data_6AF6
# 
_entry.id   6AF6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6AF6         
WWPDB D_1300008659 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'apo form'                    5zw0 unspecified 
PDB 'fad complex'                 5zw2 unspecified 
PDB 'fad complex high resolution' 5zw7 unspecified 
PDB 'fad and proline complex'     5zw8 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6AF6 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lee, C.-C.'   1 ? 
'Ko, T.-P.'    2 ? 
'Wang, A.H.J.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   GE 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Chembiochem 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1439-7633 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            20 
_citation.language                  ? 
_citation.page_first                193 
_citation.page_last                 202 
_citation.title                     'Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/cbic.201800409 
_citation.pdbx_database_id_PubMed   30095206 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lee, C.-C.'   1  ?                   
primary 'Ko, T.-P.'    2  ?                   
primary 'Chen, C.T.'   3  ?                   
primary 'Chan, Y.T.'   4  ?                   
primary 'Lo, S.Y.'     5  ?                   
primary 'Chang, J.Y.'  6  ?                   
primary 'Chen, Y.W.'   7  ?                   
primary 'Chung, T.F.'  8  ?                   
primary 'Hsieh, H.J.'  9  ?                   
primary 'Hsiao, C.D.'  10 ?                   
primary 'Wang, A.H.J.' 11 0000-0002-0016-5337 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6AF6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     85.574 
_cell.length_a_esd                 ? 
_cell.length_b                     86.306 
_cell.length_b_esd                 ? 
_cell.length_c                     145.771 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6AF6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'L-prolyl-[peptidyl-carrier protein] dehydrogenase' 43892.082 1   1.3.8.14 E244A ? ? 
2 non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE'                       785.550   1   ?        ?     ? ? 
3 non-polymer syn 1,4,7,10,13,16-HEXAOXACYCLOOCTADECANE               264.315   2   ?        ?     ? ? 
4 non-polymer syn 'CHLORIDE ION'                                      35.453    1   ?        ?     ? ? 
5 non-polymer syn PROLINE                                             115.130   2   ?        ?     ? ? 
6 non-polymer syn GLYCINE                                             75.067    1   ?        ?     ? ? 
7 water       nat water                                               18.015    504 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Flavoprotein desaturase PigA,L-prolyl-PCP dehydrogenase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDFNLSNSQSDIYESAYRFACDVLDQDAQTRISQKILSTELWKKAAAYGFAHGPVSHQFGGSELGALDTALMIEALGKGS
RDIGLSFSLCAHLCACVIPLYRFGSSELKDKYLESLVTGKLIAANAATEPDAGSDIYNMQATAQPCEGGYILNGKKIFIT
NAPIADVFIIYAKTNPDHGFLGVSAFLIEKGTPGLNVGEVIPKDCLSNCPWSEIVFNDIFIPQSQRIGMEGAGGAIFHDS
MIWAKGCLSALFVGGLARLLETTLEYAKARQQFGKAIGQFQSVSNRIIDMKLRLEQCRLMLYRACWKHDQGQDAEADIAM
SKLLISEYAVQSGLDAIQTFGGAAMDQELGLVRHLLNMIPSRIFSGTNDIQKEIIARKLGLRGTSSGSLVPRGSHHHHHH
HH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDFNLSNSQSDIYESAYRFACDVLDQDAQTRISQKILSTELWKKAAAYGFAHGPVSHQFGGSELGALDTALMIEALGKGS
RDIGLSFSLCAHLCACVIPLYRFGSSELKDKYLESLVTGKLIAANAATEPDAGSDIYNMQATAQPCEGGYILNGKKIFIT
NAPIADVFIIYAKTNPDHGFLGVSAFLIEKGTPGLNVGEVIPKDCLSNCPWSEIVFNDIFIPQSQRIGMEGAGGAIFHDS
MIWAKGCLSALFVGGLARLLETTLEYAKARQQFGKAIGQFQSVSNRIIDMKLRLEQCRLMLYRACWKHDQGQDAEADIAM
SKLLISEYAVQSGLDAIQTFGGAAMDQELGLVRHLLNMIPSRIFSGTNDIQKEIIARKLGLRGTSSGSLVPRGSHHHHHH
HH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   PHE n 
1 4   ASN n 
1 5   LEU n 
1 6   SER n 
1 7   ASN n 
1 8   SER n 
1 9   GLN n 
1 10  SER n 
1 11  ASP n 
1 12  ILE n 
1 13  TYR n 
1 14  GLU n 
1 15  SER n 
1 16  ALA n 
1 17  TYR n 
1 18  ARG n 
1 19  PHE n 
1 20  ALA n 
1 21  CYS n 
1 22  ASP n 
1 23  VAL n 
1 24  LEU n 
1 25  ASP n 
1 26  GLN n 
1 27  ASP n 
1 28  ALA n 
1 29  GLN n 
1 30  THR n 
1 31  ARG n 
1 32  ILE n 
1 33  SER n 
1 34  GLN n 
1 35  LYS n 
1 36  ILE n 
1 37  LEU n 
1 38  SER n 
1 39  THR n 
1 40  GLU n 
1 41  LEU n 
1 42  TRP n 
1 43  LYS n 
1 44  LYS n 
1 45  ALA n 
1 46  ALA n 
1 47  ALA n 
1 48  TYR n 
1 49  GLY n 
1 50  PHE n 
1 51  ALA n 
1 52  HIS n 
1 53  GLY n 
1 54  PRO n 
1 55  VAL n 
1 56  SER n 
1 57  HIS n 
1 58  GLN n 
1 59  PHE n 
1 60  GLY n 
1 61  GLY n 
1 62  SER n 
1 63  GLU n 
1 64  LEU n 
1 65  GLY n 
1 66  ALA n 
1 67  LEU n 
1 68  ASP n 
1 69  THR n 
1 70  ALA n 
1 71  LEU n 
1 72  MET n 
1 73  ILE n 
1 74  GLU n 
1 75  ALA n 
1 76  LEU n 
1 77  GLY n 
1 78  LYS n 
1 79  GLY n 
1 80  SER n 
1 81  ARG n 
1 82  ASP n 
1 83  ILE n 
1 84  GLY n 
1 85  LEU n 
1 86  SER n 
1 87  PHE n 
1 88  SER n 
1 89  LEU n 
1 90  CYS n 
1 91  ALA n 
1 92  HIS n 
1 93  LEU n 
1 94  CYS n 
1 95  ALA n 
1 96  CYS n 
1 97  VAL n 
1 98  ILE n 
1 99  PRO n 
1 100 LEU n 
1 101 TYR n 
1 102 ARG n 
1 103 PHE n 
1 104 GLY n 
1 105 SER n 
1 106 SER n 
1 107 GLU n 
1 108 LEU n 
1 109 LYS n 
1 110 ASP n 
1 111 LYS n 
1 112 TYR n 
1 113 LEU n 
1 114 GLU n 
1 115 SER n 
1 116 LEU n 
1 117 VAL n 
1 118 THR n 
1 119 GLY n 
1 120 LYS n 
1 121 LEU n 
1 122 ILE n 
1 123 ALA n 
1 124 ALA n 
1 125 ASN n 
1 126 ALA n 
1 127 ALA n 
1 128 THR n 
1 129 GLU n 
1 130 PRO n 
1 131 ASP n 
1 132 ALA n 
1 133 GLY n 
1 134 SER n 
1 135 ASP n 
1 136 ILE n 
1 137 TYR n 
1 138 ASN n 
1 139 MET n 
1 140 GLN n 
1 141 ALA n 
1 142 THR n 
1 143 ALA n 
1 144 GLN n 
1 145 PRO n 
1 146 CYS n 
1 147 GLU n 
1 148 GLY n 
1 149 GLY n 
1 150 TYR n 
1 151 ILE n 
1 152 LEU n 
1 153 ASN n 
1 154 GLY n 
1 155 LYS n 
1 156 LYS n 
1 157 ILE n 
1 158 PHE n 
1 159 ILE n 
1 160 THR n 
1 161 ASN n 
1 162 ALA n 
1 163 PRO n 
1 164 ILE n 
1 165 ALA n 
1 166 ASP n 
1 167 VAL n 
1 168 PHE n 
1 169 ILE n 
1 170 ILE n 
1 171 TYR n 
1 172 ALA n 
1 173 LYS n 
1 174 THR n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 HIS n 
1 179 GLY n 
1 180 PHE n 
1 181 LEU n 
1 182 GLY n 
1 183 VAL n 
1 184 SER n 
1 185 ALA n 
1 186 PHE n 
1 187 LEU n 
1 188 ILE n 
1 189 GLU n 
1 190 LYS n 
1 191 GLY n 
1 192 THR n 
1 193 PRO n 
1 194 GLY n 
1 195 LEU n 
1 196 ASN n 
1 197 VAL n 
1 198 GLY n 
1 199 GLU n 
1 200 VAL n 
1 201 ILE n 
1 202 PRO n 
1 203 LYS n 
1 204 ASP n 
1 205 CYS n 
1 206 LEU n 
1 207 SER n 
1 208 ASN n 
1 209 CYS n 
1 210 PRO n 
1 211 TRP n 
1 212 SER n 
1 213 GLU n 
1 214 ILE n 
1 215 VAL n 
1 216 PHE n 
1 217 ASN n 
1 218 ASP n 
1 219 ILE n 
1 220 PHE n 
1 221 ILE n 
1 222 PRO n 
1 223 GLN n 
1 224 SER n 
1 225 GLN n 
1 226 ARG n 
1 227 ILE n 
1 228 GLY n 
1 229 MET n 
1 230 GLU n 
1 231 GLY n 
1 232 ALA n 
1 233 GLY n 
1 234 GLY n 
1 235 ALA n 
1 236 ILE n 
1 237 PHE n 
1 238 HIS n 
1 239 ASP n 
1 240 SER n 
1 241 MET n 
1 242 ILE n 
1 243 TRP n 
1 244 ALA n 
1 245 LYS n 
1 246 GLY n 
1 247 CYS n 
1 248 LEU n 
1 249 SER n 
1 250 ALA n 
1 251 LEU n 
1 252 PHE n 
1 253 VAL n 
1 254 GLY n 
1 255 GLY n 
1 256 LEU n 
1 257 ALA n 
1 258 ARG n 
1 259 LEU n 
1 260 LEU n 
1 261 GLU n 
1 262 THR n 
1 263 THR n 
1 264 LEU n 
1 265 GLU n 
1 266 TYR n 
1 267 ALA n 
1 268 LYS n 
1 269 ALA n 
1 270 ARG n 
1 271 GLN n 
1 272 GLN n 
1 273 PHE n 
1 274 GLY n 
1 275 LYS n 
1 276 ALA n 
1 277 ILE n 
1 278 GLY n 
1 279 GLN n 
1 280 PHE n 
1 281 GLN n 
1 282 SER n 
1 283 VAL n 
1 284 SER n 
1 285 ASN n 
1 286 ARG n 
1 287 ILE n 
1 288 ILE n 
1 289 ASP n 
1 290 MET n 
1 291 LYS n 
1 292 LEU n 
1 293 ARG n 
1 294 LEU n 
1 295 GLU n 
1 296 GLN n 
1 297 CYS n 
1 298 ARG n 
1 299 LEU n 
1 300 MET n 
1 301 LEU n 
1 302 TYR n 
1 303 ARG n 
1 304 ALA n 
1 305 CYS n 
1 306 TRP n 
1 307 LYS n 
1 308 HIS n 
1 309 ASP n 
1 310 GLN n 
1 311 GLY n 
1 312 GLN n 
1 313 ASP n 
1 314 ALA n 
1 315 GLU n 
1 316 ALA n 
1 317 ASP n 
1 318 ILE n 
1 319 ALA n 
1 320 MET n 
1 321 SER n 
1 322 LYS n 
1 323 LEU n 
1 324 LEU n 
1 325 ILE n 
1 326 SER n 
1 327 GLU n 
1 328 TYR n 
1 329 ALA n 
1 330 VAL n 
1 331 GLN n 
1 332 SER n 
1 333 GLY n 
1 334 LEU n 
1 335 ASP n 
1 336 ALA n 
1 337 ILE n 
1 338 GLN n 
1 339 THR n 
1 340 PHE n 
1 341 GLY n 
1 342 GLY n 
1 343 ALA n 
1 344 ALA n 
1 345 MET n 
1 346 ASP n 
1 347 GLN n 
1 348 GLU n 
1 349 LEU n 
1 350 GLY n 
1 351 LEU n 
1 352 VAL n 
1 353 ARG n 
1 354 HIS n 
1 355 LEU n 
1 356 LEU n 
1 357 ASN n 
1 358 MET n 
1 359 ILE n 
1 360 PRO n 
1 361 SER n 
1 362 ARG n 
1 363 ILE n 
1 364 PHE n 
1 365 SER n 
1 366 GLY n 
1 367 THR n 
1 368 ASN n 
1 369 ASP n 
1 370 ILE n 
1 371 GLN n 
1 372 LYS n 
1 373 GLU n 
1 374 ILE n 
1 375 ILE n 
1 376 ALA n 
1 377 ARG n 
1 378 LYS n 
1 379 LEU n 
1 380 GLY n 
1 381 LEU n 
1 382 ARG n 
1 383 GLY n 
1 384 THR n 
1 385 SER n 
1 386 SER n 
1 387 GLY n 
1 388 SER n 
1 389 LEU n 
1 390 VAL n 
1 391 PRO n 
1 392 ARG n 
1 393 GLY n 
1 394 SER n 
1 395 HIS n 
1 396 HIS n 
1 397 HIS n 
1 398 HIS n 
1 399 HIS n 
1 400 HIS n 
1 401 HIS n 
1 402 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   402 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pigA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 39006' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Serratia sp. (strain ATCC 39006)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     104623 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 39006 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PIGA_SERS3 
_struct_ref.pdbx_db_accession          Q5W271 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDFNLSNSQSDIYESAYRFACDVLDQDAQTRISQKILSTELWKKAAAYGFAHGPVSHQFGGSELGALDTALMIEALGKGS
RDIGLSFSLCAHLCACVIPLYRFGSSELKDKYLESLVTGKLIAANAATEPDAGSDIYNMQATAQPCEGGYILNGKKIFIT
NAPIADVFIIYAKTNPDHGFLGVSAFLIEKGTPGLNVGEVIPKDCLSNCPWSEIVFNDIFIPQSQRIGMEGAGGAIFHDS
MIWEKGCLSALFVGGLARLLETTLEYAKARQQFGKAIGQFQSVSNRIIDMKLRLEQCRLMLYRACWKHDQGQDAEADIAM
SKLLISEYAVQSGLDAIQTFGGAAMDQELGLVRHLLNMIPSRIFSGTNDIQKEIIARKLGLRGTSS
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6AF6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 386 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5W271 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  386 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       386 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6AF6 ALA A 244 ? UNP Q5W271 GLU 244 'engineered mutation' 244 1  
1 6AF6 GLY A 387 ? UNP Q5W271 ?   ?   'expression tag'      387 2  
1 6AF6 SER A 388 ? UNP Q5W271 ?   ?   'expression tag'      388 3  
1 6AF6 LEU A 389 ? UNP Q5W271 ?   ?   'expression tag'      389 4  
1 6AF6 VAL A 390 ? UNP Q5W271 ?   ?   'expression tag'      390 5  
1 6AF6 PRO A 391 ? UNP Q5W271 ?   ?   'expression tag'      391 6  
1 6AF6 ARG A 392 ? UNP Q5W271 ?   ?   'expression tag'      392 7  
1 6AF6 GLY A 393 ? UNP Q5W271 ?   ?   'expression tag'      393 8  
1 6AF6 SER A 394 ? UNP Q5W271 ?   ?   'expression tag'      394 9  
1 6AF6 HIS A 395 ? UNP Q5W271 ?   ?   'expression tag'      395 10 
1 6AF6 HIS A 396 ? UNP Q5W271 ?   ?   'expression tag'      396 11 
1 6AF6 HIS A 397 ? UNP Q5W271 ?   ?   'expression tag'      397 12 
1 6AF6 HIS A 398 ? UNP Q5W271 ?   ?   'expression tag'      398 13 
1 6AF6 HIS A 399 ? UNP Q5W271 ?   ?   'expression tag'      399 14 
1 6AF6 HIS A 400 ? UNP Q5W271 ?   ?   'expression tag'      400 15 
1 6AF6 HIS A 401 ? UNP Q5W271 ?   ?   'expression tag'      401 16 
1 6AF6 HIS A 402 ? UNP Q5W271 ?   ?   'expression tag'      402 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                        ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'      121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'         ? 'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                 ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'     149.211 
O4B non-polymer         . 1,4,7,10,13,16-HEXAOXACYCLOOCTADECANE ? 'C12 H24 O6'        264.315 
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6AF6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.07 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.88 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '5mM L-prolylglycine, 1.6M (NH4)2SO4, 2% PEG 400, 0.1M citric acid' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-07-26 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE TPS 05A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'TPS 05A' 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6AF6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.62 
_reflns.d_resolution_low                 20 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       68585 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.2 
_reflns.pdbx_Rmerge_I_obs                0.063 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            30.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.62 
_reflns_shell.d_res_low                   1.68 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6722 
_reflns_shell.percent_possible_all        98.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.537 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6AF6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.620 
_refine.ls_d_res_low                             19.516 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     66136 
_refine.ls_number_reflns_R_free                  1995 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    96.27 
_refine.ls_percent_reflns_R_free                 3.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1556 
_refine.ls_R_factor_R_free                       0.1796 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1549 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5ZW8 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 17.65 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.12 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2927 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         110 
_refine_hist.number_atoms_solvent             504 
_refine_hist.number_atoms_total               3541 
_refine_hist.d_res_high                       1.620 
_refine_hist.d_res_low                        19.516 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  ? 3240 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.676  ? 4369 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.916 ? 1937 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.118  ? 474  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.010  ? 552  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6200 1.6605  . . 105 3501 74.00  . . . 0.2260 . 0.1899 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6605 1.7053  . . 114 3885 83.00  . . . 0.2129 . 0.1891 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7053 1.7555  . . 136 4387 93.00  . . . 0.2199 . 0.1878 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7555 1.8121  . . 142 4631 99.00  . . . 0.1936 . 0.1848 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8121 1.8768  . . 149 4720 100.00 . . . 0.2133 . 0.1859 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8768 1.9519  . . 148 4706 100.00 . . . 0.1897 . 0.1697 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9519 2.0407  . . 144 4739 100.00 . . . 0.2054 . 0.1665 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0407 2.1481  . . 151 4746 100.00 . . . 0.1915 . 0.1660 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1481 2.2825  . . 149 4728 100.00 . . . 0.1751 . 0.1547 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2825 2.4584  . . 150 4757 100.00 . . . 0.1941 . 0.1535 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4584 2.7053  . . 147 4785 100.00 . . . 0.1756 . 0.1509 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7053 3.0954  . . 146 4780 100.00 . . . 0.1640 . 0.1498 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0954 3.8948  . . 152 4811 100.00 . . . 0.1519 . 0.1323 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8948 19.5175 . . 162 4965 100.00 . . . 0.1643 . 0.1387 . . . . . . . . . . 
# 
_struct.entry_id                     6AF6 
_struct.title                        'PigA with FAD and proline' 
_struct.pdbx_descriptor              'L-prolyl-[peptidyl-carrier protein] dehydrogenase (E.C.1.3.8.14)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6AF6 
_struct_keywords.text            'red pigment, pyrrole, acyl-CoA oxidase, FAD, tetramer, BIOSYNTHETIC PROTEIN' 
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 6   ? VAL A 23  ? SER A 6   VAL A 23  1 ? 18 
HELX_P HELX_P2  AA2 ASP A 27  ? GLN A 34  ? ASP A 27  GLN A 34  1 ? 8  
HELX_P HELX_P3  AA3 SER A 38  ? GLY A 49  ? SER A 38  GLY A 49  1 ? 12 
HELX_P HELX_P4  AA4 SER A 56  ? GLY A 60  ? SER A 56  GLY A 60  5 ? 5  
HELX_P HELX_P5  AA5 GLY A 65  ? SER A 80  ? GLY A 65  SER A 80  1 ? 16 
HELX_P HELX_P6  AA6 ASP A 82  ? CYS A 96  ? ASP A 82  CYS A 96  1 ? 15 
HELX_P HELX_P7  AA7 CYS A 96  ? GLY A 104 ? CYS A 96  GLY A 104 1 ? 9  
HELX_P HELX_P8  AA8 SER A 105 ? THR A 118 ? SER A 105 THR A 118 1 ? 14 
HELX_P HELX_P9  AA9 ASP A 135 ? MET A 139 ? ASP A 135 MET A 139 5 ? 5  
HELX_P HELX_P10 AB1 ALA A 162 ? ALA A 165 ? ALA A 162 ALA A 165 5 ? 4  
HELX_P HELX_P11 AB2 GLY A 179 ? LEU A 181 ? GLY A 179 LEU A 181 5 ? 3  
HELX_P HELX_P12 AB3 ALA A 232 ? CYS A 247 ? ALA A 232 CYS A 247 1 ? 16 
HELX_P HELX_P13 AB4 SER A 249 ? ARG A 270 ? SER A 249 ARG A 270 1 ? 22 
HELX_P HELX_P14 AB5 PHE A 280 ? GLN A 310 ? PHE A 280 GLN A 310 1 ? 31 
HELX_P HELX_P15 AB6 ALA A 314 ? GLY A 341 ? ALA A 314 GLY A 341 1 ? 28 
HELX_P HELX_P16 AB7 GLY A 342 ? MET A 345 ? GLY A 342 MET A 345 5 ? 4  
HELX_P HELX_P17 AB8 GLY A 350 ? ILE A 359 ? GLY A 350 ILE A 359 1 ? 10 
HELX_P HELX_P18 AB9 PRO A 360 ? ILE A 363 ? PRO A 360 ILE A 363 5 ? 4  
HELX_P HELX_P19 AC1 THR A 367 ? LEU A 379 ? THR A 367 LEU A 379 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           G 
_struct_conn.ptnr1_label_comp_id           PRO 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           C 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           H 
_struct_conn.ptnr2_label_comp_id           GLY 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            PRO 
_struct_conn.ptnr1_auth_seq_id             506 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            GLY 
_struct_conn.ptnr2_auth_seq_id             507 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.333 
_struct_conn.pdbx_value_order              sing 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 123 ? ALA A 126 ? ALA A 123 ALA A 126 
AA1 2 VAL A 167 ? LYS A 173 ? VAL A 167 LYS A 173 
AA1 3 VAL A 183 ? GLU A 189 ? VAL A 183 GLU A 189 
AA1 4 ARG A 226 ? ILE A 227 ? ARG A 226 ILE A 227 
AA2 1 THR A 142 ? CYS A 146 ? THR A 142 CYS A 146 
AA2 2 GLY A 149 ? THR A 160 ? GLY A 149 THR A 160 
AA2 3 TRP A 211 ? PRO A 222 ? TRP A 211 PRO A 222 
AA2 4 LEU A 195 ? VAL A 197 ? LEU A 195 VAL A 197 
AA3 1 GLN A 271 ? GLN A 272 ? GLN A 271 GLN A 272 
AA3 2 LYS A 275 ? ALA A 276 ? LYS A 275 ALA A 276 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 126 ? N ALA A 126 O ILE A 169 ? O ILE A 169 
AA1 2 3 N ALA A 172 ? N ALA A 172 O SER A 184 ? O SER A 184 
AA1 3 4 N ALA A 185 ? N ALA A 185 O ILE A 227 ? O ILE A 227 
AA2 1 2 N CYS A 146 ? N CYS A 146 O GLY A 149 ? O GLY A 149 
AA2 2 3 N LEU A 152 ? N LEU A 152 O ILE A 219 ? O ILE A 219 
AA2 3 4 O VAL A 215 ? O VAL A 215 N ASN A 196 ? N ASN A 196 
AA3 1 2 N GLN A 272 ? N GLN A 272 O LYS A 275 ? O LYS A 275 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FAD 501 ? 31 'binding site for residue FAD A 501'                  
AC2 Software A O4B 502 ? 5  'binding site for residue O4B A 502'                  
AC3 Software A O4B 503 ? 4  'binding site for residue O4B A 503'                  
AC4 Software A CL  504 ? 4  'binding site for residue CL A 504'                   
AC5 Software A PRO 505 ? 6  'binding site for residue PRO A 505'                  
AC6 Software A PRO 506 ? 11 'binding site for Di-peptide PRO A 506 and GLY A 507' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 31 ASN A 125 ? ASN A 125 . ? 1_555 ? 
2  AC1 31 ALA A 127 ? ALA A 127 . ? 1_555 ? 
3  AC1 31 THR A 128 ? THR A 128 . ? 1_555 ? 
4  AC1 31 GLY A 133 ? GLY A 133 . ? 1_555 ? 
5  AC1 31 SER A 134 ? SER A 134 . ? 1_555 ? 
6  AC1 31 PHE A 158 ? PHE A 158 . ? 1_555 ? 
7  AC1 31 ILE A 159 ? ILE A 159 . ? 1_555 ? 
8  AC1 31 THR A 160 ? THR A 160 . ? 1_555 ? 
9  AC1 31 TRP A 211 ? TRP A 211 . ? 1_555 ? 
10 AC1 31 ARG A 270 ? ARG A 270 . ? 2_555 ? 
11 AC1 31 GLN A 272 ? GLN A 272 . ? 2_555 ? 
12 AC1 31 PHE A 273 ? PHE A 273 . ? 2_555 ? 
13 AC1 31 PHE A 280 ? PHE A 280 . ? 2_555 ? 
14 AC1 31 GLN A 281 ? GLN A 281 . ? 4_555 ? 
15 AC1 31 VAL A 283 ? VAL A 283 . ? 2_555 ? 
16 AC1 31 ARG A 286 ? ARG A 286 . ? 2_555 ? 
17 AC1 31 GLN A 338 ? GLN A 338 . ? 2_555 ? 
18 AC1 31 THR A 339 ? THR A 339 . ? 2_555 ? 
19 AC1 31 GLY A 342 ? GLY A 342 . ? 2_555 ? 
20 AC1 31 ILE A 363 ? ILE A 363 . ? 1_555 ? 
21 AC1 31 PHE A 364 ? PHE A 364 . ? 1_555 ? 
22 AC1 31 THR A 367 ? THR A 367 . ? 1_555 ? 
23 AC1 31 ASP A 369 ? ASP A 369 . ? 1_555 ? 
24 AC1 31 ILE A 370 ? ILE A 370 . ? 1_555 ? 
25 AC1 31 PRO F .   ? PRO A 505 . ? 1_555 ? 
26 AC1 31 PRO G .   ? PRO A 506 . ? 1_555 ? 
27 AC1 31 HOH I .   ? HOH A 685 . ? 2_555 ? 
28 AC1 31 HOH I .   ? HOH A 713 . ? 1_555 ? 
29 AC1 31 HOH I .   ? HOH A 721 . ? 1_555 ? 
30 AC1 31 HOH I .   ? HOH A 810 . ? 1_555 ? 
31 AC1 31 HOH I .   ? HOH A 828 . ? 1_555 ? 
32 AC2 5  LEU A 41  ? LEU A 41  . ? 1_555 ? 
33 AC2 5  LYS A 44  ? LYS A 44  . ? 1_555 ? 
34 AC2 5  CYS A 146 ? CYS A 146 . ? 7_545 ? 
35 AC2 5  ILE A 151 ? ILE A 151 . ? 7_545 ? 
36 AC2 5  ASP A 218 ? ASP A 218 . ? 7_545 ? 
37 AC3 4  PHE A 273 ? PHE A 273 . ? 1_555 ? 
38 AC3 4  LYS A 275 ? LYS A 275 . ? 1_555 ? 
39 AC3 4  GLN A 279 ? GLN A 279 . ? 1_555 ? 
40 AC3 4  PHE A 280 ? PHE A 280 . ? 1_555 ? 
41 AC4 4  GLN A 281 ? GLN A 281 . ? 3_555 ? 
42 AC4 4  GLN A 281 ? GLN A 281 . ? 1_555 ? 
43 AC4 4  HOH I .   ? HOH A 747 . ? 1_555 ? 
44 AC4 4  HOH I .   ? HOH A 747 . ? 3_555 ? 
45 AC5 6  ASN A 125 ? ASN A 125 . ? 1_555 ? 
46 AC5 6  MET A 241 ? MET A 241 . ? 1_555 ? 
47 AC5 6  PHE A 364 ? PHE A 364 . ? 1_555 ? 
48 AC5 6  SER A 365 ? SER A 365 . ? 1_555 ? 
49 AC5 6  FAD B .   ? FAD A 501 . ? 1_555 ? 
50 AC5 6  PRO G .   ? PRO A 506 . ? 1_555 ? 
51 AC6 11 THR A 128 ? THR A 128 . ? 1_555 ? 
52 AC6 11 GLY A 133 ? GLY A 133 . ? 1_555 ? 
53 AC6 11 SER A 134 ? SER A 134 . ? 1_555 ? 
54 AC6 11 TYR A 137 ? TYR A 137 . ? 1_555 ? 
55 AC6 11 PHE A 237 ? PHE A 237 . ? 1_555 ? 
56 AC6 11 GLY A 366 ? GLY A 366 . ? 1_555 ? 
57 AC6 11 FAD B .   ? FAD A 501 . ? 1_555 ? 
58 AC6 11 PRO F .   ? PRO A 505 . ? 1_555 ? 
59 AC6 11 HOH I .   ? HOH A 609 . ? 1_555 ? 
60 AC6 11 HOH I .   ? HOH A 612 . ? 1_555 ? 
61 AC6 11 HOH I .   ? HOH A 699 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6AF6 
_atom_sites.fract_transf_matrix[1][1]   0.011686 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011587 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006860 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 33.082 0.793   -4.056 1.00 41.85 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 31.853 0.133   -3.607 1.00 35.06 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 32.134 -1.165  -2.897 1.00 30.63 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 32.721 -2.073  -3.470 1.00 29.72 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 30.933 -0.118  -4.796 1.00 38.83 ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 29.546 -0.634  -4.441 1.00 30.37 ? 1    MET A CG    1 
ATOM   7    S  SD    A MET A 1 1   ? 28.432 0.277   -5.487 0.41 24.90 ? 1    MET A SD    1 
ATOM   8    S  SD    B MET A 1 1   ? 28.400 0.620   -3.836 0.59 30.20 ? 1    MET A SD    1 
ATOM   9    C  CE    A MET A 1 1   ? 27.957 1.604   -4.381 0.41 20.60 ? 1    MET A CE    1 
ATOM   10   C  CE    B MET A 1 1   ? 28.431 1.812   -5.167 0.59 24.38 ? 1    MET A CE    1 
ATOM   11   N  N     . ASP A 1 2   ? 31.675 -1.261  -1.652 1.00 24.49 ? 2    ASP A N     1 
ATOM   12   C  CA    . ASP A 1 2   ? 32.027 -2.328  -0.741 1.00 24.37 ? 2    ASP A CA    1 
ATOM   13   C  C     . ASP A 1 2   ? 30.945 -2.388  0.323  1.00 24.92 ? 2    ASP A C     1 
ATOM   14   O  O     . ASP A 1 2   ? 30.535 -1.337  0.822  1.00 32.87 ? 2    ASP A O     1 
ATOM   15   C  CB    . ASP A 1 2   ? 33.401 -2.008  -0.079 1.00 24.46 ? 2    ASP A CB    1 
ATOM   16   C  CG    . ASP A 1 2   ? 33.840 -3.067  0.885  1.00 40.87 ? 2    ASP A CG    1 
ATOM   17   O  OD1   . ASP A 1 2   ? 34.591 -3.975  0.470  1.00 77.29 ? 2    ASP A OD1   1 
ATOM   18   O  OD2   . ASP A 1 2   ? 33.437 -3.031  2.059  1.00 52.24 ? 2    ASP A OD2   1 
ATOM   19   N  N     . PHE A 1 3   ? 30.533 -3.592  0.719  1.00 19.88 ? 3    PHE A N     1 
ATOM   20   C  CA    . PHE A 1 3   ? 29.510 -3.737  1.754  1.00 25.27 ? 3    PHE A CA    1 
ATOM   21   C  C     . PHE A 1 3   ? 29.971 -4.567  2.957  1.00 20.90 ? 3    PHE A C     1 
ATOM   22   O  O     . PHE A 1 3   ? 29.141 -5.183  3.625  1.00 31.40 ? 3    PHE A O     1 
ATOM   23   C  CB    . PHE A 1 3   ? 28.232 -4.325  1.143  1.00 24.44 ? 3    PHE A CB    1 
ATOM   24   C  CG    . PHE A 1 3   ? 27.649 -3.465  0.046  1.00 20.59 ? 3    PHE A CG    1 
ATOM   25   C  CD1   . PHE A 1 3   ? 26.722 -2.456  0.336  1.00 21.97 ? 3    PHE A CD1   1 
ATOM   26   C  CD2   . PHE A 1 3   ? 28.024 -3.647  -1.284 1.00 16.51 ? 3    PHE A CD2   1 
ATOM   27   C  CE1   . PHE A 1 3   ? 26.192 -1.655  -0.676 1.00 20.28 ? 3    PHE A CE1   1 
ATOM   28   C  CE2   . PHE A 1 3   ? 27.505 -2.858  -2.301 1.00 17.53 ? 3    PHE A CE2   1 
ATOM   29   C  CZ    . PHE A 1 3   ? 26.596 -1.835  -2.016 1.00 19.90 ? 3    PHE A CZ    1 
ATOM   30   N  N     . ASN A 1 4   ? 31.270 -4.663  3.203  1.00 29.85 ? 4    ASN A N     1 
ATOM   31   C  CA    . ASN A 1 4   ? 31.760 -5.331  4.402  1.00 36.68 ? 4    ASN A CA    1 
ATOM   32   C  C     . ASN A 1 4   ? 32.142 -4.253  5.407  1.00 32.65 ? 4    ASN A C     1 
ATOM   33   O  O     . ASN A 1 4   ? 32.520 -3.132  5.046  1.00 34.73 ? 4    ASN A O     1 
ATOM   34   C  CB    . ASN A 1 4   ? 32.990 -6.244  4.159  1.00 38.58 ? 4    ASN A CB    1 
ATOM   35   C  CG    . ASN A 1 4   ? 32.670 -7.668  3.554  1.00 43.88 ? 4    ASN A CG    1 
ATOM   36   O  OD1   . ASN A 1 4   ? 31.648 -8.357  3.842  1.00 33.06 ? 4    ASN A OD1   1 
ATOM   37   N  ND2   . ASN A 1 4   ? 33.626 -8.129  2.733  1.00 50.31 ? 4    ASN A ND2   1 
ATOM   38   N  N     . LEU A 1 5   ? 32.022 -4.603  6.676  1.00 29.99 ? 5    LEU A N     1 
ATOM   39   C  CA    . LEU A 1 5   ? 32.542 -3.772  7.743  1.00 23.55 ? 5    LEU A CA    1 
ATOM   40   C  C     . LEU A 1 5   ? 34.048 -4.010  7.867  1.00 21.05 ? 5    LEU A C     1 
ATOM   41   O  O     . LEU A 1 5   ? 34.521 -5.145  7.693  1.00 25.31 ? 5    LEU A O     1 
ATOM   42   C  CB    . LEU A 1 5   ? 31.842 -4.154  9.038  1.00 23.26 ? 5    LEU A CB    1 
ATOM   43   C  CG    . LEU A 1 5   ? 30.326 -3.961  9.115  1.00 27.69 ? 5    LEU A CG    1 
ATOM   44   C  CD1   . LEU A 1 5   ? 29.879 -4.252  10.533 1.00 25.98 ? 5    LEU A CD1   1 
ATOM   45   C  CD2   . LEU A 1 5   ? 29.994 -2.561  8.715  1.00 24.30 ? 5    LEU A CD2   1 
ATOM   46   N  N     . SER A 1 6   ? 34.778 -2.949  8.181  1.00 20.67 ? 6    SER A N     1 
ATOM   47   C  CA    . SER A 1 6   ? 36.151 -3.095  8.622  1.00 24.57 ? 6    SER A CA    1 
ATOM   48   C  C     . SER A 1 6   ? 36.206 -3.892  9.920  1.00 26.43 ? 6    SER A C     1 
ATOM   49   O  O     . SER A 1 6   ? 35.187 -4.081  10.617 1.00 22.66 ? 6    SER A O     1 
ATOM   50   C  CB    . SER A 1 6   ? 36.768 -1.730  8.824  1.00 23.70 ? 6    SER A CB    1 
ATOM   51   O  OG    . SER A 1 6   ? 36.308 -1.133  10.018 1.00 30.11 ? 6    SER A OG    1 
ATOM   52   N  N     . ASN A 1 7   ? 37.405 -4.398  10.248 1.00 23.53 ? 7    ASN A N     1 
ATOM   53   C  CA    . ASN A 1 7   ? 37.538 -5.119  11.517 1.00 25.15 ? 7    ASN A CA    1 
ATOM   54   C  C     . ASN A 1 7   ? 37.232 -4.194  12.687 1.00 19.38 ? 7    ASN A C     1 
ATOM   55   O  O     . ASN A 1 7   ? 36.616 -4.605  13.681 1.00 20.84 ? 7    ASN A O     1 
ATOM   56   C  CB    . ASN A 1 7   ? 38.946 -5.705  11.640 1.00 32.76 ? 7    ASN A CB    1 
ATOM   57   C  CG    . ASN A 1 7   ? 39.190 -6.815  10.651 1.00 33.65 ? 7    ASN A CG    1 
ATOM   58   O  OD1   . ASN A 1 7   ? 38.310 -7.658  10.408 1.00 48.07 ? 7    ASN A OD1   1 
ATOM   59   N  ND2   . ASN A 1 7   ? 40.381 -6.826  10.053 1.00 54.60 ? 7    ASN A ND2   1 
ATOM   60   N  N     . SER A 1 8   ? 37.631 -2.939  12.552 1.00 20.78 ? 8    SER A N     1 
ATOM   61   C  CA    . SER A 1 8   ? 37.356 -1.919  13.543 1.00 21.09 ? 8    SER A CA    1 
ATOM   62   C  C     . SER A 1 8   ? 35.846 -1.712  13.714 1.00 22.57 ? 8    SER A C     1 
ATOM   63   O  O     . SER A 1 8   ? 35.338 -1.720  14.838 1.00 20.83 ? 8    SER A O     1 
ATOM   64   C  CB    . SER A 1 8   ? 38.027 -0.626  13.109 1.00 29.92 ? 8    SER A CB    1 
ATOM   65   O  OG    . SER A 1 8   ? 37.552 0.445   13.884 1.00 40.51 ? 8    SER A OG    1 
ATOM   66   N  N     . GLN A 1 9   ? 35.117 -1.597  12.594 1.00 21.23 ? 9    GLN A N     1 
ATOM   67   C  CA    . GLN A 1 9   ? 33.659 -1.449  12.645 1.00 21.27 ? 9    GLN A CA    1 
ATOM   68   C  C     . GLN A 1 9   ? 32.989 -2.671  13.236 1.00 15.42 ? 9    GLN A C     1 
ATOM   69   O  O     . GLN A 1 9   ? 32.054 -2.557  14.054 1.00 17.77 ? 9    GLN A O     1 
ATOM   70   C  CB    . GLN A 1 9   ? 33.131 -1.201  11.235 1.00 17.26 ? 9    GLN A CB    1 
ATOM   71   C  CG    . GLN A 1 9   ? 33.447 0.200   10.790 1.00 24.43 ? 9    GLN A CG    1 
ATOM   72   C  CD    . GLN A 1 9   ? 33.278 0.407   9.303  1.00 23.22 ? 9    GLN A CD    1 
ATOM   73   O  OE1   . GLN A 1 9   ? 33.392 -0.517  8.491  1.00 26.81 ? 9    GLN A OE1   1 
ATOM   74   N  NE2   . GLN A 1 9   ? 32.945 1.632   8.939  1.00 29.62 ? 9    GLN A NE2   1 
ATOM   75   N  N     . SER A 1 10  ? 33.429 -3.860  12.834 1.00 18.05 ? 10   SER A N     1 
ATOM   76   C  CA    . SER A 1 10  ? 32.876 -5.082  13.405 1.00 15.73 ? 10   SER A CA    1 
ATOM   77   C  C     . SER A 1 10  ? 33.084 -5.139  14.915 1.00 18.25 ? 10   SER A C     1 
ATOM   78   O  O     . SER A 1 10  ? 32.185 -5.539  15.670 1.00 17.00 ? 10   SER A O     1 
ATOM   79   C  CB    . SER A 1 10  ? 33.538 -6.301  12.757 1.00 21.48 ? 10   SER A CB    1 
ATOM   80   O  OG    A SER A 1 10  ? 33.170 -6.422  11.412 0.51 21.07 ? 10   SER A OG    1 
ATOM   81   O  OG    B SER A 1 10  ? 32.965 -7.491  13.246 0.49 20.94 ? 10   SER A OG    1 
ATOM   82   N  N     . ASP A 1 11  ? 34.276 -4.745  15.385 1.00 18.13 ? 11   ASP A N     1 
ATOM   83   C  CA    . ASP A 1 11  ? 34.547 -4.781  16.821 1.00 19.24 ? 11   ASP A CA    1 
ATOM   84   C  C     . ASP A 1 11  ? 33.650 -3.822  17.579 1.00 15.67 ? 11   ASP A C     1 
ATOM   85   O  O     . ASP A 1 11  ? 33.194 -4.147  18.674 1.00 16.69 ? 11   ASP A O     1 
ATOM   86   C  CB    . ASP A 1 11  ? 36.000 -4.398  17.110 1.00 21.69 ? 11   ASP A CB    1 
ATOM   87   C  CG    . ASP A 1 11  ? 36.987 -5.499  16.754 1.00 35.23 ? 11   ASP A CG    1 
ATOM   88   O  OD1   . ASP A 1 11  ? 38.210 -5.202  16.745 1.00 43.31 ? 11   ASP A OD1   1 
ATOM   89   O  OD2   . ASP A 1 11  ? 36.548 -6.636  16.459 1.00 32.78 ? 11   ASP A OD2   1 
ATOM   90   N  N     . ILE A 1 12  ? 33.433 -2.633  17.021 1.00 15.49 ? 12   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 12  ? 32.569 -1.637  17.645 1.00 14.24 ? 12   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 12  ? 31.162 -2.215  17.802 1.00 15.14 ? 12   ILE A C     1 
ATOM   93   O  O     . ILE A 1 12  ? 30.556 -2.116  18.873 1.00 14.43 ? 12   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 12  ? 32.553 -0.349  16.807 1.00 17.12 ? 12   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 12  ? 33.885 0.425   16.957 1.00 27.04 ? 12   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 12  ? 31.402 0.489   17.188 1.00 21.49 ? 12   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 12  ? 34.033 1.569   15.951 1.00 22.79 ? 12   ILE A CD1   1 
ATOM   98   N  N     . TYR A 1 13  ? 30.627 -2.797  16.710 1.00 12.21 ? 13   TYR A N     1 
ATOM   99   C  CA    . TYR A 1 13  ? 29.291 -3.410  16.752 1.00 10.76 ? 13   TYR A CA    1 
ATOM   100  C  C     . TYR A 1 13  ? 29.227 -4.541  17.769 1.00 15.71 ? 13   TYR A C     1 
ATOM   101  O  O     . TYR A 1 13  ? 28.330 -4.584  18.623 1.00 14.18 ? 13   TYR A O     1 
ATOM   102  C  CB    . TYR A 1 13  ? 28.914 -3.922  15.331 1.00 11.25 ? 13   TYR A CB    1 
ATOM   103  C  CG    . TYR A 1 13  ? 27.512 -4.518  15.330 1.00 10.84 ? 13   TYR A CG    1 
ATOM   104  C  CD1   . TYR A 1 13  ? 27.297 -5.850  15.759 1.00 15.39 ? 13   TYR A CD1   1 
ATOM   105  C  CD2   . TYR A 1 13  ? 26.413 -3.753  14.990 1.00 13.40 ? 13   TYR A CD2   1 
ATOM   106  C  CE1   . TYR A 1 13  ? 26.052 -6.392  15.862 1.00 15.82 ? 13   TYR A CE1   1 
ATOM   107  C  CE2   . TYR A 1 13  ? 25.111 -4.299  15.063 1.00 12.60 ? 13   TYR A CE2   1 
ATOM   108  C  CZ    . TYR A 1 13  ? 24.944 -5.607  15.485 1.00 14.08 ? 13   TYR A CZ    1 
ATOM   109  O  OH    . TYR A 1 13  ? 23.702 -6.199  15.580 1.00 15.39 ? 13   TYR A OH    1 
ATOM   110  N  N     . GLU A 1 14  ? 30.186 -5.480  17.706 1.00 13.69 ? 14   GLU A N     1 
ATOM   111  C  CA    . GLU A 1 14  ? 30.084 -6.642  18.573 1.00 13.45 ? 14   GLU A CA    1 
ATOM   112  C  C     . GLU A 1 14  ? 30.244 -6.260  20.028 1.00 13.34 ? 14   GLU A C     1 
ATOM   113  O  O     . GLU A 1 14  ? 29.527 -6.796  20.886 1.00 14.70 ? 14   GLU A O     1 
ATOM   114  C  CB    . GLU A 1 14  ? 31.124 -7.689  18.172 1.00 18.63 ? 14   GLU A CB    1 
ATOM   115  C  CG    . GLU A 1 14  ? 30.909 -8.344  16.782 1.00 44.25 ? 14   GLU A CG    1 
ATOM   116  C  CD    . GLU A 1 14  ? 29.501 -8.987  16.524 1.00 57.09 ? 14   GLU A CD    1 
ATOM   117  O  OE1   . GLU A 1 14  ? 29.110 -9.035  15.336 1.00 54.56 ? 14   GLU A OE1   1 
ATOM   118  O  OE2   . GLU A 1 14  ? 28.791 -9.451  17.457 1.00 44.44 ? 14   GLU A OE2   1 
ATOM   119  N  N     . SER A 1 15  ? 31.128 -5.320  20.329 1.00 13.05 ? 15   SER A N     1 
ATOM   120  C  CA    . SER A 1 15  ? 31.295 -4.910  21.720 1.00 15.18 ? 15   SER A CA    1 
ATOM   121  C  C     . SER A 1 15  ? 30.020 -4.236  22.254 1.00 14.36 ? 15   SER A C     1 
ATOM   122  O  O     . SER A 1 15  ? 29.544 -4.521  23.359 1.00 14.43 ? 15   SER A O     1 
ATOM   123  C  CB    . SER A 1 15  ? 32.509 -3.993  21.813 1.00 18.36 ? 15   SER A CB    1 
ATOM   124  O  OG    . SER A 1 15  ? 32.608 -3.427  23.118 1.00 26.35 ? 15   SER A OG    1 
ATOM   125  N  N     . ALA A 1 16  ? 29.409 -3.380  21.439 1.00 12.39 ? 16   ALA A N     1 
ATOM   126  C  CA    . ALA A 1 16  ? 28.168 -2.741  21.859 1.00 10.40 ? 16   ALA A CA    1 
ATOM   127  C  C     . ALA A 1 16  ? 27.042 -3.753  22.034 1.00 8.78  ? 16   ALA A C     1 
ATOM   128  O  O     . ALA A 1 16  ? 26.239 -3.627  22.964 1.00 10.25 ? 16   ALA A O     1 
ATOM   129  C  CB    . ALA A 1 16  ? 27.757 -1.686  20.801 1.00 10.75 ? 16   ALA A CB    1 
ATOM   130  N  N     . TYR A 1 17  ? 26.957 -4.747  21.140 1.00 9.75  ? 17   TYR A N     1 
ATOM   131  C  CA    . TYR A 1 17  ? 25.903 -5.739  21.206 1.00 8.41  ? 17   TYR A CA    1 
ATOM   132  C  C     . TYR A 1 17  ? 26.053 -6.549  22.477 1.00 11.85 ? 17   TYR A C     1 
ATOM   133  O  O     . TYR A 1 17  ? 25.070 -6.831  23.186 1.00 10.82 ? 17   TYR A O     1 
ATOM   134  C  CB    . TYR A 1 17  ? 26.000 -6.646  19.968 1.00 10.72 ? 17   TYR A CB    1 
ATOM   135  C  CG    . TYR A 1 17  ? 24.929 -7.679  19.922 1.00 12.63 ? 17   TYR A CG    1 
ATOM   136  C  CD1   . TYR A 1 17  ? 23.572 -7.318  19.654 1.00 12.46 ? 17   TYR A CD1   1 
ATOM   137  C  CD2   . TYR A 1 17  ? 25.216 -9.007  20.203 1.00 18.24 ? 17   TYR A CD2   1 
ATOM   138  C  CE1   . TYR A 1 17  ? 22.566 -8.264  19.635 1.00 13.72 ? 17   TYR A CE1   1 
ATOM   139  C  CE2   . TYR A 1 17  ? 24.198 -9.976  20.178 1.00 22.21 ? 17   TYR A CE2   1 
ATOM   140  C  CZ    . TYR A 1 17  ? 22.873 -9.591  19.878 1.00 21.36 ? 17   TYR A CZ    1 
ATOM   141  O  OH    . TYR A 1 17  ? 21.867 -10.540 19.874 1.00 22.42 ? 17   TYR A OH    1 
ATOM   142  N  N     . ARG A 1 18  ? 27.310 -6.919  22.795 1.00 11.18 ? 18   ARG A N     1 
ATOM   143  C  CA    . ARG A 1 18  ? 27.554 -7.671  24.033 1.00 12.27 ? 18   ARG A CA    1 
ATOM   144  C  C     . ARG A 1 18  ? 27.138 -6.885  25.261 1.00 12.30 ? 18   ARG A C     1 
ATOM   145  O  O     . ARG A 1 18  ? 26.513 -7.434  26.159 1.00 12.68 ? 18   ARG A O     1 
ATOM   146  C  CB    . ARG A 1 18  ? 29.050 -8.062  24.151 1.00 17.24 ? 18   ARG A CB    1 
ATOM   147  C  CG    . ARG A 1 18  ? 29.427 -9.152  23.176 1.00 28.23 ? 18   ARG A CG    1 
ATOM   148  C  CD    . ARG A 1 18  ? 29.396 -10.541 23.817 1.00 30.63 ? 18   ARG A CD    1 
ATOM   149  N  NE    . ARG A 1 18  ? 28.139 -10.906 24.487 1.00 32.01 ? 18   ARG A NE    1 
ATOM   150  C  CZ    . ARG A 1 18  ? 27.051 -11.394 23.875 1.00 32.31 ? 18   ARG A CZ    1 
ATOM   151  N  NH1   . ARG A 1 18  ? 25.965 -11.721 24.592 1.00 27.70 ? 18   ARG A NH1   1 
ATOM   152  N  NH2   . ARG A 1 18  ? 27.042 -11.552 22.550 1.00 36.45 ? 18   ARG A NH2   1 
ATOM   153  N  N     . PHE A 1 19  ? 27.473 -5.604  25.309 1.00 10.93 ? 19   PHE A N     1 
ATOM   154  C  CA    . PHE A 1 19  ? 27.059 -4.766  26.430 1.00 10.36 ? 19   PHE A CA    1 
ATOM   155  C  C     . PHE A 1 19  ? 25.553 -4.697  26.482 1.00 12.98 ? 19   PHE A C     1 
ATOM   156  O  O     . PHE A 1 19  ? 24.945 -4.807  27.543 1.00 10.93 ? 19   PHE A O     1 
ATOM   157  C  CB    . PHE A 1 19  ? 27.674 -3.388  26.304 1.00 10.58 ? 19   PHE A CB    1 
ATOM   158  C  CG    . PHE A 1 19  ? 27.431 -2.519  27.503 1.00 14.59 ? 19   PHE A CG    1 
ATOM   159  C  CD1   . PHE A 1 19  ? 28.347 -2.481  28.552 1.00 20.96 ? 19   PHE A CD1   1 
ATOM   160  C  CD2   . PHE A 1 19  ? 26.282 -1.731  27.619 1.00 16.53 ? 19   PHE A CD2   1 
ATOM   161  C  CE1   . PHE A 1 19  ? 28.090 -1.659  29.653 1.00 15.41 ? 19   PHE A CE1   1 
ATOM   162  C  CE2   . PHE A 1 19  ? 26.024 -0.928  28.724 1.00 17.60 ? 19   PHE A CE2   1 
ATOM   163  C  CZ    . PHE A 1 19  ? 26.916 -0.885  29.749 1.00 19.55 ? 19   PHE A CZ    1 
ATOM   164  N  N     . ALA A 1 20  ? 24.923 -4.431  25.337 1.00 9.53  ? 20   ALA A N     1 
ATOM   165  C  CA    . ALA A 1 20  ? 23.478 -4.319  25.378 1.00 7.94  ? 20   ALA A CA    1 
ATOM   166  C  C     . ALA A 1 20  ? 22.827 -5.612  25.872 1.00 11.14 ? 20   ALA A C     1 
ATOM   167  O  O     . ALA A 1 20  ? 21.867 -5.570  26.639 1.00 13.16 ? 20   ALA A O     1 
ATOM   168  C  CB    . ALA A 1 20  ? 22.975 -3.955  23.979 1.00 7.91  ? 20   ALA A CB    1 
ATOM   169  N  N     . CYS A 1 21  ? 23.324 -6.777  25.406 1.00 10.08 ? 21   CYS A N     1 
ATOM   170  C  CA    . CYS A 1 21  ? 22.742 -8.055  25.832 1.00 12.24 ? 21   CYS A CA    1 
ATOM   171  C  C     . CYS A 1 21  ? 23.059 -8.385  27.280 1.00 14.86 ? 21   CYS A C     1 
ATOM   172  O  O     . CYS A 1 21  ? 22.196 -8.880  28.020 1.00 15.37 ? 21   CYS A O     1 
ATOM   173  C  CB    . CYS A 1 21  ? 23.303 -9.195  24.982 1.00 11.75 ? 21   CYS A CB    1 
ATOM   174  S  SG    A CYS A 1 21  ? 22.704 -9.208  23.274 0.75 13.49 ? 21   CYS A SG    1 
ATOM   175  S  SG    B CYS A 1 21  ? 22.565 -10.698 25.417 0.25 20.94 ? 21   CYS A SG    1 
ATOM   176  N  N     . ASP A 1 22  ? 24.322 -8.269  27.647 1.00 11.82 ? 22   ASP A N     1 
ATOM   177  C  CA    . ASP A 1 22  ? 24.772 -8.781  28.948 1.00 13.56 ? 22   ASP A CA    1 
ATOM   178  C  C     . ASP A 1 22  ? 24.578 -7.819  30.101 1.00 18.97 ? 22   ASP A C     1 
ATOM   179  O  O     . ASP A 1 22  ? 24.654 -8.244  31.263 1.00 20.32 ? 22   ASP A O     1 
ATOM   180  C  CB    . ASP A 1 22  ? 26.268 -9.098  28.875 1.00 12.40 ? 22   ASP A CB    1 
ATOM   181  C  CG    . ASP A 1 22  ? 26.555 -10.273 27.925 1.00 20.03 ? 22   ASP A CG    1 
ATOM   182  O  OD1   . ASP A 1 22  ? 25.594 -10.980 27.537 1.00 25.45 ? 22   ASP A OD1   1 
ATOM   183  O  OD2   . ASP A 1 22  ? 27.722 -10.406 27.480 1.00 31.16 ? 22   ASP A OD2   1 
ATOM   184  N  N     . VAL A 1 23  ? 24.459 -6.510  29.853 1.00 11.95 ? 23   VAL A N     1 
ATOM   185  C  CA    . VAL A 1 23  ? 24.332 -5.529  30.901 1.00 10.81 ? 23   VAL A CA    1 
ATOM   186  C  C     . VAL A 1 23  ? 22.946 -4.888  30.856 1.00 11.61 ? 23   VAL A C     1 
ATOM   187  O  O     . VAL A 1 23  ? 22.178 -4.963  31.818 1.00 14.95 ? 23   VAL A O     1 
ATOM   188  C  CB    . VAL A 1 23  ? 25.455 -4.468  30.792 1.00 13.04 ? 23   VAL A CB    1 
ATOM   189  C  CG1   . VAL A 1 23  ? 25.302 -3.369  31.827 1.00 12.53 ? 23   VAL A CG1   1 
ATOM   190  C  CG2   . VAL A 1 23  ? 26.858 -5.131  30.911 1.00 18.20 ? 23   VAL A CG2   1 
ATOM   191  N  N     . LEU A 1 24  ? 22.556 -4.336  29.682 1.00 11.89 ? 24   LEU A N     1 
ATOM   192  C  CA    . LEU A 1 24  ? 21.276 -3.593  29.689 1.00 11.82 ? 24   LEU A CA    1 
ATOM   193  C  C     . LEU A 1 24  ? 20.053 -4.493  29.606 1.00 12.64 ? 24   LEU A C     1 
ATOM   194  O  O     . LEU A 1 24  ? 18.987 -4.168  30.156 1.00 13.23 ? 24   LEU A O     1 
ATOM   195  C  CB    . LEU A 1 24  ? 21.273 -2.592  28.501 1.00 8.27  ? 24   LEU A CB    1 
ATOM   196  C  CG    . LEU A 1 24  ? 22.444 -1.633  28.525 1.00 10.59 ? 24   LEU A CG    1 
ATOM   197  C  CD1   . LEU A 1 24  ? 22.332 -0.726  27.320 1.00 12.27 ? 24   LEU A CD1   1 
ATOM   198  C  CD2   . LEU A 1 24  ? 22.316 -0.724  29.743 1.00 15.04 ? 24   LEU A CD2   1 
ATOM   199  N  N     . ASP A 1 25  ? 20.130 -5.594  28.864 1.00 11.43 ? 25   ASP A N     1 
ATOM   200  C  CA    . ASP A 1 25  ? 18.967 -6.431  28.650 1.00 13.78 ? 25   ASP A CA    1 
ATOM   201  C  C     . ASP A 1 25  ? 18.651 -7.295  29.857 1.00 15.89 ? 25   ASP A C     1 
ATOM   202  O  O     . ASP A 1 25  ? 17.512 -7.728  30.009 1.00 15.32 ? 25   ASP A O     1 
ATOM   203  C  CB    . ASP A 1 25  ? 19.169 -7.310  27.442 1.00 13.26 ? 25   ASP A CB    1 
ATOM   204  C  CG    . ASP A 1 25  ? 17.879 -7.934  26.975 1.00 20.28 ? 25   ASP A CG    1 
ATOM   205  O  OD1   . ASP A 1 25  ? 16.893 -7.188  26.706 1.00 15.38 ? 25   ASP A OD1   1 
ATOM   206  O  OD2   . ASP A 1 25  ? 17.806 -9.194  26.900 1.00 22.44 ? 25   ASP A OD2   1 
ATOM   207  N  N     . GLN A 1 26  ? 19.623 -7.492  30.743 1.00 17.14 ? 26   GLN A N     1 
ATOM   208  C  CA    . GLN A 1 26  ? 19.473 -8.433  31.853 1.00 18.74 ? 26   GLN A CA    1 
ATOM   209  C  C     A GLN A 1 26  ? 18.453 -7.669  32.719 0.63 8.96  ? 26   GLN A C     1 
ATOM   210  C  C     B GLN A 1 26  ? 18.168 -8.627  32.639 0.37 18.22 ? 26   GLN A C     1 
ATOM   211  O  O     A GLN A 1 26  ? 18.639 -6.464  33.037 0.63 15.17 ? 26   GLN A O     1 
ATOM   212  O  O     B GLN A 1 26  ? 17.638 -9.746  32.692 0.37 16.91 ? 26   GLN A O     1 
ATOM   213  C  CB    . GLN A 1 26  ? 20.747 -8.382  32.721 1.00 20.45 ? 26   GLN A CB    1 
ATOM   214  C  CG    . GLN A 1 26  ? 21.866 -9.108  32.037 1.00 29.40 ? 26   GLN A CG    1 
ATOM   215  C  CD    . GLN A 1 26  ? 21.475 -10.514 31.621 1.00 33.72 ? 26   GLN A CD    1 
ATOM   216  O  OE1   . GLN A 1 26  ? 21.005 -11.305 32.450 1.00 39.97 ? 26   GLN A OE1   1 
ATOM   217  N  NE2   . GLN A 1 26  ? 21.640 -10.836 30.318 1.00 32.10 ? 26   GLN A NE2   1 
ATOM   218  N  N     A ASP A 1 27  ? 17.429 -8.324  33.199 0.54 15.39 ? 27   ASP A N     1 
ATOM   219  N  N     B ASP A 1 27  ? 17.634 -7.624  33.242 0.46 13.22 ? 27   ASP A N     1 
ATOM   220  C  CA    . ASP A 1 27  ? 16.455 -7.697  34.088 1.00 16.37 ? 27   ASP A CA    1 
ATOM   221  C  C     . ASP A 1 27  ? 15.570 -6.634  33.453 1.00 14.32 ? 27   ASP A C     1 
ATOM   222  O  O     . ASP A 1 27  ? 14.873 -5.925  34.145 1.00 15.54 ? 27   ASP A O     1 
ATOM   223  C  CB    . ASP A 1 27  ? 16.998 -7.234  35.451 1.00 19.75 ? 27   ASP A CB    1 
ATOM   224  C  CG    . ASP A 1 27  ? 15.987 -7.353  36.590 1.00 29.26 ? 27   ASP A CG    1 
ATOM   225  O  OD1   . ASP A 1 27  ? 15.235 -8.363  36.647 1.00 27.69 ? 27   ASP A OD1   1 
ATOM   226  O  OD2   . ASP A 1 27  ? 15.984 -6.410  37.425 1.00 30.10 ? 27   ASP A OD2   1 
ATOM   227  N  N     . ALA A 1 28  ? 15.646 -6.496  32.125 1.00 13.70 ? 28   ALA A N     1 
ATOM   228  C  CA    . ALA A 1 28  ? 14.882 -5.430  31.473 1.00 12.61 ? 28   ALA A CA    1 
ATOM   229  C  C     . ALA A 1 28  ? 13.383 -5.618  31.661 1.00 11.28 ? 28   ALA A C     1 
ATOM   230  O  O     . ALA A 1 28  ? 12.643 -4.629  31.787 1.00 13.16 ? 28   ALA A O     1 
ATOM   231  C  CB    . ALA A 1 28  ? 15.211 -5.371  29.979 1.00 11.48 ? 28   ALA A CB    1 
ATOM   232  N  N     . GLN A 1 29  ? 12.887 -6.860  31.651 1.00 15.27 ? 29   GLN A N     1 
ATOM   233  C  CA    . GLN A 1 29  ? 11.436 -7.028  31.765 1.00 17.35 ? 29   GLN A CA    1 
ATOM   234  C  C     . GLN A 1 29  ? 10.910 -6.454  33.058 1.00 15.25 ? 29   GLN A C     1 
ATOM   235  O  O     . GLN A 1 29  ? 9.838  -5.841  33.086 1.00 14.53 ? 29   GLN A O     1 
ATOM   236  C  CB    . GLN A 1 29  ? 11.067 -8.514  31.676 1.00 25.90 ? 29   GLN A CB    1 
ATOM   237  C  CG    . GLN A 1 29  ? 9.661  -8.841  31.223 1.00 48.74 ? 29   GLN A CG    1 
ATOM   238  C  CD    . GLN A 1 29  ? 9.553  -10.304 30.730 1.00 77.61 ? 29   GLN A CD    1 
ATOM   239  O  OE1   . GLN A 1 29  ? 9.941  -10.620 29.592 1.00 55.90 ? 29   GLN A OE1   1 
ATOM   240  N  NE2   . GLN A 1 29  ? 9.048  -11.198 31.596 1.00 58.39 ? 29   GLN A NE2   1 
ATOM   241  N  N     . THR A 1 30  ? 11.625 -6.665  34.167 1.00 15.56 ? 30   THR A N     1 
ATOM   242  C  CA    . THR A 1 30  ? 11.170 -6.069  35.415 1.00 13.91 ? 30   THR A CA    1 
ATOM   243  C  C     . THR A 1 30  ? 11.154 -4.558  35.341 1.00 13.38 ? 30   THR A C     1 
ATOM   244  O  O     . THR A 1 30  ? 10.209 -3.905  35.829 1.00 16.48 ? 30   THR A O     1 
ATOM   245  C  CB    . THR A 1 30  ? 12.107 -6.499  36.545 1.00 25.09 ? 30   THR A CB    1 
ATOM   246  O  OG1   . THR A 1 30  ? 12.066 -7.923  36.633 1.00 30.62 ? 30   THR A OG1   1 
ATOM   247  C  CG2   . THR A 1 30  ? 11.686 -5.902  37.825 1.00 27.38 ? 30   THR A CG2   1 
ATOM   248  N  N     . ARG A 1 31  ? 12.204 -3.967  34.771 1.00 12.70 ? 31   ARG A N     1 
ATOM   249  C  CA    . ARG A 1 31  ? 12.200 -2.507  34.705 1.00 12.60 ? 31   ARG A CA    1 
ATOM   250  C  C     . ARG A 1 31  ? 11.079 -2.006  33.817 1.00 16.81 ? 31   ARG A C     1 
ATOM   251  O  O     . ARG A 1 31  ? 10.420 -1.023  34.142 1.00 15.23 ? 31   ARG A O     1 
ATOM   252  C  CB    . ARG A 1 31  ? 13.505 -1.985  34.153 1.00 13.88 ? 31   ARG A CB    1 
ATOM   253  C  CG    . ARG A 1 31  ? 14.659 -2.297  35.067 1.00 15.37 ? 31   ARG A CG    1 
ATOM   254  C  CD    . ARG A 1 31  ? 15.817 -1.404  34.750 1.00 12.08 ? 31   ARG A CD    1 
ATOM   255  N  NE    . ARG A 1 31  ? 16.231 -1.485  33.371 1.00 12.24 ? 31   ARG A NE    1 
ATOM   256  C  CZ    . ARG A 1 31  ? 16.912 -2.489  32.797 1.00 12.82 ? 31   ARG A CZ    1 
ATOM   257  N  NH1   . ARG A 1 31  ? 17.187 -2.461  31.486 1.00 11.10 ? 31   ARG A NH1   1 
ATOM   258  N  NH2   . ARG A 1 31  ? 17.375 -3.522  33.541 1.00 13.74 ? 31   ARG A NH2   1 
ATOM   259  N  N     . ILE A 1 32  ? 10.880 -2.655  32.678 1.00 12.88 ? 32   ILE A N     1 
ATOM   260  C  CA    . ILE A 1 32  ? 9.819  -2.219  31.768 1.00 13.86 ? 32   ILE A CA    1 
ATOM   261  C  C     . ILE A 1 32  ? 8.451  -2.336  32.447 1.00 16.21 ? 32   ILE A C     1 
ATOM   262  O  O     . ILE A 1 32  ? 7.614  -1.433  32.345 1.00 18.87 ? 32   ILE A O     1 
ATOM   263  C  CB    . ILE A 1 32  ? 9.906  -3.051  30.469 1.00 18.47 ? 32   ILE A CB    1 
ATOM   264  C  CG1   . ILE A 1 32  ? 11.188 -2.645  29.708 1.00 15.14 ? 32   ILE A CG1   1 
ATOM   265  C  CG2   . ILE A 1 32  ? 8.583  -2.975  29.653 1.00 17.77 ? 32   ILE A CG2   1 
ATOM   266  C  CD1   . ILE A 1 32  ? 11.564 -3.668  28.624 1.00 15.14 ? 32   ILE A CD1   1 
ATOM   267  N  N     . SER A 1 33  ? 8.205  -3.451  33.148 1.00 13.88 ? 33   SER A N     1 
ATOM   268  C  CA    . SER A 1 33  ? 6.913  -3.633  33.835 1.00 15.79 ? 33   SER A CA    1 
ATOM   269  C  C     . SER A 1 33  ? 6.622  -2.523  34.822 1.00 21.36 ? 33   SER A C     1 
ATOM   270  O  O     . SER A 1 33  ? 5.467  -2.089  34.990 1.00 24.05 ? 33   SER A O     1 
ATOM   271  C  CB    . SER A 1 33  ? 6.899  -4.960  34.597 1.00 22.89 ? 33   SER A CB    1 
ATOM   272  O  OG    . SER A 1 33  ? 7.015  -6.036  33.725 1.00 41.87 ? 33   SER A OG    1 
ATOM   273  N  N     . GLN A 1 34  ? 7.652  -2.073  35.518 1.00 16.38 ? 34   GLN A N     1 
ATOM   274  C  CA    . GLN A 1 34  ? 7.540  -1.059  36.556 1.00 18.12 ? 34   GLN A CA    1 
ATOM   275  C  C     . GLN A 1 34  ? 7.755  0.348   36.030 1.00 16.30 ? 34   GLN A C     1 
ATOM   276  O  O     . GLN A 1 34  ? 7.712  1.306   36.812 1.00 19.46 ? 34   GLN A O     1 
ATOM   277  C  CB    . GLN A 1 34  ? 8.573  -1.364  37.651 1.00 19.82 ? 34   GLN A CB    1 
ATOM   278  C  CG    . GLN A 1 34  ? 8.339  -2.628  38.462 1.00 24.30 ? 34   GLN A CG    1 
ATOM   279  C  CD    . GLN A 1 34  ? 9.395  -2.746  39.567 1.00 35.33 ? 34   GLN A CD    1 
