   . GLY D 1 156 ? -14.930 3.664   26.939  1.00 50.15  ? 136 GLY D O   1 
ATOM   7476  N N   . MET D 1 157 ? -14.488 5.809   27.345  1.00 58.13  ? 137 MET D N   1 
ATOM   7477  C CA  . MET D 1 157 ? -15.863 6.159   27.590  1.00 62.95  ? 137 MET D CA  1 
ATOM   7478  C C   . MET D 1 157 ? -16.172 7.324   26.684  1.00 63.20  ? 137 MET D C   1 
ATOM   7479  O O   . MET D 1 157 ? -15.818 8.464   26.993  1.00 64.07  ? 137 MET D O   1 
ATOM   7480  C CB  . MET D 1 157 ? -16.042 6.583   29.036  1.00 69.35  ? 137 MET D CB  1 
ATOM   7481  C CG  . MET D 1 157 ? -16.554 5.503   29.960  1.00 75.56  ? 137 MET D CG  1 
ATOM   7482  S SD  . MET D 1 157 ? -17.004 6.231   31.552  1.00 84.19  ? 137 MET D SD  1 
ATOM   7483  C CE  . MET D 1 157 ? -18.666 5.589   31.736  1.00 81.09  ? 137 MET D CE  1 
ATOM   7484  N N   . HIS D 1 158 ? -16.822 7.045   25.561  1.00 64.08  ? 138 HIS D N   1 
ATOM   7485  C CA  . HIS D 1 158 ? -17.067 8.080   24.564  1.00 64.61  ? 138 HIS D CA  1 
ATOM   7486  C C   . HIS D 1 158 ? -18.469 8.647   24.711  1.00 63.27  ? 138 HIS D C   1 
ATOM   7487  O O   . HIS D 1 158 ? -19.459 7.952   24.478  1.00 59.20  ? 138 HIS D O   1 
ATOM   7488  C CB  . HIS D 1 158 ? -16.856 7.543   23.152  1.00 65.14  ? 138 HIS D CB  1 
ATOM   7489  C CG  . HIS D 1 158 ? -16.836 8.611   22.103  1.00 63.93  ? 138 HIS D CG  1 
ATOM   7490  N ND1 . HIS D 1 158 ? -17.645 8.574   20.990  1.00 63.83  ? 138 HIS D ND1 1 
ATOM   7491  C CD2 . HIS D 1 158 ? -16.115 9.753   22.007  1.00 61.94  ? 138 HIS D CD2 1 
ATOM   7492  C CE1 . HIS D 1 158 ? -17.418 9.643   20.249  1.00 63.50  ? 138 HIS D CE1 1 
ATOM   7493  N NE2 . HIS D 1 158 ? -16.491 10.372  20.842  1.00 61.85  ? 138 HIS D NE2 1 
ATOM   7494  N N   . PHE D 1 159 ? -18.531 9.918   25.093  1.00 63.65  ? 139 PHE D N   1 
ATOM   7495  C CA  . PHE D 1 159 ? -19.792 10.595  25.320  1.00 64.75  ? 139 PHE D CA  1 
ATOM   7496  C C   . PHE D 1 159 ? -20.182 11.429  24.133  1.00 61.31  ? 139 PHE D C   1 
ATOM   7497  O O   . PHE D 1 159 ? -19.364 11.724  23.282  1.00 59.42  ? 139 PHE D O   1 
ATOM   7498  C CB  . PHE D 1 159 ? -19.674 11.510  26.517  1.00 67.55  ? 139 PHE D CB  1 
ATOM   7499  C CG  . PHE D 1 159 ? -19.777 10.801  27.819  1.00 67.90  ? 139 PHE D CG  1 
ATOM   7500  C CD1 . PHE D 1 159 ? -18.641 10.332  28.456  1.00 69.82  ? 139 PHE D CD1 1 
ATOM   7501  C CD2 . PHE D 1 159 ? -21.010 10.615  28.416  1.00 70.56  ? 139 PHE D CD2 1 
ATOM   7502  C CE1 . PHE D 1 159 ? -18.732 9.679   29.671  1.00 71.12  ? 139 PHE D CE1 1 
ATOM   7503  C CE2 . PHE D 1 159 ? -21.112 9.968   29.633  1.00 72.18  ? 139 PHE D CE2 1 
ATOM   7504  C CZ  . PHE D 1 159 ? -19.970 9.494   30.259  1.00 72.70  ? 139 PHE D CZ  1 
ATOM   7505  N N   . PHE D 1 160 ? -21.442 11.830  24.105  1.00 63.75  ? 140 PHE D N   1 
ATOM   7506  C CA  . PHE D 1 160 ? -21.951 12.605  22.999  1.00 64.33  ? 140 PHE D CA  1 
ATOM   7507  C C   . PHE D 1 160 ? -22.484 13.932  23.480  1.00 70.09  ? 140 PHE D C   1 
ATOM   7508  O O   . PHE D 1 160 ? -23.425 14.002  24.261  1.00 71.13  ? 140 PHE D O   1 
ATOM   7509  C CB  . PHE D 1 160 ? -23.002 11.818  22.237  1.00 65.25  ? 140 PHE D CB  1 
ATOM   7510  C CG  . PHE D 1 160 ? -22.417 10.705  21.435  1.00 65.00  ? 140 PHE D CG  1 
ATOM   7511  C CD1 . PHE D 1 160 ? -22.132 10.872  20.087  1.00 63.62  ? 140 PHE D CD1 1 
ATOM   7512  C CD2 . PHE D 1 160 ? -22.087 9.509   22.046  1.00 66.53  ? 140 PHE D CD2 1 
ATOM   7513  C CE1 . PHE D 1 160 ? -21.556 9.849   19.354  1.00 64.09  ? 140 PHE D CE1 1 
ATOM   7514  C CE2 . PHE D 1 160 ? -21.509 8.482   21.320  1.00 66.82  ? 140 PHE D CE2 1 
ATOM   7515  C CZ  . PHE D 1 160 ? -21.240 8.653   19.972  1.00 64.51  ? 140 PHE D CZ  1 
ATOM   7516  N N   . ASN D 1 161 ? -21.809 14.974  23.010  1.00 70.65  ? 141 ASN D N   1 
ATOM   7517  C CA  . ASN D 1 161 ? -22.183 16.362  23.198  1.00 67.40  ? 141 ASN D CA  1 
ATOM   7518  C C   . ASN D 1 161 ? -23.618 16.645  22.768  1.00 66.91  ? 141 ASN D C   1 
ATOM   7519  O O   . ASN D 1 161 ? -23.949 16.430  21.612  1.00 67.54  ? 141 ASN D O   1 
ATOM   7520  C CB  . ASN D 1 161 ? -21.246 17.202  22.336  1.00 69.15  ? 141 ASN D CB  1 
ATOM   7521  C CG  . ASN D 1 161 ? -21.350 18.683  22.614  1.00 70.67  ? 141 ASN D CG  1 
ATOM   7522  O OD1 . ASN D 1 161 ? -22.032 19.120  23.535  1.00 76.15  ? 141 ASN D OD1 1 
ATOM   7523  N ND2 . ASN D 1 161 ? -20.659 19.469  21.813  1.00 65.97  ? 141 ASN D ND2 1 
ATOM   7524  N N   . PRO D 1 162 ? -24.470 17.155  23.661  1.00 70.81  ? 142 PRO D N   1 
ATOM   7525  C CA  . PRO D 1 162 ? -24.124 17.544  25.045  1.00 66.88  ? 142 PRO D CA  1 
ATOM   7526  C C   . PRO D 1 162 ? -24.233 16.403  26.052  1.00 63.41  ? 142 PRO D C   1 
ATOM   7527  O O   . PRO D 1 162 ? -25.265 15.724  26.146  1.00 54.82  ? 142 PRO D O   1 
ATOM   7528  C CB  . PRO D 1 162 ? -25.135 18.646  25.359  1.00 68.14  ? 142 PRO D CB  1 
ATOM   7529  C CG  . PRO D 1 162 ? -26.302 18.354  24.477  1.00 68.62  ? 142 PRO D CG  1 
ATOM   7530  C CD  . PRO D 1 162 ? -25.765 17.713  23.230  1.00 69.00  ? 142 PRO D CD  1 
ATOM   7531  N N   . ALA D 1 163 ? -23.160 16.217  26.810  1.00 63.16  ? 143 ALA D N   1 
ATOM   7532  C CA  . ALA D 1 163 ? -23.014 15.054  27.674  1.00 65.41  ? 143 ALA D CA  1 
ATOM   7533  C C   . ALA D 1 163 ? -24.197 14.788  28.615  1.00 66.32  ? 143 ALA D C   1 
ATOM   7534  O O   . ALA D 1 163 ? -24.603 13.640  28.753  1.00 75.08  ? 143 ALA D O   1 
ATOM   7535  C CB  . ALA D 1 163 ? -21.717 15.152  28.464  1.00 66.00  ? 143 ALA D CB  1 
ATOM   7536  N N   . PRO D 1 164 ? -24.744 15.832  29.270  1.00 66.24  ? 144 PRO D N   1 
ATOM   7537  C CA  . PRO D 1 164 ? -25.838 15.631  30.234  1.00 66.70  ? 144 PRO D CA  1 
ATOM   7538  C C   . PRO D 1 164 ? -27.110 15.066  29.641  1.00 65.21  ? 144 PRO D C   1 
ATOM   7539  O O   . PRO D 1 164 ? -27.874 14.395  30.335  1.00 68.60  ? 144 PRO D O   1 
ATOM   7540  C CB  . PRO D 1 164 ? -26.123 17.048  30.736  1.00 67.01  ? 144 PRO D CB  1 
ATOM   7541  C CG  . PRO D 1 164 ? -24.841 17.762  30.567  1.00 68.69  ? 144 PRO D CG  1 
ATOM   7542  C CD  . PRO D 1 164 ? -24.278 17.231  29.286  1.00 68.37  ? 144 PRO D CD  1 
ATOM   7543  N N   . VAL D 1 165 ? -27.327 15.342  28.367  1.00 63.72  ? 145 VAL D N   1 
ATOM   7544  C CA  . VAL D 1 165 ? -28.546 14.946  27.703  1.00 65.61  ? 145 VAL D CA  1 
ATOM   7545  C C   . VAL D 1 165 ? -28.364 13.654  26.932  1.00 63.51  ? 145 VAL D C   1 
ATOM   7546  O O   . VAL D 1 165 ? -29.107 12.699  27.129  1.00 61.95  ? 145 VAL D O   1 
ATOM   7547  C CB  . VAL D 1 165 ? -28.995 16.039  26.720  1.00 69.55  ? 145 VAL D CB  1 
ATOM   7548  C CG1 . VAL D 1 165 ? -30.191 15.561  25.899  1.00 72.55  ? 145 VAL D CG1 1 
ATOM   7549  C CG2 . VAL D 1 165 ? -29.317 17.322  27.477  1.00 67.66  ? 145 VAL D CG2 1 
ATOM   7550  N N   . MET D 1 166 ? -27.385 13.651  26.033  1.00 66.24  ? 146 MET D N   1 
ATOM   7551  C CA  . MET D 1 166 ? -27.195 12.544  25.108  1.00 64.54  ? 146 MET D CA  1 
ATOM   7552  C C   . MET D 1 166 ? -26.990 11.267  25.882  1.00 61.22  ? 146 MET D C   1 
ATOM   7553  O O   . MET D 1 166 ? -26.100 11.170  26.732  1.00 52.36  ? 146 MET D O   1 
ATOM   7554  C CB  . MET D 1 166 ? -25.975 12.764  24.226  1.00 68.73  ? 146 MET D CB  1 
ATOM   7555  C CG  . MET D 1 166 ? -26.082 13.916  23.237  1.00 70.95  ? 146 MET D CG  1 
ATOM   7556  S SD  . MET D 1 166 ? -27.305 13.625  21.957  1.00 69.88  ? 146 MET D SD  1 
ATOM   7557  C CE  . MET D 1 166 ? -28.621 14.697  22.519  1.00 73.80  ? 146 MET D CE  1 
ATOM   7558  N N   . LYS D 1 167 ? -27.810 10.285  25.544  1.00 61.90  ? 147 LYS D N   1 
ATOM   7559  C CA  . LYS D 1 167 ? -27.854 9.028   26.271  1.00 65.53  ? 147 LYS D CA  1 
ATOM   7560  C C   . LYS D 1 167 ? -26.762 8.028   25.917  1.00 62.81  ? 147 LYS D C   1 
ATOM   7561  O O   . LYS D 1 167 ? -26.459 7.151   26.716  1.00 68.65  ? 147 LYS D O   1 
ATOM   7562  C CB  . LYS D 1 167 ? -29.204 8.348   26.045  1.00 72.54  ? 147 LYS D CB  1 
ATOM   7563  C CG  . LYS D 1 167 ? -30.196 8.567   27.164  1.00 79.95  ? 147 LYS D CG  1 
ATOM   7564  C CD  . LYS D 1 167 ? -31.396 7.652   26.995  1.00 83.44  ? 147 LYS D CD  1 
ATOM   7565  C CE  . LYS D 1 167 ? -32.516 8.006   27.966  1.00 85.42  ? 147 LYS D CE  1 
ATOM   7566  N NZ  . LYS D 1 167 ? -32.504 7.156   29.189  1.00 86.66  ? 147 LYS D NZ  1 
ATOM   7567  N N   . LEU D 1 168 ? -26.191 8.119   24.725  1.00 57.67  ? 148 LEU D N   1 
ATOM   7568  C CA  . LEU D 1 168 ? -25.300 7.070   24.275  1.00 54.72  ? 148 LEU D CA  1 
ATOM   7569  C C   . LEU D 1 168 ? -23.922 7.197   24.886  1.00 54.60  ? 148 LEU D C   1 
ATOM   7570  O O   . LEU D 1 168 ? -23.424 8.294   25.138  1.00 54.68  ? 148 LEU D O   1 
ATOM   7571  C CB  . LEU D 1 168 ? -25.193 7.064   22.756  1.00 54.92  ? 148 LEU D CB  1 
ATOM   7572  C CG  . LEU D 1 168 ? -24.284 5.998   22.144  1.00 55.97  ? 148 LEU D CG  1 
ATOM   7573  C CD1 . LEU D 1 168 ? -24.816 4.603   22.415  1.00 56.94  ? 148 LEU D CD1 1 
ATOM   7574  C CD2 . LEU D 1 168 ? -24.191 6.203   20.652  1.00 58.36  ? 148 LEU D CD2 1 
ATOM   7575  N N   . VAL D 1 169 ? -23.319 6.049   25.144  1.00 56.34  ? 149 VAL D N   1 
ATOM   7576  C CA  . VAL D 1 169 ? -21.929 6.001   25.505  1.00 57.23  ? 149 VAL D CA  1 
ATOM   7577  C C   . VAL D 1 169 ? -21.312 4.844   24.769  1.00 57.77  ? 149 VAL D C   1 
ATOM   7578  O O   . VAL D 1 169 ? -21.800 3.723   24.841  1.00 56.45  ? 149 VAL D O   1 
ATOM   7579  C CB  . VAL D 1 169 ? -21.730 5.767   27.005  1.00 60.35  ? 149 VAL D CB  1 
ATOM   7580  C CG1 . VAL D 1 169 ? -20.248 5.672   27.323  1.00 60.09  ? 149 VAL D CG1 1 
ATOM   7581  C CG2 . VAL D 1 169 ? -22.343 6.903   27.802  1.00 60.95  ? 149 VAL D CG2 1 
ATOM   7582  N N   . GLU D 1 170 ? -20.234 5.116   24.055  1.00 58.32  ? 150 GLU D N   1 
ATOM   7583  C CA  . GLU D 1 170 ? -19.514 4.049   23.401  1.00 56.69  ? 150 GLU D CA  1 
ATOM   7584  C C   . GLU D 1 170 ? -18.455 3.617   24.386  1.00 52.24  ? 150 GLU D C   1 
ATOM   7585  O O   . GLU D 1 170 ? -17.587 4.407   24.741  1.00 48.98  ? 150 GLU D O   1 
ATOM   7586  C CB  . GLU D 1 170 ? -18.911 4.525   22.069  1.00 56.74  ? 150 GLU D CB  1 
ATOM   7587  C CG  . GLU D 1 170 ? -19.945 4.787   20.973  1.00 57.01  ? 150 GLU D CG  1 
ATOM   7588  C CD  . GLU D 1 170 ? -19.351 5.303   19.651  1.00 57.79  ? 150 GLU D CD  1 
ATOM   7589  O OE1 . GLU D 1 170 ? -18.544 6.265   19.653  1.00 57.12  ? 150 GLU D OE1 1 
ATOM   7590  O OE2 . GLU D 1 170 ? -19.719 4.762   18.585  1.00 54.61  ? 150 GLU D OE2 1 
ATOM   7591  N N   . VAL D 1 171 ? -18.543 2.385   24.867  1.00 50.73  ? 151 VAL D N   1 
ATOM   7592  C CA  . VAL D 1 171 ? -17.495 1.883   25.749  1.00 51.14  ? 151 VAL D CA  1 
ATOM   7593  C C   . VAL D 1 171 ? -16.465 1.185   24.887  1.00 49.48  ? 151 VAL D C   1 
ATOM   7594  O O   . VAL D 1 171 ? -16.743 0.165   24.266  1.00 48.99  ? 151 VAL D O   1 
ATOM   7595  C CB  . VAL D 1 171 ? -18.005 0.947   26.855  1.00 51.05  ? 151 VAL D CB  1 
ATOM   7596  C CG1 . VAL D 1 171 ? -16.867 0.587   27.794  1.00 48.77  ? 151 VAL D CG1 1 
ATOM   7597  C CG2 . VAL D 1 171 ? -19.093 1.636   27.648  1.00 50.69  ? 151 VAL D CG2 1 
ATOM   7598  N N   . ILE D 1 172 ? -15.276 1.762   24.867  1.00 48.65  ? 152 ILE D N   1 
ATOM   7599  C CA  . ILE D 1 172 ? -14.241 1.374   23.952  1.00 48.44  ? 152 ILE D CA  1 
ATOM   7600  C C   . ILE D 1 172 ? -13.252 0.533   24.689  1.00 48.87  ? 152 ILE D C   1 
ATOM   7601  O O   . ILE D 1 172 ? -12.581 0.999   25.603  1.00 47.03  ? 152 ILE D O   1 
ATOM   7602  C CB  . ILE D 1 172 ? -13.514 2.602   23.378  1.00 47.84  ? 152 ILE D CB  1 
ATOM   7603  C CG1 . ILE D 1 172 ? -14.517 3.580   22.779  1.00 48.81  ? 152 ILE D CG1 1 
ATOM   7604  C CG2 . ILE D 1 172 ? -12.526 2.178   22.317  1.00 46.40  ? 152 ILE D CG2 1 
ATOM   7605  C CD1 . ILE D 1 172 ? -15.552 2.932   21.888  1.00 49.56  ? 152 ILE D CD1 1 
ATOM   7606  N N   . ARG D 1 173 ? -13.146 -0.711  24.271  1.00 51.32  ? 153 ARG D N   1 
ATOM   7607  C CA  . ARG D 1 173 ? -12.204 -1.603  24.887  1.00 53.10  ? 153 ARG D CA  1 
ATOM   7608  C C   . ARG D 1 173 ? -10.909 -1.589  24.148  1.00 49.91  ? 153 ARG D C   1 
ATOM   7609  O O   . ARG D 1 173 ? -10.832 -2.044  23.000  1.00 51.78  ? 153 ARG D O   1 
ATOM   7610  C CB  . ARG D 1 173 ? -12.744 -3.006  24.875  1.00 58.16  ? 153 ARG D CB  1 
ATOM   7611  C CG  . ARG D 1 173 ? -13.874 -3.168  25.855  1.00 60.21  ? 153 ARG D CG  1 
ATOM   7612  C CD  . ARG D 1 173 ? -14.423 -4.555  25.750  1.00 60.58  ? 153 ARG D CD  1 
ATOM   7613  N NE  . ARG D 1 173 ? -13.531 -5.482  26.414  1.00 61.74  ? 153 ARG D NE  1 
ATOM   7614  C CZ  . ARG D 1 173 ? -13.939 -6.593  26.998  1.00 61.59  ? 153 ARG D CZ  1 
ATOM   7615  N NH1 . ARG D 1 173 ? -15.223 -6.911  26.990  1.00 63.34  ? 153 ARG D NH1 1 
ATOM   7616  N NH2 . ARG D 1 173 ? -13.065 -7.384  27.594  1.00 64.18  ? 153 ARG D NH2 1 
ATOM   7617  N N   . GLY D 1 174 ? -9.888  -1.075  24.817  1.00 48.40  ? 154 GLY D N   1 
ATOM   7618  C CA  . GLY D 1 174 ? -8.532  -1.326  24.408  1.00 48.56  ? 154 GLY D CA  1 
ATOM   7619  C C   . GLY D 1 174 ? -8.375  -2.832  24.334  1.00 51.73  ? 154 GLY D C   1 
ATOM   7620  O O   . GLY D 1 174 ? -9.210  -3.593  24.839  1.00 52.26  ? 154 GLY D O   1 
ATOM   7621  N N   . ILE D 1 175 ? -7.311  -3.272  23.692  1.00 52.89  ? 155 ILE D N   1 
ATOM   7622  C CA  . ILE D 1 175 ? -7.125  -4.691  23.478  1.00 53.99  ? 155 ILE D CA  1 
ATOM   7623  C C   . ILE D 1 175 ? -6.818  -5.444  24.780  1.00 57.05  ? 155 ILE D C   1 
ATOM   7624  O O   . ILE D 1 175 ? -7.042  -6.646  24.881  1.00 54.07  ? 155 ILE D O   1 
ATOM   7625  C CB  . ILE D 1 175 ? -5.985  -4.932  22.487  1.00 51.99  ? 155 ILE D CB  1 
ATOM   7626  C CG1 . ILE D 1 175 ? -6.162  -6.312  21.857  1.00 51.89  ? 155 ILE D CG1 1 
ATOM   7627  C CG2 . ILE D 1 175 ? -4.626  -4.728  23.160  1.00 48.15  ? 155 ILE D CG2 1 
ATOM   7628  C CD1 . ILE D 1 175 ? -4.871  -6.901  21.365  1.00 55.00  ? 155 ILE D CD1 1 
ATOM   7629  N N   . ALA D 1 176 ? -6.284  -4.726  25.761  1.00 59.39  ? 156 ALA D N   1 
ATOM   7630  C CA  . ALA D 1 176 ? -5.897  -5.317  27.032  1.00 59.67  ? 156 ALA D CA  1 
ATOM   7631  C C   . ALA D 1 176 ? -6.915  -5.022  28.132  1.00 62.35  ? 156 ALA D C   1 
ATOM   7632  O O   . ALA D 1 176 ? -6.722  -5.398  29.281  1.00 65.99  ? 156 ALA D O   1 
ATOM   7633  C CB  . ALA D 1 176 ? -4.531  -4.791  27.430  1.00 56.72  ? 156 ALA D CB  1 
ATOM   7634  N N   . THR D 1 177 ? -7.991  -4.343  27.776  1.00 62.57  ? 157 THR D N   1 
ATOM   7635  C CA  . THR D 1 177 ? -9.006  -3.987  28.732  1.00 64.92  ? 157 THR D CA  1 
ATOM   7636  C C   . THR D 1 177 ? -9.664  -5.267  29.244  1.00 67.22  ? 157 THR D C   1 
ATOM   7637  O O   . THR D 1 177 ? -10.050 -6.133  28.461  1.00 63.86  ? 157 THR D O   1 
ATOM   7638  C CB  . THR D 1 177 ? -10.029 -3.034  28.085  1.00 66.14  ? 157 THR D CB  1 
ATOM   7639  O OG1 . THR D 1 177 ? -9.416  -1.752  27.889  1.00 64.85  ? 157 THR D OG1 1 
ATOM   7640  C CG2 . THR D 1 177 ? -11.261 -2.873  28.947  1.00 68.27  ? 157 THR D CG2 1 
ATOM   7641  N N   . SER D 1 178 ? -9.788  -5.370  30.565  1.00 68.59  ? 158 SER D N   1 
ATOM   7642  C CA  . SER D 1 178 ? -10.324 -6.575  31.194  1.00 68.66  ? 158 SER D CA  1 
ATOM   7643  C C   . SER D 1 178 ? -11.826 -6.536  31.077  1.00 65.43  ? 158 SER D C   1 
ATOM   7644  O O   . SER D 1 178 ? -12.420 -5.451  31.063  1.00 61.38  ? 158 SER D O   1 
ATOM   7645  C CB  . SER D 1 178 ? -9.929  -6.640  32.674  1.00 71.25  ? 158 SER D CB  1 
ATOM   7646  O OG  . SER D 1 178 ? -10.914 -6.037  33.513  1.00 74.63  ? 158 SER D OG  1 
ATOM   7647  N N   . GLN D 1 179 ? -12.453 -7.706  31.035  1.00 66.02  ? 159 GLN D N   1 
ATOM   7648  C CA  . GLN D 1 179 ? -13.923 -7.758  31.008  1.00 74.03  ? 159 GLN D CA  1 
ATOM   7649  C C   . GLN D 1 179 ? -14.578 -7.227  32.302  1.00 80.23  ? 159 GLN D C   1 
ATOM   7650  O O   . GLN D 1 179 ? -15.785 -6.950  32.354  1.00 81.94  ? 159 GLN D O   1 
ATOM   7651  C CB  . GLN D 1 179 ? -14.411 -9.174  30.751  1.00 71.24  ? 159 GLN D CB  1 
ATOM   7652  C CG  . GLN D 1 179 ? -15.931 -9.264  30.740  1.00 72.25  ? 159 GLN D CG  1 
ATOM   7653  C CD  . GLN D 1 179 ? -16.505 -9.333  29.352  1.00 74.97  ? 159 GLN D CD  1 
ATOM   7654  O OE1 . GLN D 1 179 ? -15.876 -9.853  28.437  1.00 78.67  ? 159 GLN D OE1 1 
ATOM   7655  N NE2 . GLN D 1 179 ? -17.710 -8.810  29.183  1.00 79.73  ? 159 GLN D NE2 1 
ATOM   7656  N N   . GLU D 1 180 ? -13.767 -7.069  33.333  1.00 84.38  ? 160 GLU D N   1 
ATOM   7657  C CA  . GLU D 1 180 ? -14.239 -6.648  34.637  1.00 86.95  ? 160 GLU D CA  1 
ATOM   7658  C C   . GLU D 1 180 ? -14.240 -5.140  34.646  1.00 81.52  ? 160 GLU D C   1 
ATOM   7659  O O   . GLU D 1 180 ? -15.147 -4.506  35.182  1.00 84.26  ? 160 GLU D O   1 
ATOM   7660  C CB  . GLU D 1 180 ? -13.311 -7.177  35.724  1.00 94.04  ? 160 GLU D CB  1 
ATOM   7661  C CG  . GLU D 1 180 ? -12.501 -8.388  35.279  1.00 100.11 ? 160 GLU D CG  1 
ATOM   7662  C CD  . GLU D 1 180 ? -12.487 -9.496  36.299  1.00 103.66 ? 160 GLU D CD  1 
ATOM   7663  O OE1 . GLU D 1 180 ? -12.161 -9.219  37.474  1.00 105.60 ? 160 GLU D OE1 1 
ATOM   7664  O OE2 . GLU D 1 180 ? -12.795 -10.645 35.915  1.00 104.89 ? 160 GLU D OE2 1 
ATOM   7665  N N   . THR D 1 181 ? -13.207 -4.567  34.047  1.00 74.97  ? 161 THR D N   1 
ATOM   7666  C CA  . THR D 1 181 ? -13.185 -3.137  33.826  1.00 69.45  ? 161 THR D CA  1 
ATOM   7667  C C   . THR D 1 181 ? -14.341 -2.724  32.929  1.00 69.32  ? 161 THR D C   1 
ATOM   7668  O O   . THR D 1 181 ? -14.973 -1.679  33.144  1.00 65.28  ? 161 THR D O   1 
ATOM   7669  C CB  . THR D 1 181 ? -11.880 -2.708  33.180  1.00 66.06  ? 161 THR D CB  1 
ATOM   7670  O OG1 . THR D 1 181 ? -10.800 -3.149  34.006  1.00 62.08  ? 161 THR D OG1 1 
ATOM   7671  C CG2 . THR D 1 181 ? -11.832 -1.204  33.055  1.00 66.24  ? 161 THR D CG2 1 
ATOM   7672  N N   . PHE D 1 182 ? -14.625 -3.544  31.923  1.00 65.28  ? 162 PHE D N   1 
ATOM   7673  C CA  . PHE D 1 182 ? -15.698 -3.208  31.021  1.00 64.28  ? 162 PHE D CA  1 
ATOM   7674  C C   . PHE D 1 182 ? -17.021 -3.281  31.762  1.00 66.16  ? 162 PHE D C   1 
ATOM   7675  O O   . PHE D 1 182 ? -17.806 -2.330  31.721  1.00 66.02  ? 162 PHE D O   1 
ATOM   7676  C CB  . PHE D 1 182 ? -15.736 -4.108  29.786  1.00 60.69  ? 162 PHE D CB  1 
ATOM   7677  C CG  . PHE D 1 182 ? -17.039 -4.025  29.051  1.00 59.25  ? 162 PHE D CG  1 
ATOM   7678  C CD1 . PHE D 1 182 ? -17.405 -2.857  28.405  1.00 60.78  ? 162 PHE D CD1 1 
ATOM   7679  C CD2 . PHE D 1 182 ? -17.926 -5.089  29.054  1.00 59.48  ? 162 PHE D CD2 1 
ATOM   7680  C CE1 . PHE D 1 182 ? -18.626 -2.762  27.757  1.00 60.84  ? 162 PHE D CE1 1 
ATOM   7681  C CE2 . PHE D 1 182 ? -19.149 -5.004  28.404  1.00 57.86  ? 162 PHE D CE2 1 
ATOM   7682  C CZ  . PHE D 1 182 ? -19.501 -3.841  27.756  1.00 58.59  ? 162 PHE D CZ  1 
ATOM   7683  N N   . ASP D 1 183 ? -17.260 -4.401  32.443  1.00 69.74  ? 163 ASP D N   1 
ATOM   7684  C CA  . ASP D 1 183 ? -18.552 -4.620  33.112  1.00 69.09  ? 163 ASP D CA  1 
ATOM   7685  C C   . ASP D 1 183 ? -18.852 -3.548  34.159  1.00 65.85  ? 163 ASP D C   1 
ATOM   7686  O O   . ASP D 1 183 ? -20.011 -3.166  34.339  1.00 60.10  ? 163 ASP D O   1 
ATOM   7687  C CB  . ASP D 1 183 ? -18.626 -6.018  33.723  1.00 69.49  ? 163 ASP D CB  1 
ATOM   7688  C CG  . ASP D 1 183 ? -18.875 -7.094  32.681  1.00 75.00  ? 163 ASP D CG  1 
ATOM   7689  O OD1 . ASP D 1 183 ? -19.460 -6.791  31.615  1.00 77.53  ? 163 ASP D OD1 1 
ATOM   7690  O OD2 . ASP D 1 183 ? -18.493 -8.257  32.929  1.00 79.50  ? 163 ASP D OD2 1 
ATOM   7691  N N   . ALA D 1 184 ? -17.803 -3.051  34.816  1.00 62.98  ? 164 ALA D N   1 
ATOM   7692  C CA  . ALA D 1 184 ? -17.930 -1.952  35.768  1.00 66.19  ? 164 ALA D CA  1 
ATOM   7693  C C   . ALA D 1 184 ? -18.470 -0.706  35.085  1.00 69.57  ? 164 ALA D C   1 
ATOM   7694  O O   . ALA D 1 184 ? -19.525 -0.200  35.464  1.00 69.55  ? 164 ALA D O   1 
ATOM   7695  C CB  . ALA D 1 184 ? -16.582 -1.645  36.400  1.00 66.78  ? 164 ALA D CB  1 
ATOM   7696  N N   . VAL D 1 185 ? -17.744 -0.252  34.063  1.00 71.10  ? 165 VAL D N   1 
ATOM   7697  C CA  . VAL D 1 185 ? -18.044 0.985   33.332  1.00 67.19  ? 165 VAL D CA  1 
ATOM   7698  C C   . VAL D 1 185 ? -19.405 0.909   32.642  1.00 67.13  ? 165 VAL D C   1 
ATOM   7699  O O   . VAL D 1 185 ? -20.120 1.908   32.528  1.00 62.73  ? 165 VAL D O   1 
ATOM   7700  C CB  . VAL D 1 185 ? -16.945 1.291   32.301  1.00 64.28  ? 165 VAL D CB  1 
ATOM   7701  C CG1 . VAL D 1 185 ? -17.291 2.522   31.493  1.00 65.15  ? 165 VAL D CG1 1 
ATOM   7702  C CG2 . VAL D 1 185 ? -15.628 1.538   33.006  1.00 62.59  ? 165 VAL D CG2 1 
ATOM   7703  N N   . LYS D 1 186 ? -19.755 -0.286  32.182  1.00 70.68  ? 166 LYS D N   1 
ATOM   7704  C CA  . LYS D 1 186 ? -21.080 -0.524  31.642  1.00 71.97  ? 166 LYS D CA  1 
ATOM   7705  C C   . LYS D 1 186 ? -22.136 -0.265  32.708  1.00 75.15  ? 166 LYS D C   1 
ATOM   7706  O O   . LYS D 1 186 ? -23.109 0.447   32.463  1.00 75.04  ? 166 LYS D O   1 
ATOM   7707  C CB  . LYS D 1 186 ? -21.190 -1.957  31.147  1.00 71.04  ? 166 LYS D CB  1 
ATOM   7708  C CG  . LYS D 1 186 ? -22.489 -2.256  30.426  1.00 71.65  ? 166 LYS D CG  1 
ATOM   7709  C CD  . LYS D 1 186 ? -22.636 -3.751  30.210  1.00 73.95  ? 166 LYS D CD  1 
ATOM   7710  C CE  . LYS D 1 186 ? -23.998 -4.097  29.631  1.00 76.05  ? 166 LYS D CE  1 
ATOM   7711  N NZ  . LYS D 1 186 ? -24.083 -5.547  29.299  1.00 77.54  ? 166 LYS D NZ  1 
ATOM   7712  N N   . GLU D 1 187 ? -21.930 -0.837  33.893  1.00 81.59  ? 167 GLU D N   1 
ATOM   7713  C CA  . GLU D 1 187 ? -22.893 -0.700  34.999  1.00 84.21  ? 167 GLU D CA  1 
ATOM   7714  C C   . GLU D 1 187 ? -23.003 0.741   35.466  1.00 75.64  ? 167 GLU D C   1 
ATOM   7715  O O   . GLU D 1 187 ? -24.092 1.239   35.731  1.00 68.43  ? 167 GLU D O   1 
ATOM   7716  C CB  . GLU D 1 187 ? -22.512 -1.597  36.184  1.00 92.56  ? 167 GLU D CB  1 
ATOM   7717  C CG  . GLU D 1 187 ? -23.283 -2.915  36.236  1.00 98.55  ? 167 GLU D CG  1 
ATOM   7718  C CD  . GLU D 1 187 ? -22.485 -4.070  36.837  1.00 104.35 ? 167 GLU D CD  1 
ATOM   7719  O OE1 . GLU D 1 187 ? -21.267 -3.926  37.081  1.00 109.50 ? 167 GLU D OE1 1 
ATOM   7720  O OE2 . GLU D 1 187 ? -23.082 -5.143  37.065  1.00 107.66 ? 167 GLU D OE2 1 
ATOM   7721  N N   . THR D 1 188 ? -21.865 1.415   35.532  1.00 69.09  ? 168 THR D N   1 
ATOM   7722  C CA  . THR D 1 188 ? -21.836 2.795   36.011  1.00 69.40  ? 168 THR D CA  1 
ATOM   7723  C C   . THR D 1 188 ? -22.292 3.783   34.930  1.00 71.70  ? 168 THR D C   1 
ATOM   7724  O O   . THR D 1 188 ? -22.523 4.960   35.214  1.00 71.60  ? 168 THR D O   1 
ATOM   7725  C CB  . THR D 1 188 ? -20.473 3.203   36.649  1.00 66.85  ? 168 THR D CB  1 
ATOM   7726  O OG1 . THR D 1 188 ? -20.126 4.536   36.262  1.00 63.54  ? 168 THR D OG1 1 
ATOM   7727  C CG2 . THR D 1 188 ? -19.347 2.278   36.267  1.00 66.74  ? 168 THR D CG2 1 
ATOM   7728  N N   . SER D 1 189 ? -22.431 3.311   33.696  1.00 74.02  ? 169 SER D N   1 
ATOM   7729  C CA  . SER D 1 189 ? -22.973 4.151   32.634  1.00 73.99  ? 169 SER D CA  1 
ATOM   7730  C C   . SER D 1 189 ? -24.492 4.103   32.683  1.00 71.88  ? 169 SER D C   1 
ATOM   7731  O O   . SER D 1 189 ? -25.167 5.108   32.453  1.00 65.49  ? 169 SER D O   1 
ATOM   7732  C CB  . SER D 1 189 ? -22.466 3.686   31.273  1.00 74.05  ? 169 SER D CB  1 
ATOM   7733  O OG  . SER D 1 189 ? -21.068 3.888   31.148  1.00 71.49  ? 169 SER D OG  1 
ATOM   7734  N N   . ILE D 1 190 ? -25.020 2.922   32.987  1.00 71.98  ? 170 ILE D N   1 
ATOM   7735  C CA  . ILE D 1 190 ? -26.453 2.751   33.190  1.00 73.37  ? 170 ILE D CA  1 
ATOM   7736  C C   . ILE D 1 190 ? -26.839 3.431   34.494  1.00 74.35  ? 170 ILE D C   1 
ATOM   7737  O O   . ILE D 1 190 ? -27.890 4.069   34.591  1.00 66.47  ? 170 ILE D O   1 
ATOM   7738  C CB  . ILE D 1 190 ? -26.848 1.272   33.248  1.00 73.46  ? 170 ILE D CB  1 
ATOM   7739  C CG1 . ILE D 1 190 ? -26.495 0.604   31.918  1.00 72.60  ? 170 ILE D CG1 1 
ATOM   7740  C CG2 . ILE D 1 190 ? -28.342 1.126   33.533  1.00 74.22  ? 170 ILE D CG2 1 
ATOM   7741  C CD1 . ILE D 1 190 ? -26.641 -0.901  31.915  1.00 70.69  ? 170 ILE D CD1 1 
ATOM   7742  N N   . ALA D 1 191 ? -25.964 3.306   35.486  1.00 76.85  ? 171 ALA D N   1 
ATOM   7743  C CA  . ALA D 1 191 ? -26.140 3.996   36.754  1.00 77.23  ? 171 ALA D CA  1 
ATOM   7744  C C   . ALA D 1 191 ? -26.524 5.443   36.514  1.00 75.91  ? 171 ALA D C   1 
ATOM   7745  O O   . ALA D 1 191 ? -27.502 5.942   37.071  1.00 78.38  ? 171 ALA D O   1 
ATOM   7746  C CB  . ALA D 1 191 ? -24.859 3.943   37.560  1.00 78.98  ? 171 ALA D CB  1 
ATOM   7747  N N   . ILE D 1 192 ? -25.759 6.110   35.660  1.00 72.24  ? 172 ILE D N   1 
ATOM   7748  C CA  . ILE D 1 192 ? -26.006 7.523   35.383  1.00 71.68  ? 172 ILE D CA  1 
ATOM   7749  C C   . ILE D 1 192 ? -27.016 7.778   34.259  1.00 70.35  ? 172 ILE D C   1 
ATOM   7750  O O   . ILE D 1 192 ? -27.061 8.871   33.687  1.00 66.72  ? 172 ILE D O   1 
ATOM   7751  C CB  . ILE D 1 192 ? -24.704 8.273   35.092  1.00 72.35  ? 172 ILE D CB  1 
ATOM   7752  C CG1 . ILE D 1 192 ? -24.106 7.838   33.758  1.00 70.71  ? 172 ILE D CG1 1 
ATOM   7753  C CG2 . ILE D 1 192 ? -23.714 8.015   36.212  1.00 75.08  ? 172 ILE D CG2 1 
ATOM   7754  C CD1 . ILE D 1 192 ? -23.048 8.794   33.261  1.00 69.60  ? 172 ILE D CD1 1 
ATOM   7755  N N   . GLY D 1 193 ? -27.833 6.774   33.954  1.00 72.72  ? 173 GLY D N   1 
ATOM   7756  C CA  . GLY D 1 193 ? -28.973 6.955   33.067  1.00 75.11  ? 173 GLY D CA  1 
ATOM   7757  C C   . GLY D 1 193 ? -28.637 6.852   31.598  1.00 79.41  ? 173 GLY D C   1 
ATOM   7758  O O   . GLY D 1 193 ? -29.501 7.089   30.749  1.00 80.96  ? 173 GLY D O   1 
ATOM   7759  N N   . LYS D 1 194 ? -27.394 6.474   31.299  1.00 79.20  ? 174 LYS D N   1 
ATOM   7760  C CA  . LYS D 1 194 ? -26.944 6.333   29.923  1.00 76.76  ? 174 LYS D CA  1 
ATOM   7761  C C   . LYS D 1 194 ? -27.130 4.913   29.409  1.00 74.77  ? 174 LYS D C   1 
ATOM   7762  O O   . LYS D 1 194 ? -27.457 3.985   30.162  1.00 74.53  ? 174 LYS D O   1 
ATOM   7763  C CB  . LYS D 1 194 ? -25.482 6.734   29.798  1.00 78.08  ? 174 LYS D CB  1 
ATOM   7764  C CG  . LYS D 1 194 ? -25.189 8.109   30.351  1.00 80.12  ? 174 LYS D CG  1 
ATOM   7765  C CD  . LYS D 1 194 ? -25.700 9.214   29.449  1.00 79.95  ? 174 LYS D CD  1 
ATOM   7766  C CE  . LYS D 1 194 ? -24.902 10.481  29.688  1.00 79.14  ? 174 LYS D CE  1 
ATOM   7767  N NZ  . LYS D 1 194 ? -25.709 11.677  29.351  1.00 77.69  ? 174 LYS D NZ  1 
ATOM   7768  N N   . ASP D 1 195 ? -26.904 4.765   28.111  1.00 68.15  ? 175 ASP D N   1 
ATOM   7769  C CA  . ASP D 1 195 ? -27.185 3.535   27.412  1.00 66.93  ? 175 ASP D CA  1 
ATOM   7770  C C   . ASP D 1 195 ? -25.959 3.079   26.618  1.00 67.68  ? 175 ASP D C   1 
ATOM   7771  O O   . ASP D 1 195 ? -25.822 3.404   25.442  1.00 65.91  ? 175 ASP D O   1 
ATOM   7772  C CB  . ASP D 1 195 ? -28.369 3.769   26.492  1.00 66.50  ? 175 ASP D CB  1 
ATOM   7773  C CG  . ASP D 1 195 ? -29.094 2.504   26.176  1.00 69.40  ? 175 ASP D CG  1 
ATOM   7774  O OD1 . ASP D 1 195 ? -28.525 1.422   26.417  1.00 74.61  ? 175 ASP D OD1 1 
ATOM   7775  O OD2 . ASP D 1 195 ? -30.236 2.575   25.690  1.00 69.98  ? 175 ASP D OD2 1 
ATOM   7776  N N   . PRO D 1 196 ? -25.065 2.312   27.263  1.00 70.03  ? 176 PRO D N   1 
ATOM   7777  C CA  . PRO D 1 196 ? -23.760 2.042   26.689  1.00 65.85  ? 176 PRO D CA  1 
ATOM   7778  C C   . PRO D 1 196 ? -23.759 0.926   25.674  1.00 62.11  ? 176 PRO D C   1 
ATOM   7779  O O   . PRO D 1 196 ? -24.620 0.043   25.694  1.00 62.13  ? 176 PRO D O   1 
ATOM   7780  C CB  . PRO D 1 196 ? -22.913 1.616   27.900  1.00 67.58  ? 176 PRO D CB  1 
ATOM   7781  C CG  . PRO D 1 196 ? -23.833 1.600   29.065  1.00 67.94  ? 176 PRO D CG  1 
ATOM   7782  C CD  . PRO D 1 196 ? -25.224 1.606   28.541  1.00 69.79  ? 176 PRO D CD  1 
ATOM   7783  N N   . VAL D 1 197 ? -22.766 0.970   24.804  1.00 59.06  ? 177 VAL D N   1 
ATOM   7784  C CA  . VAL D 1 197 ? -22.577 -0.069  23.810  1.00 57.58  ? 177 VAL D CA  1 
ATOM   7785  C C   . VAL D 1 197 ? -21.138 -0.506  23.916  1.00 56.48  ? 177 VAL D C   1 
ATOM   7786  O O   . VAL D 1 197 ? -20.255 0.289   24.287  1.00 54.25  ? 177 VAL D O   1 
ATOM   7787  C CB  . VAL D 1 197 ? -22.898 0.434   22.399  1.00 57.15  ? 177 VAL D CB  1 
ATOM   7788  C CG1 . VAL D 1 197 ? -24.390 0.657   22.268  1.00 55.85  ? 177 VAL D CG1 1 
ATOM   7789  C CG2 . VAL D 1 197 ? -22.176 1.741   22.126  1.00 57.88  ? 177 VAL D CG2 1 
ATOM   7790  N N   . GLU D 1 198 ? -20.906 -1.777  23.628  1.00 53.55  ? 178 GLU D N   1 
ATOM   7791  C CA  . GLU D 1 198 ? -19.572 -2.323  23.766  1.00 55.29  ? 178 GLU D CA  1 
ATOM   7792  C C   . GLU D 1 198 ? -18.850 -2.246  22.432  1.00 54.20  ? 178 GLU D C   1 
ATOM   7793  O O   . GLU D 1 198 ? -19.292 -2.817  21.423  1.00 49.66  ? 178 GLU D O   1 
ATOM   7794  C CB  . GLU D 1 198 ? -19.635 -3.760  24.239  1.00 55.50  ? 178 GLU D CB  1 
ATOM   7795  C CG  . GLU D 1 198 ? -18.308 -4.319  24.713  1.00 57.78  ? 178 GLU D CG  1 
ATOM   7796  C CD  . GLU D 1 198 ? -18.377 -5.825  24.850  1.00 62.36  ? 178 GLU D CD  1 
ATOM   7797  O OE1 . GLU D 1 198 ? -19.505 -6.368  24.817  1.00 63.62  ? 178 GLU D OE1 1 
ATOM   7798  O OE2 . GLU D 1 198 ? -17.314 -6.471  24.981  1.00 60.68  ? 178 GLU D OE2 1 
ATOM   7799  N N   . VAL D 1 199 ? -17.733 -1.540  22.429  1.00 52.03  ? 179 VAL D N   1 
ATOM   7800  C CA  . VAL D 1 199 ? -16.978 -1.394  21.211  1.00 50.59  ? 179 VAL D CA  1 
ATOM   7801  C C   . VAL D 1 199 ? -15.541 -1.800  21.433  1.00 50.61  ? 179 VAL D C   1 
ATOM   7802  O O   . VAL D 1 199 ? -14.926 -1.445  22.438  1.00 51.18  ? 179 VAL D O   1 
ATOM   7803  C CB  . VAL D 1 199 ? -17.019 0.043   20.679  1.00 49.90  ? 179 VAL D CB  1 
ATOM   7804  C CG1 . VAL D 1 199 ? -16.583 0.063   19.227  1.00 50.99  ? 179 VAL D CG1 1 
ATOM   7805  C CG2 . VAL D 1 199 ? -18.420 0.609   20.786  1.00 47.58  ? 179 VAL D CG2 1 
ATOM   7806  N N   . ALA D 1 200 ? -15.018 -2.558  20.480  1.00 49.34  ? 180 ALA D N   1 
ATOM   7807  C CA  . ALA D 1 200 ? -13.614 -2.889  20.479  1.00 49.63  ? 180 ALA D CA  1 
ATOM   7808  C C   . ALA D 1 200 ? -12.877 -1.829  19.689  1.00 46.57  ? 180 ALA D C   1 
ATOM   7809  O O   . ALA D 1 200 ? -13.297 -1.481  18.600  1.00 43.58  ? 180 ALA D O   1 
ATOM   7810  C CB  . ALA D 1 200 ? -13.420 -4.238  19.843  1.00 48.37  ? 180 ALA D CB  1 
ATOM   7811  N N   . GLU D 1 201 ? -11.770 -1.331  20.220  1.00 46.32  ? 181 GLU D N   1 
ATOM   7812  C CA  . GLU D 1 201 ? -11.026 -0.283  19.535  1.00 48.69  ? 181 GLU D CA  1 
ATOM   7813  C C   . GLU D 1 201 ? -10.856 -0.535  18.034  1.00 51.33  ? 181 GLU D C   1 
ATOM   7814  O O   . GLU D 1 201 ? -10.444 -1.621  17.604  1.00 51.28  ? 181 GLU D O   1 
ATOM   7815  C CB  . GLU D 1 201 ? -9.653  -0.106  20.151  1.00 49.03  ? 181 GLU D CB  1 
ATOM   7816  C CG  . GLU D 1 201 ? -8.936  1.139   19.647  1.00 50.30  ? 181 GLU D CG  1 
ATOM   7817  C CD  . GLU D 1 201 ? -7.521  1.254   20.182  1.00 52.64  ? 181 GLU D CD  1 
ATOM   7818  O OE1 . GLU D 1 201 ? -7.295  0.919   21.365  1.00 58.61  ? 181 GLU D OE1 1 
ATOM   7819  O OE2 . GLU D 1 201 ? -6.630  1.692   19.429  1.00 51.93  ? 181 GLU D OE2 1 
ATOM   7820  N N   . ALA D 1 202 ? -11.182 0.500   17.264  1.00 50.37  ? 182 ALA D N   1 
ATOM   7821  C CA  . ALA D 1 202 ? -11.016 0.535   15.805  1.00 48.60  ? 182 ALA D CA  1 
ATOM   7822  C C   . ALA D 1 202 ? -11.358 1.967   15.401  1.00 48.85  ? 182 ALA D C   1 
ATOM   7823  O O   . ALA D 1 202 ? -12.029 2.674   16.163  1.00 48.76  ? 182 ALA D O   1 
ATOM   7824  C CB  . ALA D 1 202 ? -11.936 -0.463  15.115  1.00 47.36  ? 182 ALA D CB  1 
ATOM   7825  N N   . PRO D 1 203 ? -10.892 2.417   14.226  1.00 48.76  ? 183 PRO D N   1 
ATOM   7826  C CA  . PRO D 1 203 ? -10.976 3.848   13.909  1.00 46.50  ? 183 PRO D CA  1 
ATOM   7827  C C   . PRO D 1 203 ? -12.404 4.360   13.758  1.00 45.09  ? 183 PRO D C   1 
ATOM   7828  O O   . PRO D 1 203 ? -13.149 3.867   12.925  1.00 48.38  ? 183 PRO D O   1 
ATOM   7829  C CB  . PRO D 1 203 ? -10.235 3.946   12.579  1.00 46.67  ? 183 PRO D CB  1 
ATOM   7830  C CG  . PRO D 1 203 ? -9.310  2.781   12.588  1.00 46.40  ? 183 PRO D CG  1 
ATOM   7831  C CD  . PRO D 1 203 ? -10.124 1.690   13.204  1.00 48.52  ? 183 PRO D CD  1 
ATOM   7832  N N   . GLY D 1 204 ? -12.782 5.329   14.585  1.00 42.14  ? 184 GLY D N   1 
ATOM   7833  C CA  . GLY D 1 204 ? -14.111 5.903   14.524  1.00 40.97  ? 184 GLY D CA  1 
ATOM   7834  C C   . GLY D 1 204 ? -15.161 5.132   15.298  1.00 42.09  ? 184 GLY D C   1 
ATOM   7835  O O   . GLY D 1 204 ? -16.339 5.496   15.250  1.00 42.67  ? 184 GLY D O   1 
ATOM   7836  N N   . PHE D 1 205 ? -14.756 4.080   16.013  1.00 40.33  ? 185 PHE D N   1 
ATOM   7837  C CA  . PHE D 1 205 ? -15.690 3.314   16.827  1.00 40.44  ? 185 PHE D CA  1 
ATOM   7838  C C   . PHE D 1 205 ? -16.853 2.916   15.957  1.00 41.95  ? 185 PHE D C   1 
ATOM   7839  O O   . PHE D 1 205 ? -16.615 2.307   14.921  1.00 44.93  ? 185 PHE D O   1 
ATOM   7840  C CB  . PHE D 1 205 ? -16.127 4.133   18.029  1.00 40.35  ? 185 PHE D CB  1 
ATOM   7841  C CG  . PHE D 1 205 ? -14.989 4.707   18.776  1.00 40.96  ? 185 PHE D CG  1 
ATOM   7842  C CD1 . PHE D 1 205 ? -13.785 4.032   18.830  1.00 42.49  ? 185 PHE D CD1 1 
ATOM   7843  C CD2 . PHE D 1 205 ? -15.104 5.922   19.411  1.00 45.17  ? 185 PHE D CD2 1 
ATOM   7844  C CE1 . PHE D 1 205 ? -12.718 4.555   19.511  1.00 43.47  ? 185 PHE D CE1 1 
ATOM   7845  C CE2 . PHE D 1 205 ? -14.033 6.461   20.102  1.00 45.51  ? 185 PHE D CE2 1 
ATOM   7846  C CZ  . PHE D 1 205 ? -12.839 5.773   20.153  1.00 44.41  ? 185 PHE D CZ  1 
ATOM   7847  N N   . VAL D 1 206 ? -18.088 3.249   16.335  1.00 42.49  ? 186 VAL D N   1 
ATOM   7848  C CA  . VAL D 1 206 ? -19.218 2.937   15.474  1.00 44.72  ? 186 VAL D CA  1 
ATOM   7849  C C   . VAL D 1 206 ? -19.802 4.170   14.819  1.00 45.47  ? 186 VAL D C   1 
ATOM   7850  O O   . VAL D 1 206 ? -19.994 4.207   13.607  1.00 46.91  ? 186 VAL D O   1 
ATOM   7851  C CB  . VAL D 1 206 ? -20.337 2.184   16.210  1.00 46.61  ? 186 VAL D CB  1 
ATOM   7852  C CG1 . VAL D 1 206 ? -21.518 1.933   15.281  1.00 46.93  ? 186 VAL D CG1 1 
ATOM   7853  C CG2 . VAL D 1 206 ? -19.819 0.850   16.716  1.00 47.73  ? 186 VAL D CG2 1 
ATOM   7854  N N   . VAL D 1 207 ? -20.107 5.175   15.613  1.00 47.56  ? 187 VAL D N   1 
ATOM   7855  C CA  . VAL D 1 207 ? -20.872 6.306   15.107  1.00 46.40  ? 187 VAL D CA  1 
ATOM   7856  C C   . VAL D 1 207 ? -20.101 7.113   14.101  1.00 44.50  ? 187 VAL D C   1 
ATOM   7857  O O   . VAL D 1 207 ? -20.566 7.350   12.995  1.00 43.18  ? 187 VAL D O   1 
ATOM   7858  C CB  . VAL D 1 207 ? -21.258 7.253   16.240  1.00 47.84  ? 187 VAL D CB  1 
ATOM   7859  C CG1 . VAL D 1 207 ? -21.852 8.542   15.683  1.00 47.17  ? 187 VAL D CG1 1 
ATOM   7860  C CG2 . VAL D 1 207 ? -22.245 6.556   17.158  1.00 49.65  ? 187 VAL D CG2 1 
ATOM   7861  N N   . ASN D 1 208 ? -18.930 7.567   14.508  1.00 42.87  ? 188 ASN D N   1 
ATOM   7862  C CA  . ASN D 1 208 ? -18.128 8.391   13.640  1.00 43.30  ? 188 ASN D CA  1 
ATOM   7863  C C   . ASN D 1 208 ? -17.765 7.627   12.375  1.00 44.44  ? 188 ASN D C   1 
ATOM   7864  O O   . ASN D 1 208 ? -17.748 8.178   11.273  1.00 40.91  ? 188 ASN D O   1 
ATOM   7865  C CB  . ASN D 1 208 ? -16.862 8.825   14.365  1.00 42.42  ? 188 ASN D CB  1 
ATOM   7866  C CG  . ASN D 1 208 ? -17.098 9.992   15.298  1.00 41.81  ? 188 ASN D CG  1 
ATOM   7867  O OD1 . ASN D 1 208 ? -18.148 10.623  15.271  1.00 42.02  ? 188 ASN D OD1 1 
ATOM   7868  N ND2 . ASN D 1 208 ? -16.107 10.294  16.117  1.00 42.85  ? 188 ASN D ND2 1 
ATOM   7869  N N   . ARG D 1 209 ? -17.481 6.351   12.564  1.00 45.55  ? 189 ARG D N   1 
ATOM   7870  C CA  . ARG D 1 209 ? -17.034 5.490   11.495  1.00 47.93  ? 189 ARG D CA  1 
ATOM   7871  C C   . ARG D 1 209 ? -18.078 5.397   10.389  1.00 44.17  ? 189 ARG D C   1 
ATOM   7872  O O   . ARG D 1 209 ? -17.740 5.265   9.225   1.00 40.31  ? 189 ARG D O   1 
ATOM   7873  C CB  . ARG D 1 209 ? -16.739 4.106   12.080  1.00 52.88  ? 189 ARG D CB  1 
ATOM   7874  C CG  . ARG D 1 209 ? -16.386 3.029   11.078  1.00 57.26  ? 189 ARG D CG  1 
ATOM   7875  C CD  . ARG D 1 209 ? -15.070 3.369   10.447  1.00 61.60  ? 189 ARG D CD  1 
ATOM   7876  N NE  . ARG D 1 209 ? -14.680 2.365   9.479   1.00 66.46  ? 189 ARG D NE  1 
ATOM   7877  C CZ  . ARG D 1 209 ? -13.604 1.586   9.579   1.00 70.85  ? 189 ARG D CZ  1 
ATOM   7878  N NH1 . ARG D 1 209 ? -12.778 1.674   10.619  1.00 71.10  ? 189 ARG D NH1 1 
ATOM   7879  N NH2 . ARG D 1 209 ? -13.340 0.713   8.616   1.00 71.40  ? 189 ARG D NH2 1 
ATOM   7880  N N   . ILE D 1 210 ? -19.344 5.482   10.764  1.00 42.47  ? 190 ILE D N   1 
ATOM   7881  C CA  . ILE D 1 210 ? -20.437 5.422   9.806   1.00 43.11  ? 190 ILE D CA  1 
ATOM   7882  C C   . ILE D 1 210 ? -20.920 6.785   9.341   1.00 42.83  ? 190 ILE D C   1 
ATOM   7883  O O   . ILE D 1 210 ? -21.249 6.976   8.171   1.00 44.07  ? 190 ILE D O   1 
ATOM   7884  C CB  . ILE D 1 210 ? -21.643 4.727   10.444  1.00 43.51  ? 190 ILE D CB  1 
ATOM   7885  C CG1 . ILE D 1 210 ? -21.312 3.254   10.661  1.00 46.23  ? 190 ILE D CG1 1 
ATOM   7886  C CG2 . ILE D 1 210 ? -22.862 4.882   9.555   1.00 42.13  ? 190 ILE D CG2 1 
ATOM   7887  C CD1 . ILE D 1 210 ? -22.442 2.429   11.236  1.00 46.63  ? 190 ILE D CD1 1 
ATOM   7888  N N   . LEU D 1 211 ? -20.982 7.723   10.273  1.00 43.85  ? 191 LEU D N   1 
ATOM   7889  C CA  . LEU D 1 211 ? -21.700 8.965   10.060  1.00 42.14  ? 191 LEU D CA  1 
ATOM   7890  C C   . LEU D 1 211 ? -20.871 9.982   9.310   1.00 40.90  ? 191 LEU D C   1 
ATOM   7891  O O   . LEU D 1 211 ? -21.377 10.653  8.443   1.00 43.07  ? 191 LEU D O   1 
ATOM   7892  C CB  . LEU D 1 211 ? -22.114 9.541   11.404  1.00 41.37  ? 191 LEU D CB  1 
ATOM   7893  C CG  . LEU D 1 211 ? -23.031 10.762  11.352  1.00 42.79  ? 191 LEU D CG  1 
ATOM   7894  C CD1 . LEU D 1 211 ? -24.483 10.371  11.121  1.00 42.55  ? 191 LEU D CD1 1 
ATOM   7895  C CD2 . LEU D 1 211 ? -22.899 11.547  12.644  1.00 41.68  ? 191 LEU D CD2 1 
ATOM   7896  N N   . ILE D 1 212 ? -19.603 10.112  9.656   1.00 40.32  ? 192 ILE D N   1 
ATOM   7897  C CA  . ILE D 1 212 ? -18.776 11.156  9.062   1.00 40.66  ? 192 ILE D CA  1 
ATOM   7898  C C   . ILE D 1 212 ? -18.547 10.923  7.570   1.00 40.17  ? 192 ILE D C   1 
ATOM   7899  O O   . ILE D 1 212 ? -18.565 11.872  6.786   1.00 39.12  ? 192 ILE D O   1 
ATOM   7900  C CB  . ILE D 1 212 ? -17.428 11.297  9.790   1.00 41.76  ? 192 ILE D CB  1 
ATOM   7901  C CG1 . ILE D 1 212 ? -17.658 11.495  11.282  1.00 42.94  ? 192 ILE D CG1 1 
ATOM   7902  C CG2 . ILE D 1 212 ? -16.663 12.497  9.265   1.00 43.23  ? 192 ILE D CG2 1 
ATOM   7903  C CD1 . ILE D 1 212 ? -18.478 12.726  11.610  1.00 42.11  ? 192 ILE D CD1 1 
ATOM   7904  N N   . PRO D 1 213 ? -18.331 9.664   7.168   1.00 40.53  ? 193 PRO D N   1 
ATOM   7905  C CA  . PRO D 1 213 ? -18.129 9.376   5.750   1.00 40.67  ? 193 PRO D CA  1 
ATOM   7906  C C   . PRO D 1 213 ? -19.365 9.642   4.934   1.00 42.83  ? 193 PRO D C   1 
ATOM   7907  O O   . PRO D 1 213 ? -19.295 9.929   3.749   1.00 45.49  ? 193 PRO D O   1 
ATOM   7908  C CB  . PRO D 1 213 ? -17.785 7.896   5.750   1.00 38.77  ? 193 PRO D CB  1 
ATOM   7909  C CG  . PRO D 1 213 ? -17.074 7.735   7.030   1.00 39.47  ? 193 PRO D CG  1 
ATOM   7910  C CD  . PRO D 1 213 ? -17.878 8.540   7.998   1.00 39.16  ? 193 PRO D CD  1 
ATOM   7911  N N   . MET D 1 214 ? -20.497 9.556   5.598   1.00 45.06  ? 194 MET D N   1 
ATOM   7912  C CA  . MET D 1 214 ? -21.765 9.933   5.020   1.00 44.17  ? 194 MET D CA  1 
ATOM   7913  C C   . MET D 1 214 ? -21.828 11.428  4.724   1.00 41.88  ? 194 MET D C   1 
ATOM   7914  O O   . MET D 1 214 ? -22.430 11.872  3.744   1.00 40.19  ? 194 MET D O   1 
ATOM   7915  C CB  . MET D 1 214 ? -22.789 9.614   6.055   1.00 49.26  ? 194 MET D CB  1 
ATOM   7916  C CG  . MET D 1 214 ? -24.195 9.522   5.585   1.00 55.53  ? 194 MET D CG  1 
ATOM   7917  S SD  . MET D 1 214 ? -25.067 9.336   7.156   1.00 68.25  ? 194 MET D SD  1 
ATOM   7918  C CE  . MET D 1 214 ? -25.458 11.042  7.484   1.00 61.98  ? 194 MET D CE  1 
ATOM   7919  N N   . ILE D 1 215 ? -21.231 12.215  5.601   1.00 39.79  ? 195 ILE D N   1 
ATOM   7920  C CA  . ILE D 1 215 ? -21.157 13.646  5.362   1.00 40.40  ? 195 ILE D CA  1 
ATOM   7921  C C   . ILE D 1 215 ? -20.182 13.858  4.216   1.00 38.23  ? 195 ILE D C   1 
ATOM   7922  O O   . ILE D 1 215 ? -20.453 14.600  3.277   1.00 35.08  ? 195 ILE D O   1 
ATOM   7923  C CB  . ILE D 1 215 ? -20.716 14.397  6.623   1.00 40.07  ? 195 ILE D CB  1 
ATOM   7924  C CG1 . ILE D 1 215 ? -21.870 14.436  7.615   1.00 41.88  ? 195 ILE D CG1 1 
ATOM   7925  C CG2 . ILE D 1 215 ? -20.318 15.817  6.300   1.00 40.70  ? 195 ILE D CG2 1 
ATOM   7926  C CD1 . ILE D 1 215 ? -21.420 14.548  9.059   1.00 41.86  ? 195 ILE D CD1 1 
ATOM   7927  N N   . ASN D 1 216 ? -19.077 13.133  4.273   1.00 35.95  ? 196 ASN D N   1 
ATOM   7928  C CA  . ASN D 1 216 ? -18.047 13.280  3.286   1.00 34.88  ? 196 ASN D CA  1 
ATOM   7929  C C   . ASN D 1 216 ? -18.568 12.930  1.907   1.00 33.41  ? 196 ASN D C   1 
ATOM   7930  O O   . ASN D 1 216 ? -18.171 13.516  0.911   1.00 36.30  ? 196 ASN D O   1 
ATOM   7931  C CB  . ASN D 1 216 ? -16.886 12.395  3.666   1.00 35.73  ? 196 ASN D CB  1 
ATOM   7932  C CG  . ASN D 1 216 ? -15.663 12.657  2.833   1.00 35.07  ? 196 ASN D CG  1 
ATOM   7933  O OD1 . ASN D 1 216 ? -15.021 13.698  2.952   1.00 36.52  ? 196 ASN D OD1 1 
ATOM   7934  N ND2 . ASN D 1 216 ? -15.306 11.693  2.026   1.00 31.65  ? 196 ASN D ND2 1 
ATOM   7935  N N   . GLU D 1 217 ? -19.477 11.980  1.865   1.00 33.74  ? 197 GLU D N   1 
ATOM   7936  C CA  . GLU D 1 217 ? -20.043 11.536  0.617   1.00 34.27  ? 197 GLU D CA  1 
ATOM   7937  C C   . GLU D 1 217 ? -20.921 12.619  0.028   1.00 35.71  ? 197 GLU D C   1 
ATOM   7938  O O   . GLU D 1 217 ? -20.911 12.839  -1.186  1.00 35.06  ? 197 GLU D O   1 
ATOM   7939  C CB  . GLU D 1 217 ? -20.882 10.282  0.846   1.00 34.18  ? 197 GLU D CB  1 
ATOM   7940  C CG  . GLU D 1 217 ? -21.370 9.634   -0.444  1.00 35.33  ? 197 GLU D CG  1 
ATOM   7941  C CD  . GLU D 1 217 ? -20.229 9.084   -1.283  1.00 36.28  ? 197 GLU D CD  1 
ATOM   7942  O OE1 . GLU D 1 217 ? -19.230 8.599   -0.711  1.00 38.96  ? 197 GLU D OE1 1 
ATOM   7943  O OE2 . GLU D 1 217 ? -20.309 9.150   -2.517  1.00 37.90  ? 197 GLU D OE2 1 
ATOM   7944  N N   . ALA D 1 218 ? -21.706 13.254  0.898   1.00 36.66  ? 198 ALA D N   1 
ATOM   7945  C CA  . ALA D 1 218 ? -22.570 14.374  0.512   1.00 38.10  ? 198 ALA D CA  1 
ATOM   7946  C C   . ALA D 1 218 ? -21.804 15.549  -0.079  1.00 38.34  ? 198 ALA D C   1 
ATOM   7947  O O   . ALA D 1 218 ? -22.289 16.199  -1.003  1.00 38.88  ? 198 ALA D O   1 
ATOM   7948  C CB  . ALA D 1 218 ? -23.372 14.856  1.703   1.00 39.28  ? 198 ALA D CB  1 
ATOM   7949  N N   . VAL D 1 219 ? -20.618 15.832  0.444   1.00 37.14  ? 199 VAL D N   1 
ATOM   7950  C CA  . VAL D 1 219 ? -19.839 16.932  -0.122  1.00 39.05  ? 199 VAL D CA  1 
ATOM   7951  C C   . VAL D 1 219 ? -19.339 16.567  -1.504  1.00 37.01  ? 199 VAL D C   1 
ATOM   7952  O O   . VAL D 1 219 ? -19.263 17.420  -2.388  1.00 33.78  ? 199 VAL D O   1 
ATOM   7953  C CB  . VAL D 1 219 ? -18.708 17.469  0.797   1.00 41.60  ? 199 VAL D CB  1 
ATOM   7954  C CG1 . VAL D 1 219 ? -18.713 16.811  2.153   1.00 42.52  ? 199 VAL D CG1 1 
ATOM   7955  C CG2 . VAL D 1 219 ? -17.337 17.378  0.147   1.00 42.15  ? 199 VAL D CG2 1 
ATOM   7956  N N   . GLY D 1 220 ? -19.028 15.291  -1.686  1.00 36.99  ? 200 GLY D N   1 
ATOM   7957  C CA  . GLY D 1 220 ? -18.633 14.779  -2.994  1.00 35.45  ? 200 GLY D CA  1 
ATOM   7958  C C   . GLY D 1 220 ? -19.735 14.898  -4.025  1.00 35.41  ? 200 GLY D C   1 
ATOM   7959  O O   . GLY D 1 220 ? -19.480 15.191  -5.169  1.00 36.09  ? 200 GLY D O   1 
ATOM   7960  N N   . ILE D 1 221 ? -20.979 14.706  -3.621  1.00 37.61  ? 201 ILE D N   1 
ATOM   7961  C CA  . ILE D 1 221 ? -22.098 14.922  -4.537  1.00 38.66  ? 201 ILE D CA  1 
ATOM   7962  C C   . ILE D 1 221 ? -22.238 16.397  -4.875  1.00 37.77  ? 201 ILE D C   1 
ATOM   7963  O O   . ILE D 1 221 ? -22.553 16.763  -5.996  1.00 37.23  ? 201 ILE D O   1 
ATOM   7964  C CB  . ILE D 1 221 ? -23.399 14.415  -3.909  1.00 41.43  ? 201 ILE D CB  1 
ATOM   7965  C CG1 . ILE D 1 221 ? -23.376 12.897  -3.893  1.00 40.72  ? 201 ILE D CG1 1 
ATOM   7966  C CG2 . ILE D 1 221 ? -24.638 14.897  -4.657  1.00 41.92  ? 201 ILE D CG2 1 
ATOM   7967  C CD1 . ILE D 1 221 ? -24.264 12.320  -2.826  1.00 42.97  ? 201 ILE D CD1 1 
ATOM   7968  N N   . LEU D 1 222 ? -22.020 17.235  -3.878  1.00 37.90  ? 202 LEU D N   1 
ATOM   7969  C CA  . LEU D 1 222 ? -22.063 18.667  -4.063  1.00 35.95  ? 202 LEU D CA  1 
ATOM   7970  C C   . LEU D 1 222 ? -20.946 19.123  -4.986  1.00 35.15  ? 202 LEU D C   1 
ATOM   7971  O O   . LEU D 1 222 ? -21.169 19.871  -5.933  1.00 32.63  ? 202 LEU D O   1 
ATOM   7972  C CB  . LEU D 1 222 ? -21.946 19.373  -2.719  1.00 34.57  ? 202 LEU D CB  1 
ATOM   7973  C CG  . LEU D 1 222 ? -21.948 20.884  -2.880  1.00 35.49  ? 202 LEU D CG  1 
ATOM   7974  C CD1 . LEU D 1 222 ? -23.351 21.336  -3.246  1.00 35.01  ? 202 LEU D CD1 1 
ATOM   7975  C CD2 . LEU D 1 222 ? -21.461 21.547  -1.609  1.00 36.63  ? 202 LEU D CD2 1 
ATOM   7976  N N   . ALA D 1 223 ? -19.747 18.636  -4.719  1.00 35.73  ? 203 ALA D N   1 
ATOM   7977  C CA  . ALA D 1 223 ? -18.588 18.997  -5.513  1.00 34.63  ? 203 ALA D CA  1 
ATOM   7978  C C   . ALA D 1 223 ? -18.742 18.681  -6.990  1.00 35.15  ? 203 ALA D C   1 
ATOM   7979  O O   . ALA D 1 223 ? -18.231 19.420  -7.815  1.00 34.92  ? 203 ALA D O   1 
ATOM   7980  C CB  . ALA D 1 223 ? -17.364 18.298  -4.966  1.00 34.16  ? 203 ALA D CB  1 
ATOM   7981  N N   . GLU D 1 224 ? -19.428 17.593  -7.335  1.00 40.13  ? 204 GLU D N   1 
ATOM   7982  C CA  . GLU D 1 224 ? -19.577 17.220  -8.753  1.00 45.07  ? 204 GLU D CA  1 
ATOM   7983  C C   . GLU D 1 224 ? -20.814 17.849  -9.394  1.00 42.79  ? 204 GLU D C   1 
ATOM   7984  O O   . GLU D 1 224 ? -21.145 17.559  -10.538 1.00 41.03  ? 204 GLU D O   1 
ATOM   7985  C CB  . GLU D 1 224 ? -19.632 15.706  -8.945  1.00 54.25  ? 204 GLU D CB  1 
ATOM   7986  C CG  . GLU D 1 224 ? -18.791 14.901  -7.965  1.00 63.06  ? 204 GLU D CG  1 
ATOM   7987  C CD  . GLU D 1 224 ? -18.041 13.728  -8.594  1.00 70.73  ? 204 GLU D CD  1 
ATOM   7988  O OE1 . GLU D 1 224 ? -17.797 12.739  -7.862  1.00 78.44  ? 204 GLU D OE1 1 
ATOM   7989  O OE2 . GLU D 1 224 ? -17.690 13.781  -9.802  1.00 70.94  ? 204 GLU D OE2 1 
ATOM   7990  N N   . GLY D 1 225 ? -21.509 18.698  -8.655  1.00 39.92  ? 205 GLY D N   1 
ATOM   7991  C CA  . GLY D 1 225 ? -22.626 19.428  -9.206  1.00 38.72  ? 205 GLY D CA  1 
ATOM   7992  C C   . GLY D 1 225 ? -23.863 18.598  -9.420  1.00 39.01  ? 205 GLY D C   1 
ATOM   7993  O O   . GLY D 1 225 ? -24.692 18.960  -10.226 1.00 34.52  ? 205 GLY D O   1 
ATOM   7994  N N   . ILE D 1 226 ? -23.986 17.499  -8.679  1.00 40.80  ? 206 ILE D N   1 
ATOM   7995  C CA  . ILE D 1 226 ? -25.072 16.538  -8.867  1.00 43.08  ? 206 ILE D CA  1 
ATOM   7996  C C   . ILE D 1 226 ? -26.371 17.108  -8.362  1.00 41.38  ? 206 ILE D C   1 
ATOM   7997  O O   . ILE D 1 226 ? -27.426 16.944  -8.967  1.00 40.96  ? 206 ILE D O   1 
ATOM   7998  C CB  . ILE D 1 226 ? -24.766 15.237  -8.094  1.00 45.31  ? 206 ILE D CB  1 
ATOM   7999  C CG1 . ILE D 1 226 ? -23.534 14.544  -8.661  1.00 48.04  ? 206 ILE D CG1 1 
ATOM   8000  C CG2 . ILE D 1 226 ? -25.927 14.268  -8.136  1.00 45.38  ? 206 ILE D CG2 1 
ATOM   8001  C CD1 . ILE D 1 226 ? -23.349 14.750  -10.152 1.00 50.75  ? 206 ILE D CD1 1 
ATOM   8002  N N   . ALA D 1 227 ? -26.268 17.761  -7.226  1.00 40.36  ? 207 ALA D N   1 
ATOM   8003  C CA  . ALA D 1 227 ? -27.391 18.339  -6.579  1.00 40.28  ? 207 ALA D CA  1 
ATOM   8004  C C   . ALA D 1 227 ? -26.857 19.504  -5.786  1.00 41.35  ? 207 ALA D C   1 
ATOM   8005  O O   . ALA D 1 227 ? -25.645 19.633  -5.554  1.00 43.08  ? 207 ALA D O   1 
ATOM   8006  C CB  . ALA D 1 227 ? -28.030 17.319  -5.668  1.00 40.94  ? 207 ALA D CB  1 
ATOM   8007  N N   . SER D 1 228 ? -27.776 20.358  -5.379  1.00 40.41  ? 208 SER D N   1 
ATOM   8008  C CA  . SER D 1 228 ? -27.448 21.517  -4.576  1.00 41.41  ? 208 SER D CA  1 
ATOM   8009  C C   . SER D 1 228 ? -27.509 21.111  -3.125  1.00 41.11  ? 208 SER D C   1 
ATOM   8010  O O   . SER D 1 228 ? -28.089 20.078  -2.793  1.00 37.72  ? 208 SER D O   1 
ATOM   8011  C CB  . SER D 1 228 ? -28.469 22.605  -4.833  1.00 42.93  ? 208 SER D CB  1 
ATOM   8012  O OG  . SER D 1 228 ? -29.722 22.265  -4.255  1.00 45.43  ? 208 SER D OG  1 
ATOM   8013  N N   . VAL D 1 229 ? -26.941 21.929  -2.252  1.00 42.72  ? 209 VAL D N   1 
ATOM   8014  C CA  . VAL D 1 229 ? -26.855 21.534  -0.833  1.00 43.42  ? 209 VAL D CA  1 
ATOM   8015  C C   . VAL D 1 229 ? -28.258 21.466  -0.240  1.00 43.80  ? 209 VAL D C   1 
ATOM   8016  O O   . VAL D 1 229 ? -28.542 20.632  0.604   1.00 43.98  ? 209 VAL D O   1 
ATOM   8017  C CB  . VAL D 1 229 ? -25.892 22.396  0.047   1.00 43.30  ? 209 VAL D CB  1 
ATOM   8018  C CG1 . VAL D 1 229 ? -25.102 23.398  -0.777  1.00 43.83  ? 209 VAL D CG1 1 
ATOM   8019  C CG2 . VAL D 1 229 ? -26.610 23.101  1.185   1.00 40.72  ? 209 VAL D CG2 1 
ATOM   8020  N N   . GLU D 1 230 ? -29.141 22.330  -0.705  1.00 46.69  ? 210 GLU D N   1 
ATOM   8021  C CA  . GLU D 1 230 ? -30.493 22.335  -0.176  1.00 49.38  ? 210 GLU D CA  1 
ATOM   8022  C C   . GLU D 1 230 ? -31.151 21.033  -0.563  1.00 45.67  ? 210 GLU D C   1 
ATOM   8023  O O   . GLU D 1 230 ? -31.761 20.370  0.268   1.00 46.23  ? 210 GLU D O   1 
ATOM   8024  C CB  . GLU D 1 230 ? -31.308 23.528  -0.694  1.00 54.02  ? 210 GLU D CB  1 
ATOM   8025  C CG  . GLU D 1 230 ? -31.001 24.861  -0.003  1.00 60.88  ? 210 GLU D CG  1 
ATOM   8026  C CD  . GLU D 1 230 ? -29.768 25.599  -0.544  1.00 66.18  ? 210 GLU D CD  1 
ATOM   8027  O OE1 . GLU D 1 230 ? -29.313 25.318  -1.686  1.00 63.15  ? 210 GLU D OE1 1 
ATOM   8028  O OE2 . GLU D 1 230 ? -29.255 26.483  0.194   1.00 69.43  ? 210 GLU D OE2 1 
ATOM   8029  N N   . ASP D 1 231 ? -31.019 20.658  -1.826  1.00 44.11  ? 211 ASP D N   1 
ATOM   8030  C CA  . ASP D 1 231 ? -31.620 19.409  -2.302  1.00 44.69  ? 211 ASP D CA  1 
ATOM   8031  C C   . ASP D 1 231 ? -30.993 18.132  -1.724  1.00 43.02  ? 211 ASP D C   1 
ATOM   8032  O O   . ASP D 1 231 ? -31.687 17.143  -1.503  1.00 42.52  ? 211 ASP D O   1 
ATOM   8033  C CB  . ASP D 1 231 ? -31.568 19.362  -3.819  1.00 44.98  ? 211 ASP D CB  1 
ATOM   8034  C CG  . ASP D 1 231 ? -32.653 20.190  -4.446  1.00 47.30  ? 211 ASP D CG  1 
ATOM   8035  O OD1 . ASP D 1 231 ? -33.493 20.738  -3.684  1.00 48.22  ? 211 ASP D OD1 1 
ATOM   8036  O OD2 . ASP D 1 231 ? -32.684 20.284  -5.691  1.00 46.31  ? 211 ASP D OD2 1 
ATOM   8037  N N   . ILE D 1 232 ? -29.691 18.156  -1.488  1.00 40.71  ? 212 ILE D N   1 
ATOM   8038  C CA  . ILE D 1 232 ? -29.026 16.999  -0.939  1.00 39.87  ? 212 ILE D CA  1 
ATOM   8039  C C   . ILE D 1 232 ? -29.570 16.730  0.440   1.00 41.31  ? 212 ILE D C   1 
ATOM   8040  O O   . ILE D 1 232 ? -29.870 15.589  0.794   1.00 40.11  ? 212 ILE D O   1 
ATOM   8041  C CB  . ILE D 1 232 ? -27.516 17.220  -0.849  1.00 36.74  ? 212 ILE D CB  1 
ATOM   8042  C CG1 . ILE D 1 232 ? -26.907 17.031  -2.218  1.00 34.52  ? 212 ILE D CG1 1 
ATOM   8043  C CG2 . ILE D 1 232 ? -26.883 16.216  0.100   1.00 37.00  ? 212 ILE D CG2 1 
ATOM   8044  C CD1 . ILE D 1 232 ? -25.521 17.602  -2.324  1.00 35.30  ? 212 ILE D CD1 1 
ATOM   8045  N N   . ASP D 1 233 ? -29.700 17.794  1.217   1.00 43.15  ? 213 ASP D N   1 
ATOM   8046  C CA  . ASP D 1 233 ? -30.134 17.654  2.596   1.00 43.47  ? 213 ASP D CA  1 
ATOM   8047  C C   . ASP D 1 233 ? -31.590 17.251  2.629   1.00 43.84  ? 213 ASP D C   1 
ATOM   8048  O O   . ASP D 1 233 ? -32.012 16.458  3.455   1.00 44.72  ? 213 ASP D O   1 
ATOM   8049  C CB  . ASP D 1 233 ? -29.901 18.942  3.372   1.00 41.79  ? 213 ASP D CB  1 
ATOM   8050  C CG  . ASP D 1 233 ? -28.501 19.012  3.981   1.00 43.16  ? 213 ASP D CG  1 
ATOM   8051  O OD1 . ASP D 1 233 ? -27.644 18.163  3.667   1.00 38.74  ? 213 ASP D OD1 1 
ATOM   8052  O OD2 . ASP D 1 233 ? -28.258 19.921  4.796   1.00 45.91  ? 213 ASP D OD2 1 
ATOM   8053  N N   . LYS D 1 234 ? -32.348 17.760  1.681   1.00 46.15  ? 214 LYS D N   1 
ATOM   8054  C CA  . LYS D 1 234 ? -33.763 17.474  1.627   1.00 45.34  ? 214 LYS D CA  1 
ATOM   8055  C C   . LYS D 1 234 ? -34.038 16.063  1.173   1.00 43.78  ? 214 LYS D C   1 
ATOM   8056  O O   . LYS D 1 234 ? -34.944 15.420  1.660   1.00 47.92  ? 214 LYS D O   1 
ATOM   8057  C CB  . LYS D 1 234 ? -34.402 18.451  0.688   1.00 47.85  ? 214 LYS D CB  1 
ATOM   8058  C CG  . LYS D 1 234 ? -35.797 18.102  0.256   1.00 51.35  ? 214 LYS D CG  1 
ATOM   8059  C CD  . LYS D 1 234 ? -36.477 19.424  0.021   1.00 55.50  ? 214 LYS D CD  1 
ATOM   8060  C CE  . LYS D 1 234 ? -37.669 19.260  -0.860  1.00 59.97  ? 214 LYS D CE  1 
ATOM   8061  N NZ  . LYS D 1 234 ? -37.702 20.333  -1.884  1.00 63.89  ? 214 LYS D NZ  1 
ATOM   8062  N N   . ALA D 1 235 ? -33.257 15.580  0.227   1.00 43.59  ? 215 ALA D N   1 
ATOM   8063  C CA  . ALA D 1 235 ? -33.356 14.180  -0.197  1.00 43.19  ? 215 ALA D CA  1 
ATOM   8064  C C   . ALA D 1 235 ? -33.060 13.204  0.936   1.00 42.93  ? 215 ALA D C   1 
ATOM   8065  O O   . ALA D 1 235 ? -33.753 12.213  1.087   1.00 43.88  ? 215 ALA D O   1 
ATOM   8066  C CB  . ALA D 1 235 ? -32.412 13.916  -1.354  1.00 42.10  ? 215 ALA D CB  1 
ATOM   8067  N N   . MET D 1 236 ? -32.022 13.475  1.722   1.00 43.32  ? 216 MET D N   1 
ATOM   8068  C CA  . MET D 1 236 ? -31.696 12.607  2.859   1.00 44.57  ? 216 MET D CA  1 
ATOM   8069  C C   . MET D 1 236 ? -32.741 12.673  3.969   1.00 48.25  ? 216 MET D C   1 
ATOM   8070  O O   . MET D 1 236 ? -32.922 11.716  4.720   1.00 52.46  ? 216 MET D O   1 
ATOM   8071  C CB  . MET D 1 236 ? -30.315 12.940  3.438   1.00 42.90  ? 216 MET D CB  1 
ATOM   8072  C CG  . MET D 1 236 ? -29.148 12.587  2.539   1.00 43.74  ? 216 MET D CG  1 
ATOM   8073  S SD  . MET D 1 236 ? -29.391 11.005  1.698   1.00 46.84  ? 216 MET D SD  1 
ATOM   8074  C CE  . MET D 1 236 ? -29.050 9.896   3.056   1.00 44.38  ? 216 MET D CE  1 
ATOM   8075  N N   . LYS D 1 237 ? -33.430 13.797  4.084   1.00 50.76  ? 217 LYS D N   1 
ATOM   8076  C CA  . LYS D 1 237 ? -34.393 13.950  5.167   1.00 51.19  ? 217 LYS D CA  1 
ATOM   8077  C C   . LYS D 1 237 ? -35.673 13.209  4.856   1.00 46.45  ? 217 LYS D C   1 
ATOM   8078  O O   . LYS D 1 237 ? -36.225 12.521  5.701   1.00 46.57  ? 217 LYS D O   1 
ATOM   8079  C CB  . LYS D 1 237 ? -34.713 15.416  5.408   1.00 53.54  ? 217 LYS D CB  1 
ATOM   8080  C CG  . LYS D 1 237 ? -33.680 16.137  6.246   1.00 57.43  ? 217 LYS D CG  1 
ATOM   8081  C CD  . LYS D 1 237 ? -34.240 17.456  6.749   1.00 58.99  ? 217 LYS D CD  1 
ATOM   8082  C CE  . LYS D 1 237 ? -33.327 18.616  6.407   1.00 62.55  ? 217 LYS D CE  1 
ATOM   8083  N NZ  . LYS D 1 237 ? -34.134 19.846  6.233   1.00 63.17  ? 217 LYS D NZ  1 
ATOM   8084  N N   . LEU D 1 238 ? -36.147 13.371  3.638   1.00 42.54  ? 218 LEU D N   1 
ATOM   8085  C CA  . LEU D 1 238 ? -37.396 12.773  3.235   1.00 43.65  ? 218 LEU D CA  1 
ATOM   8086  C C   . LEU D 1 238 ? -37.188 11.339  2.820   1.00 45.17  ? 218 LEU D C   1 
ATOM   8087  O O   . LEU D 1 238 ? -38.036 10.493  3.063   1.00 48.39  ? 218 LEU D O   1 
ATOM   8088  C CB  . LEU D 1 238 ? -37.980 13.558  2.063   1.00 43.39  ? 218 LEU D CB  1 
ATOM   8089  C CG  . LEU D 1 238 ? -38.305 15.043  2.297   1.00 44.28  ? 218 LEU D CG  1 
ATOM   8090  C CD1 . LEU D 1 238 ? -39.178 15.535  1.154   1.00 44.54  ? 218 LEU D CD1 1 
ATOM   8091  C CD2 . LEU D 1 238 ? -38.993 15.286  3.641   1.00 42.45  ? 218 LEU D CD2 1 
ATOM   8092  N N   . GLY D 1 239 ? -36.058 11.088  2.167   1.00 46.98  ? 219 GLY D N   1 
ATOM   8093  C CA  . GLY D 1 239 ? -35.741 9.789   1.628   1.00 45.51  ? 219 GLY D CA  1 
ATOM   8094  C C   . GLY D 1 239 ? -35.276 8.840   2.703   1.00 47.28  ? 219 GLY D C   1 
ATOM   8095  O O   . GLY D 1 239 ? -35.646 7.682   2.693   1.00 50.81  ? 219 GLY D O   1 
ATOM   8096  N N   . ALA D 1 240 ? -34.461 9.310   3.635   1.00 48.42  ? 220 ALA D N   1 
ATOM   8097  C CA  . ALA D 1 240 ? -33.929 8.408   4.653   1.00 47.67  ? 220 ALA D CA  1 
ATOM   8098  C C   . ALA D 1 240 ? -34.541 8.652   5.996   1.00 50.19  ? 220 ALA D C   1 
ATOM   8099  O O   . ALA D 1 240 ? -34.188 7.959   6.949   1.00 50.33  ? 220 ALA D O   1 
ATOM   8100  C CB  . ALA D 1 240 ? -32.421 8.546   4.760   1.00 48.32  ? 220 ALA D CB  1 
ATOM   8101  N N   . ASN D 1 241 ? -35.426 9.649   6.077   1.00 54.66  ? 221 ASN D N   1 
ATOM   8102  C CA  . ASN D 1 241 ? -36.109 10.007  7.323   1.00 53.97  ? 221 ASN D CA  1 
ATOM   8103  C C   . ASN D 1 241 ? -35.126 10.464  8.388   1.00 50.03  ? 221 ASN D C   1 
ATOM   8104  O O   . ASN D 1 241 ? -35.277 10.155  9.556   1.00 45.20  ? 221 ASN D O   1 
ATOM   8105  C CB  . ASN D 1 241 ? -36.933 8.819   7.824   1.00 58.00  ? 221 ASN D CB  1 
ATOM   8106  C CG  . ASN D 1 241 ? -37.996 9.219   8.828   1.00 61.93  ? 221 ASN D CG  1 
ATOM   8107  O OD1 . ASN D 1 241 ? -38.523 10.329  8.794   1.00 65.09  ? 221 ASN D OD1 1 
ATOM   8108  N ND2 . ASN D 1 241 ? -38.317 8.304   9.733   1.00 64.01  ? 221 ASN D ND2 1 
ATOM   8109  N N   . HIS D 1 242 ? -34.103 11.187  7.969   1.00 51.40  ? 222 HIS D N   1 
ATOM   8110  C CA  . HIS D 1 242 ? -33.131 11.701  8.906   1.00 53.85  ? 222 HIS D CA  1 
ATOM   8111  C C   . HIS D 1 242 ? -33.613 13.055  9.401   1.00 53.50  ? 222 HIS D C   1 
ATOM   8112  O O   . HIS D 1 242 ? -34.294 13.783  8.674   1.00 45.86  ? 222 HIS D O   1 
ATOM   8113  C CB  . HIS D 1 242 ? -31.755 11.838  8.247   1.00 55.79  ? 222 HIS D CB  1 
ATOM   8114  C CG  . HIS D 1 242 ? -31.069 10.533  8.002   1.00 58.38  ? 222 HIS D CG  1 
ATOM   8115  N ND1 . HIS D 1 242 ? -29.852 10.443  7.363   1.00 61.24  ? 222 HIS D ND1 1 
ATOM   8116  C CD2 . HIS D 1 242 ? -31.432 9.264   8.300   1.00 59.03  ? 222 HIS D CD2 1 
ATOM   8117  C CE1 . HIS D 1 242 ? -29.490 9.176   7.289   1.00 56.97  ? 222 HIS D CE1 1 
ATOM   8118  N NE2 . HIS D 1 242 ? -30.432 8.440   7.848   1.00 58.39  ? 222 HIS D NE2 1 
ATOM   8119  N N   . PRO D 1 243 ? -33.243 13.400  10.637  1.00 57.10  ? 223 PRO D N   1 
ATOM   8120  C CA  . PRO D 1 243 ? -33.689 14.642  11.235  1.00 57.50  ? 223 PRO D CA  1 
ATOM   8121  C C   . PRO D 1 243 ? -32.957 15.843  10.644  1.00 57.19  ? 223 PRO D C   1 
ATOM   8122  O O   . PRO D 1 243 ? -33.536 16.912  10.544  1.00 57.18  ? 223 PRO D O   1 
ATOM   8123  C CB  . PRO D 1 243 ? -33.329 14.455  12.703  1.00 56.97  ? 223 PRO D CB  1 
ATOM   8124  C CG  . PRO D 1 243 ? -32.086 13.624  12.666  1.00 59.60  ? 223 PRO D CG  1 
ATOM   8125  C CD  . PRO D 1 243 ? -32.221 12.726  11.465  1.00 58.94  ? 223 PRO D CD  1 
ATOM   8126  N N   . MET D 1 244 ? -31.698 15.647  10.262  1.00 56.09  ? 224 MET D N   1 
ATOM   8127  C CA  . MET D 1 244 ? -30.904 16.650  9.580   1.00 54.34  ? 224 MET D CA  1 
ATOM   8128  C C   . MET D 1 244 ? -30.331 16.074  8.294   1.00 50.32  ? 224 MET D C   1 
ATOM   8129  O O   . MET D 1 244 ? -30.009 14.893  8.215   1.00 48.08  ? 224 MET D O   1 
ATOM   8130  C CB  . MET D 1 244 ? -29.746 17.096  10.475  1.00 58.48  ? 224 MET D CB  1 
ATOM   8131  C CG  . MET D 1 244 ? -30.013 18.388  11.223  1.00 62.91  ? 224 MET D CG  1 
ATOM   8132  S SD  . MET D 1 244 ? -28.533 19.100  11.955  1.00 66.65  ? 224 MET D SD  1 
ATOM   8133  C CE  . MET D 1 244 ? -28.460 18.174  13.488  1.00 67.80  ? 224 MET D CE  1 
ATOM   8134  N N   . GLY D 1 245 ? -30.189 16.928  7.290   1.00 47.49  ? 225 GLY D N   1 
ATOM   8135  C CA  . GLY D 1 245 ? -29.396 16.600  6.114   1.00 41.78  ? 225 GLY D CA  1 
ATOM   8136  C C   . GLY D 1 245 ? -27.930 16.550  6.512   1.00 38.99  ? 225 GLY D C   1 
ATOM   8137  O O   . GLY D 1 245 ? -27.532 17.100  7.533   1.00 38.89  ? 225 GLY D O   1 
ATOM   8138  N N   . PRO D 1 246 ? -27.120 15.849  5.729   1.00 36.77  ? 226 PRO D N   1 
ATOM   8139  C CA  . PRO D 1 246 ? -25.743 15.626  6.106   1.00 36.04  ? 226 PRO D CA  1 
ATOM   8140  C C   . PRO D 1 246 ? -24.876 16.871  6.046   1.00 37.32  ? 226 PRO D C   1 
ATOM   8141  O O   . PRO D 1 246 ? -23.913 16.982  6.802   1.00 36.30  ? 226 PRO D O   1 
ATOM   8142  C CB  . PRO D 1 246 ? -25.270 14.590  5.089   1.00 34.63  ? 226 PRO D CB  1 
ATOM   8143  C CG  . PRO D 1 246 ? -26.234 14.694  3.968   1.00 36.04  ? 226 PRO D CG  1 
ATOM   8144  C CD  . PRO D 1 246 ? -27.532 14.982  4.619   1.00 36.17  ? 226 PRO D CD  1 
ATOM   8145  N N   . LEU D 1 247 ? -25.185 17.796  5.154   1.00 40.51  ? 227 LEU D N   1 
ATOM   8146  C CA  . LEU D 1 247 ? -24.337 18.973  5.007   1.00 43.02  ? 227 LEU D CA  1 
ATOM   8147  C C   . LEU D 1 247 ? -24.611 19.926  6.144   1.00 43.96  ? 227 LEU D C   1 
ATOM   8148  O O   . LEU D 1 247 ? -23.717 20.492  6.760   1.00 46.02  ? 227 LEU D O   1 
ATOM   8149  C CB  . LEU D 1 247 ? -24.583 19.624  3.657   1.00 43.96  ? 227 LEU D CB  1 
ATOM   8150  C CG  . LEU D 1 247 ? -24.280 18.688  2.486   1.00 43.94  ? 227 LEU D CG  1 
ATOM   8151  C CD1 . LEU D 1 247 ? -24.736 19.317  1.196   1.00 45.43  ? 227 LEU D CD1 1 
ATOM   8152  C CD2 . LEU D 1 247 ? -22.790 18.422  2.408   1.00 45.78  ? 227 LEU D CD2 1 
ATOM   8153  N N   . GLU D 1 248 ? -25.880 20.058  6.451   1.00 47.76  ? 228 GLU D N   1 
ATOM   8154  C CA  . GLU D 1 248 ? -26.299 20.808  7.609   1.00 50.51  ? 228 GLU D CA  1 
ATOM   8155  C C   . GLU D 1 248 ? -25.726 20.184  8.873   1.00 48.85  ? 228 GLU D C   1 
ATOM   8156  O O   . GLU D 1 248 ? -25.291 20.876  9.786   1.00 45.03  ? 228 GLU D O   1 
ATOM   8157  C CB  . GLU D 1 248 ? -27.805 20.772  7.630   1.00 55.07  ? 228 GLU D CB  1 
ATOM   8158  C CG  . GLU D 1 248 ? -28.469 21.070  8.940   1.00 58.76  ? 228 GLU D CG  1 
ATOM   8159  C CD  . GLU D 1 248 ? -29.969 21.023  8.752   1.00 63.50  ? 228 GLU D CD  1 
ATOM   8160  O OE1 . GLU D 1 248 ? -30.456 20.264  7.855   1.00 64.69  ? 228 GLU D OE1 1 
ATOM   8161  O OE2 . GLU D 1 248 ? -30.648 21.761  9.485   1.00 60.77  ? 228 GLU D OE2 1 
ATOM   8162  N N   . LEU D 1 249 ? -25.735 18.858  8.902   1.00 46.95  ? 229 LEU D N   1 
ATOM   8163  C CA  . LEU D 1 249 ? -25.189 18.125  10.017  1.00 45.04  ? 229 LEU D CA  1 
ATOM   8164  C C   . LEU D 1 249 ? -23.684 18.357  10.198  1.00 44.50  ? 229 LEU D C   1 
ATOM   8165  O O   . LEU D 1 249 ? -23.203 18.494  11.325  1.00 43.79  ? 229 LEU D O   1 
ATOM   8166  C CB  . LEU D 1 249 ? -25.465 16.644  9.839   1.00 45.94  ? 229 LEU D CB  1 
ATOM   8167  C CG  . LEU D 1 249 ? -24.820 15.742  10.892  1.00 47.80  ? 229 LEU D CG  1 
ATOM   8168  C CD1 . LEU D 1 249 ? -25.201 16.165  12.296  1.00 48.09  ? 229 LEU D CD1 1 
ATOM   8169  C CD2 . LEU D 1 249 ? -25.261 14.317  10.656  1.00 47.93  ? 229 LEU D CD2 1 
ATOM   8170  N N   . GLY D 1 250 ? -22.944 18.376  9.097   1.00 41.97  ? 230 GLY D N   1 
ATOM   8171  C CA  . GLY D 1 250 ? -21.517 18.666  9.143   1.00 40.50  ? 230 GLY D CA  1 
ATOM   8172  C C   . GLY D 1 250 ? -21.226 20.070  9.634   1.00 38.32  ? 230 GLY D C   1 
ATOM   8173  O O   . GLY D 1 250 ? -20.264 20.281  10.355  1.00 37.92  ? 230 GLY D O   1 
ATOM   8174  N N   . ASP D 1 251 ? -22.067 21.020  9.241   1.00 40.44  ? 231 ASP D N   1 
ATOM   8175  C CA  . ASP D 1 251 ? -21.976 22.411  9.724   1.00 42.62  ? 231 ASP D CA  1 
ATOM   8176  C C   . ASP D 1 251 ? -22.251 22.494  11.194  1.00 44.87  ? 231 ASP D C   1 
ATOM   8177  O O   . ASP D 1 251 ? -21.725 23.355  11.882  1.00 48.84  ? 231 ASP D O   1 
ATOM   8178  C CB  . ASP D 1 251 ? -23.035 23.276  9.074   1.00 43.30  ? 231 ASP D CB  1 
ATOM   8179  C CG  . ASP D 1 251 ? -22.598 23.852  7.765   1.00 46.00  ? 231 ASP D CG  1 
ATOM   8180  O OD1 . ASP D 1 251 ? -21.414 23.706  7.406   1.00 51.33  ? 231 ASP D OD1 1 
ATOM   8181  O OD2 . ASP D 1 251 ? -23.447 24.462  7.085   1.00 47.75  ? 231 ASP D OD2 1 
ATOM   8182  N N   . PHE D 1 252 ? -23.124 21.615  11.660  1.00 44.86  ? 232 PHE D N   1 
ATOM   8183  C CA  . PHE D 1 252 ? -23.470 21.577  13.048  1.00 44.87  ? 232 PHE D CA  1 
ATOM   8184  C C   . PHE D 1 252 ? -22.389 20.958  13.917  1.00 45.11  ? 232 PHE D C   1 
ATOM   8185  O O   . PHE D 1 252 ? -22.108 21.451  14.993  1.00 49.24  ? 232 PHE D O   1 
ATOM   8186  C CB  . PHE D 1 252 ? -24.739 20.798  13.226  1.00 48.17  ? 232 PHE D CB  1 
ATOM   8187  C CG  . PHE D 1 252 ? -25.211 20.779  14.634  1.00 56.03  ? 232 PHE D CG  1 
ATOM   8188  C CD1 . PHE D 1 252 ? -25.952 21.811  15.104  1.00 60.72  ? 232 PHE D CD1 1 
ATOM   8189  C CD2 . PHE D 1 252 ? -24.874 19.761  15.495  1.00 62.47  ? 232 PHE D CD2 1 
ATOM   8190  C CE1 . PHE D 1 252 ? -26.409 21.847  16.406  1.00 62.42  ? 232 PHE D CE1 1 
ATOM   8191  C CE2 . PHE D 1 252 ? -25.314 19.777  16.806  1.00 65.02  ? 232 PHE D CE2 1 
ATOM   8192  C CZ  . PHE D 1 252 ? -26.090 20.825  17.261  1.00 63.74  ? 232 PHE D CZ  1 
ATOM   8193  N N   . ILE D 1 253 ? -21.807 19.861  13.462  1.00 44.64  ? 233 ILE D N   1 
ATOM   8194  C CA  . ILE D 1 253 ? -20.696 19.231  14.161  1.00 43.45  ? 233 ILE D CA  1 
ATOM   8195  C C   . ILE D 1 253 ? -19.473 20.120  14.064  1.00 43.54  ? 233 ILE D C   1 
ATOM   8196  O O   . ILE D 1 253 ? -18.658 20.202  14.998  1.00 40.53  ? 233 ILE D O   1 
ATOM   8197  C CB  . ILE D 1 253 ? -20.351 17.874  13.513  1.00 45.98  ? 233 ILE D CB  1 
ATOM   8198  C CG1 . ILE D 1 253 ? -21.410 16.835  13.871  1.00 45.33  ? 233 ILE D CG1 1 
ATOM   8199  C CG2 . ILE D 1 253 ? -18.976 17.378  13.945  1.00 45.87  ? 233 ILE D CG2 1 
ATOM   8200  C CD1 . ILE D 1 253 ? -21.619 15.801  12.796  1.00 44.04  ? 233 ILE D CD1 1 
ATOM   8201  N N   . GLY D 1 254 ? -19.336 20.759  12.905  1.00 43.94  ? 234 GLY D N   1 
ATOM   8202  C CA  . GLY D 1 254 ? -18.161 21.567  12.600  1.00 46.37  ? 234 GLY D CA  1 
ATOM   8203  C C   . GLY D 1 254 ? -17.366 20.835  11.548  1.00 47.10  ? 234 GLY D C   1 
ATOM   8204  O O   . GLY D 1 254 ? -17.079 19.654  11.700  1.00 51.46  ? 234 GLY D O   1 
ATOM   8205  N N   . LEU D 1 255 ? -17.034 21.530  10.468  1.00 47.21  ? 235 LEU D N   1 
ATOM   8206  C CA  . LEU D 1 255 ? -16.411 20.897  9.319   1.00 44.73  ? 235 LEU D CA  1 
ATOM   8207  C C   . LEU D 1 255 ? -14.977 20.541  9.587   1.00 43.70  ? 235 LEU D C   1 
ATOM   8208  O O   . LEU D 1 255 ? -14.456 19.602  8.994   1.00 42.40  ? 235 LEU D O   1 
ATOM   8209  C CB  . LEU D 1 255 ? -16.486 21.795  8.095   1.00 44.96  ? 235 LEU D CB  1 
ATOM   8210  C CG  . LEU D 1 255 ? -17.898 21.989  7.546   1.00 45.96  ? 235 LEU D CG  1 
ATOM   8211  C CD1 . LEU D 1 255 ? -17.791 22.709  6.223   1.00 46.28  ? 235 LEU D CD1 1 
ATOM   8212  C CD2 . LEU D 1 255 ? -18.639 20.684  7.342   1.00 47.72  ? 235 LEU D CD2 1 
ATOM   8213  N N   . ASP D 1 256 ? -14.341 21.280  10.485  1.00 42.42  ? 236 ASP D N   1 
ATOM   8214  C CA  . ASP D 1 256 ? -12.963 20.969  10.868  1.00 44.16  ? 236 ASP D CA  1 
ATOM   8215  C C   . ASP D 1 256 ? -12.919 19.649  11.623  1.00 42.33  ? 236 ASP D C   1 
ATOM   8216  O O   . ASP D 1 256 ? -11.982 18.867  11.485  1.00 42.94  ? 236 ASP D O   1 
ATOM   8217  C CB  . ASP D 1 256 ? -12.342 22.086  11.715  1.00 43.72  ? 236 ASP D CB  1 
ATOM   8218  C CG  . ASP D 1 256 ? -13.170 22.437  12.954  1.00 47.32  ? 236 ASP D CG  1 
ATOM   8219  O OD1 . ASP D 1 256 ? -14.427 22.423  12.905  1.00 46.95  ? 236 ASP D OD1 1 
ATOM   8220  O OD2 . ASP D 1 256 ? -12.546 22.752  13.985  1.00 51.20  ? 236 ASP D OD2 1 
ATOM   8221  N N   . ILE D 1 257 ? -13.955 19.408  12.409  1.00 42.99  ? 237 ILE D N   1 
ATOM   8222  C CA  . ILE D 1 257 ? -14.034 18.201  13.207  1.00 44.74  ? 237 ILE D CA  1 
ATOM   8223  C C   . ILE D 1 257 ? -14.338 17.035  12.295  1.00 43.68  ? 237 ILE D C   1 
ATOM   8224  O O   . ILE D 1 257 ? -13.760 15.962  12.442  1.00 41.58  ? 237 ILE D O   1 
ATOM   8225  C CB  . ILE D 1 257 ? -15.071 18.360  14.333  1.00 44.60  ? 237 ILE D CB  1 
ATOM   8226  C CG1 . ILE D 1 257 ? -14.430 19.179  15.452  1.00 47.78  ? 237 ILE D CG1 1 
ATOM   8227  C CG2 . ILE D 1 257 ? -15.515 17.013  14.880  1.00 42.13  ? 237 ILE D CG2 1 
ATOM   8228  C CD1 . ILE D 1 257 ? -15.404 20.089  16.144  1.00 51.89  ? 237 ILE D CD1 1 
ATOM   8229  N N   . CYS D 1 258 ? -15.230 17.270  11.342  1.00 42.11  ? 238 CYS D N   1 
ATOM   8230  C CA  . CYS D 1 258 ? -15.526 16.277  10.333  1.00 43.84  ? 238 CYS D CA  1 
ATOM   8231  C C   . CYS D 1 258 ? -14.286 15.838  9.564   1.00 44.02  ? 238 CYS D C   1 
ATOM   8232  O O   . CYS D 1 258 ? -14.102 14.659  9.274   1.00 41.50  ? 238 CYS D O   1 
ATOM   8233  C CB  . CYS D 1 258 ? -16.517 16.840  9.356   1.00 42.46  ? 238 CYS D CB  1 
ATOM   8234  S SG  . CYS D 1 258 ? -18.178 16.819  10.027  1.00 47.29  ? 238 CYS D SG  1 
ATOM   8235  N N   . LEU D 1 259 ? -13.448 16.801  9.224   1.00 43.28  ? 239 LEU D N   1 
ATOM   8236  C CA  . LEU D 1 259 ? -12.294 16.518  8.406   1.00 42.89  ? 239 LEU D CA  1 
ATOM   8237  C C   . LEU D 1 259 ? -11.228 15.817  9.226   1.00 42.64  ? 239 LEU D C   1 
ATOM   8238  O O   . LEU D 1 259 ? -10.542 14.945  8.726   1.00 41.87  ? 239 LEU D O   1 
ATOM   8239  C CB  . LEU D 1 259 ? -11.752 17.802  7.790   1.00 40.99  ? 239 LEU D CB  1 
ATOM   8240  C CG  . LEU D 1 259 ? -10.356 17.697  7.182   1.00 41.45  ? 239 LEU D CG  1 
ATOM   8241  C CD1 . LEU D 1 259 ? -10.369 17.054  5.807   1.00 42.63  ? 239 LEU D CD1 1 
ATOM   8242  C CD2 . LEU D 1 259 ? -9.778  19.084  7.080   1.00 42.64  ? 239 LEU D CD2 1 
ATOM   8243  N N   . ALA D 1 260 ? -11.087 16.198  10.486  1.00 43.26  ? 240 ALA D N   1 
ATOM   8244  C CA  . ALA D 1 260 ? -10.095 15.565  11.345  1.00 43.20  ? 240 ALA D CA  1 
ATOM   8245  C C   . ALA D 1 260 ? -10.418 14.078  11.535  1.00 41.10  ? 240 ALA D C   1 
ATOM   8246  O O   . ALA D 1 260 ? -9.520  13.243  11.641  1.00 38.60  ? 240 ALA D O   1 
ATOM   8247  C CB  . ALA D 1 260 ? -10.027 16.285  12.688  1.00 41.76  ? 240 ALA D CB  1 
ATOM   8248  N N   . ILE D 1 261 ? -11.704 13.762  11.565  1.00 40.68  ? 241 ILE D N   1 
ATOM   8249  C CA  . ILE D 1 261 ? -12.133 12.383  11.722  1.00 42.93  ? 241 ILE D CA  1 
ATOM   8250  C C   . ILE D 1 261 ? -11.833 11.573  10.483  1.00 41.04  ? 241 ILE D C   1 
ATOM   8251  O O   . ILE D 1 261 ? -11.306 10.469  10.577  1.00 42.01  ? 241 ILE D O   1 
ATOM   8252  C CB  . ILE D 1 261 ? -13.620 12.295  12.096  1.00 44.94  ? 241 ILE D CB  1 
ATOM   8253  C CG1 . ILE D 1 261 ? -13.799 12.750  13.545  1.00 45.57  ? 241 ILE D CG1 1 
ATOM   8254  C CG2 . ILE D 1 261 ? -14.119 10.864  11.992  1.00 46.57  ? 241 ILE D CG2 1 
ATOM   8255  C CD1 . ILE D 1 261 ? -15.212 13.164  13.877  1.00 48.00  ? 241 ILE D CD1 1 
ATOM   8256  N N   . MET D 1 262 ? -12.148 12.128  9.320   1.00 41.17  ? 242 MET D N   1 
ATOM   8257  C CA  . MET D 1 262 ? -11.864 11.433  8.072   1.00 41.22  ? 242 MET D CA  1 
ATOM   8258  C C   . MET D 1 262 ? -10.368 11.263  7.911   1.00 38.36  ? 242 MET D C   1 
ATOM   8259  O O   . MET D 1 262 ? -9.919  10.229  7.436   1.00 41.29  ? 242 MET D O   1 
ATOM   8260  C CB  . MET D 1 262 ? -12.421 12.182  6.867   1.00 41.35  ? 242 MET D CB  1 
ATOM   8261  C CG  . MET D 1 262 ? -13.926 12.329  6.861   1.00 42.82  ? 242 MET D CG  1 
ATOM   8262  S SD  . MET D 1 262 ? -14.833 10.798  6.618   1.00 46.78  ? 242 MET D SD  1 
ATOM   8263  C CE  . MET D 1 262 ? -14.083 10.133  5.143   1.00 46.74  ? 242 MET D CE  1 
ATOM   8264  N N   . ASP D 1 263 ? -9.606  12.278  8.299   1.00 35.99  ? 243 ASP D N   1 
ATOM   8265  C CA  . ASP D 1 263 ? -8.152  12.170  8.288   1.00 38.94  ? 243 ASP D CA  1 
ATOM   8266  C C   . ASP D 1 263 ? -7.703  10.960  9.079   1.00 38.77  ? 243 ASP D C   1 
ATOM   8267  O O   . ASP D 1 263 ? -6.794  10.236  8.667   1.00 37.32  ? 243 ASP D O   1 
ATOM   8268  C CB  . ASP D 1 263 ? -7.469  13.407  8.875   1.00 39.46  ? 243 ASP D CB  1 
ATOM   8269  C CG  . ASP D 1 263 ? -7.439  14.590  7.914   1.00 40.40  ? 243 ASP D CG  1 
ATOM   8270  O OD1 . ASP D 1 263 ? -7.450  14.388  6.685   1.00 40.45  ? 243 ASP D OD1 1 
ATOM   8271  O OD2 . ASP D 1 263 ? -7.403  15.742  8.405   1.00 42.28  ? 243 ASP D OD2 1 
ATOM   8272  N N   . VAL D 1 264 ? -8.346  10.759  10.218  1.00 41.62  ? 244 VAL D N   1 
ATOM   8273  C CA  . VAL D 1 264 ? -7.956  9.706   11.131  1.00 42.95  ? 244 VAL D CA  1 
ATOM   8274  C C   . VAL D 1 264 ? -8.371  8.361   10.569  1.00 40.61  ? 244 VAL D C   1 
ATOM   8275  O O   . VAL D 1 264 ? -7.581  7.430   10.577  1.00 35.28  ? 244 VAL D O   1 
ATOM   8276  C CB  . VAL D 1 264 ? -8.519  9.958   12.546  1.00 48.25  ? 244 VAL D CB  1 
ATOM   8277  C CG1 . VAL D 1 264 ? -8.660  8.657   13.329  1.00 51.11  ? 244 VAL D CG1 1 
ATOM   8278  C CG2 . VAL D 1 264 ? -7.610  10.939  13.278  1.00 47.17  ? 244 VAL D CG2 1 
ATOM   8279  N N   . LEU D 1 265 ? -9.592  8.262   10.058  1.00 38.33  ? 245 LEU D N   1 
ATOM   8280  C CA  . LEU D 1 265 ? -10.000 7.037   9.372   1.00 37.11  ? 245 LEU D CA  1 
ATOM   8281  C C   . LEU D 1 265 ? -9.047  6.653   8.260   1.00 37.93  ? 245 LEU D C   1 
ATOM   8282  O O   . LEU D 1 265 ? -8.707  5.490   8.117   1.00 39.07  ? 245 LEU D O   1 
ATOM   8283  C CB  . LEU D 1 265 ? -11.386 7.192   8.774   1.00 37.08  ? 245 LEU D CB  1 
ATOM   8284  C CG  . LEU D 1 265 ? -12.484 7.431   9.807   1.00 37.96  ? 245 LEU D CG  1 
ATOM   8285  C CD1 . LEU D 1 265 ? -13.813 7.588   9.114   1.00 39.06  ? 245 LEU D CD1 1 
ATOM   8286  C CD2 . LEU D 1 265 ? -12.569 6.296   10.802  1.00 38.14  ? 245 LEU D CD2 1 
ATOM   8287  N N   . TYR D 1 266 ? -8.626  7.625   7.463   1.00 38.45  ? 246 TYR D N   1 
ATOM   8288  C CA  . TYR D 1 266 ? -7.797  7.331   6.311   1.00 39.56  ? 246 TYR D CA  1 
ATOM   8289  C C   . TYR D 1 266 ? -6.420  6.919   6.766   1.00 39.06  ? 246 TYR D C   1 
ATOM   8290  O O   . TYR D 1 266 ? -5.851  5.952   6.283   1.00 44.41  ? 246 TYR D O   1 
ATOM   8291  C CB  . TYR D 1 266 ? -7.695  8.548   5.406   1.00 38.11  ? 246 TYR D CB  1 
ATOM   8292  C CG  . TYR D 1 266 ? -6.822  8.351   4.197   1.00 36.67  ? 246 TYR D CG  1 
ATOM   8293  C CD1 . TYR D 1 266 ? -6.771  7.131   3.533   1.00 37.89  ? 246 TYR D CD1 1 
ATOM   8294  C CD2 . TYR D 1 266 ? -6.091  9.400   3.687   1.00 37.09  ? 246 TYR D CD2 1 
ATOM   8295  C CE1 . TYR D 1 266 ? -5.995  6.956   2.400   1.00 37.97  ? 246 TYR D CE1 1 
ATOM   8296  C CE2 . TYR D 1 266 ? -5.305  9.244   2.570   1.00 39.13  ? 246 TYR D CE2 1 
ATOM   8297  C CZ  . TYR D 1 266 ? -5.268  8.018   1.924   1.00 38.38  ? 246 TYR D CZ  1 
ATOM   8298  O OH  . TYR D 1 266 ? -4.483  7.866   0.821   1.00 36.88  ? 246 TYR D OH  1 
ATOM   8299  N N   . SER D 1 267 ? -5.915  7.681   7.715   1.00 38.77  ? 247 SER D N   1 
ATOM   8300  C CA  . SER D 1 267 ? -4.591  7.491   8.290   1.00 40.61  ? 247 SER D CA  1 
ATOM   8301  C C   . SER D 1 267 ? -4.457  6.148   9.016   1.00 41.15  ? 247 SER D C   1 
ATOM   8302  O O   . SER D 1 267 ? -3.489  5.431   8.805   1.00 41.92  ? 247 SER D O   1 
ATOM   8303  C CB  . SER D 1 267 ? -4.329  8.628   9.274   1.00 41.13  ? 247 SER D CB  1 
ATOM   8304  O OG  . SER D 1 267 ? -3.170  8.384   10.007  1.00 44.32  ? 247 SER D OG  1 
ATOM   8305  N N   . GLU D 1 268 ? -5.427  5.822   9.864   1.00 39.71  ? 248 GLU D N   1 
ATOM   8306  C CA  . GLU D 1 268 ? -5.422  4.542   10.576  1.00 42.99  ? 248 GLU D CA  1 
ATOM   8307  C C   . GLU D 1 268 ? -5.599  3.337   9.668   1.00 42.98  ? 248 GLU D C   1 
ATOM   8308  O O   . GLU D 1 268 ? -4.842  2.388   9.782   1.00 41.26  ? 248 GLU D O   1 
ATOM   8309  C CB  . GLU D 1 268 ? -6.487  4.498   11.676  1.00 44.29  ? 248 GLU D CB  1 
ATOM   8310  C CG  . GLU D 1 268 ? -6.132  5.333   12.899  1.00 46.98  ? 248 GLU D CG  1 
ATOM   8311  C CD  . GLU D 1 268 ? -4.889  4.832   13.620  1.00 49.76  ? 248 GLU D CD  1 
ATOM   8312  O OE1 . GLU D 1 268 ? -4.904  3.658   14.042  1.00 55.99  ? 248 GLU D OE1 1 
ATOM   8313  O OE2 . GLU D 1 268 ? -3.906  5.597   13.770  1.00 48.85  ? 248 GLU D OE2 1 
ATOM   8314  N N   . THR D 1 269 ? -6.594  3.371   8.784   1.00 42.00  ? 249 THR D N   1 
ATOM   8315  C CA  . THR D 1 269 ? -6.880  2.235   7.913   1.00 38.69  ? 249 THR D CA  1 
ATOM   8316  C C   . THR D 1 269 ? -5.915  2.137   6.768   1.00 38.38  ? 249 THR D C   1 
ATOM   8317  O O   . THR D 1 269 ? -5.717  1.057   6.236   1.00 39.23  ? 249 THR D O   1 
ATOM   8318  C CB  . THR D 1 269 ? -8.272  2.306   7.252   1.00 40.90  ? 249 THR D CB  1 
ATOM   8319  O OG1 . THR D 1 269 ? -8.358  3.461   6.408   1.00 45.72  ? 249 THR D OG1 1 
ATOM   8320  C CG2 . THR D 1 269 ? -9.370  2.369   8.278   1.00 41.15  ? 249 THR D CG2 1 
ATOM   8321  N N   . GLY D 1 270 ? -5.353  3.264   6.342   1.00 37.92  ? 250 GLY D N   1 
ATOM   8322  C CA  . GLY D 1 270 ? -4.567  3.294   5.101   1.00 37.15  ? 250 GLY D CA  1 
ATOM   8323  C C   . GLY D 1 270 ? -5.394  3.031   3.842   1.00 38.22  ? 250 GLY D C   1 
ATOM   8324  O O   . GLY D 1 270 ? -4.846  2.783   2.766   1.00 37.43  ? 250 GLY D O   1 
ATOM   8325  N N   . ASP D 1 271 ? -6.710  3.105   3.960   1.00 37.94  ? 251 ASP D N   1 
ATOM   8326  C CA  . ASP D 1 271 ? -7.568  2.771   2.858   1.00 40.23  ? 251 ASP D CA  1 
ATOM   8327  C C   . ASP D 1 271 ? -8.154  4.034   2.253   1.00 40.78  ? 251 ASP D C   1 
ATOM   8328  O O   . ASP D 1 271 ? -8.829  4.799   2.923   1.00 40.62  ? 251 ASP D O   1 
ATOM   8329  C CB  . ASP D 1 271 ? -8.689  1.865   3.346   1.00 41.76  ? 251 ASP D CB  1 
ATOM   8330  C CG  . ASP D 1 271 ? -9.586  1.361   2.216   1.00 44.04  ? 251 ASP D CG  1 
ATOM   8331  O OD1 . ASP D 1 271 ? -9.404  1.754   1.037   1.00 45.95  ? 251 ASP D OD1 1 
ATOM   8332  O OD2 . ASP D 1 271 ? -10.482 0.544   2.515   1.00 46.86  ? 251 ASP D OD2 1 
ATOM   8333  N N   . SER D 1 272 ? -7.937  4.187   0.957   1.00 43.20  ? 252 SER D N   1 
ATOM   8334  C CA  . SER D 1 272 ? -8.398  5.335   0.172   1.00 46.23  ? 252 SER D CA  1 
ATOM   8335  C C   . SER D 1 272 ? -9.888  5.610   0.288   1.00 44.17  ? 252 SER D C   1 
ATOM   8336  O O   . SER D 1 272 ? -10.369 6.720   0.017   1.00 41.98  ? 252 SER D O   1 
ATOM   8337  C CB  . SER D 1 272 ? -8.084  5.072   -1.297  1.00 49.87  ? 252 SER D CB  1 
ATOM   8338  O OG  . SER D 1 272 ? -6.697  5.217   -1.541  1.00 60.27  ? 252 SER D OG  1 
ATOM   8339  N N   . LYS D 1 273 ? -10.612 4.573   0.655   1.00 40.99  ? 253 LYS D N   1 
ATOM   8340  C CA  . LYS D 1 273 ? -12.034 4.656   0.836   1.00 40.20  ? 253 LYS D CA  1 
ATOM   8341  C C   . LYS D 1 273 ? -12.413 5.823   1.735   1.00 38.59  ? 253 LYS D C   1 
ATOM   8342  O O   . LYS D 1 273 ? -13.457 6.441   1.546   1.00 40.36  ? 253 LYS D O   1 
ATOM   8343  C CB  . LYS D 1 273 ? -12.508 3.360   1.466   1.00 41.35  ? 253 LYS D CB  1 
ATOM   8344  C CG  . LYS D 1 273 ? -13.948 3.372   1.919   1.00 43.48  ? 253 LYS D CG  1 