ATOM   280  O  OE1   . GLN A 1 34  ? 9.567  -1.828  40.377 1.00 45.87 ? 34   GLN A OE1   1 
ATOM   281  N  NE2   . GLN A 1 34  ? 10.122 -3.838  39.580 1.00 41.23 ? 34   GLN A NE2   1 
ATOM   282  N  N     . LYS A 1 35  ? 7.964  0.512   34.720 1.00 12.68 ? 35   LYS A N     1 
ATOM   283  C  CA    . LYS A 1 35  ? 8.171  1.826   34.093 1.00 14.36 ? 35   LYS A CA    1 
ATOM   284  C  C     . LYS A 1 35  ? 9.376  2.527   34.693 1.00 16.33 ? 35   LYS A C     1 
ATOM   285  O  O     . LYS A 1 35  ? 9.394  3.740   34.882 1.00 20.57 ? 35   LYS A O     1 
ATOM   286  C  CB    . LYS A 1 35  ? 6.923  2.733   34.144 1.00 20.00 ? 35   LYS A CB    1 
ATOM   287  C  CG    . LYS A 1 35  ? 5.745  2.077   33.414 1.00 21.88 ? 35   LYS A CG    1 
ATOM   288  C  CD    . LYS A 1 35  ? 4.615  3.063   33.161 1.00 34.77 ? 35   LYS A CD    1 
ATOM   289  C  CE    . LYS A 1 35  ? 3.355  2.282   32.847 1.00 53.84 ? 35   LYS A CE    1 
ATOM   290  N  NZ    . LYS A 1 35  ? 3.623  1.173   31.864 1.00 56.68 ? 35   LYS A NZ    1 
ATOM   291  N  N     . ILE A 1 36  ? 10.425 1.756   34.951 1.00 12.70 ? 36   ILE A N     1 
ATOM   292  C  CA    . ILE A 1 36  ? 11.636 2.292   35.573 1.00 11.07 ? 36   ILE A CA    1 
ATOM   293  C  C     . ILE A 1 36  ? 12.663 2.632   34.513 1.00 13.21 ? 36   ILE A C     1 
ATOM   294  O  O     . ILE A 1 36  ? 12.955 1.809   33.640 1.00 12.84 ? 36   ILE A O     1 
ATOM   295  C  CB    . ILE A 1 36  ? 12.213 1.267   36.576 1.00 14.93 ? 36   ILE A CB    1 
ATOM   296  C  CG1   . ILE A 1 36  ? 11.308 1.184   37.828 1.00 24.41 ? 36   ILE A CG1   1 
ATOM   297  C  CG2   . ILE A 1 36  ? 13.651 1.636   36.968 1.00 14.13 ? 36   ILE A CG2   1 
ATOM   298  C  CD1   . ILE A 1 36  ? 11.667 -0.003  38.668 1.00 24.39 ? 36   ILE A CD1   1 
ATOM   299  N  N     . LEU A 1 37  ? 13.228 3.825   34.621 1.00 12.15 ? 37   LEU A N     1 
ATOM   300  C  CA    . LEU A 1 37  ? 14.405 4.223   33.887 1.00 12.04 ? 37   LEU A CA    1 
ATOM   301  C  C     . LEU A 1 37  ? 15.498 4.204   34.942 1.00 14.72 ? 37   LEU A C     1 
ATOM   302  O  O     . LEU A 1 37  ? 15.481 5.035   35.871 1.00 14.24 ? 37   LEU A O     1 
ATOM   303  C  CB    . LEU A 1 37  ? 14.265 5.621   33.270 1.00 16.16 ? 37   LEU A CB    1 
ATOM   304  C  CG    A LEU A 1 37  ? 15.544 5.838   32.386 0.59 19.01 ? 37   LEU A CG    1 
ATOM   305  C  CG    B LEU A 1 37  ? 15.481 5.974   32.426 0.41 18.51 ? 37   LEU A CG    1 
ATOM   306  C  CD1   A LEU A 1 37  ? 15.377 6.559   31.058 0.59 19.97 ? 37   LEU A CD1   1 
ATOM   307  C  CD1   B LEU A 1 37  ? 15.459 5.182   31.135 0.41 9.31  ? 37   LEU A CD1   1 
ATOM   308  C  CD2   A LEU A 1 37  ? 16.765 6.435   33.115 0.59 8.75  ? 37   LEU A CD2   1 
ATOM   309  C  CD2   B LEU A 1 37  ? 15.501 7.414   32.158 0.41 19.45 ? 37   LEU A CD2   1 
ATOM   310  N  N     . SER A 1 38  ? 16.406 3.234   34.819 1.00 16.64 ? 38   SER A N     1 
ATOM   311  C  CA    . SER A 1 38  ? 17.451 3.050   35.819 1.00 12.72 ? 38   SER A CA    1 
ATOM   312  C  C     . SER A 1 38  ? 18.593 4.031   35.560 1.00 8.90  ? 38   SER A C     1 
ATOM   313  O  O     . SER A 1 38  ? 19.304 3.889   34.572 1.00 16.11 ? 38   SER A O     1 
ATOM   314  C  CB    . SER A 1 38  ? 17.966 1.609   35.745 1.00 18.90 ? 38   SER A CB    1 
ATOM   315  O  OG    . SER A 1 38  ? 19.084 1.511   36.609 1.00 21.85 ? 38   SER A OG    1 
ATOM   316  N  N     . THR A 1 39  ? 18.708 5.060   36.389 1.00 14.02 ? 39   THR A N     1 
ATOM   317  C  CA    . THR A 1 39  ? 19.779 6.024   36.092 1.00 15.01 ? 39   THR A CA    1 
ATOM   318  C  C     . THR A 1 39  ? 21.146 5.410   36.341 1.00 14.60 ? 39   THR A C     1 
ATOM   319  O  O     . THR A 1 39  ? 22.112 5.789   35.699 1.00 12.66 ? 39   THR A O     1 
ATOM   320  C  CB    . THR A 1 39  ? 19.625 7.344   36.868 1.00 21.67 ? 39   THR A CB    1 
ATOM   321  O  OG1   . THR A 1 39  ? 19.505 7.086   38.272 1.00 23.70 ? 39   THR A OG1   1 
ATOM   322  C  CG2   . THR A 1 39  ? 18.365 8.166   36.358 1.00 19.41 ? 39   THR A CG2   1 
ATOM   323  N  N     . GLU A 1 40  ? 21.258 4.427   37.237 1.00 15.80 ? 40   GLU A N     1 
ATOM   324  C  CA    . GLU A 1 40  ? 22.567 3.796   37.396 1.00 17.53 ? 40   GLU A CA    1 
ATOM   325  C  C     . GLU A 1 40  ? 22.973 3.018   36.165 1.00 15.58 ? 40   GLU A C     1 
ATOM   326  O  O     . GLU A 1 40  ? 24.123 3.111   35.708 1.00 16.03 ? 40   GLU A O     1 
ATOM   327  C  CB    . GLU A 1 40  ? 22.535 2.897   38.657 1.00 19.62 ? 40   GLU A CB    1 
ATOM   328  C  CG    . GLU A 1 40  ? 22.416 3.739   39.872 1.00 26.37 ? 40   GLU A CG    1 
ATOM   329  C  CD    . GLU A 1 40  ? 22.267 2.888   41.139 1.00 54.04 ? 40   GLU A CD    1 
ATOM   330  O  OE1   . GLU A 1 40  ? 21.726 1.760   41.038 1.00 48.49 ? 40   GLU A OE1   1 
ATOM   331  O  OE2   . GLU A 1 40  ? 22.681 3.349   42.227 1.00 50.60 ? 40   GLU A OE2   1 
ATOM   332  N  N     . LEU A 1 41  ? 22.027 2.300   35.553 1.00 14.37 ? 41   LEU A N     1 
ATOM   333  C  CA    . LEU A 1 41  ? 22.289 1.613   34.320 1.00 12.49 ? 41   LEU A CA    1 
ATOM   334  C  C     . LEU A 1 41  ? 22.542 2.590   33.174 1.00 12.91 ? 41   LEU A C     1 
ATOM   335  O  O     . LEU A 1 41  ? 23.394 2.367   32.323 1.00 14.04 ? 41   LEU A O     1 
ATOM   336  C  CB    . LEU A 1 41  ? 21.069 0.755   34.024 1.00 19.80 ? 41   LEU A CB    1 
ATOM   337  C  CG    . LEU A 1 41  ? 21.215 -0.450  33.221 1.00 23.50 ? 41   LEU A CG    1 
ATOM   338  C  CD1   . LEU A 1 41  ? 22.340 -1.354  33.737 1.00 15.34 ? 41   LEU A CD1   1 
ATOM   339  C  CD2   . LEU A 1 41  ? 19.873 -1.170  33.366 1.00 17.81 ? 41   LEU A CD2   1 
ATOM   340  N  N     . TRP A 1 42  ? 21.742 3.660   33.120 1.00 12.69 ? 42   TRP A N     1 
ATOM   341  C  CA    . TRP A 1 42  ? 21.937 4.675   32.115 1.00 10.53 ? 42   TRP A CA    1 
ATOM   342  C  C     . TRP A 1 42  ? 23.371 5.209   32.178 1.00 9.67  ? 42   TRP A C     1 
ATOM   343  O  O     . TRP A 1 42  ? 24.031 5.403   31.146 1.00 10.83 ? 42   TRP A O     1 
ATOM   344  C  CB    . TRP A 1 42  ? 20.928 5.802   32.423 1.00 12.16 ? 42   TRP A CB    1 
ATOM   345  C  CG    . TRP A 1 42  ? 20.766 6.920   31.354 1.00 12.99 ? 42   TRP A CG    1 
ATOM   346  C  CD1   . TRP A 1 42  ? 19.714 7.054   30.504 1.00 15.45 ? 42   TRP A CD1   1 
ATOM   347  C  CD2   . TRP A 1 42  ? 21.636 8.034   31.107 1.00 10.52 ? 42   TRP A CD2   1 
ATOM   348  N  NE1   . TRP A 1 42  ? 19.872 8.195   29.719 1.00 11.81 ? 42   TRP A NE1   1 
ATOM   349  C  CE2   . TRP A 1 42  ? 21.044 8.803   30.062 1.00 9.07  ? 42   TRP A CE2   1 
ATOM   350  C  CE3   . TRP A 1 42  ? 22.833 8.483   31.681 1.00 11.22 ? 42   TRP A CE3   1 
ATOM   351  C  CZ2   . TRP A 1 42  ? 21.625 9.963   29.558 1.00 13.02 ? 42   TRP A CZ2   1 
ATOM   352  C  CZ3   . TRP A 1 42  ? 23.425 9.649   31.162 1.00 15.16 ? 42   TRP A CZ3   1 
ATOM   353  C  CH2   . TRP A 1 42  ? 22.809 10.355  30.087 1.00 13.05 ? 42   TRP A CH2   1 
ATOM   354  N  N     . LYS A 1 43  ? 23.841 5.494   33.393 1.00 11.67 ? 43   LYS A N     1 
ATOM   355  C  CA    . LYS A 1 43  ? 25.205 6.065   33.506 1.00 12.84 ? 43   LYS A CA    1 
ATOM   356  C  C     . LYS A 1 43  ? 26.280 5.058   33.107 1.00 12.28 ? 43   LYS A C     1 
ATOM   357  O  O     . LYS A 1 43  ? 27.274 5.423   32.467 1.00 13.86 ? 43   LYS A O     1 
ATOM   358  C  CB    . LYS A 1 43  ? 25.444 6.570   34.927 1.00 13.34 ? 43   LYS A CB    1 
ATOM   359  C  CG    . LYS A 1 43  ? 24.690 7.840   35.180 1.00 17.33 ? 43   LYS A CG    1 
ATOM   360  C  CD    . LYS A 1 43  ? 24.651 8.269   36.663 1.00 18.97 ? 43   LYS A CD    1 
ATOM   361  C  CE    . LYS A 1 43  ? 23.768 9.459   36.855 1.00 22.34 ? 43   LYS A CE    1 
ATOM   362  N  NZ    . LYS A 1 43  ? 24.470 10.747  36.593 1.00 19.46 ? 43   LYS A NZ    1 
ATOM   363  N  N     . LYS A 1 44  ? 26.060 3.767   33.379 1.00 12.14 ? 44   LYS A N     1 
ATOM   364  C  CA    . LYS A 1 44  ? 27.027 2.761   32.919 1.00 10.26 ? 44   LYS A CA    1 
ATOM   365  C  C     . LYS A 1 44  ? 27.094 2.694   31.405 1.00 12.72 ? 44   LYS A C     1 
ATOM   366  O  O     . LYS A 1 44  ? 28.179 2.538   30.794 1.00 16.26 ? 44   LYS A O     1 
ATOM   367  C  CB    . LYS A 1 44  ? 26.668 1.363   33.468 1.00 14.71 ? 44   LYS A CB    1 
ATOM   368  C  CG    . LYS A 1 44  ? 27.041 1.238   34.907 1.00 17.73 ? 44   LYS A CG    1 
ATOM   369  C  CD    . LYS A 1 44  ? 26.882 -0.210  35.419 1.00 17.82 ? 44   LYS A CD    1 
ATOM   370  C  CE    . LYS A 1 44  ? 27.254 -0.210  36.860 1.00 22.72 ? 44   LYS A CE    1 
ATOM   371  N  NZ    . LYS A 1 44  ? 26.962 -1.571  37.478 1.00 19.28 ? 44   LYS A NZ    1 
ATOM   372  N  N     . ALA A 1 45  ? 25.917 2.759   30.771 1.00 11.40 ? 45   ALA A N     1 
ATOM   373  C  CA    . ALA A 1 45  ? 25.855 2.755   29.331 1.00 10.76 ? 45   ALA A CA    1 
ATOM   374  C  C     . ALA A 1 45  ? 26.517 4.002   28.763 1.00 12.88 ? 45   ALA A C     1 
ATOM   375  O  O     . ALA A 1 45  ? 27.263 3.926   27.783 1.00 15.09 ? 45   ALA A O     1 
ATOM   376  C  CB    . ALA A 1 45  ? 24.360 2.629   28.908 1.00 11.05 ? 45   ALA A CB    1 
ATOM   377  N  N     . ALA A 1 46  ? 26.216 5.162   29.339 1.00 11.97 ? 46   ALA A N     1 
ATOM   378  C  CA    . ALA A 1 46  ? 26.845 6.385   28.861 1.00 11.76 ? 46   ALA A CA    1 
ATOM   379  C  C     . ALA A 1 46  ? 28.366 6.257   28.920 1.00 14.47 ? 46   ALA A C     1 
ATOM   380  O  O     . ALA A 1 46  ? 29.074 6.532   27.947 1.00 16.63 ? 46   ALA A O     1 
ATOM   381  C  CB    . ALA A 1 46  ? 26.377 7.587   29.703 1.00 11.16 ? 46   ALA A CB    1 
ATOM   382  N  N     . ALA A 1 47  ? 28.868 5.831   30.063 1.00 14.02 ? 47   ALA A N     1 
ATOM   383  C  CA    . ALA A 1 47  ? 30.329 5.740   30.251 1.00 16.14 ? 47   ALA A CA    1 
ATOM   384  C  C     . ALA A 1 47  ? 30.960 4.653   29.395 1.00 20.04 ? 47   ALA A C     1 
ATOM   385  O  O     . ALA A 1 47  ? 32.122 4.782   28.983 1.00 20.34 ? 47   ALA A O     1 
ATOM   386  C  CB    . ALA A 1 47  ? 30.612 5.500   31.718 1.00 15.57 ? 47   ALA A CB    1 
ATOM   387  N  N     . TYR A 1 48  ? 30.222 3.572   29.101 1.00 17.18 ? 48   TYR A N     1 
ATOM   388  C  CA    . TYR A 1 48  ? 30.739 2.558   28.191 1.00 14.77 ? 48   TYR A CA    1 
ATOM   389  C  C     . TYR A 1 48  ? 31.051 3.145   26.825 1.00 17.04 ? 48   TYR A C     1 
ATOM   390  O  O     . TYR A 1 48  ? 31.945 2.652   26.142 1.00 17.93 ? 48   TYR A O     1 
ATOM   391  C  CB    . TYR A 1 48  ? 29.748 1.364   28.029 1.00 15.92 ? 48   TYR A CB    1 
ATOM   392  C  CG    . TYR A 1 48  ? 30.039 0.497   26.780 1.00 21.48 ? 48   TYR A CG    1 
ATOM   393  C  CD1   . TYR A 1 48  ? 30.866 -0.616  26.851 1.00 18.57 ? 48   TYR A CD1   1 
ATOM   394  C  CD2   . TYR A 1 48  ? 29.531 0.851   25.511 1.00 20.82 ? 48   TYR A CD2   1 
ATOM   395  C  CE1   . TYR A 1 48  ? 31.203 -1.332  25.692 1.00 21.29 ? 48   TYR A CE1   1 
ATOM   396  C  CE2   . TYR A 1 48  ? 29.851 0.168   24.350 1.00 20.03 ? 48   TYR A CE2   1 
ATOM   397  C  CZ    . TYR A 1 48  ? 30.680 -0.939  24.444 1.00 27.65 ? 48   TYR A CZ    1 
ATOM   398  O  OH    . TYR A 1 48  ? 30.999 -1.618  23.283 1.00 26.50 ? 48   TYR A OH    1 
ATOM   399  N  N     . GLY A 1 49  ? 30.286 4.151   26.367 1.00 14.71 ? 49   GLY A N     1 
ATOM   400  C  CA    . GLY A 1 49  ? 30.592 4.752   25.103 1.00 17.06 ? 49   GLY A CA    1 
ATOM   401  C  C     . GLY A 1 49  ? 29.347 5.240   24.382 1.00 16.39 ? 49   GLY A C     1 
ATOM   402  O  O     . GLY A 1 49  ? 29.483 5.908   23.359 1.00 16.64 ? 49   GLY A O     1 
ATOM   403  N  N     . PHE A 1 50  ? 28.140 4.954   24.907 1.00 15.24 ? 50   PHE A N     1 
ATOM   404  C  CA    . PHE A 1 50  ? 26.949 5.373   24.144 1.00 14.37 ? 50   PHE A CA    1 
ATOM   405  C  C     . PHE A 1 50  ? 26.695 6.866   24.230 1.00 21.06 ? 50   PHE A C     1 
ATOM   406  O  O     . PHE A 1 50  ? 25.885 7.378   23.438 1.00 21.38 ? 50   PHE A O     1 
ATOM   407  C  CB    . PHE A 1 50  ? 25.691 4.592   24.605 1.00 13.36 ? 50   PHE A CB    1 
ATOM   408  C  CG    . PHE A 1 50  ? 25.746 3.117   24.216 1.00 12.07 ? 50   PHE A CG    1 
ATOM   409  C  CD1   . PHE A 1 50  ? 26.016 2.116   25.148 1.00 13.93 ? 50   PHE A CD1   1 
ATOM   410  C  CD2   . PHE A 1 50  ? 25.577 2.723   22.873 1.00 14.92 ? 50   PHE A CD2   1 
ATOM   411  C  CE1   . PHE A 1 50  ? 26.121 0.772   24.744 1.00 14.79 ? 50   PHE A CE1   1 
ATOM   412  C  CE2   . PHE A 1 50  ? 25.669 1.365   22.515 1.00 13.66 ? 50   PHE A CE2   1 
ATOM   413  C  CZ    . PHE A 1 50  ? 25.922 0.392   23.444 1.00 14.33 ? 50   PHE A CZ    1 
ATOM   414  N  N     . ALA A 1 51  ? 27.308 7.574   25.178 1.00 13.85 ? 51   ALA A N     1 
ATOM   415  C  CA    . ALA A 1 51  ? 27.212 9.027   25.222 1.00 13.86 ? 51   ALA A CA    1 
ATOM   416  C  C     . ALA A 1 51  ? 28.417 9.706   24.555 1.00 18.45 ? 51   ALA A C     1 
ATOM   417  O  O     . ALA A 1 51  ? 28.610 10.920  24.746 1.00 18.30 ? 51   ALA A O     1 
ATOM   418  C  CB    . ALA A 1 51  ? 27.048 9.523   26.650 1.00 11.93 ? 51   ALA A CB    1 
ATOM   419  N  N     . HIS A 1 52  ? 29.233 8.961   23.784 1.00 15.12 ? 52   HIS A N     1 
ATOM   420  C  CA    . HIS A 1 52  ? 30.466 9.534   23.225 1.00 18.90 ? 52   HIS A CA    1 
ATOM   421  C  C     . HIS A 1 52  ? 30.357 10.023  21.784 1.00 21.52 ? 52   HIS A C     1 
ATOM   422  O  O     . HIS A 1 52  ? 30.644 11.194  21.494 1.00 20.97 ? 52   HIS A O     1 
ATOM   423  C  CB    . HIS A 1 52  ? 31.609 8.515   23.333 1.00 22.89 ? 52   HIS A CB    1 
ATOM   424  C  CG    . HIS A 1 52  ? 31.942 8.145   24.735 1.00 20.08 ? 52   HIS A CG    1 
ATOM   425  N  ND1   . HIS A 1 52  ? 32.997 7.301   25.030 1.00 21.00 ? 52   HIS A ND1   1 
ATOM   426  C  CD2   . HIS A 1 52  ? 31.330 8.416   25.917 1.00 21.39 ? 52   HIS A CD2   1 
ATOM   427  C  CE1   . HIS A 1 52  ? 33.033 7.093   26.331 1.00 19.65 ? 52   HIS A CE1   1 
ATOM   428  N  NE2   . HIS A 1 52  ? 32.045 7.769   26.898 1.00 25.13 ? 52   HIS A NE2   1 
ATOM   429  N  N     . GLY A 1 53  ? 29.972 9.157   20.849 1.00 21.35 ? 53   GLY A N     1 
ATOM   430  C  CA    . GLY A 1 53  ? 29.805 9.612   19.465 1.00 19.09 ? 53   GLY A CA    1 
ATOM   431  C  C     . GLY A 1 53  ? 31.099 10.205  18.912 1.00 17.45 ? 53   GLY A C     1 
ATOM   432  O  O     . GLY A 1 53  ? 32.185 9.660   19.127 1.00 21.33 ? 53   GLY A O     1 
ATOM   433  N  N     . PRO A 1 54  ? 30.998 11.354  18.243 1.00 18.29 ? 54   PRO A N     1 
ATOM   434  C  CA    . PRO A 1 54  ? 32.164 11.986  17.623 1.00 23.82 ? 54   PRO A CA    1 
ATOM   435  C  C     . PRO A 1 54  ? 33.050 12.748  18.583 1.00 20.40 ? 54   PRO A C     1 
ATOM   436  O  O     . PRO A 1 54  ? 34.032 13.337  18.132 1.00 22.06 ? 54   PRO A O     1 
ATOM   437  C  CB    . PRO A 1 54  ? 31.519 12.954  16.623 1.00 21.30 ? 54   PRO A CB    1 
ATOM   438  C  CG    . PRO A 1 54  ? 30.297 13.436  17.363 1.00 24.16 ? 54   PRO A CG    1 
ATOM   439  C  CD    . PRO A 1 54  ? 29.765 12.152  18.021 1.00 20.15 ? 54   PRO A CD    1 
ATOM   440  N  N     . VAL A 1 55  ? 32.736 12.771  19.877 1.00 19.44 ? 55   VAL A N     1 
ATOM   441  C  CA    . VAL A 1 55  ? 33.487 13.620  20.797 1.00 15.19 ? 55   VAL A CA    1 
ATOM   442  C  C     . VAL A 1 55  ? 34.932 13.144  20.874 1.00 20.11 ? 55   VAL A C     1 
ATOM   443  O  O     . VAL A 1 55  ? 35.215 11.944  20.913 1.00 21.56 ? 55   VAL A O     1 
ATOM   444  C  CB    . VAL A 1 55  ? 32.822 13.603  22.184 1.00 16.85 ? 55   VAL A CB    1 
ATOM   445  C  CG1   . VAL A 1 55  ? 33.651 14.401  23.166 1.00 18.37 ? 55   VAL A CG1   1 
ATOM   446  C  CG2   . VAL A 1 55  ? 31.424 14.203  22.097 1.00 17.22 ? 55   VAL A CG2   1 
ATOM   447  N  N     . SER A 1 56  ? 35.858 14.099  20.875 1.00 23.50 ? 56   SER A N     1 
ATOM   448  C  CA    . SER A 1 56  ? 37.281 13.812  20.912 1.00 19.82 ? 56   SER A CA    1 
ATOM   449  C  C     . SER A 1 56  ? 37.742 13.212  22.248 1.00 24.94 ? 56   SER A C     1 
ATOM   450  O  O     . SER A 1 56  ? 37.103 13.347  23.300 1.00 18.67 ? 56   SER A O     1 
ATOM   451  C  CB    . SER A 1 56  ? 38.072 15.096  20.671 1.00 20.41 ? 56   SER A CB    1 
ATOM   452  O  OG    . SER A 1 56  ? 37.754 16.029  21.694 1.00 27.78 ? 56   SER A OG    1 
ATOM   453  N  N     . HIS A 1 57  ? 38.944 12.623  22.191 1.00 22.65 ? 57   HIS A N     1 
ATOM   454  C  CA    . HIS A 1 57  ? 39.588 12.063  23.369 1.00 23.67 ? 57   HIS A CA    1 
ATOM   455  C  C     . HIS A 1 57  ? 39.774 13.103  24.465 1.00 18.46 ? 57   HIS A C     1 
ATOM   456  O  O     . HIS A 1 57  ? 39.739 12.763  25.651 1.00 26.39 ? 57   HIS A O     1 
ATOM   457  C  CB    . HIS A 1 57  ? 40.926 11.448  22.955 1.00 29.80 ? 57   HIS A CB    1 
ATOM   458  C  CG    A HIS A 1 57  ? 40.776 10.277  22.020 0.46 32.76 ? 57   HIS A CG    1 
ATOM   459  C  CG    B HIS A 1 57  ? 41.698 10.862  24.105 0.54 32.38 ? 57   HIS A CG    1 
ATOM   460  N  ND1   A HIS A 1 57  ? 40.607 10.423  20.658 0.46 32.15 ? 57   HIS A ND1   1 
ATOM   461  N  ND1   B HIS A 1 57  ? 41.602 9.535   24.466 0.54 31.44 ? 57   HIS A ND1   1 
ATOM   462  C  CD2   A HIS A 1 57  ? 40.726 8.943   22.260 0.46 38.29 ? 57   HIS A CD2   1 
ATOM   463  C  CD2   B HIS A 1 57  ? 42.573 11.427  24.974 0.54 34.07 ? 57   HIS A CD2   1 
ATOM   464  C  CE1   A HIS A 1 57  ? 40.493 9.230   20.097 0.46 26.50 ? 57   HIS A CE1   1 
ATOM   465  C  CE1   B HIS A 1 57  ? 42.378 9.308   25.511 0.54 34.20 ? 57   HIS A CE1   1 
ATOM   466  N  NE2   A HIS A 1 57  ? 40.553 8.317   21.046 0.46 27.04 ? 57   HIS A NE2   1 
ATOM   467  N  NE2   B HIS A 1 57  ? 42.982 10.439  25.837 0.54 32.93 ? 57   HIS A NE2   1 
ATOM   468  N  N     . GLN A 1 58  ? 39.973 14.367  24.082 1.00 24.64 ? 58   GLN A N     1 
ATOM   469  C  CA    . GLN A 1 58  ? 40.162 15.452  25.042 1.00 22.73 ? 58   GLN A CA    1 
ATOM   470  C  C     . GLN A 1 58  ? 39.013 15.535  26.038 1.00 32.34 ? 58   GLN A C     1 
ATOM   471  O  O     . GLN A 1 58  ? 39.195 15.987  27.175 1.00 28.83 ? 58   GLN A O     1 
ATOM   472  C  CB    . GLN A 1 58  ? 40.302 16.778  24.299 1.00 28.66 ? 58   GLN A CB    1 
ATOM   473  C  CG    . GLN A 1 58  ? 40.399 17.986  25.251 1.00 35.46 ? 58   GLN A CG    1 
ATOM   474  C  CD    . GLN A 1 58  ? 40.572 19.332  24.545 1.00 39.65 ? 58   GLN A CD    1 
ATOM   475  O  OE1   . GLN A 1 58  ? 40.593 19.403  23.313 1.00 42.47 ? 58   GLN A OE1   1 
ATOM   476  N  NE2   . GLN A 1 58  ? 40.670 20.408  25.333 1.00 35.52 ? 58   GLN A NE2   1 
ATOM   477  N  N     . PHE A 1 59  ? 37.816 15.119  25.631 1.00 22.82 ? 59   PHE A N     1 
ATOM   478  C  CA    . PHE A 1 59  ? 36.660 15.218  26.498 1.00 19.53 ? 59   PHE A CA    1 
ATOM   479  C  C     . PHE A 1 59  ? 36.096 13.848  26.869 1.00 22.82 ? 59   PHE A C     1 
ATOM   480  O  O     . PHE A 1 59  ? 34.990 13.782  27.420 1.00 27.21 ? 59   PHE A O     1 
ATOM   481  C  CB    . PHE A 1 59  ? 35.597 16.079  25.820 1.00 21.66 ? 59   PHE A CB    1 
ATOM   482  C  CG    . PHE A 1 59  ? 36.033 17.455  25.595 1.00 22.73 ? 59   PHE A CG    1 
ATOM   483  C  CD1   . PHE A 1 59  ? 36.118 18.336  26.663 1.00 21.79 ? 59   PHE A CD1   1 
ATOM   484  C  CD2   . PHE A 1 59  ? 36.429 17.863  24.334 1.00 23.88 ? 59   PHE A CD2   1 
ATOM   485  C  CE1   . PHE A 1 59  ? 36.546 19.626  26.451 1.00 29.04 ? 59   PHE A CE1   1 
ATOM   486  C  CE2   . PHE A 1 59  ? 36.844 19.148  24.135 1.00 25.65 ? 59   PHE A CE2   1 
ATOM   487  C  CZ    . PHE A 1 59  ? 36.924 20.019  25.193 1.00 23.35 ? 59   PHE A CZ    1 
ATOM   488  N  N     . GLY A 1 60  ? 36.846 12.764  26.631 1.00 21.22 ? 60   GLY A N     1 
ATOM   489  C  CA    . GLY A 1 60  ? 36.446 11.443  27.052 1.00 21.97 ? 60   GLY A CA    1 
ATOM   490  C  C     . GLY A 1 60  ? 35.877 10.585  25.951 1.00 19.56 ? 60   GLY A C     1 
ATOM   491  O  O     . GLY A 1 60  ? 35.500 9.439   26.220 1.00 21.74 ? 60   GLY A O     1 
ATOM   492  N  N     . GLY A 1 61  ? 35.811 11.087  24.728 1.00 19.63 ? 61   GLY A N     1 
ATOM   493  C  CA    . GLY A 1 61  ? 35.251 10.314  23.627 1.00 18.34 ? 61   GLY A CA    1 
ATOM   494  C  C     . GLY A 1 61  ? 36.288 9.554   22.829 1.00 22.77 ? 61   GLY A C     1 
ATOM   495  O  O     . GLY A 1 61  ? 37.477 9.562   23.133 1.00 27.45 ? 61   GLY A O     1 
ATOM   496  N  N     . SER A 1 62  ? 35.816 8.831   21.800 1.00 21.03 ? 62   SER A N     1 
ATOM   497  C  CA    . SER A 1 62  ? 36.690 8.030   20.940 1.00 25.36 ? 62   SER A CA    1 
ATOM   498  C  C     . SER A 1 62  ? 36.679 8.495   19.504 1.00 24.47 ? 62   SER A C     1 
ATOM   499  O  O     . SER A 1 62  ? 37.217 7.812   18.631 1.00 29.72 ? 62   SER A O     1 
ATOM   500  C  CB    . SER A 1 62  ? 36.320 6.544   20.979 1.00 41.61 ? 62   SER A CB    1 
ATOM   501  O  OG    . SER A 1 62  ? 36.655 5.986   22.242 1.00 51.67 ? 62   SER A OG    1 
ATOM   502  N  N     . GLU A 1 63  ? 36.114 9.661   19.247 1.00 21.13 ? 63   GLU A N     1 
ATOM   503  C  CA    . GLU A 1 63  ? 36.157 10.282  17.950 1.00 21.98 ? 63   GLU A CA    1 
ATOM   504  C  C     . GLU A 1 63  ? 35.616 9.329   16.885 1.00 24.47 ? 63   GLU A C     1 
ATOM   505  O  O     . GLU A 1 63  ? 36.231 9.057   15.860 1.00 23.51 ? 63   GLU A O     1 
ATOM   506  C  CB    . GLU A 1 63  ? 37.558 10.807  17.619 1.00 26.81 ? 63   GLU A CB    1 
ATOM   507  C  CG    . GLU A 1 63  ? 37.383 12.215  17.040 1.00 44.47 ? 63   GLU A CG    1 
ATOM   508  C  CD    . GLU A 1 63  ? 38.669 12.923  16.658 1.00 61.04 ? 63   GLU A CD    1 
ATOM   509  O  OE1   . GLU A 1 63  ? 38.638 13.626  15.629 1.00 67.55 ? 63   GLU A OE1   1 
ATOM   510  O  OE2   . GLU A 1 63  ? 39.689 12.794  17.375 1.00 59.06 ? 63   GLU A OE2   1 
ATOM   511  N  N     . LEU A 1 64  ? 34.439 8.796   17.161 1.00 21.27 ? 64   LEU A N     1 
ATOM   512  C  CA    . LEU A 1 64  ? 33.741 7.989   16.160 1.00 18.51 ? 64   LEU A CA    1 
ATOM   513  C  C     . LEU A 1 64  ? 33.141 8.857   15.054 1.00 16.62 ? 64   LEU A C     1 
ATOM   514  O  O     . LEU A 1 64  ? 32.688 9.977   15.301 1.00 20.14 ? 64   LEU A O     1 
ATOM   515  C  CB    . LEU A 1 64  ? 32.610 7.210   16.843 1.00 18.45 ? 64   LEU A CB    1 
ATOM   516  C  CG    . LEU A 1 64  ? 33.082 6.214   17.889 1.00 24.54 ? 64   LEU A CG    1 
ATOM   517  C  CD1   . LEU A 1 64  ? 31.886 5.316   18.237 1.00 35.12 ? 64   LEU A CD1   1 
ATOM   518  C  CD2   . LEU A 1 64  ? 34.220 5.395   17.353 1.00 25.76 ? 64   LEU A CD2   1 
ATOM   519  N  N     . GLY A 1 65  ? 33.092 8.312   13.827 1.00 19.62 ? 65   GLY A N     1 
ATOM   520  C  CA    . GLY A 1 65  ? 32.362 8.983   12.764 1.00 21.03 ? 65   GLY A CA    1 
ATOM   521  C  C     . GLY A 1 65  ? 30.888 8.627   12.899 1.00 20.04 ? 65   GLY A C     1 
ATOM   522  O  O     . GLY A 1 65  ? 30.501 7.892   13.826 1.00 14.75 ? 65   GLY A O     1 
ATOM   523  N  N     . ALA A 1 66  ? 30.081 9.127   11.941 1.00 16.54 ? 66   ALA A N     1 
ATOM   524  C  CA    . ALA A 1 66  ? 28.631 8.890   11.968 1.00 14.49 ? 66   ALA A CA    1 
ATOM   525  C  C     . ALA A 1 66  ? 28.330 7.430   11.707 1.00 14.41 ? 66   ALA A C     1 
ATOM   526  O  O     . ALA A 1 66  ? 27.458 6.849   12.365 1.00 13.59 ? 66   ALA A O     1 
ATOM   527  C  CB    . ALA A 1 66  ? 27.902 9.748   10.929 1.00 15.90 ? 66   ALA A CB    1 
ATOM   528  N  N     . LEU A 1 67  ? 29.041 6.793   10.776 1.00 12.31 ? 67   LEU A N     1 
ATOM   529  C  CA    . LEU A 1 67  ? 28.742 5.379   10.528 1.00 14.89 ? 67   LEU A CA    1 
ATOM   530  C  C     . LEU A 1 67  ? 29.086 4.527   11.745 1.00 17.08 ? 67   LEU A C     1 
ATOM   531  O  O     . LEU A 1 67  ? 28.293 3.663   12.137 1.00 14.38 ? 67   LEU A O     1 
ATOM   532  C  CB    . LEU A 1 67  ? 29.432 4.872   9.260  1.00 13.21 ? 67   LEU A CB    1 
ATOM   533  C  CG    . LEU A 1 67  ? 29.201 3.394   8.917  1.00 12.68 ? 67   LEU A CG    1 
ATOM   534  C  CD1   . LEU A 1 67  ? 27.660 3.146   8.759  1.00 16.89 ? 67   LEU A CD1   1 
ATOM   535  C  CD2   . LEU A 1 67  ? 29.909 3.057   7.617  1.00 22.33 ? 67   LEU A CD2   1 
ATOM   536  N  N     . ASP A 1 68  ? 30.235 4.787   12.406 1.00 13.09 ? 68   ASP A N     1 
ATOM   537  C  CA    . ASP A 1 68  ? 30.572 4.014   13.604 1.00 16.48 ? 68   ASP A CA    1 
ATOM   538  C  C     . ASP A 1 68  ? 29.539 4.205   14.705 1.00 11.48 ? 68   ASP A C     1 
ATOM   539  O  O     . ASP A 1 68  ? 29.198 3.252   15.427 1.00 13.37 ? 68   ASP A O     1 
ATOM   540  C  CB    . ASP A 1 68  ? 31.927 4.463   14.178 1.00 18.30 ? 68   ASP A CB    1 
ATOM   541  C  CG    . ASP A 1 68  ? 33.121 4.291   13.233 1.00 34.86 ? 68   ASP A CG    1 
ATOM   542  O  OD1   . ASP A 1 68  ? 33.180 3.326   12.467 1.00 31.84 ? 68   ASP A OD1   1 
ATOM   543  O  OD2   . ASP A 1 68  ? 34.061 5.154   13.330 1.00 43.53 ? 68   ASP A OD2   1 
ATOM   544  N  N     . THR A 1 69  ? 29.078 5.442   14.881 1.00 9.09  ? 69   THR A N     1 
ATOM   545  C  CA    . THR A 1 69  ? 28.117 5.762   15.926 1.00 12.86 ? 69   THR A CA    1 
ATOM   546  C  C     . THR A 1 69  ? 26.828 5.031   15.628 1.00 14.65 ? 69   THR A C     1 
ATOM   547  O  O     . THR A 1 69  ? 26.200 4.438   16.527 1.00 11.60 ? 69   THR A O     1 
ATOM   548  C  CB    . THR A 1 69  ? 27.886 7.273   15.986 1.00 12.15 ? 69   THR A CB    1 
ATOM   549  O  OG1   . THR A 1 69  ? 29.132 7.930   16.347 1.00 15.32 ? 69   THR A OG1   1 
ATOM   550  C  CG2   . THR A 1 69  ? 26.801 7.651   17.036 1.00 13.81 ? 69   THR A CG2   1 
ATOM   551  N  N     . ALA A 1 70  ? 26.442 5.025   14.353 1.00 11.79 ? 70   ALA A N     1 
ATOM   552  C  CA    . ALA A 1 70  ? 25.213 4.320   13.961 1.00 13.21 ? 70   ALA A CA    1 
ATOM   553  C  C     . ALA A 1 70  ? 25.330 2.832   14.193 1.00 11.36 ? 70   ALA A C     1 
ATOM   554  O  O     . ALA A 1 70  ? 24.366 2.204   14.659 1.00 10.29 ? 70   ALA A O     1 
ATOM   555  C  CB    . ALA A 1 70  ? 24.881 4.585   12.483 1.00 13.18 ? 70   ALA A CB    1 
ATOM   556  N  N     . LEU A 1 71  ? 26.489 2.243   13.887 1.00 12.01 ? 71   LEU A N     1 
ATOM   557  C  CA    . LEU A 1 71  ? 26.687 0.824   14.173 1.00 11.39 ? 71   LEU A CA    1 
ATOM   558  C  C     . LEU A 1 71  ? 26.523 0.513   15.665 1.00 9.77  ? 71   LEU A C     1 
ATOM   559  O  O     . LEU A 1 71  ? 25.950 -0.524  16.031 1.00 10.51 ? 71   LEU A O     1 
ATOM   560  C  CB    . LEU A 1 71  ? 28.071 0.390   13.704 1.00 14.95 ? 71   LEU A CB    1 
ATOM   561  C  CG    . LEU A 1 71  ? 28.102 0.310   12.179 1.00 17.03 ? 71   LEU A CG    1 
ATOM   562  C  CD1   . LEU A 1 71  ? 29.532 0.096   11.789 1.00 21.03 ? 71   LEU A CD1   1 
ATOM   563  C  CD2   . LEU A 1 71  ? 27.247 -0.848  11.623 1.00 18.14 ? 71   LEU A CD2   1 
ATOM   564  N  N     . MET A 1 72  ? 27.128 1.335   16.539 1.00 11.60 ? 72   MET A N     1 
ATOM   565  C  CA    . MET A 1 72  ? 26.981 1.134   17.967 1.00 12.45 ? 72   MET A CA    1 
ATOM   566  C  C     . MET A 1 72  ? 25.528 1.149   18.373 1.00 10.03 ? 72   MET A C     1 
ATOM   567  O  O     . MET A 1 72  ? 25.069 0.320   19.166 1.00 9.57  ? 72   MET A O     1 
ATOM   568  C  CB    . MET A 1 72  ? 27.714 2.233   18.730 1.00 14.75 ? 72   MET A CB    1 
ATOM   569  C  CG    A MET A 1 72  ? 29.106 1.926   18.903 0.55 17.13 ? 72   MET A CG    1 
ATOM   570  C  CG    B MET A 1 72  ? 27.823 1.978   20.161 0.45 9.78  ? 72   MET A CG    1 
ATOM   571  S  SD    A MET A 1 72  ? 29.687 3.199   19.996 0.55 19.69 ? 72   MET A SD    1 
ATOM   572  S  SD    B MET A 1 72  ? 28.772 3.289   20.943 0.45 17.22 ? 72   MET A SD    1 
ATOM   573  C  CE    A MET A 1 72  ? 29.536 2.441   21.631 0.55 20.61 ? 72   MET A CE    1 
ATOM   574  C  CE    B MET A 1 72  ? 30.416 2.600   20.722 0.45 28.78 ? 72   MET A CE    1 
ATOM   575  N  N     . ILE A 1 73  ? 24.775 2.109   17.822 1.00 10.14 ? 73   ILE A N     1 
ATOM   576  C  CA    . ILE A 1 73  ? 23.392 2.245   18.248 1.00 8.82  ? 73   ILE A CA    1 
ATOM   577  C  C     . ILE A 1 73  ? 22.534 1.147   17.637 1.00 8.45  ? 73   ILE A C     1 
ATOM   578  O  O     . ILE A 1 73  ? 21.563 0.715   18.274 1.00 7.49  ? 73   ILE A O     1 
ATOM   579  C  CB    . ILE A 1 73  ? 22.930 3.655   17.876 1.00 8.74  ? 73   ILE A CB    1 
ATOM   580  C  CG1   . ILE A 1 73  ? 23.723 4.673   18.725 1.00 10.50 ? 73   ILE A CG1   1 
ATOM   581  C  CG2   . ILE A 1 73  ? 21.407 3.850   18.100 1.00 9.30  ? 73   ILE A CG2   1 
ATOM   582  C  CD1   . ILE A 1 73  ? 23.463 6.116   18.349 1.00 13.84 ? 73   ILE A CD1   1 
ATOM   583  N  N     . GLU A 1 74  ? 22.841 0.698   16.422 1.00 7.40  ? 74   GLU A N     1 
ATOM   584  C  CA    . GLU A 1 74  ? 22.135 -0.453  15.861 1.00 8.34  ? 74   GLU A CA    1 
ATOM   585  C  C     . GLU A 1 74  ? 22.290 -1.651  16.778 1.00 8.28  ? 74   GLU A C     1 
ATOM   586  O  O     . GLU A 1 74  ? 21.331 -2.367  17.058 1.00 8.61  ? 74   GLU A O     1 
ATOM   587  C  CB    . GLU A 1 74  ? 22.648 -0.804  14.456 1.00 8.58  ? 74   GLU A CB    1 
ATOM   588  C  CG    . GLU A 1 74  ? 21.849 -1.924  13.782 1.00 10.30 ? 74   GLU A CG    1 
ATOM   589  C  CD    . GLU A 1 74  ? 22.402 -2.319  12.426 1.00 13.04 ? 74   GLU A CD    1 
ATOM   590  O  OE1   . GLU A 1 74  ? 23.003 -1.480  11.769 1.00 17.86 ? 74   GLU A OE1   1 
ATOM   591  O  OE2   . GLU A 1 74  ? 22.315 -3.494  12.027 1.00 14.75 ? 74   GLU A OE2   1 
ATOM   592  N  N     . ALA A 1 75  ? 23.517 -1.874  17.250 1.00 7.52  ? 75   ALA A N     1 
ATOM   593  C  CA    . ALA A 1 75  ? 23.762 -2.993  18.157 1.00 8.96  ? 75   ALA A CA    1 
ATOM   594  C  C     . ALA A 1 75  ? 22.963 -2.865  19.446 1.00 8.24  ? 75   ALA A C     1 
ATOM   595  O  O     . ALA A 1 75  ? 22.440 -3.860  19.969 1.00 9.64  ? 75   ALA A O     1 
ATOM   596  C  CB    . ALA A 1 75  ? 25.267 -3.036  18.508 1.00 9.63  ? 75   ALA A CB    1 
ATOM   597  N  N     . LEU A 1 76  ? 22.881 -1.654  19.982 1.00 7.20  ? 76   LEU A N     1 
ATOM   598  C  CA    . LEU A 1 76  ? 22.072 -1.370  21.166 1.00 8.44  ? 76   LEU A CA    1 
ATOM   599  C  C     . LEU A 1 76  ? 20.617 -1.702  20.919 1.00 7.89  ? 76   LEU A C     1 
ATOM   600  O  O     . LEU A 1 76  ? 19.955 -2.287  21.771 1.00 8.48  ? 76   LEU A O     1 
ATOM   601  C  CB    . LEU A 1 76  ? 22.221 0.106   21.505 1.00 8.21  ? 76   LEU A CB    1 
ATOM   602  C  CG    . LEU A 1 76  ? 21.409 0.667   22.663 1.00 7.05  ? 76   LEU A CG    1 
ATOM   603  C  CD1   . LEU A 1 76  ? 21.682 -0.191  23.983 1.00 7.90  ? 76   LEU A CD1   1 
ATOM   604  C  CD2   . LEU A 1 76  ? 21.740 2.166   22.810 1.00 7.79  ? 76   LEU A CD2   1 
ATOM   605  N  N     . GLY A 1 77  ? 20.098 -1.309  19.753 1.00 7.38  ? 77   GLY A N     1 
ATOM   606  C  CA    . GLY A 1 77  ? 18.676 -1.605  19.495 1.00 8.44  ? 77   GLY A CA    1 
ATOM   607  C  C     . GLY A 1 77  ? 18.393 -3.088  19.304 1.00 8.41  ? 77   GLY A C     1 
ATOM   608  O  O     . GLY A 1 77  ? 17.295 -3.569  19.651 1.00 9.70  ? 77   GLY A O     1 
ATOM   609  N  N     . LYS A 1 78  ? 19.349 -3.845  18.734 1.00 6.94  ? 78   LYS A N     1 
ATOM   610  C  CA    . LYS A 1 78  ? 19.164 -5.294  18.588 1.00 6.63  ? 78   LYS A CA    1 
ATOM   611  C  C     . LYS A 1 78  ? 19.356 -6.021  19.914 1.00 7.57  ? 78   LYS A C     1 
ATOM   612  O  O     . LYS A 1 78  ? 18.680 -7.036  20.148 1.00 9.65  ? 78   LYS A O     1 
ATOM   613  C  CB    . LYS A 1 78  ? 20.146 -5.848  17.545 1.00 8.28  ? 78   LYS A CB    1 
ATOM   614  C  CG    . LYS A 1 78  ? 19.756 -7.274  17.116 1.00 8.34  ? 78   LYS A CG    1 
ATOM   615  C  CD    . LYS A 1 78  ? 20.708 -7.819  16.110 1.00 11.17 ? 78   LYS A CD    1 
ATOM   616  C  CE    . LYS A 1 78  ? 20.194 -9.171  15.678 1.00 14.94 ? 78   LYS A CE    1 
ATOM   617  N  NZ    . LYS A 1 78  ? 21.243 -9.823  14.785 1.00 17.95 ? 78   LYS A NZ    1 
ATOM   618  N  N     . GLY A 1 79  ? 20.265 -5.530  20.725 1.00 7.28  ? 79   GLY A N     1 
ATOM   619  C  CA    . GLY A 1 79  ? 20.668 -6.265  21.922 1.00 7.85  ? 79   GLY A CA    1 
ATOM   620  C  C     . GLY A 1 79  ? 19.829 -6.056  23.165 1.00 9.53  ? 79   GLY A C     1 
ATOM   621  O  O     . GLY A 1 79  ? 19.795 -6.937  24.029 1.00 11.38 ? 79   GLY A O     1 
ATOM   622  N  N     . SER A 1 80  ? 19.130 -4.937  23.315 1.00 8.89  ? 80   SER A N     1 
ATOM   623  C  CA    . SER A 1 80  ? 18.406 -4.644  24.550 1.00 8.74  ? 80   SER A CA    1 
ATOM   624  C  C     . SER A 1 80  ? 16.941 -4.369  24.253 1.00 11.27 ? 80   SER A C     1 
ATOM   625  O  O     . SER A 1 80  ? 16.636 -3.524  23.413 1.00 11.30 ? 80   SER A O     1 
ATOM   626  C  CB    . SER A 1 80  ? 19.022 -3.422  25.263 1.00 9.53  ? 80   SER A CB    1 
ATOM   627  O  OG    . SER A 1 80  ? 18.204 -3.115  26.378 1.00 11.29 ? 80   SER A OG    1 
ATOM   628  N  N     . ARG A 1 81  ? 16.037 -5.050  24.965 1.00 12.65 ? 81   ARG A N     1 
ATOM   629  C  CA    A ARG A 1 81  ? 14.620 -4.744  24.859 0.65 10.96 ? 81   ARG A CA    1 
ATOM   630  C  CA    B ARG A 1 81  ? 14.644 -4.690  24.747 0.35 10.86 ? 81   ARG A CA    1 
ATOM   631  C  C     . ARG A 1 81  ? 14.249 -3.410  25.455 1.00 11.46 ? 81   ARG A C     1 
ATOM   632  O  O     . ARG A 1 81  ? 13.116 -2.948  25.237 1.00 12.30 ? 81   ARG A O     1 
ATOM   633  C  CB    A ARG A 1 81  ? 13.814 -5.814  25.604 0.65 15.14 ? 81   ARG A CB    1 
ATOM   634  C  CB    B ARG A 1 81  ? 13.714 -5.797  25.235 0.35 16.65 ? 81   ARG A CB    1 
ATOM   635  C  CG    A ARG A 1 81  ? 14.038 -7.179  24.988 0.65 12.36 ? 81   ARG A CG    1 
ATOM   636  C  CG    B ARG A 1 81  ? 13.937 -6.056  26.689 0.35 10.48 ? 81   ARG A CG    1 
ATOM   637  C  CD    A ARG A 1 81  ? 13.544 -8.283  25.908 0.65 14.99 ? 81   ARG A CD    1 
ATOM   638  C  CD    B ARG A 1 81  ? 13.209 -7.323  27.146 0.35 14.32 ? 81   ARG A CD    1 
ATOM   639  N  NE    A ARG A 1 81  ? 14.419 -8.403  27.052 0.65 12.89 ? 81   ARG A NE    1 
ATOM   640  N  NE    B ARG A 1 81  ? 13.804 -7.904  28.343 0.35 30.75 ? 81   ARG A NE    1 
ATOM   641  C  CZ    A ARG A 1 81  ? 14.139 -9.145  28.120 0.65 28.55 ? 81   ARG A CZ    1 
ATOM   642  C  CZ    B ARG A 1 81  ? 14.498 -9.043  28.369 0.35 25.83 ? 81   ARG A CZ    1 
ATOM   643  N  NH1   A ARG A 1 81  ? 12.991 -9.816  28.176 0.65 23.89 ? 81   ARG A NH1   1 
ATOM   644  N  NH1   B ARG A 1 81  ? 14.687 -9.752  27.254 0.35 21.10 ? 81   ARG A NH1   1 
ATOM   645  N  NH2   A ARG A 1 81  ? 14.999 -9.196  29.135 0.65 27.72 ? 81   ARG A NH2   1 
ATOM   646  N  NH2   B ARG A 1 81  ? 15.002 -9.474  29.519 0.35 28.39 ? 81   ARG A NH2   1 
ATOM   647  N  N     . ASP A 1 82  ? 15.123 -2.835  26.281 1.00 9.84  ? 82   ASP A N     1 
ATOM   648  C  CA    . ASP A 1 82  ? 14.763 -1.625  27.017 1.00 8.59  ? 82   ASP A CA    1 
ATOM   649  C  C     . ASP A 1 82  ? 15.018 -0.412  26.115 1.00 11.16 ? 82   ASP A C     1 
ATOM   650  O  O     . ASP A 1 82  ? 15.953 0.381   26.281 1.00 10.04 ? 82   ASP A O     1 
ATOM   651  C  CB    . ASP A 1 82  ? 15.545 -1.550  28.337 1.00 9.91  ? 82   ASP A CB    1 
ATOM   652  C  CG    . ASP A 1 82  ? 15.081 -0.427  29.250 1.00 15.28 ? 82   ASP A CG    1 
ATOM   653  O  OD1   . ASP A 1 82  ? 14.180 0.387   28.878 1.00 12.83 ? 82   ASP A OD1   1 
ATOM   654  O  OD2   . ASP A 1 82  ? 15.653 -0.303  30.344 1.00 12.89 ? 82   ASP A OD2   1 
ATOM   655  N  N     . ILE A 1 83  ? 14.140 -0.280  25.111 1.00 9.29  ? 83   ILE A N     1 
ATOM   656  C  CA    . ILE A 1 83  ? 14.329 0.769   24.121 1.00 10.76 ? 83   ILE A CA    1 
ATOM   657  C  C     . ILE A 1 83  ? 14.054 2.147   24.726 1.00 10.31 ? 83   ILE A C     1 
ATOM   658  O  O     . ILE A 1 83  ? 14.601 3.128   24.236 1.00 9.04  ? 83   ILE A O     1 
ATOM   659  C  CB    . ILE A 1 83  ? 13.425 0.458   22.920 1.00 11.89 ? 83   ILE A CB    1 
ATOM   660  C  CG1   A ILE A 1 83  ? 13.867 1.351   21.766 0.43 11.86 ? 83   ILE A CG1   1 
ATOM   661  C  CG1   B ILE A 1 83  ? 14.014 -0.655  22.049 0.57 12.08 ? 83   ILE A CG1   1 
ATOM   662  C  CG2   A ILE A 1 83  ? 12.064 0.630   23.313 0.43 8.72  ? 83   ILE A CG2   1 
ATOM   663  C  CG2   B ILE A 1 83  ? 13.031 1.720   22.080 0.57 11.12 ? 83   ILE A CG2   1 
ATOM   664  C  CD1   A ILE A 1 83  ? 13.428 0.916   20.434 0.43 17.36 ? 83   ILE A CD1   1 
ATOM   665  C  CD1   B ILE A 1 83  ? 15.006 -0.127  21.059 0.57 13.91 ? 83   ILE A CD1   1 
ATOM   666  N  N     . GLY A 1 84  ? 13.224 2.260   25.764 1.00 8.74  ? 84   GLY A N     1 
ATOM   667  C  CA    . GLY A 1 84  ? 13.048 3.562   26.419 1.00 8.40  ? 84   GLY A CA    1 
ATOM   668  C  C     . GLY A 1 84  ? 14.366 4.069   26.979 1.00 10.80 ? 84   GLY A C     1 
ATOM   669  O  O     . GLY A 1 84  ? 14.726 5.245   26.827 1.00 9.29  ? 84   GLY A O     1 
ATOM   670  N  N     . LEU A 1 85  ? 15.110 3.185   27.679 1.00 8.61  ? 85   LEU A N     1 
ATOM   671  C  CA    . LEU A 1 85  ? 16.413 3.607   28.179 1.00 9.02  ? 85   LEU A CA    1 
ATOM   672  C  C     . LEU A 1 85  ? 17.337 3.985   27.024 1.00 8.41  ? 85   LEU A C     1 
ATOM   673  O  O     . LEU A 1 85  ? 18.064 4.981   27.087 1.00 8.64  ? 85   LEU A O     1 
ATOM   674  C  CB    . LEU A 1 85  ? 17.008 2.433   29.014 1.00 8.93  ? 85   LEU A CB    1 
ATOM   675  C  CG    . LEU A 1 85  ? 18.425 2.719   29.519 1.00 12.96 ? 85   LEU A CG    1 
ATOM   676  C  CD1   A LEU A 1 85  ? 18.562 3.836   30.415 0.56 12.71 ? 85   LEU A CD1   1 
ATOM   677  C  CD1   B LEU A 1 85  ? 18.573 2.142   31.007 0.44 12.61 ? 85   LEU A CD1   1 
ATOM   678  C  CD2   A LEU A 1 85  ? 18.855 1.310   30.116 0.56 10.44 ? 85   LEU A CD2   1 
ATOM   679  C  CD2   B LEU A 1 85  ? 19.598 2.378   28.686 0.44 8.82  ? 85   LEU A CD2   1 
ATOM   680  N  N     . SER A 1 86  ? 17.345 3.162   25.944 1.00 7.02  ? 86   SER A N     1 
ATOM   681  C  CA    . SER A 1 86  ? 18.238 3.447   24.815 1.00 5.49  ? 86   SER A CA    1 
ATOM   682  C  C     . SER A 1 86  ? 17.873 4.766   24.161 1.00 6.87  ? 86   SER A C     1 
ATOM   683  O  O     . SER A 1 86  ? 18.755 5.543   23.794 1.00 8.45  ? 86   SER A O     1 
ATOM   684  C  CB    . SER A 1 86  ? 18.136 2.352   23.774 1.00 8.04  ? 86   SER A CB    1 
ATOM   685  O  OG    . SER A 1 86  ? 18.523 1.135   24.404 1.00 10.45 ? 86   SER A OG    1 
ATOM   686  N  N     . PHE A 1 87  ? 16.570 5.021   24.015 1.00 8.17  ? 87   PHE A N     1 
ATOM   687  C  CA    . PHE A 1 87  ? 16.158 6.276   23.415 1.00 7.15  ? 87   PHE A CA    1 
ATOM   688  C  C     . PHE A 1 87  ? 16.628 7.459   24.274 1.00 8.22  ? 87   PHE A C     1 
ATOM   689  O  O     . PHE A 1 87  ? 17.105 8.461   23.747 1.00 9.37  ? 87   PHE A O     1 
ATOM   690  C  CB    . PHE A 1 87  ? 14.611 6.296   23.214 1.00 8.01  ? 87   PHE A CB    1 
ATOM   691  C  CG    . PHE A 1 87  ? 14.109 7.566   22.549 1.00 8.83  ? 87   PHE A CG    1 
ATOM   692  C  CD1   . PHE A 1 87  ? 14.187 7.694   21.196 1.00 16.66 ? 87   PHE A CD1   1 
ATOM   693  C  CD2   . PHE A 1 87  ? 13.608 8.603   23.306 1.00 14.04 ? 87   PHE A CD2   1 
ATOM   694  C  CE1   . PHE A 1 87  ? 13.743 8.943   20.597 1.00 16.34 ? 87   PHE A CE1   1 
ATOM   695  C  CE2   . PHE A 1 87  ? 13.143 9.774   22.698 1.00 14.83 ? 87   PHE A CE2   1 
ATOM   696  C  CZ    . PHE A 1 87  ? 13.270 9.907   21.372 1.00 15.33 ? 87   PHE A CZ    1 
ATOM   697  N  N     . SER A 1 88  ? 16.474 7.330   25.596 1.00 7.89  ? 88   SER A N     1 
ATOM   698  C  CA    . SER A 1 88  ? 16.902 8.398   26.514 1.00 8.15  ? 88   SER A CA    1 
ATOM   699  C  C     . SER A 1 88  ? 18.402 8.691   26.349 1.00 8.89  ? 88   SER A C     1 
ATOM   700  O  O     . SER A 1 88  ? 18.813 9.840   26.306 1.00 9.16  ? 88   SER A O     1 
ATOM   701  C  CB    . SER A 1 88  ? 16.603 7.952   27.951 1.00 8.68  ? 88   SER A CB    1 
ATOM   702  O  OG    . SER A 1 88  ? 17.286 8.785   28.893 1.00 10.04 ? 88   SER A OG    1 
ATOM   703  N  N     . LEU A 1 89  ? 19.215 7.658   26.221 1.00 7.56  ? 89   LEU A N     1 
ATOM   704  C  CA    . LEU A 1 89  ? 20.652 7.829   26.050 1.00 9.80  ? 89   LEU A CA    1 
ATOM   705  C  C     . LEU A 1 89  ? 20.984 8.469   24.725 1.00 8.96  ? 89   LEU A C     1 
ATOM   706  O  O     . LEU A 1 89  ? 21.836 9.357   24.637 1.00 11.08 ? 89   LEU A O     1 
ATOM   707  C  CB    . LEU A 1 89  ? 21.338 6.448   26.095 1.00 14.30 ? 89   LEU A CB    1 
ATOM   708  C  CG    . LEU A 1 89  ? 21.608 5.829   27.403 1.00 27.73 ? 89   LEU A CG    1 
ATOM   709  C  CD1   . LEU A 1 89  ? 21.835 4.322   27.112 1.00 32.41 ? 89   LEU A CD1   1 
ATOM   710  C  CD2   . LEU A 1 89  ? 22.893 6.506   27.906 1.00 24.00 ? 89   LEU A CD2   1 
ATOM   711  N  N     . CYS A 1 90  ? 20.343 7.997   23.647 1.00 12.39 ? 90   CYS A N     1 
ATOM   712  C  CA    . CYS A 1 90  ? 20.652 8.556   22.340 1.00 13.68 ? 90   CYS A CA    1 
ATOM   713  C  C     . CYS A 1 90  ? 20.157 9.994   22.220 1.00 9.87  ? 90   CYS A C     1 
ATOM   714  O  O     . CYS A 1 90  ? 20.773 10.803  21.495 1.00 13.99 ? 90   CYS A O     1 
ATOM   715  C  CB    . CYS A 1 90  ? 20.064 7.645   21.256 1.00 17.22 ? 90   CYS A CB    1 
ATOM   716  S  SG    . CYS A 1 90  ? 20.894 6.005   21.232 1.00 22.41 ? 90   CYS A SG    1 
ATOM   717  N  N     . ALA A 1 91  ? 19.070 10.365  22.907 1.00 8.49  ? 91   ALA A N     1 
ATOM   718  C  CA    . ALA A 1 91  ? 18.626 11.752  22.900 1.00 10.92 ? 91   ALA A CA    1 
ATOM   719  C  C     . ALA A 1 91  ? 19.674 12.632  23.578 1.00 13.44 ? 91   ALA A C     1 
ATOM   720  O  O     . ALA A 1 91  ? 20.038 13.688  23.079 1.00 12.55 ? 91   ALA A O     1 
ATOM   721  C  CB    . ALA A 1 91  ? 17.282 11.888  23.592 1.00 12.80 ? 91   ALA A CB    1 
ATOM   722  N  N     . HIS A 1 92  ? 20.194 12.177  24.711 1.00 9.14  ? 92   HIS A N     1 
ATOM   723  C  CA    . HIS A 1 92  ? 21.254 12.923  25.390 1.00 8.96  ? 92   HIS A CA    1 
ATOM   724  C  C     . HIS A 1 92  ? 22.472 13.071  24.501 1.00 10.53 ? 92   HIS A C     1 
ATOM   725  O  O     . HIS A 1 92  ? 23.016 14.174  24.366 1.00 11.33 ? 92   HIS A O     1 
ATOM   726  C  CB    . HIS A 1 92  ? 21.549 12.142  26.678 1.00 6.87  ? 92   HIS A CB    1 
ATOM   727  C  CG    . HIS A 1 92  ? 22.842 12.493  27.353 1.00 9.57  ? 92   HIS A CG    1 
ATOM   728  N  ND1   . HIS A 1 92  ? 22.898 13.416  28.385 1.00 10.67 ? 92   HIS A ND1   1 
ATOM   729  C  CD2   . HIS A 1 92  ? 24.099 12.021  27.182 1.00 7.81  ? 92   HIS A CD2   1 
ATOM   730  C  CE1   . HIS A 1 92  ? 24.148 13.498  28.818 1.00 9.95  ? 92   HIS A CE1   1 
ATOM   731  N  NE2   . HIS A 1 92  ? 24.891 12.621  28.156 1.00 10.16 ? 92   HIS A NE2   1 
ATOM   732  N  N     . LEU A 1 93  ? 22.876 11.993  23.827 1.00 8.42  ? 93   LEU A N     1 
ATOM   733  C  CA    . LEU A 1 93  ? 24.026 12.047  22.940 1.00 9.26  ? 93   LEU A CA    1 
ATOM   734  C  C     . LEU A 1 93  ? 23.768 13.005  21.765 1.00 13.46 ? 93   LEU A C     1 
ATOM   735  O  O     . LEU A 1 93  ? 24.530 13.973  21.521 1.00 10.02 ? 93   LEU A O     1 
ATOM   736  C  CB    . LEU A 1 93  ? 24.290 10.656  22.383 1.00 11.16 ? 93   LEU A CB    1 
ATOM   737  C  CG    . LEU A 1 93  ? 25.312 10.715  21.250 1.00 14.57 ? 93   LEU A CG    1 
ATOM   738  C  CD1   . LEU A 1 93  ? 26.752 11.197  21.724 1.00 19.87 ? 93   LEU A CD1   1 
ATOM   739  C  CD2   . LEU A 1 93  ? 25.444 9.309   20.603 1.00 20.30 ? 93   LEU A CD2   1 
ATOM   740  N  N     . CYS A 1 94  ? 22.638 12.800  21.040 1.00 10.91 ? 94   CYS A N     1 
ATOM   741  C  CA    . CYS A 1 94  ? 22.551 13.489  19.747 1.00 14.76 ? 94   CYS A CA    1 
ATOM   742  C  C     . CYS A 1 94  ? 22.088 14.914  19.884 1.00 13.46 ? 94   CYS A C     1 
ATOM   743  O  O     . CYS A 1 94  ? 22.466 15.777  19.075 1.00 16.49 ? 94   CYS A O     1 
ATOM   744  C  CB    . CYS A 1 94  ? 21.590 12.725  18.799 1.00 13.18 ? 94   CYS A CB    1 
ATOM   745  S  SG    . CYS A 1 94  ? 22.183 11.091  18.421 1.00 19.95 ? 94   CYS A SG    1 
ATOM   746  N  N     . ALA A 1 95  ? 21.220 15.205  20.834 1.00 11.35 ? 95   ALA A N     1 
ATOM   747  C  CA    . ALA A 1 95  ? 20.653 16.529  20.899 1.00 12.20 ? 95   ALA A CA    1 
ATOM   748  C  C     . ALA A 1 95  ? 21.349 17.383  21.941 1.00 13.63 ? 95   ALA A C     1 
ATOM   749  O  O     . ALA A 1 95  ? 21.030 18.593  22.043 1.00 16.93 ? 95   ALA A O     1 
ATOM   750  C  CB    . ALA A 1 95  ? 19.156 16.452  21.212 1.00 17.03 ? 95   ALA A CB    1 
ATOM   751  N  N     . CYS A 1 96  ? 22.253 16.787  22.739 1.00 13.86 ? 96   CYS A N     1 
ATOM   752  C  CA    . CYS A 1 96  ? 22.882 17.599  23.789 1.00 10.90 ? 96   CYS A CA    1 
ATOM   753  C  C     . CYS A 1 96  ? 24.403 17.507  23.791 1.00 13.31 ? 96   CYS A C     1 
ATOM   754  O  O     . CYS A 1 96  ? 25.055 18.532  23.632 1.00 13.86 ? 96   CYS A O     1 
ATOM   755  C  CB    . CYS A 1 96  ? 22.360 17.176  25.184 1.00 13.54 ? 96   CYS A CB    1 
ATOM   756  S  SG    . CYS A 1 96  ? 20.543 17.285  25.339 1.00 14.89 ? 96   CYS A SG    1 
ATOM   757  N  N     . VAL A 1 97  ? 24.967 16.311  23.896 1.00 10.74 ? 97   VAL A N     1 
ATOM   758  C  CA    . VAL A 1 97  ? 26.420 16.155  23.825 1.00 11.51 ? 97   VAL A CA    1 
ATOM   759  C  C     . VAL A 1 97  ? 26.959 16.706  22.509 1.00 16.96 ? 97   VAL A C     1 
ATOM   760  O  O     . VAL A 1 97  ? 27.942 17.454  22.477 1.00 14.89 ? 97   VAL A O     1 
ATOM   761  C  CB    . VAL A 1 97  ? 26.811 14.679  24.015 1.00 11.97 ? 97   VAL A CB    1 
ATOM   762  C  CG1   . VAL A 1 97  ? 28.294 14.457  23.664 1.00 13.76 ? 97   VAL A CG1   1 
ATOM   763  C  CG2   . VAL A 1 97  ? 26.521 14.241  25.417 1.00 11.35 ? 97   VAL A CG2   1 
ATOM   764  N  N     . ILE A 1 98  ? 26.363 16.303  21.386 1.00 14.05 ? 98   ILE A N     1 
ATOM   765  C  CA    . ILE A 1 98  ? 26.999 16.652  20.119 1.00 13.79 ? 98   ILE A CA    1 
ATOM   766  C  C     . ILE A 1 98  ? 26.918 18.161  19.840 1.00 13.62 ? 98   ILE A C     1 
ATOM   767  O  O     . ILE A 1 98  ? 27.953 18.751  19.460 1.00 15.67 ? 98   ILE A O     1 
ATOM   768  C  CB    . ILE A 1 98  ? 26.439 15.765  19.000 1.00 15.13 ? 98   ILE A CB    1 
ATOM   769  C  CG1   . ILE A 1 98  ? 26.948 14.328  19.263 1.00 17.93 ? 98   ILE A CG1   1 
ATOM   770  C  CG2   . ILE A 1 98  ? 26.894 16.286  17.633 1.00 15.69 ? 98   ILE A CG2   1 
ATOM   771  C  CD1   . ILE A 1 98  ? 26.408 13.270  18.336 1.00 18.94 ? 98   ILE A CD1   1 
ATOM   772  N  N     . PRO A 1 99  ? 25.802 18.863  20.040 1.00 12.87 ? 99   PRO A N     1 
ATOM   773  C  CA    . PRO A 1 99  ? 25.859 20.314  19.809 1.00 16.92 ? 99   PRO A CA    1 
ATOM   774  C  C     . PRO A 1 99  ? 26.789 21.029  20.759 1.00 18.83 ? 99   PRO A C     1 
ATOM   775  O  O     . PRO A 1 99  ? 27.420 22.006  20.365 1.00 15.40 ? 99   PRO A O     1 
ATOM   776  C  CB    . PRO A 1 99  ? 24.407 20.782  19.996 1.00 20.01 ? 99   PRO A CB    1 
ATOM   777  C  CG    . PRO A 1 99  ? 23.686 19.635  20.624 1.00 21.61 ? 99   PRO A CG    1 
ATOM   778  C  CD    . PRO A 1 99  ? 24.373 18.405  20.198 1.00 15.46 ? 99   PRO A CD    1 
ATOM   779  N  N     . LEU A 1 100 ? 26.888 20.604  22.011 1.00 13.55 ? 100  LEU A N     1 
ATOM   780  C  CA    . LEU A 1 100 ? 27.877 21.270  22.880 1.00 14.10 ? 100  LEU A CA    1 
ATOM   781  C  C     . LEU A 1 100 ? 29.312 21.065  22.351 1.00 14.08 ? 100  LEU A C     1 
ATOM   782  O  O     . LEU A 1 100 ? 30.139 21.999  22.329 1.00 15.24 ? 100  LEU A O     1 
ATOM   783  C  CB    . LEU A 1 100 ? 27.740 20.745  24.315 1.00 13.67 ? 100  LEU A CB    1 
ATOM   784  C  CG    . LEU A 1 100 ? 28.802 21.252  25.326 1.00 14.92 ? 100  LEU A CG    1 
ATOM   785  C  CD1   . LEU A 1 100 ? 28.681 22.772  25.444 1.00 22.58 ? 100  LEU A CD1   1 
ATOM   786  C  CD2   . LEU A 1 100 ? 28.550 20.637  26.654 1.00 16.13 ? 100  LEU A CD2   1 
ATOM   787  N  N     . TYR A 1 101 ? 29.657 19.845  21.957 1.00 11.67 ? 101  TYR A N     1 
ATOM   788  C  CA    . TYR A 1 101 ? 30.964 19.573  21.397 1.00 12.79 ? 101  TYR A CA    1 
ATOM   789  C  C     . TYR A 1 101 ? 31.195 20.393  20.137 1.00 18.00 ? 101  TYR A C     1 
ATOM   790  O  O     . TYR A 1 101 ? 32.289 20.942  19.921 1.00 16.92 ? 101  TYR A O     1 
ATOM   791  C  CB    . TYR A 1 101 ? 31.057 18.069  21.087 1.00 13.29 ? 101  TYR A CB    1 
ATOM   792  C  CG    . TYR A 1 101 ? 32.321 17.687  20.347 1.00 15.36 ? 101  TYR A CG    1 
ATOM   793  C  CD1   . TYR A 1 101 ? 33.566 17.872  20.937 1.00 21.43 ? 101  TYR A CD1   1 
ATOM   794  C  CD2   . TYR A 1 101 ? 32.254 17.161  19.065 1.00 18.17 ? 101  TYR A CD2   1 
ATOM   795  C  CE1   . TYR A 1 101 ? 34.724 17.532  20.283 1.00 21.44 ? 101  TYR A CE1   1 
ATOM   796  C  CE2   . TYR A 1 101 ? 33.447 16.816  18.382 1.00 23.99 ? 101  TYR A CE2   1 
ATOM   797  C  CZ    . TYR A 1 101 ? 34.665 17.016  19.023 1.00 26.68 ? 101  TYR A CZ    1 
ATOM   798  O  OH    . TYR A 1 101 ? 35.865 16.698  18.407 1.00 29.38 ? 101  TYR A OH    1 
ATOM   799  N  N     . ARG A 1 102 ? 30.204 20.410  19.236 1.00 15.46 ? 102  ARG A N     1 
ATOM   800  C  CA    . ARG A 1 102 ? 30.455 21.008  17.920 1.00 13.80 ? 102  ARG A CA    1 
ATOM   801  C  C     . ARG A 1 102 ? 30.421 22.529  17.927 1.00 18.15 ? 102  ARG A C     1 
ATOM   802  O  O     . ARG A 1 102 ? 31.095 23.150  17.084 1.00 17.52 ? 102  ARG A O     1 
ATOM   803  C  CB    . ARG A 1 102 ? 29.465 20.453  16.873 1.00 16.25 ? 102  ARG A CB    1 
ATOM   804  C  CG    . ARG A 1 102 ? 29.768 18.992  16.577 1.00 17.25 ? 102  ARG A CG    1 
ATOM   805  C  CD    . ARG A 1 102 ? 28.875 18.351  15.487 1.00 32.60 ? 102  ARG A CD    1 
ATOM   806  N  NE    . ARG A 1 102 ? 28.568 19.240  14.368 1.00 39.82 ? 102  ARG A NE    1 
ATOM   807  C  CZ    . ARG A 1 102 ? 29.413 19.527  13.386 1.00 46.72 ? 102  ARG A CZ    1 