ATOM   8345  C CD  . LYS D 1 273 ? -14.325 2.034   2.514   1.00 45.41  ? 253 LYS D CD  1 
ATOM   8346  C CE  . LYS D 1 273 ? -15.735 2.114   3.057   1.00 47.94  ? 253 LYS D CE  1 
ATOM   8347  N NZ  . LYS D 1 273 ? -16.332 0.767   3.208   1.00 47.98  ? 253 LYS D NZ  1 
ATOM   8348  N N   . TYR D 1 274 ? -11.567 6.123   2.714   1.00 35.63  ? 254 TYR D N   1 
ATOM   8349  C CA  . TYR D 1 274 ? -11.897 7.130   3.704   1.00 38.20  ? 254 TYR D CA  1 
ATOM   8350  C C   . TYR D 1 274 ? -11.205 8.446   3.447   1.00 37.15  ? 254 TYR D C   1 
ATOM   8351  O O   . TYR D 1 274 ? -11.034 9.238   4.378   1.00 35.13  ? 254 TYR D O   1 
ATOM   8352  C CB  . TYR D 1 274 ? -11.537 6.623   5.108   1.00 40.97  ? 254 TYR D CB  1 
ATOM   8353  C CG  . TYR D 1 274 ? -12.249 5.348   5.416   1.00 40.67  ? 254 TYR D CG  1 
ATOM   8354  C CD1 . TYR D 1 274 ? -13.590 5.359   5.747   1.00 40.72  ? 254 TYR D CD1 1 
ATOM   8355  C CD2 . TYR D 1 274 ? -11.599 4.133   5.317   1.00 42.38  ? 254 TYR D CD2 1 
ATOM   8356  C CE1 . TYR D 1 274 ? -14.271 4.191   5.991   1.00 41.64  ? 254 TYR D CE1 1 
ATOM   8357  C CE2 . TYR D 1 274 ? -12.264 2.953   5.565   1.00 43.97  ? 254 TYR D CE2 1 
ATOM   8358  C CZ  . TYR D 1 274 ? -13.599 2.993   5.903   1.00 43.98  ? 254 TYR D CZ  1 
ATOM   8359  O OH  . TYR D 1 274 ? -14.270 1.833   6.142   1.00 41.67  ? 254 TYR D OH  1 
ATOM   8360  N N   . ARG D 1 275 ? -10.808 8.706   2.203   1.00 35.28  ? 255 ARG D N   1 
ATOM   8361  C CA  . ARG D 1 275 ? -10.133 9.954   1.937   1.00 34.95  ? 255 ARG D CA  1 
ATOM   8362  C C   . ARG D 1 275 ? -11.141 11.063  2.020   1.00 33.74  ? 255 ARG D C   1 
ATOM   8363  O O   . ARG D 1 275 ? -12.207 10.960  1.432   1.00 35.47  ? 255 ARG D O   1 
ATOM   8364  C CB  . ARG D 1 275 ? -9.448  9.959   0.591   1.00 34.82  ? 255 ARG D CB  1 
ATOM   8365  C CG  . ARG D 1 275 ? -10.374 10.067  -0.596  1.00 33.98  ? 255 ARG D CG  1 
ATOM   8366  C CD  . ARG D 1 275 ? -9.632  9.566   -1.812  1.00 36.27  ? 255 ARG D CD  1 
ATOM   8367  N NE  . ARG D 1 275 ? -10.433 9.538   -3.029  1.00 36.96  ? 255 ARG D NE  1 
ATOM   8368  C CZ  . ARG D 1 275 ? -11.117 8.478   -3.455  1.00 42.24  ? 255 ARG D CZ  1 
ATOM   8369  N NH1 . ARG D 1 275 ? -11.135 7.353   -2.741  1.00 44.48  ? 255 ARG D NH1 1 
ATOM   8370  N NH2 . ARG D 1 275 ? -11.805 8.538   -4.592  1.00 40.87  ? 255 ARG D NH2 1 
ATOM   8371  N N   . PRO D 1 276 ? -10.812 12.113  2.778   1.00 34.10  ? 256 PRO D N   1 
ATOM   8372  C CA  . PRO D 1 276 ? -11.655 13.295  2.851   1.00 33.25  ? 256 PRO D CA  1 
ATOM   8373  C C   . PRO D 1 276 ? -11.682 14.001  1.522   1.00 32.91  ? 256 PRO D C   1 
ATOM   8374  O O   . PRO D 1 276 ? -10.679 14.072  0.806   1.00 32.92  ? 256 PRO D O   1 
ATOM   8375  C CB  . PRO D 1 276 ? -10.966 14.179  3.875   1.00 32.90  ? 256 PRO D CB  1 
ATOM   8376  C CG  . PRO D 1 276 ? -9.561  13.696  3.942   1.00 32.95  ? 256 PRO D CG  1 
ATOM   8377  C CD  . PRO D 1 276 ? -9.598  12.244  3.602   1.00 34.41  ? 256 PRO D CD  1 
ATOM   8378  N N   . HIS D 1 277 ? -12.844 14.509  1.197   1.00 32.39  ? 257 HIS D N   1 
ATOM   8379  C CA  . HIS D 1 277 ? -13.000 15.183  -0.030  1.00 33.98  ? 257 HIS D CA  1 
ATOM   8380  C C   . HIS D 1 277 ? -12.186 16.469  -0.062  1.00 34.94  ? 257 HIS D C   1 
ATOM   8381  O O   . HIS D 1 277 ? -11.925 17.136  0.930   1.00 35.89  ? 257 HIS D O   1 
ATOM   8382  C CB  . HIS D 1 277 ? -14.460 15.462  -0.311  1.00 34.38  ? 257 HIS D CB  1 
ATOM   8383  C CG  . HIS D 1 277 ? -14.724 15.741  -1.746  1.00 35.24  ? 257 HIS D CG  1 
ATOM   8384  N ND1 . HIS D 1 277 ? -14.362 16.928  -2.347  1.00 38.30  ? 257 HIS D ND1 1 
ATOM   8385  C CD2 . HIS D 1 277 ? -15.249 14.968  -2.721  1.00 36.03  ? 257 HIS D CD2 1 
ATOM   8386  C CE1 . HIS D 1 277 ? -14.663 16.878  -3.631  1.00 37.26  ? 257 HIS D CE1 1 
ATOM   8387  N NE2 . HIS D 1 277 ? -15.217 15.704  -3.882  1.00 37.03  ? 257 HIS D NE2 1 
ATOM   8388  N N   . THR D 1 278 ? -11.809 16.791  -1.270  1.00 36.97  ? 258 THR D N   1 
ATOM   8389  C CA  . THR D 1 278 ? -10.915 17.872  -1.584  1.00 37.28  ? 258 THR D CA  1 
ATOM   8390  C C   . THR D 1 278 ? -11.643 19.218  -1.312  1.00 37.61  ? 258 THR D C   1 
ATOM   8391  O O   . THR D 1 278 ? -11.052 20.193  -0.839  1.00 34.50  ? 258 THR D O   1 
ATOM   8392  C CB  . THR D 1 278 ? -10.428 17.603  -3.045  1.00 36.59  ? 258 THR D CB  1 
ATOM   8393  O OG1 . THR D 1 278 ? -9.005  17.635  -3.093  1.00 38.81  ? 258 THR D OG1 1 
ATOM   8394  C CG2 . THR D 1 278 ? -11.046 18.502  -4.070  1.00 36.24  ? 258 THR D CG2 1 
ATOM   8395  N N   . LEU D 1 279 ? -12.945 19.235  -1.571  1.00 36.77  ? 259 LEU D N   1 
ATOM   8396  C CA  . LEU D 1 279 ? -13.767 20.402  -1.302  1.00 37.79  ? 259 LEU D CA  1 
ATOM   8397  C C   . LEU D 1 279 ? -13.936 20.624  0.187   1.00 38.01  ? 259 LEU D C   1 
ATOM   8398  O O   . LEU D 1 279 ? -13.965 21.758  0.638   1.00 41.65  ? 259 LEU D O   1 
ATOM   8399  C CB  . LEU D 1 279 ? -15.136 20.255  -1.958  1.00 37.75  ? 259 LEU D CB  1 
ATOM   8400  C CG  . LEU D 1 279 ? -16.108 21.431  -1.799  1.00 39.51  ? 259 LEU D CG  1 
ATOM   8401  C CD1 . LEU D 1 279 ? -15.593 22.702  -2.448  1.00 38.59  ? 259 LEU D CD1 1 
ATOM   8402  C CD2 . LEU D 1 279 ? -17.455 21.077  -2.407  1.00 40.82  ? 259 LEU D CD2 1 
ATOM   8403  N N   . LEU D 1 280 ? -14.043 19.554  0.956   1.00 38.36  ? 260 LEU D N   1 
ATOM   8404  C CA  . LEU D 1 280 ? -14.163 19.702  2.394   1.00 38.92  ? 260 LEU D CA  1 
ATOM   8405  C C   . LEU D 1 280 ? -12.912 20.389  2.963   1.00 40.10  ? 260 LEU D C   1 
ATOM   8406  O O   . LEU D 1 280 ? -12.998 21.211  3.885   1.00 38.17  ? 260 LEU D O   1 
ATOM   8407  C CB  . LEU D 1 280 ? -14.396 18.349  3.057   1.00 39.24  ? 260 LEU D CB  1 
ATOM   8408  C CG  . LEU D 1 280 ? -14.320 18.345  4.581   1.00 40.54  ? 260 LEU D CG  1 
ATOM   8409  C CD1 . LEU D 1 280 ? -15.465 19.162  5.126   1.00 41.55  ? 260 LEU D CD1 1 
ATOM   8410  C CD2 . LEU D 1 280 ? -14.375 16.927  5.121   1.00 40.41  ? 260 LEU D CD2 1 
ATOM   8411  N N   . LYS D 1 281 ? -11.759 20.063  2.391   1.00 40.15  ? 261 LYS D N   1 
ATOM   8412  C CA  . LYS D 1 281 ? -10.505 20.678  2.800   1.00 37.85  ? 261 LYS D CA  1 
ATOM   8413  C C   . LYS D 1 281 ? -10.491 22.145  2.504   1.00 37.70  ? 261 LYS D C   1 
ATOM   8414  O O   . LYS D 1 281 ? -9.947  22.942  3.271   1.00 42.65  ? 261 LYS D O   1 
ATOM   8415  C CB  . LYS D 1 281 ? -9.344  20.073  2.050   1.00 37.39  ? 261 LYS D CB  1 
ATOM   8416  C CG  . LYS D 1 281 ? -8.822  18.807  2.671   1.00 37.09  ? 261 LYS D CG  1 
ATOM   8417  C CD  . LYS D 1 281 ? -7.940  18.070  1.682   1.00 36.33  ? 261 LYS D CD  1 
ATOM   8418  C CE  . LYS D 1 281 ? -7.632  16.688  2.213   1.00 36.22  ? 261 LYS D CE  1 
ATOM   8419  N NZ  . LYS D 1 281 ? -6.375  16.145  1.671   1.00 35.66  ? 261 LYS D NZ  1 
ATOM   8420  N N   . LYS D 1 282 ? -11.057 22.513  1.370   1.00 35.28  ? 262 LYS D N   1 
ATOM   8421  C CA  . LYS D 1 282 ? -11.084 23.915  1.009   1.00 35.77  ? 262 LYS D CA  1 
ATOM   8422  C C   . LYS D 1 282 ? -11.998 24.735  1.937   1.00 35.74  ? 262 LYS D C   1 
ATOM   8423  O O   . LYS D 1 282 ? -11.628 25.817  2.357   1.00 36.38  ? 262 LYS D O   1 
ATOM   8424  C CB  . LYS D 1 282 ? -11.508 24.056  -0.436  1.00 34.25  ? 262 LYS D CB  1 
ATOM   8425  C CG  . LYS D 1 282 ? -11.235 25.427  -0.992  1.00 32.13  ? 262 LYS D CG  1 
ATOM   8426  C CD  . LYS D 1 282 ? -11.065 25.340  -2.487  1.00 30.73  ? 262 LYS D CD  1 
ATOM   8427  C CE  . LYS D 1 282 ? -12.416 25.394  -3.151  1.00 31.41  ? 262 LYS D CE  1 
ATOM   8428  N NZ  . LYS D 1 282 ? -12.306 25.057  -4.594  1.00 32.12  ? 262 LYS D NZ  1 
ATOM   8429  N N   . TYR D 1 283 ? -13.182 24.219  2.250   1.00 34.14  ? 263 TYR D N   1 
ATOM   8430  C CA  . TYR D 1 283 ? -14.030 24.863  3.236   1.00 36.45  ? 263 TYR D CA  1 
ATOM   8431  C C   . TYR D 1 283 ? -13.320 25.071  4.571   1.00 37.90  ? 263 TYR D C   1 
ATOM   8432  O O   . TYR D 1 283 ? -13.398 26.144  5.158   1.00 39.51  ? 263 TYR D O   1 
ATOM   8433  C CB  . TYR D 1 283 ? -15.289 24.049  3.480   1.00 36.30  ? 263 TYR D CB  1 
ATOM   8434  C CG  . TYR D 1 283 ? -16.407 24.409  2.560   1.00 35.47  ? 263 TYR D CG  1 
ATOM   8435  C CD1 . TYR D 1 283 ? -16.423 23.961  1.251   1.00 35.44  ? 263 TYR D CD1 1 
ATOM   8436  C CD2 . TYR D 1 283 ? -17.454 25.179  2.995   1.00 35.38  ? 263 TYR D CD2 1 
ATOM   8437  C CE1 . TYR D 1 283 ? -17.455 24.267  0.403   1.00 33.99  ? 263 TYR D CE1 1 
ATOM   8438  C CE2 . TYR D 1 283 ? -18.489 25.504  2.145   1.00 35.16  ? 263 TYR D CE2 1 
ATOM   8439  C CZ  . TYR D 1 283 ? -18.475 25.045  0.849   1.00 35.38  ? 263 TYR D CZ  1 
ATOM   8440  O OH  . TYR D 1 283 ? -19.498 25.359  -0.010  1.00 37.04  ? 263 TYR D OH  1 
ATOM   8441  N N   . VAL D 1 284 ? -12.625 24.055  5.059   1.00 37.72  ? 264 VAL D N   1 
ATOM   8442  C CA  . VAL D 1 284 ? -11.958 24.189  6.355   1.00 36.36  ? 264 VAL D CA  1 
ATOM   8443  C C   . VAL D 1 284 ? -10.833 25.201  6.272   1.00 38.91  ? 264 VAL D C   1 
ATOM   8444  O O   . VAL D 1 284 ? -10.600 25.972  7.207   1.00 38.87  ? 264 VAL D O   1 
ATOM   8445  C CB  . VAL D 1 284 ? -11.391 22.854  6.852   1.00 33.72  ? 264 VAL D CB  1 
ATOM   8446  C CG1 . VAL D 1 284 ? -10.485 23.058  8.060   1.00 31.92  ? 264 VAL D CG1 1 
ATOM   8447  C CG2 . VAL D 1 284 ? -12.530 21.945  7.232   1.00 33.85  ? 264 VAL D CG2 1 
ATOM   8448  N N   . ARG D 1 285 ? -10.133 25.192  5.148   1.00 40.23  ? 265 ARG D N   1 
ATOM   8449  C CA  . ARG D 1 285 ? -9.062  26.140  4.937   1.00 39.66  ? 265 ARG D CA  1 
ATOM   8450  C C   . ARG D 1 285 ? -9.519  27.590  4.904   1.00 40.42  ? 265 ARG D C   1 
ATOM   8451  O O   . ARG D 1 285 ? -8.737  28.483  5.193   1.00 39.27  ? 265 ARG D O   1 
ATOM   8452  C CB  . ARG D 1 285 ? -8.353  25.811  3.653   1.00 41.09  ? 265 ARG D CB  1 
ATOM   8453  C CG  . ARG D 1 285 ? -7.265  24.801  3.879   1.00 41.31  ? 265 ARG D CG  1 
ATOM   8454  C CD  . ARG D 1 285 ? -6.924  24.112  2.589   1.00 40.97  ? 265 ARG D CD  1 
ATOM   8455  N NE  . ARG D 1 285 ? -5.849  23.176  2.817   1.00 41.95  ? 265 ARG D NE  1 
ATOM   8456  C CZ  . ARG D 1 285 ? -5.527  22.179  2.004   1.00 41.79  ? 265 ARG D CZ  1 
ATOM   8457  N NH1 . ARG D 1 285 ? -6.180  21.980  0.876   1.00 42.08  ? 265 ARG D NH1 1 
ATOM   8458  N NH2 . ARG D 1 285 ? -4.528  21.379  2.326   1.00 40.46  ? 265 ARG D NH2 1 
ATOM   8459  N N   . ALA D 1 286 ? -10.770 27.827  4.530   1.00 41.67  ? 266 ALA D N   1 
ATOM   8460  C CA  . ALA D 1 286 ? -11.305 29.191  4.500   1.00 42.60  ? 266 ALA D CA  1 
ATOM   8461  C C   . ALA D 1 286 ? -11.792 29.634  5.866   1.00 44.05  ? 266 ALA D C   1 
ATOM   8462  O O   . ALA D 1 286 ? -12.111 30.790  6.050   1.00 45.75  ? 266 ALA D O   1 
ATOM   8463  C CB  . ALA D 1 286 ? -12.452 29.295  3.515   1.00 41.67  ? 266 ALA D CB  1 
ATOM   8464  N N   . GLY D 1 287 ? -11.895 28.706  6.810   1.00 44.26  ? 267 GLY D N   1 
ATOM   8465  C CA  . GLY D 1 287 ? -12.444 29.021  8.112   1.00 42.89  ? 267 GLY D CA  1 
ATOM   8466  C C   . GLY D 1 287 ? -13.958 29.037  8.073   1.00 42.67  ? 267 GLY D C   1 
ATOM   8467  O O   . GLY D 1 287 ? -14.604 29.573  8.976   1.00 43.40  ? 267 GLY D O   1 
ATOM   8468  N N   . TRP D 1 288 ? -14.520 28.446  7.026   1.00 40.54  ? 268 TRP D N   1 
ATOM   8469  C CA  . TRP D 1 288 ? -15.957 28.281  6.897   1.00 41.07  ? 268 TRP D CA  1 
ATOM   8470  C C   . TRP D 1 288 ? -16.331 26.958  7.537   1.00 43.46  ? 268 TRP D C   1 
ATOM   8471  O O   . TRP D 1 288 ? -16.655 25.992  6.845   1.00 44.42  ? 268 TRP D O   1 
ATOM   8472  C CB  . TRP D 1 288 ? -16.333 28.228  5.423   1.00 41.28  ? 268 TRP D CB  1 
ATOM   8473  C CG  . TRP D 1 288 ? -16.113 29.497  4.674   1.00 41.57  ? 268 TRP D CG  1 
ATOM   8474  C CD1 . TRP D 1 288 ? -15.569 30.660  5.148   1.00 42.07  ? 268 TRP D CD1 1 
ATOM   8475  C CD2 . TRP D 1 288 ? -16.406 29.726  3.297   1.00 40.27  ? 268 TRP D CD2 1 
ATOM   8476  N NE1 . TRP D 1 288 ? -15.534 31.604  4.152   1.00 41.26  ? 268 TRP D NE1 1 
ATOM   8477  C CE2 . TRP D 1 288 ? -16.039 31.054  3.006   1.00 40.40  ? 268 TRP D CE2 1 
ATOM   8478  C CE3 . TRP D 1 288 ? -16.975 28.949  2.290   1.00 41.10  ? 268 TRP D CE3 1 
ATOM   8479  C CZ2 . TRP D 1 288 ? -16.222 31.619  1.753   1.00 42.39  ? 268 TRP D CZ2 1 
ATOM   8480  C CZ3 . TRP D 1 288 ? -17.153 29.511  1.034   1.00 43.51  ? 268 TRP D CZ3 1 
ATOM   8481  C CH2 . TRP D 1 288 ? -16.774 30.831  0.774   1.00 42.97  ? 268 TRP D CH2 1 
ATOM   8482  N N   . LEU D 1 289 ? -16.309 26.915  8.863   1.00 43.43  ? 269 LEU D N   1 
ATOM   8483  C CA  . LEU D 1 289 ? -16.422 25.639  9.576   1.00 41.82  ? 269 LEU D CA  1 
ATOM   8484  C C   . LEU D 1 289 ? -17.826 25.247  9.995   1.00 41.76  ? 269 LEU D C   1 
ATOM   8485  O O   . LEU D 1 289 ? -17.999 24.237  10.656  1.00 39.96  ? 269 LEU D O   1 
ATOM   8486  C CB  . LEU D 1 289 ? -15.531 25.647  10.803  1.00 41.09  ? 269 LEU D CB  1 
ATOM   8487  C CG  . LEU D 1 289 ? -14.156 26.286  10.587  1.00 41.23  ? 269 LEU D CG  1 
ATOM   8488  C CD1 . LEU D 1 289 ? -13.411 26.314  11.896  1.00 38.84  ? 269 LEU D CD1 1 
ATOM   8489  C CD2 . LEU D 1 289 ? -13.321 25.522  9.571   1.00 41.62  ? 269 LEU D CD2 1 
ATOM   8490  N N   . GLY D 1 290 ? -18.828 26.019  9.609   1.00 44.43  ? 270 GLY D N   1 
ATOM   8491  C CA  . GLY D 1 290 ? -20.192 25.723  10.022  1.00 47.78  ? 270 GLY D CA  1 
ATOM   8492  C C   . GLY D 1 290 ? -20.782 26.781  10.935  1.00 49.19  ? 270 GLY D C   1 
ATOM   8493  O O   . GLY D 1 290 ? -20.439 27.965  10.835  1.00 51.92  ? 270 GLY D O   1 
ATOM   8494  N N   . ARG D 1 291 ? -21.690 26.344  11.807  1.00 50.93  ? 271 ARG D N   1 
ATOM   8495  C CA  . ARG D 1 291 ? -22.446 27.252  12.690  1.00 54.10  ? 271 ARG D CA  1 
ATOM   8496  C C   . ARG D 1 291 ? -21.559 28.068  13.587  1.00 52.31  ? 271 ARG D C   1 
ATOM   8497  O O   . ARG D 1 291 ? -21.681 29.279  13.653  1.00 51.00  ? 271 ARG D O   1 
ATOM   8498  C CB  . ARG D 1 291 ? -23.430 26.487  13.559  1.00 56.68  ? 271 ARG D CB  1 
ATOM   8499  C CG  . ARG D 1 291 ? -24.802 26.435  12.942  1.00 61.91  ? 271 ARG D CG  1 
ATOM   8500  C CD  . ARG D 1 291 ? -25.751 25.586  13.751  1.00 69.74  ? 271 ARG D CD  1 
ATOM   8501  N NE  . ARG D 1 291 ? -26.973 25.330  12.979  1.00 82.17  ? 271 ARG D NE  1 
ATOM   8502  C CZ  . ARG D 1 291 ? -27.848 24.357  13.240  1.00 87.46  ? 271 ARG D CZ  1 
ATOM   8503  N NH1 . ARG D 1 291 ? -27.658 23.561  14.269  1.00 94.01  ? 271 ARG D NH1 1 
ATOM   8504  N NH2 . ARG D 1 291 ? -28.924 24.180  12.485  1.00 84.07  ? 271 ARG D NH2 1 
ATOM   8505  N N   . LYS D 1 292 ? -20.634 27.400  14.251  1.00 53.57  ? 272 LYS D N   1 
ATOM   8506  C CA  . LYS D 1 292 ? -19.741 28.076  15.169  1.00 54.70  ? 272 LYS D CA  1 
ATOM   8507  C C   . LYS D 1 292 ? -18.945 29.218  14.550  1.00 54.17  ? 272 LYS D C   1 
ATOM   8508  O O   . LYS D 1 292 ? -18.303 29.983  15.270  1.00 56.56  ? 272 LYS D O   1 
ATOM   8509  C CB  . LYS D 1 292 ? -18.751 27.081  15.750  1.00 57.92  ? 272 LYS D CB  1 
ATOM   8510  C CG  . LYS D 1 292 ? -17.777 26.522  14.727  1.00 62.76  ? 272 LYS D CG  1 
ATOM   8511  C CD  . LYS D 1 292 ? -16.539 25.958  15.399  1.00 61.72  ? 272 LYS D CD  1 
ATOM   8512  C CE  . LYS D 1 292 ? -16.330 24.513  15.005  1.00 60.86  ? 272 LYS D CE  1 
ATOM   8513  N NZ  . LYS D 1 292 ? -14.948 24.122  15.356  1.00 62.28  ? 272 LYS D NZ  1 
ATOM   8514  N N   . SER D 1 293 ? -18.933 29.312  13.229  1.00 51.37  ? 273 SER D N   1 
ATOM   8515  C CA  . SER D 1 293 ? -18.145 30.346  12.582  1.00 49.25  ? 273 SER D CA  1 
ATOM   8516  C C   . SER D 1 293 ? -19.007 31.202  11.669  1.00 46.84  ? 273 SER D C   1 
ATOM   8517  O O   . SER D 1 293 ? -18.507 32.118  11.033  1.00 46.17  ? 273 SER D O   1 
ATOM   8518  C CB  . SER D 1 293 ? -16.959 29.725  11.836  1.00 48.99  ? 273 SER D CB  1 
ATOM   8519  O OG  . SER D 1 293 ? -17.327 29.332  10.529  1.00 50.17  ? 273 SER D OG  1 
ATOM   8520  N N   . GLY D 1 294 ? -20.302 30.913  11.617  1.00 44.66  ? 274 GLY D N   1 
ATOM   8521  C CA  . GLY D 1 294 ? -21.227 31.771  10.911  1.00 45.57  ? 274 GLY D CA  1 
ATOM   8522  C C   . GLY D 1 294 ? -21.408 31.362  9.476   1.00 48.56  ? 274 GLY D C   1 
ATOM   8523  O O   . GLY D 1 294 ? -22.318 31.858  8.810   1.00 52.05  ? 274 GLY D O   1 
ATOM   8524  N N   . LYS D 1 295 ? -20.569 30.437  9.006   1.00 50.48  ? 275 LYS D N   1 
ATOM   8525  C CA  . LYS D 1 295 ? -20.594 30.015  7.610   1.00 46.91  ? 275 LYS D CA  1 
ATOM   8526  C C   . LYS D 1 295 ? -20.001 28.629  7.424   1.00 45.83  ? 275 LYS D C   1 
ATOM   8527  O O   . LYS D 1 295 ? -18.906 28.329  7.928   1.00 40.65  ? 275 LYS D O   1 
ATOM   8528  C CB  . LYS D 1 295 ? -19.803 31.003  6.775   1.00 45.72  ? 275 LYS D CB  1 
ATOM   8529  C CG  . LYS D 1 295 ? -20.050 30.884  5.295   1.00 48.83  ? 275 LYS D CG  1 
ATOM   8530  C CD  . LYS D 1 295 ? -19.137 31.831  4.528   1.00 51.62  ? 275 LYS D CD  1 
ATOM   8531  C CE  . LYS D 1 295 ? -19.800 32.399  3.279   1.00 52.94  ? 275 LYS D CE  1 
ATOM   8532  N NZ  . LYS D 1 295 ? -20.411 31.341  2.432   1.00 55.89  ? 275 LYS D NZ  1 
ATOM   8533  N N   . GLY D 1 296 ? -20.733 27.796  6.692   1.00 46.03  ? 276 GLY D N   1 
ATOM   8534  C CA  . GLY D 1 296 ? -20.240 26.486  6.258   1.00 45.23  ? 276 GLY D CA  1 
ATOM   8535  C C   . GLY D 1 296 ? -20.800 26.177  4.883   1.00 42.52  ? 276 GLY D C   1 
ATOM   8536  O O   . GLY D 1 296 ? -20.598 26.936  3.961   1.00 40.74  ? 276 GLY D O   1 
ATOM   8537  N N   . PHE D 1 297 ? -21.519 25.073  4.742   1.00 41.28  ? 277 PHE D N   1 
ATOM   8538  C CA  . PHE D 1 297 ? -22.240 24.814  3.502   1.00 42.68  ? 277 PHE D CA  1 
ATOM   8539  C C   . PHE D 1 297 ? -23.450 25.722  3.409   1.00 44.63  ? 277 PHE D C   1 
ATOM   8540  O O   . PHE D 1 297 ? -23.923 26.030  2.318   1.00 44.71  ? 277 PHE D O   1 
ATOM   8541  C CB  . PHE D 1 297 ? -22.633 23.343  3.373   1.00 40.62  ? 277 PHE D CB  1 
ATOM   8542  C CG  . PHE D 1 297 ? -21.446 22.445  3.205   1.00 43.15  ? 277 PHE D CG  1 
ATOM   8543  C CD1 . PHE D 1 297 ? -20.714 22.459  2.028   1.00 44.21  ? 277 PHE D CD1 1 
ATOM   8544  C CD2 . PHE D 1 297 ? -21.018 21.639  4.236   1.00 42.54  ? 277 PHE D CD2 1 
ATOM   8545  C CE1 . PHE D 1 297 ? -19.598 21.663  1.882   1.00 41.83  ? 277 PHE D CE1 1 
ATOM   8546  C CE2 . PHE D 1 297 ? -19.900 20.854  4.095   1.00 40.95  ? 277 PHE D CE2 1 
ATOM   8547  C CZ  . PHE D 1 297 ? -19.191 20.866  2.918   1.00 41.56  ? 277 PHE D CZ  1 
ATOM   8548  N N   . TYR D 1 298 ? -23.931 26.145  4.570   1.00 48.29  ? 278 TYR D N   1 
ATOM   8549  C CA  . TYR D 1 298 ? -24.999 27.123  4.683   1.00 48.94  ? 278 TYR D CA  1 
ATOM   8550  C C   . TYR D 1 298 ? -24.444 28.424  5.242   1.00 50.73  ? 278 TYR D C   1 
ATOM   8551  O O   . TYR D 1 298 ? -23.447 28.430  5.964   1.00 49.64  ? 278 TYR D O   1 
ATOM   8552  C CB  . TYR D 1 298 ? -26.062 26.610  5.640   1.00 47.25  ? 278 TYR D CB  1 
ATOM   8553  C CG  . TYR D 1 298 ? -26.875 25.462  5.134   1.00 45.43  ? 278 TYR D CG  1 
ATOM   8554  C CD1 . TYR D 1 298 ? -26.533 24.156  5.453   1.00 46.05  ? 278 TYR D CD1 1 
ATOM   8555  C CD2 . TYR D 1 298 ? -28.011 25.676  4.377   1.00 43.40  ? 278 TYR D CD2 1 
ATOM   8556  C CE1 . TYR D 1 298 ? -27.292 23.090  5.013   1.00 45.11  ? 278 TYR D CE1 1 
ATOM   8557  C CE2 . TYR D 1 298 ? -28.779 24.614  3.930   1.00 44.92  ? 278 TYR D CE2 1 
ATOM   8558  C CZ  . TYR D 1 298 ? -28.409 23.322  4.253   1.00 46.04  ? 278 TYR D CZ  1 
ATOM   8559  O OH  . TYR D 1 298 ? -29.140 22.246  3.821   1.00 47.16  ? 278 TYR D OH  1 
ATOM   8560  N N   . ASP D 1 299 ? -25.104 29.526  4.924   1.00 57.14  ? 279 ASP D N   1 
ATOM   8561  C CA  . ASP D 1 299 ? -24.722 30.820  5.478   1.00 62.78  ? 279 ASP D CA  1 
ATOM   8562  C C   . ASP D 1 299 ? -25.571 31.092  6.715   1.00 61.84  ? 279 ASP D C   1 
ATOM   8563  O O   . ASP D 1 299 ? -26.790 31.030  6.638   1.00 62.34  ? 279 ASP D O   1 
ATOM   8564  C CB  . ASP D 1 299 ? -24.925 31.927  4.441   1.00 65.10  ? 279 ASP D CB  1 
ATOM   8565  C CG  . ASP D 1 299 ? -23.992 33.109  4.663   1.00 71.74  ? 279 ASP D CG  1 
ATOM   8566  O OD1 . ASP D 1 299 ? -23.818 33.545  5.825   1.00 73.54  ? 279 ASP D OD1 1 
ATOM   8567  O OD2 . ASP D 1 299 ? -23.414 33.596  3.673   1.00 76.83  ? 279 ASP D OD2 1 
ATOM   8568  N N   . TYR D 1 300 ? -24.941 31.392  7.848   1.00 62.61  ? 280 TYR D N   1 
ATOM   8569  C CA  . TYR D 1 300 ? -25.688 31.613  9.096   1.00 65.51  ? 280 TYR D CA  1 
ATOM   8570  C C   . TYR D 1 300 ? -25.807 33.099  9.420   1.00 72.93  ? 280 TYR D C   1 
ATOM   8571  O O   . TYR D 1 300 ? -25.132 33.625  10.304  1.00 73.08  ? 280 TYR D O   1 
ATOM   8572  C CB  . TYR D 1 300 ? -25.073 30.807  10.234  1.00 63.34  ? 280 TYR D CB  1 
ATOM   8573  C CG  . TYR D 1 300 ? -25.142 29.334  9.928   1.00 60.96  ? 280 TYR D CG  1 
ATOM   8574  C CD1 . TYR D 1 300 ? -24.049 28.655  9.381   1.00 61.39  ? 280 TYR D CD1 1 
ATOM   8575  C CD2 . TYR D 1 300 ? -26.321 28.628  10.110  1.00 60.04  ? 280 TYR D CD2 1 
ATOM   8576  C CE1 . TYR D 1 300 ? -24.127 27.304  9.066   1.00 56.58  ? 280 TYR D CE1 1 
ATOM   8577  C CE2 . TYR D 1 300 ? -26.406 27.280  9.798   1.00 57.66  ? 280 TYR D CE2 1 
ATOM   8578  C CZ  . TYR D 1 300 ? -25.313 26.632  9.277   1.00 54.70  ? 280 TYR D CZ  1 
ATOM   8579  O OH  . TYR D 1 300 ? -25.434 25.311  8.975   1.00 54.93  ? 280 TYR D OH  1 
ATOM   8580  N N   . SER D 1 301 ? -26.699 33.750  8.675   1.00 81.25  ? 281 SER D N   1 
ATOM   8581  C CA  . SER D 1 301 ? -26.882 35.201  8.707   1.00 84.82  ? 281 SER D CA  1 
ATOM   8582  C C   . SER D 1 301 ? -25.603 35.925  8.271   1.00 81.50  ? 281 SER D C   1 
ATOM   8583  O O   . SER D 1 301 ? -25.421 36.214  7.090   1.00 78.28  ? 281 SER D O   1 
ATOM   8584  C CB  . SER D 1 301 ? -27.321 35.668  10.100  1.00 85.22  ? 281 SER D CB  1 
ATOM   8585  O OG  . SER D 1 301 ? -27.845 36.982  10.053  1.00 85.02  ? 281 SER D OG  1 
ATOM   8586  N N   . MET E 1 21  ? -50.154 18.999  -17.922 1.00 81.56  ? 1   MET E N   1 
ATOM   8587  C CA  . MET E 1 21  ? -50.206 17.505  -17.855 1.00 86.74  ? 1   MET E CA  1 
ATOM   8588  C C   . MET E 1 21  ? -51.481 17.041  -17.196 1.00 88.21  ? 1   MET E C   1 
ATOM   8589  O O   . MET E 1 21  ? -51.745 17.376  -16.047 1.00 90.20  ? 1   MET E O   1 
ATOM   8590  C CB  . MET E 1 21  ? -49.031 16.941  -17.070 1.00 87.50  ? 1   MET E CB  1 
ATOM   8591  C CG  . MET E 1 21  ? -47.697 17.371  -17.633 1.00 89.34  ? 1   MET E CG  1 
ATOM   8592  S SD  . MET E 1 21  ? -46.478 16.066  -17.508 1.00 87.95  ? 1   MET E SD  1 
ATOM   8593  C CE  . MET E 1 21  ? -44.984 17.014  -17.743 1.00 86.78  ? 1   MET E CE  1 
ATOM   8594  N N   . LYS E 1 22  ? -52.252 16.250  -17.928 1.00 89.09  ? 2   LYS E N   1 
ATOM   8595  C CA  . LYS E 1 22  ? -53.556 15.793  -17.463 1.00 91.33  ? 2   LYS E CA  1 
ATOM   8596  C C   . LYS E 1 22  ? -53.642 14.277  -17.381 1.00 88.61  ? 2   LYS E C   1 
ATOM   8597  O O   . LYS E 1 22  ? -54.237 13.735  -16.448 1.00 86.23  ? 2   LYS E O   1 
ATOM   8598  C CB  . LYS E 1 22  ? -54.667 16.345  -18.373 1.00 96.24  ? 2   LYS E CB  1 
ATOM   8599  C CG  . LYS E 1 22  ? -55.398 17.555  -17.791 1.00 101.01 ? 2   LYS E CG  1 
ATOM   8600  C CD  . LYS E 1 22  ? -55.053 18.875  -18.473 1.00 102.78 ? 2   LYS E CD  1 
ATOM   8601  C CE  . LYS E 1 22  ? -55.187 20.073  -17.536 1.00 102.18 ? 2   LYS E CE  1 
ATOM   8602  N NZ  . LYS E 1 22  ? -53.865 20.715  -17.282 1.00 102.58 ? 2   LYS E NZ  1 
ATOM   8603  N N   . LYS E 1 23  ? -53.039 13.602  -18.354 1.00 84.77  ? 3   LYS E N   1 
ATOM   8604  C CA  . LYS E 1 23  ? -53.107 12.157  -18.448 1.00 83.66  ? 3   LYS E CA  1 
ATOM   8605  C C   . LYS E 1 23  ? -51.728 11.505  -18.370 1.00 81.60  ? 3   LYS E C   1 
ATOM   8606  O O   . LYS E 1 23  ? -50.774 11.963  -19.003 1.00 78.21  ? 3   LYS E O   1 
ATOM   8607  C CB  . LYS E 1 23  ? -53.782 11.770  -19.754 1.00 84.73  ? 3   LYS E CB  1 
ATOM   8608  C CG  . LYS E 1 23  ? -54.035 10.284  -19.867 1.00 88.42  ? 3   LYS E CG  1 
ATOM   8609  C CD  . LYS E 1 23  ? -54.867 9.972   -21.092 1.00 90.30  ? 3   LYS E CD  1 
ATOM   8610  C CE  . LYS E 1 23  ? -54.853 8.482   -21.388 1.00 90.47  ? 3   LYS E CE  1 
ATOM   8611  N NZ  . LYS E 1 23  ? -55.518 8.168   -22.675 1.00 88.89  ? 3   LYS E NZ  1 
ATOM   8612  N N   . VAL E 1 24  ? -51.653 10.407  -17.622 1.00 77.46  ? 4   VAL E N   1 
ATOM   8613  C CA  . VAL E 1 24  ? -50.391 9.750   -17.317 1.00 72.90  ? 4   VAL E CA  1 
ATOM   8614  C C   . VAL E 1 24  ? -50.471 8.261   -17.563 1.00 72.04  ? 4   VAL E C   1 
ATOM   8615  O O   . VAL E 1 24  ? -51.391 7.609   -17.089 1.00 73.65  ? 4   VAL E O   1 
ATOM   8616  C CB  . VAL E 1 24  ? -50.043 9.924   -15.830 1.00 71.04  ? 4   VAL E CB  1 
ATOM   8617  C CG1 . VAL E 1 24  ? -48.685 9.319   -15.515 1.00 70.56  ? 4   VAL E CG1 1 
ATOM   8618  C CG2 . VAL E 1 24  ? -50.030 11.389  -15.474 1.00 73.59  ? 4   VAL E CG2 1 
ATOM   8619  N N   . CYS E 1 25  ? -49.491 7.710   -18.266 1.00 69.82  ? 5   CYS E N   1 
ATOM   8620  C CA  . CYS E 1 25  ? -49.395 6.261   -18.380 1.00 67.68  ? 5   CYS E CA  1 
ATOM   8621  C C   . CYS E 1 25  ? -48.244 5.728   -17.555 1.00 64.57  ? 5   CYS E C   1 
ATOM   8622  O O   . CYS E 1 25  ? -47.107 6.165   -17.709 1.00 63.35  ? 5   CYS E O   1 
ATOM   8623  C CB  . CYS E 1 25  ? -49.210 5.830   -19.821 1.00 68.33  ? 5   CYS E CB  1 
ATOM   8624  S SG  . CYS E 1 25  ? -48.807 4.078   -19.942 1.00 72.40  ? 5   CYS E SG  1 
ATOM   8625  N N   . VAL E 1 26  ? -48.552 4.770   -16.691 1.00 62.40  ? 6   VAL E N   1 
ATOM   8626  C CA  . VAL E 1 26  ? -47.565 4.154   -15.834 1.00 59.73  ? 6   VAL E CA  1 
ATOM   8627  C C   . VAL E 1 26  ? -47.363 2.741   -16.297 1.00 62.35  ? 6   VAL E C   1 
ATOM   8628  O O   . VAL E 1 26  ? -48.281 1.945   -16.269 1.00 68.11  ? 6   VAL E O   1 
ATOM   8629  C CB  . VAL E 1 26  ? -48.036 4.110   -14.381 1.00 59.70  ? 6   VAL E CB  1 
ATOM   8630  C CG1 . VAL E 1 26  ? -47.277 3.045   -13.612 1.00 58.93  ? 6   VAL E CG1 1 
ATOM   8631  C CG2 . VAL E 1 26  ? -47.803 5.452   -13.722 1.00 61.57  ? 6   VAL E CG2 1 
ATOM   8632  N N   . ILE E 1 27  ? -46.149 2.428   -16.711 1.00 64.85  ? 7   ILE E N   1 
ATOM   8633  C CA  . ILE E 1 27  ? -45.856 1.127   -17.262 1.00 63.74  ? 7   ILE E CA  1 
ATOM   8634  C C   . ILE E 1 27  ? -45.218 0.194   -16.263 1.00 66.61  ? 7   ILE E C   1 
ATOM   8635  O O   . ILE E 1 27  ? -44.166 0.497   -15.692 1.00 64.95  ? 7   ILE E O   1 
ATOM   8636  C CB  . ILE E 1 27  ? -44.846 1.251   -18.373 1.00 62.47  ? 7   ILE E CB  1 
ATOM   8637  C CG1 . ILE E 1 27  ? -45.551 1.620   -19.649 1.00 62.62  ? 7   ILE E CG1 1 
ATOM   8638  C CG2 . ILE E 1 27  ? -44.112 -0.069  -18.551 1.00 63.32  ? 7   ILE E CG2 1 
ATOM   8639  C CD1 . ILE E 1 27  ? -44.615 2.278   -20.617 1.00 64.43  ? 7   ILE E CD1 1 
ATOM   8640  N N   . GLY E 1 28  ? -45.810 -0.978  -16.115 1.00 69.86  ? 8   GLY E N   1 
ATOM   8641  C CA  . GLY E 1 28  ? -45.307 -1.945  -15.177 1.00 72.03  ? 8   GLY E CA  1 
ATOM   8642  C C   . GLY E 1 28  ? -46.205 -1.823  -13.982 1.00 72.49  ? 8   GLY E C   1 
ATOM   8643  O O   . GLY E 1 28  ? -46.303 -0.758  -13.378 1.00 76.32  ? 8   GLY E O   1 
ATOM   8644  N N   . ALA E 1 29  ? -46.887 -2.911  -13.663 1.00 72.62  ? 9   ALA E N   1 
ATOM   8645  C CA  . ALA E 1 29  ? -47.878 -2.913  -12.609 1.00 71.57  ? 9   ALA E CA  1 
ATOM   8646  C C   . ALA E 1 29  ? -47.362 -3.700  -11.420 1.00 69.13  ? 9   ALA E C   1 
ATOM   8647  O O   . ALA E 1 29  ? -48.066 -4.536  -10.880 1.00 71.60  ? 9   ALA E O   1 
ATOM   8648  C CB  . ALA E 1 29  ? -49.169 -3.513  -13.129 1.00 71.56  ? 9   ALA E CB  1 
ATOM   8649  N N   . GLY E 1 30  ? -46.126 -3.430  -11.014 1.00 69.63  ? 10  GLY E N   1 
ATOM   8650  C CA  . GLY E 1 30  ? -45.539 -4.108  -9.863  1.00 64.10  ? 10  GLY E CA  1 
ATOM   8651  C C   . GLY E 1 30  ? -45.763 -3.256  -8.640  1.00 63.67  ? 10  GLY E C   1 
ATOM   8652  O O   . GLY E 1 30  ? -46.525 -2.298  -8.683  1.00 63.67  ? 10  GLY E O   1 
ATOM   8653  N N   . THR E 1 31  ? -45.091 -3.599  -7.552  1.00 64.04  ? 11  THR E N   1 
ATOM   8654  C CA  . THR E 1 31  ? -45.107 -2.781  -6.334  1.00 67.51  ? 11  THR E CA  1 
ATOM   8655  C C   . THR E 1 31  ? -44.914 -1.267  -6.582  1.00 70.86  ? 11  THR E C   1 
ATOM   8656  O O   . THR E 1 31  ? -45.683 -0.447  -6.061  1.00 76.54  ? 11  THR E O   1 
ATOM   8657  C CB  . THR E 1 31  ? -44.020 -3.255  -5.351  1.00 66.69  ? 11  THR E CB  1 
ATOM   8658  O OG1 . THR E 1 31  ? -44.348 -4.560  -4.867  1.00 66.16  ? 11  THR E OG1 1 
ATOM   8659  C CG2 . THR E 1 31  ? -43.896 -2.298  -4.164  1.00 67.74  ? 11  THR E CG2 1 
ATOM   8660  N N   . MET E 1 32  ? -43.894 -0.901  -7.357  1.00 65.82  ? 12  MET E N   1 
ATOM   8661  C CA  . MET E 1 32  ? -43.603 0.515   -7.590  1.00 64.35  ? 12  MET E CA  1 
ATOM   8662  C C   . MET E 1 32  ? -44.558 1.173   -8.583  1.00 59.31  ? 12  MET E C   1 
ATOM   8663  O O   . MET E 1 32  ? -45.067 2.261   -8.327  1.00 57.56  ? 12  MET E O   1 
ATOM   8664  C CB  . MET E 1 32  ? -42.157 0.713   -8.055  1.00 64.05  ? 12  MET E CB  1 
ATOM   8665  C CG  . MET E 1 32  ? -41.142 0.633   -6.931  1.00 62.43  ? 12  MET E CG  1 
ATOM   8666  S SD  . MET E 1 32  ? -41.541 1.697   -5.535  1.00 67.49  ? 12  MET E SD  1 
ATOM   8667  C CE  . MET E 1 32  ? -41.712 3.294   -6.344  1.00 62.34  ? 12  MET E CE  1 
ATOM   8668  N N   . GLY E 1 33  ? -44.790 0.525   -9.711  1.00 56.33  ? 13  GLY E N   1 
ATOM   8669  C CA  . GLY E 1 33  ? -45.629 1.106   -10.755 1.00 62.54  ? 13  GLY E CA  1 
ATOM   8670  C C   . GLY E 1 33  ? -47.069 1.309   -10.310 1.00 67.48  ? 13  GLY E C   1 
ATOM   8671  O O   . GLY E 1 33  ? -47.669 2.359   -10.550 1.00 68.59  ? 13  GLY E O   1 
ATOM   8672  N N   . SER E 1 34  ? -47.613 0.306   -9.631  1.00 72.75  ? 14  SER E N   1 
ATOM   8673  C CA  . SER E 1 34  ? -48.975 0.380   -9.108  1.00 73.85  ? 14  SER E CA  1 
ATOM   8674  C C   . SER E 1 34  ? -49.063 1.399   -7.980  1.00 70.27  ? 14  SER E C   1 
ATOM   8675  O O   . SER E 1 34  ? -50.076 2.075   -7.844  1.00 72.21  ? 14  SER E O   1 
ATOM   8676  C CB  . SER E 1 34  ? -49.479 -0.990  -8.631  1.00 77.11  ? 14  SER E CB  1 
ATOM   8677  O OG  . SER E 1 34  ? -48.443 -1.775  -8.081  1.00 83.71  ? 14  SER E OG  1 
ATOM   8678  N N   . GLY E 1 35  ? -48.011 1.505   -7.173  1.00 68.41  ? 15  GLY E N   1 
ATOM   8679  C CA  . GLY E 1 35  ? -47.925 2.575   -6.175  1.00 67.23  ? 15  GLY E CA  1 
ATOM   8680  C C   . GLY E 1 35  ? -47.930 3.945   -6.843  1.00 65.99  ? 15  GLY E C   1 
ATOM   8681  O O   . GLY E 1 35  ? -48.499 4.913   -6.334  1.00 65.04  ? 15  GLY E O   1 
ATOM   8682  N N   . ILE E 1 36  ? -47.300 4.022   -8.004  1.00 64.53  ? 16  ILE E N   1 
ATOM   8683  C CA  . ILE E 1 36  ? -47.184 5.282   -8.708  1.00 62.82  ? 16  ILE E CA  1 
ATOM   8684  C C   . ILE E 1 36  ? -48.499 5.643   -9.376  1.00 59.41  ? 16  ILE E C   1 
ATOM   8685  O O   . ILE E 1 36  ? -48.844 6.808   -9.476  1.00 55.69  ? 16  ILE E O   1 
ATOM   8686  C CB  . ILE E 1 36  ? -46.023 5.235   -9.724  1.00 62.81  ? 16  ILE E CB  1 
ATOM   8687  C CG1 . ILE E 1 36  ? -44.695 5.188   -8.960  1.00 63.85  ? 16  ILE E CG1 1 
ATOM   8688  C CG2 . ILE E 1 36  ? -46.029 6.462   -10.630 1.00 61.91  ? 16  ILE E CG2 1 
ATOM   8689  C CD1 . ILE E 1 36  ? -43.510 4.736   -9.784  1.00 63.46  ? 16  ILE E CD1 1 
ATOM   8690  N N   . ALA E 1 37  ? -49.231 4.640   -9.834  1.00 62.36  ? 17  ALA E N   1 
ATOM   8691  C CA  . ALA E 1 37  ? -50.533 4.877   -10.442 1.00 62.63  ? 17  ALA E CA  1 
ATOM   8692  C C   . ALA E 1 37  ? -51.500 5.394   -9.391  1.00 62.83  ? 17  ALA E C   1 
ATOM   8693  O O   . ALA E 1 37  ? -52.240 6.357   -9.626  1.00 57.40  ? 17  ALA E O   1 
ATOM   8694  C CB  . ALA E 1 37  ? -51.063 3.598   -11.041 1.00 65.58  ? 17  ALA E CB  1 
ATOM   8695  N N   . GLN E 1 38  ? -51.491 4.745   -8.232  1.00 61.18  ? 18  GLN E N   1 
ATOM   8696  C CA  . GLN E 1 38  ? -52.270 5.226   -7.110  1.00 63.15  ? 18  GLN E CA  1 
ATOM   8697  C C   . GLN E 1 38  ? -51.962 6.702   -6.878  1.00 63.86  ? 18  GLN E C   1 
ATOM   8698  O O   . GLN E 1 38  ? -52.829 7.549   -7.072  1.00 65.29  ? 18  GLN E O   1 
ATOM   8699  C CB  . GLN E 1 38  ? -51.980 4.415   -5.850  1.00 61.38  ? 18  GLN E CB  1 
ATOM   8700  C CG  . GLN E 1 38  ? -52.824 4.817   -4.646  1.00 59.36  ? 18  GLN E CG  1 
ATOM   8701  C CD  . GLN E 1 38  ? -52.766 3.792   -3.534  1.00 58.78  ? 18  GLN E CD  1 
ATOM   8702  O OE1 . GLN E 1 38  ? -52.660 2.587   -3.786  1.00 61.40  ? 18  GLN E OE1 1 
ATOM   8703  N NE2 . GLN E 1 38  ? -52.830 4.259   -2.293  1.00 54.91  ? 18  GLN E NE2 1 
ATOM   8704  N N   . ALA E 1 39  ? -50.719 7.004   -6.512  1.00 64.37  ? 19  ALA E N   1 
ATOM   8705  C CA  . ALA E 1 39  ? -50.332 8.373   -6.131  1.00 63.86  ? 19  ALA E CA  1 
ATOM   8706  C C   . ALA E 1 39  ? -50.899 9.434   -7.065  1.00 61.94  ? 19  ALA E C   1 
ATOM   8707  O O   . ALA E 1 39  ? -51.307 10.506  -6.612  1.00 60.20  ? 19  ALA E O   1 
ATOM   8708  C CB  . ALA E 1 39  ? -48.822 8.507   -6.078  1.00 65.60  ? 19  ALA E CB  1 
ATOM   8709  N N   . PHE E 1 40  ? -50.919 9.118   -8.360  1.00 57.88  ? 20  PHE E N   1 
ATOM   8710  C CA  . PHE E 1 40  ? -51.405 10.030  -9.391  1.00 59.66  ? 20  PHE E CA  1 
ATOM   8711  C C   . PHE E 1 40  ? -52.924 10.168  -9.465  1.00 61.81  ? 20  PHE E C   1 
ATOM   8712  O O   . PHE E 1 40  ? -53.460 11.272  -9.582  1.00 57.40  ? 20  PHE E O   1 
ATOM   8713  C CB  . PHE E 1 40  ? -50.904 9.571   -10.749 1.00 58.54  ? 20  PHE E CB  1 
ATOM   8714  C CG  . PHE E 1 40  ? -49.644 10.233  -11.159 1.00 60.84  ? 20  PHE E CG  1 
ATOM   8715  C CD1 . PHE E 1 40  ? -49.685 11.474  -11.769 1.00 62.94  ? 20  PHE E CD1 1 
ATOM   8716  C CD2 . PHE E 1 40  ? -48.416 9.641   -10.905 1.00 60.13  ? 20  PHE E CD2 1 
ATOM   8717  C CE1 . PHE E 1 40  ? -48.519 12.110  -12.146 1.00 65.38  ? 20  PHE E CE1 1 
ATOM   8718  C CE2 . PHE E 1 40  ? -47.243 10.266  -11.273 1.00 61.53  ? 20  PHE E CE2 1 
ATOM   8719  C CZ  . PHE E 1 40  ? -47.292 11.504  -11.896 1.00 66.29  ? 20  PHE E CZ  1 
ATOM   8720  N N   . ALA E 1 41  ? -53.612 9.038   -9.430  1.00 64.94  ? 21  ALA E N   1 
ATOM   8721  C CA  . ALA E 1 41  ? -55.063 9.037   -9.519  1.00 66.84  ? 21  ALA E CA  1 
ATOM   8722  C C   . ALA E 1 41  ? -55.666 9.571   -8.229  1.00 64.58  ? 21  ALA E C   1 
ATOM   8723  O O   . ALA E 1 41  ? -56.745 10.166  -8.240  1.00 65.25  ? 21  ALA E O   1 
ATOM   8724  C CB  . ALA E 1 41  ? -55.580 7.641   -9.812  1.00 67.20  ? 21  ALA E CB  1 
ATOM   8725  N N   . ALA E 1 42  ? -54.951 9.402   -7.122  1.00 59.43  ? 22  ALA E N   1 
ATOM   8726  C CA  . ALA E 1 42  ? -55.440 9.902   -5.850  1.00 58.16  ? 22  ALA E CA  1 
ATOM   8727  C C   . ALA E 1 42  ? -55.376 11.413  -5.833  1.00 60.96  ? 22  ALA E C   1 
ATOM   8728  O O   . ALA E 1 42  ? -55.673 12.030  -4.814  1.00 63.97  ? 22  ALA E O   1 
ATOM   8729  C CB  . ALA E 1 42  ? -54.638 9.328   -4.700  1.00 55.93  ? 22  ALA E CB  1 
ATOM   8730  N N   . LYS E 1 43  ? -54.971 12.002  -6.956  1.00 61.86  ? 23  LYS E N   1 
ATOM   8731  C CA  . LYS E 1 43  ? -54.822 13.446  -7.064  1.00 61.67  ? 23  LYS E CA  1 
ATOM   8732  C C   . LYS E 1 43  ? -55.469 13.997  -8.340  1.00 64.73  ? 23  LYS E C   1 
ATOM   8733  O O   . LYS E 1 43  ? -55.218 15.137  -8.743  1.00 63.54  ? 23  LYS E O   1 
ATOM   8734  C CB  . LYS E 1 43  ? -53.336 13.799  -6.982  1.00 61.00  ? 23  LYS E CB  1 
ATOM   8735  C CG  . LYS E 1 43  ? -52.747 13.558  -5.595  1.00 59.95  ? 23  LYS E CG  1 
ATOM   8736  C CD  . LYS E 1 43  ? -52.559 14.857  -4.827  1.00 60.53  ? 23  LYS E CD  1 
ATOM   8737  C CE  . LYS E 1 43  ? -52.835 14.704  -3.340  1.00 60.68  ? 23  LYS E CE  1 
ATOM   8738  N NZ  . LYS E 1 43  ? -51.878 13.792  -2.655  1.00 61.19  ? 23  LYS E NZ  1 
ATOM   8739  N N   . GLY E 1 44  ? -56.326 13.189  -8.956  1.00 68.26  ? 24  GLY E N   1 
ATOM   8740  C CA  . GLY E 1 44  ? -57.182 13.654  -10.033 1.00 68.87  ? 24  GLY E CA  1 
ATOM   8741  C C   . GLY E 1 44  ? -56.664 13.374  -11.421 1.00 75.05  ? 24  GLY E C   1 
ATOM   8742  O O   . GLY E 1 44  ? -57.208 13.889  -12.402 1.00 77.02  ? 24  GLY E O   1 
ATOM   8743  N N   . PHE E 1 45  ? -55.627 12.551  -11.528 1.00 75.94  ? 25  PHE E N   1 
ATOM   8744  C CA  . PHE E 1 45  ? -55.063 12.262  -12.838 1.00 76.27  ? 25  PHE E CA  1 
ATOM   8745  C C   . PHE E 1 45  ? -55.740 11.113  -13.539 1.00 78.02  ? 25  PHE E C   1 
ATOM   8746  O O   . PHE E 1 45  ? -56.043 10.090  -12.930 1.00 74.24  ? 25  PHE E O   1 
ATOM   8747  C CB  . PHE E 1 45  ? -53.574 12.003  -12.733 1.00 76.81  ? 25  PHE E CB  1 
ATOM   8748  C CG  . PHE E 1 45  ? -52.792 13.251  -12.590 1.00 77.14  ? 25  PHE E CG  1 
ATOM   8749  C CD1 . PHE E 1 45  ? -52.613 13.820  -11.347 1.00 75.39  ? 25  PHE E CD1 1 
ATOM   8750  C CD2 . PHE E 1 45  ? -52.293 13.896  -13.708 1.00 78.50  ? 25  PHE E CD2 1 
ATOM   8751  C CE1 . PHE E 1 45  ? -51.916 14.999  -11.214 1.00 76.49  ? 25  PHE E CE1 1 
ATOM   8752  C CE2 . PHE E 1 45  ? -51.590 15.075  -13.584 1.00 77.76  ? 25  PHE E CE2 1 
ATOM   8753  C CZ  . PHE E 1 45  ? -51.400 15.626  -12.333 1.00 77.39  ? 25  PHE E CZ  1 
ATOM   8754  N N   . GLU E 1 46  ? -55.969 11.288  -14.834 1.00 82.47  ? 26  GLU E N   1 
ATOM   8755  C CA  . GLU E 1 46  ? -56.396 10.182  -15.667 1.00 87.04  ? 26  GLU E CA  1 
ATOM   8756  C C   . GLU E 1 46  ? -55.187 9.299   -15.896 1.00 83.52  ? 26  GLU E C   1 
ATOM   8757  O O   . GLU E 1 46  ? -54.225 9.703   -16.553 1.00 82.51  ? 26  GLU E O   1 
ATOM   8758  C CB  . GLU E 1 46  ? -56.956 10.669  -16.996 1.00 91.25  ? 26  GLU E CB  1 
ATOM   8759  C CG  . GLU E 1 46  ? -56.998 9.584   -18.067 1.00 95.31  ? 26  GLU E CG  1 
ATOM   8760  C CD  . GLU E 1 46  ? -58.274 9.600   -18.873 1.00 96.96  ? 26  GLU E CD  1 
ATOM   8761  O OE1 . GLU E 1 46  ? -58.205 9.618   -20.124 1.00 88.35  ? 26  GLU E OE1 1 
ATOM   8762  O OE2 . GLU E 1 46  ? -59.351 9.592   -18.246 1.00 103.81 ? 26  GLU E OE2 1 
ATOM   8763  N N   . VAL E 1 47  ? -55.251 8.092   -15.359 1.00 77.13  ? 27  VAL E N   1 
ATOM   8764  C CA  . VAL E 1 47  ? -54.105 7.218   -15.346 1.00 76.83  ? 27  VAL E CA  1 
ATOM   8765  C C   . VAL E 1 47  ? -54.325 6.001   -16.213 1.00 76.16  ? 27  VAL E C   1 
ATOM   8766  O O   . VAL E 1 47  ? -55.250 5.232   -15.975 1.00 83.52  ? 27  VAL E O   1 
ATOM   8767  C CB  . VAL E 1 47  ? -53.832 6.738   -13.925 1.00 73.23  ? 27  VAL E CB  1 
ATOM   8768  C CG1 . VAL E 1 47  ? -52.790 5.641   -13.934 1.00 74.39  ? 27  VAL E CG1 1 
ATOM   8769  C CG2 . VAL E 1 47  ? -53.337 7.889   -13.087 1.00 72.61  ? 27  VAL E CG2 1 
ATOM   8770  N N   . VAL E 1 48  ? -53.473 5.824   -17.212 1.00 74.64  ? 28  VAL E N   1 
ATOM   8771  C CA  . VAL E 1 48  ? -53.415 4.569   -17.936 1.00 72.78  ? 28  VAL E CA  1 
ATOM   8772  C C   . VAL E 1 48  ? -52.461 3.661   -17.196 1.00 71.42  ? 28  VAL E C   1 
ATOM   8773  O O   . VAL E 1 48  ? -51.563 4.127   -16.501 1.00 73.74  ? 28  VAL E O   1 
ATOM   8774  C CB  . VAL E 1 48  ? -52.873 4.758   -19.340 1.00 73.05  ? 28  VAL E CB  1 
ATOM   8775  C CG1 . VAL E 1 48  ? -52.712 3.413   -20.025 1.00 75.19  ? 28  VAL E CG1 1 
ATOM   8776  C CG2 . VAL E 1 48  ? -53.802 5.644   -20.131 1.00 74.08  ? 28  VAL E CG2 1 
ATOM   8777  N N   . LEU E 1 49  ? -52.640 2.364   -17.344 1.00 68.38  ? 29  LEU E N   1 
ATOM   8778  C CA  . LEU E 1 49  ? -51.769 1.471   -16.661 1.00 67.90  ? 29  LEU E CA  1 
ATOM   8779  C C   . LEU E 1 49  ? -51.558 0.200   -17.449 1.00 72.84  ? 29  LEU E C   1 
ATOM   8780  O O   . LEU E 1 49  ? -52.425 -0.671  -17.507 1.00 75.21  ? 29  LEU E O   1 