ATOM   808  N  NH1   . ARG A 1 102 ? 30.633 18.988  13.386 1.00 39.02 ? 102  ARG A NH1   1 
ATOM   809  N  NH2   . ARG A 1 102 ? 29.031 20.358  12.411 1.00 39.74 ? 102  ARG A NH2   1 
ATOM   810  N  N     . PHE A 1 103 ? 29.661 23.151  18.823 1.00 14.23 ? 103  PHE A N     1 
ATOM   811  C  CA    . PHE A 1 103 ? 29.502 24.599  18.819 1.00 12.79 ? 103  PHE A CA    1 
ATOM   812  C  C     . PHE A 1 103 ? 29.883 25.290  20.119 1.00 21.39 ? 103  PHE A C     1 
ATOM   813  O  O     . PHE A 1 103 ? 29.956 26.528  20.133 1.00 16.84 ? 103  PHE A O     1 
ATOM   814  C  CB    . PHE A 1 103 ? 28.032 24.944  18.488 1.00 14.14 ? 103  PHE A CB    1 
ATOM   815  C  CG    . PHE A 1 103 ? 27.613 24.478  17.111 1.00 18.20 ? 103  PHE A CG    1 
ATOM   816  C  CD1   . PHE A 1 103 ? 27.021 23.218  16.944 1.00 16.50 ? 103  PHE A CD1   1 
ATOM   817  C  CD2   . PHE A 1 103 ? 27.856 25.245  16.001 1.00 20.94 ? 103  PHE A CD2   1 
ATOM   818  C  CE1   . PHE A 1 103 ? 26.659 22.763  15.682 1.00 19.98 ? 103  PHE A CE1   1 
ATOM   819  C  CE2   . PHE A 1 103 ? 27.495 24.781  14.738 1.00 21.57 ? 103  PHE A CE2   1 
ATOM   820  C  CZ    . PHE A 1 103 ? 26.911 23.521  14.582 1.00 23.45 ? 103  PHE A CZ    1 
ATOM   821  N  N     . GLY A 1 104 ? 30.108 24.569  21.216 1.00 13.53 ? 104  GLY A N     1 
ATOM   822  C  CA    . GLY A 1 104 ? 30.341 25.241  22.473 1.00 15.27 ? 104  GLY A CA    1 
ATOM   823  C  C     . GLY A 1 104 ? 31.723 25.886  22.490 1.00 19.62 ? 104  GLY A C     1 
ATOM   824  O  O     . GLY A 1 104 ? 32.652 25.420  21.831 1.00 18.10 ? 104  GLY A O     1 
ATOM   825  N  N     . SER A 1 105 ? 31.862 26.926  23.315 1.00 16.61 ? 105  SER A N     1 
ATOM   826  C  CA    . SER A 1 105 ? 33.179 27.529  23.530 1.00 21.81 ? 105  SER A CA    1 
ATOM   827  C  C     . SER A 1 105 ? 34.091 26.590  24.313 1.00 23.01 ? 105  SER A C     1 
ATOM   828  O  O     . SER A 1 105 ? 33.662 25.611  24.927 1.00 17.96 ? 105  SER A O     1 
ATOM   829  C  CB    . SER A 1 105 ? 33.029 28.822  24.319 1.00 16.91 ? 105  SER A CB    1 
ATOM   830  O  OG    . SER A 1 105 ? 32.481 28.542  25.613 1.00 19.01 ? 105  SER A OG    1 
ATOM   831  N  N     . SER A 1 106 ? 35.397 26.901  24.286 1.00 21.00 ? 106  SER A N     1 
ATOM   832  C  CA    . SER A 1 106 ? 36.354 26.201  25.123 1.00 26.52 ? 106  SER A CA    1 
ATOM   833  C  C     . SER A 1 106 ? 35.935 26.232  26.578 1.00 18.70 ? 106  SER A C     1 
ATOM   834  O  O     . SER A 1 106 ? 35.969 25.194  27.267 1.00 20.76 ? 106  SER A O     1 
ATOM   835  C  CB    . SER A 1 106 ? 37.731 26.841  24.943 1.00 25.61 ? 106  SER A CB    1 
ATOM   836  O  OG    A SER A 1 106 ? 38.257 26.401  23.717 0.64 29.16 ? 106  SER A OG    1 
ATOM   837  O  OG    B SER A 1 106 ? 38.699 26.166  25.710 0.36 22.21 ? 106  SER A OG    1 
ATOM   838  N  N     . GLU A 1 107 ? 35.481 27.397  27.068 1.00 19.22 ? 107  GLU A N     1 
ATOM   839  C  CA    . GLU A 1 107 ? 35.134 27.471  28.486 1.00 21.42 ? 107  GLU A CA    1 
ATOM   840  C  C     . GLU A 1 107 ? 33.909 26.609  28.794 1.00 22.79 ? 107  GLU A C     1 
ATOM   841  O  O     . GLU A 1 107 ? 33.876 25.914  29.825 1.00 21.89 ? 107  GLU A O     1 
ATOM   842  C  CB    . GLU A 1 107 ? 34.930 28.920  28.960 1.00 25.81 ? 107  GLU A CB    1 
ATOM   843  C  CG    . GLU A 1 107 ? 33.787 29.712  28.341 1.00 57.46 ? 107  GLU A CG    1 
ATOM   844  C  CD    . GLU A 1 107 ? 33.530 31.080  29.038 1.00 73.90 ? 107  GLU A CD    1 
ATOM   845  O  OE1   . GLU A 1 107 ? 32.958 31.991  28.364 1.00 49.65 ? 107  GLU A OE1   1 
ATOM   846  O  OE2   . GLU A 1 107 ? 33.885 31.236  30.246 1.00 57.73 ? 107  GLU A OE2   1 
ATOM   847  N  N     . LEU A 1 108 ? 32.916 26.592  27.893 1.00 17.19 ? 108  LEU A N     1 
ATOM   848  C  CA    . LEU A 1 108 ? 31.723 25.801  28.200 1.00 17.21 ? 108  LEU A CA    1 
ATOM   849  C  C     . LEU A 1 108 ? 31.994 24.301  28.088 1.00 19.73 ? 108  LEU A C     1 
ATOM   850  O  O     . LEU A 1 108 ? 31.525 23.522  28.919 1.00 19.87 ? 108  LEU A O     1 
ATOM   851  C  CB    . LEU A 1 108 ? 30.590 26.227  27.257 1.00 21.78 ? 108  LEU A CB    1 
ATOM   852  C  CG    A LEU A 1 108 ? 29.530 27.211  27.701 0.37 18.83 ? 108  LEU A CG    1 
ATOM   853  C  CG    B LEU A 1 108 ? 29.161 25.956  27.738 0.63 16.33 ? 108  LEU A CG    1 
ATOM   854  C  CD1   A LEU A 1 108 ? 28.601 27.468  26.525 0.37 15.88 ? 108  LEU A CD1   1 
ATOM   855  C  CD1   B LEU A 1 108 ? 28.796 26.609  29.081 0.63 18.91 ? 108  LEU A CD1   1 
ATOM   856  C  CD2   A LEU A 1 108 ? 28.752 26.660  28.893 0.37 18.81 ? 108  LEU A CD2   1 
ATOM   857  C  CD2   B LEU A 1 108 ? 28.263 26.469  26.637 0.63 15.90 ? 108  LEU A CD2   1 
ATOM   858  N  N     . LYS A 1 109 ? 32.736 23.872  27.063 1.00 18.69 ? 109  LYS A N     1 
ATOM   859  C  CA    . LYS A 1 109 ? 33.132 22.474  26.967 1.00 16.17 ? 109  LYS A CA    1 
ATOM   860  C  C     . LYS A 1 109 ? 33.963 22.052  28.174 1.00 21.72 ? 109  LYS A C     1 
ATOM   861  O  O     . LYS A 1 109 ? 33.765 20.968  28.735 1.00 19.51 ? 109  LYS A O     1 
ATOM   862  C  CB    . LYS A 1 109 ? 33.896 22.225  25.677 1.00 14.85 ? 109  LYS A CB    1 
ATOM   863  C  CG    . LYS A 1 109 ? 33.061 22.459  24.442 1.00 17.82 ? 109  LYS A CG    1 
ATOM   864  C  CD    . LYS A 1 109 ? 33.782 22.003  23.206 1.00 18.00 ? 109  LYS A CD    1 
ATOM   865  C  CE    . LYS A 1 109 ? 34.865 23.089  22.884 1.00 23.15 ? 109  LYS A CE    1 
ATOM   866  N  NZ    . LYS A 1 109 ? 35.463 22.859  21.527 1.00 23.63 ? 109  LYS A NZ    1 
ATOM   867  N  N     . ASP A 1 110 ? 34.959 22.872  28.550 1.00 20.72 ? 110  ASP A N     1 
ATOM   868  C  CA    . ASP A 1 110 ? 35.780 22.531  29.714 1.00 24.64 ? 110  ASP A CA    1 
ATOM   869  C  C     . ASP A 1 110 ? 34.958 22.294  30.978 1.00 21.26 ? 110  ASP A C     1 
ATOM   870  O  O     . ASP A 1 110 ? 35.306 21.431  31.792 1.00 22.76 ? 110  ASP A O     1 
ATOM   871  C  CB    . ASP A 1 110 ? 36.791 23.644  29.975 1.00 24.64 ? 110  ASP A CB    1 
ATOM   872  C  CG    . ASP A 1 110 ? 37.937 23.639  28.981 1.00 42.47 ? 110  ASP A CG    1 
ATOM   873  O  OD1   . ASP A 1 110 ? 38.723 24.621  29.002 1.00 48.21 ? 110  ASP A OD1   1 
ATOM   874  O  OD2   . ASP A 1 110 ? 38.047 22.682  28.173 1.00 34.84 ? 110  ASP A OD2   1 
ATOM   875  N  N     . LYS A 1 111 ? 33.908 23.082  31.192 1.00 18.27 ? 111  LYS A N     1 
ATOM   876  C  CA    . LYS A 1 111 ? 33.097 22.979  32.388 1.00 16.19 ? 111  LYS A CA    1 
ATOM   877  C  C     . LYS A 1 111 ? 32.164 21.775  32.341 1.00 20.84 ? 111  LYS A C     1 
ATOM   878  O  O     . LYS A 1 111 ? 32.007 21.076  33.352 1.00 17.70 ? 111  LYS A O     1 
ATOM   879  C  CB    . LYS A 1 111 ? 32.298 24.268  32.577 1.00 19.79 ? 111  LYS A CB    1 
ATOM   880  C  CG    . LYS A 1 111 ? 31.427 24.280  33.822 1.00 21.52 ? 111  LYS A CG    1 
ATOM   881  C  CD    . LYS A 1 111 ? 31.010 25.693  34.184 1.00 26.17 ? 111  LYS A CD    1 
ATOM   882  C  CE    . LYS A 1 111 ? 30.277 25.720  35.542 1.00 35.55 ? 111  LYS A CE    1 
ATOM   883  N  NZ    . LYS A 1 111 ? 29.672 27.068  35.765 1.00 42.04 ? 111  LYS A NZ    1 
ATOM   884  N  N     . TYR A 1 112 ? 31.516 21.511  31.176 1.00 19.75 ? 112  TYR A N     1 
ATOM   885  C  CA    . TYR A 1 112 ? 30.397 20.567  31.160 1.00 14.61 ? 112  TYR A CA    1 
ATOM   886  C  C     . TYR A 1 112 ? 30.580 19.337  30.291 1.00 13.76 ? 112  TYR A C     1 
ATOM   887  O  O     . TYR A 1 112 ? 29.972 18.312  30.608 1.00 15.87 ? 112  TYR A O     1 
ATOM   888  C  CB    . TYR A 1 112 ? 29.125 21.260  30.653 1.00 15.06 ? 112  TYR A CB    1 
ATOM   889  C  CG    . TYR A 1 112 ? 28.591 22.309  31.558 1.00 13.66 ? 112  TYR A CG    1 
ATOM   890  C  CD1   . TYR A 1 112 ? 27.884 21.983  32.727 1.00 14.36 ? 112  TYR A CD1   1 
ATOM   891  C  CD2   . TYR A 1 112 ? 28.800 23.630  31.239 1.00 15.71 ? 112  TYR A CD2   1 
ATOM   892  C  CE1   . TYR A 1 112 ? 27.402 22.971  33.533 1.00 15.47 ? 112  TYR A CE1   1 
ATOM   893  C  CE2   . TYR A 1 112 ? 28.293 24.618  32.026 1.00 16.51 ? 112  TYR A CE2   1 
ATOM   894  C  CZ    . TYR A 1 112 ? 27.626 24.295  33.169 1.00 14.78 ? 112  TYR A CZ    1 
ATOM   895  O  OH    . TYR A 1 112 ? 27.092 25.302  33.985 1.00 21.06 ? 112  TYR A OH    1 
ATOM   896  N  N     . LEU A 1 113 ? 31.412 19.373  29.250 1.00 15.33 ? 113  LEU A N     1 
ATOM   897  C  CA    . LEU A 1 113 ? 31.275 18.352  28.206 1.00 17.72 ? 113  LEU A CA    1 
ATOM   898  C  C     . LEU A 1 113 ? 31.720 16.980  28.669 1.00 19.44 ? 113  LEU A C     1 
ATOM   899  O  O     . LEU A 1 113 ? 31.025 15.974  28.447 1.00 15.42 ? 113  LEU A O     1 
ATOM   900  C  CB    . LEU A 1 113 ? 32.042 18.751  26.957 1.00 14.44 ? 113  LEU A CB    1 
ATOM   901  C  CG    . LEU A 1 113 ? 31.916 17.796  25.770 1.00 16.61 ? 113  LEU A CG    1 
ATOM   902  C  CD1   . LEU A 1 113 ? 30.433 17.467  25.370 1.00 15.37 ? 113  LEU A CD1   1 
ATOM   903  C  CD2   . LEU A 1 113 ? 32.707 18.418  24.620 1.00 16.00 ? 113  LEU A CD2   1 
ATOM   904  N  N     . GLU A 1 114 ? 32.863 16.896  29.345 1.00 16.04 ? 114  GLU A N     1 
ATOM   905  C  CA    . GLU A 1 114 ? 33.253 15.574  29.810 1.00 16.29 ? 114  GLU A CA    1 
ATOM   906  C  C     . GLU A 1 114 ? 32.233 14.970  30.775 1.00 16.18 ? 114  GLU A C     1 
ATOM   907  O  O     . GLU A 1 114 ? 32.030 13.742  30.758 1.00 18.15 ? 114  GLU A O     1 
ATOM   908  C  CB    . GLU A 1 114 ? 34.648 15.631  30.440 1.00 18.60 ? 114  GLU A CB    1 
ATOM   909  C  CG    . GLU A 1 114 ? 35.191 14.229  30.615 1.00 21.73 ? 114  GLU A CG    1 
ATOM   910  C  CD    . GLU A 1 114 ? 36.660 14.180  30.991 1.00 58.41 ? 114  GLU A CD    1 
ATOM   911  O  OE1   . GLU A 1 114 ? 37.167 13.046  31.201 1.00 44.26 ? 114  GLU A OE1   1 
ATOM   912  O  OE2   . GLU A 1 114 ? 37.293 15.262  31.077 1.00 38.26 ? 114  GLU A OE2   1 
ATOM   913  N  N     . SER A 1 115 ? 31.590 15.778  31.600 1.00 15.21 ? 115  SER A N     1 
ATOM   914  C  CA    . SER A 1 115 ? 30.568 15.267  32.498 1.00 13.57 ? 115  SER A CA    1 
ATOM   915  C  C     . SER A 1 115 ? 29.380 14.695  31.715 1.00 14.92 ? 115  SER A C     1 
ATOM   916  O  O     . SER A 1 115 ? 28.776 13.708  32.144 1.00 15.01 ? 115  SER A O     1 
ATOM   917  C  CB    . SER A 1 115 ? 30.060 16.366  33.422 1.00 21.39 ? 115  SER A CB    1 
ATOM   918  O  OG    . SER A 1 115 ? 31.085 16.677  34.363 1.00 25.78 ? 115  SER A OG    1 
ATOM   919  N  N     . LEU A 1 116 ? 29.041 15.314  30.586 1.00 14.23 ? 116  LEU A N     1 
ATOM   920  C  CA    . LEU A 1 116 ? 27.959 14.757  29.762 1.00 14.50 ? 116  LEU A CA    1 
ATOM   921  C  C     . LEU A 1 116 ? 28.394 13.489  29.072 1.00 14.84 ? 116  LEU A C     1 
ATOM   922  O  O     . LEU A 1 116 ? 27.626 12.515  28.972 1.00 14.12 ? 116  LEU A O     1 
ATOM   923  C  CB    . LEU A 1 116 ? 27.478 15.779  28.730 1.00 14.26 ? 116  LEU A CB    1 
ATOM   924  C  CG    . LEU A 1 116 ? 26.895 17.022  29.421 1.00 14.93 ? 116  LEU A CG    1 
ATOM   925  C  CD1   . LEU A 1 116 ? 26.786 18.132  28.438 1.00 23.31 ? 116  LEU A CD1   1 
ATOM   926  C  CD2   . LEU A 1 116 ? 25.594 16.770  30.100 1.00 19.61 ? 116  LEU A CD2   1 
ATOM   927  N  N     . VAL A 1 117 ? 29.626 13.467  28.590 1.00 15.17 ? 117  VAL A N     1 
ATOM   928  C  CA    . VAL A 1 117 ? 30.190 12.320  27.869 1.00 15.93 ? 117  VAL A CA    1 
ATOM   929  C  C     . VAL A 1 117 ? 30.297 11.082  28.758 1.00 20.88 ? 117  VAL A C     1 
ATOM   930  O  O     . VAL A 1 117 ? 30.081 9.956   28.305 1.00 19.80 ? 117  VAL A O     1 
ATOM   931  C  CB    . VAL A 1 117 ? 31.555 12.751  27.292 1.00 15.18 ? 117  VAL A CB    1 
ATOM   932  C  CG1   . VAL A 1 117 ? 32.321 11.535  26.777 1.00 20.34 ? 117  VAL A CG1   1 
ATOM   933  C  CG2   . VAL A 1 117 ? 31.295 13.734  26.155 1.00 17.57 ? 117  VAL A CG2   1 
ATOM   934  N  N     . THR A 1 118 ? 30.613 11.254  30.033 1.00 16.70 ? 118  THR A N     1 
ATOM   935  C  CA    . THR A 1 118 ? 30.731 10.107  30.927 1.00 16.56 ? 118  THR A CA    1 
ATOM   936  C  C     . THR A 1 118 ? 29.410 9.795   31.637 1.00 20.54 ? 118  THR A C     1 
ATOM   937  O  O     . THR A 1 118 ? 29.344 8.844   32.417 1.00 26.97 ? 118  THR A O     1 
ATOM   938  C  CB    . THR A 1 118 ? 31.855 10.364  31.966 1.00 24.71 ? 118  THR A CB    1 
ATOM   939  O  OG1   . THR A 1 118 ? 31.512 11.488  32.786 1.00 23.82 ? 118  THR A OG1   1 
ATOM   940  C  CG2   . THR A 1 118 ? 33.166 10.692  31.243 1.00 23.73 ? 118  THR A CG2   1 
ATOM   941  N  N     . GLY A 1 119 ? 28.374 10.599  31.412 1.00 15.74 ? 119  GLY A N     1 
ATOM   942  C  CA    . GLY A 1 119 ? 27.081 10.430  32.025 1.00 18.53 ? 119  GLY A CA    1 
ATOM   943  C  C     . GLY A 1 119 ? 26.987 10.898  33.460 1.00 18.02 ? 119  GLY A C     1 
ATOM   944  O  O     . GLY A 1 119 ? 25.985 10.638  34.108 1.00 20.89 ? 119  GLY A O     1 
ATOM   945  N  N     . LYS A 1 120 ? 28.012 11.562  33.982 1.00 15.84 ? 120  LYS A N     1 
ATOM   946  C  CA    . LYS A 1 120 ? 27.885 12.173  35.295 1.00 15.78 ? 120  LYS A CA    1 
ATOM   947  C  C     . LYS A 1 120 ? 26.739 13.164  35.350 1.00 12.68 ? 120  LYS A C     1 
ATOM   948  O  O     . LYS A 1 120 ? 26.056 13.299  36.386 1.00 17.17 ? 120  LYS A O     1 
ATOM   949  C  CB    . LYS A 1 120 ? 29.225 12.832  35.633 1.00 14.24 ? 120  LYS A CB    1 
ATOM   950  C  CG    A LYS A 1 120 ? 30.310 11.784  35.774 0.51 20.73 ? 120  LYS A CG    1 
ATOM   951  C  CG    B LYS A 1 120 ? 29.210 13.667  36.916 0.49 18.95 ? 120  LYS A CG    1 
ATOM   952  C  CD    A LYS A 1 120 ? 31.602 12.313  36.386 0.51 30.71 ? 120  LYS A CD    1 
ATOM   953  C  CD    B LYS A 1 120 ? 30.658 13.952  37.303 0.49 20.64 ? 120  LYS A CD    1 
ATOM   954  C  CE    A LYS A 1 120 ? 32.795 11.708  35.654 0.51 26.89 ? 120  LYS A CE    1 
ATOM   955  C  CE    B LYS A 1 120 ? 30.834 15.360  37.818 0.49 28.87 ? 120  LYS A CE    1 
ATOM   956  N  NZ    A LYS A 1 120 ? 33.133 12.517  34.457 0.51 22.66 ? 120  LYS A NZ    1 
ATOM   957  N  NZ    B LYS A 1 120 ? 30.557 16.377  36.765 0.49 21.87 ? 120  LYS A NZ    1 
ATOM   958  N  N     . LEU A 1 121 ? 26.476 13.864  34.235 1.00 14.28 ? 121  LEU A N     1 
ATOM   959  C  CA    . LEU A 1 121 ? 25.353 14.785  34.162 1.00 13.77 ? 121  LEU A CA    1 
ATOM   960  C  C     . LEU A 1 121 ? 24.477 14.284  33.024 1.00 13.21 ? 121  LEU A C     1 
ATOM   961  O  O     . LEU A 1 121 ? 24.999 13.913  31.980 1.00 13.82 ? 121  LEU A O     1 
ATOM   962  C  CB    . LEU A 1 121 ? 25.792 16.227  33.830 1.00 16.43 ? 121  LEU A CB    1 
ATOM   963  C  CG    . LEU A 1 121 ? 26.658 16.993  34.845 1.00 18.04 ? 121  LEU A CG    1 
ATOM   964  C  CD1   . LEU A 1 121 ? 27.079 18.311  34.300 1.00 23.82 ? 121  LEU A CD1   1 
ATOM   965  C  CD2   . LEU A 1 121 ? 25.815 17.149  36.055 1.00 19.71 ? 121  LEU A CD2   1 
ATOM   966  N  N     . ILE A 1 122 ? 23.177 14.267  33.263 1.00 11.54 ? 122  ILE A N     1 
ATOM   967  C  CA    . ILE A 1 122 ? 22.187 13.938  32.219 1.00 9.13  ? 122  ILE A CA    1 
ATOM   968  C  C     . ILE A 1 122 ? 21.691 15.248  31.615 1.00 10.13 ? 122  ILE A C     1 
ATOM   969  O  O     . ILE A 1 122 ? 21.435 16.216  32.329 1.00 10.68 ? 122  ILE A O     1 
ATOM   970  C  CB    . ILE A 1 122 ? 21.035 13.149  32.856 1.00 10.44 ? 122  ILE A CB    1 
ATOM   971  C  CG1   . ILE A 1 122 ? 21.577 11.827  33.424 1.00 14.31 ? 122  ILE A CG1   1 
ATOM   972  C  CG2   . ILE A 1 122 ? 19.982 12.836  31.710 1.00 12.11 ? 122  ILE A CG2   1 
ATOM   973  C  CD1   . ILE A 1 122 ? 20.507 11.039  34.162 1.00 16.40 ? 122  ILE A CD1   1 
ATOM   974  N  N     . ALA A 1 123 ? 21.503 15.279  30.287 1.00 8.06  ? 123  ALA A N     1 
ATOM   975  C  CA    . ALA A 1 123 ? 21.040 16.499  29.651 1.00 8.47  ? 123  ALA A CA    1 
ATOM   976  C  C     . ALA A 1 123 ? 19.736 16.259  28.878 1.00 9.66  ? 123  ALA A C     1 
ATOM   977  O  O     . ALA A 1 123 ? 19.432 15.135  28.464 1.00 11.50 ? 123  ALA A O     1 
ATOM   978  C  CB    . ALA A 1 123 ? 22.073 17.035  28.671 1.00 9.84  ? 123  ALA A CB    1 
ATOM   979  N  N     . ALA A 1 124 ? 18.988 17.356  28.716 1.00 9.27  ? 124  ALA A N     1 
ATOM   980  C  CA    . ALA A 1 124 ? 17.743 17.335  27.927 1.00 8.39  ? 124  ALA A CA    1 
ATOM   981  C  C     . ALA A 1 124 ? 17.812 18.495  26.957 1.00 11.94 ? 124  ALA A C     1 
ATOM   982  O  O     . ALA A 1 124 ? 18.391 19.531  27.288 1.00 12.00 ? 124  ALA A O     1 
ATOM   983  C  CB    . ALA A 1 124 ? 16.570 17.530  28.828 1.00 9.73  ? 124  ALA A CB    1 
ATOM   984  N  N     . ASN A 1 125 ? 17.201 18.332  25.772 1.00 8.04  ? 125  ASN A N     1 
ATOM   985  C  CA    . ASN A 1 125 ? 17.194 19.373  24.735 1.00 10.47 ? 125  ASN A CA    1 
ATOM   986  C  C     . ASN A 1 125 ? 15.781 19.935  24.660 1.00 15.26 ? 125  ASN A C     1 
ATOM   987  O  O     . ASN A 1 125 ? 14.811 19.174  24.586 1.00 11.99 ? 125  ASN A O     1 
ATOM   988  C  CB    . ASN A 1 125 ? 17.663 18.765  23.410 1.00 15.15 ? 125  ASN A CB    1 
ATOM   989  C  CG    . ASN A 1 125 ? 16.910 19.293  22.201 1.00 29.04 ? 125  ASN A CG    1 
ATOM   990  O  OD1   . ASN A 1 125 ? 15.928 18.717  21.744 1.00 44.71 ? 125  ASN A OD1   1 
ATOM   991  N  ND2   . ASN A 1 125 ? 17.405 20.336  21.664 1.00 30.56 ? 125  ASN A ND2   1 
ATOM   992  N  N     . ALA A 1 126 ? 15.633 21.250  24.736 1.00 10.44 ? 126  ALA A N     1 
ATOM   993  C  CA    . ALA A 1 126 ? 14.306 21.820  24.850 1.00 11.06 ? 126  ALA A CA    1 
ATOM   994  C  C     . ALA A 1 126 ? 14.127 22.826  23.721 1.00 14.24 ? 126  ALA A C     1 
ATOM   995  O  O     . ALA A 1 126 ? 14.541 23.989  23.829 1.00 10.64 ? 126  ALA A O     1 
ATOM   996  C  CB    . ALA A 1 126 ? 14.074 22.457  26.211 1.00 12.06 ? 126  ALA A CB    1 
ATOM   997  N  N     . ALA A 1 127 ? 13.439 22.392  22.664 1.00 11.28 ? 127  ALA A N     1 
ATOM   998  C  CA    . ALA A 1 127 ? 13.158 23.254  21.518 1.00 9.82  ? 127  ALA A CA    1 
ATOM   999  C  C     . ALA A 1 127 ? 11.663 23.401  21.292 1.00 9.93  ? 127  ALA A C     1 
ATOM   1000 O  O     . ALA A 1 127 ? 11.149 24.527  21.149 1.00 9.54  ? 127  ALA A O     1 
ATOM   1001 C  CB    . ALA A 1 127 ? 13.838 22.684  20.261 1.00 14.21 ? 127  ALA A CB    1 
ATOM   1002 N  N     . THR A 1 128 ? 10.937 22.262  21.237 1.00 8.49  ? 128  THR A N     1 
ATOM   1003 C  CA    . THR A 1 128 ? 9.507  22.278  20.955 1.00 6.78  ? 128  THR A CA    1 
ATOM   1004 C  C     . THR A 1 128 ? 8.706  23.088  21.951 1.00 8.03  ? 128  THR A C     1 
ATOM   1005 O  O     . THR A 1 128 ? 8.916  23.045  23.173 1.00 8.61  ? 128  THR A O     1 
ATOM   1006 C  CB    . THR A 1 128 ? 9.005  20.817  20.915 1.00 9.01  ? 128  THR A CB    1 
ATOM   1007 O  OG1   . THR A 1 128 ? 9.785  20.193  19.933 1.00 9.41  ? 128  THR A OG1   1 
ATOM   1008 C  CG2   . THR A 1 128 ? 7.498  20.772  20.588 1.00 8.11  ? 128  THR A CG2   1 
ATOM   1009 N  N     . GLU A 1 129 ? 7.668  23.764  21.448 1.00 9.30  ? 129  GLU A N     1 
ATOM   1010 C  CA    . GLU A 1 129 ? 6.762  24.548  22.271 1.00 6.65  ? 129  GLU A CA    1 
ATOM   1011 C  C     . GLU A 1 129 ? 5.340  24.224  21.900 1.00 9.12  ? 129  GLU A C     1 
ATOM   1012 O  O     . GLU A 1 129 ? 5.104  23.673  20.811 1.00 11.10 ? 129  GLU A O     1 
ATOM   1013 C  CB    . GLU A 1 129 ? 6.965  26.069  22.034 1.00 9.10  ? 129  GLU A CB    1 
ATOM   1014 C  CG    . GLU A 1 129 ? 8.433  26.512  22.314 1.00 10.55 ? 129  GLU A CG    1 
ATOM   1015 C  CD    . GLU A 1 129 ? 8.554  28.027  22.301 1.00 13.92 ? 129  GLU A CD    1 
ATOM   1016 O  OE1   . GLU A 1 129 ? 7.475  28.676  22.101 1.00 18.53 ? 129  GLU A OE1   1 
ATOM   1017 O  OE2   . GLU A 1 129 ? 9.723  28.481  22.415 1.00 13.49 ? 129  GLU A OE2   1 
ATOM   1018 N  N     . PRO A 1 130 ? 4.376  24.615  22.713 1.00 10.72 ? 130  PRO A N     1 
ATOM   1019 C  CA    . PRO A 1 130 ? 2.964  24.391  22.339 1.00 14.84 ? 130  PRO A CA    1 
ATOM   1020 C  C     . PRO A 1 130 ? 2.606  24.896  20.955 1.00 16.75 ? 130  PRO A C     1 
ATOM   1021 O  O     . PRO A 1 130 ? 1.838  24.175  20.280 1.00 16.83 ? 130  PRO A O     1 
ATOM   1022 C  CB    . PRO A 1 130 ? 2.186  25.157  23.424 1.00 16.35 ? 130  PRO A CB    1 
ATOM   1023 C  CG    . PRO A 1 130 ? 3.075  25.006  24.591 1.00 15.16 ? 130  PRO A CG    1 
ATOM   1024 C  CD    . PRO A 1 130 ? 4.470  25.176  24.084 1.00 10.94 ? 130  PRO A CD    1 
ATOM   1025 N  N     . ASP A 1 131 ? 3.130  26.048  20.487 1.00 12.33 ? 131  ASP A N     1 
ATOM   1026 C  CA    . ASP A 1 131 ? 2.798  26.539  19.146 1.00 12.68 ? 131  ASP A CA    1 
ATOM   1027 C  C     . ASP A 1 131 ? 3.928  26.411  18.156 1.00 11.29 ? 131  ASP A C     1 
ATOM   1028 O  O     . ASP A 1 131 ? 3.889  27.003  17.067 1.00 14.19 ? 131  ASP A O     1 
ATOM   1029 C  CB    . ASP A 1 131 ? 2.319  27.998  19.185 1.00 17.83 ? 131  ASP A CB    1 
ATOM   1030 C  CG    . ASP A 1 131 ? 1.104  28.159  20.068 1.00 25.48 ? 131  ASP A CG    1 
ATOM   1031 O  OD1   . ASP A 1 131 ? 1.104  29.118  20.862 1.00 40.70 ? 131  ASP A OD1   1 
ATOM   1032 O  OD2   . ASP A 1 131 ? 0.156  27.327  19.972 1.00 29.58 ? 131  ASP A OD2   1 
ATOM   1033 N  N     . ALA A 1 132 ? 4.914  25.580  18.437 1.00 8.09  ? 132  ALA A N     1 
ATOM   1034 C  CA    . ALA A 1 132 ? 6.042  25.446  17.539 1.00 9.23  ? 132  ALA A CA    1 
ATOM   1035 C  C     . ALA A 1 132 ? 6.490  23.994  17.658 1.00 11.54 ? 132  ALA A C     1 
ATOM   1036 O  O     . ALA A 1 132 ? 7.297  23.620  18.526 1.00 10.11 ? 132  ALA A O     1 
ATOM   1037 C  CB    . ALA A 1 132 ? 7.205  26.385  17.847 1.00 11.93 ? 132  ALA A CB    1 
ATOM   1038 N  N     . GLY A 1 133 ? 5.970  23.165  16.747 1.00 9.55  ? 133  GLY A N     1 
ATOM   1039 C  CA    . GLY A 1 133 ? 6.367  21.754  16.723 1.00 12.05 ? 133  GLY A CA    1 
ATOM   1040 C  C     . GLY A 1 133 ? 7.049  21.554  15.387 1.00 9.62  ? 133  GLY A C     1 
ATOM   1041 O  O     . GLY A 1 133 ? 8.259  21.772  15.219 1.00 10.52 ? 133  GLY A O     1 
ATOM   1042 N  N     . SER A 1 134 ? 6.275  21.207  14.321 1.00 7.03  ? 134  SER A N     1 
ATOM   1043 C  CA    . SER A 1 134 ? 6.867  21.191  13.009 1.00 6.40  ? 134  SER A CA    1 
ATOM   1044 C  C     . SER A 1 134 ? 7.426  22.558  12.611 1.00 6.45  ? 134  SER A C     1 
ATOM   1045 O  O     . SER A 1 134 ? 8.475  22.631  11.953 1.00 10.28 ? 134  SER A O     1 
ATOM   1046 C  CB    . SER A 1 134 ? 5.859  20.743  11.956 1.00 7.25  ? 134  SER A CB    1 
ATOM   1047 O  OG    . SER A 1 134 ? 5.478  19.358  12.299 1.00 8.53  ? 134  SER A OG    1 
ATOM   1048 N  N     . ASP A 1 135 ? 6.679  23.601  12.932 1.00 8.75  ? 135  ASP A N     1 
ATOM   1049 C  CA    . ASP A 1 135 ? 7.084  24.982  12.638 1.00 7.70  ? 135  ASP A CA    1 
ATOM   1050 C  C     . ASP A 1 135 ? 7.963  25.450  13.816 1.00 10.50 ? 135  ASP A C     1 
ATOM   1051 O  O     . ASP A 1 135 ? 7.586  26.324  14.604 1.00 10.73 ? 135  ASP A O     1 
ATOM   1052 C  CB    . ASP A 1 135 ? 5.830  25.834  12.455 1.00 8.04  ? 135  ASP A CB    1 
ATOM   1053 C  CG    . ASP A 1 135 ? 6.102  27.289  12.042 1.00 7.95  ? 135  ASP A CG    1 
ATOM   1054 O  OD1   . ASP A 1 135 ? 7.223  27.661  11.652 1.00 15.47 ? 135  ASP A OD1   1 
ATOM   1055 O  OD2   . ASP A 1 135 ? 5.083  28.000  12.155 1.00 13.83 ? 135  ASP A OD2   1 
ATOM   1056 N  N     . ILE A 1 136 ? 9.154  24.832  13.892 1.00 9.76  ? 136  ILE A N     1 
ATOM   1057 C  CA    . ILE A 1 136 ? 9.940  24.984  15.128 1.00 8.92  ? 136  ILE A CA    1 
ATOM   1058 C  C     . ILE A 1 136 ? 10.534 26.373  15.217 1.00 13.85 ? 136  ILE A C     1 
ATOM   1059 O  O     . ILE A 1 136 ? 10.706 26.907  16.333 1.00 13.84 ? 136  ILE A O     1 
ATOM   1060 C  CB    . ILE A 1 136 ? 10.993 23.867  15.166 1.00 14.54 ? 136  ILE A CB    1 
ATOM   1061 C  CG1   . ILE A 1 136 ? 11.710 23.812  16.534 1.00 13.99 ? 136  ILE A CG1   1 
ATOM   1062 C  CG2   . ILE A 1 136 ? 11.988 23.988  14.012 1.00 15.52 ? 136  ILE A CG2   1 
ATOM   1063 C  CD1   . ILE A 1 136 ? 10.772 23.612  17.713 1.00 12.25 ? 136  ILE A CD1   1 
ATOM   1064 N  N     . TYR A 1 137 ? 10.773 27.023  14.080 1.00 13.91 ? 137  TYR A N     1 
ATOM   1065 C  CA    . TYR A 1 137 ? 11.374 28.353  14.170 1.00 17.36 ? 137  TYR A CA    1 
ATOM   1066 C  C     . TYR A 1 137 ? 10.358 29.439  14.431 1.00 17.78 ? 137  TYR A C     1 
ATOM   1067 O  O     . TYR A 1 137 ? 10.766 30.600  14.577 1.00 21.60 ? 137  TYR A O     1 
ATOM   1068 C  CB    . TYR A 1 137 ? 12.258 28.632  12.935 1.00 18.99 ? 137  TYR A CB    1 
ATOM   1069 C  CG    . TYR A 1 137 ? 13.313 27.539  12.787 1.00 21.53 ? 137  TYR A CG    1 
ATOM   1070 C  CD1   . TYR A 1 137 ? 14.272 27.303  13.790 1.00 25.03 ? 137  TYR A CD1   1 
ATOM   1071 C  CD2   . TYR A 1 137 ? 13.321 26.683  11.686 1.00 22.13 ? 137  TYR A CD2   1 
ATOM   1072 C  CE1   . TYR A 1 137 ? 15.204 26.267  13.668 1.00 24.30 ? 137  TYR A CE1   1 
ATOM   1073 C  CE2   . TYR A 1 137 ? 14.240 25.662  11.570 1.00 26.64 ? 137  TYR A CE2   1 
ATOM   1074 C  CZ    . TYR A 1 137 ? 15.189 25.469  12.557 1.00 42.33 ? 137  TYR A CZ    1 
ATOM   1075 O  OH    . TYR A 1 137 ? 16.106 24.450  12.420 1.00 48.11 ? 137  TYR A OH    1 
ATOM   1076 N  N     . ASN A 1 138 ? 9.082  29.108  14.620 1.00 11.78 ? 138  ASN A N     1 
ATOM   1077 C  CA    . ASN A 1 138 ? 8.066  29.957  15.225 1.00 10.71 ? 138  ASN A CA    1 
ATOM   1078 C  C     . ASN A 1 138 ? 8.106  29.914  16.745 1.00 12.02 ? 138  ASN A C     1 
ATOM   1079 O  O     . ASN A 1 138 ? 7.157  30.323  17.390 1.00 15.60 ? 138  ASN A O     1 
ATOM   1080 C  CB    . ASN A 1 138 ? 6.654  29.521  14.734 1.00 15.61 ? 138  ASN A CB    1 
ATOM   1081 C  CG    . ASN A 1 138 ? 5.539  30.497  15.102 1.00 23.36 ? 138  ASN A CG    1 
ATOM   1082 O  OD1   . ASN A 1 138 ? 5.632  31.626  14.770 1.00 25.46 ? 138  ASN A OD1   1 
ATOM   1083 N  ND2   . ASN A 1 138 ? 4.489  30.028  15.810 1.00 24.21 ? 138  ASN A ND2   1 
ATOM   1084 N  N     . MET A 1 139 ? 9.121  29.312  17.341 1.00 12.73 ? 139  MET A N     1 
ATOM   1085 C  CA    . MET A 1 139 ? 9.127  29.274  18.797 1.00 10.38 ? 139  MET A CA    1 
ATOM   1086 C  C     . MET A 1 139 ? 9.040  30.703  19.351 1.00 10.84 ? 139  MET A C     1 
ATOM   1087 O  O     . MET A 1 139 ? 9.584  31.648  18.762 1.00 16.20 ? 139  MET A O     1 
ATOM   1088 C  CB    . MET A 1 139 ? 10.377 28.545  19.295 1.00 12.99 ? 139  MET A CB    1 
ATOM   1089 C  CG    . MET A 1 139 ? 11.682 29.258  18.874 1.00 14.69 ? 139  MET A CG    1 
ATOM   1090 S  SD    . MET A 1 139 ? 13.104 28.347  19.594 1.00 15.58 ? 139  MET A SD    1 
ATOM   1091 C  CE    . MET A 1 139 ? 13.188 26.837  18.636 1.00 14.68 ? 139  MET A CE    1 
ATOM   1092 N  N     . GLN A 1 140 ? 8.347  30.812  20.468 1.00 12.75 ? 140  GLN A N     1 
ATOM   1093 C  CA    . GLN A 1 140 ? 8.044  32.093  21.098 1.00 12.04 ? 140  GLN A CA    1 
ATOM   1094 C  C     . GLN A 1 140 ? 8.864  32.336  22.346 1.00 14.71 ? 140  GLN A C     1 
ATOM   1095 O  O     . GLN A 1 140 ? 8.861  33.488  22.810 1.00 15.50 ? 140  GLN A O     1 
ATOM   1096 C  CB    . GLN A 1 140 ? 6.592  32.159  21.484 1.00 18.11 ? 140  GLN A CB    1 
ATOM   1097 C  CG    . GLN A 1 140 ? 5.732  31.941  20.225 1.00 23.93 ? 140  GLN A CG    1 
ATOM   1098 C  CD    . GLN A 1 140 ? 5.782  33.135  19.313 1.00 38.21 ? 140  GLN A CD    1 
ATOM   1099 O  OE1   . GLN A 1 140 ? 5.375  34.219  19.732 1.00 36.62 ? 140  GLN A OE1   1 
ATOM   1100 N  NE2   . GLN A 1 140 ? 6.289  32.970  18.062 1.00 28.63 ? 140  GLN A NE2   1 
ATOM   1101 N  N     . ALA A 1 141 ? 9.534  31.326  22.904 1.00 10.85 ? 141  ALA A N     1 
ATOM   1102 C  CA    . ALA A 1 141 ? 10.390 31.632  24.062 1.00 11.85 ? 141  ALA A CA    1 
ATOM   1103 C  C     . ALA A 1 141 ? 11.401 32.702  23.672 1.00 11.55 ? 141  ALA A C     1 
ATOM   1104 O  O     . ALA A 1 141 ? 11.996 32.690  22.577 1.00 12.36 ? 141  ALA A O     1 
ATOM   1105 C  CB    . ALA A 1 141 ? 11.141 30.372  24.574 1.00 11.52 ? 141  ALA A CB    1 
ATOM   1106 N  N     . THR A 1 142 ? 11.700 33.602  24.642 1.00 12.23 ? 142  THR A N     1 
ATOM   1107 C  CA    . THR A 1 142 ? 12.550 34.745  24.346 1.00 15.36 ? 142  THR A CA    1 
ATOM   1108 C  C     . THR A 1 142 ? 13.715 34.782  25.314 1.00 9.59  ? 142  THR A C     1 
ATOM   1109 O  O     . THR A 1 142 ? 13.528 34.550  26.497 1.00 14.10 ? 142  THR A O     1 
ATOM   1110 C  CB    . THR A 1 142 ? 11.787 36.068  24.502 1.00 17.10 ? 142  THR A CB    1 
ATOM   1111 O  OG1   . THR A 1 142 ? 11.158 36.127  25.785 1.00 14.37 ? 142  THR A OG1   1 
ATOM   1112 C  CG2   . THR A 1 142 ? 10.741 36.191  23.420 1.00 20.27 ? 142  THR A CG2   1 
ATOM   1113 N  N     . ALA A 1 143 ? 14.892 35.044  24.790 1.00 12.55 ? 143  ALA A N     1 
ATOM   1114 C  CA    . ALA A 1 143 ? 16.082 35.265  25.621 1.00 10.59 ? 143  ALA A CA    1 
ATOM   1115 C  C     . ALA A 1 143 ? 16.509 36.694  25.298 1.00 11.03 ? 143  ALA A C     1 
ATOM   1116 O  O     . ALA A 1 143 ? 17.221 36.924  24.326 1.00 14.26 ? 143  ALA A O     1 
ATOM   1117 C  CB    . ALA A 1 143 ? 17.147 34.267  25.290 1.00 11.51 ? 143  ALA A CB    1 
ATOM   1118 N  N     . GLN A 1 144 ? 15.997 37.649  26.109 1.00 14.37 ? 144  GLN A N     1 
ATOM   1119 C  CA    . GLN A 1 144 ? 16.211 39.092  25.826 1.00 15.30 ? 144  GLN A CA    1 
ATOM   1120 C  C     . GLN A 1 144 ? 17.595 39.510  26.296 1.00 18.50 ? 144  GLN A C     1 
ATOM   1121 O  O     . GLN A 1 144 ? 17.909 39.326  27.482 1.00 17.23 ? 144  GLN A O     1 
ATOM   1122 C  CB    . GLN A 1 144 ? 15.171 39.908  26.519 1.00 19.50 ? 144  GLN A CB    1 
ATOM   1123 C  CG    A GLN A 1 144 ? 15.433 41.399  26.278 0.52 19.63 ? 144  GLN A CG    1 
ATOM   1124 C  CG    B GLN A 1 144 ? 13.755 39.429  26.219 0.48 23.18 ? 144  GLN A CG    1 
ATOM   1125 C  CD    A GLN A 1 144 ? 14.195 42.218  26.450 0.52 36.92 ? 144  GLN A CD    1 
ATOM   1126 C  CD    B GLN A 1 144 ? 12.635 40.193  26.937 0.48 28.31 ? 144  GLN A CD    1 
ATOM   1127 O  OE1   A GLN A 1 144 ? 13.163 41.718  26.906 0.52 41.35 ? 144  GLN A OE1   1 
ATOM   1128 O  OE1   B GLN A 1 144 ? 11.956 39.656  27.822 0.48 19.58 ? 144  GLN A OE1   1 
ATOM   1129 N  NE2   A GLN A 1 144 ? 14.273 43.486  26.075 0.52 36.99 ? 144  GLN A NE2   1 
ATOM   1130 N  NE2   B GLN A 1 144 ? 12.416 41.436  26.524 0.48 29.58 ? 144  GLN A NE2   1 
ATOM   1131 N  N     . PRO A 1 145 ? 18.477 39.965  25.406 1.00 14.99 ? 145  PRO A N     1 
ATOM   1132 C  CA    . PRO A 1 145 ? 19.820 40.360  25.838 1.00 20.12 ? 145  PRO A CA    1 
ATOM   1133 C  C     . PRO A 1 145 ? 19.747 41.480  26.860 1.00 22.87 ? 145  PRO A C     1 
ATOM   1134 O  O     . PRO A 1 145 ? 18.897 42.374  26.784 1.00 20.75 ? 145  PRO A O     1 
ATOM   1135 C  CB    . PRO A 1 145 ? 20.503 40.825  24.545 1.00 22.52 ? 145  PRO A CB    1 
ATOM   1136 C  CG    . PRO A 1 145 ? 19.696 40.126  23.418 1.00 24.79 ? 145  PRO A CG    1 
ATOM   1137 C  CD    . PRO A 1 145 ? 18.290 40.109  23.940 1.00 14.68 ? 145  PRO A CD    1 
ATOM   1138 N  N     . CYS A 1 146 ? 20.625 41.380  27.843 1.00 19.23 ? 146  CYS A N     1 
ATOM   1139 C  CA    . CYS A 1 146 ? 20.749 42.401  28.900 1.00 18.15 ? 146  CYS A CA    1 
ATOM   1140 C  C     . CYS A 1 146 ? 22.211 42.477  29.313 1.00 23.08 ? 146  CYS A C     1 
ATOM   1141 O  O     . CYS A 1 146 ? 23.059 41.731  28.810 1.00 24.81 ? 146  CYS A O     1 
ATOM   1142 C  CB    . CYS A 1 146 ? 19.876 42.057  30.094 1.00 19.26 ? 146  CYS A CB    1 
ATOM   1143 S  SG    . CYS A 1 146 ? 20.321 40.483  30.918 1.00 22.60 ? 146  CYS A SG    1 
ATOM   1144 N  N     . GLU A 1 147 ? 22.528 43.384  30.263 1.00 24.36 ? 147  GLU A N     1 
ATOM   1145 C  CA    . GLU A 1 147 ? 23.900 43.408  30.751 1.00 28.54 ? 147  GLU A CA    1 
ATOM   1146 C  C     . GLU A 1 147 ? 24.189 42.081  31.421 1.00 29.66 ? 147  GLU A C     1 
ATOM   1147 O  O     . GLU A 1 147 ? 23.459 41.660  32.342 1.00 32.17 ? 147  GLU A O     1 
ATOM   1148 C  CB    . GLU A 1 147 ? 24.175 44.559  31.762 1.00 31.39 ? 147  GLU A CB    1 
ATOM   1149 C  CG    A GLU A 1 147 ? 23.938 46.007  31.267 0.56 40.72 ? 147  GLU A CG    1 
ATOM   1150 C  CG    B GLU A 1 147 ? 25.638 44.513  32.244 0.44 33.61 ? 147  GLU A CG    1 
ATOM   1151 C  CD    A GLU A 1 147 ? 23.822 47.046  32.417 0.56 29.91 ? 147  GLU A CD    1 
ATOM   1152 C  CD    B GLU A 1 147 ? 26.159 45.817  32.876 0.44 27.36 ? 147  GLU A CD    1 
ATOM   1153 O  OE1   A GLU A 1 147 ? 23.552 46.634  33.586 0.56 11.98 ? 147  GLU A OE1   1 
ATOM   1154 O  OE1   B GLU A 1 147 ? 25.332 46.620  33.351 0.44 26.38 ? 147  GLU A OE1   1 
ATOM   1155 O  OE2   A GLU A 1 147 ? 23.976 48.269  32.122 0.56 27.78 ? 147  GLU A OE2   1 
ATOM   1156 O  OE2   B GLU A 1 147 ? 27.397 46.036  32.862 0.44 24.77 ? 147  GLU A OE2   1 
ATOM   1157 N  N     . GLY A 1 148 ? 25.245 41.438  30.962 1.00 20.75 ? 148  GLY A N     1 
ATOM   1158 C  CA    . GLY A 1 148 ? 25.715 40.219  31.557 1.00 27.43 ? 148  GLY A CA    1 
ATOM   1159 C  C     . GLY A 1 148 ? 25.189 38.946  30.920 1.00 23.42 ? 148  GLY A C     1 
ATOM   1160 O  O     . GLY A 1 148 ? 25.767 37.872  31.168 1.00 16.66 ? 148  GLY A O     1 
ATOM   1161 N  N     . GLY A 1 149 ? 24.155 39.038  30.074 1.00 20.88 ? 149  GLY A N     1 
ATOM   1162 C  CA    . GLY A 1 149 ? 23.573 37.791  29.590 1.00 14.94 ? 149  GLY A CA    1 
ATOM   1163 C  C     . GLY A 1 149 ? 22.193 38.028  29.019 1.00 14.58 ? 149  GLY A C     1 
ATOM   1164 O  O     . GLY A 1 149 ? 22.016 38.916  28.168 1.00 17.51 ? 149  GLY A O     1 
ATOM   1165 N  N     . TYR A 1 150 ? 21.208 37.243  29.482 1.00 13.99 ? 150  TYR A N     1 
ATOM   1166 C  CA    . TYR A 1 150 ? 19.876 37.219  28.886 1.00 12.11 ? 150  TYR A CA    1 
ATOM   1167 C  C     . TYR A 1 150 ? 18.850 36.956  29.949 1.00 11.25 ? 150  TYR A C     1 
ATOM   1168 O  O     . TYR A 1 150 ? 19.139 36.279  30.938 1.00 14.78 ? 150  TYR A O     1 
ATOM   1169 C  CB    . TYR A 1 150 ? 19.776 36.068  27.818 1.00 11.35 ? 150  TYR A CB    1 
ATOM   1170 C  CG    . TYR A 1 150 ? 20.836 36.122  26.793 1.00 12.21 ? 150  TYR A CG    1 
ATOM   1171 C  CD1   . TYR A 1 150 ? 20.617 36.734  25.542 1.00 12.87 ? 150  TYR A CD1   1 
ATOM   1172 C  CD2   . TYR A 1 150 ? 22.115 35.624  27.056 1.00 13.57 ? 150  TYR A CD2   1 
ATOM   1173 C  CE1   . TYR A 1 150 ? 21.657 36.815  24.622 1.00 13.35 ? 150  TYR A CE1   1 
ATOM   1174 C  CE2   . TYR A 1 150 ? 23.152 35.708  26.131 1.00 14.02 ? 150  TYR A CE2   1 
ATOM   1175 C  CZ    . TYR A 1 150 ? 22.898 36.306  24.902 1.00 14.35 ? 150  TYR A CZ    1 
ATOM   1176 O  OH    . TYR A 1 150 ? 23.915 36.383  23.963 1.00 19.88 ? 150  TYR A OH    1 
ATOM   1177 N  N     . ILE A 1 151 ? 17.642 37.447  29.729 1.00 11.47 ? 151  ILE A N     1 
ATOM   1178 C  CA    . ILE A 1 151 ? 16.467 37.135  30.542 1.00 13.30 ? 151  ILE A CA    1 
ATOM   1179 C  C     . ILE A 1 151 ? 15.607 36.190  29.710 1.00 15.91 ? 151  ILE A C     1 
ATOM   1180 O  O     . ILE A 1 151 ? 15.147 36.570  28.632 1.00 15.36 ? 151  ILE A O     1 
ATOM   1181 C  CB    . ILE A 1 151 ? 15.669 38.392  30.896 1.00 15.97 ? 151  ILE A CB    1 
ATOM   1182 C  CG1   . ILE A 1 151 ? 16.506 39.359  31.787 1.00 18.66 ? 151  ILE A CG1   1 
ATOM   1183 C  CG2   . ILE A 1 151 ? 14.418 37.974  31.649 1.00 17.09 ? 151  ILE A CG2   1 
ATOM   1184 C  CD1   . ILE A 1 151 ? 16.951 38.733  33.098 1.00 16.43 ? 151  ILE A CD1   1 
ATOM   1185 N  N     . LEU A 1 152 ? 15.403 34.962  30.202 1.00 11.71 ? 152  LEU A N     1 
ATOM   1186 C  CA    . LEU A 1 152 ? 14.702 33.900  29.445 1.00 10.81 ? 152  LEU A CA    1 
ATOM   1187 C  C     . LEU A 1 152 ? 13.293 33.683  29.987 1.00 11.74 ? 152  LEU A C     1 
ATOM   1188 O  O     . LEU A 1 152 ? 13.098 33.477  31.195 1.00 12.25 ? 152  LEU A O     1 
ATOM   1189 C  CB    . LEU A 1 152 ? 15.548 32.631  29.560 1.00 10.72 ? 152  LEU A CB    1 
ATOM   1190 C  CG    . LEU A 1 152 ? 14.902 31.341  28.958 1.00 11.90 ? 152  LEU A CG    1 
ATOM   1191 C  CD1   . LEU A 1 152 ? 14.758 31.372  27.399 1.00 11.64 ? 152  LEU A CD1   1 
ATOM   1192 C  CD2   . LEU A 1 152 ? 15.656 30.138  29.393 1.00 12.09 ? 152  LEU A CD2   1 
ATOM   1193 N  N     . ASN A 1 153 ? 12.282 33.661  29.078 1.00 10.90 ? 153  ASN A N     1 
ATOM   1194 C  CA    . ASN A 1 153 ? 10.916 33.337  29.438 1.00 9.58  ? 153  ASN A CA    1 
ATOM   1195 C  C     . ASN A 1 153 ? 10.327 32.428  28.359 1.00 9.82  ? 153  ASN A C     1 
ATOM   1196 O  O     . ASN A 1 153 ? 10.657 32.602  27.197 1.00 12.41 ? 153  ASN A O     1 
ATOM   1197 C  CB    . ASN A 1 153 ? 10.030 34.597  29.465 1.00 15.73 ? 153  ASN A CB    1 
ATOM   1198 C  CG    . ASN A 1 153 ? 10.253 35.379  30.761 1.00 14.42 ? 153  ASN A CG    1 
ATOM   1199 O  OD1   . ASN A 1 153 ? 9.760  34.961  31.803 1.00 14.50 ? 153  ASN A OD1   1 
ATOM   1200 N  ND2   . ASN A 1 153 ? 11.011 36.475  30.683 1.00 17.43 ? 153  ASN A ND2   1 
ATOM   1201 N  N     . GLY A 1 154 ? 9.416  31.538  28.766 1.00 13.00 ? 154  GLY A N     1 
ATOM   1202 C  CA    . GLY A 1 154 ? 8.699  30.730  27.772 1.00 10.79 ? 154  GLY A CA    1 
ATOM   1203 C  C     . GLY A 1 154 ? 8.412  29.345  28.327 1.00 13.70 ? 154  GLY A C     1 
ATOM   1204 O  O     . GLY A 1 154 ? 8.540  29.073  29.521 1.00 12.56 ? 154  GLY A O     1 
ATOM   1205 N  N     . LYS A 1 155 ? 7.885  28.490  27.430 1.00 11.82 ? 155  LYS A N     1 
ATOM   1206 C  CA    . LYS A 1 155 ? 7.449  27.160  27.840 1.00 10.37 ? 155  LYS A CA    1 
ATOM   1207 C  C     . LYS A 1 155 ? 7.866  26.171  26.766 1.00 9.11  ? 155  LYS A C     1 
ATOM   1208 O  O     . LYS A 1 155 ? 7.674  26.439  25.585 1.00 12.09 ? 155  LYS A O     1 
ATOM   1209 C  CB    . LYS A 1 155 ? 5.936  27.114  28.052 1.00 14.46 ? 155  LYS A CB    1 
ATOM   1210 C  CG    . LYS A 1 155 ? 5.428  25.722  28.401 1.00 18.25 ? 155  LYS A CG    1 
ATOM   1211 C  CD    . LYS A 1 155 ? 3.949  25.789  28.707 1.00 19.48 ? 155  LYS A CD    1 
ATOM   1212 C  CE    . LYS A 1 155 ? 3.403  24.419  29.149 1.00 30.59 ? 155  LYS A CE    1 
ATOM   1213 N  NZ    . LYS A 1 155 ? 1.945  24.555  29.475 1.00 31.85 ? 155  LYS A NZ    1 
ATOM   1214 N  N     . LYS A 1 156 ? 8.462  25.045  27.177 1.00 8.46  ? 156  LYS A N     1 
ATOM   1215 C  CA    . LYS A 1 156 ? 8.863  23.989  26.253 1.00 8.35  ? 156  LYS A CA    1 
ATOM   1216 C  C     . LYS A 1 156 ? 8.117  22.732  26.635 1.00 10.19 ? 156  LYS A C     1 
ATOM   1217 O  O     . LYS A 1 156 ? 7.863  22.484  27.806 1.00 9.94  ? 156  LYS A O     1 
ATOM   1218 C  CB    . LYS A 1 156 ? 10.364 23.736  26.298 1.00 9.21  ? 156  LYS A CB    1 
ATOM   1219 C  CG    . LYS A 1 156 ? 11.227 24.939  25.949 1.00 8.74  ? 156  LYS A CG    1 
ATOM   1220 C  CD    . LYS A 1 156 ? 10.935 25.485  24.546 1.00 10.85 ? 156  LYS A CD    1 
ATOM   1221 C  CE    . LYS A 1 156 ? 12.086 26.359  24.079 1.00 9.80  ? 156  LYS A CE    1 
ATOM   1222 N  NZ    . LYS A 1 156 ? 11.851 26.805  22.640 1.00 11.38 ? 156  LYS A NZ    1 
ATOM   1223 N  N     . ILE A 1 157 ? 7.791  21.904  25.623 1.00 8.56  ? 157  ILE A N     1 
ATOM   1224 C  CA    . ILE A 1 157 ? 7.011  20.713  25.896 1.00 8.31  ? 157  ILE A CA    1 
ATOM   1225 C  C     . ILE A 1 157 ? 7.643  19.538  25.190 1.00 6.81  ? 157  ILE A C     1 
ATOM   1226 O  O     . ILE A 1 157 ? 8.436  19.694  24.255 1.00 8.32  ? 157  ILE A O     1 
ATOM   1227 C  CB    . ILE A 1 157 ? 5.516  20.849  25.468 1.00 10.29 ? 157  ILE A CB    1 
ATOM   1228 C  CG1   . ILE A 1 157 ? 5.440  21.149  23.953 1.00 10.66 ? 157  ILE A CG1   1 
ATOM   1229 C  CG2   . ILE A 1 157 ? 4.800  21.931  26.343 1.00 11.24 ? 157  ILE A CG2   1 
ATOM   1230 C  CD1   . ILE A 1 157 ? 3.984  20.982  23.414 1.00 11.16 ? 157  ILE A CD1   1 
ATOM   1231 N  N     . PHE A 1 158 ? 7.231  18.347  25.635 1.00 6.67  ? 158  PHE A N     1 
ATOM   1232 C  CA    . PHE A 1 158 ? 7.664  17.061  25.035 1.00 6.49  ? 158  PHE A CA    1 
ATOM   1233 C  C     . PHE A 1 158 ? 9.161  16.828  25.228 1.00 7.57  ? 158  PHE A C     1 
ATOM   1234 O  O     . PHE A 1 158 ? 9.860  16.286  24.361 1.00 9.32  ? 158  PHE A O     1 
ATOM   1235 C  CB    . PHE A 1 158 ? 7.325  16.979  23.522 1.00 7.37  ? 158  PHE A CB    1 
ATOM   1236 C  CG    . PHE A 1 158 ? 5.867  17.150  23.211 1.00 6.40  ? 158  PHE A CG    1 
ATOM   1237 C  CD1   . PHE A 1 158 ? 4.850  16.846  24.114 1.00 9.38  ? 158  PHE A CD1   1 
ATOM   1238 C  CD2   . PHE A 1 158 ? 5.519  17.653  21.952 1.00 8.76  ? 158  PHE A CD2   1 
ATOM   1239 C  CE1   . PHE A 1 158 ? 3.502  16.983  23.743 1.00 12.90 ? 158  PHE A CE1   1 
ATOM   1240 C  CE2   . PHE A 1 158 ? 4.134  17.771  21.619 1.00 8.62  ? 158  PHE A CE2   1 
ATOM   1241 C  CZ    . PHE A 1 158 ? 3.194  17.445  22.475 1.00 10.27 ? 158  PHE A CZ    1 
ATOM   1242 N  N     . ILE A 1 159 ? 9.695  17.231  26.383 1.00 7.86  ? 159  ILE A N     1 
ATOM   1243 C  CA    . ILE A 1 159 ? 11.146 17.257  26.536 1.00 7.89  ? 159  ILE A CA    1 
ATOM   1244 C  C     . ILE A 1 159 ? 11.630 15.943  27.133 1.00 9.30  ? 159  ILE A C     1 
ATOM   1245 O  O     . ILE A 1 159 ? 11.508 15.713  28.341 1.00 8.02  ? 159  ILE A O     1 
ATOM   1246 C  CB    . ILE A 1 159 ? 11.565 18.444  27.400 1.00 6.30  ? 159  ILE A CB    1 
ATOM   1247 C  CG1   . ILE A 1 159 ? 10.997 19.754  26.788 1.00 7.35  ? 159  ILE A CG1   1 
ATOM   1248 C  CG2   . ILE A 1 159 ? 13.098 18.520  27.517 1.00 9.24  ? 159  ILE A CG2   1 
ATOM   1249 C  CD1   . ILE A 1 159 ? 11.316 19.922  25.238 1.00 10.20 ? 159  ILE A CD1   1 
ATOM   1250 N  N     . THR A 1 160 ? 12.250 15.126  26.286 1.00 8.08  ? 160  THR A N     1 
ATOM   1251 C  CA    . THR A 1 160 ? 12.849 13.845  26.711 1.00 8.64  ? 160  THR A CA    1 
ATOM   1252 C  C     . THR A 1 160 ? 13.912 14.107  27.776 1.00 9.17  ? 160  THR A C     1 
ATOM   1253 O  O     . THR A 1 160 ? 14.726 15.031  27.629 1.00 8.53  ? 160  THR A O     1 
ATOM   1254 C  CB    . THR A 1 160 ? 13.440 13.188  25.478 1.00 11.72 ? 160  THR A CB    1 
ATOM   1255 O  OG1   . THR A 1 160 ? 12.323 12.876  24.625 1.00 9.26  ? 160  THR A OG1   1 
ATOM   1256 C  CG2   . THR A 1 160 ? 14.154 11.874  25.880 1.00 9.24  ? 160  THR A CG2   1 
ATOM   1257 N  N     . ASN A 1 161 ? 13.834 13.323  28.849 1.00 7.99  ? 161  ASN A N     1 
ATOM   1258 C  CA    . ASN A 1 161 ? 14.753 13.391  29.995 1.00 8.38  ? 161  ASN A CA    1 
ATOM   1259 C  C     . ASN A 1 161 ? 14.551 14.608  30.881 1.00 10.84 ? 161  ASN A C     1 
ATOM   1260 O  O     . ASN A 1 161 ? 15.303 14.707  31.851 1.00 10.19 ? 161  ASN A O     1 
ATOM   1261 C  CB    . ASN A 1 161 ? 16.222 13.371  29.575 1.00 6.45  ? 161  ASN A CB    1 
ATOM   1262 C  CG    . ASN A 1 161 ? 16.600 12.043  28.901 1.00 7.89  ? 161  ASN A CG    1 
ATOM   1263 O  OD1   . ASN A 1 161 ? 16.086 11.044  29.319 1.00 10.90 ? 161  ASN A OD1   1 
ATOM   1264 N  ND2   . ASN A 1 161 ? 17.484 12.057  27.929 1.00 10.37 ? 161  ASN A ND2   1 
ATOM   1265 N  N     . ALA A 1 162 ? 13.593 15.518  30.631 1.00 9.07  ? 162  ALA A N     1 
ATOM   1266 C  CA    . ALA A 1 162 ? 13.534 16.681  31.519 1.00 10.42 ? 162  ALA A CA    1 
ATOM   1267 C  C     . ALA A 1 162 ? 13.393 16.311  32.998 1.00 11.11 ? 162  ALA A C     1 
ATOM   1268 O  O     . ALA A 1 162 ? 14.055 16.968  33.821 1.00 11.63 ? 162  ALA A O     1 
ATOM   1269 C  CB    . ALA A 1 162 ? 12.370 17.616  31.083 1.00 9.09  ? 162  ALA A CB    1 
ATOM   1270 N  N     . PRO A 1 163 ? 12.581 15.333  33.403 1.00 8.44  ? 163  PRO A N     1 
ATOM   1271 C  CA    . PRO A 1 163 ? 12.455 15.046  34.842 1.00 10.60 ? 163  PRO A CA    1 
ATOM   1272 C  C     . PRO A 1 163 ? 13.721 14.514  35.474 1.00 12.28 ? 163  PRO A C     1 
ATOM   1273 O  O     . PRO A 1 163 ? 13.811 14.578  36.704 1.00 15.59 ? 163  PRO A O     1 
ATOM   1274 C  CB    . PRO A 1 163 ? 11.332 13.989  34.906 1.00 12.57 ? 163  PRO A CB    1 
ATOM   1275 C  CG    . PRO A 1 163 ? 10.513 14.210  33.619 1.00 13.69 ? 163  PRO A CG    1 
ATOM   1276 C  CD    . PRO A 1 163 ? 11.574 14.589  32.587 1.00 8.38  ? 163  PRO A CD    1 
ATOM   1277 N  N     . ILE A 1 164 ? 14.682 14.015  34.719 1.00 9.15  ? 164  ILE A N     1 
ATOM   1278 C  CA    . ILE A 1 164 ? 15.924 13.470  35.280 1.00 11.71 ? 164  ILE A CA    1 
ATOM   1279 C  C     . ILE A 1 164 ? 17.155 14.288  34.901 1.00 13.13 ? 164  ILE A C     1 
ATOM   1280 O  O     . ILE A 1 164 ? 18.263 13.939  35.331 1.00 13.30 ? 164  ILE A O     1 
ATOM   1281 C  CB    . ILE A 1 164 ? 16.120 11.986  34.904 1.00 11.29 ? 164  ILE A CB    1 
ATOM   1282 C  CG1   . ILE A 1 164 ? 16.241 11.825  33.402 1.00 12.05 ? 164  ILE A CG1   1 
ATOM   1283 C  CG2   . ILE A 1 164 ? 14.932 11.180  35.473 1.00 13.00 ? 164  ILE A CG2   1 
ATOM   1284 C  CD1   . ILE A 1 164 ? 16.765 10.417  32.954 1.00 16.05 ? 164  ILE A CD1   1 
ATOM   1285 N  N     . ALA A 1 165 ? 17.017 15.376  34.136 1.00 9.41  ? 165  ALA A N     1 
ATOM   1286 C  CA    . ALA A 1 165 ? 18.200 16.064  33.614 1.00 7.65  ? 165  ALA A CA    1 
ATOM   1287 C  C     . ALA A 1 165 ? 18.842 16.989  34.651 1.00 9.97  ? 165  ALA A C     1 
ATOM   1288 O  O     . ALA A 1 165 ? 18.156 17.636  35.426 1.00 12.97 ? 165  ALA A O     1 
ATOM   1289 C  CB    . ALA A 1 165 ? 17.811 16.921  32.414 1.00 10.40 ? 165  ALA A CB    1 
ATOM   1290 N  N     . ASP A 1 166 ? 20.143 17.062  34.587 1.00 9.43  ? 166  ASP A N     1 
ATOM   1291 C  CA    . ASP A 1 166 ? 20.919 18.042  35.349 1.00 12.27 ? 166  ASP A CA    1 
ATOM   1292 C  C     . ASP A 1 166 ? 21.139 19.325  34.590 1.00 12.08 ? 166  ASP A C     1 
ATOM   1293 O  O     . ASP A 1 166 ? 21.337 20.388  35.214 1.00 12.92 ? 166  ASP A O     1 
ATOM   1294 C  CB    . ASP A 1 166 ? 22.286 17.438  35.662 1.00 11.85 ? 166  ASP A CB    1 
ATOM   1295 C  CG    . ASP A 1 166 ? 22.149 16.156  36.474 1.00 16.05 ? 166  ASP A CG    1 
ATOM   1296 O  OD1   . ASP A 1 166 ? 21.644 16.221  37.612 1.00 20.07 ? 166  ASP A OD1   1 
ATOM   1297 O  OD2   . ASP A 1 166 ? 22.446 15.049  35.972 1.00 14.17 ? 166  ASP A OD2   1 
ATOM   1298 N  N     . VAL A 1 167 ? 21.206 19.257  33.261 1.00 11.22 ? 167  VAL A N     1 
ATOM   1299 C  CA    . VAL A 1 167 ? 21.368 20.462  32.474 1.00 12.30 ? 167  VAL A CA    1 
ATOM   1300 C  C     . VAL A 1 167 ? 20.429 20.380  31.290 1.00 12.97 ? 167  VAL A C     1 
ATOM   1301 O  O     . VAL A 1 167 ? 19.998 19.293  30.879 1.00 10.97 ? 167  VAL A O     1 
ATOM   1302 C  CB    . VAL A 1 167 ? 22.783 20.682  31.938 1.00 12.84 ? 167  VAL A CB    1 
ATOM   1303 C  CG1   . VAL A 1 167 ? 23.803 20.848  33.165 1.00 16.61 ? 167  VAL A CG1   1 
ATOM   1304 C  CG2   . VAL A 1 167 ? 23.184 19.558  31.113 1.00 14.86 ? 167  VAL A CG2   1 
ATOM   1305 N  N     . PHE A 1 168 ? 20.145 21.558  30.749 1.00 9.54  ? 168  PHE A N     1 
ATOM   1306 C  CA    . PHE A 1 168 ? 19.169 21.699  29.672 1.00 10.75 ? 168  PHE A CA    1 
ATOM   1307 C  C     . PHE A 1 168 ? 19.827 22.497  28.554 1.00 10.76 ? 168  PHE A C     1 
ATOM   1308 O  O     . PHE A 1 168 ? 20.369 23.582  28.796 1.00 12.35 ? 168  PHE A O     1 
ATOM   1309 C  CB    . PHE A 1 168 ? 17.904 22.401  30.159 1.00 9.44  ? 168  PHE A CB    1 
ATOM   1310 C  CG    . PHE A 1 168 ? 17.168 21.641  31.253 1.00 11.18 ? 168  PHE A CG    1 
ATOM   1311 C  CD1   . PHE A 1 168 ? 16.085 20.820  30.898 1.00 12.31 ? 168  PHE A CD1   1 
ATOM   1312 C  CD2   . PHE A 1 168 ? 17.589 21.704  32.608 1.00 12.93 ? 168  PHE A CD2   1 
ATOM   1313 C  CE1   . PHE A 1 168 ? 15.426 20.073  31.878 1.00 15.97 ? 168  PHE A CE1   1 
ATOM   1314 C  CE2   . PHE A 1 168 ? 16.959 20.912  33.587 1.00 18.72 ? 168  PHE A CE2   1 
ATOM   1315 C  CZ    . PHE A 1 168 ? 15.826 20.123  33.190 1.00 15.26 ? 168  PHE A CZ    1 
ATOM   1316 N  N     . ILE A 1 169 ? 19.750 22.001  27.315 1.00 9.75  ? 169  ILE A N     1 
ATOM   1317 C  CA    . ILE A 1 169 ? 20.175 22.772  26.139 1.00 9.69  ? 169  ILE A CA    1 
ATOM   1318 C  C     . ILE A 1 169 ? 18.890 23.394  25.598 1.00 12.50 ? 169  ILE A C     1 
ATOM   1319 O  O     . ILE A 1 169 ? 17.983 22.667  25.189 1.00 14.79 ? 169  ILE A O     1 
ATOM   1320 C  CB    . ILE A 1 169 ? 20.835 21.881  25.081 1.00 14.71 ? 169  ILE A CB    1 
ATOM   1321 C  CG1   . ILE A 1 169 ? 22.014 21.080  25.654 1.00 17.92 ? 169  ILE A CG1   1 
ATOM   1322 C  CG2   . ILE A 1 169 ? 21.160 22.650  23.810 1.00 15.11 ? 169  ILE A CG2   1 
ATOM   1323 C  CD1   . ILE A 1 169 ? 23.052 21.924  26.386 1.00 19.37 ? 169  ILE A CD1   1 
ATOM   1324 N  N     . ILE A 1 170 ? 18.758 24.720  25.655 1.00 9.12  ? 170  ILE A N     1 
ATOM   1325 C  CA    . ILE A 1 170 ? 17.478 25.325  25.335 1.00 10.24 ? 170  ILE A CA    1 
ATOM   1326 C  C     . ILE A 1 170 ? 17.636 26.318  24.191 1.00 9.94  ? 170  ILE A C     1 
ATOM   1327 O  O     . ILE A 1 170 ? 18.692 26.902  23.947 1.00 11.48 ? 170  ILE A O     1 
ATOM   1328 C  CB    . ILE A 1 170 ? 16.775 25.950  26.541 1.00 16.90 ? 170  ILE A CB    1 
ATOM   1329 C  CG1   . ILE A 1 170 ? 17.437 27.239  26.921 1.00 15.49 ? 170  ILE A CG1   1 
ATOM   1330 C  CG2   . ILE A 1 170 ? 16.718 24.963  27.782 1.00 13.71 ? 170  ILE A CG2   1 
ATOM   1331 C  CD1   . ILE A 1 170 ? 16.651 28.426  26.272 1.00 20.67 ? 170  ILE A CD1   1 
ATOM   1332 N  N     . TYR A 1 171 ? 16.590 26.366  23.368 1.00 9.77  ? 171  TYR A N     1 
ATOM   1333 C  CA    . TYR A 1 171 ? 16.555 27.242  22.202 1.00 10.45 ? 171  TYR A CA    1 
ATOM   1334 C  C     . TYR A 1 171 ? 15.523 28.324  22.423 1.00 8.50  ? 171  TYR A C     1 
ATOM   1335 O  O     . TYR A 1 171 ? 14.432 28.073  22.913 1.00 9.07  ? 171  TYR A O     1 
ATOM   1336 C  CB    . TYR A 1 171 ? 16.231 26.429  20.933 1.00 7.05  ? 171  TYR A CB    1 