ATOM   8781  C CB  . LEU E 1 49  ? -52.318 1.140   -15.285 1.00 66.29  ? 29  LEU E CB  1 
ATOM   8782  C CG  . LEU E 1 49  ? -51.580 -0.073  -14.731 1.00 67.60  ? 29  LEU E CG  1 
ATOM   8783  C CD1 . LEU E 1 49  ? -50.169 -0.128  -15.287 1.00 69.60  ? 29  LEU E CD1 1 
ATOM   8784  C CD2 . LEU E 1 49  ? -51.481 -0.042  -13.233 1.00 65.71  ? 29  LEU E CD2 1 
ATOM   8785  N N   . ARG E 1 50  ? -50.359 0.083   -18.000 1.00 75.92  ? 30  ARG E N   1 
ATOM   8786  C CA  . ARG E 1 50  ? -50.007 -1.017  -18.845 1.00 74.52  ? 30  ARG E CA  1 
ATOM   8787  C C   . ARG E 1 50  ? -49.066 -2.017  -18.171 1.00 74.37  ? 30  ARG E C   1 
ATOM   8788  O O   . ARG E 1 50  ? -48.190 -1.636  -17.404 1.00 76.20  ? 30  ARG E O   1 
ATOM   8789  C CB  . ARG E 1 50  ? -49.336 -0.409  -20.050 1.00 72.86  ? 30  ARG E CB  1 
ATOM   8790  C CG  . ARG E 1 50  ? -49.327 -1.306  -21.242 1.00 78.32  ? 30  ARG E CG  1 
ATOM   8791  C CD  . ARG E 1 50  ? -48.105 -2.179  -21.226 1.00 81.37  ? 30  ARG E CD  1 
ATOM   8792  N NE  . ARG E 1 50  ? -47.714 -2.519  -22.578 1.00 84.51  ? 30  ARG E NE  1 
ATOM   8793  C CZ  . ARG E 1 50  ? -46.766 -3.391  -22.876 1.00 84.02  ? 30  ARG E CZ  1 
ATOM   8794  N NH1 . ARG E 1 50  ? -46.108 -4.010  -21.909 1.00 84.49  ? 30  ARG E NH1 1 
ATOM   8795  N NH2 . ARG E 1 50  ? -46.474 -3.636  -24.144 1.00 84.33  ? 30  ARG E NH2 1 
ATOM   8796  N N   . ASP E 1 51  ? -49.270 -3.299  -18.446 1.00 71.45  ? 31  ASP E N   1 
ATOM   8797  C CA  . ASP E 1 51  ? -48.223 -4.289  -18.243 1.00 73.65  ? 31  ASP E CA  1 
ATOM   8798  C C   . ASP E 1 51  ? -48.311 -5.273  -19.393 1.00 77.92  ? 31  ASP E C   1 
ATOM   8799  O O   . ASP E 1 51  ? -48.900 -4.964  -20.429 1.00 81.60  ? 31  ASP E O   1 
ATOM   8800  C CB  . ASP E 1 51  ? -48.310 -4.974  -16.876 1.00 72.31  ? 31  ASP E CB  1 
ATOM   8801  C CG  . ASP E 1 51  ? -46.935 -5.403  -16.351 1.00 73.38  ? 31  ASP E CG  1 
ATOM   8802  O OD1 . ASP E 1 51  ? -46.007 -5.555  -17.170 1.00 80.55  ? 31  ASP E OD1 1 
ATOM   8803  O OD2 . ASP E 1 51  ? -46.764 -5.585  -15.128 1.00 70.65  ? 31  ASP E OD2 1 
ATOM   8804  N N   . ILE E 1 52  ? -47.732 -6.452  -19.246 1.00 84.69  ? 32  ILE E N   1 
ATOM   8805  C CA  . ILE E 1 52  ? -47.566 -7.305  -20.411 1.00 91.70  ? 32  ILE E CA  1 
ATOM   8806  C C   . ILE E 1 52  ? -48.657 -8.370  -20.572 1.00 97.96  ? 32  ILE E C   1 
ATOM   8807  O O   . ILE E 1 52  ? -48.917 -8.811  -21.689 1.00 95.41  ? 32  ILE E O   1 
ATOM   8808  C CB  . ILE E 1 52  ? -46.155 -7.929  -20.438 1.00 91.24  ? 32  ILE E CB  1 
ATOM   8809  C CG1 . ILE E 1 52  ? -45.755 -8.246  -21.882 1.00 92.93  ? 32  ILE E CG1 1 
ATOM   8810  C CG2 . ILE E 1 52  ? -46.068 -9.153  -19.527 1.00 90.90  ? 32  ILE E CG2 1 
ATOM   8811  C CD1 . ILE E 1 52  ? -44.944 -7.154  -22.539 1.00 91.87  ? 32  ILE E CD1 1 
ATOM   8812  N N   . LYS E 1 53  ? -49.286 -8.782  -19.474 1.00 104.59 ? 33  LYS E N   1 
ATOM   8813  C CA  . LYS E 1 53  ? -50.330 -9.806  -19.526 1.00 105.99 ? 33  LYS E CA  1 
ATOM   8814  C C   . LYS E 1 53  ? -51.405 -9.514  -18.491 1.00 104.35 ? 33  LYS E C   1 
ATOM   8815  O O   . LYS E 1 53  ? -51.093 -9.221  -17.340 1.00 103.16 ? 33  LYS E O   1 
ATOM   8816  C CB  . LYS E 1 53  ? -49.733 -11.209 -19.324 1.00 111.97 ? 33  LYS E CB  1 
ATOM   8817  C CG  . LYS E 1 53  ? -49.380 -11.905 -20.637 1.00 116.86 ? 33  LYS E CG  1 
ATOM   8818  C CD  . LYS E 1 53  ? -48.881 -13.339 -20.454 1.00 118.51 ? 33  LYS E CD  1 
ATOM   8819  C CE  . LYS E 1 53  ? -49.828 -14.384 -21.043 1.00 116.04 ? 33  LYS E CE  1 
ATOM   8820  N NZ  . LYS E 1 53  ? -50.914 -14.787 -20.109 1.00 114.87 ? 33  LYS E NZ  1 
ATOM   8821  N N   . ASP E 1 54  ? -52.667 -9.607  -18.913 1.00 103.40 ? 34  ASP E N   1 
ATOM   8822  C CA  . ASP E 1 54  ? -53.826 -9.258  -18.069 1.00 103.17 ? 34  ASP E CA  1 
ATOM   8823  C C   . ASP E 1 54  ? -53.683 -9.741  -16.627 1.00 102.29 ? 34  ASP E C   1 
ATOM   8824  O O   . ASP E 1 54  ? -54.137 -9.068  -15.700 1.00 103.33 ? 34  ASP E O   1 
ATOM   8825  C CB  . ASP E 1 54  ? -55.136 -9.813  -18.651 1.00 102.79 ? 34  ASP E CB  1 
ATOM   8826  C CG  . ASP E 1 54  ? -55.464 -9.241  -20.025 1.00 101.81 ? 34  ASP E CG  1 
ATOM   8827  O OD1 . ASP E 1 54  ? -54.599 -9.295  -20.920 1.00 103.26 ? 34  ASP E OD1 1 
ATOM   8828  O OD2 . ASP E 1 54  ? -56.592 -8.743  -20.218 1.00 98.47  ? 34  ASP E OD2 1 
ATOM   8829  N N   . GLU E 1 55  ? -53.069 -10.909 -16.442 1.00 98.36  ? 35  GLU E N   1 
ATOM   8830  C CA  . GLU E 1 55  ? -52.767 -11.398 -15.099 1.00 99.08  ? 35  GLU E CA  1 
ATOM   8831  C C   . GLU E 1 55  ? -52.043 -10.309 -14.309 1.00 94.29  ? 35  GLU E C   1 
ATOM   8832  O O   . GLU E 1 55  ? -52.518 -9.871  -13.261 1.00 91.77  ? 35  GLU E O   1 
ATOM   8833  C CB  . GLU E 1 55  ? -51.907 -12.668 -15.148 1.00 102.05 ? 35  GLU E CB  1 
ATOM   8834  C CG  . GLU E 1 55  ? -51.502 -13.207 -13.773 1.00 106.70 ? 35  GLU E CG  1 
ATOM   8835  C CD  . GLU E 1 55  ? -50.425 -14.280 -13.852 1.00 110.42 ? 35  GLU E CD  1 
ATOM   8836  O OE1 . GLU E 1 55  ? -50.520 -15.144 -14.746 1.00 113.24 ? 35  GLU E OE1 1 
ATOM   8837  O OE2 . GLU E 1 55  ? -49.482 -14.264 -13.027 1.00 106.10 ? 35  GLU E OE2 1 
ATOM   8838  N N   . PHE E 1 56  ? -50.897 -9.880  -14.833 1.00 96.56  ? 36  PHE E N   1 
ATOM   8839  C CA  . PHE E 1 56  ? -50.035 -8.893  -14.164 1.00 95.61  ? 36  PHE E CA  1 
ATOM   8840  C C   . PHE E 1 56  ? -50.785 -7.605  -13.852 1.00 87.47  ? 36  PHE E C   1 
ATOM   8841  O O   . PHE E 1 56  ? -50.677 -7.066  -12.744 1.00 80.39  ? 36  PHE E O   1 
ATOM   8842  C CB  . PHE E 1 56  ? -48.812 -8.567  -15.027 1.00 98.78  ? 36  PHE E CB  1 
ATOM   8843  C CG  . PHE E 1 56  ? -47.847 -9.708  -15.171 1.00 101.02 ? 36  PHE E CG  1 
ATOM   8844  C CD1 . PHE E 1 56  ? -47.061 -10.109 -14.099 1.00 102.99 ? 36  PHE E CD1 1 
ATOM   8845  C CD2 . PHE E 1 56  ? -47.710 -10.367 -16.383 1.00 103.41 ? 36  PHE E CD2 1 
ATOM   8846  C CE1 . PHE E 1 56  ? -46.165 -11.155 -14.231 1.00 105.30 ? 36  PHE E CE1 1 
ATOM   8847  C CE2 . PHE E 1 56  ? -46.817 -11.413 -16.524 1.00 104.63 ? 36  PHE E CE2 1 
ATOM   8848  C CZ  . PHE E 1 56  ? -46.043 -11.809 -15.446 1.00 104.60 ? 36  PHE E CZ  1 
ATOM   8849  N N   . VAL E 1 57  ? -51.537 -7.126  -14.842 1.00 79.83  ? 37  VAL E N   1 
ATOM   8850  C CA  . VAL E 1 57  ? -52.387 -5.957  -14.676 1.00 79.66  ? 37  VAL E CA  1 
ATOM   8851  C C   . VAL E 1 57  ? -53.219 -6.161  -13.418 1.00 84.57  ? 37  VAL E C   1 
ATOM   8852  O O   . VAL E 1 57  ? -53.151 -5.353  -12.507 1.00 87.45  ? 37  VAL E O   1 
ATOM   8853  C CB  . VAL E 1 57  ? -53.288 -5.716  -15.907 1.00 77.77  ? 37  VAL E CB  1 
ATOM   8854  C CG1 . VAL E 1 57  ? -54.294 -4.608  -15.649 1.00 77.38  ? 37  VAL E CG1 1 
ATOM   8855  C CG2 . VAL E 1 57  ? -52.447 -5.357  -17.120 1.00 75.49  ? 37  VAL E CG2 1 
ATOM   8856  N N   . ASP E 1 58  ? -53.932 -7.280  -13.337 1.00 88.42  ? 38  ASP E N   1 
ATOM   8857  C CA  . ASP E 1 58  ? -54.848 -7.529  -12.221 1.00 88.20  ? 38  ASP E CA  1 
ATOM   8858  C C   . ASP E 1 58  ? -54.157 -7.625  -10.881 1.00 82.89  ? 38  ASP E C   1 
ATOM   8859  O O   . ASP E 1 58  ? -54.621 -7.027  -9.917  1.00 75.65  ? 38  ASP E O   1 
ATOM   8860  C CB  . ASP E 1 58  ? -55.671 -8.789  -12.465 1.00 92.52  ? 38  ASP E CB  1 
ATOM   8861  C CG  . ASP E 1 58  ? -56.597 -8.649  -13.660 1.00 94.57  ? 38  ASP E CG  1 
ATOM   8862  O OD1 . ASP E 1 58  ? -57.061 -7.516  -13.925 1.00 94.13  ? 38  ASP E OD1 1 
ATOM   8863  O OD2 . ASP E 1 58  ? -56.848 -9.668  -14.343 1.00 94.55  ? 38  ASP E OD2 1 
ATOM   8864  N N   . ARG E 1 59  ? -53.058 -8.365  -10.808 1.00 86.04  ? 39  ARG E N   1 
ATOM   8865  C CA  . ARG E 1 59  ? -52.261 -8.371  -9.581  1.00 92.17  ? 39  ARG E CA  1 
ATOM   8866  C C   . ARG E 1 59  ? -52.047 -6.915  -9.131  1.00 90.19  ? 39  ARG E C   1 
ATOM   8867  O O   . ARG E 1 59  ? -52.138 -6.592  -7.943  1.00 83.25  ? 39  ARG E O   1 
ATOM   8868  C CB  . ARG E 1 59  ? -50.911 -9.058  -9.799  1.00 96.09  ? 39  ARG E CB  1 
ATOM   8869  C CG  . ARG E 1 59  ? -49.945 -8.896  -8.628  1.00 100.78 ? 39  ARG E CG  1 
ATOM   8870  C CD  . ARG E 1 59  ? -48.687 -9.728  -8.820  1.00 103.40 ? 39  ARG E CD  1 
ATOM   8871  N NE  . ARG E 1 59  ? -47.464 -8.955  -8.565  1.00 106.37 ? 39  ARG E NE  1 
ATOM   8872  C CZ  . ARG E 1 59  ? -46.589 -9.173  -7.578  1.00 104.09 ? 39  ARG E CZ  1 
ATOM   8873  N NH1 . ARG E 1 59  ? -46.763 -10.164 -6.706  1.00 103.22 ? 39  ARG E NH1 1 
ATOM   8874  N NH2 . ARG E 1 59  ? -45.514 -8.394  -7.468  1.00 100.24 ? 39  ARG E NH2 1 
ATOM   8875  N N   . GLY E 1 60  ? -51.765 -6.056  -10.111 1.00 87.19  ? 40  GLY E N   1 
ATOM   8876  C CA  . GLY E 1 60  ? -51.552 -4.627  -9.897  1.00 84.72  ? 40  GLY E CA  1 
ATOM   8877  C C   . GLY E 1 60  ? -52.707 -3.864  -9.270  1.00 85.76  ? 40  GLY E C   1 
ATOM   8878  O O   . GLY E 1 60  ? -52.564 -3.298  -8.189  1.00 83.37  ? 40  GLY E O   1 
ATOM   8879  N N   . LEU E 1 61  ? -53.860 -3.862  -9.934  1.00 84.88  ? 41  LEU E N   1 
ATOM   8880  C CA  . LEU E 1 61  ? -55.024 -3.069  -9.480  1.00 86.27  ? 41  LEU E CA  1 
ATOM   8881  C C   . LEU E 1 61  ? -55.594 -3.684  -8.227  1.00 84.72  ? 41  LEU E C   1 
ATOM   8882  O O   . LEU E 1 61  ? -56.021 -2.985  -7.299  1.00 82.93  ? 41  LEU E O   1 
ATOM   8883  C CB  . LEU E 1 61  ? -56.141 -3.016  -10.515 1.00 86.43  ? 41  LEU E CB  1 
ATOM   8884  C CG  . LEU E 1 61  ? -55.728 -2.621  -11.918 1.00 87.31  ? 41  LEU E CG  1 
ATOM   8885  C CD1 . LEU E 1 61  ? -54.982 -3.781  -12.515 1.00 92.95  ? 41  LEU E CD1 1 
ATOM   8886  C CD2 . LEU E 1 61  ? -56.915 -2.301  -12.796 1.00 82.34  ? 41  LEU E CD2 1 
ATOM   8887  N N   . ASP E 1 62  ? -55.610 -5.008  -8.214  1.00 85.01  ? 42  ASP E N   1 
ATOM   8888  C CA  . ASP E 1 62  ? -55.913 -5.739  -6.995  1.00 89.69  ? 42  ASP E CA  1 
ATOM   8889  C C   . ASP E 1 62  ? -54.977 -5.266  -5.866  1.00 86.48  ? 42  ASP E C   1 
ATOM   8890  O O   . ASP E 1 62  ? -55.383 -5.194  -4.703  1.00 90.10  ? 42  ASP E O   1 
ATOM   8891  C CB  . ASP E 1 62  ? -55.828 -7.253  -7.255  1.00 92.08  ? 42  ASP E CB  1 
ATOM   8892  C CG  . ASP E 1 62  ? -55.620 -8.072  -5.996  1.00 93.25  ? 42  ASP E CG  1 
ATOM   8893  O OD1 . ASP E 1 62  ? -56.112 -7.695  -4.910  1.00 93.59  ? 42  ASP E OD1 1 
ATOM   8894  O OD2 . ASP E 1 62  ? -54.961 -9.125  -6.104  1.00 97.31  ? 42  ASP E OD2 1 
ATOM   8895  N N   . PHE E 1 63  ? -53.741 -4.913  -6.213  1.00 84.20  ? 43  PHE E N   1 
ATOM   8896  C CA  . PHE E 1 63  ? -52.795 -4.397  -5.220  1.00 84.43  ? 43  PHE E CA  1 
ATOM   8897  C C   . PHE E 1 63  ? -53.174 -3.006  -4.668  1.00 81.35  ? 43  PHE E C   1 
ATOM   8898  O O   . PHE E 1 63  ? -52.984 -2.719  -3.473  1.00 75.91  ? 43  PHE E O   1 
ATOM   8899  C CB  . PHE E 1 63  ? -51.371 -4.365  -5.785  1.00 85.20  ? 43  PHE E CB  1 
ATOM   8900  C CG  . PHE E 1 63  ? -50.366 -3.841  -4.812  1.00 88.40  ? 43  PHE E CG  1 
ATOM   8901  C CD1 . PHE E 1 63  ? -50.181 -4.484  -3.598  1.00 88.93  ? 43  PHE E CD1 1 
ATOM   8902  C CD2 . PHE E 1 63  ? -49.642 -2.681  -5.077  1.00 90.61  ? 43  PHE E CD2 1 
ATOM   8903  C CE1 . PHE E 1 63  ? -49.273 -4.004  -2.672  1.00 89.34  ? 43  PHE E CE1 1 
ATOM   8904  C CE2 . PHE E 1 63  ? -48.731 -2.193  -4.154  1.00 90.72  ? 43  PHE E CE2 1 
ATOM   8905  C CZ  . PHE E 1 63  ? -48.546 -2.857  -2.949  1.00 90.18  ? 43  PHE E CZ  1 
ATOM   8906  N N   . ILE E 1 64  ? -53.703 -2.161  -5.548  1.00 76.77  ? 44  ILE E N   1 
ATOM   8907  C CA  . ILE E 1 64  ? -54.059 -0.778  -5.222  1.00 78.77  ? 44  ILE E CA  1 
ATOM   8908  C C   . ILE E 1 64  ? -55.300 -0.748  -4.340  1.00 81.06  ? 44  ILE E C   1 
ATOM   8909  O O   . ILE E 1 64  ? -55.380 0.005   -3.363  1.00 78.08  ? 44  ILE E O   1 
ATOM   8910  C CB  . ILE E 1 64  ? -54.333 0.029   -6.509  1.00 79.15  ? 44  ILE E CB  1 
ATOM   8911  C CG1 . ILE E 1 64  ? -53.081 0.055   -7.388  1.00 75.25  ? 44  ILE E CG1 1 
ATOM   8912  C CG2 . ILE E 1 64  ? -54.759 1.461   -6.194  1.00 79.35  ? 44  ILE E CG2 1 
ATOM   8913  C CD1 . ILE E 1 64  ? -53.330 0.550   -8.794  1.00 75.49  ? 44  ILE E CD1 1 
ATOM   8914  N N   . ASN E 1 65  ? -56.269 -1.576  -4.708  1.00 85.30  ? 45  ASN E N   1 
ATOM   8915  C CA  . ASN E 1 65  ? -57.511 -1.720  -3.959  1.00 86.79  ? 45  ASN E CA  1 
ATOM   8916  C C   . ASN E 1 65  ? -57.278 -2.066  -2.492  1.00 85.71  ? 45  ASN E C   1 
ATOM   8917  O O   . ASN E 1 65  ? -57.767 -1.368  -1.595  1.00 83.77  ? 45  ASN E O   1 
ATOM   8918  C CB  . ASN E 1 65  ? -58.358 -2.814  -4.599  1.00 88.82  ? 45  ASN E CB  1 
ATOM   8919  C CG  . ASN E 1 65  ? -59.568 -3.164  -3.770  1.00 89.65  ? 45  ASN E CG  1 
ATOM   8920  O OD1 . ASN E 1 65  ? -59.550 -4.112  -2.980  1.00 85.32  ? 45  ASN E OD1 1 
ATOM   8921  N ND2 . ASN E 1 65  ? -60.635 -2.392  -3.942  1.00 89.58  ? 45  ASN E ND2 1 
ATOM   8922  N N   . LYS E 1 66  ? -56.544 -3.154  -2.266  1.00 84.94  ? 46  LYS E N   1 
ATOM   8923  C CA  . LYS E 1 66  ? -56.169 -3.587  -0.923  1.00 90.17  ? 46  LYS E CA  1 
ATOM   8924  C C   . LYS E 1 66  ? -55.666 -2.388  -0.111  1.00 91.94  ? 46  LYS E C   1 
ATOM   8925  O O   . LYS E 1 66  ? -55.933 -2.255  1.091   1.00 90.29  ? 46  LYS E O   1 
ATOM   8926  C CB  . LYS E 1 66  ? -55.076 -4.658  -1.022  1.00 96.73  ? 46  LYS E CB  1 
ATOM   8927  C CG  . LYS E 1 66  ? -54.642 -5.255  0.309   1.00 102.17 ? 46  LYS E CG  1 
ATOM   8928  C CD  . LYS E 1 66  ? -53.361 -4.615  0.824   1.00 107.42 ? 46  LYS E CD  1 
ATOM   8929  C CE  . LYS E 1 66  ? -53.142 -4.927  2.290   1.00 108.62 ? 46  LYS E CE  1 
ATOM   8930  N NZ  . LYS E 1 66  ? -52.198 -6.049  2.531   1.00 110.67 ? 46  LYS E NZ  1 
ATOM   8931  N N   . ASN E 1 67  ? -54.929 -1.521  -0.795  1.00 92.89  ? 47  ASN E N   1 
ATOM   8932  C CA  . ASN E 1 67  ? -54.289 -0.380  -0.168  1.00 91.65  ? 47  ASN E CA  1 
ATOM   8933  C C   . ASN E 1 67  ? -55.236 0.725   0.220   1.00 88.94  ? 47  ASN E C   1 
ATOM   8934  O O   . ASN E 1 67  ? -55.122 1.288   1.307   1.00 85.00  ? 47  ASN E O   1 
ATOM   8935  C CB  . ASN E 1 67  ? -53.222 0.191   -1.088  1.00 94.98  ? 47  ASN E CB  1 
ATOM   8936  C CG  . ASN E 1 67  ? -51.849 0.006   -0.527  1.00 94.63  ? 47  ASN E CG  1 
ATOM   8937  O OD1 . ASN E 1 67  ? -51.261 -1.071  -0.638  1.00 97.31  ? 47  ASN E OD1 1 
ATOM   8938  N ND2 . ASN E 1 67  ? -51.329 1.048   0.105   1.00 89.32  ? 47  ASN E ND2 1 
ATOM   8939  N N   . LEU E 1 68  ? -56.143 1.056   -0.688  1.00 86.90  ? 48  LEU E N   1 
ATOM   8940  C CA  . LEU E 1 68  ? -57.144 2.067   -0.407  1.00 84.88  ? 48  LEU E CA  1 
ATOM   8941  C C   . LEU E 1 68  ? -57.980 1.568   0.773   1.00 85.74  ? 48  LEU E C   1 
ATOM   8942  O O   . LEU E 1 68  ? -58.153 2.284   1.757   1.00 78.76  ? 48  LEU E O   1 
ATOM   8943  C CB  . LEU E 1 68  ? -57.972 2.346   -1.654  1.00 81.80  ? 48  LEU E CB  1 
ATOM   8944  C CG  . LEU E 1 68  ? -57.103 2.920   -2.789  1.00 80.65  ? 48  LEU E CG  1 
ATOM   8945  C CD1 . LEU E 1 68  ? -57.728 2.732   -4.162  1.00 80.74  ? 48  LEU E CD1 1 
ATOM   8946  C CD2 . LEU E 1 68  ? -56.805 4.390   -2.557  1.00 78.81  ? 48  LEU E CD2 1 
ATOM   8947  N N   . SER E 1 69  ? -58.422 0.312   0.692   1.00 84.23  ? 49  SER E N   1 
ATOM   8948  C CA  . SER E 1 69  ? -59.122 -0.371  1.793   1.00 84.18  ? 49  SER E CA  1 
ATOM   8949  C C   . SER E 1 69  ? -58.531 -0.089  3.164   1.00 86.75  ? 49  SER E C   1 
ATOM   8950  O O   . SER E 1 69  ? -59.246 0.318   4.095   1.00 89.83  ? 49  SER E O   1 
ATOM   8951  C CB  . SER E 1 69  ? -59.131 -1.880  1.593   1.00 82.07  ? 49  SER E CB  1 
ATOM   8952  O OG  . SER E 1 69  ? -59.711 -2.232  0.352   1.00 81.14  ? 49  SER E OG  1 
ATOM   8953  N N   . LYS E 1 70  ? -57.230 -0.335  3.293   1.00 88.45  ? 50  LYS E N   1 
ATOM   8954  C CA  . LYS E 1 70  ? -56.538 -0.087  4.553   1.00 89.27  ? 50  LYS E CA  1 
ATOM   8955  C C   . LYS E 1 70  ? -56.706 1.358   5.029   1.00 88.26  ? 50  LYS E C   1 
ATOM   8956  O O   . LYS E 1 70  ? -56.669 1.626   6.228   1.00 86.72  ? 50  LYS E O   1 
ATOM   8957  C CB  . LYS E 1 70  ? -55.053 -0.378  4.413   1.00 90.77  ? 50  LYS E CB  1 
ATOM   8958  C CG  . LYS E 1 70  ? -54.678 -1.839  4.505   1.00 92.50  ? 50  LYS E CG  1 
ATOM   8959  C CD  . LYS E 1 70  ? -53.331 -1.957  5.197   1.00 91.92  ? 50  LYS E CD  1 
ATOM   8960  C CE  . LYS E 1 70  ? -52.629 -3.239  4.832   1.00 89.74  ? 50  LYS E CE  1 
ATOM   8961  N NZ  . LYS E 1 70  ? -51.317 -3.355  5.505   1.00 89.48  ? 50  LYS E NZ  1 
ATOM   8962  N N   . LEU E 1 71  ? -56.867 2.281   4.083   1.00 85.60  ? 51  LEU E N   1 
ATOM   8963  C CA  . LEU E 1 71  ? -57.013 3.714   4.385   1.00 87.05  ? 51  LEU E CA  1 
ATOM   8964  C C   . LEU E 1 71  ? -58.436 4.077   4.790   1.00 87.99  ? 51  LEU E C   1 
ATOM   8965  O O   . LEU E 1 71  ? -58.664 4.927   5.653   1.00 78.26  ? 51  LEU E O   1 
ATOM   8966  C CB  . LEU E 1 71  ? -56.635 4.554   3.158   1.00 86.09  ? 51  LEU E CB  1 
ATOM   8967  C CG  . LEU E 1 71  ? -55.209 4.411   2.616   1.00 81.40  ? 51  LEU E CG  1 
ATOM   8968  C CD1 . LEU E 1 71  ? -55.154 4.866   1.173   1.00 79.85  ? 51  LEU E CD1 1 
ATOM   8969  C CD2 . LEU E 1 71  ? -54.225 5.210   3.449   1.00 78.04  ? 51  LEU E CD2 1 
ATOM   8970  N N   . VAL E 1 72  ? -59.375 3.438   4.106   1.00 96.05  ? 52  VAL E N   1 
ATOM   8971  C CA  . VAL E 1 72  ? -60.812 3.625   4.315   1.00 97.75  ? 52  VAL E CA  1 
ATOM   8972  C C   . VAL E 1 72  ? -61.143 3.113   5.696   1.00 97.67  ? 52  VAL E C   1 
ATOM   8973  O O   . VAL E 1 72  ? -61.898 3.728   6.451   1.00 93.76  ? 52  VAL E O   1 
ATOM   8974  C CB  . VAL E 1 72  ? -61.664 2.805   3.320   1.00 98.03  ? 52  VAL E CB  1 
ATOM   8975  C CG1 . VAL E 1 72  ? -62.696 3.678   2.658   1.00 97.59  ? 52  VAL E CG1 1 
ATOM   8976  C CG2 . VAL E 1 72  ? -60.823 2.210   2.227   1.00 99.68  ? 52  VAL E CG2 1 
ATOM   8977  N N   . LYS E 1 73  ? -60.552 1.965   6.002   1.00 95.30  ? 53  LYS E N   1 
ATOM   8978  C CA  . LYS E 1 73  ? -60.674 1.356   7.308   1.00 92.57  ? 53  LYS E CA  1 
ATOM   8979  C C   . LYS E 1 73  ? -60.018 2.212   8.382   1.00 91.24  ? 53  LYS E C   1 
ATOM   8980  O O   . LYS E 1 73  ? -60.584 2.423   9.453   1.00 83.08  ? 53  LYS E O   1 
ATOM   8981  C CB  . LYS E 1 73  ? -60.042 -0.025  7.298   1.00 92.01  ? 53  LYS E CB  1 
ATOM   8982  C CG  . LYS E 1 73  ? -59.656 -0.506  8.685   1.00 93.03  ? 53  LYS E CG  1 
ATOM   8983  C CD  . LYS E 1 73  ? -60.059 -1.946  8.879   1.00 95.52  ? 53  LYS E CD  1 
ATOM   8984  C CE  . LYS E 1 73  ? -59.306 -2.859  7.928   1.00 96.79  ? 53  LYS E CE  1 
ATOM   8985  N NZ  . LYS E 1 73  ? -58.992 -4.143  8.603   1.00 95.00  ? 53  LYS E NZ  1 
ATOM   8986  N N   . LYS E 1 74  ? -58.820 2.705   8.096   1.00 95.86  ? 54  LYS E N   1 
ATOM   8987  C CA  . LYS E 1 74  ? -58.147 3.598   9.033   1.00 99.97  ? 54  LYS E CA  1 
ATOM   8988  C C   . LYS E 1 74  ? -58.927 4.926   9.123   1.00 95.77  ? 54  LYS E C   1 
ATOM   8989  O O   . LYS E 1 74  ? -58.655 5.756   9.988   1.00 90.94  ? 54  LYS E O   1 
ATOM   8990  C CB  . LYS E 1 74  ? -56.683 3.836   8.620   1.00 105.61 ? 54  LYS E CB  1 
ATOM   8991  C CG  . LYS E 1 74  ? -55.659 3.437   9.678   1.00 106.47 ? 54  LYS E CG  1 
ATOM   8992  C CD  . LYS E 1 74  ? -54.346 4.187   9.501   1.00 108.38 ? 54  LYS E CD  1 
ATOM   8993  C CE  . LYS E 1 74  ? -53.333 3.814   10.577  1.00 108.84 ? 54  LYS E CE  1 
ATOM   8994  N NZ  . LYS E 1 74  ? -52.139 4.706   10.566  1.00 107.30 ? 54  LYS E NZ  1 
ATOM   8995  N N   . GLY E 1 75  ? -59.897 5.111   8.226   1.00 93.93  ? 55  GLY E N   1 
ATOM   8996  C CA  . GLY E 1 75  ? -60.704 6.322   8.184   1.00 96.20  ? 55  GLY E CA  1 
ATOM   8997  C C   . GLY E 1 75  ? -59.843 7.513   7.822   1.00 103.91 ? 55  GLY E C   1 
ATOM   8998  O O   . GLY E 1 75  ? -60.102 8.638   8.260   1.00 95.04  ? 55  GLY E O   1 
ATOM   8999  N N   . LYS E 1 76  ? -58.799 7.249   7.036   1.00 111.87 ? 56  LYS E N   1 
ATOM   9000  C CA  . LYS E 1 76  ? -57.960 8.294   6.476   1.00 110.01 ? 56  LYS E CA  1 
ATOM   9001  C C   . LYS E 1 76  ? -58.663 8.811   5.229   1.00 105.48 ? 56  LYS E C   1 
ATOM   9002  O O   . LYS E 1 76  ? -58.430 9.943   4.802   1.00 98.82  ? 56  LYS E O   1 
ATOM   9003  C CB  . LYS E 1 76  ? -56.558 7.753   6.171   1.00 112.97 ? 56  LYS E CB  1 
ATOM   9004  C CG  . LYS E 1 76  ? -55.438 8.775   6.335   1.00 114.66 ? 56  LYS E CG  1 
ATOM   9005  C CD  . LYS E 1 76  ? -54.328 8.250   7.238   1.00 115.55 ? 56  LYS E CD  1 
ATOM   9006  C CE  . LYS E 1 76  ? -53.034 9.029   7.057   1.00 111.23 ? 56  LYS E CE  1 
ATOM   9007  N NZ  . LYS E 1 76  ? -52.113 8.841   8.209   1.00 107.82 ? 56  LYS E NZ  1 
ATOM   9008  N N   . ILE E 1 77  ? -59.550 7.983   4.671   1.00 103.68 ? 57  ILE E N   1 
ATOM   9009  C CA  . ILE E 1 77  ? -60.398 8.387   3.554   1.00 100.34 ? 57  ILE E CA  1 
ATOM   9010  C C   . ILE E 1 77  ? -61.739 7.648   3.561   1.00 102.30 ? 57  ILE E C   1 
ATOM   9011  O O   . ILE E 1 77  ? -61.990 6.793   4.413   1.00 101.16 ? 57  ILE E O   1 
ATOM   9012  C CB  . ILE E 1 77  ? -59.673 8.190   2.210   1.00 94.03  ? 57  ILE E CB  1 
ATOM   9013  C CG1 . ILE E 1 77  ? -59.263 6.723   2.010   1.00 89.22  ? 57  ILE E CG1 1 
ATOM   9014  C CG2 . ILE E 1 77  ? -58.446 9.086   2.164   1.00 94.37  ? 57  ILE E CG2 1 
ATOM   9015  C CD1 . ILE E 1 77  ? -59.620 6.180   0.644   1.00 85.60  ? 57  ILE E CD1 1 
ATOM   9016  N N   . GLU E 1 78  ? -62.595 7.992   2.609   1.00 100.47 ? 58  GLU E N   1 
ATOM   9017  C CA  . GLU E 1 78  ? -63.953 7.492   2.593   1.00 99.91  ? 58  GLU E CA  1 
ATOM   9018  C C   . GLU E 1 78  ? -64.158 6.598   1.384   1.00 99.46  ? 58  GLU E C   1 
ATOM   9019  O O   . GLU E 1 78  ? -63.801 6.977   0.267   1.00 102.30 ? 58  GLU E O   1 
ATOM   9020  C CB  . GLU E 1 78  ? -64.924 8.669   2.555   1.00 102.83 ? 58  GLU E CB  1 
ATOM   9021  C CG  . GLU E 1 78  ? -66.346 8.302   2.953   1.00 107.18 ? 58  GLU E CG  1 
ATOM   9022  C CD  . GLU E 1 78  ? -67.370 9.335   2.510   1.00 107.80 ? 58  GLU E CD  1 
ATOM   9023  O OE1 . GLU E 1 78  ? -67.171 10.535  2.808   1.00 105.28 ? 58  GLU E OE1 1 
ATOM   9024  O OE2 . GLU E 1 78  ? -68.378 8.948   1.870   1.00 101.30 ? 58  GLU E OE2 1 
ATOM   9025  N N   . GLU E 1 79  ? -64.747 5.422   1.612   1.00 95.39  ? 59  GLU E N   1 
ATOM   9026  C CA  . GLU E 1 79  ? -64.999 4.447   0.545   1.00 91.90  ? 59  GLU E CA  1 
ATOM   9027  C C   . GLU E 1 79  ? -65.442 5.134   -0.714  1.00 92.58  ? 59  GLU E C   1 
ATOM   9028  O O   . GLU E 1 79  ? -65.017 4.778   -1.806  1.00 94.28  ? 59  GLU E O   1 
ATOM   9029  C CB  . GLU E 1 79  ? -66.098 3.472   0.943   1.00 88.78  ? 59  GLU E CB  1 
ATOM   9030  C CG  . GLU E 1 79  ? -66.456 2.475   -0.161  1.00 89.24  ? 59  GLU E CG  1 
ATOM   9031  C CD  . GLU E 1 79  ? -65.514 1.281   -0.221  1.00 88.65  ? 59  GLU E CD  1 
ATOM   9032  O OE1 . GLU E 1 79  ? -64.895 0.942   0.816   1.00 87.51  ? 59  GLU E OE1 1 
ATOM   9033  O OE2 . GLU E 1 79  ? -65.403 0.666   -1.306  1.00 85.73  ? 59  GLU E OE2 1 
ATOM   9034  N N   . ALA E 1 80  ? -66.322 6.113   -0.552  1.00 95.90  ? 60  ALA E N   1 
ATOM   9035  C CA  . ALA E 1 80  ? -66.792 6.915   -1.675  1.00 97.20  ? 60  ALA E CA  1 
ATOM   9036  C C   . ALA E 1 80  ? -65.640 7.262   -2.626  1.00 94.01  ? 60  ALA E C   1 
ATOM   9037  O O   . ALA E 1 80  ? -65.752 7.116   -3.844  1.00 86.59  ? 60  ALA E O   1 
ATOM   9038  C CB  . ALA E 1 80  ? -67.446 8.184   -1.156  1.00 97.38  ? 60  ALA E CB  1 
ATOM   9039  N N   . THR E 1 81  ? -64.536 7.706   -2.034  1.00 92.72  ? 61  THR E N   1 
ATOM   9040  C CA  . THR E 1 81  ? -63.332 8.108   -2.753  1.00 89.65  ? 61  THR E CA  1 
ATOM   9041  C C   . THR E 1 81  ? -62.603 6.959   -3.440  1.00 85.51  ? 61  THR E C   1 
ATOM   9042  O O   . THR E 1 81  ? -62.387 6.980   -4.648  1.00 82.29  ? 61  THR E O   1 
ATOM   9043  C CB  . THR E 1 81  ? -62.328 8.750   -1.775  1.00 91.86  ? 61  THR E CB  1 
ATOM   9044  O OG1 . THR E 1 81  ? -62.771 10.067  -1.426  1.00 84.18  ? 61  THR E OG1 1 
ATOM   9045  C CG2 . THR E 1 81  ? -60.943 8.815   -2.393  1.00 94.98  ? 61  THR E CG2 1 
ATOM   9046  N N   . LYS E 1 82  ? -62.165 5.993   -2.643  1.00 78.87  ? 62  LYS E N   1 
ATOM   9047  C CA  . LYS E 1 82  ? -61.502 4.815   -3.162  1.00 76.62  ? 62  LYS E CA  1 
ATOM   9048  C C   . LYS E 1 82  ? -62.104 4.387   -4.485  1.00 77.55  ? 62  LYS E C   1 
ATOM   9049  O O   . LYS E 1 82  ? -61.399 4.091   -5.449  1.00 83.15  ? 62  LYS E O   1 
ATOM   9050  C CB  . LYS E 1 82  ? -61.646 3.694   -2.157  1.00 78.14  ? 62  LYS E CB  1 
ATOM   9051  C CG  . LYS E 1 82  ? -61.691 2.317   -2.772  1.00 78.12  ? 62  LYS E CG  1 
ATOM   9052  C CD  . LYS E 1 82  ? -61.491 1.296   -1.683  1.00 79.70  ? 62  LYS E CD  1 
ATOM   9053  C CE  . LYS E 1 82  ? -61.788 -0.095  -2.194  1.00 81.24  ? 62  LYS E CE  1 
ATOM   9054  N NZ  . LYS E 1 82  ? -61.174 -1.081  -1.271  1.00 82.54  ? 62  LYS E NZ  1 
ATOM   9055  N N   . VAL E 1 83  ? -63.425 4.346   -4.512  1.00 81.09  ? 63  VAL E N   1 
ATOM   9056  C CA  . VAL E 1 83  ? -64.153 4.003   -5.724  1.00 84.76  ? 63  VAL E CA  1 
ATOM   9057  C C   . VAL E 1 83  ? -63.806 4.997   -6.817  1.00 84.80  ? 63  VAL E C   1 
ATOM   9058  O O   . VAL E 1 83  ? -63.470 4.604   -7.922  1.00 80.71  ? 63  VAL E O   1 
ATOM   9059  C CB  . VAL E 1 83  ? -65.681 4.052   -5.518  1.00 88.46  ? 63  VAL E CB  1 
ATOM   9060  C CG1 . VAL E 1 83  ? -66.389 3.387   -6.692  1.00 85.16  ? 63  VAL E CG1 1 
ATOM   9061  C CG2 . VAL E 1 83  ? -66.075 3.383   -4.207  1.00 88.83  ? 63  VAL E CG2 1 
ATOM   9062  N N   . GLU E 1 84  ? -63.907 6.280   -6.481  1.00 89.45  ? 64  GLU E N   1 
ATOM   9063  C CA  . GLU E 1 84  ? -63.627 7.386   -7.399  1.00 91.81  ? 64  GLU E CA  1 
ATOM   9064  C C   . GLU E 1 84  ? -62.235 7.254   -8.028  1.00 93.55  ? 64  GLU E C   1 
ATOM   9065  O O   . GLU E 1 84  ? -62.088 7.248   -9.257  1.00 90.97  ? 64  GLU E O   1 
ATOM   9066  C CB  . GLU E 1 84  ? -63.729 8.725   -6.642  1.00 94.53  ? 64  GLU E CB  1 
ATOM   9067  C CG  . GLU E 1 84  ? -64.685 9.739   -7.255  1.00 96.38  ? 64  GLU E CG  1 
ATOM   9068  C CD  . GLU E 1 84  ? -63.981 10.931  -7.883  1.00 98.97  ? 64  GLU E CD  1 
ATOM   9069  O OE1 . GLU E 1 84  ? -63.591 11.847  -7.120  1.00 96.04  ? 64  GLU E OE1 1 
ATOM   9070  O OE2 . GLU E 1 84  ? -63.836 10.963  -9.130  1.00 93.71  ? 64  GLU E OE2 1 
ATOM   9071  N N   . ILE E 1 85  ? -61.223 7.145   -7.171  1.00 89.95  ? 65  ILE E N   1 
ATOM   9072  C CA  . ILE E 1 85  ? -59.844 6.982   -7.613  1.00 86.42  ? 65  ILE E CA  1 
ATOM   9073  C C   . ILE E 1 85  ? -59.729 5.791   -8.553  1.00 88.59  ? 65  ILE E C   1 
ATOM   9074  O O   . ILE E 1 85  ? -59.326 5.949   -9.714  1.00 90.48  ? 65  ILE E O   1 
ATOM   9075  C CB  . ILE E 1 85  ? -58.909 6.767   -6.417  1.00 81.12  ? 65  ILE E CB  1 
ATOM   9076  C CG1 . ILE E 1 85  ? -58.751 8.074   -5.647  1.00 76.34  ? 65  ILE E CG1 1 
ATOM   9077  C CG2 . ILE E 1 85  ? -57.551 6.250   -6.870  1.00 82.93  ? 65  ILE E CG2 1 
ATOM   9078  C CD1 . ILE E 1 85  ? -58.333 7.852   -4.211  1.00 73.98  ? 65  ILE E CD1 1 
ATOM   9079  N N   . LEU E 1 86  ? -60.100 4.608   -8.056  1.00 83.59  ? 66  LEU E N   1 
ATOM   9080  C CA  . LEU E 1 86  ? -60.059 3.381   -8.864  1.00 82.16  ? 66  LEU E CA  1 
ATOM   9081  C C   . LEU E 1 86  ? -60.713 3.511   -10.250 1.00 78.93  ? 66  LEU E C   1 
ATOM   9082  O O   . LEU E 1 86  ? -60.418 2.707   -11.125 1.00 81.07  ? 66  LEU E O   1 
ATOM   9083  C CB  . LEU E 1 86  ? -60.703 2.209   -8.120  1.00 82.95  ? 66  LEU E CB  1 
ATOM   9084  C CG  . LEU E 1 86  ? -59.930 1.558   -6.973  1.00 87.97  ? 66  LEU E CG  1 
ATOM   9085  C CD1 . LEU E 1 86  ? -60.850 0.639   -6.186  1.00 90.85  ? 66  LEU E CD1 1 
ATOM   9086  C CD2 . LEU E 1 86  ? -58.730 0.775   -7.476  1.00 88.34  ? 66  LEU E CD2 1 
ATOM   9087  N N   . THR E 1 87  ? -61.598 4.496   -10.448 1.00 82.38  ? 67  THR E N   1 
ATOM   9088  C CA  . THR E 1 87  ? -62.219 4.742   -11.780 1.00 86.30  ? 67  THR E CA  1 
ATOM   9089  C C   . THR E 1 87  ? -61.352 5.623   -12.680 1.00 85.42  ? 67  THR E C   1 
ATOM   9090  O O   . THR E 1 87  ? -61.643 5.779   -13.866 1.00 81.85  ? 67  THR E O   1 
ATOM   9091  C CB  . THR E 1 87  ? -63.632 5.413   -11.741 1.00 87.59  ? 67  THR E CB  1 
ATOM   9092  O OG1 . THR E 1 87  ? -63.519 6.836   -11.910 1.00 81.99  ? 67  THR E OG1 1 
ATOM   9093  C CG2 . THR E 1 87  ? -64.401 5.112   -10.465 1.00 87.14  ? 67  THR E CG2 1 
ATOM   9094  N N   . ARG E 1 88  ? -60.319 6.231   -12.112 1.00 85.10  ? 68  ARG E N   1 
ATOM   9095  C CA  . ARG E 1 88  ? -59.384 7.029   -12.897 1.00 85.42  ? 68  ARG E CA  1 
ATOM   9096  C C   . ARG E 1 88  ? -58.252 6.178   -13.482 1.00 83.01  ? 68  ARG E C   1 
ATOM   9097  O O   . ARG E 1 88  ? -57.552 6.594   -14.408 1.00 81.10  ? 68  ARG E O   1 
ATOM   9098  C CB  . ARG E 1 88  ? -58.846 8.168   -12.046 1.00 85.33  ? 68  ARG E CB  1 
ATOM   9099  C CG  . ARG E 1 88  ? -59.842 9.309   -11.944 1.00 85.19  ? 68  ARG E CG  1 
ATOM   9100  C CD  . ARG E 1 88  ? -59.232 10.513  -11.265 1.00 86.64  ? 68  ARG E CD  1 
ATOM   9101  N NE  . ARG E 1 88  ? -59.329 10.411  -9.811  1.00 89.30  ? 68  ARG E NE  1 
ATOM   9102  C CZ  . ARG E 1 88  ? -60.094 11.185  -9.044  1.00 89.23  ? 68  ARG E CZ  1 
ATOM   9103  N NH1 . ARG E 1 88  ? -60.842 12.146  -9.583  1.00 88.11  ? 68  ARG E NH1 1 
ATOM   9104  N NH2 . ARG E 1 88  ? -60.103 11.004  -7.724  1.00 88.18  ? 68  ARG E NH2 1 
ATOM   9105  N N   . ILE E 1 89  ? -58.111 4.973   -12.949 1.00 80.79  ? 69  ILE E N   1 
ATOM   9106  C CA  . ILE E 1 89  ? -57.099 4.033   -13.388 1.00 77.68  ? 69  ILE E CA  1 
ATOM   9107  C C   . ILE E 1 89  ? -57.665 3.024   -14.374 1.00 76.21  ? 69  ILE E C   1 
ATOM   9108  O O   . ILE E 1 89  ? -58.629 2.331   -14.070 1.00 79.47  ? 69  ILE E O   1 
ATOM   9109  C CB  . ILE E 1 89  ? -56.575 3.234   -12.200 1.00 73.20  ? 69  ILE E CB  1 
ATOM   9110  C CG1 . ILE E 1 89  ? -55.901 4.169   -11.202 1.00 69.09  ? 69  ILE E CG1 1 
ATOM   9111  C CG2 . ILE E 1 89  ? -55.616 2.161   -12.690 1.00 74.80  ? 69  ILE E CG2 1 
ATOM   9112  C CD1 . ILE E 1 89  ? -55.711 3.531   -9.851  1.00 68.04  ? 69  ILE E CD1 1 
ATOM   9113  N N   . SER E 1 90  ? -57.026 2.894   -15.527 1.00 75.56  ? 70  SER E N   1 
ATOM   9114  C CA  . SER E 1 90  ? -57.543 2.036   -16.586 1.00 74.54  ? 70  SER E CA  1 
ATOM   9115  C C   . SER E 1 90  ? -56.491 1.018   -17.084 1.00 77.49  ? 70  SER E C   1 
ATOM   9116  O O   . SER E 1 90  ? -55.701 1.313   -17.986 1.00 74.51  ? 70  SER E O   1 
ATOM   9117  C CB  . SER E 1 90  ? -58.056 2.922   -17.732 1.00 72.94  ? 70  SER E CB  1 
ATOM   9118  O OG  . SER E 1 90  ? -58.336 4.244   -17.272 1.00 68.27  ? 70  SER E OG  1 
ATOM   9119  N N   . GLY E 1 91  ? -56.502 -0.181  -16.496 1.00 77.84  ? 71  GLY E N   1 
ATOM   9120  C CA  . GLY E 1 91  ? -55.544 -1.252  -16.836 1.00 79.63  ? 71  GLY E CA  1 
ATOM   9121  C C   . GLY E 1 91  ? -55.559 -1.662  -18.303 1.00 82.76  ? 71  GLY E C   1 
ATOM   9122  O O   . GLY E 1 91  ? -56.536 -1.410  -19.000 1.00 88.93  ? 71  GLY E O   1 
ATOM   9123  N N   . THR E 1 92  ? -54.488 -2.304  -18.770 1.00 83.03  ? 72  THR E N   1 
ATOM   9124  C CA  . THR E 1 92  ? -54.303 -2.567  -20.205 1.00 82.70  ? 72  THR E CA  1 
ATOM   9125  C C   . THR E 1 92  ? -53.062 -3.394  -20.476 1.00 81.55  ? 72  THR E C   1 
ATOM   9126  O O   . THR E 1 92  ? -52.206 -3.552  -19.615 1.00 87.11  ? 72  THR E O   1 
ATOM   9127  C CB  . THR E 1 92  ? -54.111 -1.255  -21.010 1.00 85.56  ? 72  THR E CB  1 
ATOM   9128  O OG1 . THR E 1 92  ? -55.169 -0.333  -20.734 1.00 97.83  ? 72  THR E OG1 1 
ATOM   9129  C CG2 . THR E 1 92  ? -54.092 -1.509  -22.497 1.00 83.19  ? 72  THR E CG2 1 
ATOM   9130  N N   . VAL E 1 93  ? -52.989 -3.931  -21.687 1.00 78.81  ? 73  VAL E N   1 
ATOM   9131  C CA  . VAL E 1 93  ? -51.750 -4.480  -22.234 1.00 78.19  ? 73  VAL E CA  1 
ATOM   9132  C C   . VAL E 1 93  ? -51.319 -3.859  -23.561 1.00 78.36  ? 73  VAL E C   1 
ATOM   9133  O O   . VAL E 1 93  ? -50.178 -4.040  -23.974 1.00 79.33  ? 73  VAL E O   1 
ATOM   9134  C CB  . VAL E 1 93  ? -51.869 -5.995  -22.454 1.00 77.27  ? 73  VAL E CB  1 
ATOM   9135  C CG1 . VAL E 1 93  ? -52.260 -6.686  -21.155 1.00 77.25  ? 73  VAL E CG1 1 
ATOM   9136  C CG2 . VAL E 1 93  ? -52.872 -6.301  -23.559 1.00 76.50  ? 73  VAL E CG2 1 
ATOM   9137  N N   . ASP E 1 94  ? -52.249 -3.205  -24.254 1.00 78.53  ? 74  ASP E N   1 
ATOM   9138  C CA  . ASP E 1 94  ? -51.946 -2.432  -25.456 1.00 80.20  ? 74  ASP E CA  1 
ATOM   9139  C C   . ASP E 1 94  ? -51.055 -1.228  -25.119 1.00 83.62  ? 74  ASP E C   1 
ATOM   9140  O O   . ASP E 1 94  ? -51.518 -0.216  -24.576 1.00 83.48  ? 74  ASP E O   1 
ATOM   9141  C CB  . ASP E 1 94  ? -53.243 -1.975  -26.156 1.00 79.38  ? 74  ASP E CB  1 
ATOM   9142  C CG  . ASP E 1 94  ? -53.026 -1.601  -27.625 1.00 79.83  ? 74  ASP E CG  1 
ATOM   9143  O OD1 . ASP E 1 94  ? -51.886 -1.706  -28.112 1.00 86.36  ? 74  ASP E OD1 1 
ATOM   9144  O OD2 . ASP E 1 94  ? -53.994 -1.208  -28.308 1.00 77.47  ? 74  ASP E OD2 1 
ATOM   9145  N N   . LEU E 1 95  ? -49.771 -1.362  -25.447 1.00 87.83  ? 75  LEU E N   1 
ATOM   9146  C CA  . LEU E 1 95  ? -48.789 -0.274  -25.315 1.00 90.48  ? 75  LEU E CA  1 
ATOM   9147  C C   . LEU E 1 95  ? -49.348 1.043   -25.845 1.00 87.30  ? 75  LEU E C   1 
ATOM   9148  O O   . LEU E 1 95  ? -49.070 2.107   -25.294 1.00 90.47  ? 75  LEU E O   1 
ATOM   9149  C CB  . LEU E 1 95  ? -47.492 -0.627  -26.074 1.00 94.30  ? 75  LEU E CB  1 
ATOM   9150  C CG  . LEU E 1 95  ? -46.115 -0.110  -25.603 1.00 92.52  ? 75  LEU E CG  1 
ATOM   9151  C CD1 . LEU E 1 95  ? -45.946 1.379   -25.845 1.00 93.31  ? 75  LEU E CD1 1 
ATOM   9152  C CD2 . LEU E 1 95  ? -45.823 -0.433  -24.145 1.00 90.32  ? 75  LEU E CD2 1 
ATOM   9153  N N   . ASN E 1 96  ? -50.163 0.952   -26.893 1.00 84.69  ? 76  ASN E N   1 
ATOM   9154  C CA  . ASN E 1 96  ? -50.675 2.130   -27.599 1.00 84.84  ? 76  ASN E CA  1 
ATOM   9155  C C   . ASN E 1 96  ? -51.611 3.009   -26.786 1.00 80.37  ? 76  ASN E C   1 
ATOM   9156  O O   . ASN E 1 96  ? -51.869 4.134   -27.197 1.00 78.08  ? 76  ASN E O   1 
ATOM   9157  C CB  . ASN E 1 96  ? -51.387 1.731   -28.893 1.00 88.57  ? 76  ASN E CB  1 
ATOM   9158  C CG  . ASN E 1 96  ? -50.520 0.871   -29.797 1.00 93.51  ? 76  ASN E CG  1 
ATOM   9159  O OD1 . ASN E 1 96  ? -49.802 1.385   -30.658 1.00 97.67  ? 76  ASN E OD1 1 
ATOM   9160  N ND2 . ASN E 1 96  ? -50.570 -0.443  -29.599 1.00 92.81  ? 76  ASN E ND2 1 
ATOM   9161  N N   . MET E 1 97  ? -52.115 2.523   -25.649 1.00 80.92  ? 77  MET E N   1 
ATOM   9162  C CA  . MET E 1 97  ? -52.936 3.363   -24.762 1.00 85.65  ? 77  MET E CA  1 
ATOM   9163  C C   . MET E 1 97  ? -52.178 4.592   -24.251 1.00 85.69  ? 77  MET E C   1 
ATOM   9164  O O   . MET E 1 97  ? -52.787 5.550   -23.763 1.00 87.53  ? 77  MET E O   1 
ATOM   9165  C CB  . MET E 1 97  ? -53.483 2.549   -23.588 1.00 91.57  ? 77  MET E CB  1 
ATOM   9166  C CG  . MET E 1 97  ? -54.537 1.529   -24.002 1.00 98.45  ? 77  MET E CG  1 
ATOM   9167  S SD  . MET E 1 97  ? -55.897 2.196   -24.986 1.00 100.42 ? 77  MET E SD  1 
ATOM   9168  C CE  . MET E 1 97  ? -56.665 3.241   -23.749 1.00 95.75  ? 77  MET E CE  1 
ATOM   9169  N N   . ALA E 1 98  ? -50.854 4.556   -24.386 1.00 80.94  ? 78  ALA E N   1 
ATOM   9170  C CA  . ALA E 1 98  ? -49.978 5.661   -24.012 1.00 78.19  ? 78  ALA E CA  1 
ATOM   9171  C C   . ALA E 1 98  ? -49.927 6.815   -25.022 1.00 76.59  ? 78  ALA E C   1 
ATOM   9172  O O   . ALA E 1 98  ? -49.702 7.960   -24.622 1.00 76.59  ? 78  ALA E O   1 
ATOM   9173  C CB  . ALA E 1 98  ? -48.575 5.132   -23.772 1.00 79.28  ? 78  ALA E CB  1 
ATOM   9174  N N   . ALA E 1 99  ? -50.133 6.526   -26.312 1.00 70.97  ? 79  ALA E N   1 
ATOM   9175  C CA  . ALA E 1 99  ? -50.051 7.546   -27.382 1.00 68.98  ? 79  ALA E CA  1 
ATOM   9176  C C   . ALA E 1 99  ? -50.577 8.885   -26.918 1.00 67.81  ? 79  ALA E C   1 
ATOM   9177  O O   . ALA E 1 99  ? -50.041 9.940   -27.229 1.00 67.84  ? 79  ALA E O   1 
ATOM   9178  C CB  . ALA E 1 99  ? -50.827 7.098   -28.620 1.00 67.48  ? 79  ALA E CB  1 
ATOM   9179  N N   . ASP E 1 100 ? -51.644 8.801   -26.153 1.00 74.49  ? 80  ASP E N   1 
ATOM   9180  C CA  . ASP E 1 100 ? -52.401 9.945   -25.722 1.00 80.31  ? 80  ASP E CA  1 
ATOM   9181  C C   . ASP E 1 100 ? -51.747 10.741  -24.588 1.00 80.18  ? 80  ASP E C   1 
ATOM   9182  O O   . ASP E 1 100 ? -51.964 11.946  -24.460 1.00 77.90  ? 80  ASP E O   1 
ATOM   9183  C CB  . ASP E 1 100 ? -53.755 9.431   -25.251 1.00 85.00  ? 80  ASP E CB  1 
ATOM   9184  C CG  . ASP E 1 100 ? -54.840 10.459  -25.371 1.00 89.35  ? 80  ASP E CG  1 
ATOM   9185  O OD1 . ASP E 1 100 ? -54.602 11.528  -25.971 1.00 94.24  ? 80  ASP E OD1 1 
ATOM   9186  O OD2 . ASP E 1 100 ? -55.946 10.193  -24.868 1.00 93.31  ? 80  ASP E OD2 1 
ATOM   9187  N N   . CYS E 1 101 ? -50.952 10.062  -23.769 1.00 78.99  ? 81  CYS E N   1 
ATOM   9188  C CA  . CYS E 1 101 ? -50.486 10.624  -22.507 1.00 75.85  ? 81  CYS E CA  1 
ATOM   9189  C C   . CYS E 1 101 ? -49.525 11.783  -22.633 1.00 70.21  ? 81  CYS E C   1 
ATOM   9190  O O   . CYS E 1 101 ? -48.882 11.972  -23.654 1.00 65.26  ? 81  CYS E O   1 
ATOM   9191  C CB  . CYS E 1 101 ? -49.854 9.529   -21.678 1.00 75.87  ? 81  CYS E CB  1 
ATOM   9192  S SG  . CYS E 1 101 ? -50.963 8.113   -21.623 1.00 85.52  ? 81  CYS E SG  1 
ATOM   9193  N N   . ASP E 1 102 ? -49.474 12.563  -21.564 1.00 69.35  ? 82  ASP E N   1 
ATOM   9194  C CA  . ASP E 1 102 ? -48.608 13.730  -21.463 1.00 70.39  ? 82  ASP E CA  1 
ATOM   9195  C C   . ASP E 1 102 ? -47.295 13.365  -20.795 1.00 66.52  ? 82  ASP E C   1 
ATOM   9196  O O   . ASP E 1 102 ? -46.269 14.028  -20.980 1.00 63.47  ? 82  ASP E O   1 
ATOM   9197  C CB  . ASP E 1 102 ? -49.302 14.790  -20.623 1.00 74.14  ? 82  ASP E CB  1 
ATOM   9198  C CG  . ASP E 1 102 ? -50.505 15.378  -21.321 1.00 75.28  ? 82  ASP E CG  1 
ATOM   9199  O OD1 . ASP E 1 102 ? -50.320 16.067  -22.350 1.00 71.35  ? 82  ASP E OD1 1 
ATOM   9200  O OD2 . ASP E 1 102 ? -51.630 15.148  -20.829 1.00 71.24  ? 82  ASP E OD2 1 
ATOM   9201  N N   . LEU E 1 103 ? -47.364 12.314  -19.992 1.00 60.54  ? 83  LEU E N   1 
ATOM   9202  C CA  . LEU E 1 103 ? -46.248 11.822  -19.243 1.00 58.49  ? 83  LEU E CA  1 
ATOM   9203  C C   . LEU E 1 103 ? -46.367 10.323  -19.164 1.00 59.29  ? 83  LEU E C   1 
ATOM   9204  O O   . LEU E 1 103 ? -47.406 9.806   -18.757 1.00 61.49  ? 83  LEU E O   1 
ATOM   9205  C CB  . LEU E 1 103 ? -46.285 12.394  -17.830 1.00 56.83  ? 83  LEU E CB  1 
ATOM   9206  C CG  . LEU E 1 103 ? -45.312 11.752  -16.837 1.00 59.26  ? 83  LEU E CG  1 
ATOM   9207  C CD1 . LEU E 1 103 ? -43.889 11.944  -17.325 1.00 60.98  ? 83  LEU E CD1 1 
ATOM   9208  C CD2 . LEU E 1 103 ? -45.462 12.340  -15.447 1.00 57.74  ? 83  LEU E CD2 1 
ATOM   9209  N N   . VAL E 1 104 ? -45.309 9.624   -19.546 1.00 58.70  ? 84  VAL E N   1 
ATOM   9210  C CA  . VAL E 1 104 ? -45.244 8.184   -19.335 1.00 59.03  ? 84  VAL E CA  1 
ATOM   9211  C C   . VAL E 1 104 ? -44.176 7.906   -18.275 1.00 61.08  ? 84  VAL E C   1 
ATOM   9212  O O   . VAL E 1 104 ? -43.165 8.599   -18.220 1.00 62.37  ? 84  VAL E O   1 
ATOM   9213  C CB  . VAL E 1 104 ? -44.932 7.446   -20.647 1.00 60.17  ? 84  VAL E CB  1 
ATOM   9214  C CG1 . VAL E 1 104 ? -45.071 5.937   -20.466 1.00 58.95  ? 84  VAL E CG1 1 
ATOM   9215  C CG2 . VAL E 1 104 ? -45.866 7.931   -21.748 1.00 59.24  ? 84  VAL E CG2 1 
ATOM   9216  N N   . ILE E 1 105 ? -44.413 6.926   -17.412 1.00 57.43  ? 85  ILE E N   1 
ATOM   9217  C CA  . ILE E 1 105 ? -43.440 6.581   -16.395 1.00 54.73  ? 85  ILE E CA  1 
ATOM   9218  C C   . ILE E 1 105 ? -43.240 5.098   -16.340 1.00 57.07  ? 85  ILE E C   1 
ATOM   9219  O O   . ILE E 1 105 ? -44.127 4.361   -15.928 1.00 56.50  ? 85  ILE E O   1 
ATOM   9220  C CB  . ILE E 1 105 ? -43.879 6.995   -15.000 1.00 54.92  ? 85  ILE E CB  1 
ATOM   9221  C CG1 . ILE E 1 105 ? -44.175 8.489   -14.959 1.00 56.58  ? 85  ILE E CG1 1 
ATOM   9222  C CG2 . ILE E 1 105 ? -42.793 6.626   -13.994 1.00 54.00  ? 85  ILE E CG2 1 
ATOM   9223  C CD1 . ILE E 1 105 ? -44.733 8.935   -13.622 1.00 57.98  ? 85  ILE E CD1 1 
ATOM   9224  N N   . GLU E 1 106 ? -42.046 4.668   -16.710 1.00 59.91  ? 86  GLU E N   1 
ATOM   9225  C CA  . GLU E 1 106 ? -41.752 3.256   -16.773 1.00 59.54  ? 86  GLU E CA  1 
ATOM   9226  C C   . GLU E 1 106 ? -41.196 2.800   -15.448 1.00 58.51  ? 86  GLU E C   1 
ATOM   9227  O O   . GLU E 1 106 ? -40.261 3.396   -14.924 1.00 59.22  ? 86  GLU E O   1 
ATOM   9228  C CB  . GLU E 1 106 ? -40.780 2.976   -17.907 1.00 61.34  ? 86  GLU E CB  1 
ATOM   9229  C CG  . GLU E 1 106 ? -40.186 1.587   -17.870 1.00 65.62  ? 86  GLU E CG  1 
ATOM   9230  C CD  . GLU E 1 106 ? -38.891 1.567   -17.116 1.00 67.58  ? 86  GLU E CD  1 
ATOM   9231  O OE1 . GLU E 1 106 ? -38.132 2.553   -17.228 1.00 71.68  ? 86  GLU E OE1 1 
ATOM   9232  O OE2 . GLU E 1 106 ? -38.646 0.569   -16.410 1.00 70.24  ? 86  GLU E OE2 1 
ATOM   9233  N N   . ALA E 1 107 ? -41.800 1.750   -14.908 1.00 60.95  ? 87  ALA E N   1 
ATOM   9234  C CA  . ALA E 1 107 ? -41.353 1.125   -13.670 1.00 63.51  ? 87  ALA E CA  1 
ATOM   9235  C C   . ALA E 1 107 ? -41.284 -0.362  -13.939 1.00 69.11  ? 87  ALA E C   1 
ATOM   9236  O O   . ALA E 1 107 ? -41.666 -1.193  -13.123 1.00 65.50  ? 87  ALA E O   1 
ATOM   9237  C CB  . ALA E 1 107 ? -42.315 1.425   -12.545 1.00 62.05  ? 87  ALA E CB  1 
ATOM   9238  N N   . ALA E 1 108 ? -40.814 -0.678  -15.134 1.00 78.44  ? 88  ALA E N   1 
ATOM   9239  C CA  . ALA E 1 108 ? -40.514 -2.037  -15.493 1.00 83.92  ? 88  ALA E CA  1 
ATOM   9240  C C   . ALA E 1 108 ? -39.154 -2.468  -14.937 1.00 88.34  ? 88  ALA E C   1 
ATOM   9241  O O   . ALA E 1 108 ? -38.517 -1.796  -14.112 1.00 95.61  ? 88  ALA E O   1 
ATOM   9242  C CB  . ALA E 1 108 ? -40.589 -2.211  -17.017 1.00 88.34  ? 88  ALA E CB  1 
ATOM   9243  N N   . VAL E 1 109 ? -38.814 -3.675  -15.357 1.00 89.67  ? 89  VAL E N   1 
ATOM   9244  C CA  . VAL E 1 109 ? -37.675 -4.474  -14.925 1.00 89.12  ? 89  VAL E CA  1 
ATOM   9245  C C   . VAL E 1 109 ? -36.335 -3.773  -15.089 1.00 84.94  ? 89  VAL E C   1 
ATOM   9246  O O   . VAL E 1 109 ? -36.087 -3.116  -16.111 1.00 76.48  ? 89  VAL E O   1 
ATOM   9247  C CB  . VAL E 1 109 ? -37.677 -5.824  -15.709 1.00 92.30  ? 89  VAL E CB  1 
ATOM   9248  C CG1 . VAL E 1 109 ? -37.890 -5.611  -17.211 1.00 89.42  ? 89  VAL E CG1 1 
ATOM   9249  C CG2 . VAL E 1 109 ? -36.406 -6.628  -15.463 1.00 93.24  ? 89  VAL E CG2 1 
ATOM   9250  N N   . GLU E 1 110 ? -35.472 -3.932  -14.088 1.00 81.80  ? 90  GLU E N   1 
ATOM   9251  C CA  . GLU E 1 110 ? -34.181 -3.260  -14.098 1.00 84.32  ? 90  GLU E CA  1 
ATOM   9252  C C   . GLU E 1 110 ? -33.246 -4.025  -15.037 1.00 83.19  ? 90  GLU E C   1 
ATOM   9253  O O   . GLU E 1 110 ? -32.352 -4.762  -14.614 1.00 84.84  ? 90  GLU E O   1 
ATOM   9254  C CB  . GLU E 1 110 ? -33.635 -3.076  -12.676 1.00 85.71  ? 90  GLU E CB  1 
ATOM   9255  C CG  . GLU E 1 110 ? -34.437 -2.051  -11.863 1.00 88.10  ? 90  GLU E CG  1 
ATOM   9256  C CD  . GLU E 1 110 ? -33.793 -0.673  -11.789 1.00 86.06  ? 90  GLU E CD  1 
ATOM   9257  O OE1 . GLU E 1 110 ? -33.540 -0.188  -10.662 1.00 81.27  ? 90  GLU E OE1 1 
ATOM   9258  O OE2 . GLU E 1 110 ? -33.548 -0.078  -12.856 1.00 81.25  ? 90  GLU E OE2 1 
ATOM   9259  N N   . ARG E 1 111 ? -33.506 -3.832  -16.329 1.00 81.42  ? 91  ARG E N   1 
ATOM   9260  C CA  . ARG E 1 111 ? -32.765 -4.465  -17.410 1.00 80.15  ? 91  ARG E CA  1 
ATOM   9261  C C   . ARG E 1 111 ? -32.718 -3.576  -18.661 1.00 74.23  ? 91  ARG E C   1 
ATOM   9262  O O   . ARG E 1 111 ? -33.752 -3.251  -19.254 1.00 72.82  ? 91  ARG E O   1 
ATOM   9263  C CB  . ARG E 1 111 ? -33.407 -5.796  -17.748 1.00 89.31  ? 91  ARG E CB  1 
ATOM   9264  C CG  . ARG E 1 111 ? -33.255 -6.173  -19.207 1.00 100.26 ? 91  ARG E CG  1 
ATOM   9265  C CD  . ARG E 1 111 ? -33.757 -7.566  -19.490 1.00 107.80 ? 91  ARG E CD  1 
ATOM   9266  N NE  . ARG E 1 111 ? -33.417 -8.498  -18.428 1.00 113.44 ? 91  ARG E NE  1 
ATOM   9267  C CZ  . ARG E 1 111 ? -32.795 -9.660  -18.599 1.00 115.92 ? 91  ARG E CZ  1 
ATOM   9268  N NH1 . ARG E 1 111 ? -32.435 -10.080 -19.810 1.00 120.51 ? 91  ARG E NH1 1 
ATOM   9269  N NH2 . ARG E 1 111 ? -32.547 -10.417 -17.541 1.00 112.46 ? 91  ARG E NH2 1 
ATOM   9270  N N   . MET E 1 112 ? -31.508 -3.234  -19.088 1.00 68.65  ? 92  MET E N   1 
ATOM   9271  C CA  . MET E 1 112 ? -31.313 -2.150  -20.053 1.00 65.75  ? 92  MET E CA  1 
ATOM   9272  C C   . MET E 1 112 ? -31.898 -2.386  -21.446 1.00 64.64  ? 92  MET E C   1 
ATOM   9273  O O   . MET E 1 112 ? -32.559 -1.502  -22.002 1.00 59.84  ? 92  MET E O   1 
ATOM   9274  C CB  . MET E 1 112 ? -29.826 -1.801  -20.170 1.00 63.93  ? 92  MET E CB  1 
ATOM   9275  C CG  . MET E 1 112 ? -29.529 -0.619  -21.094 1.00 62.23  ? 92  MET E CG  1 
ATOM   9276  S SD  . MET E 1 112 ? -30.348 0.946   -20.678 1.00 63.62  ? 92  MET E SD  1 
ATOM   9277  C CE  . MET E 1 112 ? -29.176 1.631   -19.513 1.00 65.14  ? 92  MET E CE  1 
ATOM   9278  N N   . ASP E 1 113 ? -31.628 -3.552  -22.019 1.00 68.40  ? 93  ASP E N   1 
ATOM   9279  C CA  . ASP E 1 113 ? -32.095 -3.872  -23.382 1.00 71.71  ? 93  ASP E CA  1 
ATOM   9280  C C   . ASP E 1 113 ? -33.615 -3.788  -23.511 1.00 70.10  ? 93  ASP E C   1 
ATOM   9281  O O   . ASP E 1 113 ? -34.135 -3.444  -24.570 1.00 66.72  ? 93  ASP E O   1 
ATOM   9282  C CB  . ASP E 1 113 ? -31.621 -5.260  -23.821 1.00 76.56  ? 93  ASP E CB  1 
ATOM   9283  C CG  . ASP E 1 113 ? -31.817 -6.309  -22.751 1.00 80.20  ? 93  ASP E CG  1 
ATOM   9284  O OD1 . ASP E 1 113 ? -32.370 -5.971  -21.696 1.00 90.54  ? 93  ASP E OD1 1 
ATOM   9285  O OD2 . ASP E 1 113 ? -31.409 -7.464  -22.957 1.00 78.84  ? 93  ASP E OD2 1 
ATOM   9286  N N   . ILE E 1 114 ? -34.322 -4.102  -22.433 1.00 71.18  ? 94  ILE E N   1 
ATOM   9287  C CA  . ILE E 1 114 ? -35.770 -3.965  -22.436 1.00 75.94  ? 94  ILE E CA  1 
ATOM   9288  C C   . ILE E 1 114 ? -36.228 -2.521  -22.293 1.00 73.77  ? 94  ILE E C   1 
ATOM   9289  O O   . ILE E 1 114 ? -37.156 -2.109  -22.993 1.00 76.18  ? 94  ILE E O   1 
ATOM   9290  C CB  . ILE E 1 114 ? -36.448 -4.847  -21.369 1.00 81.54  ? 94  ILE E CB  1 
ATOM   9291  C CG1 . ILE E 1 114 ? -36.916 -6.161  -22.007 1.00 82.63  ? 94  ILE E CG1 1 
ATOM   9292  C CG2 . ILE E 1 114 ? -37.646 -4.143  -20.735 1.00 85.18  ? 94  ILE E CG2 1 
ATOM   9293  C CD1 . ILE E 1 114 ? -36.187 -7.381  -21.507 1.00 83.30  ? 94  ILE E CD1 1 
ATOM   9294  N N   . LYS E 1 115 ? -35.598 -1.752  -21.407 1.00 68.06  ? 95  LYS E N   1 
ATOM   9295  C CA  . LYS E 1 115 ? -35.997 -0.357  -21.241 1.00 65.48  ? 95  LYS E CA  1 
ATOM   9296  C C   . LYS E 1 115 ? -35.835 0.365   -22.555 1.00 62.51  ? 95  LYS E C   1 
ATOM   9297  O O   . LYS E 1 115 ? -36.687 1.141   -22.963 1.00 57.04  ? 95  LYS E O   1 
ATOM   9298  C CB  . LYS E 1 115 ? -35.172 0.341   -20.176 1.00 66.23  ? 95  LYS E CB  1 
ATOM   9299  C CG  . LYS E 1 115 ? -35.449 -0.197  -18.793 1.00 67.04  ? 95  LYS E CG  1 
ATOM   9300  C CD  . LYS E 1 115 ? -35.073 0.813   -17.729 1.00 66.72  ? 95  LYS E CD  1 
ATOM   9301  C CE  . LYS E 1 115 ? -36.054 0.760   -16.578 1.00 69.54  ? 95  LYS E CE  1 
ATOM   9302  N NZ  . LYS E 1 115 ? -35.748 -0.155  -15.448 1.00 69.58  ? 95  LYS E NZ  1 
ATOM   9303  N N   . LYS E 1 116 ? -34.734 0.072   -23.224 1.00 64.65  ? 96  LYS E N   1 
ATOM   9304  C CA  . LYS E 1 116 ? -34.447 0.672   -24.509 1.00 67.49  ? 96  LYS E CA  1 
ATOM   9305  C C   . LYS E 1 116 ? -35.539 0.397   -25.527 1.00 66.26  ? 96  LYS E C   1 
ATOM   9306  O O   . LYS E 1 116 ? -35.834 1.252   -26.362 1.00 62.87  ? 96  LYS E O   1 
ATOM   9307  C CB  . LYS E 1 116 ? -33.115 0.162   -25.061 1.00 70.73  ? 96  LYS E CB  1 
ATOM   9308  C CG  . LYS E 1 116 ? -31.998 1.184   -24.986 1.00 72.73  ? 96  LYS E CG  1 
ATOM   9309  C CD  . LYS E 1 116 ? -30.916 0.776   -24.009 1.00 74.65  ? 96  LYS E CD  1 
ATOM   9310  C CE  . LYS E 1 116 ? -29.810 -0.011  -24.701 1.00 76.81  ? 96  LYS E CE  1 
ATOM   9311  N NZ  . LYS E 1 116 ? -28.653 0.855   -25.056 1.00 75.76  ? 96  LYS E NZ  1 
ATOM   9312  N N   . GLN E 1 117 ? -36.133 -0.789  -25.468 1.00 67.96  ? 97  GLN E N   1 
ATOM   9313  C CA  . GLN E 1 117 ? -37.188 -1.122  -26.418 1.00 71.19  ? 97  GLN E CA  1 
ATOM   9314  C C   . GLN E 1 117 ? -38.479 -0.394  -26.062 1.00 66.08  ? 97  GLN E C   1 
ATOM   9315  O O   . GLN E 1 117 ? -39.079 0.298   -26.898 1.00 63.79  ? 97  GLN E O   1 
ATOM   9316  C CB  . GLN E 1 117 ? -37.428 -2.633  -26.497 1.00 76.05  ? 97  GLN E CB  1 
ATOM   9317  C CG  . GLN E 1 117 ? -38.097 -3.046  -27.806 1.00 79.54  ? 97  GLN E CG  1 
ATOM   9318  C CD  . GLN E 1 117 ? -37.338 -2.569  -29.042 1.00 83.44  ? 97  GLN E CD  1 
ATOM   9319  O OE1 . GLN E 1 117 ? -37.935 -2.091  -30.011 1.00 82.79  ? 97  GLN E OE1 1 
ATOM   9320  N NE2 . GLN E 1 117 ? -36.012 -2.682  -29.003 1.00 85.19  ? 97  GLN E NE2 1 
ATOM   9321  N N   . ILE E 1 118 ? -38.888 -0.535  -24.809 1.00 59.60  ? 98  ILE E N   1 
ATOM   9322  C CA  . ILE E 1 118 ? -40.071 0.159   -24.337 1.00 59.68  ? 98  ILE E CA  1 
ATOM   9323  C C   . ILE E 1 118 ? -39.990 1.629   -24.699 1.00 59.19  ? 98  ILE E C   1 
ATOM   9324  O O   . ILE E 1 118 ? -40.975 2.238   -25.112 1.00 62.59  ? 98  ILE E O   1 
ATOM   9325  C CB  . ILE E 1 118 ? -40.224 0.080   -22.820 1.00 62.36  ? 98  ILE E CB  1 
ATOM   9326  C CG1 . ILE E 1 118 ? -40.071 -1.360  -22.347 1.00 64.21  ? 98  ILE E CG1 1 
ATOM   9327  C CG2 . ILE E 1 118 ? -41.570 0.650   -22.418 1.00 64.83  ? 98  ILE E CG2 1 
ATOM   9328  C CD1 . ILE E 1 118 ? -40.937 -1.743  -21.169 1.00 65.76  ? 98  ILE E CD1 1 
ATOM   9329  N N   . PHE E 1 119 ? -38.806 2.198   -24.532 1.00 55.40  ? 99  PHE E N   1 
ATOM   9330  C CA  . PHE E 1 119 ? -38.623 3.606   -24.794 1.00 55.31  ? 99  PHE E CA  1 
ATOM   9331  C C   . PHE E 1 119 ? -38.602 3.934   -26.261 1.00 56.54  ? 99  PHE E C   1 
ATOM   9332  O O   . PHE E 1 119 ? -39.126 4.969   -26.653 1.00 62.68  ? 99  PHE E O   1 
ATOM   9333  C CB  . PHE E 1 119 ? -37.361 4.136   -24.121 1.00 56.23  ? 99  PHE E CB  1 
ATOM   9334  C CG  . PHE E 1 119 ? -37.610 4.645   -22.745 1.00 53.10  ? 99  PHE E CG  1 
ATOM   9335  C CD1 . PHE E 1 119 ? -37.902 3.770   -21.719 1.00 51.79  ? 99  PHE E CD1 1 
ATOM   9336  C CD2 . PHE E 1 119 ? -37.607 5.997   -22.490 1.00 53.77  ? 99  PHE E CD2 1 
ATOM   9337  C CE1 . PHE E 1 119 ? -38.167 4.231   -20.453 1.00 52.75  ? 99  PHE E CE1 1 
ATOM   9338  C CE2 . PHE E 1 119 ? -37.857 6.467   -21.221 1.00 53.59  ? 99  PHE E CE2 1 
ATOM   9339  C CZ  . PHE E 1 119 ? -38.143 5.584   -20.201 1.00 52.90  ? 99  PHE E CZ  1 
ATOM   9340  N N   . ALA E 1 120 ? -37.992 3.078   -27.073 1.00 60.14  ? 100 ALA E N   1 
ATOM   9341  C CA  . ALA E 1 120 ? -38.000 3.304   -28.520 1.00 60.38  ? 100 ALA E CA  1 
ATOM   9342  C C   . ALA E 1 120 ? -39.408 3.143   -29.081 1.00 59.22  ? 100 ALA E C   1 
ATOM   9343  O O   . ALA E 1 120 ? -39.776 3.831   -30.030 1.00 64.49  ? 100 ALA E O   1 
ATOM   9344  C CB  . ALA E 1 120 ? -37.035 2.374   -29.230 1.00 60.36  ? 100 ALA E CB  1 
ATOM   9345  N N   . ASP E 1 121 ? -40.194 2.245   -28.493 1.00 59.70  ? 101 ASP E N   1 
ATOM   9346  C CA  . ASP E 1 121 ? -41.596 2.114   -28.875 1.00 64.08  ? 101 ASP E CA  1 
ATOM   9347  C C   . ASP E 1 121 ? -42.321 3.406   -28.552 1.00 67.07  ? 101 ASP E C   1 
ATOM   9348  O O   . ASP E 1 121 ? -42.820 4.094   -29.448 1.00 68.75  ? 101 ASP E O   1 
ATOM   9349  C CB  . ASP E 1 121 ? -42.264 0.947   -28.148 1.00 65.03  ? 101 ASP E CB  1 
ATOM   9350  C CG  . ASP E 1 121 ? -41.839 -0.413  -28.698 1.00 70.09  ? 101 ASP E CG  1 
ATOM   9351  O OD1 . ASP E 1 121 ? -41.560 -0.518  -29.918 1.00 68.97  ? 101 ASP E OD1 1 
ATOM   9352  O OD2 . ASP E 1 121 ? -41.794 -1.388  -27.908 1.00 69.13  ? 101 ASP E OD2 1 
ATOM   9353  N N   . LEU E 1 122 ? -42.333 3.744   -27.267 1.00 65.34  ? 102 LEU E N   1 
ATOM   9354  C CA  . LEU E 1 122 ? -43.045 4.913   -26.770 1.00 62.48  ? 102 LEU E CA  1 
ATOM   9355  C C   . LEU E 1 122 ? -42.667 6.166   -27.509 1.00 61.90  ? 102 LEU E C   1 
ATOM   9356  O O   . LEU E 1 122 ? -43.486 7.065   -27.666 1.00 61.40  ? 102 LEU E O   1 
ATOM   9357  C CB  . LEU E 1 122 ? -42.735 5.124   -25.299 1.00 63.85  ? 102 LEU E CB  1 
ATOM   9358  C CG  . LEU E 1 122 ? -43.404 4.163   -24.327 1.00 62.13  ? 102 LEU E CG  1 
ATOM   9359  C CD1 . LEU E 1 122 ? -42.710 4.266   -22.983 1.00 62.39  ? 102 LEU E CD1 1 
ATOM   9360  C CD2 . LEU E 1 122 ? -44.879 4.494   -24.199 1.00 61.84  ? 102 LEU E CD2 1 
ATOM   9361  N N   . ASP E 1 123 ? -41.418 6.238   -27.951 1.00 64.49  ? 103 ASP E N   1 
ATOM   9362  C CA  . ASP E 1 123 ? -40.973 7.389   -28.722 1.00 68.03  ? 103 ASP E CA  1 
ATOM   9363  C C   . ASP E 1 123 ? -41.772 7.492   -30.022 1.00 73.31  ? 103 ASP E C   1 
ATOM   9364  O O   . ASP E 1 123 ? -41.972 8.588   -30.544 1.00 69.97  ? 103 ASP E O   1 
ATOM   9365  C CB  . ASP E 1 123 ? -39.483 7.306   -29.029 1.00 64.65  ? 103 ASP E CB  1 
ATOM   9366  C CG  . ASP E 1 123 ? -39.004 8.461   -29.887 1.00 62.98  ? 103 ASP E CG  1 
ATOM   9367  O OD1 . ASP E 1 123 ? -39.407 9.619   -29.631 1.00 60.04  ? 103 ASP E OD1 1 
ATOM   9368  O OD2 . ASP E 1 123 ? -38.212 8.216   -30.817 1.00 62.50  ? 103 ASP E OD2 1 
ATOM   9369  N N   . ASN E 1 124 ? -42.233 6.343   -30.516 1.00 78.93  ? 104 ASN E N   1 
ATOM   9370  C CA  . ASN E 1 124 ? -43.047 6.256   -31.738 1.00 81.30  ? 104 ASN E CA  1 
ATOM   9371  C C   . ASN E 1 124 ? -44.555 6.299   -31.497 1.00 77.52  ? 104 ASN E C   1 
ATOM   9372  O O   . ASN E 1 124 ? -45.286 6.946   -32.240 1.00 73.84  ? 104 ASN E O   1 
ATOM   9373  C CB  . ASN E 1 124 ? -42.702 4.978   -32.507 1.00 85.00  ? 104 ASN E CB  1 
ATOM   9374  C CG  . ASN E 1 124 ? -41.630 5.202   -33.551 1.00 85.68  ? 104 ASN E CG  1 
ATOM   9375  O OD1 . ASN E 1 124 ? -41.550 6.276   -34.156 1.00 84.08  ? 104 ASN E OD1 1 
ATOM   9376  N ND2 . ASN E 1 124 ? -40.805 4.183   -33.783 1.00 82.23  ? 104 ASN E ND2 1 
ATOM   9377  N N   . ILE E 1 125 ? -45.012 5.592   -30.470 1.00 74.88  ? 105 ILE E N   1 
ATOM   9378  C CA  . ILE E 1 125 ? -46.429 5.568   -30.116 1.00 71.57  ? 105 ILE E CA  1 
ATOM   9379  C C   . ILE E 1 125 ? -46.919 6.979   -29.798 1.00 73.53  ? 105 ILE E C   1 
ATOM   9380  O O   . ILE E 1 125 ? -47.934 7.434   -30.325 1.00 77.42  ? 105 ILE E O   1 
ATOM   9381  C CB  . ILE E 1 125 ? -46.674 4.687   -28.874 1.00 74.38  ? 105 ILE E CB  1 
ATOM   9382  C CG1 . ILE E 1 125 ? -46.763 3.202   -29.231 1.00 75.57  ? 105 ILE E CG1 1 
ATOM   9383  C CG2 . ILE E 1 125 ? -47.986 5.047   -28.210 1.00 77.14  ? 105 ILE E CG2 1 
ATOM   9384  C CD1 . ILE E 1 125 ? -45.565 2.634   -29.959 1.00 77.43  ? 105 ILE E CD1 1 
ATOM   9385  N N   . CYS E 1 126 ? -46.175 7.658   -28.931 1.00 73.80  ? 106 CYS E N   1 
ATOM   9386  C CA  . CYS E 1 126 ? -46.628 8.887   -28.300 1.00 69.39  ? 106 CYS E CA  1 
ATOM   9387  C C   . CYS E 1 126 ? -46.481 10.095  -29.191 1.00 67.70  ? 106 CYS E C   1 
ATOM   9388  O O   . CYS E 1 126 ? -45.595 10.161  -30.033 1.00 68.02  ? 106 CYS E O   1 
ATOM   9389  C CB  . CYS E 1 126 ? -45.864 9.117   -26.995 1.00 67.00  ? 106 CYS E CB  1 
ATOM   9390  S SG  . CYS E 1 126 ? -45.913 7.696   -25.873 1.00 66.98  ? 106 CYS E SG  1 
ATOM   9391  N N   . LYS E 1 127 ? -47.383 11.042  -28.998 1.00 68.28  ? 107 LYS E N   1 
ATOM   9392  C CA  . LYS E 1 127 ? -47.270 12.356  -29.606 1.00 70.73  ? 107 LYS E CA  1 
ATOM   9393  C C   . LYS E 1 127 ? -45.948 12.974  -29.169 1.00 71.80  ? 107 LYS E C   1 
ATOM   9394  O O   . LYS E 1 127 ? -45.303 12.448  -28.267 1.00 70.50  ? 107 LYS E O   1 
ATOM   9395  C CB  . LYS E 1 127 ? -48.432 13.245  -29.170 1.00 74.64  ? 107 LYS E CB  1 
ATOM   9396  C CG  . LYS E 1 127 ? -48.913 12.996  -27.749 1.00 76.24  ? 107 LYS E CG  1 
ATOM   9397  C CD  . LYS E 1 127 ? -49.326 14.285  -27.078 1.00 77.20  ? 107 LYS E CD  1 
ATOM   9398  C CE  . LYS E 1 127 ? -50.143 14.038  -25.828 1.00 76.44  ? 107 LYS E CE  1 
ATOM   9399  N NZ  . LYS E 1 127 ? -50.706 15.323  -25.336 1.00 74.32  ? 107 LYS E NZ  1 
ATOM   9400  N N   . PRO E 1 128 ? -45.539 14.091  -29.796 1.00 73.28  ? 108 PRO E N   1 
ATOM   9401  C CA  . PRO E 1 128 ? -44.191 14.601  -29.537 1.00 74.45  ? 108 PRO E CA  1 
ATOM   9402  C C   . PRO E 1 128 ? -43.992 15.255  -28.177 1.00 73.75  ? 108 PRO E C   1 
ATOM   9403  O O   . PRO E 1 128 ? -42.882 15.229  -27.650 1.00 77.44  ? 108 PRO E O   1 
ATOM   9404  C CB  . PRO E 1 128 ? -43.977 15.643  -30.651 1.00 75.06  ? 108 PRO E CB  1 
ATOM   9405  C CG  . PRO E 1 128 ? -45.071 15.418  -31.634 1.00 74.72  ? 108 PRO E CG  1 
ATOM   9406  C CD  . PRO E 1 128 ? -46.215 14.868  -30.845 1.00 74.55  ? 108 PRO E CD  1 
ATOM   9407  N N   . GLU E 1 129 ? -45.052 15.824  -27.614 1.00 71.51  ? 109 GLU E N   1 
ATOM   9408  C CA  . GLU E 1 129 ? -44.932 16.574  -26.355 1.00 69.34  ? 109 GLU E CA  1 
ATOM   9409  C C   . GLU E 1 129 ? -44.887 15.630  -25.157 1.00 65.38  ? 109 GLU E C   1 
ATOM   9410  O O   . GLU E 1 129 ? -44.583 16.041  -24.040 1.00 59.10  ? 109 GLU E O   1 
ATOM   9411  C CB  . GLU E 1 129 ? -46.034 17.647  -26.172 1.00 69.14  ? 109 GLU E CB  1 
ATOM   9412  C CG  . GLU E 1 129 ? -47.422 17.291  -26.684 1.00 72.65  ? 109 GLU E CG  1 
ATOM   9413  C CD  . GLU E 1 129 ? -47.629 17.629  -28.160 1.00 75.09  ? 109 GLU E CD  1 
ATOM   9414  O OE1 . GLU E 1 129 ? -47.454 18.810  -28.533 1.00 72.54  ? 109 GLU E OE1 1 
ATOM   9415  O OE2 . GLU E 1 129 ? -47.972 16.716  -28.949 1.00 76.48  ? 109 GLU E OE2 1 
ATOM   9416  N N   . THR E 1 130 ? -45.170 14.358  -25.387 1.00 63.87  ? 110 THR E N   1 
ATOM   9417  C CA  . THR E 1 130 ? -45.072 13.397  -24.314 1.00 65.95  ? 110 THR E CA  1 
ATOM   9418  C C   . THR E 1 130 ? -43.670 13.379  -23.736 1.00 64.96  ? 110 THR E C   1 
ATOM   9419  O O   . THR E 1 130 ? -42.685 13.474  -24.463 1.00 65.20  ? 110 THR E O   1 
ATOM   9420  C CB  . THR E 1 130 ? -45.362 11.987  -24.813 1.00 68.59  ? 110 THR E CB  1 
ATOM   9421  O OG1 . THR E 1 130 ? -46.373 12.057  -25.823 1.00 71.05  ? 110 THR E OG1 1 
ATOM   9422  C CG2 . THR E 1 130 ? -45.820 11.104  -23.666 1.00 69.53  ? 110 THR E CG2 1 
ATOM   9423  N N   . ILE E 1 131 ? -43.599 13.240  -22.424 1.00 61.82  ? 111 ILE E N   1 
ATOM   9424  C CA  . ILE E 1 131 ? -42.344 13.087  -21.736 1.00 56.83  ? 111 ILE E CA  1 
ATOM   9425  C C   . ILE E 1 131 ? -42.272 11.667  -21.233 1.00 54.54  ? 111 ILE E C   1 
ATOM   9426  O O   . ILE E 1 131 ? -43.211 11.161  -20.624 1.00 54.57  ? 111 ILE E O   1 
ATOM   9427  C CB  . ILE E 1 131 ? -42.244 14.063  -20.567 1.00 56.10  ? 111 ILE E CB  1 
ATOM   9428  C CG1 . ILE E 1 131 ? -41.771 15.414  -21.088 1.00 55.14  ? 111 ILE E CG1 1 
ATOM   9429  C CG2 . ILE E 1 131 ? -41.267 13.556  -19.520 1.00 56.01  ? 111 ILE E CG2 1 
ATOM   9430  C CD1 . ILE E 1 131 ? -42.006 16.541  -20.116 1.00 54.12  ? 111 ILE E CD1 1 
ATOM   9431  N N   . LEU E 1 132 ? -41.148 11.028  -21.492 1.00 51.74  ? 112 LEU E N   1 
ATOM   9432  C CA  . LEU E 1 132 ? -40.959 9.654   -21.095 1.00 51.01  ? 112 LEU E CA  1 
ATOM   9433  C C   . LEU E 1 132 ? -40.026 9.611   -19.906 1.00 50.89  ? 112 LEU E C   1 
ATOM   9434  O O   . LEU E 1 132 ? -38.872 10.013  -20.008 1.00 52.03  ? 112 LEU E O   1 
ATOM   9435  C CB  . LEU E 1 132 ? -40.366 8.862   -22.247 1.00 51.81  ? 112 LEU E CB  1 
ATOM   9436  C CG  . LEU E 1 132 ? -40.980 9.176   -23.612 1.00 53.61  ? 112 LEU E CG  1 
ATOM   9437  C CD1 . LEU E 1 132 ? -40.162 8.565   -24.726 1.00 53.75  ? 112 LEU E CD1 1 
ATOM   9438  C CD2 . LEU E 1 132 ? -42.391 8.644   -23.679 1.00 54.12  ? 112 LEU E CD2 1 
ATOM   9439  N N   . ALA E 1 133 ? -40.531 9.124   -18.782 1.00 48.43  ? 113 ALA E N   1 
ATOM   9440  C CA  . ALA E 1 133 ? -39.756 9.052   -17.572 1.00 49.24  ? 113 ALA E CA  1 
ATOM   9441  C C   . ALA E 1 133 ? -39.565 7.623   -17.151 1.00 50.90  ? 113 ALA E C   1 
ATOM   9442  O O   . ALA E 1 133 ? -40.317 6.740   -17.556 1.00 55.62  ? 113 ALA E O   1 
ATOM   9443  C CB  . ALA E 1 133 ? -40.451 9.814   -16.473 1.00 50.33  ? 113 ALA E CB  1 
ATOM   9444  N N   . SER E 1 134 ? -38.555 7.404   -16.323 1.00 50.62  ? 114 SER E N   1 
ATOM   9445  C CA  . SER E 1 134 ? -38.298 6.083   -15.799 1.00 50.38  ? 114 SER E CA  1 
ATOM   9446  C C   . SER E 1 134 ? -38.020 6.163   -14.323 1.00 49.45  ? 114 SER E C   1 
ATOM   9447  O O   . SER E 1 134 ? -37.412 7.116   -13.844 1.00 50.25  ? 114 SER E O   1 
ATOM   9448  C CB  . SER E 1 134 ? -37.114 5.442   -16.514 1.00 54.04  ? 114 SER E CB  1 
ATOM   9449  O OG  . SER E 1 134 ? -36.630 4.309   -15.789 1.00 56.43  ? 114 SER E OG  1 
ATOM   9450  N N   . ASN E 1 135 ? -38.470 5.139   -13.611 1.00 49.56  ? 115 ASN E N   1 
ATOM   9451  C CA  . ASN E 1 135 ? -38.305 5.053   -12.172 1.00 50.31  ? 115 ASN E CA  1 
ATOM   9452  C C   . ASN E 1 135 ? -37.023 4.325   -11.819 1.00 50.34  ? 115 ASN E C   1 
ATOM   9453  O O   . ASN E 1 135 ? -36.723 4.110   -10.642 1.00 48.58  ? 115 ASN E O   1 
ATOM   9454  C CB  . ASN E 1 135 ? -39.482 4.289   -11.571 1.00 51.28  ? 115 ASN E CB  1 
ATOM   9455  C CG  . ASN E 1 135 ? -39.416 4.214   -10.053 1.00 55.83  ? 115 ASN E CG  1 
ATOM   9456  O OD1 . ASN E 1 135 ? -39.251 5.231   -9.368  1.00 60.59  ? 115 ASN E OD1 1 
ATOM   9457  N ND2 . ASN E 1 135 ? -39.524 3.008   -9.518  1.00 55.45  ? 115 ASN E ND2 1 
ATOM   9458  N N   . THR E 1 136 ? -36.276 3.903   -12.831 1.00 53.72  ? 116 THR E N   1 
ATOM   9459  C CA  . THR E 1 136 ? -35.073 3.144   -12.570 1.00 54.20  ? 116 THR E CA  1 
ATOM   9460  C C   . THR E 1 136 ? -34.201 3.830   -11.544 1.00 54.57  ? 116 THR E C   1 
ATOM   9461  O O   . THR E 1 136 ? -34.120 5.068   -11.457 1.00 58.61  ? 116 THR E O   1 
ATOM   9462  C CB  . THR E 1 136 ? -34.197 2.961   -13.805 1.00 53.46  ? 116 THR E CB  1 
ATOM   9463  O OG1 . THR E 1 136 ? -33.106 2.107   -13.457 1.00 51.76  ? 116 THR E OG1 1 
ATOM   9464  C CG2 . THR E 1 136 ? -33.616 4.286   -14.250 1.00 54.30  ? 116 THR E CG2 1 
ATOM   9465  N N   . SER E 1 137 ? -33.514 3.007   -10.788 1.00 55.86  ? 117 SER E N   1 
ATOM   9466  C CA  . SER E 1 137 ? -32.642 3.517   -9.771  1.00 57.60  ? 117 SER E CA  1 
ATOM   9467  C C   . SER E 1 137 ? -31.184 3.152   -10.044 1.00 54.05  ? 117 SER E C   1 
ATOM   9468  O O   . SER E 1 137 ? -30.312 3.507   -9.278  1.00 54.81  ? 117 SER E O   1 
ATOM   9469  C CB  . SER E 1 137 ? -33.095 2.968   -8.424  1.00 60.83  ? 117 SER E CB  1 
ATOM   9470  O OG  . SER E 1 137 ? -32.130 2.083   -7.890  1.00 64.57  ? 117 SER E OG  1 
ATOM   9471  N N   . SER E 1 138 ? -30.913 2.443   -11.128 1.00 53.83  ? 118 SER E N   1 
ATOM   9472  C CA  . SER E 1 138 ? -29.571 1.931   -11.338 1.00 55.17  ? 118 SER E CA  1 
ATOM   9473  C C   . SER E 1 138 ? -29.184 1.743   -12.800 1.00 54.74  ? 118 SER E C   1 
ATOM   9474  O O   . SER E 1 138 ? -28.138 1.172   -13.092 1.00 55.78  ? 118 SER E O   1 
ATOM   9475  C CB  . SER E 1 138 ? -29.451 0.595   -10.619 1.00 56.07  ? 118 SER E CB  1 
ATOM   9476  O OG  . SER E 1 138 ? -30.189 -0.385  -11.336 1.00 59.37  ? 118 SER E OG  1 
ATOM   9477  N N   . LEU E 1 139 ? -30.028 2.201   -13.715 1.00 53.22  ? 119 LEU E N   1 
ATOM   9478  C CA  . LEU E 1 139 ? -29.669 2.246   -15.112 1.00 49.52  ? 119 LEU E CA  1 
ATOM   9479  C C   . LEU E 1 139 ? -29.510 3.702   -15.501 1.00 47.15  ? 119 LEU E C   1 
ATOM   9480  O O   . LEU E 1 139 ? -30.018 4.593   -14.832 1.00 46.94  ? 119 LEU E O   1 
ATOM   9481  C CB  . LEU E 1 139 ? -30.730 1.544   -15.943 1.00 50.74  ? 119 LEU E CB  1 
ATOM   9482  C CG  . LEU E 1 139 ? -30.767 0.039   -15.634 1.00 53.59  ? 119 LEU E CG  1 
ATOM   9483  C CD1 . LEU E 1 139 ? -32.053 -0.612  -16.130 1.00 54.76  ? 119 LEU E CD1 1 
ATOM   9484  C CD2 . LEU E 1 139 ? -29.562 -0.658  -16.241 1.00 51.94  ? 119 LEU E CD2 1 
ATOM   9485  N N   . SER E 1 140 ? -28.789 3.943   -16.581 1.00 44.05  ? 120 SER E N   1 
ATOM   9486  C CA  . SER E 1 140 ? -28.485 5.295   -16.979 1.00 40.62  ? 120 SER E CA  1 
ATOM   9487  C C   . SER E 1 140 ? -29.619 5.885   -17.778 1.00 42.28  ? 120 SER E C   1 
ATOM   9488  O O   . SER E 1 140 ? -29.957 5.382   -18.854 1.00 42.17  ? 120 SER E O   1 
ATOM   9489  C CB  . SER E 1 140 ? -27.209 5.352   -17.809 1.00 40.80  ? 120 SER E CB  1 
ATOM   9490  O OG  . SER E 1 140 ? -27.248 6.455   -18.697 1.00 38.52  ? 120 SER E OG  1 
ATOM   9491  N N   . ILE E 1 141 ? -30.173 6.975   -17.258 1.00 42.12  ? 121 ILE E N   1 
ATOM   9492  C CA  . ILE E 1 141 ? -31.245 7.692   -17.919 1.00 45.80  ? 121 ILE E CA  1 
ATOM   9493  C C   . ILE E 1 141 ? -30.777 8.217   -19.267 1.00 45.92  ? 121 ILE E C   1 
ATOM   9494  O O   . ILE E 1 141 ? -31.495 8.162   -20.260 1.00 48.01  ? 121 ILE E O   1 
ATOM   9495  C CB  . ILE E 1 141 ? -31.716 8.877   -17.056 1.00 49.14  ? 121 ILE E CB  1 
ATOM   9496  C CG1 . ILE E 1 141 ? -32.509 8.366   -15.848 1.00 53.30  ? 121 ILE E CG1 1 
ATOM   9497  C CG2 . ILE E 1 141 ? -32.582 9.825   -17.875 1.00 51.46  ? 121 ILE E CG2 1 
ATOM   9498  C CD1 . ILE E 1 141 ? -33.899 7.857   -16.207 1.00 54.54  ? 121 ILE E CD1 1 
ATOM   9499  N N   . THR E 1 142 ? -29.572 8.757   -19.277 1.00 45.05  ? 122 THR E N   1 
ATOM   9500  C CA  . THR E 1 142 ? -28.916 9.183   -20.509 1.00 45.67  ? 122 THR E CA  1 
ATOM   9501  C C   . THR E 1 142 ? -28.870 8.095   -21.582 1.00 45.20  ? 122 THR E C   1 
ATOM   9502  O O   . THR E 1 142 ? -29.141 8.360   -22.742 1.00 46.25  ? 122 THR E O   1 
ATOM   9503  C CB  . THR E 1 142 ? -27.470 9.591   -20.202 1.00 44.33  ? 122 THR E CB  1 
ATOM   9504  O OG1 . THR E 1 142 ? -27.484 10.637  -19.224 1.00 43.10  ? 122 THR E OG1 1 
ATOM   9505  C CG2 . THR E 1 142 ? -26.754 10.056  -21.437 1.00 43.09  ? 122 THR E CG2 1 
ATOM   9506  N N   . GLU E 1 143 ? -28.495 6.885   -21.197 1.00 46.57  ? 123 GLU E N   1 
ATOM   9507  C CA  . GLU E 1 143 ? -28.357 5.805   -22.161 1.00 50.74  ? 123 GLU E CA  1 
ATOM   9508  C C   . GLU E 1 143 ? -29.711 5.357   -22.690 1.00 51.16  ? 123 GLU E C   1 
ATOM   9509  O O   . GLU E 1 143 ? -29.846 5.012   -23.859 1.00 50.99  ? 123 GLU E O   1 
ATOM   9510  C CB  . GLU E 1 143 ? -27.635 4.613   -21.543 1.00 53.11  ? 123 GLU E CB  1 
ATOM   9511  C CG  . GLU E 1 143 ? -27.054 3.674   -22.588 1.00 54.47  ? 123 GLU E CG  1 
ATOM   9512  C CD  . GLU E 1 143 ? -26.524 2.377   -22.002 1.00 56.19  ? 123 GLU E CD  1 
ATOM   9513  O OE1 . GLU E 1 143 ? -26.029 2.366   -20.848 1.00 55.03  ? 123 GLU E OE1 1 
ATOM   9514  O OE2 . GLU E 1 143 ? -26.601 1.360   -22.718 1.00 55.08  ? 123 GLU E OE2 1 
ATOM   9515  N N   . VAL E 1 144 ? -30.716 5.349   -21.829 1.00 50.36  ? 124 VAL E N   1 
ATOM   9516  C CA  . VAL E 1 144 ? -32.050 4.988   -22.271 1.00 49.70  ? 124 VAL E CA  1 
ATOM   9517  C C   . VAL E 1 144 ? -32.523 6.009   -23.293 1.00 50.49  ? 124 VAL E C   1 
ATOM   9518  O O   . VAL E 1 144 ? -33.049 5.649   -24.343 1.00 48.81  ? 124 VAL E O   1 
ATOM   9519  C CB  . VAL E 1 144 ? -33.029 4.943   -21.090 1.00 50.64  ? 124 VAL E CB  1 
ATOM   9520  C CG1 . VAL E 1 144 ? -34.457 4.819   -21.578 1.00 52.39  ? 124 VAL E CG1 1 
ATOM   9521  C CG2 . VAL E 1 144 ? -32.692 3.781   -20.170 1.00 48.58  ? 124 VAL E CG2 1 
ATOM   9522  N N   . ALA E 1 145 ? -32.316 7.284   -22.980 1.00 49.45  ? 125 ALA E N   1 
ATOM   9523  C CA  . ALA E 1 145 ? -32.750 8.375   -23.850 1.00 48.55  ? 125 ALA E CA  1 
ATOM   9524  C C   . ALA E 1 145 ? -32.131 8.325   -25.239 1.00 48.48  ? 125 ALA E C   1 
ATOM   9525  O O   . ALA E 1 145 ? -32.674 8.876   -26.178 1.00 50.36  ? 125 ALA E O   1 
ATOM   9526  C CB  . ALA E 1 145 ? -32.438 9.710   -23.206 1.00 47.09  ? 125 ALA E CB  1 
ATOM   9527  N N   . SER E 1 146 ? -30.983 7.680   -25.361 1.00 51.99  ? 126 SER E N   1 
ATOM   9528  C CA  . SER E 1 146 ? -30.347 7.485   -26.662 1.00 53.36  ? 126 SER E CA  1 
ATOM   9529  C C   . SER E 1 146 ? -31.076 6.517   -27.561 1.00 54.17  ? 126 SER E C   1 
ATOM   9530  O O   . SER E 1 146 ? -30.788 6.456   -28.744 1.00 58.34  ? 126 SER E O   1 
ATOM   9531  C CB  . SER E 1 146 ? -28.934 6.965   -26.481 1.00 54.32  ? 126 SER E CB  1 
ATOM   9532  O OG  . SER E 1 146 ? -28.095 8.062   -26.231 1.00 55.84  ? 126 SER E OG  1 
ATOM   9533  N N   . ALA E 1 147 ? -31.983 5.732   -26.996 1.00 53.00  ? 127 ALA E N   1 
ATOM   9534  C CA  . ALA E 1 147 ? -32.801 4.844   -27.783 1.00 51.72  ? 127 ALA E CA  1 
ATOM   9535  C C   . ALA E 1 147 ? -33.936 5.599   -28.463 1.00 51.30  ? 127 ALA E C   1 
ATOM   9536  O O   . ALA E 1 147 ? -34.540 5.099   -29.397 1.00 55.53  ? 127 ALA E O   1 
ATOM   9537  C CB  . ALA E 1 147 ? -33.350 3.737   -26.908 1.00 53.21  ? 127 ALA E CB  1 
ATOM   9538  N N   . THR E 1 148 ? -34.212 6.811   -28.012 1.00 54.11  ? 128 THR E N   1 
ATOM   9539  C CA  . THR E 1 148 ? -35.285 7.598   -28.589 1.00 53.22  ? 128 THR E CA  1 
ATOM   9540  C C   . THR E 1 148 ? -34.715 8.658   -29.489 1.00 55.72  ? 128 THR E C   1 
ATOM   9541  O O   . THR E 1 148 ? -33.497 8.792   -29.630 1.00 54.95  ? 128 THR E O   1 
ATOM   9542  C CB  . THR E 1 148 ? -36.140 8.292   -27.508 1.00 53.45  ? 128 THR E CB  1 
ATOM   9543  O OG1 . THR E 1 148 ? -35.581 9.572   -27.167 1.00 51.78  ? 128 THR E OG1 1 
ATOM   9544  C CG2 . THR E 1 148 ? -36.239 7.440   -26.272 1.00 55.40  ? 128 THR E CG2 1 
ATOM   9545  N N   . LYS E 1 149 ? -35.624 9.413   -30.089 1.00 60.86  ? 129 LYS E N   1 
ATOM   9546  C CA  . LYS E 1 149 ? -35.285 10.566  -30.894 1.00 63.99  ? 129 LYS E CA  1 
ATOM   9547  C C   . LYS E 1 149 ? -35.784 11.820  -30.214 1.00 59.67  ? 129 LYS E C   1 
ATOM   9548  O O   . LYS E 1 149 ? -35.893 12.866  -30.836 1.00 57.64  ? 129 LYS E O   1 
ATOM   9549  C CB  . LYS E 1 149 ? -35.902 10.424  -32.280 1.00 70.97  ? 129 LYS E CB  1 
ATOM   9550  C CG  . LYS E 1 149 ? -35.277 9.294   -33.087 1.00 78.86  ? 129 LYS E CG  1 
ATOM   9551  C CD  . LYS E 1 149 ? -34.990 9.716   -34.526 1.00 87.40  ? 129 LYS E CD  1 
ATOM   9552  C CE  . LYS E 1 149 ? -33.529 9.507   -34.938 1.00 92.01  ? 129 LYS E CE  1 
ATOM   9553  N NZ  . LYS E 1 149 ? -32.495 9.742   -33.880 1.00 93.81  ? 129 LYS E NZ  1 
ATOM   9554  N N   . ARG E 1 150 ? -36.071 11.707  -28.922 1.00 60.66  ? 130 ARG E N   1 
ATOM   9555  C CA  . ARG E 1 150 ? -36.500 12.841  -28.126 1.00 60.13  ? 130 ARG E CA  1 
ATOM   9556  C C   . ARG E 1 150 ? -35.812 12.814  -26.768 1.00 59.20  ? 130 ARG E C   1 
ATOM   9557  O O   . ARG E 1 150 ? -36.463 12.890  -25.728 1.00 56.95  ? 130 ARG E O   1 
ATOM   9558  C CB  . ARG E 1 150 ? -38.002 12.768  -27.928 1.00 61.82  ? 130 ARG E CB  1 
ATOM   9559  C CG  . ARG E 1 150 ? -38.424 11.541  -27.135 1.00 62.47  ? 130 ARG E CG  1 
ATOM   9560  C CD  . ARG E 1 150 ? -39.863 11.654  -26.713 1.00 61.06  ? 130 ARG E CD  1 
ATOM   9561  N NE  . ARG E 1 150 ? -40.712 10.964  -27.662 1.00 62.25  ? 130 ARG E NE  1 
ATOM   9562  C CZ  . ARG E 1 150 ? -41.997 11.228  -27.861 1.00 64.07  ? 130 ARG E CZ  1 
ATOM   9563  N NH1 . ARG E 1 150 ? -42.610 12.194  -27.181 1.00 64.92  ? 130 ARG E NH1 1 
ATOM   9564  N NH2 . ARG E 1 150 ? -42.674 10.518  -28.754 1.00 62.21  ? 130 ARG E NH2 1 
ATOM   9565  N N   . PRO E 1 151 ? -34.482 12.727  -26.766 1.00 58.77  ? 131 PRO E N   1 
ATOM   9566  C CA  . PRO E 1 151 ? -33.745 12.628  -25.506 1.00 57.79  ? 131 PRO E CA  1 
ATOM   9567  C C   . PRO E 1 151 ? -33.916 13.851  -24.616 1.00 55.19  ? 131 PRO E C   1 
ATOM   9568  O O   . PRO E 1 151 ? -33.731 13.758  -23.401 1.00 57.62  ? 131 PRO E O   1 
ATOM   9569  C CB  . PRO E 1 151 ? -32.288 12.502  -25.960 1.00 58.11  ? 131 PRO E CB  1 
ATOM   9570  C CG  . PRO E 1 151 ? -32.259 13.118  -27.321 1.00 57.42  ? 131 PRO E CG  1 
ATOM   9571  C CD  . PRO E 1 151 ? -33.585 12.806  -27.929 1.00 57.89  ? 131 PRO E CD  1 
ATOM   9572  N N   . ASP E 1 152 ? -34.259 14.983  -25.228 1.00 53.35  ? 132 ASP E N   1 
ATOM   9573  C CA  . ASP E 1 152 ? -34.615 16.202  -24.493 1.00 53.02  ? 132 ASP E CA  1 
ATOM   9574  C C   . ASP E 1 152 ? -35.823 16.000  -23.610 1.00 48.94  ? 132 ASP E C   1 
ATOM   9575  O O   . ASP E 1 152 ? -36.016 16.738  -22.650 1.00 44.48  ? 132 ASP E O   1 
ATOM   9576  C CB  . ASP E 1 152 ? -34.915 17.358  -25.458 1.00 56.70  ? 132 ASP E CB  1 
ATOM   9577  C CG  . ASP E 1 152 ? -36.033 17.028  -26.454 1.00 58.75  ? 132 ASP E CG  1 
ATOM   9578  O OD1 . ASP E 1 152 ? -35.921 16.009  -27.178 1.00 62.97  ? 132 ASP E OD1 1 
ATOM   9579  O OD2 . ASP E 1 152 ? -37.012 17.796  -26.516 1.00 54.54  ? 132 ASP E OD2 1 
ATOM   9580  N N   . LYS E 1 153 ? -36.633 15.004  -23.954 1.00 50.01  ? 133 LYS E N   1 
ATOM   9581  C CA  . LYS E 1 153 ? -37.851 14.698  -23.227 1.00 55.12  ? 133 LYS E CA  1 
ATOM   9582  C C   . LYS E 1 153 ? -37.801 13.367  -22.514 1.00 52.99  ? 133 LYS E C   1 
ATOM   9583  O O   . LYS E 1 153 ? -38.837 12.762  -22.242 1.00 55.82  ? 133 LYS E O   1 
ATOM   9584  C CB  . LYS E 1 153 ? -39.020 14.692  -24.197 1.00 60.35  ? 133 LYS E CB  1 
ATOM   9585  C CG  . LYS E 1 153 ? -39.482 16.079  -24.538 1.00 62.96  ? 133 LYS E CG  1 
ATOM   9586  C CD  . LYS E 1 153 ? -40.433 16.036  -25.703 1.00 67.03  ? 133 LYS E CD  1 
ATOM   9587  C CE  . LYS E 1 153 ? -41.071 17.396  -25.913 1.00 69.66  ? 133 LYS E CE  1 
ATOM   9588  N NZ  . LYS E 1 153 ? -41.999 17.760  -24.805 1.00 71.78  ? 133 LYS E NZ  1 
ATOM   9589  N N   . VAL E 1 154 ? -36.604 12.904  -22.206 1.00 50.58  ? 134 VAL E N   1 
ATOM   9590  C CA  . VAL E 1 154 ? -36.465 11.711  -21.415 1.00 46.28  ? 134 VAL E CA  1 
ATOM   9591  C C   . VAL E 1 154 ? -35.849 12.115  -20.103 1.00 44.67  ? 134 VAL E C   1 
ATOM   9592  O O   . VAL E 1 154 ? -34.987 12.990  -20.046 1.00 44.27  ? 134 VAL E O   1 
ATOM   9593  C CB  . VAL E 1 154 ? -35.581 10.702  -22.096 1.00 47.44  ? 134 VAL E CB  1 
ATOM   9594  C CG1 . VAL E 1 154 ? -35.549 9.431   -21.284 1.00 49.81  ? 134 VAL E CG1 1 
ATOM   9595  C CG2 . VAL E 1 154 ? -36.118 10.417  -23.479 1.00 50.11  ? 134 VAL E CG2 1 
ATOM   9596  N N   . ILE E 1 155 ? -36.311 11.499  -19.035 1.00 42.16  ? 135 ILE E N   1 
ATOM   9597  C CA  . ILE E 1 155 ? -35.897 11.935  -17.740 1.00 42.64  ? 135 ILE E CA  1 
ATOM   9598  C C   . ILE E 1 155 ? -36.110 10.821  -16.744 1.00 43.74  ? 135 ILE E C   1 
ATOM   9599  O O   . ILE E 1 155 ? -36.732 9.807   -17.053 1.00 43.99  ? 135 ILE E O   1 
ATOM   9600  C CB  . ILE E 1 155 ? -36.696 13.179  -17.342 1.00 43.03  ? 135 ILE E CB  1 
ATOM   9601  C CG1 . ILE E 1 155 ? -36.065 13.883  -16.152 1.00 44.10  ? 135 ILE E CG1 1 
ATOM   9602  C CG2 . ILE E 1 155 ? -38.111 12.800  -17.001 1.00 45.15  ? 135 ILE E CG2 1 
ATOM   9603  C CD1 . ILE E 1 155 ? -36.661 15.241  -15.893 1.00 45.34  ? 135 ILE E CD1 1 
ATOM   9604  N N   . GLY E 1 156 ? -35.560 11.002  -15.553 1.00 43.38  ? 136 GLY E N   1 
ATOM   9605  C CA  . GLY E 1 156 ? -35.769 10.057  -14.485 1.00 42.27  ? 136 GLY E CA  1 
ATOM   9606  C C   . GLY E 1 156 ? -36.694 10.661  -13.460 1.00 45.36  ? 136 GLY E C   1 
ATOM   9607  O O   . GLY E 1 156 ? -36.569 11.856  -13.127 1.00 43.89  ? 136 GLY E O   1 
ATOM   9608  N N   . MET E 1 157 ? -37.625 9.843   -12.969 1.00 44.68  ? 137 MET E N   1 
ATOM   9609  C CA  . MET E 1 157 ? -38.498 10.225  -11.866 1.00 45.71  ? 137 MET E CA  1 
ATOM   9610  C C   . MET E 1 157 ? -38.437 9.144   -10.832 1.00 43.91  ? 137 MET E C   1 
ATOM   9611  O O   . MET E 1 157 ? -39.184 8.176   -10.886 1.00 43.48  ? 137 MET E O   1 
ATOM   9612  C CB  . MET E 1 157 ? -39.929 10.329  -12.334 1.00 50.19  ? 137 MET E CB  1 
ATOM   9613  C CG  . MET E 1 157 ? -40.309 11.669  -12.893 1.00 52.92  ? 137 MET E CG  1 
ATOM   9614  S SD  . MET E 1 157 ? -42.085 11.689  -13.197 1.00 58.78  ? 137 MET E SD  1 
ATOM   9615  C CE  . MET E 1 157 ? -42.684 12.168  -11.570 1.00 56.33  ? 137 MET E CE  1 
ATOM   9616  N N   . HIS E 1 158 ? -37.548 9.303   -9.881  1.00 43.49  ? 138 HIS E N   1 
ATOM   9617  C CA  . HIS E 1 158 ? -37.274 8.224   -8.980  1.00 44.20  ? 138 HIS E CA  1 
ATOM   9618  C C   . HIS E 1 158 ? -38.139 8.354   -7.761  1.00 47.09  ? 138 HIS E C   1 
ATOM   9619  O O   . HIS E 1 158 ? -37.932 9.248   -6.950  1.00 44.62  ? 138 HIS E O   1 
ATOM   9620  C CB  . HIS E 1 158 ? -35.813 8.254   -8.585  1.00 45.14  ? 138 HIS E CB  1 
ATOM   9621  C CG  . HIS E 1 158 ? -35.394 7.092   -7.751  1.00 46.02  ? 138 HIS E CG  1 
ATOM   9622  N ND1 . HIS E 1 158 ? -34.692 7.237   -6.573  1.00 45.94  ? 138 HIS E ND1 1 
ATOM   9623  C CD2 . HIS E 1 158 ? -35.576 5.761   -7.925  1.00 47.49  ? 138 HIS E CD2 1 
ATOM   9624  C CE1 . HIS E 1 158 ? -34.453 6.042   -6.061  1.00 47.53  ? 138 HIS E CE1 1 
ATOM   9625  N NE2 . HIS E 1 158 ? -34.982 5.129   -6.858  1.00 48.47  ? 138 HIS E NE2 1 
ATOM   9626  N N   . PHE E 1 159 ? -39.100 7.447   -7.630  1.00 51.04  ? 139 PHE E N   1 
ATOM   9627  C CA  . PHE E 1 159 ? -39.998 7.440   -6.485  1.00 51.29  ? 139 PHE E CA  1 
ATOM   9628  C C   . PHE E 1 159 ? -39.391 6.656   -5.333  1.00 52.12  ? 139 PHE E C   1 
ATOM   9629  O O   . PHE E 1 159 ? -38.319 6.074   -5.460  1.00 54.10  ? 139 PHE E O   1 
ATOM   9630  C CB  . PHE E 1 159 ? -41.358 6.865   -6.894  1.00 51.09  ? 139 PHE E CB  1 
ATOM   9631  C CG  . PHE E 1 159 ? -42.154 7.797   -7.746  1.00 50.61  ? 139 PHE E CG  1 
ATOM   9632  C CD1 . PHE E 1 159 ? -41.920 7.872   -9.105  1.00 51.72  ? 139 PHE E CD1 1 
ATOM   9633  C CD2 . PHE E 1 159 ? -43.107 8.624   -7.184  1.00 50.89  ? 139 PHE E CD2 1 
ATOM   9634  C CE1 . PHE E 1 159 ? -42.632 8.745   -9.900  1.00 51.51  ? 139 PHE E CE1 1 
ATOM   9635  C CE2 . PHE E 1 159 ? -43.828 9.497   -7.968  1.00 51.79  ? 139 PHE E CE2 1 
ATOM   9636  C CZ  . PHE E 1 159 ? -43.586 9.564   -9.331  1.00 52.92  ? 139 PHE E CZ  1 
ATOM   9637  N N   . PHE E 1 160 ? -40.080 6.667   -4.202  1.00 52.41  ? 140 PHE E N   1 
ATOM   9638  C CA  . PHE E 1 160 ? -39.629 5.945   -3.040  1.00 53.70  ? 140 PHE E CA  1 
ATOM   9639  C C   . PHE E 1 160 ? -40.759 5.140   -2.467  1.00 59.40  ? 140 PHE E C   1 
ATOM   9640  O O   . PHE E 1 160 ? -41.911 5.572   -2.472  1.00 64.21  ? 140 PHE E O   1 
ATOM   9641  C CB  . PHE E 1 160 ? -39.084 6.906   -2.010  1.00 52.77  ? 140 PHE E CB  1 
ATOM   9642  C CG  . PHE E 1 160 ? -37.734 7.415   -2.361  1.00 54.50  ? 140 PHE E CG  1 
ATOM   9643  C CD1 . PHE E 1 160 ? -37.589 8.409   -3.315  1.00 54.33  ? 140 PHE E CD1 1 
ATOM   9644  C CD2 . PHE E 1 160 ? -36.598 6.865   -1.783  1.00 53.69  ? 140 PHE E CD2 1 
ATOM   9645  C CE1 . PHE E 1 160 ? -36.336 8.874   -3.670  1.00 52.84  ? 140 PHE E CE1 1 
ATOM   9646  C CE2 . PHE E 1 160 ? -35.342 7.331   -2.128  1.00 54.01  ? 140 PHE E CE2 1 
ATOM   9647  C CZ  . PHE E 1 160 ? -35.212 8.338   -3.077  1.00 52.54  ? 140 PHE E CZ  1 
ATOM   9648  N N   . ASN E 1 161 ? -40.401 3.967   -1.961  1.00 63.44  ? 141 ASN E N   1 
ATOM   9649  C CA  . ASN E 1 161 ? -41.357 2.969   -1.523  1.00 61.99  ? 141 ASN E CA  1 
ATOM   9650  C C   . ASN E 1 161 ? -41.798 3.217   -0.080  1.00 58.45  ? 141 ASN E C   1 