ATOM   1337 C  CG    . TYR A 1 171 ? 17.320 25.451  20.614 1.00 7.64  ? 171  TYR A CG    1 
ATOM   1338 C  CD1   . TYR A 1 171 ? 18.332 25.726  19.749 1.00 11.95 ? 171  TYR A CD1   1 
ATOM   1339 C  CD2   . TYR A 1 171 ? 17.272 24.184  21.198 1.00 11.41 ? 171  TYR A CD2   1 
ATOM   1340 C  CE1   . TYR A 1 171 ? 19.322 24.850  19.483 1.00 13.66 ? 171  TYR A CE1   1 
ATOM   1341 C  CE2   . TYR A 1 171 ? 18.259 23.283  20.947 1.00 14.01 ? 171  TYR A CE2   1 
ATOM   1342 C  CZ    . TYR A 1 171 ? 19.268 23.591  20.063 1.00 18.43 ? 171  TYR A CZ    1 
ATOM   1343 O  OH    . TYR A 1 171 ? 20.215 22.633  19.804 1.00 17.87 ? 171  TYR A OH    1 
ATOM   1344 N  N     . ALA A 1 172 ? 15.902 29.597  22.149 1.00 8.41  ? 172  ALA A N     1 
ATOM   1345 C  CA    . ALA A 1 172 ? 14.997 30.709  22.402 1.00 10.42 ? 172  ALA A CA    1 
ATOM   1346 C  C     . ALA A 1 172 ? 15.359 31.838  21.455 1.00 9.40  ? 172  ALA A C     1 
ATOM   1347 O  O     . ALA A 1 172 ? 16.469 31.867  20.919 1.00 11.47 ? 172  ALA A O     1 
ATOM   1348 C  CB    . ALA A 1 172 ? 15.124 31.224  23.875 1.00 9.87  ? 172  ALA A CB    1 
ATOM   1349 N  N     . LYS A 1 173 ? 14.401 32.741  21.254 1.00 11.37 ? 173  LYS A N     1 
ATOM   1350 C  CA    . LYS A 1 173 ? 14.578 33.891  20.359 1.00 9.33  ? 173  LYS A CA    1 
ATOM   1351 C  C     . LYS A 1 173 ? 15.353 34.980  21.077 1.00 10.71 ? 173  LYS A C     1 
ATOM   1352 O  O     . LYS A 1 173 ? 14.822 35.599  22.024 1.00 15.52 ? 173  LYS A O     1 
ATOM   1353 C  CB    . LYS A 1 173 ? 13.215 34.423  19.926 1.00 17.91 ? 173  LYS A CB    1 
ATOM   1354 C  CG    . LYS A 1 173 ? 12.401 33.404  19.051 1.00 19.49 ? 173  LYS A CG    1 
ATOM   1355 C  CD    . LYS A 1 173 ? 12.860 33.510  17.627 1.00 15.87 ? 173  LYS A CD    1 
ATOM   1356 C  CE    . LYS A 1 173 ? 12.171 32.505  16.638 1.00 19.54 ? 173  LYS A CE    1 
ATOM   1357 N  NZ    . LYS A 1 173 ? 10.749 32.857  16.343 1.00 19.90 ? 173  LYS A NZ    1 
ATOM   1358 N  N     . THR A 1 174 ? 16.518 35.246  20.565 1.00 13.74 ? 174  THR A N     1 
ATOM   1359 C  CA    . THR A 1 174 ? 17.251 36.475  20.913 1.00 18.15 ? 174  THR A CA    1 
ATOM   1360 C  C     . THR A 1 174 ? 16.885 37.646  20.022 1.00 25.85 ? 174  THR A C     1 
ATOM   1361 O  O     . THR A 1 174 ? 17.138 38.798  20.389 1.00 20.71 ? 174  THR A O     1 
ATOM   1362 C  CB    . THR A 1 174 ? 18.751 36.237  20.841 1.00 18.03 ? 174  THR A CB    1 
ATOM   1363 O  OG1   . THR A 1 174 ? 19.101 35.503  19.659 1.00 18.03 ? 174  THR A OG1   1 
ATOM   1364 C  CG2   . THR A 1 174 ? 19.234 35.437  22.035 1.00 15.78 ? 174  THR A CG2   1 
ATOM   1365 N  N     . ASN A 1 175 ? 16.263 37.385  18.883 1.00 19.34 ? 175  ASN A N     1 
ATOM   1366 C  CA    . ASN A 1 175 ? 15.691 38.423  18.031 1.00 23.27 ? 175  ASN A CA    1 
ATOM   1367 C  C     . ASN A 1 175 ? 14.314 37.924  17.627 1.00 23.00 ? 175  ASN A C     1 
ATOM   1368 O  O     . ASN A 1 175 ? 14.171 37.170  16.657 1.00 24.96 ? 175  ASN A O     1 
ATOM   1369 C  CB    . ASN A 1 175 ? 16.591 38.680  16.827 1.00 22.83 ? 175  ASN A CB    1 
ATOM   1370 C  CG    . ASN A 1 175 ? 16.170 39.917  16.054 1.00 42.65 ? 175  ASN A CG    1 
ATOM   1371 O  OD1   . ASN A 1 175 ? 15.029 40.386  16.172 1.00 38.13 ? 175  ASN A OD1   1 
ATOM   1372 N  ND2   . ASN A 1 175 ? 17.089 40.450  15.266 1.00 48.05 ? 175  ASN A ND2   1 
ATOM   1373 N  N     . PRO A 1 176 ? 13.275 38.289  18.370 1.00 31.10 ? 176  PRO A N     1 
ATOM   1374 C  CA    . PRO A 1 176 ? 11.932 37.779  18.052 1.00 28.81 ? 176  PRO A CA    1 
ATOM   1375 C  C     . PRO A 1 176 ? 11.412 38.244  16.687 1.00 47.62 ? 176  PRO A C     1 
ATOM   1376 O  O     . PRO A 1 176 ? 10.393 37.713  16.223 1.00 49.44 ? 176  PRO A O     1 
ATOM   1377 C  CB    . PRO A 1 176 ? 11.064 38.310  19.208 1.00 37.83 ? 176  PRO A CB    1 
ATOM   1378 C  CG    . PRO A 1 176 ? 12.042 38.643  20.323 1.00 29.14 ? 176  PRO A CG    1 
ATOM   1379 C  CD    . PRO A 1 176 ? 13.302 39.071  19.621 1.00 36.76 ? 176  PRO A CD    1 
ATOM   1380 N  N     . ASP A 1 177 ? 12.085 39.191  16.024 1.00 34.57 ? 177  ASP A N     1 
ATOM   1381 C  CA    . ASP A 1 177 ? 11.645 39.618  14.699 1.00 55.21 ? 177  ASP A CA    1 
ATOM   1382 C  C     . ASP A 1 177 ? 11.823 38.512  13.665 1.00 59.96 ? 177  ASP A C     1 
ATOM   1383 O  O     . ASP A 1 177 ? 11.101 38.473  12.664 1.00 59.03 ? 177  ASP A O     1 
ATOM   1384 C  CB    . ASP A 1 177 ? 12.422 40.861  14.245 1.00 70.38 ? 177  ASP A CB    1 
ATOM   1385 C  CG    . ASP A 1 177 ? 11.836 42.182  14.783 1.00 92.81 ? 177  ASP A CG    1 
ATOM   1386 O  OD1   . ASP A 1 177 ? 10.858 42.167  15.569 1.00 84.19 ? 177  ASP A OD1   1 
ATOM   1387 O  OD2   . ASP A 1 177 ? 12.369 43.252  14.400 1.00 99.74 ? 177  ASP A OD2   1 
ATOM   1388 N  N     . HIS A 1 178 ? 12.781 37.622  13.879 1.00 42.97 ? 178  HIS A N     1 
ATOM   1389 C  CA    . HIS A 1 178 ? 13.197 36.682  12.863 1.00 34.05 ? 178  HIS A CA    1 
ATOM   1390 C  C     . HIS A 1 178 ? 12.715 35.292  13.234 1.00 42.22 ? 178  HIS A C     1 
ATOM   1391 O  O     . HIS A 1 178 ? 12.108 35.068  14.289 1.00 42.40 ? 178  HIS A O     1 
ATOM   1392 C  CB    . HIS A 1 178 ? 14.716 36.673  12.677 1.00 35.57 ? 178  HIS A CB    1 
ATOM   1393 C  CG    . HIS A 1 178 ? 15.317 38.015  12.396 1.00 54.46 ? 178  HIS A CG    1 
ATOM   1394 N  ND1   . HIS A 1 178 ? 14.584 39.184  12.403 1.00 59.35 ? 178  HIS A ND1   1 
ATOM   1395 C  CD2   . HIS A 1 178 ? 16.592 38.371  12.104 1.00 56.34 ? 178  HIS A CD2   1 
ATOM   1396 C  CE1   . HIS A 1 178 ? 15.381 40.201  12.124 1.00 75.76 ? 178  HIS A CE1   1 
ATOM   1397 N  NE2   . HIS A 1 178 ? 16.604 39.734  11.937 1.00 81.90 ? 178  HIS A NE2   1 
ATOM   1398 N  N     . GLY A 1 179 ? 13.001 34.353  12.351 1.00 32.81 ? 179  GLY A N     1 
ATOM   1399 C  CA    . GLY A 1 179 ? 12.620 32.987  12.590 1.00 26.91 ? 179  GLY A CA    1 
ATOM   1400 C  C     . GLY A 1 179 ? 13.905 32.256  12.873 1.00 28.18 ? 179  GLY A C     1 
ATOM   1401 O  O     . GLY A 1 179 ? 14.514 32.426  13.935 1.00 25.69 ? 179  GLY A O     1 
ATOM   1402 N  N     . PHE A 1 180 ? 14.330 31.473  11.892 1.00 22.85 ? 180  PHE A N     1 
ATOM   1403 C  CA    . PHE A 1 180 ? 15.541 30.672  11.990 1.00 19.69 ? 180  PHE A CA    1 
ATOM   1404 C  C     . PHE A 1 180 ? 16.731 31.496  12.470 1.00 26.75 ? 180  PHE A C     1 
ATOM   1405 O  O     . PHE A 1 180 ? 17.487 31.058  13.344 1.00 21.86 ? 180  PHE A O     1 
ATOM   1406 C  CB    . PHE A 1 180 ? 15.800 30.066  10.615 1.00 22.01 ? 180  PHE A CB    1 
ATOM   1407 C  CG    . PHE A 1 180 ? 16.994 29.193  10.532 1.00 26.62 ? 180  PHE A CG    1 
ATOM   1408 C  CD1   . PHE A 1 180 ? 16.909 27.831  10.846 1.00 25.66 ? 180  PHE A CD1   1 
ATOM   1409 C  CD2   . PHE A 1 180 ? 18.191 29.710  10.086 1.00 25.96 ? 180  PHE A CD2   1 
ATOM   1410 C  CE1   . PHE A 1 180 ? 18.020 27.018  10.741 1.00 25.36 ? 180  PHE A CE1   1 
ATOM   1411 C  CE2   . PHE A 1 180 ? 19.303 28.912  9.994  1.00 27.01 ? 180  PHE A CE2   1 
ATOM   1412 C  CZ    . PHE A 1 180 ? 19.221 27.554  10.302 1.00 28.17 ? 180  PHE A CZ    1 
ATOM   1413 N  N     . LEU A 1 181 ? 16.901 32.707  11.930 1.00 23.31 ? 181  LEU A N     1 
ATOM   1414 C  CA    . LEU A 1 181 ? 18.094 33.481  12.253 1.00 21.69 ? 181  LEU A CA    1 
ATOM   1415 C  C     . LEU A 1 181 ? 17.972 34.286  13.535 1.00 16.46 ? 181  LEU A C     1 
ATOM   1416 O  O     . LEU A 1 181 ? 18.937 34.966  13.894 1.00 24.49 ? 181  LEU A O     1 
ATOM   1417 C  CB    . LEU A 1 181 ? 18.440 34.418  11.113 1.00 23.98 ? 181  LEU A CB    1 
ATOM   1418 C  CG    . LEU A 1 181 ? 18.792 33.704  9.808  1.00 24.11 ? 181  LEU A CG    1 
ATOM   1419 C  CD1   . LEU A 1 181 ? 18.698 34.704  8.649  1.00 31.37 ? 181  LEU A CD1   1 
ATOM   1420 C  CD2   . LEU A 1 181 ? 20.164 33.097  9.904  1.00 25.03 ? 181  LEU A CD2   1 
ATOM   1421 N  N     . GLY A 1 182 ? 16.862 34.199  14.240 1.00 18.35 ? 182  GLY A N     1 
ATOM   1422 C  CA    . GLY A 1 182 ? 16.672 34.890  15.494 1.00 19.16 ? 182  GLY A CA    1 
ATOM   1423 C  C     . GLY A 1 182 ? 16.813 33.984  16.698 1.00 13.84 ? 182  GLY A C     1 
ATOM   1424 O  O     . GLY A 1 182 ? 16.507 34.421  17.810 1.00 16.32 ? 182  GLY A O     1 
ATOM   1425 N  N     . VAL A 1 183 ? 17.170 32.719  16.504 1.00 16.84 ? 183  VAL A N     1 
ATOM   1426 C  CA    . VAL A 1 183 ? 17.231 31.729  17.595 1.00 13.12 ? 183  VAL A CA    1 
ATOM   1427 C  C     . VAL A 1 183 ? 18.664 31.633  18.096 1.00 9.93  ? 183  VAL A C     1 
ATOM   1428 O  O     . VAL A 1 183 ? 19.598 31.558  17.293 1.00 13.37 ? 183  VAL A O     1 
ATOM   1429 C  CB    . VAL A 1 183 ? 16.753 30.343  17.078 1.00 14.11 ? 183  VAL A CB    1 
ATOM   1430 C  CG1   . VAL A 1 183 ? 17.040 29.188  18.139 1.00 13.13 ? 183  VAL A CG1   1 
ATOM   1431 C  CG2   . VAL A 1 183 ? 15.320 30.436  16.734 1.00 14.37 ? 183  VAL A CG2   1 
ATOM   1432 N  N     . SER A 1 184 ? 18.835 31.554  19.438 1.00 11.85 ? 184  SER A N     1 
ATOM   1433 C  CA    . SER A 1 184 ? 20.109 31.174  20.034 1.00 10.39 ? 184  SER A CA    1 
ATOM   1434 C  C     . SER A 1 184 ? 19.927 29.960  20.939 1.00 8.36  ? 184  SER A C     1 
ATOM   1435 O  O     . SER A 1 184 ? 18.810 29.641  21.352 1.00 11.85 ? 184  SER A O     1 
ATOM   1436 C  CB    . SER A 1 184 ? 20.725 32.344  20.857 1.00 15.29 ? 184  SER A CB    1 
ATOM   1437 O  OG    . SER A 1 184 ? 20.969 33.405  19.936 1.00 14.26 ? 184  SER A OG    1 
ATOM   1438 N  N     . ALA A 1 185 ? 21.039 29.320  21.243 1.00 12.85 ? 185  ALA A N     1 
ATOM   1439 C  CA    . ALA A 1 185 ? 21.045 28.126  22.080 1.00 10.54 ? 185  ALA A CA    1 
ATOM   1440 C  C     . ALA A 1 185 ? 21.766 28.432  23.371 1.00 15.85 ? 185  ALA A C     1 
ATOM   1441 O  O     . ALA A 1 185 ? 22.805 29.135  23.350 1.00 12.11 ? 185  ALA A O     1 
ATOM   1442 C  CB    . ALA A 1 185 ? 21.765 27.004  21.353 1.00 10.46 ? 185  ALA A CB    1 
ATOM   1443 N  N     . PHE A 1 186 ? 21.289 27.833  24.457 1.00 9.86  ? 186  PHE A N     1 
ATOM   1444 C  CA    . PHE A 1 186 ? 21.920 28.095  25.767 1.00 12.07 ? 186  PHE A CA    1 
ATOM   1445 C  C     . PHE A 1 186 ? 22.001 26.818  26.579 1.00 14.99 ? 186  PHE A C     1 
ATOM   1446 O  O     . PHE A 1 186 ? 21.136 25.960  26.472 1.00 12.73 ? 186  PHE A O     1 
ATOM   1447 C  CB    . PHE A 1 186 ? 21.110 29.093  26.573 1.00 11.73 ? 186  PHE A CB    1 
ATOM   1448 C  CG    . PHE A 1 186 ? 20.848 30.410  25.840 1.00 14.48 ? 186  PHE A CG    1 
ATOM   1449 C  CD1   . PHE A 1 186 ? 19.720 30.563  25.025 1.00 9.95  ? 186  PHE A CD1   1 
ATOM   1450 C  CD2   . PHE A 1 186 ? 21.750 31.470  25.918 1.00 13.54 ? 186  PHE A CD2   1 
ATOM   1451 C  CE1   . PHE A 1 186 ? 19.465 31.721  24.324 1.00 13.27 ? 186  PHE A CE1   1 
ATOM   1452 C  CE2   . PHE A 1 186 ? 21.486 32.653  25.206 1.00 12.90 ? 186  PHE A CE2   1 
ATOM   1453 C  CZ    . PHE A 1 186 ? 20.341 32.782  24.457 1.00 13.12 ? 186  PHE A CZ    1 
ATOM   1454 N  N     . LEU A 1 187 ? 22.939 26.759  27.515 1.00 9.87  ? 187  LEU A N     1 
ATOM   1455 C  CA    . LEU A 1 187 ? 22.967 25.664  28.476 1.00 11.73 ? 187  LEU A CA    1 
ATOM   1456 C  C     . LEU A 1 187 ? 22.553 26.221  29.821 1.00 14.29 ? 187  LEU A C     1 
ATOM   1457 O  O     . LEU A 1 187 ? 23.115 27.226  30.259 1.00 16.19 ? 187  LEU A O     1 
ATOM   1458 C  CB    . LEU A 1 187 ? 24.352 25.036  28.557 1.00 10.99 ? 187  LEU A CB    1 
ATOM   1459 C  CG    . LEU A 1 187 ? 24.482 23.862  29.513 1.00 14.81 ? 187  LEU A CG    1 
ATOM   1460 C  CD1   . LEU A 1 187 ? 25.650 23.048  29.080 1.00 15.70 ? 187  LEU A CD1   1 
ATOM   1461 C  CD2   . LEU A 1 187 ? 24.615 24.270  31.015 1.00 20.01 ? 187  LEU A CD2   1 
ATOM   1462 N  N     . ILE A 1 188 ? 21.525 25.644  30.447 1.00 8.99  ? 188  ILE A N     1 
ATOM   1463 C  CA    . ILE A 1 188 ? 21.150 26.080  31.799 1.00 10.37 ? 188  ILE A CA    1 
ATOM   1464 C  C     . ILE A 1 188 ? 21.124 24.888  32.750 1.00 12.62 ? 188  ILE A C     1 
ATOM   1465 O  O     . ILE A 1 188 ? 20.945 23.733  32.347 1.00 13.47 ? 188  ILE A O     1 
ATOM   1466 C  CB    . ILE A 1 188 ? 19.818 26.856  31.867 1.00 16.79 ? 188  ILE A CB    1 
ATOM   1467 C  CG1   . ILE A 1 188 ? 18.644 25.968  31.514 1.00 17.03 ? 188  ILE A CG1   1 
ATOM   1468 C  CG2   . ILE A 1 188 ? 19.863 28.137  31.020 1.00 15.54 ? 188  ILE A CG2   1 
ATOM   1469 C  CD1   . ILE A 1 188 ? 17.306 26.693  31.748 1.00 23.47 ? 188  ILE A CD1   1 
ATOM   1470 N  N     . GLU A 1 189 ? 21.350 25.158  34.037 1.00 13.15 ? 189  GLU A N     1 
ATOM   1471 C  CA    . GLU A 1 189 ? 21.408 24.090  35.020 1.00 12.52 ? 189  GLU A CA    1 
ATOM   1472 C  C     . GLU A 1 189 ? 20.107 23.889  35.772 1.00 15.60 ? 189  GLU A C     1 
ATOM   1473 O  O     . GLU A 1 189 ? 19.410 24.834  36.094 1.00 13.36 ? 189  GLU A O     1 
ATOM   1474 C  CB    . GLU A 1 189 ? 22.526 24.403  36.044 1.00 15.44 ? 189  GLU A CB    1 
ATOM   1475 C  CG    . GLU A 1 189 ? 23.868 24.578  35.394 1.00 18.14 ? 189  GLU A CG    1 
ATOM   1476 C  CD    . GLU A 1 189 ? 24.984 24.805  36.500 1.00 27.67 ? 189  GLU A CD    1 
ATOM   1477 O  OE1   . GLU A 1 189 ? 24.625 25.027  37.673 1.00 35.22 ? 189  GLU A OE1   1 
ATOM   1478 O  OE2   . GLU A 1 189 ? 26.177 24.754  36.199 1.00 31.19 ? 189  GLU A OE2   1 
ATOM   1479 N  N     . LYS A 1 190 ? 19.810 22.634  36.117 1.00 14.00 ? 190  LYS A N     1 
ATOM   1480 C  CA    . LYS A 1 190 ? 18.726 22.368  37.043 1.00 10.44 ? 190  LYS A CA    1 
ATOM   1481 C  C     . LYS A 1 190 ? 18.896 23.216  38.314 1.00 13.38 ? 190  LYS A C     1 
ATOM   1482 O  O     . LYS A 1 190 ? 20.001 23.369  38.829 1.00 17.56 ? 190  LYS A O     1 
ATOM   1483 C  CB    . LYS A 1 190 ? 18.764 20.877  37.418 1.00 14.50 ? 190  LYS A CB    1 
ATOM   1484 C  CG    . LYS A 1 190 ? 17.759 20.457  38.422 1.00 20.87 ? 190  LYS A CG    1 
ATOM   1485 C  CD    . LYS A 1 190 ? 17.956 18.978  38.769 1.00 20.84 ? 190  LYS A CD    1 
ATOM   1486 C  CE    . LYS A 1 190 ? 17.150 18.615  40.042 1.00 40.10 ? 190  LYS A CE    1 
ATOM   1487 N  NZ    . LYS A 1 190 ? 17.414 17.213  40.533 1.00 39.14 ? 190  LYS A NZ    1 
ATOM   1488 N  N     . GLY A 1 191 ? 17.830 23.765  38.792 1.00 16.51 ? 191  GLY A N     1 
ATOM   1489 C  CA    . GLY A 1 191 ? 17.966 24.496  40.049 1.00 15.05 ? 191  GLY A CA    1 
ATOM   1490 C  C     . GLY A 1 191 ? 18.098 25.986  39.866 1.00 17.73 ? 191  GLY A C     1 
ATOM   1491 O  O     . GLY A 1 191 ? 17.970 26.732  40.855 1.00 20.21 ? 191  GLY A O     1 
ATOM   1492 N  N     . THR A 1 192 ? 18.341 26.457  38.653 1.00 13.18 ? 192  THR A N     1 
ATOM   1493 C  CA    . THR A 1 192 ? 18.489 27.897  38.467 1.00 15.45 ? 192  THR A CA    1 
ATOM   1494 C  C     . THR A 1 192 ? 17.177 28.604  38.793 1.00 17.45 ? 192  THR A C     1 
ATOM   1495 O  O     . THR A 1 192 ? 16.083 28.103  38.476 1.00 15.20 ? 192  THR A O     1 
ATOM   1496 C  CB    . THR A 1 192 ? 18.955 28.232  37.040 1.00 17.92 ? 192  THR A CB    1 
ATOM   1497 O  OG1   A THR A 1 192 ? 20.061 27.429  36.626 0.31 14.14 ? 192  THR A OG1   1 
ATOM   1498 O  OG1   B THR A 1 192 ? 19.342 29.618  37.023 0.69 19.10 ? 192  THR A OG1   1 
ATOM   1499 C  CG2   A THR A 1 192 ? 19.332 29.692  36.950 0.31 19.16 ? 192  THR A CG2   1 
ATOM   1500 C  CG2   B THR A 1 192 ? 17.913 27.977  36.015 0.69 10.16 ? 192  THR A CG2   1 
ATOM   1501 N  N     . PRO A 1 193 ? 17.211 29.754  39.480 1.00 13.01 ? 193  PRO A N     1 
ATOM   1502 C  CA    . PRO A 1 193 ? 15.958 30.439  39.787 1.00 12.46 ? 193  PRO A CA    1 
ATOM   1503 C  C     . PRO A 1 193 ? 15.159 30.744  38.529 1.00 12.29 ? 193  PRO A C     1 
ATOM   1504 O  O     . PRO A 1 193 ? 15.702 31.270  37.550 1.00 13.64 ? 193  PRO A O     1 
ATOM   1505 C  CB    . PRO A 1 193 ? 16.409 31.753  40.444 1.00 16.17 ? 193  PRO A CB    1 
ATOM   1506 C  CG    . PRO A 1 193 ? 17.692 31.439  40.971 1.00 12.86 ? 193  PRO A CG    1 
ATOM   1507 C  CD    . PRO A 1 193 ? 18.394 30.436  40.063 1.00 14.97 ? 193  PRO A CD    1 
ATOM   1508 N  N     . GLY A 1 194 ? 13.869 30.388  38.582 1.00 12.52 ? 194  GLY A N     1 
ATOM   1509 C  CA    . GLY A 1 194 ? 12.971 30.671  37.463 1.00 14.20 ? 194  GLY A CA    1 
ATOM   1510 C  C     . GLY A 1 194 ? 12.771 29.479  36.551 1.00 16.70 ? 194  GLY A C     1 
ATOM   1511 O  O     . GLY A 1 194 ? 11.929 29.559  35.635 1.00 15.24 ? 194  GLY A O     1 
ATOM   1512 N  N     . LEU A 1 195 ? 13.538 28.402  36.738 1.00 14.98 ? 195  LEU A N     1 
ATOM   1513 C  CA    . LEU A 1 195 ? 13.330 27.176  35.946 1.00 14.14 ? 195  LEU A CA    1 
ATOM   1514 C  C     . LEU A 1 195 ? 12.362 26.260  36.676 1.00 18.21 ? 195  LEU A C     1 
ATOM   1515 O  O     . LEU A 1 195 ? 12.608 25.840  37.826 1.00 17.80 ? 195  LEU A O     1 
ATOM   1516 C  CB    . LEU A 1 195 ? 14.652 26.479  35.700 1.00 14.75 ? 195  LEU A CB    1 
ATOM   1517 C  CG    . LEU A 1 195 ? 14.575 25.120  34.951 1.00 15.98 ? 195  LEU A CG    1 
ATOM   1518 C  CD1   . LEU A 1 195 ? 14.136 25.385  33.510 1.00 14.99 ? 195  LEU A CD1   1 
ATOM   1519 C  CD2   . LEU A 1 195 ? 15.930 24.513  34.927 1.00 15.26 ? 195  LEU A CD2   1 
ATOM   1520 N  N     . ASN A 1 196 ? 11.240 25.959  36.047 1.00 12.13 ? 196  ASN A N     1 
ATOM   1521 C  CA    . ASN A 1 196 ? 10.247 25.088  36.668 1.00 12.86 ? 196  ASN A CA    1 
ATOM   1522 C  C     . ASN A 1 196 ? 10.114 23.861  35.765 1.00 13.48 ? 196  ASN A C     1 
ATOM   1523 O  O     . ASN A 1 196 ? 9.472  23.936  34.716 1.00 14.37 ? 196  ASN A O     1 
ATOM   1524 C  CB    . ASN A 1 196 ? 8.922  25.808  36.822 1.00 14.19 ? 196  ASN A CB    1 
ATOM   1525 C  CG    A ASN A 1 196 ? 9.068  27.089  37.631 0.55 22.16 ? 196  ASN A CG    1 
ATOM   1526 C  CG    B ASN A 1 196 ? 7.896  24.970  37.571 0.45 18.11 ? 196  ASN A CG    1 
ATOM   1527 O  OD1   A ASN A 1 196 ? 9.377  27.027  38.824 0.55 32.59 ? 196  ASN A OD1   1 
ATOM   1528 O  OD1   B ASN A 1 196 ? 8.190  23.857  38.047 0.45 26.89 ? 196  ASN A OD1   1 
ATOM   1529 N  ND2   A ASN A 1 196 ? 8.900  28.256  36.974 0.55 26.79 ? 196  ASN A ND2   1 
ATOM   1530 N  ND2   B ASN A 1 196 ? 6.681  25.506  37.698 0.45 34.78 ? 196  ASN A ND2   1 
ATOM   1531 N  N     . VAL A 1 197 ? 10.679 22.746  36.188 1.00 12.59 ? 197  VAL A N     1 
ATOM   1532 C  CA    . VAL A 1 197 ? 10.579 21.481  35.437 1.00 12.33 ? 197  VAL A CA    1 
ATOM   1533 C  C     . VAL A 1 197 ? 9.341  20.750  35.917 1.00 16.89 ? 197  VAL A C     1 
ATOM   1534 O  O     . VAL A 1 197 ? 9.197  20.489  37.116 1.00 17.95 ? 197  VAL A O     1 
ATOM   1535 C  CB    . VAL A 1 197 ? 11.831 20.623  35.655 1.00 12.77 ? 197  VAL A CB    1 
ATOM   1536 C  CG1   . VAL A 1 197 ? 11.678 19.260  34.924 1.00 14.57 ? 197  VAL A CG1   1 
ATOM   1537 C  CG2   . VAL A 1 197 ? 13.098 21.348  35.180 1.00 16.63 ? 197  VAL A CG2   1 
ATOM   1538 N  N     . GLY A 1 198 ? 8.465  20.369  34.979 1.00 13.29 ? 198  GLY A N     1 
ATOM   1539 C  CA    . GLY A 1 198 ? 7.236  19.680  35.353 1.00 15.46 ? 198  GLY A CA    1 
ATOM   1540 C  C     . GLY A 1 198 ? 7.497  18.240  35.766 1.00 14.85 ? 198  GLY A C     1 
ATOM   1541 O  O     . GLY A 1 198 ? 8.545  17.645  35.506 1.00 17.49 ? 198  GLY A O     1 
ATOM   1542 N  N     . GLU A 1 199 ? 6.518  17.664  36.485 1.00 20.66 ? 199  GLU A N     1 
ATOM   1543 C  CA    . GLU A 1 199 ? 6.575  16.238  36.800 1.00 19.50 ? 199  GLU A CA    1 
ATOM   1544 C  C     . GLU A 1 199 ? 6.427  15.405  35.522 1.00 13.56 ? 199  GLU A C     1 
ATOM   1545 O  O     . GLU A 1 199 ? 5.857  15.871  34.540 1.00 17.92 ? 199  GLU A O     1 
ATOM   1546 C  CB    . GLU A 1 199 ? 5.431  15.808  37.719 1.00 28.66 ? 199  GLU A CB    1 
ATOM   1547 C  CG    . GLU A 1 199 ? 5.214  16.523  39.029 1.00 59.63 ? 199  GLU A CG    1 
ATOM   1548 C  CD    . GLU A 1 199 ? 3.843  16.138  39.594 1.00 74.83 ? 199  GLU A CD    1 
ATOM   1549 O  OE1   . GLU A 1 199 ? 3.465  14.947  39.452 1.00 67.10 ? 199  GLU A OE1   1 
ATOM   1550 O  OE2   . GLU A 1 199 ? 3.128  17.019  40.128 1.00 73.52 ? 199  GLU A OE2   1 
ATOM   1551 N  N     . VAL A 1 200 ? 6.965  14.191  35.567 1.00 18.52 ? 200  VAL A N     1 
ATOM   1552 C  CA    . VAL A 1 200 ? 6.897  13.312  34.408 1.00 16.67 ? 200  VAL A CA    1 
ATOM   1553 C  C     . VAL A 1 200 ? 5.453  13.164  33.973 1.00 18.76 ? 200  VAL A C     1 
ATOM   1554 O  O     . VAL A 1 200 ? 4.534  13.036  34.797 1.00 15.37 ? 200  VAL A O     1 
ATOM   1555 C  CB    . VAL A 1 200 ? 7.530  11.949  34.719 1.00 17.50 ? 200  VAL A CB    1 
ATOM   1556 C  CG1   . VAL A 1 200 ? 6.812  11.267  35.876 1.00 20.32 ? 200  VAL A CG1   1 
ATOM   1557 C  CG2   . VAL A 1 200 ? 7.512  11.069  33.476 1.00 22.79 ? 200  VAL A CG2   1 
ATOM   1558 N  N     . ILE A 1 201 ? 5.235  13.212  32.662 1.00 13.58 ? 201  ILE A N     1 
ATOM   1559 C  CA    . ILE A 1 201 ? 3.915  13.004  32.088 1.00 12.39 ? 201  ILE A CA    1 
ATOM   1560 C  C     . ILE A 1 201 ? 3.919  11.605  31.484 1.00 13.69 ? 201  ILE A C     1 
ATOM   1561 O  O     . ILE A 1 201 ? 4.695  11.357  30.557 1.00 12.72 ? 201  ILE A O     1 
ATOM   1562 C  CB    . ILE A 1 201 ? 3.599  14.066  31.041 1.00 10.52 ? 201  ILE A CB    1 
ATOM   1563 C  CG1   . ILE A 1 201 ? 3.757  15.485  31.669 1.00 13.05 ? 201  ILE A CG1   1 
ATOM   1564 C  CG2   . ILE A 1 201 ? 2.177  13.798  30.437 1.00 12.96 ? 201  ILE A CG2   1 
ATOM   1565 C  CD1   . ILE A 1 201 ? 3.613  16.614  30.665 1.00 15.66 ? 201  ILE A CD1   1 
ATOM   1566 N  N     . PRO A 1 202 ? 3.075  10.689  31.969 1.00 13.21 ? 202  PRO A N     1 
ATOM   1567 C  CA    . PRO A 1 202 ? 3.103  9.295   31.508 1.00 12.11 ? 202  PRO A CA    1 
ATOM   1568 C  C     . PRO A 1 202 ? 2.649  9.134   30.066 1.00 16.70 ? 202  PRO A C     1 
ATOM   1569 O  O     . PRO A 1 202 ? 1.936  9.971   29.487 1.00 14.53 ? 202  PRO A O     1 
ATOM   1570 C  CB    . PRO A 1 202 ? 2.162  8.590   32.478 1.00 12.96 ? 202  PRO A CB    1 
ATOM   1571 C  CG    . PRO A 1 202 ? 1.249  9.656   32.973 1.00 23.96 ? 202  PRO A CG    1 
ATOM   1572 C  CD    . PRO A 1 202 ? 2.070  10.941  33.018 1.00 19.59 ? 202  PRO A CD    1 
ATOM   1573 N  N     . LYS A 1 203 ? 3.178  8.088   29.445 1.00 13.65 ? 203  LYS A N     1 
ATOM   1574 C  CA    . LYS A 1 203 ? 2.776  7.726   28.089 1.00 12.56 ? 203  LYS A CA    1 
ATOM   1575 C  C     . LYS A 1 203 ? 2.853  6.217   27.967 1.00 11.74 ? 203  LYS A C     1 
ATOM   1576 O  O     . LYS A 1 203 ? 3.586  5.559   28.713 1.00 14.56 ? 203  LYS A O     1 
ATOM   1577 C  CB    . LYS A 1 203 ? 3.651  8.380   27.002 1.00 15.45 ? 203  LYS A CB    1 
ATOM   1578 C  CG    . LYS A 1 203 ? 5.113  8.505   27.297 1.00 12.85 ? 203  LYS A CG    1 
ATOM   1579 C  CD    . LYS A 1 203 ? 5.903  9.122   26.117 1.00 15.22 ? 203  LYS A CD    1 
ATOM   1580 C  CE    . LYS A 1 203 ? 7.367  8.892   26.295 1.00 19.31 ? 203  LYS A CE    1 
ATOM   1581 N  NZ    A LYS A 1 203 ? 7.907  9.922   27.185 0.59 16.86 ? 203  LYS A NZ    1 
ATOM   1582 N  NZ    B LYS A 1 203 ? 8.245  9.831   25.516 0.41 14.86 ? 203  LYS A NZ    1 
ATOM   1583 N  N     . ASP A 1 204 ? 2.109  5.679   26.991 1.00 11.42 ? 204  ASP A N     1 
ATOM   1584 C  CA    . ASP A 1 204 ? 2.187  4.238   26.714 1.00 9.24  ? 204  ASP A CA    1 
ATOM   1585 C  C     . ASP A 1 204 ? 3.338  3.891   25.764 1.00 12.39 ? 204  ASP A C     1 
ATOM   1586 O  O     . ASP A 1 204 ? 3.925  2.797   25.875 1.00 15.58 ? 204  ASP A O     1 
ATOM   1587 C  CB    . ASP A 1 204 ? 0.863  3.785   26.074 1.00 14.39 ? 204  ASP A CB    1 
ATOM   1588 C  CG    . ASP A 1 204 ? -0.353 3.955   27.003 1.00 31.50 ? 204  ASP A CG    1 
ATOM   1589 O  OD1   . ASP A 1 204 ? -0.332 3.337   28.090 1.00 33.61 ? 204  ASP A OD1   1 
ATOM   1590 O  OD2   . ASP A 1 204 ? -1.330 4.681   26.635 1.00 36.16 ? 204  ASP A OD2   1 
ATOM   1591 N  N     . CYS A 1 205 ? 3.668  4.754   24.822 1.00 11.71 ? 205  CYS A N     1 
ATOM   1592 C  CA    . CYS A 1 205 ? 4.832  4.513   23.969 1.00 9.32  ? 205  CYS A CA    1 
ATOM   1593 C  C     . CYS A 1 205 ? 6.090  4.939   24.696 1.00 10.83 ? 205  CYS A C     1 
ATOM   1594 O  O     . CYS A 1 205 ? 6.088  5.964   25.360 1.00 13.85 ? 205  CYS A O     1 
ATOM   1595 C  CB    . CYS A 1 205 ? 4.747  5.350   22.700 1.00 9.56  ? 205  CYS A CB    1 
ATOM   1596 S  SG    . CYS A 1 205 ? 3.213  5.041   21.710 1.00 13.01 ? 205  CYS A SG    1 
ATOM   1597 N  N     . LEU A 1 206 ? 7.185  4.174   24.537 1.00 10.50 ? 206  LEU A N     1 
ATOM   1598 C  CA    . LEU A 1 206 ? 8.472  4.501   25.214 1.00 9.62  ? 206  LEU A CA    1 
ATOM   1599 C  C     . LEU A 1 206 ? 8.214  4.831   26.685 1.00 10.66 ? 206  LEU A C     1 
ATOM   1600 O  O     . LEU A 1 206 ? 8.641  5.869   27.181 1.00 11.86 ? 206  LEU A O     1 
ATOM   1601 C  CB    . LEU A 1 206 ? 9.180  5.644   24.516 1.00 10.34 ? 206  LEU A CB    1 
ATOM   1602 C  CG    . LEU A 1 206 ? 9.548  5.393   23.029 1.00 12.02 ? 206  LEU A CG    1 
ATOM   1603 C  CD1   . LEU A 1 206 ? 10.152 6.692   22.384 1.00 14.48 ? 206  LEU A CD1   1 
ATOM   1604 C  CD2   . LEU A 1 206 ? 10.576 4.269   22.943 1.00 10.48 ? 206  LEU A CD2   1 
ATOM   1605 N  N     . SER A 1 207 ? 7.439  3.964   27.370 1.00 8.93  ? 207  SER A N     1 
ATOM   1606 C  CA    . SER A 1 207 ? 6.737  4.407   28.560 1.00 9.18  ? 207  SER A CA    1 
ATOM   1607 C  C     . SER A 1 207 ? 7.676  4.658   29.717 1.00 11.66 ? 207  SER A C     1 
ATOM   1608 O  O     . SER A 1 207 ? 7.287  5.397   30.618 1.00 12.76 ? 207  SER A O     1 
ATOM   1609 C  CB    . SER A 1 207 ? 5.687  3.379   28.989 1.00 14.88 ? 207  SER A CB    1 
ATOM   1610 O  OG    . SER A 1 207 ? 6.300  2.134   29.278 1.00 23.53 ? 207  SER A OG    1 
ATOM   1611 N  N     . ASN A 1 208 ? 8.879  4.043   29.730 1.00 11.27 ? 208  ASN A N     1 
ATOM   1612 C  CA    . ASN A 1 208 ? 9.787  4.351   30.820 1.00 9.64  ? 208  ASN A CA    1 
ATOM   1613 C  C     . ASN A 1 208 ? 10.801 5.422   30.467 1.00 13.87 ? 208  ASN A C     1 
ATOM   1614 O  O     . ASN A 1 208 ? 11.666 5.725   31.300 1.00 17.34 ? 208  ASN A O     1 
ATOM   1615 C  CB    . ASN A 1 208 ? 10.484 3.073   31.290 1.00 8.46  ? 208  ASN A CB    1 
ATOM   1616 C  CG    . ASN A 1 208 ? 11.442 2.511   30.247 1.00 14.09 ? 208  ASN A CG    1 
ATOM   1617 O  OD1   . ASN A 1 208 ? 11.272 2.698   29.039 1.00 16.08 ? 208  ASN A OD1   1 
ATOM   1618 N  ND2   . ASN A 1 208 ? 12.452 1.772   30.694 1.00 12.31 ? 208  ASN A ND2   1 
ATOM   1619 N  N     . CYS A 1 209 ? 10.650 6.108   29.326 1.00 10.60 ? 209  CYS A N     1 
ATOM   1620 C  CA    . CYS A 1 209 ? 11.557 7.195   28.973 1.00 9.61  ? 209  CYS A CA    1 
ATOM   1621 C  C     . CYS A 1 209 ? 10.886 8.479   29.399 1.00 16.33 ? 209  CYS A C     1 
ATOM   1622 O  O     . CYS A 1 209 ? 9.881  8.851   28.796 1.00 12.81 ? 209  CYS A O     1 
ATOM   1623 C  CB    . CYS A 1 209 ? 11.774 7.158   27.474 1.00 11.48 ? 209  CYS A CB    1 
ATOM   1624 S  SG    . CYS A 1 209 ? 12.931 8.464   26.944 1.00 17.55 ? 209  CYS A SG    1 
ATOM   1625 N  N     . PRO A 1 210 ? 11.336 9.158   30.454 1.00 12.17 ? 210  PRO A N     1 
ATOM   1626 C  CA    . PRO A 1 210 ? 10.542 10.243  31.030 1.00 9.99  ? 210  PRO A CA    1 
ATOM   1627 C  C     . PRO A 1 210 ? 10.585 11.494  30.181 1.00 11.07 ? 210  PRO A C     1 
ATOM   1628 O  O     . PRO A 1 210 ? 11.589 11.792  29.556 1.00 13.97 ? 210  PRO A O     1 
ATOM   1629 C  CB    . PRO A 1 210 ? 11.234 10.490  32.390 1.00 13.78 ? 210  PRO A CB    1 
ATOM   1630 C  CG    . PRO A 1 210 ? 12.621 10.146  32.117 1.00 16.44 ? 210  PRO A CG    1 
ATOM   1631 C  CD    . PRO A 1 210 ? 12.597 8.965   31.209 1.00 17.47 ? 210  PRO A CD    1 
ATOM   1632 N  N     . TRP A 1 211 ? 9.452  12.175  30.081 1.00 9.20  ? 211  TRP A N     1 
ATOM   1633 C  CA    . TRP A 1 211 ? 9.461  13.508  29.476 1.00 8.19  ? 211  TRP A CA    1 
ATOM   1634 C  C     . TRP A 1 211 ? 8.513  14.387  30.268 1.00 7.47  ? 211  TRP A C     1 
ATOM   1635 O  O     . TRP A 1 211 ? 7.689  13.901  31.056 1.00 8.80  ? 211  TRP A O     1 
ATOM   1636 C  CB    . TRP A 1 211 ? 9.130  13.487  27.966 1.00 10.50 ? 211  TRP A CB    1 
ATOM   1637 C  CG    . TRP A 1 211 ? 7.684  13.174  27.575 1.00 8.27  ? 211  TRP A CG    1 
ATOM   1638 C  CD1   . TRP A 1 211 ? 6.637  12.794  28.380 1.00 11.60 ? 211  TRP A CD1   1 
ATOM   1639 C  CD2   . TRP A 1 211 ? 7.198  13.184  26.228 1.00 8.40  ? 211  TRP A CD2   1 
ATOM   1640 N  NE1   . TRP A 1 211 ? 5.498  12.536  27.576 1.00 11.42 ? 211  TRP A NE1   1 
ATOM   1641 C  CE2   . TRP A 1 211 ? 5.826  12.812  26.272 1.00 10.60 ? 211  TRP A CE2   1 
ATOM   1642 C  CE3   . TRP A 1 211 ? 7.789  13.492  25.004 1.00 9.85  ? 211  TRP A CE3   1 
ATOM   1643 C  CZ2   . TRP A 1 211 ? 5.051  12.720  25.103 1.00 11.07 ? 211  TRP A CZ2   1 
ATOM   1644 C  CZ3   . TRP A 1 211 ? 7.025  13.393  23.824 1.00 14.04 ? 211  TRP A CZ3   1 
ATOM   1645 C  CH2   . TRP A 1 211 ? 5.664  13.028  23.916 1.00 10.52 ? 211  TRP A CH2   1 
ATOM   1646 N  N     . SER A 1 212 ? 8.684  15.697  30.117 1.00 9.14  ? 212  SER A N     1 
ATOM   1647 C  CA    . SER A 1 212 ? 7.762  16.643  30.742 1.00 8.75  ? 212  SER A CA    1 
ATOM   1648 C  C     . SER A 1 212 ? 7.888  18.001  30.047 1.00 9.29  ? 212  SER A C     1 
ATOM   1649 O  O     . SER A 1 212 ? 8.655  18.171  29.080 1.00 9.81  ? 212  SER A O     1 
ATOM   1650 C  CB    . SER A 1 212 ? 8.009  16.811  32.265 1.00 13.94 ? 212  SER A CB    1 
ATOM   1651 O  OG    . SER A 1 212 ? 9.340  17.325  32.448 1.00 13.62 ? 212  SER A OG    1 
ATOM   1652 N  N     . GLU A 1 213 ? 7.117  18.968  30.571 1.00 11.04 ? 213  GLU A N     1 
ATOM   1653 C  CA    . GLU A 1 213 ? 7.257  20.354  30.137 1.00 8.13  ? 213  GLU A CA    1 
ATOM   1654 C  C     . GLU A 1 213 ? 8.245  21.078  31.025 1.00 11.56 ? 213  GLU A C     1 
ATOM   1655 O  O     . GLU A 1 213 ? 8.482  20.673  32.159 1.00 12.20 ? 213  GLU A O     1 
ATOM   1656 C  CB    . GLU A 1 213 ? 5.905  21.060  30.191 1.00 12.48 ? 213  GLU A CB    1 
ATOM   1657 C  CG    . GLU A 1 213 ? 5.569  21.716  31.512 1.00 23.57 ? 213  GLU A CG    1 
ATOM   1658 C  CD    . GLU A 1 213 ? 5.198  20.740  32.650 1.00 50.69 ? 213  GLU A CD    1 
ATOM   1659 O  OE1   . GLU A 1 213 ? 5.056  19.489  32.431 1.00 26.64 ? 213  GLU A OE1   1 
ATOM   1660 O  OE2   . GLU A 1 213 ? 5.048  21.264  33.793 1.00 61.03 ? 213  GLU A OE2   1 
ATOM   1661 N  N     . ILE A 1 214 ? 8.773  22.170  30.522 1.00 9.79  ? 214  ILE A N     1 
ATOM   1662 C  CA    . ILE A 1 214 ? 9.603  23.034  31.360 1.00 11.77 ? 214  ILE A CA    1 
ATOM   1663 C  C     . ILE A 1 214 ? 9.119  24.477  31.153 1.00 12.56 ? 214  ILE A C     1 
ATOM   1664 O  O     . ILE A 1 214 ? 8.781  24.872  30.036 1.00 11.72 ? 214  ILE A O     1 
ATOM   1665 C  CB    . ILE A 1 214 ? 11.105 22.884  31.059 1.00 12.97 ? 214  ILE A CB    1 
ATOM   1666 C  CG1   A ILE A 1 214 ? 11.613 23.325  29.738 0.60 10.45 ? 214  ILE A CG1   1 
ATOM   1667 C  CG1   B ILE A 1 214 ? 11.632 21.445  31.158 0.40 15.28 ? 214  ILE A CG1   1 
ATOM   1668 C  CG2   A ILE A 1 214 ? 11.623 21.413  31.401 0.60 15.48 ? 214  ILE A CG2   1 
ATOM   1669 C  CG2   B ILE A 1 214 ? 11.870 23.895  31.777 0.40 9.78  ? 214  ILE A CG2   1 
ATOM   1670 C  CD1   A ILE A 1 214 ? 13.165 23.065  29.618 0.60 11.96 ? 214  ILE A CD1   1 
ATOM   1671 C  CD1   B ILE A 1 214 ? 12.722 21.252  30.161 0.40 14.51 ? 214  ILE A CD1   1 
ATOM   1672 N  N     . VAL A 1 215 ? 9.110  25.290  32.223 1.00 11.45 ? 215  VAL A N     1 
ATOM   1673 C  CA    . VAL A 1 215 ? 8.668  26.683  32.104 1.00 9.37  ? 215  VAL A CA    1 
ATOM   1674 C  C     . VAL A 1 215 ? 9.812  27.545  32.615 1.00 14.06 ? 215  VAL A C     1 
ATOM   1675 O  O     . VAL A 1 215 ? 10.402 27.212  33.646 1.00 14.18 ? 215  VAL A O     1 
ATOM   1676 C  CB    . VAL A 1 215 ? 7.392  26.918  32.933 1.00 11.35 ? 215  VAL A CB    1 
ATOM   1677 C  CG1   . VAL A 1 215 ? 6.964  28.382  32.877 1.00 17.40 ? 215  VAL A CG1   1 
ATOM   1678 C  CG2   . VAL A 1 215 ? 6.229  26.118  32.327 1.00 19.00 ? 215  VAL A CG2   1 
ATOM   1679 N  N     . PHE A 1 216 ? 10.142 28.587  31.863 1.00 11.63 ? 216  PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 216 ? 11.135 29.612  32.208 1.00 9.78  ? 216  PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 216 ? 10.393 30.858  32.674 1.00 15.89 ? 216  PHE A C     1 
ATOM   1682 O  O     . PHE A 1 216 ? 9.628  31.455  31.906 1.00 15.07 ? 216  PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 216 ? 11.995 29.988  30.999 1.00 11.08 ? 216  PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 216 ? 12.423 28.819  30.131 1.00 12.67 ? 216  PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 216 ? 12.314 28.917  28.752 1.00 16.91 ? 216  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 216 ? 12.961 27.689  30.696 1.00 12.38 ? 216  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 216 ? 12.822 27.884  27.912 1.00 12.01 ? 216  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 216 ? 13.427 26.585  29.861 1.00 10.83 ? 216  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 216 ? 13.331 26.723  28.490 1.00 13.77 ? 216  PHE A CZ    1 
ATOM   1690 N  N     . ASN A 1 217 ? 10.643 31.286  33.926 1.00 13.81 ? 217  ASN A N     1 
ATOM   1691 C  CA    . ASN A 1 217 ? 10.086 32.558  34.407 1.00 14.66 ? 217  ASN A CA    1 
ATOM   1692 C  C     . ASN A 1 217 ? 11.222 33.504  34.790 1.00 13.85 ? 217  ASN A C     1 
ATOM   1693 O  O     . ASN A 1 217 ? 11.823 33.363  35.880 1.00 18.29 ? 217  ASN A O     1 
ATOM   1694 C  CB    . ASN A 1 217 ? 9.198  32.313  35.594 1.00 18.74 ? 217  ASN A CB    1 
ATOM   1695 C  CG    A ASN A 1 217 ? 8.367  33.531  35.981 0.61 22.43 ? 217  ASN A CG    1 
ATOM   1696 C  CG    B ASN A 1 217 ? 7.980  31.519  35.267 0.39 15.26 ? 217  ASN A CG    1 
ATOM   1697 O  OD1   A ASN A 1 217 ? 8.109  34.440  35.172 0.61 24.90 ? 217  ASN A OD1   1 
ATOM   1698 O  OD1   B ASN A 1 217 ? 7.228  31.848  34.360 0.39 22.95 ? 217  ASN A OD1   1 
ATOM   1699 N  ND2   A ASN A 1 217 ? 7.905  33.523  37.227 0.61 22.15 ? 217  ASN A ND2   1 
ATOM   1700 N  ND2   B ASN A 1 217 ? 7.781  30.445  36.005 0.39 20.80 ? 217  ASN A ND2   1 
ATOM   1701 N  N     . ASP A 1 218 ? 11.537 34.430  33.879 1.00 14.03 ? 218  ASP A N     1 
ATOM   1702 C  CA    . ASP A 1 218 ? 12.598 35.431  34.108 1.00 20.31 ? 218  ASP A CA    1 
ATOM   1703 C  C     . ASP A 1 218 ? 13.897 34.802  34.598 1.00 19.88 ? 218  ASP A C     1 
ATOM   1704 O  O     . ASP A 1 218 ? 14.490 35.229  35.596 1.00 17.47 ? 218  ASP A O     1 
ATOM   1705 C  CB    . ASP A 1 218 ? 12.090 36.488  35.098 1.00 21.69 ? 218  ASP A CB    1 
ATOM   1706 C  CG    . ASP A 1 218 ? 10.972 37.350  34.500 1.00 20.54 ? 218  ASP A CG    1 
ATOM   1707 O  OD1   . ASP A 1 218 ? 11.136 37.766  33.336 1.00 20.53 ? 218  ASP A OD1   1 
ATOM   1708 O  OD2   . ASP A 1 218 ? 9.971  37.648  35.209 1.00 29.43 ? 218  ASP A OD2   1 
ATOM   1709 N  N     . ILE A 1 219 ? 14.328 33.738  33.928 1.00 14.07 ? 219  ILE A N     1 
ATOM   1710 C  CA    . ILE A 1 219 ? 15.631 33.150  34.209 1.00 13.83 ? 219  ILE A CA    1 
ATOM   1711 C  C     . ILE A 1 219 ? 16.731 34.075  33.723 1.00 14.57 ? 219  ILE A C     1 
ATOM   1712 O  O     . ILE A 1 219 ? 16.722 34.573  32.583 1.00 15.79 ? 219  ILE A O     1 
ATOM   1713 C  CB    . ILE A 1 219 ? 15.757 31.770  33.539 1.00 12.28 ? 219  ILE A CB    1 
ATOM   1714 C  CG1   . ILE A 1 219 ? 14.744 30.859  34.177 1.00 11.23 ? 219  ILE A CG1   1 
ATOM   1715 C  CG2   . ILE A 1 219 ? 17.216 31.281  33.565 1.00 14.95 ? 219  ILE A CG2   1 
ATOM   1716 C  CD1   . ILE A 1 219 ? 14.741 29.405  33.454 1.00 14.69 ? 219  ILE A CD1   1 
ATOM   1717 N  N     . PHE A 1 220 ? 17.743 34.295  34.576 1.00 16.26 ? 220  PHE A N     1 
ATOM   1718 C  CA    . PHE A 1 220 ? 18.931 34.967  34.089 1.00 12.99 ? 220  PHE A CA    1 
ATOM   1719 C  C     . PHE A 1 220 ? 19.946 33.959  33.573 1.00 13.91 ? 220  PHE A C     1 
ATOM   1720 O  O     . PHE A 1 220 ? 20.370 33.051  34.301 1.00 16.44 ? 220  PHE A O     1 
ATOM   1721 C  CB    . PHE A 1 220 ? 19.576 35.839  35.189 1.00 15.72 ? 220  PHE A CB    1 
ATOM   1722 C  CG    . PHE A 1 220 ? 20.831 36.458  34.735 1.00 12.39 ? 220  PHE A CG    1 
ATOM   1723 C  CD1   . PHE A 1 220 ? 20.797 37.555  33.893 1.00 14.27 ? 220  PHE A CD1   1 
ATOM   1724 C  CD2   . PHE A 1 220 ? 22.062 35.946  35.091 1.00 21.77 ? 220  PHE A CD2   1 
ATOM   1725 C  CE1   . PHE A 1 220 ? 21.953 38.155  33.436 1.00 20.98 ? 220  PHE A CE1   1 
ATOM   1726 C  CE2   . PHE A 1 220 ? 23.222 36.525  34.621 1.00 20.16 ? 220  PHE A CE2   1 
ATOM   1727 C  CZ    . PHE A 1 220 ? 23.174 37.615  33.790 1.00 18.52 ? 220  PHE A CZ    1 
ATOM   1728 N  N     . ILE A 1 221 ? 20.279 34.069  32.292 1.00 11.73 ? 221  ILE A N     1 
ATOM   1729 C  CA    . ILE A 1 221 ? 21.308 33.248  31.667 1.00 11.46 ? 221  ILE A CA    1 
ATOM   1730 C  C     . ILE A 1 221 ? 22.572 34.081  31.576 1.00 13.81 ? 221  ILE A C     1 
ATOM   1731 O  O     . ILE A 1 221 ? 22.607 35.059  30.798 1.00 13.44 ? 221  ILE A O     1 
ATOM   1732 C  CB    . ILE A 1 221 ? 20.913 32.804  30.242 1.00 13.00 ? 221  ILE A CB    1 
ATOM   1733 C  CG1   . ILE A 1 221 ? 19.504 32.222  30.224 1.00 16.67 ? 221  ILE A CG1   1 
ATOM   1734 C  CG2   . ILE A 1 221 ? 21.969 31.823  29.737 1.00 13.04 ? 221  ILE A CG2   1 
ATOM   1735 C  CD1   . ILE A 1 221 ? 19.077 31.725  28.763 1.00 18.40 ? 221  ILE A CD1   1 
ATOM   1736 N  N     . PRO A 1 222 ? 23.647 33.677  32.227 1.00 11.56 ? 222  PRO A N     1 
ATOM   1737 C  CA    . PRO A 1 222 ? 24.906 34.385  32.036 1.00 15.74 ? 222  PRO A CA    1 
ATOM   1738 C  C     . PRO A 1 222 ? 25.415 34.220  30.616 1.00 16.66 ? 222  PRO A C     1 
ATOM   1739 O  O     . PRO A 1 222 ? 25.276 33.159  29.993 1.00 16.44 ? 222  PRO A O     1 
ATOM   1740 C  CB    . PRO A 1 222 ? 25.843 33.695  33.033 1.00 16.96 ? 222  PRO A CB    1 
ATOM   1741 C  CG    . PRO A 1 222 ? 24.934 33.089  34.070 1.00 19.05 ? 222  PRO A CG    1 
ATOM   1742 C  CD    . PRO A 1 222 ? 23.713 32.640  33.273 1.00 14.53 ? 222  PRO A CD    1 
ATOM   1743 N  N     . GLN A 1 223 ? 26.052 35.269  30.112 1.00 16.52 ? 223  GLN A N     1 
ATOM   1744 C  CA    . GLN A 1 223 ? 26.596 35.270  28.746 1.00 17.92 ? 223  GLN A CA    1 
ATOM   1745 C  C     . GLN A 1 223 ? 27.409 34.044  28.402 1.00 17.23 ? 223  GLN A C     1 
ATOM   1746 O  O     . GLN A 1 223 ? 27.413 33.568  27.242 1.00 17.72 ? 223  GLN A O     1 
ATOM   1747 C  CB    . GLN A 1 223 ? 27.505 36.501  28.566 1.00 23.37 ? 223  GLN A CB    1 
ATOM   1748 C  CG    . GLN A 1 223 ? 27.982 36.678  27.146 1.00 25.72 ? 223  GLN A CG    1 
ATOM   1749 C  CD    . GLN A 1 223 ? 26.857 37.140  26.253 1.00 25.71 ? 223  GLN A CD    1 
ATOM   1750 O  OE1   . GLN A 1 223 ? 26.072 38.042  26.607 1.00 28.64 ? 223  GLN A OE1   1 
ATOM   1751 N  NE2   . GLN A 1 223 ? 26.709 36.470  25.122 1.00 28.06 ? 223  GLN A NE2   1 
ATOM   1752 N  N     . SER A 1 224 ? 28.172 33.542  29.363 1.00 16.31 ? 224  SER A N     1 
ATOM   1753 C  CA    . SER A 1 224 ? 29.064 32.449  29.069 1.00 11.71 ? 224  SER A CA    1 
ATOM   1754 C  C     . SER A 1 224 ? 28.326 31.136  28.806 1.00 17.04 ? 224  SER A C     1 
ATOM   1755 O  O     . SER A 1 224 ? 28.968 30.176  28.364 1.00 17.70 ? 224  SER A O     1 
ATOM   1756 C  CB    . SER A 1 224 ? 30.050 32.230  30.221 1.00 24.15 ? 224  SER A CB    1 
ATOM   1757 O  OG    . SER A 1 224 ? 29.369 31.836  31.393 1.00 23.53 ? 224  SER A OG    1 
ATOM   1758 N  N     . GLN A 1 225 ? 27.028 31.109  29.033 1.00 13.64 ? 225  GLN A N     1 
ATOM   1759 C  CA    . GLN A 1 225 ? 26.283 29.856  28.856 1.00 12.44 ? 225  GLN A CA    1 
ATOM   1760 C  C     . GLN A 1 225 ? 25.572 29.807  27.515 1.00 16.10 ? 225  GLN A C     1 
ATOM   1761 O  O     . GLN A 1 225 ? 24.894 28.814  27.234 1.00 17.29 ? 225  GLN A O     1 
ATOM   1762 C  CB    . GLN A 1 225 ? 25.306 29.670  29.988 1.00 18.05 ? 225  GLN A CB    1 
ATOM   1763 C  CG    . GLN A 1 225 ? 26.081 29.261  31.314 1.00 19.59 ? 225  GLN A CG    1 
ATOM   1764 C  CD    . GLN A 1 225 ? 25.200 29.156  32.525 1.00 28.64 ? 225  GLN A CD    1 
ATOM   1765 O  OE1   . GLN A 1 225 ? 24.028 28.735  32.458 1.00 25.63 ? 225  GLN A OE1   1 
ATOM   1766 N  NE2   . GLN A 1 225 ? 25.749 29.547  33.673 1.00 19.84 ? 225  GLN A NE2   1 
ATOM   1767 N  N     . ARG A 1 226 ? 25.720 30.831  26.677 1.00 12.58 ? 226  ARG A N     1 
ATOM   1768 C  CA    . ARG A 1 226 ? 25.277 30.716  25.290 1.00 12.62 ? 226  ARG A CA    1 
ATOM   1769 C  C     . ARG A 1 226 ? 26.157 29.731  24.531 1.00 15.66 ? 226  ARG A C     1 
ATOM   1770 O  O     . ARG A 1 226 ? 27.379 29.718  24.655 1.00 15.22 ? 226  ARG A O     1 
ATOM   1771 C  CB    . ARG A 1 226 ? 25.302 32.105  24.616 1.00 11.52 ? 226  ARG A CB    1 
ATOM   1772 C  CG    . ARG A 1 226 ? 24.617 32.098  23.232 1.00 16.21 ? 226  ARG A CG    1 
ATOM   1773 C  CD    . ARG A 1 226 ? 24.832 33.420  22.396 1.00 14.19 ? 226  ARG A CD    1 
ATOM   1774 N  NE    . ARG A 1 226 ? 26.216 33.501  22.020 1.00 20.50 ? 226  ARG A NE    1 
ATOM   1775 C  CZ    . ARG A 1 226 ? 26.917 34.624  22.035 1.00 34.76 ? 226  ARG A CZ    1 
ATOM   1776 N  NH1   . ARG A 1 226 ? 26.341 35.771  22.361 1.00 32.72 ? 226  ARG A NH1   1 
ATOM   1777 N  NH2   . ARG A 1 226 ? 28.184 34.593  21.684 1.00 25.77 ? 226  ARG A NH2   1 
ATOM   1778 N  N     . ILE A 1 227 ? 25.537 28.836  23.746 1.00 13.44 ? 227  ILE A N     1 
ATOM   1779 C  CA    . ILE A 1 227 ? 26.250 27.846  22.971 1.00 9.65  ? 227  ILE A CA    1 
ATOM   1780 C  C     . ILE A 1 227 ? 26.360 28.385  21.541 1.00 12.49 ? 227  ILE A C     1 
ATOM   1781 O  O     . ILE A 1 227 ? 25.331 28.711  20.927 1.00 16.18 ? 227  ILE A O     1 
ATOM   1782 C  CB    . ILE A 1 227 ? 25.498 26.497  22.965 1.00 12.60 ? 227  ILE A CB    1 
ATOM   1783 C  CG1   . ILE A 1 227 ? 25.401 25.925  24.364 1.00 16.51 ? 227  ILE A CG1   1 
ATOM   1784 C  CG2   . ILE A 1 227 ? 26.246 25.521  22.034 1.00 14.32 ? 227  ILE A CG2   1 
ATOM   1785 C  CD1   . ILE A 1 227 ? 24.393 24.729  24.460 1.00 16.91 ? 227  ILE A CD1   1 
ATOM   1786 N  N     . GLY A 1 228 ? 27.595 28.553  21.061 1.00 17.70 ? 228  GLY A N     1 
ATOM   1787 C  CA    . GLY A 1 228 ? 27.839 29.108  19.722 1.00 15.76 ? 228  GLY A CA    1 
ATOM   1788 C  C     . GLY A 1 228 ? 27.527 30.606  19.718 1.00 20.26 ? 228  GLY A C     1 
ATOM   1789 O  O     . GLY A 1 228 ? 27.372 31.252  20.754 1.00 20.80 ? 228  GLY A O     1 
ATOM   1790 N  N     . MET A 1 229 ? 27.416 31.145  18.507 1.00 19.46 ? 229  MET A N     1 
ATOM   1791 C  CA    . MET A 1 229 ? 27.222 32.570  18.328 1.00 20.80 ? 229  MET A CA    1 
ATOM   1792 C  C     . MET A 1 229 ? 25.770 32.990  18.493 1.00 22.60 ? 229  MET A C     1 
ATOM   1793 O  O     . MET A 1 229 ? 24.827 32.199  18.397 1.00 17.81 ? 229  MET A O     1 
ATOM   1794 C  CB    . MET A 1 229 ? 27.715 32.977  16.937 1.00 23.63 ? 229  MET A CB    1 
ATOM   1795 C  CG    . MET A 1 229 ? 29.206 32.841  16.779 1.00 38.05 ? 229  MET A CG    1 
ATOM   1796 S  SD    . MET A 1 229 ? 29.730 33.486  15.168 1.00 76.49 ? 229  MET A SD    1 
ATOM   1797 C  CE    . MET A 1 229 ? 28.699 32.521  14.047 1.00 52.66 ? 229  MET A CE    1 
ATOM   1798 N  N     . GLU A 1 230 ? 25.582 34.285  18.689 1.00 17.22 ? 230  GLU A N     1 
ATOM   1799 C  CA    . GLU A 1 230 ? 24.243 34.833  18.748 1.00 15.69 ? 230  GLU A CA    1 
ATOM   1800 C  C     . GLU A 1 230 ? 23.539 34.644  17.420 1.00 19.38 ? 230  GLU A C     1 
ATOM   1801 O  O     . GLU A 1 230 ? 24.100 34.970  16.371 1.00 22.02 ? 230  GLU A O     1 
ATOM   1802 C  CB    . GLU A 1 230 ? 24.335 36.326  19.038 1.00 25.95 ? 230  GLU A CB    1 
ATOM   1803 C  CG    . GLU A 1 230 ? 23.018 36.956  19.295 1.00 23.94 ? 230  GLU A CG    1 
ATOM   1804 C  CD    . GLU A 1 230 ? 22.866 37.164  20.769 1.00 34.30 ? 230  GLU A CD    1 
ATOM   1805 O  OE1   . GLU A 1 230 ? 22.100 38.054  21.193 1.00 32.45 ? 230  GLU A OE1   1 
ATOM   1806 O  OE2   . GLU A 1 230 ? 23.557 36.412  21.493 1.00 36.46 ? 230  GLU A OE2   1 
ATOM   1807 N  N     . GLY A 1 231 ? 22.304 34.131  17.462 1.00 17.17 ? 231  GLY A N     1 
ATOM   1808 C  CA    . GLY A 1 231 ? 21.518 33.934  16.263 1.00 19.94 ? 231  GLY A CA    1 
ATOM   1809 C  C     . GLY A 1 231 ? 21.851 32.672  15.493 1.00 19.62 ? 231  GLY A C     1 
ATOM   1810 O  O     . GLY A 1 231 ? 21.263 32.435  14.412 1.00 22.31 ? 231  GLY A O     1 
ATOM   1811 N  N     . ALA A 1 232 ? 22.772 31.862  16.000 1.00 18.18 ? 232  ALA A N     1 
ATOM   1812 C  CA    . ALA A 1 232 ? 23.195 30.625  15.363 1.00 17.65 ? 232  ALA A CA    1 
ATOM   1813 C  C     . ALA A 1 232 ? 22.437 29.418  15.877 1.00 17.71 ? 232  ALA A C     1 
ATOM   1814 O  O     . ALA A 1 232 ? 22.781 28.301  15.470 1.00 17.30 ? 232  ALA A O     1 
ATOM   1815 C  CB    . ALA A 1 232 ? 24.686 30.390  15.555 1.00 22.24 ? 232  ALA A CB    1 
ATOM   1816 N  N     . GLY A 1 233 ? 21.427 29.643  16.723 1.00 16.89 ? 233  GLY A N     1 
ATOM   1817 C  CA    . GLY A 1 233 ? 20.694 28.539  17.345 1.00 13.78 ? 233  GLY A CA    1 
ATOM   1818 C  C     . GLY A 1 233 ? 19.974 27.682  16.326 1.00 17.32 ? 233  GLY A C     1 
ATOM   1819 O  O     . GLY A 1 233 ? 19.937 26.453  16.456 1.00 18.63 ? 233  GLY A O     1 
ATOM   1820 N  N     . GLY A 1 234 ? 19.377 28.316  15.318 1.00 16.65 ? 234  GLY A N     1 
ATOM   1821 C  CA    . GLY A 1 234 ? 18.743 27.554  14.240 1.00 18.27 ? 234  GLY A CA    1 
ATOM   1822 C  C     . GLY A 1 234 ? 19.698 26.598  13.567 1.00 22.07 ? 234  GLY A C     1 
ATOM   1823 O  O     . GLY A 1 234 ? 19.368 25.419  13.357 1.00 23.84 ? 234  GLY A O     1 
ATOM   1824 N  N     . ALA A 1 235 ? 20.909 27.052  13.270 1.00 20.42 ? 235  ALA A N     1 
ATOM   1825 C  CA    . ALA A 1 235 ? 21.877 26.164  12.641 1.00 21.04 ? 235  ALA A CA    1 
ATOM   1826 C  C     . ALA A 1 235 ? 22.312 25.050  13.586 1.00 19.53 ? 235  ALA A C     1 
ATOM   1827 O  O     . ALA A 1 235 ? 22.590 23.919  13.162 1.00 22.33 ? 235  ALA A O     1 
ATOM   1828 C  CB    . ALA A 1 235 ? 23.100 26.927  12.186 1.00 22.70 ? 235  ALA A CB    1 
ATOM   1829 N  N     . ILE A 1 236 ? 22.455 25.373  14.864 1.00 14.32 ? 236  ILE A N     1 
ATOM   1830 C  CA    . ILE A 1 236 ? 22.819 24.349  15.832 1.00 13.40 ? 236  ILE A CA    1 
ATOM   1831 C  C     . ILE A 1 236 ? 21.697 23.319  15.956 1.00 13.99 ? 236  ILE A C     1 
ATOM   1832 O  O     . ILE A 1 236 ? 21.953 22.119  16.064 1.00 17.17 ? 236  ILE A O     1 
ATOM   1833 C  CB    . ILE A 1 236 ? 23.116 25.043  17.180 1.00 17.11 ? 236  ILE A CB    1 
ATOM   1834 C  CG1   . ILE A 1 236 ? 24.374 25.878  17.011 1.00 14.50 ? 236  ILE A CG1   1 
ATOM   1835 C  CG2   . ILE A 1 236 ? 23.341 24.001  18.320 1.00 16.48 ? 236  ILE A CG2   1 
ATOM   1836 C  CD1   . ILE A 1 236 ? 24.581 26.867  18.190 1.00 17.85 ? 236  ILE A CD1   1 
ATOM   1837 N  N     . PHE A 1 237 ? 20.471 23.783  16.097 1.00 14.40 ? 237  PHE A N     1 
ATOM   1838 C  CA    . PHE A 1 237 ? 19.359 22.829  16.236 1.00 16.07 ? 237  PHE A CA    1 
ATOM   1839 C  C     . PHE A 1 237 ? 19.301 21.935  15.012 1.00 17.67 ? 237  PHE A C     1 
ATOM   1840 O  O     . PHE A 1 237 ? 19.111 20.704  15.111 1.00 17.72 ? 237  PHE A O     1 
ATOM   1841 C  CB    . PHE A 1 237 ? 18.039 23.572  16.407 1.00 18.52 ? 237  PHE A CB    1 
ATOM   1842 C  CG    . PHE A 1 237 ? 16.841 22.646  16.547 1.00 21.17 ? 237  PHE A CG    1 
ATOM   1843 C  CD1   . PHE A 1 237 ? 16.654 21.946  17.741 1.00 20.02 ? 237  PHE A CD1   1 
ATOM   1844 C  CD2   . PHE A 1 237 ? 15.957 22.449  15.499 1.00 27.39 ? 237  PHE A CD2   1 
ATOM   1845 C  CE1   . PHE A 1 237 ? 15.578 21.055  17.885 1.00 27.57 ? 237  PHE A CE1   1 
ATOM   1846 C  CE2   . PHE A 1 237 ? 14.868 21.560  15.650 1.00 22.76 ? 237  PHE A CE2   1 
ATOM   1847 C  CZ    . PHE A 1 237 ? 14.691 20.899  16.847 1.00 21.86 ? 237  PHE A CZ    1 
ATOM   1848 N  N     . HIS A 1 238 ? 19.410 22.558  13.849 1.00 15.76 ? 238  HIS A N     1 
ATOM   1849 C  CA    . HIS A 1 238 ? 19.400 21.829  12.591 1.00 18.34 ? 238  HIS A CA    1 
ATOM   1850 C  C     . HIS A 1 238 ? 20.446 20.738  12.578 1.00 19.42 ? 238  HIS A C     1 
ATOM   1851 O  O     . HIS A 1 238 ? 20.148 19.583  12.235 1.00 21.54 ? 238  HIS A O     1 
ATOM   1852 C  CB    . HIS A 1 238 ? 19.636 22.801  11.445 1.00 27.78 ? 238  HIS A CB    1 
ATOM   1853 C  CG    . HIS A 1 238 ? 19.564 22.140  10.124 1.00 38.66 ? 238  HIS A CG    1 
ATOM   1854 N  ND1   . HIS A 1 238 ? 18.366 21.728  9.586  1.00 36.51 ? 238  HIS A ND1   1 
ATOM   1855 C  CD2   . HIS A 1 238 ? 20.533 21.729  9.277  1.00 39.26 ? 238  HIS A CD2   1 
ATOM   1856 C  CE1   . HIS A 1 238 ? 18.598 21.133  8.433  1.00 39.06 ? 238  HIS A CE1   1 
ATOM   1857 N  NE2   . HIS A 1 238 ? 19.903 21.117  8.223  1.00 37.18 ? 238  HIS A NE2   1 
ATOM   1858 N  N     . ASP A 1 239 ? 21.686 21.084  12.932 1.00 20.96 ? 239  ASP A N     1 
ATOM   1859 C  CA    . ASP A 1 239 ? 22.779 20.121  12.945 1.00 22.15 ? 239  ASP A CA    1 
ATOM   1860 C  C     . ASP A 1 239 ? 22.545 19.008  13.975 1.00 19.73 ? 239  ASP A C     1 
ATOM   1861 O  O     . ASP A 1 239 ? 22.846 17.830  13.730 1.00 23.04 ? 239  ASP A O     1 
ATOM   1862 C  CB    . ASP A 1 239 ? 24.061 20.883  13.218 1.00 24.69 ? 239  ASP A CB    1 
ATOM   1863 C  CG    . ASP A 1 239 ? 25.270 19.997  13.231 1.00 40.16 ? 239  ASP A CG    1 
ATOM   1864 O  OD1   . ASP A 1 239 ? 25.857 19.797  12.155 1.00 38.61 ? 239  ASP A OD1   1 
ATOM   1865 O  OD2   . ASP A 1 239 ? 25.660 19.522  14.321 1.00 29.64 ? 239  ASP A OD2   1 
ATOM   1866 N  N     . SER A 1 240 ? 21.951 19.334  15.107 1.00 15.72 ? 240  SER A N     1 
ATOM   1867 C  CA    . SER A 1 240 ? 21.716 18.272  16.055 1.00 10.64 ? 240  SER A CA    1 
ATOM   1868 C  C     . SER A 1 240 ? 20.611 17.337  15.550 1.00 15.66 ? 240  SER A C     1 
ATOM   1869 O  O     . SER A 1 240 ? 20.649 16.131  15.851 1.00 16.51 ? 240  SER A O     1 
ATOM   1870 C  CB    . SER A 1 240 ? 21.371 18.843  17.442 1.00 19.93 ? 240  SER A CB    1 
ATOM   1871 O  OG    A SER A 1 240 ? 20.048 19.261  17.546 0.66 19.82 ? 240  SER A OG    1 
ATOM   1872 O  OG    B SER A 1 240 ? 22.149 19.991  17.743 0.34 18.62 ? 240  SER A OG    1 
ATOM   1873 N  N     . MET A 1 241 ? 19.642 17.858  14.793 1.00 16.39 ? 241  MET A N     1 
ATOM   1874 C  CA    . MET A 1 241 ? 18.593 16.944  14.303 1.00 15.18 ? 241  MET A CA    1 
ATOM   1875 C  C     . MET A 1 241 ? 19.115 16.031  13.222 1.00 17.69 ? 241  MET A C     1 
ATOM   1876 O  O     . MET A 1 241 ? 18.567 14.919  13.064 1.00 20.54 ? 241  MET A O     1 
ATOM   1877 C  CB    . MET A 1 241 ? 17.336 17.699  13.788 1.00 17.66 ? 241  MET A CB    1 
ATOM   1878 C  CG    . MET A 1 241 ? 16.519 18.350  14.928 1.00 22.77 ? 241  MET A CG    1 
ATOM   1879 S  SD    . MET A 1 241 ? 15.981 17.220  16.296 1.00 26.48 ? 241  MET A SD    1 
ATOM   1880 C  CE    . MET A 1 241 ? 17.119 17.568  17.686 1.00 27.04 ? 241  MET A CE    1 
ATOM   1881 N  N     . ILE A 1 242 ? 20.192 16.422  12.533 1.00 15.69 ? 242  ILE A N     1 
ATOM   1882 C  CA    . ILE A 1 242 ? 20.839 15.516  11.582 1.00 19.47 ? 242  ILE A CA    1 
ATOM   1883 C  C     . ILE A 1 242 ? 21.394 14.291  12.300 1.00 20.82 ? 242  ILE A C     1 
ATOM   1884 O  O     . ILE A 1 242 ? 21.144 13.147  11.891 1.00 16.54 ? 242  ILE A O     1 
ATOM   1885 C  CB    . ILE A 1 242 ? 21.921 16.244  10.774 1.00 32.37 ? 242  ILE A CB    1 
ATOM   1886 C  CG1   . ILE A 1 242 ? 21.261 17.217  9.800  1.00 29.71 ? 242  ILE A CG1   1 
ATOM   1887 C  CG2   . ILE A 1 242 ? 22.726 15.235  10.009 1.00 37.85 ? 242  ILE A CG2   1 
ATOM   1888 C  CD1   . ILE A 1 242 ? 20.160 16.544  9.005  1.00 33.22 ? 242  ILE A CD1   1 
ATOM   1889 N  N     . TRP A 1 243 ? 22.101 14.498  13.431 1.00 18.11 ? 243  TRP A N     1 
ATOM   1890 C  CA    . TRP A 1 243 ? 22.616 13.371  14.213 1.00 15.94 ? 243  TRP A CA    1 
ATOM   1891 C  C     . TRP A 1 243 ? 21.479 12.558  14.834 1.00 12.75 ? 243  TRP A C     1 
ATOM   1892 O  O     . TRP A 1 243 ? 21.543 11.320  14.916 1.00 13.70 ? 243  TRP A O     1 
ATOM   1893 C  CB    . TRP A 1 243 ? 23.542 13.897  15.339 1.00 18.27 ? 243  TRP A CB    1 
ATOM   1894 C  CG    . TRP A 1 243 ? 24.912 14.260  14.811 1.00 19.49 ? 243  TRP A CG    1 
ATOM   1895 C  CD1   . TRP A 1 243 ? 25.286 15.455  14.312 1.00 18.55 ? 243  TRP A CD1   1 
ATOM   1896 C  CD2   . TRP A 1 243 ? 26.054 13.380  14.682 1.00 23.55 ? 243  TRP A CD2   1 
ATOM   1897 N  NE1   . TRP A 1 243 ? 26.613 15.395  13.896 1.00 24.86 ? 243  TRP A NE1   1 
ATOM   1898 C  CE2   . TRP A 1 243 ? 27.097 14.134  14.114 1.00 19.35 ? 243  TRP A CE2   1 
ATOM   1899 C  CE3   . TRP A 1 243 ? 26.294 12.047  15.034 1.00 19.49 ? 243  TRP A CE3   1 
ATOM   1900 C  CZ2   . TRP A 1 243 ? 28.378 13.582  13.858 1.00 20.27 ? 243  TRP A CZ2   1 
ATOM   1901 C  CZ3   . TRP A 1 243 ? 27.556 11.480  14.773 1.00 26.09 ? 243  TRP A CZ3   1 
ATOM   1902 C  CH2   . TRP A 1 243 ? 28.588 12.265  14.210 1.00 22.71 ? 243  TRP A CH2   1 
ATOM   1903 N  N     . ALA A 1 244 ? 20.471 13.242  15.342 1.00 9.19  ? 244  ALA A N     1 
ATOM   1904 C  CA    . ALA A 1 244 ? 19.307 12.540  15.883 1.00 11.39 ? 244  ALA A CA    1 
ATOM   1905 C  C     . ALA A 1 244 ? 18.610 11.701  14.817 1.00 18.33 ? 244  ALA A C     1 
ATOM   1906 O  O     . ALA A 1 244 ? 18.267 10.519  15.066 1.00 18.23 ? 244  ALA A O     1 
ATOM   1907 C  CB    . ALA A 1 244 ? 18.357 13.541  16.527 1.00 13.67 ? 244  ALA A CB    1 
ATOM   1908 N  N     . LYS A 1 245 ? 18.423 12.248  13.605 1.00 13.05 ? 245  LYS A N     1 
ATOM   1909 C  CA    . LYS A 1 245 ? 17.767 11.436  12.591 1.00 14.79 ? 245  LYS A CA    1 
ATOM   1910 C  C     A LYS A 1 245 ? 18.688 10.394  11.960 0.48 15.00 ? 245  LYS A C     1 
ATOM   1911 C  C     B LYS A 1 245 ? 18.552 10.158  12.352 0.52 15.56 ? 245  LYS A C     1 
ATOM   1912 O  O     A LYS A 1 245 ? 18.216 9.379   11.420 0.48 13.72 ? 245  LYS A O     1 
ATOM   1913 O  O     B LYS A 1 245 ? 18.017 9.060   12.583 0.52 13.99 ? 245  LYS A O     1 
ATOM   1914 C  CB    . LYS A 1 245 ? 17.373 12.295  11.385 1.00 13.52 ? 245  LYS A CB    1 
ATOM   1915 C  CG    . LYS A 1 245 ? 16.216 13.100  11.848 1.00 13.44 ? 245  LYS A CG    1 
ATOM   1916 C  CD    . LYS A 1 245 ? 15.565 13.908  10.716 1.00 13.97 ? 245  LYS A CD    1 
ATOM   1917 C  CE    . LYS A 1 245 ? 16.557 14.769  10.064 1.00 10.27 ? 245  LYS A CE    1 
ATOM   1918 N  NZ    . LYS A 1 245 ? 15.857 15.716  9.085  1.00 14.43 ? 245  LYS A NZ    1 
ATOM   1919 N  N     A GLY A 1 246 ? 19.959 10.729  11.803 0.62 13.32 ? 246  GLY A N     1 
ATOM   1920 N  N     B GLY A 1 246 ? 19.854 10.283  12.118 0.38 13.92 ? 246  GLY A N     1 
ATOM   1921 C  CA    A GLY A 1 246 ? 20.871 9.840   11.109 0.62 12.99 ? 246  GLY A CA    1 
ATOM   1922 C  CA    B GLY A 1 246 ? 20.711 9.119   11.979 0.38 14.52 ? 246  GLY A CA    1 
ATOM   1923 C  C     A GLY A 1 246 ? 21.364 8.705   11.980 0.62 15.28 ? 246  GLY A C     1 
ATOM   1924 C  C     B GLY A 1 246 ? 20.702 8.159   13.159 0.38 12.17 ? 246  GLY A C     1 
ATOM   1925 O  O     A GLY A 1 246 ? 21.379 7.560   11.550 0.62 24.11 ? 246  GLY A O     1 
ATOM   1926 O  O     B GLY A 1 246 ? 20.544 6.963   12.968 0.38 9.11  ? 246  GLY A O     1 
ATOM   1927 N  N     A CYS A 1 247 ? 21.764 8.993   13.205 0.62 9.54  ? 247  CYS A N     1 
ATOM   1928 N  N     B CYS A 1 247 ? 20.937 8.653   14.384 0.38 7.81  ? 247  CYS A N     1 
ATOM   1929 C  CA    A CYS A 1 247 ? 22.304 7.976   14.090 0.62 10.33 ? 247  CYS A CA    1 
ATOM   1930 C  CA    B CYS A 1 247 ? 21.199 7.736   15.499 0.38 8.09  ? 247  CYS A CA    1 
ATOM   1931 C  C     A CYS A 1 247 ? 21.309 7.425   15.085 0.62 7.44  ? 247  CYS A C     1 
ATOM   1932 C  C     B CYS A 1 247 ? 19.952 7.002   15.950 0.38 7.81  ? 247  CYS A C     1 
ATOM   1933 O  O     A CYS A 1 247 ? 21.268 6.212   15.240 0.62 9.49  ? 247  CYS A O     1 
ATOM   1934 O  O     B CYS A 1 247 ? 19.983 5.785   16.160 0.38 9.58  ? 247  CYS A O     1 
ATOM   1935 C  CB    A CYS A 1 247 ? 23.506 8.513   14.878 0.62 12.73 ? 247  CYS A CB    1 
ATOM   1936 C  CB    B CYS A 1 247 ? 21.795 8.479   16.676 0.38 15.24 ? 247  CYS A CB    1 
ATOM   1937 S  SG    A CYS A 1 247 ? 24.856 8.997   13.764 0.62 15.33 ? 247  CYS A SG    1 
ATOM   1938 S  SG    B CYS A 1 247 ? 23.457 8.961   16.366 0.38 19.24 ? 247  CYS A SG    1 
ATOM   1939 N  N     A LEU A 1 248 ? 20.488 8.264   15.732 0.62 7.39  ? 248  LEU A N     1 
ATOM   1940 N  N     B LEU A 1 248 ? 18.836 7.712   16.128 0.38 9.97  ? 248  LEU A N     1 
ATOM   1941 C  CA    A LEU A 1 248 ? 19.519 7.724   16.671 0.62 8.22  ? 248  LEU A CA    1 
ATOM   1942 C  CA    B LEU A 1 248 ? 17.639 6.975   16.491 0.38 10.04 ? 248  LEU A CA    1 
ATOM   1943 C  C     A LEU A 1 248 ? 18.591 6.720   15.987 0.62 9.14  ? 248  LEU A C     1 
ATOM   1944 C  C     B LEU A 1 248 ? 17.179 6.084   15.347 0.38 9.08  ? 248  LEU A C     1 
ATOM   1945 O  O     A LEU A 1 248 ? 18.271 5.679   16.568 0.62 9.66  ? 248  LEU A O     1 
ATOM   1946 O  O     B LEU A 1 248 ? 16.701 4.971   15.599 0.38 11.68 ? 248  LEU A O     1 
ATOM   1947 C  CB    A LEU A 1 248 ? 18.739 8.845   17.329 0.62 12.03 ? 248  LEU A CB    1 
ATOM   1948 C  CB    B LEU A 1 248 ? 16.560 7.941   16.974 0.38 11.10 ? 248  LEU A CB    1 
ATOM   1949 C  CG    A LEU A 1 248 ? 17.874 8.501   18.522 0.62 11.45 ? 248  LEU A CG    1 
ATOM   1950 C  CG    B LEU A 1 248 ? 17.085 8.577   18.276 0.38 18.71 ? 248  LEU A CG    1 
ATOM   1951 C  CD1   A LEU A 1 248 ? 17.716 9.762   19.372 0.62 12.36 ? 248  LEU A CD1   1 
ATOM   1952 C  CD1   B LEU A 1 248 ? 16.405 9.885   18.682 0.38 21.94 ? 248  LEU A CD1   1 
ATOM   1953 C  CD2   A LEU A 1 248 ? 16.470 8.037   18.080 0.62 13.89 ? 248  LEU A CD2   1 
ATOM   1954 C  CD2   B LEU A 1 248 ? 16.996 7.602   19.453 0.38 15.45 ? 248  LEU A CD2   1 
ATOM   1955 N  N     A SER A 1 249 ? 18.254 6.954   14.719 0.62 8.38  ? 249  SER A N     1 
ATOM   1956 N  N     B SER A 1 249 ? 17.434 6.483   14.099 0.38 8.51  ? 249  SER A N     1 
ATOM   1957 C  CA    A SER A 1 249 ? 17.340 6.050   13.999 0.62 7.11  ? 249  SER A CA    1 
ATOM   1958 C  CA    B SER A 1 249 ? 17.195 5.568   12.999 0.38 12.03 ? 249  SER A CA    1 
ATOM   1959 C  C     A SER A 1 249 ? 17.835 4.601   13.875 0.62 9.09  ? 249  SER A C     1 
ATOM   1960 C  C     B SER A 1 249 ? 17.980 4.284   13.204 0.38 9.73  ? 249  SER A C     1 
ATOM   1961 O  O     A SER A 1 249 ? 17.012 3.699   13.713 0.62 6.41  ? 249  SER A O     1 
ATOM   1962 O  O     B SER A 1 249 ? 17.500 3.186   12.897 0.38 4.65  ? 249  SER A O     1 
ATOM   1963 C  CB    A SER A 1 249 ? 17.045 6.570   12.590 0.62 9.26  ? 249  SER A CB    1 
ATOM   1964 C  CB    B SER A 1 249 ? 17.561 6.236   11.685 0.38 9.89  ? 249  SER A CB    1 
ATOM   1965 O  OG    A SER A 1 249 ? 16.466 7.846   12.589 0.62 12.52 ? 249  SER A OG    1 
ATOM   1966 O  OG    B SER A 1 249 ? 16.544 7.153   11.347 0.38 14.78 ? 249  SER A OG    1 
ATOM   1967 N  N     . ALA A 1 250 ? 19.168 4.378   13.792 1.00 9.14  ? 250  ALA A N     1 
ATOM   1968 C  CA    . ALA A 1 250 ? 19.859 3.102   13.861 1.00 8.47  ? 250  ALA A CA    1 
ATOM   1969 C  C     . ALA A 1 250 ? 19.269 2.225   14.967 1.00 7.64  ? 250  ALA A C     1 
ATOM   1970 O  O     . ALA A 1 250 ? 19.248 0.991   14.812 1.00 8.59  ? 250  ALA A O     1 
ATOM   1971 C  CB    . ALA A 1 250 ? 21.379 3.326   14.049 1.00 7.91  ? 250  ALA A CB    1 
ATOM   1972 N  N     . LEU A 1 251 ? 18.771 2.830   16.051 1.00 7.81  ? 251  LEU A N     1 
ATOM   1973 C  CA    . LEU A 1 251 ? 18.186 2.065   17.123 1.00 7.38  ? 251  LEU A CA    1 
ATOM   1974 C  C     . LEU A 1 251 ? 17.048 1.202   16.593 1.00 8.02  ? 251  LEU A C     1 
ATOM   1975 O  O     . LEU A 1 251 ? 16.874 0.034   16.968 1.00 9.50  ? 251  LEU A O     1 
ATOM   1976 C  CB    . LEU A 1 251 ? 17.635 3.033   18.196 1.00 12.79 ? 251  LEU A CB    1 
ATOM   1977 C  CG    . LEU A 1 251 ? 17.323 2.587   19.573 1.00 18.90 ? 251  LEU A CG    1 
ATOM   1978 C  CD1   . LEU A 1 251 ? 18.621 1.953   20.215 1.00 14.16 ? 251  LEU A CD1   1 
ATOM   1979 C  CD2   . LEU A 1 251 ? 16.960 3.879   20.332 1.00 13.96 ? 251  LEU A CD2   1 
ATOM   1980 N  N     . PHE A 1 252 ? 16.247 1.798   15.689 1.00 6.55  ? 252  PHE A N     1 
ATOM   1981 C  CA    . PHE A 1 252 ? 15.062 1.091   15.200 1.00 7.27  ? 252  PHE A CA    1 
ATOM   1982 C  C     . PHE A 1 252 ? 15.437 0.073   14.130 1.00 8.55  ? 252  PHE A C     1 
ATOM   1983 O  O     . PHE A 1 252 ? 14.723 -0.918  13.960 1.00 7.92  ? 252  PHE A O     1 
ATOM   1984 C  CB    . PHE A 1 252 ? 14.031 2.156   14.724 1.00 6.99  ? 252  PHE A CB    1 
ATOM   1985 C  CG    . PHE A 1 252 ? 13.714 3.153   15.742 1.00 7.32  ? 252  PHE A CG    1 
ATOM   1986 C  CD1   . PHE A 1 252 ? 13.984 4.459   15.529 1.00 15.42 ? 252  PHE A CD1   1 
ATOM   1987 C  CD2   . PHE A 1 252 ? 13.221 2.784   16.969 1.00 13.13 ? 252  PHE A CD2   1 
ATOM   1988 C  CE1   . PHE A 1 252 ? 13.765 5.424   16.552 1.00 14.63 ? 252  PHE A CE1   1 
ATOM   1989 C  CE2   . PHE A 1 252 ? 12.943 3.772   17.995 1.00 20.89 ? 252  PHE A CE2   1 
ATOM   1990 C  CZ    . PHE A 1 252 ? 13.246 5.083   17.751 1.00 17.47 ? 252  PHE A CZ    1 
ATOM   1991 N  N     . VAL A 1 253 ? 16.540 0.270   13.400 1.00 7.49  ? 253  VAL A N     1 
ATOM   1992 C  CA    . VAL A 1 253 ? 17.049 -0.792  12.522 1.00 5.77  ? 253  VAL A CA    1 
ATOM   1993 C  C     . VAL A 1 253 ? 17.421 -2.016  13.363 1.00 6.62  ? 253  VAL A C     1 
ATOM   1994 O  O     . VAL A 1 253 ? 17.091 -3.166  13.014 1.00 8.34  ? 253  VAL A O     1 
ATOM   1995 C  CB    . VAL A 1 253 ? 18.267 -0.298  11.734 1.00 9.78  ? 253  VAL A CB    1 
ATOM   1996 C  CG1   . VAL A 1 253 ? 18.900 -1.419  10.988 1.00 8.85  ? 253  VAL A CG1   1 
ATOM   1997 C  CG2   . VAL A 1 253 ? 17.830 0.784   10.765 1.00 9.61  ? 253  VAL A CG2   1 
ATOM   1998 N  N     . GLY A 1 254 ? 18.168 -1.791  14.475 1.00 6.60  ? 254  GLY A N     1 
ATOM   1999 C  CA    . GLY A 1 254 ? 18.563 -2.954  15.283 1.00 6.68  ? 254  GLY A CA    1 
ATOM   2000 C  C     . GLY A 1 254 ? 17.350 -3.606  15.927 1.00 5.89  ? 254  GLY A C     1 
ATOM   2001 O  O     . GLY A 1 254 ? 17.256 -4.830  15.972 1.00 6.76  ? 254  GLY A O     1 
ATOM   2002 N  N     . GLY A 1 255 ? 16.337 -2.793  16.298 1.00 6.51  ? 255  GLY A N     1 
ATOM   2003 C  CA    . GLY A 1 255 ? 15.103 -3.385  16.830 1.00 8.04  ? 255  GLY A CA    1 
ATOM   2004 C  C     . GLY A 1 255 ? 14.381 -4.219  15.787 1.00 7.13  ? 255  GLY A C     1 
ATOM   2005 O  O     . GLY A 1 255 ? 13.784 -5.267  16.108 1.00 7.37  ? 255  GLY A O     1 
ATOM   2006 N  N     . LEU A 1 256 ? 14.397 -3.771  14.526 1.00 6.78  ? 256  LEU A N     1 
ATOM   2007 C  CA    . LEU A 1 256 ? 13.737 -4.550  13.467 1.00 4.82  ? 256  LEU A CA    1 
ATOM   2008 C  C     . LEU A 1 256 ? 14.494 -5.853  13.203 1.00 5.58  ? 256  LEU A C     1 
ATOM   2009 O  O     . LEU A 1 256 ? 13.909 -6.903  12.926 1.00 7.18  ? 256  LEU A O     1 
ATOM   2010 C  CB    . LEU A 1 256 ? 13.650 -3.707  12.182 1.00 5.86  ? 256  LEU A CB    1 
ATOM   2011 C  CG    . LEU A 1 256 ? 13.073 -4.404  10.943 1.00 8.36  ? 256  LEU A CG    1 
ATOM   2012 C  CD1   . LEU A 1 256 ? 11.705 -5.036  11.238 1.00 11.96 ? 256  LEU A CD1   1 
ATOM   2013 C  CD2   . LEU A 1 256 ? 12.966 -3.333  9.839  1.00 9.34  ? 256  LEU A CD2   1 
ATOM   2014 N  N     . ALA A 1 257 ? 15.828 -5.805  13.234 1.00 5.89  ? 257  ALA A N     1 
ATOM   2015 C  CA    . ALA A 1 257 ? 16.575 -7.055  13.127 1.00 6.74  ? 257  ALA A CA    1 
ATOM   2016 C  C     . ALA A 1 257 ? 16.227 -8.071  14.219 1.00 6.08  ? 257  ALA A C     1 
ATOM   2017 O  O     . ALA A 1 257 ? 16.134 -9.271  13.934 1.00 8.03  ? 257  ALA A O     1 
ATOM   2018 C  CB    . ALA A 1 257 ? 18.068 -6.747  13.138 1.00 8.37  ? 257  ALA A CB    1 
ATOM   2019 N  N     . ARG A 1 258 ? 16.081 -7.619  15.458 1.00 6.52  ? 258  ARG A N     1 
ATOM   2020 C  CA    . ARG A 1 258 ? 15.704 -8.503  16.555 1.00 8.08  ? 258  ARG A CA    1 
ATOM   2021 C  C     . ARG A 1 258 ? 14.267 -9.015  16.330 1.00 9.70  ? 258  ARG A C     1 
ATOM   2022 O  O     . ARG A 1 258 ? 13.983 -10.206 16.465 1.00 8.71  ? 258  ARG A O     1 
ATOM   2023 C  CB    . ARG A 1 258 ? 15.829 -7.692  17.851 1.00 8.75  ? 258  ARG A CB    1 
ATOM   2024 C  CG    . ARG A 1 258 ? 15.336 -8.498  19.066 1.00 12.01 ? 258  ARG A CG    1 
ATOM   2025 C  CD    . ARG A 1 258 ? 15.412 -7.695  20.407 1.00 17.60 ? 258  ARG A CD    1 
ATOM   2026 N  NE    A ARG A 1 258 ? 14.970 -8.504  21.496 0.41 21.68 ? 258  ARG A NE    1 
ATOM   2027 N  NE    B ARG A 1 258 ? 15.626 -6.250  20.436 0.59 17.63 ? 258  ARG A NE    1 
ATOM   2028 C  CZ    A ARG A 1 258 ? 15.789 -8.847  22.467 0.41 21.92 ? 258  ARG A CZ    1 
ATOM   2029 C  CZ    B ARG A 1 258 ? 14.663 -5.398  20.762 0.59 20.61 ? 258  ARG A CZ    1 
ATOM   2030 N  NH1   A ARG A 1 258 ? 17.036 -8.392  22.418 0.41 14.88 ? 258  ARG A NH1   1 
ATOM   2031 N  NH1   B ARG A 1 258 ? 14.884 -4.086  20.798 0.59 15.13 ? 258  ARG A NH1   1 
ATOM   2032 N  NH2   A ARG A 1 258 ? 15.359 -9.621  23.448 0.41 16.43 ? 258  ARG A NH2   1 
ATOM   2033 N  NH2   B ARG A 1 258 ? 13.460 -5.885  21.054 0.59 19.16 ? 258  ARG A NH2   1 
ATOM   2034 N  N     . LEU A 1 259 ? 13.374 -8.124  15.934 1.00 7.48  ? 259  LEU A N     1 
ATOM   2035 C  CA    . LEU A 1 259 ? 11.992 -8.523  15.649 1.00 7.43  ? 259  LEU A CA    1 
ATOM   2036 C  C     . LEU A 1 259 ? 11.922 -9.572  14.555 1.00 6.88  ? 259  LEU A C     1 
ATOM   2037 O  O     . LEU A 1 259 ? 11.139 -10.528 14.651 1.00 8.25  ? 259  LEU A O     1 
ATOM   2038 C  CB    . LEU A 1 259 ? 11.190 -7.310  15.184 1.00 6.85  ? 259  LEU A CB    1 
ATOM   2039 C  CG    . LEU A 1 259 ? 9.713  -7.580  14.975 1.00 7.95  ? 259  LEU A CG    1 
ATOM   2040 C  CD1   . LEU A 1 259 ? 9.036  -7.896  16.334 1.00 12.10 ? 259  LEU A CD1   1 
ATOM   2041 C  CD2   . LEU A 1 259 ? 9.026  -6.320  14.309 1.00 6.66  ? 259  LEU A CD2   1 
ATOM   2042 N  N     . LEU A 1 260 ? 12.678 -9.400  13.462 1.00 6.36  ? 260  LEU A N     1 
ATOM   2043 C  CA    . LEU A 1 260 ? 12.633 -10.359 12.381 1.00 6.14  ? 260  LEU A CA    1 
ATOM   2044 C  C     . LEU A 1 260 ? 13.117 -11.727 12.846 1.00 5.59  ? 260  LEU A C     1 
ATOM   2045 O  O     . LEU A 1 260 ? 12.528 -12.752 12.484 1.00 7.70  ? 260  LEU A O     1 
ATOM   2046 C  CB    . LEU A 1 260 ? 13.456 -9.811  11.205 1.00 8.70  ? 260  LEU A CB    1 
ATOM   2047 C  CG    . LEU A 1 260 ? 13.595 -10.791 10.054 1.00 8.93  ? 260  LEU A CG    1 
ATOM   2048 C  CD1   . LEU A 1 260 ? 12.200 -11.145 9.440  1.00 9.66  ? 260  LEU A CD1   1 
ATOM   2049 C  CD2   . LEU A 1 260 ? 14.506 -10.124 8.965  1.00 14.76 ? 260  LEU A CD2   1 
ATOM   2050 N  N     . GLU A 1 261 ? 14.201 -11.761 13.639 1.00 7.97  ? 261  GLU A N     1 
ATOM   2051 C  CA    . GLU A 1 261 ? 14.707 -13.046 14.141 1.00 8.57  ? 261  GLU A CA    1 
ATOM   2052 C  C     . GLU A 1 261 ? 13.637 -13.762 14.973 1.00 9.57  ? 261  GLU A C     1 
ATOM   2053 O  O     . GLU A 1 261 ? 13.372 -14.966 14.780 1.00 10.37 ? 261  GLU A O     1 
ATOM   2054 C  CB    . GLU A 1 261 ? 15.978 -12.756 14.961 1.00 9.73  ? 261  GLU A CB    1 
ATOM   2055 C  CG    A GLU A 1 261 ? 17.126 -12.527 14.003 0.57 13.91 ? 261  GLU A CG    1 
ATOM   2056 C  CG    B GLU A 1 261 ? 16.689 -14.047 15.434 0.43 10.61 ? 261  GLU A CG    1 
ATOM   2057 C  CD    A GLU A 1 261 ? 18.535 -12.328 14.603 0.57 23.48 ? 261  GLU A CD    1 
ATOM   2058 C  CD    B GLU A 1 261 ? 18.065 -13.784 16.052 0.43 25.31 ? 261  GLU A CD    1 
ATOM   2059 O  OE1   A GLU A 1 261 ? 18.729 -12.601 15.798 0.57 24.50 ? 261  GLU A OE1   1 
ATOM   2060 O  OE1   B GLU A 1 261 ? 18.460 -12.608 16.174 0.43 26.21 ? 261  GLU A OE1   1 
ATOM   2061 O  OE2   A GLU A 1 261 ? 19.459 -11.923 13.822 0.57 14.90 ? 261  GLU A OE2   1 
ATOM   2062 O  OE2   B GLU A 1 261 ? 18.752 -14.760 16.419 0.43 29.46 ? 261  GLU A OE2   1 
ATOM   2063 N  N     . THR A 1 262 ? 12.939 -13.015 15.836 1.00 6.29  ? 262  THR A N     1 
ATOM   2064 C  CA    . THR A 1 262 ? 11.892 -13.617 16.662 1.00 6.57  ? 262  THR A CA    1 
ATOM   2065 C  C     . THR A 1 262 ? 10.741 -14.131 15.819 1.00 9.37  ? 262  THR A C     1 
ATOM   2066 O  O     . THR A 1 262 ? 10.177 -15.203 16.076 1.00 7.95  ? 262  THR A O     1 
ATOM   2067 C  CB    . THR A 1 262 ? 11.385 -12.542 17.627 1.00 9.75  ? 262  THR A CB    1 
ATOM   2068 O  OG1   . THR A 1 262 ? 12.450 -12.197 18.512 1.00 15.32 ? 262  THR A OG1   1 
ATOM   2069 C  CG2   . THR A 1 262 ? 10.172 -13.000 18.397 1.00 12.81 ? 262  THR A CG2   1 
ATOM   2070 N  N     . THR A 1 263 ? 10.368 -13.352 14.801 1.00 7.34  ? 263  THR A N     1 
ATOM   2071 C  CA    . THR A 1 263 ? 9.220  -13.719 13.975 1.00 4.24  ? 263  THR A CA    1 
ATOM   2072 C  C     . THR A 1 263 ? 9.532  -14.939 13.106 1.00 6.82  ? 263  THR A C     1 
ATOM   2073 O  O     . THR A 1 263 ? 8.686  -15.816 12.950 1.00 8.16  ? 263  THR A O     1 
ATOM   2074 C  CB    . THR A 1 263 ? 8.868  -12.516 13.092 1.00 5.53  ? 263  THR A CB    1 
ATOM   2075 O  OG1   . THR A 1 263 ? 8.568  -11.418 13.943 1.00 7.64  ? 263  THR A OG1   1 
ATOM   2076 C  CG2   . THR A 1 263 ? 7.640  -12.779 12.220 1.00 7.74  ? 263  THR A CG2   1 
ATOM   2077 N  N     . LEU A 1 264 ? 10.716 -14.979 12.473 1.00 6.79  ? 264  LEU A N     1 
ATOM   2078 C  CA    . LEU A 1 264 ? 11.137 -16.150 11.703 1.00 5.09  ? 264  LEU A CA    1 
ATOM   2079 C  C     . LEU A 1 264 ? 11.151 -17.413 12.551 1.00 6.37  ? 264  LEU A C     1 
ATOM   2080 O  O     . LEU A 1 264 ? 10.639 -18.458 12.113 1.00 9.87  ? 264  LEU A O     1 
ATOM   2081 C  CB    . LEU A 1 264 ? 12.537 -15.879 11.164 1.00 8.26  ? 264  LEU A CB    1 
ATOM   2082 C  CG    . LEU A 1 264 ? 12.571 -15.017 9.912  1.00 11.83 ? 264  LEU A CG    1 
ATOM   2083 C  CD1   . LEU A 1 264 ? 14.007 -14.621 9.667  1.00 15.83 ? 264  LEU A CD1   1 
ATOM   2084 C  CD2   . LEU A 1 264 ? 12.064 -15.860 8.737  1.00 10.01 ? 264  LEU A CD2   1 
ATOM   2085 N  N     . GLU A 1 265 ? 11.662 -17.305 13.785 1.00 8.58  ? 265  GLU A N     1 
ATOM   2086 C  CA    A GLU A 1 265 ? 11.686 -18.472 14.676 0.56 9.51  ? 265  GLU A CA    1 
ATOM   2087 C  CA    B GLU A 1 265 ? 11.688 -18.468 14.678 0.44 9.52  ? 265  GLU A CA    1 
ATOM   2088 C  C     . GLU A 1 265 ? 10.281 -18.974 14.928 1.00 9.16  ? 265  GLU A C     1 
ATOM   2089 O  O     . GLU A 1 265 ? 10.030 -20.197 14.879 1.00 10.23 ? 265  GLU A O     1 
ATOM   2090 C  CB    A GLU A 1 265 ? 12.400 -18.125 15.983 0.56 10.07 ? 265  GLU A CB    1 
ATOM   2091 C  CB    B GLU A 1 265 ? 12.392 -18.107 15.988 0.44 10.10 ? 265  GLU A CB    1 
ATOM   2092 C  CG    A GLU A 1 265 ? 13.912 -18.132 15.872 0.56 14.73 ? 265  GLU A CG    1 
ATOM   2093 C  CG    B GLU A 1 265 ? 12.487 -19.257 16.979 0.44 8.27  ? 265  GLU A CG    1 
ATOM   2094 C  CD    A GLU A 1 265 ? 14.626 -17.666 17.160 0.56 25.92 ? 265  GLU A CD    1 
ATOM   2095 C  CD    B GLU A 1 265 ? 13.052 -18.835 18.351 0.44 25.00 ? 265  GLU A CD    1 
ATOM   2096 O  OE1   A GLU A 1 265 ? 14.052 -17.802 18.260 0.56 36.72 ? 265  GLU A OE1   1 
ATOM   2097 O  OE1   B GLU A 1 265 ? 12.783 -17.693 18.813 0.44 25.74 ? 265  GLU A OE1   1 
ATOM   2098 O  OE2   A GLU A 1 265 ? 15.777 -17.166 17.075 0.56 38.63 ? 265  GLU A OE2   1 
ATOM   2099 O  OE2   B GLU A 1 265 ? 13.761 -19.654 18.968 0.44 26.46 ? 265  GLU A OE2   1 
ATOM   2100 N  N     . TYR A 1 266 ? 9.346  -18.049 15.199 1.00 6.48  ? 266  TYR A N     1 
ATOM   2101 C  CA    . TYR A 1 266 ? 7.987  -18.497 15.493 1.00 6.44  ? 266  TYR A CA    1 
ATOM   2102 C  C     . TYR A 1 266 ? 7.346  -19.108 14.271 1.00 8.18  ? 266  TYR A C     1 
ATOM   2103 O  O     . TYR A 1 266 ? 6.593  -20.078 14.381 1.00 7.31  ? 266  TYR A O     1 
ATOM   2104 C  CB    . TYR A 1 266 ? 7.157  -17.305 16.021 1.00 5.74  ? 266  TYR A CB    1 
ATOM   2105 C  CG    . TYR A 1 266 ? 5.811  -17.764 16.539 1.00 6.39  ? 266  TYR A CG    1 
ATOM   2106 C  CD1   . TYR A 1 266 ? 5.759  -18.388 17.783 1.00 9.30  ? 266  TYR A CD1   1 
ATOM   2107 C  CD2   . TYR A 1 266 ? 4.646  -17.533 15.867 1.00 6.20  ? 266  TYR A CD2   1 
ATOM   2108 C  CE1   . TYR A 1 266 ? 4.566  -18.770 18.350 1.00 8.53  ? 266  TYR A CE1   1 
ATOM   2109 C  CE2   . TYR A 1 266 ? 3.429  -17.957 16.396 1.00 7.47  ? 266  TYR A CE2   1 
ATOM   2110 C  CZ    . TYR A 1 266 ? 3.407  -18.564 17.647 1.00 10.40 ? 266  TYR A CZ    1 
ATOM   2111 O  OH    . TYR A 1 266 ? 2.278  -19.064 18.219 1.00 10.62 ? 266  TYR A OH    1 
ATOM   2112 N  N     . ALA A 1 267 ? 7.584  -18.548 13.083 1.00 6.19  ? 267  ALA A N     1 
ATOM   2113 C  CA    . ALA A 1 267 ? 6.890  -19.050 11.906 1.00 7.71  ? 267  ALA A CA    1 
ATOM   2114 C  C     . ALA A 1 267 ? 7.408  -20.417 11.501 1.00 7.82  ? 267  ALA A C     1 
ATOM   2115 O  O     . ALA A 1 267 ? 6.688  -21.164 10.860 1.00 8.44  ? 267  ALA A O     1 
ATOM   2116 C  CB    . ALA A 1 267 ? 7.032  -18.090 10.738 1.00 8.18  ? 267  ALA A CB    1 
ATOM   2117 N  N     . LYS A 1 268 ? 8.598  -20.761 11.962 1.00 7.15  ? 268  LYS A N     1 
ATOM   2118 C  CA    . LYS A 1 268 ? 9.072  -22.129 11.712 1.00 7.68  ? 268  LYS A CA    1 
ATOM   2119 C  C     . LYS A 1 268 ? 8.567  -23.123 12.755 1.00 10.84 ? 268  LYS A C     1 
ATOM   2120 O  O     . LYS A 1 268 ? 8.494  -24.327 12.432 1.00 13.19 ? 268  LYS A O     1 
ATOM   2121 C  CB    . LYS A 1 268 ? 10.605 -22.125 11.739 1.00 9.21  ? 268  LYS A CB    1 
ATOM   2122 C  CG    . LYS A 1 268 ? 11.196 -21.347 10.594 1.00 10.80 ? 268  LYS A CG    1 
ATOM   2123 C  CD    . LYS A 1 268 ? 12.690 -21.146 10.866 1.00 13.79 ? 268  LYS A CD    1 
ATOM   2124 C  CE    . LYS A 1 268 ? 13.238 -20.255 9.767  1.00 22.33 ? 268  LYS A CE    1 
ATOM   2125 N  NZ    . LYS A 1 268 ? 14.639 -19.765 9.997  1.00 20.82 ? 268  LYS A NZ    1 
ATOM   2126 N  N     . ALA A 1 269 ? 8.338  -22.668 13.998 1.00 8.34  ? 269  ALA A N     1 
ATOM   2127 C  CA    . ALA A 1 269 ? 7.975  -23.523 15.132 1.00 8.71  ? 269  ALA A CA    1 
ATOM   2128 C  C     . ALA A 1 269 ? 6.509  -23.783 15.211 1.00 12.38 ? 269  ALA A C     1 
ATOM   2129 O  O     . ALA A 1 269 ? 6.107  -24.919 15.482 1.00 15.24 ? 269  ALA A O     1 
ATOM   2130 C  CB    . ALA A 1 269 ? 8.462  -22.917 16.437 1.00 13.28 ? 269  ALA A CB    1 
ATOM   2131 N  N     . ARG A 1 270 ? 5.706  -22.735 15.058 1.00 7.34  ? 270  ARG A N     1 
ATOM   2132 C  CA    . ARG A 1 270 ? 4.250  -22.866 15.198 1.00 6.74  ? 270  ARG A CA    1 
ATOM   2133 C  C     . ARG A 1 270 ? 3.612  -23.639 14.064 1.00 10.73 ? 270  ARG A C     1 
ATOM   2134 O  O     . ARG A 1 270 ? 3.699  -23.252 12.879 1.00 7.95  ? 270  ARG A O     1 
ATOM   2135 C  CB    . ARG A 1 270 ? 3.693  -21.449 15.299 1.00 7.97  ? 270  ARG A CB    1 
ATOM   2136 C  CG    . ARG A 1 270 ? 2.165  -21.365 15.300 1.00 9.05  ? 270  ARG A CG    1 
ATOM   2137 C  CD    . ARG A 1 270 ? 1.557  -22.112 16.456 1.00 8.91  ? 270  ARG A CD    1 
ATOM   2138 N  NE    . ARG A 1 270 ? 0.111  -21.832 16.458 1.00 8.31  ? 270  ARG A NE    1 
ATOM   2139 C  CZ    . ARG A 1 270 ? -0.705 -22.399 17.359 1.00 12.56 ? 270  ARG A CZ    1 
ATOM   2140 N  NH1   . ARG A 1 270 ? -0.184 -23.328 18.191 1.00 13.87 ? 270  ARG A NH1   1 
ATOM   2141 N  NH2   . ARG A 1 270 ? -1.985 -22.040 17.433 1.00 12.11 ? 270  ARG A NH2   1 
ATOM   2142 N  N     . GLN A 1 271 ? 2.918  -24.738 14.398 1.00 7.24  ? 271  GLN A N     1 
ATOM   2143 C  CA    . GLN A 1 271 ? 2.241  -25.558 13.421 1.00 7.36  ? 271  GLN A CA    1 
ATOM   2144 C  C     . GLN A 1 271 ? 0.746  -25.331 13.490 1.00 8.65  ? 271  GLN A C     1 
ATOM   2145 O  O     . GLN A 1 271 ? 0.177  -25.335 14.596 1.00 12.23 ? 271  GLN A O     1 
ATOM   2146 C  CB    . GLN A 1 271 ? 2.476  -27.049 13.722 1.00 12.52 ? 271  GLN A CB    1 
ATOM   2147 C  CG    . GLN A 1 271 ? 3.846  -27.370 14.142 1.00 24.82 ? 271  GLN A CG    1 
ATOM   2148 C  CD    . GLN A 1 271 ? 4.648  -27.641 12.949 1.00 28.33 ? 271  GLN A CD    1 
ATOM   2149 O  OE1   . GLN A 1 271 ? 4.302  -28.524 12.149 1.00 24.71 ? 271  GLN A OE1   1 
ATOM   2150 N  NE2   . GLN A 1 271 ? 5.708  -26.853 12.760 1.00 26.25 ? 271  GLN A NE2   1 
ATOM   2151 N  N     . GLN A 1 272 ? 0.114  -25.236 12.329 1.00 8.31  ? 272  GLN A N     1 
ATOM   2152 C  CA    . GLN A 1 272 ? -1.328 -25.378 12.170 1.00 5.87  ? 272  GLN A CA    1 
ATOM   2153 C  C     . GLN A 1 272 ? -1.592 -26.088 10.862 1.00 10.05 ? 272  GLN A C     1 
ATOM   2154 O  O     . GLN A 1 272 ? -0.836 -25.922 9.909  1.00 10.06 ? 272  GLN A O     1 
ATOM   2155 C  CB    . GLN A 1 272 ? -2.073 -24.002 12.133 1.00 7.54  ? 272  GLN A CB    1 
ATOM   2156 C  CG    . GLN A 1 272 ? -2.157 -23.274 13.508 1.00 7.69  ? 272  GLN A CG    1 
ATOM   2157 C  CD    . GLN A 1 272 ? -3.085 -23.998 14.512 1.00 9.73  ? 272  GLN A CD    1 
ATOM   2158 O  OE1   . GLN A 1 272 ? -4.299 -23.788 14.508 1.00 10.01 ? 272  GLN A OE1   1 
ATOM   2159 N  NE2   . GLN A 1 272 ? -2.522 -24.872 15.304 1.00 11.32 ? 272  GLN A NE2   1 
ATOM   2160 N  N     . PHE A 1 273 ? -2.672 -26.892 10.813 1.00 9.70  ? 273  PHE A N     1 
ATOM   2161 C  CA    . PHE A 1 273 ? -2.987 -27.648 9.580  1.00 8.78  ? 273  PHE A CA    1 
ATOM   2162 C  C     . PHE A 1 273 ? -1.840 -28.568 9.214  1.00 10.23 ? 273  PHE A C     1 
ATOM   2163 O  O     . PHE A 1 273 ? -1.663 -28.902 8.020  1.00 15.49 ? 273  PHE A O     1 
ATOM   2164 C  CB    . PHE A 1 273 ? -3.351 -26.706 8.412  1.00 10.38 ? 273  PHE A CB    1 
ATOM   2165 C  CG    . PHE A 1 273 ? -4.459 -25.789 8.729  1.00 9.65  ? 273  PHE A CG    1 
ATOM   2166 C  CD1   . PHE A 1 273 ? -5.789 -26.210 8.671  1.00 10.95 ? 273  PHE A CD1   1 
ATOM   2167 C  CD2   . PHE A 1 273 ? -4.209 -24.466 9.098  1.00 8.34  ? 273  PHE A CD2   1 
ATOM   2168 C  CE1   . PHE A 1 273 ? -6.893 -25.354 8.923  1.00 11.56 ? 273  PHE A CE1   1 
ATOM   2169 C  CE2   . PHE A 1 273 ? -5.324 -23.620 9.411  1.00 6.60  ? 273  PHE A CE2   1 
ATOM   2170 C  CZ    . PHE A 1 273 ? -6.649 -24.050 9.309  1.00 7.87  ? 273  PHE A CZ    1 
ATOM   2171 N  N     . GLY A 1 274 ? -1.104 -29.009 10.187 1.00 12.01 ? 274  GLY A N     1 
ATOM   2172 C  CA    . GLY A 1 274 ? -0.120 -30.036 9.916  1.00 13.90 ? 274  GLY A CA    1 
ATOM   2173 C  C     . GLY A 1 274 ? 1.177  -29.523 9.364  1.00 15.61 ? 274  GLY A C     1 
ATOM   2174 O  O     . GLY A 1 274 ? 2.019  -30.321 8.921  1.00 14.93 ? 274  GLY A O     1 
ATOM   2175 N  N     . LYS A 1 275 ? 1.423  -28.217 9.415  1.00 9.82  ? 275  LYS A N     1 
ATOM   2176 C  CA    . LYS A 1 275 ? 2.707  -27.721 8.935  1.00 11.17 ? 275  LYS A CA    1 
ATOM   2177 C  C     . LYS A 1 275 ? 3.045  -26.424 9.649  1.00 8.96  ? 275  LYS A C     1 
ATOM   2178 O  O     . LYS A 1 275 ? 2.193  -25.803 10.306 1.00 8.80  ? 275  LYS A O     1 
ATOM   2179 C  CB    . LYS A 1 275 ? 2.644  -27.465 7.434  1.00 12.27 ? 275  LYS A CB    1 
ATOM   2180 C  CG    . LYS A 1 275 ? 1.630  -26.363 7.088  1.00 11.40 ? 275  LYS A CG    1 
ATOM   2181 C  CD    . LYS A 1 275 ? 1.280  -26.465 5.571  1.00 16.99 ? 275  LYS A CD    1 
ATOM   2182 C  CE    . LYS A 1 275 ? 0.347  -27.628 5.310  1.00 20.03 ? 275  LYS A CE    1 
ATOM   2183 N  NZ    . LYS A 1 275 ? 0.288  -27.986 3.855  1.00 20.89 ? 275  LYS A NZ    1 
ATOM   2184 N  N     . ALA A 1 276 ? 4.273  -25.993 9.483  1.00 7.28  ? 276  ALA A N     1 
ATOM   2185 C  CA    . ALA A 1 276 ? 4.676  -24.692 10.033 1.00 6.23  ? 276  ALA A CA    1 
ATOM   2186 C  C     . ALA A 1 276 ? 3.911  -23.563 9.364  1.00 5.96  ? 276  ALA A C     1 
ATOM   2187 O  O     . ALA A 1 276 ? 3.705  -23.582 8.168  1.00 7.55  ? 276  ALA A O     1 
ATOM   2188 C  CB    . ALA A 1 276 ? 6.175  -24.460 9.854  1.00 9.97  ? 276  ALA A CB    1 
ATOM   2189 N  N     . ILE A 1 277 ? 3.485  -22.576 10.169 1.00 8.26  ? 277  ILE A N     1 
ATOM   2190 C  CA    . ILE A 1 277 ? 2.645  -21.531 9.558  1.00 8.19  ? 277  ILE A CA    1 
ATOM   2191 C  C     . ILE A 1 277 ? 3.433  -20.749 8.515  1.00 5.72  ? 277  ILE A C     1 
ATOM   2192 O  O     . ILE A 1 277 ? 2.817  -20.213 7.580  1.00 6.15  ? 277  ILE A O     1 
ATOM   2193 C  CB    . ILE A 1 277 ? 2.079  -20.549 10.615 1.00 4.87  ? 277  ILE A CB    1 
ATOM   2194 C  CG1   . ILE A 1 277 ? 3.206  -19.962 11.445 1.00 5.23  ? 277  ILE A CG1   1 
ATOM   2195 C  CG2   . ILE A 1 277 ? 1.053  -21.293 11.518 1.00 6.44  ? 277  ILE A CG2   1 
ATOM   2196 C  CD1   . ILE A 1 277 ? 2.692  -18.742 12.366 1.00 7.36  ? 277  ILE A CD1   1 
ATOM   2197 N  N     . GLY A 1 278 ? 4.758  -20.750 8.605  1.00 5.97  ? 278  GLY A N     1 
ATOM   2198 C  CA    . GLY A 1 278 ? 5.525  -20.083 7.553  1.00 5.76  ? 278  GLY A CA    1 
ATOM   2199 C  C     . GLY A 1 278 ? 5.417  -20.724 6.189  1.00 6.53  ? 278  GLY A C     1 
ATOM   2200 O  O     . GLY A 1 278 ? 5.752  -20.076 5.178  1.00 8.40  ? 278  GLY A O     1 
ATOM   2201 N  N     . GLN A 1 279 ? 4.895  -21.936 6.090  1.00 4.99  ? 279  GLN A N     1 
ATOM   2202 C  CA    . GLN A 1 279 ? 4.677  -22.558 4.784  1.00 4.80  ? 279  GLN A CA    1 
ATOM   2203 C  C     . GLN A 1 279 ? 3.528  -21.967 3.987  1.00 5.52  ? 279  GLN A C     1 
ATOM   2204 O  O     . GLN A 1 279 ? 3.461  -22.235 2.787  1.00 10.38 ? 279  GLN A O     1 
ATOM   2205 C  CB    . GLN A 1 279 ? 4.381  -24.076 4.964  1.00 7.95  ? 279  GLN A CB    1 
ATOM   2206 C  CG    . GLN A 1 279 ? 5.566  -24.794 5.644  1.00 9.85  ? 279  GLN A CG    1 
ATOM   2207 C  CD    . GLN A 1 279 ? 6.489  -25.477 4.722  1.00 19.45 ? 279  GLN A CD    1 
ATOM   2208 O  OE1   . GLN A 1 279 ? 6.496  -25.224 3.499  1.00 18.02 ? 279  GLN A OE1   1 
ATOM   2209 N  NE2   . GLN A 1 279 ? 7.305  -26.351 5.281  1.00 29.12 ? 279  GLN A NE2   1 
ATOM   2210 N  N     . PHE A 1 280 ? 2.587  -21.216 4.619  1.00 6.10  ? 280  PHE A N     1 
ATOM   2211 C  CA    . PHE A 1 280 ? 1.504  -20.559 3.919  1.00 7.25  ? 280  PHE A CA    1 
ATOM   2212 C  C     . PHE A 1 280 ? 1.991  -19.261 3.359  1.00 6.93  ? 280  PHE A C     1 
ATOM   2213 O  O     . PHE A 1 280 ? 2.605  -18.489 4.084  1.00 7.09  ? 280  PHE A O     1 
ATOM   2214 C  CB    . PHE A 1 280 ? 0.396  -20.297 4.936  1.00 5.24  ? 280  PHE A CB    1 
ATOM   2215 C  CG    . PHE A 1 280 ? -0.206 -21.578 5.455  1.00 5.90  ? 280  PHE A CG    1 
ATOM   2216 C  CD1   . PHE A 1 280 ? -1.022 -22.326 4.612  1.00 9.85  ? 280  PHE A CD1   1 
ATOM   2217 C  CD2   . PHE A 1 280 ? 0.004  -21.940 6.758  1.00 12.17 ? 280  PHE A CD2   1 
ATOM   2218 C  CE1   . PHE A 1 280 ? -1.619 -23.502 5.080  1.00 16.60 ? 280  PHE A CE1   1 
ATOM   2219 C  CE2   . PHE A 1 280 ? -0.579 -23.163 7.239  1.00 11.37 ? 280  PHE A CE2   1 
ATOM   2220 C  CZ    . PHE A 1 280 ? -1.363 -23.893 6.393  1.00 10.78 ? 280  PHE A CZ    1 
ATOM   2221 N  N     . GLN A 1 281 ? 1.709  -19.012 2.093  1.00 5.53  ? 281  GLN A N     1 
ATOM   2222 C  CA    . GLN A 1 281 ? 2.268  -17.787 1.495  1.00 4.45  ? 281  GLN A CA    1 
ATOM   2223 C  C     . GLN A 1 281 ? 1.715  -16.528 2.151  1.00 6.91  ? 281  GLN A C     1 
ATOM   2224 O  O     . GLN A 1 281 ? 2.402  -15.494 2.148  1.00 6.76  ? 281  GLN A O     1 
ATOM   2225 C  CB    . GLN A 1 281 ? 2.027  -17.752 -0.014 1.00 6.14  ? 281  GLN A CB    1 
ATOM   2226 C  CG    . GLN A 1 281 ? 2.924  -18.821 -0.707 1.00 7.03  ? 281  GLN A CG    1 
ATOM   2227 C  CD    . GLN A 1 281 ? 2.560  -19.038 -2.154 1.00 9.81  ? 281  GLN A CD    1 
ATOM   2228 O  OE1   . GLN A 1 281 ? 1.601  -18.441 -2.714 1.00 8.05  ? 281  GLN A OE1   1 
ATOM   2229 N  NE2   . GLN A 1 281 ? 3.311  -19.939 -2.818 1.00 7.38  ? 281  GLN A NE2   1 
ATOM   2230 N  N     . SER A 1 282 ? 0.483  -16.539 2.695  1.00 6.12  ? 282  SER A N     1 
ATOM   2231 C  CA    . SER A 1 282 ? 0.071  -15.304 3.381  1.00 5.71  ? 282  SER A CA    1 
ATOM   2232 C  C     . SER A 1 282 ? 1.037  -14.947 4.507  1.00 6.86  ? 282  SER A C     1 
ATOM   2233 O  O     . SER A 1 282 ? 1.282  -13.756 4.777  1.00 8.31  ? 282  SER A O     1 
ATOM   2234 C  CB    . SER A 1 282 ? -1.310 -15.488 3.970  1.00 6.22  ? 282  SER A CB    1 
ATOM   2235 O  OG    . SER A 1 282 ? -2.299 -15.498 2.910  1.00 8.85  ? 282  SER A OG    1 
ATOM   2236 N  N     . VAL A 1 283 ? 1.541  -15.953 5.212  1.00 4.72  ? 283  VAL A N     1 
ATOM   2237 C  CA    . VAL A 1 283 ? 2.451  -15.735 6.336  1.00 3.62  ? 283  VAL A CA    1 
ATOM   2238 C  C     . VAL A 1 283 ? 3.842  -15.393 5.839  1.00 4.80  ? 283  VAL A C     1 
ATOM   2239 O  O     . VAL A 1 283 ? 4.442  -14.420 6.297  1.00 6.65  ? 283  VAL A O     1 
ATOM   2240 C  CB    . VAL A 1 283 ? 2.493  -16.988 7.209  1.00 5.98  ? 283  VAL A CB    1 
ATOM   2241 C  CG1   . VAL A 1 283 ? 3.576  -16.846 8.328  1.00 7.90  ? 283  VAL A CG1   1 
ATOM   2242 C  CG2   . VAL A 1 283 ? 1.050  -17.146 7.835  1.00 6.53  ? 283  VAL A CG2   1 
ATOM   2243 N  N     . SER A 1 284 ? 4.345  -16.202 4.925  1.00 5.45  ? 284  SER A N     1 
ATOM   2244 C  CA    . SER A 1 284 ? 5.721  -15.971 4.482  1.00 5.33  ? 284  SER A CA    1 
ATOM   2245 C  C     . SER A 1 284 ? 5.839  -14.692 3.678  1.00 6.35  ? 284  SER A C     1 
ATOM   2246 O  O     . SER A 1 284 ? 6.844  -13.991 3.837  1.00 6.77  ? 284  SER A O     1 
ATOM   2247 C  CB    . SER A 1 284 ? 6.278  -17.142 3.645  1.00 6.77  ? 284  SER A CB    1 
ATOM   2248 O  OG    . SER A 1 284 ? 5.502  -17.357 2.461  1.00 7.29  ? 284  SER A OG    1 
ATOM   2249 N  N     . ASN A 1 285 ? 4.807  -14.318 2.946  1.00 5.47  ? 285  ASN A N     1 
ATOM   2250 C  CA    . ASN A 1 285 ? 4.918  -13.041 2.199  1.00 7.91  ? 285  ASN A CA    1 
ATOM   2251 C  C     . ASN A 1 285 ? 5.114  -11.863 3.148  1.00 6.83  ? 285  ASN A C     1 
ATOM   2252 O  O     . ASN A 1 285 ? 5.849  -10.912 2.826  1.00 6.51  ? 285  ASN A O     1 
ATOM   2253 C  CB    . ASN A 1 285 ? 3.681  -12.805 1.324  1.00 7.92  ? 285  ASN A CB    1 
ATOM   2254 C  CG    . ASN A 1 285 ? 3.688  -13.671 0.053  1.00 8.01  ? 285  ASN A CG    1 
ATOM   2255 O  OD1   . ASN A 1 285 ? 4.696  -14.324 -0.275 1.00 12.23 ? 285  ASN A OD1   1 
ATOM   2256 N  ND2   . ASN A 1 285 ? 2.534  -13.743 -0.589 1.00 13.99 ? 285  ASN A ND2   1 
ATOM   2257 N  N     . ARG A 1 286 ? 4.378  -11.823 4.297  1.00 6.73  ? 286  ARG A N     1 
ATOM   2258 C  CA    . ARG A 1 286 ? 4.556  -10.727 5.257  1.00 6.55  ? 286  ARG A CA    1 
ATOM   2259 C  C     . ARG A 1 286 ? 5.944  -10.730 5.866  1.00 6.64  ? 286  ARG A C     1 
ATOM   2260 O  O     . ARG A 1 286 ? 6.549  -9.672  6.099  1.00 7.03  ? 286  ARG A O     1 
ATOM   2261 C  CB    . ARG A 1 286 ? 3.508  -10.808 6.396  1.00 10.96 ? 286  ARG A CB    1 
ATOM   2262 C  CG    . ARG A 1 286 ? 2.191  -10.222 6.008  1.00 12.66 ? 286  ARG A CG    1 
ATOM   2263 C  CD    . ARG A 1 286 ? 1.312  -10.053 7.312  1.00 11.50 ? 286  ARG A CD    1 
ATOM   2264 N  NE    . ARG A 1 286 ? 1.209  -11.339 7.944  1.00 12.31 ? 286  ARG A NE    1 
ATOM   2265 C  CZ    . ARG A 1 286 ? 0.118  -12.117 7.824  1.00 10.28 ? 286  ARG A CZ    1 
ATOM   2266 N  NH1   . ARG A 1 286 ? -0.913 -11.711 7.078  1.00 17.57 ? 286  ARG A NH1   1 
ATOM   2267 N  NH2   . ARG A 1 286 ? 0.071  -13.333 8.394  1.00 11.79 ? 286  ARG A NH2   1 
ATOM   2268 N  N     . ILE A 1 287 ? 6.472  -11.924 6.199  1.00 5.61  ? 287  ILE A N     1 
ATOM   2269 C  CA    . ILE A 1 287 ? 7.812  -11.971 6.758  1.00 5.26  ? 287  ILE A CA    1 
ATOM   2270 C  C     . ILE A 1 287 ? 8.839  -11.501 5.711  1.00 5.34  ? 287  ILE A C     1 
ATOM   2271 O  O     . ILE A 1 287 ? 9.814  -10.793 6.044  1.00 7.49  ? 287  ILE A O     1 
ATOM   2272 C  CB    . ILE A 1 287 ? 8.129  -13.372 7.269  1.00 6.23  ? 287  ILE A CB    1 
ATOM   2273 C  CG1   . ILE A 1 287 ? 7.172  -13.647 8.454  1.00 6.75  ? 287  ILE A CG1   1 
ATOM   2274 C  CG2   . ILE A 1 287 ? 9.595  -13.465 7.691  1.00 10.14 ? 287  ILE A CG2   1 
ATOM   2275 C  CD1   . ILE A 1 287 ? 7.264  -15.104 8.863  1.00 11.12 ? 287  ILE A CD1   1 
ATOM   2276 N  N     . ILE A 1 288 ? 8.634  -11.878 4.440  1.00 4.75  ? 288  ILE A N     1 
ATOM   2277 C  CA    . ILE A 1 288 ? 9.530  -11.392 3.388  1.00 5.04  ? 288  ILE A CA    1 
ATOM   2278 C  C     . ILE A 1 288 ? 9.472  -9.857  3.298  1.00 6.32  ? 288  ILE A C     1 
ATOM   2279 O  O     . ILE A 1 288 ? 10.507 -9.206  3.139  1.00 7.08  ? 288  ILE A O     1 
ATOM   2280 C  CB    . ILE A 1 288 ? 9.204  -12.107 2.063  1.00 6.87  ? 288  ILE A CB    1 
ATOM   2281 C  CG1   . ILE A 1 288 ? 9.691  -13.581 2.155  1.00 8.76  ? 288  ILE A CG1   1 
ATOM   2282 C  CG2   . ILE A 1 288 ? 9.923  -11.339 0.893  1.00 10.65 ? 288  ILE A CG2   1 
ATOM   2283 C  CD1   . ILE A 1 288 ? 8.989  -14.467 1.103  1.00 14.08 ? 288  ILE A CD1   1 
ATOM   2284 N  N     . ASP A 1 289 ? 8.288  -9.263  3.418  1.00 6.09  ? 289  ASP A N     1 
ATOM   2285 C  CA    . ASP A 1 289 ? 8.198  -7.807  3.469  1.00 8.29  ? 289  ASP A CA    1 
ATOM   2286 C  C     . ASP A 1 289 ? 9.050  -7.250  4.602  1.00 9.11  ? 289  ASP A C     1 
ATOM   2287 O  O     . ASP A 1 289 ? 9.748  -6.233  4.408  1.00 7.80  ? 289  ASP A O     1 
ATOM   2288 C  CB    . ASP A 1 289 ? 6.750  -7.358  3.662  1.00 10.13 ? 289  ASP A CB    1 
ATOM   2289 C  CG    . ASP A 1 289 ? 5.946  -7.467  2.413  1.00 23.06 ? 289  ASP A CG    1 
ATOM   2290 O  OD1   . ASP A 1 289 ? 4.691  -7.535  2.575  1.00 22.76 ? 289  ASP A OD1   1 
ATOM   2291 O  OD2   . ASP A 1 289 ? 6.573  -7.521  1.316  1.00 20.16 ? 289  ASP A OD2   1 
ATOM   2292 N  N     . MET A 1 290 ? 9.024  -7.881  5.792  1.00 6.91  ? 290  MET A N     1 
ATOM   2293 C  CA    . MET A 1 290 ? 9.854  -7.400  6.895  1.00 5.15  ? 290  MET A CA    1 
ATOM   2294 C  C     . MET A 1 290 ? 11.318 -7.463  6.520  1.00 5.35  ? 290  MET A C     1 
ATOM   2295 O  O     . MET A 1 290 ? 12.069 -6.505  6.783  1.00 6.45  ? 290  MET A O     1 
ATOM   2296 C  CB    . MET A 1 290 ? 9.602  -8.264  8.184  1.00 6.25  ? 290  MET A CB    1 
ATOM   2297 C  CG    . MET A 1 290 ? 8.162  -8.099  8.659  1.00 8.06  ? 290  MET A CG    1 
ATOM   2298 S  SD    . MET A 1 290 ? 7.835  -9.363  9.945  1.00 10.63 ? 290  MET A SD    1 
ATOM   2299 C  CE    . MET A 1 290 ? 8.842  -8.838  11.296 1.00 10.94 ? 290  MET A CE    1 
ATOM   2300 N  N     . LYS A 1 291 ? 11.755 -8.600  5.954  1.00 5.65  ? 291  LYS A N     1 
ATOM   2301 C  CA    . LYS A 1 291 ? 13.148 -8.744  5.532  1.00 6.61  ? 291  LYS A CA    1 
ATOM   2302 C  C     . LYS A 1 291 ? 13.529 -7.724  4.452  1.00 5.20  ? 291  LYS A C     1 
ATOM   2303 O  O     . LYS A 1 291 ? 14.597 -7.098  4.547  1.00 7.89  ? 291  LYS A O     1 
ATOM   2304 C  CB    . LYS A 1 291 ? 13.339 -10.181 5.026  1.00 7.03  ? 291  LYS A CB    1 
ATOM   2305 C  CG    . LYS A 1 291 ? 14.738 -10.437 4.419  1.00 10.61 ? 291  LYS A CG    1 
ATOM   2306 C  CD    . LYS A 1 291 ? 15.820 -10.410 5.460  1.00 18.02 ? 291  LYS A CD    1 
ATOM   2307 C  CE    . LYS A 1 291 ? 17.114 -10.984 4.788  1.00 20.17 ? 291  LYS A CE    1 
ATOM   2308 N  NZ    . LYS A 1 291 ? 18.104 -10.937 5.907  1.00 25.20 ? 291  LYS A NZ    1 
ATOM   2309 N  N     . LEU A 1 292 ? 12.685 -7.531  3.443  1.00 4.99  ? 292  LEU A N     1 
ATOM   2310 C  CA    . LEU A 1 292 ? 13.016 -6.536  2.397  1.00 4.62  ? 292  LEU A CA    1 
ATOM   2311 C  C     . LEU A 1 292 ? 13.147 -5.150  3.004  1.00 5.22  ? 292  LEU A C     1 
ATOM   2312 O  O     . LEU A 1 292 ? 14.063 -4.397  2.632  1.00 6.01  ? 292  LEU A O     1 
ATOM   2313 C  CB    . LEU A 1 292 ? 11.897 -6.493  1.363  1.00 6.42  ? 292  LEU A CB    1 
ATOM   2314 C  CG    . LEU A 1 292 ? 11.775 -7.755  0.505  1.00 7.23  ? 292  LEU A CG    1 
ATOM   2315 C  CD1   . LEU A 1 292 ? 10.437 -7.700  -0.242 1.00 8.07  ? 292  LEU A CD1   1 
ATOM   2316 C  CD2   . LEU A 1 292 ? 12.877 -7.840  -0.490 1.00 10.63 ? 292  LEU A CD2   1 
ATOM   2317 N  N     . ARG A 1 293 ? 12.227 -4.790  3.909  1.00 5.25  ? 293  ARG A N     1 
ATOM   2318 C  CA    . ARG A 1 293 ? 12.320 -3.470  4.568  1.00 4.45  ? 293  ARG A CA    1 
ATOM   2319 C  C     . ARG A 1 293 ? 13.626 -3.319  5.320  1.00 5.11  ? 293  ARG A C     1 
ATOM   2320 O  O     . ARG A 1 293 ? 14.303 -2.287  5.243  1.00 6.72  ? 293  ARG A O     1 
ATOM   2321 C  CB    . ARG A 1 293 ? 11.156 -3.299  5.577  1.00 5.41  ? 293  ARG A CB    1 
ATOM   2322 C  CG    . ARG A 1 293 ? 9.830  -3.104  4.884  1.00 6.29  ? 293  ARG A CG    1 
ATOM   2323 C  CD    . ARG A 1 293 ? 8.742  -3.182  5.976  1.00 9.40  ? 293  ARG A CD    1 
ATOM   2324 N  NE    . ARG A 1 293 ? 7.439  -3.239  5.368  1.00 9.73  ? 293  ARG A NE    1 
ATOM   2325 C  CZ    . ARG A 1 293 ? 6.472  -4.031  5.850  1.00 10.49 ? 293  ARG A CZ    1 
ATOM   2326 N  NH1   . ARG A 1 293 ? 6.679  -4.772  6.974  1.00 9.79  ? 293  ARG A NH1   1 
ATOM   2327 N  NH2   . ARG A 1 293 ? 5.334  -4.111  5.167  1.00 12.28 ? 293  ARG A NH2   1 
ATOM   2328 N  N     . LEU A 1 294 ? 14.011 -4.346  6.098  1.00 6.53  ? 294  LEU A N     1 
ATOM   2329 C  CA    . LEU A 1 294 ? 15.184 -4.201  6.924  1.00 6.28  ? 294  LEU A CA    1 
ATOM   2330 C  C     . LEU A 1 294 ? 16.439 -4.025  6.051  1.00 8.79  ? 294  LEU A C     1 
ATOM   2331 O  O     . LEU A 1 294 ? 17.308 -3.191  6.344  1.00 7.91  ? 294  LEU A O     1 
ATOM   2332 C  CB    . LEU A 1 294 ? 15.281 -5.461  7.791  1.00 6.24  ? 294  LEU A CB    1 
ATOM   2333 C  CG    . LEU A 1 294 ? 16.630 -5.619  8.516  1.00 5.85  ? 294  LEU A CG    1 
ATOM   2334 C  CD1   . LEU A 1 294 ? 16.865 -4.463  9.523  1.00 6.86  ? 294  LEU A CD1   1 
ATOM   2335 C  CD2   . LEU A 1 294 ? 16.704 -7.036  9.273  1.00 9.98  ? 294  LEU A CD2   1 
ATOM   2336 N  N     . GLU A 1 295 ? 16.543 -4.805  4.977  1.00 6.55  ? 295  GLU A N     1 
ATOM   2337 C  CA    . GLU A 1 295 ? 17.757 -4.728  4.154  1.00 7.62  ? 295  GLU A CA    1 
ATOM   2338 C  C     . GLU A 1 295 ? 17.821 -3.375  3.465  1.00 9.40  ? 295  GLU A C     1 
ATOM   2339 O  O     . GLU A 1 295 ? 18.886 -2.749  3.405  1.00 9.15  ? 295  GLU A O     1 
ATOM   2340 C  CB    . GLU A 1 295 ? 17.759 -5.840  3.105  1.00 7.35  ? 295  GLU A CB    1 
ATOM   2341 C  CG    . GLU A 1 295 ? 17.914 -7.235  3.829  1.00 10.97 ? 295  GLU A CG    1 
ATOM   2342 C  CD    . GLU A 1 295 ? 19.050 -7.279  4.911  1.00 22.43 ? 295  GLU A CD    1 
ATOM   2343 O  OE1   . GLU A 1 295 ? 20.205 -6.857  4.651  1.00 22.28 ? 295  GLU A OE1   1 
ATOM   2344 O  OE2   . GLU A 1 295 ? 18.776 -7.708  6.072  1.00 26.32 ? 295  GLU A OE2   1 
ATOM   2345 N  N     . GLN A 1 296 ? 16.674 -2.901  2.958  1.00 4.87  ? 296  GLN A N     1 
ATOM   2346 C  CA    . GLN A 1 296 ? 16.706 -1.622  2.233  1.00 6.64  ? 296  GLN A CA    1 
ATOM   2347 C  C     . GLN A 1 296 ? 17.023 -0.468  3.157  1.00 6.79  ? 296  GLN A C     1 
ATOM   2348 O  O     . GLN A 1 296 ? 17.860 0.392   2.843  1.00 8.20  ? 296  GLN A O     1 
ATOM   2349 C  CB    . GLN A 1 296 ? 15.342 -1.347  1.586  1.00 6.01  ? 296  GLN A CB    1 
ATOM   2350 C  CG    . GLN A 1 296 ? 15.043 -2.205  0.353  1.00 5.98  ? 296  GLN A CG    1 
ATOM   2351 C  CD    . GLN A 1 296 ? 13.629 -1.988  -0.069 1.00 8.85  ? 296  GLN A CD    1 
ATOM   2352 O  OE1   . GLN A 1 296 ? 13.374 -1.282  -1.066 1.00 7.34  ? 296  GLN A OE1   1 
ATOM   2353 N  NE2   . GLN A 1 296 ? 12.659 -2.557  0.679  1.00 6.11  ? 296  GLN A NE2   1 
ATOM   2354 N  N     . CYS A 1 297 ? 16.318 -0.374  4.287  1.00 6.82  ? 297  CYS A N     1 
ATOM   2355 C  CA    . CYS A 1 297 ? 16.524 0.814   5.107  1.00 7.51  ? 297  CYS A CA    1 
ATOM   2356 C  C     . CYS A 1 297 ? 17.879 0.791   5.804  1.00 8.56  ? 297  CYS A C     1 
ATOM   2357 O  O     . CYS A 1 297 ? 18.446 1.852   5.989  1.00 8.14  ? 297  CYS A O     1 
ATOM   2358 C  CB    . CYS A 1 297 ? 15.394 1.056   6.135  1.00 8.14  ? 297  CYS A CB    1 
ATOM   2359 S  SG    . CYS A 1 297 ? 15.300 -0.086  7.523  1.00 9.60  ? 297  CYS A SG    1 
ATOM   2360 N  N     . ARG A 1 298 ? 18.423 -0.373  6.116  1.00 6.36  ? 298  ARG A N     1 
ATOM   2361 C  CA    . ARG A 1 298 ? 19.759 -0.399  6.712  1.00 9.30  ? 298  ARG A CA    1 
ATOM   2362 C  C     . ARG A 1 298 ? 20.800 0.083   5.694  1.00 8.82  ? 298  ARG A C     1 
ATOM   2363 O  O     . ARG A 1 298 ? 21.685 0.861   6.052  1.00 9.80  ? 298  ARG A O     1 
ATOM   2364 C  CB    . ARG A 1 298 ? 20.040 -1.793  7.274  1.00 11.66 ? 298  ARG A CB    1 
ATOM   2365 C  CG    A ARG A 1 298 ? 21.498 -2.000  7.597  0.63 16.07 ? 298  ARG A CG    1 
ATOM   2366 C  CG    B ARG A 1 298 ? 20.592 -2.789  6.334  0.37 6.05  ? 298  ARG A CG    1 
ATOM   2367 C  CD    A ARG A 1 298 ? 21.719 -3.086  8.661  0.63 25.57 ? 298  ARG A CD    1 
ATOM   2368 C  CD    B ARG A 1 298 ? 20.531 -4.239  6.925  0.37 10.73 ? 298  ARG A CD    1 
ATOM   2369 N  NE    . ARG A 1 298 ? 21.071 -4.314  8.283  1.00 21.22 ? 298  ARG A NE    1 
ATOM   2370 C  CZ    . ARG A 1 298 ? 20.913 -5.380  9.050  1.00 22.00 ? 298  ARG A CZ    1 
ATOM   2371 N  NH1   . ARG A 1 298 ? 20.275 -6.423  8.546  1.00 25.09 ? 298  ARG A NH1   1 
ATOM   2372 N  NH2   . ARG A 1 298 ? 21.375 -5.424  10.280 1.00 25.18 ? 298  ARG A NH2   1 
ATOM   2373 N  N     . LEU A 1 299 ? 20.638 -0.268  4.402  1.00 6.78  ? 299  LEU A N     1 
ATOM   2374 C  CA    . LEU A 1 299 ? 21.615 0.243   3.424  1.00 6.05  ? 299  LEU A CA    1 
ATOM   2375 C  C     . LEU A 1 299 ? 21.494 1.748   3.274  1.00 8.58  ? 299  LEU A C     1 
ATOM   2376 O  O     . LEU A 1 299 ? 22.499 2.450   3.095  1.00 8.18  ? 299  LEU A O     1 
ATOM   2377 C  CB    . LEU A 1 299 ? 21.392 -0.424  2.054  1.00 7.81  ? 299  LEU A CB    1 
ATOM   2378 C  CG    . LEU A 1 299 ? 21.857 -1.858  2.042  1.00 11.53 ? 299  LEU A CG    1 
ATOM   2379 C  CD1   . LEU A 1 299 ? 21.415 -2.535  0.774  1.00 14.01 ? 299  LEU A CD1   1 
ATOM   2380 C  CD2   . LEU A 1 299 ? 23.366 -1.970  2.210  1.00 26.95 ? 299  LEU A CD2   1 
ATOM   2381 N  N     . MET A 1 300 ? 20.255 2.276   3.245  1.00 6.83  ? 300  MET A N     1 
ATOM   2382 C  CA    . MET A 1 300 ? 20.058 3.718   3.166  1.00 7.28  ? 300  MET A CA    1 
ATOM   2383 C  C     . MET A 1 300 ? 20.709 4.437   4.327  1.00 10.72 ? 300  MET A C     1 
ATOM   2384 O  O     . MET A 1 300 ? 21.295 5.521   4.137  1.00 10.83 ? 300  MET A O     1 
ATOM   2385 C  CB    . MET A 1 300 ? 18.567 4.057   3.097  1.00 10.42 ? 300  MET A CB    1 
ATOM   2386 C  CG    . MET A 1 300 ? 17.916 3.573   1.787  1.00 8.79  ? 300  MET A CG    1 
ATOM   2387 S  SD    . MET A 1 300 ? 18.386 4.540   0.321  1.00 10.04 ? 300  MET A SD    1 
ATOM   2388 C  CE    . MET A 1 300 ? 17.509 6.078   0.663  1.00 11.97 ? 300  MET A CE    1 
ATOM   2389 N  N     . LEU A 1 301 ? 20.588 3.874   5.538  1.00 8.42  ? 301  LEU A N     1 
ATOM   2390 C  CA    . LEU A 1 301 ? 21.175 4.507   6.715  1.00 7.70  ? 301  LEU A CA    1 
ATOM   2391 C  C     . LEU A 1 301 ? 22.688 4.478   6.614  1.00 8.78  ? 301  LEU A C     1 
ATOM   2392 O  O     . LEU A 1 301 ? 23.349 5.508   6.833  1.00 9.84  ? 301  LEU A O     1 