ATOM   9651  O O   . ASN E 1 161 ? -40.953 3.334   0.804   1.00 53.57  ? 141 ASN E O   1 
ATOM   9652  C CB  . ASN E 1 161 ? -40.704 1.598   -1.623  1.00 65.83  ? 141 ASN E CB  1 
ATOM   9653  C CG  . ASN E 1 161 ? -41.711 0.472   -1.614  1.00 69.46  ? 141 ASN E CG  1 
ATOM   9654  O OD1 . ASN E 1 161 ? -42.526 0.357   -0.701  1.00 70.66  ? 141 ASN E OD1 1 
ATOM   9655  N ND2 . ASN E 1 161 ? -41.651 -0.379  -2.630  1.00 69.90  ? 141 ASN E ND2 1 
ATOM   9656  N N   . PRO E 1 162 ? -43.107 3.281   0.180   1.00 57.29  ? 142 PRO E N   1 
ATOM   9657  C CA  . PRO E 1 162 ? -44.186 3.128   -0.820  1.00 54.35  ? 142 PRO E CA  1 
ATOM   9658  C C   . PRO E 1 162 ? -44.616 4.441   -1.469  1.00 51.42  ? 142 PRO E C   1 
ATOM   9659  O O   . PRO E 1 162 ? -44.896 5.424   -0.776  1.00 48.75  ? 142 PRO E O   1 
ATOM   9660  C CB  . PRO E 1 162 ? -45.344 2.562   0.010   1.00 54.36  ? 142 PRO E CB  1 
ATOM   9661  C CG  . PRO E 1 162 ? -45.112 3.102   1.377   1.00 54.90  ? 142 PRO E CG  1 
ATOM   9662  C CD  . PRO E 1 162 ? -43.614 3.159   1.559   1.00 55.96  ? 142 PRO E CD  1 
ATOM   9663  N N   . ALA E 1 163 ? -44.716 4.421   -2.793  1.00 50.78  ? 143 ALA E N   1 
ATOM   9664  C CA  . ALA E 1 163 ? -44.904 5.635   -3.602  1.00 54.42  ? 143 ALA E CA  1 
ATOM   9665  C C   . ALA E 1 163 ? -46.072 6.567   -3.248  1.00 60.75  ? 143 ALA E C   1 
ATOM   9666  O O   . ALA E 1 163 ? -45.924 7.775   -3.348  1.00 64.14  ? 143 ALA E O   1 
ATOM   9667  C CB  . ALA E 1 163 ? -45.001 5.256   -5.065  1.00 52.96  ? 143 ALA E CB  1 
ATOM   9668  N N   . PRO E 1 164 ? -47.247 6.019   -2.899  1.00 66.33  ? 144 PRO E N   1 
ATOM   9669  C CA  . PRO E 1 164 ? -48.377 6.891   -2.559  1.00 65.57  ? 144 PRO E CA  1 
ATOM   9670  C C   . PRO E 1 164 ? -48.171 7.703   -1.292  1.00 63.76  ? 144 PRO E C   1 
ATOM   9671  O O   . PRO E 1 164 ? -48.762 8.767   -1.132  1.00 58.74  ? 144 PRO E O   1 
ATOM   9672  C CB  . PRO E 1 164 ? -49.542 5.911   -2.367  1.00 68.46  ? 144 PRO E CB  1 
ATOM   9673  C CG  . PRO E 1 164 ? -48.931 4.554   -2.291  1.00 70.92  ? 144 PRO E CG  1 
ATOM   9674  C CD  . PRO E 1 164 ? -47.689 4.633   -3.114  1.00 69.29  ? 144 PRO E CD  1 
ATOM   9675  N N   . VAL E 1 165 ? -47.329 7.209   -0.405  1.00 61.82  ? 145 VAL E N   1 
ATOM   9676  C CA  . VAL E 1 165 ? -47.118 7.863   0.866   1.00 62.63  ? 145 VAL E CA  1 
ATOM   9677  C C   . VAL E 1 165 ? -45.865 8.742   0.873   1.00 62.87  ? 145 VAL E C   1 
ATOM   9678  O O   . VAL E 1 165 ? -45.871 9.821   1.466   1.00 61.92  ? 145 VAL E O   1 
ATOM   9679  C CB  . VAL E 1 165 ? -47.043 6.802   1.979   1.00 67.35  ? 145 VAL E CB  1 
ATOM   9680  C CG1 . VAL E 1 165 ? -46.669 7.426   3.317   1.00 67.17  ? 145 VAL E CG1 1 
ATOM   9681  C CG2 . VAL E 1 165 ? -48.378 6.078   2.087   1.00 66.78  ? 145 VAL E CG2 1 
ATOM   9682  N N   . MET E 1 166 ? -44.804 8.291   0.208   1.00 64.15  ? 146 MET E N   1 
ATOM   9683  C CA  . MET E 1 166 ? -43.495 8.935   0.313   1.00 60.75  ? 146 MET E CA  1 
ATOM   9684  C C   . MET E 1 166 ? -43.403 10.234  -0.472  1.00 62.21  ? 146 MET E C   1 
ATOM   9685  O O   . MET E 1 166 ? -43.771 10.312  -1.642  1.00 58.98  ? 146 MET E O   1 
ATOM   9686  C CB  . MET E 1 166 ? -42.416 7.987   -0.175  1.00 60.74  ? 146 MET E CB  1 
ATOM   9687  C CG  . MET E 1 166 ? -42.192 6.810   0.748   1.00 59.97  ? 146 MET E CG  1 
ATOM   9688  S SD  . MET E 1 166 ? -41.605 7.332   2.367   1.00 59.52  ? 146 MET E SD  1 
ATOM   9689  C CE  . MET E 1 166 ? -39.846 7.511   2.092   1.00 60.83  ? 146 MET E CE  1 
ATOM   9690  N N   . LYS E 1 167 ? -42.869 11.246  0.185   1.00 63.37  ? 147 LYS E N   1 
ATOM   9691  C CA  . LYS E 1 167 ? -42.873 12.584  -0.358  1.00 65.08  ? 147 LYS E CA  1 
ATOM   9692  C C   . LYS E 1 167 ? -41.815 12.796  -1.439  1.00 59.98  ? 147 LYS E C   1 
ATOM   9693  O O   . LYS E 1 167 ? -42.071 13.466  -2.441  1.00 53.62  ? 147 LYS E O   1 
ATOM   9694  C CB  . LYS E 1 167 ? -42.692 13.586  0.788   1.00 75.03  ? 147 LYS E CB  1 
ATOM   9695  C CG  . LYS E 1 167 ? -43.951 14.373  1.120   1.00 80.78  ? 147 LYS E CG  1 
ATOM   9696  C CD  . LYS E 1 167 ? -43.776 15.852  0.781   1.00 89.09  ? 147 LYS E CD  1 
ATOM   9697  C CE  . LYS E 1 167 ? -45.045 16.491  0.236   1.00 91.58  ? 147 LYS E CE  1 
ATOM   9698  N NZ  . LYS E 1 167 ? -45.337 17.812  0.861   1.00 90.95  ? 147 LYS E NZ  1 
ATOM   9699  N N   . LEU E 1 168 ? -40.635 12.221  -1.240  1.00 55.97  ? 148 LEU E N   1 
ATOM   9700  C CA  . LEU E 1 168 ? -39.508 12.513  -2.106  1.00 52.65  ? 148 LEU E CA  1 
ATOM   9701  C C   . LEU E 1 168 ? -39.640 11.870  -3.484  1.00 51.61  ? 148 LEU E C   1 
ATOM   9702  O O   . LEU E 1 168 ? -40.169 10.767  -3.640  1.00 51.60  ? 148 LEU E O   1 
ATOM   9703  C CB  . LEU E 1 168 ? -38.215 12.070  -1.434  1.00 51.07  ? 148 LEU E CB  1 
ATOM   9704  C CG  . LEU E 1 168 ? -36.893 12.413  -2.110  1.00 50.70  ? 148 LEU E CG  1 
ATOM   9705  C CD1 . LEU E 1 168 ? -36.724 13.915  -2.220  1.00 54.16  ? 148 LEU E CD1 1 
ATOM   9706  C CD2 . LEU E 1 168 ? -35.748 11.832  -1.306  1.00 50.28  ? 148 LEU E CD2 1 
ATOM   9707  N N   . VAL E 1 169 ? -39.204 12.619  -4.485  1.00 53.07  ? 149 VAL E N   1 
ATOM   9708  C CA  . VAL E 1 169 ? -38.859 12.059  -5.778  1.00 51.67  ? 149 VAL E CA  1 
ATOM   9709  C C   . VAL E 1 169 ? -37.587 12.753  -6.204  1.00 50.04  ? 149 VAL E C   1 
ATOM   9710  O O   . VAL E 1 169 ? -37.468 13.974  -6.131  1.00 47.11  ? 149 VAL E O   1 
ATOM   9711  C CB  . VAL E 1 169 ? -39.978 12.170  -6.837  1.00 51.49  ? 149 VAL E CB  1 
ATOM   9712  C CG1 . VAL E 1 169 ? -41.164 12.925  -6.294  1.00 54.10  ? 149 VAL E CG1 1 
ATOM   9713  C CG2 . VAL E 1 169 ? -39.488 12.803  -8.121  1.00 50.51  ? 149 VAL E CG2 1 
ATOM   9714  N N   . GLU E 1 170 ? -36.616 11.942  -6.579  1.00 46.35  ? 150 GLU E N   1 
ATOM   9715  C CA  . GLU E 1 170 ? -35.416 12.434  -7.170  1.00 44.34  ? 150 GLU E CA  1 
ATOM   9716  C C   . GLU E 1 170 ? -35.725 12.499  -8.646  1.00 44.71  ? 150 GLU E C   1 
ATOM   9717  O O   . GLU E 1 170 ? -36.020 11.484  -9.281  1.00 44.55  ? 150 GLU E O   1 
ATOM   9718  C CB  . GLU E 1 170 ? -34.272 11.473  -6.907  1.00 44.99  ? 150 GLU E CB  1 
ATOM   9719  C CG  . GLU E 1 170 ? -33.699 11.546  -5.507  1.00 46.09  ? 150 GLU E CG  1 
ATOM   9720  C CD  . GLU E 1 170 ? -32.732 10.406  -5.220  1.00 46.60  ? 150 GLU E CD  1 
ATOM   9721  O OE1 . GLU E 1 170 ? -33.040 9.249   -5.589  1.00 47.16  ? 150 GLU E OE1 1 
ATOM   9722  O OE2 . GLU E 1 170 ? -31.668 10.657  -4.622  1.00 43.44  ? 150 GLU E OE2 1 
ATOM   9723  N N   . VAL E 1 171 ? -35.698 13.696  -9.197  1.00 43.24  ? 151 VAL E N   1 
ATOM   9724  C CA  . VAL E 1 171 ? -35.908 13.841  -10.615 1.00 42.27  ? 151 VAL E CA  1 
ATOM   9725  C C   . VAL E 1 171 ? -34.539 13.809  -11.236 1.00 41.36  ? 151 VAL E C   1 
ATOM   9726  O O   . VAL E 1 171 ? -33.715 14.672  -10.958 1.00 42.11  ? 151 VAL E O   1 
ATOM   9727  C CB  . VAL E 1 171 ? -36.567 15.186  -10.950 1.00 44.87  ? 151 VAL E CB  1 
ATOM   9728  C CG1 . VAL E 1 171 ? -36.658 15.369  -12.449 1.00 44.03  ? 151 VAL E CG1 1 
ATOM   9729  C CG2 . VAL E 1 171 ? -37.956 15.260  -10.349 1.00 45.44  ? 151 VAL E CG2 1 
ATOM   9730  N N   . ILE E 1 172 ? -34.291 12.826  -12.082 1.00 41.00  ? 152 ILE E N   1 
ATOM   9731  C CA  . ILE E 1 172 ? -32.950 12.625  -12.590 1.00 40.42  ? 152 ILE E CA  1 
ATOM   9732  C C   . ILE E 1 172 ? -32.813 13.136  -13.986 1.00 39.41  ? 152 ILE E C   1 
ATOM   9733  O O   . ILE E 1 172 ? -33.473 12.666  -14.896 1.00 40.14  ? 152 ILE E O   1 
ATOM   9734  C CB  . ILE E 1 172 ? -32.555 11.151  -12.598 1.00 42.38  ? 152 ILE E CB  1 
ATOM   9735  C CG1 . ILE E 1 172 ? -32.985 10.478  -11.296 1.00 41.56  ? 152 ILE E CG1 1 
ATOM   9736  C CG2 . ILE E 1 172 ? -31.052 11.045  -12.796 1.00 43.21  ? 152 ILE E CG2 1 
ATOM   9737  C CD1 . ILE E 1 172 ? -32.470 11.186  -10.067 1.00 43.12  ? 152 ILE E CD1 1 
ATOM   9738  N N   . ARG E 1 173 ? -31.928 14.089  -14.164 1.00 40.76  ? 153 ARG E N   1 
ATOM   9739  C CA  . ARG E 1 173 ? -31.745 14.670  -15.472 1.00 41.79  ? 153 ARG E CA  1 
ATOM   9740  C C   . ARG E 1 173 ? -30.668 13.960  -16.211 1.00 41.79  ? 153 ARG E C   1 
ATOM   9741  O O   . ARG E 1 173 ? -29.547 13.854  -15.734 1.00 42.89  ? 153 ARG E O   1 
ATOM   9742  C CB  . ARG E 1 173 ? -31.354 16.114  -15.346 1.00 42.28  ? 153 ARG E CB  1 
ATOM   9743  C CG  . ARG E 1 173 ? -32.555 16.996  -15.143 1.00 43.75  ? 153 ARG E CG  1 
ATOM   9744  C CD  . ARG E 1 173 ? -32.109 18.397  -14.885 1.00 41.61  ? 153 ARG E CD  1 
ATOM   9745  N NE  . ARG E 1 173 ? -31.878 19.086  -16.137 1.00 40.64  ? 153 ARG E NE  1 
ATOM   9746  C CZ  . ARG E 1 173 ? -31.929 20.403  -16.246 1.00 41.12  ? 153 ARG E CZ  1 
ATOM   9747  N NH1 . ARG E 1 173 ? -32.205 21.147  -15.181 1.00 41.44  ? 153 ARG E NH1 1 
ATOM   9748  N NH2 . ARG E 1 173 ? -31.723 20.979  -17.410 1.00 39.54  ? 153 ARG E NH2 1 
ATOM   9749  N N   . GLY E 1 174 ? -31.002 13.475  -17.395 1.00 42.59  ? 154 GLY E N   1 
ATOM   9750  C CA  . GLY E 1 174 ? -29.988 12.978  -18.282 1.00 41.29  ? 154 GLY E CA  1 
ATOM   9751  C C   . GLY E 1 174 ? -29.218 14.177  -18.791 1.00 42.59  ? 154 GLY E C   1 
ATOM   9752  O O   . GLY E 1 174 ? -29.641 15.317  -18.645 1.00 43.53  ? 154 GLY E O   1 
ATOM   9753  N N   . ILE E 1 175 ? -28.078 13.922  -19.394 1.00 42.91  ? 155 ILE E N   1 
ATOM   9754  C CA  . ILE E 1 175 ? -27.274 15.001  -19.877 1.00 42.62  ? 155 ILE E CA  1 
ATOM   9755  C C   . ILE E 1 175 ? -28.013 15.757  -20.979 1.00 43.24  ? 155 ILE E C   1 
ATOM   9756  O O   . ILE E 1 175 ? -27.714 16.910  -21.224 1.00 44.41  ? 155 ILE E O   1 
ATOM   9757  C CB  . ILE E 1 175 ? -25.905 14.488  -20.358 1.00 43.31  ? 155 ILE E CB  1 
ATOM   9758  C CG1 . ILE E 1 175 ? -24.886 15.631  -20.299 1.00 42.44  ? 155 ILE E CG1 1 
ATOM   9759  C CG2 . ILE E 1 175 ? -26.018 13.844  -21.737 1.00 43.17  ? 155 ILE E CG2 1 
ATOM   9760  C CD1 . ILE E 1 175 ? -23.525 15.292  -20.854 1.00 43.13  ? 155 ILE E CD1 1 
ATOM   9761  N N   . ALA E 1 176 ? -28.988 15.114  -21.622 1.00 45.06  ? 156 ALA E N   1 
ATOM   9762  C CA  . ALA E 1 176 ? -29.736 15.729  -22.735 1.00 46.77  ? 156 ALA E CA  1 
ATOM   9763  C C   . ALA E 1 176 ? -31.120 16.247  -22.351 1.00 48.16  ? 156 ALA E C   1 
ATOM   9764  O O   . ALA E 1 176 ? -31.777 16.899  -23.159 1.00 50.89  ? 156 ALA E O   1 
ATOM   9765  C CB  . ALA E 1 176 ? -29.875 14.735  -23.865 1.00 45.00  ? 156 ALA E CB  1 
ATOM   9766  N N   . THR E 1 177 ? -31.553 15.939  -21.133 1.00 48.31  ? 157 THR E N   1 
ATOM   9767  C CA  . THR E 1 177 ? -32.829 16.393  -20.606 1.00 48.23  ? 157 THR E CA  1 
ATOM   9768  C C   . THR E 1 177 ? -32.920 17.915  -20.595 1.00 50.71  ? 157 THR E C   1 
ATOM   9769  O O   . THR E 1 177 ? -32.116 18.592  -19.949 1.00 50.69  ? 157 THR E O   1 
ATOM   9770  C CB  . THR E 1 177 ? -33.013 15.882  -19.176 1.00 47.56  ? 157 THR E CB  1 
ATOM   9771  O OG1 . THR E 1 177 ? -33.007 14.451  -19.187 1.00 45.28  ? 157 THR E OG1 1 
ATOM   9772  C CG2 . THR E 1 177 ? -34.320 16.397  -18.568 1.00 48.08  ? 157 THR E CG2 1 
ATOM   9773  N N   . SER E 1 178 ? -33.935 18.429  -21.287 1.00 51.98  ? 158 SER E N   1 
ATOM   9774  C CA  . SER E 1 178 ? -34.134 19.863  -21.452 1.00 51.67  ? 158 SER E CA  1 
ATOM   9775  C C   . SER E 1 178 ? -34.631 20.485  -20.171 1.00 51.20  ? 158 SER E C   1 
ATOM   9776  O O   . SER E 1 178 ? -35.169 19.786  -19.311 1.00 48.59  ? 158 SER E O   1 
ATOM   9777  C CB  . SER E 1 178 ? -35.147 20.130  -22.577 1.00 52.24  ? 158 SER E CB  1 
ATOM   9778  O OG  . SER E 1 178 ? -36.497 19.974  -22.149 1.00 50.54  ? 158 SER E OG  1 
ATOM   9779  N N   . GLN E 1 179 ? -34.475 21.799  -20.050 1.00 53.97  ? 159 GLN E N   1 
ATOM   9780  C CA  . GLN E 1 179 ? -35.059 22.510  -18.908 1.00 55.28  ? 159 GLN E CA  1 
ATOM   9781  C C   . GLN E 1 179 ? -36.590 22.489  -18.921 1.00 56.48  ? 159 GLN E C   1 
ATOM   9782  O O   . GLN E 1 179 ? -37.229 22.361  -17.880 1.00 54.95  ? 159 GLN E O   1 
ATOM   9783  C CB  . GLN E 1 179 ? -34.609 23.953  -18.875 1.00 54.89  ? 159 GLN E CB  1 
ATOM   9784  C CG  . GLN E 1 179 ? -34.948 24.635  -17.560 1.00 55.03  ? 159 GLN E CG  1 
ATOM   9785  C CD  . GLN E 1 179 ? -33.980 24.257  -16.467 1.00 54.17  ? 159 GLN E CD  1 
ATOM   9786  O OE1 . GLN E 1 179 ? -32.821 23.933  -16.738 1.00 58.20  ? 159 GLN E OE1 1 
ATOM   9787  N NE2 . GLN E 1 179 ? -34.441 24.293  -15.230 1.00 47.24  ? 159 GLN E NE2 1 
ATOM   9788  N N   . GLU E 1 180 ? -37.174 22.633  -20.100 1.00 61.46  ? 160 GLU E N   1 
ATOM   9789  C CA  . GLU E 1 180 ? -38.624 22.549  -20.218 1.00 65.04  ? 160 GLU E CA  1 
ATOM   9790  C C   . GLU E 1 180 ? -39.116 21.251  -19.611 1.00 57.69  ? 160 GLU E C   1 
ATOM   9791  O O   . GLU E 1 180 ? -40.072 21.244  -18.851 1.00 57.43  ? 160 GLU E O   1 
ATOM   9792  C CB  . GLU E 1 180 ? -39.063 22.630  -21.677 1.00 72.46  ? 160 GLU E CB  1 
ATOM   9793  C CG  . GLU E 1 180 ? -39.081 24.049  -22.224 1.00 81.44  ? 160 GLU E CG  1 
ATOM   9794  C CD  . GLU E 1 180 ? -39.734 24.143  -23.597 1.00 88.97  ? 160 GLU E CD  1 
ATOM   9795  O OE1 . GLU E 1 180 ? -40.647 23.333  -23.898 1.00 94.92  ? 160 GLU E OE1 1 
ATOM   9796  O OE2 . GLU E 1 180 ? -39.334 25.031  -24.384 1.00 88.05  ? 160 GLU E OE2 1 
ATOM   9797  N N   . THR E 1 181 ? -38.444 20.158  -19.944 1.00 53.30  ? 161 THR E N   1 
ATOM   9798  C CA  . THR E 1 181 ? -38.837 18.846  -19.461 1.00 49.88  ? 161 THR E CA  1 
ATOM   9799  C C   . THR E 1 181 ? -38.673 18.757  -17.958 1.00 49.15  ? 161 THR E C   1 
ATOM   9800  O O   . THR E 1 181 ? -39.603 18.367  -17.254 1.00 45.53  ? 161 THR E O   1 
ATOM   9801  C CB  . THR E 1 181 ? -37.993 17.768  -20.131 1.00 52.30  ? 161 THR E CB  1 
ATOM   9802  O OG1 . THR E 1 181 ? -38.116 17.910  -21.552 1.00 51.78  ? 161 THR E OG1 1 
ATOM   9803  C CG2 . THR E 1 181 ? -38.441 16.373  -19.715 1.00 51.48  ? 161 THR E CG2 1 
ATOM   9804  N N   . PHE E 1 182 ? -37.502 19.139  -17.458 1.00 47.81  ? 162 PHE E N   1 
ATOM   9805  C CA  . PHE E 1 182 ? -37.303 19.143  -16.019 1.00 47.61  ? 162 PHE E CA  1 
ATOM   9806  C C   . PHE E 1 182 ? -38.408 19.924  -15.310 1.00 47.93  ? 162 PHE E C   1 
ATOM   9807  O O   . PHE E 1 182 ? -39.035 19.422  -14.375 1.00 50.53  ? 162 PHE E O   1 
ATOM   9808  C CB  . PHE E 1 182 ? -35.961 19.744  -15.608 1.00 45.46  ? 162 PHE E CB  1 
ATOM   9809  C CG  . PHE E 1 182 ? -35.875 19.963  -14.134 1.00 43.93  ? 162 PHE E CG  1 
ATOM   9810  C CD1 . PHE E 1 182 ? -35.826 18.886  -13.284 1.00 42.78  ? 162 PHE E CD1 1 
ATOM   9811  C CD2 . PHE E 1 182 ? -35.952 21.236  -13.592 1.00 47.91  ? 162 PHE E CD2 1 
ATOM   9812  C CE1 . PHE E 1 182 ? -35.798 19.067  -11.916 1.00 43.84  ? 162 PHE E CE1 1 
ATOM   9813  C CE2 . PHE E 1 182 ? -35.915 21.432  -12.220 1.00 47.68  ? 162 PHE E CE2 1 
ATOM   9814  C CZ  . PHE E 1 182 ? -35.839 20.341  -11.379 1.00 45.41  ? 162 PHE E CZ  1 
ATOM   9815  N N   . ASP E 1 183 ? -38.605 21.159  -15.749 1.00 49.37  ? 163 ASP E N   1 
ATOM   9816  C CA  . ASP E 1 183 ? -39.600 22.057  -15.153 1.00 55.44  ? 163 ASP E CA  1 
ATOM   9817  C C   . ASP E 1 183 ? -41.022 21.490  -15.121 1.00 52.53  ? 163 ASP E C   1 
ATOM   9818  O O   . ASP E 1 183 ? -41.719 21.599  -14.113 1.00 52.68  ? 163 ASP E O   1 
ATOM   9819  C CB  . ASP E 1 183 ? -39.598 23.415  -15.871 1.00 59.71  ? 163 ASP E CB  1 
ATOM   9820  C CG  . ASP E 1 183 ? -38.453 24.325  -15.412 1.00 63.13  ? 163 ASP E CG  1 
ATOM   9821  O OD1 . ASP E 1 183 ? -37.893 24.114  -14.306 1.00 68.66  ? 163 ASP E OD1 1 
ATOM   9822  O OD2 . ASP E 1 183 ? -38.119 25.266  -16.158 1.00 62.17  ? 163 ASP E OD2 1 
ATOM   9823  N N   . ALA E 1 184 ? -41.442 20.859  -16.202 1.00 51.19  ? 164 ALA E N   1 
ATOM   9824  C CA  . ALA E 1 184 ? -42.777 20.286  -16.247 1.00 53.58  ? 164 ALA E CA  1 
ATOM   9825  C C   . ALA E 1 184 ? -42.934 19.101  -15.310 1.00 55.13  ? 164 ALA E C   1 
ATOM   9826  O O   . ALA E 1 184 ? -43.975 18.938  -14.675 1.00 54.18  ? 164 ALA E O   1 
ATOM   9827  C CB  . ALA E 1 184 ? -43.102 19.865  -17.656 1.00 56.56  ? 164 ALA E CB  1 
ATOM   9828  N N   . VAL E 1 185 ? -41.904 18.262  -15.253 1.00 56.02  ? 165 VAL E N   1 
ATOM   9829  C CA  . VAL E 1 185 ? -41.904 17.098  -14.379 1.00 53.25  ? 165 VAL E CA  1 
ATOM   9830  C C   . VAL E 1 185 ? -41.837 17.525  -12.928 1.00 52.87  ? 165 VAL E C   1 
ATOM   9831  O O   . VAL E 1 185 ? -42.403 16.888  -12.048 1.00 51.83  ? 165 VAL E O   1 
ATOM   9832  C CB  . VAL E 1 185 ? -40.709 16.191  -14.692 1.00 55.35  ? 165 VAL E CB  1 
ATOM   9833  C CG1 . VAL E 1 185 ? -40.493 15.145  -13.600 1.00 55.43  ? 165 VAL E CG1 1 
ATOM   9834  C CG2 . VAL E 1 185 ? -40.927 15.516  -16.032 1.00 54.19  ? 165 VAL E CG2 1 
ATOM   9835  N N   . LYS E 1 186 ? -41.131 18.611  -12.680 1.00 55.64  ? 166 LYS E N   1 
ATOM   9836  C CA  . LYS E 1 186 ? -41.037 19.134  -11.332 1.00 56.14  ? 166 LYS E CA  1 
ATOM   9837  C C   . LYS E 1 186 ? -42.381 19.661  -10.876 1.00 57.90  ? 166 LYS E C   1 
ATOM   9838  O O   . LYS E 1 186 ? -42.785 19.486  -9.725  1.00 55.91  ? 166 LYS E O   1 
ATOM   9839  C CB  . LYS E 1 186 ? -40.039 20.263  -11.295 1.00 53.35  ? 166 LYS E CB  1 
ATOM   9840  C CG  . LYS E 1 186 ? -40.112 21.050  -10.015 1.00 54.22  ? 166 LYS E CG  1 
ATOM   9841  C CD  . LYS E 1 186 ? -39.137 22.199  -10.055 1.00 55.97  ? 166 LYS E CD  1 
ATOM   9842  C CE  . LYS E 1 186 ? -39.065 22.860  -8.698  1.00 59.23  ? 166 LYS E CE  1 
ATOM   9843  N NZ  . LYS E 1 186 ? -37.935 23.822  -8.654  1.00 62.35  ? 166 LYS E NZ  1 
ATOM   9844  N N   . GLU E 1 187 ? -43.049 20.337  -11.798 1.00 63.73  ? 167 GLU E N   1 
ATOM   9845  C CA  . GLU E 1 187 ? -44.368 20.903  -11.545 1.00 68.66  ? 167 GLU E CA  1 
ATOM   9846  C C   . GLU E 1 187 ? -45.357 19.825  -11.183 1.00 62.20  ? 167 GLU E C   1 
ATOM   9847  O O   . GLU E 1 187 ? -46.061 19.902  -10.181 1.00 54.09  ? 167 GLU E O   1 
ATOM   9848  C CB  . GLU E 1 187 ? -44.888 21.577  -12.803 1.00 77.14  ? 167 GLU E CB  1 
ATOM   9849  C CG  . GLU E 1 187 ? -44.550 23.043  -12.911 1.00 83.77  ? 167 GLU E CG  1 
ATOM   9850  C CD  . GLU E 1 187 ? -45.074 23.627  -14.203 1.00 91.54  ? 167 GLU E CD  1 
ATOM   9851  O OE1 . GLU E 1 187 ? -46.254 23.366  -14.537 1.00 93.98  ? 167 GLU E OE1 1 
ATOM   9852  O OE2 . GLU E 1 187 ? -44.305 24.335  -14.890 1.00 96.24  ? 167 GLU E OE2 1 
ATOM   9853  N N   . THR E 1 188 ? -45.408 18.827  -12.047 1.00 58.18  ? 168 THR E N   1 
ATOM   9854  C CA  . THR E 1 188 ? -46.279 17.696  -11.859 1.00 57.95  ? 168 THR E CA  1 
ATOM   9855  C C   . THR E 1 188 ? -46.030 17.010  -10.519 1.00 58.32  ? 168 THR E C   1 
ATOM   9856  O O   . THR E 1 188 ? -46.975 16.632  -9.830  1.00 61.66  ? 168 THR E O   1 
ATOM   9857  C CB  . THR E 1 188 ? -46.069 16.692  -12.989 1.00 59.02  ? 168 THR E CB  1 
ATOM   9858  O OG1 . THR E 1 188 ? -46.249 17.354  -14.247 1.00 56.37  ? 168 THR E OG1 1 
ATOM   9859  C CG2 . THR E 1 188 ? -47.048 15.569  -12.883 1.00 60.61  ? 168 THR E CG2 1 
ATOM   9860  N N   . SER E 1 189 ? -44.767 16.856  -10.143 1.00 57.44  ? 169 SER E N   1 
ATOM   9861  C CA  . SER E 1 189 ? -44.439 16.210  -8.874  1.00 55.87  ? 169 SER E CA  1 
ATOM   9862  C C   . SER E 1 189 ? -45.042 16.994  -7.701  1.00 57.45  ? 169 SER E C   1 
ATOM   9863  O O   . SER E 1 189 ? -45.381 16.435  -6.645  1.00 54.84  ? 169 SER E O   1 
ATOM   9864  C CB  . SER E 1 189 ? -42.926 16.084  -8.727  1.00 53.74  ? 169 SER E CB  1 
ATOM   9865  O OG  . SER E 1 189 ? -42.373 15.528  -9.909  1.00 50.91  ? 169 SER E OG  1 
ATOM   9866  N N   . ILE E 1 190 ? -45.200 18.293  -7.898  1.00 57.57  ? 170 ILE E N   1 
ATOM   9867  C CA  . ILE E 1 190 ? -45.817 19.125  -6.880  1.00 60.72  ? 170 ILE E CA  1 
ATOM   9868  C C   . ILE E 1 190 ? -47.345 19.018  -6.936  1.00 60.59  ? 170 ILE E C   1 
ATOM   9869  O O   . ILE E 1 190 ? -47.985 18.807  -5.912  1.00 57.67  ? 170 ILE E O   1 
ATOM   9870  C CB  . ILE E 1 190 ? -45.320 20.569  -7.003  1.00 62.94  ? 170 ILE E CB  1 
ATOM   9871  C CG1 . ILE E 1 190 ? -43.839 20.611  -6.627  1.00 63.92  ? 170 ILE E CG1 1 
ATOM   9872  C CG2 . ILE E 1 190 ? -46.099 21.505  -6.092  1.00 60.27  ? 170 ILE E CG2 1 
ATOM   9873  C CD1 . ILE E 1 190 ? -43.129 21.855  -7.108  1.00 62.73  ? 170 ILE E CD1 1 
ATOM   9874  N N   . ALA E 1 191 ? -47.921 19.111  -8.129  1.00 64.30  ? 171 ALA E N   1 
ATOM   9875  C CA  . ALA E 1 191 ? -49.364 18.889  -8.303  1.00 66.23  ? 171 ALA E CA  1 
ATOM   9876  C C   . ALA E 1 191 ? -49.857 17.648  -7.565  1.00 65.16  ? 171 ALA E C   1 
ATOM   9877  O O   . ALA E 1 191 ? -50.970 17.657  -7.050  1.00 70.53  ? 171 ALA E O   1 
ATOM   9878  C CB  . ALA E 1 191 ? -49.734 18.783  -9.777  1.00 66.43  ? 171 ALA E CB  1 
ATOM   9879  N N   . ILE E 1 192 ? -49.045 16.590  -7.508  1.00 60.89  ? 172 ILE E N   1 
ATOM   9880  C CA  . ILE E 1 192 ? -49.480 15.341  -6.854  1.00 58.53  ? 172 ILE E CA  1 
ATOM   9881  C C   . ILE E 1 192 ? -48.973 15.239  -5.423  1.00 57.74  ? 172 ILE E C   1 
ATOM   9882  O O   . ILE E 1 192 ? -48.983 14.166  -4.816  1.00 55.83  ? 172 ILE E O   1 
ATOM   9883  C CB  . ILE E 1 192 ? -49.078 14.090  -7.648  1.00 56.19  ? 172 ILE E CB  1 
ATOM   9884  C CG1 . ILE E 1 192 ? -47.561 13.940  -7.746  1.00 54.83  ? 172 ILE E CG1 1 
ATOM   9885  C CG2 . ILE E 1 192 ? -49.667 14.158  -9.043  1.00 56.94  ? 172 ILE E CG2 1 
ATOM   9886  C CD1 . ILE E 1 192 ? -47.140 12.524  -8.054  1.00 51.74  ? 172 ILE E CD1 1 
ATOM   9887  N N   . GLY E 1 193 ? -48.515 16.374  -4.912  1.00 55.66  ? 173 GLY E N   1 
ATOM   9888  C CA  . GLY E 1 193 ? -48.204 16.524  -3.510  1.00 57.59  ? 173 GLY E CA  1 
ATOM   9889  C C   . GLY E 1 193 ? -46.859 15.954  -3.140  1.00 60.95  ? 173 GLY E C   1 
ATOM   9890  O O   . GLY E 1 193 ? -46.633 15.618  -1.983  1.00 62.15  ? 173 GLY E O   1 
ATOM   9891  N N   . LYS E 1 194 ? -45.957 15.845  -4.109  1.00 61.26  ? 174 LYS E N   1 
ATOM   9892  C CA  . LYS E 1 194 ? -44.635 15.324  -3.819  1.00 58.01  ? 174 LYS E CA  1 
ATOM   9893  C C   . LYS E 1 194 ? -43.665 16.457  -3.710  1.00 54.36  ? 174 LYS E C   1 
ATOM   9894  O O   . LYS E 1 194 ? -44.004 17.600  -3.992  1.00 60.32  ? 174 LYS E O   1 
ATOM   9895  C CB  . LYS E 1 194 ? -44.194 14.345  -4.892  1.00 58.91  ? 174 LYS E CB  1 
ATOM   9896  C CG  . LYS E 1 194 ? -45.145 13.182  -5.058  1.00 59.27  ? 174 LYS E CG  1 
ATOM   9897  C CD  . LYS E 1 194 ? -44.874 12.107  -4.036  1.00 57.60  ? 174 LYS E CD  1 
ATOM   9898  C CE  . LYS E 1 194 ? -45.578 10.844  -4.464  1.00 56.98  ? 174 LYS E CE  1 
ATOM   9899  N NZ  . LYS E 1 194 ? -45.872 10.018  -3.275  1.00 57.53  ? 174 LYS E NZ  1 
ATOM   9900  N N   . ASP E 1 195 ? -42.455 16.128  -3.284  1.00 54.27  ? 175 ASP E N   1 
ATOM   9901  C CA  . ASP E 1 195 ? -41.415 17.112  -3.100  1.00 52.57  ? 175 ASP E CA  1 
ATOM   9902  C C   . ASP E 1 195 ? -40.161 16.732  -3.878  1.00 53.86  ? 175 ASP E C   1 
ATOM   9903  O O   . ASP E 1 195 ? -39.336 15.950  -3.407  1.00 52.96  ? 175 ASP E O   1 
ATOM   9904  C CB  . ASP E 1 195 ? -41.099 17.238  -1.621  1.00 51.43  ? 175 ASP E CB  1 
ATOM   9905  C CG  . ASP E 1 195 ? -40.599 18.593  -1.269  1.00 52.86  ? 175 ASP E CG  1 
ATOM   9906  O OD1 . ASP E 1 195 ? -40.322 19.384  -2.205  1.00 53.61  ? 175 ASP E OD1 1 
ATOM   9907  O OD2 . ASP E 1 195 ? -40.470 18.874  -0.058  1.00 54.69  ? 175 ASP E OD2 1 
ATOM   9908  N N   . PRO E 1 196 ? -40.011 17.287  -5.082  1.00 55.38  ? 176 PRO E N   1 
ATOM   9909  C CA  . PRO E 1 196 ? -38.932 16.860  -5.966  1.00 53.02  ? 176 PRO E CA  1 
ATOM   9910  C C   . PRO E 1 196 ? -37.632 17.552  -5.687  1.00 48.19  ? 176 PRO E C   1 
ATOM   9911  O O   . PRO E 1 196 ? -37.625 18.719  -5.329  1.00 49.12  ? 176 PRO E O   1 
ATOM   9912  C CB  . PRO E 1 196 ? -39.430 17.278  -7.342  1.00 53.66  ? 176 PRO E CB  1 
ATOM   9913  C CG  . PRO E 1 196 ? -40.269 18.472  -7.064  1.00 55.27  ? 176 PRO E CG  1 
ATOM   9914  C CD  . PRO E 1 196 ? -40.967 18.166  -5.772  1.00 55.28  ? 176 PRO E CD  1 
ATOM   9915  N N   . VAL E 1 197 ? -36.542 16.823  -5.860  1.00 48.07  ? 177 VAL E N   1 
ATOM   9916  C CA  . VAL E 1 197 ? -35.217 17.416  -5.856  1.00 46.79  ? 177 VAL E CA  1 
ATOM   9917  C C   . VAL E 1 197 ? -34.634 17.225  -7.238  1.00 45.99  ? 177 VAL E C   1 
ATOM   9918  O O   . VAL E 1 197 ? -35.041 16.315  -7.965  1.00 42.61  ? 177 VAL E O   1 
ATOM   9919  C CB  . VAL E 1 197 ? -34.302 16.807  -4.788  1.00 47.81  ? 177 VAL E CB  1 
ATOM   9920  C CG1 . VAL E 1 197 ? -34.831 17.144  -3.414  1.00 47.22  ? 177 VAL E CG1 1 
ATOM   9921  C CG2 . VAL E 1 197 ? -34.207 15.302  -4.936  1.00 48.84  ? 177 VAL E CG2 1 
ATOM   9922  N N   . GLU E 1 198 ? -33.698 18.094  -7.601  1.00 46.46  ? 178 GLU E N   1 
ATOM   9923  C CA  . GLU E 1 198 ? -33.052 18.036  -8.914  1.00 47.27  ? 178 GLU E CA  1 
ATOM   9924  C C   . GLU E 1 198 ? -31.706 17.323  -8.860  1.00 45.45  ? 178 GLU E C   1 
ATOM   9925  O O   . GLU E 1 198 ? -30.794 17.740  -8.137  1.00 42.52  ? 178 GLU E O   1 
ATOM   9926  C CB  . GLU E 1 198 ? -32.849 19.439  -9.465  1.00 48.14  ? 178 GLU E CB  1 
ATOM   9927  C CG  . GLU E 1 198 ? -32.447 19.447  -10.923 1.00 49.63  ? 178 GLU E CG  1 
ATOM   9928  C CD  . GLU E 1 198 ? -32.290 20.847  -11.466 1.00 51.57  ? 178 GLU E CD  1 
ATOM   9929  O OE1 . GLU E 1 198 ? -32.573 21.818  -10.735 1.00 56.78  ? 178 GLU E OE1 1 
ATOM   9930  O OE2 . GLU E 1 198 ? -31.889 20.979  -12.631 1.00 49.79  ? 178 GLU E OE2 1 
ATOM   9931  N N   . VAL E 1 199 ? -31.586 16.261  -9.646  1.00 45.10  ? 179 VAL E N   1 
ATOM   9932  C CA  . VAL E 1 199 ? -30.358 15.485  -9.682  1.00 44.22  ? 179 VAL E CA  1 
ATOM   9933  C C   . VAL E 1 199 ? -29.839 15.261  -11.096 1.00 41.59  ? 179 VAL E C   1 
ATOM   9934  O O   . VAL E 1 199 ? -30.566 14.786  -11.973 1.00 37.70  ? 179 VAL E O   1 
ATOM   9935  C CB  . VAL E 1 199 ? -30.563 14.124  -9.013  1.00 46.61  ? 179 VAL E CB  1 
ATOM   9936  C CG1 . VAL E 1 199 ? -29.229 13.459  -8.758  1.00 46.38  ? 179 VAL E CG1 1 
ATOM   9937  C CG2 . VAL E 1 199 ? -31.294 14.301  -7.698  1.00 47.26  ? 179 VAL E CG2 1 
ATOM   9938  N N   . ALA E 1 200 ? -28.573 15.614  -11.303 1.00 39.28  ? 180 ALA E N   1 
ATOM   9939  C CA  . ALA E 1 200 ? -27.855 15.225  -12.519 1.00 40.72  ? 180 ALA E CA  1 
ATOM   9940  C C   . ALA E 1 200 ? -27.499 13.747  -12.413 1.00 42.82  ? 180 ALA E C   1 
ATOM   9941  O O   . ALA E 1 200 ? -27.055 13.288  -11.366 1.00 45.95  ? 180 ALA E O   1 
ATOM   9942  C CB  . ALA E 1 200 ? -26.592 16.039  -12.678 1.00 37.48  ? 180 ALA E CB  1 
ATOM   9943  N N   . GLU E 1 201 ? -27.684 13.002  -13.488 1.00 41.33  ? 181 GLU E N   1 
ATOM   9944  C CA  . GLU E 1 201 ? -27.390 11.577  -13.460 1.00 41.39  ? 181 GLU E CA  1 
ATOM   9945  C C   . GLU E 1 201 ? -25.983 11.287  -12.961 1.00 40.60  ? 181 GLU E C   1 
ATOM   9946  O O   . GLU E 1 201 ? -24.996 11.739  -13.531 1.00 40.28  ? 181 GLU E O   1 
ATOM   9947  C CB  . GLU E 1 201 ? -27.540 10.972  -14.847 1.00 41.41  ? 181 GLU E CB  1 
ATOM   9948  C CG  . GLU E 1 201 ? -27.488 9.462   -14.865 1.00 40.49  ? 181 GLU E CG  1 
ATOM   9949  C CD  . GLU E 1 201 ? -27.299 8.915   -16.262 1.00 40.58  ? 181 GLU E CD  1 
ATOM   9950  O OE1 . GLU E 1 201 ? -28.003 9.386   -17.176 1.00 38.74  ? 181 GLU E OE1 1 
ATOM   9951  O OE2 . GLU E 1 201 ? -26.440 8.023   -16.451 1.00 39.71  ? 181 GLU E OE2 1 
ATOM   9952  N N   . ALA E 1 202 ? -25.930 10.519  -11.888 1.00 40.35  ? 182 ALA E N   1 
ATOM   9953  C CA  . ALA E 1 202 ? -24.708 9.985   -11.363 1.00 39.02  ? 182 ALA E CA  1 
ATOM   9954  C C   . ALA E 1 202 ? -25.089 8.720   -10.599 1.00 39.42  ? 182 ALA E C   1 
ATOM   9955  O O   . ALA E 1 202 ? -26.263 8.496   -10.284 1.00 37.99  ? 182 ALA E O   1 
ATOM   9956  C CB  . ALA E 1 202 ? -24.050 11.000  -10.454 1.00 39.01  ? 182 ALA E CB  1 
ATOM   9957  N N   . PRO E 1 203 ? -24.108 7.875   -10.304 1.00 39.87  ? 183 PRO E N   1 
ATOM   9958  C CA  . PRO E 1 203 ? -24.403 6.587   -9.673  1.00 40.72  ? 183 PRO E CA  1 
ATOM   9959  C C   . PRO E 1 203 ? -25.053 6.732   -8.312  1.00 39.85  ? 183 PRO E C   1 
ATOM   9960  O O   . PRO E 1 203 ? -24.498 7.389   -7.435  1.00 39.98  ? 183 PRO E O   1 
ATOM   9961  C CB  . PRO E 1 203 ? -23.020 5.963   -9.494  1.00 42.53  ? 183 PRO E CB  1 
ATOM   9962  C CG  . PRO E 1 203 ? -22.151 6.667   -10.482 1.00 43.08  ? 183 PRO E CG  1 
ATOM   9963  C CD  . PRO E 1 203 ? -22.665 8.066   -10.517 1.00 41.39  ? 183 PRO E CD  1 
ATOM   9964  N N   . GLY E 1 204 ? -26.227 6.141   -8.145  1.00 38.93  ? 184 GLY E N   1 
ATOM   9965  C CA  . GLY E 1 204 ? -26.908 6.171   -6.852  1.00 40.01  ? 184 GLY E CA  1 
ATOM   9966  C C   . GLY E 1 204 ? -27.619 7.487   -6.545  1.00 40.32  ? 184 GLY E C   1 
ATOM   9967  O O   . GLY E 1 204 ? -28.191 7.636   -5.471  1.00 43.15  ? 184 GLY E O   1 
ATOM   9968  N N   . PHE E 1 205 ? -27.584 8.445   -7.468  1.00 37.16  ? 185 PHE E N   1 
ATOM   9969  C CA  . PHE E 1 205 ? -28.287 9.708   -7.283  1.00 36.41  ? 185 PHE E CA  1 
ATOM   9970  C C   . PHE E 1 205 ? -27.862 10.351  -5.981  1.00 35.22  ? 185 PHE E C   1 
ATOM   9971  O O   . PHE E 1 205 ? -26.683 10.549  -5.743  1.00 36.92  ? 185 PHE E O   1 
ATOM   9972  C CB  . PHE E 1 205 ? -29.799 9.485   -7.305  1.00 37.51  ? 185 PHE E CB  1 
ATOM   9973  C CG  . PHE E 1 205 ? -30.271 8.698   -8.476  1.00 39.04  ? 185 PHE E CG  1 
ATOM   9974  C CD1 . PHE E 1 205 ? -29.558 8.697   -9.661  1.00 38.99  ? 185 PHE E CD1 1 
ATOM   9975  C CD2 . PHE E 1 205 ? -31.446 7.987   -8.408  1.00 40.58  ? 185 PHE E CD2 1 
ATOM   9976  C CE1 . PHE E 1 205 ? -29.994 7.987   -10.742 1.00 38.23  ? 185 PHE E CE1 1 
ATOM   9977  C CE2 . PHE E 1 205 ? -31.896 7.269   -9.493  1.00 40.79  ? 185 PHE E CE2 1 
ATOM   9978  C CZ  . PHE E 1 205 ? -31.165 7.266   -10.662 1.00 40.12  ? 185 PHE E CZ  1 
ATOM   9979  N N   . VAL E 1 206 ? -28.793 10.669  -5.112  1.00 34.70  ? 186 VAL E N   1 
ATOM   9980  C CA  . VAL E 1 206 ? -28.389 11.246  -3.866  1.00 35.73  ? 186 VAL E CA  1 
ATOM   9981  C C   . VAL E 1 206 ? -28.566 10.281  -2.718  1.00 36.74  ? 186 VAL E C   1 
ATOM   9982  O O   . VAL E 1 206 ? -27.661 10.097  -1.907  1.00 36.82  ? 186 VAL E O   1 
ATOM   9983  C CB  . VAL E 1 206 ? -29.182 12.506  -3.577  1.00 35.11  ? 186 VAL E CB  1 
ATOM   9984  C CG1 . VAL E 1 206 ? -28.894 12.957  -2.168  1.00 34.62  ? 186 VAL E CG1 1 
ATOM   9985  C CG2 . VAL E 1 206 ? -28.801 13.587  -4.566  1.00 35.20  ? 186 VAL E CG2 1 
ATOM   9986  N N   . VAL E 1 207 ? -29.731 9.660   -2.654  1.00 38.10  ? 187 VAL E N   1 
ATOM   9987  C CA  . VAL E 1 207 ? -30.106 8.902   -1.473  1.00 39.29  ? 187 VAL E CA  1 
ATOM   9988  C C   . VAL E 1 207 ? -29.381 7.575   -1.356  1.00 37.62  ? 187 VAL E C   1 
ATOM   9989  O O   . VAL E 1 207 ? -28.780 7.294   -0.334  1.00 40.31  ? 187 VAL E O   1 
ATOM   9990  C CB  . VAL E 1 207 ? -31.618 8.678   -1.426  1.00 41.05  ? 187 VAL E CB  1 
ATOM   9991  C CG1 . VAL E 1 207 ? -31.992 7.835   -0.217  1.00 41.76  ? 187 VAL E CG1 1 
ATOM   9992  C CG2 . VAL E 1 207 ? -32.323 10.020  -1.344  1.00 40.73  ? 187 VAL E CG2 1 
ATOM   9993  N N   . ASN E 1 208 ? -29.434 6.763   -2.396  1.00 37.06  ? 188 ASN E N   1 
ATOM   9994  C CA  . ASN E 1 208 ? -28.752 5.471   -2.365  1.00 35.76  ? 188 ASN E CA  1 
ATOM   9995  C C   . ASN E 1 208 ? -27.262 5.645   -2.206  1.00 37.38  ? 188 ASN E C   1 
ATOM   9996  O O   . ASN E 1 208 ? -26.627 4.952   -1.432  1.00 39.23  ? 188 ASN E O   1 
ATOM   9997  C CB  . ASN E 1 208 ? -29.029 4.715   -3.646  1.00 34.98  ? 188 ASN E CB  1 
ATOM   9998  C CG  . ASN E 1 208 ? -30.406 4.114   -3.654  1.00 36.59  ? 188 ASN E CG  1 
ATOM   9999  O OD1 . ASN E 1 208 ? -31.039 4.014   -2.613  1.00 36.45  ? 188 ASN E OD1 1 
ATOM   10000 N ND2 . ASN E 1 208 ? -30.875 3.697   -4.815  1.00 36.71  ? 188 ASN E ND2 1 
ATOM   10001 N N   . ARG E 1 209 ? -26.714 6.590   -2.941  1.00 38.88  ? 189 ARG E N   1 
ATOM   10002 C CA  . ARG E 1 209 ? -25.300 6.890   -2.882  1.00 40.34  ? 189 ARG E CA  1 
ATOM   10003 C C   . ARG E 1 209 ? -24.791 7.126   -1.482  1.00 38.40  ? 189 ARG E C   1 
ATOM   10004 O O   . ARG E 1 209 ? -23.652 6.818   -1.172  1.00 35.73  ? 189 ARG E O   1 
ATOM   10005 C CB  . ARG E 1 209 ? -25.070 8.175   -3.642  1.00 46.03  ? 189 ARG E CB  1 
ATOM   10006 C CG  . ARG E 1 209 ? -23.938 8.100   -4.599  1.00 50.10  ? 189 ARG E CG  1 
ATOM   10007 C CD  . ARG E 1 209 ? -22.653 8.464   -3.927  1.00 54.42  ? 189 ARG E CD  1 
ATOM   10008 N NE  . ARG E 1 209 ? -21.562 8.115   -4.826  1.00 61.33  ? 189 ARG E NE  1 
ATOM   10009 C CZ  . ARG E 1 209 ? -20.968 8.955   -5.677  1.00 66.23  ? 189 ARG E CZ  1 
ATOM   10010 N NH1 . ARG E 1 209 ? -21.311 10.252  -5.746  1.00 64.09  ? 189 ARG E NH1 1 
ATOM   10011 N NH2 . ARG E 1 209 ? -19.996 8.488   -6.452  1.00 65.67  ? 189 ARG E NH2 1 
ATOM   10012 N N   . ILE E 1 210 ? -25.611 7.763   -0.658  1.00 40.08  ? 190 ILE E N   1 
ATOM   10013 C CA  . ILE E 1 210 ? -25.204 8.075   0.706   1.00 40.05  ? 190 ILE E CA  1 
ATOM   10014 C C   . ILE E 1 210 ? -25.661 7.008   1.680   1.00 39.18  ? 190 ILE E C   1 
ATOM   10015 O O   . ILE E 1 210 ? -24.909 6.642   2.572   1.00 40.17  ? 190 ILE E O   1 
ATOM   10016 C CB  . ILE E 1 210 ? -25.768 9.415   1.176   1.00 41.59  ? 190 ILE E CB  1 
ATOM   10017 C CG1 . ILE E 1 210 ? -25.166 10.548  0.357   1.00 43.21  ? 190 ILE E CG1 1 
ATOM   10018 C CG2 . ILE E 1 210 ? -25.441 9.637   2.642   1.00 41.88  ? 190 ILE E CG2 1 
ATOM   10019 C CD1 . ILE E 1 210 ? -25.743 11.903  0.703   1.00 43.59  ? 190 ILE E CD1 1 
ATOM   10020 N N   . LEU E 1 211 ? -26.885 6.524   1.514   1.00 37.44  ? 191 LEU E N   1 
ATOM   10021 C CA  . LEU E 1 211 ? -27.489 5.643   2.502   1.00 39.79  ? 191 LEU E CA  1 
ATOM   10022 C C   . LEU E 1 211 ? -26.913 4.244   2.477   1.00 41.72  ? 191 LEU E C   1 
ATOM   10023 O O   . LEU E 1 211 ? -26.530 3.712   3.518   1.00 43.13  ? 191 LEU E O   1 
ATOM   10024 C CB  . LEU E 1 211 ? -28.998 5.559   2.299   1.00 41.10  ? 191 LEU E CB  1 
ATOM   10025 C CG  . LEU E 1 211 ? -29.774 4.897   3.436   1.00 41.70  ? 191 LEU E CG  1 
ATOM   10026 C CD1 . LEU E 1 211 ? -29.746 5.772   4.660   1.00 39.96  ? 191 LEU E CD1 1 
ATOM   10027 C CD2 . LEU E 1 211 ? -31.215 4.643   3.022   1.00 42.67  ? 191 LEU E CD2 1 
ATOM   10028 N N   . ILE E 1 212 ? -26.843 3.650   1.293   1.00 41.19  ? 192 ILE E N   1 
ATOM   10029 C CA  . ILE E 1 212 ? -26.445 2.253   1.182   1.00 38.96  ? 192 ILE E CA  1 
ATOM   10030 C C   . ILE E 1 212 ? -25.013 2.005   1.641   1.00 39.38  ? 192 ILE E C   1 
ATOM   10031 O O   . ILE E 1 212 ? -24.766 1.052   2.364   1.00 42.43  ? 192 ILE E O   1 
ATOM   10032 C CB  . ILE E 1 212 ? -26.692 1.709   -0.229  1.00 40.59  ? 192 ILE E CB  1 
ATOM   10033 C CG1 . ILE E 1 212 ? -28.126 2.015   -0.648  1.00 41.46  ? 192 ILE E CG1 1 
ATOM   10034 C CG2 . ILE E 1 212 ? -26.505 0.200   -0.267  1.00 40.20  ? 192 ILE E CG2 1 
ATOM   10035 C CD1 . ILE E 1 212 ? -29.170 1.640   0.401   1.00 43.06  ? 192 ILE E CD1 1 
ATOM   10036 N N   . PRO E 1 213 ? -24.064 2.873   1.259   1.00 38.18  ? 193 PRO E N   1 
ATOM   10037 C CA  . PRO E 1 213 ? -22.678 2.723   1.730   1.00 38.20  ? 193 PRO E CA  1 
ATOM   10038 C C   . PRO E 1 213 ? -22.540 2.818   3.234   1.00 38.12  ? 193 PRO E C   1 
ATOM   10039 O O   . PRO E 1 213 ? -21.584 2.327   3.821   1.00 34.90  ? 193 PRO E O   1 
ATOM   10040 C CB  . PRO E 1 213 ? -21.960 3.901   1.075   1.00 36.83  ? 193 PRO E CB  1 
ATOM   10041 C CG  . PRO E 1 213 ? -22.688 4.057   -0.200  1.00 38.50  ? 193 PRO E CG  1 
ATOM   10042 C CD  . PRO E 1 213 ? -24.138 3.786   0.112   1.00 37.88  ? 193 PRO E CD  1 
ATOM   10043 N N   . MET E 1 214 ? -23.506 3.460   3.849   1.00 41.04  ? 194 MET E N   1 
ATOM   10044 C CA  . MET E 1 214 ? -23.550 3.535   5.290   1.00 45.60  ? 194 MET E CA  1 
ATOM   10045 C C   . MET E 1 214 ? -23.985 2.189   5.907   1.00 43.94  ? 194 MET E C   1 
ATOM   10046 O O   . MET E 1 214 ? -23.466 1.766   6.940   1.00 42.01  ? 194 MET E O   1 
ATOM   10047 C CB  . MET E 1 214 ? -24.475 4.679   5.656   1.00 50.84  ? 194 MET E CB  1 
ATOM   10048 C CG  . MET E 1 214 ? -25.124 4.602   7.010   1.00 57.01  ? 194 MET E CG  1 
ATOM   10049 S SD  . MET E 1 214 ? -26.624 5.581   6.929   1.00 65.51  ? 194 MET E SD  1 
ATOM   10050 C CE  . MET E 1 214 ? -25.804 7.144   6.812   1.00 61.69  ? 194 MET E CE  1 
ATOM   10051 N N   . ILE E 1 215 ? -24.916 1.516   5.251   1.00 40.93  ? 195 ILE E N   1 
ATOM   10052 C CA  . ILE E 1 215 ? -25.268 0.160   5.613   1.00 40.53  ? 195 ILE E CA  1 
ATOM   10053 C C   . ILE E 1 215 ? -24.069 -0.768  5.407   1.00 41.35  ? 195 ILE E C   1 
ATOM   10054 O O   . ILE E 1 215 ? -23.782 -1.621  6.233   1.00 42.73  ? 195 ILE E O   1 
ATOM   10055 C CB  . ILE E 1 215 ? -26.460 -0.309  4.778   1.00 39.77  ? 195 ILE E CB  1 
ATOM   10056 C CG1 . ILE E 1 215 ? -27.690 0.490   5.195   1.00 41.83  ? 195 ILE E CG1 1 
ATOM   10057 C CG2 . ILE E 1 215 ? -26.693 -1.794  4.957   1.00 39.06  ? 195 ILE E CG2 1 
ATOM   10058 C CD1 . ILE E 1 215 ? -28.917 0.231   4.354   1.00 43.41  ? 195 ILE E CD1 1 
ATOM   10059 N N   . ASN E 1 216 ? -23.349 -0.571  4.313   1.00 42.69  ? 196 ASN E N   1 
ATOM   10060 C CA  . ASN E 1 216 ? -22.216 -1.424  3.977   1.00 40.52  ? 196 ASN E CA  1 
ATOM   10061 C C   . ASN E 1 216 ? -21.113 -1.239  4.997   1.00 39.63  ? 196 ASN E C   1 
ATOM   10062 O O   . ASN E 1 216 ? -20.351 -2.148  5.263   1.00 42.49  ? 196 ASN E O   1 
ATOM   10063 C CB  . ASN E 1 216 ? -21.726 -1.078  2.567   1.00 41.49  ? 196 ASN E CB  1 
ATOM   10064 C CG  . ASN E 1 216 ? -20.694 -2.061  2.024   1.00 40.86  ? 196 ASN E CG  1 
ATOM   10065 O OD1 . ASN E 1 216 ? -21.002 -3.214  1.733   1.00 39.03  ? 196 ASN E OD1 1 
ATOM   10066 N ND2 . ASN E 1 216 ? -19.476 -1.583  1.829   1.00 36.91  ? 196 ASN E ND2 1 
ATOM   10067 N N   . GLU E 1 217 ? -21.030 -0.053  5.575   1.00 40.27  ? 197 GLU E N   1 
ATOM   10068 C CA  . GLU E 1 217 ? -20.011 0.231   6.574   1.00 40.48  ? 197 GLU E CA  1 
ATOM   10069 C C   . GLU E 1 217 ? -20.347 -0.510  7.847   1.00 41.59  ? 197 GLU E C   1 
ATOM   10070 O O   . GLU E 1 217 ? -19.460 -1.015  8.532   1.00 42.04  ? 197 GLU E O   1 
ATOM   10071 C CB  . GLU E 1 217 ? -19.978 1.724   6.874   1.00 40.90  ? 197 GLU E CB  1 
ATOM   10072 C CG  . GLU E 1 217 ? -18.810 2.139   7.741   1.00 40.94  ? 197 GLU E CG  1 
ATOM   10073 C CD  . GLU E 1 217 ? -17.483 1.989   7.029   1.00 41.70  ? 197 GLU E CD  1 
ATOM   10074 O OE1 . GLU E 1 217 ? -17.406 2.286   5.830   1.00 46.39  ? 197 GLU E OE1 1 
ATOM   10075 O OE2 . GLU E 1 217 ? -16.507 1.566   7.664   1.00 45.20  ? 197 GLU E OE2 1 
ATOM   10076 N N   . ALA E 1 218 ? -21.645 -0.551  8.155   1.00 42.95  ? 198 ALA E N   1 
ATOM   10077 C CA  . ALA E 1 218 ? -22.147 -1.205  9.359   1.00 43.07  ? 198 ALA E CA  1 
ATOM   10078 C C   . ALA E 1 218 ? -21.844 -2.682  9.309   1.00 44.57  ? 198 ALA E C   1 
ATOM   10079 O O   . ALA E 1 218 ? -21.449 -3.272  10.320  1.00 44.34  ? 198 ALA E O   1 
ATOM   10080 C CB  . ALA E 1 218 ? -23.644 -0.989  9.513   1.00 42.90  ? 198 ALA E CB  1 
ATOM   10081 N N   . VAL E 1 219 ? -21.991 -3.286  8.133   1.00 43.62  ? 199 VAL E N   1 
ATOM   10082 C CA  . VAL E 1 219 ? -21.675 -4.708  8.056   1.00 43.69  ? 199 VAL E CA  1 
ATOM   10083 C C   . VAL E 1 219 ? -20.159 -4.929  8.143   1.00 43.81  ? 199 VAL E C   1 
ATOM   10084 O O   . VAL E 1 219 ? -19.716 -5.983  8.610   1.00 43.34  ? 199 VAL E O   1 
ATOM   10085 C CB  . VAL E 1 219 ? -22.333 -5.483  6.882   1.00 41.56  ? 199 VAL E CB  1 
ATOM   10086 C CG1 . VAL E 1 219 ? -23.325 -4.643  6.112   1.00 42.22  ? 199 VAL E CG1 1 
ATOM   10087 C CG2 . VAL E 1 219 ? -21.306 -6.076  5.956   1.00 41.48  ? 199 VAL E CG2 1 
ATOM   10088 N N   . GLY E 1 220 ? -19.377 -3.938  7.725   1.00 41.88  ? 200 GLY E N   1 
ATOM   10089 C CA  . GLY E 1 220 ? -17.922 -4.031  7.831   1.00 40.02  ? 200 GLY E CA  1 
ATOM   10090 C C   . GLY E 1 220 ? -17.451 -3.997  9.268   1.00 41.12  ? 200 GLY E C   1 
ATOM   10091 O O   . GLY E 1 220 ? -16.489 -4.658  9.621   1.00 46.10  ? 200 GLY E O   1 
ATOM   10092 N N   . ILE E 1 221 ? -18.152 -3.239  10.098  1.00 42.62  ? 201 ILE E N   1 
ATOM   10093 C CA  . ILE E 1 221 ? -17.841 -3.145  11.520  1.00 43.10  ? 201 ILE E CA  1 
ATOM   10094 C C   . ILE E 1 221 ? -18.191 -4.433  12.246  1.00 43.62  ? 201 ILE E C   1 
ATOM   10095 O O   . ILE E 1 221 ? -17.461 -4.914  13.110  1.00 40.96  ? 201 ILE E O   1 
ATOM   10096 C CB  . ILE E 1 221 ? -18.665 -2.024  12.150  1.00 45.51  ? 201 ILE E CB  1 
ATOM   10097 C CG1 . ILE E 1 221 ? -17.975 -0.690  11.898  1.00 47.28  ? 201 ILE E CG1 1 
ATOM   10098 C CG2 . ILE E 1 221 ? -18.859 -2.242  13.643  1.00 45.10  ? 201 ILE E CG2 1 
ATOM   10099 C CD1 . ILE E 1 221 ? -18.941 0.470   11.874  1.00 47.69  ? 201 ILE E CD1 1 
ATOM   10100 N N   . LEU E 1 222 ? -19.357 -4.953  11.916  1.00 43.93  ? 202 LEU E N   1 
ATOM   10101 C CA  . LEU E 1 222 ? -19.807 -6.219  12.455  1.00 45.16  ? 202 LEU E CA  1 
ATOM   10102 C C   . LEU E 1 222 ? -18.843 -7.330  12.099  1.00 45.97  ? 202 LEU E C   1 
ATOM   10103 O O   . LEU E 1 222 ? -18.452 -8.116  12.959  1.00 46.49  ? 202 LEU E O   1 
ATOM   10104 C CB  . LEU E 1 222 ? -21.168 -6.551  11.873  1.00 46.27  ? 202 LEU E CB  1 
ATOM   10105 C CG  . LEU E 1 222 ? -21.741 -7.920  12.196  1.00 48.61  ? 202 LEU E CG  1 
ATOM   10106 C CD1 . LEU E 1 222 ? -22.248 -7.961  13.624  1.00 50.21  ? 202 LEU E CD1 1 
ATOM   10107 C CD2 . LEU E 1 222 ? -22.865 -8.219  11.225  1.00 49.49  ? 202 LEU E CD2 1 
ATOM   10108 N N   . ALA E 1 223 ? -18.464 -7.385  10.825  1.00 45.13  ? 203 ALA E N   1 
ATOM   10109 C CA  . ALA E 1 223 ? -17.570 -8.426  10.328  1.00 42.20  ? 203 ALA E CA  1 
ATOM   10110 C C   . ALA E 1 223 ? -16.228 -8.459  11.053  1.00 43.70  ? 203 ALA E C   1 
ATOM   10111 O O   . ALA E 1 223 ? -15.602 -9.505  11.171  1.00 42.97  ? 203 ALA E O   1 
ATOM   10112 C CB  . ALA E 1 223 ? -17.341 -8.244  8.845   1.00 40.52  ? 203 ALA E CB  1 
ATOM   10113 N N   . GLU E 1 224 ? -15.785 -7.315  11.540  1.00 47.45  ? 204 GLU E N   1 
ATOM   10114 C CA  . GLU E 1 224 ? -14.509 -7.241  12.230  1.00 51.04  ? 204 GLU E CA  1 
ATOM   10115 C C   . GLU E 1 224 ? -14.638 -7.440  13.743  1.00 48.21  ? 204 GLU E C   1 
ATOM   10116 O O   . GLU E 1 224 ? -13.670 -7.261  14.483  1.00 42.33  ? 204 GLU E O   1 
ATOM   10117 C CB  . GLU E 1 224 ? -13.872 -5.892  11.937  1.00 58.71  ? 204 GLU E CB  1 
ATOM   10118 C CG  . GLU E 1 224 ? -13.454 -5.722  10.489  1.00 64.22  ? 204 GLU E CG  1 
ATOM   10119 C CD  . GLU E 1 224 ? -12.334 -4.709  10.343  1.00 69.62  ? 204 GLU E CD  1 
ATOM   10120 O OE1 . GLU E 1 224 ? -11.151 -5.121  10.259  1.00 69.24  ? 204 GLU E OE1 1 
ATOM   10121 O OE2 . GLU E 1 224 ? -12.635 -3.500  10.343  1.00 73.76  ? 204 GLU E OE2 1 
ATOM   10122 N N   . GLY E 1 225 ? -15.834 -7.800  14.198  1.00 45.37  ? 205 GLY E N   1 
ATOM   10123 C CA  . GLY E 1 225 ? -16.082 -8.015  15.619  1.00 49.37  ? 205 GLY E CA  1 
ATOM   10124 C C   . GLY E 1 225 ? -15.976 -6.764  16.483  1.00 51.62  ? 205 GLY E C   1 
ATOM   10125 O O   . GLY E 1 225 ? -15.688 -6.843  17.675  1.00 53.37  ? 205 GLY E O   1 
ATOM   10126 N N   . ILE E 1 226 ? -16.212 -5.607  15.885  1.00 53.12  ? 206 ILE E N   1 
ATOM   10127 C CA  . ILE E 1 226 ? -16.045 -4.342  16.581  1.00 51.25  ? 206 ILE E CA  1 
ATOM   10128 C C   . ILE E 1 226 ? -17.209 -4.132  17.511  1.00 49.45  ? 206 ILE E C   1 
ATOM   10129 O O   . ILE E 1 226 ? -17.049 -3.594  18.600  1.00 46.81  ? 206 ILE E O   1 
ATOM   10130 C CB  . ILE E 1 226 ? -15.979 -3.165  15.594  1.00 51.67  ? 206 ILE E CB  1 
ATOM   10131 C CG1 . ILE E 1 226 ? -14.797 -3.310  14.645  1.00 51.91  ? 206 ILE E CG1 1 
ATOM   10132 C CG2 . ILE E 1 226 ? -15.829 -1.851  16.325  1.00 53.59  ? 206 ILE E CG2 1 
ATOM   10133 C CD1 . ILE E 1 226 ? -13.533 -3.822  15.306  1.00 53.43  ? 206 ILE E CD1 1 
ATOM   10134 N N   . ALA E 1 227 ? -18.378 -4.554  17.058  1.00 48.39  ? 207 ALA E N   1 
ATOM   10135 C CA  . ALA E 1 227 ? -19.581 -4.460  17.835  1.00 48.99  ? 207 ALA E CA  1 
ATOM   10136 C C   . ALA E 1 227 ? -20.619 -5.401  17.264  1.00 51.02  ? 207 ALA E C   1 
ATOM   10137 O O   . ALA E 1 227 ? -20.460 -5.939  16.167  1.00 53.32  ? 207 ALA E O   1 
ATOM   10138 C CB  . ALA E 1 227 ? -20.090 -3.037  17.793  1.00 51.74  ? 207 ALA E CB  1 
ATOM   10139 N N   . SER E 1 228 ? -21.700 -5.575  18.002  1.00 50.72  ? 208 SER E N   1 
ATOM   10140 C CA  . SER E 1 228 ? -22.743 -6.505  17.608  1.00 52.31  ? 208 SER E CA  1 
ATOM   10141 C C   . SER E 1 228 ? -23.817 -5.785  16.837  1.00 54.35  ? 208 SER E C   1 
ATOM   10142 O O   . SER E 1 228 ? -23.890 -4.554  16.848  1.00 54.11  ? 208 SER E O   1 
ATOM   10143 C CB  . SER E 1 228 ? -23.376 -7.131  18.839  1.00 50.46  ? 208 SER E CB  1 
ATOM   10144 O OG  . SER E 1 228 ? -23.963 -6.126  19.646  1.00 52.14  ? 208 SER E OG  1 
ATOM   10145 N N   . VAL E 1 229 ? -24.687 -6.558  16.205  1.00 56.13  ? 209 VAL E N   1 
ATOM   10146 C CA  . VAL E 1 229 ? -25.674 -5.957  15.321  1.00 59.66  ? 209 VAL E CA  1 
ATOM   10147 C C   . VAL E 1 229 ? -26.599 -5.031  16.110  1.00 62.44  ? 209 VAL E C   1 
ATOM   10148 O O   . VAL E 1 229 ? -27.015 -3.996  15.603  1.00 65.61  ? 209 VAL E O   1 
ATOM   10149 C CB  . VAL E 1 229 ? -26.487 -6.978  14.478  1.00 60.74  ? 209 VAL E CB  1 
ATOM   10150 C CG1 . VAL E 1 229 ? -25.907 -8.386  14.551  1.00 60.78  ? 209 VAL E CG1 1 
ATOM   10151 C CG2 . VAL E 1 229 ? -27.958 -6.968  14.855  1.00 61.24  ? 209 VAL E CG2 1 
ATOM   10152 N N   . GLU E 1 230 ? -26.896 -5.394  17.352  1.00 64.87  ? 210 GLU E N   1 
ATOM   10153 C CA  . GLU E 1 230 ? -27.868 -4.633  18.155  1.00 63.91  ? 210 GLU E CA  1 
ATOM   10154 C C   . GLU E 1 230 ? -27.228 -3.379  18.715  1.00 58.28  ? 210 GLU E C   1 
ATOM   10155 O O   . GLU E 1 230 ? -27.885 -2.353  18.820  1.00 56.72  ? 210 GLU E O   1 
ATOM   10156 C CB  . GLU E 1 230 ? -28.517 -5.458  19.284  1.00 66.02  ? 210 GLU E CB  1 
ATOM   10157 C CG  . GLU E 1 230 ? -27.785 -6.727  19.704  1.00 74.80  ? 210 GLU E CG  1 
ATOM   10158 C CD  . GLU E 1 230 ? -28.028 -7.900  18.753  1.00 79.29  ? 210 GLU E CD  1 
ATOM   10159 O OE1 . GLU E 1 230 ? -29.139 -8.007  18.171  1.00 79.53  ? 210 GLU E OE1 1 
ATOM   10160 O OE2 . GLU E 1 230 ? -27.095 -8.719  18.586  1.00 80.03  ? 210 GLU E OE2 1 
ATOM   10161 N N   . ASP E 1 231 ? -25.953 -3.465  19.068  1.00 54.09  ? 211 ASP E N   1 
ATOM   10162 C CA  . ASP E 1 231 ? -25.215 -2.298  19.546  1.00 56.81  ? 211 ASP E CA  1 
ATOM   10163 C C   . ASP E 1 231 ? -24.866 -1.305  18.432  1.00 56.77  ? 211 ASP E C   1 
ATOM   10164 O O   . ASP E 1 231 ? -24.672 -0.109  18.678  1.00 54.20  ? 211 ASP E O   1 
ATOM   10165 C CB  . ASP E 1 231 ? -23.934 -2.747  20.251  1.00 60.51  ? 211 ASP E CB  1 
ATOM   10166 C CG  . ASP E 1 231 ? -24.131 -2.985  21.743  1.00 62.64  ? 211 ASP E CG  1 
ATOM   10167 O OD1 . ASP E 1 231 ? -25.295 -3.005  22.234  1.00 58.87  ? 211 ASP E OD1 1 
ATOM   10168 O OD2 . ASP E 1 231 ? -23.092 -3.138  22.426  1.00 64.16  ? 211 ASP E OD2 1 
ATOM   10169 N N   . ILE E 1 232 ? -24.778 -1.808  17.207  1.00 56.90  ? 212 ILE E N   1 
ATOM   10170 C CA  . ILE E 1 232 ? -24.477 -0.969  16.074  1.00 51.83  ? 212 ILE E CA  1 
ATOM   10171 C C   . ILE E 1 232 ? -25.710 -0.174  15.757  1.00 53.04  ? 212 ILE E C   1 
ATOM   10172 O O   . ILE E 1 232 ? -25.622 1.021   15.484  1.00 54.07  ? 212 ILE E O   1 
ATOM   10173 C CB  . ILE E 1 232 ? -24.067 -1.803  14.859  1.00 51.15  ? 212 ILE E CB  1 
ATOM   10174 C CG1 . ILE E 1 232 ? -22.628 -2.281  15.019  1.00 49.50  ? 212 ILE E CG1 1 
ATOM   10175 C CG2 . ILE E 1 232 ? -24.184 -0.997  13.572  1.00 51.92  ? 212 ILE E CG2 1 
ATOM   10176 C CD1 . ILE E 1 232 ? -22.278 -3.399  14.062  1.00 48.24  ? 212 ILE E CD1 1 
ATOM   10177 N N   . ASP E 1 233 ? -26.862 -0.830  15.790  1.00 52.33  ? 213 ASP E N   1 
ATOM   10178 C CA  . ASP E 1 233 ? -28.088 -0.133  15.476  1.00 54.61  ? 213 ASP E CA  1 
ATOM   10179 C C   . ASP E 1 233 ? -28.411 0.856   16.561  1.00 55.33  ? 213 ASP E C   1 
ATOM   10180 O O   . ASP E 1 233 ? -28.836 1.977   16.286  1.00 58.54  ? 213 ASP E O   1 
ATOM   10181 C CB  . ASP E 1 233 ? -29.226 -1.107  15.242  1.00 55.47  ? 213 ASP E CB  1 
ATOM   10182 C CG  . ASP E 1 233 ? -29.157 -1.726  13.860  1.00 57.83  ? 213 ASP E CG  1 
ATOM   10183 O OD1 . ASP E 1 233 ? -28.169 -1.452  13.128  1.00 54.98  ? 213 ASP E OD1 1 
ATOM   10184 O OD2 . ASP E 1 233 ? -30.086 -2.473  13.498  1.00 59.16  ? 213 ASP E OD2 1 
ATOM   10185 N N   . LYS E 1 234 ? -28.149 0.467   17.794  1.00 52.85  ? 214 LYS E N   1 
ATOM   10186 C CA  . LYS E 1 234 ? -28.423 1.346   18.910  1.00 53.34  ? 214 LYS E CA  1 
ATOM   10187 C C   . LYS E 1 234 ? -27.522 2.565   18.868  1.00 51.64  ? 214 LYS E C   1 
ATOM   10188 O O   . LYS E 1 234 ? -27.969 3.691   19.086  1.00 51.15  ? 214 LYS E O   1 
ATOM   10189 C CB  . LYS E 1 234 ? -28.229 0.591   20.208  1.00 55.86  ? 214 LYS E CB  1 
ATOM   10190 C CG  . LYS E 1 234 ? -28.254 1.467   21.439  1.00 59.25  ? 214 LYS E CG  1 
ATOM   10191 C CD  . LYS E 1 234 ? -28.913 0.726   22.585  1.00 63.62  ? 214 LYS E CD  1 
ATOM   10192 C CE  . LYS E 1 234 ? -27.899 0.107   23.521  1.00 64.18  ? 214 LYS E CE  1 
ATOM   10193 N NZ  . LYS E 1 234 ? -28.592 -0.879  24.389  1.00 65.89  ? 214 LYS E NZ  1 
ATOM   10194 N N   . ALA E 1 235 ? -26.250 2.344   18.583  1.00 49.23  ? 215 ALA E N   1 
ATOM   10195 C CA  . ALA E 1 235 ? -25.319 3.456   18.510  1.00 49.79  ? 215 ALA E CA  1 
ATOM   10196 C C   . ALA E 1 235 ? -25.756 4.462   17.450  1.00 49.61  ? 215 ALA E C   1 
ATOM   10197 O O   . ALA E 1 235 ? -25.634 5.662   17.631  1.00 52.10  ? 215 ALA E O   1 
ATOM   10198 C CB  . ALA E 1 235 ? -23.928 2.949   18.212  1.00 50.78  ? 215 ALA E CB  1 
ATOM   10199 N N   . MET E 1 236 ? -26.283 3.971   16.344  1.00 48.05  ? 216 MET E N   1 
ATOM   10200 C CA  . MET E 1 236 ? -26.732 4.860   15.303  1.00 49.23  ? 216 MET E CA  1 
ATOM   10201 C C   . MET E 1 236 ? -28.043 5.534   15.657  1.00 51.55  ? 216 MET E C   1 
ATOM   10202 O O   . MET E 1 236 ? -28.204 6.717   15.380  1.00 55.21  ? 216 MET E O   1 
ATOM   10203 C CB  . MET E 1 236 ? -26.834 4.126   13.965  1.00 47.81  ? 216 MET E CB  1 
ATOM   10204 C CG  . MET E 1 236 ? -25.472 3.764   13.371  1.00 48.03  ? 216 MET E CG  1 
ATOM   10205 S SD  . MET E 1 236 ? -24.196 5.024   13.623  1.00 48.08  ? 216 MET E SD  1 
ATOM   10206 C CE  . MET E 1 236 ? -24.708 6.232   12.408  1.00 48.32  ? 216 MET E CE  1 
ATOM   10207 N N   . LYS E 1 237 ? -28.972 4.806   16.271  1.00 52.99  ? 217 LYS E N   1 
ATOM   10208 C CA  . LYS E 1 237 ? -30.260 5.407   16.625  1.00 55.47  ? 217 LYS E CA  1 
ATOM   10209 C C   . LYS E 1 237 ? -30.096 6.461   17.690  1.00 54.98  ? 217 LYS E C   1 
ATOM   10210 O O   . LYS E 1 237 ? -30.817 7.443   17.704  1.00 52.22  ? 217 LYS E O   1 
ATOM   10211 C CB  . LYS E 1 237 ? -31.253 4.373   17.129  1.00 57.79  ? 217 LYS E CB  1 
ATOM   10212 C CG  . LYS E 1 237 ? -31.665 3.391   16.060  1.00 63.64  ? 217 LYS E CG  1 
ATOM   10213 C CD  . LYS E 1 237 ? -33.070 2.881   16.277  1.00 66.52  ? 217 LYS E CD  1 
ATOM   10214 C CE  . LYS E 1 237 ? -33.075 1.393   16.547  1.00 70.50  ? 217 LYS E CE  1 
ATOM   10215 N NZ  . LYS E 1 237 ? -34.476 0.944   16.757  1.00 72.28  ? 217 LYS E NZ  1 
ATOM   10216 N N   . LEU E 1 238 ? -29.152 6.243   18.589  1.00 55.91  ? 218 LEU E N   1 
ATOM   10217 C CA  . LEU E 1 238 ? -28.976 7.135   19.716  1.00 58.53  ? 218 LEU E CA  1 
ATOM   10218 C C   . LEU E 1 238 ? -27.914 8.168   19.474  1.00 60.37  ? 218 LEU E C   1 
ATOM   10219 O O   . LEU E 1 238 ? -27.974 9.251   20.052  1.00 60.26  ? 218 LEU E O   1 
ATOM   10220 C CB  . LEU E 1 238 ? -28.587 6.346   20.963  1.00 60.27  ? 218 LEU E CB  1 
ATOM   10221 C CG  . LEU E 1 238 ? -29.674 5.433   21.541  1.00 61.47  ? 218 LEU E CG  1 
ATOM   10222 C CD1 . LEU E 1 238 ? -29.219 4.955   22.905  1.00 61.84  ? 218 LEU E CD1 1 
ATOM   10223 C CD2 . LEU E 1 238 ? -31.032 6.109   21.659  1.00 60.25  ? 218 LEU E CD2 1 
ATOM   10224 N N   . GLY E 1 239 ? -26.930 7.823   18.649  1.00 60.82  ? 219 GLY E N   1 
ATOM   10225 C CA  . GLY E 1 239 ? -25.773 8.685   18.417  1.00 57.60  ? 219 GLY E CA  1 
ATOM   10226 C C   . GLY E 1 239 ? -26.017 9.736   17.355  1.00 53.42  ? 219 GLY E C   1 
ATOM   10227 O O   . GLY E 1 239 ? -25.544 10.859  17.466  1.00 55.85  ? 219 GLY E O   1 
ATOM   10228 N N   . ALA E 1 240 ? -26.746 9.357   16.320  1.00 51.97  ? 220 ALA E N   1 
ATOM   10229 C CA  . ALA E 1 240 ? -27.033 10.236  15.201  1.00 53.54  ? 220 ALA E CA  1 
ATOM   10230 C C   . ALA E 1 240 ? -28.519 10.470  15.105  1.00 55.13  ? 220 ALA E C   1 
ATOM   10231 O O   . ALA E 1 240 ? -28.997 11.033  14.117  1.00 53.53  ? 220 ALA E O   1 
ATOM   10232 C CB  . ALA E 1 240 ? -26.538 9.598   13.913  1.00 54.42  ? 220 ALA E CB  1 
ATOM   10233 N N   . ASN E 1 241 ? -29.255 10.000  16.110  1.00 56.25  ? 221 ASN E N   1 
ATOM   10234 C CA  . ASN E 1 241 ? -30.678 10.258  16.191  1.00 57.31  ? 221 ASN E CA  1 
ATOM   10235 C C   . ASN E 1 241 ? -31.395 9.787   14.928  1.00 53.90  ? 221 ASN E C   1 
ATOM   10236 O O   . ASN E 1 241 ? -32.242 10.495  14.384  1.00 54.24  ? 221 ASN E O   1 
ATOM   10237 C CB  . ASN E 1 241 ? -30.901 11.756  16.425  1.00 61.13  ? 221 ASN E CB  1 
ATOM   10238 C CG  . ASN E 1 241 ? -32.320 12.087  16.835  1.00 64.82  ? 221 ASN E CG  1 
ATOM   10239 O OD1 . ASN E 1 241 ? -33.078 11.229  17.292  1.00 69.44  ? 221 ASN E OD1 1 
ATOM   10240 N ND2 . ASN E 1 241 ? -32.688 13.346  16.669  1.00 67.28  ? 221 ASN E ND2 1 
ATOM   10241 N N   . HIS E 1 242 ? -31.038 8.595   14.463  1.00 50.18  ? 222 HIS E N   1 
ATOM   10242 C CA  . HIS E 1 242 ? -31.677 8.025   13.297  1.00 52.05  ? 222 HIS E CA  1 
ATOM   10243 C C   . HIS E 1 242 ? -32.837 7.153   13.722  1.00 53.96  ? 222 HIS E C   1 
ATOM   10244 O O   . HIS E 1 242 ? -32.748 6.451   14.726  1.00 53.94  ? 222 HIS E O   1 
ATOM   10245 C CB  . HIS E 1 242 ? -30.718 7.135   12.507  1.00 53.58  ? 222 HIS E CB  1 
ATOM   10246 C CG  . HIS E 1 242 ? -29.675 7.878   11.744  1.00 54.22  ? 222 HIS E CG  1 
ATOM   10247 N ND1 . HIS E 1 242 ? -28.651 7.231   11.089  1.00 54.24  ? 222 HIS E ND1 1 
ATOM   10248 C CD2 . HIS E 1 242 ? -29.468 9.203   11.556  1.00 52.31  ? 222 HIS E CD2 1 
ATOM   10249 C CE1 . HIS E 1 242 ? -27.865 8.124   10.517  1.00 53.93  ? 222 HIS E CE1 1 
ATOM   10250 N NE2 . HIS E 1 242 ? -28.341 9.327   10.781  1.00 54.97  ? 222 HIS E NE2 1 
ATOM   10251 N N   . PRO E 1 243 ? -33.897 7.126   12.911  1.00 54.87  ? 223 PRO E N   1 
ATOM   10252 C CA  . PRO E 1 243 ? -35.087 6.347   13.237  1.00 57.66  ? 223 PRO E CA  1 
ATOM   10253 C C   . PRO E 1 243 ? -34.831 4.839   13.332  1.00 59.23  ? 223 PRO E C   1 
ATOM   10254 O O   . PRO E 1 243 ? -35.351 4.189   14.230  1.00 63.56  ? 223 PRO E O   1 
ATOM   10255 C CB  . PRO E 1 243 ? -36.040 6.640   12.072  1.00 56.86  ? 223 PRO E CB  1 
ATOM   10256 C CG  . PRO E 1 243 ? -35.237 7.334   11.022  1.00 58.73  ? 223 PRO E CG  1 
ATOM   10257 C CD  . PRO E 1 243 ? -33.821 7.454   11.477  1.00 56.69  ? 223 PRO E CD  1 
ATOM   10258 N N   . MET E 1 244 ? -34.057 4.306   12.394  1.00 59.80  ? 224 MET E N   1 
ATOM   10259 C CA  . MET E 1 244 ? -33.710 2.893   12.346  1.00 57.61  ? 224 MET E CA  1 
ATOM   10260 C C   . MET E 1 244 ? -32.204 2.794   12.285  1.00 52.49  ? 224 MET E C   1 
ATOM   10261 O O   . MET E 1 244 ? -31.550 3.679   11.755  1.00 52.85  ? 224 MET E O   1 
ATOM   10262 C CB  . MET E 1 244 ? -34.295 2.279   11.086  1.00 61.07  ? 224 MET E CB  1 
ATOM   10263 C CG  . MET E 1 244 ? -34.989 0.959   11.316  1.00 66.07  ? 224 MET E CG  1 
ATOM   10264 S SD  . MET E 1 244 ? -35.771 0.329   9.822   1.00 71.14  ? 224 MET E SD  1 
ATOM   10265 C CE  . MET E 1 244 ? -36.930 1.658   9.485   1.00 73.14  ? 224 MET E CE  1 
ATOM   10266 N N   . GLY E 1 245 ? -31.648 1.726   12.824  1.00 50.38  ? 225 GLY E N   1 
ATOM   10267 C CA  . GLY E 1 245 ? -30.210 1.476   12.696  1.00 46.86  ? 225 GLY E CA  1 
ATOM   10268 C C   . GLY E 1 245 ? -29.899 0.845   11.345  1.00 43.78  ? 225 GLY E C   1 
ATOM   10269 O O   . GLY E 1 245 ? -30.794 0.325   10.677  1.00 41.84  ? 225 GLY E O   1 
ATOM   10270 N N   . PRO E 1 246 ? -28.631 0.904   10.923  1.00 40.12  ? 226 PRO E N   1 
ATOM   10271 C CA  . PRO E 1 246 ? -28.258 0.551   9.561   1.00 40.05  ? 226 PRO E CA  1 
ATOM   10272 C C   . PRO E 1 246 ? -28.545 -0.887  9.176   1.00 41.48  ? 226 PRO E C   1 
ATOM   10273 O O   . PRO E 1 246 ? -29.015 -1.150  8.065   1.00 42.92  ? 226 PRO E O   1 
ATOM   10274 C CB  . PRO E 1 246 ? -26.752 0.827   9.525   1.00 39.62  ? 226 PRO E CB  1 
ATOM   10275 C CG  . PRO E 1 246 ? -26.335 1.073   10.934  1.00 39.31  ? 226 PRO E CG  1 
ATOM   10276 C CD  . PRO E 1 246 ? -27.544 1.608   11.612  1.00 39.72  ? 226 PRO E CD  1 
ATOM   10277 N N   . LEU E 1 247 ? -28.272 -1.806  10.089  1.00 41.33  ? 227 LEU E N   1 
ATOM   10278 C CA  . LEU E 1 247 ? -28.411 -3.216  9.783   1.00 41.30  ? 227 LEU E CA  1 
ATOM   10279 C C   . LEU E 1 247 ? -29.873 -3.573  9.658   1.00 42.83  ? 227 LEU E C   1 
ATOM   10280 O O   . LEU E 1 247 ? -30.312 -4.172  8.670   1.00 42.04  ? 227 LEU E O   1 
ATOM   10281 C CB  . LEU E 1 247 ? -27.721 -4.035  10.852  1.00 41.80  ? 227 LEU E CB  1 
ATOM   10282 C CG  . LEU E 1 247 ? -26.209 -3.785  10.881  1.00 42.37  ? 227 LEU E CG  1 
ATOM   10283 C CD1 . LEU E 1 247 ? -25.544 -4.621  11.956  1.00 43.62  ? 227 LEU E CD1 1 
ATOM   10284 C CD2 . LEU E 1 247 ? -25.594 -4.126  9.538   1.00 42.57  ? 227 LEU E CD2 1 
ATOM   10285 N N   . GLU E 1 248 ? -30.626 -3.164  10.661  1.00 44.31  ? 228 GLU E N   1 
ATOM   10286 C CA  . GLU E 1 248 ? -32.072 -3.200  10.614  1.00 47.84  ? 228 GLU E CA  1 
ATOM   10287 C C   . GLU E 1 248 ? -32.623 -2.657  9.286   1.00 46.41  ? 228 GLU E C   1 
ATOM   10288 O O   . GLU E 1 248 ? -33.444 -3.287  8.604   1.00 45.15  ? 228 GLU E O   1 
ATOM   10289 C CB  . GLU E 1 248 ? -32.562 -2.349  11.767  1.00 54.42  ? 228 GLU E CB  1 
ATOM   10290 C CG  . GLU E 1 248 ? -34.050 -2.331  11.982  1.00 58.78  ? 228 GLU E CG  1 
ATOM   10291 C CD  . GLU E 1 248 ? -34.400 -1.612  13.268  1.00 62.18  ? 228 GLU E CD  1 
ATOM   10292 O OE1 . GLU E 1 248 ? -33.483 -1.036  13.928  1.00 58.60  ? 228 GLU E OE1 1 
ATOM   10293 O OE2 . GLU E 1 248 ? -35.602 -1.622  13.600  1.00 64.61  ? 228 GLU E OE2 1 
ATOM   10294 N N   . LEU E 1 249 ? -32.146 -1.477  8.919   1.00 46.11  ? 229 LEU E N   1 
ATOM   10295 C CA  . LEU E 1 249 ? -32.586 -0.822  7.696   1.00 44.31  ? 229 LEU E CA  1 
ATOM   10296 C C   . LEU E 1 249 ? -32.246 -1.660  6.496   1.00 43.38  ? 229 LEU E C   1 
ATOM   10297 O O   . LEU E 1 249 ? -33.033 -1.770  5.553   1.00 41.07  ? 229 LEU E O   1 
ATOM   10298 C CB  . LEU E 1 249 ? -31.906 0.514   7.578   1.00 45.33  ? 229 LEU E CB  1 
ATOM   10299 C CG  . LEU E 1 249 ? -32.228 1.346   6.354   1.00 46.50  ? 229 LEU E CG  1 
ATOM   10300 C CD1 . LEU E 1 249 ? -33.708 1.673   6.258   1.00 46.59  ? 229 LEU E CD1 1 
ATOM   10301 C CD2 . LEU E 1 249 ? -31.407 2.619   6.473   1.00 46.17  ? 229 LEU E CD2 1 
ATOM   10302 N N   . GLY E 1 250 ? -31.056 -2.253  6.554   1.00 43.73  ? 230 GLY E N   1 
ATOM   10303 C CA  . GLY E 1 250 ? -30.608 -3.204  5.560   1.00 44.43  ? 230 GLY E CA  1 
ATOM   10304 C C   . GLY E 1 250 ? -31.609 -4.320  5.343   1.00 44.78  ? 230 GLY E C   1 
ATOM   10305 O O   . GLY E 1 250 ? -32.004 -4.583  4.194   1.00 46.63  ? 230 GLY E O   1 
ATOM   10306 N N   . ASP E 1 251 ? -32.021 -4.956  6.445   1.00 44.63  ? 231 ASP E N   1 
ATOM   10307 C CA  . ASP E 1 251 ? -33.001 -6.054  6.409   1.00 46.51  ? 231 ASP E CA  1 
ATOM   10308 C C   . ASP E 1 251 ? -34.355 -5.592  5.875   1.00 47.44  ? 231 ASP E C   1 
ATOM   10309 O O   . ASP E 1 251 ? -35.075 -6.343  5.212   1.00 45.04  ? 231 ASP E O   1 
ATOM   10310 C CB  . ASP E 1 251 ? -33.216 -6.634  7.806   1.00 47.28  ? 231 ASP E CB  1 
ATOM   10311 C CG  . ASP E 1 251 ? -32.004 -7.404  8.335   1.00 49.74  ? 231 ASP E CG  1 
ATOM   10312 O OD1 . ASP E 1 251 ? -31.081 -7.730  7.559   1.00 50.72  ? 231 ASP E OD1 1 
ATOM   10313 O OD2 . ASP E 1 251 ? -31.976 -7.703  9.552   1.00 50.92  ? 231 ASP E OD2 1 
ATOM   10314 N N   . PHE E 1 252 ? -34.681 -4.344  6.180   1.00 50.07  ? 232 PHE E N   1 
ATOM   10315 C CA  . PHE E 1 252 ? -35.945 -3.756  5.793   1.00 52.47  ? 232 PHE E CA  1 
ATOM   10316 C C   . PHE E 1 252 ? -35.996 -3.443  4.314   1.00 51.38  ? 232 PHE E C   1 
ATOM   10317 O O   . PHE E 1 252 ? -37.005 -3.694  3.658   1.00 48.75  ? 232 PHE E O   1 
ATOM   10318 C CB  . PHE E 1 252 ? -36.160 -2.477  6.581   1.00 56.50  ? 232 PHE E CB  1 
ATOM   10319 C CG  . PHE E 1 252 ? -37.473 -1.834  6.317   1.00 59.41  ? 232 PHE E CG  1 
ATOM   10320 C CD1 . PHE E 1 252 ? -38.618 -2.315  6.918   1.00 63.38  ? 232 PHE E CD1 1 
ATOM   10321 C CD2 . PHE E 1 252 ? -37.569 -0.746  5.465   1.00 66.54  ? 232 PHE E CD2 1 
ATOM   10322 C CE1 . PHE E 1 252 ? -39.844 -1.720  6.685   1.00 64.89  ? 232 PHE E CE1 1 
ATOM   10323 C CE2 . PHE E 1 252 ? -38.790 -0.142  5.219   1.00 67.41  ? 232 PHE E CE2 1 
ATOM   10324 C CZ  . PHE E 1 252 ? -39.932 -0.630  5.833   1.00 67.20  ? 232 PHE E CZ  1 
ATOM   10325 N N   . ILE E 1 253 ? -34.915 -2.863  3.802   1.00 51.98  ? 233 ILE E N   1 
ATOM   10326 C CA  . ILE E 1 253 ? -34.770 -2.635  2.361   1.00 50.87  ? 233 ILE E CA  1 
ATOM   10327 C C   . ILE E 1 253 ? -34.605 -3.957  1.610   1.00 48.48  ? 233 ILE E C   1 
ATOM   10328 O O   . ILE E 1 253 ? -35.071 -4.119  0.475   1.00 42.35  ? 233 ILE E O   1 
ATOM   10329 C CB  . ILE E 1 253 ? -33.545 -1.753  2.075   1.00 54.49  ? 233 ILE E CB  1 
ATOM   10330 C CG1 . ILE E 1 253 ? -33.840 -0.301  2.451   1.00 55.62  ? 233 ILE E CG1 1 
ATOM   10331 C CG2 . ILE E 1 253 ? -33.154 -1.807  0.609   1.00 52.99  ? 233 ILE E CG2 1 
ATOM   10332 C CD1 . ILE E 1 253 ? -32.596 0.504   2.740   1.00 55.41  ? 233 ILE E CD1 1 
ATOM   10333 N N   . GLY E 1 254 ? -33.930 -4.900  2.249   1.00 46.56  ? 234 GLY E N   1 
ATOM   10334 C CA  . GLY E 1 254 ? -33.566 -6.137  1.588   1.00 48.99  ? 234 GLY E CA  1 
ATOM   10335 C C   . GLY E 1 254 ? -32.084 -6.099  1.270   1.00 50.19  ? 234 GLY E C   1 
ATOM   10336 O O   . GLY E 1 254 ? -31.579 -5.162  0.647   1.00 47.56  ? 234 GLY E O   1 
ATOM   10337 N N   . LEU E 1 255 ? -31.381 -7.125  1.709   1.00 49.81  ? 235 LEU E N   1 
ATOM   10338 C CA  . LEU E 1 255 ? -29.939 -7.152  1.572   1.00 46.69  ? 235 LEU E CA  1 
ATOM   10339 C C   . LEU E 1 255 ? -29.508 -7.394  0.146   1.00 46.70  ? 235 LEU E C   1 
ATOM   10340 O O   . LEU E 1 255 ? -28.435 -6.974  -0.246  1.00 43.65  ? 235 LEU E O   1 
ATOM   10341 C CB  . LEU E 1 255 ? -29.363 -8.222  2.468   1.00 46.77  ? 235 LEU E CB  1 
ATOM   10342 C CG  . LEU E 1 255 ? -29.669 -7.921  3.919   1.00 47.09  ? 235 LEU E CG  1 
ATOM   10343 C CD1 . LEU E 1 255 ? -28.963 -8.911  4.805   1.00 48.46  ? 235 LEU E CD1 1 
ATOM   10344 C CD2 . LEU E 1 255 ? -29.187 -6.523  4.237   1.00 48.30  ? 235 LEU E CD2 1 
ATOM   10345 N N   . ASP E 1 256 ? -30.341 -8.063  -0.636  1.00 44.34  ? 236 ASP E N   1 
ATOM   10346 C CA  . ASP E 1 256 ? -30.053 -8.217  -2.061  1.00 45.68  ? 236 ASP E CA  1 
ATOM   10347 C C   . ASP E 1 256 ? -30.113 -6.879  -2.783  1.00 45.41  ? 236 ASP E C   1 
ATOM   10348 O O   . ASP E 1 256 ? -29.314 -6.610  -3.670  1.00 47.31  ? 236 ASP E O   1 
ATOM   10349 C CB  . ASP E 1 256 ? -31.042 -9.186  -2.708  1.00 46.31  ? 236 ASP E CB  1 
ATOM   10350 C CG  . ASP E 1 256 ? -32.504 -8.856  -2.376  1.00 48.93  ? 236 ASP E CG  1 
ATOM   10351 O OD1 . ASP E 1 256 ? -32.787 -8.359  -1.252  1.00 48.45  ? 236 ASP E OD1 1 
ATOM   10352 O OD2 . ASP E 1 256 ? -33.368 -9.093  -3.243  1.00 47.49  ? 236 ASP E OD2 1 
ATOM   10353 N N   . ILE E 1 257 ? -31.090 -6.063  -2.400  1.00 45.88  ? 237 ILE E N   1 
ATOM   10354 C CA  . ILE E 1 257 ? -31.258 -4.725  -2.941  1.00 43.79  ? 237 ILE E CA  1 
ATOM   10355 C C   . ILE E 1 257 ? -30.060 -3.875  -2.559  1.00 42.05  ? 237 ILE E C   1 
ATOM   10356 O O   . ILE E 1 257 ? -29.538 -3.134  -3.373  1.00 39.64  ? 237 ILE E O   1 
ATOM   10357 C CB  . ILE E 1 257 ? -32.529 -4.051  -2.385  1.00 44.03  ? 237 ILE E CB  1 
ATOM   10358 C CG1 . ILE E 1 257 ? -33.781 -4.846  -2.762  1.00 43.42  ? 237 ILE E CG1 1 
ATOM   10359 C CG2 . ILE E 1 257 ? -32.664 -2.627  -2.894  1.00 43.05  ? 237 ILE E CG2 1 
ATOM   10360 C CD1 . ILE E 1 257 ? -33.906 -5.141  -4.229  1.00 43.67  ? 237 ILE E CD1 1 
ATOM   10361 N N   . CYS E 1 258 ? -29.621 -3.990  -1.316  1.00 41.32  ? 238 CYS E N   1 
ATOM   10362 C CA  . CYS E 1 258 ? -28.464 -3.241  -0.876  1.00 41.94  ? 238 CYS E CA  1 
ATOM   10363 C C   . CYS E 1 258 ? -27.236 -3.678  -1.643  1.00 41.80  ? 238 CYS E C   1 
ATOM   10364 O O   . CYS E 1 258 ? -26.513 -2.849  -2.163  1.00 44.29  ? 238 CYS E O   1 
ATOM   10365 C CB  . CYS E 1 258 ? -28.247 -3.411  0.615   1.00 41.49  ? 238 CYS E CB  1 
ATOM   10366 S SG  . CYS E 1 258 ? -29.543 -2.602  1.588   1.00 46.36  ? 238 CYS E SG  1 
ATOM   10367 N N   . LEU E 1 259 ? -27.028 -4.982  -1.745  1.00 41.62  ? 239 LEU E N   1 
ATOM   10368 C CA  . LEU E 1 259 ? -25.870 -5.501  -2.445  1.00 39.79  ? 239 LEU E CA  1 
ATOM   10369 C C   . LEU E 1 259 ? -25.812 -5.024  -3.896  1.00 39.84  ? 239 LEU E C   1 
ATOM   10370 O O   . LEU E 1 259 ? -24.750 -4.674  -4.408  1.00 40.08  ? 239 LEU E O   1 
ATOM   10371 C CB  . LEU E 1 259 ? -25.864 -7.022  -2.427  1.00 37.94  ? 239 LEU E CB  1 
ATOM   10372 C CG  . LEU E 1 259 ? -24.684 -7.722  -3.133  1.00 38.71  ? 239 LEU E CG  1 
ATOM   10373 C CD1 . LEU E 1 259 ? -23.317 -7.264  -2.632  1.00 37.36  ? 239 LEU E CD1 1 
ATOM   10374 C CD2 . LEU E 1 259 ? -24.813 -9.224  -2.922  1.00 41.56  ? 239 LEU E CD2 1 
ATOM   10375 N N   . ALA E 1 260 ? -26.952 -5.029  -4.562  1.00 38.81  ? 240 ALA E N   1 
ATOM   10376 C CA  . ALA E 1 260 ? -26.983 -4.719  -5.985  1.00 38.44  ? 240 ALA E CA  1 
ATOM   10377 C C   . ALA E 1 260 ? -26.687 -3.231  -6.224  1.00 40.98  ? 240 ALA E C   1 
ATOM   10378 O O   . ALA E 1 260 ? -26.140 -2.856  -7.263  1.00 43.71  ? 240 ALA E O   1 
ATOM   10379 C CB  . ALA E 1 260 ? -28.332 -5.100  -6.572  1.00 35.46  ? 240 ALA E CB  1 
ATOM   10380 N N   . ILE E 1 261 ? -27.043 -2.393  -5.257  1.00 40.06  ? 241 ILE E N   1 
ATOM   10381 C CA  . ILE E 1 261 ? -26.770 -0.972  -5.359  1.00 42.43  ? 241 ILE E CA  1 
ATOM   10382 C C   . ILE E 1 261 ? -25.293 -0.698  -5.120  1.00 41.53  ? 241 ILE E C   1 
ATOM   10383 O O   . ILE E 1 261 ? -24.696 0.112   -5.808  1.00 40.10  ? 241 ILE E O   1 
ATOM   10384 C CB  . ILE E 1 261 ? -27.631 -0.175  -4.378  1.00 43.16  ? 241 ILE E CB  1 
ATOM   10385 C CG1 . ILE E 1 261 ? -29.072 -0.146  -4.861  1.00 41.78  ? 241 ILE E CG1 1 
ATOM   10386 C CG2 . ILE E 1 261 ? -27.149 1.260   -4.248  1.00 43.38  ? 241 ILE E CG2 1 
ATOM   10387 C CD1 . ILE E 1 261 ? -30.030 0.133   -3.726  1.00 44.04  ? 241 ILE E CD1 1 
ATOM   10388 N N   . MET E 1 262 ? -24.694 -1.381  -4.156  1.00 41.56  ? 242 MET E N   1 
ATOM   10389 C CA  . MET E 1 262 ? -23.258 -1.247  -3.966  1.00 41.00  ? 242 MET E CA  1 
ATOM   10390 C C   . MET E 1 262 ? -22.564 -1.714  -5.225  1.00 38.82  ? 242 MET E C   1 
ATOM   10391 O O   . MET E 1 262 ? -21.683 -1.054  -5.726  1.00 37.78  ? 242 MET E O   1 
ATOM   10392 C CB  . MET E 1 262 ? -22.775 -2.066  -2.778  1.00 41.32  ? 242 MET E CB  1 
ATOM   10393 C CG  . MET E 1 262 ? -23.246 -1.545  -1.437  1.00 41.56  ? 242 MET E CG  1 
ATOM   10394 S SD  . MET E 1 262 ? -22.941 0.211   -1.165  1.00 42.86  ? 242 MET E SD  1 
ATOM   10395 C CE  . MET E 1 262 ? -21.160 0.284   -0.912  1.00 41.92  ? 242 MET E CE  1 
ATOM   10396 N N   . ASP E 1 263 ? -22.991 -2.849  -5.749  1.00 39.81  ? 243 ASP E N   1 
ATOM   10397 C CA  . ASP E 1 263 ? -22.432 -3.345  -7.000  1.00 41.82  ? 243 ASP E CA  1 
ATOM   10398 C C   . ASP E 1 263 ? -22.467 -2.276  -8.085  1.00 41.54  ? 243 ASP E C   1 
ATOM   10399 O O   . ASP E 1 263 ? -21.520 -2.122  -8.818  1.00 39.41  ? 243 ASP E O   1 
ATOM   10400 C CB  . ASP E 1 263 ? -23.166 -4.596  -7.487  1.00 43.43  ? 243 ASP E CB  1 
ATOM   10401 C CG  . ASP E 1 263 ? -22.684 -5.893  -6.792  1.00 47.44  ? 243 ASP E CG  1 
ATOM   10402 O OD1 . ASP E 1 263 ? -21.535 -5.968  -6.288  1.00 48.99  ? 243 ASP E OD1 1 
ATOM   10403 O OD2 . ASP E 1 263 ? -23.476 -6.859  -6.758  1.00 53.46  ? 243 ASP E OD2 1 
ATOM   10404 N N   . VAL E 1 264 ? -23.556 -1.527  -8.173  1.00 43.98  ? 244 VAL E N   1 
ATOM   10405 C CA  . VAL E 1 264 ? -23.704 -0.534  -9.228  1.00 42.52  ? 244 VAL E CA  1 
ATOM   10406 C C   . VAL E 1 264 ? -22.776 0.651   -9.021  1.00 41.48  ? 244 VAL E C   1 
ATOM   10407 O O   . VAL E 1 264 ? -22.195 1.155   -9.968  1.00 39.56  ? 244 VAL E O   1 
ATOM   10408 C CB  . VAL E 1 264 ? -25.144 -0.015  -9.299  1.00 43.94  ? 244 VAL E CB  1 
ATOM   10409 C CG1 . VAL E 1 264 ? -25.243 1.173   -10.239 1.00 45.38  ? 244 VAL E CG1 1 
ATOM   10410 C CG2 . VAL E 1 264 ? -26.058 -1.100  -9.807  1.00 42.82  ? 244 VAL E CG2 1 
ATOM   10411 N N   . LEU E 1 265 ? -22.666 1.097   -7.777  1.00 39.12  ? 245 LEU E N   1 
ATOM   10412 C CA  . LEU E 1 265 ? -21.738 2.149   -7.424  1.00 38.65  ? 245 LEU E CA  1 
ATOM   10413 C C   . LEU E 1 265 ? -20.306 1.769   -7.754  1.00 38.46  ? 245 LEU E C   1 
ATOM   10414 O O   . LEU E 1 265 ? -19.549 2.572   -8.297  1.00 36.89  ? 245 LEU E O   1 
ATOM   10415 C CB  . LEU E 1 265 ? -21.829 2.447   -5.933  1.00 38.92  ? 245 LEU E CB  1 
ATOM   10416 C CG  . LEU E 1 265 ? -23.187 2.991   -5.481  1.00 40.15  ? 245 LEU E CG  1 
ATOM   10417 C CD1 . LEU E 1 265 ? -23.121 3.264   -3.996  1.00 41.60  ? 245 LEU E CD1 1 
ATOM   10418 C CD2 . LEU E 1 265 ? -23.605 4.259   -6.203  1.00 39.39  ? 245 LEU E CD2 1 
ATOM   10419 N N   . TYR E 1 266 ? -19.936 0.547   -7.402  1.00 38.42  ? 246 TYR E N   1 
ATOM   10420 C CA  . TYR E 1 266 ? -18.595 0.068   -7.660  1.00 38.61  ? 246 TYR E CA  1 
ATOM   10421 C C   . TYR E 1 266 ? -18.332 -0.020  -9.145  1.00 37.78  ? 246 TYR E C   1 
ATOM   10422 O O   . TYR E 1 266 ? -17.308 0.446   -9.631  1.00 40.26  ? 246 TYR E O   1 
ATOM   10423 C CB  . TYR E 1 266 ? -18.384 -1.295  -7.032  1.00 38.01  ? 246 TYR E CB  1 
ATOM   10424 C CG  . TYR E 1 266 ? -16.970 -1.801  -7.131  1.00 38.98  ? 246 TYR E CG  1 
ATOM   10425 C CD1 . TYR E 1 266 ? -15.883 -0.938  -7.106  1.00 40.66  ? 246 TYR E CD1 1 
ATOM   10426 C CD2 . TYR E 1 266 ? -16.718 -3.148  -7.220  1.00 41.22  ? 246 TYR E CD2 1 
ATOM   10427 C CE1 . TYR E 1 266 ? -14.591 -1.411  -7.171  1.00 38.73  ? 246 TYR E CE1 1 
ATOM   10428 C CE2 . TYR E 1 266 ? -15.434 -3.628  -7.290  1.00 40.85  ? 246 TYR E CE2 1 
ATOM   10429 C CZ  . TYR E 1 266 ? -14.378 -2.757  -7.260  1.00 39.94  ? 246 TYR E CZ  1 
ATOM   10430 O OH  . TYR E 1 266 ? -13.111 -3.260  -7.331  1.00 37.55  ? 246 TYR E OH  1 
ATOM   10431 N N   . SER E 1 267 ? -19.273 -0.600  -9.861  1.00 36.60  ? 247 SER E N   1 
ATOM   10432 C CA  . SER E 1 267 ? -19.094 -0.813  -11.272 1.00 37.46  ? 247 SER E CA  1 
ATOM   10433 C C   . SER E 1 267 ? -19.144 0.518   -12.054 1.00 36.94  ? 247 SER E C   1 
ATOM   10434 O O   . SER E 1 267 ? -18.347 0.726   -12.963 1.00 37.16  ? 247 SER E O   1 
ATOM   10435 C CB  . SER E 1 267 ? -20.081 -1.880  -11.765 1.00 37.71  ? 247 SER E CB  1 
ATOM   10436 O OG  . SER E 1 267 ? -20.868 -1.456  -12.847 1.00 42.96  ? 247 SER E OG  1 
ATOM   10437 N N   . GLU E 1 268 ? -20.029 1.432   -11.684 1.00 35.78  ? 248 GLU E N   1 
ATOM   10438 C CA  . GLU E 1 268 ? -20.090 2.712   -12.391 1.00 36.28  ? 248 GLU E CA  1 
ATOM   10439 C C   . GLU E 1 268 ? -18.887 3.582   -12.104 1.00 36.16  ? 248 GLU E C   1 
ATOM   10440 O O   . GLU E 1 268 ? -18.302 4.139   -13.012 1.00 35.48  ? 248 GLU E O   1 
ATOM   10441 C CB  . GLU E 1 268 ? -21.359 3.468   -12.046 1.00 37.86  ? 248 GLU E CB  1 
ATOM   10442 C CG  . GLU E 1 268 ? -22.565 2.963   -12.799 1.00 39.50  ? 248 GLU E CG  1 
ATOM   10443 C CD  . GLU E 1 268 ? -22.415 3.142   -14.301 1.00 45.39  ? 248 GLU E CD  1 
ATOM   10444 O OE1 . GLU E 1 268 ? -22.164 4.283   -14.776 1.00 47.83  ? 248 GLU E OE1 1 
ATOM   10445 O OE2 . GLU E 1 268 ? -22.552 2.130   -15.013 1.00 48.42  ? 248 GLU E OE2 1 
ATOM   10446 N N   . THR E 1 269 ? -18.513 3.700   -10.842 1.00 35.67  ? 249 THR E N   1 
ATOM   10447 C CA  . THR E 1 269 ? -17.423 4.585   -10.479 1.00 36.14  ? 249 THR E CA  1 
ATOM   10448 C C   . THR E 1 269 ? -16.067 3.979   -10.738 1.00 39.21  ? 249 THR E C   1 
ATOM   10449 O O   . THR E 1 269 ? -15.096 4.701   -11.013 1.00 36.46  ? 249 THR E O   1 
ATOM   10450 C CB  . THR E 1 269 ? -17.464 4.922   -8.987  1.00 36.02  ? 249 THR E CB  1 
ATOM   10451 O OG1 . THR E 1 269 ? -17.349 3.721   -8.211  1.00 34.62  ? 249 THR E OG1 1 
ATOM   10452 C CG2 . THR E 1 269 ? -18.744 5.623   -8.680  1.00 35.70  ? 249 THR E CG2 1 
ATOM   10453 N N   . GLY E 1 270 ? -15.994 2.657   -10.584 1.00 38.19  ? 250 GLY E N   1 
ATOM   10454 C CA  . GLY E 1 270 ? -14.731 1.963   -10.705 1.00 37.64  ? 250 GLY E CA  1 
ATOM   10455 C C   . GLY E 1 270 ? -13.856 2.194   -9.503  1.00 38.55  ? 250 GLY E C   1 
ATOM   10456 O O   . GLY E 1 270 ? -12.640 2.008   -9.574  1.00 37.74  ? 250 GLY E O   1 
ATOM   10457 N N   . ASP E 1 271 ? -14.478 2.549   -8.380  1.00 41.46  ? 251 ASP E N   1 
ATOM   10458 C CA  . ASP E 1 271 ? -13.729 2.931   -7.188  1.00 41.87  ? 251 ASP E CA  1 
ATOM   10459 C C   . ASP E 1 271 ? -13.955 1.960   -6.044  1.00 41.19  ? 251 ASP E C   1 
ATOM   10460 O O   . ASP E 1 271 ? -15.088 1.804   -5.550  1.00 37.00  ? 251 ASP E O   1 
ATOM   10461 C CB  . ASP E 1 271 ? -14.123 4.346   -6.767  1.00 42.86  ? 251 ASP E CB  1 
ATOM   10462 C CG  . ASP E 1 271 ? -13.224 4.912   -5.677  1.00 45.39  ? 251 ASP E CG  1 
ATOM   10463 O OD1 . ASP E 1 271 ? -12.437 4.144   -5.062  1.00 44.81  ? 251 ASP E OD1 1 
ATOM   10464 O OD2 . ASP E 1 271 ? -13.319 6.140   -5.424  1.00 48.49  ? 251 ASP E OD2 1 
ATOM   10465 N N   . SER E 1 272 ? -12.855 1.325   -5.633  1.00 42.69  ? 252 SER E N   1 
ATOM   10466 C CA  . SER E 1 272 ? -12.808 0.420   -4.478  1.00 42.80  ? 252 SER E CA  1 
ATOM   10467 C C   . SER E 1 272 ? -13.581 0.942   -3.290  1.00 41.23  ? 252 SER E C   1 
ATOM   10468 O O   . SER E 1 272 ? -14.043 0.174   -2.446  1.00 38.74  ? 252 SER E O   1 
ATOM   10469 C CB  . SER E 1 272 ? -11.360 0.224   -4.027  1.00 44.42  ? 252 SER E CB  1 
ATOM   10470 O OG  . SER E 1 272 ? -10.788 -0.893  -4.678  1.00 51.65  ? 252 SER E OG  1 
ATOM   10471 N N   . LYS E 1 273 ? -13.678 2.259   -3.211  1.00 40.07  ? 253 LYS E N   1 
ATOM   10472 C CA  . LYS E 1 273 ? -14.367 2.921   -2.120  1.00 40.12  ? 253 LYS E CA  1 
ATOM   10473 C C   . LYS E 1 273 ? -15.723 2.282   -1.896  1.00 37.06  ? 253 LYS E C   1 
ATOM   10474 O O   . LYS E 1 273 ? -16.143 2.111   -0.766  1.00 36.46  ? 253 LYS E O   1 
ATOM   10475 C CB  . LYS E 1 273 ? -14.568 4.393   -2.468  1.00 42.59  ? 253 LYS E CB  1 
ATOM   10476 C CG  . LYS E 1 273 ? -15.021 5.227   -1.297  1.00 44.48  ? 253 LYS E CG  1 
ATOM   10477 C CD  . LYS E 1 273 ? -15.651 6.524   -1.734  1.00 46.61  ? 253 LYS E CD  1 
ATOM   10478 C CE  . LYS E 1 273 ? -16.297 7.181   -0.540  1.00 44.95  ? 253 LYS E CE  1 
ATOM   10479 N NZ  . LYS E 1 273 ? -16.503 8.623   -0.789  1.00 44.38  ? 253 LYS E NZ  1 
ATOM   10480 N N   . TYR E 1 274 ? -16.385 1.928   -2.993  1.00 34.19  ? 254 TYR E N   1 
ATOM   10481 C CA  . TYR E 1 274 ? -17.725 1.388   -2.968  1.00 34.82  ? 254 TYR E CA  1 
ATOM   10482 C C   . TYR E 1 274 ? -17.833 -0.142  -3.086  1.00 34.27  ? 254 TYR E C   1 
ATOM   10483 O O   . TYR E 1 274 ? -18.894 -0.665  -3.443  1.00 34.31  ? 254 TYR E O   1 
ATOM   10484 C CB  . TYR E 1 274 ? -18.510 2.044   -4.107  1.00 38.81  ? 254 TYR E CB  1 
ATOM   10485 C CG  . TYR E 1 274 ? -18.512 3.544   -3.982  1.00 40.46  ? 254 TYR E CG  1 
ATOM   10486 C CD1 . TYR E 1 274 ? -19.280 4.179   -3.004  1.00 41.53  ? 254 TYR E CD1 1 
ATOM   10487 C CD2 . TYR E 1 274 ? -17.712 4.322   -4.797  1.00 40.64  ? 254 TYR E CD2 1 
ATOM   10488 C CE1 . TYR E 1 274 ? -19.260 5.551   -2.859  1.00 41.61  ? 254 TYR E CE1 1 
ATOM   10489 C CE2 . TYR E 1 274 ? -17.689 5.694   -4.663  1.00 42.33  ? 254 TYR E CE2 1 
ATOM   10490 C CZ  . TYR E 1 274 ? -18.462 6.297   -3.693  1.00 42.28  ? 254 TYR E CZ  1 
ATOM   10491 O OH  . TYR E 1 274 ? -18.428 7.646   -3.565  1.00 40.77  ? 254 TYR E OH  1 
ATOM   10492 N N   . ARG E 1 275 ? -16.764 -0.875  -2.793  1.00 33.21  ? 255 ARG E N   1 
ATOM   10493 C CA  . ARG E 1 275 ? -16.834 -2.334  -2.895  1.00 33.54  ? 255 ARG E CA  1 
ATOM   10494 C C   . ARG E 1 275 ? -17.747 -2.835  -1.822  1.00 33.81  ? 255 ARG E C   1 
ATOM   10495 O O   . ARG E 1 275 ? -17.669 -2.397  -0.682  1.00 36.79  ? 255 ARG E O   1 
ATOM   10496 C CB  . ARG E 1 275 ? -15.488 -3.001  -2.734  1.00 33.07  ? 255 ARG E CB  1 
ATOM   10497 C CG  . ARG E 1 275 ? -14.859 -2.779  -1.385  1.00 34.13  ? 255 ARG E CG  1 
ATOM   10498 C CD  . ARG E 1 275 ? -13.382 -3.064  -1.478  1.00 36.81  ? 255 ARG E CD  1 
ATOM   10499 N NE  . ARG E 1 275 ? -12.763 -3.008  -0.162  1.00 38.02  ? 255 ARG E NE  1 
ATOM   10500 C CZ  . ARG E 1 275 ? -12.163 -1.940  0.348   1.00 39.82  ? 255 ARG E CZ  1 
ATOM   10501 N NH1 . ARG E 1 275 ? -12.102 -0.811  -0.332  1.00 43.12  ? 255 ARG E NH1 1 
ATOM   10502 N NH2 . ARG E 1 275 ? -11.615 -1.998  1.550   1.00 38.02  ? 255 ARG E NH2 1 
ATOM   10503 N N   . PRO E 1 276 ? -18.641 -3.737  -2.182  1.00 32.20  ? 256 PRO E N   1 
ATOM   10504 C CA  . PRO E 1 276 ? -19.526 -4.285  -1.181  1.00 33.44  ? 256 PRO E CA  1 
ATOM   10505 C C   . PRO E 1 276 ? -18.791 -5.238  -0.289  1.00 33.70  ? 256 PRO E C   1 
ATOM   10506 O O   . PRO E 1 276 ? -17.890 -5.938  -0.730  1.00 36.79  ? 256 PRO E O   1 
ATOM   10507 C CB  . PRO E 1 276 ? -20.580 -5.031  -1.991  1.00 33.25  ? 256 PRO E CB  1 
ATOM   10508 C CG  . PRO E 1 276 ? -20.049 -5.128  -3.369  1.00 32.56  ? 256 PRO E CG  1 
ATOM   10509 C CD  . PRO E 1 276 ? -19.074 -4.024  -3.548  1.00 32.41  ? 256 PRO E CD  1 
ATOM   10510 N N   . HIS E 1 277 ? -19.176 -5.256  0.964   1.00 35.08  ? 257 HIS E N   1 
ATOM   10511 C CA  . HIS E 1 277 ? -18.509 -6.096  1.911   1.00 37.30  ? 257 HIS E CA  1 
ATOM   10512 C C   . HIS E 1 277 ? -18.795 -7.589  1.681   1.00 37.89  ? 257 HIS E C   1 
ATOM   10513 O O   . HIS E 1 277 ? -19.870 -8.016  1.285   1.00 39.60  ? 257 HIS E O   1 
ATOM   10514 C CB  . HIS E 1 277 ? -18.856 -5.690  3.337   1.00 37.81  ? 257 HIS E CB  1 
ATOM   10515 C CG  . HIS E 1 277 ? -17.829 -6.132  4.324   1.00 40.09  ? 257 HIS E CG  1 
ATOM   10516 N ND1 . HIS E 1 277 ? -17.686 -7.448  4.705   1.00 42.05  ? 257 HIS E ND1 1 
ATOM   10517 C CD2 . HIS E 1 277 ? -16.854 -5.447  4.962   1.00 41.23  ? 257 HIS E CD2 1 
ATOM   10518 C CE1 . HIS E 1 277 ? -16.680 -7.551  5.556   1.00 42.68  ? 257 HIS E CE1 1 
ATOM   10519 N NE2 . HIS E 1 277 ? -16.162 -6.350  5.734   1.00 42.42  ? 257 HIS E NE2 1 
ATOM   10520 N N   . THR E 1 278 ? -17.784 -8.361  1.982   1.00 38.97  ? 258 THR E N   1 