ATOM   2393 C  CB    . LEU A 1 301 ? 20.757 3.774   7.976  1.00 9.85  ? 301  LEU A CB    1 
ATOM   2394 C  CG    . LEU A 1 301 ? 21.385 4.430   9.257  1.00 13.12 ? 301  LEU A CG    1 
ATOM   2395 C  CD1   . LEU A 1 301 ? 20.914 5.818   9.364  1.00 18.48 ? 301  LEU A CD1   1 
ATOM   2396 C  CD2   . LEU A 1 301 ? 20.964 3.608   10.410 1.00 26.71 ? 301  LEU A CD2   1 
ATOM   2397 N  N     . TYR A 1 302 ? 23.226 3.331   6.238  1.00 8.19  ? 302  TYR A N     1 
ATOM   2398 C  CA    . TYR A 1 302 ? 24.695 3.208   6.134  1.00 9.98  ? 302  TYR A CA    1 
ATOM   2399 C  C     . TYR A 1 302 ? 25.241 4.173   5.106  1.00 11.18 ? 302  TYR A C     1 
ATOM   2400 O  O     . TYR A 1 302 ? 26.249 4.833   5.341  1.00 11.40 ? 302  TYR A O     1 
ATOM   2401 C  CB    . TYR A 1 302 ? 25.110 1.801   5.775  1.00 9.62  ? 302  TYR A CB    1 
ATOM   2402 C  CG    . TYR A 1 302 ? 24.841 0.768   6.834  1.00 11.59 ? 302  TYR A CG    1 
ATOM   2403 C  CD1   . TYR A 1 302 ? 24.486 1.104   8.140  1.00 13.03 ? 302  TYR A CD1   1 
ATOM   2404 C  CD2   . TYR A 1 302 ? 25.012 -0.570  6.489  1.00 19.68 ? 302  TYR A CD2   1 
ATOM   2405 C  CE1   . TYR A 1 302 ? 24.248 0.105   9.071  1.00 18.54 ? 302  TYR A CE1   1 
ATOM   2406 C  CE2   . TYR A 1 302 ? 24.831 -1.562  7.424  1.00 35.39 ? 302  TYR A CE2   1 
ATOM   2407 C  CZ    . TYR A 1 302 ? 24.471 -1.194  8.722  1.00 29.42 ? 302  TYR A CZ    1 
ATOM   2408 O  OH    . TYR A 1 302 ? 24.268 -2.186  9.655  1.00 41.18 ? 302  TYR A OH    1 
ATOM   2409 N  N     . ARG A 1 303 ? 24.565 4.313   3.975  1.00 8.44  ? 303  ARG A N     1 
ATOM   2410 C  CA    . ARG A 1 303 ? 25.103 5.243   2.995  1.00 10.90 ? 303  ARG A CA    1 
ATOM   2411 C  C     . ARG A 1 303 ? 24.987 6.680   3.465  1.00 12.97 ? 303  ARG A C     1 
ATOM   2412 O  O     . ARG A 1 303 ? 25.894 7.478   3.211  1.00 13.44 ? 303  ARG A O     1 
ATOM   2413 C  CB    . ARG A 1 303 ? 24.409 5.078   1.640  1.00 9.13  ? 303  ARG A CB    1 
ATOM   2414 C  CG    . ARG A 1 303 ? 24.993 5.996   0.609  1.00 10.43 ? 303  ARG A CG    1 
ATOM   2415 C  CD    . ARG A 1 303 ? 24.408 5.655   -0.742 1.00 15.87 ? 303  ARG A CD    1 
ATOM   2416 N  NE    . ARG A 1 303 ? 23.073 6.202   -0.828 1.00 18.98 ? 303  ARG A NE    1 
ATOM   2417 C  CZ    . ARG A 1 303 ? 22.319 6.190   -1.931 1.00 32.67 ? 303  ARG A CZ    1 
ATOM   2418 N  NH1   . ARG A 1 303 ? 22.779 5.645   -3.040 1.00 27.18 ? 303  ARG A NH1   1 
ATOM   2419 N  NH2   . ARG A 1 303 ? 21.111 6.724   -1.920 1.00 23.62 ? 303  ARG A NH2   1 
ATOM   2420 N  N     . ALA A 1 304 ? 23.879 7.060   4.132  1.00 8.99  ? 304  ALA A N     1 
ATOM   2421 C  CA    . ALA A 1 304 ? 23.715 8.418   4.620  1.00 9.26  ? 304  ALA A CA    1 
ATOM   2422 C  C     . ALA A 1 304 ? 24.836 8.751   5.595  1.00 15.70 ? 304  ALA A C     1 
ATOM   2423 O  O     . ALA A 1 304 ? 25.474 9.815   5.495  1.00 14.20 ? 304  ALA A O     1 
ATOM   2424 C  CB    . ALA A 1 304 ? 22.371 8.606   5.321  1.00 13.14 ? 304  ALA A CB    1 
ATOM   2425 N  N     . CYS A 1 305 ? 25.120 7.822   6.504  1.00 11.05 ? 305  CYS A N     1 
ATOM   2426 C  CA    . CYS A 1 305 ? 26.163 8.080   7.498  1.00 11.44 ? 305  CYS A CA    1 
ATOM   2427 C  C     . CYS A 1 305 ? 27.529 8.091   6.844  1.00 13.84 ? 305  CYS A C     1 
ATOM   2428 O  O     . CYS A 1 305 ? 28.366 8.943   7.178  1.00 15.97 ? 305  CYS A O     1 
ATOM   2429 C  CB    . CYS A 1 305 ? 26.108 7.003   8.600  1.00 14.05 ? 305  CYS A CB    1 
ATOM   2430 S  SG    . CYS A 1 305 ? 24.646 7.174   9.648  1.00 13.66 ? 305  CYS A SG    1 
ATOM   2431 N  N     . TRP A 1 306 ? 27.765 7.178   5.904  1.00 11.57 ? 306  TRP A N     1 
ATOM   2432 C  CA    . TRP A 1 306 ? 29.029 7.163   5.183  1.00 13.57 ? 306  TRP A CA    1 
ATOM   2433 C  C     . TRP A 1 306 ? 29.231 8.473   4.414  1.00 15.28 ? 306  TRP A C     1 
ATOM   2434 O  O     . TRP A 1 306 ? 30.339 9.040   4.434  1.00 17.35 ? 306  TRP A O     1 
ATOM   2435 C  CB    . TRP A 1 306 ? 29.075 5.970   4.258  1.00 16.90 ? 306  TRP A CB    1 
ATOM   2436 C  CG    . TRP A 1 306 ? 30.334 5.903   3.404  1.00 14.34 ? 306  TRP A CG    1 
ATOM   2437 C  CD1   . TRP A 1 306 ? 31.525 5.286   3.740  1.00 17.15 ? 306  TRP A CD1   1 
ATOM   2438 C  CD2   . TRP A 1 306 ? 30.500 6.407   2.085  1.00 20.34 ? 306  TRP A CD2   1 
ATOM   2439 N  NE1   . TRP A 1 306 ? 32.408 5.373   2.689  1.00 20.70 ? 306  TRP A NE1   1 
ATOM   2440 C  CE2   . TRP A 1 306 ? 31.814 6.083   1.678  1.00 21.45 ? 306  TRP A CE2   1 
ATOM   2441 C  CE3   . TRP A 1 306 ? 29.679 7.133   1.219  1.00 19.74 ? 306  TRP A CE3   1 
ATOM   2442 C  CZ2   . TRP A 1 306 ? 32.309 6.437   0.416  1.00 25.17 ? 306  TRP A CZ2   1 
ATOM   2443 C  CZ3   . TRP A 1 306 ? 30.177 7.465   -0.044 1.00 24.20 ? 306  TRP A CZ3   1 
ATOM   2444 C  CH2   . TRP A 1 306 ? 31.476 7.126   -0.413 1.00 20.84 ? 306  TRP A CH2   1 
ATOM   2445 N  N     . LYS A 1 307 ? 28.183 8.976   3.728  1.00 13.58 ? 307  LYS A N     1 
ATOM   2446 C  CA    . LYS A 1 307 ? 28.331 10.248  2.994  1.00 15.87 ? 307  LYS A CA    1 
ATOM   2447 C  C     . LYS A 1 307 ? 28.684 11.379  3.964  1.00 22.25 ? 307  LYS A C     1 
ATOM   2448 O  O     . LYS A 1 307 ? 29.539 12.224  3.663  1.00 20.86 ? 307  LYS A O     1 
ATOM   2449 C  CB    . LYS A 1 307 ? 27.058 10.610  2.216  1.00 15.17 ? 307  LYS A CB    1 
ATOM   2450 C  CG    . LYS A 1 307 ? 26.902 9.791   0.981  1.00 17.45 ? 307  LYS A CG    1 
ATOM   2451 C  CD    . LYS A 1 307 ? 25.527 10.070  0.400  1.00 26.28 ? 307  LYS A CD    1 
ATOM   2452 C  CE    . LYS A 1 307 ? 25.464 9.859   -1.062 1.00 33.66 ? 307  LYS A CE    1 
ATOM   2453 N  NZ    . LYS A 1 307 ? 24.191 10.474  -1.565 1.00 30.33 ? 307  LYS A NZ    1 
ATOM   2454 N  N     . HIS A 1 308 ? 28.016 11.426  5.117  1.00 18.14 ? 308  HIS A N     1 
ATOM   2455 C  CA    . HIS A 1 308 ? 28.380 12.414  6.136  1.00 19.38 ? 308  HIS A CA    1 
ATOM   2456 C  C     . HIS A 1 308 ? 29.868 12.330  6.481  1.00 23.69 ? 308  HIS A C     1 
ATOM   2457 O  O     . HIS A 1 308 ? 30.597 13.352  6.515  1.00 25.65 ? 308  HIS A O     1 
ATOM   2458 C  CB    . HIS A 1 308 ? 27.540 12.229  7.398  1.00 18.32 ? 308  HIS A CB    1 
ATOM   2459 C  CG    . HIS A 1 308 ? 27.822 13.267  8.430  1.00 29.33 ? 308  HIS A CG    1 
ATOM   2460 N  ND1   . HIS A 1 308 ? 28.880 13.168  9.309  1.00 30.40 ? 308  HIS A ND1   1 
ATOM   2461 C  CD2   . HIS A 1 308 ? 27.208 14.443  8.699  1.00 40.74 ? 308  HIS A CD2   1 
ATOM   2462 C  CE1   . HIS A 1 308 ? 28.890 14.231  10.093 1.00 35.95 ? 308  HIS A CE1   1 
ATOM   2463 N  NE2   . HIS A 1 308 ? 27.884 15.017  9.747  1.00 36.86 ? 308  HIS A NE2   1 
ATOM   2464 N  N     . ASP A 1 309 ? 30.344 11.124  6.747  1.00 18.80 ? 309  ASP A N     1 
ATOM   2465 C  CA    . ASP A 1 309 ? 31.750 10.910  7.100  1.00 17.87 ? 309  ASP A CA    1 
ATOM   2466 C  C     . ASP A 1 309 ? 32.670 11.320  5.963  1.00 27.74 ? 309  ASP A C     1 
ATOM   2467 O  O     . ASP A 1 309 ? 33.837 11.644  6.215  1.00 27.47 ? 309  ASP A O     1 
ATOM   2468 C  CB    . ASP A 1 309 ? 32.036 9.464   7.465  1.00 18.95 ? 309  ASP A CB    1 
ATOM   2469 C  CG    . ASP A 1 309 ? 31.429 9.071   8.809  1.00 19.89 ? 309  ASP A CG    1 
ATOM   2470 O  OD1   . ASP A 1 309 ? 31.137 9.997   9.589  1.00 21.41 ? 309  ASP A OD1   1 
ATOM   2471 O  OD2   . ASP A 1 309 ? 31.179 7.863   9.052  1.00 22.12 ? 309  ASP A OD2   1 
ATOM   2472 N  N     . GLN A 1 310 ? 32.201 11.253  4.709  1.00 19.74 ? 310  GLN A N     1 
ATOM   2473 C  CA    . GLN A 1 310 ? 33.057 11.692  3.610  1.00 24.13 ? 310  GLN A CA    1 
ATOM   2474 C  C     . GLN A 1 310 ? 33.018 13.199  3.406  1.00 19.66 ? 310  GLN A C     1 
ATOM   2475 O  O     . GLN A 1 310 ? 33.712 13.712  2.516  1.00 28.41 ? 310  GLN A O     1 
ATOM   2476 C  CB    . GLN A 1 310 ? 32.668 10.978  2.297  1.00 23.74 ? 310  GLN A CB    1 
ATOM   2477 C  CG    . GLN A 1 310 ? 32.811 9.452   2.289  1.00 21.21 ? 310  GLN A CG    1 
ATOM   2478 C  CD    A GLN A 1 310 ? 34.244 8.999   2.084  0.65 29.27 ? 310  GLN A CD    1 
ATOM   2479 C  CD    B GLN A 1 310 ? 33.823 8.921   3.264  0.35 27.90 ? 310  GLN A CD    1 
ATOM   2480 O  OE1   A GLN A 1 310 ? 34.798 8.227   2.877  0.65 31.59 ? 310  GLN A OE1   1 
ATOM   2481 O  OE1   B GLN A 1 310 ? 35.021 9.125   3.097  0.35 26.08 ? 310  GLN A OE1   1 
ATOM   2482 N  NE2   A GLN A 1 310 ? 34.847 9.454   0.992  0.65 25.81 ? 310  GLN A NE2   1 
ATOM   2483 N  NE2   B GLN A 1 310 ? 33.348 8.212   4.289  0.35 23.82 ? 310  GLN A NE2   1 
ATOM   2484 N  N     . GLY A 1 311 ? 32.217 13.929  4.151  1.00 22.45 ? 311  GLY A N     1 
ATOM   2485 C  CA    . GLY A 1 311 ? 32.057 15.350  3.922  1.00 23.55 ? 311  GLY A CA    1 
ATOM   2486 C  C     . GLY A 1 311 ? 31.133 15.714  2.786  1.00 31.88 ? 311  GLY A C     1 
ATOM   2487 O  O     . GLY A 1 311 ? 31.115 16.877  2.376  1.00 33.61 ? 311  GLY A O     1 
ATOM   2488 N  N     . GLN A 1 312 ? 30.379 14.756  2.241  1.00 26.67 ? 312  GLN A N     1 
ATOM   2489 C  CA    . GLN A 1 312 ? 29.363 15.046  1.235  1.00 32.36 ? 312  GLN A CA    1 
ATOM   2490 C  C     . GLN A 1 312 ? 28.113 15.603  1.914  1.00 26.21 ? 312  GLN A C     1 
ATOM   2491 O  O     . GLN A 1 312 ? 27.968 15.556  3.143  1.00 33.38 ? 312  GLN A O     1 
ATOM   2492 C  CB    . GLN A 1 312 ? 29.062 13.794  0.404  1.00 30.16 ? 312  GLN A CB    1 
ATOM   2493 C  CG    . GLN A 1 312 ? 30.273 13.284  -0.327 1.00 25.95 ? 312  GLN A CG    1 
ATOM   2494 C  CD    . GLN A 1 312 ? 30.064 11.944  -1.057 1.00 29.98 ? 312  GLN A CD    1 
ATOM   2495 O  OE1   . GLN A 1 312 ? 28.937 11.573  -1.423 1.00 35.32 ? 312  GLN A OE1   1 
ATOM   2496 N  NE2   . GLN A 1 312 ? 31.160 11.250  -1.325 1.00 36.10 ? 312  GLN A NE2   1 
ATOM   2497 N  N     . ASP A 1 313 ? 27.234 16.197  1.105  1.00 33.11 ? 313  ASP A N     1 
ATOM   2498 C  CA    . ASP A 1 313 ? 25.952 16.714  1.580  1.00 39.93 ? 313  ASP A CA    1 
ATOM   2499 C  C     . ASP A 1 313 ? 25.049 15.521  1.850  1.00 30.92 ? 313  ASP A C     1 
ATOM   2500 O  O     . ASP A 1 313 ? 24.667 14.815  0.911  1.00 33.76 ? 313  ASP A O     1 
ATOM   2501 C  CB    . ASP A 1 313 ? 25.338 17.637  0.524  1.00 35.92 ? 313  ASP A CB    1 
ATOM   2502 C  CG    . ASP A 1 313 ? 24.035 18.325  0.996  1.00 59.86 ? 313  ASP A CG    1 
ATOM   2503 O  OD1   . ASP A 1 313 ? 23.646 18.215  2.190  1.00 52.18 ? 313  ASP A OD1   1 
ATOM   2504 O  OD2   . ASP A 1 313 ? 23.400 18.994  0.148  1.00 63.59 ? 313  ASP A OD2   1 
ATOM   2505 N  N     . ALA A 1 314 ? 24.765 15.242  3.120  1.00 23.07 ? 314  ALA A N     1 
ATOM   2506 C  CA    . ALA A 1 314 ? 23.975 14.047  3.419  1.00 22.38 ? 314  ALA A CA    1 
ATOM   2507 C  C     . ALA A 1 314 ? 22.581 14.375  3.937  1.00 23.79 ? 314  ALA A C     1 
ATOM   2508 O  O     . ALA A 1 314 ? 21.879 13.441  4.365  1.00 18.04 ? 314  ALA A O     1 
ATOM   2509 C  CB    . ALA A 1 314 ? 24.687 13.151  4.428  1.00 20.45 ? 314  ALA A CB    1 
ATOM   2510 N  N     . GLU A 1 315 ? 22.140 15.637  3.855  1.00 23.15 ? 315  GLU A N     1 
ATOM   2511 C  CA    . GLU A 1 315 ? 20.884 16.011  4.492  1.00 25.10 ? 315  GLU A CA    1 
ATOM   2512 C  C     . GLU A 1 315 ? 19.701 15.235  3.918  1.00 20.98 ? 315  GLU A C     1 
ATOM   2513 O  O     . GLU A 1 315 ? 18.872 14.710  4.669  1.00 20.69 ? 315  GLU A O     1 
ATOM   2514 C  CB    . GLU A 1 315 ? 20.608 17.503  4.345  1.00 32.55 ? 315  GLU A CB    1 
ATOM   2515 C  CG    . GLU A 1 315 ? 19.521 17.815  5.362  1.00 35.93 ? 315  GLU A CG    1 
ATOM   2516 C  CD    . GLU A 1 315 ? 18.925 19.196  5.293  1.00 62.93 ? 315  GLU A CD    1 
ATOM   2517 O  OE1   . GLU A 1 315 ? 19.239 19.975  4.342  1.00 57.68 ? 315  GLU A OE1   1 
ATOM   2518 O  OE2   . GLU A 1 315 ? 18.116 19.462  6.230  1.00 34.21 ? 315  GLU A OE2   1 
ATOM   2519 N  N     . ALA A 1 316 ? 19.612 15.158  2.596  1.00 15.82 ? 316  ALA A N     1 
ATOM   2520 C  CA    . ALA A 1 316 ? 18.487 14.461  1.981  1.00 15.72 ? 316  ALA A CA    1 
ATOM   2521 C  C     . ALA A 1 316 ? 18.576 12.965  2.271  1.00 12.93 ? 316  ALA A C     1 
ATOM   2522 O  O     . ALA A 1 316 ? 17.537 12.317  2.485  1.00 10.91 ? 316  ALA A O     1 
ATOM   2523 C  CB    . ALA A 1 316 ? 18.453 14.696  0.460  1.00 20.28 ? 316  ALA A CB    1 
ATOM   2524 N  N     . ASP A 1 317 ? 19.798 12.402  2.296  1.00 10.52 ? 317  ASP A N     1 
ATOM   2525 C  CA    . ASP A 1 317 ? 19.971 10.981  2.547  1.00 11.51 ? 317  ASP A CA    1 
ATOM   2526 C  C     . ASP A 1 317 ? 19.533 10.630  3.962  1.00 8.84  ? 317  ASP A C     1 
ATOM   2527 O  O     . ASP A 1 317 ? 18.929 9.593   4.183  1.00 9.58  ? 317  ASP A O     1 
ATOM   2528 C  CB    . ASP A 1 317 ? 21.437 10.600  2.324  1.00 12.54 ? 317  ASP A CB    1 
ATOM   2529 C  CG    . ASP A 1 317 ? 21.904 11.049  0.948  1.00 37.79 ? 317  ASP A CG    1 
ATOM   2530 O  OD1   . ASP A 1 317 ? 21.759 10.222  0.012  1.00 32.64 ? 317  ASP A OD1   1 
ATOM   2531 O  OD2   . ASP A 1 317 ? 22.256 12.266  0.801  1.00 33.21 ? 317  ASP A OD2   1 
ATOM   2532 N  N     . ILE A 1 318 ? 19.830 11.518  4.927  1.00 10.90 ? 318  ILE A N     1 
ATOM   2533 C  CA    . ILE A 1 318 ? 19.427 11.281  6.305  1.00 11.21 ? 318  ILE A CA    1 
ATOM   2534 C  C     . ILE A 1 318 ? 17.909 11.418  6.465  1.00 8.38  ? 318  ILE A C     1 
ATOM   2535 O  O     . ILE A 1 318 ? 17.285 10.598  7.168  1.00 7.95  ? 318  ILE A O     1 
ATOM   2536 C  CB    . ILE A 1 318 ? 20.193 12.258  7.221  1.00 14.49 ? 318  ILE A CB    1 
ATOM   2537 C  CG1   . ILE A 1 318 ? 21.627 11.743  7.316  1.00 19.60 ? 318  ILE A CG1   1 
ATOM   2538 C  CG2   . ILE A 1 318 ? 19.594 12.222  8.561  1.00 14.39 ? 318  ILE A CG2   1 
ATOM   2539 C  CD1   . ILE A 1 318 ? 22.580 12.813  7.653  1.00 30.60 ? 318  ILE A CD1   1 
ATOM   2540 N  N     . ALA A 1 319 ? 17.293 12.414  5.794  1.00 8.67  ? 319  ALA A N     1 
ATOM   2541 C  CA    . ALA A 1 319 ? 15.833 12.512  5.845  1.00 6.36  ? 319  ALA A CA    1 
ATOM   2542 C  C     . ALA A 1 319 ? 15.189 11.275  5.229  1.00 6.88  ? 319  ALA A C     1 
ATOM   2543 O  O     . ALA A 1 319 ? 14.193 10.772  5.772  1.00 7.46  ? 319  ALA A O     1 
ATOM   2544 C  CB    . ALA A 1 319 ? 15.351 13.765  5.082  1.00 8.29  ? 319  ALA A CB    1 
ATOM   2545 N  N     . MET A 1 320 ? 15.748 10.784  4.104  1.00 6.13  ? 320  MET A N     1 
ATOM   2546 C  CA    . MET A 1 320 ? 15.178 9.574   3.475  1.00 5.59  ? 320  MET A CA    1 
ATOM   2547 C  C     . MET A 1 320 ? 15.304 8.376   4.391  1.00 6.44  ? 320  MET A C     1 
ATOM   2548 O  O     . MET A 1 320 ? 14.365 7.569   4.509  1.00 7.91  ? 320  MET A O     1 
ATOM   2549 C  CB    . MET A 1 320 ? 15.873 9.222   2.156  1.00 6.90  ? 320  MET A CB    1 
ATOM   2550 C  CG    . MET A 1 320 ? 15.576 10.262  1.088  1.00 8.18  ? 320  MET A CG    1 
ATOM   2551 S  SD    . MET A 1 320 ? 16.191 9.698   -0.542 1.00 15.18 ? 320  MET A SD    1 
ATOM   2552 C  CE    . MET A 1 320 ? 17.936 9.839   -0.432 1.00 18.39 ? 320  MET A CE    1 
ATOM   2553 N  N     . SER A 1 321 ? 16.463 8.259   5.072  1.00 7.64  ? 321  SER A N     1 
ATOM   2554 C  CA    . SER A 1 321 ? 16.665 7.146   5.995  1.00 8.68  ? 321  SER A CA    1 
ATOM   2555 C  C     . SER A 1 321 ? 15.699 7.214   7.156  1.00 4.88  ? 321  SER A C     1 
ATOM   2556 O  O     . SER A 1 321 ? 15.126 6.183   7.564  1.00 7.16  ? 321  SER A O     1 
ATOM   2557 C  CB    . SER A 1 321 ? 18.123 7.180   6.488  1.00 10.33 ? 321  SER A CB    1 
ATOM   2558 O  OG    A SER A 1 321 ? 18.937 6.885   5.385  0.58 11.90 ? 321  SER A OG    1 
ATOM   2559 O  OG    B SER A 1 321 ? 18.423 6.149   7.380  0.42 12.82 ? 321  SER A OG    1 
ATOM   2560 N  N     . LYS A 1 322 ? 15.545 8.395   7.763  1.00 5.38  ? 322  LYS A N     1 
ATOM   2561 C  CA    . LYS A 1 322 ? 14.669 8.510   8.919  1.00 4.89  ? 322  LYS A CA    1 
ATOM   2562 C  C     . LYS A 1 322 ? 13.228 8.160   8.538  1.00 6.33  ? 322  LYS A C     1 
ATOM   2563 O  O     . LYS A 1 322 ? 12.535 7.427   9.272  1.00 7.31  ? 322  LYS A O     1 
ATOM   2564 C  CB    . LYS A 1 322 ? 14.800 9.951   9.456  1.00 8.41  ? 322  LYS A CB    1 
ATOM   2565 C  CG    . LYS A 1 322 ? 14.129 10.085  10.815 1.00 11.31 ? 322  LYS A CG    1 
ATOM   2566 C  CD    . LYS A 1 322 ? 12.672 10.430  10.695 1.00 11.03 ? 322  LYS A CD    1 
ATOM   2567 C  CE    . LYS A 1 322 ? 12.010 10.726  12.080 1.00 21.04 ? 322  LYS A CE    1 
ATOM   2568 N  NZ    . LYS A 1 322 ? 10.546 11.051  11.902 1.00 16.52 ? 322  LYS A NZ    1 
ATOM   2569 N  N     . LEU A 1 323 ? 12.799 8.643   7.372  1.00 6.19  ? 323  LEU A N     1 
ATOM   2570 C  CA    . LEU A 1 323 ? 11.454 8.344   6.864  1.00 6.93  ? 323  LEU A CA    1 
ATOM   2571 C  C     . LEU A 1 323 ? 11.267 6.842   6.656  1.00 8.03  ? 323  LEU A C     1 
ATOM   2572 O  O     . LEU A 1 323 ? 10.271 6.268   7.116  1.00 9.25  ? 323  LEU A O     1 
ATOM   2573 C  CB    . LEU A 1 323 ? 11.292 9.115   5.551  1.00 6.89  ? 323  LEU A CB    1 
ATOM   2574 C  CG    . LEU A 1 323 ? 10.011 8.942   4.722  1.00 10.61 ? 323  LEU A CG    1 
ATOM   2575 C  CD1   A LEU A 1 323 ? 8.826  9.272   5.525  0.68 8.84  ? 323  LEU A CD1   1 
ATOM   2576 C  CD1   B LEU A 1 323 ? 10.054 9.960   3.572  0.32 12.28 ? 323  LEU A CD1   1 
ATOM   2577 C  CD2   A LEU A 1 323 ? 10.157 9.899   3.500  0.68 12.37 ? 323  LEU A CD2   1 
ATOM   2578 C  CD2   B LEU A 1 323 ? 9.650  7.575   4.183  0.32 5.32  ? 323  LEU A CD2   1 
ATOM   2579 N  N     . LEU A 1 324 ? 12.197 6.195   5.967  1.00 5.87  ? 324  LEU A N     1 
ATOM   2580 C  CA    . LEU A 1 324 ? 11.991 4.781   5.673  1.00 5.04  ? 324  LEU A CA    1 
ATOM   2581 C  C     . LEU A 1 324 ? 12.074 3.956   6.932  1.00 5.94  ? 324  LEU A C     1 
ATOM   2582 O  O     . LEU A 1 324 ? 11.246 3.044   7.135  1.00 6.00  ? 324  LEU A O     1 
ATOM   2583 C  CB    . LEU A 1 324 ? 13.027 4.287   4.695  1.00 6.21  ? 324  LEU A CB    1 
ATOM   2584 C  CG    . LEU A 1 324 ? 12.895 4.890   3.290  1.00 7.19  ? 324  LEU A CG    1 
ATOM   2585 C  CD1   . LEU A 1 324 ? 14.180 4.525   2.571  1.00 8.46  ? 324  LEU A CD1   1 
ATOM   2586 C  CD2   . LEU A 1 324 ? 11.668 4.318   2.577  1.00 6.97  ? 324  LEU A CD2   1 
ATOM   2587 N  N     . ILE A 1 325 ? 13.092 4.209   7.786  1.00 4.91  ? 325  ILE A N     1 
ATOM   2588 C  CA    . ILE A 1 325 ? 13.242 3.356   8.970  1.00 4.27  ? 325  ILE A CA    1 
ATOM   2589 C  C     . ILE A 1 325 ? 11.990 3.412   9.832  1.00 5.56  ? 325  ILE A C     1 
ATOM   2590 O  O     . ILE A 1 325 ? 11.513 2.374   10.335 1.00 7.07  ? 325  ILE A O     1 
ATOM   2591 C  CB    . ILE A 1 325 ? 14.492 3.785   9.760  1.00 6.89  ? 325  ILE A CB    1 
ATOM   2592 C  CG1   . ILE A 1 325 ? 15.726 3.364   8.957  1.00 6.77  ? 325  ILE A CG1   1 
ATOM   2593 C  CG2   . ILE A 1 325 ? 14.492 3.082   11.193 1.00 7.06  ? 325  ILE A CG2   1 
ATOM   2594 C  CD1   . ILE A 1 325 ? 16.989 4.070   9.488  1.00 12.40 ? 325  ILE A CD1   1 
ATOM   2595 N  N     . SER A 1 326 ? 11.471 4.608   10.062 1.00 6.66  ? 326  SER A N     1 
ATOM   2596 C  CA    . SER A 1 326 ? 10.357 4.721   11.006 1.00 4.54  ? 326  SER A CA    1 
ATOM   2597 C  C     . SER A 1 326 ? 9.077  4.123   10.439 1.00 6.41  ? 326  SER A C     1 
ATOM   2598 O  O     . SER A 1 326 ? 8.381  3.381   11.143 1.00 7.18  ? 326  SER A O     1 
ATOM   2599 C  CB    . SER A 1 326 ? 10.167 6.194   11.436 1.00 7.02  ? 326  SER A CB    1 
ATOM   2600 O  OG    . SER A 1 326 ? 9.915  7.025   10.303 1.00 8.18  ? 326  SER A OG    1 
ATOM   2601 N  N     . GLU A 1 327 ? 8.790  4.379   9.155  1.00 6.27  ? 327  GLU A N     1 
ATOM   2602 C  CA    A GLU A 1 327 ? 7.648  3.725   8.513  0.50 7.33  ? 327  GLU A CA    1 
ATOM   2603 C  CA    B GLU A 1 327 ? 7.642  3.719   8.532  0.50 7.33  ? 327  GLU A CA    1 
ATOM   2604 C  C     . GLU A 1 327 ? 7.797  2.205   8.542  1.00 6.76  ? 327  GLU A C     1 
ATOM   2605 O  O     . GLU A 1 327 ? 6.849  1.478   8.891  1.00 7.49  ? 327  GLU A O     1 
ATOM   2606 C  CB    A GLU A 1 327 ? 7.507  4.232   7.077  0.50 11.09 ? 327  GLU A CB    1 
ATOM   2607 C  CB    B GLU A 1 327 ? 7.450  4.211   7.107  0.50 11.13 ? 327  GLU A CB    1 
ATOM   2608 C  CG    A GLU A 1 327 ? 7.241  5.768   6.935  0.50 11.47 ? 327  GLU A CG    1 
ATOM   2609 C  CG    B GLU A 1 327 ? 6.203  3.618   6.437  0.50 9.07  ? 327  GLU A CG    1 
ATOM   2610 C  CD    A GLU A 1 327 ? 5.853  6.219   7.352  0.50 20.14 ? 327  GLU A CD    1 
ATOM   2611 C  CD    B GLU A 1 327 ? 4.910  4.017   7.068  0.50 22.41 ? 327  GLU A CD    1 
ATOM   2612 O  OE1   A GLU A 1 327 ? 4.996  5.321   7.526  0.50 23.47 ? 327  GLU A OE1   1 
ATOM   2613 O  OE1   B GLU A 1 327 ? 4.879  4.889   7.961  0.50 21.27 ? 327  GLU A OE1   1 
ATOM   2614 O  OE2   A GLU A 1 327 ? 5.603  7.457   7.481  0.50 10.61 ? 327  GLU A OE2   1 
ATOM   2615 O  OE2   B GLU A 1 327 ? 3.884  3.452   6.643  0.50 19.41 ? 327  GLU A OE2   1 
ATOM   2616 N  N     . TYR A 1 328 ? 8.978  1.722   8.171  1.00 4.72  ? 328  TYR A N     1 
ATOM   2617 C  CA    . TYR A 1 328 ? 9.172  0.272   8.130  1.00 4.70  ? 328  TYR A CA    1 
ATOM   2618 C  C     . TYR A 1 328 ? 9.121  -0.342  9.517  1.00 8.25  ? 328  TYR A C     1 
ATOM   2619 O  O     . TYR A 1 328 ? 8.680  -1.503  9.658  1.00 7.98  ? 328  TYR A O     1 
ATOM   2620 C  CB    . TYR A 1 328 ? 10.498 -0.055  7.461  1.00 4.87  ? 328  TYR A CB    1 
ATOM   2621 C  CG    . TYR A 1 328 ? 10.596 0.207   5.987  1.00 5.95  ? 328  TYR A CG    1 
ATOM   2622 C  CD1   . TYR A 1 328 ? 9.472  0.529   5.209  1.00 6.91  ? 328  TYR A CD1   1 
ATOM   2623 C  CD2   . TYR A 1 328 ? 11.842 0.109   5.377  1.00 5.78  ? 328  TYR A CD2   1 
ATOM   2624 C  CE1   . TYR A 1 328 ? 9.609  0.746   3.835  1.00 6.66  ? 328  TYR A CE1   1 
ATOM   2625 C  CE2   . TYR A 1 328 ? 11.988 0.300   3.953  1.00 5.35  ? 328  TYR A CE2   1 
ATOM   2626 C  CZ    . TYR A 1 328 ? 10.862 0.608   3.221  1.00 7.42  ? 328  TYR A CZ    1 
ATOM   2627 O  OH    . TYR A 1 328 ? 10.927 0.821   1.869  1.00 8.74  ? 328  TYR A OH    1 
ATOM   2628 N  N     . ALA A 1 329 ? 9.604  0.380   10.541 1.00 6.08  ? 329  ALA A N     1 
ATOM   2629 C  CA    . ALA A 1 329 ? 9.578  -0.183  11.886 1.00 7.08  ? 329  ALA A CA    1 
ATOM   2630 C  C     . ALA A 1 329 ? 8.137  -0.370  12.344 1.00 6.38  ? 329  ALA A C     1 
ATOM   2631 O  O     . ALA A 1 329 ? 7.828  -1.348  13.034 1.00 7.78  ? 329  ALA A O     1 
ATOM   2632 C  CB    . ALA A 1 329 ? 10.313 0.770   12.848 1.00 6.75  ? 329  ALA A CB    1 
ATOM   2633 N  N     . VAL A 1 330 ? 7.287  0.624   12.064 1.00 5.65  ? 330  VAL A N     1 
ATOM   2634 C  CA    . VAL A 1 330 ? 5.890  0.512   12.471 1.00 5.13  ? 330  VAL A CA    1 
ATOM   2635 C  C     . VAL A 1 330 ? 5.200  -0.606  11.698 1.00 7.86  ? 330  VAL A C     1 
ATOM   2636 O  O     . VAL A 1 330 ? 4.497  -1.446  12.303 1.00 6.43  ? 330  VAL A O     1 
ATOM   2637 C  CB    . VAL A 1 330 ? 5.186  1.866   12.269 1.00 7.62  ? 330  VAL A CB    1 
ATOM   2638 C  CG1   . VAL A 1 330 ? 3.699  1.707   12.553 1.00 9.44  ? 330  VAL A CG1   1 
ATOM   2639 C  CG2   . VAL A 1 330 ? 5.735  2.851   13.273 1.00 7.02  ? 330  VAL A CG2   1 
ATOM   2640 N  N     . GLN A 1 331 ? 5.306  -0.580  10.378 1.00 6.69  ? 331  GLN A N     1 
ATOM   2641 C  CA    . GLN A 1 331 ? 4.621  -1.610  9.582  1.00 6.19  ? 331  GLN A CA    1 
ATOM   2642 C  C     . GLN A 1 331 ? 5.115  -3.004  9.955  1.00 5.56  ? 331  GLN A C     1 
ATOM   2643 O  O     . GLN A 1 331 ? 4.315  -3.949  10.014 1.00 7.59  ? 331  GLN A O     1 
ATOM   2644 C  CB    . GLN A 1 331 ? 4.875  -1.403  8.108  1.00 11.03 ? 331  GLN A CB    1 
ATOM   2645 C  CG    . GLN A 1 331 ? 4.163  -0.181  7.534  1.00 18.20 ? 331  GLN A CG    1 
ATOM   2646 C  CD    . GLN A 1 331 ? 2.627  -0.157  7.777  1.00 33.32 ? 331  GLN A CD    1 
ATOM   2647 O  OE1   . GLN A 1 331 ? 2.047  0.927   8.027  1.00 36.77 ? 331  GLN A OE1   1 
ATOM   2648 N  NE2   . GLN A 1 331 ? 1.962  -1.340  7.705  1.00 14.97 ? 331  GLN A NE2   1 
ATOM   2649 N  N     . SER A 1 332 ? 6.412  -3.161  10.230 1.00 5.78  ? 332  SER A N     1 
ATOM   2650 C  CA    . SER A 1 332 ? 6.893  -4.507  10.551 1.00 5.10  ? 332  SER A CA    1 
ATOM   2651 C  C     . SER A 1 332 ? 6.461  -4.934  11.934 1.00 7.32  ? 332  SER A C     1 
ATOM   2652 O  O     . SER A 1 332 ? 6.298  -6.148  12.181 1.00 6.93  ? 332  SER A O     1 
ATOM   2653 C  CB    . SER A 1 332 ? 8.424  -4.552  10.476 1.00 7.40  ? 332  SER A CB    1 
ATOM   2654 O  OG    . SER A 1 332 ? 8.860  -4.225  9.160  1.00 6.63  ? 332  SER A OG    1 
ATOM   2655 N  N     . GLY A 1 333 ? 6.275  -3.966  12.838 1.00 6.26  ? 333  GLY A N     1 
ATOM   2656 C  CA    . GLY A 1 333 ? 5.716  -4.301  14.162 1.00 5.92  ? 333  GLY A CA    1 
ATOM   2657 C  C     . GLY A 1 333 ? 4.324  -4.894  14.010 1.00 6.57  ? 333  GLY A C     1 
ATOM   2658 O  O     . GLY A 1 333 ? 3.983  -5.889  14.658 1.00 8.32  ? 333  GLY A O     1 
ATOM   2659 N  N     . LEU A 1 334 ? 3.500  -4.283  13.143 1.00 6.69  ? 334  LEU A N     1 
ATOM   2660 C  CA    . LEU A 1 334 ? 2.176  -4.826  12.864 1.00 7.97  ? 334  LEU A CA    1 
ATOM   2661 C  C     . LEU A 1 334 ? 2.257  -6.214  12.218 1.00 7.47  ? 334  LEU A C     1 
ATOM   2662 O  O     . LEU A 1 334 ? 1.459  -7.100  12.560 1.00 8.63  ? 334  LEU A O     1 
ATOM   2663 C  CB    . LEU A 1 334 ? 1.422  -3.872  11.938 1.00 11.13 ? 334  LEU A CB    1 
ATOM   2664 C  CG    . LEU A 1 334 ? 0.922  -2.646  12.669 1.00 12.02 ? 334  LEU A CG    1 
ATOM   2665 C  CD1   . LEU A 1 334 ? 0.371  -1.710  11.645 1.00 21.68 ? 334  LEU A CD1   1 
ATOM   2666 C  CD2   . LEU A 1 334 ? -0.124 -2.938  13.725 1.00 13.24 ? 334  LEU A CD2   1 
ATOM   2667 N  N     . ASP A 1 335 ? 3.196  -6.410  11.290 1.00 7.17  ? 335  ASP A N     1 
ATOM   2668 C  CA    . ASP A 1 335 ? 3.341  -7.710  10.605 1.00 7.44  ? 335  ASP A CA    1 
ATOM   2669 C  C     . ASP A 1 335 ? 3.772  -8.800  11.576 1.00 8.48  ? 335  ASP A C     1 
ATOM   2670 O  O     . ASP A 1 335 ? 3.344  -9.965  11.446 1.00 8.18  ? 335  ASP A O     1 
ATOM   2671 C  CB    . ASP A 1 335 ? 4.339  -7.603  9.463  1.00 5.39  ? 335  ASP A CB    1 
ATOM   2672 C  CG    . ASP A 1 335 ? 3.788  -6.866  8.261  1.00 16.29 ? 335  ASP A CG    1 
ATOM   2673 O  OD1   . ASP A 1 335 ? 2.573  -6.540  8.245  1.00 13.92 ? 335  ASP A OD1   1 
ATOM   2674 O  OD2   . ASP A 1 335 ? 4.606  -6.564  7.351  1.00 16.51 ? 335  ASP A OD2   1 
ATOM   2675 N  N     . ALA A 1 336 ? 4.650  -8.474  12.539 1.00 5.99  ? 336  ALA A N     1 
ATOM   2676 C  CA    . ALA A 1 336 ? 5.065  -9.490  13.535 1.00 6.01  ? 336  ALA A CA    1 
ATOM   2677 C  C     . ALA A 1 336 ? 3.876  -9.882  14.374 1.00 5.97  ? 336  ALA A C     1 
ATOM   2678 O  O     . ALA A 1 336 ? 3.647  -11.069 14.619 1.00 7.64  ? 336  ALA A O     1 
ATOM   2679 C  CB    . ALA A 1 336 ? 6.182  -8.949  14.462 1.00 7.73  ? 336  ALA A CB    1 
ATOM   2680 N  N     . ILE A 1 337 ? 3.122  -8.898  14.846 1.00 6.35  ? 337  ILE A N     1 
ATOM   2681 C  CA    . ILE A 1 337 ? 1.934  -9.210  15.633 1.00 5.51  ? 337  ILE A CA    1 
ATOM   2682 C  C     . ILE A 1 337 ? 1.028  -10.139 14.847 1.00 9.76  ? 337  ILE A C     1 
ATOM   2683 O  O     . ILE A 1 337 ? 0.539  -11.149 15.386 1.00 10.66 ? 337  ILE A O     1 
ATOM   2684 C  CB    . ILE A 1 337 ? 1.235  -7.891  16.000 1.00 6.22  ? 337  ILE A CB    1 
ATOM   2685 C  CG1   . ILE A 1 337 ? 2.053  -7.224  17.077 1.00 6.41  ? 337  ILE A CG1   1 
ATOM   2686 C  CG2   . ILE A 1 337 ? -0.206 -8.177  16.484 1.00 9.38  ? 337  ILE A CG2   1 
ATOM   2687 C  CD1   . ILE A 1 337 ? 1.627  -5.730  17.253 1.00 9.59  ? 337  ILE A CD1   1 
ATOM   2688 N  N     . GLN A 1 338 ? 0.812  -9.830  13.550 1.00 7.05  ? 338  GLN A N     1 
ATOM   2689 C  CA    . GLN A 1 338 ? -0.121 -10.667 12.766 1.00 8.01  ? 338  GLN A CA    1 
ATOM   2690 C  C     . GLN A 1 338 ? 0.417  -12.101 12.616 1.00 8.53  ? 338  GLN A C     1 
ATOM   2691 O  O     . GLN A 1 338 ? -0.365 -13.064 12.628 1.00 8.63  ? 338  GLN A O     1 
ATOM   2692 C  CB    . GLN A 1 338 ? -0.353 -10.146 11.360 1.00 8.60  ? 338  GLN A CB    1 
ATOM   2693 C  CG    A GLN A 1 338 ? -1.833 -10.636 10.887 0.58 11.61 ? 338  GLN A CG    1 
ATOM   2694 C  CG    B GLN A 1 338 ? -0.931 -8.789  11.127 0.42 12.96 ? 338  GLN A CG    1 
ATOM   2695 C  CD    A GLN A 1 338 ? -3.159 -10.382 11.867 0.58 15.24 ? 338  GLN A CD    1 
ATOM   2696 C  CD    B GLN A 1 338 ? -1.822 -8.850  9.890  0.42 17.24 ? 338  GLN A CD    1 
ATOM   2697 O  OE1   A GLN A 1 338 ? -3.131 -9.630  12.878 0.58 14.62 ? 338  GLN A OE1   1 
ATOM   2698 O  OE1   B GLN A 1 338 ? -2.913 -9.417  9.941  0.42 20.73 ? 338  GLN A OE1   1 
ATOM   2699 N  NE2   A GLN A 1 338 ? -4.295 -11.123 11.544 0.58 10.70 ? 338  GLN A NE2   1 
ATOM   2700 N  NE2   B GLN A 1 338 ? -1.351 -8.311  8.774  0.42 15.02 ? 338  GLN A NE2   1 
ATOM   2701 N  N     . THR A 1 339 ? 1.737  -12.272 12.530 1.00 6.07  ? 339  THR A N     1 
ATOM   2702 C  CA    . THR A 1 339 ? 2.331  -13.627 12.467 1.00 4.63  ? 339  THR A CA    1 
ATOM   2703 C  C     . THR A 1 339 ? 2.011  -14.443 13.721 1.00 9.48  ? 339  THR A C     1 
ATOM   2704 O  O     . THR A 1 339 ? 1.800  -15.655 13.641 1.00 7.18  ? 339  THR A O     1 
ATOM   2705 C  CB    . THR A 1 339 ? 3.851  -13.509 12.301 1.00 6.59  ? 339  THR A CB    1 
ATOM   2706 O  OG1   . THR A 1 339 ? 4.124  -12.704 11.147 1.00 8.66  ? 339  THR A OG1   1 
ATOM   2707 C  CG2   . THR A 1 339 ? 4.476  -14.891 12.114 1.00 6.57  ? 339  THR A CG2   1 
ATOM   2708 N  N     . PHE A 1 340 ? 2.051  -13.802 14.891 1.00 5.86  ? 340  PHE A N     1 
ATOM   2709 C  CA    . PHE A 1 340 ? 1.854  -14.523 16.144 1.00 5.04  ? 340  PHE A CA    1 
ATOM   2710 C  C     . PHE A 1 340 ? 0.368  -14.803 16.441 1.00 7.82  ? 340  PHE A C     1 
ATOM   2711 O  O     . PHE A 1 340 ? 0.068  -15.691 17.260 1.00 9.08  ? 340  PHE A O     1 
ATOM   2712 C  CB    . PHE A 1 340 ? 2.490  -13.760 17.289 1.00 6.12  ? 340  PHE A CB    1 
ATOM   2713 C  CG    . PHE A 1 340 ? 3.942  -14.010 17.440 1.00 7.76  ? 340  PHE A CG    1 
ATOM   2714 C  CD1   . PHE A 1 340 ? 4.859  -13.413 16.590 1.00 9.70  ? 340  PHE A CD1   1 
ATOM   2715 C  CD2   . PHE A 1 340 ? 4.398  -14.799 18.499 1.00 9.84  ? 340  PHE A CD2   1 
ATOM   2716 C  CE1   . PHE A 1 340 ? 6.233  -13.653 16.775 1.00 7.58  ? 340  PHE A CE1   1 
ATOM   2717 C  CE2   . PHE A 1 340 ? 5.746  -15.032 18.679 1.00 10.22 ? 340  PHE A CE2   1 
ATOM   2718 C  CZ    . PHE A 1 340 ? 6.670  -14.450 17.829 1.00 6.82  ? 340  PHE A CZ    1 
ATOM   2719 N  N     . GLY A 1 341 ? -0.560 -14.052 15.861 1.00 8.82  ? 341  GLY A N     1 
ATOM   2720 C  CA    . GLY A 1 341 ? -1.981 -14.277 16.200 1.00 11.55 ? 341  GLY A CA    1 
ATOM   2721 C  C     . GLY A 1 341 ? -2.259 -13.953 17.653 1.00 8.94  ? 341  GLY A C     1 
ATOM   2722 O  O     . GLY A 1 341 ? -1.732 -12.990 18.206 1.00 7.87  ? 341  GLY A O     1 
ATOM   2723 N  N     . GLY A 1 342 ? -3.115 -14.767 18.276 1.00 7.85  ? 342  GLY A N     1 
ATOM   2724 C  CA    . GLY A 1 342 ? -3.458 -14.503 19.682 1.00 8.99  ? 342  GLY A CA    1 
ATOM   2725 C  C     . GLY A 1 342 ? -2.272 -14.516 20.623 1.00 10.10 ? 342  GLY A C     1 
ATOM   2726 O  O     . GLY A 1 342 ? -2.253 -13.833 21.672 1.00 10.15 ? 342  GLY A O     1 
ATOM   2727 N  N     . ALA A 1 343 ? -1.233 -15.274 20.279 1.00 7.73  ? 343  ALA A N     1 
ATOM   2728 C  CA    . ALA A 1 343 ? -0.070 -15.276 21.129 1.00 6.75  ? 343  ALA A CA    1 
ATOM   2729 C  C     . ALA A 1 343 ? 0.690  -13.942 21.162 1.00 8.74  ? 343  ALA A C     1 
ATOM   2730 O  O     . ALA A 1 343 ? 1.510  -13.744 22.057 1.00 9.58  ? 343  ALA A O     1 
ATOM   2731 C  CB    . ALA A 1 343 ? 0.886  -16.385 20.621 1.00 9.68  ? 343  ALA A CB    1 
ATOM   2732 N  N     . ALA A 1 344 ? 0.346  -12.994 20.251 1.00 8.20  ? 344  ALA A N     1 
ATOM   2733 C  CA    . ALA A 1 344 ? 0.966  -11.671 20.312 1.00 7.74  ? 344  ALA A CA    1 
ATOM   2734 C  C     . ALA A 1 344 ? 0.502  -10.897 21.538 1.00 11.73 ? 344  ALA A C     1 
ATOM   2735 O  O     . ALA A 1 344 ? 1.128  -9.906  21.914 1.00 11.41 ? 344  ALA A O     1 
ATOM   2736 C  CB    . ALA A 1 344 ? 0.573  -10.887 19.018 1.00 7.29  ? 344  ALA A CB    1 
ATOM   2737 N  N     . MET A 1 345 ? -0.663 -11.246 22.080 1.00 8.79  ? 345  MET A N     1 
ATOM   2738 C  CA    . MET A 1 345 ? -1.269 -10.441 23.161 1.00 9.71  ? 345  MET A CA    1 
ATOM   2739 C  C     . MET A 1 345 ? -0.780 -10.999 24.485 1.00 20.11 ? 345  MET A C     1 
ATOM   2740 O  O     . MET A 1 345 ? -1.507 -11.639 25.239 1.00 25.81 ? 345  MET A O     1 
ATOM   2741 C  CB    . MET A 1 345 ? -2.795 -10.481 23.045 1.00 15.22 ? 345  MET A CB    1 
ATOM   2742 C  CG    . MET A 1 345 ? -3.419 -9.213  22.375 1.00 20.14 ? 345  MET A CG    1 
ATOM   2743 S  SD    . MET A 1 345 ? -3.633 -9.738  20.746 1.00 39.42 ? 345  MET A SD    1 
ATOM   2744 C  CE    . MET A 1 345 ? -2.275 -8.692  20.099 1.00 18.69 ? 345  MET A CE    1 
ATOM   2745 N  N     . ASP A 1 346 ? 0.505  -10.820 24.711 1.00 16.66 ? 346  ASP A N     1 
ATOM   2746 C  CA    . ASP A 1 346 ? 1.248  -11.523 25.770 1.00 16.99 ? 346  ASP A CA    1 
ATOM   2747 C  C     . ASP A 1 346 ? 2.343  -10.582 26.218 1.00 18.70 ? 346  ASP A C     1 
ATOM   2748 O  O     . ASP A 1 346 ? 3.241  -10.291 25.421 1.00 20.02 ? 346  ASP A O     1 
ATOM   2749 C  CB    . ASP A 1 346 ? 1.830  -12.821 25.272 1.00 17.88 ? 346  ASP A CB    1 
ATOM   2750 C  CG    . ASP A 1 346 ? 2.736  -13.513 26.311 1.00 29.24 ? 346  ASP A CG    1 
ATOM   2751 O  OD1   . ASP A 1 346 ? 3.046  -12.936 27.382 1.00 26.86 ? 346  ASP A OD1   1 
ATOM   2752 O  OD2   . ASP A 1 346 ? 3.143  -14.660 26.069 1.00 28.10 ? 346  ASP A OD2   1 
ATOM   2753 N  N     . GLN A 1 347 ? 2.230  -10.042 27.442 1.00 16.65 ? 347  GLN A N     1 
ATOM   2754 C  CA    . GLN A 1 347 ? 3.135  -8.972  27.831 1.00 13.86 ? 347  GLN A CA    1 
ATOM   2755 C  C     . GLN A 1 347 ? 4.556  -9.478  27.986 1.00 17.96 ? 347  GLN A C     1 
ATOM   2756 O  O     . GLN A 1 347 ? 5.498  -8.675  27.839 1.00 22.35 ? 347  GLN A O     1 
ATOM   2757 C  CB    . GLN A 1 347 ? 2.641  -8.328  29.145 1.00 20.63 ? 347  GLN A CB    1 
ATOM   2758 C  CG    . GLN A 1 347 ? 1.338  -7.554  28.916 1.00 20.18 ? 347  GLN A CG    1 
ATOM   2759 C  CD    . GLN A 1 347 ? 0.794  -6.944  30.183 1.00 22.94 ? 347  GLN A CD    1 
ATOM   2760 O  OE1   . GLN A 1 347 ? 1.104  -7.412  31.280 1.00 24.39 ? 347  GLN A OE1   1 
ATOM   2761 N  NE2   . GLN A 1 347 ? -0.029 -5.899  30.049 1.00 27.67 ? 347  GLN A NE2   1 
ATOM   2762 N  N     . GLU A 1 348 ? 4.736  -10.785 28.210 1.00 19.75 ? 348  GLU A N     1 
ATOM   2763 C  CA    . GLU A 1 348 ? 6.106  -11.293 28.340 1.00 24.71 ? 348  GLU A CA    1 
ATOM   2764 C  C     . GLU A 1 348 ? 6.825  -11.347 27.003 1.00 23.19 ? 348  GLU A C     1 
ATOM   2765 O  O     . GLU A 1 348 ? 8.057  -11.264 26.956 1.00 26.48 ? 348  GLU A O     1 
ATOM   2766 C  CB    . GLU A 1 348 ? 6.100  -12.684 28.966 1.00 27.96 ? 348  GLU A CB    1 
ATOM   2767 C  CG    . GLU A 1 348 ? 5.404  -12.714 30.310 1.00 49.13 ? 348  GLU A CG    1 
ATOM   2768 C  CD    . GLU A 1 348 ? 5.664  -14.005 31.059 1.00 77.76 ? 348  GLU A CD    1 
ATOM   2769 O  OE1   . GLU A 1 348 ? 6.681  -14.065 31.782 1.00 79.23 ? 348  GLU A OE1   1 
ATOM   2770 O  OE2   . GLU A 1 348 ? 4.866  -14.960 30.908 1.00 84.05 ? 348  GLU A OE2   1 
ATOM   2771 N  N     . LEU A 1 349 ? 6.080  -11.475 25.910 1.00 14.81 ? 349  LEU A N     1 
ATOM   2772 C  CA    . LEU A 1 349 ? 6.680  -11.558 24.615 1.00 14.31 ? 349  LEU A CA    1 
ATOM   2773 C  C     . LEU A 1 349 ? 7.090  -10.185 24.118 1.00 13.31 ? 349  LEU A C     1 
ATOM   2774 O  O     . LEU A 1 349 ? 8.056  -10.067 23.373 1.00 17.82 ? 349  LEU A O     1 
ATOM   2775 C  CB    . LEU A 1 349 ? 5.687  -12.178 23.631 1.00 19.56 ? 349  LEU A CB    1 
ATOM   2776 C  CG    A LEU A 1 349 ? 5.641  -13.711 23.602 0.50 22.28 ? 349  LEU A CG    1 
ATOM   2777 C  CG    B LEU A 1 349 ? 6.129  -12.453 22.213 0.50 23.01 ? 349  LEU A CG    1 
ATOM   2778 C  CD1   A LEU A 1 349 ? 4.996  -14.232 22.333 0.50 19.36 ? 349  LEU A CD1   1 
ATOM   2779 C  CD1   B LEU A 1 349 ? 7.310  -13.381 22.199 0.50 23.96 ? 349  LEU A CD1   1 
ATOM   2780 C  CD2   A LEU A 1 349 ? 7.056  -14.342 23.788 0.50 22.81 ? 349  LEU A CD2   1 
ATOM   2781 C  CD2   B LEU A 1 349 ? 4.933  -13.113 21.564 0.50 22.07 ? 349  LEU A CD2   1 
ATOM   2782 N  N     . GLY A 1 350 ? 6.341  -9.151  24.483 1.00 12.19 ? 350  GLY A N     1 
ATOM   2783 C  CA    . GLY A 1 350 ? 6.820  -7.820  24.135 1.00 12.25 ? 350  GLY A CA    1 
ATOM   2784 C  C     . GLY A 1 350 ? 6.511  -7.331  22.741 1.00 14.07 ? 350  GLY A C     1 
ATOM   2785 O  O     . GLY A 1 350 ? 7.058  -6.295  22.361 1.00 13.05 ? 350  GLY A O     1 
ATOM   2786 N  N     . LEU A 1 351 ? 5.673  -8.019  21.962 1.00 10.42 ? 351  LEU A N     1 
ATOM   2787 C  CA    . LEU A 1 351 ? 5.500  -7.587  20.566 1.00 8.83  ? 351  LEU A CA    1 
ATOM   2788 C  C     . LEU A 1 351 ? 4.625  -6.355  20.519 1.00 9.41  ? 351  LEU A C     1 
ATOM   2789 O  O     . LEU A 1 351 ? 4.838  -5.476  19.660 1.00 9.09  ? 351  LEU A O     1 
ATOM   2790 C  CB    . LEU A 1 351 ? 4.838  -8.678  19.717 1.00 9.13  ? 351  LEU A CB    1 
ATOM   2791 C  CG    . LEU A 1 351 ? 5.635  -9.943  19.609 1.00 14.52 ? 351  LEU A CG    1 
ATOM   2792 C  CD1   . LEU A 1 351 ? 4.741  -10.995 18.891 1.00 17.59 ? 351  LEU A CD1   1 
ATOM   2793 C  CD2   . LEU A 1 351 ? 6.953  -9.720  18.890 1.00 17.67 ? 351  LEU A CD2   1 
ATOM   2794 N  N     . VAL A 1 352 ? 3.589  -6.306  21.359 1.00 9.65  ? 352  VAL A N     1 
ATOM   2795 C  CA    . VAL A 1 352 ? 2.750  -5.127  21.345 1.00 9.43  ? 352  VAL A CA    1 
ATOM   2796 C  C     . VAL A 1 352 ? 3.507  -3.924  21.894 1.00 10.00 ? 352  VAL A C     1 
ATOM   2797 O  O     . VAL A 1 352 ? 3.463  -2.819  21.298 1.00 9.99  ? 352  VAL A O     1 
ATOM   2798 C  CB    . VAL A 1 352 ? 1.448  -5.408  22.101 1.00 10.48 ? 352  VAL A CB    1 
ATOM   2799 C  CG1   . VAL A 1 352 ? 0.653  -4.113  22.251 1.00 11.84 ? 352  VAL A CG1   1 
ATOM   2800 C  CG2   . VAL A 1 352 ? 0.611  -6.446  21.294 1.00 11.63 ? 352  VAL A CG2   1 
ATOM   2801 N  N     . ARG A 1 353 ? 4.285  -4.135  22.958 1.00 8.18  ? 353  ARG A N     1 
ATOM   2802 C  CA    . ARG A 1 353 ? 5.108  -3.050  23.479 1.00 8.18  ? 353  ARG A CA    1 
ATOM   2803 C  C     . ARG A 1 353 ? 6.116  -2.582  22.434 1.00 11.73 ? 353  ARG A C     1 
ATOM   2804 O  O     . ARG A 1 353 ? 6.411  -1.392  22.334 1.00 9.81  ? 353  ARG A O     1 
ATOM   2805 C  CB    . ARG A 1 353 ? 5.786  -3.487  24.773 1.00 11.63 ? 353  ARG A CB    1 
ATOM   2806 C  CG    . ARG A 1 353 ? 6.410  -2.222  25.438 1.00 19.39 ? 353  ARG A CG    1 
ATOM   2807 C  CD    . ARG A 1 353 ? 6.257  -2.135  26.965 1.00 27.08 ? 353  ARG A CD    1 
ATOM   2808 N  NE    . ARG A 1 353 ? 4.858  -2.008  27.402 1.00 30.25 ? 353  ARG A NE    1 
ATOM   2809 C  CZ    . ARG A 1 353 ? 4.108  -0.909  27.323 1.00 42.33 ? 353  ARG A CZ    1 
ATOM   2810 N  NH1   . ARG A 1 353 ? 2.848  -0.963  27.739 1.00 26.15 ? 353  ARG A NH1   1 
ATOM   2811 N  NH2   . ARG A 1 353 ? 4.591  0.237   26.822 1.00 24.78 ? 353  ARG A NH2   1 
ATOM   2812 N  N     . HIS A 1 354 ? 6.662  -3.513  21.656 1.00 10.15 ? 354  HIS A N     1 
ATOM   2813 C  CA    . HIS A 1 354 ? 7.582  -3.126  20.594 1.00 8.91  ? 354  HIS A CA    1 
ATOM   2814 C  C     . HIS A 1 354 ? 6.899  -2.172  19.610 1.00 9.89  ? 354  HIS A C     1 
ATOM   2815 O  O     . HIS A 1 354 ? 7.485  -1.158  19.195 1.00 9.90  ? 354  HIS A O     1 
ATOM   2816 C  CB    . HIS A 1 354 ? 8.113  -4.380  19.890 1.00 8.55  ? 354  HIS A CB    1 
ATOM   2817 C  CG    . HIS A 1 354 ? 8.917  -4.046  18.685 1.00 10.58 ? 354  HIS A CG    1 
ATOM   2818 N  ND1   . HIS A 1 354 ? 10.191 -3.534  18.766 1.00 16.67 ? 354  HIS A ND1   1 
ATOM   2819 C  CD2   . HIS A 1 354 ? 8.584  -4.049  17.364 1.00 8.02  ? 354  HIS A CD2   1 
ATOM   2820 C  CE1   . HIS A 1 354 ? 10.638 -3.294  17.544 1.00 15.20 ? 354  HIS A CE1   1 
ATOM   2821 N  NE2   . HIS A 1 354 ? 9.698  -3.636  16.672 1.00 10.40 ? 354  HIS A NE2   1 
ATOM   2822 N  N     . LEU A 1 355 ? 5.674  -2.481  19.206 1.00 7.93  ? 355  LEU A N     1 
ATOM   2823 C  CA    . LEU A 1 355 ? 4.992  -1.593  18.277 1.00 8.29  ? 355  LEU A CA    1 
ATOM   2824 C  C     . LEU A 1 355 ? 4.778  -0.231  18.920 1.00 7.54  ? 355  LEU A C     1 
ATOM   2825 O  O     . LEU A 1 355 ? 4.997  0.794   18.275 1.00 8.19  ? 355  LEU A O     1 
ATOM   2826 C  CB    . LEU A 1 355 ? 3.661  -2.220  17.846 1.00 7.33  ? 355  LEU A CB    1 
ATOM   2827 C  CG    . LEU A 1 355 ? 2.784  -1.263  17.018 1.00 11.10 ? 355  LEU A CG    1 
ATOM   2828 C  CD1   . LEU A 1 355 ? 3.415  -0.933  15.637 1.00 8.95  ? 355  LEU A CD1   1 
ATOM   2829 C  CD2   . LEU A 1 355 ? 1.411  -1.886  16.918 1.00 14.53 ? 355  LEU A CD2   1 
ATOM   2830 N  N     . LEU A 1 356 ? 4.328  -0.205  20.180 1.00 6.71  ? 356  LEU A N     1 
ATOM   2831 C  CA    . LEU A 1 356 ? 4.185  1.084   20.881 1.00 7.42  ? 356  LEU A CA    1 
ATOM   2832 C  C     . LEU A 1 356 ? 5.470  1.862   20.841 1.00 8.25  ? 356  LEU A C     1 
ATOM   2833 O  O     . LEU A 1 356 ? 5.452  3.097   20.656 1.00 10.08 ? 356  LEU A O     1 
ATOM   2834 C  CB    . LEU A 1 356 ? 3.777  0.848   22.347 1.00 8.82  ? 356  LEU A CB    1 
ATOM   2835 C  CG    . LEU A 1 356 ? 2.377  0.289   22.438 1.00 11.82 ? 356  LEU A CG    1 
ATOM   2836 C  CD1   . LEU A 1 356 ? 2.209  -0.111  23.906 1.00 11.52 ? 356  LEU A CD1   1 
ATOM   2837 C  CD2   . LEU A 1 356 ? 1.434  1.398   22.128 1.00 16.56 ? 356  LEU A CD2   1 
ATOM   2838 N  N     . ASN A 1 357 ? 6.590  1.181   21.059 1.00 7.74  ? 357  ASN A N     1 
ATOM   2839 C  CA    . ASN A 1 357 ? 7.857  1.885   21.079 1.00 8.96  ? 357  ASN A CA    1 
ATOM   2840 C  C     . ASN A 1 357 ? 8.249  2.404   19.718 1.00 8.86  ? 357  ASN A C     1 
ATOM   2841 O  O     . ASN A 1 357 ? 9.081  3.322   19.658 1.00 10.92 ? 357  ASN A O     1 
ATOM   2842 C  CB    . ASN A 1 357 ? 8.954  0.956   21.579 1.00 7.79  ? 357  ASN A CB    1 
ATOM   2843 C  CG    . ASN A 1 357 ? 8.806  0.718   23.108 1.00 9.13  ? 357  ASN A CG    1 
ATOM   2844 O  OD1   . ASN A 1 357 ? 8.179  1.487   23.839 1.00 9.62  ? 357  ASN A OD1   1 
ATOM   2845 N  ND2   . ASN A 1 357 ? 9.370  -0.394  23.580 1.00 11.94 ? 357  ASN A ND2   1 
ATOM   2846 N  N     . MET A 1 358 ? 7.749  1.801   18.644 1.00 7.62  ? 358  MET A N     1 
ATOM   2847 C  CA    . MET A 1 358 ? 8.100  2.286   17.314 1.00 6.02  ? 358  MET A CA    1 
ATOM   2848 C  C     . MET A 1 358 ? 7.226  3.416   16.839 1.00 8.37  ? 358  MET A C     1 
ATOM   2849 O  O     . MET A 1 358 ? 7.688  4.216   16.008 1.00 8.12  ? 358  MET A O     1 
ATOM   2850 C  CB    . MET A 1 358 ? 8.012  1.189   16.263 1.00 6.97  ? 358  MET A CB    1 
ATOM   2851 C  CG    . MET A 1 358 ? 8.924  -0.050  16.450 1.00 10.04 ? 358  MET A CG    1 
ATOM   2852 S  SD    . MET A 1 358 ? 10.670 0.421   16.650 1.00 13.05 ? 358  MET A SD    1 
ATOM   2853 C  CE    . MET A 1 358 ? 10.861 0.341   18.487 1.00 16.00 ? 358  MET A CE    1 
ATOM   2854 N  N     . ILE A 1 359 ? 6.022  3.533   17.385 1.00 7.90  ? 359  ILE A N     1 
ATOM   2855 C  CA    . ILE A 1 359 ? 5.088  4.564   16.901 1.00 9.08  ? 359  ILE A CA    1 
ATOM   2856 C  C     . ILE A 1 359 ? 5.718  5.955   16.943 1.00 8.14  ? 359  ILE A C     1 
ATOM   2857 O  O     . ILE A 1 359 ? 5.603  6.706   15.952 1.00 9.26  ? 359  ILE A O     1 
ATOM   2858 C  CB    . ILE A 1 359 ? 3.782  4.482   17.691 1.00 9.52  ? 359  ILE A CB    1 
ATOM   2859 C  CG1   . ILE A 1 359 ? 3.048  3.251   17.155 1.00 11.00 ? 359  ILE A CG1   1 
ATOM   2860 C  CG2   . ILE A 1 359 ? 2.967  5.805   17.536 1.00 11.33 ? 359  ILE A CG2   1 
ATOM   2861 C  CD1   A ILE A 1 359 ? 1.843  2.874   17.988 0.58 10.04 ? 359  ILE A CD1   1 
ATOM   2862 C  CD1   B ILE A 1 359 ? 2.596  3.389   15.834 0.42 8.86  ? 359  ILE A CD1   1 
ATOM   2863 N  N     . PRO A 1 360 ? 6.436  6.359   18.006 1.00 8.68  ? 360  PRO A N     1 
ATOM   2864 C  CA    . PRO A 1 360 ? 6.962  7.736   17.990 1.00 8.60  ? 360  PRO A CA    1 
ATOM   2865 C  C     . PRO A 1 360 ? 8.129  7.965   17.064 1.00 10.13 ? 360  PRO A C     1 
ATOM   2866 O  O     . PRO A 1 360 ? 8.484  9.129   16.847 1.00 11.58 ? 360  PRO A O     1 
ATOM   2867 C  CB    . PRO A 1 360 ? 7.377  8.001   19.445 1.00 11.15 ? 360  PRO A CB    1 
ATOM   2868 C  CG    . PRO A 1 360 ? 6.929  6.820   20.225 1.00 13.20 ? 360  PRO A CG    1 
ATOM   2869 C  CD    . PRO A 1 360 ? 6.659  5.683   19.302 1.00 9.82  ? 360  PRO A CD    1 
ATOM   2870 N  N     . SER A 1 361 ? 8.697  6.933   16.439 1.00 6.20  ? 361  SER A N     1 
ATOM   2871 C  CA    . SER A 1 361 ? 9.810  7.156   15.524 1.00 7.49  ? 361  SER A CA    1 
ATOM   2872 C  C     . SER A 1 361 ? 9.380  7.952   14.309 1.00 9.06  ? 361  SER A C     1 
ATOM   2873 O  O     . SER A 1 361 ? 10.233 8.620   13.684 1.00 9.93  ? 361  SER A O     1 
ATOM   2874 C  CB    . SER A 1 361 ? 10.424 5.835   15.087 1.00 9.43  ? 361  SER A CB    1 
ATOM   2875 O  OG    . SER A 1 361 ? 9.564  5.089   14.263 1.00 9.20  ? 361  SER A OG    1 
ATOM   2876 N  N     . ARG A 1 362 ? 8.081  7.933   13.978 1.00 6.62  ? 362  ARG A N     1 
ATOM   2877 C  CA    . ARG A 1 362 ? 7.601  8.715   12.841 1.00 7.34  ? 362  ARG A CA    1 
ATOM   2878 C  C     . ARG A 1 362 ? 7.382  10.180  13.209 1.00 8.76  ? 362  ARG A C     1 
ATOM   2879 O  O     . ARG A 1 362 ? 7.110  10.975  12.319 1.00 9.24  ? 362  ARG A O     1 
ATOM   2880 C  CB    . ARG A 1 362 ? 6.298  8.144   12.293 1.00 6.73  ? 362  ARG A CB    1 
ATOM   2881 C  CG    . ARG A 1 362 ? 6.505  6.699   11.856 1.00 8.72  ? 362  ARG A CG    1 
ATOM   2882 C  CD    . ARG A 1 362 ? 5.335  6.081   10.970 1.00 14.25 ? 362  ARG A CD    1 
ATOM   2883 N  NE    . ARG A 1 362 ? 4.140  6.232   11.746 1.00 11.71 ? 362  ARG A NE    1 
ATOM   2884 C  CZ    . ARG A 1 362 ? 2.911  5.916   11.282 1.00 27.93 ? 362  ARG A CZ    1 
ATOM   2885 N  NH1   . ARG A 1 362 ? 2.769  5.423   10.057 1.00 24.78 ? 362  ARG A NH1   1 
ATOM   2886 N  NH2   . ARG A 1 362 ? 1.848  6.149   12.043 1.00 21.28 ? 362  ARG A NH2   1 
ATOM   2887 N  N     . ILE A 1 363 ? 7.558  10.541  14.475 1.00 8.76  ? 363  ILE A N     1 
ATOM   2888 C  CA    . ILE A 1 363 ? 7.242  11.888  14.976 1.00 8.54  ? 363  ILE A CA    1 
ATOM   2889 C  C     . ILE A 1 363 ? 8.492  12.626  15.453 1.00 11.51 ? 363  ILE A C     1 
ATOM   2890 O  O     . ILE A 1 363 ? 8.706  13.812  15.120 1.00 11.15 ? 363  ILE A O     1 
ATOM   2891 C  CB    . ILE A 1 363 ? 6.222  11.795  16.109 1.00 7.04  ? 363  ILE A CB    1 
ATOM   2892 C  CG1   . ILE A 1 363 ? 4.942  11.067  15.652 1.00 12.45 ? 363  ILE A CG1   1 
ATOM   2893 C  CG2   . ILE A 1 363 ? 5.846  13.192  16.677 1.00 8.98  ? 363  ILE A CG2   1 
ATOM   2894 C  CD1   . ILE A 1 363 ? 4.074  10.640  16.812 1.00 15.63 ? 363  ILE A CD1   1 
ATOM   2895 N  N     . PHE A 1 364 ? 9.357  11.955  16.221 1.00 10.98 ? 364  PHE A N     1 
ATOM   2896 C  CA    A PHE A 1 364 ? 10.361 12.853  16.776 0.50 12.81 ? 364  PHE A CA    1 
ATOM   2897 C  CA    B PHE A 1 364 ? 10.564 12.576  16.831 0.50 12.84 ? 364  PHE A CA    1 
ATOM   2898 C  C     . PHE A 1 364 ? 11.488 13.141  15.758 1.00 11.39 ? 364  PHE A C     1 
ATOM   2899 O  O     . PHE A 1 364 ? 11.617 12.541  14.672 1.00 12.86 ? 364  PHE A O     1 
ATOM   2900 C  CB    A PHE A 1 364 ? 10.887 12.338  18.125 0.50 13.72 ? 364  PHE A CB    1 
ATOM   2901 C  CB    B PHE A 1 364 ? 11.394 11.546  17.657 0.50 12.34 ? 364  PHE A CB    1 
ATOM   2902 C  CG    A PHE A 1 364 ? 11.236 10.893  18.118 0.50 13.95 ? 364  PHE A CG    1 
ATOM   2903 C  CG    B PHE A 1 364 ? 12.488 10.834  16.841 0.50 10.99 ? 364  PHE A CG    1 
ATOM   2904 C  CD1   A PHE A 1 364 ? 12.234 10.415  17.302 0.50 13.31 ? 364  PHE A CD1   1 
ATOM   2905 C  CD1   B PHE A 1 364 ? 13.815 11.243  16.884 0.50 11.55 ? 364  PHE A CD1   1 
ATOM   2906 C  CD2   A PHE A 1 364 ? 10.578 10.013  18.933 0.50 13.15 ? 364  PHE A CD2   1 
ATOM   2907 C  CD2   B PHE A 1 364 ? 12.177 9.726   16.038 0.50 12.62 ? 364  PHE A CD2   1 
ATOM   2908 C  CE1   A PHE A 1 364 ? 12.548 9.077   17.270 0.50 14.86 ? 364  PHE A CE1   1 
ATOM   2909 C  CE1   B PHE A 1 364 ? 14.788 10.639  16.068 0.50 16.95 ? 364  PHE A CE1   1 
ATOM   2910 C  CE2   A PHE A 1 364 ? 10.875 8.654   18.926 0.50 13.78 ? 364  PHE A CE2   1 
ATOM   2911 C  CE2   B PHE A 1 364 ? 13.157 9.087   15.269 0.50 17.60 ? 364  PHE A CE2   1 
ATOM   2912 C  CZ    A PHE A 1 364 ? 11.875 8.179   18.110 0.50 14.67 ? 364  PHE A CZ    1 
ATOM   2913 C  CZ    B PHE A 1 364 ? 14.469 9.566   15.262 0.50 17.77 ? 364  PHE A CZ    1 
ATOM   2914 N  N     . SER A 1 365 ? 12.209 14.216  16.086 1.00 10.79 ? 365  SER A N     1 
ATOM   2915 C  CA    . SER A 1 365 ? 13.199 14.841  15.217 1.00 13.26 ? 365  SER A CA    1 
ATOM   2916 C  C     . SER A 1 365 ? 12.611 15.318  13.897 1.00 17.31 ? 365  SER A C     1 
ATOM   2917 O  O     . SER A 1 365 ? 13.355 15.510  12.932 1.00 18.63 ? 365  SER A O     1 
ATOM   2918 C  CB    . SER A 1 365 ? 14.395 13.961  14.976 1.00 20.55 ? 365  SER A CB    1 
ATOM   2919 O  OG    A SER A 1 365 ? 15.112 13.878  16.215 0.46 23.54 ? 365  SER A OG    1 
ATOM   2920 O  OG    B SER A 1 365 ? 14.101 12.872  14.118 0.54 23.90 ? 365  SER A OG    1 
ATOM   2921 N  N     . GLY A 1 366 ? 11.300 15.515  13.872 1.00 10.25 ? 366  GLY A N     1 
ATOM   2922 C  CA    . GLY A 1 366 ? 10.644 16.031  12.683 1.00 10.80 ? 366  GLY A CA    1 
ATOM   2923 C  C     . GLY A 1 366 ? 9.744  14.935  12.163 1.00 8.86  ? 366  GLY A C     1 
ATOM   2924 O  O     . GLY A 1 366 ? 10.196 13.811  11.956 1.00 10.50 ? 366  GLY A O     1 
ATOM   2925 N  N     . THR A 1 367 ? 8.471  15.236  11.948 1.00 7.58  ? 367  THR A N     1 
ATOM   2926 C  CA    . THR A 1 367 ? 7.611  14.167  11.477 1.00 7.01  ? 367  THR A CA    1 
ATOM   2927 C  C     . THR A 1 367 ? 7.986  13.698  10.061 1.00 8.23  ? 367  THR A C     1 
ATOM   2928 O  O     . THR A 1 367 ? 8.750  14.297  9.329  1.00 7.44  ? 367  THR A O     1 
ATOM   2929 C  CB    . THR A 1 367 ? 6.167  14.633  11.422 1.00 5.73  ? 367  THR A CB    1 
ATOM   2930 O  OG1   . THR A 1 367 ? 6.089  15.592  10.349 1.00 7.68  ? 367  THR A OG1   1 
ATOM   2931 C  CG2   . THR A 1 367 ? 5.671  15.236  12.753 1.00 9.51  ? 367  THR A CG2   1 
ATOM   2932 N  N     . ASN A 1 368 ? 7.400  12.569  9.665  1.00 6.53  ? 368  ASN A N     1 
ATOM   2933 C  CA    . ASN A 1 368 ? 7.726  12.076  8.337  1.00 6.65  ? 368  ASN A CA    1 
ATOM   2934 C  C     . ASN A 1 368 ? 7.188  12.969  7.225  1.00 7.64  ? 368  ASN A C     1 
ATOM   2935 O  O     . ASN A 1 368 ? 7.799  13.035  6.165  1.00 6.83  ? 368  ASN A O     1 
ATOM   2936 C  CB    . ASN A 1 368 ? 7.198  10.648  8.218  1.00 7.89  ? 368  ASN A CB    1 
ATOM   2937 C  CG    . ASN A 1 368 ? 8.162  9.662   8.888  1.00 11.49 ? 368  ASN A CG    1 
ATOM   2938 O  OD1   . ASN A 1 368 ? 9.256  10.055  9.368  1.00 11.77 ? 368  ASN A OD1   1 
ATOM   2939 N  ND2   . ASN A 1 368 ? 7.740  8.416   8.955  1.00 11.91 ? 368  ASN A ND2   1 
ATOM   2940 N  N     . ASP A 1 369 ? 6.134  13.723  7.499  1.00 8.23  ? 369  ASP A N     1 
ATOM   2941 C  CA    . ASP A 1 369 ? 5.699  14.714  6.504  1.00 6.27  ? 369  ASP A CA    1 
ATOM   2942 C  C     . ASP A 1 369 ? 6.723  15.810  6.344  1.00 6.99  ? 369  ASP A C     1 
ATOM   2943 O  O     . ASP A 1 369 ? 6.960  16.291  5.229  1.00 8.01  ? 369  ASP A O     1 
ATOM   2944 C  CB    . ASP A 1 369 ? 4.358  15.339  6.890  1.00 8.02  ? 369  ASP A CB    1 
ATOM   2945 C  CG    . ASP A 1 369 ? 3.255  14.327  7.031  1.00 12.86 ? 369  ASP A CG    1 
ATOM   2946 O  OD1   . ASP A 1 369 ? 3.099  13.403  6.172  1.00 13.79 ? 369  ASP A OD1   1 
ATOM   2947 O  OD2   . ASP A 1 369 ? 2.574  14.414  8.085  1.00 16.61 ? 369  ASP A OD2   1 
ATOM   2948 N  N     . ILE A 1 370 ? 7.361  16.208  7.457  1.00 7.27  ? 370  ILE A N     1 
ATOM   2949 C  CA    . ILE A 1 370 ? 8.426  17.192  7.405  1.00 6.74  ? 370  ILE A CA    1 
ATOM   2950 C  C     . ILE A 1 370 ? 9.668  16.611  6.722  1.00 9.43  ? 370  ILE A C     1 
ATOM   2951 O  O     . ILE A 1 370 ? 10.352 17.315  5.986  1.00 8.29  ? 370  ILE A O     1 
ATOM   2952 C  CB    . ILE A 1 370 ? 8.709  17.704  8.834  1.00 8.57  ? 370  ILE A CB    1 
ATOM   2953 C  CG1   . ILE A 1 370 ? 7.737  18.845  9.256  1.00 12.75 ? 370  ILE A CG1   1 
ATOM   2954 C  CG2   . ILE A 1 370 ? 10.132 18.247  8.964  1.00 14.21 ? 370  ILE A CG2   1 
ATOM   2955 C  CD1   A ILE A 1 370 ? 6.338  18.744  8.872  0.57 13.33 ? 370  ILE A CD1   1 
ATOM   2956 C  CD1   B ILE A 1 370 ? 7.664  19.976  8.328  0.43 13.67 ? 370  ILE A CD1   1 
ATOM   2957 N  N     . GLN A 1 371 ? 9.983  15.302  6.912  1.00 5.52  ? 371  GLN A N     1 
ATOM   2958 C  CA    . GLN A 1 371 ? 11.076 14.766  6.145  1.00 5.83  ? 371  GLN A CA    1 
ATOM   2959 C  C     . GLN A 1 371 ? 10.796 14.885  4.672  1.00 6.22  ? 371  GLN A C     1 
ATOM   2960 O  O     . GLN A 1 371 ? 11.712 15.121  3.883  1.00 7.93  ? 371  GLN A O     1 
ATOM   2961 C  CB    . GLN A 1 371 ? 11.345 13.277  6.474  1.00 6.61  ? 371  GLN A CB    1 
ATOM   2962 C  CG    . GLN A 1 371 ? 11.599 13.022  7.963  1.00 6.53  ? 371  GLN A CG    1 
ATOM   2963 C  CD    . GLN A 1 371 ? 12.580 14.005  8.566  1.00 7.91  ? 371  GLN A CD    1 
ATOM   2964 O  OE1   . GLN A 1 371 ? 13.633 14.251  7.970  1.00 9.53  ? 371  GLN A OE1   1 
ATOM   2965 N  NE2   . GLN A 1 371 ? 12.205 14.619  9.655  1.00 13.20 ? 371  GLN A NE2   1 
ATOM   2966 N  N     . LYS A 1 372 ? 9.535  14.629  4.265  1.00 6.63  ? 372  LYS A N     1 
ATOM   2967 C  CA    . LYS A 1 372 ? 9.216  14.763  2.832  1.00 7.39  ? 372  LYS A CA    1 
ATOM   2968 C  C     . LYS A 1 372 ? 9.352  16.207  2.370  1.00 6.84  ? 372  LYS A C     1 
ATOM   2969 O  O     . LYS A 1 372 ? 9.805  16.432  1.255  1.00 10.34 ? 372  LYS A O     1 
ATOM   2970 C  CB    . LYS A 1 372 ? 7.780  14.252  2.549  1.00 8.27  ? 372  LYS A CB    1 
ATOM   2971 C  CG    . LYS A 1 372 ? 7.719  12.705  2.685  1.00 10.24 ? 372  LYS A CG    1 
ATOM   2972 C  CD    . LYS A 1 372 ? 6.233  12.276  2.486  1.00 17.99 ? 372  LYS A CD    1 
ATOM   2973 C  CE    . LYS A 1 372 ? 5.893  10.851  2.926  1.00 33.96 ? 372  LYS A CE    1 
ATOM   2974 N  NZ    . LYS A 1 372 ? 4.529  10.454  2.293  1.00 37.23 ? 372  LYS A NZ    1 
ATOM   2975 N  N     . GLU A 1 373 ? 9.027  17.189  3.220  1.00 5.59  ? 373  GLU A N     1 
ATOM   2976 C  CA    . GLU A 1 373 ? 9.279  18.582  2.834  1.00 8.61  ? 373  GLU A CA    1 
ATOM   2977 C  C     . GLU A 1 373 ? 10.753 18.830  2.637  1.00 12.35 ? 373  GLU A C     1 
ATOM   2978 O  O     . GLU A 1 373 ? 11.153 19.578  1.741  1.00 10.51 ? 373  GLU A O     1 
ATOM   2979 C  CB    . GLU A 1 373 ? 8.723  19.538  3.871  1.00 8.09  ? 373  GLU A CB    1 
ATOM   2980 C  CG    . GLU A 1 373 ? 7.151  19.526  3.897  1.00 9.94  ? 373  GLU A CG    1 
ATOM   2981 C  CD    . GLU A 1 373 ? 6.595  19.864  2.481  1.00 17.30 ? 373  GLU A CD    1 
ATOM   2982 O  OE1   . GLU A 1 373 ? 6.737  21.002  2.047  1.00 18.68 ? 373  GLU A OE1   1 
ATOM   2983 O  OE2   . GLU A 1 373 ? 6.098  18.937  1.839  1.00 18.22 ? 373  GLU A OE2   1 
ATOM   2984 N  N     . ILE A 1 374 ? 11.586 18.268  3.517  1.00 8.82  ? 374  ILE A N     1 
ATOM   2985 C  CA    . ILE A 1 374 ? 13.030 18.442  3.349  1.00 7.61  ? 374  ILE A CA    1 
ATOM   2986 C  C     . ILE A 1 374 ? 13.497 17.842  2.033  1.00 9.10  ? 374  ILE A C     1 
ATOM   2987 O  O     . ILE A 1 374 ? 14.253 18.457  1.274  1.00 10.87 ? 374  ILE A O     1 
ATOM   2988 C  CB    . ILE A 1 374 ? 13.748 17.802  4.543  1.00 10.54 ? 374  ILE A CB    1 
ATOM   2989 C  CG1   . ILE A 1 374 ? 13.498 18.648  5.776  1.00 9.52  ? 374  ILE A CG1   1 
ATOM   2990 C  CG2   . ILE A 1 374 ? 15.271 17.700  4.299  1.00 9.98  ? 374  ILE A CG2   1 
ATOM   2991 C  CD1   . ILE A 1 374 ? 13.919 17.920  7.139  1.00 12.03 ? 374  ILE A CD1   1 
ATOM   2992 N  N     . ILE A 1 375 ? 13.058 16.616  1.727  1.00 6.73  ? 375  ILE A N     1 
ATOM   2993 C  CA    . ILE A 1 375 ? 13.467 15.955  0.504  1.00 7.00  ? 375  ILE A CA    1 
ATOM   2994 C  C     . ILE A 1 375 ? 12.948 16.733  -0.705 1.00 9.48  ? 375  ILE A C     1 
ATOM   2995 O  O     . ILE A 1 375 ? 13.663 16.961  -1.661 1.00 10.80 ? 375  ILE A O     1 
ATOM   2996 C  CB    . ILE A 1 375 ? 12.996 14.496  0.503  1.00 8.54  ? 375  ILE A CB    1 
ATOM   2997 C  CG1   . ILE A 1 375 ? 13.655 13.725  1.656  1.00 8.24  ? 375  ILE A CG1   1 
ATOM   2998 C  CG2   . ILE A 1 375 ? 13.335 13.851  -0.836 1.00 7.34  ? 375  ILE A CG2   1 
ATOM   2999 C  CD1   . ILE A 1 375 ? 12.843 12.459  2.040  1.00 9.21  ? 375  ILE A CD1   1 
ATOM   3000 N  N     . ALA A 1 376 ? 11.708 17.201  -0.630 1.00 7.71  ? 376  ALA A N     1 
ATOM   3001 C  CA    . ALA A 1 376 ? 11.146 17.993  -1.729 1.00 7.63  ? 376  ALA A CA    1 
ATOM   3002 C  C     . ALA A 1 376 ? 11.977 19.245  -1.995 1.00 10.48 ? 376  ALA A C     1 
ATOM   3003 O  O     . ALA A 1 376 ? 12.295 19.537  -3.165 1.00 10.97 ? 376  ALA A O     1 
ATOM   3004 C  CB    . ALA A 1 376 ? 9.682  18.397  -1.406 1.00 8.34  ? 376  ALA A CB    1 
ATOM   3005 N  N     . ARG A 1 377 ? 12.428 19.915  -0.927 1.00 8.88  ? 377  ARG A N     1 
ATOM   3006 C  CA    . ARG A 1 377 ? 13.295 21.096  -1.075 1.00 9.14  ? 377  ARG A CA    1 
ATOM   3007 C  C     . ARG A 1 377 ? 14.616 20.712  -1.757 1.00 11.71 ? 377  ARG A C     1 
ATOM   3008 O  O     . ARG A 1 377 ? 15.077 21.413  -2.675 1.00 14.41 ? 377  ARG A O     1 
ATOM   3009 C  CB    . ARG A 1 377 ? 13.531 21.732  0.275  1.00 11.08 ? 377  ARG A CB    1 
ATOM   3010 C  CG    . ARG A 1 377 ? 14.475 22.965  0.138  1.00 17.86 ? 377  ARG A CG    1 
ATOM   3011 C  CD    . ARG A 1 377 ? 14.454 23.807  1.407  1.00 24.02 ? 377  ARG A CD    1 
ATOM   3012 N  NE    A ARG A 1 377 ? 14.628 22.966  2.613  0.56 22.54 ? 377  ARG A NE    1 
ATOM   3013 N  NE    B ARG A 1 377 ? 13.092 24.306  1.702  0.44 23.57 ? 377  ARG A NE    1 
ATOM   3014 C  CZ    A ARG A 1 377 ? 15.787 22.437  3.021  0.56 27.06 ? 377  ARG A CZ    1 
ATOM   3015 C  CZ    B ARG A 1 377 ? 12.491 25.377  1.151  0.44 30.47 ? 377  ARG A CZ    1 
ATOM   3016 N  NH1   A ARG A 1 377 ? 16.901 22.648  2.318  0.56 29.11 ? 377  ARG A NH1   1 
ATOM   3017 N  NH1   B ARG A 1 377 ? 13.084 26.149  0.236  0.44 22.69 ? 377  ARG A NH1   1 
ATOM   3018 N  NH2   A ARG A 1 377 ? 15.844 21.700  4.133  0.56 24.03 ? 377  ARG A NH2   1 
ATOM   3019 N  NH2   B ARG A 1 377 ? 11.262 25.682  1.520  0.44 24.20 ? 377  ARG A NH2   1 
ATOM   3020 N  N     . LYS A 1 378 ? 15.243 19.619  -1.313 1.00 9.67  ? 378  LYS A N     1 
ATOM   3021 C  CA    . LYS A 1 378 ? 16.519 19.183  -1.906 1.00 11.17 ? 378  LYS A CA    1 
ATOM   3022 C  C     . LYS A 1 378 ? 16.356 18.784  -3.368 1.00 17.96 ? 378  LYS A C     1 
ATOM   3023 O  O     . LYS A 1 378 ? 17.259 19.017  -4.176 1.00 18.57 ? 378  LYS A O     1 
ATOM   3024 C  CB    . LYS A 1 378 ? 17.172 18.049  -1.125 1.00 14.29 ? 378  LYS A CB    1 
ATOM   3025 C  CG    . LYS A 1 378 ? 17.550 18.399  0.310  1.00 18.98 ? 378  LYS A CG    1 
ATOM   3026 C  CD    . LYS A 1 378 ? 18.406 19.650  0.418  1.00 28.16 ? 378  LYS A CD    1 
ATOM   3027 C  CE    . LYS A 1 378 ? 19.902 19.375  0.345  1.00 56.21 ? 378  LYS A CE    1 
ATOM   3028 N  NZ    . LYS A 1 378 ? 20.709 20.566  0.819  1.00 42.02 ? 378  LYS A NZ    1 
ATOM   3029 N  N     . LEU A 1 379 ? 15.187 18.254  -3.747 1.00 14.86 ? 379  LEU A N     1 
ATOM   3030 C  CA    . LEU A 1 379 ? 14.871 17.903  -5.120 1.00 12.33 ? 379  LEU A CA    1 
ATOM   3031 C  C     . LEU A 1 379 ? 14.537 19.106  -5.975 1.00 11.50 ? 379  LEU A C     1 
ATOM   3032 O  O     . LEU A 1 379 ? 14.329 18.919  -7.190 1.00 16.07 ? 379  LEU A O     1 
ATOM   3033 C  CB    . LEU A 1 379 ? 13.710 16.894  -5.161 1.00 12.16 ? 379  LEU A CB    1 
ATOM   3034 C  CG    . LEU A 1 379 ? 14.097 15.508  -4.656 1.00 12.00 ? 379  LEU A CG    1 
ATOM   3035 C  CD1   . LEU A 1 379 ? 12.806 14.600  -4.609 1.00 15.26 ? 379  LEU A CD1   1 
ATOM   3036 C  CD2   . LEU A 1 379 ? 15.231 14.901  -5.530 1.00 18.40 ? 379  LEU A CD2   1 
ATOM   3037 N  N     . GLY A 1 380 ? 14.483 20.295  -5.415 1.00 11.97 ? 380  GLY A N     1 
ATOM   3038 C  CA    . GLY A 1 380 ? 14.125 21.482  -6.211 1.00 13.60 ? 380  GLY A CA    1 
ATOM   3039 C  C     . GLY A 1 380 ? 12.659 21.732  -6.403 1.00 14.43 ? 380  GLY A C     1 
ATOM   3040 O  O     . GLY A 1 380 ? 12.287 22.540  -7.281 1.00 13.90 ? 380  GLY A O     1 
ATOM   3041 N  N     . LEU A 1 381 ? 11.786 21.071  -5.617 1.00 12.84 ? 381  LEU A N     1 
ATOM   3042 C  CA    . LEU A 1 381 ? 10.331 21.237  -5.728 1.00 10.21 ? 381  LEU A CA    1 
ATOM   3043 C  C     . LEU A 1 381 ? 9.764  22.316  -4.815 1.00 9.99  ? 381  LEU A C     1 
ATOM   3044 O  O     . LEU A 1 381 ? 8.523  22.447  -4.687 1.00 11.79 ? 381  LEU A O     1 
ATOM   3045 C  CB    . LEU A 1 381 ? 9.623  19.888  -5.402 1.00 6.12  ? 381  LEU A CB    1 
ATOM   3046 C  CG    . LEU A 1 381 ? 10.106 18.817  -6.318 1.00 6.78  ? 381  LEU A CG    1 
ATOM   3047 C  CD1   . LEU A 1 381 ? 9.548  17.451  -5.845 1.00 11.02 ? 381  LEU A CD1   1 
ATOM   3048 C  CD2   . LEU A 1 381 ? 9.647  19.054  -7.800 1.00 17.32 ? 381  LEU A CD2   1 
ATOM   3049 N  N     . ARG A 1 382 ? 10.613 23.122  -4.166 1.00 12.59 ? 382  ARG A N     1 
ATOM   3050 C  CA    . ARG A 1 382 ? 10.149 24.171  -3.245 1.00 11.65 ? 382  ARG A CA    1 
ATOM   3051 C  C     . ARG A 1 382 ? 10.787 25.506  -3.656 1.00 22.60 ? 382  ARG A C     1 
ATOM   3052 O  O     . ARG A 1 382 ? 11.150 26.324  -2.822 1.00 31.38 ? 382  ARG A O     1 
ATOM   3053 C  CB    . ARG A 1 382 ? 10.462 23.837  -1.785 1.00 13.44 ? 382  ARG A CB    1 
ATOM   3054 C  CG    . ARG A 1 382 ? 9.758  22.540  -1.284 1.00 10.33 ? 382  ARG A CG    1 
ATOM   3055 C  CD    . ARG A 1 382 ? 8.287  22.794  -1.079 1.00 10.04 ? 382  ARG A CD    1 
ATOM   3056 N  NE    . ARG A 1 382 ? 7.503  21.615  -0.680 1.00 9.28  ? 382  ARG A NE    1 
ATOM   3057 C  CZ    . ARG A 1 382 ? 6.918  20.768  -1.529 1.00 8.04  ? 382  ARG A CZ    1 
ATOM   3058 N  NH1   . ARG A 1 382 ? 6.141  19.802  -1.038 1.00 9.12  ? 382  ARG A NH1   1 
ATOM   3059 N  NH2   . ARG A 1 382 ? 7.082  20.903  -2.838 1.00 9.65  ? 382  ARG A NH2   1 
ATOM   3060 N  N     . GLY A 1 383 ? 10.918 25.708  -4.961 1.00 28.83 ? 383  GLY A N     1 
ATOM   3061 C  CA    . GLY A 1 383 ? 11.725 26.807  -5.517 1.00 37.41 ? 383  GLY A CA    1 
ATOM   3062 C  C     . GLY A 1 383 ? 11.002 28.144  -5.592 1.00 41.67 ? 383  GLY A C     1 
ATOM   3063 O  O     . GLY A 1 383 ? 10.062 28.379  -4.827 1.00 46.15 ? 383  GLY A O     1 
HETATM 3064 P  PA    . FAD B 2 .   ? 2.613  19.143  14.669 1.00 6.84  ? 501  FAD A PA    1 
HETATM 3065 O  O1A   . FAD B 2 .   ? 1.433  19.720  15.252 1.00 7.08  ? 501  FAD A O1A   1 
HETATM 3066 O  O2A   . FAD B 2 .   ? 3.620  19.973  14.126 1.00 6.65  ? 501  FAD A O2A   1 
HETATM 3067 O  O5B   . FAD B 2 .   ? 2.163  18.143  13.482 1.00 7.78  ? 501  FAD A O5B   1 
HETATM 3068 C  C5B   . FAD B 2 .   ? 0.810  17.629  13.441 1.00 6.24  ? 501  FAD A C5B   1 
HETATM 3069 C  C4B   . FAD B 2 .   ? 0.607  16.972  12.065 1.00 7.39  ? 501  FAD A C4B   1 
HETATM 3070 O  O4B   . FAD B 2 .   ? 0.696  18.013  11.061 1.00 7.48  ? 501  FAD A O4B   1 
HETATM 3071 C  C3B   . FAD B 2 .   ? 1.687  15.954  11.681 1.00 7.22  ? 501  FAD A C3B   1 
HETATM 3072 O  O3B   . FAD B 2 .   ? 1.114  14.961  10.823 1.00 10.90 ? 501  FAD A O3B   1 
HETATM 3073 C  C2B   . FAD B 2 .   ? 2.656  16.810  10.869 1.00 6.24  ? 501  FAD A C2B   1 
HETATM 3074 O  O2B   . FAD B 2 .   ? 3.421  16.060  9.954  1.00 8.02  ? 501  FAD A O2B   1 
HETATM 3075 C  C1B   . FAD B 2 .   ? 1.650  17.674  10.104 1.00 5.95  ? 501  FAD A C1B   1 
HETATM 3076 N  N9A   . FAD B 2 .   ? 2.231  18.884  9.532  1.00 6.59  ? 501  FAD A N9A   1 
HETATM 3077 C  C8A   . FAD B 2 .   ? 2.710  19.994  10.206 1.00 7.24  ? 501  FAD A C8A   1 
HETATM 3078 N  N7A   . FAD B 2 .   ? 3.241  20.890  9.413  1.00 7.62  ? 501  FAD A N7A   1 
HETATM 3079 C  C5A   . FAD B 2 .   ? 3.167  20.308  8.146  1.00 6.61  ? 501  FAD A C5A   1 
HETATM 3080 C  C6A   . FAD B 2 .   ? 3.602  20.736  6.872  1.00 9.82  ? 501  FAD A C6A   1 
HETATM 3081 N  N6A   . FAD B 2 .   ? 4.205  21.908  6.650  1.00 10.17 ? 501  FAD A N6A   1 
HETATM 3082 N  N1A   . FAD B 2 .   ? 3.358  19.913  5.810  1.00 8.12  ? 501  FAD A N1A   1 
HETATM 3083 C  C2A   . FAD B 2 .   ? 2.728  18.746  6.040  1.00 6.96  ? 501  FAD A C2A   1 
HETATM 3084 N  N3A   . FAD B 2 .   ? 2.272  18.252  7.189  1.00 6.20  ? 501  FAD A N3A   1 
HETATM 3085 C  C4A   . FAD B 2 .   ? 2.527  19.086  8.211  1.00 6.73  ? 501  FAD A C4A   1 
HETATM 3086 N  N1    . FAD B 2 .   ? 11.065 18.003  21.291 1.00 7.85  ? 501  FAD A N1    1 
HETATM 3087 C  C2    . FAD B 2 .   ? 12.104 18.639  21.918 1.00 13.70 ? 501  FAD A C2    1 
HETATM 3088 O  O2    . FAD B 2 .   ? 12.312 19.855  21.819 1.00 10.73 ? 501  FAD A O2    1 
HETATM 3089 N  N3    . FAD B 2 .   ? 12.921 17.928  22.734 1.00 8.42  ? 501  FAD A N3    1 
HETATM 3090 C  C4    . FAD B 2 .   ? 12.822 16.536  22.958 1.00 8.99  ? 501  FAD A C4    1 
HETATM 3091 O  O4    . FAD B 2 .   ? 13.578 15.956  23.750 1.00 9.32  ? 501  FAD A O4    1 
HETATM 3092 C  C4X   . FAD B 2 .   ? 11.742 15.880  22.248 1.00 10.40 ? 501  FAD A C4X   1 
HETATM 3093 N  N5    . FAD B 2 .   ? 11.603 14.582  22.410 1.00 8.20  ? 501  FAD A N5    1 
HETATM 3094 C  C5X   . FAD B 2 .   ? 10.506 13.973  21.837 1.00 9.63  ? 501  FAD A C5X   1 
HETATM 3095 C  C6    . FAD B 2 .   ? 10.351 12.601  22.015 1.00 10.82 ? 501  FAD A C6    1 
HETATM 3096 C  C7    . FAD B 2 .   ? 9.285  11.936  21.430 1.00 12.87 ? 501  FAD A C7    1 
HETATM 3097 C  C7M   . FAD B 2 .   ? 9.129  10.451  21.660 1.00 16.35 ? 501  FAD A C7M   1 
HETATM 3098 C  C8    . FAD B 2 .   ? 8.410  12.632  20.588 1.00 10.75 ? 501  FAD A C8    1 
HETATM 3099 C  C8M   . FAD B 2 .   ? 7.224  11.922  19.942 1.00 15.58 ? 501  FAD A C8M   1 
HETATM 3100 C  C9    . FAD B 2 .   ? 8.557  14.003  20.420 1.00 8.83  ? 501  FAD A C9    1 
HETATM 3101 C  C9A   . FAD B 2 .   ? 9.639  14.659  20.984 1.00 7.34  ? 501  FAD A C9A   1 
HETATM 3102 N  N10   . FAD B 2 .   ? 9.863  16.046  20.777 1.00 7.99  ? 501  FAD A N10   1 
HETATM 3103 C  C10   . FAD B 2 .   ? 10.884 16.695  21.456 1.00 9.02  ? 501  FAD A C10   1 
HETATM 3104 C  "C1'" . FAD B 2 .   ? 8.863  16.852  20.019 1.00 8.53  ? 501  FAD A "C1'" 1 
HETATM 3105 C  "C2'" . FAD B 2 .   ? 8.877  16.631  18.505 1.00 6.27  ? 501  FAD A "C2'" 1 
HETATM 3106 O  "O2'" . FAD B 2 .   ? 10.004 17.334  17.988 1.00 11.66 ? 501  FAD A "O2'" 1 
HETATM 3107 C  "C3'" . FAD B 2 .   ? 7.559  17.165  17.912 1.00 7.25  ? 501  FAD A "C3'" 1 
HETATM 3108 O  "O3'" . FAD B 2 .   ? 6.562  16.279  18.414 1.00 8.52  ? 501  FAD A "O3'" 1 
HETATM 3109 C  "C4'" . FAD B 2 .   ? 7.571  17.137  16.391 1.00 10.32 ? 501  FAD A "C4'" 1 
HETATM 3110 O  "O4'" . FAD B 2 .   ? 8.514  18.079  15.876 1.00 11.95 ? 501  FAD A "O4'" 1 
HETATM 3111 C  "C5'" . FAD B 2 .   ? 6.192  17.330  15.798 1.00 7.33  ? 501  FAD A "C5'" 1 
HETATM 3112 O  "O5'" . FAD B 2 .   ? 5.553  18.512  16.389 1.00 5.79  ? 501  FAD A "O5'" 1 
HETATM 3113 P  P     . FAD B 2 .   ? 4.169  18.460  17.001 1.00 8.59  ? 501  FAD A P     1 
HETATM 3114 O  O1P   . FAD B 2 .   ? 4.038  17.280  17.946 1.00 10.77 ? 501  FAD A O1P   1 
HETATM 3115 O  O2P   . FAD B 2 .   ? 3.842  19.804  17.479 1.00 10.97 ? 501  FAD A O2P   1 
HETATM 3116 O  O3P   . FAD B 2 .   ? 3.234  18.080  15.687 1.00 7.06  ? 501  FAD A O3P   1 
HETATM 3117 C  CAA   . O4B C 3 .   ? 23.355 -1.085  38.633 1.00 23.68 ? 502  O4B A CAA   1 
HETATM 3118 O  OAM   . O4B C 3 .   ? 24.605 -0.527  38.822 1.00 24.88 ? 502  O4B A OAM   1 
HETATM 3119 C  CAC   . O4B C 3 .   ? 24.823 -0.150  40.123 1.00 23.37 ? 502  O4B A CAC   1 
HETATM 3120 C  CAD   . O4B C 3 .   ? 26.169 0.546   40.281 1.00 24.40 ? 502  O4B A CAD   1 
HETATM 3121 O  OAO   . O4B C 3 .   ? 27.246 -0.323  39.950 1.00 29.58 ? 502  O4B A OAO   1 
HETATM 3122 C  CAG   . O4B C 3 .   ? 28.499 0.150   40.356 1.00 28.40 ? 502  O4B A CAG   1 
HETATM 3123 C  CAH   . O4B C 3 .   ? 29.631 -0.833  39.949 1.00 29.92 ? 502  O4B A CAH   1 
HETATM 3124 O  OAQ   . O4B C 3 .   ? 29.407 -1.427  38.692 1.00 32.16 ? 502  O4B A OAQ   1 
HETATM 3125 C  CAK   . O4B C 3 .   ? 30.470 -2.195  38.223 1.00 26.73 ? 502  O4B A CAK   1 
HETATM 3126 C  CAL   . O4B C 3 .   ? 30.216 -2.812  36.863 1.00 24.13 ? 502  O4B A CAL   1 
HETATM 3127 O  OAR   . O4B C 3 .   ? 28.970 -3.426  36.776 1.00 27.22 ? 502  O4B A OAR   1 
HETATM 3128 C  CAJ   . O4B C 3 .   ? 28.945 -4.190  35.595 1.00 28.20 ? 502  O4B A CAJ   1 
HETATM 3129 C  CAI   . O4B C 3 .   ? 27.591 -4.864  35.484 1.00 23.45 ? 502  O4B A CAI   1 
HETATM 3130 O  OAP   . O4B C 3 .   ? 26.609 -3.875  35.756 1.00 28.72 ? 502  O4B A OAP   1 
HETATM 3131 C  CAF   . O4B C 3 .   ? 25.378 -4.495  35.850 1.00 21.30 ? 502  O4B A CAF   1 
HETATM 3132 C  CAE   . O4B C 3 .   ? 24.195 -3.542  36.070 1.00 22.44 ? 502  O4B A CAE   1 
HETATM 3133 O  OAN   . O4B C 3 .   ? 24.465 -2.538  37.003 1.00 27.08 ? 502  O4B A OAN   1 
HETATM 3134 C  CAB   . O4B C 3 .   ? 23.295 -1.867  37.326 1.00 19.54 ? 502  O4B A CAB   1 
HETATM 3135 C  CAA   . O4B D 3 .   ? 3.319  -29.814 3.945  1.00 26.76 ? 503  O4B A CAA   1 
HETATM 3136 O  OAM   . O4B D 3 .   ? 2.035  -30.375 3.812  1.00 32.79 ? 503  O4B A OAM   1 
HETATM 3137 C  CAC   . O4B D 3 .   ? 1.699  -31.281 4.822  1.00 31.00 ? 503  O4B A CAC   1 
HETATM 3138 C  CAD   . O4B D 3 .   ? 0.237  -31.724 4.674  1.00 34.20 ? 503  O4B A CAD   1 
HETATM 3139 O  OAO   . O4B D 3 .   ? -0.601 -30.597 4.705  1.00 27.66 ? 503  O4B A OAO   1 
HETATM 3140 C  CAG   . O4B D 3 .   ? -1.948 -30.804 4.512  1.00 24.54 ? 503  O4B A CAG   1 
HETATM 3141 C  CAH   . O4B D 3 .   ? -2.721 -29.504 4.737  1.00 32.58 ? 503  O4B A CAH   1 
HETATM 3142 O  OAQ   . O4B D 3 .   ? -2.520 -28.678 3.628  1.00 32.07 ? 503  O4B A OAQ   1 
HETATM 3143 C  CAK   . O4B D 3 .   ? -3.267 -27.501 3.756  1.00 29.18 ? 503  O4B A CAK   1 
HETATM 3144 C  CAL   . O4B D 3 .   ? -2.906 -26.540 2.616  1.00 27.68 ? 503  O4B A CAL   1 
HETATM 3145 O  OAR   . O4B D 3 .   ? -1.579 -26.122 2.789  1.00 21.06 ? 503  O4B A OAR   1 
HETATM 3146 C  CAJ   . O4B D 3 .   ? -1.187 -25.232 1.735  1.00 17.27 ? 503  O4B A CAJ   1 
HETATM 3147 C  CAI   . O4B D 3 .   ? 0.291  -24.867 1.879  1.00 18.01 ? 503  O4B A CAI   1 
HETATM 3148 O  OAP   . O4B D 3 .   ? 1.098  -26.019 1.877  1.00 21.17 ? 503  O4B A OAP   1 
HETATM 3149 C  CAF   . O4B D 3 .   ? 2.441  -25.616 1.777  1.00 16.26 ? 503  O4B A CAF   1 
HETATM 3150 C  CAE   . O4B D 3 .   ? 3.379  -26.827 1.818  1.00 23.63 ? 503  O4B A CAE   1 
HETATM 3151 O  OAN   . O4B D 3 .   ? 2.989  -27.748 2.798  1.00 27.93 ? 503  O4B A OAN   1 
HETATM 3152 C  CAB   . O4B D 3 .   ? 3.636  -28.988 2.684  1.00 26.18 ? 503  O4B A CAB   1 
HETATM 3153 CL CL    . CL  E 4 .   ? -0.000 -20.925 0.000  0.48 8.77  ? 504  CL  A CL    1 
HETATM 3154 N  N     . PRO F 5 .   ? 15.099 15.521  20.600 1.00 37.20 ? 505  PRO A N     1 
HETATM 3155 C  CA    . PRO F 5 .   ? 14.524 15.320  19.266 1.00 29.91 ? 505  PRO A CA    1 
HETATM 3156 C  C     . PRO F 5 .   ? 13.383 16.281  18.867 1.00 30.23 ? 505  PRO A C     1 
HETATM 3157 O  O     . PRO F 5 .   ? 12.304 15.910  18.417 1.00 13.11 ? 505  PRO A O     1 
HETATM 3158 C  CB    . PRO F 5 .   ? 14.066 13.871  19.343 1.00 28.96 ? 505  PRO A CB    1 
HETATM 3159 C  CG    . PRO F 5 .   ? 15.286 13.210  20.064 1.00 32.98 ? 505  PRO A CG    1 
HETATM 3160 C  CD    . PRO F 5 .   ? 15.702 14.268  21.099 1.00 23.47 ? 505  PRO A CD    1 
HETATM 3161 O  OXT   . PRO F 5 .   ? 13.567 17.495  18.942 1.00 32.16 ? 505  PRO A OXT   1 
HETATM 3162 N  N     . PRO G 5 .   ? 10.507 20.209  15.503 1.00 31.25 ? 506  PRO A N     1 
HETATM 3163 C  CA    . PRO G 5 .   ? 11.745 20.009  14.760 1.00 38.05 ? 506  PRO A CA    1 
HETATM 3164 C  C     . PRO G 5 .   ? 11.639 19.927  13.228 1.00 58.04 ? 506  PRO A C     1 
HETATM 3165 O  O     . PRO G 5 .   ? 10.588 20.210  12.616 1.00 53.90 ? 506  PRO A O     1 
HETATM 3166 C  CB    . PRO G 5 .   ? 12.286 18.728  15.403 1.00 27.57 ? 506  PRO A CB    1 
HETATM 3167 C  CG    . PRO G 5 .   ? 11.987 19.007  16.880 1.00 25.52 ? 506  PRO A CG    1 
HETATM 3168 C  CD    . PRO G 5 .   ? 10.738 19.961  16.938 1.00 29.63 ? 506  PRO A CD    1 
HETATM 3169 N  N     . GLY H 6 .   ? 12.783 19.626  12.614 1.00 50.54 ? 507  GLY A N     1 
HETATM 3170 C  CA    . GLY H 6 .   ? 13.025 19.964  11.222 1.00 47.15 ? 507  GLY A CA    1 
HETATM 3171 C  C     . GLY H 6 .   ? 14.518 20.241  11.063 1.00 64.37 ? 507  GLY A C     1 
HETATM 3172 O  O     . GLY H 6 .   ? 15.328 19.310  11.003 1.00 47.01 ? 507  GLY A O     1 
HETATM 3173 O  OXT   . GLY H 6 .   ? 14.972 21.394  11.023 1.00 47.49 ? 507  GLY A OXT   1 
HETATM 3174 O  O     . HOH I 7 .   ? 7.197  32.785  14.100 1.00 41.06 ? 601  HOH A O     1 
HETATM 3175 O  O     . HOH I 7 .   ? 6.251  28.979  36.186 1.00 36.64 ? 602  HOH A O     1 
HETATM 3176 O  O     . HOH I 7 .   ? 40.255 12.296  19.621 1.00 37.21 ? 603  HOH A O     1 
HETATM 3177 O  O     . HOH I 7 .   ? -1.027 25.615  20.763 1.00 42.71 ? 604  HOH A O     1 
HETATM 3178 O  O     . HOH I 7 .   ? 7.920  -26.897 13.041 1.00 33.36 ? 605  HOH A O     1 
HETATM 3179 O  O     . HOH I 7 .   ? 1.638  -3.516  8.140  1.00 32.80 ? 606  HOH A O     1 
HETATM 3180 O  O     A HOH I 7 .   ? 12.777 -16.526 19.617 0.46 21.70 ? 607  HOH A O     1 
HETATM 3181 O  O     B HOH I 7 .   ? 16.887 -17.296 16.019 0.54 30.90 ? 607  HOH A O     1 
HETATM 3182 O  O     . HOH I 7 .   ? 17.877 -11.154 17.807 1.00 23.17 ? 608  HOH A O     1 
HETATM 3183 O  O     . HOH I 7 .   ? 16.427 23.140  10.569 1.00 50.48 ? 609  HOH A O     1 
HETATM 3184 O  O     . HOH I 7 .   ? 28.932 -9.777  19.733 1.00 45.84 ? 610  HOH A O     1 
HETATM 3185 O  O     . HOH I 7 .   ? 7.263  32.724  32.218 1.00 28.43 ? 611  HOH A O     1 
HETATM 3186 O  O     . HOH I 7 .   ? 17.525 18.661  10.488 1.00 33.12 ? 612  HOH A O     1 
HETATM 3187 O  O     . HOH I 7 .   ? 34.791 -4.097  3.678  1.00 52.58 ? 613  HOH A O     1 
HETATM 3188 O  O     . HOH I 7 .   ? 38.949 26.938  28.564 1.00 40.51 ? 614  HOH A O     1 
HETATM 3189 O  O     . HOH I 7 .   ? 12.158 -3.898  20.948 1.00 32.15 ? 615  HOH A O     1 
HETATM 3190 O  O     . HOH I 7 .   ? 34.501 5.837   23.243 1.00 36.13 ? 616  HOH A O     1 
HETATM 3191 O  O     . HOH I 7 .   ? 34.597 6.857   5.807  1.00 39.92 ? 617  HOH A O     1 
HETATM 3192 O  O     . HOH I 7 .   ? 28.530 16.221  5.395  1.00 45.13 ? 618  HOH A O     1 
HETATM 3193 O  O     . HOH I 7 .   ? 10.080 39.552  32.086 1.00 39.04 ? 619  HOH A O     1 
HETATM 3194 O  O     . HOH I 7 .   ? 7.218  -26.940 16.255 1.00 34.88 ? 620  HOH A O     1 
HETATM 3195 O  O     . HOH I 7 .   ? 26.255 48.643  34.353 1.00 30.26 ? 621  HOH A O     1 
HETATM 3196 O  O     . HOH I 7 .   ? 17.528 6.978   39.731 1.00 33.11 ? 622  HOH A O     1 
HETATM 3197 O  O     . HOH I 7 .   ? 16.462 -10.684 25.404 1.00 41.02 ? 623  HOH A O     1 
HETATM 3198 O  O     . HOH I 7 .   ? 29.609 -8.931  28.220 1.00 27.79 ? 624  HOH A O     1 
HETATM 3199 O  O     . HOH I 7 .   ? 33.631 10.826  -1.363 1.00 39.55 ? 625  HOH A O     1 
HETATM 3200 O  O     . HOH I 7 .   ? 29.110 7.803   34.693 1.00 36.47 ? 626  HOH A O     1 
HETATM 3201 O  O     . HOH I 7 .   ? 10.526 10.874  25.842 1.00 20.53 ? 627  HOH A O     1 
HETATM 3202 O  O     . HOH I 7 .   ? 31.269 30.524  26.621 1.00 29.19 ? 628  HOH A O     1 
HETATM 3203 O  O     . HOH I 7 .   ? 7.687  30.002  10.802 1.00 36.61 ? 629  HOH A O     1 
HETATM 3204 O  O     . HOH I 7 .   ? 6.205  -16.380 0.226  1.00 15.24 ? 630  HOH A O     1 
HETATM 3205 O  O     . HOH I 7 .   ? -1.691 2.561   30.090 1.00 45.80 ? 631  HOH A O     1 
HETATM 3206 O  O     . HOH I 7 .   ? -2.556 -11.944 27.532 1.00 14.76 ? 632  HOH A O     1 
HETATM 3207 O  O     . HOH I 7 .   ? 15.290 -15.061 18.413 1.00 40.71 ? 633  HOH A O     1 
HETATM 3208 O  O     . HOH I 7 .   ? 25.839 14.293  38.723 1.00 34.70 ? 634  HOH A O     1 
HETATM 3209 O  O     . HOH I 7 .   ? 21.492 7.468   0.727  1.00 41.79 ? 635  HOH A O     1 
HETATM 3210 O  O     . HOH I 7 .   ? 21.937 2.622   44.563 1.00 51.79 ? 636  HOH A O     1 
HETATM 3211 O  O     . HOH I 7 .   ? 19.544 20.074  20.286 1.00 21.04 ? 637  HOH A O     1 
HETATM 3212 O  O     . HOH I 7 .   ? -3.045 -12.762 13.061 1.00 24.51 ? 638  HOH A O     1 
HETATM 3213 O  O     . HOH I 7 .   ? -3.870 -12.633 9.515  1.00 18.27 ? 639  HOH A O     1 
HETATM 3214 O  O     . HOH I 7 .   ? 12.446 -8.425  21.952 1.00 35.84 ? 640  HOH A O     1 
HETATM 3215 O  O     . HOH I 7 .   ? 5.335  -23.983 1.566  1.00 19.17 ? 641  HOH A O     1 
HETATM 3216 O  O     . HOH I 7 .   ? 18.729 -10.953 28.555 1.00 37.61 ? 642  HOH A O     1 
HETATM 3217 O  O     . HOH I 7 .   ? 7.627  -26.582 1.611  1.00 35.40 ? 643  HOH A O     1 
HETATM 3218 O  O     . HOH I 7 .   ? 7.875  0.057   40.915 1.00 44.54 ? 644  HOH A O     1 
HETATM 3219 O  O     . HOH I 7 .   ? 0.286  -6.342  9.463  1.00 21.21 ? 645  HOH A O     1 
HETATM 3220 O  O     . HOH I 7 .   ? 3.900  20.412  35.968 1.00 37.49 ? 646  HOH A O     1 
HETATM 3221 O  O     . HOH I 7 .   ? 4.995  28.420  21.352 1.00 20.36 ? 647  HOH A O     1 
HETATM 3222 O  O     . HOH I 7 .   ? 19.039 12.506  37.363 1.00 29.29 ? 648  HOH A O     1 
HETATM 3223 O  O     . HOH I 7 .   ? 7.327  34.989  32.748 1.00 24.65 ? 649  HOH A O     1 
HETATM 3224 O  O     . HOH I 7 .   ? 20.742 39.595  19.585 1.00 35.35 ? 650  HOH A O     1 
HETATM 3225 O  O     . HOH I 7 .   ? 4.692  19.199  37.545 1.00 35.60 ? 651  HOH A O     1 
HETATM 3226 O  O     . HOH I 7 .   ? 20.402 30.249  13.274 1.00 24.60 ? 652  HOH A O     1 
HETATM 3227 O  O     . HOH I 7 .   ? 28.366 9.488   -2.887 1.00 40.86 ? 653  HOH A O     1 
HETATM 3228 O  O     . HOH I 7 .   ? 25.760 25.899  39.859 1.00 43.96 ? 654  HOH A O     1 
HETATM 3229 O  O     . HOH I 7 .   ? 3.458  -9.246  22.905 1.00 18.35 ? 655  HOH A O     1 
HETATM 3230 O  O     . HOH I 7 .   ? 22.698 12.747  37.199 1.00 25.77 ? 656  HOH A O     1 
HETATM 3231 O  O     . HOH I 7 .   ? 24.827 19.932  16.772 1.00 30.65 ? 657  HOH A O     1 
HETATM 3232 O  O     . HOH I 7 .   ? 5.554  -6.130  27.215 1.00 21.62 ? 658  HOH A O     1 
HETATM 3233 O  O     . HOH I 7 .   ? 10.181 16.666  37.308 1.00 29.19 ? 659  HOH A O     1 
HETATM 3234 O  O     . HOH I 7 .   ? 2.274  -20.691 20.285 1.00 27.84 ? 660  HOH A O     1 
HETATM 3235 O  O     . HOH I 7 .   ? 23.383 23.540  10.683 1.00 34.07 ? 661  HOH A O     1 
HETATM 3236 O  O     . HOH I 7 .   ? 4.007  12.294  37.265 1.00 43.51 ? 662  HOH A O     1 
HETATM 3237 O  O     . HOH I 7 .   ? 34.919 -7.229  9.615  1.00 41.45 ? 663  HOH A O     1 
HETATM 3238 O  O     . HOH I 7 .   ? 4.467  30.493  11.561 1.00 26.97 ? 664  HOH A O     1 
HETATM 3239 O  O     . HOH I 7 .   ? 19.277 15.213  38.196 1.00 37.41 ? 665  HOH A O     1 
HETATM 3240 O  O     . HOH I 7 .   ? 2.521  -15.741 23.744 1.00 20.79 ? 666  HOH A O     1 
HETATM 3241 O  O     . HOH I 7 .   ? 17.465 17.637  8.023  1.00 30.96 ? 667  HOH A O     1 
HETATM 3242 O  O     . HOH I 7 .   ? 12.543 37.086  28.001 1.00 17.65 ? 668  HOH A O     1 
HETATM 3243 O  O     . HOH I 7 .   ? 21.634 18.307  39.234 1.00 36.98 ? 669  HOH A O     1 
HETATM 3244 O  O     . HOH I 7 .   ? 6.947  1.277   26.229 1.00 19.26 ? 670  HOH A O     1 
HETATM 3245 O  O     . HOH I 7 .   ? 24.216 8.901   -3.692 1.00 40.73 ? 671  HOH A O     1 
HETATM 3246 O  O     . HOH I 7 .   ? -0.434 11.131  29.285 1.00 19.86 ? 672  HOH A O     1 
HETATM 3247 O  O     . HOH I 7 .   ? 15.125 -5.876  39.871 1.00 25.00 ? 673  HOH A O     1 
HETATM 3248 O  O     . HOH I 7 .   ? 21.876 -12.842 21.184 1.00 47.60 ? 674  HOH A O     1 
HETATM 3249 O  O     . HOH I 7 .   ? 34.536 3.803   28.498 1.00 33.81 ? 675  HOH A O     1 
HETATM 3250 O  O     . HOH I 7 .   ? 24.891 13.029  -1.509 1.00 47.85 ? 676  HOH A O     1 
HETATM 3251 O  O     . HOH I 7 .   ? -1.220 7.035   25.422 1.00 29.55 ? 677  HOH A O     1 
HETATM 3252 O  O     . HOH I 7 .   ? 39.966 20.840  27.855 1.00 46.65 ? 678  HOH A O     1 
HETATM 3253 O  O     . HOH I 7 .   ? 20.998 -13.526 33.903 1.00 39.44 ? 679  HOH A O     1 
HETATM 3254 O  O     . HOH I 7 .   ? 12.378 -5.796  18.632 1.00 33.77 ? 680  HOH A O     1 
HETATM 3255 O  O     . HOH I 7 .   ? 13.877 24.161  -8.656 1.00 28.15 ? 681  HOH A O     1 
HETATM 3256 O  O     . HOH I 7 .   ? 3.002  12.214  3.791  1.00 33.73 ? 682  HOH A O     1 
HETATM 3257 O  O     . HOH I 7 .   ? 31.141 -0.426  20.903 1.00 19.85 ? 683  HOH A O     1 
HETATM 3258 O  O     . HOH I 7 .   ? 22.416 -7.876  5.737  1.00 43.50 ? 684  HOH A O     1 
HETATM 3259 O  O     . HOH I 7 .   ? -0.023 -18.349 17.074 1.00 8.45  ? 685  HOH A O     1 
HETATM 3260 O  O     . HOH I 7 .   ? 8.169  0.737   30.571 1.00 19.65 ? 686  HOH A O     1 
HETATM 3261 O  O     . HOH I 7 .   ? 30.335 1.415   31.894 1.00 22.25 ? 687  HOH A O     1 
HETATM 3262 O  O     . HOH I 7 .   ? 19.409 -9.575  24.163 1.00 25.35 ? 688  HOH A O     1 
HETATM 3263 O  O     . HOH I 7 .   ? 17.500 43.620  24.874 1.00 38.42 ? 689  HOH A O     1 
HETATM 3264 O  O     . HOH I 7 .   ? 33.698 12.107  14.035 1.00 39.99 ? 690  HOH A O     1 
HETATM 3265 O  O     . HOH I 7 .   ? 3.121  -13.362 8.755  1.00 10.91 ? 691  HOH A O     1 
HETATM 3266 O  O     . HOH I 7 .   ? 2.679  -9.232  2.068  1.00 31.41 ? 692  HOH A O     1 
HETATM 3267 O  O     . HOH I 7 .   ? 24.182 42.055  26.397 1.00 44.48 ? 693  HOH A O     1 
HETATM 3268 O  O     . HOH I 7 .   ? 9.889  -11.374 21.912 1.00 32.17 ? 694  HOH A O     1 
HETATM 3269 O  O     . HOH I 7 .   ? 21.762 -5.409  13.838 1.00 16.57 ? 695  HOH A O     1 
HETATM 3270 O  O     . HOH I 7 .   ? 3.462  27.895  14.310 1.00 31.33 ? 696  HOH A O     1 
HETATM 3271 O  O     . HOH I 7 .   ? 25.027 -7.910  33.916 1.00 27.17 ? 697  HOH A O     1 
HETATM 3272 O  O     . HOH I 7 .   ? 17.779 32.959  37.190 1.00 18.76 ? 698  HOH A O     1 
HETATM 3273 O  O     . HOH I 7 .   ? 13.675 17.111  10.778 1.00 19.30 ? 699  HOH A O     1 
HETATM 3274 O  O     . HOH I 7 .   ? 19.364 -0.966  37.656 1.00 21.49 ? 700  HOH A O     1 
HETATM 3275 O  O     . HOH I 7 .   ? 33.173 23.641  19.861 1.00 19.99 ? 701  HOH A O     1 
HETATM 3276 O  O     . HOH I 7 .   ? 34.746 18.813  30.049 1.00 20.64 ? 702  HOH A O     1 
HETATM 3277 O  O     . HOH I 7 .   ? 14.721 26.155  39.776 1.00 30.13 ? 703  HOH A O     1 
HETATM 3278 O  O     . HOH I 7 .   ? 18.111 14.234  26.276 1.00 18.42 ? 704  HOH A O     1 
HETATM 3279 O  O     . HOH I 7 .   ? 23.441 30.378  19.862 1.00 15.97 ? 705  HOH A O     1 
HETATM 3280 O  O     . HOH I 7 .   ? 21.728 25.186  39.879 1.00 39.96 ? 706  HOH A O     1 
HETATM 3281 O  O     . HOH I 7 .   ? 15.497 1.205   32.601 1.00 13.40 ? 707  HOH A O     1 
HETATM 3282 O  O     . HOH I 7 .   ? 2.514  9.900   0.549  1.00 34.21 ? 708  HOH A O     1 
HETATM 3283 O  O     . HOH I 7 .   ? 19.252 -9.815  20.112 1.00 21.98 ? 709  HOH A O     1 
HETATM 3284 O  O     . HOH I 7 .   ? 17.740 -0.985  22.879 1.00 9.85  ? 710  HOH A O     1 
HETATM 3285 O  O     . HOH I 7 .   ? 30.333 19.779  35.070 1.00 45.54 ? 711  HOH A O     1 
HETATM 3286 O  O     . HOH I 7 .   ? 17.532 -10.324 11.842 1.00 21.23 ? 712  HOH A O     1 
HETATM 3287 O  O     . HOH I 7 .   ? 3.830  21.448  19.658 1.00 11.43 ? 713  HOH A O     1 
HETATM 3288 O  O     . HOH I 7 .   ? 9.755  26.722  11.232 1.00 15.95 ? 714  HOH A O     1 
HETATM 3289 O  O     . HOH I 7 .   ? 34.720 -0.417  -5.880 1.00 39.06 ? 715  HOH A O     1 
HETATM 3290 O  O     . HOH I 7 .   ? -3.379 -7.321  14.324 1.00 17.10 ? 716  HOH A O     1 
HETATM 3291 O  O     . HOH I 7 .   ? 33.888 0.845   26.827 1.00 32.71 ? 717  HOH A O     1 
HETATM 3292 O  O     . HOH I 7 .   ? 15.468 17.668  36.063 1.00 18.13 ? 718  HOH A O     1 
HETATM 3293 O  O     . HOH I 7 .   ? 32.305 6.288   10.993 1.00 19.23 ? 719  HOH A O     1 
HETATM 3294 O  O     . HOH I 7 .   ? 9.820  -25.500 10.338 1.00 21.76 ? 720  HOH A O     1 
HETATM 3295 O  O     . HOH I 7 .   ? 15.856 15.894  25.282 1.00 10.93 ? 721  HOH A O     1 
HETATM 3296 O  O     . HOH I 7 .   ? 1.664  5.050   6.414  1.00 41.16 ? 722  HOH A O     1 
HETATM 3297 O  O     . HOH I 7 .   ? 14.278 -9.831  32.143 1.00 22.12 ? 723  HOH A O     1 
HETATM 3298 O  O     . HOH I 7 .   ? 22.912 -5.931  34.282 1.00 23.68 ? 724  HOH A O     1 
HETATM 3299 O  O     . HOH I 7 .   ? 12.241 -1.607  14.918 1.00 16.40 ? 725  HOH A O     1 
HETATM 3300 O  O     . HOH I 7 .   ? 15.399 34.982  38.179 1.00 37.41 ? 726  HOH A O     1 
HETATM 3301 O  O     . HOH I 7 .   ? 9.294  -5.224  23.555 1.00 32.59 ? 727  HOH A O     1 
HETATM 3302 O  O     . HOH I 7 .   ? 18.652 -0.427  26.777 1.00 13.72 ? 728  HOH A O     1 
HETATM 3303 O  O     . HOH I 7 .   ? 3.384  -6.815  4.891  1.00 20.05 ? 729  HOH A O     1 
HETATM 3304 O  O     . HOH I 7 .   ? 28.306 6.963   20.786 1.00 32.04 ? 730  HOH A O     1 
HETATM 3305 O  O     . HOH I 7 .   ? 33.402 7.883   20.858 1.00 28.77 ? 731  HOH A O     1 
HETATM 3306 O  O     . HOH I 7 .   ? 3.693  -4.424  28.050 1.00 27.12 ? 732  HOH A O     1 
HETATM 3307 O  O     . HOH I 7 .   ? 37.513 19.933  32.501 1.00 48.70 ? 733  HOH A O     1 
HETATM 3308 O  O     . HOH I 7 .   ? 8.669  40.079  35.361 1.00 46.12 ? 734  HOH A O     1 
HETATM 3309 O  O     . HOH I 7 .   ? 32.194 6.149   7.136  1.00 28.62 ? 735  HOH A O     1 
HETATM 3310 O  O     . HOH I 7 .   ? 0.110  -11.696 3.346  1.00 16.42 ? 736  HOH A O     1 
HETATM 3311 O  O     . HOH I 7 .   ? 14.946 -18.887 12.605 1.00 22.06 ? 737  HOH A O     1 
HETATM 3312 O  O     . HOH I 7 .   ? 29.131 48.066  33.597 1.00 35.23 ? 738  HOH A O     1 
HETATM 3313 O  O     . HOH I 7 .   ? 12.581 22.269  4.343  1.00 41.36 ? 739  HOH A O     1 
HETATM 3314 O  O     . HOH I 7 .   ? 23.810 39.524  26.001 1.00 25.00 ? 740  HOH A O     1 
HETATM 3315 O  O     . HOH I 7 .   ? 35.544 26.414  31.986 1.00 26.24 ? 741  HOH A O     1 
HETATM 3316 O  O     . HOH I 7 .   ? 36.202 -6.636  6.064  1.00 44.55 ? 742  HOH A O     1 
HETATM 3317 O  O     . HOH I 7 .   ? 27.971 30.974  34.529 1.00 37.86 ? 743  HOH A O     1 
HETATM 3318 O  O     A HOH I 7 .   ? 17.133 -10.912 32.237 0.52 23.17 ? 744  HOH A O     1 
HETATM 3319 O  O     B HOH I 7 .   ? 19.745 -5.261  33.121 0.48 15.77 ? 744  HOH A O     1 
HETATM 3320 O  O     . HOH I 7 .   ? 4.495  34.934  22.268 1.00 39.82 ? 745  HOH A O     1 
HETATM 3321 O  O     . HOH I 7 .   ? 35.466 8.569   28.858 1.00 27.98 ? 746  HOH A O     1 
HETATM 3322 O  O     . HOH I 7 .   ? 2.706  -22.408 0.118  1.00 15.27 ? 747  HOH A O     1 
HETATM 3323 O  O     . HOH I 7 .   ? 34.745 14.365  15.650 1.00 46.23 ? 748  HOH A O     1 
HETATM 3324 O  O     . HOH I 7 .   ? 34.557 20.490  18.378 1.00 34.68 ? 749  HOH A O     1 
HETATM 3325 O  O     . HOH I 7 .   ? 9.987  -2.980  13.985 1.00 11.82 ? 750  HOH A O     1 
HETATM 3326 O  O     . HOH I 7 .   ? 19.818 7.407   2.709  1.00 21.79 ? 751  HOH A O     1 
HETATM 3327 O  O     . HOH I 7 .   ? 13.508 23.455  -3.731 1.00 18.23 ? 752  HOH A O     1 
HETATM 3328 O  O     . HOH I 7 .   ? 6.881  35.001  24.054 1.00 38.30 ? 753  HOH A O     1 
HETATM 3329 O  O     . HOH I 7 .   ? 20.565 30.268  34.358 1.00 27.50 ? 754  HOH A O     1 
HETATM 3330 O  O     . HOH I 7 .   ? 4.585  22.731  1.634  1.00 24.91 ? 755  HOH A O     1 
HETATM 3331 O  O     . HOH I 7 .   ? 7.121  10.006  30.254 1.00 16.36 ? 756  HOH A O     1 
HETATM 3332 O  O     . HOH I 7 .   ? 13.490 -9.066  34.514 1.00 31.00 ? 757  HOH A O     1 
HETATM 3333 O  O     . HOH I 7 .   ? 10.153 -16.659 18.466 1.00 14.11 ? 758  HOH A O     1 
HETATM 3334 O  O     . HOH I 7 .   ? 29.612 28.612  23.373 1.00 19.27 ? 759  HOH A O     1 
HETATM 3335 O  O     . HOH I 7 .   ? 12.016 -22.125 15.319 1.00 18.42 ? 760  HOH A O     1 
HETATM 3336 O  O     . HOH I 7 .   ? 8.426  35.622  26.160 1.00 38.18 ? 761  HOH A O     1 
HETATM 3337 O  O     . HOH I 7 .   ? 19.818 37.246  17.583 1.00 23.30 ? 762  HOH A O     1 
HETATM 3338 O  O     . HOH I 7 .   ? 11.540 33.677  38.653 1.00 33.83 ? 763  HOH A O     1 
HETATM 3339 O  O     . HOH I 7 .   ? 4.699  -1.376  31.402 1.00 38.34 ? 764  HOH A O     1 
HETATM 3340 O  O     . HOH I 7 .   ? 26.223 3.677   37.481 1.00 25.15 ? 765  HOH A O     1 
HETATM 3341 O  O     . HOH I 7 .   ? 4.823  6.463   31.436 1.00 18.82 ? 766  HOH A O     1 
HETATM 3342 O  O     . HOH I 7 .   ? 17.832 15.830  7.029  1.00 22.84 ? 767  HOH A O     1 
HETATM 3343 O  O     . HOH I 7 .   ? 33.848 21.081  35.482 1.00 43.18 ? 768  HOH A O     1 
HETATM 3344 O  O     . HOH I 7 .   ? 11.806 0.387   27.355 1.00 12.92 ? 769  HOH A O     1 
HETATM 3345 O  O     . HOH I 7 .   ? 34.305 -8.430  15.545 1.00 43.57 ? 770  HOH A O     1 
HETATM 3346 O  O     . HOH I 7 .   ? 35.791 2.242   12.606 1.00 38.56 ? 771  HOH A O     1 
HETATM 3347 O  O     . HOH I 7 .   ? -4.841 -16.679 3.249  1.00 19.25 ? 772  HOH A O     1 
HETATM 3348 O  O     . HOH I 7 .   ? 10.213 24.076  10.261 1.00 31.56 ? 773  HOH A O     1 
HETATM 3349 O  O     . HOH I 7 .   ? 7.765  37.195  33.506 1.00 42.14 ? 774  HOH A O     1 
HETATM 3350 O  O     . HOH I 7 .   ? 14.660 7.665   36.507 1.00 22.95 ? 775  HOH A O     1 
HETATM 3351 O  O     . HOH I 7 .   ? 12.823 -14.041 20.624 1.00 33.54 ? 776  HOH A O     1 
HETATM 3352 O  O     . HOH I 7 .   ? 37.116 25.194  21.427 1.00 35.67 ? 777  HOH A O     1 
HETATM 3353 O  O     . HOH I 7 .   ? 29.195 31.807  25.243 1.00 30.50 ? 778  HOH A O     1 
HETATM 3354 O  O     . HOH I 7 .   ? 5.656  -5.845  16.975 1.00 12.68 ? 779  HOH A O     1 
HETATM 3355 O  O     . HOH I 7 .   ? 8.088  7.844   31.796 1.00 22.35 ? 780  HOH A O     1 
HETATM 3356 O  O     . HOH I 7 .   ? 39.147 -2.573  17.228 1.00 43.61 ? 781  HOH A O     1 
HETATM 3357 O  O     . HOH I 7 .   ? 22.234 21.711  39.392 1.00 40.04 ? 782  HOH A O     1 
HETATM 3358 O  O     . HOH I 7 .   ? -1.602 -14.386 24.380 1.00 17.70 ? 783  HOH A O     1 
HETATM 3359 O  O     . HOH I 7 .   ? 27.234 17.346  11.752 1.00 44.96 ? 784  HOH A O     1 
HETATM 3360 O  O     . HOH I 7 .   ? 23.920 -9.030  15.465 1.00 34.06 ? 785  HOH A O     1 
HETATM 3361 O  O     . HOH I 7 .   ? 7.878  23.427  2.993  1.00 37.12 ? 786  HOH A O     1 
HETATM 3362 O  O     . HOH I 7 .   ? 6.143  10.123  -0.024 1.00 20.36 ? 787  HOH A O     1 
HETATM 3363 O  O     . HOH I 7 .   ? 10.750 6.390   33.909 1.00 24.89 ? 788  HOH A O     1 
HETATM 3364 O  O     . HOH I 7 .   ? 38.709 18.661  21.189 1.00 41.91 ? 789  HOH A O     1 
HETATM 3365 O  O     . HOH I 7 .   ? 21.525 35.323  12.760 1.00 29.42 ? 790  HOH A O     1 
HETATM 3366 O  O     . HOH I 7 .   ? 6.605  23.450  34.755 1.00 24.43 ? 791  HOH A O     1 
HETATM 3367 O  O     . HOH I 7 .   ? 23.393 -12.619 28.316 1.00 46.55 ? 792  HOH A O     1 
HETATM 3368 O  O     . HOH I 7 .   ? 9.294  -1.340  0.953  1.00 37.52 ? 793  HOH A O     1 
HETATM 3369 O  O     . HOH I 7 .   ? 15.428 -16.624 13.683 1.00 21.74 ? 794  HOH A O     1 
HETATM 3370 O  O     . HOH I 7 .   ? 23.020 14.760  39.651 1.00 36.24 ? 795  HOH A O     1 
HETATM 3371 O  O     . HOH I 7 .   ? 2.161  14.586  35.188 1.00 30.45 ? 796  HOH A O     1 
HETATM 3372 O  O     A HOH I 7 .   ? 13.030 8.259   14.175 0.38 8.40  ? 797  HOH A O     1 
HETATM 3373 O  O     B HOH I 7 .   ? 13.712 6.709   12.188 0.62 11.14 ? 797  HOH A O     1 
HETATM 3374 O  O     . HOH I 7 .   ? 7.452  19.767  39.270 1.00 40.46 ? 798  HOH A O     1 
HETATM 3375 O  O     . HOH I 7 .   ? 11.664 -9.828  19.921 1.00 23.65 ? 799  HOH A O     1 
HETATM 3376 O  O     . HOH I 7 .   ? 39.349 18.222  28.967 1.00 43.88 ? 800  HOH A O     1 
HETATM 3377 O  O     . HOH I 7 .   ? -2.257 -4.783  31.481 1.00 34.95 ? 801  HOH A O     1 
HETATM 3378 O  O     . HOH I 7 .   ? 20.777 32.746  37.130 1.00 27.30 ? 802  HOH A O     1 
HETATM 3379 O  O     . HOH I 7 .   ? 34.985 26.361  20.434 1.00 41.95 ? 803  HOH A O     1 
HETATM 3380 O  O     . HOH I 7 .   ? 23.532 39.622  23.148 1.00 37.49 ? 804  HOH A O     1 
HETATM 3381 O  O     . HOH I 7 .   ? -0.096 -26.994 16.945 1.00 21.84 ? 805  HOH A O     1 
HETATM 3382 O  O     . HOH I 7 .   ? 17.220 -3.903  36.694 1.00 24.26 ? 806  HOH A O     1 
HETATM 3383 O  O     . HOH I 7 .   ? 23.265 20.753  37.337 1.00 29.01 ? 807  HOH A O     1 
HETATM 3384 O  O     . HOH I 7 .   ? -1.431 -9.537  5.234  1.00 39.67 ? 808  HOH A O     1 
HETATM 3385 O  O     . HOH I 7 .   ? 33.376 11.564  10.554 1.00 45.97 ? 809  HOH A O     1 
HETATM 3386 O  O     . HOH I 7 .   ? 5.095  22.996  4.115  1.00 20.29 ? 810  HOH A O     1 
HETATM 3387 O  O     . HOH I 7 .   ? 7.961  17.956  12.828 1.00 12.16 ? 811  HOH A O     1 
HETATM 3388 O  O     . HOH I 7 .   ? 28.714 34.235  24.737 1.00 37.85 ? 812  HOH A O     1 
HETATM 3389 O  O     . HOH I 7 .   ? 20.264 -10.773 26.971 1.00 39.83 ? 813  HOH A O     1 
HETATM 3390 O  O     . HOH I 7 .   ? 31.270 -5.201  25.596 1.00 19.60 ? 814  HOH A O     1 
HETATM 3391 O  O     A HOH I 7 .   ? 30.126 18.211  36.638 0.49 22.19 ? 815  HOH A O     1 
HETATM 3392 O  O     B HOH I 7 .   ? 28.745 18.011  38.441 0.51 28.68 ? 815  HOH A O     1 
HETATM 3393 O  O     . HOH I 7 .   ? 9.878  -1.257  26.311 1.00 22.15 ? 816  HOH A O     1 
HETATM 3394 O  O     . HOH I 7 .   ? 15.358 -12.131 18.437 1.00 20.31 ? 817  HOH A O     1 
HETATM 3395 O  O     . HOH I 7 .   ? 7.147  29.716  24.800 1.00 17.58 ? 818  HOH A O     1 
HETATM 3396 O  O     . HOH I 7 .   ? 12.583 28.574  40.461 1.00 35.67 ? 819  HOH A O     1 
HETATM 3397 O  O     . HOH I 7 .   ? 16.230 -10.930 35.697 1.00 37.42 ? 820  HOH A O     1 
HETATM 3398 O  O     . HOH I 7 .   ? 7.461  35.853  21.844 1.00 43.95 ? 821  HOH A O     1 
HETATM 3399 O  O     . HOH I 7 .   ? 2.828  -4.081  6.654  1.00 26.19 ? 822  HOH A O     1 
HETATM 3400 O  O     . HOH I 7 .   ? 10.918 -3.060  23.322 1.00 28.63 ? 823  HOH A O     1 
HETATM 3401 O  O     . HOH I 7 .   ? 30.337 27.771  17.520 1.00 31.72 ? 824  HOH A O     1 
HETATM 3402 O  O     . HOH I 7 .   ? 5.551  -30.384 10.278 1.00 46.55 ? 825  HOH A O     1 
HETATM 3403 O  O     . HOH I 7 .   ? 11.879 22.618  38.846 1.00 19.54 ? 826  HOH A O     1 
HETATM 3404 O  O     . HOH I 7 .   ? 35.271 -4.847  -2.235 1.00 43.96 ? 827  HOH A O     1 
HETATM 3405 O  O     . HOH I 7 .   ? 1.583  18.233  19.229 1.00 13.23 ? 828  HOH A O     1 
HETATM 3406 O  O     . HOH I 7 .   ? 37.068 1.704   10.101 1.00 33.43 ? 829  HOH A O     1 
HETATM 3407 O  O     . HOH I 7 .   ? 1.356  -33.094 8.200  1.00 29.09 ? 830  HOH A O     1 
HETATM 3408 O  O     . HOH I 7 .   ? 9.529  35.155  17.723 1.00 40.16 ? 831  HOH A O     1 
HETATM 3409 O  O     . HOH I 7 .   ? 37.076 -1.054  17.124 1.00 35.14 ? 832  HOH A O     1 
HETATM 3410 O  O     . HOH I 7 .   ? -0.814 -28.804 13.119 1.00 18.38 ? 833  HOH A O     1 
HETATM 3411 O  O     . HOH I 7 .   ? 22.234 27.947  34.691 1.00 16.30 ? 834  HOH A O     1 
HETATM 3412 O  O     . HOH I 7 .   ? 33.238 7.397   29.791 1.00 26.19 ? 835  HOH A O     1 
HETATM 3413 O  O     . HOH I 7 .   ? 32.930 18.424  32.425 1.00 22.35 ? 836  HOH A O     1 
HETATM 3414 O  O     . HOH I 7 .   ? 15.079 22.918  38.108 1.00 23.90 ? 837  HOH A O     1 
HETATM 3415 O  O     . HOH I 7 .   ? 35.331 -0.039  -2.315 1.00 42.69 ? 838  HOH A O     1 
HETATM 3416 O  O     . HOH I 7 .   ? 33.929 15.372  34.418 1.00 45.42 ? 839  HOH A O     1 
HETATM 3417 O  O     . HOH I 7 .   ? 17.271 -12.986 7.883  1.00 19.40 ? 840  HOH A O     1 
HETATM 3418 O  O     . HOH I 7 .   ? 4.485  -30.710 7.319  1.00 44.94 ? 841  HOH A O     1 
HETATM 3419 O  O     . HOH I 7 .   ? 9.875  24.235  -7.623 1.00 24.26 ? 842  HOH A O     1 
HETATM 3420 O  O     . HOH I 7 .   ? 36.727 10.160  30.657 1.00 31.21 ? 843  HOH A O     1 
HETATM 3421 O  O     . HOH I 7 .   ? 6.590  -1.395  3.199  1.00 27.57 ? 844  HOH A O     1 
HETATM 3422 O  O     . HOH I 7 .   ? 3.713  28.095  22.562 1.00 32.22 ? 845  HOH A O     1 
HETATM 3423 O  O     . HOH I 7 .   ? 22.765 27.974  37.736 1.00 40.77 ? 846  HOH A O     1 
HETATM 3424 O  O     . HOH I 7 .   ? 22.169 7.461   39.546 1.00 28.70 ? 847  HOH A O     1 
HETATM 3425 O  O     . HOH I 7 .   ? 3.893  -6.543  24.670 1.00 12.72 ? 848  HOH A O     1 
HETATM 3426 O  O     . HOH I 7 .   ? 5.208  18.253  27.824 1.00 17.64 ? 849  HOH A O     1 
HETATM 3427 O  O     . HOH I 7 .   ? 14.266 38.475  22.590 1.00 38.00 ? 850  HOH A O     1 
HETATM 3428 O  O     . HOH I 7 .   ? 10.731 22.445  2.470  1.00 38.44 ? 851  HOH A O     1 
HETATM 3429 O  O     . HOH I 7 .   ? 11.229 25.160  40.392 1.00 38.66 ? 852  HOH A O     1 
HETATM 3430 O  O     . HOH I 7 .   ? 21.439 16.376  0.563  1.00 35.29 ? 853  HOH A O     1 
HETATM 3431 O  O     . HOH I 7 .   ? 13.466 -9.527  38.762 1.00 34.13 ? 854  HOH A O     1 
HETATM 3432 O  O     . HOH I 7 .   ? 37.363 18.172  30.379 1.00 35.67 ? 855  HOH A O     1 
HETATM 3433 O  O     . HOH I 7 .   ? 11.271 -21.314 18.858 1.00 37.47 ? 856  HOH A O     1 
HETATM 3434 O  O     . HOH I 7 .   ? 0.660  3.807   8.675  1.00 34.21 ? 857  HOH A O     1 
HETATM 3435 O  O     . HOH I 7 .   ? 4.333  10.674  6.101  1.00 33.14 ? 858  HOH A O     1 
HETATM 3436 O  O     . HOH I 7 .   ? 9.732  -3.133  0.370  1.00 30.21 ? 859  HOH A O     1 
HETATM 3437 O  O     . HOH I 7 .   ? 16.548 15.712  38.085 1.00 27.18 ? 860  HOH A O     1 
HETATM 3438 O  O     . HOH I 7 .   ? 16.816 43.699  28.490 1.00 42.27 ? 861  HOH A O     1 
HETATM 3439 O  O     . HOH I 7 .   ? 37.014 20.449  20.641 1.00 31.10 ? 862  HOH A O     1 
HETATM 3440 O  O     . HOH I 7 .   ? -0.366 22.461  21.393 1.00 33.90 ? 863  HOH A O     1 
HETATM 3441 O  O     . HOH I 7 .   ? 16.175 -22.315 9.554  1.00 28.89 ? 864  HOH A O     1 
HETATM 3442 O  O     . HOH I 7 .   ? 6.897  32.544  24.899 1.00 29.82 ? 865  HOH A O     1 
HETATM 3443 O  O     . HOH I 7 .   ? 34.686 -6.422  19.983 1.00 36.44 ? 866  HOH A O     1 
HETATM 3444 O  O     . HOH I 7 .   ? 12.225 5.502   36.924 1.00 22.11 ? 867  HOH A O     1 
HETATM 3445 O  O     . HOH I 7 .   ? 0.000  -12.194 0.000  0.50 18.67 ? 868  HOH A O     1 
HETATM 3446 O  O     . HOH I 7 .   ? 7.932  -8.471  35.277 1.00 47.68 ? 869  HOH A O     1 
HETATM 3447 O  O     . HOH I 7 .   ? 26.661 10.557  38.678 1.00 29.49 ? 870  HOH A O     1 
HETATM 3448 O  O     . HOH I 7 .   ? 8.656  13.695  38.040 1.00 27.78 ? 871  HOH A O     1 
HETATM 3449 O  O     . HOH I 7 .   ? 25.199 33.578  13.906 1.00 41.95 ? 872  HOH A O     1 