ATOM   10521 C CA  . THR E 1 278 ? -17.727 -9.769  1.694   1.00 39.53  ? 258 THR E CA  1 
ATOM   10522 C C   . THR E 1 278 ? -18.802 -10.539 2.511   1.00 40.67  ? 258 THR E C   1 
ATOM   10523 O O   . THR E 1 278 ? -19.466 -11.444 2.014   1.00 40.90  ? 258 THR E O   1 
ATOM   10524 C CB  . THR E 1 278 ? -16.242 -10.158 1.917   1.00 40.04  ? 258 THR E CB  1 
ATOM   10525 O OG1 . THR E 1 278 ? -15.755 -10.819 0.760   1.00 43.83  ? 258 THR E OG1 1 
ATOM   10526 C CG2 . THR E 1 278 ? -15.973 -10.942 3.170   1.00 41.31  ? 258 THR E CG2 1 
ATOM   10527 N N   . LEU E 1 279 ? -19.004 -10.118 3.746   1.00 41.99  ? 259 LEU E N   1 
ATOM   10528 C CA  . LEU E 1 279 ? -20.063 -10.639 4.591   1.00 43.91  ? 259 LEU E CA  1 
ATOM   10529 C C   . LEU E 1 279 ? -21.452 -10.408 3.993   1.00 44.95  ? 259 LEU E C   1 
ATOM   10530 O O   . LEU E 1 279 ? -22.316 -11.285 4.039   1.00 48.15  ? 259 LEU E O   1 
ATOM   10531 C CB  . LEU E 1 279 ? -19.973 -9.965  5.963   1.00 45.77  ? 259 LEU E CB  1 
ATOM   10532 C CG  . LEU E 1 279 ? -20.262 -10.836 7.177   1.00 48.90  ? 259 LEU E CG  1 
ATOM   10533 C CD1 . LEU E 1 279 ? -20.291 -10.009 8.442   1.00 50.20  ? 259 LEU E CD1 1 
ATOM   10534 C CD2 . LEU E 1 279 ? -21.606 -11.448 7.013   1.00 52.93  ? 259 LEU E CD2 1 
ATOM   10535 N N   . LEU E 1 280 ? -21.671 -9.232  3.421   1.00 45.54  ? 260 LEU E N   1 
ATOM   10536 C CA  . LEU E 1 280 ? -22.971 -8.934  2.837   1.00 44.42  ? 260 LEU E CA  1 
ATOM   10537 C C   . LEU E 1 280 ? -23.245 -9.911  1.714   1.00 42.83  ? 260 LEU E C   1 
ATOM   10538 O O   . LEU E 1 280 ? -24.365 -10.372 1.516   1.00 40.34  ? 260 LEU E O   1 
ATOM   10539 C CB  . LEU E 1 280 ? -23.007 -7.508  2.298   1.00 46.80  ? 260 LEU E CB  1 
ATOM   10540 C CG  . LEU E 1 280 ? -24.277 -7.130  1.527   1.00 48.78  ? 260 LEU E CG  1 
ATOM   10541 C CD1 . LEU E 1 280 ? -25.525 -7.218  2.390   1.00 48.93  ? 260 LEU E CD1 1 
ATOM   10542 C CD2 . LEU E 1 280 ? -24.149 -5.727  0.974   1.00 50.72  ? 260 LEU E CD2 1 
ATOM   10543 N N   . LYS E 1 281 ? -22.196 -10.206 0.964   1.00 43.22  ? 261 LYS E N   1 
ATOM   10544 C CA  . LYS E 1 281 ? -22.279 -11.155 -0.138  1.00 44.03  ? 261 LYS E CA  1 
ATOM   10545 C C   . LYS E 1 281 ? -22.709 -12.520 0.328   1.00 40.28  ? 261 LYS E C   1 
ATOM   10546 O O   . LYS E 1 281 ? -23.482 -13.208 -0.322  1.00 42.69  ? 261 LYS E O   1 
ATOM   10547 C CB  . LYS E 1 281 ? -20.929 -11.262 -0.818  1.00 44.66  ? 261 LYS E CB  1 
ATOM   10548 C CG  . LYS E 1 281 ? -20.800 -10.270 -1.951  1.00 43.43  ? 261 LYS E CG  1 
ATOM   10549 C CD  . LYS E 1 281 ? -19.348 -10.056 -2.294  1.00 44.66  ? 261 LYS E CD  1 
ATOM   10550 C CE  . LYS E 1 281 ? -19.201 -8.949  -3.312  1.00 43.97  ? 261 LYS E CE  1 
ATOM   10551 N NZ  . LYS E 1 281 ? -18.192 -9.335  -4.320  1.00 42.50  ? 261 LYS E NZ  1 
ATOM   10552 N N   . LYS E 1 282 ? -22.201 -12.881 1.485   1.00 38.93  ? 262 LYS E N   1 
ATOM   10553 C CA  . LYS E 1 282 ? -22.495 -14.140 2.096   1.00 38.69  ? 262 LYS E CA  1 
ATOM   10554 C C   . LYS E 1 282 ? -23.926 -14.260 2.592   1.00 38.97  ? 262 LYS E C   1 
ATOM   10555 O O   . LYS E 1 282 ? -24.581 -15.256 2.321   1.00 42.49  ? 262 LYS E O   1 
ATOM   10556 C CB  . LYS E 1 282 ? -21.553 -14.359 3.255   1.00 38.19  ? 262 LYS E CB  1 
ATOM   10557 C CG  . LYS E 1 282 ? -21.667 -15.770 3.787   1.00 37.96  ? 262 LYS E CG  1 
ATOM   10558 C CD  . LYS E 1 282 ? -20.312 -16.312 4.164   1.00 36.35  ? 262 LYS E CD  1 
ATOM   10559 C CE  . LYS E 1 282 ? -20.048 -15.966 5.599   1.00 37.30  ? 262 LYS E CE  1 
ATOM   10560 N NZ  . LYS E 1 282 ? -18.602 -16.137 5.854   1.00 38.55  ? 262 LYS E NZ  1 
ATOM   10561 N N   . TYR E 1 283 ? -24.394 -13.271 3.342   1.00 37.21  ? 263 TYR E N   1 
ATOM   10562 C CA  . TYR E 1 283 ? -25.799 -13.242 3.730   1.00 38.48  ? 263 TYR E CA  1 
ATOM   10563 C C   . TYR E 1 283 ? -26.730 -13.371 2.542   1.00 39.98  ? 263 TYR E C   1 
ATOM   10564 O O   . TYR E 1 283 ? -27.708 -14.116 2.592   1.00 44.46  ? 263 TYR E O   1 
ATOM   10565 C CB  . TYR E 1 283 ? -26.153 -11.956 4.456   1.00 39.25  ? 263 TYR E CB  1 
ATOM   10566 C CG  . TYR E 1 283 ? -25.898 -12.015 5.929   1.00 40.00  ? 263 TYR E CG  1 
ATOM   10567 C CD1 . TYR E 1 283 ? -24.610 -11.968 6.422   1.00 39.78  ? 263 TYR E CD1 1 
ATOM   10568 C CD2 . TYR E 1 283 ? -26.951 -12.113 6.842   1.00 40.64  ? 263 TYR E CD2 1 
ATOM   10569 C CE1 . TYR E 1 283 ? -24.366 -12.020 7.787   1.00 39.59  ? 263 TYR E CE1 1 
ATOM   10570 C CE2 . TYR E 1 283 ? -26.709 -12.154 8.202   1.00 40.93  ? 263 TYR E CE2 1 
ATOM   10571 C CZ  . TYR E 1 283 ? -25.404 -12.117 8.657   1.00 42.68  ? 263 TYR E CZ  1 
ATOM   10572 O OH  . TYR E 1 283 ? -25.109 -12.160 9.992   1.00 45.10  ? 263 TYR E OH  1 
ATOM   10573 N N   . VAL E 1 284 ? -26.446 -12.638 1.479   1.00 41.65  ? 264 VAL E N   1 
ATOM   10574 C CA  . VAL E 1 284 ? -27.326 -12.662 0.325   1.00 41.60  ? 264 VAL E CA  1 
ATOM   10575 C C   . VAL E 1 284 ? -27.317 -14.048 -0.307  1.00 43.11  ? 264 VAL E C   1 
ATOM   10576 O O   . VAL E 1 284 ? -28.357 -14.583 -0.705  1.00 41.76  ? 264 VAL E O   1 
ATOM   10577 C CB  . VAL E 1 284 ? -26.893 -11.614 -0.715  1.00 41.30  ? 264 VAL E CB  1 
ATOM   10578 C CG1 . VAL E 1 284 ? -27.616 -11.828 -2.047  1.00 38.15  ? 264 VAL E CG1 1 
ATOM   10579 C CG2 . VAL E 1 284 ? -27.142 -10.216 -0.175  1.00 41.23  ? 264 VAL E CG2 1 
ATOM   10580 N N   . ARG E 1 285 ? -26.124 -14.611 -0.420  1.00 44.53  ? 265 ARG E N   1 
ATOM   10581 C CA  . ARG E 1 285 ? -25.961 -15.922 -1.019  1.00 43.88  ? 265 ARG E CA  1 
ATOM   10582 C C   . ARG E 1 285 ? -26.734 -17.001 -0.286  1.00 44.51  ? 265 ARG E C   1 
ATOM   10583 O O   . ARG E 1 285 ? -27.220 -17.941 -0.906  1.00 43.74  ? 265 ARG E O   1 
ATOM   10584 C CB  . ARG E 1 285 ? -24.497 -16.291 -1.035  1.00 44.50  ? 265 ARG E CB  1 
ATOM   10585 C CG  . ARG E 1 285 ? -23.844 -15.907 -2.334  1.00 43.14  ? 265 ARG E CG  1 
ATOM   10586 C CD  . ARG E 1 285 ? -22.378 -15.752 -2.115  1.00 41.30  ? 265 ARG E CD  1 
ATOM   10587 N NE  . ARG E 1 285 ? -21.708 -15.374 -3.335  1.00 42.84  ? 265 ARG E NE  1 
ATOM   10588 C CZ  . ARG E 1 285 ? -20.426 -15.040 -3.386  1.00 41.78  ? 265 ARG E CZ  1 
ATOM   10589 N NH1 . ARG E 1 285 ? -19.685 -15.050 -2.288  1.00 43.32  ? 265 ARG E NH1 1 
ATOM   10590 N NH2 . ARG E 1 285 ? -19.884 -14.700 -4.532  1.00 38.61  ? 265 ARG E NH2 1 
ATOM   10591 N N   . ALA E 1 286 ? -26.836 -16.846 1.032   1.00 44.35  ? 266 ALA E N   1 
ATOM   10592 C CA  . ALA E 1 286 ? -27.586 -17.759 1.888   1.00 42.84  ? 266 ALA E CA  1 
ATOM   10593 C C   . ALA E 1 286 ? -29.101 -17.583 1.796   1.00 44.22  ? 266 ALA E C   1 
ATOM   10594 O O   . ALA E 1 286 ? -29.839 -18.305 2.453   1.00 47.41  ? 266 ALA E O   1 
ATOM   10595 C CB  . ALA E 1 286 ? -27.166 -17.551 3.326   1.00 43.03  ? 266 ALA E CB  1 
ATOM   10596 N N   . GLY E 1 287 ? -29.563 -16.605 1.025   1.00 41.31  ? 267 GLY E N   1 
ATOM   10597 C CA  . GLY E 1 287 ? -30.977 -16.286 0.973   1.00 40.69  ? 267 GLY E CA  1 
ATOM   10598 C C   . GLY E 1 287 ? -31.471 -15.566 2.222   1.00 42.37  ? 267 GLY E C   1 
ATOM   10599 O O   . GLY E 1 287 ? -32.682 -15.449 2.422   1.00 44.15  ? 267 GLY E O   1 
ATOM   10600 N N   . TRP E 1 288 ? -30.550 -15.085 3.055   1.00 40.35  ? 268 TRP E N   1 
ATOM   10601 C CA  . TRP E 1 288 ? -30.906 -14.352 4.267   1.00 42.74  ? 268 TRP E CA  1 
ATOM   10602 C C   . TRP E 1 288 ? -31.013 -12.882 3.976   1.00 43.13  ? 268 TRP E C   1 
ATOM   10603 O O   . TRP E 1 288 ? -30.162 -12.099 4.391   1.00 42.41  ? 268 TRP E O   1 
ATOM   10604 C CB  . TRP E 1 288 ? -29.850 -14.547 5.346   1.00 42.41  ? 268 TRP E CB  1 
ATOM   10605 C CG  . TRP E 1 288 ? -29.743 -15.930 5.792   1.00 41.83  ? 268 TRP E CG  1 
ATOM   10606 C CD1 . TRP E 1 288 ? -30.405 -17.014 5.287   1.00 42.02  ? 268 TRP E CD1 1 
ATOM   10607 C CD2 . TRP E 1 288 ? -28.868 -16.423 6.801   1.00 39.52  ? 268 TRP E CD2 1 
ATOM   10608 N NE1 . TRP E 1 288 ? -30.011 -18.146 5.944   1.00 43.11  ? 268 TRP E NE1 1 
ATOM   10609 C CE2 . TRP E 1 288 ? -29.066 -17.814 6.876   1.00 40.24  ? 268 TRP E CE2 1 
ATOM   10610 C CE3 . TRP E 1 288 ? -27.938 -15.821 7.655   1.00 39.85  ? 268 TRP E CE3 1 
ATOM   10611 C CZ2 . TRP E 1 288 ? -28.382 -18.616 7.778   1.00 41.24  ? 268 TRP E CZ2 1 
ATOM   10612 C CZ3 . TRP E 1 288 ? -27.254 -16.613 8.558   1.00 40.79  ? 268 TRP E CZ3 1 
ATOM   10613 C CH2 . TRP E 1 288 ? -27.474 -18.003 8.610   1.00 42.40  ? 268 TRP E CH2 1 
ATOM   10614 N N   . LEU E 1 289 ? -32.087 -12.509 3.303   1.00 44.25  ? 269 LEU E N   1 
ATOM   10615 C CA  . LEU E 1 289 ? -32.211 -11.174 2.754   1.00 45.74  ? 269 LEU E CA  1 
ATOM   10616 C C   . LEU E 1 289 ? -32.844 -10.148 3.684   1.00 48.38  ? 269 LEU E C   1 
ATOM   10617 O O   . LEU E 1 289 ? -32.988 -8.974  3.316   1.00 48.33  ? 269 LEU E O   1 
ATOM   10618 C CB  . LEU E 1 289 ? -33.009 -11.268 1.471   1.00 46.09  ? 269 LEU E CB  1 
ATOM   10619 C CG  . LEU E 1 289 ? -32.541 -12.358 0.507   1.00 45.16  ? 269 LEU E CG  1 
ATOM   10620 C CD1 . LEU E 1 289 ? -33.352 -12.282 -0.779  1.00 43.40  ? 269 LEU E CD1 1 
ATOM   10621 C CD2 . LEU E 1 289 ? -31.058 -12.226 0.201   1.00 45.35  ? 269 LEU E CD2 1 
ATOM   10622 N N   . GLY E 1 290 ? -33.203 -10.586 4.885   1.00 53.54  ? 270 GLY E N   1 
ATOM   10623 C CA  . GLY E 1 290 ? -33.893 -9.742  5.863   1.00 55.27  ? 270 GLY E CA  1 
ATOM   10624 C C   . GLY E 1 290 ? -35.364 -10.104 5.978   1.00 55.80  ? 270 GLY E C   1 
ATOM   10625 O O   . GLY E 1 290 ? -35.751 -11.259 5.800   1.00 57.79  ? 270 GLY E O   1 
ATOM   10626 N N   . ARG E 1 291 ? -36.182 -9.103  6.263   1.00 55.90  ? 271 ARG E N   1 
ATOM   10627 C CA  . ARG E 1 291 ? -37.596 -9.302  6.569   1.00 58.99  ? 271 ARG E CA  1 
ATOM   10628 C C   . ARG E 1 291 ? -38.346 -10.100 5.548   1.00 59.72  ? 271 ARG E C   1 
ATOM   10629 O O   . ARG E 1 291 ? -39.048 -11.041 5.898   1.00 66.42  ? 271 ARG E O   1 
ATOM   10630 C CB  . ARG E 1 291 ? -38.300 -7.965  6.706   1.00 60.92  ? 271 ARG E CB  1 
ATOM   10631 C CG  . ARG E 1 291 ? -38.017 -7.333  8.037   1.00 68.01  ? 271 ARG E CG  1 
ATOM   10632 C CD  . ARG E 1 291 ? -38.958 -6.190  8.349   1.00 76.07  ? 271 ARG E CD  1 
ATOM   10633 N NE  . ARG E 1 291 ? -38.301 -5.283  9.288   1.00 84.74  ? 271 ARG E NE  1 
ATOM   10634 C CZ  . ARG E 1 291 ? -38.846 -4.194  9.822   1.00 86.42  ? 271 ARG E CZ  1 
ATOM   10635 N NH1 . ARG E 1 291 ? -40.097 -3.837  9.527   1.00 87.74  ? 271 ARG E NH1 1 
ATOM   10636 N NH2 . ARG E 1 291 ? -38.119 -3.453  10.653  1.00 84.53  ? 271 ARG E NH2 1 
ATOM   10637 N N   . LYS E 1 292 ? -38.211 -9.732  4.284   1.00 60.16  ? 272 LYS E N   1 
ATOM   10638 C CA  . LYS E 1 292 ? -38.912 -10.451 3.226   1.00 60.34  ? 272 LYS E CA  1 
ATOM   10639 C C   . LYS E 1 292 ? -38.591 -11.942 3.173   1.00 59.53  ? 272 LYS E C   1 
ATOM   10640 O O   . LYS E 1 292 ? -39.134 -12.662 2.336   1.00 60.57  ? 272 LYS E O   1 
ATOM   10641 C CB  . LYS E 1 292 ? -38.569 -9.869  1.866   1.00 62.60  ? 272 LYS E CB  1 
ATOM   10642 C CG  . LYS E 1 292 ? -37.147 -10.169 1.420   1.00 66.00  ? 272 LYS E CG  1 
ATOM   10643 C CD  . LYS E 1 292 ? -36.980 -9.846  -0.051  1.00 67.20  ? 272 LYS E CD  1 
ATOM   10644 C CE  . LYS E 1 292 ? -35.775 -8.962  -0.283  1.00 66.13  ? 272 LYS E CE  1 
ATOM   10645 N NZ  . LYS E 1 292 ? -35.820 -8.496  -1.685  1.00 68.66  ? 272 LYS E NZ  1 
ATOM   10646 N N   . SER E 1 293 ? -37.670 -12.409 4.000   1.00 55.79  ? 273 SER E N   1 
ATOM   10647 C CA  . SER E 1 293 ? -37.382 -13.823 4.001   1.00 55.42  ? 273 SER E CA  1 
ATOM   10648 C C   . SER E 1 293 ? -37.253 -14.411 5.400   1.00 52.58  ? 273 SER E C   1 
ATOM   10649 O O   . SER E 1 293 ? -36.812 -15.535 5.560   1.00 50.16  ? 273 SER E O   1 
ATOM   10650 C CB  . SER E 1 293 ? -36.131 -14.079 3.151   1.00 57.09  ? 273 SER E CB  1 
ATOM   10651 O OG  . SER E 1 293 ? -35.006 -13.385 3.653   1.00 58.24  ? 273 SER E OG  1 
ATOM   10652 N N   . GLY E 1 294 ? -37.653 -13.660 6.417   1.00 52.50  ? 274 GLY E N   1 
ATOM   10653 C CA  . GLY E 1 294 ? -37.614 -14.160 7.788   1.00 53.59  ? 274 GLY E CA  1 
ATOM   10654 C C   . GLY E 1 294 ? -36.268 -14.053 8.470   1.00 53.93  ? 274 GLY E C   1 
ATOM   10655 O O   . GLY E 1 294 ? -36.154 -14.314 9.674   1.00 54.02  ? 274 GLY E O   1 
ATOM   10656 N N   . LYS E 1 295 ? -35.248 -13.642 7.719   1.00 54.29  ? 275 LYS E N   1 
ATOM   10657 C CA  . LYS E 1 295 ? -33.894 -13.640 8.240   1.00 51.02  ? 275 LYS E CA  1 
ATOM   10658 C C   . LYS E 1 295 ? -32.938 -12.759 7.455   1.00 47.42  ? 275 LYS E C   1 
ATOM   10659 O O   . LYS E 1 295 ? -32.849 -12.821 6.233   1.00 42.35  ? 275 LYS E O   1 
ATOM   10660 C CB  . LYS E 1 295 ? -33.347 -15.058 8.254   1.00 51.18  ? 275 LYS E CB  1 
ATOM   10661 C CG  . LYS E 1 295 ? -32.399 -15.281 9.406   1.00 53.61  ? 275 LYS E CG  1 
ATOM   10662 C CD  . LYS E 1 295 ? -31.528 -16.485 9.149   1.00 54.12  ? 275 LYS E CD  1 
ATOM   10663 C CE  . LYS E 1 295 ? -30.892 -16.964 10.433  1.00 54.79  ? 275 LYS E CE  1 
ATOM   10664 N NZ  . LYS E 1 295 ? -29.946 -15.938 10.929  1.00 55.43  ? 275 LYS E NZ  1 
ATOM   10665 N N   . GLY E 1 296 ? -32.221 -11.936 8.190   1.00 45.86  ? 276 GLY E N   1 
ATOM   10666 C CA  . GLY E 1 296 ? -31.145 -11.151 7.642   1.00 47.13  ? 276 GLY E CA  1 
ATOM   10667 C C   . GLY E 1 296 ? -30.175 -11.050 8.778   1.00 45.48  ? 276 GLY E C   1 
ATOM   10668 O O   . GLY E 1 296 ? -29.870 -12.043 9.420   1.00 47.80  ? 276 GLY E O   1 
ATOM   10669 N N   . PHE E 1 297 ? -29.718 -9.850  9.063   1.00 45.96  ? 277 PHE E N   1 
ATOM   10670 C CA  . PHE E 1 297 ? -28.884 -9.653  10.234  1.00 51.78  ? 277 PHE E CA  1 
ATOM   10671 C C   . PHE E 1 297 ? -29.642 -9.943  11.518  1.00 53.48  ? 277 PHE E C   1 
ATOM   10672 O O   . PHE E 1 297 ? -29.023 -10.253 12.535  1.00 53.97  ? 277 PHE E O   1 
ATOM   10673 C CB  . PHE E 1 297 ? -28.359 -8.229  10.272  1.00 52.79  ? 277 PHE E CB  1 
ATOM   10674 C CG  . PHE E 1 297 ? -27.397 -7.944  9.184   1.00 53.99  ? 277 PHE E CG  1 
ATOM   10675 C CD1 . PHE E 1 297 ? -26.098 -8.407  9.263   1.00 55.31  ? 277 PHE E CD1 1 
ATOM   10676 C CD2 . PHE E 1 297 ? -27.797 -7.254  8.058   1.00 53.19  ? 277 PHE E CD2 1 
ATOM   10677 C CE1 . PHE E 1 297 ? -25.205 -8.161  8.240   1.00 53.06  ? 277 PHE E CE1 1 
ATOM   10678 C CE2 . PHE E 1 297 ? -26.909 -7.008  7.034   1.00 51.10  ? 277 PHE E CE2 1 
ATOM   10679 C CZ  . PHE E 1 297 ? -25.615 -7.460  7.124   1.00 50.05  ? 277 PHE E CZ  1 
ATOM   10680 N N   . TYR E 1 298 ? -30.968 -9.796  11.458  1.00 55.32  ? 278 TYR E N   1 
ATOM   10681 C CA  . TYR E 1 298 ? -31.876 -10.164 12.542  1.00 54.07  ? 278 TYR E CA  1 
ATOM   10682 C C   . TYR E 1 298 ? -32.766 -11.313 12.110  1.00 57.61  ? 278 TYR E C   1 
ATOM   10683 O O   . TYR E 1 298 ? -32.941 -11.577 10.922  1.00 56.34  ? 278 TYR E O   1 
ATOM   10684 C CB  . TYR E 1 298 ? -32.817 -9.017  12.880  1.00 53.84  ? 278 TYR E CB  1 
ATOM   10685 C CG  . TYR E 1 298 ? -32.185 -7.831  13.523  1.00 52.30  ? 278 TYR E CG  1 
ATOM   10686 C CD1 . TYR E 1 298 ? -31.663 -6.809  12.759  1.00 51.69  ? 278 TYR E CD1 1 
ATOM   10687 C CD2 . TYR E 1 298 ? -32.158 -7.707  14.898  1.00 52.95  ? 278 TYR E CD2 1 
ATOM   10688 C CE1 . TYR E 1 298 ? -31.095 -5.702  13.351  1.00 53.58  ? 278 TYR E CE1 1 
ATOM   10689 C CE2 . TYR E 1 298 ? -31.601 -6.598  15.506  1.00 53.37  ? 278 TYR E CE2 1 
ATOM   10690 C CZ  . TYR E 1 298 ? -31.068 -5.598  14.728  1.00 54.47  ? 278 TYR E CZ  1 
ATOM   10691 O OH  . TYR E 1 298 ? -30.497 -4.492  15.318  1.00 54.67  ? 278 TYR E OH  1 
ATOM   10692 N N   . ASP E 1 299 ? -33.388 -11.929 13.107  1.00 66.69  ? 279 ASP E N   1 
ATOM   10693 C CA  . ASP E 1 299 ? -34.320 -13.039 12.932  1.00 68.90  ? 279 ASP E CA  1 
ATOM   10694 C C   . ASP E 1 299 ? -35.774 -12.562 13.031  1.00 68.82  ? 279 ASP E C   1 
ATOM   10695 O O   . ASP E 1 299 ? -36.121 -11.802 13.930  1.00 68.95  ? 279 ASP E O   1 
ATOM   10696 C CB  . ASP E 1 299 ? -34.063 -14.055 14.036  1.00 70.80  ? 279 ASP E CB  1 
ATOM   10697 C CG  . ASP E 1 299 ? -33.868 -15.438 13.511  1.00 71.98  ? 279 ASP E CG  1 
ATOM   10698 O OD1 . ASP E 1 299 ? -34.823 -15.973 12.916  1.00 70.98  ? 279 ASP E OD1 1 
ATOM   10699 O OD2 . ASP E 1 299 ? -32.761 -15.986 13.698  1.00 74.58  ? 279 ASP E OD2 1 
ATOM   10700 N N   . TYR E 1 300 ? -36.623 -13.033 12.126  1.00 71.13  ? 280 TYR E N   1 
ATOM   10701 C CA  . TYR E 1 300 ? -38.015 -12.575 12.049  1.00 74.15  ? 280 TYR E CA  1 
ATOM   10702 C C   . TYR E 1 300 ? -39.002 -13.738 12.209  1.00 81.55  ? 280 TYR E C   1 
ATOM   10703 O O   . TYR E 1 300 ? -39.953 -13.890 11.437  1.00 75.09  ? 280 TYR E O   1 
ATOM   10704 C CB  . TYR E 1 300 ? -38.225 -11.839 10.724  1.00 70.92  ? 280 TYR E CB  1 
ATOM   10705 C CG  . TYR E 1 300 ? -37.330 -10.632 10.621  1.00 67.90  ? 280 TYR E CG  1 
ATOM   10706 C CD1 . TYR E 1 300 ? -36.163 -10.654 9.843   1.00 64.82  ? 280 TYR E CD1 1 
ATOM   10707 C CD2 . TYR E 1 300 ? -37.625 -9.476  11.344  1.00 63.19  ? 280 TYR E CD2 1 
ATOM   10708 C CE1 . TYR E 1 300 ? -35.329 -9.552  9.777   1.00 61.02  ? 280 TYR E CE1 1 
ATOM   10709 C CE2 . TYR E 1 300 ? -36.803 -8.372  11.285  1.00 63.06  ? 280 TYR E CE2 1 
ATOM   10710 C CZ  . TYR E 1 300 ? -35.659 -8.413  10.503  1.00 63.33  ? 280 TYR E CZ  1 
ATOM   10711 O OH  . TYR E 1 300 ? -34.855 -7.305  10.460  1.00 61.73  ? 280 TYR E OH  1 
ATOM   10712 N N   . SER E 1 301 ? -38.762 -14.549 13.235  1.00 88.51  ? 281 SER E N   1 
ATOM   10713 C CA  . SER E 1 301 ? -39.494 -15.803 13.440  1.00 90.33  ? 281 SER E CA  1 
ATOM   10714 C C   . SER E 1 301 ? -40.529 -15.683 14.550  1.00 88.82  ? 281 SER E C   1 
ATOM   10715 O O   . SER E 1 301 ? -41.716 -15.517 14.271  1.00 89.04  ? 281 SER E O   1 
ATOM   10716 C CB  . SER E 1 301 ? -38.518 -16.943 13.752  1.00 90.86  ? 281 SER E CB  1 
ATOM   10717 O OG  . SER E 1 301 ? -37.237 -16.445 14.102  1.00 90.25  ? 281 SER E OG  1 
ATOM   10718 N N   . SER F 1 12  ? 2.509   57.036  -15.149 1.00 42.56  ? -8  SER F N   1 
ATOM   10719 C CA  . SER F 1 12  ? 1.623   55.834  -15.316 1.00 40.69  ? -8  SER F CA  1 
ATOM   10720 C C   . SER F 1 12  ? 0.901   55.823  -16.676 1.00 42.96  ? -8  SER F C   1 
ATOM   10721 O O   . SER F 1 12  ? -0.029  55.010  -16.911 1.00 41.55  ? -8  SER F O   1 
ATOM   10722 C CB  . SER F 1 12  ? 0.557   55.786  -14.202 1.00 40.73  ? -8  SER F CB  1 
ATOM   10723 O OG  . SER F 1 12  ? -0.783  56.000  -14.729 1.00 38.38  ? -8  SER F OG  1 
ATOM   10724 N N   . GLY F 1 13  ? 1.319   56.720  -17.571 1.00 43.84  ? -7  GLY F N   1 
ATOM   10725 C CA  . GLY F 1 13  ? 0.708   56.838  -18.877 1.00 39.62  ? -7  GLY F CA  1 
ATOM   10726 C C   . GLY F 1 13  ? 1.242   55.736  -19.767 1.00 41.66  ? -7  GLY F C   1 
ATOM   10727 O O   . GLY F 1 13  ? 0.674   55.472  -20.837 1.00 41.70  ? -7  GLY F O   1 
ATOM   10728 N N   . LEU F 1 14  ? 2.329   55.082  -19.342 1.00 39.05  ? -6  LEU F N   1 
ATOM   10729 C CA  . LEU F 1 14  ? 2.899   54.019  -20.159 1.00 37.60  ? -6  LEU F CA  1 
ATOM   10730 C C   . LEU F 1 14  ? 2.197   52.691  -19.923 1.00 41.85  ? -6  LEU F C   1 
ATOM   10731 O O   . LEU F 1 14  ? 2.401   51.732  -20.668 1.00 42.73  ? -6  LEU F O   1 
ATOM   10732 C CB  . LEU F 1 14  ? 4.391   53.894  -19.895 1.00 33.02  ? -6  LEU F CB  1 
ATOM   10733 C CG  . LEU F 1 14  ? 5.245   55.007  -20.509 1.00 32.60  ? -6  LEU F CG  1 
ATOM   10734 C CD1 . LEU F 1 14  ? 6.717   54.636  -20.444 1.00 31.96  ? -6  LEU F CD1 1 
ATOM   10735 C CD2 . LEU F 1 14  ? 4.864   55.208  -21.964 1.00 31.32  ? -6  LEU F CD2 1 
ATOM   10736 N N   . VAL F 1 15  ? 1.351   52.640  -18.906 1.00 48.17  ? -5  VAL F N   1 
ATOM   10737 C CA  . VAL F 1 15  ? 0.633   51.432  -18.594 1.00 51.74  ? -5  VAL F CA  1 
ATOM   10738 C C   . VAL F 1 15  ? -0.594  51.307  -19.461 1.00 50.97  ? -5  VAL F C   1 
ATOM   10739 O O   . VAL F 1 15  ? -1.394  52.224  -19.510 1.00 55.32  ? -5  VAL F O   1 
ATOM   10740 C CB  . VAL F 1 15  ? 0.159   51.452  -17.139 1.00 56.34  ? -5  VAL F CB  1 
ATOM   10741 C CG1 . VAL F 1 15  ? -0.783  50.289  -16.863 1.00 57.67  ? -5  VAL F CG1 1 
ATOM   10742 C CG2 . VAL F 1 15  ? 1.346   51.381  -16.209 1.00 57.13  ? -5  VAL F CG2 1 
ATOM   10743 N N   . PRO F 1 16  ? -0.776  50.144  -20.094 1.00 53.84  ? -4  PRO F N   1 
ATOM   10744 C CA  . PRO F 1 16  ? -1.944  49.881  -20.924 1.00 54.64  ? -4  PRO F CA  1 
ATOM   10745 C C   . PRO F 1 16  ? -3.218  50.283  -20.218 1.00 54.01  ? -4  PRO F C   1 
ATOM   10746 O O   . PRO F 1 16  ? -3.344  50.098  -19.010 1.00 56.23  ? -4  PRO F O   1 
ATOM   10747 C CB  . PRO F 1 16  ? -1.910  48.363  -21.117 1.00 52.89  ? -4  PRO F CB  1 
ATOM   10748 C CG  . PRO F 1 16  ? -0.975  47.867  -20.079 1.00 52.75  ? -4  PRO F CG  1 
ATOM   10749 C CD  . PRO F 1 16  ? 0.033   48.931  -19.921 1.00 52.96  ? -4  PRO F CD  1 
ATOM   10750 N N   . ARG F 1 17  ? -4.167  50.821  -20.962 1.00 56.09  ? -3  ARG F N   1 
ATOM   10751 C CA  . ARG F 1 17  ? -5.298  51.450  -20.321 1.00 60.48  ? -3  ARG F CA  1 
ATOM   10752 C C   . ARG F 1 17  ? -6.278  50.406  -19.844 1.00 57.56  ? -3  ARG F C   1 
ATOM   10753 O O   . ARG F 1 17  ? -7.035  50.643  -18.905 1.00 54.76  ? -3  ARG F O   1 
ATOM   10754 C CB  . ARG F 1 17  ? -5.972  52.423  -21.269 1.00 71.34  ? -3  ARG F CB  1 
ATOM   10755 C CG  . ARG F 1 17  ? -7.276  51.900  -21.875 1.00 84.89  ? -3  ARG F CG  1 
ATOM   10756 C CD  . ARG F 1 17  ? -8.482  52.746  -21.470 1.00 93.36  ? -3  ARG F CD  1 
ATOM   10757 N NE  . ARG F 1 17  ? -8.224  54.182  -21.608 1.00 102.27 ? -3  ARG F NE  1 
ATOM   10758 C CZ  . ARG F 1 17  ? -7.603  54.756  -22.644 1.00 107.10 ? -3  ARG F CZ  1 
ATOM   10759 N NH1 . ARG F 1 17  ? -7.193  54.043  -23.696 1.00 106.46 ? -3  ARG F NH1 1 
ATOM   10760 N NH2 . ARG F 1 17  ? -7.406  56.068  -22.643 1.00 107.83 ? -3  ARG F NH2 1 
ATOM   10761 N N   . GLY F 1 18  ? -6.254  49.247  -20.500 1.00 58.85  ? -2  GLY F N   1 
ATOM   10762 C CA  . GLY F 1 18  ? -7.099  48.118  -20.125 1.00 53.04  ? -2  GLY F CA  1 
ATOM   10763 C C   . GLY F 1 18  ? -6.916  47.679  -18.689 1.00 50.45  ? -2  GLY F C   1 
ATOM   10764 O O   . GLY F 1 18  ? -7.808  47.058  -18.115 1.00 50.68  ? -2  GLY F O   1 
ATOM   10765 N N   . SER F 1 19  ? -5.771  48.008  -18.099 1.00 46.76  ? -1  SER F N   1 
ATOM   10766 C CA  . SER F 1 19  ? -5.514  47.649  -16.716 1.00 47.10  ? -1  SER F CA  1 
ATOM   10767 C C   . SER F 1 19  ? -5.760  48.829  -15.817 1.00 47.81  ? -1  SER F C   1 
ATOM   10768 O O   . SER F 1 19  ? -5.203  49.897  -16.024 1.00 55.25  ? -1  SER F O   1 
ATOM   10769 C CB  . SER F 1 19  ? -4.080  47.160  -16.545 1.00 44.73  ? -1  SER F CB  1 
ATOM   10770 O OG  . SER F 1 19  ? -3.735  47.124  -15.172 1.00 42.83  ? -1  SER F OG  1 
ATOM   10771 N N   . HIS F 1 20  ? -6.598  48.639  -14.816 1.00 48.51  ? 0   HIS F N   1 
ATOM   10772 C CA  . HIS F 1 20  ? -6.854  49.700  -13.872 1.00 52.93  ? 0   HIS F CA  1 
ATOM   10773 C C   . HIS F 1 20  ? -5.793  49.708  -12.830 1.00 49.10  ? 0   HIS F C   1 
ATOM   10774 O O   . HIS F 1 20  ? -5.579  50.705  -12.177 1.00 51.48  ? 0   HIS F O   1 
ATOM   10775 C CB  . HIS F 1 20  ? -8.228  49.546  -13.274 1.00 56.94  ? 0   HIS F CB  1 
ATOM   10776 C CG  . HIS F 1 20  ? -9.303  49.681  -14.295 1.00 70.85  ? 0   HIS F CG  1 
ATOM   10777 N ND1 . HIS F 1 20  ? -10.140 50.774  -14.358 1.00 78.69  ? 0   HIS F ND1 1 
ATOM   10778 C CD2 . HIS F 1 20  ? -9.633  48.893  -15.345 1.00 79.46  ? 0   HIS F CD2 1 
ATOM   10779 C CE1 . HIS F 1 20  ? -10.971 50.629  -15.376 1.00 81.83  ? 0   HIS F CE1 1 
ATOM   10780 N NE2 . HIS F 1 20  ? -10.682 49.498  -15.994 1.00 82.26  ? 0   HIS F NE2 1 
ATOM   10781 N N   . MET F 1 21  ? -5.102  48.594  -12.696 1.00 49.67  ? 1   MET F N   1 
ATOM   10782 C CA  . MET F 1 21  ? -3.983  48.539  -11.811 1.00 50.11  ? 1   MET F CA  1 
ATOM   10783 C C   . MET F 1 21  ? -2.784  49.089  -12.511 1.00 47.07  ? 1   MET F C   1 
ATOM   10784 O O   . MET F 1 21  ? -2.553  48.826  -13.678 1.00 44.70  ? 1   MET F O   1 
ATOM   10785 C CB  . MET F 1 21  ? -3.719  47.117  -11.411 1.00 54.09  ? 1   MET F CB  1 
ATOM   10786 C CG  . MET F 1 21  ? -4.863  46.556  -10.619 1.00 57.05  ? 1   MET F CG  1 
ATOM   10787 S SD  . MET F 1 21  ? -4.483  44.872  -10.159 1.00 60.47  ? 1   MET F SD  1 
ATOM   10788 C CE  . MET F 1 21  ? -5.172  44.979  -8.539  1.00 62.09  ? 1   MET F CE  1 
ATOM   10789 N N   . LYS F 1 22  ? -2.009  49.850  -11.773 1.00 49.99  ? 2   LYS F N   1 
ATOM   10790 C CA  . LYS F 1 22  ? -0.918  50.594  -12.353 1.00 53.12  ? 2   LYS F CA  1 
ATOM   10791 C C   . LYS F 1 22  ? 0.427   50.272  -11.698 1.00 54.27  ? 2   LYS F C   1 
ATOM   10792 O O   . LYS F 1 22  ? 1.475   50.320  -12.348 1.00 55.21  ? 2   LYS F O   1 
ATOM   10793 C CB  . LYS F 1 22  ? -1.261  52.081  -12.250 1.00 51.92  ? 2   LYS F CB  1 
ATOM   10794 C CG  . LYS F 1 22  ? -1.774  52.662  -13.549 1.00 55.09  ? 2   LYS F CG  1 
ATOM   10795 C CD  . LYS F 1 22  ? -3.188  52.242  -13.921 1.00 57.15  ? 2   LYS F CD  1 
ATOM   10796 C CE  . LYS F 1 22  ? -3.588  52.863  -15.263 1.00 57.87  ? 2   LYS F CE  1 
ATOM   10797 N NZ  . LYS F 1 22  ? -4.538  52.037  -16.042 1.00 60.19  ? 2   LYS F NZ  1 
ATOM   10798 N N   . LYS F 1 23  ? 0.386   49.923  -10.419 1.00 53.53  ? 3   LYS F N   1 
ATOM   10799 C CA  . LYS F 1 23  ? 1.588   49.655  -9.659  1.00 54.84  ? 3   LYS F CA  1 
ATOM   10800 C C   . LYS F 1 23  ? 1.618   48.213  -9.176  1.00 49.72  ? 3   LYS F C   1 
ATOM   10801 O O   . LYS F 1 23  ? 0.648   47.708  -8.592  1.00 44.29  ? 3   LYS F O   1 
ATOM   10802 C CB  . LYS F 1 23  ? 1.647   50.601  -8.469  1.00 62.21  ? 3   LYS F CB  1 
ATOM   10803 C CG  . LYS F 1 23  ? 2.763   51.624  -8.548  1.00 67.41  ? 3   LYS F CG  1 
ATOM   10804 C CD  . LYS F 1 23  ? 4.103   50.990  -8.183  1.00 72.16  ? 3   LYS F CD  1 
ATOM   10805 C CE  . LYS F 1 23  ? 5.104   52.029  -7.693  1.00 71.83  ? 3   LYS F CE  1 
ATOM   10806 N NZ  . LYS F 1 23  ? 5.084   52.140  -6.205  1.00 70.70  ? 3   LYS F NZ  1 
ATOM   10807 N N   . VAL F 1 24  ? 2.749   47.564  -9.410  1.00 45.48  ? 4   VAL F N   1 
ATOM   10808 C CA  . VAL F 1 24  ? 2.888   46.156  -9.115  1.00 45.17  ? 4   VAL F CA  1 
ATOM   10809 C C   . VAL F 1 24  ? 4.137   45.866  -8.327  1.00 43.62  ? 4   VAL F C   1 
ATOM   10810 O O   . VAL F 1 24  ? 5.219   46.318  -8.696  1.00 40.23  ? 4   VAL F O   1 
ATOM   10811 C CB  . VAL F 1 24  ? 2.970   45.326  -10.401 1.00 45.35  ? 4   VAL F CB  1 
ATOM   10812 C CG1 . VAL F 1 24  ? 3.181   43.857  -10.067 1.00 46.52  ? 4   VAL F CG1 1 
ATOM   10813 C CG2 . VAL F 1 24  ? 1.698   45.488  -11.205 1.00 45.74  ? 4   VAL F CG2 1 
ATOM   10814 N N   . CYS F 1 25  ? 3.986   45.059  -7.279  1.00 42.74  ? 5   CYS F N   1 
ATOM   10815 C CA  . CYS F 1 25  ? 5.125   44.620  -6.498  1.00 42.55  ? 5   CYS F CA  1 
ATOM   10816 C C   . CYS F 1 25  ? 5.268   43.116  -6.564  1.00 42.18  ? 5   CYS F C   1 
ATOM   10817 O O   . CYS F 1 25  ? 4.308   42.385  -6.391  1.00 40.11  ? 5   CYS F O   1 
ATOM   10818 C CB  . CYS F 1 25  ? 4.955   45.034  -5.047  1.00 45.37  ? 5   CYS F CB  1 
ATOM   10819 S SG  . CYS F 1 25  ? 6.265   44.434  -3.952  1.00 47.00  ? 5   CYS F SG  1 
ATOM   10820 N N   . VAL F 1 26  ? 6.486   42.668  -6.803  1.00 40.32  ? 6   VAL F N   1 
ATOM   10821 C CA  . VAL F 1 26  ? 6.793   41.271  -6.802  1.00 40.50  ? 6   VAL F CA  1 
ATOM   10822 C C   . VAL F 1 26  ? 7.657   40.955  -5.602  1.00 42.58  ? 6   VAL F C   1 
ATOM   10823 O O   . VAL F 1 26  ? 8.610   41.669  -5.323  1.00 44.69  ? 6   VAL F O   1 
ATOM   10824 C CB  . VAL F 1 26  ? 7.572   40.881  -8.052  1.00 40.37  ? 6   VAL F CB  1 
ATOM   10825 C CG1 . VAL F 1 26  ? 8.082   39.468  -7.910  1.00 40.20  ? 6   VAL F CG1 1 
ATOM   10826 C CG2 . VAL F 1 26  ? 6.687   40.975  -9.268  1.00 39.72  ? 6   VAL F CG2 1 
ATOM   10827 N N   . ILE F 1 27  ? 7.332   39.867  -4.913  1.00 44.09  ? 7   ILE F N   1 
ATOM   10828 C CA  . ILE F 1 27  ? 8.094   39.429  -3.755  1.00 43.62  ? 7   ILE F CA  1 
ATOM   10829 C C   . ILE F 1 27  ? 8.864   38.180  -4.108  1.00 43.23  ? 7   ILE F C   1 
ATOM   10830 O O   . ILE F 1 27  ? 8.272   37.137  -4.371  1.00 45.52  ? 7   ILE F O   1 
ATOM   10831 C CB  . ILE F 1 27  ? 7.193   39.061  -2.567  1.00 43.50  ? 7   ILE F CB  1 
ATOM   10832 C CG1 . ILE F 1 27  ? 6.098   40.106  -2.345  1.00 43.12  ? 7   ILE F CG1 1 
ATOM   10833 C CG2 . ILE F 1 27  ? 8.040   38.880  -1.324  1.00 41.72  ? 7   ILE F CG2 1 
ATOM   10834 C CD1 . ILE F 1 27  ? 6.564   41.301  -1.557  1.00 44.52  ? 7   ILE F CD1 1 
ATOM   10835 N N   . GLY F 1 28  ? 10.183  38.281  -4.082  1.00 41.07  ? 8   GLY F N   1 
ATOM   10836 C CA  . GLY F 1 28  ? 11.025  37.176  -4.455  1.00 40.80  ? 8   GLY F CA  1 
ATOM   10837 C C   . GLY F 1 28  ? 11.755  37.514  -5.730  1.00 43.04  ? 8   GLY F C   1 
ATOM   10838 O O   . GLY F 1 28  ? 11.141  37.731  -6.772  1.00 42.50  ? 8   GLY F O   1 
ATOM   10839 N N   . ALA F 1 29  ? 13.078  37.545  -5.638  1.00 43.73  ? 9   ALA F N   1 
ATOM   10840 C CA  . ALA F 1 29  ? 13.915  37.942  -6.745  1.00 42.28  ? 9   ALA F CA  1 
ATOM   10841 C C   . ALA F 1 29  ? 14.530  36.739  -7.389  1.00 42.34  ? 9   ALA F C   1 
ATOM   10842 O O   . ALA F 1 29  ? 15.571  36.851  -8.039  1.00 39.19  ? 9   ALA F O   1 
ATOM   10843 C CB  . ALA F 1 29  ? 14.996  38.892  -6.269  1.00 43.60  ? 9   ALA F CB  1 
ATOM   10844 N N   . GLY F 1 30  ? 13.874  35.592  -7.225  1.00 45.62  ? 10  GLY F N   1 
ATOM   10845 C CA  . GLY F 1 30  ? 14.342  34.352  -7.828  1.00 46.10  ? 10  GLY F CA  1 
ATOM   10846 C C   . GLY F 1 30  ? 14.044  34.327  -9.316  1.00 47.19  ? 10  GLY F C   1 
ATOM   10847 O O   . GLY F 1 30  ? 13.763  35.356  -9.942  1.00 48.33  ? 10  GLY F O   1 
ATOM   10848 N N   . THR F 1 31  ? 14.095  33.132  -9.875  1.00 46.75  ? 11  THR F N   1 
ATOM   10849 C CA  . THR F 1 31  ? 13.920  32.947  -11.297 1.00 46.20  ? 11  THR F CA  1 
ATOM   10850 C C   . THR F 1 31  ? 12.559  33.426  -11.746 1.00 45.29  ? 11  THR F C   1 
ATOM   10851 O O   . THR F 1 31  ? 12.448  34.179  -12.708 1.00 47.37  ? 11  THR F O   1 
ATOM   10852 C CB  . THR F 1 31  ? 14.061  31.459  -11.670 1.00 48.63  ? 11  THR F CB  1 
ATOM   10853 O OG1 . THR F 1 31  ? 15.384  31.014  -11.346 1.00 53.66  ? 11  THR F OG1 1 
ATOM   10854 C CG2 . THR F 1 31  ? 13.817  31.231  -13.153 1.00 47.34  ? 11  THR F CG2 1 
ATOM   10855 N N   . MET F 1 32  ? 11.523  32.959  -11.067 1.00 45.06  ? 12  MET F N   1 
ATOM   10856 C CA  . MET F 1 32  ? 10.160  33.256  -11.499 1.00 44.90  ? 12  MET F CA  1 
ATOM   10857 C C   . MET F 1 32  ? 9.770   34.688  -11.140 1.00 44.41  ? 12  MET F C   1 
ATOM   10858 O O   . MET F 1 32  ? 9.185   35.400  -11.947 1.00 42.41  ? 12  MET F O   1 
ATOM   10859 C CB  . MET F 1 32  ? 9.147   32.271  -10.894 1.00 42.81  ? 12  MET F CB  1 
ATOM   10860 C CG  . MET F 1 32  ? 9.047   30.946  -11.619 1.00 42.33  ? 12  MET F CG  1 
ATOM   10861 S SD  . MET F 1 32  ? 8.539   31.038  -13.346 1.00 48.21  ? 12  MET F SD  1 
ATOM   10862 C CE  . MET F 1 32  ? 6.943   31.847  -13.249 1.00 46.31  ? 12  MET F CE  1 
ATOM   10863 N N   . GLY F 1 33  ? 10.093  35.109  -9.928  1.00 44.24  ? 13  GLY F N   1 
ATOM   10864 C CA  . GLY F 1 33  ? 9.661   36.418  -9.454  1.00 44.65  ? 13  GLY F CA  1 
ATOM   10865 C C   . GLY F 1 33  ? 10.264  37.536  -10.277 1.00 45.12  ? 13  GLY F C   1 
ATOM   10866 O O   . GLY F 1 33  ? 9.624   38.534  -10.578 1.00 43.43  ? 13  GLY F O   1 
ATOM   10867 N N   . SER F 1 34  ? 11.509  37.359  -10.666 1.00 47.03  ? 14  SER F N   1 
ATOM   10868 C CA  . SER F 1 34  ? 12.179  38.383  -11.424 1.00 46.26  ? 14  SER F CA  1 
ATOM   10869 C C   . SER F 1 34  ? 11.793  38.288  -12.914 1.00 42.14  ? 14  SER F C   1 
ATOM   10870 O O   . SER F 1 34  ? 11.857  39.270  -13.645 1.00 43.36  ? 14  SER F O   1 
ATOM   10871 C CB  . SER F 1 34  ? 13.684  38.285  -11.185 1.00 47.43  ? 14  SER F CB  1 
ATOM   10872 O OG  . SER F 1 34  ? 14.244  37.314  -12.024 1.00 50.81  ? 14  SER F OG  1 
ATOM   10873 N N   . GLY F 1 35  ? 11.382  37.104  -13.352 1.00 38.68  ? 15  GLY F N   1 
ATOM   10874 C CA  . GLY F 1 35  ? 10.805  36.939  -14.679 1.00 35.36  ? 15  GLY F CA  1 
ATOM   10875 C C   . GLY F 1 35  ? 9.439   37.599  -14.724 1.00 35.12  ? 15  GLY F C   1 
ATOM   10876 O O   . GLY F 1 35  ? 9.053   38.153  -15.726 1.00 34.75  ? 15  GLY F O   1 
ATOM   10877 N N   . ILE F 1 36  ? 8.701   37.534  -13.626 1.00 34.58  ? 16  ILE F N   1 
ATOM   10878 C CA  . ILE F 1 36  ? 7.395   38.168  -13.545 1.00 35.40  ? 16  ILE F CA  1 
ATOM   10879 C C   . ILE F 1 36  ? 7.534   39.696  -13.529 1.00 38.35  ? 16  ILE F C   1 
ATOM   10880 O O   . ILE F 1 36  ? 6.751   40.415  -14.155 1.00 38.17  ? 16  ILE F O   1 
ATOM   10881 C CB  . ILE F 1 36  ? 6.640   37.674  -12.307 1.00 34.50  ? 16  ILE F CB  1 
ATOM   10882 C CG1 . ILE F 1 36  ? 6.259   36.199  -12.503 1.00 35.70  ? 16  ILE F CG1 1 
ATOM   10883 C CG2 . ILE F 1 36  ? 5.373   38.480  -12.083 1.00 33.54  ? 16  ILE F CG2 1 
ATOM   10884 C CD1 . ILE F 1 36  ? 5.812   35.496  -11.241 1.00 34.94  ? 16  ILE F CD1 1 
ATOM   10885 N N   . ALA F 1 37  ? 8.544   40.175  -12.815 1.00 37.89  ? 17  ALA F N   1 
ATOM   10886 C CA  . ALA F 1 37  ? 8.848   41.593  -12.762 1.00 38.02  ? 17  ALA F CA  1 
ATOM   10887 C C   . ALA F 1 37  ? 9.175   42.099  -14.151 1.00 38.26  ? 17  ALA F C   1 
ATOM   10888 O O   . ALA F 1 37  ? 8.690   43.130  -14.589 1.00 35.64  ? 17  ALA F O   1 
ATOM   10889 C CB  . ALA F 1 37  ? 10.032  41.822  -11.852 1.00 37.61  ? 17  ALA F CB  1 
ATOM   10890 N N   . GLN F 1 38  ? 10.007  41.346  -14.846 1.00 40.30  ? 18  GLN F N   1 
ATOM   10891 C CA  . GLN F 1 38  ? 10.419  41.745  -16.167 1.00 39.48  ? 18  GLN F CA  1 
ATOM   10892 C C   . GLN F 1 38  ? 9.211   41.768  -17.091 1.00 41.24  ? 18  GLN F C   1 
ATOM   10893 O O   . GLN F 1 38  ? 9.150   42.589  -18.001 1.00 44.39  ? 18  GLN F O   1 
ATOM   10894 C CB  . GLN F 1 38  ? 11.492  40.811  -16.693 1.00 36.58  ? 18  GLN F CB  1 
ATOM   10895 C CG  . GLN F 1 38  ? 11.717  40.921  -18.183 1.00 37.87  ? 18  GLN F CG  1 
ATOM   10896 C CD  . GLN F 1 38  ? 12.849  40.032  -18.668 1.00 38.46  ? 18  GLN F CD  1 
ATOM   10897 O OE1 . GLN F 1 38  ? 13.538  39.382  -17.876 1.00 44.66  ? 18  GLN F OE1 1 
ATOM   10898 N NE2 . GLN F 1 38  ? 13.037  39.987  -19.974 1.00 36.32  ? 18  GLN F NE2 1 
ATOM   10899 N N   . ALA F 1 39  ? 8.240   40.892  -16.858 1.00 37.29  ? 19  ALA F N   1 
ATOM   10900 C CA  . ALA F 1 39  ? 7.134   40.802  -17.796 1.00 35.99  ? 19  ALA F CA  1 
ATOM   10901 C C   . ALA F 1 39  ? 6.215   41.998  -17.678 1.00 36.11  ? 19  ALA F C   1 
ATOM   10902 O O   . ALA F 1 39  ? 5.733   42.515  -18.669 1.00 38.80  ? 19  ALA F O   1 
ATOM   10903 C CB  . ALA F 1 39  ? 6.352   39.531  -17.604 1.00 33.65  ? 19  ALA F CB  1 
ATOM   10904 N N   . PHE F 1 40  ? 5.966   42.410  -16.455 1.00 38.71  ? 20  PHE F N   1 
ATOM   10905 C CA  . PHE F 1 40  ? 5.263   43.647  -16.182 1.00 39.65  ? 20  PHE F CA  1 
ATOM   10906 C C   . PHE F 1 40  ? 6.029   44.885  -16.634 1.00 39.76  ? 20  PHE F C   1 
ATOM   10907 O O   . PHE F 1 40  ? 5.468   45.764  -17.274 1.00 39.79  ? 20  PHE F O   1 
ATOM   10908 C CB  . PHE F 1 40  ? 4.988   43.749  -14.699 1.00 38.98  ? 20  PHE F CB  1 
ATOM   10909 C CG  . PHE F 1 40  ? 3.780   42.995  -14.286 1.00 40.27  ? 20  PHE F CG  1 
ATOM   10910 C CD1 . PHE F 1 40  ? 2.540   43.578  -14.387 1.00 41.35  ? 20  PHE F CD1 1 
ATOM   10911 C CD2 . PHE F 1 40  ? 3.879   41.700  -13.832 1.00 40.15  ? 20  PHE F CD2 1 
ATOM   10912 C CE1 . PHE F 1 40  ? 1.409   42.886  -14.035 1.00 43.03  ? 20  PHE F CE1 1 
ATOM   10913 C CE2 . PHE F 1 40  ? 2.760   40.998  -13.475 1.00 41.14  ? 20  PHE F CE2 1 
ATOM   10914 C CZ  . PHE F 1 40  ? 1.520   41.588  -13.580 1.00 43.92  ? 20  PHE F CZ  1 
ATOM   10915 N N   . ALA F 1 41  ? 7.302   44.969  -16.292 1.00 39.24  ? 21  ALA F N   1 
ATOM   10916 C CA  . ALA F 1 41  ? 8.076   46.156  -16.654 1.00 40.35  ? 21  ALA F CA  1 
ATOM   10917 C C   . ALA F 1 41  ? 8.168   46.356  -18.162 1.00 39.71  ? 21  ALA F C   1 
ATOM   10918 O O   . ALA F 1 41  ? 8.068   47.473  -18.651 1.00 38.96  ? 21  ALA F O   1 
ATOM   10919 C CB  . ALA F 1 41  ? 9.463   46.102  -16.050 1.00 41.59  ? 21  ALA F CB  1 
ATOM   10920 N N   . ALA F 1 42  ? 8.329   45.277  -18.905 1.00 38.85  ? 22  ALA F N   1 
ATOM   10921 C CA  . ALA F 1 42  ? 8.475   45.394  -20.344 1.00 38.29  ? 22  ALA F CA  1 
ATOM   10922 C C   . ALA F 1 42  ? 7.195   45.921  -20.987 1.00 39.62  ? 22  ALA F C   1 
ATOM   10923 O O   . ALA F 1 42  ? 7.216   46.410  -22.120 1.00 36.26  ? 22  ALA F O   1 
ATOM   10924 C CB  . ALA F 1 42  ? 8.831   44.050  -20.942 1.00 38.29  ? 22  ALA F CB  1 
ATOM   10925 N N   . LYS F 1 43  ? 6.080   45.809  -20.271 1.00 39.93  ? 23  LYS F N   1 
ATOM   10926 C CA  . LYS F 1 43  ? 4.797   46.251  -20.801 1.00 40.62  ? 23  LYS F CA  1 
ATOM   10927 C C   . LYS F 1 43  ? 4.366   47.596  -20.283 1.00 40.52  ? 23  LYS F C   1 
ATOM   10928 O O   . LYS F 1 43  ? 3.265   48.054  -20.576 1.00 44.06  ? 23  LYS F O   1 
ATOM   10929 C CB  . LYS F 1 43  ? 3.731   45.221  -20.489 1.00 41.19  ? 23  LYS F CB  1 
ATOM   10930 C CG  . LYS F 1 43  ? 3.803   44.060  -21.446 1.00 44.34  ? 23  LYS F CG  1 
ATOM   10931 C CD  . LYS F 1 43  ? 2.934   44.347  -22.667 1.00 48.92  ? 23  LYS F CD  1 
ATOM   10932 C CE  . LYS F 1 43  ? 3.170   43.374  -23.812 1.00 50.98  ? 23  LYS F CE  1 
ATOM   10933 N NZ  . LYS F 1 43  ? 4.520   42.752  -23.732 1.00 52.86  ? 23  LYS F NZ  1 
ATOM   10934 N N   . GLY F 1 44  ? 5.229   48.227  -19.508 1.00 42.30  ? 24  GLY F N   1 
ATOM   10935 C CA  . GLY F 1 44  ? 5.036   49.623  -19.138 1.00 43.27  ? 24  GLY F CA  1 
ATOM   10936 C C   . GLY F 1 44  ? 4.677   49.853  -17.689 1.00 44.48  ? 24  GLY F C   1 
ATOM   10937 O O   . GLY F 1 44  ? 4.352   50.975  -17.326 1.00 46.02  ? 24  GLY F O   1 
ATOM   10938 N N   . PHE F 1 45  ? 4.732   48.807  -16.862 1.00 43.12  ? 25  PHE F N   1 
ATOM   10939 C CA  . PHE F 1 45  ? 4.368   48.930  -15.457 1.00 41.42  ? 25  PHE F CA  1 
ATOM   10940 C C   . PHE F 1 45  ? 5.577   49.358  -14.687 1.00 42.41  ? 25  PHE F C   1 
ATOM   10941 O O   . PHE F 1 45  ? 6.688   49.011  -15.057 1.00 42.33  ? 25  PHE F O   1 
ATOM   10942 C CB  . PHE F 1 45  ? 3.897   47.597  -14.886 1.00 40.00  ? 25  PHE F CB  1 
ATOM   10943 C CG  . PHE F 1 45  ? 2.502   47.252  -15.252 1.00 37.91  ? 25  PHE F CG  1 
ATOM   10944 C CD1 . PHE F 1 45  ? 2.205   46.828  -16.521 1.00 37.87  ? 25  PHE F CD1 1 
ATOM   10945 C CD2 . PHE F 1 45  ? 1.485   47.376  -14.337 1.00 39.16  ? 25  PHE F CD2 1 
ATOM   10946 C CE1 . PHE F 1 45  ? 0.913   46.511  -16.871 1.00 38.06  ? 25  PHE F CE1 1 
ATOM   10947 C CE2 . PHE F 1 45  ? 0.183   47.063  -14.676 1.00 38.33  ? 25  PHE F CE2 1 
ATOM   10948 C CZ  . PHE F 1 45  ? -0.100  46.626  -15.943 1.00 37.79  ? 25  PHE F CZ  1 
ATOM   10949 N N   . GLU F 1 46  ? 5.362   50.087  -13.601 1.00 44.95  ? 26  GLU F N   1 
ATOM   10950 C CA  . GLU F 1 46  ? 6.430   50.315  -12.641 1.00 48.83  ? 26  GLU F CA  1 
ATOM   10951 C C   . GLU F 1 46  ? 6.396   49.156  -11.669 1.00 44.56  ? 26  GLU F C   1 
ATOM   10952 O O   . GLU F 1 46  ? 5.334   48.798  -11.161 1.00 41.85  ? 26  GLU F O   1 
ATOM   10953 C CB  . GLU F 1 46  ? 6.244   51.630  -11.885 1.00 52.21  ? 26  GLU F CB  1 
ATOM   10954 C CG  . GLU F 1 46  ? 6.543   52.865  -12.724 1.00 57.32  ? 26  GLU F CG  1 
ATOM   10955 C CD  . GLU F 1 46  ? 8.020   53.218  -12.777 1.00 61.17  ? 26  GLU F CD  1 
ATOM   10956 O OE1