HETATM 3450 O  O     . HOH I 7 .   ? 33.413 3.537   6.616  1.00 31.37 ? 873  HOH A O     1 
HETATM 3451 O  O     . HOH I 7 .   ? 5.934  -3.726  2.209  1.00 37.13 ? 874  HOH A O     1 
HETATM 3452 O  O     . HOH I 7 .   ? 21.377 13.006  -2.018 1.00 45.70 ? 875  HOH A O     1 
HETATM 3453 O  O     . HOH I 7 .   ? 9.291  33.922  13.891 1.00 33.15 ? 876  HOH A O     1 
HETATM 3454 O  O     . HOH I 7 .   ? 27.773 36.400  18.682 1.00 31.17 ? 877  HOH A O     1 
HETATM 3455 O  O     . HOH I 7 .   ? 36.199 29.251  22.514 1.00 28.12 ? 878  HOH A O     1 
HETATM 3456 O  O     . HOH I 7 .   ? 7.896  22.350  -7.672 1.00 20.82 ? 879  HOH A O     1 
HETATM 3457 O  O     . HOH I 7 .   ? 14.154 -0.725  18.154 1.00 35.01 ? 880  HOH A O     1 
HETATM 3458 O  O     . HOH I 7 .   ? 29.115 35.102  31.825 1.00 21.95 ? 881  HOH A O     1 
HETATM 3459 O  O     . HOH I 7 .   ? 19.687 -8.897  10.259 1.00 21.31 ? 882  HOH A O     1 
HETATM 3460 O  O     . HOH I 7 .   ? 16.703 -17.651 9.174  1.00 32.02 ? 883  HOH A O     1 
HETATM 3461 O  O     . HOH I 7 .   ? 33.532 24.964  17.516 1.00 44.90 ? 884  HOH A O     1 
HETATM 3462 O  O     . HOH I 7 .   ? 10.820 -2.346  21.525 1.00 18.14 ? 885  HOH A O     1 
HETATM 3463 O  O     . HOH I 7 .   ? 7.506  29.420  -3.477 1.00 40.37 ? 886  HOH A O     1 
HETATM 3464 O  O     . HOH I 7 .   ? 28.142 29.202  16.236 1.00 21.30 ? 887  HOH A O     1 
HETATM 3465 O  O     . HOH I 7 .   ? 28.044 16.320  -1.860 1.00 38.92 ? 888  HOH A O     1 
HETATM 3466 O  O     . HOH I 7 .   ? -2.657 28.570  19.820 1.00 51.85 ? 889  HOH A O     1 
HETATM 3467 O  O     . HOH I 7 .   ? 10.220 -9.155  26.329 1.00 46.40 ? 890  HOH A O     1 
HETATM 3468 O  O     . HOH I 7 .   ? 1.445  7.138   24.349 1.00 4.78  ? 891  HOH A O     1 
HETATM 3469 O  O     . HOH I 7 .   ? 29.756 28.793  31.772 1.00 36.57 ? 892  HOH A O     1 
HETATM 3470 O  O     . HOH I 7 .   ? 25.699 -4.843  10.327 1.00 40.38 ? 893  HOH A O     1 
HETATM 3471 O  O     . HOH I 7 .   ? 36.053 30.214  25.894 1.00 27.97 ? 894  HOH A O     1 
HETATM 3472 O  O     . HOH I 7 .   ? 41.634 15.133  21.547 1.00 31.62 ? 895  HOH A O     1 
HETATM 3473 O  O     . HOH I 7 .   ? 9.039  0.614   28.342 1.00 28.72 ? 896  HOH A O     1 
HETATM 3474 O  O     . HOH I 7 .   ? 15.044 33.918  9.705  1.00 25.63 ? 897  HOH A O     1 
HETATM 3475 O  O     . HOH I 7 .   ? 9.318  35.578  20.507 1.00 30.92 ? 898  HOH A O     1 
HETATM 3476 O  O     . HOH I 7 .   ? 1.782  26.952  31.509 1.00 49.17 ? 899  HOH A O     1 
HETATM 3477 O  O     . HOH I 7 .   ? 39.970 -1.894  10.721 1.00 27.13 ? 900  HOH A O     1 
HETATM 3478 O  O     . HOH I 7 .   ? 25.903 -10.424 16.647 1.00 44.39 ? 901  HOH A O     1 
HETATM 3479 O  O     . HOH I 7 .   ? 5.633  -5.767  30.898 1.00 47.54 ? 902  HOH A O     1 
HETATM 3480 O  O     . HOH I 7 .   ? 38.080 27.079  30.887 1.00 42.57 ? 903  HOH A O     1 
HETATM 3481 O  O     . HOH I 7 .   ? 0.040  -6.395  34.081 1.00 41.95 ? 904  HOH A O     1 
HETATM 3482 O  O     . HOH I 7 .   ? 12.342 30.679  9.556  1.00 24.35 ? 905  HOH A O     1 
HETATM 3483 O  O     . HOH I 7 .   ? 1.751  32.061  19.855 1.00 46.53 ? 906  HOH A O     1 
HETATM 3484 O  O     . HOH I 7 .   ? 22.992 -11.688 16.676 1.00 44.81 ? 907  HOH A O     1 
HETATM 3485 O  O     . HOH I 7 .   ? 0.288  25.501  26.930 1.00 37.86 ? 908  HOH A O     1 
HETATM 3486 O  O     . HOH I 7 .   ? 8.039  4.304   37.844 1.00 44.95 ? 909  HOH A O     1 
HETATM 3487 O  O     . HOH I 7 .   ? 38.547 23.259  23.263 1.00 33.54 ? 910  HOH A O     1 
HETATM 3488 O  O     . HOH I 7 .   ? 7.814  -6.326  30.651 1.00 43.68 ? 911  HOH A O     1 
HETATM 3489 O  O     . HOH I 7 .   ? 21.532 -8.009  12.149 1.00 10.02 ? 912  HOH A O     1 
HETATM 3490 O  O     . HOH I 7 .   ? 6.397  -27.889 8.025  1.00 10.94 ? 913  HOH A O     1 
HETATM 3491 O  O     . HOH I 7 .   ? 35.047 -4.057  -4.423 1.00 44.21 ? 914  HOH A O     1 
HETATM 3492 O  O     . HOH I 7 .   ? 39.563 -4.343  7.878  1.00 31.16 ? 915  HOH A O     1 
HETATM 3493 O  O     . HOH I 7 .   ? 32.047 5.606   21.453 1.00 41.23 ? 916  HOH A O     1 
HETATM 3494 O  O     . HOH I 7 .   ? 20.481 -4.969  35.204 1.00 36.00 ? 917  HOH A O     1 
HETATM 3495 O  O     . HOH I 7 .   ? 31.984 16.459  14.853 1.00 32.30 ? 918  HOH A O     1 
HETATM 3496 O  O     . HOH I 7 .   ? 2.395  24.905  32.659 1.00 48.14 ? 919  HOH A O     1 
HETATM 3497 O  O     . HOH I 7 .   ? 25.087 16.441  6.108  1.00 37.51 ? 920  HOH A O     1 
HETATM 3498 O  O     . HOH I 7 .   ? 18.741 9.308   40.505 1.00 39.73 ? 921  HOH A O     1 
HETATM 3499 O  O     . HOH I 7 .   ? 24.483 -13.499 22.000 1.00 50.92 ? 922  HOH A O     1 
HETATM 3500 O  O     . HOH I 7 .   ? 37.088 10.756  5.028  1.00 46.87 ? 923  HOH A O     1 
HETATM 3501 O  O     . HOH I 7 .   ? 2.618  -25.354 17.594 1.00 8.78  ? 924  HOH A O     1 
HETATM 3502 O  O     . HOH I 7 .   ? 5.436  15.808  27.690 1.00 19.38 ? 925  HOH A O     1 
HETATM 3503 O  O     . HOH I 7 .   ? 40.813 10.244  15.624 1.00 44.09 ? 926  HOH A O     1 
HETATM 3504 O  O     . HOH I 7 .   ? 0.592  23.478  26.670 1.00 40.14 ? 927  HOH A O     1 
HETATM 3505 O  O     . HOH I 7 .   ? 1.756  31.268  17.174 1.00 42.08 ? 928  HOH A O     1 
HETATM 3506 O  O     . HOH I 7 .   ? 6.452  -8.090  30.960 1.00 44.23 ? 929  HOH A O     1 
HETATM 3507 O  O     . HOH I 7 .   ? 23.303 33.334  11.944 1.00 36.53 ? 930  HOH A O     1 
HETATM 3508 O  O     . HOH I 7 .   ? 0.880  -6.892  5.399  1.00 34.16 ? 931  HOH A O     1 
HETATM 3509 O  O     . HOH I 7 .   ? 22.154 -11.926 11.820 1.00 52.38 ? 932  HOH A O     1 
HETATM 3510 O  O     . HOH I 7 .   ? 15.796 28.351  42.844 1.00 45.38 ? 933  HOH A O     1 
HETATM 3511 O  O     . HOH I 7 .   ? 27.837 42.582  32.779 1.00 44.77 ? 934  HOH A O     1 
HETATM 3512 O  O     . HOH I 7 .   ? 6.790  35.825  30.458 1.00 35.46 ? 935  HOH A O     1 
HETATM 3513 O  O     . HOH I 7 .   ? 8.344  -4.658  1.585  1.00 28.85 ? 936  HOH A O     1 
HETATM 3514 O  O     . HOH I 7 .   ? 13.351 -3.829  40.576 1.00 43.46 ? 937  HOH A O     1 
HETATM 3515 O  O     . HOH I 7 .   ? 27.496 -5.189  6.600  1.00 48.31 ? 938  HOH A O     1 
HETATM 3516 O  O     . HOH I 7 .   ? 25.679 4.170   -4.032 1.00 28.49 ? 939  HOH A O     1 
HETATM 3517 O  O     . HOH I 7 .   ? 34.823 -1.280  24.599 1.00 50.87 ? 940  HOH A O     1 
HETATM 3518 O  O     . HOH I 7 .   ? 10.694 -7.472  19.771 1.00 38.64 ? 941  HOH A O     1 
HETATM 3519 O  O     . HOH I 7 .   ? 31.266 34.946  27.873 1.00 35.16 ? 942  HOH A O     1 
HETATM 3520 O  O     . HOH I 7 .   ? 7.982  -27.712 10.315 1.00 39.27 ? 943  HOH A O     1 
HETATM 3521 O  O     . HOH I 7 .   ? 11.073 27.339  4.547  1.00 51.60 ? 944  HOH A O     1 
HETATM 3522 O  O     . HOH I 7 .   ? 32.242 16.652  -0.884 1.00 49.21 ? 945  HOH A O     1 
HETATM 3523 O  O     . HOH I 7 .   ? 10.761 -7.973  23.960 1.00 39.11 ? 946  HOH A O     1 
HETATM 3524 O  O     . HOH I 7 .   ? 29.089 4.999   35.396 1.00 39.85 ? 947  HOH A O     1 
HETATM 3525 O  O     . HOH I 7 .   ? 1.433  -30.274 13.028 1.00 35.65 ? 948  HOH A O     1 
HETATM 3526 O  O     . HOH I 7 .   ? 33.252 14.326  8.537  1.00 49.76 ? 949  HOH A O     1 
HETATM 3527 O  O     . HOH I 7 .   ? 30.523 1.592   37.326 1.00 38.59 ? 950  HOH A O     1 
HETATM 3528 O  O     . HOH I 7 .   ? 20.650 10.249  -3.311 1.00 48.83 ? 951  HOH A O     1 
HETATM 3529 O  O     . HOH I 7 .   ? 9.455  30.974  39.116 1.00 24.41 ? 952  HOH A O     1 
HETATM 3530 O  O     . HOH I 7 .   ? 15.948 13.187  39.142 1.00 31.98 ? 953  HOH A O     1 
HETATM 3531 O  O     . HOH I 7 .   ? 2.894  14.842  26.933 1.00 25.64 ? 954  HOH A O     1 
HETATM 3532 O  O     . HOH I 7 .   ? 25.815 21.300  36.895 1.00 34.00 ? 955  HOH A O     1 
HETATM 3533 O  O     . HOH I 7 .   ? 19.118 16.494  -5.831 1.00 48.89 ? 956  HOH A O     1 
HETATM 3534 O  O     . HOH I 7 .   ? 23.165 46.212  28.219 1.00 52.26 ? 957  HOH A O     1 
HETATM 3535 O  O     . HOH I 7 .   ? 29.747 -6.063  28.007 1.00 24.18 ? 958  HOH A O     1 
HETATM 3536 O  O     . HOH I 7 .   ? 8.978  32.087  11.870 1.00 42.22 ? 959  HOH A O     1 
HETATM 3537 O  O     . HOH I 7 .   ? 19.563 -3.270  36.355 1.00 38.38 ? 960  HOH A O     1 
HETATM 3538 O  O     . HOH I 7 .   ? 6.304  33.236  29.280 1.00 36.52 ? 961  HOH A O     1 
HETATM 3539 O  O     . HOH I 7 .   ? 22.394 30.518  11.574 1.00 35.35 ? 962  HOH A O     1 
HETATM 3540 O  O     . HOH I 7 .   ? 32.001 7.668   34.560 1.00 39.94 ? 963  HOH A O     1 
HETATM 3541 O  O     . HOH I 7 .   ? 23.915 -5.678  6.504  1.00 42.11 ? 964  HOH A O     1 
HETATM 3542 O  O     . HOH I 7 .   ? 26.215 42.245  34.640 1.00 32.30 ? 965  HOH A O     1 
HETATM 3543 O  O     . HOH I 7 .   ? 33.105 -3.895  26.690 1.00 43.82 ? 966  HOH A O     1 
HETATM 3544 O  O     . HOH I 7 .   ? 5.909  24.597  4.875  1.00 39.55 ? 967  HOH A O     1 
HETATM 3545 O  O     . HOH I 7 .   ? 11.435 -24.790 14.558 1.00 30.75 ? 968  HOH A O     1 
HETATM 3546 O  O     . HOH I 7 .   ? -4.621 -30.077 0.977  1.00 49.53 ? 969  HOH A O     1 
HETATM 3547 O  O     . HOH I 7 .   ? 33.023 2.195   31.441 1.00 40.35 ? 970  HOH A O     1 
HETATM 3548 O  O     . HOH I 7 .   ? 9.788  5.652   38.005 1.00 37.70 ? 971  HOH A O     1 
HETATM 3549 O  O     . HOH I 7 .   ? -2.134 -31.499 12.703 1.00 33.22 ? 972  HOH A O     1 
HETATM 3550 O  O     A HOH I 7 .   ? 3.766  2.069   4.972  0.51 24.21 ? 973  HOH A O     1 
HETATM 3551 O  O     B HOH I 7 .   ? -4.127 -9.137  8.281  0.49 29.02 ? 973  HOH A O     1 
HETATM 3552 O  O     . HOH I 7 .   ? 31.006 24.148  13.533 1.00 51.21 ? 974  HOH A O     1 
HETATM 3553 O  O     . HOH I 7 .   ? 23.466 -8.310  9.275  1.00 48.90 ? 975  HOH A O     1 
HETATM 3554 O  O     . HOH I 7 .   ? -5.088 -30.348 8.187  1.00 38.81 ? 976  HOH A O     1 
HETATM 3555 O  O     . HOH I 7 .   ? 9.396  -19.625 18.578 1.00 18.96 ? 977  HOH A O     1 
HETATM 3556 O  O     . HOH I 7 .   ? 19.017 24.868  7.668  1.00 50.71 ? 978  HOH A O     1 
HETATM 3557 O  O     . HOH I 7 .   ? 25.555 22.178  39.919 1.00 53.89 ? 979  HOH A O     1 
HETATM 3558 O  O     . HOH I 7 .   ? 31.005 30.703  21.515 1.00 33.46 ? 980  HOH A O     1 
HETATM 3559 O  O     . HOH I 7 .   ? 12.117 -22.776 17.661 1.00 39.95 ? 981  HOH A O     1 
HETATM 3560 O  O     . HOH I 7 .   ? 36.145 24.435  33.927 1.00 35.87 ? 982  HOH A O     1 
HETATM 3561 O  O     . HOH I 7 .   ? -0.785 -28.814 15.747 1.00 42.91 ? 983  HOH A O     1 
HETATM 3562 O  O     . HOH I 7 .   ? 5.848  0.141   4.713  1.00 35.08 ? 984  HOH A O     1 
HETATM 3563 O  O     . HOH I 7 .   ? 14.645 40.820  22.415 1.00 47.37 ? 985  HOH A O     1 
HETATM 3564 O  O     . HOH I 7 .   ? 2.148  20.772  29.898 1.00 38.44 ? 986  HOH A O     1 
HETATM 3565 O  O     . HOH I 7 .   ? 7.754  37.224  28.837 1.00 38.87 ? 987  HOH A O     1 
HETATM 3566 O  O     . HOH I 7 .   ? -3.644 -31.838 9.811  1.00 47.33 ? 988  HOH A O     1 
HETATM 3567 O  O     . HOH I 7 .   ? 26.870 5.513   20.251 1.00 36.78 ? 989  HOH A O     1 
HETATM 3568 O  O     . HOH I 7 .   ? 33.245 -8.115  21.857 1.00 35.19 ? 990  HOH A O     1 
HETATM 3569 O  O     . HOH I 7 .   ? 35.923 -1.677  19.781 1.00 41.01 ? 991  HOH A O     1 
HETATM 3570 O  O     . HOH I 7 .   ? 33.721 19.442  15.636 1.00 42.87 ? 992  HOH A O     1 
HETATM 3571 O  O     . HOH I 7 .   ? 7.063  34.247  27.351 1.00 39.81 ? 993  HOH A O     1 
HETATM 3572 O  O     . HOH I 7 .   ? 7.826  -5.680  27.109 1.00 39.35 ? 994  HOH A O     1 
HETATM 3573 O  O     . HOH I 7 .   ? -1.431 -20.312 20.888 1.00 20.33 ? 995  HOH A O     1 
HETATM 3574 O  O     . HOH I 7 .   ? 17.624 22.663  -5.643 1.00 47.68 ? 996  HOH A O     1 
HETATM 3575 O  O     . HOH I 7 .   ? 19.317 -13.450 3.076  1.00 43.38 ? 997  HOH A O     1 
HETATM 3576 O  O     . HOH I 7 .   ? 4.167  -4.148  30.691 1.00 37.25 ? 998  HOH A O     1 
HETATM 3577 O  O     . HOH I 7 .   ? 25.493 -6.602  12.043 1.00 36.05 ? 999  HOH A O     1 
HETATM 3578 O  O     . HOH I 7 .   ? 4.804  -0.380  39.042 1.00 43.41 ? 1000 HOH A O     1 
HETATM 3579 O  O     . HOH I 7 .   ? 10.384 -13.904 24.961 1.00 45.80 ? 1001 HOH A O     1 
HETATM 3580 O  O     . HOH I 7 .   ? 18.143 21.523  42.158 1.00 29.10 ? 1002 HOH A O     1 
HETATM 3581 O  O     . HOH I 7 .   ? 34.180 -0.378  20.945 1.00 35.06 ? 1003 HOH A O     1 
HETATM 3582 O  O     . HOH I 7 .   ? 5.972  -4.978  37.834 1.00 43.77 ? 1004 HOH A O     1 
HETATM 3583 O  O     . HOH I 7 .   ? 5.075  -22.569 19.088 1.00 38.14 ? 1005 HOH A O     1 
HETATM 3584 O  O     . HOH I 7 .   ? 1.447  -12.800 31.489 1.00 40.28 ? 1006 HOH A O     1 
HETATM 3585 O  O     . HOH I 7 .   ? 20.676 -12.900 10.044 1.00 51.92 ? 1007 HOH A O     1 
HETATM 3586 O  O     . HOH I 7 .   ? 14.973 25.493  -5.430 1.00 48.53 ? 1008 HOH A O     1 
HETATM 3587 O  O     . HOH I 7 .   ? 20.705 10.986  38.578 1.00 39.48 ? 1009 HOH A O     1 
HETATM 3588 O  O     . HOH I 7 .   ? 6.971  0.205   1.009  1.00 46.04 ? 1010 HOH A O     1 
HETATM 3589 O  O     . HOH I 7 .   ? 4.609  29.917  30.299 1.00 39.67 ? 1011 HOH A O     1 
HETATM 3590 O  O     . HOH I 7 .   ? 5.778  25.032  0.779  1.00 26.06 ? 1012 HOH A O     1 
HETATM 3591 O  O     A HOH I 7 .   ? 5.492  31.410  34.285 0.48 27.31 ? 1013 HOH A O     1 
HETATM 3592 O  O     B HOH I 7 .   ? 7.103  36.675  36.374 0.52 30.50 ? 1013 HOH A O     1 
HETATM 3593 O  O     . HOH I 7 .   ? 8.290  3.960   1.727  1.00 34.88 ? 1014 HOH A O     1 
HETATM 3594 O  O     . HOH I 7 .   ? 15.494 21.728  41.481 1.00 31.97 ? 1015 HOH A O     1 
HETATM 3595 O  O     . HOH I 7 .   ? 2.994  -19.649 22.240 1.00 40.88 ? 1016 HOH A O     1 
HETATM 3596 O  O     . HOH I 7 .   ? 31.776 -10.018 26.807 1.00 46.46 ? 1017 HOH A O     1 
HETATM 3597 O  O     . HOH I 7 .   ? -0.092 -16.796 24.629 1.00 24.35 ? 1018 HOH A O     1 
HETATM 3598 O  O     . HOH I 7 .   ? 19.157 -11.827 36.122 1.00 47.10 ? 1019 HOH A O     1 
HETATM 3599 O  O     . HOH I 7 .   ? 16.898 -12.895 10.685 1.00 27.84 ? 1020 HOH A O     1 
HETATM 3600 O  O     . HOH I 7 .   ? 15.733 8.784   38.695 1.00 27.87 ? 1021 HOH A O     1 
HETATM 3601 O  O     . HOH I 7 .   ? 25.254 40.271  19.635 1.00 48.22 ? 1022 HOH A O     1 
HETATM 3602 O  O     . HOH I 7 .   ? 35.070 2.674   20.283 1.00 35.95 ? 1023 HOH A O     1 
HETATM 3603 O  O     . HOH I 7 .   ? 7.606  -6.736  37.905 1.00 40.46 ? 1024 HOH A O     1 
HETATM 3604 O  O     . HOH I 7 .   ? 5.624  7.486   33.845 1.00 29.81 ? 1025 HOH A O     1 
HETATM 3605 O  O     . HOH I 7 .   ? 0.812  22.380  32.883 1.00 49.50 ? 1026 HOH A O     1 
HETATM 3606 O  O     . HOH I 7 .   ? 31.283 35.937  30.887 1.00 37.11 ? 1027 HOH A O     1 
HETATM 3607 O  O     . HOH I 7 .   ? 27.746 40.734  34.282 1.00 39.15 ? 1028 HOH A O     1 
HETATM 3608 O  O     . HOH I 7 .   ? 28.632 8.838   37.159 1.00 34.95 ? 1029 HOH A O     1 
HETATM 3609 O  O     . HOH I 7 .   ? 32.709 -7.378  24.658 1.00 32.17 ? 1030 HOH A O     1 
HETATM 3610 O  O     . HOH I 7 .   ? 24.855 11.750  10.381 1.00 37.86 ? 1031 HOH A O     1 
HETATM 3611 O  O     . HOH I 7 .   ? 34.257 27.384  18.408 1.00 53.73 ? 1032 HOH A O     1 
HETATM 3612 O  O     . HOH I 7 .   ? 1.812  17.091  33.986 1.00 43.66 ? 1033 HOH A O     1 
HETATM 3613 O  O     . HOH I 7 .   ? 31.462 -12.375 26.919 1.00 57.58 ? 1034 HOH A O     1 
HETATM 3614 O  O     . HOH I 7 .   ? 4.432  37.793  21.869 1.00 47.74 ? 1035 HOH A O     1 
HETATM 3615 O  O     . HOH I 7 .   ? 20.656 16.602  -2.109 1.00 37.74 ? 1036 HOH A O     1 
HETATM 3616 O  O     . HOH I 7 .   ? 10.621 28.345  9.101  1.00 36.53 ? 1037 HOH A O     1 
HETATM 3617 O  O     . HOH I 7 .   ? 31.768 13.400  12.503 1.00 41.99 ? 1038 HOH A O     1 
HETATM 3618 O  O     . HOH I 7 .   ? 35.352 7.844   10.146 1.00 44.61 ? 1039 HOH A O     1 
HETATM 3619 O  O     . HOH I 7 .   ? 14.064 24.937  41.792 1.00 44.76 ? 1040 HOH A O     1 
HETATM 3620 O  O     . HOH I 7 .   ? -6.276 -28.784 5.771  1.00 44.18 ? 1041 HOH A O     1 
HETATM 3621 O  O     . HOH I 7 .   ? 29.934 -1.036  33.285 1.00 23.32 ? 1042 HOH A O     1 
HETATM 3622 O  O     . HOH I 7 .   ? 9.054  -4.261  26.015 1.00 30.59 ? 1043 HOH A O     1 
HETATM 3623 O  O     . HOH I 7 .   ? 14.430 19.235  38.016 1.00 27.83 ? 1044 HOH A O     1 
HETATM 3624 O  O     . HOH I 7 .   ? 25.669 -12.518 17.881 1.00 51.01 ? 1045 HOH A O     1 
HETATM 3625 O  O     . HOH I 7 .   ? 8.569  41.560  33.736 1.00 44.81 ? 1046 HOH A O     1 
HETATM 3626 O  O     . HOH I 7 .   ? 14.166 21.314  39.017 1.00 30.78 ? 1047 HOH A O     1 
HETATM 3627 O  O     . HOH I 7 .   ? 26.332 51.555  30.339 1.00 46.81 ? 1048 HOH A O     1 
HETATM 3628 O  O     . HOH I 7 .   ? 17.720 16.148  -7.811 1.00 38.04 ? 1049 HOH A O     1 
HETATM 3629 O  O     . HOH I 7 .   ? 24.998 29.818  11.934 1.00 37.02 ? 1050 HOH A O     1 
HETATM 3630 O  O     . HOH I 7 .   ? 4.022  28.896  24.955 1.00 30.78 ? 1051 HOH A O     1 
HETATM 3631 O  O     . HOH I 7 .   ? -5.855 -28.030 0.745  1.00 38.58 ? 1052 HOH A O     1 
HETATM 3632 O  O     . HOH I 7 .   ? 29.493 39.537  29.350 1.00 44.06 ? 1053 HOH A O     1 
HETATM 3633 O  O     . HOH I 7 .   ? 30.652 2.988   34.509 1.00 38.42 ? 1054 HOH A O     1 
HETATM 3634 O  O     . HOH I 7 .   ? 10.428 -14.228 22.010 1.00 31.02 ? 1055 HOH A O     1 
HETATM 3635 O  O     . HOH I 7 .   ? 7.050  3.605   3.360  1.00 41.14 ? 1056 HOH A O     1 
HETATM 3636 O  O     A HOH I 7 .   ? 5.180  25.890  35.793 0.55 30.80 ? 1057 HOH A O     1 
HETATM 3637 O  O     B HOH I 7 .   ? 9.897  28.969  38.831 0.45 18.52 ? 1057 HOH A O     1 
HETATM 3638 O  O     . HOH I 7 .   ? 17.222 11.109  38.760 1.00 37.87 ? 1058 HOH A O     1 
HETATM 3639 O  O     . HOH I 7 .   ? 21.698 25.278  8.890  1.00 35.68 ? 1059 HOH A O     1 
HETATM 3640 O  O     . HOH I 7 .   ? 0.445  11.589  36.247 1.00 36.75 ? 1060 HOH A O     1 
HETATM 3641 O  O     . HOH I 7 .   ? 12.672 -25.392 10.899 1.00 32.69 ? 1061 HOH A O     1 
HETATM 3642 O  O     . HOH I 7 .   ? 10.368 -26.207 16.572 1.00 41.39 ? 1062 HOH A O     1 
HETATM 3643 O  O     . HOH I 7 .   ? 4.122  -17.596 22.683 1.00 33.14 ? 1063 HOH A O     1 
HETATM 3644 O  O     . HOH I 7 .   ? 12.377 8.363   35.277 1.00 25.62 ? 1064 HOH A O     1 
HETATM 3645 O  O     . HOH I 7 .   ? 14.516 -21.352 14.306 1.00 24.78 ? 1065 HOH A O     1 
HETATM 3646 O  O     . HOH I 7 .   ? 25.304 5.736   39.306 1.00 37.99 ? 1066 HOH A O     1 
HETATM 3647 O  O     . HOH I 7 .   ? 28.535 20.497  36.985 1.00 46.37 ? 1067 HOH A O     1 
HETATM 3648 O  O     . HOH I 7 .   ? 33.978 7.073   32.516 1.00 27.10 ? 1068 HOH A O     1 
HETATM 3649 O  O     A HOH I 7 .   ? 10.352 24.545  1.975  0.68 23.91 ? 1069 HOH A O     1 
HETATM 3650 O  O     B HOH I 7 .   ? 16.022 20.477  2.341  0.32 16.26 ? 1069 HOH A O     1 
HETATM 3651 O  O     . HOH I 7 .   ? 11.224 21.857  6.388  1.00 39.86 ? 1070 HOH A O     1 
HETATM 3652 O  O     . HOH I 7 .   ? 28.646 3.478   37.196 1.00 38.39 ? 1071 HOH A O     1 
HETATM 3653 O  O     . HOH I 7 .   ? 35.908 9.050   33.180 1.00 38.95 ? 1072 HOH A O     1 
HETATM 3654 O  O     . HOH I 7 .   ? 15.653 -23.585 12.398 1.00 45.95 ? 1073 HOH A O     1 
HETATM 3655 O  O     . HOH I 7 .   ? 10.013 -6.429  26.035 1.00 40.09 ? 1074 HOH A O     1 
HETATM 3656 O  O     . HOH I 7 .   ? 0.042  13.926  33.794 1.00 43.00 ? 1075 HOH A O     1 
HETATM 3657 O  O     . HOH I 7 .   ? 30.477 -3.493  32.325 1.00 38.45 ? 1076 HOH A O     1 
HETATM 3658 O  O     . HOH I 7 .   ? 0.449  -16.520 29.449 1.00 41.39 ? 1077 HOH A O     1 
HETATM 3659 O  O     . HOH I 7 .   ? 17.102 -15.438 11.762 1.00 28.35 ? 1078 HOH A O     1 
HETATM 3660 O  O     . HOH I 7 .   ? 8.765  -16.076 20.692 1.00 20.94 ? 1079 HOH A O     1 
HETATM 3661 O  O     . HOH I 7 .   ? 17.955 43.297  22.044 1.00 45.39 ? 1080 HOH A O     1 
HETATM 3662 O  O     . HOH I 7 .   ? 8.295  38.018  21.294 1.00 39.71 ? 1081 HOH A O     1 
HETATM 3663 O  O     . HOH I 7 .   ? -1.258 22.915  23.772 1.00 43.49 ? 1082 HOH A O     1 
HETATM 3664 O  O     . HOH I 7 .   ? 8.450  24.616  5.327  1.00 47.54 ? 1083 HOH A O     1 
HETATM 3665 O  O     . HOH I 7 .   ? 24.205 7.532   40.247 1.00 48.98 ? 1084 HOH A O     1 
HETATM 3666 O  O     . HOH I 7 .   ? 9.086  22.742  6.351  1.00 44.61 ? 1085 HOH A O     1 
HETATM 3667 O  O     . HOH I 7 .   ? 2.725  19.083  27.659 1.00 34.35 ? 1086 HOH A O     1 
HETATM 3668 O  O     . HOH I 7 .   ? -1.218 -16.695 27.427 1.00 34.76 ? 1087 HOH A O     1 
HETATM 3669 O  O     . HOH I 7 .   ? 9.216  39.884  22.905 1.00 44.91 ? 1088 HOH A O     1 
HETATM 3670 O  O     . HOH I 7 .   ? 10.744 10.525  36.297 1.00 26.84 ? 1089 HOH A O     1 
HETATM 3671 O  O     . HOH I 7 .   ? -6.952 -26.236 4.374  1.00 46.71 ? 1090 HOH A O     1 
HETATM 3672 O  O     . HOH I 7 .   ? 2.485  28.477  26.134 1.00 45.81 ? 1091 HOH A O     1 
HETATM 3673 O  O     . HOH I 7 .   ? 14.924 29.100  7.228  1.00 41.66 ? 1092 HOH A O     1 
HETATM 3674 O  O     . HOH I 7 .   ? -0.464 -19.550 23.423 1.00 31.71 ? 1093 HOH A O     1 
HETATM 3675 O  O     . HOH I 7 .   ? 22.666 29.827  8.824  1.00 42.54 ? 1094 HOH A O     1 
HETATM 3676 O  O     . HOH I 7 .   ? 1.469  -19.927 26.763 1.00 49.16 ? 1095 HOH A O     1 
HETATM 3677 O  O     . HOH I 7 .   ? 5.920  40.207  38.194 1.00 53.30 ? 1096 HOH A O     1 
HETATM 3678 O  O     . HOH I 7 .   ? 16.017 27.139  7.449  1.00 46.20 ? 1097 HOH A O     1 
HETATM 3679 O  O     . HOH I 7 .   ? 7.386  -20.431 20.408 1.00 38.01 ? 1098 HOH A O     1 
HETATM 3680 O  O     . HOH I 7 .   ? 6.590  8.814   38.150 1.00 51.37 ? 1099 HOH A O     1 
HETATM 3681 O  O     . HOH I 7 .   ? 6.772  -17.668 21.669 1.00 22.64 ? 1100 HOH A O     1 
HETATM 3682 O  O     . HOH I 7 .   ? 30.920 -5.058  30.071 1.00 38.75 ? 1101 HOH A O     1 
HETATM 3683 O  O     . HOH I 7 .   ? 32.012 -2.567  29.894 1.00 45.65 ? 1102 HOH A O     1 
HETATM 3684 O  O     . HOH I 7 .   ? 4.716  38.925  24.146 1.00 51.69 ? 1103 HOH A O     1 
HETATM 3685 O  O     . HOH I 7 .   ? 36.608 0.244   30.921 1.00 44.81 ? 1104 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   ASN 4   4   4   ASN ASN A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   GLN 9   9   9   GLN GLN A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  CYS 21  21  21  CYS CYS A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  TRP 42  42  42  TRP TRP A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  GLY 53  53  53  GLY GLY A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  CYS 90  90  90  CYS CYS A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 TYR 101 101 101 TYR TYR A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ASP 135 135 135 ASP ASP A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 GLN 144 144 144 GLN GLN A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 CYS 146 146 146 CYS CYS A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 HIS 178 178 178 HIS HIS A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ASN 196 196 196 ASN ASN A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 CYS 205 205 205 CYS CYS A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 CYS 209 209 209 CYS CYS A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 TRP 211 211 211 TRP TRP A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 PHE 237 237 237 PHE PHE A . n 
A 1 238 HIS 238 238 238 HIS HIS A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 MET 241 241 241 MET MET A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 TRP 243 243 243 TRP TRP A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 LYS 245 245 245 LYS LYS A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 CYS 247 247 247 CYS CYS A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 PHE 273 273 273 PHE PHE A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 ILE 277 277 277 ILE ILE A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 PHE 280 280 280 PHE PHE A . n 
A 1 281 GLN 281 281 281 GLN GLN A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 GLU 295 295 295 GLU GLU A . n 
A 1 296 GLN 296 296 296 GLN GLN A . n 
A 1 297 CYS 297 297 297 CYS CYS A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 MET 300 300 300 MET MET A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 CYS 305 305 305 CYS CYS A . n 
A 1 306 TRP 306 306 306 TRP TRP A . n 
A 1 307 LYS 307 307 307 LYS LYS A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 ASP 309 309 309 ASP ASP A . n 
A 1 310 GLN 310 310 310 GLN GLN A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 GLN 312 312 312 GLN GLN A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 ALA 316 316 316 ALA ALA A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 ALA 319 319 319 ALA ALA A . n 
A 1 320 MET 320 320 320 MET MET A . n 
A 1 321 SER 321 321 321 SER SER A . n 
A 1 322 LYS 322 322 322 LYS LYS A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 ALA 329 329 329 ALA ALA A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 ASP 335 335 335 ASP ASP A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 GLN 338 338 338 GLN GLN A . n 
A 1 339 THR 339 339 339 THR THR A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 GLY 341 341 341 GLY GLY A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 MET 345 345 345 MET MET A . n 
A 1 346 ASP 346 346 346 ASP ASP A . n 
A 1 347 GLN 347 347 347 GLN GLN A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 GLY 350 350 350 GLY GLY A . n 
A 1 351 LEU 351 351 351 LEU LEU A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 HIS 354 354 354 HIS HIS A . n 
A 1 355 LEU 355 355 355 LEU LEU A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 ASN 357 357 357 ASN ASN A . n 
A 1 358 MET 358 358 358 MET MET A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 PRO 360 360 360 PRO PRO A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 ARG 362 362 362 ARG ARG A . n 
A 1 363 ILE 363 363 363 ILE ILE A . n 
A 1 364 PHE 364 364 364 PHE PHE A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 THR 367 367 367 THR THR A . n 
A 1 368 ASN 368 368 368 ASN ASN A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 GLN 371 371 371 GLN GLN A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 ILE 374 374 374 ILE ILE A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 ALA 376 376 376 ALA ALA A . n 
A 1 377 ARG 377 377 377 ARG ARG A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 LEU 379 379 379 LEU LEU A . n 
A 1 380 GLY 380 380 380 GLY GLY A . n 
A 1 381 LEU 381 381 381 LEU LEU A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 THR 384 384 ?   ?   ?   A . n 
A 1 385 SER 385 385 ?   ?   ?   A . n 
A 1 386 SER 386 386 ?   ?   ?   A . n 
A 1 387 GLY 387 387 ?   ?   ?   A . n 
A 1 388 SER 388 388 ?   ?   ?   A . n 
A 1 389 LEU 389 389 ?   ?   ?   A . n 
A 1 390 VAL 390 390 ?   ?   ?   A . n 
A 1 391 PRO 391 391 ?   ?   ?   A . n 
A 1 392 ARG 392 392 ?   ?   ?   A . n 
A 1 393 GLY 393 393 ?   ?   ?   A . n 
A 1 394 SER 394 394 ?   ?   ?   A . n 
A 1 395 HIS 395 395 ?   ?   ?   A . n 
A 1 396 HIS 396 396 ?   ?   ?   A . n 
A 1 397 HIS 397 397 ?   ?   ?   A . n 
A 1 398 HIS 398 398 ?   ?   ?   A . n 
A 1 399 HIS 399 399 ?   ?   ?   A . n 
A 1 400 HIS 400 400 ?   ?   ?   A . n 
A 1 401 HIS 401 401 ?   ?   ?   A . n 
A 1 402 HIS 402 402 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FAD 1   501  500 FAD FAD A . 
C 3 O4B 1   502  501 O4B O4B A . 
D 3 O4B 1   503  502 O4B O4B A . 
E 4 CL  1   504  510 CL  CL  A . 
F 5 PRO 1   505  600 PRO PRO A . 
G 5 PRO 1   506  650 PRO PRO A . 
H 6 GLY 1   507  651 GLY GLY A . 
I 7 HOH 1   601  359 HOH HOH A . 
I 7 HOH 2   602  165 HOH HOH A . 
I 7 HOH 3   603  308 HOH HOH A . 
I 7 HOH 4   604  459 HOH HOH A . 
I 7 HOH 5   605  127 HOH HOH A . 
I 7 HOH 6   606  418 HOH HOH A . 
I 7 HOH 7   607  400 HOH HOH A . 
I 7 HOH 8   608  122 HOH HOH A . 
I 7 HOH 9   609  487 HOH HOH A . 
I 7 HOH 10  610  430 HOH HOH A . 
I 7 HOH 11  611  204 HOH HOH A . 
I 7 HOH 12  612  296 HOH HOH A . 
I 7 HOH 13  613  427 HOH HOH A . 
I 7 HOH 14  614  346 HOH HOH A . 
I 7 HOH 15  615  379 HOH HOH A . 
I 7 HOH 16  616  317 HOH HOH A . 
I 7 HOH 17  617  112 HOH HOH A . 
I 7 HOH 18  618  468 HOH HOH A . 
I 7 HOH 19  619  236 HOH HOH A . 
I 7 HOH 20  620  326 HOH HOH A . 
I 7 HOH 21  621  146 HOH HOH A . 
I 7 HOH 22  622  302 HOH HOH A . 
I 7 HOH 23  623  431 HOH HOH A . 
I 7 HOH 24  624  139 HOH HOH A . 
I 7 HOH 25  625  183 HOH HOH A . 
I 7 HOH 26  626  233 HOH HOH A . 
I 7 HOH 27  627  79  HOH HOH A . 
I 7 HOH 28  628  23  HOH HOH A . 
I 7 HOH 29  629  31  HOH HOH A . 
I 7 HOH 30  630  98  HOH HOH A . 
I 7 HOH 31  631  435 HOH HOH A . 
I 7 HOH 32  632  71  HOH HOH A . 
I 7 HOH 33  633  124 HOH HOH A . 
I 7 HOH 34  634  311 HOH HOH A . 
I 7 HOH 35  635  381 HOH HOH A . 
I 7 HOH 36  636  436 HOH HOH A . 
I 7 HOH 37  637  102 HOH HOH A . 
I 7 HOH 38  638  291 HOH HOH A . 
I 7 HOH 39  639  60  HOH HOH A . 
I 7 HOH 40  640  307 HOH HOH A . 
I 7 HOH 41  641  47  HOH HOH A . 
I 7 HOH 42  642  345 HOH HOH A . 
I 7 HOH 43  643  182 HOH HOH A . 
I 7 HOH 44  644  375 HOH HOH A . 
I 7 HOH 45  645  59  HOH HOH A . 
I 7 HOH 46  646  306 HOH HOH A . 
I 7 HOH 47  647  35  HOH HOH A . 
I 7 HOH 48  648  144 HOH HOH A . 
I 7 HOH 49  649  136 HOH HOH A . 
I 7 HOH 50  650  174 HOH HOH A . 
I 7 HOH 51  651  258 HOH HOH A . 
I 7 HOH 52  652  30  HOH HOH A . 
I 7 HOH 53  653  419 HOH HOH A . 
I 7 HOH 54  654  457 HOH HOH A . 
I 7 HOH 55  655  86  HOH HOH A . 
I 7 HOH 56  656  145 HOH HOH A . 
I 7 HOH 57  657  168 HOH HOH A . 
I 7 HOH 58  658  289 HOH HOH A . 
I 7 HOH 59  659  143 HOH HOH A . 
I 7 HOH 60  660  131 HOH HOH A . 
I 7 HOH 61  661  297 HOH HOH A . 
I 7 HOH 62  662  445 HOH HOH A . 
I 7 HOH 63  663  428 HOH HOH A . 
I 7 HOH 64  664  135 HOH HOH A . 
I 7 HOH 65  665  66  HOH HOH A . 
I 7 HOH 66  666  84  HOH HOH A . 
I 7 HOH 67  667  293 HOH HOH A . 
I 7 HOH 68  668  104 HOH HOH A . 
I 7 HOH 69  669  93  HOH HOH A . 
I 7 HOH 70  670  225 HOH HOH A . 
I 7 HOH 71  671  263 HOH HOH A . 
I 7 HOH 72  672  83  HOH HOH A . 
I 7 HOH 73  673  156 HOH HOH A . 
I 7 HOH 74  674  351 HOH HOH A . 
I 7 HOH 75  675  162 HOH HOH A . 
I 7 HOH 76  676  466 HOH HOH A . 
I 7 HOH 77  677  199 HOH HOH A . 
I 7 HOH 78  678  241 HOH HOH A . 
I 7 HOH 79  679  300 HOH HOH A . 
I 7 HOH 80  680  213 HOH HOH A . 
I 7 HOH 81  681  129 HOH HOH A . 
I 7 HOH 82  682  109 HOH HOH A . 
I 7 HOH 83  683  7   HOH HOH A . 
I 7 HOH 84  684  114 HOH HOH A . 
I 7 HOH 85  685  38  HOH HOH A . 
I 7 HOH 86  686  76  HOH HOH A . 
I 7 HOH 87  687  16  HOH HOH A . 
I 7 HOH 88  688  121 HOH HOH A . 
I 7 HOH 89  689  415 HOH HOH A . 
I 7 HOH 90  690  261 HOH HOH A . 
I 7 HOH 91  691  106 HOH HOH A . 
I 7 HOH 92  692  178 HOH HOH A . 
I 7 HOH 93  693  392 HOH HOH A . 
I 7 HOH 94  694  249 HOH HOH A . 
I 7 HOH 95  695  50  HOH HOH A . 
I 7 HOH 96  696  280 HOH HOH A . 
I 7 HOH 97  697  137 HOH HOH A . 
I 7 HOH 98  698  14  HOH HOH A . 
I 7 HOH 99  699  88  HOH HOH A . 
I 7 HOH 100 700  10  HOH HOH A . 
I 7 HOH 101 701  21  HOH HOH A . 
I 7 HOH 102 702  164 HOH HOH A . 
I 7 HOH 103 703  140 HOH HOH A . 
I 7 HOH 104 704  91  HOH HOH A . 
I 7 HOH 105 705  29  HOH HOH A . 
I 7 HOH 106 706  416 HOH HOH A . 
I 7 HOH 107 707  63  HOH HOH A . 
I 7 HOH 108 708  334 HOH HOH A . 
I 7 HOH 109 709  49  HOH HOH A . 
I 7 HOH 110 710  53  HOH HOH A . 
I 7 HOH 111 711  441 HOH HOH A . 
I 7 HOH 112 712  51  HOH HOH A . 
I 7 HOH 113 713  37  HOH HOH A . 
I 7 HOH 114 714  94  HOH HOH A . 
I 7 HOH 115 715  3   HOH HOH A . 
I 7 HOH 116 716  58  HOH HOH A . 
I 7 HOH 117 717  268 HOH HOH A . 
I 7 HOH 118 718  142 HOH HOH A . 
I 7 HOH 119 719  6   HOH HOH A . 
I 7 HOH 120 720  130 HOH HOH A . 
I 7 HOH 121 721  90  HOH HOH A . 
I 7 HOH 122 722  391 HOH HOH A . 
I 7 HOH 123 723  154 HOH HOH A . 
I 7 HOH 124 724  138 HOH HOH A . 
I 7 HOH 125 725  56  HOH HOH A . 
I 7 HOH 126 726  210 HOH HOH A . 
I 7 HOH 127 727  150 HOH HOH A . 
I 7 HOH 128 728  62  HOH HOH A . 
I 7 HOH 129 729  100 HOH HOH A . 
I 7 HOH 130 730  18  HOH HOH A . 
I 7 HOH 131 731  278 HOH HOH A . 
I 7 HOH 132 732  81  HOH HOH A . 
I 7 HOH 133 733  443 HOH HOH A . 
I 7 HOH 134 734  438 HOH HOH A . 
I 7 HOH 135 735  113 HOH HOH A . 
I 7 HOH 136 736  108 HOH HOH A . 
I 7 HOH 137 737  227 HOH HOH A . 
I 7 HOH 138 738  318 HOH HOH A . 
I 7 HOH 139 739  254 HOH HOH A . 
I 7 HOH 140 740  157 HOH HOH A . 
I 7 HOH 141 741  101 HOH HOH A . 
I 7 HOH 142 742  401 HOH HOH A . 
I 7 HOH 143 743  212 HOH HOH A . 
I 7 HOH 144 744  211 HOH HOH A . 
I 7 HOH 145 745  344 HOH HOH A . 
I 7 HOH 146 746  17  HOH HOH A . 
I 7 HOH 147 747  175 HOH HOH A . 
I 7 HOH 148 748  166 HOH HOH A . 
I 7 HOH 149 749  260 HOH HOH A . 
I 7 HOH 150 750  55  HOH HOH A . 
I 7 HOH 151 751  87  HOH HOH A . 
I 7 HOH 152 752  45  HOH HOH A . 
I 7 HOH 153 753  330 HOH HOH A . 
I 7 HOH 154 754  274 HOH HOH A . 
I 7 HOH 155 755  42  HOH HOH A . 
I 7 HOH 156 756  72  HOH HOH A . 
I 7 HOH 157 757  190 HOH HOH A . 
I 7 HOH 158 758  125 HOH HOH A . 
I 7 HOH 159 759  25  HOH HOH A . 
I 7 HOH 160 760  48  HOH HOH A . 
I 7 HOH 161 761  314 HOH HOH A . 
I 7 HOH 162 762  28  HOH HOH A . 
I 7 HOH 163 763  406 HOH HOH A . 
I 7 HOH 164 764  75  HOH HOH A . 
I 7 HOH 165 765  158 HOH HOH A . 
I 7 HOH 166 766  74  HOH HOH A . 
I 7 HOH 167 767  19  HOH HOH A . 
I 7 HOH 168 768  442 HOH HOH A . 
I 7 HOH 169 769  77  HOH HOH A . 
I 7 HOH 170 770  397 HOH HOH A . 
I 7 HOH 171 771  185 HOH HOH A . 
I 7 HOH 172 772  97  HOH HOH A . 
I 7 HOH 173 773  96  HOH HOH A . 
I 7 HOH 174 774  341 HOH HOH A . 
I 7 HOH 175 775  64  HOH HOH A . 
I 7 HOH 176 776  353 HOH HOH A . 
I 7 HOH 177 777  172 HOH HOH A . 
I 7 HOH 178 778  24  HOH HOH A . 
I 7 HOH 179 779  57  HOH HOH A . 
I 7 HOH 180 780  73  HOH HOH A . 
I 7 HOH 181 781  366 HOH HOH A . 
I 7 HOH 182 782  456 HOH HOH A . 
I 7 HOH 183 783  198 HOH HOH A . 
I 7 HOH 184 784  478 HOH HOH A . 
I 7 HOH 185 785  299 HOH HOH A . 
I 7 HOH 186 786  301 HOH HOH A . 
I 7 HOH 187 787  229 HOH HOH A . 
I 7 HOH 188 788  206 HOH HOH A . 
I 7 HOH 189 789  187 HOH HOH A . 
I 7 HOH 190 790  209 HOH HOH A . 
I 7 HOH 191 791  70  HOH HOH A . 
I 7 HOH 192 792  248 HOH HOH A . 
I 7 HOH 193 793  462 HOH HOH A . 
I 7 HOH 194 794  126 HOH HOH A . 
I 7 HOH 195 795  239 HOH HOH A . 
I 7 HOH 196 796  313 HOH HOH A . 
I 7 HOH 197 797  312 HOH HOH A . 
I 7 HOH 198 798  447 HOH HOH A . 
I 7 HOH 199 799  153 HOH HOH A . 
I 7 HOH 200 800  321 HOH HOH A . 
I 7 HOH 201 801  378 HOH HOH A . 
I 7 HOH 202 802  15  HOH HOH A . 
I 7 HOH 203 803  259 HOH HOH A . 
I 7 HOH 204 804  217 HOH HOH A . 
I 7 HOH 205 805  134 HOH HOH A . 
I 7 HOH 206 806  11  HOH HOH A . 
I 7 HOH 207 807  92  HOH HOH A . 
I 7 HOH 208 808  231 HOH HOH A . 
I 7 HOH 209 809  439 HOH HOH A . 
I 7 HOH 210 810  283 HOH HOH A . 
I 7 HOH 211 811  89  HOH HOH A . 
I 7 HOH 212 812  403 HOH HOH A . 
I 7 HOH 213 813  214 HOH HOH A . 
I 7 HOH 214 814  8   HOH HOH A . 
I 7 HOH 215 815  342 HOH HOH A . 
I 7 HOH 216 816  80  HOH HOH A . 
I 7 HOH 217 817  123 HOH HOH A . 
I 7 HOH 218 818  34  HOH HOH A . 
I 7 HOH 219 819  207 HOH HOH A . 
I 7 HOH 220 820  275 HOH HOH A . 
I 7 HOH 221 821  449 HOH HOH A . 
I 7 HOH 222 822  417 HOH HOH A . 
I 7 HOH 223 823  151 HOH HOH A . 
I 7 HOH 224 824  26  HOH HOH A . 
I 7 HOH 225 825  269 HOH HOH A . 
I 7 HOH 226 826  68  HOH HOH A . 
I 7 HOH 227 827  111 HOH HOH A . 
I 7 HOH 228 828  85  HOH HOH A . 
I 7 HOH 229 829  5   HOH HOH A . 
I 7 HOH 230 830  41  HOH HOH A . 
I 7 HOH 231 831  337 HOH HOH A . 
I 7 HOH 232 832  118 HOH HOH A . 
I 7 HOH 233 833  39  HOH HOH A . 
I 7 HOH 234 834  13  HOH HOH A . 
I 7 HOH 235 835  161 HOH HOH A . 
I 7 HOH 236 836  163 HOH HOH A . 
I 7 HOH 237 837  69  HOH HOH A . 
I 7 HOH 238 838  184 HOH HOH A . 
I 7 HOH 239 839  372 HOH HOH A . 
I 7 HOH 240 840  128 HOH HOH A . 
I 7 HOH 241 841  255 HOH HOH A . 
I 7 HOH 242 842  44  HOH HOH A . 
I 7 HOH 243 843  232 HOH HOH A . 
I 7 HOH 244 844  61  HOH HOH A . 
I 7 HOH 245 845  448 HOH HOH A . 
I 7 HOH 246 846  421 HOH HOH A . 
I 7 HOH 247 847  203 HOH HOH A . 
I 7 HOH 248 848  82  HOH HOH A . 
I 7 HOH 249 849  285 HOH HOH A . 
I 7 HOH 250 850  292 HOH HOH A . 
I 7 HOH 251 851  358 HOH HOH A . 
I 7 HOH 252 852  247 HOH HOH A . 
I 7 HOH 253 853  177 HOH HOH A . 
I 7 HOH 254 854  155 HOH HOH A . 
I 7 HOH 255 855  242 HOH HOH A . 
I 7 HOH 256 856  267 HOH HOH A . 
I 7 HOH 257 857  110 HOH HOH A . 
I 7 HOH 258 858  303 HOH HOH A . 
I 7 HOH 259 859  116 HOH HOH A . 
I 7 HOH 260 860  192 HOH HOH A . 
I 7 HOH 261 861  454 HOH HOH A . 
I 7 HOH 262 862  188 HOH HOH A . 
I 7 HOH 263 863  328 HOH HOH A . 
I 7 HOH 264 864  195 HOH HOH A . 
I 7 HOH 265 865  222 HOH HOH A . 
I 7 HOH 266 866  119 HOH HOH A . 
I 7 HOH 267 867  147 HOH HOH A . 
I 7 HOH 268 868  99  HOH HOH A . 
I 7 HOH 269 869  356 HOH HOH A . 
I 7 HOH 270 870  160 HOH HOH A . 
I 7 HOH 271 871  191 HOH HOH A . 
I 7 HOH 272 872  390 HOH HOH A . 
I 7 HOH 273 873  4   HOH HOH A . 
I 7 HOH 274 874  383 HOH HOH A . 
I 7 HOH 275 875  467 HOH HOH A . 
I 7 HOH 276 876  281 HOH HOH A . 
I 7 HOH 277 877  173 HOH HOH A . 
I 7 HOH 278 878  22  HOH HOH A . 
I 7 HOH 279 879  179 HOH HOH A . 
I 7 HOH 280 880  384 HOH HOH A . 
I 7 HOH 281 881  12  HOH HOH A . 
I 7 HOH 282 882  1   HOH HOH A . 
I 7 HOH 283 883  52  HOH HOH A . 
I 7 HOH 284 884  189 HOH HOH A . 
I 7 HOH 285 885  54  HOH HOH A . 
I 7 HOH 286 886  350 HOH HOH A . 
I 7 HOH 287 887  27  HOH HOH A . 
I 7 HOH 288 888  176 HOH HOH A . 
I 7 HOH 289 889  364 HOH HOH A . 
I 7 HOH 290 890  476 HOH HOH A . 
I 7 HOH 291 891  286 HOH HOH A . 
I 7 HOH 292 892  103 HOH HOH A . 
I 7 HOH 293 893  479 HOH HOH A . 
I 7 HOH 294 894  410 HOH HOH A . 
I 7 HOH 295 895  408 HOH HOH A . 
I 7 HOH 296 896  171 HOH HOH A . 
I 7 HOH 297 897  399 HOH HOH A . 
I 7 HOH 298 898  298 HOH HOH A . 
I 7 HOH 299 899  355 HOH HOH A . 
I 7 HOH 300 900  117 HOH HOH A . 
I 7 HOH 301 901  405 HOH HOH A . 
I 7 HOH 302 902  78  HOH HOH A . 
I 7 HOH 303 903  240 HOH HOH A . 
I 7 HOH 304 904  252 HOH HOH A . 
I 7 HOH 305 905  282 HOH HOH A . 
I 7 HOH 306 906  228 HOH HOH A . 
I 7 HOH 307 907  343 HOH HOH A . 
I 7 HOH 308 908  133 HOH HOH A . 
I 7 HOH 309 909  472 HOH HOH A . 
I 7 HOH 310 910  220 HOH HOH A . 
I 7 HOH 311 911  251 HOH HOH A . 
I 7 HOH 312 912  2   HOH HOH A . 
I 7 HOH 313 913  461 HOH HOH A . 
I 7 HOH 314 914  426 HOH HOH A . 
I 7 HOH 315 915  288 HOH HOH A . 
I 7 HOH 316 916  398 HOH HOH A . 
I 7 HOH 317 917  202 HOH HOH A . 
I 7 HOH 318 918  279 HOH HOH A . 
I 7 HOH 319 919  257 HOH HOH A . 
I 7 HOH 320 920  20  HOH HOH A . 
I 7 HOH 321 921  338 HOH HOH A . 
I 7 HOH 322 922  500 HOH HOH A . 
I 7 HOH 323 923  488 HOH HOH A . 
I 7 HOH 324 924  460 HOH HOH A . 
I 7 HOH 325 925  284 HOH HOH A . 
I 7 HOH 326 926  440 HOH HOH A . 
I 7 HOH 327 927  196 HOH HOH A . 
I 7 HOH 328 928  32  HOH HOH A . 
I 7 HOH 329 929  473 HOH HOH A . 
I 7 HOH 330 930  216 HOH HOH A . 
I 7 HOH 331 931  224 HOH HOH A . 
I 7 HOH 332 932  499 HOH HOH A . 
I 7 HOH 333 933  422 HOH HOH A . 
I 7 HOH 334 934  434 HOH HOH A . 
I 7 HOH 335 935  315 HOH HOH A . 
I 7 HOH 336 936  230 HOH HOH A . 
I 7 HOH 337 937  393 HOH HOH A . 
I 7 HOH 338 938  465 HOH HOH A . 
I 7 HOH 339 939  404 HOH HOH A . 
I 7 HOH 340 940  429 HOH HOH A . 
I 7 HOH 341 941  320 HOH HOH A . 
I 7 HOH 342 942  218 HOH HOH A . 
I 7 HOH 343 943  46  HOH HOH A . 
I 7 HOH 344 944  425 HOH HOH A . 
I 7 HOH 345 945  490 HOH HOH A . 
I 7 HOH 346 946  152 HOH HOH A . 
I 7 HOH 347 947  354 HOH HOH A . 
I 7 HOH 348 948  181 HOH HOH A . 
I 7 HOH 349 949  489 HOH HOH A . 
I 7 HOH 350 950  237 HOH HOH A . 
I 7 HOH 351 951  380 HOH HOH A . 
I 7 HOH 352 952  287 HOH HOH A . 
I 7 HOH 353 953  305 HOH HOH A . 
I 7 HOH 354 954  105 HOH HOH A . 
I 7 HOH 355 955  244 HOH HOH A . 
I 7 HOH 356 956  497 HOH HOH A . 
I 7 HOH 357 957  363 HOH HOH A . 
I 7 HOH 358 958  194 HOH HOH A . 
I 7 HOH 359 959  332 HOH HOH A . 
I 7 HOH 360 960  407 HOH HOH A . 
I 7 HOH 361 961  382 HOH HOH A . 
I 7 HOH 362 962  170 HOH HOH A . 
I 7 HOH 363 963  349 HOH HOH A . 
I 7 HOH 364 964  340 HOH HOH A . 
I 7 HOH 365 965  290 HOH HOH A . 
I 7 HOH 366 966  272 HOH HOH A . 
I 7 HOH 367 967  335 HOH HOH A . 
I 7 HOH 368 968  265 HOH HOH A . 
I 7 HOH 369 969  496 HOH HOH A . 
I 7 HOH 370 970  327 HOH HOH A . 
I 7 HOH 371 971  388 HOH HOH A . 
I 7 HOH 372 972  40  HOH HOH A . 
I 7 HOH 373 973  464 HOH HOH A . 
I 7 HOH 374 974  491 HOH HOH A . 
I 7 HOH 375 975  376 HOH HOH A . 
I 7 HOH 376 976  411 HOH HOH A . 
I 7 HOH 377 977  180 HOH HOH A . 
I 7 HOH 378 978  368 HOH HOH A . 
I 7 HOH 379 979  483 HOH HOH A . 
I 7 HOH 380 980  369 HOH HOH A . 
I 7 HOH 381 981  266 HOH HOH A . 
I 7 HOH 382 982  243 HOH HOH A . 
I 7 HOH 383 983  310 HOH HOH A . 
I 7 HOH 384 984  463 HOH HOH A . 
I 7 HOH 385 985  503 HOH HOH A . 
I 7 HOH 386 986  316 HOH HOH A . 
I 7 HOH 387 987  455 HOH HOH A . 
I 7 HOH 388 988  450 HOH HOH A . 
I 7 HOH 389 989  186 HOH HOH A . 
I 7 HOH 390 990  201 HOH HOH A . 
I 7 HOH 391 991  386 HOH HOH A . 
I 7 HOH 392 992  169 HOH HOH A . 
I 7 HOH 393 993  256 HOH HOH A . 
I 7 HOH 394 994  319 HOH HOH A . 
I 7 HOH 395 995  36  HOH HOH A . 
I 7 HOH 396 996  420 HOH HOH A . 
I 7 HOH 397 997  389 HOH HOH A . 
I 7 HOH 398 998  325 HOH HOH A . 
I 7 HOH 399 999  480 HOH HOH A . 
I 7 HOH 400 1000 484 HOH HOH A . 
I 7 HOH 401 1001 373 HOH HOH A . 
I 7 HOH 402 1002 245 HOH HOH A . 
I 7 HOH 403 1003 215 HOH HOH A . 
I 7 HOH 404 1004 377 HOH HOH A . 
I 7 HOH 405 1005 33  HOH HOH A . 
I 7 HOH 406 1006 423 HOH HOH A . 
I 7 HOH 407 1007 498 HOH HOH A . 
I 7 HOH 408 1008 452 HOH HOH A . 
I 7 HOH 409 1009 374 HOH HOH A . 
I 7 HOH 410 1010 501 HOH HOH A . 
I 7 HOH 411 1011 294 HOH HOH A . 
I 7 HOH 412 1012 43  HOH HOH A . 
I 7 HOH 413 1013 336 HOH HOH A . 
I 7 HOH 414 1014 115 HOH HOH A . 
I 7 HOH 415 1015 193 HOH HOH A . 
I 7 HOH 416 1016 333 HOH HOH A . 
I 7 HOH 417 1017 362 HOH HOH A . 
I 7 HOH 418 1018 132 HOH HOH A . 
I 7 HOH 419 1019 482 HOH HOH A . 
I 7 HOH 420 1020 271 HOH HOH A . 
I 7 HOH 421 1021 65  HOH HOH A . 
I 7 HOH 422 1022 477 HOH HOH A . 
I 7 HOH 423 1023 309 HOH HOH A . 
I 7 HOH 424 1024 371 HOH HOH A . 
I 7 HOH 425 1025 148 HOH HOH A . 
I 7 HOH 426 1026 361 HOH HOH A . 
I 7 HOH 427 1027 219 HOH HOH A . 
I 7 HOH 428 1028 433 HOH HOH A . 
I 7 HOH 429 1029 348 HOH HOH A . 
I 7 HOH 430 1030 9   HOH HOH A . 
I 7 HOH 431 1031 409 HOH HOH A . 
I 7 HOH 432 1032 469 HOH HOH A . 
I 7 HOH 433 1033 339 HOH HOH A . 
I 7 HOH 434 1034 502 HOH HOH A . 
I 7 HOH 435 1035 495 HOH HOH A . 
I 7 HOH 436 1036 270 HOH HOH A . 
I 7 HOH 437 1037 95  HOH HOH A . 
I 7 HOH 438 1038 167 HOH HOH A . 
I 7 HOH 439 1039 262 HOH HOH A . 
I 7 HOH 440 1040 246 HOH HOH A . 
I 7 HOH 441 1041 424 HOH HOH A . 
I 7 HOH 442 1042 235 HOH HOH A . 
I 7 HOH 443 1043 149 HOH HOH A . 
I 7 HOH 444 1044 141 HOH HOH A . 
I 7 HOH 445 1045 370 HOH HOH A . 
I 7 HOH 446 1046 504 HOH HOH A . 
I 7 HOH 447 1047 67  HOH HOH A . 
I 7 HOH 448 1048 485 HOH HOH A . 
I 7 HOH 449 1049 331 HOH HOH A . 
I 7 HOH 450 1050 329 HOH HOH A . 
I 7 HOH 451 1051 221 HOH HOH A . 
I 7 HOH 452 1052 414 HOH HOH A . 
I 7 HOH 453 1053 481 HOH HOH A . 
I 7 HOH 454 1054 238 HOH HOH A . 
I 7 HOH 455 1055 208 HOH HOH A . 
I 7 HOH 456 1056 387 HOH HOH A . 
I 7 HOH 457 1057 304 HOH HOH A . 
I 7 HOH 458 1058 365 HOH HOH A . 
I 7 HOH 459 1059 323 HOH HOH A . 
I 7 HOH 460 1060 446 HOH HOH A . 
I 7 HOH 461 1061 223 HOH HOH A . 
I 7 HOH 462 1062 322 HOH HOH A . 
I 7 HOH 463 1063 107 HOH HOH A . 
I 7 HOH 464 1064 205 HOH HOH A . 
I 7 HOH 465 1065 226 HOH HOH A . 
I 7 HOH 466 1066 159 HOH HOH A . 
I 7 HOH 467 1067 396 HOH HOH A . 
I 7 HOH 468 1068 234 HOH HOH A . 
I 7 HOH 469 1069 277 HOH HOH A . 
I 7 HOH 470 1070 394 HOH HOH A . 
I 7 HOH 471 1071 352 HOH HOH A . 
I 7 HOH 472 1072 360 HOH HOH A . 
I 7 HOH 473 1073 402 HOH HOH A . 
I 7 HOH 474 1074 432 HOH HOH A . 
I 7 HOH 475 1075 295 HOH HOH A . 
I 7 HOH 476 1076 273 HOH HOH A . 
I 7 HOH 477 1077 444 HOH HOH A . 
I 7 HOH 478 1078 264 HOH HOH A . 
I 7 HOH 479 1079 200 HOH HOH A . 
I 7 HOH 480 1080 453 HOH HOH A . 
I 7 HOH 481 1081 324 HOH HOH A . 
I 7 HOH 482 1082 458 HOH HOH A . 
I 7 HOH 483 1083 451 HOH HOH A . 
I 7 HOH 484 1084 437 HOH HOH A . 
I 7 HOH 485 1085 395 HOH HOH A . 
I 7 HOH 486 1086 197 HOH HOH A . 
I 7 HOH 487 1087 347 HOH HOH A . 
I 7 HOH 488 1088 493 HOH HOH A . 
I 7 HOH 489 1089 253 HOH HOH A . 
I 7 HOH 490 1090 471 HOH HOH A . 
I 7 HOH 491 1091 470 HOH HOH A . 
I 7 HOH 492 1092 412 HOH HOH A . 
I 7 HOH 493 1093 276 HOH HOH A . 
I 7 HOH 494 1094 385 HOH HOH A . 
I 7 HOH 495 1095 474 HOH HOH A . 
I 7 HOH 496 1096 492 HOH HOH A . 
I 7 HOH 497 1097 413 HOH HOH A . 
I 7 HOH 498 1098 357 HOH HOH A . 
I 7 HOH 499 1099 486 HOH HOH A . 
I 7 HOH 500 1100 250 HOH HOH A . 
I 7 HOH 501 1101 120 HOH HOH A . 
I 7 HOH 502 1102 367 HOH HOH A . 
I 7 HOH 503 1103 494 HOH HOH A . 
I 7 HOH 504 1104 475 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 22980 ? 
1 MORE         -164  ? 
1 'SSA (A^2)'  48180 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A CL  504 ? E CL  . 
2 1 A HOH 868 ? I HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-05 
2 'Structure model' 1 1 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation.title'                   
5 2 'Structure model' '_citation.year'                    
6 2 'Structure model' '_citation_author.identifier_ORCID' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(1.12_2829: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .                  4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 647  ? ? O A HOH 845  ? ? 1.79 
2  1 O   A HOH 793  ? ? O A HOH 859  ? ? 1.94 
3  1 O   A HOH 823  ? ? O A HOH 885  ? ? 1.94 
4  1 O   A HOH 810  ? ? O A HOH 967  ? ? 1.95 
5  1 O   A HOH 1051 ? ? O A HOH 1091 ? ? 1.98 
6  1 O   A HOH 606  ? ? O A HOH 822  ? ? 1.99 
7  1 O   A HOH 837  ? ? O A HOH 1047 ? ? 2.06 
8  1 OD1 A ASN 138  ? ? O A HOH 601  ? ? 2.06 
9  1 O   A HOH 908  ? ? O A HOH 927  ? ? 2.06 
10 1 O   A HOH 856  ? ? O A HOH 981  ? ? 2.07 
11 1 O   A HOH 1014 ? ? O A HOH 1056 ? ? 2.08 
12 1 O   A HOH 667  ? ? O A HOH 767  ? ? 2.09 
13 1 O   A HOH 730  ? ? O A HOH 989  ? ? 2.11 
14 1 ND2 A ASN 217  ? B O A HOH 602  ? ? 2.13 
15 1 O   A HOH 615  ? ? O A HOH 885  ? ? 2.13 
16 1 O   A HOH 646  ? ? O A HOH 651  ? ? 2.14 
17 1 O   A HOH 847  ? ? O A HOH 1084 ? ? 2.15 
18 1 ND1 A HIS 57   ? A O A HOH 603  ? ? 2.17 
19 1 O   A HOH 994  ? ? O A HOH 1043 ? ? 2.17 
20 1 O   A HOH 965  ? ? O A HOH 1028 ? ? 2.18 
21 1 O   A HOH 902  ? ? O A HOH 998  ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 967  ? ? 1_555 O A HOH 1090 ? ? 2_555 2.01 
2 1 O A HOH 1010 ? ? 1_555 O A HOH 1010 ? ? 4_555 2.06 
3 1 O A HOH 621  ? ? 1_555 O A HOH 622  ? ? 7_555 2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             338 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            A 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             338 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            A 
_pdbx_validate_rmsd_bond.bond_value                1.668 
_pdbx_validate_rmsd_bond.bond_target_value         1.506 
_pdbx_validate_rmsd_bond.bond_deviation            0.162 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              135 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              135 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              135 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                111.76 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            -6.54 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 96  ? ? -129.24 -56.17 
2 1 ALA A 127 ? ? -120.56 -50.69 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1100 ? 5.84 . 
2 1 O ? A HOH 1101 ? 5.90 . 
3 1 O ? A HOH 1102 ? 6.43 . 
4 1 O ? A HOH 1103 ? 6.49 . 
5 1 O ? A HOH 1104 ? 6.67 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 384 ? A THR 384 
2  1 Y 1 A SER 385 ? A SER 385 
3  1 Y 1 A SER 386 ? A SER 386 
4  1 Y 1 A GLY 387 ? A GLY 387 
5  1 Y 1 A SER 388 ? A SER 388 
6  1 Y 1 A LEU 389 ? A LEU 389 
7  1 Y 1 A VAL 390 ? A VAL 390 
8  1 Y 1 A PRO 391 ? A PRO 391 
9  1 Y 1 A ARG 392 ? A ARG 392 
10 1 Y 1 A GLY 393 ? A GLY 393 
11 1 Y 1 A SER 394 ? A SER 394 
12 1 Y 1 A HIS 395 ? A HIS 395 
13 1 Y 1 A HIS 396 ? A HIS 396 
14 1 Y 1 A HIS 397 ? A HIS 397 
15 1 Y 1 A HIS 398 ? A HIS 398 
16 1 Y 1 A HIS 399 ? A HIS 399 
17 1 Y 1 A HIS 400 ? A HIS 400 
18 1 Y 1 A HIS 401 ? A HIS 401 
19 1 Y 1 A HIS 402 ? A HIS 402 
# 
_pdbx_audit_support.funding_organization   'Academia Sinica (Taiwan)' 
_pdbx_audit_support.country                Taiwan 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 FAD ? ? FAD ? ? 'SUBJECT OF INVESTIGATION' ? 
2 GLY ? ? GLY ? ? 'SUBJECT OF INVESTIGATION' ? 
3 PRO ? ? PRO ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FLAVIN-ADENINE DINUCLEOTIDE'         FAD 
3 1,4,7,10,13,16-HEXAOXACYCLOOCTADECANE O4B 
4 'CHLORIDE ION'                        CL  
5 PROLINE                               PRO 
6 GLYCINE                               GLY 
7 water                                 HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'equilibrium centrifugation' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#